1MAUA

Crystal structure of tryptophanyl-trna synthetase complexed with atp and tryptophanamide in a pre-transition state conformation
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
328
structure length
328
Chain Sequence
b'MKTIFSGIQPSGVITIGNYIGALRQFVELQHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYLAVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFKEKSAGKEAVSAGLLTYPPLMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGELFTIPEARIPKVGARIMSLVDPTKKMSKSDPNPKAYITLLDDAKTIEKKIKSAVTDSEGTIRYDKEAKPGISNLLNIYSTLSGQSIEELERQYEGKGYGVFKADLAQVVIETLRPIQERYHHWMESEELDRVLDEGAEKANRVASEMVRKMEQAMGLGRRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tryptophan-tRNA ligase
publication title Interconversion of ATP binding and conformational free energies by tryptophanyl-tRNA synthetase: structures of ATP bound to open and closed, pre-transition-state conformations.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ligase
total genus 121
structure length 328
sequence length 328
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2002-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1mauA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1mauA01
3ZGZA 4EG1A 3P0IA 4MW6A 1M8FA 4EG5A 1F9AA 2A1TR 3FI0A 3AIIA 1KORA 2PZBA 1WJGA 1SURA 3P0JA 5LLTA 1GTSA 4ND6A 3CLSC 1R6XA 2E89A 1O95D 1QRSA 2PIDA 2R5WA 1OWPA 3IOCA 4UZEA 1NUTA 3HL4A 1EFVB 4ZCSA 1OWLA 3CLTD 3SZ3A 1O97C 4EG6A 4OJMX 3MLBA 1WKBA 2GOYA 1K4MA 5HG0A 3H9BA 4MWBA 1PG2A 4JXZA 3ND6A 2TS1A 3COZA 3CR8A 4NATA 1F4LA 5HUJA 4HJRA 1P7PA 1YI8A 5F23A 1NUSA 1YUMA 3RBAA 1COZA 1IQUA 1EE1A 4MW1A 1G8HA 2DR2A 4QRDA 3FNRA 3TZEA 3LE8A 2Z09A 2G36A 4U7JA 4MW4A 1GLNA 3KT6A 1JMVA 2WSIA 2RE8A 2DXIA 1MB9A 1TYCA 4TS1A 1NSYA 3PXUA 3ISJA 4EG4A 4GU5A 2NZ2A 1U7DA 5BNZA 2AG6A 1OBHA 3CVYA 2PZAA 3PNBA 2QUJA 2O8VA 4FZJA 1N78A 4DE5A 4NAHA 3IMGA 4MUKA 3S3TA 4JXXA 1EUQA 3ZJTA 3COYA 5FNZA 3TS1A 2DLCX 3G6KA 4YP7A 1NURA 4ARCA 4DLPA 2IELA 1K97A 2HGZA 2X0KA 2OQ2A 1NUQA 5JBNA 5DK4A 1WY5A 2J4DA 5LFAA 3CA8A 3Q10A 1XNHA 1GTRA 1MJHA 2E18A 1KH2A 2ZP1A 2A1UB 1TYDE 1TEZA 4ZCQA 4Q93A 1MOPA 2H2AA 3CLUD 3X1MA 1IH8A 1LI7A 4MUEA 3CVUA 4RPIA 4ZCTA 4L2IA 1IQ0A 1WXEA 1XJQA 4RUKA 4ZT4A 2CYCA 3CLRD 3IH5A 1M8JA 1KAQA 4YBRA 4CT0A 3OTWA 4YP5A 1NUUA 3SDBA 4K0RA 4JYZA 4EFKA 1PG0A 3FIUA 2J07A 4MVYA 4DNXA 4QREA 1KKUA 4MW0A 4MVCA 2X1LA 1KH3A 1OBCA 3TNJA 1H3FA 1EFPA 1JEDA 4BWVA 3ND7A 5KHAA 2A7XA 4MQ6A 3HFJA 3FOCA 4MULA 2EL7A 2QTNA 4MUHA 1WXHA 3M5WA 1J1UA 4KKVA 2YXNA 2V0CA 1Q11A 4OUDB 1KQOA 4ZT6A 3VGJA 4HPWA 4F3RA 3AG5A 4I6JA 4MVXA 1WZ2A 2CV0A 3IOBA 4CQNA 2CFOA 3QE4A 4XSVA 2CV1A 2AZXA 3Q4GA 1I6MA 1PFVA 1QU2A 1IRXA 3H97A 1EUYA 1RQGA 1PFWA 5LM3A 2DPLA 4WSOA 1MB2A 4MUGA 1WOYA 3DO8A 3RFFA 4EF6A 2D13A 3RHSA 4MLPA 1JILA 1XNJA 3KT0A 3C8ZA 1QRUA 3ZUGA 1N2HA 1A8HA 1O0CA 5H16A 3HV0A 1JZSA 3IOEA 4S1OA 1NZJA 4E1AA 2CV2A 3ZXSA 4GRIA 4KR6A 3GUZA 2IJGX 2E0IA 4F4HA 1K92A 3L93A 4MUNA 1O95C 1S4MA 2Z08A 5AHWA 2A88A 1XNGA 1QTQA 3UOWA 2IP1A 2GKSA 3CLTC 1J1ZA 3MMXA 1WQ3A 2BYTA 2PG3A 4H3SA 1OWOA 5DB4A 3X1KA 1JIJA 2HZ7A 5DEOA 2RD2A 2D54A 3G5AA 3IMEA 1WXFA 2DUMA 4G5YA 4MVWA 1MAWA 4AS1A 4ZT2A 3RK1A 2A4MA 3P0HA 3MLAA 4JZYA 1ZUNA 1JIIA 1YUNA 3RJZA 4CDNA 1EXDA 3GLVA 1TYAE 1QJCA 1EJ2A 1MAUA 1I6LA 3G59A 4U8HA 1ILEA 1U0BB 4ZT3A 4KPUB 2CUZA 3BL5A 3NBAA 4XFDA 3AKZA 3P52A 4KR7A 2E21A 1ZJWA 4Q16A 3ZXIA 3Q12A 4R2MA 1NI5A 1NYLA 1O94D 1U3CA 3IMCA 3D6VA 5H7XA 1KP3A 1VBKA 1VBMA 3JXEA 2D5BA 3TQOA 3A2KA 1M8GA 3U1VA 1B6TA 3NBKA 1H1TA 1G59A 1T6YA 2CT8A 2JANA 3CVWA 1F7UA 1VBNA 3FETA 2H29A 4U63A 2QJTA 3UMVA 5FO0A 1M1ZA 2VXOA 1ZH6A 1OWMA 3PNYA 1I2DA 3F3MA 2DEUA 1N2OA 4DDKA 4YP6A 1KQNA 3FDXA 5K0TA 2CSXA 1O6BA 4R0NA 1IQRA 1KR2A 2J09A 4MWDA 4AQ7A 4MUFA 3ZJVA 3N9IA 3CLUC 1QQTA 3ZIUA 1EFPB 5KWVA 1X6VA 3A05A 1KAMA 3FHJA 4QBTA 1HYBA 4I6GA 3E27A 3IVCA 3ELBA 3IVXA 3IDFA 1IVSA 1TQ8A 4P2BA 3SP1A 1M8KA 2A1TS 3K32A 1ZH0A 1N1DA 1GPMA 1U7XA 1YIAA 1G8GA 2AKEA 1JGTA 5K0SA 1KQPA 1Q15A 2PXHA 2DERA 1D2RA 4NDAA 4NX2A 3PRHA 1N75A 3HZRA 1U3DA 1TFUA 3KT3A 2PZ8A 3PNVA 4OUDA 3CLSD 2VTBA 3L92A 3FWKA 3UK2A 1N3LA 1O96A 4DDHA 3HMQA 1QU3A 4MW7A 3FG9A 2QJOA 4MWEA 1T9GS 3DV2A 2YY5A 1O97D 1JEEA 2C5SA 4NZPA 5IJXA 3TZLA 4YMIA 5KCMA 3SEQA 2WB2A 5J58A 1JHDA 3GMIA 3SZGA 1MBZA 4J75A 4PBSA 4EG3A 2I1LA 1M83A 4JFAA 3H99A 2J5BA 3COVA 4MW5A 1WXIA 4WNYA 3UC5A 4ZCRA 1WXGA 2XRZA 3A4IA 4R2LA 1UFVA 1T6ZA 4HK4A 2B7LA 4MWCA 1JIKA 3SYTA 1EFVA 4CDMA 1GZUA 1GN8A 4ND7A 4UZFA 1DNPA 2BTEA 3N2YA 1MC1A 2X3FA 2ZUEA 1J09A 2WQ7A 3VRHA 4MUIA 4NAUA 3ZJUA 5TGTA 2JAXA 4XFJA 1PFYA 3AFHA 1O0BA 1T9GR 4DDMA 5FO1A 4A91A 2QTRA 3N05A 3HGMA 3RK0A 3H05A 3IUEA 1N2JA 3KFLA 5DASA 3TQIA 1MRZA 3UY4A 1J20A 1QRTA 2J08A 5J59A 3A04A 1YULA 3N8HA 2YWBA 2O5RA 4G6ZA 2YWCA 2QTMA 1J21A 2NSYA 4MAFA 2HMAA 1OWNA 3QTBA 2Z3VA 4G5FA 4MUJA 5HUHA 4KR9A 2OV4A 4PBRA 1G8FA 1LW7A 4HJXA 3NV7A 1Q19A 3QTTA 1N2IA 4ZCPA 1JZQA 2JA2A 1BS2A 3LCJA 2V0GA 1JECA 1N2BA 3MXTA 5J5AA 4KPUA 4EGAA 3FH0A 2DETA 4I6EA 1J70A 2QJFA 3AL0C 1KH1A 1FFYA 1O5TA 1F7VA 1YIDA 5EKDA 1QNFA 5TEVA 1CT9A 1PFUA 1N77A 4L2IB 2A1UA 1Q77A 1V47A 3DPIA 3IODA 3LOQA 2EJCA 1O94C 3FY4A 5TS2A 1V8FA 2CYAA 4ARIA 4X0EA 3VU8A 3I05A 3CVVA 3ILVA 3ND5A 3CVXA 1H3NA 1OD6A 3KT8A 3INNA 2A86A 5IHXA 2QUHA 4K03A 1I6KA 2PFSA 1IFXA 3IUBA 2XRYA 2QUIA 3K9WA 2GM3A 1KP2A 1FYDA 1VLHA 1R6UA 1T6XA 3CLRC 3OP1A 4PY2A 3H9CA 2CYBA 1N2GA 1X8XA 1H3EA 2WQ6A 1VL2A 1ULHA 4PBTA 1N2EA 1TYBE 1K4KA 5TEWA 1WQ4A 1GAXA 4DJAA 4EG8A 1NUPA 2ZUFA 1Y42X 4J76A 4MW2A 3IVGA 3SEZA 1IHOA 1LI5A 1M8PA 4ZT7A 1NP7A 3X1JA 4ZT5A 2X1MA 4MW9A 2VTBB 2A84A 2QUKA 4EG7A 3DLAA 1O96B 3AG6A 3COWA 3MUEA 3D6UA 1R6TA
chains in the Genus database with same CATH superfamily
2WMYA 5F1OA 3U56A 3ZX4A 2P1RA 2V7GA 4PSKA 1FS6A 3WBBA 2LKCA 1JBEA 1SIOA 1P2SA 1NOIA 3MCTA 1DZ3A 1V4VA 4B17A 4ZYLA 3C7AA 2NZYA 1TO6A 5DP1A 2QZSA 4QFBA 4B82A 2OFOA 5JYBA 2H59A 2YRFA 4Y0VA 5IBRA 1W36B 2NUAA 4Y2UA 1VKOA 3DE1X 5K09A 3EZYA 4MPJA 5I4KA 4RAOA 2I2DA 3V1KA 1PT9A 5F9MA 1RAFA 1H2FA 1SBNE 1U9YA 1DC8A 2BRUA 2E87A 2FE1A 5DV9A 5JSZA 1ZIOA 3M4JA 3DMHA 2P1ZA 2NVWA 1NYTA 3JWPA 2ATVA 4YH1A 1XTZA 5FPQA 3UOAB 1CLUA 1U1EA 4X1IA 1LA2A 3QFHA 3R5XA 4N3GA 2J5KA 5DCWA 2BI7A 1DIBA 2QRVB 4HUJA 2P69A 5FT9A 4ZHQA 3DLHA 2QD2A 1NUSA 3H9QA 3BIXA 3UANA 3N86A 3WGHA 1L5OA 3A11A 3W7VA 3ECSA 3HI4A 3L6RA 1UBTS 1CUCA 1EE1A 1GR0A 1HE2A 2PA3A 3AEQB 3E2IA 3FMIA 4JP8A 4QQ8A 4D99A 1ATIA 3BDVA 3CFYA 2M1ZA 4WWHA 2DQZA 5L3SA 1XQ6A 1JKIA 3UT5A 4C0BA 2PGNA 3KZMA 2OA0A 2YOGA 2P62A 3BEDA 3O3NB 2CUNA 3LX8A 1PGPA 3LDAA 4J0QA 1YQUA 2WJPA 3UC9A 3DOEA 2PCJA 1ONBA 1T6BY 1U2RA 2FOIA 3JQFC 2ONZA 5EZSA 1ORTA 1Z26A 3P7MA 4GU5A 3LX6A 4A27A 4ZI2A 3ZKAA 2BHRA 3LUFA 1EGAA 2PKCA 4FYYA 4KQKA 4QVKA 4XOIA 3VZBA 3TLGB 3IKLA 2PZAA 4FMPA 1JW9B 1OXSC 1WMFA 3R74A 3NANA 5IABA 2Q0HA 1C4OA 1JI3A 2OHGA 1NBHA 2QM8A 3JD4A 4GM4A 4DE5A 3EPJA 2XOKA 1I7DA 4PZLA 3RVKA 1R5JA 1KEEB 4X66B 4AUKA 3ABQB 2BZGA 5GV8A 1G7RA 5FNVB 1E18A 1P1CA 1VA5A 3X2FA 1BQ4A 3MWJA 2UXBB 1KVRA 4UCXA 3M0EA 5F3WB 3FBWA 4M0MA 2VWGA 3NHSA 1X9IA 1UK7A 2CF5A 2ZRNA 3O4GA 2WHPB 3PRJA 4GI2A 4XPZA 1ZOIA 2PWZA 3RC2A 1J0XO 1ITZA 4YQZA 1XNHA 1IU9A 1U98A 3Q7RA 3LXUX 4JJZA 3GLKA 5K0ZA 4YRQA 8GPBA 1EX7A 1BYUA 4D92A 3GCZA 1ZM4A 3DA8A 1RACA 2XB9A 1RFGE 3HU5A 3RC7A 1Z88A 3ZK8A 2Q2NA 2O4UX 3EVTA 4Y6SA 2TECE 1G8SA 3F7OA 3RS0A 1G2IA 1WW3A 2I2WA 2UZ1B 4DILA 2O0KA 3DL2A 4LTNA 1GRVA 2FGJA 4M37A 4XM0A 1OC4A 3WIEA 4BV2A 3SSMA 4EW2A 3GDFA 1SBIA 1UADA 3CLRD 4GWKA 4YBRA 5B4UA 1XDGA 5GOTA 4C1NA 5I3CA 3F78A 1JH9A 4L8LA 4NZNA 1N6PA 4BCCA 5IDVA 5EJ8A 4A1FA 3QPBA 4AIRA 1XDDA 4QHSA 3OM9A 4YK7A 3AR9A 3SDZA 5KYWA 3U62A 2C8VA 4DNXA 4QREA 2LNDA 2Q0SA 3U4CA 5K20A 1R74A 1CZLA 2KWIA 3QPUA 3U6BA 2NW6A 2J6IA 4HVCA 4U39A 4S04A 3DKPA 1QZXA 4LF8B 3CUVA 3DO6A 3V6LA 1O6FA 1E5DA 1NPDA 3NG1A 2W2PA 2KJQA 4Q1CA 4XGNA 1MJGM 5BR1A 2DCMA 1GILA 1LBIA 2R1ZA 2YN2A 3PC7A 1JEYB 3M5PA 2IP2A 3BBLA 3KB6A 3PZRA 4I7EA 5KYYB 1KQOA 3ICQB 1I9CA 4XX0B 2GUWA 1SUFA 2NXWA 2YWHA 2AN3A 4WN9B 5A3JA 3L1IA 1KR5A 3SXUB 1IHDA 1MAVA 2P0EA 2VSOA 1XJ5A 4MA0A 4YXFA 2AZXA 1D6JA 1IN5A 1Q1ZA 4DV3B 1NZFA 1UBFA 1PTKA 3DYBA 3MT8A 4BDTA 2F8SA 2BBTA 3K2EA 4COOA 2WVJA 2ZRMA 2IV3A 4WSOA 3EOAI 5IXYA 1MB2A 2V97A 1E3DA 4P31A 1VI6A 4G0YA 1EAYA 1GN9A 4U6QA 1UC4B 1QFXA 2IHVA 3ZHQA 3UMMA 4EW1A 5K3OA 2AZDA 4TS9A 3DAYA 3EFEA 4HNHA 4YAEA 5DHPA 3QF4A 1EWVA 3GRYA 2B34A 4GKKB 5E1BA 5IKXA 1ADYA 3EDOA 4DR7B 2IBTA 1DAIA 4L15A 3KT0A 4ZYYA 5E4FA 3EH2A 4LK3A 4HQLA 1K7CA 5BW8A 1FCJA 1YJQA 1F1JA 4U7DA 4FKBA 5CK5A 1EJBA 3IBTA 4MQ5A 2W2NA 3IVAA 5TDHA 3R9XB 1T1JA 3IRVA 3R0JA 1PZMA 3CZAA 2FFRA 3GUCA 3REGA 1JXAA 4F93B 4GXRA 2EFHB 4H17A 4EQ6A 5JU6A 4J07A 5JSFA 1NULA 3VSCA 1V8OA 3DB2A 4NMXB 3SE0A 5I45A 1TW2A 1FTNA 2VUIB 4LFBB 1AY0A 4FSHA 5MN4A 4DQKA 4CV1A 4D57A 1XC7A 3AUYA 3L2OB 4ND5A 5K3SA 4AXXA 4IH9A 4DUYB 1J1ZA 2WMDA 1I4DD 3LAWA 4FKMA 4I1OA 3CE6A 2Q45A 2PH3A 3HCCA 3T5CA 4JC8A 3B2QA 3JYLA 4TXNA 3CEMA 3PV0A 2BELA 1G18A 5DNCA 2OOKA 2FPPA 1VJRA 5LQNA 1QR6A 4I50A 1MAAA 2V5UA 2ZS9A 4E14A 4N8SA 4ME6A 2ZTLA 1HL3A 1VFPA 4GOND 3TPFA 5KNBH 1ODSA 1RQXA 2X40A 1MO3A 4YDRA 3VTZA 2ILTA 3LC7O 1APBA 4BO7A 2QAIA 4M0LA 1RRPA 2Q5JA 4KUGA 1NNEA 1ECPA 3RB8A 2YYZA 2ZRCA 5ELLA 5FLKA 1KAOA 1ZINA 4MQBA 2HJ9A 1OFUX 3AQ4A 4TLCA 4CIWA 2P8JA 3AJEA 2P11A 4MIOA 5E9JA 2FF7A 3CNLA 5C4GB 1BVUA 3RVLA 1U04A 3F8TA 4D9EA 1NZDA 1ESDA 1LSOA 1K0FA 3A6FA 2XNDD 4HB3A 5E4TA 1KOLA 1II8B 4F1KA 4KB5A 4OXXA 4JJEA 4BNXA 4LF4B 1IZYA 3NKFA 3EXHB 2AS0A 1KP3A 2RHDA 4LISA 4M36A 3R8XA 2HDHA 3GLIA 4PLWA 4MEBA 4Y67A 3U1VA 4FQ7A 2Y8EA 1CIPA 3MTEA 3W6ZA 2AMVA 3AHEA 3FIJA 3LC2O 3I9V1 2HT6A 5KX5A 4DR4B 4KH0A 4XPIA 2V3CC 1B93A 3AUAA 3Q6NA 3P2EA 3QITA 1R4MB 3W2GA 1CJTC 4B3IA 1SO8A 1M1ZA 4LE0A 4QIHA 5C31A 3PC8A 1PR6A 1O58A 1W4ZA 2FOXA 1SB9A 3MGGA 4MV7A 4QL3A 1B8NA 1PSWA 3MOGA 5BUZA 5L3QA 4LHYA 4P7FA 1CYDA 2NZJA 3EOBI 3IV7A 1QBGA 1J8MF 4KBGA 1Z0IA 3T94A 3N9IA 3VHLB 4BWFB 4FFOA 3KJNA 4ITRC 3GY0A 1N6LA 3M5CA 3RBZA 3OURA 3PQ2A 3ZIUA 3L6BA 4YV7A 5CDGA 4I1IA 1ZQ9A 2ZI3A 4Z5XA 1P72A 4AKSA 1RC0A 4ABTA 3ELBA 1A2OA 5F3RA 4AX8A 2AG0A 4LJKA 2X8BA 4KVGA 1O87A 3JALB 3DJFA 4RZUA 4G5QA 5EXEA 4KHPB 1T1SA 5FBLB 4FMCB 2AMJA 3JU3A 3WGUA 3IJPA 2OPHA 1GG8A 4U00A 4NXMB 4GLOA 3EIWA 2Y99A 2XBUA 1N75A 3KTFA 1QIHA 4UTNA 1XMIA 2D5IA 3AIMA 3PFFA 4IKOA 1VMIA 1ENYA 2D0PB 3KT3A 1G9SA 4NE2A 1ZOOA 4XJTA 5DNWA 4DPMA 4WLUA 2JLXA 3L92A 2I7DA 2C42A 3ZOZA 3WLHA 1ISSA 1RYZA 1RPAA 5FPHA 3I6IA 1EIWA 1LUAA 3H5TA 2QG9A 3RK4A 4AUEA 1IOVA 3I64A 2F7SA 2IUEA 4W1QA 1YV9A 4RXTA 1Q92A 1DAGA 2I6XA 2RHOA 3DZCA 3L0ZA 4HC4A 2GBLA 1J0CA 1SVNA 4FE4A 5TT0A 4DCTA 3VX3A 1E3SA 4QLOA 5JAQA 3UQYS 3FKQA 3GMIA 3LDFA 1USIA 4FFRA 4NNPA 1T36B 1FP7A 1N1MA 5JWRA 1CJVC 3D64A 3UC5A 2D0OB 1WXGA 5GZ3A 2X8WA 1SU6A 4C89A 1BDHA 1OCEA 1IN7A 3JTMA 3EUFA 2FPRA 1BWQA 3KJGA 2JLAA 4Y2PA 5IAEA 3A1NA 4PLFA 4UZFA 1Y9AA 2EFGA 2FW6A 4BVLA 4FTWA 1EX1A 3RSFA 1UIMA 4D41A 3BEOA 3JQCA 2O8NA 4ZYUA 4QNNA 4F4DA 4DIUA 3HNPA 3QVVA 2AF4C 1PJ8A 1WTCA 2OMEA 5JG7A 1Z63A 1I24A 3PDIB 2JBAB 4MEJA 1QH9A 1CNFA 3L8MA 2A0FA 4U7GA 2PO7A 3V1YA 2JHPA 4GOOD 3BWYA 4Z9XA 1NAIA 1UZMA 4U2BA 4LGCA 2J0UA 1MVNA 4CIBA 1NLFA 2WIDA 4C88A 3C5WP 4OI4A 4NZ9A 2V9PA 1GYQA 3QWAA 1LGYA 2H5JA 3L5KA 4LIPD 5BW4A 3PWZA 3UY4A 2VYNA 2VZ9A 4P7GA 5KVQA 2H5EA 3BWBA 5TGZA 1F6WA 2D5CA 2FK8A 4UHFA 3TNDA 1JFLA 1VMDA 5DSTA 5SY6A 1AHIA 4EOGA 1Z2AA 4OBXA 3S8MA 4BZPA 3LL7A 3P4XA 4C4PA 4JJIA 5TV2A 3ND8A 3OIFA 2R87A 4HI0E 4HNRA 4RFSB 1EHIA 3PC2A 5CPFA 4ZVKA 3NUQA 3SKYA 3W9SA 4Z7NB 3QLVA 3S68A 4IIJA 2YHUA 3CUWA 4C6HA 1ESCA 2FW0A 2QRHA 3B6JA 1R8QA 3BE5A 1KQGA 1QKJA 3FCCA 13PKA 3AUUA 3FYHA 4LF7B 1SBHA 4ZI7A 5CM9C 5DO9A 2ONJA 3ZDEA 2PD4A 2OL4A 3SYRA 3H7IA 3UFXA 4WLFA 4E32A 2GARA 4WY8A 4Z49A 1NXTA 5BO5A 3WYFA 2IUTA 2W9XA 3TM5A 5TARA 4CM1A 3GJXC 4TLMB 3CNBA 4DBZA 3BRWD 3HB7A 1YH3A 2BT4A 4DNPA 1EVEA 1D4FA 2JRLA 4ND3A 1AU9A 1M6EX 1SU7A 3HU2A 2OO3A 1OIXA 4WBXC 1C30A 2A78A 4YR9A 1YIDA 4L75A 3F7TA 4MRAA 4D4IA 1XALA 3D4PA 1J2TA 3RSCA 2ADOA 1WP9A 1E2PA 1PR3A 3SIRA 3AH8A 1TKBA 2L0XA 3I72A 5F7OA 4F3TA 1JDNA 1UF9A 4F86A 1XWFA 4TXMA 2KB0A 4F6RA 4UU1A 3K20A 2AHRA 4YJDA 4II2A 3H2SA 3V4RA 2Q6IA 3F2IA 3ICEA 1VLVA 3CB4A 2Q07A 2WJZB 4JUCA 3KAPA 4PONA 5JR3A 2DR3A 3RS4A 3Q72A 2Q3DA 4AJKA 2P9YA 1IN4A 4F3YA 2CVHA 1T9CA 1ACMA 1VXOA 2J46A 5DM70 1WCIA 3RWMB 1ZOSA 2JFFA 1X7WB 3RLFA 4KPYA 2XRYA 4BEWA 1TVKA 1C14A 4UHCA 1FYDA 1PQYA 3PGMA 3WKAA 1WUKS 3MM4A 2HFJA 2ZSDA 2IWHA 3RLIA 3H9CA 1ZGJA 2WM8A 5JDCA 2ODTX 2CYBA 2PUBA 5B12A 1ZFNA 3EVDA 2WQ6A 3IIKA 4M76B 2BR4A 1S2NA 4B74A 4H1VA 4GX5A 5THKA 1XRRA 1MPTA 1SAYA 1Z75A 2CDNA 5BV1A 1SZJG 2QRZA 4HX2A 2YJ6A 3WAGA 4X94A 2C58A 1ZI6A 2X19A 4NK4A 2RGAA 4RETA 4B3FX 1IHOA 1K88A 3M9XA 5F9FA 3JS5A 1GQSA 5HBRA 3N2IA 2G9RA 3OQIA 1UDXA 2JI9A 3N2ZB 4IS2A 4JLAA 2FZVA 2DSNA 3GGCA 1AMNA 3LHDA 2HREA 5GONF 4CIYA 3H6GA 1MLDA 4DM4A 4F9EA 4W9NA 2NOAA 4I0WB 2PJUA 2Z5GA 3IBYA 3ZGZA 2QN6A 2W6PA 2J6BA 4H0NA 1YR6A 3CH4B 2O8CB 1ACLA 4EG5A 4KBFA 2BMDA 5C8VA 3HVUA 4HAZA 2OM2A 3L7CA 3STXA 2WYUA 2JDID 3OJ0A 5J2TB 1SC3A 1U3GA 3CLSC 3R3HA 2K2QB 1OROA 4XVQA 1UL1X 4YHBA 3R7NA 1N7GA 3RUPA 3I2GA 2PX4A 4NENA 4GBMA 3WB0A 3PFKA 1ZNZA 2BEWB 3JTEA 2B5VA 1CVLA 3ELDA 1G9XA 1OIVA 3HL4A 2B1QA 1EFVB 1PZHA 4U7TB 2YBEA 1SD5A 2J3EA 1N92A 1FDOA 4IL5A 3FJ1A 3DEIA 4OYHA 4PRZA 4Y6RA 3T1OA 5JY1A 1OVMA 3IFSA 5I7FA 3GOHA 4LCEA 3SMVA 5EVJA 2X14A 5HG0A 4DR3B 1FMCA 4RD1A 4MWBA 2C94A 1IIBA 1TCBA 4DIMA 1HEIA 3ZD7A 4EFMA 3CR8A 3B38A 5LZ9A 2NYVA 1MX3A 1IAQA 2G67A 2ECKA 3GFFA 2ZYDA 1B0ZA 1YI8A 2AVDA 3DM5A 1RBYA 3K9QO 3RV4A 3VSDA 3AZQA 3SJUA 3P4UA 4Q7LA 3N8IA 4HLQB 3BD7A 2IY9A 4PGMA 1U81A 2FEOA 3FNRA 2Z09A 1YR9A 3I9OA 3JRNA 3C85A 3O8QA 4E31A 1PL6A 1Z33A 3BGSA 3ZI0A 2AG8A 5CBPB 4ZEWA 3CRMA 3RFXA 2MSKA 3BE6A 3QEAZ 4K05A 4EHIA 5B37A 1IY9A 5NLLA 5B3JC 1RTTA 1P2DA 5K45A 3LTEA 4D4JA 4OBBA 1XRMA 4S0XA 3AINA 1YI1A 4CQMD 2PLRA 4PQFA 5EJ9A 3I8SA 4PVCA 1X0VA 2EEZA 5G2OA 1ODJA 3V1LA 2O54A 4OP1A 4RVHA 4O3FA 3V4VB 3TD2A 2HA3A 2H8GA 3BKWA 4IHJF 1NVWQ 4O2AB 4UUOA 1B2RA 3DR3A 4MIEA 3OQ1A 3M70A 3K0CC 2GJKA 3JD0A 3N75A 3MTDA 1ZVMA 3LH5A 4IM7A 1BXGB 1RRMA 1T3HA 1BKDR 1J42A 2JHFA 2VT3A 2VYFA 3LVRE 2DLNA 1O9GA 1V5EA 3H4IA 5CDFA 1T3TA 4K6CA 2HHLA 1IN1A 3ADPA 5AESA 1E1CA 1Y7PA 1IEWA 4OXNA 4PINA 5BQXA 4RKYA 1ILWA 1Q1EA 3I92A 4X7MA 1A9YA 2INGX 3JQEA 1KH2A 3Q3CA 1T0UA 1M7HA 3AP2A 2JVJA 1K6EA 1C9DB 1CU1A 4R8LA 4LC0A 5AICA 3SQLA 4FHZA 3CSUA 1PSDA 1RYDA 3OM1A 2B35A 2HSZA 2B2CA 4F72A 1DXHA 1U4SA 2GKGA 1MW9X 3ASVA 3TX2A 2BLNA 2COUA 4MUEA 4DIBA 1Y8RA 3OQVA 4EHFA 1BVRA 3LXMA 5HFAA 1QZ3A 4ICIA 4P34A 6AT1A 4TMFA 4R81A 3OCUA 4IQGA 1R4ZA 1Z8HA 2JK0A 3A9VA 4RXUA 1QZUA 4C3OB 5B2FA 2JIBA 2O6LA 3PR3A 5GAJA 4C7MA 5H9WA 5HQ3B 4Y9TA 4KX5A 4UASA 3T9DA 3TXAA 2E9SA 4F2HA 2HF8A 3EEIA 4BFVA 1EHYA 4NYIR 4C08A 4MVYA 4DYVA 3M83A 1Z37A 4P5DA 2PRYA 1JDTA 1SMKA 1JHUA 1OJLA 4J29A 3U4IA 4DLLA 3REQA 2Q3CA 3V4OA 1XZIA 4MQ6A 3ZW8A 5ALLA 3FOCA 4YCNA 2J5QA 2XDQA 5KKNB 2DZDA 2D1TA 2R1TA 1P81A 2AUTA 2V8OA 4B6PA 3M5WA 1KEKA 3F97A 3MCVA 3CYFA 4PZYA 2CL5A 3I0MA 4C7VA 5FJJA 1RYYA 3MRXA 1IBSA 4DLVA 4AMVA 3RRMA 3BERA 3FPFA 3V46A 4R05A 1L4EA 1XKXA 4L76A 2RJ3A 2B61A 2Y2UA 1D07A 4G0UA 2OHXA 1JLRA 1AQYA 3ZDFA 1OH6A 1Q57A 2C2MA 3HZZA 4WJZA 4Z4CA 2Z5VA 7YASA 3FYUB 2XGMA 5JSHA 3N2EA 3MBKA 5DFAA 4WECA 5C53B 4YJHB 1Q21A 3DLCA 3UCFA 1M2WA 5KMGB 2YIVX 2UYGA 5HEKA 2OFWA 3WSVA 5ADUS 3DMYA 4ESEA 2C9DA 2PL3A 1QPZA 2J33A 5A9TA 3BXOA 3EBLA 1E2FA 1RKQA 1PSZA 3CISA 3PWSA 4U5QA 5HMLA 1HBJA 1C0KA 1R0RE 1MAHA 5HILA 1C9JA 1N2HA 4JSTA 3AVTA 4ACAA 4G9BA 1DRKA 4P81A 1IN6A 1DTWA 1GUZA 1KJNA 3LVFO 1G3IA 3T9FA 4CBVA 2Q1YA 2PKXA 4YMUA 3OD1A 3K0HA 2IY8A 3AFGA 5GGXA 2M6LA 4F4HA 1XZFA 4TYNA 1FMLA 3IAS1 3L93A 2HW8A 1T5LA 1O95C 2VN8A 3P5SA 2VS1A 1XTPA 4ZU1X 2FZ5A 3C6MA 1M0WA 4F21A 3HP7A 4IWNA 1QQ6A 2WD8A 3WLMA 5EIOA 1U9ZA 4HATA 3FCXA 3EIEA 2OB1A 3ZUPA 1N4DA 1FUKA 4TWBA 2QYTA 1L7QA 1Z0UA 4KTVE 2CHQA 3FWZA 1KZ6A 1ZAYA 4PGGA 3AF5A 3F6EX 2LBPA 3QX8A 1VM6A 3RODA 1ZOPA 1BGWA 3U3DA 2D54A 3ZY5A 3GK3A 1P2VA 2C9BA 1XYGA 2E1RA 3TPCA 4ENQA 1UBEA 3LY7A 1SUWA 2GRJA 1TX4B 1P0IA 3BHJA 4I8DA 1A3CA 4YT8A 3RUDA 3B1XA 3N39C 2PS1A 3IJEB 4QQKA 1ZN8A 2DBZA 1FX0B 3B1YA 2PWPA 3GRAA 3K8ZA 3QV2A 4NONA 2YS6A 5AHRA 2R751 4NABA 1Y3DE 2GF2A 3RJZA 3WNZA 2NO6A 3IP3A 3WLJA 4D0GA 4HGNA 4C0QC 4D80A 2QX9A 1RNLA 3H0KA 1K68A 1WXXA 3EX7C 2W2KB 1QYWA 4DLXA 2PANA 1G21E 1OX4B 3I8OA 3MGKA 5IUJC 4IRXA 2H3HA 1ICIA 1FBNA 4XDZA 1KSHA 4YJ2F 4DMLA 1KI4A 1T24A 2Z2XA 4RDXA 3UJ8A 3Q12A 2I3AA 5K8TA 3ENQA 1PVDA 4URFA 2VPIA 3IMCA 4RM2A 5H7XA 2CWDA 4LDPA 4NV1A 4UTOA 5JS7A 4GWLA 2X0RA 1DO0A 4EYOA 3H8WA 4OUKX 1YKFA 4M0CA 4A9AA 1B6TA 1SXJE 3RC1A 3OLWA 5MFPA 2IHJA 2FMTA 1A4XA 4RCZA 1OXXK 3PITA 4BMXA 3DLBA 1SVSA 1BJRE 2V1UA 1WHTA 5CEFA 3ZCQA 2WWWA 4TTQA 1WX1A 4TV8B 3ZLTA 1Z7EA 5EUCA 4QGGA 3PUVA 1QORA 3BRSA 3TR6A 2QGZA 3BRWA 5FO0A 3EW9A 3NP9A 4NH0A 3CEPB 2JI4A 3SHOA 2UYCA 1N5MA 5G40A 4BLRA 4M38A 2P5TB 1J0DA 4XR9A 1Z6PA 4AY3A 2Q27A 1CX9B 3FDXA 4EYEA 3H6HA 1YZQA 3WLOA 1P9OA 2YFYA 4FYKA 3HL0A 4MWDA 4AQ7A 4B47A 3SFVA 3ELWA 4KW7A 2ZI6A 1AKNA 1T4BA 4CV2A 3IBFA 2A2ZA 1BKSB 2YNMA 3OZUA 2PLWA 3HLKA 1Z3IX 1V2GA 1X6VA 2AZ4A 4CF7A 2FA9A 2ZB3A 4FZRA 2GCGA 3ZV4A 4EZBA 4R0MA 4GL2A 5DLDA 4GPIB 2Q5FA 4BGVA 4BLUA 1EB8A 4EENA 2VYVD 5C4MA 4FI3C 3SFZA 1R16A 3X0DA 2BBWA 3K32A 5EXPA 1N1DA 3VNAA 3OIUA 2EFCB 1U2EA 1UP7A 3M4ZA 1CR2A 1ZN2A 3L4BC 4H7DA 5K3FB 4UU8A 3KTAA 1C7ZA 3N0RA 5ER6A 3HKCA 3ZV7A 2XCUA 2XUHA 1WDWB 4TV9B 3UMBA 4LXIA 3SC6A 1WZNA 2VTBA 2WDPA 5JQGA 4F4JA 2GPBA 3K0SA 1WDMA 3TVYA 1IBLB 3O7MA 2Q1SA 2NQ8A 2B8WA 2QGFA 3AUXA 4MV9A 3HSSA 4UUQA 4AJEA 1NT2A 1A9SA 1PTJA 1ZYUA 2YY5A 3NJ8A 1FRZA 5JCOC 4J4BA 4ZTZB 2WK1A 4FM9A 1SCIA 1MABB 1YJ8A 4BFCA 3SKVA 3QKWA 4JDPA 5FI5A 3RRYA 1LQUA 1MEEA 2AJCA 3ZH2A 4AY2A 1SHUX 4PBSA 3UG7A 1HE3A 1PDOA 4BP9A 4DIKA 1V6SA 1C3EA 1R15A 3NP7A 3A4VA 2G1UA 2CFRA 3O73A 1GLGA 3QVUA 4WBSA 4L16A 2CNNA 3OIDA 1PWHA 5C5DA 1D0SA 2BTEA 4JCCA 2OD7A 4GYYA 4QYMA 3O2NA 5KOIA 3OX1A 4C0WA 2X3FA 3FMOB 3HKEA 3DL4A 2JDIA 3H3FA 1UODA 3L49A 3P2YA 3PUWA 4MTCA 2ATEA 3FWYA 2IFTA 3EG5A 1EQAA 3JQBC 1A77A 3ND9A 3NHWA 1HTBA 3KUXA 4K6HA 4IG9A 3D81A 4YRSA 5B7GA 5CDSA 2P35A 5CFRA 2KHZA 3BFKA 4FDTA 3HGMA 1GV0A 3B6EA 3VVLA 2NSLA 2E5LB 2WTEA 4GIBA 1K2VN 1KDVA 1CVIA 3PG5A 2HBZA 1VHLA 4R7GA 5EKTA 2IHBA 5TQ2B 1N0UA 4IDGA 1QYXA 5LKRA 2Y27A 3KP1A 1NLZA 3PC4A 3HWSA 3QWIA 4A03A 2H00A 1XO1A 1HORA 1Q1NA 1C9YA 3AY3A 1YZLA 3GFSA 1ZVQA 5LVAA 3NVAA 1RHQA 2D2XA 5BVHB 1XRQA 5AW9A 2QTMA 3T7EA 2NSYA 4ARVA 4ERXA 5A9SB 1QAQA 4K0KB 3E18A 5KHOC 1XHEA 1P3DA 2RGNC 5JRJA 2QX7A 1KMHB 1R50A 4Z86A 3U3MA 1QP8A 2WWYA 2A0XA 1U9IC 2QJRA 3ZN2A 4Z51A 4PBRA 5J4LA 1MJFA 1AMUA 2MOKA 3EK2A 1TLFA 1YZTA 2E2WA 3VNSA 1SEPA 4UAGA 1RXSA 1Q19A 4W1PA 1VIAA 1L4KA 4ZCPA 4YAUA 2QXUA 3C87A 2Z4SA 4OHRA 5IH7A 3KAQA 2O7SA 4N1AA 1XRLA 3UMSA 5J5AA 4RF5A 4CQMA 1N5OX 4KPUA 4CMBA 1COWA 2Y66A 2I2FA 1DL5A 4Z4FA 1OLSB 4CTJA 4BX8A 1PV2A 4KG7A 1KH1A 1I4OA 4V0KA 4TOIA 4BRSA 4N49A 1YC2A 3IQDB 4UU0A 3C3MA 5B3LA 4HWSA 3QVTA 4FU0A 3ZWQA 1JYFA 1H5UA 2LIPA 1NI4A 4U0KA 1YZNA 3W77A 1UDBA 1JLLA 1UBMS 3QTLA 1RWKA 4H16A 1QNLA 4INOA 4IVPA 4L2IB 5KOJA 5AD1A 3FCSB 3HEMA 1DC4A 5TMBA 1UMDB 1XU7A 4YMVA 4KFUA 1P77A 3HCOA 4X7PA 3CUYA 3WAJA 4QWWA 4C2UA 4QPCA 3D6NB 3T35A 3I05A 1LLDA 2G1KA 2KI5A 3L01A 4HRYA 2R7LA 1CS0B 4DOMA 1DJNA 1LJLA 1PJSA 2QR3A 3UYKA 3KLMX 4BVAA 1YL5A 3LVBA 4B5LA 1I0ZA 2PM8A 2C95A 3OPVA 1Z83A 1ADCA 5AKLA 1SR8A 4U4AA 2DBYA 3HUEA 4MRVA 4O4LF 2IQIA 4OXRA 4LNUB 4DCUA 1JAIA 5FL7A 2GM3A 1KP2A 4B8YA 4CM6A 1UPAA 5SZHB 3OP1A 2FWMX 1N7IA 2C2YA 4IFIA 5LWQA 3GD5A 1IWBB 1DTSA 2MJLA 1ZM2A 4R54A 5HGXA 2KYRA 3C3KA 3EGXB 1TC2A 1XQ1A 6CHYA 1T91A 1J5EB 5TVGA 3OLQA 1GSAA 2IODA 4G26A 4NG4A 2CE7A 1NUPA 2WAMA 3A4MA 3N7UA 1SQGA 4GGOA 1M2OB 3M6IA 1G2QA 2CHUA 2E4ZA 4EVRA 1DRJA 1VE5A 1AV7A 1GTZA 4RLFA 1QQBA 3X1JA 2RK3A 1ZK0A 2G5GX 4PSUA 3E70C 4RV5A 5F5LA 2NVUA 4EMUA 2WU8A 2NU8B 5JNWA 1NRIA 1VSVA 2QY6A 3IE2A 4F5WA 5ICGA 3F9RA 4HYYA 5AM0A 2D4AA 1QS0B 3ZZMA 5G1OA 2B1RA 1BWRA 1Q0PA 3DLAA 5DRYA 5EWLB 3RIGA 4AUMA 4DCCA 1Y9EA 1YS6A 3IMFA 3KKNA 2Q9CA 2A58A 3IXQA 1Y8AA 5KVVA 1GCAA 1WP4A 4V24A 3HY4A 1GL7A 3CX3A 1JHOA 3F8SA 1KPHA 2AOTA 3UMCA 4EGJA 4FI3F 1WJGA 4U7FA 4GR4A 3SBOA 1RRGA 4R3UC 3GGJA 5CNMA 1S8AA 1N5IA 1IL0A 2VVTA 1EGHA 3WA7A 5KNDH 4GFDA 4MB2A 2QRPA 4Y2TA 1JJVA 1YRAA 1GPBA 5CA0A 1T43A 1MKYA 1V45E 3WBKA 2WT9A 5D01A 3A9UA 3L6DA 5DZSA 4D4KA 1UJ6A 5ALWA 4QYIA 1F0YA 3JZMA 2Y0EA 1NQXA 5EQTA 2W90A 4QBFA 5HHTA 3HB5X 1M67A 2F67A 1E0SA 3O4RA 4CMCA 1DRVA 2JLQA 1ZN9A 1NN1A 5DYTA 5FRDA 2OHHA 4ENRA 2VHUA 5C7YA 1GNTA 1K4MA 4JMPA 2PJRA 2FP3A 4JHLA 2BFDB 3WJ1A 4RZ3A 5C34B 4YCMA 3P2KA 1L1RA 1XXHE 4FZVA 5A3RA 3B6MA 3U19A 4LVCA 4WOKA 4J7CA 5FYQA 3CF6R 4CDGA 1VKHA 3VC3A 3THXB 2IXAA 1OV4A 2C9OA 3H2IA 3TVDA 3HU3A 4J4TA 1FVHA 1GL3A 3PGVA 4R68A 3HGTA 5AK3A 2FWRA 4RPKA 3WE7A 1MJGA 1X13A 5AW8A 4GW3A 2W6ID 5FWDA 4O3MA 3MD9A 3YASA 1NJGA 3H16A 1NW4A 2HPZA 4MS4B 4C78A 3K5HA 3HU1A 3QI7A 3QP9A 3TIGA 3WMGA 1A27A 1R18A 1US8B 2GB4A 1OR8A 2GXUA 3BL8A 1NVKA 2IZ1A 1C4WA 1GQRA 5GZ1A 1JR6A 1UPFA 3SZOA 3JATB 1XD8A 2EJTA 3ED5A 5FJIA 5GZ6A 3DBOB 1S0UA 1NE2A 4N0DA 2DRIA 3O82A 4UUAA 2BN4A 3H8JA 1WS6A 4BLVA 4TTIA 3BORA 4UOQA 4IDNA 1Y4UA 2EFEB 1NV9A 2R6HA 3HB9A 4AKGA 1KVSA 3CVYA 3HP1A 1M9NA 1PKXA 1TJ4A 2XTZA 1NXVA 4DL9A 1L5WA 2C8LA 1V11B 1MCZA 2AC7A 2AL7A 2CL7X 4WFQA 1BEEA 5HF5A 5FOQA 3F74A 1A4UA 3QPWA 2JJ8A 1XD2A 4YP7A 1TM1E 3IAM6 1K27A 1EXWA 2ISSD 3LWBA 1WSAA 2DHQA 1P4GA 2TSYB 2I4RA 2ZKIA 3IHTA 4W9RA 1E9VA 2WT8A 3SQOA 3ZGVA 1A8PA 1JPJA 3DE6X 3VMMA 2EKBA 4CW7A 2ZIZA 3LHFA 1ZJ4A 2GN2A 3G2NA 2QWXA 4L0DA 1YB5A 2F8TA 2QB5A 5FPYA 3VDQA 1IUOA 4KQMA 2E18A 4RPCA 3RVPA 3T6KA 3TTTA 3FFBA 5LMUB 1DC3A 2HSGA 3RT7A 2I6GA 3GEIA 4RD2A 4V39A 4CI0B 1T1GA 2ID7A 2JFXA 3W8FA 3AU9A 1XK6A 3Q7SA 4MP3A 3TQHA 4QGSA 3BMNB 4CNBA 1QMPA 4TWZA 3O0TA 1D2AA 4G2TA 3WNBA 1IH8A 2XECA 3KAJA 1QFYA 4RY0A 1YR1A 4RPHA 1F9EA 3I6BA 4WKGA 3TEMA 5KNCA 1QDUA 1IQ0A 5BWLA 1JLHA 1XJQA 2H7VA 4KMRA 3NDBB 3JWJA 3P45A 3FWPA 2QPOA 1XGKA 3IH5A 4DV5B 4RSHA 4OHKA 3HB0A 4G1MB 3VI4B 1RJEA 2ZBQA 1ZCAA 3QLUA 1IY8A 1MFPA 4YP5A 5LXTA 3UBTA 2X23A 3H4MA 1WUIS 1Y0BA 4FYWA 3M6AA 1E2LA 2C2BA 4TKLA 3WGKA 4DHWA 4EI9A 1U8XX 3KQWA 2AOVA 4MW0A 4ARZA 4E30A 1L4GA 5HZHA 5KTYA 1YTUA 5CYPA 3GJ3A 1EFPA 4MYDA 3RR2A 4L6IA 4ETWA 4JQSA 5G1PA 3PNKA 5FA6A 1E2QA 1H2XA 2B6NA 5AMXA 4AMBA 5ITZB 1CUIA 2IV7A 3UWDA 3T4XA 4KR2A 4PG5A 2QTNA 2WUFA 1OU0A 3GBSA 4EVQA 3U5TA 1YXMA 2VPTA 4NEHB 1V1RB 5C3MA 2UYQA 4P4TA 3ULKA 1QG0A 2ZWPA 5AVXA 3E5MA 1HA3A 1CXZA 1XB2A 2HA7A 3M6MD 4H18A 4BFZA 4MVXA 1NY6A 4F85A 1D2HA 3R6WA 1GKLA 3G2QA 1PFVA 1HE1C 5FWXA 4E51A 5JXWA 1QU2A 4L4UA 3IJRA 1M2HA 4HNGA 3NJRA 3PWTA 3C6QA 5JMPA 1HOTA 3MJ4A 5JAOA 5LOVB 4AULA 1JPVA 4IMJB 3VM6A 1I4WA 3FPEA 1Z36A 3EGDA 4GUAA 4JMLA 4A0QA 1DKRA 4AICA 4YV0A 4US2R 4D82A 4MQFB 3O4JA 4R6WA 1W19A 4U7HA 4NMHA 3QEMA 4EL0A 1SCUB 4FGSA 3SQNA 3IL2A 3AI1A 3H8SA 2I3ZA 5IKEA 5BT9A 3EPHA 1TF5A 3I1FA 3S8EA 3TQRA 3OD5A 1Z4KA 2QTTA 2O2CA 3QOFA 4NOMA 5HK9A 1PR0A 5SZIA 3EFBA 5HKAA 4BUJA 3RS9A 5DN6A 1G41A 2AMYA 2QRNA 5CIWA 1T2CA 5FB3A 4EEXA 4EPVA 3VR6H 2OYCA 1LPMA 1AB5A 4J7AA 3DGFC 4KU4A 2H5LA 2OUKA 4KJZA 4OM7A 5JCZA 1HT3A 2H4XA 1WW2A 1Y8CA 1R2QA 3ELYA 4F46A 3IIEA 5F1PA 2XLBA 2JGRA 2YY6A 2IGTA 3EOZA 2WIGA 2XGGA 1YA4A 2VDWA 4U9IS 1V4BA 4XQ0A 5LC1A 4EDHA 1S4MA 1BA3A 5HJ5A 1UBNA 2PBRA 3TE6A 3CTMA 4WCVA 1OYYA 3MCZA 4G41A 2WD7B 1WM1A 3C1UA 4DNQA 5FAKA 1G98A 3U1BA 4OAPA 4BZWA 3KPWA 3EE6A 1KYQA 4EUKA 3P2IA 2OWEA 4MMZB 5B30A 4Y18A 8ATCA 5DLEA 3ETNA 4UJ5A 2IF0A 3C45A 2QVGA 2EW8A 2K4MA 2O4CA 2HJHA 2ZI7A 4PYNA 4ZO8A 3UCEA 1T8TA 1WBDA 2DUMA 3IQZA 2ASEA 4L6CA 4OQYA 3GLFB 2JFQA 4EELA 4JKOA 3AVUA 2DAPA 2R00C 2H1FA 1BE0A 1DFHA 2ZREA 4ML3A 4ZT2A 4N6NA 2OBXA 2UZ3A 3OLYA 3DMPA 4IDPA 4LC1A 4MLDA 4Q19A 4RLQA 1KTIA 1UKYA 1ZMBA 1YZFA 4LSZA 2UUAB 4E4YA 3JQ7B 3FBTA 1CZNA 3HCDA 1MD9A 3BIWA 3KR9A 4R83A 5B1YA 1G20A 2IZ5A 3EVAA 1Z6YA 4NBTA 2J0QA 2NUPA 3SSNA 1VZ3A 3BL5A 3R3WA 1QGZA 4XFDA 4XLZA 5TRTA 2IC5A 3DDOA 1U99A 1DFIA 1RWQA 2QD4A 2I76A 2R1VA 4R1UA 4AZ0A 4BVEA 1T29A 1MOSA 1ZI9A 2SKEA 4OMDA 4ZQCB 2LCQA 4ZK2A 1UKZA 3K0AB 2IYVA 1ZD2P 4CEJA 1GNVA 3D6HA 4Y1RA 5TLSA 5TMPA 1W8IA 2VSFA 2C96A 3OESA 1WXWA 5FPPA 3TQQA 1IVNA 1SXIA 4MR7A 3ZCXA 2I54A 2G9ZA 4WNCA 5FOXA 4YWJA 5BOSB 2IYUA 3B48A 2IXGA 1Z6QA 1EBFA 1TT7A 1ZK3A 3FTDA 3U09A 2A9PA 1BDJA 1DDOA 2C4WA 3KTOA 4GXQA 1BC5A 1WUTA 2A9VA 2QSJA 1NBME 1M6WA 2HMTA 2QJTA 2UV8A 4LS3A 4MVJI 1NVBA 9MHTA 4YJ3F 2QZ4A 2ZWVA 3N53A 5FV7A 4Q9AA 5C7LO 3QVMA 2D74A 3LW7A 4AP6A 1NXQA 2LTAA 2OILA 3X1WA 2XQFA 1ULUA 3DFIA 3GJRA 3PLNA 5LP6A 1XQYA 3MOIA 3PRYA 2Z4TA 3KSDO 3VA7A 4R0NA 4W8OA 3VKHA 1NBIA 1SZPA 4PZUA 4ZJYA 4D9FA 1OPRA 3N58A 4MQLA 2Z8YM 3GC6A 1G2OA 1YTLA 4JNCA 4E15A 3N3BC 1ONNA 3C6ZA 1I8TA 2A0KA 2F43B 1AVTA 4TMWA 5DCUA 5CB0A 3MMZA 5I7RA 1AHPA 4Y9RA 4CTNA 1FSGA 1UQRA 5HA5A 5CLQA 2EYQA 3FHTA 3TLMA 4UVDA 1NASA 2WJ4A 4DJEC 2FWBA 3EQ6A 2CSXA 3WMFA 2CUKA 2HLPA 1E79A 2R8OA 4AJPA 2AKEA 1E5LA 4UULA 3CMMA 2JLBA 5CEJA 3GJ6A 3R77A 1NOJA 1B14A 4HR7A 2O2GA 4NCKA 4EIWA 5JZMA 3A3PA 4FR0A 2JZOA 1E2JA 2X3UA 2YJZA 1NC1A 3TCXB 1KJJA 4GZMA 4MINA 1KI6B 4OHBA 3M6FA 3RJMA 2D1RA 2BC9A 1FP4A 4G25A 2PZ8A 1Q3TA 3NTQA 4E21A 2JGFA 3NYIA 2R66A 3PGA1 3H9UA 2H1WA 4DPLA 2YJGA 3T06B 1KGDA 3Q7TA 5C35A 4J0KA 3DVAA 4CKEB 2YVLA 3GCWA 3QNUA 3LUHA 1EINA 4E33A 4N6GA 4O29A 4CN8A 3RYCB 3HMKA 4I4TA 4URUR 1O97D 1JEEA 3DQPA 1G7CA 3DZHA 2GZRA 4P3PA 4MK4A 4ND1A 4RK7A 4DTCA 2NYRA 1XZGA 1Y3IA 1YR7A 5JANA 1E6UA 4J75A 2R4QA 2P77A 3MLEA 4JVLA 5SY4A 4KOAA 3VHXA 4Q5IA 1K4YA 2H2GA 4JFAA 2FMKA 1OB5A 3G68A 4BO9A 1E6WA 1JDBB 5JSZB 3EHDA 1Y80A 3K9HA 1PL8A 2JEZA 4UHBA 4IVRA 1NKTA 2B7LA 1KFJB 3QUCA 5E7QA 1MXFA 4TZ0A 2XYPA 2EHDA 2I55A 5JBQA 1S4QA 1BFDA 2ECOA 3ZDCA 4TMZA 1U2GC 2P40A 2ZATA 5LZ4A 2RARA 1YKSA 2OD2A 3HJHA 1G5IA 4O4HA 2R8ZA 2G63A 1J09A 1MQAA 2I7TA 5IDQA 1GU7A 5JVDB 2CC2A 5T4EA 3P8ZA 3IAFA 2ZYUX 4NE7A 3G85A 2JBHA 2JAXA 4KAXA 5EP4A 5K0EA 3L8DA 2LPMA 1ND6A 3MRSA 5K8LA 2ZR7A 5FO1A 4A91A 4CYMA 3W5IA 1H2WA 2X0IA 3I5UA 1JAXA 2EHJA 4Q15A 5DASA 5KTRA 4MKFA 4X8LA 5IM4A 2I6FA 2MINA 3UNXA 3ZPXA 1H4TA 1VB3A 4JA0A 4ER0A 2GJ8A 3WMWA 4YRIA 4BWYA 3C48A 3TE7A 1H5QA 3NIGB 4NBLA 3DAGA 2G5TA 1YS1X 4AY6A 1LCIA 1TADA 1WU7A 1CIVA 3BE8A 3D8SA 2DPHA 5K0JA 1J21A 1KE1A 3SQMA 4E70A 2HWWA 5GINE 3NH9A 3Q7QA 3E6AA 3WIUA 5J1SB 1U0LA 1YL6A 2Q99A 3BUSA 1ZJ5A 3IELA 5CUQA 2PGXA 1PR1A 2WAXA 2D1SA 2W6IA 2FAXA 3H1EA 2NADA 3P20A 3JYNA 2H18A 3Q0EA 2GTHA 5J63A 1Y34E 2Q5OA 4Q4AB 3WGYA 4LJ9A 1ESEA 2YYYA 3VPHA 4FINA 1LRKA 3NB0A 1SXPA 1PS9A 5FBQB 3THWA 3IHLA 4IJUA 1SCJA 4YA6A 4DHEA 5B1HA 3EGEA 4MJXA 2XMCA 3V55A 1O57A 2WB4A 1ZO8A 1N2BA 2FP4A 3SK0A 4YCCA 3BRCA 4QU5A 4P0PB 5AVWA 4QZVA 2XE8A 2P4UA 2DETA 3LECA 1VMAA 3IESA 1Y1TA 4KO8A 4F9GA 4IHQA 4KRFA 2A6PA 3FMPB 2VJKA 1XEAA 3GAMA 3H13A 5I8WA 3ZLBA 1T1IA 3QFTA 4II7A 3TNLA 5JECA 1O6ZA 4Q3LA 2PT6A 5LBIA 4BNNA 3H11A 3HUUA 1V48A 4PYMA 3Q9UA 1LI4A 1BU8A 1MO5A 4IW3B 3V5NA 4IOJA 4GVLA 4CL2A 3WKBA 4I9NA 2OV6A 4DUGD 4ZTBA 3UHFA 5BXQC 4BQNA 1Y9JA 4C6RA 1MEOA 2YV4A 3E9ZA 2ONCA 1VECA 3K3PA 4P80A 5BNTA 5J2UF 1CWUA 2FDRA 1I5RA 3G8BA 3W0LB 4FPXA 5KYWB 1LBSA 1SBQA 5LD2B 3VSAA 2A9KA 4TYYA 3Q8LA 5EZYF 4B3GA 2GAFA 1E60A 2XVAA 3QEOA 4S1TA 4UE3S 2JFWA 2Z9BA 5GY7A 1E3JA 1XVLA 3AM5A 3MWKA 4R0VA 3V4ZA 2GCNA 4J2TA 2VF8A 3SS9X 4BS9A 3QPCA 1NLMA 2FQQA 3DDNA 4ENTA 4DQVA 5G02A 4BLTA 3FFAA 4YREA 1JA9A 4UAVA 2VJCA 5A5EA 1KGSA 1N2GA 1XU9A 3RTAA 3WLNA 2KE5A 1S7GA 721PA 5JZVA 2Z5FA 5ALXA 2OV8A 3B89A 4ERNA 1K4KA 1RI5A 5FLXA 1NRJB 1SVKA 2VUHB 4PTLA 3SHQA 1V6AA 4G9EA 3HXQA 4F9TA 3BS4A 3UJDA 2DX7A 1H65A 2V74B 5DBHX 5I8PA 2QY9A 5FP0A 1E64A 1M8PA 3G8DA 4QTUB 4ZT7A 5CVTA 4YASA 2C78A 1Z6XA 1JEJA 2EBHX 4P84A 1YVPA 2A84A 1MV5A 1QB7A 3CWQA 5D3MA 1U0EA 2VPYA 1NJ6A 5FLYA 1R0ZA 2VP5A 1K6IA 4H9GA 4Z3DA 1O8BA 1HYEA 3K0EA 1WZCA 4B6RA 1R6TA 1YQWA 3S7TA 4IRMA 3SKXA 1XFDA 3NWJA 2WKPA 2QM0A 3W8DA 4FCTA 4S05A 2IXBA 4QA9A 5CT9A 1SXQA 2QVZX 3NM5A 4Q37A 3D1JA 3GRFA 4KWEA 3IXLA 2P9FA 3FI0A 3Q0IA 3L0CA 3A26A 3WLTA 4B80A 5AVQA 1KRWA 2B36A 3PWKA 3CWCA 3IC5A 1NU8A 3Q0TA 3URKA 1GTSA 4B3SB 4GPZA 1X2EA 4M4SA 5HDQA 1DZIA 1D8AA 1N5KA 2PX3A 2B4TO 4Q18A 3PIDA 1NA5A 4J0HA 1NDQA 1V41E 1S9DA 3G5MA 2LP4Y 2XX3A 1QMGA 3CLTD 5AM5A 4YRDA 5ESRA 3PL1A 4BQPA 2PKRA 2ZRQA 3EXEB 4D3YA 3TH5A 4EWLA 1QK4A 4WJLA 2JAWA 2EX4A 1CB7A 2L18A 1HT0A 2NO4A 3LY9A 1RYFA 3FBGA 3PZBA 4X5OA 3S1SA 4ZGBA 1MOQA 3L02A 4PCUA 2N1MA 2QSYA 4WFIA 4OLHA 3PEWA 4RTOA 1HH4A 4W63A 4K9MA 2FPPB 3E2MA 1PWXA 3EIHA 3HJAA 4GD3Q 4URHA 4F5EA 5HZMA 1AKEA 1NW3A 3CNOA 1ATZA 5FUMA 2CLDX 1XEXA 1XLTA 2IEAA 3FNQA 2N3ZA 1NSFA 2BDTA 3TZEA 1NVEA 2B1JA 1SXGA 3L79A 4TMYA 3R5KA 1USVA 3T9CA 3HLTA 4OQLA 2IUYA 4Y98A 5CVCA 5LXTB 2DTXA 4RACA 3NHKA 5D8DA 3TCNA 4BV3A 5AI6A 1L5FA 4QXOA 1XJCA 3H9JA 4IG4A 1SU8A 4KXMA 3ZHCA 2EKLA 3HDTA 2RE8A 1CETA 3LT4A 4X3CA 1V16A 1ZL2A 3ISJA 1GIAA 2ZT5A 3OUTA 2VTDA 1IEVA 3EVGA 2ECPA 1VLLA 5K5EA 1OKKA 1QGUA 2CXHA 2FPLA 2OZLA 5CT6A 3A58B 5JS6A 3MHPA 4FZJA 1G0NA 3SJZA 1SC1A 2RC6A 5C1DA 4AZVA 5E3IA 1P4SA 3W6OA 1ZSVA 4JXXA 3C6KA 4TLAA 3DCNA 1Z4PX 3C24A 2QL9A 3TX6A 1E94E 3THRA 4RFLA 4DARA 5I5EA 3UMJA 2AYXA 4TXHA 3GLIB 1CQJA 1MHPA 5BSKA 1GVNB 1TM5E 3EVNA 4LV8B 3VU1A 3C6BA 4MMYB 1JKJA 3NORA 4NAHA 4HDCA 4UAJA 2IVFA 3BMCA 1RIFA 2BFFA 4YO8A 5KX5B 2BF7A 1SK8A 2VXYA 3L6OO 1WY5A 4BNDA 2J4DA 3GG2A 5AW7A 5FEMA 1Z13A 3Q85A 1AT1A 2JKVA 4ADSG 5SZJA 2G77B 3ROXA 2DOKA 4EY3A 1Y1QA 1M2NA 1K3FA 1EK1A 4EF5A 3TRJA 2VP9A 3DEYX 4Z2AA 4IX1A 1TEZA 5T4HA 3P9KA 1B7GO 2H2AA 2ZIXB 3JQAB 3KQUA 1LI7A 4H7FA 1MF7A 2VQ3A 3I2JA 4PAMA 5L3QB 3WHKA 3KZKA 3R7WB 2OFXA 2YHBA 5ITWA 3K9FC 3DT6A 2O8BB 1ZZEA 4OCZA 1M1YB 3C3PA 1QYVA 1ZNYA 5ERGB 1IE3A 4H3HB 3AERB 1JEQA 3M1LA 1X1RA 1IHXA 1M8JA 3BMXA 1NDUA 2WKRA 2HJSA 3BILA 4B76A 3KPYA 4J43A 4BUCA 3OTWA 2GVZC 5KJ1A 3U0BA 1G291 4A7PA 5CW1A 1T9KA 1RPJA 2ZUBA 3FIUA 5KOHB 2JLVA 1XA0A 1DARA 5D86A 4ZYWA 4GPD1 1WIWA 4GMKA 3LTNC 3OQJA 5LWHA 2V03A 4GI5A 1HMYA 4G2NA 1F0NA 4IWYA 2P4SA 4PIMA 3R9WA 2COEA 1KDRA 5KHAA 4EUHA 4NY1A 4AROA 1DIAA 4QICA 1RPNA 1CDZA 3V4PB 4LE2A 2CD9A 4MUHA 4RVNA 5EQJB 5H80A 3QE9Y 4MV8A 3K5WA 1LPPA 5FUQA 4KKVA 5EMHA 1T8WA 3TNYA 3CTPA 1GADO 5ULLA 3ZR4B 3HGQA 2FXVA 1ZEMA 1PZXA 3VGJA 2P5YA 2XZTA 2GO1A 3GWGA 4ZRDA 1OMOA 1OE0A 3AG5A 4XX1A 2CXSA 4I6JA 5CGQB 5EFOA 5EG5A 4ZGGA 3OQMA 2PGJA 2JAPA 3Q4GA 4JI7B 1GQFA 4IMPA 1H0RA 4RTPA 3NHAA 5K7SA 3JY6A 2OO7A 3QVJA 3S2YA 3ESXA 3LX4A 2CFCA 1F17A 3SXPA 1MTZA 4PAGA 2MT9A 4F11A 4MP6A 1G1MA 4EZIA 3O9MA 3NHZA 2D2VA 3MCWA 5HFJA 3WWEA 3ZGLA 2IZ7A 3RC9A 5EJ4A 2BZSA 4JYPA 3DS8A 1C2TA 4HSEA 1KEUA 4MKXA 3KJXA 3DO8A 3VX4A 4O02B 4EYSA 1C0EA 3R0IA 2IS1A 2WSSD 2ZYGA 3PHLA 1KYTA 4G65A 3OLXA 1ZN7A 1BE6A 1ORVA 2WA2A 1T9AA 2WV7A 3FOWA 4BE4A 4X3PA 1STOA 4JZKA 5KQSA 4ZV9A 3S6JA 1SHTX 3HUTA 2RMKA 3QHPA 4KO4S 5EJ6A 3LSYA 5CCDA 1YACA 2Z2ZA 2Q3MA 1KO7A 2BMWA 4EQZA 4HQNA 4Z99A 3FAKA 1S9HA 2A67A 4HXEB 4JUBA 5FULA 3X1ZA 5K0BA 1JZSA 1S2DA 3ZHTA 1DG1G 1PQPA 4S1OA 2L82A 2V55B 3VPGA 1U7UA 4YUXA 3RI3A 4XWKA 3VJKA 2HC9A 4PR0A 1NFRA 1DPGA 1YA8A 2X13A 3T7CA 1K9VF 3G23A 3RKSA 4EJ6A 2ZJ3A 3QOYA 2BCEA 1DOHA 1Y3CE 2J7KA 1IY0A 1YDGA 2V7TA 4JBGA 5BOVA 2M6RA 1JU3A 2QTBA 5E8RA 1RFLA 5TR9A 2GJ4A 4G8CA 4LK2A 2QV0A 1TRHA 1XNGA 4X41A 4HTFA 3ANTA 3ZE8A 1LSUA 1FLDA 3ICCA 4KGZA 3G2LA 2IP1A 4IDCA 3HXTA 3GOQA 4ZQBA 2AG1A 2GESA 3INGA 5JZ9A 3U44A 4H3SA 1IXZA 1CRQA 1RI3A 3X1KA 2B4AA 3MFQA 3ZE1B 4TKVB 1ZM9A 1A9QA 1WXFA 5BV0A 2QROA 1KZ4A 4H6XA 3HR4A 2Y05A 1T4MA 4C0XA 3G9UA 4N0EA 2CL0X 4K6MA 2ZCUA 2PX6A 2IEGA 4ZU3A 1NAHA 3MLAA 4LPKA 2AFHA 2GASA 4K2HA 1E2MA 1VIVA 1ZUNA 2AEMA 3B2NA 4JEIA 4Y0NA 1MVOA 4GBJA 3H1FA 3G2JA 4YJKA 2F3SA 2ZW9A 1P1JA 3D1LA 4ZI7B 3LO8A 2PYZA 3RADC 2OCIA 1NUAA 4BRZA 3I23A 4DCOA 4HWKA 2C7VA 3IPRA 1QGAA 1E3TA 1TPYA 4KN5A 3TIVA 1J25A 3USCS 4MS1A 1RXUA 2F3PA 4BKMA 3LBAA 5TGDA 1YGYA 2C5GA 2HGSA 3P52A 4Q34A 1G8AA 1P7ZA 2E21A 1S1MA 2QIPA 2IXTA 4AG5A 3MILA 1C30B 3H87A 1Y4SA 4TTRA 4IVQA 1PD0A 1S7CA 1U0JA 2OLKA 2AEEA 3G88A 3HADA 1A9PA 4CLEA 1U6IA 4U8GA 5J2UA 4DC9A 2G70A 3HR8A 4I08A 3KSRA 2BWJA 4B9EA 5EPOA 3T5BA 1X86B 1J97A 3WGLA 1JE1A 2GDZA 5DI3A 3W6PA 1E0AA 2Y2VA 4WXEA 5FEUA 3EXHC 4PANA 4TSRA 1K7YA 3Q6IA 4RSGA 4JKYA 4C0HA 4I55A 3VYRB 4F6RB 4DXHA 2ABWA 2J41A 1MV8A 3DAHA 2EXXA 3AK4A 3E8XA 4XQCA 4YWHA 4YRAA 1VBNA 3T9AA 2F8MA 4E6PA 4AZSA 2C00A 5D87A 1R0XA 1X7DA 2VTEA 4IXMA 2SECE 1YFZA 1CUFA 2A3RA 1ZXXA 2ZUCA 4HH4A 1TQ4A 4RYDA 4QXAA 4BPRA 3S8YA 3EWSA 1D1TA 2VK2A 3DVRX 4H0CA 3ZDZB 4HB2A 2PGOA 1NVXQ 1QF7A 5FNVF 5LYJF 1V7PC 3W7AA 1NJ2A 1OZ0A 2W2OA 2WM3A 1F8UA 3C4JA 3RVSA 3U7RA 4IDOA 1CUJA 4POOA 4UNQA 3LPLA 3L84A 2QAGA 3PICA 3PXBA 4V0NA 4CKYA 2FDXA 2QHXA 1FW8A 5EY5B 5FTNA 3A05A 1QIMA 4CL0A 4N5DA 4AZ3A 2VJOA 5EMJA 4NG5A 2C4MA 4EY7A 2UXDB 4W4TA 1M8KA 2A1TS 3ROTA 2C0QA 2OD9A 2RGGA 2YHIA 4FGUA 4GMGA 4KRXA 5EPEA 1SK9A 3KVVA 2C7OA 4DLYA 4MV4A 1XVAA 3ETDA 4QLAA 1Z6AA 1LNSA 4HVTA 4NX2A 2PT5A 2QQFA 2RH8A 3A2MA 3K0BA 5LQJA 2OUIA 4K9RA 3VYVA 5SZKB 5JS2A 3WRXC 1D5WA 4JFRA 2VP0A 2ISQA 3KE9A 3IIIA 3PVZA 1WD7A 1NR5A 4O5OA 2GN4A 1G5FA 3PVCA 1CQXA 2FJPA 4P36A 2OXFA 1F0PA 2NU9B 4WGGA 3DV2A 4L3OA 4NENB 2JD0A 1GG2A 4PZ0A 1JQLB 1L3BA 1TU3A 3TRKA 4D9NA 5CTAA 2CXQA 3AKDA 4UU7A 3U7QA 3LL4A 5EMKA 1U7HA 1JPNA 1ZHHA 2Y1DA 2ZUUA 3BHMA 3FF4A 4INAA 4JR2A 4MGKR 2EF0A 3H99A 4G1UC 5AOBA 3FYCA 2XTAA 4FHFA 1QOPB 1R5OA 1UDAA 2XE4A 1K1EA 3A4IA 1E3EA 2G9VA 4R9SA 1R88A 3FTNA 4W8GA 2C99A 2ENUA 3NHJA 2RKBA 2R47A 5D84A 3ZH9B 1I3MA 3LQ2A 3HXMA 2N0SA 3FPCA 2J87A 4CDMA 1O08A 1N8TA 4D46A 4RHYA 1G6KA 2DKNA 1E2NA 3DHYA 3H4TA 3HCFA 4HFRA 1P73A 4X85A 5I4IA 2WQZA 4QM7A 5FBHA 2ZUEA 2HZBA 1V8DA 2OCGA 4NAUA 3UICA 1YC5A 4A92A 4LDZA 1Z7WA 3OOJA 1JS1X 4HG2A 4N9WA 5HCNA 2AN5A 1TE2A 2A9QA 4Q9IA 1Q20A 3NHUA 4RK6A 2FPGB 4J16A 1EDDA 2DFPA 3ZD8A 2PKQP 3B1ZA 3QOWA 2V7QD 5B6PA 4V1CI 1VG0B 4LBVA 4DV7B 2RAFA 3KLOA 3HQ4O 3O2JA 3TDNA 1U5BA 3W90A 3MMPA 3ZU5A 3ZBTA 1TB4A 4WVLA 1VCNA 2IW3A 3CCCA 4WCFA 3PL5A 4CLRA 1SQ5A 2OP0A 5EKXA 4DLRA 1PE0A 2W98A 2H9AA 5LLSA 5BSFA 3LUJA 4ILKA 4C29A 4JBXA 5BN5B 2HMAA 1LC0A 1MG5A 1ZWKA 2O48X 3FDIA 3LBFA 3FGOA 3QTBA 1TLLA 5KWIA 4QATA 3CO5A 4DPKA 1CY4A 4WRRA 3ZWKA 4E22A 2OV4A 1GGEA 1HV8A 3DV0A 3LLSA 1L0BA 2XVYA 3MT9A 3P9SA 2QR5A 4IGEA 1EDOA 2NT3A 2Z0MA 3QBJA 2CDBA 3RTBA 5JDIA 4EHHA 2X0EA 1I5EA 2QZPA 2VDJA 2W0SA 3CE9A 5HNKA 3KSAC 1TYZA 1GPAA 1Z07A 5A3SA 4OI0A 1E1CB 2E4AA 2VJPA 4G0WA 5HF8A 4LSWA 1XMOB 1ADJA 3HG7A 4LBYA 5LN1A 3VNQA 4ZQHA 3F4KA 2DT5A 4KQFA 4GQBA 3W4JA 4PPFA 2HM7A 3U5ZB 3LG2A 3CURA 4CRWB 1HZJA 4J1NA 3GX1A 4X44A 4D26A 4CHTA 4F91B 4FGLA 4A73A 1EBUA 3QVSA 2BHNA 1JQ3A 2WPDD 1FNNA 1DJQA 1Y8RB 5FHQA 1JYSA 2HH9A 4QJ5A 5LZ8A 3WK5A 3HSKA 1Q77A 4FZ3A 2B7BA 1UBJS 2DWUA 2ZU0C 2B9VA 1G5PA 2EJCA 2N42A 2QMOA 2YMLA 1V8FA 3FY4A 4JODA 3X3HA 4BJ3A 1AF4A 3VU8A 4ZDKA 5CH3A 5F2EA 1PR2A 5IC6A 2X77A 2P41A 2XVZA 2WFAA 4XARA 4JT8A 2JVKA 3KV1A 2MTBA 3GDOA 1ZGZA 3G17A 4PZAA 4Y1FA 4UPEA 1R37A 2PFSA 4OA5A 4EPWA 5L53A 2AR7A 2IPXA 3M5DA 2ERYA 2NYUA 3I6QA 4C30A 3WOVA 5HX7A 5BY2A 4DCPA 3IPCA 3NDJA 3G6WA 5DU2A 4IY1A 4FSXA 3X1YA 5I7WA 3N70A 4ZVVA 1KJ9A 2C61A 4FX5A 4PW0A 4RTKA 2B21A 2DJIA 5CDUA 2LDBA 3OQ6A 1UPBA 1OFIA 5CIQA 3IT1A 1MGOA 3PEFA 5BR8B 2Z2JA 2YW2A 3HK2A 3GBVA 4Q47A 2W4MA 1GVHA 4XB1A 3HYNA 4EB6A 2H1VA 3K35A 4EKDA 3HO8A 3RAFC 1KI3A 1T5BA 1NP7A 2GVDC 2R60A 3DSRA 3OY2A 1G8JA 1AHHA 1W73A 2V98A 2X1MA 3BREA 3DKRA 2FW9A 3K9NA 1KEPA 3QXCA 1J99A 3PVSA 4RESA 2PBLA 3UUEA 1SNYA 4M89A 4C87A 4E88A 4ENWA 3T5PA 3OIVA 3FLEA 1B00A 1RJGA 4EHKA 3E5RA 3PI7A 3KDAA 3MUNA 2P6UA 1OA1A 3INYA 2M32A 4IDQA 1LVHA 3MN1A 1OXVA 4OGFA 5GV7A 4DYHA 2HLHA 3WLPA 4ESVA 3FLAA 1HTTA 1M8FA 2RSLA 4HZUB 6Q21A 5JMOA 1YZHA 2W8BA 3SC2A 5BQ5A 3OE1A 1SURA 2P4EA 4F1JA 2QL5A 2BP7B 3EC7A 1BXKA 3WGMA 3ZHSA 4DSAA 2YICA 2JKZA 3X43A 1PS0A 1MC8A 2XMSA 2FN9A 4YDQA 1P39A 1XK7A 2BKEA 2WZBA 1WNFA 3D8TA 4UXJA 1KC3A 3IT2A 2C98A 4MR8B 3E7XA 1VLMA 4FNAA 4FMCF 1Y1KE 4OD0A 2P9GA 3IUSA 4HMOA 1UAYA 2J0VA 3WMEA 5BW6B 2XNSA 3M81A 4OJMX 1KYIA 2YUTA 1UIRA 1VB5A 3S2ZA 4D5EA 4EJSA 4OHXA 5JSUA 2RIPA 4DCGA 1TJ3A 2AQIA 2GHQA 2PSDA 2Q6TA 3NIBA 3TOXA 1PG2A 5HS4A 2PQ2A 3OMLA 4JXZA 3CVOA 1DHTA 3H65A 3OU2A 3TO5A 3VR5H 1E2IA 3WGNA 1ZIPA 1Z4IA 2BEKA 1X7YA 1M6YA 1RU3A 2XYVA 4QOSA 2WU0A 3V7FA 4EF4A 1XRSB 4HJRA 2ODBA 3P9ZA 2GEUA 1VDZA 4H0FA 4M0KA 4Q03A 3RBAA 3I32A 3RHTA 2HF2A 4KQJA 2GNOA 3HJBA 3N2KA 1EM6A 2AV6A 2GN0A 1PGNA 2D8MA 3ELUA 3PKJA 5JCJA 3WA6A 4KSBA 4IIYA 4ITUA 4PCAA 3P0EA 2V7XA 4M8IA 3WMRA 2ZIAA 4U7JA 4MW4A 1GLNA 1YRQA 4ZVQA 2AMFA 2VCHA 4PN3A 3HVRA 1KSJA 1ZY2A 2R8RA 2NSJA 3IQIX 4QTZA 4BMDA 4IPTA 4YAIA 1ZSYA 4QEZA 3BDAA 2XMPA 2PLNA 1UFKA 4M60A 3U3ZA 4X61A 4K9LA 1OTYA 4EG4A 1YZVA 3DEJA 1U7DA 2C9MA 1E89A 2P2ZA 3KVYA 1EX6A 1GLVA 2G88A 4K1LA 1WZUA 5FFMA 3PNBA 4WI1A 5H83A 1BMDA 4XUEA 1B8OA 5DPMA 2GBFA 5AKZA 3AETA 4ZQGA 3EY4A 1C4KA 4KPGA 4ISBA 1U02A 4RK4A 2WR8A 4LBWA 3TG8A 4TSFD 3P9XA 1ISGA 3COYA 2PS3A 3FVRA 1U5AA 2Z1NA 4X8HA 1BVYF 3IAM1 4F96A 4ARCA 5TPWB 1CERA 1GNPA 1UBRS 4JP5A 4XVRA 2IELA 5IWAB 4B3BA 1KVTA 1TI7A 4FE7A 5IC4A 1MHTA 4H7KA 2DKOA 3NUGA 3VUEA 4HAUA 5BWMA 4DQUA 5JBNA 1BJTA 2HMUA 5JQWA 3D5TA 4I5EA 4FFNA 3MIZA 1XL0A 3Q10A 1NVGA 4PLCA 2I2XB 1GTRA 4V02A 2I80A 4M53A 1JIVA 4ARIA 5LYJA 1PJCA 2VSXA 3B8HA 2A1UB 5HKKD 2G08A 10MHA 3X2EA 4N7RA 2YJNA 4UVEA 4AN4A 3C5CA 4L3WA 4Q93A 4NJOA 4UNRA 1C1HA 3TD9A 3V8RA 1Y89A 5B6IA 4XUDA 1TUGA 2FDCA 4OHUA 1SUEA 1QVRA 2ALJA 4P4SA 1QE0A 3OCYA 4WFKA 3TLZA 3O8CA 1EFKA 3U7HB 4D43A 1DBSA 1CZUA 2E48A 4PTYA 4S12A 4WTOA 3AI7A 5F3DA 3ZJ5A 1E2BA 3D3WA 1HDRA 1A5TA 1ACJA 2OOSA 3Q7EA 3I5AA 1FVXA 3QE0A 2IPNA 3BICA 4R41A 1U3VA 3L6UA 3GP3A 1EEHA 3F5QA 3NIFB 5IAGA 3A3NA 3UK0A 4JYZA 2IBMA 2IX9A 1DBRA 2GD0A 5GONB 3IALA 4M1YA 3UAWA 3OZVA 2IXFA 2GNAA 1SXHA 2DUWA 3M49A 4GDMA 2VNKA 2X1LA 2HA2A 2ZDQA 3I9JA 5IAJA 3WGGA 1H3FA 1FU8A 4M9ZA 2Q2QA 4NFHA 2VJMA 3TBFA 4EMBA 1KRHA 4FS3A 3ASUA 3NHRA 1SUPA 3R2JA 2PZEA 2WIAA 3KTAB 3SR3A 1KSGA 1N36B 2OENG 1I0LA 1YB4A 2OV3A 3L0OA 1OH7A 4MRMA 2YXNA 3VZQA 1EK2A 4IR7A 1Y5RA 4MCHA 3HJCA 3Q8XB 1KKMA 2R62A 1JQAA 2HCJB 2XCLA 3N2GA 3V97A 3ZNNA 5JNSA 3HHPA 3WXBA 4AN0A 1T9DA 3FW1A 5J47A 1Y1PA 2LXNA 2C0CA 4GI3A 1AF7A 1W88A 3UJ6A 5FA8A 1Y81A 4JB8A 2F6RA 4HL6A 2SBTA 4RF2A 1LLCA 4D81A 4OB7A 2ZRHA 3LLVA 2AJDA 1CDDA 3NTRA 3L7NA 1JP7A 1P2BA 4HDKA 3BB4A 1V95A 1IB6A 4HUQA 4V1CB 1TQDA 1UMCB 1L6RA 2NVBA 1PJRA 1T4CB 2VHZA 3CKLA 2XI4A 4J0IA 4JLKA 4LHEA 4YTEA 1EGQA 1XPOA 2X86A 1ZGBA 2FGKA 4M1MA 2ZR8A 3WL6A 5GM1A 4MLPA 5JFOA 3I9NA 2C7PA 5JNVA 4ZWNA 4XYMA 2O0MA 3TKLA 3SYLA 2FTKE 3HKEB 3WSWA 3DTVA 3QK7A 4LWZA 2GXAA 3IOEA 1DBWA 3SHTA 3QBTA 2PA0A 4HHEA 5HCUA 1S5PA 3D6TB 4LJ7A 4OGWA 4E1AA 2DSTA 3C15C 1PJ2A 5GADl 4B83A 2OEPA 2ZYWX 3LK7A 4EVSA 4CKWA 4JHXA 1CJUC 4WERA 1FTWA 2O1XA 4PIVA 2FW8A 5EIWA 5MDHA 3GAAA 3K9LA 4CMHA 3DOCA 2Z8YA 4E13A 3ANNA 2FEPA 4GLBA 1R8SA 3I52A 3OU6A 4QYWA 3PGKA 1OU4A 1U3TA 3FPJA 2QRUA 4KDFA 2LKDA 2ACVA 2CLHB 2R5NA 3GXOA 4IHJB 4NL4H 3QWHA 3MMXA 4JJKA 5AP9A 4ZVPA 3LWNA 4PXYA 4M7WA 3E7DA 2G76A 3KB1A 4WCDA 3G5AA 1TT5A 3SBDA 3LP5A 4TL8A 1M0TA 4C07A 4HSGA 4LRTB 2D2EA 4DDWA 5ALUA 3KJQA 3G9XA 4AS1A 2IYFA 3QV1A 2WW8A 1KARA 1M0SA 5ELXA 2GUGA 4RKRA 1YJBA 1T3SA 3EW7A 1Z4MA 2IUSA 2PD6A 3JZFA 1GQ2A 3AHJA 1PL7A 4M8NE 2A9JA 2VQFB 2PUCA 1P6XA 4G4SO 3PF9A 3GLVA 4CLOB 1EXDA 4QBKA 3R24A 2NACA 3KUKA 3NGXA 4TRRA 1RKVA 5BT8A 1D1SA 1J07A 3KM0A 4YRFA 1QPBA 2UVPB 1GY8A 4CQMB 4KPUB 1L1FA 1HEYA 2H85A 1YNOA 2XNCA 1ZAKA 3DXZA 3FAZA 3MNFA 3QVGA 5A4IS 3SX0A 3AWIA 4D6PA 2VP4A 4YMHA 3G8AA 4OGLA 5L7YA 2RGEA 1OT5A 2ARKA 3BJEA 4KNYA 1NI4B 1NVVR 3E9DA 3D6VA 2BH9A 2VPZA 4LRYA 5DX8A 3B2EA 1LPNA 3JXEA 3HA5A 3V8EA 5KOJB 1KI9A 4C7KA 1E3WA 3PUZA 4IO0A 3TQOA 4OXKA 3P1JA 4ND8A 1Z0KA 1EXNA 1KQFA 4AJ2A 4KR0A 4BMVA 3O2SB 2WE8A 1ECBA 3WVNA 2GSDA 1H1TA 3HNOA 4H1HA 1BCSB 1MR3F 2XW6A 4TSKA 2ZR0A 1L3CA 4CFYA 3OTHA 2VHJA 2Z2IA 1XHLA 3NCTA 3GMTA 5ENZA 3IKJA 1NVDA 4G56A 3A1DA 2IHKA 4GZ6A 5FAXA 3WIBA 1NVFA 2FQYA 1OXKB 3KDSE 4MPPA 4DREA 2I6QA 1CQIA 3OLVA 4JT9A 5LQKA 2FLVA 2W2LD 2PUGA 4GKAA 3NHBA 1GV1A 1N3IA 2JNWA 2CNWD 2RH9B 3D8UA 3FHCB 1LF0A 2AN9A 2MDTA 4TWRA 1UKVY 4BQOA 1GFIA 4LDRA 1OC2A 4WL0A 1QANA 2OXTA 3T8YA 8OHMA 4ZC8A 5EJIA 1YF3A 2GFIA 1EUDB 4X9XA 1U8AA 2WICA 1O6GA 3GP5A 4E5VA 5B1DA 2KS6A 4G5SA 3G0GA 4MHTA 1A7JA 3DC7A 1TL7C 4FNMA 7ADHA 1RRKA 3NTVA 2JJ2D 4YJGA 2X9QA 5EMLA 4N5HX 4GHWA 5AJUA 4UD2A 1AB6A 4J0FA 2PS0A 1Z15A 2G7ZA 2NVUB 1F51E 1LPSA 4CR8A 1DO2A 2Z30A 2OGWA 2QS9A 3N28A 1XZPA 1CQWA 1K3TA 1V9LA 3FOBA 2QLLA 3F1KA 3VNRA 1VYHA 3DTYA 1X1SA 4S24A 4NXNB 2BHTA 3X1XA 3ZS9A 1KZ1A 4UKDA 4DWJA 5REQA 3ZXYA 1LK0A 2BH2A 1VYUA 3ZU3A 1JT2A 3UKJA 2GCOA 1ZD5A 3S2EA 5TQVA 2ZSEA 3ZWXA 1N3LA 1FPQA 2UXCB 1E20A 2IYAA 3IVRA 1TM4E 2JK1A 2R85A 2V59A 2VPPA 3B20A 5AXCA 3TK1A 4BMSA 4CI9A 3ROKA 1MDFA 4UDYX 4OJTA 4EBFA 2NMVA 5ALGA 2I6SA 3RJ5A 3V42A 2DFTA 2BY4A 1ZA2A 1JBQA 4BQRA 5AUNB 1DKQA 1DT5A 1H2BA 2GPSA 2ZBGA 4QYIB 3GA5A 2NO0A 3GG9A 1X92A 4HXFB 4ALNA 3G8CA 3OJEA 2EJVA 3HUDA 3HY6A 4BFTA 5KYGA 5C8XA 4AJHA 3CF2A 1XZ8A 5K6AC 2EKDA 2QTWB 3G2HA 4C7BA 3JYQA 2HQOA 3G9QA 1RABA 4LAFA 1X7XA 3PFHA 3N76A 1PX2A 3JQPA 4Q7KA 4ZOBA 2TYSB 3KL4A 3OZ7A 2BSQA 2JGNA 3VZPA 2EWMA 3JZAA 4HX9A 4HNQA 1VJGA 4K46A 1AKUA 3HPQA 1IBRA 4KI7A 5DTEA 2C3YA 4DRZA 4MUIA 1EZZA 3A70A 3WLRA 1KY5A 3JVUA 3ZZ0A 4OK5A 4XFJA 4OK6A 3DOHA 3HSYA 4RENA 2ZUDA 3NDRA 2NTVA 4QM6A 4N0MA 1FMFA 4E5UA 4NYJQ 2E49A 2XVMA 2C54A 2O3JA 1JMKC 5KC9A 4BVKA 1DUVG 4BXOA 3ONWA 2I2BA 3BSYA 4NEQA 3TZ6A 1QIEA 4HD8A 1F2VA 2O0JA 3R23A 2JKYA 1V4NA 2FLKA 1NWCA 3HJRA 3QVXA 4JVOA