1MAUA

Crystal structure of tryptophanyl-trna synthetase complexed with atp and tryptophanamide in a pre-transition state conformation
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
328
structure length
328
Chain Sequence
b'MKTIFSGIQPSGVITIGNYIGALRQFVELQHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYLAVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFKEKSAGKEAVSAGLLTYPPLMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGELFTIPEARIPKVGARIMSLVDPTKKMSKSDPNPKAYITLLDDAKTIEKKIKSAVTDSEGTIRYDKEAKPGISNLLNIYSTLSGQSIEELERQYEGKGYGVFKADLAQVVIETLRPIQERYHHWMESEELDRVLDEGAEKANRVASEMVRKMEQAMGLGRRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tryptophan-tRNA ligase
publication title Interconversion of ATP binding and conformational free energies by tryptophanyl-tRNA synthetase: structures of ATP bound to open and closed, pre-transition-state conformations.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ligase
total genus 121
structure length 328
sequence length 328
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2002-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1mauA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1mauA01
4HPWA 1M8FA 2YWCA 4WSOA 4ZT6A 5H16A 1O97C 3NBAA 2EJCA 2Z08A 2YY5A 5FO1A 3ND5A 1G59A 5J5AA 1S4MA 1U3DA 2DUMA 3ZXSA 4ZT3A 1U7XA 5TEVA 3IODA 1OBCA 1ZJWA 3L92A 1YI8A 3X1MA 1XNJA 2YXNA 4ZCSA 1Q11A 4JFAA 4L2IB 3RHSA 5K0TA 3A2KA 4YMIA 2DR2A 1JZQA 1M1ZA 2DEUA 2I1LA 3NBKA 4MW2A 1LI5A 4DDHA 3CLRC 3I05A 1EFVB 2YWBA 1I2DA 3AL0C 1LI7A 2J07A 3S3TA 3QTTA 4DLPA 3TQOA 1EE1A 3IVGA 3N05A 1JEEA 3CVVA 3GMIA 2X0KA 4MVYA 3KT8A 4GRIA 1EXDA 3ZJUA 1JEDA 2RE8A 1IQRA 2O8VA 1MJHA 3MXTA 1K4MA 1GTRA 3N2YA 1GZUA 1I6LA 2D54A 4MWBA 2D5BA 3CA8A 1N3LA 1J70A 4S1OA 1I6KA 4NDAA 3MLAA 4J76A 2CUZA 3FI0A 3RBAA 1PG0A 1COZA 1J1UA 3DLAA 1JMVA 2QTMA 1JIJA 3CVXA 4YP7A 1Q15A 1I6MA 3K32A 1YIAA 3AIIA 3CLUC 1KAQA 2J5BA 1NUSA 3L93A 4JYZA 5DEOA 1WY5A 2GKSA 1QJCA 4MVXA 2QTRA 3BL5A 2JA2A 1G8FA 4Q93A 4HK4A 5DK4A 1YUNA 3FWKA 4P2BA 2PFSA 1A8HA 3D6UA 4MULA 4EGAA 3IMCA 3ZGZA 5TEWA 1MC1A 2HMAA 3ILVA 1VBKA 1N2BA 5DASA 4ZT4A 4MWCA 2OV4A 1WJGA 3UY4A 4ZT2A 4MWDA 1PG2A 4EG5A 2IP1A 1R6UA 5DB4A 2NZ2A 1X8XA 1WOYA 4G5YA 2CV1A 2PZAA 3ELBA 5KHAA 4ZCRA 1N2EA 1YIDA 3SDBA 1FYDA 2V0CA 3CR8A 3G6KA 4U63A 3SEQA 1TFUA 1N2HA 1O97D 3UOWA 1EFVA 3LCJA 2E21A 3IH5A 3LE8A 4EF6A 3IMEA 3Q12A 3TZLA 1OBHA 1NUUA 3IOBA 1F7UA 1KORA 1MB9A 4YBRA 1O95C 2J09A 3K9WA 3H05A 3MUEA 2EL7A 1T6XA 4J75A 1VL2A 4X0EA 3DPIA 5K0SA 3HV0A 1KH2A 2RD2A 3KFLA 3CLRD 3TQIA 2A1TR 1UFVA 4MAFA 1WXHA 2QJOA 3ND7A 1OD6A 3AKZA 4F3RA 4MUFA 3AG5A 3SZGA 2CSXA 1QU2A 3F3MA 1XNHA 1NUPA 1WXEA 1GN8A 3ZJTA 1XNGA 4KR6A 4NATA 1V47A 4MLPA 3NV7A 4EG6A 3UMVA 1FFYA 1WXGA 5LLTA 3TZEA 1B6TA 1O5TA 1T9GR 1O0CA 1NURA 3DV2A 1KR2A 1OWLA 3HMQA 1OWMA 1IVSA 5H7XA 1EJ2A 2Z09A 4I6JA 1J21A 1G8HA 4YP6A 3COYA 4MW9A 4MW0A 2DXIA 4ARIA 1MBZA 2CT8A 3CLUD 3ZUGA 1J09A 5KCMA 4TS1A 1ILEA 2CYCA 4PBRA 2IELA 3H97A 4NAUA 4MUGA 1WQ4A 4ND7A 4ZT7A 3FH0A 5LM3A 1IFXA 3TNJA 2GM3A 4NAHA 1U0BB 4PBSA 2PZ8A 2WQ7A 1EUYA 4EG7A 4ND6A 1QRSA 3LOQA 2AZXA 3CLTD 4XFJA 4MW6A 1H3NA 2GOYA 2A7XA 4MW7A 4ZCTA 1CT9A 2A84A 2CYBA 1TYBE 1U3CA 4ARCA 4MUJA 1NSYA 1IRXA 2AG6A 1QRTA 4CQNA 1QQTA 3ND6A 1M8KA 3ZIUA 1ZUNA 2J4DA 1HYBA 4E1AA 3A04A 4HJXA 1EFPA 1IH8A 4MW4A 4MUEA 3CLSD 3H99A 3MLBA 2JANA 1H3FA 3P0HA 3FNRA 5AHWA 3D6VA 3A4IA 1J20A 2OQ2A 1O95D 4QBTA 2PXHA 4R2LA 1O96B 3KT6A 1PFWA 1K97A 4R0NA 1EUQA 3FY4A 3FHJA 4JZYA 3HFJA 1JILA 1O94C 3PRHA 1JHDA 4UZFA 1KKUA 1QRUA 1G8GA 1OWOA 3CVWA 3CVUA 4MUNA 3OTWA 4K03A 3IOEA 3PNYA 4KPUA 3MMXA 2HGZA 2XRZA 2CFOA 2BYTA 1OWNA 4U8HA 1P7PA 2PG3A 1R6TA 1KAMA 2A88A 1ZH0A 3PNVA 1VLHA 3GUZA 4K0RA 4MUHA 3IDFA 2NSYA 1K4KA 4CDMA 3HZRA 5EKDA 4MVWA 1M8PA 2D13A 4PY2A 1QTQA 1GPMA 4AS1A 1KQOA 4NZPA 4Q16A 5LFAA 2CV2A 5IJXA 1XJQA 1M8GA 1O6BA 4RUKA 1X6VA 4H3SA 4KR9A 2WB2A 1O0BA 1YUMA 3UC5A 1R6XA 4FZJA 4A91A 3IMGA 3SZ3A 1NUTA 1Q19A 1VBMA 4MUIA 1EFPB 3H9CA 1MB2A 1DNPA 2CV0A 2QJTA 1H3EA 4G5FA 4KKVA 3H9BA 4ZT5A 4EG4A 5TGTA 2HZ7A 3PXUA 3IVCA 3KT3A 2QUHA 2A1TS 3P0IA 1IHOA 4JXZA 2C5SA 2DETA 1PFUA 4YP5A 3TS1A 1N77A 4CT0A 3RK0A 2ZUFA 3OP1A 2PZBA 2QJFA 3RK1A 3SEZA 1PFYA 3N9IA 4R2MA 2E18A 1N1DA 1WXIA 3C8ZA 2V0GA 4XSVA 4F4HA 1O96A 1N2IA 1N2OA 3QE4A 2BTEA 4KPUB 4DE5A 3COZA 3P0JA 1V8FA 2B7LA 4WNYA 4EG8A 5FNZA 1T9GS 2X1LA 3AG6A 4I6EA 2A1UB 5JBNA 4MW1A 1MOPA 5HG0A 4U7JA 5F23A 1TEZA 2DPLA 1GAXA 1GTSA 2QTNA 1MAUA 3PNBA 5J59A 3U1VA 1PFVA 3A05A 1TYCA 4MQ6A 3FIUA 3FG9A 4OUDB 1GLNA 4G6ZA 4GU5A 5HUHA 3ISJA 2VTBB 1LW7A 2Z3VA 4ZCPA 3IUBA 2AKEA 3FOCA 1SURA 1M8JA 2H2AA 4PBTA 3RJZA 2G36A 3VRHA 2CYAA 1T6YA 3Q10A 3JXEA 2TS1A 1O94D 1TQ8A 4EG1A 3VU8A 3KT0A 3QTBA 3DO8A 1KQNA 1JECA 1MRZA 2X3FA 4OJMX 1IQUA 1NUQA 1M83A 1QNFA 1N78A 3GLVA 2DLCX 3G59A 1TYDE 1BS2A 1KP3A 5BNZA 4XFDA 3SP1A 1F4LA 4MW5A 3FDXA 1JIIA 2QUKA 1NZJA 5IHXA 1T6ZA 1JZSA 2PIDA 3HGMA 1WQ3A 4DDMA 1K92A 3X1JA 2WQ6A 1N2JA 3IUEA 1OWPA 4UZEA 4DJAA 1TYAE 1QU3A 3INNA 2R5WA 3RFFA 4CDNA 1J1ZA 1YULA 1WKBA 5HUJA 4JXXA 2O5RA 1JGTA 1Q77A 4HJRA 2ZP1A 2A1UA 3CLTC 3CVYA 1F7VA 3VGJA 2E89A 1KH3A 4L2IA 1NP7A 2H29A 2WSIA 1U7DA 1N2GA 1MAWA 3E27A 1VBNA 4DDKA 5J58A 2A4MA 3Q4GA 2VXOA 4EG3A 1KP2A 2E0IA 2XRYA 4OUDA 3COVA 3FETA 4AQ7A 1ULHA 3COWA 4DNXA 2X1MA 2VTBA 1WZ2A 1KH1A 4MVCA 2J08A 4KR7A 3N8HA 4I6GA 3P52A 1JIKA 3HL4A 3ZXIA 1IQ0A 3CLSC 4RPIA 5TS2A 3IOCA 2QUIA 1D2RA 1Y42X 3G5AA 3IVXA 1KQPA 1N75A 1WXFA 1F9AA 4ZCQA 4BWVA 3AFHA 2A86A 5KWVA 4NX2A 5FO0A 2QUJA 4MWEA 4QRDA 1NYLA 1ZH6A 4MUKA 4EFKA 1RQGA 3X1KA 3ZJVA 2IJGX 2DERA 3SYTA 3UK2A 1NI5A 2ZUEA 2JAXA 1H1TA 3M5WA 4QREA
chains in the Genus database with same CATH superfamily
4D4IA 1XWIA 2IYYA 1NXOA 4IDPA 4TS9A 1P91A 3DW3X 4JR0A 1VHLA 3D8NA 4H3KB 4WSOA 2OHJA 3RIEA 1BDJA 4XB1A 5C80A 3MQ2A 2OZEA 4QJ5A 1YVPA 4HXGA 3NHAA 5KDDA 2NTVA 4JT9A 4TS3A 1MIOB 3DMPA 3R9KA 5B7NA 1U0HC 1VBFA 2NUBA 3HCPA 5DM1A 2AMFA 4DCCA 4JSRA 3ESAA 3OY7A 5IK2D 1I4DD 4Q01A 3OPYB 3EZ7A 1ZGBA 1TK9A 4X7RA 5EKSA 1LVUA 8LDHA 1RPNA 3W5DA 2YX1A 3UJ8A 2M1ZA 2W2VA 1FLAA 4CVNA 1M9NA 1RLTA 1ZRHA 3PXGA 2AGVA 4FGKA 3TH5A 3KUXA 3LMKA 4GEKA 3JVEA 4Q4JA 4YT5A 5BWNA 5B3AA 1KE2A 4RGQA 5DTJA 4YQFA 1WDWB 3DULA 3KJXA 3AEZA 1CNFA 3UHPA 1EFVB 3KQVA 3WAGA 3R4VA 4XASA 4EYKA 4MYHA 4GGMX 3VQTA 4DR3B 2GPSA 4AZSA 1QCCA 3I0ZA 3WBFA 1R8XA 3G2NA 3NETA 5BYKA 5G1PA 1JEJA 2EBFX 1VI6A 3JQBA 3Q7QA 4CN9A 2IQIA 1JH9A 1AKTA 2J0UB 2OAQ1 2QTAA 2ZI7A 2R1ZA 2D2FA 4MVYA 1TTQB 2GTPA 3EJWA 1RTKA 2TSYB 1R5BA 5JZ9A 3DMNA 1FVXA 2PAFA 4ZMSA 5C8YF 2PUHA 1JQEA 1QIMA 5BMOA 1UXOA 2BFOA 4JQZA 1MJHA 3JW8A 1JIVA 5KYVA 1AMUA 1H9CA 4L8YA 1NNUA 4C0AC 2ZT5A 1PQWA 4WKGA 3DVQX 2FVXA 3K92A 3RKSA 2O0JA 1L8AA 3NHJA 5H59A 3BS4A 4UBMA 3L7JA 5HMMA 4ZO4A 2OV3A 1VJ1A 3QKUA 1Z45A 4YACA 5K2MA 1P3DA 4J1NA 4UMFA 3CZ9A 5DWVA 3ZEIA 3ETGA 4OQMA 3R3SA 1I6KA 2A57A 3AXTA 2MOKA 4LEIA 4MV8A 3UWSA 3D3KA 4J1SA 4LC1A 1JWBB 3N0TA 4Y98A 3VSEA 3PGMA 4B4DA 3A0UA 1NA5A 3E58A 4N3AA 3TPCA 4HGNA 2Q1TA 2OXEA 3Q85A 1Z4MA 1V2HE 5ED0A 5ENDA 2Z5LA 1KAQA 3JQQA 3R41A 4BRUA 4X1OA 5BO5A 1A04A 1ZXXA 2VRWA 5EZQA 1KJQA 2R00C 1MX5A 2Y4NA 3RNLA 1J06A 1U31A 2EWVA 2C4MA 4Q3DA 1QJ4A 1D0SA 4E6EA 1C4WA 1M2OA 3C8UA 1R00A 4JBYA 3EHEA 4LC9A 4OK6A 4QOFA 3SYKA 1W36D 3G85A 2D5AA 3OG9A 2AC7A 4LGVA 2GQ0A 1E89A 3RCBA 5JCPA 1M5UA 3I2GA 5B3KA 2RK6A 3GLIE 1DT5A 3HKDA 3T52A 1L3CA 1X0XA 1NN3A 2ATCA 3HKCA 4HEA1 2VHEA 2Q3MA 5DB4A 2C2BA 5I7EA 3C3MA 4JGBA 1EK2A 4AN1A 3R23A 5AWFC 3B9QA 5LMCA 1YONA 2H1RA 1YQWA 4AFNA 4X85A 3ETDA 1VI2A 2BFMA 2PZKA 521PA 3RT7A 4QUDA 1LK5A 4NVRA 3UOWA 3EPLA 2DPMA 2Q3DA 3NRBA 3Q12A 4C6SA 3IUQA 2GFIA 1CUCA 2VSFA 3TLEA 3WYNA 4I55F 2JIDA 1OBHA 3NYRA 4IDNA 4Q9KA 3DLIA 2DLDA 1GV1A 3BSYA 1M74A 1Z8HA 3UZUA 1JEYA 4MWOA 2O8EA 3BXXA 3WB0A 1XR3A 4L08A 3SF0A 4B32A 3O8RA 5FCDA 1A72A 2R7KA 4LF7B 2PGXA 4GMFA 1E98A 2OCDA 3GARA 1TCVA 1X1TA 2H11A 4GX2A 2YJGA 1M6YA 4Q7MB 4M54A 4G1VA 1JU3A 4PS1A 4UREA 4KOAA 1CUJA 3ZQJA 4Q0MA 3HB9A 1XNRB 1BMTA 1WVIA 2REXB 1X19A 2UDPA 5CAEA 1IHDA 3AEQB 2DBRA 1QC5A 2A1TR 4M0DA 4FTWA 4RKQA 1OE0A 1CDZA 3VISA 1JKJB 1T25A 4N3NA 2EZ4A 4NR0A 3DF9A 1HE8B 1OXXK 2BEUA 4FE7A 1T8TA 4KRFA 1BVRA 2LIPA 4EZBA 1OASA 4GZ6A 1WUJS 1SC3A 1JTFA 1K66A 1A69A 3M81A 1V7PC 4MVJF 4O2LA 1Y7LA 1N3IA 2OHGA 4P4SA 1PV1A 5K6RA 2VXBA 4H60A 1O54A 3GO4A 1OGJA 2EIXA 1R8SA 1UMDA 3SC4A 3BDAA 3FCXA 3SKVA 2V7WA 4ESVA 3B82A 2QXYA 4BZZA 4AJEA 2EBUA 5AM3A 5BNTA 5J2UB 3JPYA 3AB3A 3MCWA 2REOA 1I7LA 2ZQZA 4BQEA 1FE8A 1ZRSA 5H0IA 4RFSA 3TTWA 4P38A 5F52A 5H7XA 2W2TA 3A6GA 1FQWA 4RIFA 3LT5A 4YP6A 2C00A 5C4MA 3BSWA 1JFFB 4DXDA 1H9AA 2FZCA 4O2BA 4JKOA 4Y30A 4ZCIA 4JC0A 5LDDC 4UM9B 4N41A 2QP4A 4JSYA 2XSZD 1V4BA 4KIGA 4WINA 1G16A 3MGGA 3S1AB 2EZTA 3SS7X 1VL0A 5ILOA 2JK0A 4OX9Y 1G18A 1I1HA 4QGSA 1AY0A 4JYPA 1M6HA 1QAMA 2IUFA 1IYZA 4PW0A 3GEHA 1SC6A 2G8NA 3GUVA 3HRKA 4MUGA 4YJHA 1VMDA 3D02A 4TM8A 4XWWA 1IMOA 1IL0A 1EK5A 4ZC1A 1PHPA 4EM6A 3KHUA 3ZCSA 3UHJA 1TO1E 3WLMA 1PZFA 2JAPA 2PZ8A 3D6AA 2GZRA 1M2NA 3QA3E 3NHSA 4M8NE 2NP7A 5B7GA 1KMHA 1ODTC 2HDHA 4EG7A 1T5HX 5HZKA 4TMXA 4DC1A 3E53A 1V41E 2VDOB 5M29A 1I7DA 3HYNA 2AFHB 4MNTA 2FSHA 2IYOA 1L1RA 2WDZA 2GOYA 1EI9A 3M4ZA 4X92A 3L6BA 3NVAA 1DTEA 4HEHA 4ODIA 4EECA 2ORIA 2J45A 3U31A 4A2CA 1U65A 4IUBS 4PPGA 4Z3KA 3OICA 4M36A 1XYGA 2OZPA 3QBEA 4B5LA 2BEWA 1PT8A 4IRXA 3HN6A 3OZGA 3G9TA 1GQRA 3IKLA 1OBFO 4IXNA 1VJRA 4UHKA 1C9EA 3P45A 1Z12A 1ZCZA 1BJRE 5AOVA 4HJXA 4F3YA 2NMVA 1WMEA 3KLNA 4LIPD 5FWNA 1EFPA 2YV1A 3B60A 1C2TA 1PLLA 1NJGA 3PIRA 4HZIA 4P5DA 4TGLA 2XXAB 2CJXA 2JANA 1HO3A 2J8ZA 2J9FA 5CHEA 4CM7A 5K8JB 1QOPB 1N8NA 3DGEC 4J9UE 2E1RA 2DMRA 3RROA 4IVNA 3M33A 2BFEA 1RHQA 1M6VB 3WSTA 2BP7B 3ZJ4A 4FDUA 4DV6B 3WK7A 4MKXA 3MRXA 3T8YA 2FXVA 4NH4A 3V2GA 2DJ5A 3V4ZA 5B57C 4LGCA 2RGBA 3E7DA 3L0YA 3ZU6A 5ENVA 1QKJA 3EULA 4DLNA 4HCJA 5G4KA 4KQCA 1A2KC 1VMEA 2YFKA 2FW0A 3HCNA 3QI2A 3G13A 4OGKA 3UFBA 4I55B 1MB0A 1CY6A 2JLRA 1UKBA 5C35A 3FPLA 1Z62A 1KR5A 3MCAA 2GPBA 2HGZA 3RREA 3SX0A 1YFLA 3PFIA 5IABA 4M53A 4Q6BA 3LDHA 1MV8A 1ZH0A 1YBVA 3NTOA 5LSAA 3R09A 3GUZA 4ZYVA 3F7MA 2QNIA 2HQBA 4NL4H 3R1IA 5I8PA 4QQ8A 4BQOA 4R1TA 3N53A 2C57A 3LJKA 3WRXA 4C87A 4IH9A 4WZ6A 4NCAA 1RE1A 2B3TA 4MB6A 3BJRA 4CNQA 2B0JA 1ZNQO 2XUJA 1TQ2A 1E4VA 4ATNA 2CV2A 1CE8B 3DVAB 1FU7A 5H3CA 1LC0A 2PKCA 1AGPA 4TV9F 1D1SA 2P3SA 2SCUA 1BYUA 4Z0NA 3E4CA 5KBYA 1O4WA 4PX3A 5K51A 1SUDA 3PVZA 5DCLA 3FI9A 3EFOA 1YCGA 3KEOA 4Q39A 3RU7A 4F4CA 3OJEA 5EIAA 3GT7A 5J23A 3AJRA 4TQUS 3L8MA 1AV7A 1DNPA 1PNTA 3MOSA 4UUQA 3QLUC 4LDQA 3ID6C 1OJLA 2FFJA 4PZEA 2O57A 1JVBA 1MABB 3OIGA 5BR8B 4CL8A 1WZCA 2QU8A 2ZYIA 2NUAA 3NAZA 4O33A 1H4QA 4PPFA 2A1TS 1D2AA 1XP8A 3EGXA 3EPPA 3WMGA 1BEZA 1X9HA 2E4UA 3AGPA 3WIEA 3P1JA 2VAMA 2XCLA 4I7EA 5KJFA 3GV0A 2EGHA 4LOLA 3C48A 3DAOA 4YJ2F 3ZDEA 4E2FA 4JDPA 3AGQA 3DZDA 2E18A 2P4SA 1OB2A 1USGA 2FPMA 5JMTA 3IPLA 1WXIA 1H2RS 1WA5A 4DR6B 5K3CA 2WJPA 1IY9A 4UEKA 5CVCA 3OCXA 3M1YA 1EJBA 4ETWA 3P0JA 2HPAA 3IV6A 3P2JA 2B7LA 4WNYA 3W1EA 1CDEA 1KYIA 2C61A 1T2EA 3PBKA 4J1QA 4M2LA 1DCFA 1DL5A 1F6BA 2ONCA 4DIMA 3FYUA 2I55A 4Z86A 3UA3A 1JHRA 1ORRA 3LSYA 3BF7A 1JU9A 1U8YA 4YJFB 1D4FA 1LI4A 1U8AA 1Y1LA 1B8UA 2A9JA 1C9KA 1VA5A 2HWWA 1H2YA 3C1AA 3L5OA 4BNUA 4EHDA 4ETIA 2Y9MB 4KACA 3UKDA 1BVUA 1DKRA 4G0XA 4MYCA 4RU1A 2IH4A 1L1QA 1UAGA 2V4UA 3RC8A 4OUDB 4DCSA 4XWKA 5FAKA 1YRYE 4Y2UA 4WJLA 3WLEA 3VI4B 3Q40A 5BSWA 3OKCA 4E2ZA 4W8OA 1D1QA 1EP3B 2J59A 4KGZA 5IC5A 1ZINA 4C07A 5B2FA 2BBWA 4ZN6A 5JVDF 2XRMA 4BLTA 4OHUA 4ARUA 4W5NA 2G36A 1M7BA 2CNOA 3S1SA 5DHUA 3STTA 1JJFA 1BKSB 4KBYA 3RTEA 3VPCA 4EJSB 3T1QA 2EX0A 4IIUA 4NDZA 5ALTA 5K99A 4IUYA 1YZQA 4CQLB 1LFDB 2PEZA 3RSSA 1GR0A 4EY8A 1NR7A 4RVSA 1IJBA 4L22A 4ZOLF 5KQMA 5I9BA 2OXTA 5KUTA 3B53X 1IQUA 4NBUA 5TQ2B 4UAGA 3NUZA 4DBLE 1S2IA 4D44A 3A31A 5D85A 3TLGB 1F5NA 3H1TA 4UE6A 2ZQ5A 1ND5A 2V3CC 5CX1A 3WMRA 1TYEB 4Y9UA 3NWEA 1A5ZA 2A3NA 3FDXA 5ALNA 3SYRA 4C0KA 5JEDA 4KAFA 3JAWB 1A5AB 3V6LA 5JAPA 2ERXA 1XUOA 4UKDA 4XA8A 1LLFA 1V16A 2X76A 4GOXA 3U0BA 1ZGZA 3STWA 5BMVF 1KO7A 4G8BA 1U9ZA 3W5CA 1DGQA 2IV7A 1QHNA 3S4YA 3SKXA 4Y2YA 4F7WA 5A6VA 5ICCA 2GEDA 4IX9A 1A5BB 4A9AA 3EEIA 3VO1A 4DKXA 2L19A 1I7PA 2YHAA 4JBLA 5JDIC 5JSHA 1F8XA 4XUDA 2PYIA 4JUCA 2CVOA 3BZBA 4ABTA 3OZTA 4LS3A 2FJPA 1FDSA 6LDHA 5J1SB 1VJ0A 1CLEA 2J3MA 4NKRA 4NHOA 3SBXA 2D1YA 2WICA 3LPLA 4DG5A 1ZM7A 3ELUA 5TDHA 4BQSA 1MC4A 4BDTA 4GOOD 3EWAA 2P1DA 5KWJA 5KTOA 2VP6A 2GJSA 3K0AB 4YJGB 5H5JA 1OMOA 2G9UA 3V4SA 4EY6A 2GPAA 3D7NA 3NI2A 3CF4A 1WNFA 3ZI0A 1QO0A 3BWCA 3ESQA 4V24A 2OMEA 5IWCA 3ETJA 2JC3A 1GQYA 3URMA 5KPJA 5E1DA 2H1LA 4K26A 4Y6OA 1TCCA 5HKAA 1U9IA 2FW7A 3K70C 1LZLA 5HZHA 5CXXA 2DRIA 1OYWA 3F7NA 4MRMB 2XWPA 4KGXA 4U1RA 5D3ZA 2Y1EA 4EYSA 1ECLA 1X77A 2G08A 4HX5A 2OT3B 3K0HA 5JAZA 2V6FA 1CJTC 2WHPA 1P2VA 1FRZA 2BHTA 1AK2A 3OQJA 4EQZA 5L3ZA 1PYOA 1QKIA 4XIIA 1L5QA 2I4NA 2Z5VA 3EOZA 1D2RA 1TMKA 2G8LA 3IVXA 4MVJE 3QXHA 3MMZA 1WTAA 1WXFA 3GUHA 4NARA 2NU7A 2AG1A 2RGEA 4HBGA 4WACA 4M8LA 3KZ1E 2UKDA 3AR7A 2HV8A 4YJ2B 3BD6A 1B2LA 3LY7A 2YRFA 4LN1A 2DERA 1R74A 4EBBA 4RGBA 5EZYF 4QREA 1MZVA 3Q6IA 1YSCA 2FSIA 3O8NA 4YP9A 3B3GA 5MN6A 2VDUE 3S7ZA 1SWVA 1YRAA 3CBQA 4MR8B 1CR4A 4F4JA 3K1AB 4DLWA 3P2IA 4MB2A 4ZO6A 2CHVA 4I3HA 3RJMA 2YXPX 1FYEA 2GHTA 1S4MA 4J3JA 2W6QA 3TPFA 5LJIA 2DFNA 1X80B 2I6QA 3JALB 4Y6QA 4CETA 5HVNA 1MF7A 1L5SA 5JS2A 2C5LA 4X45A 4C05A 5TEVA 1GRNA 1P6QA 1R4MB 4MIYA 4HLUA 1RJ9B 1UBCA 2AFRA 2WB4A 3V48A 2XIQA 5C8ZA 1BGWA 3DOUA 2YXNA 3QVKA 3EFEA 4R2HA 2CC2A 3ORSA 4YGYA 4BE9A 1ZOPA 5IKPA 1USIA 1NG1A 3WL3A 3MF4A 4MVJM 3ZQUA 1EM8A 3CUKA 3G0OA 3NIBA 4IEEA 4X00A 3ESCA 5ARBA 4HDNB 2LXNA 2O5VA 3C5VA 3DCNA 5F33A 5FBZA 4DPLA 3TI7A 2JK1A 4H7DA 2AF4C 2OHVA 1I94B 1NR1A 1F2UA 3NDIA 4FQ5A 2AI2A 1D0VA 3O93A 1LBHA 2EV9A 1TCAA 2E85A 2G72A 1QO7A 3L2OB 4LY3A 4P08A 4D0LB 3WHIA 3I5UA 1H42A 4XJXA 4DLPA 3IVGA 4KZPA 4XSHA 1AKNA 3D0KA 3EB9A 4ROTA 1JW9B 2B4RO 3T1TA 4GQIA 1QP0A 3ECAA 5DGTA 2IYLD 1OROA 3RFVA 1ZISA 5FPSA 1T4BA 2C59A 1P2DA 2ZIUB 3BTVA 3UJ9A 4B87A 5M5BA 4B33A 2IEAA 1Q7BA 1IJFA 2VJCA 3X1YA 2Q3CA 2H85A 1L8LA 5LC1A 5BSGA 1XN4A 1ISJA 3LP8A 3UYKA 2CHEA 2MTBA 1X1BA 2MCFA 2YHSA 4C1NA 1QO0D 3DDHA 3SMVA 3EBLA 3NVKI 1DAIA 2X8JB 4KIWA 1QHEA 4Q1DA 2ZRFA 3DLAA 2O2EA 4K9OA 5JROA 5EE9A 3CINA 1Z0FA 5FKJA 2OG1A 5PGMA 3FRJA 2O2XA 1RXUA 1ZIPA 2PGDA 3DWFA 3OH8A 1JBQA 2J9YB 2P9ZA 2O9JA 2VRCA 1VKZA 2V6BA 1ZGGA 4TYNA 1FP4A 1P62B 2C5BA 4TLEA 4CLEA 3SNKA 3SLKA 4ZYLA 4Z3DA 4N76A 3EQ7A 1Y4DE 5T8KA 1LSUA 1XKQA 2FPGB 5JCJA 3O7MA 3L82B 3ILVA 3PC3A 5DLYA 5HE8A 5C4GB 3ICWA 5CA1B 3ROXA 3CW2A 3L6RA 3FCAA 1UT6A 2I2XB 2QW0X 2ZIZA 3I1FA 3QUCA 2FQXA 4OB8A 1Y63A 4PXSA 1MXHA 3IMFA 1ZRNA 1LPSA 3GLRA 4FLFA 2ZS7A 1O94A 4G4JA 4DMFA 2A9KA 4G5YA 1KRXA 1L3IA 3WGHA 1E2DA 1OX4A 1OY1A 1Y3BE 2XWSA 4IGEA 4L5YA 3WRYC 4XYLA 2WUFA 3OZRA 3M1IA 2ZUBA 2ZWMA 5LJLA 4U63A 1NQTA 2WU8A 1EP9A 2H1IA 3AEKB 3WIBA 2E4VA 1X7HA 3EDMA 2GB4A 3QPDA 5EUBA 4Q7QA 2XW6A 1B2RA 1NFRA 4YAUA 3A1VA 3QOYA 4R0VA 1XZQA 1PJQA 1UDAA 3ENZA 4S12A 3RIHA 3ZDAA 3ACBA 3ZYCA 5CB4F 1DOZA 1KZYC 3TIVA 5TIIA 1OZAA 2CFTA 2O8BA 2G5GX 2DQYA 2P2YA 4M87A 3P0RA 3GEPA 5CYPA 1JH8A 5EYPA 4RK6A 3M4JA 1OFHA 5CYGA 4PTZA 4C0XA 5EJMA 1AXEA 3NORA 1XZBA 3W3ZB 5BQOA 2D0PB 3B13B 1W44A 1Z5WA 4M0MA 3MUEA 1PJCA 4FEAA 2Q0HA 1E96A 1NBMD 4OAPA 4BFUA 4NNJA 2Q2NA 3GFGA 3HFSA 4RWZA 3BPSA 1MEJA 1XZEA 5CJJA 2WMOB 1OYOA 2JFBA 4O4LA 4PX2A 1PQ4A 3IPYA 4P22A 4Q37A 4S04A 1TMGE 4ZI2A 2H1VA 2ZVPX 3TQIA 4UAJA 3PA6A 3UHFA 5F9HA 3CKLA 3IEVA 4H0NA 5ILGA 1U90A 3H2BA 3NAGA 5J4KA 4LV5B 4HEQA 1RYFA 5A05A 4BS9A 4D7AA 4JI7B 4ZGWA 3DOJA 3VKVA 3VHQA 2CUTA 3ZD9A 1NUPA 1GNQA 3Q9UA 1YS4A 2FW6A 4J91A 4COOA 1EX1A 1MDFA 4QYIA 2AOVA 3PYXA 2GK3A 3RE1A 4D3ZA 5C5EA 3UAYA 5JLJA 5CBKA 3UMVA 1FFYA 1CEYA 3R7SA 4AU1A 4C29A 2WKQA 3AKYA 3EUWA 2J3IA 3DKPA 3PI7A 2BM9A 4DL9A 1EK6A 2DKNA 1T4DA 3LDAA 5JWHA 1XL1A 3IIJA 5FA5A 2WWGA 4PZPA 3WKAA 3ZIDA 4YI5A 4DQDA 1EZ4A 1LUAA 3IHLA 3LVBA 3C5EA 3O8OA 1FMJA 1U2ZA 3REQA 3WLNA 5KWIA 2ZI6A 1WR8A 3FNIA 5JNUA 3KKPA 1V71A 1BS9A 4DA7A 1VE6A 1ZSVA 2HLDD 2QP9X 2A8YA 4F3TA 1G8HA 3AERB 3ML1A 2V6MA 4O2AB 1NU8A 2QX4A 5LQSA 4D0NA 4DQKA 3FWNA 2JIZD 3B7GA 1P0FA 1WLYA 2BCEA 1AQUA 4TL9A 4RLFA 1U4SA 3CS3A 1HETA 1O1YA 4IDDA 4TLDA 4FYIA 1KYWA 2CT8A 2ECKA 1COWD 2G83A 1N0WA 4OQNA 4TS1A 1L5RA 1SOAA 4KQIA 1PTJA 5E4FA 3VH3A 4AJ4A 1XCOA 3EXHC 5KZMB 1GO2A 3KQYA 2Q5HA 4RV9A 4H6PA 4XVRA 3T1VA 1QIGA 2OGSA 3JQAA 5DHTA 1KJIA 1TC1A 4MVJI 5LA6A 1GPKA 4AYTA 1JJAA 2QXUA 3AHIA 4GX0A 3L0CA 3W7AA 1U4NA 1GTJ1 3TNJA 4NCNA 3GH1A 4IINA 4MQ5A 4BECA 4MGYR 4D79A 5JSZA 5I7SA 4ONEA 1BD4A 2PY6A 4DXHA 3QG5A 1J9ZA 1WNTA 4JKYA 2BLNA 1AQYA 4FX2A 2XZLA 2FDCA 2IZ1A 4MPDA 4RVFA 4XPIB 2E48A 3LLUA 4ZCTA 3O8CA 3HCFA 1GIAA 3O92A 1ZN9A 1DFHA 1YAJA 3HDJA 4MIOA 1VSTA 5DOVA 3WGJA 1B14A 3U4GA 1JXQA 1ORHA 2HSWA 4IPTA 1L0BA 4O4JA 4KUEA 5T4HA 3V1KA 4BFXA 4XVHA 4Z8YA 5ITZA 5B3JA 1E7MA 3CIOA 1G8SA 1PBNA 1UQTA 3E8XA 3OT4A 4GBMA 4X65B 3K70D 5GV8A 3MJVA 2QRHA 5BSMA 5U1PA 3AL0C 3M1AA 4BEBA 1T9BA 5I4IA 4NCBA 1E4EA 3FWZA 2TMGA 1Z73A 2PQ2A 1X7ZA 3IA2A 4JL8A 5A6SA 2ORYA 3G2IA 3D9QX 1HDEA 3ME5A 3O31A 2YHBA 2Z9DA 2YUIA 1N8SA 1FQOA 2P7IA 2RCYA 3ICOA 1XMPA 4Q3NA 4QFMA 4X44A 1E60A 4ZU1X 3UXYA 1CK4A 5IZ4A 4QXMA 5KX5A 3TGLA 1PSZA 5DHFA 4BLUA 3F9RA 3WGTA 4BNJA 2LR0A 1B8VA 3Q6NA 1UIMA 4CTMA 5JC8A 5FR1A 1MG0A 4F71A 1XDSA 1NRXA 3N2IA 3L7MA 4MCAA 4YRCA 3N58A 2AFIB 2EU8A 1Y4ZA 2VZEA 1H0HA 2G9RA 3I76A 3QEMB 4G81A 3T61A 3D7SA 3HFJA 5HGXA 5ALXA 5JJCA 4OFZA 4ZDIA 3ANSA 5KYXA 4OD0A 1J5PA 5JC1A 2WKSA 3K2EA 1WAMA 3ZE8A 5FEUA 3UJPA 1ECBA 3RAGA 4QOJA 3WZLA 5C7LO 1UAAA 2GVDC 1D8TA 2HH9A 2PGAA 2WU3A 3H8WA 4OAQA 4PX5A 1M2EA 5GJVC 1JA9A 4BWGA 4CI0B 2IS6A 1AH2A 1HTWA 3H1FA 3B5IA 3HBJA 5AW9A 4GE0A 4BNIA 5IAEA 4EITA 2VATA 1W4BA 1EDEA 5A9RA 2HRQA 5KSWB 1RWVA 2GVNA 1TL7C 3CXRA 4V0MA 3UAGA 1Y6JA 2H8KA 3G5MA 2HSZA 4ALKA 1R5NA 1CRZA 2BI8A 1K4KA 2PZEA 3VJKA 2FPKA 4DM3A 3HKEA 3GDHA 5BR7A 1FDVA 1OI4A 1TCUA 2JATA 1ZM3A 1XU7A 4P7KA 5G4LA 1B42A 1QG4A 4BKRA 5C4IA 3UQZA 4JJ4A 1FU4A 3GPDG 4BAUA 2FYTA 3H17A 4U2GA 3SC2B 4Q1VA 4RY8A 4G3XA 4I36A 1T2FA 5JMWA 1WXDA 1V3UA 3LQYA 2G3YA 1Y5IA 2JGKA 2B36A 2H63A 2FMXA 2P6MA 1A98A 4FMCB 4GW3A 3GJ8A 4JLSA 1HFWA 4MXDA 3S44A 2IEBA 3H1BA 5A5FA 3MW8A 3SZ3A 3UH1A 1E0AA 1EE9A 2ZG6A 3KE9A 1KS2A 4MYDA 2GARA 2C2XA 1ESNA 2KBEA 1YL5A 2FDRA 2WUWE 2WUVA 2YOHA 2EXXA 3NHZA 4JS0A 3WKEA 3D6TB 4M8IA 5CXQA 3QNWA 2PUEA 2C3MA 5E2IA 3MWFA 2YW9A 1DRJA 2C3UA 1R3UA 2HZ7A 2WT9A 3JQAD 4PZUA 4QOSA 1G20B 2QP3A 5DXAA 3NFRA 2DBZA 4GLOA 4CMEA 2C0QA 3PJRA 4GWLA 3SZUA 1TO6A 1JKIA 3CLVA 1PFUA 1QZUA 2HPHA 4EI2A 5AJTA 1CSEE 2FVYA 3CEHA 1Q0TA 4Q12A 2ZI9A 5AKJA 4ZQCB 5IANA 4IG4A 1PFYA 2YDXA 1MO5A 3DTVD 4GQBA 1DZIA 2IPAB 2WG0A 2ASVA 4V0KA 4IIEA 1FIUA 3C8ZA 3KXKA 1A9XB 4EENA 4LF6B 4JNCA 5HFJA 1HT0A 2BTEA 2I0FA 4RV4A 4LV8B 3VOTA 1YB6A 3SM9A 2QV7A 2H2FA 1XD9A 3FRIA 1G4AE 1Q0ZA 4BLQA 4DMMA 1FTGA 1VGQA 5G3ZA 4CLRB 3LX4A 2ISCA 2MSNA 2VWGA 3SHFA 5L7YA 3PT5A 4WXRA 4B4KA 2CK3A 5L45A 2VP9A 2WWYA 2QD1A 3L4JA 4P54A 5JDCA 5L53A 3PNBA 3QIVA 3W8DA 1SU6A 1FFHA 4CMIB 4DCPA 5E9WA 5HKKA 5HUQA 3QFFA 3TLAA 3A05A 1VYUA 2ZGVA 4LE2A 4CZ2A 2A5DA 4GYJA 1HQKA 2X2OA 2PCLA 2KBFA 4KJXA 4MMYB 5HUHA 1RJFA 5IJ9B 4LHWA 4V2UA 5EIXA 1F8UA 3B1KA 1QYCA 1IC6A 2H1WA 3EAGA 3KV3O 2Y71A 3T0IA 4PSDA 1Q3HA 4JA0A 5F51A 3M4XA 1UOQA 3RS9A 2CLDX 1RKUA 2RG1A 2WFLA 4CLHA 4F2HA 3QXCA 4WQMA 1FVHA 3QUQA 1P77A 1GNLA 2GHRA 2ZTLA 2VF5X 5CT4A 4KI7A 2QI9F 4RZHA 5FYQA 4FSDA 2XQJA 3VDXA 1VMIA 2C8VA 3MJCA 3MTIA 4HDCA 2YS7A 2Z8XA 3TAXA 4DV3B 5ERYA 3HDGA 4PTLA 2QNBA 5FL7D 4P84A 3TLJA 4L8FA 1M1YA 3N8IA 1L4MA 1EUZA 1C0IA 3PXXA 3PQ6A 5CK5A 2MSEB 4QYMA 2RDMA 4BRWA 1N78A 1TU0A 1HNNA 2EEPA 2GCPA 1OJ7A 2JJ2D 2DLCX 3JVDA 5ALYA 5BWMA 1RZRA 1TK2A 4NJOA 3S2ZA 5AFSA 3I45A 1NVWQ 3KYDB 3SJUA 4CM9D 4JUDX 4BFZA 1RHUA 3X1XA 5F98A 2GTIA 2YDYA 2MT9A 2Q0XA 4TV8A 5COAA 1ULTA 3ZEAA 1RWBA 1YB2A 3TGWA 3V5NA 4AG3A 5C8VA 5KVVA 4BE7B 1JDUA 1HTBA 2ZJFA 1ZD8A 2Y05A 2XMCA 3DEIA 3GP3A 1N0UA 3R6LA 5EHZA 3LC0A 3LBFA 2FEAA 4DY4A 4DNOA 5JH7A 3F5MA 4OA8A 4QLAA 2FWAA 1OW3B 3B36A 2BSQA 4LF5B 1ZL2A 1P7WA 1U98A 1ZK2A 2KSQA 2RONA 4AJIA 3NONA 3GNSA 1ONBA 3ZXUB 4C7XA 4JI0B 1QU3A 1KIFA 1T3SA 3ESBA 3BJIC 2OTCA 1FPQA 2BKXA 1J1ZA 3KTOA 3A9CA 1E7WA 3N2GA 3MWYW 3TJRA 4D8TA 1WKBA 4EO7A 4M86A 2UZ1A 3SSAA 2Y77A 4TN1A 3ZZ0A 2GD6A 4M22A 4S2UA 1WABA 2WHRA 3JARB 2ZE5A 5CT5A 5AUOB 3QX9A 3DZFA 4FW9A 4GI1A 1CVRA 1PJ2A 4L2IA 4ZO8A 1CUHA 3PQ7A 4DDKA 1VBNA 3T3IA 2XDQA 1SXHA 1DAHA 3GUCA 2DFKB 3IUPA 4HQLA 4JJ7A 2PL5A 4QOEA 5BYBA 2YZNA 4F11A 3HC7A 5E9QA 1AV6A 2YYZA 2E9SA 4F2GA 1BFKA 2O07A 2Q3HA 2RHDA 1IXZA 1RQPA 3QOFA 2ZBRA 1XN1A 4FDAA 4AF6A 3KQHA 3NC1C 4HGRA 4O4HB 1P6XA 4RF4A 5EUCA 4KR7A 2INGX 3KSMA 1XHEA 3HA2A 4YCCA 4UCQA 4DR1B 2J9GA 3IEIA 2EKBA 2YBDA 3I2YX 1BW9B 1LPMA 1DFIA 3C45A 1WSAA 2W71A 1A27A 3FPFA 4PV7A 4DR2B 5JCXA 2OVBA 3V4FA 4ARSA 4X6XA 5G1OA 4URZR 2ID7A 2W48A 4JLVA 5LYJB 1E1RA 3BXEA 1A7KA 4AKHA 3IHTA 4BWVA 4FDTA 4ZCQA 3LXXA 3AFHA 3DB1A 4UEQA 2VSYA 5D7BA 4D4JA 1E3EA 1N7GA 5KKNB 2BGIA 3T5CA 4QXAA 1QOQB 4JBHA 2WWWA 3X1KA 3A6KA 3RRFA 2JLWA 4CGYA 4RH0A 1U1GA 5FIUA 2DYKA 2QL7A 3TVTA 3RYFA 1NDQA 2DUWA 1R8QA 2BCGY 5LU9A 1T5TA 4OXQA 3UF0A 4KFCA 1EX9A 3QMMA 4X1IB 1GM5A 2V58A 1AN0A 1E6LA 1OT3A 3HA7A 3P4XA 4HUJA 3SM3A 4E1VA 2PKRA 1WUTA 1PS8A 3AP3A 4YN3A 1NAIA 1WQ1R 3NGMA 1SIWA 4NNPA 1HOXA 1NMXA 1TLLA 2RARA 2W6ZA 2FPIA 3C5CA 3DGFC 3JWEA 3ND5A 2L82A 3CT6A 1FFGA 4BV2A 5F21A 1UCFA 1ZOSA 2WSYB 3P71T 2WWHA 1U94A 4FYMA 4PLCA 3S2UA 4YMHA 3BFPA 1XJ0A 1KWGA 3TRDA 3UJNA 3CGGA 4TL6A 3VDNB 1Q1BA 2F1KA 1DJOA 5ADHA 1T2NA 3WNVA 3MFYA 4RDXA 3F4KA 5GP1A 4I9HA 1U81A 3FTPA 4RHCA 3PD1A 1ML4A 1II9A 1DAFA 4JT4A 1J2EA 3NZEA 5B6JA 2ACWA 5JQWA 1YF3A 3EDYA 4K9NA 4IIVA 3HFRA 4CIBA 2BH2A 1M1UA 1NNSA 5CNIA 4MW2A 1R88A 4QDJA 5DCUA 5ITVA 1Y9DA 1UBRS 2GWHA 3OFNA 3T7JA 1FJXA 1AUPA 2EG5A 1JDSA 1VRCA 4V3CA 2NOAA 4FCWA 1QHXA 4I8DA 4NC9A 3W4IA 4AY6A 2LE0A 4LDAA 3QTTA 5A7HA 2I1QA 1EB9A 2W4QA 3CYFA 5FUWA 3A9VA 4IO1A 5J40A 4E0BA 4F8JA 4OBBA 1R9MA 5K7SA 1EFCA 1NX6A 5KEIA 3X2SA 2VOEA 1K7FB 1OV4A 4L51A 1T6NA 1MVLA 2HWKA 2W5UA 4G1UC 4YR9A 2Q6VA 3HJBA 2W2XA 2XNSA 1KNXA 2TECE 4GBED 4XDGA 4BX3A 1L5LA 5K3DA 1V25A 2Y1OA 4KXMA 4GP7A 2OZVA 2CNBA 4WASA 2D2VA 2GM5A 4EW3A 5J4HA 2ZIXB 2XMPA 4QTYA 2XE8A 3A9WA 5C52B 2B0CA 3RRNA 4O3FA 1G7SA 2QVBA 5AMXA 1C30A 3L79A 3C15C 4R54A 5CJPA 1RYNA 4BVAA 4UVIA 3WY9A 3I9LA 2JGNA 1JHVA 3PG5A 2Z2JA 1ZMXA 3JAKB 3WLOA 4L28A 1WMDA 4BMYA 4MQUA 4D99A 4XW2A 1NUSA 5DYYA 4Q4HA 3V46A 3ZXYA 1E4OA 1UKEA 2UYOA 4JR2A 1KP9A 2GKSA 3MA0A 1ZQ1A 1DBRA 1Q1AA 2BONA 2RHOA 4MP6A 2JA2A 2H2HA 3TR0A 3BH6A 1MJNA 4OX9B 4G0PA 1DG1G 1U8EA 3W7BA 4RULA 5IAGA 5TEWA 1E1RD 2JAQA 3W7VA 1MO3A 4HC4A 4C7JA 3AUYA 1MIOA 3WWYA 1HYGA 3PU6A 1RAHA 1YHNA 2F3TA 4NLLA 3EEYA 4PFQA 2I7VA 2A5JA 2CWWA 3OPYA 3I6YA 3FYCA 1GHTA 4Z9YA 1E2FA 1EXNA 4NBSA 4RC9A 4Q15A 5ALHA 2PZAA 5F12A 4JLNA 5KHAA 2C2HA 2F8LA 5K9ZA 3CZQA 5BNFA 2FPPB 2R6FA 1P1CA 3AM4A 3UHAA 4BQIA 2FX3A 4TPKA 1N2HA 2IWRA 4M1YA 4MS4B 2A5FA 5DYTA 4AF8A 4C3VA 1KY2A 4UOZA 4QDKA 1EFVA 3LCJA 2R8ZA 5SZJA 2DY1A 1S2NA 3N28A 4MQLA 1LC3A 2AEFA 4L0QA 3VHRA 2XMZA 1Z4QA 4KGDA 4UATA 4MOWA 5EJ4A 3AFGA 5GOTA 4K9DA 3UBTA 1SA0B 3ZCPA 1GEEA 5DX0A 3AH8A 4FS8A 4C0HA 4E6PA 2IUEA 2HDOA 3DZGA 4RSHA 3FHTA 1UWVA 3C6ZA 3IULA 4KR3A 3Q11A 4ZAGA 5AKZA 4F0JA 4A1FA 3EEBA 4S35A 1T1EA 2ARKA 1NSTA 3OCYA 2QRPA 3PQ4A 3L7CA 3CX4A 4IXWA 1UWKA 2QG4A 3KU1A 5K2OA 3Q7EA 3IV9A 1NLYA 3PFKA 2GKOA 1CJBA 1M34B 2HJSA 1P29A 2VJAA 1ID1A 3ECCA 1E1DA 3FFWA 4KAJA 3UHOA 5F7OA 1UFVA 2BFDB 3ZV3A 3L7YA 3GZNB 4YDHB 2WTEA 1Q6YA 2HA3A 1AQIA 2B4AA 4LUCA 1J0DA 4G2NA 2N0SA 3P9XA 1XNHA 2FX2A 4W5QA 2HV9A 2IH5A 3C7CB 5C3MA 4A2WA 4RK5A 4OKNA 4BFYA 4KOEC 2PMKA 1JNXX 2DT8A 1EG2A 2B7CA 1BRMA 2WTMA 3A58B 4RV5A 5CVVA 4GR4A 3OIYA 3F73A 2OHFA 2Q3LA 2O7VA 3FYDA 4V0ME 5FULA 3KSAC 3L7IA 4P3PA 2P9JA 1JHYA 2ZANA 4K46A 3S2EA 3E5HA 5J2TB 4GL4A 4MRRA 3GDWA 3K9BA 3LX5A 1Z26A 4EX7A 5BSHA 1EJ2A 3KO8A 1X94A 1JAYA 2C9BA 3T12A 1S5PA 3LTEA 5GGXA 1IOVA 2GPNA 4JBNA 2VP4A 1QCDA 2ZJBA 5JY6A 3ZU2A 3RS5A 3PIIA 2VYQA 2ZZNA 3PWTA 3ROEA 3QJYA 1MBZA 3K0BA 1Z36A 4PLHA 5CJ2A 3O95A 3EVFA 1N92A 2XNJA 5B36A 3FBTA 3RU3A 3U5TA 2NZWA 1LRLA 3G9XA 4OP3A 4WCFA 4E88A 1WD7A 4KRGA 1AHHA 2QAGA 3OLYA 1CLUA 4CM8B 1W6UA 3QFHA 2W37A 1IFXA 4JQSA 2PT6A 3O0TA 4DREA 1IEVA 1VLZA 4UUPA 5EJ5A 3QMPA 5C31A 3SZMA 2VF2A 1GQQA 2RBKA 3SKYA 4N5IX 1I3NA 4PPNA 2DX7A 3BUSA 4NBLA 3EZ2A 1QQ6A 3QI7A 4DIKA 2GK4A 1CUYA 4IHJB 2Q99A 5KOJB 1E5LA 2XAAA 4E09A 4K2HA 2ZXEA 5HMLA 3HU5A 5GINE 4QIHA 3PWKA 2W98A 1G7RA 4DABA 1QZ3A 1GP2A 1SPXA 2ZYUX 5CX4A 2BZGA 1Z38A 3HA3A 1UBHS 1ZK3A 3OLZA 4G65A 1XRLA 3AEQA 1CF2O 1XVUA 4E1AA 1LW6E 4JWKA 4FM9A 1Q0RA 4NRDA 5CA0B 5B2ZA 1JKJA 1UMCB 2CZCA 2ZJ4A 3ERCA 4M21A 2DWQA 2FPOA 1ZK0A 1FLNA 4NSNA 4QJIA 3HXOA 3MLBA 3K0CC 5LVAA 3WK9A 2EIHA 4BJ6A 4W7IA 3KKEA 2NLOA 1PRYA 2QVCA 4OHYA 3LQKA 4WTOA 1JT9A 1ZSYA 1TIKA 3G0GA 4WERA 1H2ZA 2VNSA 4ZOBA 2FZGA 1PSWA 2GZMA 1ACJA 1PNVA 1QIEA 2I3BA 2VJOA 2ZU6A 1O08A 2G28A 2MSDB 1YS9A 3QG1A 5DGXA 1ZRMA 2I80A 4R0NA 5FBWB 3RFUA 5KS2A 2IPNA 4DM7A 3FHJA 3RGWS 3L6DA 4C7OB 2F1RA 4RZXA 5J2UA 1D2GA 2JFNA 3HCDA 3K5WA 4KZKA 3R7NA 1SOUA 2HHAA 3I32A 2W11A 3CZAA 2FETA 1OWOA 4ANFA 4B5KA 3T34A 4Q1EA 2WJYA 1H2BA 5B58T 2X8LA 2FCAA 4RANA 3GP5A 4QYTA 4I9NA 1KGSA 4BXOB 3BORA 1JFFA 2JKYA 3K09A 5LPNA 3C41J 2FUCA 2KM1A 3ZBPA 4D3FA 1IUOA 1E9FA 2PG3A 1R6TA 5CXUA 1I3LA 1M1YE 1VYHA 5ANRB 2YV4A 4TRJA 5AVXA 2E37A 4V39A 4TMYA 3HO8A 3NOVA 5CURA 2PZFA 1YD7A 4RPGA 5AXBA 1X8JA 2ZJ3A 4ZOEA 2GTHA 5GZ1A 4PY2A 5K8IA 4Y7CA 3IDZA 3OM1A 1OFGA 1A0OA 2LUOA 4J49A 4J4TA 3KLOA 4C4AA 3MUFA 1BE1A 4EFMA 3SIWA 4EEZA 3CG0A 1W9HA 1RYHA 1Q50A 2ZAYA 4MDYA 2WF8A 4RKFA 4UMDA 5GZ6A 4NCIA 5GQSA 4F04A 3AU8A 4EKYA 4I5GA 1ST3A 1YUMA 1HEUA 2NO4A 2JHCA 3UT0A 3QKSA 4LBZA 1ISMA 5CLHA 4GDFA 2AFHA 1TTTA 4CEIA 3GJSA 4KXNA 4RSRA 3RVMA 3LA6A 3LY8A 3AILA 2D0IA 3PUHA 3JZDA 1VG9B 1JP7A 3C70A 1H3EA 4ZHSA 1SVNA 4ROSA 4QYSA 1VKHA 1B4DA 1I4TD 3K31A 3FZGA 3HN2A 3FN4A 2YZKA 1Z82A 3TZ6A 1VSQA 1UZNA 1P4AA 2XEDA 2YCLA 3I2IA 3IUNA 2XVMA 4HGPA 1WCIB 5FBKA 3W2EA 4HAXA 4WE3A 2XXAA 4YP5A 3VR4D 1FJ2A 1KFJB 3O90A 1EE2A 4IW3B 5ALWA 1IWBB 1ZVJA 3NOXA 2BGRA 3BSFA 2H8GA 3GQVA 5KJ6A 4GOND 4QD3A 2H7VA 3PE3A 1M6VA 3WQQA 2BP7A 1U0OC 4UPEA 3ZKWB 3E9RA 4I14A 5KSPA 1TA4A 3NM4A 2IU6A 4OO3A 4CKBB 3RAEC 4DE5A 4R2KA 5JS6A 3FAZA 5DMHA 4MWZA 3FCEA 4EG8A 3GCXA 2XNCA 1CVLA 1W47A 5AJHA 5TX7A 2C7BA 1F8FA 1GG8A 3TTYA 3TMKA 4EA8A 1UKVY 4N8DA 3I9FA 4MW1A 2DUUA 4U7JA 2R86A 4I55A 3G7UA 3UUEA 3C4JA 1Z9BA 3TXXA 3U17A 5A7GA 3TAHA 2JFPA 1Z29A 5DI3B 2HRZA 3AJAA 1T3ZA 2P41A 1TYCA 4Z99A 1I5RA 4HGZA 5K3BA 1CCWA 3EIHA 3ZE2B 5GZ3A 2XUZA 1SRQA 4K3UA 1K8QA 2AUNA 4WLFA 1XZFA 1SVMA 3R5SA 4UTRA 2X19A 2OV6A 2IPLA 5JZBA 4D45A 4MHSA 4UW9A 4AJLA 3E1GA 3SXJA 5KWSA 3IELA 4ALJA 4MUXA 4OBXA 4S2EA 3RIYA 2BUBA 1KJZA 3DC7A 2GAJA 1CE8A 3BIXA 3DVAA 4F86A 3GVPA 3OP4A 3KZVA 2YWFA 3W5HA 5C1PA 1GADO 4EELA 1JG7A 2WWTA 2OCXA 2X86A 3D54D 1A8PA 1JB9A 3OMLA 4IIYA 4X90A 2NM0A 5ES3A 1ISPA 4HQFA 1I2AA 3JYQA 3TL6A 4EUKA 1KSGA 2XVYA 5ECWA 3WIUA 4WY8A 3A2NA 4MKRA 4QFCA 2CJFA 3VC1A 1FSZA 1NRWA 1TZBA 2PK3A 1P1RA 2IUTA 3C3YA 2WJIA 3FZEA 3P2EA 4BJ5A 2H51A 4P4GA 4QDOA 4I9GA 1RAIA 1MABA 3RUCA 3TR5A 2NUPB 5IHXA 2E3JA 4IOMA 1G5PA 4QFDA 1LV7A 2H3EA 3ANTA 5FPKA 3LP6A 4JEMA 4H4CA 5FI1B 5ELXA 2XR1A 2EW8A 3SMQA 5J4LA 1ZD5A 4X20B 4N6NA 4JA2A 4FLMA 3NFYA 3URKA 1TW2A 3GVHA 2C98A 4JU9A 2E55A 4ND8B 4G23A 4GSLA 5EJFA 4ZXFA 1NL3A 3WIOA 5E0KB 3WRVA 3BDVA 2ATEA 4IILA 1JNYA 4M1MA 4B1FA 2NSHA 5CNKA 4EVIA 4BPRA 1NP3A 1GITA 3OPVA 2VQ3A 2QT0A 3PD0A 5ELMA 3T5DA 2JVKA 2OFOA 4IZIA 5JXWA 2O5RA 1ISRA 1CUWA 2IZ7A 2Y0PA 4ZRNA 1YCFA 3B6EA 5AI5A 1HDRA 2ZP1A 3P27A 2P4EA 1LBSA 1ZOLA 2FR1A 3CH5A 4YJFA 3SJBA 4K0KB 1ZBDA 2G0AA 3FSGD 4W9NC 2FEMA 1WF6A 1X39A 2ZJYA 2BBOA 3PC2A 1L3BA 5A4IS 4BC0A 3Q1KA 1V7ZA 1NYTA 1ZCAA 3DZJA 2XTJA 4OF4A 1G1MA 4OUDA 1HR0B 3FETA 3DHVA 5JCZA 1FFCA 1FFEA 1SWWA 4R01A 3CCCA 2VAXA 4FFRA 1Q92A 1XAHA 2OE2A 3HA5A 3I9V1 4DJDC 2E2WA 4EQ6B 3DE3X 3LKVA 2JIRA 2ZIVB 4I6GA 2CLLB 2IS1A 1UBKS 2SNIE 4CRWB 4NV3A 4E5KA 2CVFA 2D06A 2Q45A 1NVKA 4I1RA 5TS2A 1VZ3A 3RANA 3RS0A 4AKTA 4EJSA 4U7DA 1DBQA 3ZWXA 5K3EA 3ZQKA 4MR9B 2IIQA 5JTTA 1Y42X 1MB4A 1ZIYA 4CQLA 5AVYA 1BE8A 2RC6A 2Z1MA 3VMMA 5EJ6A 1QIDA 2J7PD 3BFKA 3COPA 2DECA 4CF7A 1ZXLA 3NC0C 4MWEA 5BNWA 3Q9NA 1SXJB 5TQ2A 4AUNA 4DG8A 4LJKA 2V7VA 3NJ4A 1QYDA 2YVKA 4FHEA 2PD3A 4FNAA 4MGIR 3UK2A 3TLGA 2H6EA 2PX0A 2QPLA 3FJOA 3ZNPA 4JT8A 3INTA 2FWPA 1SZDA 3CNLA 2CY0A 1QQ5A 3ILSA 3JAWA 4YJ3B 5KDLA 4IZHA 1B8NA 1A8QA 4K9RA 3ZOKA 2Q28A 4TTSA 5INTA 1HUQA 5TR9A 1QGDA 1E8NA 1C0KA 2X8WA 3N8DA 4NIMA 3RF7A 4CHTA 7YASA 1FJGB 1EFHA 1U3DA 4D9CA 5A4JA 3NNDA 3EGIA 4IV5A 3MWEB 3ZVRA 3TVDA 5ITSA 1PWHA 2DWCA 2F67A 3MB5A 1ZJWA 2FMUA 4DNPA 4IWYA 3IQDB 4S1WA 2NYRA 4RW0A 2G17A 4KQEA 5GM1A 2O4UX 5ARCA 2P4QA 1IIRA 3B7PA 3B9RA 4HDKB 3QKIA 3Q0EA 1E2EA 1II0A 4IIDA 2SKEA 1ZD4A 1YKGA 3I9MA 1N0HA 1VLJA 4ZVPA 3K0AA 3A3YA 2O7RA 4L85A 4JGGA 1UEXC 3CSSA 3LU1A 5ETJA 5HF8A 1WB4A 1WEHA 2CHGA 3TG2A 1RMQA 2J07A 3QRWA 1X15A 1DC4A 3S3TA 2WFZA 3CVVA 2FP4B 2H08A 3AIMA 5JFOA 4UM8B 2BKUA 4C0LA 1FRFS 5KYWB 4DLKA 5SY9A 4GPZA 5BV2P 4HLNA 2IYSA 4LCEA 1DWQA 4FOSA 4KUGA 4B45A 4ADSG 4BGUA 1IQRA 2D62A 3UKOA 1TRHA 1I2MA 3GG2A 3NTLA 4MRMA 4O5AA 5KCZA 1UH5A 2QL6A 3F9CA 3TTTA 2DQSA 2VT2A 1GTRA 3PQ2A 2W4IA 1EMDA 3PL5A 3K9HA 4XUEA 2PWAA 1M1XB 3G9UA 5EG5A 4G0MA 2Q2VA 3TFOA 3UNXA 4GXTA 4KH1A 4FFDA 1GZ4A 1C50A 2AWNA 2GA8A 3WL6A 3OTOB 2P5UA 2XZDA 3JWIA 4NPCA 4FR0A 1IG0A 4D9EA 2EJVA 3GJXC 3TBHA 3AR3A 5A4AA 4Q3CA 1RABA 3AVXA 4YJ2A 4TL7A 4KNWA 4PFSA 2JS7A 5ER6A 2VYFA 3EBPA 1B74A 1OXKB 3EGDB 3KQLA 3CLUC 2J5BA 4HWKA 6ABPA 4MHTA 2ETVA 4Z4GA 1OZGA 1WY5A 4AS2A 4G1CA 2AQHA 2PM8A 2FOLA 4MVXA 4WKBA 3NM5A 4MR8A 5TY0A 3K1AA 3L05A 2W70A 1UM9A 1Z8NA 3FPSA 3QVGB 4YALA 5TSDA 3CPHA 3LVRE 2QUBA 3AJEA 1R9NA 3IMCA 4OQFA 2HD4A 5FWDA 4ZTUB 1X80A 1QUEA 3JALA 2Q6LA 3ZH2A 5AD1A 4DANA 4X71A 4OSOA 1H6AA 1GUYA 1YBFA 1R4MA 2CXQA 4EW2A 1RJ9A 1AN9A 2OLJA 2NP6A 4O4IA 5AW8A 4GM1A 3EZGA 3QV1A 1BA3A 3UO8B 1GZDA 1RWPA 1BHSA 1JKXA 4D8VA 1WMBA 1FY2A 2JEZA 2P9QA 3PRKE 4RKRA 5FV4A 1ZIXA 1WBDA 2X6RA 2A5LA 4HDNA 4JJZA 3H87A 5KNCD 4QJ3A 4A6XA 3TMYA 1OGIA 3D4OA 4QG3A 1PJ4A 1W581 5AW7A 3T1OA 3NNSA 4HZGA 5FNVB 1R6AA 1IIBA 1Y7PA 2PS3A 4I46A 2NO1A 2B4QA 1LPAB 4PXAA 4OOEA 3K2QA 4GQAA 4PG5A 1U2DA 1E79A 1FFAA 4CLOB 4DLLA 5FEMA 4W8GA 2V54A 2XUOA 3HUUA 1XEWX 4JMLA 3L9XA 2BGLA 3RHTA 3IOBA 1F7UA 5KSOA 1MB9A 3IT1A 1ORVA 2IHJA 4A5OA 4YQYA 3B2QA 2B92A 4B6QA 2B78A 2VQDA 2ST1A 4NU8X 3AR2A 2XMDA 1UEJA 4M7RA 4N7BA 4UASA 3WADA 2G1PA 1H2AS 1W0KD 3LW7A 1BWSA 4KXYA 1UFKA 2ROQA 3O21A 2PTHA 3H83A 5JYDA 3GPLA 4LYYA 3LQ4A 4H6VA 3R0IA 4H7KA 3AHFA 2X9VA 5CITA 3AM3A 2RD2A 4YUXA 1XAGA 4FJ1A 3TD2A 4DYDA 5JXIA 1XVVA 3F6SA 2IW3A 3MOIA 1WW8A 3T94A 3ZX5A 4BMOB 2Q5CA 2I2BA 4F21A 5LWHA 2GAOA 4QL3A 5A9TA 3AKZA 2X8JA 5B53A 4EHNA 4QRHA 3I52A 3SZGA 4FUTA 2B4TO 2YWGA 5H3LA 4C6HA 4HAIA 4MLCA 5JAHA 1BS1A 3O75A 3DBHB 2X13A 5GMOA 4NWIA 3D2AA 3OE1A 2Y0DA 4MJ7A 5AUNB 2C8KA 4HLUC 5M34A 1QONA 2HBYA 3U40A 3E2PA 1L7PA 2CLKB 2WWXA 4PWYA 5HDQA 4PO9A 4PXYA 5DCYA 3COSA 4LI0A 1X1AA 2FPGA 1E6KA 2O6HA 1IY2A 1SOVA 1NU6A 1IWPB 1WMFA 2BRUA 2ECQA 3MGKA 3HUTA 3MS2A 4MI3A 4AZVA 2PKYX 3E05A 5CA1A 3BE6A 1W4RA 1X7XB 4O63O 1U5AA 1ESEA 5T4FA 3DB2A 4DRYA 1O6ZA 3ZDDA 5AM1A 5EJGA 5TPZA 1B26A 1LDEA 1OZHA 5IUJC 1JBEA 1KOFA 1VKRA 2BISA 4P3XA 2QD2A 1BCSB 2AOTB 4MUKA 4OKIA 3N7TA 5AVZA 2JZOA 2XTAA 3V34A 3KL2A 3N6XA 2IX3A 3ZCRA 1NKVA 3RSHA 3VJMA 1W46A 5SICE 4EEKA 4OQYA 2YVAA 3Q8WA 4W5RA 4OHZA 3AEKA 3I2JA 3GCWA 4WPGA 1SB9A 1UMBB 2HWXA 1ZYUA 2BKEA 4G5OA 4C4OA 2D1SA 4ND7A 2WAAA 3O1IC 5KQPA 1J2YA 4OEHA 1C7FA 1IAVA 1XCLA 1T35A 2H31A 2HRDA 2XUGA 1XZNA 1NQAO 3T3PB 4DZTA 1NATA 2FJ0A 3LVFO 5AKGA 2PRSA 2IYNA 4ND6A 3VYRB 5A1TA 4U9HS 4LCBA 4RE6A 4IUDS 4TLAA 1DIOB 5IEJA 4JD5A 4D97A 3RC7A 1VJGA 3PUYA 4PC1A 2VDWA 2MSCB 4PYLA 5L3SA 2UV8A 3P8ZA 3K1YA 2ZYAA 4X93A 3N2KB 4MLDA 1CJVC 3VR4H 9MHTA 1O57A 4RIGA 3L8EA 4CQNA 1KVQA 1T1JA 5B55A 2PPVA 1NV8A 2QLMA 2XMBA 2IEZA 1M8KA 4TTJA 3LFUA 4QHSA 4OQPA 4PONA 1W8DA 1TF2A 2JI8A 1K89A 3GHHA 4X64B 3ZGYA 3FTFA 4G1FA 2P79A 3C4QA 1JBKA 2OO5A 1ECPA 3G2OA 3N7UA 2VYCA 1R50A 5D5QA 5FOVA 3OEWA 3VBCA 3PLAE 2IU0A 1W88B 2UUOA 5KI6A 4B2LA 1PJRA 3BIJA 3TOXA 1XZ8A 4BATA 4EYQA 2AI3A 5GM2A 3H2JA 5T8KC 4BLSA 1ADGA 1J20A 2OQ2A 2AHOA 2YXDA 3GA0A 3NBYC 3QTLA 3U0VA 2QTFA 1T26A 5KVCA 4HYYA 1PLJA 1U1FA 4MUMA 4HNQA 5I8ZA 5I7RA 4FYJA 4Q82A 4BNVA 1SZPA 3OCWA 3AM5A 2JJMA 3HZOA 3KOOA 5FDFA 4WCVA 4MUYA 2AJBA 1SQGA 2ZOSA 3HN7A 2XDAA 3I73A 5L6MB 4TLMB 1O94C 3ZE1B 2AXPA 1F14A 2Y0CA 1M6WA 1CJKC 1VIVA 3BAZA 3P97A 3V8PA 1R4NA 4MAMA 1Y8AA 4ZQGA 1YZLA 1UDCA 5DSXA 2CCKA 2V6JA 4A36A 1DAKA 5DYNA 2JDID 1W93A 3NHLA 3IL2A 1Y5LA 4QBIA 1HK7A 3AERA 2FLWA 5HK9A 1KFKB 1LPBB 4O2AA 4G9GA 2AOWA 2PSEA 2W6CX 1EVQA 3NEJA 1G6HA 3RH0A 1YACA 2Q9BA 3NH6A 1C5KA 3KZKA 4I3FA 2AMLA 1PAUA 3OEHA 3R74A 4W5OA 1PWYE 1CQWA 1GNRA 2C29D 4PU0A 3HZRA 4CL2A 4LYHA 2ADFA 2VNJA 2WSBA 2VSQA 1CPYA 4XYEA 2HCJB 5B37A 2GR9A 3DMRA 3OO0A 4AKIA 4YFYA 1K7XB 4NZPA 1AQNA 2JZCA 1BIFA 3HXMA 2FZWA 3QLJA 3QVSA 1FLDA 5JZMA 2H3HA 1GL9B 2R7LA 4M60A 4CM6A 3QLVC 1I33A 3TL3A 3BTUA 4PNEA 1YR8A 2WA1A 4GFDA 3T7IA 5IVIA 4BMDA 1EX7A 3U3KA 5C5CA 1B7GO 1SK8A 2P75A 3QSGA 2GHIA 2GN9A 4XPIA 1S8NA 1FLVA 2RAVA 1D6SA 1GYRA 4QELA 4LYFA 5GAJA 4XYMA 2VNKA 2V55B 3ZDQA 2UYGA 3KFXA 4D8WA 1YNOA 4KKVA 5MN4A 1CQXA 1V95A 2XKKA 2WAOA 3QVTA 1EFRA 4PRKA 2O50A 1NY6A 3F78A 2QUHA 1XCJA 2CJYA 1AZSC 1RU3A 2BIFA 3P0FA 1N2SA 1EVEA 2K2QB 3MCVA 4IEIA 4HVAA 4MKZA 4N39A 1JRLA 1VM6A 4GYKA 4M3NA 2CMKA 1IN5A 5IUKC 3ROPA 3HWSA 3PUKA 2ZTUA 2ZUFA 5A3QA 1Q17A 1XTPA 2ZR7A 1P3JA 2DTXA 1TO2E 1JG2A 1U2GA 3ZY3A 1FNNA 3KPUA 4X63A 1RPZA 3HCAA 5C2JB 4X5OA 5KTYA 3A3OA 3MUOA 2OBLA 1OIWA 5DWQA 4LZLA 1BMQA 2VVTA 2CLOB 1DQSA 4HQ0A 3PHLA 4MLZA 4YVFA 1JQKA 3L4EA 5LP1A 4YAIA 1YS2X 3COZA 3JZFA 2AFIA 5A3VA 3QEMA 4DXAA 1E9BA 1GQ2A 1U3FA 3F6YA 1H94A 2X1LA 4GHWA 1BTOA 2FEKA 1RYDA 1PTJC 2EJUA 2HHHB 2OSVA 4BB5A 2IWHA 3I8XA 4TVBA 3U1VA 5IEBA 4HDMB 2X0EA 4FKBA 3TDNA 1WMSA 1IMJA 4BBZA 1G98A 3FIUA 5JNSA 3GVIA 2RGUA 4RJ2A 3KE8A 4XARA 3R2JA 4DMKA 1B8OA 2NT4A 3C3CA 1KA9H 4DF3A 1V5IA 1LXCA 1UBGA 1LDYA 1CRWG 1SCNE 3K6JA 2FG6C 4TXJA 2XB6A 4LZZA 2BE7A 3KKMA 4J3NA 5BY2A 4LMBA 5DULA 5BXYA 5GADl 1QK5A 1U3VA 3C1TA 5FR2A 3E9DA 1ZC3A 3BN3A 1GRVA 2VJNA 3LZ6A 4OHMA 4OAOA 2I2CA 1OCEA 2GYVA 1YQTA 4FX5A 1GCOA 1JUDA 1YS6A 4LRSB 5FTJA 3SC2A 1N2XA 5BW5A 2XVXA 5B3JC 3HLYA 1KXJA 2FPWA 1Z18A 2JFOA 1FFBA 1YVDA 3ITDA 3R9XA 4DVGA 1Y4AE 3IT2A 1ZM2A 3NBUA 3D0QA 4KN8A 4U00A 1Q5PA 1OYVA 3PXEA 4GMGA 5DJ5A 5E6UB 4G8CA 1XQ9A 2XUIA 1SUSA 1YWGO 1QK4A 4AVYA 4QBHA 2EFEB 1JTEA 3GFOA 1XVTA 2IRWA 5DISB 2FFQA 3SP1A 3VSAA 1DCMA 1Y82A 3OEHD 4Y2SA 1YB7A 5K45A 4NQRA 4YP0A 2G07A 4Z53A 2DCUA 4AX8A 1PR1A 2WFMA 1G20A 4DB4A 1P1BA 3IKJA 4OHCA 4TTAA 3ZGVA 1RM4A 4MVJH 5DN6D 4DDMA 5JXJA 2O0HA 3A1TA 3KPWA 3QYFA 1V39A 2D2XA 4X62B 1I1NA 2UZIR 5ENZA 2JPDA 3LFHA 4ISCA 3ET4A 3FIJA 4MDHA 4XIYA 1B3BA 4YAWA 1OAKA 4DJTA 2WU1A 1PWZA 4D4HA 1RPJA 3MTQA 4RXUA 3BRQA 2ZIWB 4UOEA 5I7HA 5L4NA 1MN6A 1YB4A 3LIPA 4MX8A 4RL6A 3WO1A 3W04A 3IQZA 4DJ5X 1A9XA 4G0UA 1QS0B 5EP3A 3OOWA 3O4IA 4IGKA 5FPTA 5JMPA 4E03A 1AHPA 3EIQA 3H86A 1RLJA 2JKVA 3C1UA 4WBNB 5HUJA 4RSGA 1XLWA 1U5BB 3H9UA 3LDUA 4DYHA 1E8DA 3BM5A 1NVTA 3E4DA 2GCGA 4CLRA 3GOHA 4GICA 4EPVA 1Z34A 3IE1A 1KH3A 1VLVA 2OHXA 4JP8A 1XL0A 4J03A 4I5IA 2PD4A 4M9XA 5BQ5A 1U8FO 3BHIA 1MORA 4LOKA 4RZIA 4CMIA 3L7OA 6NULA 1FDOA 2VS1A 3UJ6A 3LPCA 5IAJA 1YO6A 1O9HA 4G5GA 2QN3A 4JUBA 4YCLA 1F60A 3KYJB 5KHOC 5IJ9A 5JZSA 1CV2A 5B1EA 2HQSA 4DLBA 4REMA 6Q21A 2J08A 4DA9A 2BVNA 4IXTA 4GPD1 2K5UA 2QMHA 2WA2A 3D4IA 3GX1A 4MK4A 2D1FA 3CPJB 4CLXA 4TX1A 4Z4QA 2ZBUA 3HI4A 4AM8A 3UT5A 3CCBA 3UWDA 4ZFNA 1J49A 5CU7A 4RH3A 9ATCA 3PZRA 2J5XA 4N54A 1YDFA 4OJQA 1F48A 2JI9A 2KMLA 4BKMA 4CM4A 4YMUA 5AVTA 4DLVA 2BMAA 4FMDF 4DUPA 1I01A 1W4LA 3P9RA 2FUG6 2A86A 2OBNA 3FR7A 3K96A 1OAOA 4H08A 2CGEA 3FWHA 4FFVA 1NHWA 1WM1A 1C9JA 1UPUA 3DNMA 1Z6TA 1ZH6A 1VYTA 1RWOA 2FFBA 1BAPA 2HFJA 3BMCB 2XUKA 3BREA 3ESRA 2BFBB 3NANA 3P5SA 4R8SA 1VRVA 2EATA 4FYXA 1WHTB 1OKKA 2CVPA 2JRLA 1UINA 2B6HA 3KYDA 3T1YB 1EXWA 1ORTA 5B4VA 5DNWA 3ZHCA 3F96A 4ZT6A 1NP6A 4KSBA 1X3SA 1XXHB 5CLJA 4YX9A 1EFTA 1R2QA 2YY5A 2FFAA 1RBMA 1V8DA 1AIPA 3TBKA 3CWQA 3WAKA 2V1XA 2QV0A 4ZYZA 2ODEA 2J7KA 2Z6UA 1Y9AA 3G2MA 3VFDA 3TZQA 5KNCH 1CJSA 2BTQB 4WY5A 5ALOA 5SZIA 2C3OA 4EPYA 5IKMA 1U2SA 1M72A 4ZV9A 3X1MA 2GT1A 4ZHQB 3L1HA 3O82A 1NYRA 1F2VA 1H4VB 2YJ4A 5KYGA 5DNYB 1NY5A 4JROA 1SBQA 1XMVA 1IDN1 2GN1A 2E6UX 3UMRA 5K8TA 1V1RB 2DEUA 2PAAA 3NBKA 4LCJA 3WWEA 1K6XA 3DBRB 1NI3A 4BP8A 2OA0A 3CLRC 1XTVA 2NO6A 2FDXA 2JI6A 4L9WA 4MQ4A 5KMGB 2N1MA 2O7QA 3C4VA 1WY7A 1H5NA 4MJXA 4XX0B 4B7UA 2XADA 4KEAA 3D4PA 4U2EA 3VOAA 3HGQA 3W05A 4H35A 1NMSA 1PV4A 3SIXA 3EUEA 4PGMA 4Q6WA 2GKGA 1NW7A 2I76A 1XEWY 1Z47A 2V4ZA 2QYTA 1F17A 1G7TA 2A9RA 2QZJA 2PQ0A 4LJRA 2O8VA 4O4HA 1L5YA 1KFBB 3TSWA 5KYTA 2A5YB 2AD1A 2V8BA 5FFMA 4MJ3A 1RD4A 1Z2AA 1GSAA 1BW9A 1UF9A 2FHPA 2P30A 3E3OA 4BNKA 1WVMA 4R7ZA 1DQNA 3WMXA 4DFDA 4IIGA 2VP5A 2JG3A 3NOOA 5LYJA 1VIYA 1RCUA 1QK3A 2X40A 4FOPA 3GLHB 5EPUA 4C5BA 1CUDA 1ECGA 1KEEB 1KTVA 2DSTA 2EJTA 3OC0A 4IUCS 3MTAA 1G21B 1SR8A 3CKYA 4IMPA 4J76A 1E7YA 1HQDA 1OU4A 3WL7A 2BFAA 1E6EA 3KFVA 3CN9A 4L6CA 3T9BA 2WTNA 3OM9A 5CBPB 3WR5A 5BUQA 1WB9A 4MI1A 5JY1A 2W90A 4IVQA 3E48A 4N0DA 4RZUA 1QE3A 5EJ7A 2ANCA 3LOUA 1ZIDA 4WRRA 4X1IA 2H65A 2R1TA 2Z9CA 1QJCA 3HVHA 4LRWA 4XDZA 1DAPA 2HEGA 2VJMA 2ZSFA 2FQ1A 1Z3CA 1X2EA 3FWKA 1ETHA 2VHJA 4GR5A 4KB5A 5H4HA 1R8JA 2PFSA 1CW2B 3EGEA 2CXPA 4J0GA 3T3NA 3D6UA 2PUDA 2QS9A 4FFOA 4XWYA 4C4SA 1YQ9A 3EVGA 4U6NA 2CW5A 2V5AA 4ZU6X 3VZDA 3MINB 3R5JA 1NPDA 4IDFA 4J4BA 5FOUA 1NT4A 3GFFA 3TR6A 3FFXA 1E2IA 3LY9A 3FDZB 4AKEA 4Q9LA 3CTMA 1IPFA 4BUZA 4A15A 1Y34E 3E23A 4S3MA 5EQJB 2CXUA 5SYAA 3TFQA 4Y2XA 1XO1A 3GFTA 3N8NA 3HDHA 2GEBA 3O8QB 1HEYA 4Q3KA 1KMIY 2V0CA 2IUUA 3VYUB 4EHHA 5CFMA 2IHNA 2KLBA 5H3HA 5DM70 3FD8A 3U44B 2PMWB 2Z3WA 1RQXA 3WJ2A 3PX7A 2HQRA 1BJKA 1Z2PX 1OZFA 2AK3A 3BILA 1P7CA 3SJ7A 1BSVA 3I4FA 4Q1AA 4R51A 4F84A 1Z37A 3WLKX 1EJ6A 4BAZA 2EX4A 3GRYA 4I4TF 4EL0A 1QDLB 1IJEA 1I4WA 4CEHB 3WK5A 3OJCA 4LYAA 1H8ED 1GU7A 2HCTA 5CVDA 1G8MA 2R44A 3RRZA 3I5MA 4WH0A 1PEAA 2JB9A 1S9DA 2NZ8A 3IDOA 3WGIA 1DMSA 2BGWA 1Z8DA 1T6XA 4AZ3B 1PJTA 4NZYA 3U4DA 1XSEA 1FEZA 2VCYA 4RA6B 2B61A 2B25A 4YRRA 3FE2A 3WLIA 1YGYA 4PE5B 4R81A 3U7RA 821PA 2ZB3A 4P36A 1ACMA 1M2WA 1XU4A 2WTAA 1MJFA 3AKEA 3OWXA 3MTBA 1ZR2A 1X2BA 2ZIXA 4Q1FA 1OC2A 4JP1A 2OL4A 1HFJA 2OG2A 3F6EX 4XSGA 3V97A 2PLRA 3DOFA 4YC7A 3I53A 3QWFA 2H9YA 1VSBA 2GJ8A 2VDLB 3ESDA 3JSXA 3RVQA 2HWUA 5CLGA 3OQNA 1ENPA 1U7UA 3JAKA 1ODJA 3FMIA 3RKUA 3KCNA 4GLJA 4LTNA 4WZBB 4D3SA 6REQB 1IM5A 3AW8A 3FB4A 3LYUA 4B3GA 2XWQA 3VNVA 4EI7A 3AFOA 3R5FA 1V9CA 1WXGA 3RVJA 1GGHA 2HWYA 4LQLA 4LYJA 5J3JA 1HZZA 4C2UA 3BXZA 3TRHA 5T6MA 2EGUA 2HUNA 1Z68A 4LX8A 4V0QA 2IHTA 4ER6A 3SYNA 3QKRB 2JCVA 3KQWA 1L4YA 1QIKA 2IK8A 4PCUA 4PAQA 4OHXA 3SQDA 4B6FA 5CFQA 1Z5VA 3HJTA 3OJXA 1NW6A 2BHLA 3U3JA 1NF9A 5BORA 3G5UA 3PFBA 5IJZA 1UODA 3T5BA 1T8UA 7MHTA 3QW2A 1F0NA 5FLXA 2QLBA 5FWXB 2YW2A 1AUVA 3DMTC 3H16A 3AUSA 3G2JA 2FPPA 2ZKLA 5BN1A 2D6FA 3IVAA 4X3OA 4A2PA 2JLYA 2L0XA 1E8MA 2IELA 1VSUA 3LYLA 3II6X 4RGYA 1KO8A 2BN4A 2LNDA 3MOGA 3KALA 5TS3A 3TG8A 4WKNA 3L1IA 1JSLA 1L5OA 3MTEA 4O1IA 4YY3B 2D7JA 3BWDD 3N2ZB 4Y7DA 4BWFB 3MMSA 4WLEA 2XCUA 4HAVA 1DAMA 1SA0A 3RUEA 3WDKA 1UDWA 1VB3A 2AZXA 2Q3FA 2WM3A 3DYIA 2BFFB 4D9HA 2VJQA 1X7DA 1G41A 1QVVA 1RZ3A 1CNEA 1M5RA 3LLVA 2CFSA 3AZPA 1ISFA 1W5AA 3KAKA 4PM4A 1BDIA 3FUTA 4HNGA 4WOJA 1CT9A 3LNTA 2A84A 3NDJA 1EDZA 3H6KA 1KQ3A 1W36B 4F4IA 1YRQA 5EMJA 4G8DA 3MXOA 3N2LA 3ND6A 3BL6A 3MG9A 3QE2A 2B94A 1KYVA 4X8OA 3G02A 3RJTA 4L8GA 2WTBA 3BGOS 3R3YA 5P21A 1GTMA 3V7NA 2JFUA 4O8ZA 4P5PA 2G4CA 3C6BA 3WG9A 3CEJA 3DO6A 2XWJI 2CUKA 1G3QA 2QD4A 1JSRA 5KTRA 1ZGAA 4AECA 1NRIA 4FWBA 1O95D 4M0PA 4JLUA 1FOEB 4O3MA 5C1OA 4YQEA 3B1YA 2OGWA 3DBVO 1RRFA 4B75A 1QQAA 1NG9A 3DZHA 2JFWA 5G40A 1GOTA 1XYYA 2J6IA 3MGBA 4RQUA 4BV8A 1DARA 4AD8A 4NU6A 3NP7A 1YASA 2XLBA 1IZ8A 5BYAA 1E7QA 2O6LA 3CVWA 2O0LA 2LCQA 4U02A 5F3DA 2VHWA 2LVBA 5J2TA 4ZQEA 4TTRA 3GJQA 1VHDA 4QDTA 5ALLA 3LGAA 4WKOA 4CDRA 4KPUA 3TSOA 1ZEMA 1GZ6A 2H0AA 1B41A 1OIVA 1SIBE 3IYLW 5HQJA 3NWJA 1DS6A 2BGUA 2MWMA 1E18A 2PA3A 4P8RA 5EN4A 5FFNA 3TQCA 4NYMR 1NNEA 1LD3A 1I5OA 2OYSA 2NSYA 3ZN2A 2QU7A 3AR6A 3BIOA 4ESOA 2FEPA 4EDFA 2W6JA 3WGVA 1QFMA 2D13A 3ZI7A 1GPMA 3G5TA 1KQOA 1QBKC 1XK7A 2A0YA 5H9VA 4YUWA 2OZLA 1G5RA 2MU1A 2R1VB 3G8DA 3DKKA 4Y1RB 1EINA 1XJQA 4TXLA 4KI0A 2WUEA 1TIBA 2AJLI 2POQX 3RFTA 1B93A 1VG0B 4XE5A 2WTUA 4A91A 4F93B 3ER6A 3EISA 2JLUA 3R7DA 1HT2E 4IHJA 4RETA 5KOJA 1Y4UA 3JQPA 3H9CA 4OXYA 4UBIA 1UJMA 4JJ8A 2KLHA 1CKEA 2ZIAA 4HS4A 4RJIA 2XBLA 2O2CA 3O83A 5ALKA 1NVGA 1NMYA 1QHFA 4B6OA 4QHYA 3CFYA 3ULKA 4MROA 2HEIA 1I3KA 4R9VA 5CA0A 4NOLA 1YR1A 1VKJA 4C7MA 1UMCA 1DTWB 5JXGA 4M8SA 3LZCA 2QNRA 1CUAA 1RJEA 1EK1A 1KS9A 1QNLA 2FI1A 2V65A 3B3FA 1QTNA 3IJ5A 4NECA 4I0WB 3U1TA 3KEGA 2C83A 2Z57A 3HUFA 1E32A 4IKOA 2Y93A 4K6CA 4AY5A 4DZRA 2DQKA 2JI4A 3ADBA 4RNDB 2FFRA 2R2AA 1QQBA 2W9XA 1U2QA 2R6R1 3VR0A 1CZNA 1SXQA 3RI3A 3W2TA 3GELA 4IIXA 1D7AA 5E6RB 4UAVA 4WXMA 2IKQA 2QTWB 3DM9B 2YC4C 4KG7A 2F55A 5CB0A 4US0R 2P6RA 4C7OA 1TM1E 5FPQA 5L4SA 1PDVA 1XZLA 2GK7A 3I4CA 2G1KA 5CRIA 4FLEA 1KBQA 3BGDA 3A11A 4IEFB 4OBWA 4HH4A 4TN5A 3O9VA 4RAQA 2AVDA 3HZZA