1MAUA

Crystal structure of tryptophanyl-trna synthetase complexed with atp and tryptophanamide in a pre-transition state conformation
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
328
structure length
328
Chain Sequence
MKTIFSGIQPSGVITIGNYIGALRQFVELQHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYLAVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFKEKSAGKEAVSAGLLTYPPLMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGELFTIPEARIPKVGARIMSLVDPTKKMSKSDPNPKAYITLLDDAKTIEKKIKSAVTDSEGTIRYDKEAKPGISNLLNIYSTLSGQSIEELERQYEGKGYGVFKADLAQVVIETLRPIQERYHHWMESEELDRVLDEGAEKANRVASEMVRKMEQAMGLGRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tryptophan-tRNA ligase
publication title Interconversion of ATP binding and conformational free energies by tryptophanyl-tRNA synthetase: structures of ATP bound to open and closed, pre-transition-state conformations.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ligase
total genus 121
structure length 328
sequence length 328
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2002-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1mauA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1mauA01
2X1MA 1EFPA 2R5WA 4A91A 1QU3A 1QNFA 2IP1A 1M8KA 1D2RA 3ELBA 1NYLA 1R6UA 1O0CA 1QRUA 1WQ4A 3MXTA 2YY5A 4UZFA 1R6XA 3H97A 2H29A 1X8XA 2CFOA 5HUHA 4MVWA 1N2OA 1K97A 4NZPA 4CDNA 3GMIA 4ND7A 1MJHA 1TYCA 3SP1A 3MMXA 3CVXA 1V8FA 4OUDA 3AKZA 2QUHA 1F9AA 2H2AA 1GTSA 1EUQA 1O95C 3D6UA 4ZT2A 1WXFA 3K9WA 3TQOA 4Q93A 3Q4GA 3GLVA 5TS2A 1JILA 1YUMA 3SDBA 4MAFA 1Q11A 4EG7A 2CT8A 1QU2A 1MC1A 1F7UA 3CA8A 4JZYA 2B7LA 2BTEA 1IFXA 5J5AA 3IODA 5TEVA 1N2BA 2DETA 3IMGA 2O5RA 2J4DA 3DO8A 4UZEA 1KQOA 4Q16A 3CLTD 3N05A 3IUBA 5LM3A 4P2BA 1WY5A 4EFKA 1JZQA 2J08A 4KPUB 1NUPA 1CT9A 1J20A 1OWNA 4MWCA 1O94C 3ZGZA 2AZXA 3HL4A 1EFVB 1A8HA 2BYTA 3RK0A 4CDMA 4MW0A 2YXNA 3SEZA 3AIIA 4BWVA 1QRTA 3N2YA 1QTQA 3AL0C 5FNZA 3PRHA 2ZUEA 4MWDA 3IH5A 3CLSC 2VTBA 1JGTA 3L93A 3ZJTA 3X1JA 1IQRA 4XFJA 3TQIA 4ZT3A 2CSXA 3FETA 4DDKA 3FH0A 1M1ZA 3IMEA 5HG0A 3RK1A 3MUEA 1Y42X 1WXIA 1KR2A 4EG3A 2CV2A 4ZCRA 4KPUA 2O8VA 2A1TR 4MUGA 4RPIA 3CLUC 3SZGA 2A1TS 4F3RA 3D6VA 3CVUA 2J5BA 1LI5A 4ZCPA 2XRZA 2G36A 2WQ6A 2HGZA 1UFVA 3QTTA 1T6ZA 2DPLA 2A1UB 4TS1A 1KAQA 1PFWA 3SZ3A 4MW6A 2QUIA 1MB2A 5KWVA 2RD2A 2CUZA 4R2MA 3FNRA 1GPMA 3BL5A 4EG1A 1TYAE 2QJTA 3TZLA 3A04A 4J75A 3F3MA 2PZBA 4L2IB 3CVWA 4JYZA 1O95D 4WSOA 5K0SA 1KH2A 1WXHA 2NZ2A 4YBRA 1U7XA 3LCJA 4YP6A 4MWEA 1PFUA 3L92A 1U3DA 2A86A 1NURA 1JMVA 1EJ2A 3MLAA 3SEQA 4ARIA 2PXHA 4K0RA 3Q12A 2QTRA 1HYBA 3ZIUA 3COVA 1TEZA 3VU8A 1F4LA 1JIJA 1QQTA 4S1OA 1FFYA 3H05A 1NUUA 4K03A 2A1UA 3FOCA 4NX2A 2A7XA 3KT8A 4HJRA 3RJZA 2PG3A 4XSVA 2HMAA 4R0NA 1BS2A 2YWCA 3PNVA 1WXEA 2PZAA 1V47A 3KT6A 3IMCA 4G5FA 2GOYA 3IOBA 4AQ7A 1M83A 3OTWA 4ARCA 2GKSA 4R2LA 3P0IA 3IVGA 4L2IA 1WZ2A 4JXXA 1J1UA 3S3TA 3QE4A 3CVVA 4KR7A 3DV2A 3FI0A 2EL7A 3VRHA 1GLNA 5BNZA 1JIKA 2X3FA 1WQ3A 4ZT6A 1ZH0A 1S4MA 3ZXIA 2A4MA 4ZT4A 1MAUA 1T9GR 1K4MA 5H16A 3CVYA 2J07A 4KR6A 5IHXA 2Z08A 1T9GS 3LOQA 4MVCA 3H99A 2D13A 3G6KA 4MUEA 4JXZA 1H3EA 3MLBA 3U1VA 3TNJA 1IHOA 4NDAA 2Z3VA 3H9CA 2AG6A 2QJFA 3ZXSA 1N3LA 1RQGA 5H7XA 1KH3A 4MW4A 1N2GA 4MW5A 4HK4A 4MVYA 3IOEA 3ZJUA 2PZ8A 2JANA 1WJGA 3PNYA 1N75A 5J59A 4PBTA 2GM3A 4DJAA 3VGJA 2QTNA 1J21A 4G5YA 3RFFA 1VLHA 2X0KA 2PFSA 3PNBA 2DEUA 4MQ6A 1PG0A 1JEEA 4RUKA 1NZJA 1M8FA 1J70A 3AG5A 1M8JA 1OWMA 1COZA 1U3CA 3I05A 1TFUA 3NBAA 4GU5A 1ZUNA 4ZCQA 2E89A 2HZ7A 1YULA 3A05A 3ISJA 2E0IA 4MUFA 4NATA 1VBKA 5KCMA 5J58A 1O97D 3HGMA 2CYAA 1N2JA 1KH1A 1ILEA 1EFVA 5AHWA 1ULHA 3HMQA 1H1TA 1KKUA 1GTRA 3HZRA 4E1AA 2JA2A 1IH8A 3KFLA 3IVXA 2YWBA 3UC5A 2WSIA 1TQ8A 2RE8A 1N78A 1JECA 1H3NA 1PFVA 1N1DA 1EUYA 2DLCX 2PIDA 3AG6A 3Q10A 3RBAA 3ILVA 1I6MA 5FO1A 4MUHA 3UY4A 4EG5A 3K32A 1T6XA 2WQ7A 4EG4A 1WOYA 3N9IA 3X1KA 1NUSA 4MUKA 4OJMX 1JIIA 1VBMA 4JFAA 4KR9A 4CT0A 4MULA 1OWPA 2I1LA 1N77A 5DK4A 2TS1A 4YMIA 4EG6A 2DUMA 1XJQA 2X1LA 4XFDA 1IQUA 4ND6A 1O5TA 3H9BA 2ZP1A 2OQ2A 3CLRC 1K92A 1O0BA 4X0EA 1GN8A 1WXGA 2D54A 1JZSA 1J09A 3FY4A 3RHSA 5IJXA 4H3SA 1Q15A 1GAXA 2CYBA 1X6VA 2CV0A 2CYCA 2DERA 1U0BB 2QTMA 5DASA 4HJXA 3P0JA 1EXDA 4DNXA 1WKBA 4NAHA 3TZEA 1JEDA 1M8PA 1NSYA 1YIDA 1LI7A 1O94D 1OD6A 4U63A 1GZUA 2E21A 4GRIA 3COZA 1OBHA 1QJCA 4WNYA 1NUTA 1G8GA 3IUEA 2D5BA 4FZJA 2V0GA 5JBNA 1DNPA 5TEWA 3COWA 4I6GA 1ZH6A 3AFHA 4MLPA 2WB2A 1MOPA 1N2HA 3CLSD 1MAWA 1Q77A 1YUNA 1U7DA 3QTBA 4NAUA 2V0CA 1KORA 1FYDA 4EG8A 1IVSA 3CR8A 5LFAA 2IJGX 4MW7A 1TYBE 4MVXA 3TS1A 2VTBB 3P0HA 1O6BA 3LE8A 3NV7A 3N8HA 1IQ0A 4MW9A 5KHAA 4DDMA 3ND5A 3FDXA 3HV0A 2ZUFA 3ND7A 3G5AA 4HPWA 1Q19A 1XNJA 4KKVA 4J76A 2DXIA 3KT0A 1B6TA 2AKEA 3CLUD 3IOCA 2CV1A 4ZT5A 4PY2A 1PG2A 3COYA 4MUJA 1OBCA 1SURA 1I2DA 1F7VA 4MW1A 1K4KA 1M8GA 3NBKA 1KQPA 2NSYA 3UK2A 1T6YA 3OP1A 5FO0A 1KQNA 5DB4A 1N2IA 4DE5A 3M5WA 4G6ZA 1YI8A 1H3FA 1NUQA 1YIAA 2JAXA 4QBTA 2EJCA 3ZUGA 1PFYA 3FG9A 4EF6A 5HUJA 1ZJWA 1O96B 4DDHA 1KP2A 4YP5A 4MWBA 4QRDA 4ZCTA 1G8HA 1NI5A 3DLAA 4U8HA 1LW7A 1NP7A 3G59A 3C8ZA 3CLTC 3A2KA 2C5SA 4AS1A 3UOWA 2QUKA 3JXEA 4I6JA 5LLTA 3CLRD 1R6TA 4MW2A 2J09A 4CQNA 2Z09A 1OWOA 1EFPB 3HFJA 4MUIA 1I6LA 5K0TA 1IRXA 3DPIA 4F4HA 2XRYA 4U7JA 1KP3A 1VL2A 1P7PA 2VXOA 4DLPA 3X1MA 2A84A 3UMVA 1N2EA 4ZCSA 5EKDA 2OV4A 3P52A 1VBNA 3INNA 2DR2A 2QJOA 5F23A 1MBZA 1KAMA 3FWKA 4PBSA 1QRSA 3IVCA 4MUNA 5DEOA 4EGAA 3GUZA 3ND6A 1J1ZA 4OUDB 1O96A 2E18A 1I6KA 3A4IA 2A88A 3FHJA 3PXUA 3ZJVA 1XNHA 3FIUA 4ZT7A 3E27A 1EE1A 1MRZA 4I6EA 5TGTA 4QREA 3KT3A 1XNGA 4PBRA 1TYDE 4YP7A 1G59A 1OWLA 2QUJA 2IELA 1G8FA 1JHDA 1MB9A 3IDFA 3SYTA 1O97C
chains in the Genus database with same CATH superfamily
5AM1A 4AG5A 2HGSA 1H5UA 1XEAA 3DW1X 4MV6A 4QQ8A 3F78A 3H84A 1NASA 3I8OA 1IN7A 2GJKA 4KFUA 4CM8B 1TVKB 1FUYB 3R3WA 2P9QA 1UANA 3EEIA 1UJMA 4BQEA 3WYFA 4KXXA 3AR6A 1WQ4A 4UZFA 5TIIA 2C5BA 1JXAA 1UEJA 1Z0AA 2FN8A 2JLSA 3BRWD 1WR8A 3GVHA 4WVLA 2BFBB 3HKDA 3QVGA 3WMRA 3ADPA 2ZR0A 2D7CA 2O8CB 4EFMA 2CLSA 2TRSB 1O6ZA 3CTPA 3CZ9A 1XAGA 4BRZA 1NV8A 4CDNA 3C3YA 3DMDA 1MMFB 3KTDA 1KEEB 4MGZR 3VR6A 3W3AD 1JLKA 2L42A 3WX0A 4AW9A 4HUJA 3K1YA 3T99A 2G0TA 4II7A 4DADA 1QGOA 1UOQA 1QR6A 1H4QA 5AWFC 1Q50A 5KC9A 1R8XA 3FTQA 1SQ6A 3NPAA 1RQNA 3WB9A 5HJ7A 3UGTA 2CJWA 5LMZA 1DC3A 5HFJA 1ESNA 1KYZA 1W0KD 2JK0A 3CUYA 4TMYA 3CUEF 5FNVB 1JEOA 1M2OB 1JU9A 1KC1A 1NM5C 2AG1A 3I0MA 3UEOA 4FB4A 2X2EA 1U3UA 3RLFA 4JEMA 1QU2A 3LXMA 3OTGA 2JA1A 5EXTA 1TTTA 1IN1A 1A95A 2VHZA 2QZ9A 2DULA 4V03A 1DXYA 3L4BA 5CFPA 2JCXA 1F4VA 1Z29A 2VA8A 1RM0A 1NI4B 1P4GA 3IAM6 4RZ3A 5LQRA 2O5VA 5ESWA 3TL2A 2XOXA 4LTDA 2Q6TA 1ZGCA 3A9UA 1E94E 4PNHA 4PYNA 3EOBI 4FGLA 4L6IA 3DT6A 1RS0A 4R69A 3JWEA 2V6JA 4V0ME 3UO8B 1CHDA 2H31A 4YJ3F 3RQSA 3U26A 2LKDA 4DDWA 1O9HA 4WK6A 1GZ7A 3EGIA 3RB8A 3M1IA 1HM5A 4RTLA 1RJ9B 2JIMA 4ED9A 2CXSA 5CDFA 1KKMA 4BMCA 1GCOA 1K5DA 1KEWA 5JHHB 13PKA 5E6UA 4GXQA 4PVCA 2DPMA 1AKWA 1QE0A 4Q15A 8ADHA 3ICVA 3DMTA 5E7QA 4YYEA 1CR6A 1TKCA 4LXHA 3JSAA 1OGJA 3G2QA 4D9FA 2AOVA 1M1YB 4OK3A 1V25A 4ZVVA 3BMXA 1GT6A 3SR4A 4F6CA 1DFIA 4N5IX 1E6KA 2BLNA 4KSYA 1GFSA 3S40A 3FZYA 4Q6WA 1U9ZA 4UEQA 3ZI7A 5CW2A 3OZFA 2CSXA 2IFTA 4BLWA 1BQ3A 3TQSA 3QVLA 2XJ9A 5EPUA 4M0CA 3OE7D 4FE7A 2G7ZA 1ZVQA 3R7AA 1YIOA 7ADHA 5IH7A 1O08A 2IEGA 2B20A 2SKCA 4DB4A 5T4EA 4KGDA 3TJZA 4IQFA 4GUDA 3R3YA 5KAPA 2V4MA 1OLSB 1X94A 4PR0A 2W6ID 3UJHA 1DLIA 2BRUA 3P96A 4DNOA 2O54A 1GDDA 1DKQA 2Z2KA 1XD9A 4IGFA 3OF3A 2GEVA 4MJXA 1Y4AE 4X66B 2A1TS 2ECFA 1E4VA 3DNFA 1PD1A 4PHHA 3CVUA 4OUKX 4HVLA 3RYFA 4MKFA 3TRFA 1UBNA 1UM8A 3TPZA 2W70A 1ZO8A 1J00A 4K5QA 3G17A 3BMNA 2DPLA 1NONA 2GWHA 1GRCA 2M9MA 2ONCA 2MYPA 3BFXA 3K5HA 4LDRA 5EOVA 4KPEC 3D0QA 3KQMA 1CIVA 3N8IA 2R4QA 3DKVA 1SXHA 3ZS9A 4POAA 3L0OA 4ML3A 4TOIA 2H7XA 1YOVA 4EG1A 3T61A 1PVOA 3ITDA 1UOEA 2GK4A 3FZNA 1SK8A 5CH3A 5E2AA 1PJ4A 3UQYS 5L3QA 3TZLA 4CIBA 1GPDG 2C7VA 1WBJB 2CCKA 2XI4A 3CVWA 4EMTA 3SBDA 5LC1A 1WMSA 1ZM7A 2HSJA 2R3SA 4V24A 3OP4A 4RK4A 2IY7A 1Y7LA 2ZJYA 1R2QA 1AK2A 4G26A 2VA9A 1HDGO 4AZ0B 5EZYA 4H3HB 1BS1A 3SMVA 4WWHA 2PXCA 4CU5A 2GZ2A 1DBWA 1FOEB 4ATNA 1H0RA 3HCCA 3NGLA 3QA3E 5A5FA 2JDIA 3BYZA 3JQFA 4W5OA 3D6MA 4G56A 2CLDX 2Z8YM 1L5GB 2WWVD 3A2NA 3FPKA 2PS0A 5BSFA 4P0PB 1UJ6A 2IEIA 3TTXA 4BCCA 2OAEA 2A6PA 3T5PA 4Q3DA 1GPWB 4ALKA 4EPRA 1H4VB 3OQJA 4ZN6A 3EXG2 3PC7A 4JNCA 3Q87B 4E2WA 3K09C 5KVAA 2JGLA 4ZK6A 4DDTA 1WXEA 4PRYA 5BRAA 3F3YA 5TVGA 4WLNA 2X6TA 1ADBA 3IMCA 4IUCS 2HH9A 2XEXA 5DTJA 1TKBA 4FLEA 4KODA 3SJZA 1LS1A 3UPDA 3U2QA 2C96A 3IVGA 1LCIA 3KOZA 5EMNA 4E7PA 3JWHA 3HJRA 5FBHA 3OOWA 2WPNA 3UJ3X 2VP5A 2JFVA 4GR4A 1X3SA 2Q0XA 3UHPA 3FI0A 1Y6JA 4OYHA 1J0XO 4IPTA 1QE5A 4PO8A 1JIKA 1I4EB 4ROSA 1Q1EA 2VRCA 3UT5B 4RJTA 1CJTC 3A36A 3F73A 3SU8A 2W6JD 1Z56C 3BL8A 1IZ8A 4ZT4A 2I4RA 2DM6A 1E98A 2Z08A 4E5NA 3PBKA 2D0IA 2V45A 2YW2A 1GHTA 3V7WA 4BFTA 4E12A 3IPCA 4MUEA 3T34A 3LWBA 4BZZA 1IHOA 4B4VA 1EP1B 3ADBA 2E6UX 4YRNA 3HXQA 1WB9A 2G80A 2AHRA 1DAOA 3MJEA 3P71T 2JJ2D 4DCUA 4EELA 4Y8VA 5B64A 1TK3A 2P90A 2W2XA 3BVPA 5E7MA 1WMAA 4C1NA 5JCPA 4I1PA 3I62A 3PQ6A 3FPGA 3M6FA 3K1JA 3PNYA 1T5IA 1WX1A 2QRPA 4E09A 1BAPA 4EATA 1D0VA 1SCUB 2GUWA 3ZWYA 2FW9A 1B3RA 1UK9A 3VGPA 2EW8A 4YCCA 2AD1A 4K9DA 1ADCA 3S8YA 1GARA 5C32A 4OB7A 2IOYA 3ILSA 4AJNA 1F8UA 1QHEA 1TD1A 3GK3A 5B6IA 2B2CA 2VTDA 1N6PA 4TT8A 4X9XA 3QU4A 1J70A 4MKHA 1MVNA 2B5WA 1G5RA 1K7FB 3AFMA 2QMUA 4Q3BA 5ALDA 3V9PA 1B6RA 4MI9A 2D7DA 1ZZGA 3I2JA 4HLDA 1EVKA 3PUWA 4XLZA 4YAUA 4DWOA 2QNBA 1IXYA 4CF3A 2FZKA 2HBZA 1W1WA 2JHAA 4ZCQA 1H8HA 1OKKD 1JPJA 1R0CA 1D0IA 3ESAA 2UVQA 2BL4A 4H08A 2WHYA 3ZCVA 4UU7A 1VSUA 2BFFA 5EHXA 1VBKA 5B2ZA 1U65A 4BFCA 2QT0A 1A4XA 2XUPA 4CGYA 5CK4A 4GLOA 2QV0A 5G02A 3FI9A 4WHMA 3QLVA 3FNBA 3VZBA 3PSHA 1R6AA 1KKUA 1YT5A 4E4TA 2EDAA 5KMGA 2NVUB 2PH5A 5I4BA 1Z18A 5F2OA 2HJSA 1LI4A 3O4JA 4I9GA 4J1NA 1PEKE 1TAGA 4ZI2A 1BE8A 3Q41A 5GONF 3RIXA 5KQLA 2PRYA 3KR0A 2IW1A 4ZIRA 1H65A 1KSJA 2GZDA 2CEAA 2O3SA 1JR2A 1T6XA 2MHCA 3LRPA 5DTRA 4AJEA 3T0GA 1ID1A 2QW0X 4YFVA 2W2MA 4XIIA 1K8QA 4URHA 3AUUA 1OWPA 1H2HA 3H6KA 1ICIA 2X9GA 3NORA 4IUDS 1FTYA 4PLWA 2OQRA 3GFRA 3PQ4A 5CB6A 2W2LD 4CM4B 4D1YA 5EJMA 1XJQA 1IK6A 4LWOA 1ZINA 1TM2A 3AU9A 4RBNA 2PNJA 1QP8A 3KB1A 4MLZA 1QHHB 2WD8A 1ZISA 1V9CA 1F8YA 4H3VA 1K92A 1G42A 3K0SA 3R8FA 1UJBA 4HGPA 1Q0TA 2RI1A 3LUGA 1J09A 3MXOA 3P2IA 1MJ5A 2GJ8A 2XVXA 1XEXB 4KACA 3IC5A 4Q12A 1HA3A 1YB7A 1GQSA 1H5QA 1Q15A 2OHIA 3MHPA 4NH4A 5DNUA 4C04A 2BC9A 1XLVA 3QWBA 4R05A 3WRYC 2Y9PB 5AJYA 3V8NA 1E3MA 2CYCA 1YDFA 3HXPA 2OC9A 3KBOA 2O8NA 4Z0NA 5JG7A 2Y77A 4XQGA 3TOSA 3LI2A 3SHQA 1D03A 2ZRDA 3KUUA 1S2GA 3BDAA 2QTMA 1V7QA 2QD4A 1QYXA 2NUAA 4MR7A 1G2IA 5D5QA 3K0HA 2AXNA 2PRIA 5FFNA 2BY4A 4BEVA 4U7DA 3DV0A 3RPEA 5BV8A 5CNIA 1JFFA 1PS9A 2CNWD 2G1KA 1T29A 4LJAA 4BP3A 1KO7A 1W1IA 1TYZA 1Y3DE 2CHEA 3NWOA 3QH4A 1LI7A 1MIHA 4WOBA 1Y6ZA 3T5BA 5JECA 3KQNA 2E21A 4EI2A 4GRIA 4BL5A 3I9FA 1OUMA 1ABBA 2QB5A 3AM5A 3PNQA 4I1YA 4ZPXA 1QJCA 4BNZA 5A0VA 4DMMA 5FBLB 2UZ4A 1W52X 2VP6A 2Z2YA 3MTDA 2ABWA 3EAGA 4NENA 5EJ2A 4JAVC 4FR5A 3U7JA 1SEPA 2AXPA 2WVHA 1OV4A 3QE0A 1GL6A 4X64B 4IIJA 4TT3A 2JH9A 2P91A 3E23A 5KVQA 3E9YA 2ZVQX 5KI6A 2V0CA 3T38A 2NU8B 5D1HA 1XQWA 2I2FA 4AVYA 2XXAA 2ACKA 3GEMA 5IXJA 3OLXA 3VOAA 2VR1A 3DFIA 5DP2A 3I58A 1HDIA 4QIHA 1GO2A 1EU1A 4QNMA 3IE1A 2H5JA 3DCYA 5BNTA 4KR3A 4PU0A 2NXWA 2XOEA 5EAIA 2GJ9A 2ZIZA 5KYUB 1V26A 1JA9A 2D0OB 1RAHA 4UNQA 4QVKA 1GU1A 5HZHA 1XNJA 1YI1A 1Z3CA 3R7BA 4PYLA 1KZ1A 3TCXB 3GI1A 4BLTA 1H93A 2BKAA 2ORWA 3DMTC 4R1NA 1UK6A 3FLMA 3TRDA 1AHIA 1CUXA 4JLDA 1AV6A 4BO0A 5TQVA 4FSXA 1U1DA 3DE4X 4JVSB 4MUJA 5IJZA 3NAQA 4GWGA 2V58A 2XWJI 5J23A 1G38A 2AJLI 2BFMA 3MUNA 2IDMA 1XPUA 1H0SA 4F6RA 4K9NA 3D6TB 1JI0A 2Q9BA 1G7RA 4RDCA 4M9CA 4TMXA 3U7QA 2WOOA 4DGSA 4F85A 4A8JA 3LHDA 3G89A 1AK1A 2RGBA 3KQVA 4G5HA 4WXEA 2WJVA 1KQNA 3K8YA 5E2IA 3UJ7A 1V1MA 1ZMTA 4B44A 4M6WA 5K8UA 5AHRA 1Y1PA 1H3FA 3EXFB 4HXFB 5CA0B 2AUMA 2PH1A 1JDZA 2H7VA 3BK7A 3I5AA 1XRNA 1UDAA 5C0OE 2G1JA 4QDTA 3RT9A 4QJIA 1P1JA 3T7EA 1XQVA 2H00A 3JARA 1AMOA 4C7OB 1P1KA 1SBCA 1YQQA 1K6EA 2NZJA 4OPMA 5EGNA 2WINI 3D8HA 3SHFA 5KSOA 3LDHA 5C9ZA 1IHUA 1EVIA 4JBYA 2BRUC 2QN8A 1K5PA 1QYDA 2YHIB 1NJ8A 1S8OA 1MQAA 2ID9A 4GM4A 4I6JA 4LZPA 2ZBPA 5CA1F 4CIVA 5IEBA 3C8UA 5T7BA 1IN6A 2D00A 4MR9A 1VL5A 1E9RA 2H85A 5IULC 2ZYAA 5BUCA 3GRCA 4Q9KA 4CKEA 3A0UA 3M5CA 1EFPB 4UBMA 1XMIA 3U3DA 4LFAB 3WLMA 1Z6YA 4RH1A 2IBSA 3BKXA 2RARA 3PD1A 3HKBA 4U7JA 5CVEA 3GEIA 5J1SB 5D8DA 2M1XA 1JSRA 3K73O 4XGNA 5JMPA 4YRKA 4F1JA 2RGNA 5E1BA 1JQLB 3NHYA 2OBLA 2KBFA 4KQ6A 4FQ5A 2AC2A 1P39A 2XMQA 2XODA 4JIGA 3BMQB 1NQVA 1UDXA 3C41J 3OM9A 4KGXA 3BWDD 4Q3AA 1SXJD 4RKFA 5CIWA 5EKSA 1W47A 3W8EA 4F3KA 1FFXA 1RP7A 1IWOA 4J7AA 2I6QA 4R7ZA 1V41E 2NO7A 5E38A 4QFCA 5HE8A 5T3UA 2ZS9A 1U1EA 4G5QA 1DI0A 2D7JA 2WYIA 3A26A 5KQPA 1FMFA 1GPLA 3DE5X 2P78A 3GLHB 3FMPB 3L5OA 4NE2A 1EE1A 1NQUA 1Z25A 4KMRA 3ZDZB 2GD1O 2XA9A 1KAEA 1FXUA 1ESCA 1OLUA 1SEVA 1RRKA 2H59A 2OP1A 5TRTA 2YFQA 3WLHA 5L40A 3FUTA 3INRA 2BGJA 3JQFC 3D2LA 2FSHA 1JMKC 1GPYA 3KLNA 3RFTA 4C07A 5DHQA 3S28A 3EGDB 3BREA 3KYIB 1U0SY 3DBLA 1JIUA 5FIUA 4QUHA 4DNFA 1SWVA 1H2FA 2PWYA 4JJ8A 1CUZA 3X2SA 1VC2A 3H5LA 3PT5A 1AC5A 4B8WA 3GVIA 4UUOA 4ZD6A 1U8XX 2R7KA 3R23A 2PD6A 3PWZA 3VPAA 5JNLA 3UK0A 1WDMA 4KWEA 4KBGA 1MX5A 4G1CA 4COKA 4WLEA 1SUSA 3FGOA 4W5NA 1N1GA 3DEZA 4EQ6A 1A96A 1L5HB 3IKVA 4KWCA 3BBPA 3IMFA 4QDXA 3U4CA 2UDPA 4GYYA 5BWBA 3MMXA 3N39C 5CAEB 1NUAA 3TBFA 3I76A 3FHTA 4L76A 5G40A 2NTVA 4PFJA 4TV9B 1T24A 1C1DB 2W2OA 3TLMA 1XG5A 1JHAA 2IGTA 2JGFA 2WIBA 1E1LA 1VRCA 2CUTA 3DCJA 4MVJA 4TLCA 5MHTA 4YWJA 1PGNA 4I3FA 4UXJA 2G8NA 4FGUA 3NKFA 1KBOA 3FJ1A 4IQGA 4EY6A 3TQOA 3GLVA 4ZYLA 3UV6A 4OLJA 4EVSA 1WZIA 2ZUBA 3W5DA 3SKVA 4JT8A 2OGZA 2GILA 2E9SA 3WA7A 3DTVD 3UTDA 4EUSA 1Q11A 1UWCA 4V0LA 4YIKA 3TL3A 3KL2A 3B7GA 3OVMA 1S9HA 2OK7A 3FUUA 2P6OA 3GQVA 4MLCA 4O2AB 2LNDA 3IIMA 3BKWA 3DTVB 2FPRA 2J85A 3UUEA 3NAMA 1M2FA 1W4ZA 1TVKA 1WF6A 3D3EA 4AJPA 4CM8A 4F92B 1UBKS 3A4VA 2P41A 1DRVA 1HZJA 2NLOA 2GBGA 2UVPB 1D1QA 2ZSAA 3AF2A 2VJCA 3K2BA 3M81A 3O73A 2XB2A 1OIVA 2ERXA 2GDJA 3R6TA 4WX2B 2BKXA 4Q16A 4KO8A 3TCNA 2BFBA 4KQXA 3RANA 4BAZA 3NTUA 3S8EA 2O8CA 1BSVA 5BN4A 3B9PA 3H18A 2P2CA 1PJTA 3BRWA 4OHCA 4YONB 1FBTA 3W04A 5DHTA 4D74A 1KEEA 3BFKA 4DR7B 4CQMD 3U0BA 9ABPA 5TPWB 1EUDB 5F5NA 1J9GA 1F3OA 2WY2D 3ZGZA 3RKUA 4KP7A 1ZGGA 3W3AA 4TV8A 2ZSKA 4WOPA 3EIWA 4CQMB 2DHQA 5JWHA 3S2UA 4L4ZA 3RAGA 4MDFA 5KNLA 2P2NA 2R6R1 5GVSA 3KQOA 3M49A 3PFHA 4PLZA 3ZYCA 4Y2XA 5FNVA 4UHDA 1NLZA 2ZBEA 1M2OA 2YUTA 5DHPA 1PIWA 4HAVA 4R81A 4GVXA 4IJ5A 1XWFA 5JDIC 3NVAA 2YWEA 3TSAA 4D81A 3HXKA 1W0KA 1GA4A 2VNSA 3ODGA 3QITA 3WGYA 4EY4A 4JEHA 1G8SA 3ACBA 4RELA 4DSUA 5JXGA 5TLSA 3B3FA 5U1PA 1IM8A 2Q9CA 4UD2A 2JAPA 3FR7A 4QDJA 1OPRA 3OESA 1VHDA 2FWNA 4FHZA 4KQGA 3AUAA 4ZT3A 4M1SA 1NI4A 4G2TA 4ESEA 5HR5A 3O8RA 2OVBA 5AOCA 3UKDA 3ESBA 3QKWA 3QXGA 3OM1A 3RAPR 4FOPA 4LS3A 2RIRA 2P79A 3QLVC 1QFSA 4RIFA 3KU4A 5EKXA 4N0EA 4UMDA 5ESDA 3RVPA 2I3AA 4OHXA 1GG9A 1L4MA 1IIRA 2XZTA 3ZCSA 5BRJA 4G1VA 4B31A 2BHNA 4RESA 4X20A 2P6MA 1C41A 3NRCA 3TQHA 3D6HA 4HBGA 3NOVA 3QX9A 1OB5A 3HM9A 1RJ9A 2PX2A 4X6UA 4MB0A 3H8JA 2EYUA 3PGVA 3TSCA 4CM9D 2IWRA 4EFNA 4BQIA 1ZM9A 3Q2KA 1E2MA 2FLVA 2HIMA 1LI5A 3AY3A 4DUPA 4IF4A 3MJHA 4HBZA 4FMDF 3N7AA 1E6LA 3ZX4A 5ES4B 4CMHA 4HEQA 5DSXA 5TGDA 2VSOA 3UJPA 3AYXB 4RMIA 5LPNA 1YB4A 4MRAA 1XZEA 3F2IA 4OY3A 3SS7X 1XTVA 2EATA 1M1YA 4IINA 3U17A 1GUAA 2CXXA 2PVCA 1TCUA 1MO2A 1DX6A 1PTJA 3K94A 1NVXQ 4OHBA 1GGNA 1KJ9A 1CDDA 2IL1A 2H07A 3WQBA 2P40A 2OCYC 3HZOA 3TD9A 2IXGA 1AH2A 1PBTA 1PDOA 1M6WA 1E9CA 1T25A 1ILWA 4G25A 3QZUA 2QVLA 5K3SA 1GSOA 1ZWKA 3WKEA 4N3CA 1TFRA 2GA9A 4IJWA 5C4MA 3LP6A 4EUHA 1NJ6A 3C8HA 3OE7A 4M89A 5EUMA 5HSGA 3MJTA 1J97A 2OY0A 3HCWA 4UUQA 5CPBA 3W8FA 2GTPA 3JYPA 1OH6A 1OLSA 1PFUA 1TC2A 2GYUA 3GLTA 1OZHA 4D82A 1TU4A 3FMFA 3K8ZA 3UIEA 3B2QA 1LTQA 4HNAB 5SZJA 5BW8A 1Y4SA 1MT3A 1MNQA 3H5IA 1HE3A 2W6IA 1S2DA 3OQIB 3JRWA 3QM1A 4IDCA 4IRXA 3O47A 3UWDA 3ZIUA 2FH5B 3W5AA 2DTEA 4F04A 4DCNA 3DE3X 2YJ5A 1M6YA 2PZEA 3DLPX 3QELB 5DFAA 3V3TA 5BSVA 3O8CA 4Y18A 2QSZA 3H16A 2DTXA 2HPVA 5IKEA 4CV0A 3ZDXB 4DNPA 3EVDA 2MCFA 3MTIA 1TRHA 5JXIA 1VE6A 4Z86A 3I9KA 1CDEA 2UYQA 4CMJA 1X38A 5EL0A 1ZU5A 5JAIA 2Q4BA 3QBVA 4XGRA 3SC4A 4BV9A 1KS9A 2EWMA 2GKSA 3HM2A 1HYHA 4QTXA 4PG4A 3VJRA 1Z6PA 2ZS7A 2V7TA 4M9ZA 3PFBA 4JELA 4QFDA 4BO6A 2HD4A 3NNSA 4DR2B 3BGVA 1LPBB 4OGFA 3VNSA 5AVWA 4JJAA 2HFJA 5HCUA 3HYCA 3SX4A 2OR3A 4AZ0A 1I3LA 3HP7A 5AW3A 1Q3KA 3HU2A 4CE6A 1UR5A 5DEIA 5JTUA 1WW2A 5FL7D 3K5PA 3CRNA 3SZUA 4N18A 5K0CA 3K92A 3KK0A 4L6AA 4MQ4A 4P86A 2X41A 5H16A 5K3FB 5M3BA 2FMXA 3UAZA 1Y98A 1KVTA 4BECA 5CEJA 1YZFA 3DWIA 1ZQ1A 2YYYA 1HBJA 4J4TA 3VKGA 1PL0A 1EXNA 1LLQA 2H1FA 2HJRA 1XALA 4JXZA 4HAYA 2B8WA 4FW8A 3OICA 1E2FA 4KVZA 4HQ6A 3NR2A 5ALKA 2Z30A 3B6IA 2YXLA 3WGJA 2HQBA 1IDN1 3HYSA 3AIMA 4Y98A 4D97A 1Y9ZA 3GYGA 4ZHSA 2XUGA 4YJ2B 4E46A 2P8JA 1EVJA 3UMFA 3OPYI 4CF7A 4KIUA 2NGRA 3V6MA 3QVXA 2JANA 3BQ9A 4GL4A 4D9JA 3G6WA 2KE5A 1N75A 3GPBA 4GOLD 2CNBA 3JYLA 5GOTA 4A8JC 1C4WA 1DINA 4JJFA 3W05A 4M0EA 2Q6OA 4E2FA 2QE6A 4QT4A 3UPUA 2B94A 4WOCA 4BO5A 5CCDA 4ZYYA 4MQ6A 3BJRA 3AEQB 4F21A 2Y1EA 1NVUQ 3UYLA 3UB2A 3GMTA 1B15A 3A1EA 3H9UA 2WEKA 4BZXA 3FYHA 2W93A 1NN0A 1VYHA 1Q3TA 3Q9NA 3UT5A 3K31A 4OQEA 3PGMA 4D96A 5C1DA 4IZIA 3COJA 3CNBA 1J06A 3OY7A 3DYVA 4UM5A 4U2GA 2FGKA 5DYWA 3TI7A 2A33A 1EVQA 1XC7A 2GQ0A 1SUWA 1VSTA 3CH6A 3LG2A 2W6JA 2NO0A 4DPKA 1YZQA 4CF4A 1DJLA 1XU4A 2AK2A 3R9XB 4ANFA 2OCAA 1XTZA 4QARA 4XVCA 5L6MB 4B3CA 3V1MA 4C0SA 3RF6A 1HXHA 2A9KA 2I66A 4OQLA 4HGYA 1K8XB 4PRZA 4FYYA 2MSNA 1P8AA 5CFRA 3N3AC 5KJFA 2OCDA 3BWCA 5B3KA 5GVRA 3CZRA 3L7CA 4D3XA 2HCFA 1TO2E 3AHJA 4QPDA 2JJ2A 1A1VA 1PW7A 2HT1A 1SCUA 1YVUA 2V6FA 4I8DA 5AD1A 2IYNA 1VRWA 2IXBA 2JA2A 2WA1A 3CWZA 4Q7KA 4GBED 3SHTA 3WJ7A 1AB5A 1USUA 4HSGA 1CCWA 2D5AA 1IB6A 1K63A 2WJPA 4R2JA 2ET6A 4U3JB 1NGSA 1R9MA 3PXDA 3TOZA 4F9TA 3DDZX 3R75A 4QYMA 2ZUVA 5GJWC 4MUHA 5ALEA 4N65A 4EGQA 3R3JA 1E0KA 3QA9A 3A32A 2WI8A 4EG4A 1OREA 3JVVA 4FW9A 3DBIA 1JJBA 1NA5A 5B2FA 2ZRKA 2JFQA 4JFAA 2RKOA 3FGNA 3Q6NA 4US2R 2I1LA 1KR5A 1GL3A 2GD6A 4PN3A 2Z4TA 3AF4A 5K0ZA 2Q8NA 1FQOA 4F4CA 1FDSA 5LDGA 1NZFA 3ZZTA 1JLSA 2AEFA 3BXXA 3AETB 3TQQA 5CEEA 3GW8A 3OZ7A 2JLCA 1C8VB 2OG2A 1QG4A 4IP0A 1OKKA 3HA7A 4N9QA 4S1TA 5D01A 4NBSA 4KU4A 5EJEA 2D54A 2YBDA 2P6PA 1A2BA 1YDGA 4FJ0A 3LCCA 3NP7A 5EKTA 1C81A 1OYVA 1YCHA 3HH8A 3GRYA 2Q5HA 2HF9A 3A1DA 3PC6A 4X94A 2NVUA 4PO3X 3GUUA 2D5LA 1E3IA 1XGKA 2JLBA 3I72A 5BWOA 2IXFA 4CM6A 2RGWA 2V7QD 4PPNA 1Z0KA 1SKMA 2A5DA 4B47A 1JG3A 3C8DA 1W5AA 2TMDA 1LVUA 1U5CA 2PYIA 5EJGA 2RG7A 2O2DA 2XOKD 1FQWA 3PIDA 3I4CA 3VR4H 5LNK6 1RXYA 1M8PA 4BVJA 4LISA 4UFOA 2C57A 3I2GA 2QDXA 1MC8A 4LK3A 3O7WA 3T5GA 2R1VB 4BEJA 3I5MA 1DOZA 4OGWA 1RHQA 4X97A 5E0OA 4CR8A 4E5DA 2ZZNA 3B20A 4PFSA 3MFYA 4CM4A 4CQLB 1GUFA 3TOVA 2EBUA 2AYYA 1YA8A 4GI1A 2G7MC 1ESMA 5G0VA 5F64A 1GZ6A 1JU3A 2F9LA 2ZANA 4UUAA 3I28A 4E1BA 3QSGA 4UREA 1MOPA 1QHHA 2W2LA 4LYGA 5F23A 3JS5A 3W9SA 3HQ4O 4ZQFA 5M29A 1NXTA 2ZJ1A 5AJWA 1USKA 1KORA 3DLTA 1FYDA 2YWFA 4OI1A 5KNCD 5DGDA 3TOXA 1XEXA 1Z8DA 3CUSA 3JQ8B 1C8BA 3RUPA 1K5GA 2EFHB 2VUHB 2EARA 2I99A 4I3HA 4XYMA 1Y82A 6ADHA 2DECA 3FSRA 4WGFA 5I7FA 4BVKA 1XZNA 2FR8A 1P5RA 2DZDA 3SG0A 4B2YA 2AN9A 4H15A 1UOPA 4BNMA 4N82A 1BMTA 4H1VA 3KYDB 4IFIA 4NWIA 4LI3X 5F35A 5BVGB 5HVNA 4G81A 1OU0A 4G85A 4WTOA 5DWDA 3UJ8A 1DKLA 1RXCA 2ONKA 3A6KA 4LZWA 1B6SA 1PHPA 4HNVA 2SNIE 3SK0A 2CNWA 3GEGA 3FFWA 4YQYA 2COKA 2QN7A 4Z3DA 3PGJA 4MWTA 4KN9S 4ZQEA 1Q0HA 1SCJA 1K2VN 2ERCA 1OZGA 1PQPA 3EUEA 2XX3A 5LQDA 1W44A 1ECLA 2CHFA 2R9VA 3A9CA 3FMIA 4FR2A 4TS9A 5BT8A 3OLVA 3AB8A 3QLTA 5BQOA 1KI8A 3G9UA 1NUHA 4X6LA 4H7IA 3ENNA 1U0GA 4KMSA 1CEEA 3WAGA 4MVJM 2JI9A 4XIJA 2NU8A 5LQJA 2C9CA 3PV0A 4AX8A 1KMMA 3BQMB 1YR2A 2W8BB 3LYAA 2EP5A 1CXZA 2KM1A 4HB0A 4CEIB 4MEJA 2WTNA 1OIXA 2MOKA 1ZGJA 3P9XA 4P08A 4CEHB 3A4LA 4MWBA 5TB5A 3VVBA 5FADA 1TAHA 2GETA 4P80A 1KEKA 1XHLA 3OX4A 3HB7A 2FZWA 2Q0SA 2ID4A 2RHBA 5GGYA 3MGBA 1L0BA 2PSFA 5KYUA 1P2BA 2JLWA 3K0EA 2CNLA 3ZQKA 1OBVA 1QUEA 3F0TA 4MR8B 5FTWA 1WBDA 1VFNA 1D9ZA 4OSEA 3QNMA 1YV9A 4IIEA 3DOIA 2K7ZA 2A92A 3SPXA 4M21A 2NYRA 1XZJA 2FUCA 3P27A 3KVNA 5FBKA 2WU4A 3A4NA 3CT4A 5A4JA 4NRDA 1EB8A 1C5KA 2W7TA 2ZSUA 4A0HA 4RTQA 3ZQJA 5EEHA 5EKDA 3L2OB 1BOFA 3S8MA 2ZYGA 2JFGA 3KO8A 3P9PA 4JC0A 5G4LA 4AUEA 3RG8A 1EA7A 1NBAA 3EXFA 1J2RA 4K3UA 2AE1A 3PQEA 1XCMA 4QU5A 3HCBA 4BO8A 5B5SA 3OZVA 4C7OA 2ZWOA 2G6TA 3VZRA 1ZJYA 3ROFA 3NHPA 3E27A 1X92A 1IULA 1W88B 3IA7A 621PA 3QOXA 5GIOE 4UNIA 4QFBA 2YHIA 3O91A 3JTMA 4L78A 5AUNB 4OI0A 1WP4A 2PLNA 1GZ3A 1IU9A 4GFDA 1I14A 3G0DA 4MK4A 5KKNB 1MB9A 4IMPA 4Z2YA 3GT7A 4GHWA 5AT1A 1C4OA 2Y6UA 3KKMA 4L73A 5IW8A 4FB5A 1B42A 1ZM3A 2YWJA 1EFPA 1AQJA 4GQIA 5AM3A 1V8ZA 1JEQA 1Z8HA 1V7ZA 5IBQA 4DZTA 1F0KA 1QIKA 4OJQA 1X1CA 3DL4A 3CZ4A 2UAGA 4WKBA 1D2RA 3QHAA 3B78A 1CS0B 2E2WA 5HKLA 3DYBA 2C07A 3U80A 1HQCA 5THQA 1I33A 1ZP6A 2UUOA 1PWYE 3KWJA 2VCEA 3AWIA 4U9IS 5B37A 3IFSA 2RH5A 3V7YA 3BMQA 4RSMA 4LHWA 3U37A 1ZJ5A 4BNXA 2VRBA 1YJAA 2DUUA 4IQ8A 4IBOA 1SXJA 2HEGA 1J9EA 5HHTA 2H2AA 5KQSA 4CCYB 1U1CA 2SKDA 1E7RA 1W25A 3FSEA 2E7ZA 3GLHA 1F0YA 3MT8A 4JDUA 3D6UA 4LVOA 4O25A 3S2FA 4DBLC 5EJ7A 5KYVA 1E3WB 1RYYA 3BZBA 4EMUA 1N5DA 4Q93A 1B1AA 3DQZA 4ZQCB 3ZX5A 4KLNA 1BFUA 4P7FA 3T3IA 1O9GA 5H5JA 2RHDA 3HEBA 5U4XA 5HPYB 2YDYA 4FC7A 1DV1A 4PCVA 4G0WA 1DT5A 2OECA 4FYXA 4HVCA 3ICWA 2XGGA 4N5HX 2P2LA 2WWTA 4PONA 5CGQB 3VJMA 4BIMA 3EGDA 4DWWA 4WT7A 5LDHA 3RUFA 2D2FA 2XYPA 2D0DA 2PGOA 3FB1A 4QECA 5DYNA 3TRJA 4BC0A 4KQ1A 4POOA 1ODTC 1T2UA 2PMWB 4XAQA 5TEVA 3OOSA 1PK8A 3WO1A 4M9SA 2WHEA 3FGPA 2A9FA 1SCAA 3C16C 4HRVA 3WOVA 4U5QA 3WMGA 1KFKB 3NM4A 5J5VA 1KSHA 2BEUB 5EZYB 1GNSA 2B36A 4CZ2A 4DZZA 3VZPA 1Z0ZA 2A0XA 4H6XA 2JLZA 4OFZA 1L5HA 2CJPA 1NU6A 4P2BA 1G9XA 4EFKA 3W3ZB 1XA0A 1M6NA 2QLLA 2PWBA 1CT9A 5AVTA 3T1TA 5CAEA 1YQUA 4PYKA 1ULZA 1N7HA 2AKYA 1B7GO 2RB5A 4TV9A 4ZARA 1C1DA 3U1TA 2BJVA 3ZW8A 1LK7A 3HY3A 3QE9Y 5ED0A 1RHUA 4RLHA 4OL0A 1QIDA 1IRIA 1QC5B 1MAVA 1YQDA 5KNBH 2FOLA 2DFLA 4J0GA 4M9RA 3CF6R 1L7AA 3Q3EA 3SJCA 4M8IA 5K0NA 3EGWA 1YS9A 4PC7A 5DXFA 4K26A 4F2HA 3TTVA 4OA8A 5G1NA 4DCCA 4O2AA 3GVCA 4AKSA 4KO3S 1Y8QB 3DTVA 4GZ6A 3LQRA 4XFJA 1P80A 3I4FA 3ZY5A 4KTVE 3EPPA 5HW0A 4MRSA 1VCOA 2G09A 2WWFA 3VUFA 4GMKA 4HWSA 3OZWA 3WLNA 5KYYB 2UVPA 2RBEA 1XDZA 3H2YA 2W98A 4GMFA 1RPNA 2QPAA 1EBUA 4BB6A 7YASA 2GPWA 1FP2A 1UDBA 2IGBA 3A0RB 4B8ZA 2A8YA 4PXAA 1M6HA 2ORED 4AYXA 1F3LA 3G49A 2Y0DA 2AFIB 2SHKA 2C7OA 1W96A 4RKWA 2AT1A 2M6RA 3WA6A 2P2GA 5TPWA 2QN3A 3GDFA 2P9CA 2E5WA 3B1KA 3C4QA 4K6FA 5TJ9A 1P60A 1TAQA 4CQMA 2FUKA 3GEPA 1FCJA 2PAAA 2ZRCA 2PMKA 3EW7A 3SAJA 3SYNA 1Y6RA 1PUJA 1F5NA 3IURA 3KUKA 1C7JA 1W0JA 1T2DA 4KJXA 3UUGA 3LC7O 4OHUA 4RSGA 5FFMA 5HTOA 1ID8A 2GVZC 3TCKA 2RAFA 4ZEWA 1JHMA 1IG0A 2VSFA 1D5CA 5EWLB 1ZK3A 4I5FA 2QQ5A 4JYMA 4RXMA 2XXJA 1QYWA 1IJFA 3VXKA 3L7KA 1M73E 2ZYVX 1F8GA 2GCEA 4M55A 2Y71A 5CLFA 1Y8RB 2PUDA 3EDOA 1IL0A 4FNGA 4OBEA 2XNKA 4JMPA 1OT3A 4HH1A 4IOMA 3VU0A 5IKOA 4Z1OA 4FT4A 2QX6A 4EKEA 2R6AA 3R5SA 5HKKD 1WXHA 1YKSA 3FDIA 3N6VA 5DZSA 3ZDCA 3F47A 2HREA 1KVSA 4BU1A 4CTJA 1ZW6A 3LUCA 4L85A 2FRVA 3WKAA 2O7NA 4DVJA 1UP6A 1ZM4A 4OOEA 4EYSA 1J2TA 4GGOA 2F1KA 3P0RA 2XSZD 1P62B 4MYDA 5JVDF 3NT2A 3WIVA 4O3FA 3VR2D 1EJ2A 1NMEA 1YJ8A 1P1RA 2B4QA 1ZSNA 2BMDA 4O4IA 2GFIA 4ONEA 4ARIA 3WE7A 1L7QA 1JPUA 2XE4A 3VBCA 4CNQA 4DMHA 1NIJA 3GN2A 2O5EA 3WLTA 3TQFA 5DX0A 4DIFA 1TEZA 1C80A 1F4LA 1LLUA 3ASVA 3D2AA 4CM9A 1XRMA 1ODJA 2W37A 2W4QA 1U7UA 3CNLA 3R1IA 4HYQA 5KDLA 3WYAA 2FFQA 5GJBA 4E14A 2PSHA 1FFGA 3HZZA 2P30A 2F9MA 3C3XA 3CM0A 2GAOA 3ROPA 1OI3A 2HMAA 1BS9A 3FX2A 4Z8YA 1GTZA 2FFHA 4IJVA 4BJ1A 1ZR2A 1EINA 3DKKA 2JJQA 3OJLA 4OHKA 4UMVA 1OA1A 3PTLA 4Q6BA 4U8GA 3S70A 3LQ4A 5H82A 4JFRA 4WK2B 4OJKA 1U8TA 4M1EA 4RK5A 3NHWA 2E4YA 3ABOB 5E1DA 1XCJA 2WTAA 1BGWA 5M2QA 3SYKA 3C1OA 3KEOA 1U4NA 2GPAA 1GCUA 4LRYA 1X9HA 4LYEA 3SM3A 4BX2A 4E6PA 4D3DA 1L4BA 3U0VA 4DOMA 2AR9A 4JBNA 2ZFUA 3AVXA 4HNAA 3LDFA 2UYCA 2EBWA 1N0UA 3V4VB 3C3KA 4DCPA 3OQIA 5B58C 3M33A 1PJ3A 2VJMB 1GQRA 3PLNA 1TEVA 2ZUWA 5EXXA 1I3NA 3IBCA 2C2GA 1OC2A 1Y3AA 3K6JA 4IQ4A 1KY2A 3QELA 1PI3A 1U1IA 3DEYX 1JW9B 4KRYA 3NPMA 3W8RA 1R0SA 3M5DA 1FDWA 4R68A 2I7DA 1N2GA 1HORA 2HA0A 4NEQA 3B52X 4IJUA 5CB4A 2R6DA 4IH4A 1NVWQ 5I8WA 2CJFA 5DRYA 1Y89A 4IHKA 4CYMA 1THTA 2BKVA 1J21A 1WW8A 2HQRA 5FLKA 2GLTA 1M33A 3QHQA 4RXTA 3GF4A 3M3HA 2GF0A 1CUAA 1U2PA 2HEIA 1AD2A 2PLWA 5AJHA 1PG0A 3DFFA 5K8IA 4YXFA 3FZGA 3UG7A 2IEBA 2Q45A 3O84A 5I4IA 1RYZA 3G5TA 2GR9A 3TYXA 3AG5A 3HJGA 3DM5A 1UF9A 4FBMA 5EQDA 4QPJC 3KPJA 1G8PA 3Q9UA 2QRUA 4NYJR 5K3FA 3MWFA 2I0FA 4PEVA 1W34A 4GU5A 4EX6A 1YVDA 3O4VA 2AE2A 1YULA 5FL7A 5KTRA 2E4AA 4CMBA 2JEYA 1AQUA 3GARA 5AXBA 3W5BA 4MIKA 1E58A 1ORWA 1R12A 1QOQB 3QEMB 5CFZA 2WABA 1J0EA 3ZE0B 3Q3GE 5I7VA 3SX2A 5IAEA 1WIWA 1G9TA 3BJMA 1G6Q1 2DFKB 2ZZKA 4YJ2A 5EMLA 4HX9A 4O4JF 3V1NA 3MD0A 3NHZA 1IOVA 2FPOA 2F3TA 4JI2B 3EH1A 2FDCA 5ALRA 2OHXA 4BWYA 1U8ZA 4RACA 5JMTA 2ECQA 3ZEAA 1RACA 2O7QA 3WRXC 2D59A 2HJ9A 2QA5A 2RK4A 7GPBA 3GVPA 1QORA 3PPVA 3MCVA 3K1AA 3BFPA 2XUJA 2FEKA 1RWXA 2NSHA 2UUPA 1ZNWA 4Q1DA 1EJ6A 2E4UA 1E89A 4KV9A 3AEQA 5JQGF 1EDZA 1DCMA 1RE1A 1U2ZA 4A15A 1ZD9A 1MHTA 2LIPA 3NC1C 1HNXB 1WOYA 1XN1A 2GBLA 1XWIA 3SYLA 4WNCA 3X1KA 1K66A 3OC6A 1H2EA 3ZIAD 1NKTA 2V3WA 1ISSA 4QUGA 4Q9JA 5K0LA 4AS2A 3UAVA 4B33A 1EESA 1KPHA 1CQXA 4WBSA 5IM4A 4B3MB 1P77A 3AC0A 4UMFA 1NBOA 3WGIA 1UWLA 4D3FA 3HGQA 2PS9A 4PXSA 1EX1A 2I2CA 5CJ2A 3UK1A 1QG0A 3R9XA 1EIWA 4DQDA 4S24A 3MC1A 1J90A 6YASA 4U2KA 2H0RA 1GQOA 1E4EB 2O0JA 3DS8A 2BP7B 1VE5A 3WRVA 1E7WA 5CDUA 3BBLA 2VXYA 2UUCB 1SUCA 1UJ4A 4GI5A 2P1RA 3R3ZA 1NKSA 3ZWNA 2HK7A 2B1IA 1GR1A 2G77B 4E3ZA 4EYQA 1H4TA 1KBZA 3O3OB 3QF7A 2NSLA 4LNHA 3LPCA 3NQ41 4UE2A 4ERXA 2EGUA 2VSYA 4GOXA 4PGAA 1SCQA 4R7TA 3G8YA 4ZMSA 1ZVMA 3N1UA 5DXAA 1LSSA 3AR2A 2PUGA 2ZCVA 3EC1A 2CNNA 3OCJA 3T0IA 5ICSA 1SQSA 4IWNA 3ZY3A 4JJZA 5DRTA 4BQFA 1O94D 1YIDA 3LYHA 4H6PA 1T3ZA 4HXEB 4OM8A 4JVLA 4TKVB 2V5VA 1X14A 3E8SA 4YECA 4DYVA 5AIBA 1P72A 3DJYA 1P4AA 1SY7A 4WD3A 4WNYA 4FBLA 5FV7A 2J3KA 1FFHA 4F5YA 2D5BA 1T0IA 3HUDA 5IDVA 3AETA 4RLQA 2WTEA 3KTAB 4UXHA 3T5MA 1I3KA 1RLIA 5L4NA 1A04A 2OORA 6REQB 2EJVA 2I34A 3W34A 2W9XA 4FKZA 4FYMA 5A1JA 1UBOS 1KZGB 4JYAB 1YUNA 5EIBD 5KNDD 3DQQA 1NMXA 3PENA 4ROTA 5F3WB 4PG8A 3H1BA 2G71A 2HQOA 1Z0UA 4UC0A 1RM5A 2YMMA 5JS7A 1X1TA 4FEGA 3RBXA 4DV1B 4P7GA 4MW7A 3D02A 1U9JA 3GZTB 2JAUA 2OYRA 2EWWA 4BNLA 4WN3A 1EBFA 3X3HA 4TWRA 2P3SA 3P8ZA 4FI3F 5DGXA 1AQNA 4FE4A 3H1EA 3H2SA 3LP5A 4CUJA 2IT1A 5AW2A 4RVCA 3FA2A 1A77A 1MORA 3RSOA 3LTEA 4GZ3A 3HVUA 5KHAA 1QF9A 3IBGA 3DHVA 4LXTA 4OH7A 1SIBE 1RI3A 4FHFA 4UFNA 2O8FB 2GBPA 2V7QA 3RODA 5ADWA 2RB4A 1U8UA 4S2EA 1VJDA 3RVOA 1XVVA 2V4UA 4DQUA 3LKZA 4ZO4A 1Q7RA 2R1VA 1ENZA 1YL5A 2XOKA 4G8DA 1KARA 1L7PA 1EMDA 4JKOA 3PHGA 4KZPA 4ZT5A 4KR0A 4CM3A 2VP4A 1AN0A 4WBNF 4EO4A 1OXSC 2PH3A 5D5PA 4CQLA 2BCJQ 4XEUA 5EESA 1MD9A 1F7VA 1I5OA 1PWZA 2WJWA 4OYLA 1DP4A 1UCFA 2JJ8A 2GBFA 4FPXA 4I99A 3IQWA 4FYVA 3UTCA 1XTKA 1R9JA 2WF7A 2YXBA 4INJA 4IS2A 4X1YB 3KPYA 4F56A 1E0SA 1SHZA 3KEMA 1YE3A 5JNUA 2VXBA 3U1BA 4FU0A 1WXQA 5BMVA 2IF2A 3ZNQA 3CPEA 4C4RA 3H2IA 3JQ8A 2EJBA 2XQJA 2IITA 5CH5A 2NTEA 4LV8B 2NADA 4QBTA 3WSWA 1OI4A 1PFYA 1TLLA 5KNCA 3SVTA 1O96B 2NAFA 2MSDB 3D3JA 1UC8A 3MGCA 1LWOA 3KFXA 1BD4A 3G2LA 4EI8A 1NVVQ 4I1UA 4B3GA 1GZSA 2P68A 4JLKA 3UV3A 3DLAA 2QJWA 4DLTA 1GTJ1 3ND8A 5IYZA 1JHVA 2BFDB 3PC2A 4C2TA 4PM4A 5LQUA 4S05A 5JZVA 2VOJA 1RPZA 3KYDA 1TJNA 2QUKA 1RHMA 1TZMA 1ZN2A 2QYTA 1ODLA 4Q00A 3G2JA 3CNEA 4RMJA 4K3VA 5COQA 4ZJZA 1W94A 3N2IA 4YCDA 3AV0B 4FHEA 1VGQA 2ZJOA 2QRKA 4RJKA 1NPYA 5K0JA 4HEA6 2YBEA 4YQZA 4YVFA 1OAOA 4OQZA 1RXIA 1IRXA 3PT9A 5FYDA 3ZE1B 4B3RB 4HTFB 4K8RB 3KAJA 4Q4HB 1AGXA 2G9RA 2FXIA 2Z4RA 3Q72A 2ZT7A 4XLTA 2ZI4A 3C43A 2J6BA 3H6HA 4MPPA 5EHGA 1RFLA 1I4DD 2XT0A 3QYPA 5E8JA 2JLXA 1LD3A 3QKTA 2CVHA 4L5CA 2RHRA 4R9NA 4HLQB 5F5LA 4TMKA 4U2CA 4E2YA 1SRQA 1GVNB 5LQCA 2VHVA 3CBQA 2BFOA 1FL9A 2W8BA 3GUZA 1EFUA 1GKUB 4L5JA 2C03A 4E3WA 4CEIA 1RQ7A 2E18A 1ZCFA 5J63A 4EB8A 4CEHA 1OH5A 3M9XA 4QUAA 4BFLA 3ZJVA 2QM3A 3UANA 1QCCA 2G40A 1F1JA 3B7PA 1NZDA 3KCQA 3KT3A 4CWAA 4R31A 4PBRA 2RGEA 1Y1SA 4I66A 4UJ5A 1V8BA 2GASA 2IX9A 2P5YA 3LF1A 2QUJA 4ZI7B 1SU4A 3AQIA 5A4AA 1ZW1A 1W30A 2IU4A 1G6OA 4HDAA 1DQPA 5EXSA 1RPAA 2UU9B 1JV2B 3JPYA 4K1LA 4MR8A 5BUQA 2J4CA 3EIHA 5KTYA 2VIIA 4RY0A 1ZVVA 3UWKA 5KQRA 3ED5A 2POQX 4FLMA 4AM8A 4FILA 3AUJB 4KGZA 3E2IA 2Q5CA 4H31A 2H0QA 1MP0A 4Z9FA 5C7OO 3BSFA 4U02A 2FUNB 1WCV1 3ZKWB 2BFNA 1QLWA 2Y1KA 1KOLA 1D3AA 1KPIA 2CDBA 2H1WA 2B5VA 2NU6A 3H9JA 2N3ZA 3HKCB 4CMIB 5K51A 1IXZA 4ENVA 4J9VA 4K9LA 3T1OA 4CFYA 1RWMA 3VC2A 1MO5A 5KX5F 1UKVY 5AKGA 3IP5A 2V9ZA 1MJHA 2AJ8A 1YZTA 2R7MA 4NV0A 5FEMA 1M66A 3TXAA 4EY8A 2HWYA 2QYOA 4C89A 5E3IA 2XB8A 1NMZA 2KLHA 1DCTA 2GN1A 1XKXA 2JARA 1U80A 4GYJA 2A78A 4W7SA 3AVPA 3CY6A 5DM70 2WU8A 4BASA 3HCPA 1JH9A 4MGYR 1IN5A 3ZE9A 3AHGA 1FTSA 2VZ9A 2I1WA 1ZXLA 3L0IB 1W88A 1RYMA 1ZL0A 1Z22A 3KC2A 2RH4A 3QG5A 4V02A 1FX0B 1XK7A 1N9ZA 4C76A 2IK8A 3HR4A 4HDSB 2CW5A 1UM9B 1U98A 1KERA 5AW4A 2ODEA 3CIFA 4DEYA 3GGPA 2OE2A 5DBHX 1KEVA 2CLOB 3SFTA 3R3SA 4AO7A 2P1ZA 1WB5A 1N2SA 2P6UA 5BR7A 2WUVA 5ICGA 1KJ8A 4KAJA 4MB6A 4URZR 3GJZA 1SHUX 5C51B 2QLJA 3E5NA 4NR0A 4LK2A 4RVNA 1CS0A 5E9WA 4LYYA 1GU0A 4HH4A 1A8IA 4AKEA 3ANMA 1HZZA 2XMGA 1MQ8B 2OO5C 4GR9A 4JBGA 5K05A 3R5HA 1V3QE 2GNPA 1ECCA 1PZHA 1P7ZA 2PBZA 3LC2O 3NBYC 4Q21A 1NX6A 1HNNA 3PK0A 1IUPA 2Q49A 4CF5A 1I7DA 1OI7A 1XZPA 1HFKA 3O95A 1DUIA 5LKAA 2WC1A 1AKVA 1YDHA 2G17A 1GPAA 4DC9A 3IIJA 4CCYA 3C98A 3KIPA 4CCSA 1OVGA 1Y80A 5KYWB 4TLMB 1PGQA 1E69A 4F3NA 2O0LA 1CQPA 4MYCA 1G4HA 2C5AA 4DJ5X 5C46F 1XTPA 4MKIA 4CDMA 1E3WA 5HKBA 1IBKB 4PGMA 3QVJA 2WAMA 3SQOA 2QLBA 3O2JA 2AQ8A 4QYSA 1IHXA 3E4CA 5FBRB 3RJ9A 4RD3A 2ZBDA 4OD0A 1QTQA 5GIPE 1Z17A 4RO0A 2ATXA 3PRHA 5EE5B 1UOOA 3N5KA 2R6JA 1AGRA 3OJFA 3T4XA 1LLCA 3FGZA 3H8WA 1YS6A 3JQ9A 4BV8A 3UA4A 3WBKA 1SQGA 3U6BA 1VKNA 4ID3A 5FXMA 3W78A 3SZOA 1DUVG 1RQXA 2YHAA 4KX5A 1WSWA 3LUDA 1W2WB 2NXCA 4Z6KA 3IQHX 2OYCA 1RM4A 3L49A 3HA3A 5E6RB 1DU4A 1KPGA 4ZO7A 1IHYA 4R1SA 1GKKA 3F7OA 2EKLA 2EW2A 4YIHA 2BEUA 1KF0A 4QU0A 4CETA 3O1HB 4IX1A 5I01A 1KFBB 1SC9A 2J3LA 3BTVA 2M6SA 2UZ3A 3GEBA 4NVRA 5F73A 1UPTA 4OLFA 5DN6D 2Z8XA 1DEHA 2C97A 3REQB 3ECSA 3Q8KA 2C00A 1CUFA 3ZXXA 1FUUA 2JK1A 3QI2A 3V33A 2LCIA 4IDOA 2AFVA 2JASA 2XLCA 3D3NA 1V5FA 4IDDA 4O29A 2QP4A 3HO1A 1P8JA 4LXYA 4ZVKA 4RA6A 1GILA 1QC5A 2EZ4A 4JOSA 1S3FA 2VK4A 4KLZA 2GJSA 1RJEA 4ON9A 1XDDA 5I7SA 4OFBA 5H4GA 3RDPA 4P2GA 4TS1A 4PTZA 5KHOC 2GPYA 2QMYA 5KPJA 2MMGA 3RVQA 4A2WA 5B3LA 1W93A 4IY1A 3FYDA 4EPYA 3RSFA 3O8DA 2A0KA 3ZDDA 4JJKA 2HMWA 1T2AA 1P74A 2QK4A 3OH8A 3B9QA 4GZMA 1Y8QA 4PS0A 1HL7A 3W8DA 3ZU4A 1FRFS 2C2ZA 1H2BA 2VHWA 4L8LA 1EWYA 1DAMA 4PAGA 4DSTA 1J8QA 5KYYA 1P4HA 2EJWA 2A58A 2QDKA 5B6JA 2AUNA 4FGJA 4OKSA 1C7QA 2EEZA 1W87A 3CPHA 2HDWA 5GTDA 4UFPA 4S0ZA 3FTDA 1WD7A 5EEGA 3T41A 4R4JA 2J46A 1G41A 4PYJA 2AFIA 1HUQA 1U3DA 3WNVA 2BFWA 1Y1LA 2AH5A 4HQ0A 1Z8FA 5D3MB 1FEZA 2Q4DA 4B3TB 4JU9A 2ZRPA 3KM0A 1ZUD1 4M53A 4YRLA 5IVPA 5DISB 4QOJA 2PXHA 5CT4A 2OGTA 5CBPB 2PTGA 3ZEIA 1DG3A 3CWCA 2IZ5A 4XVHA 5LYJA 4OV6B 3RKSA 2D1SA 2I76A 3TSYA 1KYTA 3DT9A 3H05A 5I7RA 2FWJA 3PFWO 4FZ3A 1JT2A 4HFMA 2ZAOA 4HV4A 1AQIA 1OILA 2PUVA 4BFZA 1APBA 1WE2A 2AQKA 1X7GA 4G8BA 5EWLA 4FWTA 1PJZA 5FLEX 1TZJA 4WOKA 1AKMA 1OT5A 3FRHA 3HTXA 2B2NA 1N9KA 1W76A 1THZA 2A1IA 2OORC 2PA3A 5SYNA 3RJMA 1QGZA 1Y8RA 5KZMB 2OUKA 1SOAA 1D4OA 3WO0A 1E2IA 1CV2A 3OU7A 1IZ0A 1KQ3A 2ZITA 3HB1A 1JJVA 4OO3A 4Q1CA 1FVOA 3OHMA 3TFWA 4AF6A 2JEOA 5AKKA 1XUOA 1W4CA 3FNFA 3IILA 5FR1A 3M3DA 3VOSA 4GSYA 3N8GA 1R5NA 2ETXA 3WHPA 2HAEA 1NW9B 4CMCA 1QLJA 5LL6P 1NLFA 1EWQA 4B43A 1WQ1R 4ISCA 4IJMA 5HKKA 2YV5A 3WNZA 4YAOA 3DM9B 1ZGHA 1AKRA 3TAXA 3SC6A 1SUEA 1ZK4A 1NDQA 1KBQA 2PANA 3KHKA 4K7JA 2YW9A 4X92A 5EZ6B 4BTEA 5B36A 1OV6A 2PMBA 1T9GS 5I7OA 2XSZA 2QTFA 2CFIA 3CKLA 4NK4A 3TMAA 3VR2A 5FEUA 1NF3A 2F1JA 3A1SA 3FMOB 4GVPA 1U0NA 2Q1WA 1FB5A 2QENA 3PGLA 2IS6A 2OBMA 1IBSA 5LLSA 5SY4A 4BKUA 2ODNA 1K7CA 1VGRA 4RF4A 4ZGWA 4PSVA 1SUAA 1CB0A 2ADOA 3EX7C 3WLPA 4NICA 5J59A 3UV7A 1S2LA 3RTDA 3FVQA 2ZRMA 1G5IA 4RGVA 4E15A 4G5YA 4ZOLF 3EUWA 2LV8A 1NG1A 1C9DB 3MSCA 5TMBA 1M34B 2WZQA 2G83A 3QUSA 1JAYA 3QLJA 3R41A 4M0KA 4NZ9A 2I71A 4RDHA 3KJFA 3NOXA 4US1R 1WHTB 1M8FA 4L8FA 1IM2A 2PKRA 1FXWA 4AWBA 1NFFA 1BHO1 2GSDA 4RHTA 3O8LA 5JASA 2E4XA 2HSWA 2J8ZA 5C18A 2B9VA 2C92A 1TT7A 4KE6A 3D7RA 3TLGB 4I2VA 1I1NA 2H1CA 2WZCA 4P92A 4BMVA 4YMLA 2VJMA 4ZAFA 3EVEA 4IIHA 1OYOA 4YAWA 1CYEA 1T2EA 1AQYA 2AEMA 3IDSA 1A8SA 3ZLBA 1QIEA 2ESRA 1HDRA 5K3CA 1W8IA 1L9XA 1AUOA 1OAOC 2RG1A 3OPYB 4BUJA 3O4FA 2HHJA 4CQJA 1A5AB 2P9TA 3PQ8A 1TA9A 3ZV7A 1L7OA 1P2TA 2WWRA 4Y30A 1SBIA 3PNLA 1Z5NA 2QQFA 2I4TA 3P9YA 4K6CA 1AO0A 3K0CC 4M83A 3TTUA 5BQ3A 3MVEA 1DT3A 5AW5A 1YJBA 4RKYA 3NIWA 7MDHA 4YGXB 4YDQA 1W46A 3P26A 2RE8A 1BA3A 1S2NA 3UHOA 1G66A 1DAGA 3OZGA 5HXAA 5JJKA 2GARA 2CLMB 3QYAA 5A7GA 4IVRA 3MNFA 1JLMA 2NO1A 1DKRA 1WCIB 1A5TA 3E22B 4LMPA 4PZUA 5IN5A 3ZHZA 1XL0A 3SQXA 1ONBA 2JLAA 1MO3A 2QQ0A 3TDKA 3JYNA 4HCJA 2YYZA 1RRCA 4KPYA 1NXVA 3HJNA 3DLCA 2O7RA 4BY9E 4E11A 1R6VA 2YJ3A 3QVKA 5H3HA 5MN6A 2WAAA 3AEYA 3JRNA 3QMMA 4QXPA 3PQ5A 4BVEA 3QEMA 3R0VA 3RYTC 4C4TA 1BDIA 3W4JA 4AICA 4Z9AA 3B3AA 5IKXA 3BIOA 2XW6A 5DI3B 2ZJBA 4DR5B 4KFSA 5IAAA 5LOVB 3GGDA 3FY4A 3II6X 3NW9A 4MMXB 3RGWS 1Y0BA 1MPTA 5LXTA 4G37A 4NYMQ 1SXPA 5LB4A 1WHSA 2QX4A 4TLLB 1JHOA 5LU9A 2PYZA 1WA5A 2CFTA 3K1ZA 3ZHYA 3U4MA 5AMXA 3OCYA 4W1QA 1XTTA 1E7SA 4QQNA 1E77A 3GAFA 4R51A 1ACMA 5CXSA 5HGJA 3TF5A 4C5CA 4L72A 4WZBE 2J45A 2VAVA 1D4FA 3PA6A 2G5GX 3NTVA 1NBME 3JALB 4NAHA 5D6NA 5JOQA 3ER9A 2ZSEA 3S1LA 1DAIA 1JEDA 3FKQA 1RHJA 2YVQA 4CIYA 4LECA 1CQJB 5P21A 3KKZA 3ZCQA 3GP8A 5CU7A 4NFLA 1JBQA 3DXXA 4R8VA 2WR8A 4CUKA 4JEUA 3O4GA 1T5SA 4C7XA 1T2CA 3ZIAA 1GFZA 4D6YA 3HBJA 2OD9A 2XZDA 3HJHA 1X80B 1WVIA 5CT6A 4ADSG 4D8VA 2ETVA 4UKDA 2IPOA 4EGCB 3EA0A 4G8JA 2FP3A 3TG8A 4NS4A 2YMLA 5JJIA 2ZSFA 2QTGA 3RRFA 3E7FA 3ZI4A 2HNKA 1UAGA 1E4EA 1ZD8A 3MMNA 2BP7A 3VMFA 2P77A 1TC1A 3OCVA 5EMJA 5FQNA 2VF5X 4QGFA 4GECA 2ZE6A 4RADA 4C7VA 1JFTA 9MHTA 4EEXA 2D4HA 1RLOA 1VZ2A 1IEQA 1QQ6A 4OKIA 1A0OA 1N34B 5TY0A 4ESVA 4JP2A 4AJIA 3GLUA 4XWKA 2N1MA 2I8AA 1RKXA 3QY9A 2F1RA 3WLKX 2IUSA 1Q0QA 4MYUA 1MPXA 1RLMA 2OSBA 3P9IA 4AG3A 4N3GA 5JLAA 5BSMA 4DM3A 5C5CA 2D4AA 3BE8A 3GB9A 4UEOA 1J5EB 1T9HA 6GPBA 1EZ4A 2IP4A 4BMOB 1B16A 4EYGA 5FT9A 5T4FA 5BWNA 3M0EA 1UT6A 3DBVO 4N7BA 4OB6A 4TKVA 1DE0A 5K4HA 1KVQA 2QRVB 3QFRA 4F06A 4N3BA 3OFSA 2O0HA 4BLPA 2C4MA 1E2KA 1O94A 2QAJA 2VDVE 3FE2A 3TZKA 3BWMA 2DPHA 1OBCA 1VPVA 2JIQA 4LOAA 5DHRA 1V9LA 4TL6A 1CY0A 4O2RA 4MW1A 3KTAA 1FRNA 3CF2A 5JANA 3CUUA 3PPXA 4MROA 3WLLA 6REQA 3KZOA 3WSTA 2NSYA 3PFGA 3JQ9C 2X0RA 3DL0A 3ELUA 3OPNA 4JYBA 1FTNA 4FEEA 1D4ZA 4GKVA 4XX1A 3N3BC 2ZWIA 5TV2A 5K6AC 1TI7A 3CVJA 4RV4A 1JG7A 1RBZA 4PAMA 4YFYA 1NULA 2BSXA 4D7AA 1FW8A 5KNDA 1N7IA 1ZGZA 2HK8A 2WFMA 5DNYB 5EN4A 2HLNA 4LDNA 2VJQA 3DFMA 4QJ3A 1PK9A 4UHCA 3N28A 4U00A 3JQRA 4HQNA 4E33A 2PKXA 4R1MA 2Y4NA 1QXSA 1KGDA 4V2UA 5JDCA 1JSZA 2Q7XA 2JB9A 3HDVA 4IHJF 1I5EA 4ZGGA 3PTAA 1N0IA 2F48A 3UOWA 4AJLA 1OXTA 1BJRE 3A6DA 4C0WA 5J2TB 4W82A 2O8FA 1RLTA 1CLUA 5HZMA 1MO4A 2BFPA 5HS4A 2PT9A 2YR0A 4KH1A 4L1KA 2X0IA 4NU0A 2ZYHA 1CD5A 3RUHA 2F8SA 4JI0B 2JGRA 3WYDA 3LH5A 2Y0EA 3BUSA 1OBOA 4DV4B 2WKRA 5CLJA 5K3DA 4IF6A 2C4HA 4LMAA 3WYBA 2X4DA 5FX2A 2Z2XA 4FJ2A 1YFKA 2X7XA 3FOWA 1CC1S 5J4LA 2QM8A 4TKZA 4X1YA 5L7YA 3URKA 3C6KA 1JS1X 1LPOA 3DXFA 3T3OA 4B8YA 3DNMA 4DLKA 3OT5A 4FS8A 3OETA 1CUGA 1WL8A 2I33A 4EMSA 4EGAA 1L7EA 2FZVA 3ND6A 2OLEA 1FP1D 1M3SA 2WZBA 4QLOA 1O96A 4HQKA 2JKZA 1XMSA 3ID6C 3L7BA 2BGTA 1LQ2A 1BG6A 1NR5A 2A88A 2WAXA 4OIMA 4B7AA 5BXYA 1BXGB 3FIUA 1GM5A 3GCGA 2QY9A 3DDOA 1BEUB 2BFDA 3RWBA 4R0MA 1TYDE 1FLDA 3QBDA 2OLKA 4TROA 2Q50A 3IDFA 1Y8ZA 4JOCA 3W7VA 1RKQA 1ONSA 3GJRA 3I0NA 1UADA 1XQ6A 1ZZEA 1O97C 2X1MA 3DVQX 2R1TB 3DVRX 2EVWX 3LY7A 4NU5A 4JT4A 2F9FA 2PSEA 3PR2B 4UDYX 5IC5A 2CL0X 2E4ZA 4HTFA 4Q4HA 4RZHA 4XYGA 3SE0A 1SKYE 2OFPA 2QTBA 4KVAA 2V8OA 1QANA 1FS5A 1QCZA 2D1QA 4PQRA 5CP8A 4G36A 1R0ZA 4NJMA 4G0XA 1MDBA 3AF6A 1QCYA 3F71A 3HDYA 1Z6XA 1W2GA 2UV8A 3TQRA 1V3UA 1K97A 4QXRA 1KYVA 4ND7A 1C29B 2HXYA 2YJGA 3GMIA 2CWWA 4O2BB 3P9RA 3MAGA 4ID9A 3GRZA 5TX7A 3ROGA 3W4IA 4ZMRA 3BILA 3T3MB 3BF7A 5EWMA 2OB1A 1E6CA 1ISIA 4YQEA 1RRFA 1F9AA 2YIMA 4E7OA 4XSGA 4EYEA 4NZMA 5THXA 4RH3A 1TMYA 1Q16A 1DAFA 1NSFA 3QUAA 4PG7A 4C29A 3S1SA 4J4BA 1KZ6A 5CX1B 3HXMA 1FDOA 4EJ0A 5FLYA 4ZI7A 4Q9IA 1PNRA 2DUWA 3ENKA 1JILA 4MB2A 3V7FA 5IBCA 1LGYA 3E3NA 1YUMA 1N2XA 2IZ1A 2J9YB 3N0TA 2IPMA 2KS6A 4E5VA 2FFAA 2BR4A 1OTHA 3UAYA 1WABA 2ONYA 3MG9A 2CZGA 2JVKA 4IDEA 2JNWA 4TTJA 5EJ9A 1TAUA 1IWBB 1T9DA 4TZTA 2BTEA 3LS2A 4Q1BA 2HV9A 3TW8B 3WWPA 4FE3A 3W2EA 4BKQA 1FFEA 1MAHA 1GRRA 1HDYA 2X8LA 3ZKWA 4P31A 4IVPA 2WLTA 3C1UA 2O5RA 1YRHA 4L28A 1T9ZA 4W1SA 4WJZA 5D1NA 5ER6A 2IS2A 1D09A 3HKCA 4CMIA 4Y2QA 3QEAZ 3C3AA 3C3CA 1YNOA 1OZAA 4BRUA 1J39A 4LV6A 3QV1A 1Q91A 3NTLA 1SRRA 3LT1A 4J43A 3SC2A 4FDLA 4YRZA 3ASZA 2VWHA 3PDWA 4YCMA 1QZ3A 2A5YB 2J08A 3NC4A 3PQDA 1RKBA 1ORDA 3KSZO 1AE1A 4KXQA 3KLBA 2P75A 5KWIA 1WUJS 3W4KA 4Y3UA 2G1UA 3FNEA 1E3TA 4NS1A 2RAVA 4BZQA 2JGIA 5DHAA 3FD8A 1D8AA 3CH5A 3VYTB 3R0ZA 2YXNA 3USZA 2HN9A 3DAPA 4HUTA 1FX0A 1HT3A 3BK1A 4P98A 4UD6A 1U3FA 2B8NA 3AUSA 4UQLA 1QRTA 2WNIA 2Y0PA 3PVCA 3Q7TA 4HDSA 1UM9A 2AFHE 4L6CA 4PAOA 3D8TA 1KAHA 4QBHA 1EGMB 2VTBA 2ZVJA 2QTVB 2BZSA 2GT1A 1A5SB 5DYGA 4AFNA 4FOOA 4QL3A 3HC7A 3STTA 3ZJTA 5D00A 4WCFB 1FF9A 2E3JA 1B2LA 1DKNA 3FETA 3G7SA 1JKIA 5DBGA 4D9CA 2NTNA 4E51A 3CYFA 3L04A 5I47A 2PM8A 4FUQA 4EY3A 3EIQA 1B26A 3GEHA 1SB9A 2JCBA 3LYLA 4U2EA 4C2UA 1IATA 1YC2A 2GWRA 2NO5A 3QFSA 3NP9A 3VH3A 2IC5A 5HF5A 1ZHOA 1PBNA 4B6SA 3ZWMA 4OI4A 3PGXA 4MAAA 5I9MA 4F72A 2IPXA 4KRFA 4UNRA 1NQWA 3HK2A 2A1TR 4KXMA 1MA0A 1P9OA 3E7XA 1V6CA 3EVBA 2VPZA 3TIIA 4ZALA 5KYWA 4PGFA 4YJGB 3RREA 1OU4A 4GMDA 4NF2A 1RMQA 2G36A 4EGSA 5AW9A 2ZB2A 3GIDA 2O3TA 2QD3A 2KYRA 5JXWA 1P2UA 4HAWA 4BUCA 2DQKA 1XVTA 3KELA 3TNYA 4R5HA 1G19A 4IOLA 5ECWA 4AUKA 1FS6A 2PKCA 1W5FA 3L6BA 4KFTA 3VYRB 2RD2A 2GN0A 3W90A 4MEBA 3M6UA 3NVDA 1RFGE 4DEVA 1VLMA 1ZIYA 4JJGA 4ND8B 2VTEA 3OZDA 3GGCA 1Q17A 3K9HA 4NCIA 3TEMA 4LPKA 2ZBVA 1Q44A 4UU8A 3TJMA 3ML1A 3ZR4B 1YK0A 4X3PA 1WXDA 1EZ1A 4EW1A 5E6RA 4JYZA 3BC1A 4QWMA 4UTVA 2F00A 3L7DA 3UJNA 4X93A 3K53A 4QTTB 3RFCA 3FWZA 1O58A 1VLZA 4FKBA 3RSCA 3TBKA 5BUZA 1WETA 3RRJA 1S3IA 2OO3A 2WYHA 2FNAA 3TZQA 3VC1A 3REQA 1FE8A 2HXSA 2IOHA 2W6ZA 4E4YA 1WNTA 4KXNA 5L8VA 1FSPA 5FHRA 2FZEA 3O8BA 1P18A 5DN6A 4G1UC 4CPDA 2FV8A 1HE2A 4IKOA 4IV8A 4K0RA 4M0UA 3WP0A 3EPLA 4XUGB 2LPMA 3DZGA 1TIKA 1YD7A 4MRVA 2BIFA 2XB9A 5BYJA 4BMDA 5BPFA 5I9IA 2WG1A 3AFOA 4DR6B 1XCPA 1ZKDA 4NMMA 3IKLA 4HGZA 4HPXB 4BNUA 2CXUA 2VBIA 2Z9BA 3RS9A 4EARA 1OB2A 1H2YA 1K27A 2C7BA 2J9FB 4YMHA 3THWB 3AH8A 3W5UA 4QQFA 3CW9A 4XWTA 1JB9A 3KHTA 4FHGA 5EE0A 2E6KA 2IYZA 3SICE 3DFKA 4R41A 1VXRA 2PZAA 1VE9A 3CPSA 4J9UE 4KXFB 4O4LF 4B46A 2B9EA 4ES6A 2Z5VA 4I4TB 5KSZA 2GVNA 1V71A 1XROA 5L3ZA 4LIPD 3T5DA 3OHSX 3W6ZA 1HKUA 1P75A 4TXMA 2NPFA 4URVR 1J5PA 4NFYA 4J0KA 2PV0A 2Y0BA 4FFVA 1QBKC 3IQGX 4JB2A 1AA9A 4EF5A 4ZRNA 2DE0X 4IV5A 4PIPA 4H7HA 3VU9B 3WAKA 3ZJ5A 1QGYA 4ZT6A 2HA5A 5FTKA 2HHAA 2UZ1A 2EQ5A 3Q3JB 3F90A 5D3MA 1FUIA 1N6OA 4UBLA 3CVYA 4FX2A 1B2RA 1JVSA 3PVSA 4A3SA 4GYKA 2WJJA 5LCXA 5JFTA 2PMEA 1E59A 1TM7E 2D13A 5CBPA 3JAMA 1TKRA 3HY4A 4UTZA 1M7BA 5KB3A 3V4FA 1LNSA 1QDUA 4GNRA 3H7IA 4RHCA 3ZQ6A 3ZXYA 4Y67A 5LZ8A 3OTHA 5K5EA 1Y9DA 3D7LA 5DJ5A 1L5VA 3C3DA 1DAPA 1ODCA 4FWIB 1U9YA 5D3ZA 1PK7A 3BAFA 1ECGA 3WQHA 1V8OA 2PL5A 5EHQA 5HZKA 4HR7A 2HCBA 1UXIA 2XCQA 2CJYA 2ZWMA 4JLJA 4AIRA 3DMGA 5EUCA 4R0VA 1RADA 3VGJA 2FKNA 4JJIA 4XWYA 5LD2B 4FK8A 4D8YA 5LZ5A 4QJBA 1TGVA 2P69A 2SBTA 2X77A 821PA 3NOQA 1WZUA 3FBTA 3PNBA 2QUZA 4P6VF 5EIBC 4QEZA 1SBYA 3RFUA 2AJBA 3IAUA 1X87A 3MJFA 4HTAA 3UGQA 2GJAA 5JADA 4RM3A 2KSQA 3GD5A 5FWDA 4B7UA 3KOMA 3J80A 3BN3A 4DQXA 4JODA 3ZE8A 5FYQA 2B1RA 2H48A 4CNBA 4MTLA 2C84A 5JDCC 3KUXA 2R47A 1NHGA 4YREA 1IHPA 2A5FA 5GZ6A 4ZYUA 4YJKA 2AA3A 1XAIA 2G5TA 3O7MA 3KSRA 4D9BA 2E89A 1E8NA 4R8MA 3WJAA 1DVRA 4YMSA 3R7DA 5A0FA 1BMDA 2XADA 4ETMA 1OW3B 2ADMA 4KQCA 4HAZA 2XMSA 4UDXX 1TL7C 2CLEB 2DF8A 1TKAA 2IYWA 3ESCA 5IXYA 3CHYA 3EQ7A 1GZDA 3ENVA 1KMNA 3DOCA 3HGMA 4UQPA 3TK1A 5DIZA 2VYND 3CV3A 2HPZA 1P7WA 1P7VA 1I2ZA 5DNCA 4XE5A 2IZ0A 5ITVA 3NZEA 4J29A 2VJDA 1F1BA 1H1TA 3WB2A 3HZRA 1PSDA 3V1KA 2Q6VA 1YBVA 2KLBA 3IJ5A 3NHSA 4NBWA 4V3BA 4DZRA 2X15A 1W75A 1R4NB 2PA0A 3W6UA 1M34A 3UGKA 3VO9A 2GUGA 3EVFA 4I1SA 4QBIA 3GT0A 4QDZA 1TU0A 2PIDA 3DAYA 3RBAA 1G2OA 3OF5A 1MT0A 2ZYIA 4FFDA 8AT1A 4F86A 1WHTA 3AKEA 4YAIA 2ISCA 4E32A 1E9FA 2JVIA 3KUDA 3K0KA 2CNKA 5E9JA 3F97A 4HMOA 5BQPA 1VBMA 2PUEA 5KTNA 3DZIA 4ZVOA 3G0BA 1BW9B 1T8TA 1TCCA 1N6NA 2JL1A 5LB2A 3TLGA 9ATCA 4KAXA 4A7PA 1S3SA 3O4IA 3WK9A 4AAYA 1K8YB 4FC6A 4RX1A 4ZVSA 1GDTA 2IW3A 2ZP1A 1ND6A 2QL5A 3DD1A 4RYDA 4ZWNA 3BA1A 4G65A 1NFQA 3E2PA 1TW3A 2H11A 3PU6A 1ABFA 1OTYA 4M7WA 2B30A 3OPYA 3ZK9A 5HIKA 1JQKA 1WXGA 3M6LA 5IF3A 2JG3A 3O1JC 1JZSA 4YUWA 4M9UA 4EIWA 3KKKA 4I55F 3U4QB 1SUFA 1XLTA 4EAAA 3WHLA 3D4IA 3I3SR 4UU0A 2ZU0C 2O59A 1WPRA 2PBFA 3USCS 1YQEA 1BX3A 3WGGA 1D2EA 1GZ5A 4URFA 4QZVA 4JC8A 3C45A 3QVTA 2AI3A 2VYVD 1YR9A 1ZIPA 1ZEJA 3MJCA 2QRQA