1MAUA

Crystal structure of tryptophanyl-trna synthetase complexed with atp and tryptophanamide in a pre-transition state conformation
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
328
structure length
328
Chain Sequence
MKTIFSGIQPSGVITIGNYIGALRQFVELQHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYLAVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFKEKSAGKEAVSAGLLTYPPLMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGELFTIPEARIPKVGARIMSLVDPTKKMSKSDPNPKAYITLLDDAKTIEKKIKSAVTDSEGTIRYDKEAKPGISNLLNIYSTLSGQSIEELERQYEGKGYGVFKADLAQVVIETLRPIQERYHHWMESEELDRVLDEGAEKANRVASEMVRKMEQAMGLGRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords tryptophan-tRNA ligase
publication title Interconversion of ATP binding and conformational free energies by tryptophanyl-tRNA synthetase: structures of ATP bound to open and closed, pre-transition-state conformations.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 121
structure length 328
sequence length 328
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2002-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1mauA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1mauA01
1GLNA 3QE4A 1H3FA 3SZ3A 4YP6A 1VBKA 2DLCX 3H99A 4GRIA 1J21A 1EUYA 1U7XA 5DEOA 4MAFA 2RE8A 2VTBB 5AHWA 1IHOA 2JA2A 3CLTC 4K0RA 1PFUA 4KR9A 3CVVA 4PBRA 1T6XA 2GM3A 5FO0A 3CLRD 3NBAA 2Z09A 4FZJA 3NBKA 1BS2A 1H3NA 1XNGA 1U0BB 1VBNA 2E18A 4KPUA 1KQOA 5DASA 4BWVA 3N2YA 4JYZA 2A1TS 4J75A 4MW4A 1J70A 4P2BA 4ZCSA 5DB4A 2JAXA 1XNHA 4NDAA 3ELBA 2BTEA 3DO8A 5TS2A 3A2KA 1R6UA 1N2JA 2NSYA 2QUHA 3KT0A 1LI7A 4MUGA 1GAXA 2GKSA 3IOEA 4DNXA 2Z3VA 1NUQA 3P52A 4OJMX 1KQPA 4ZT5A 3H9CA 3VU8A 3IODA 1JGTA 1ZJWA 2ZUFA 1JIJA 4HK4A 2H29A 3SEZA 4OUDA 1G8FA 2IELA 2A7XA 2VXOA 2A1UA 3FG9A 3Q12A 1QU3A 3TZEA 3TQOA 3IMGA 1YIAA 3CLUC 1I6LA 2HGZA 1N3LA 1N2GA 4I6GA 3PNVA 2WQ6A 1T9GS 3G59A 1WJGA 2J4DA 3FI0A 1O95D 1QRTA 1XNJA 3Q4GA 3SZGA 1JZQA 5J58A 1K92A 1O96A 5IHXA 1K4MA 3OTWA 4G5FA 1UFVA 3FH0A 4G5YA 4JZYA 2QTMA 2X3FA 3KFLA 4MWDA 4QBTA 3P0HA 4ZCTA 1M83A 4EGAA 1VLHA 3A4IA 1OWLA 1JMVA 1LI5A 3AG5A 3RHSA 2HMAA 1KH2A 3ZIUA 3FHJA 4J76A 1H3EA 1N2HA 1WXIA 3U1VA 3HL4A 1M8JA 4MVXA 1N2IA 4L2IB 4JXZA 2QJOA 1MB9A 1NP7A 1WKBA 5HUHA 4NATA 1QQTA 1XJQA 1KR2A 5KHAA 4EF6A 4EG5A 3DLAA 3COWA 2VTBA 3ZJUA 4HJRA 5LLTA 1TFUA 2QJFA 1O97D 1O0CA 2PZAA 3ND7A 3COVA 1Q19A 1QJCA 3AFHA 1O94D 2AG6A 1EE1A 1EXDA 2A4MA 1NZJA 1YI8A 3CLTD 3PNYA 1V8FA 3VRHA 3X1MA 3P0JA 2J08A 1Q15A 3S3TA 2CT8A 2B7LA 1N78A 4MW1A 4MW5A 3E27A 4EG8A 2A86A 1TYCA 1GZUA 3TS1A 1MRZA 1QTQA 1EJ2A 1WQ3A 5HUJA 2YWBA 3PNBA 2QUKA 3PXUA 5KCMA 1J1ZA 3CLSC 3N9IA 2DR2A 3PRHA 1NYLA 3N8HA 5FNZA 1GN8A 3IOCA 2CV1A 2V0GA 2PZBA 4ZT6A 3A05A 3JXEA 5J5AA 3RK1A 1ZH0A 4R2MA 2G36A 1M1ZA 1TYBE 4K03A 3KT8A 2QTNA 3FNRA 2XRYA 3TQIA 1NUUA 1V47A 1G59A 1OWOA 5LM3A 2HZ7A 3CR8A 1M8PA 3IUBA 2ZUEA 1OWNA 1WXFA 1T9GR 4MUNA 2CFOA 3CA8A 3IH5A 4R2LA 1EFPB 3FOCA 2J5BA 1R6TA 4GU5A 4A91A 1TYDE 1U3CA 4WNYA 1ZH6A 2CV2A 1QRUA 2H2AA 4PBSA 1JILA 3QTTA 1Q11A 2WSIA 3LE8A 2DUMA 3FIUA 1MOPA 4WSOA 5EKDA 3SYTA 2E0IA 4L2IA 3CVWA 4CT0A 1N75A 3IVXA 1NUTA 2O5RA 4EG4A 4EG3A 1MAWA 2NZ2A 1JHDA 1K97A 2D13A 2Z08A 2OQ2A 3ZGZA 1WQ4A 1YUMA 1N2EA 4G6ZA 4U63A 2AZXA 3ISJA 1N77A 3UMVA 1M8GA 4MQ6A 4MUIA 3UC5A 1GTSA 2WB2A 1EFVB 1MC1A 4UZFA 3FETA 1R6XA 2E21A 1IQ0A 4YMIA 1J09A 1WOYA 1KQNA 1A8HA 1KORA 3NV7A 1G8HA 3ZXSA 3K32A 2I1LA 1OWPA 4KR6A 1I2DA 4MWEA 1SURA 2GOYA 3CVXA 3RJZA 1Y42X 4ZCQA 4XFJA 1YUNA 3CLRC 4MVWA 3INNA 4AQ7A 3AG6A 1JIKA 1KAMA 2D5BA 4XFDA 1O5TA 3K9WA 3IMCA 4MW9A 4UZEA 2X1MA 1PFVA 3AKZA 3IOBA 1FFYA 5FO1A 1WY5A 4MUFA 4TS1A 1RQGA 4F4HA 4MUHA 3ND6A 3H97A 2PIDA 3P0IA 4RUKA 4QREA 3DPIA 2TS1A 4NZPA 4KPUB 2JANA 4E1AA 4EG7A 1F7VA 4AS1A 3TZLA 4DE5A 1G8GA 1F4LA 2QTRA 4ZCRA 1EUQA 2DETA 2PZ8A 3X1KA 1S4MA 4NAHA 1YULA 3COYA 1U7DA 4RPIA 1GTRA 4MW0A 4MVCA 3IDFA 3BL5A 4MWCA 2QUJA 4OUDB 1J1UA 2C5SA 1KP3A 2D54A 2EJCA 4EG1A 1JECA 4PBTA 4ZT2A 3RFFA 1KP2A 3IVCA 1H1TA 3H05A 4CDNA 1JIIA 2CUZA 2O8VA 1JEDA 3GMIA 3AL0C 4ARIA 3ILVA 3MLBA 4QRDA 3F3MA 2CYCA 1MJHA 3ZJTA 2YXNA 1N2BA 4MUKA 3I05A 1IH8A 4DDHA 1IQUA 4MVYA 4ZT7A 2WQ7A 3CVUA 4X0EA 4DDKA 3TNJA 1JZSA 1EFVA 2V0CA 3UOWA 4H3SA 4KKVA 3CLUD 4ZCPA 3ZJVA 4MW2A 1MBZA 2EL7A 2CSXA 1NSYA 1O97C 5IJXA 5J59A 3X1JA 4JXXA 1IVSA 1KAQA 1O94C 4NAUA 3LCJA 1LW7A 3FWKA 2OV4A 1NUPA 3H9BA 1N1DA 4CQNA 4HPWA 5DK4A 1TYAE 4YP5A 3UY4A 2J07A 3UK2A 5BNZA 4ND6A 3L93A 4DJAA 2A84A 1O0BA 1Q77A 4CDMA 3AIIA 2IP1A 3MMXA 3SEQA 1IFXA 2YWCA 1OWMA 1KKUA 1OD6A 3G5AA 3KT3A 1OBCA 2DXIA 2QUIA 1PFWA 1FYDA 5H7XA 4S1OA 3MXTA 3FDXA 1ILEA 1MB2A 2A88A 3FY4A 1I6KA 1ULHA 1PG2A 3VGJA 4ZT4A 4DDMA 3MLAA 2J09A 4MUJA 4Q16A 4MW7A 4ARCA 3D6VA 1IRXA 4F3RA 3HZRA 1I6MA 3N05A 1IQRA 5TEWA 4U7JA 1B6TA 1COZA 1TEZA 1K4KA 1PFYA 5TEVA 4U8HA 3HFJA 3SDBA 5F23A 4YP7A 1VL2A 3OP1A 2CYBA 2PFSA 1MAUA 2PXHA 3ZUGA 5HG0A 1PG0A 1GPMA 3KT6A 1M8FA 1ZUNA 3CLSD 4ND7A 3DV2A 2YY5A 3HMQA 4KR7A 3IMEA 2QJTA 3QTBA 4PY2A 2CYAA 1WXHA 3D6UA 3MUEA 1KH3A 2IJGX 5TGTA 3A04A 3RK0A 4DLPA 1WZ2A 3IUEA 1M8KA 2X1LA 1O6BA 1T6YA 3G6KA 2XRZA 4NX2A 1YIDA 1NUSA 4YBRA 2CV0A 3Q10A 1QNFA 1EFPA 3CVYA 1TQ8A 1CT9A 3SP1A 2BYTA 1J20A 2DEUA 1DNPA 3L92A 2ZP1A 5KWVA 2DPLA 1O95C 4EFKA 4JFAA 1WXGA 1N2OA 2R5WA 2X0KA 2A1UB 3LOQA 1U3DA 4MW6A 3COZA 3GUZA 1X8XA 3M5WA 1QRSA 4I6JA 4MULA 4MUEA 1QU2A 5H16A 3GLVA 5LFAA 1T6ZA 3HV0A 1O96B 1NURA 4R0NA 2PG3A 3IVGA 5K0SA 3HGMA 1OBHA 1KH1A 1P7PA 5JBNA 4MWBA 4HJXA 4MLPA 2AKEA 5K0TA 1D2RA 2RD2A 4Q93A 1F9AA 3ND5A 1JEEA 3C8ZA 2A1TR 4EG6A 3ZXIA 4ZT3A 2DERA 1X6VA 1NI5A 2E89A 1F7UA 1WXEA 4XSVA 1VBMA 4I6EA 3RBAA 1HYBA
chains in the Genus database with same CATH superfamily
3H9QA 4K3UA 3QE4A 3CPHA 4GRIA 1SCUA 4XFKA 1O87A 3U4HA 5AJZA 4UE6A 4ER0A 3MTIA 3A37A 4DDWA 5C80A 4CV2A 4WBNB 5J3JA 3U6KA 3FHCB 2P5UA 5E2BA 1RXWA 1EX1A 1BE8A 1GTZA 1IHOA 1EAMA 1TNDA 1U7WA 2DOKA 3BAFA 3L4EA 4G8CA 3CLTC 4K0RA 4O4LB 4Q7EA 3TK1A 5TMBA 3LNCA 3R0QA 3N2KB 3UENA 1HDRA 4D97A 5FT9A 4DT1B 1GXSA 2EATA 3INGA 1L9KA 5FO0A 1JU9A 1PDWA 3QYAA 5J63A 2Z1DA 2IZ5A 3ES9A 1UXHA 2A33A 4HWOA 3HP7A 3QLVA 5DASA 4KDFA 2I7CA 2QRKA 4LY6A 2WHRA 3ONWA 4CMIA 4DIFA 3OJCA 1K6EA 2ZIFA 4R1PA 4Z3DA 4JYZA 1UC8A 3BT7A 1PLLA 4JQSA 4QNMA 3WIVA 1JJIA 2AQHA 1GNRA 2ZYTX 4RSRA 4BQNA 1XDGA 2VH1A 2GAJA 1V39A 2FVYA 5CCDA 5DLPA 5T6BA 5C1DA 3VR2A 3PICA 1KEZA 5BYAA 3K9NA 4YJKA 1Y8AA 3OFKA 2VYNA 2ZTMA 5DCLA 3PVZA 2VAXA 3U62A 1G4HA 1VHQA 3P52A 2OHIA 3KHKA 3WX0A 3T3GA 1BE1A 1DC8A 2BKUA 3RSCA 1OLSB 3QRWA 4QRIA 4M36A 3A14A 3AF3A 4FEEA 1QQ7A 1Y5LA 2VXOA 5AKIA 1K0FA 1G19A 3A32A 3AQ4A 4QHYA 3A1TA 2XI4A 1UC4B 1AF4A 1SD5A 2QOEA 2XV1A 1PD1A 3IVMA 3WZMA 3E9QA 3WSWA 3OLVA 2OQIA 1W7AA 4ZYYA 3HO6A 5I5GA 1U7HA 1SVIA 1HNXB 3Q7IA 1DIRA 2NW6A 2R8OA 1DOZA 4QJBA 3EPKA 3OIDA 5K03A 1TM4E 3CR3C 1P6QA 5D5HA 5KSOA 2EZTA 4CQMA 1ULTA 4G85A 2B4RO 1EIZA 3QWBA 4CGZA 3DD5A 1K5PA 4L5AA 3HJNA 3WHPA 5IHXA 3OZGA 5AW0A 2W2NA 4R5HA 2BFAA 4MLZA 4EO7A 1DAHA 4ETWA 4EI8A 3W5SA 2C0PA 4WT7A 5DNDA 3U48A 3KFLA 1I24A 2ODWA 5CW2A 5LQSA 3S8YA 1JPNA 3KX2A 4RW0A 1N3BA 3K2QA 2AJDA 4LVNA 2V9PA 4JB0A 1LEHA 1E5XA 2P75A 1LTHR 4F46A 3QUCA 4G5XA 5DE3A 1AHIA 2WMYA 1J2UA 4MRSA 4B7AA 3EMDA 4BNFA 3OPNA 3I76A 2Q5HA 4KIUA 4WESA 1FNNA 3N39C 3AUAA 1RIFA 3PPYA 4OVKA 2YWRA 3VPHA 2GF0A 1WKBA 1LPAB 3CWZA 3M4YA 3HBNA 1RI5A 2GYWA 4QAQA 1I3MA 2YHIA 3PNSA 3JQGB 4BQSA 4KIWA 2VTBA 3WRXC 3ZBUA 2R47A 3CIFA 3DBLA 3GT7A 1KJNA 3NHPA 2Y2VA 3TDKA 3UT6A 3VI3B 1BDIA 5AVYA 2UVQA 3RSGA 2QGFA 4I5FA 4JB2A 4O4JB 3GLIA 2BOVA 3PFIA 3JR3A 4U7FA 1E1YA 1XZAA 2PUCA 2QUZA 3M33A 4E07A 1T9CA 2JGKA 2PSHA 5KI6A 5C81A 1RWBA 2Y2UA 2Z8XA 4UBLA 3GLIE 2O2EA 4E03A 2FWBA 3L84A 4TS4A 2SBTA 3ZD8A 5AFSA 3X0DA 5H59A 4DDUA 2WHXA 1CB0A 1SK8A 3O4HA 3S28A 8OHMA 2Y1LA 4AG5A 5HOEA 1YA4A 2WBLC 2GYYA 2ZTLA 4I4TB 1L5GB 2VT3A 1T5DX 3WWCA 4BO8A 2PMCA 2P2GA 1DRVA 1ZMOA 2J5KA 1B0PA 3I2YX 4P9NA 2FR8C 3O82A 4M38A 4AUNA 2JLXA 4UU7A 1XRQA 1N6OA 2XUKA 1W48A 3JASA 1Y7TA 2QUKA 2JEYA 1KQGA 1ZNXA 2Q6IA 4WTOA 2N9UA 2OVBA 3JQPA 4B3HA 1TIPA 2WZDA 3DDUA 3W6UA 3ZJ4A 3VSBA 1GN8A 2IRWA 3S2IA 1UKBA 3WLRA 1N5KA 5AVWA 3EYAA 1GNLA 4IHJF 4L74A 1MT0A 2QMUA 1J99A 3A05A 3HBFA 1G5FA 1GYQA 2XHEA 1GQFA 3JVVA 4L8VA 4AL4A 4YMHA 2ZU6A 4V0RA 2YNMC 4B31A 5F3WB 5ALKA 1MEOA 1L1QA 4HMQA 4LJYA 5JHGB 2W6NA 5T4HA 2AMJA 2DFPA 3NO4A 4PR0A 4N48A 4AQDA 2EVWX 2FLWA 3SNHA 2VO1A 1AD2A 4I2VA 4UHEA 2ZUTA 2VAWA 5K3AA 4DL9A 1U2QA 2BUCA 3DTTA 1SUFA 2JFZA 2C5AA 2I55A 1T9ZA 2GCOB 4YXFA 1TU3A 1Z7WA 4B2LA 2FX2A 4LX8A 2YWGA 2F6RA 1M2KA 3ELUA 3QOYA 2ECKA 4K9PA 1PE0A 2FHPA 2Y71A 4MIEA 1GQOA 3RG2A 2AD5A 2W6MA 4CM5A 1H0RA 2F8SA 1Q1EA 2Q27A 3ECCA 4BAGA 4F97A 2AUMA 1YJAA 2XX3A 4NOKA 2FQWA 2JGJA 1M1YB 1BFKA 3QTTA 1MF7A 1P2DA 3DULA 4IMJB 1DSSG 2WZCA 4E0BA 3OICA 1I14A 3FGOA 4YX9A 1FMFA 3DAOA 4W9NA 4O5OA 1JYEA 2NUAB 5LDGA 1M3SA 1QFZA 2VDJA 1YJQA 3A0RB 4X1IA 3AR2A 2B3TA 3P2MA 4XCXA 2Y77A 1ZISA 1ETUA 2PUVA 3FMFA 3PWKA 4KGVA 1ESMA 3UKDA 3ZWDA 5K5EA 3ZE6A 4RA9A 2K5UA 5CVJA 3W8EA 4E2FA 1G0NA 2EWVA 2LW7A 4R1QA 4EVIA 5DNWA 3W9SA 1E3LA 3D8TA 4G0XA 1P0PA 2AR9A 3PHBE 3RYIA 3UPUA 1XKTA 1I94B 1XMOB 4H15A 3L7AA 4BQEA 4D4GA 4N18A 2BH9A 1ZU5A 3KO8A 2QAGB 2Q5JA 3BMXA 4MUIA 2BRUC 2O19A 5TVGA 2C1EA 3QU5A 1NJ1A 5TPZA 5I48A 4EMSA 4FUQA 3WGIA 3QITA 4N9WA 1UK6A 5CFRA 3DOOA 2JBWA 3QI2A 1GAEO 4NV3A 2GARA 5KMGB 1KO5A 1O6FA 1Q50A 4MQBA 3FNIA 2IOYA 3BE4A 1L1RA 1OZAA 4G4SO 4XUEA 1YD7A 5CG2A 3CVXA 1R0ZA 3EULA 1P4HA 5K01A 1EWTA 3EEBA 5AW1A 3BA6A 3LQFA 2Q3LA 2JLVA 1DU4A 3KQKA 4FJ2A 4AS3A 1LTQA 1KAMA 4FLFA 5BSTA 3U9LA 1M34B 4MW9A 3WTCA 4IIBA 4S0XA 5A0VA 1NDQA 2XYPA 3LQKA 3NH9A 1KSGA 3ANXA 1QCDA 3D3EA 1CRPA 1ZICA 2OA0A 3GPDG 5K3EA 2C9CA 4HWKA 5GONF 1ABEA 4IIDA 3AWIA 4OFXA 2TS1A 1OCEA 3OESA 2JANA 4BX0A 1KJ9A 2R6CA 4L9WA 5IT4A 3HDHA 4NFHA 4QYIA 1G8GA 3JTMA 3UGTA 2JLZA 5IAEA 3G88A 4PTLA 2Z8YM 4FZRA 1GNVA 1O3YA 2QTRA 3L77A 2VL7A 4NNOA 4ZAYA 4AZ0B 4EJMA 2JF0A 1OHHD 1ZSVA 4ZCRA 2BFNA 5HIKA 1FW6A 1KK1A 1J1IA 1I4LD 4OAQA 5FNVF 5BN4B 4Y7CA 4BLPA 1Q1ZA 5FJJA 3O47A 3QNMA 2QA5A 1DEAA 5SV2A 2B37A 1PSWA 1HYQA 3BFJA 2W9XA 4B74A 3KZVA 4X97A 2JARA 3B1YA 1YQDA 4JROA 3OEYA 5HA5A 2UVPB 3ZHBA 5B5SA 6Q21A 1KYXA 1WRBA 1K5DA 2QUJA 3OZSA 5CLIA 1CUBA 4RPKA 4N82A 3L1IA 5CRIA 1F8UA 3RGWS 3LDUA 3NFRA 1WXXA 3LKDA 1I13A 5TDHA 3RIEA 2EBWA 2NQTA 4LY9A 2HRCA 5IHPA 2O8VA 4MWZA 4BGEA 2G0TA 2JH3A 3ZS8A 4ZDIA 5ITVA 3HUFA 1AY0A 4BZQA 4F21A 2GNAA 1XKLA 4JYCA 5ALGA 3T3HA 3OURA 1WABA 4R1NA 3U3DA 2PSSA 3S2GA 1SULA 4I8DA 5EGSA 1QO9A 4LRYA 2NO1A 5EMJA 3CZMA 1JHZA 4X66B 2JLRA 5KB3A 1IY8A 1QK3A 1C2TA 2HDHA 3LZCA 3IIKA 4MIOA 4W5HA 4Y1EA 1PQWA 5JDIA 4DEXA 5IYZB 3HKBA 3AF4A 3GDHA 1OFUA 3LNTA 4ZT7A 1GN9A 3M4NA 2DBRA 3PBKA 4BRSA 4OXNA 2WFMA 4ZDKA 2A0FA 4P1ZA 4IJQA 1YKSA 4P7GA 4Q7KA 2C42A 2EX4A 3FI9A 2A30A 3ZHTA 4UFNA 3SFVA 3UA4A 5E3IA 4D6PA 1IRIA 4W8GA 2IHVA 5A5GA 1SUSA 1H2YA 4O4IA 5P21A 3OOHA 1UT8A 1VLMA 2VWQA 3LCMA 2RBEA 3O73A 4YVFA 1XJWA 3IHTA 1PJLA 1SUDA 5K6RA 1IJBA 2OV4A 2XPCA 3LT1A 2X23A 3WNQA 1Y4SA 1Q0UA 4M1QA 3H9BA 2J0EA 4CR8A 2HBYA 4ER7A 4JQZA 4GX1A 4LOHA 2V45A 4Q4LA 3USCS 2DT5A 4TYQA 3QW4B 2IIBA 5D3MB 1X7YB 4YJGA 2YDXA 2ID8A 3K53A 4LJ6A 4ARVA 4CKBB 2IYEA 1HQCA 4NYJQ 1KNQA 1S2DA 3ZCUA 2YV3A 3UXMA 3EODA 3UQYS 1QVAA 3PHGA 4OFWA 2QVCA 3VVMA 2MHCA 3L7IA 4GOMD 1V43A 2I34A 1V5WA 2D1SA 4GM4A 5FPPA 5KVAA 3JYHA 4D3YA 1VSQA 1FUYB 4IIUA 3U4IA 5KEIA 1C7FA 4A8JB 1X19A 1XFAA 4C21A 5AUNB 1P62B 3V1NA 4BFLA 2WIJA 5E6SB 3TEFA 2XCOA 2AL7A 4OXIA 2GN2A 1KPIA 2BKVA 2A88A 4FS8A 5EIHA 4L4RA 1SVWA 2Z5GA 1OLUB 2OV3A 1Y9ZA 4DIEA 1ODIA 3ZE7A 1XAIA 1HPLA 4BP3A 2J09A 4B9EA 5BQ3A 3R9XB 3DL7A 3KVRA 3DTVA 3IJEB 2CVHA 3MG9A 1M2HA 5ALJA 2HTEA 3ZQUA 3R09A 4BKRA 4D4HA 3ZZMA 3ICQB 1NNSA 2V65A 5CAEA 3ZHCA 4HLUA 4MICA 1S2IA 2D00A 5DYTA 3ZHYA 1N57A 2Z4SA 3NKFA 1AKVA 4B33A 2G1AA 2VBFA 3MT7A 3U7EB 4E2ZA 2RG1A 2FSPA 1XTRA 5J47A 2O8BB 2R00C 2PL5A 1E0SA 1ZCZA 5DTEA 4PQFA 3R7WA 4PC6A 1B6TA 1FBNA 4Z2YA 1IAVA 4OGGA 1C4KA 3KUCA 5DVZA 4AJOA 5LP6F 1JI0A 4RVNA 3R5JA 1UK8A 4FMBB 3SC2A 1CY6A 1G66A 2E5WA 2JIQA 2VK8A 2BISA 2WWYA 3STHA 3DMTA 4PCVA 3AVTA 1XCPA 4A6EA 4KREA 1GVHA 3BXHA 3SEFA 3ET4A 2J46A 1RLTA 3BKWA 1OJ7A 3LIPA 4AJJA 4RK6A 3C7DB 5JNUA 1F3OA 2JZCA 2ZYSA 3D4OA 3V8PA 1LW6E 1AE1A 1FVHA 4D56A 3EF0A 2EHJA 2AXQA 3O4VA 3A04A 1ND6A 3OF5A 2DYKA 1PR9A 1V71A 1FOEB 1ZLXA 2QR2A 4R6WA 3SBDA 1QF6A 2X3YA 2FZVA 4C3OB 1E96A 5JSZA 1UZMA 4QU9A 3KD2A 4C0WA 4DTIA 1CNEA 1QDUA 1TQ8A 2ZZKA 3DBRB 2EFEB 3I9LA 3MXOA 4LVUA 3SP1A 2W6IA 3H1AA 3N0VA 4NV0A 2G07A 3C3KA 3IO3A 1TT5B 5JEDA 5K45A 1IN1A 2G5CA 2AYXA 3LXXA 4V0SA 3EXIB 3WRXA 3I6QA 2IOFK 3JU3A 3MWDA 5HNKA 1CZHA 4O63O 3V4ZA 4LV8B 5EPOA 1XXHB 2C9BA 2FSUA 2IHTA 1XO1A 2O8FB 2EERA 2HF7A 3LUDA 4OLFA 4QXAA 1JTFA 3CO0S 1QWOA 3O8BA 1GGJA 3WL3A 4ZV4A 1IZYA 2IYXA 1FS4A 1A3CA 3WV5A 1XFDA 3NHMA 1T24A 1KI6B 4DUPA 4KXFB 3HV0A 1UKAA 1YQUA 4NG4A 4DREA 1FTQA 4D41A 1JHXA 1UM8A 2AI2A 3C3XA 5JSHA 2A14A 4PPFA 1H0KA 5IAGA 1ZD4A 1HQKA 2PA0A 5JLAA 2ESRA 3WWEA 2LZ0A 5CX1B 3RTGA 4XH9B 4NBUA 4HJXA 2OFOA 4LI3X 1V2GA 2QAJA 4QQ8A 5CVTA 5KQGA 2PUTA 1KZGB 2DH6A 3ND5A 4KACA 1T5IA 5D01A 3SXUB 4DFDA 5I47A 1XEAA 3QI7A 1KYVA 4JCOA 4NOJA 4TTRA 2CL5A 2Y4OA 3NH6A 1ZKMA 3TAHA 4EG6A 1E4YA 4TLBA 2VDNB 2GNOA 1A50B 1WZUA 2JFNA 5JXGA 3VV3A 1H0HA 3FDJA 5HJ7A 4BNWA 1DQNA 5NLLA 2HNBA 2VPYA 5JD5A 4QM6A 1HYBA 3SQDA 3U3MA 2QN8A 3ILSA 4O2BB 4XI9A 1EJ6A 1YFZA 4IICA 3H11A 3E3MA 1U7XA 2I9KA 1KE1A 6CHYA 2F1OA 3DEJA 3GHYA 1N4AA 1Z0UA 4H1TA 1PNQA 4RS3A 4PYOA 3OZXA 1ENYA 1TIBA 5B1DA 5TE9A 3VJKA 1M6VB 1M66A 1PFUA 3EA0A 3LYHA 4OSEA 1PL7A 3SSOA 5GADl 5EN4A 3ZLJA 4KL8S 3N87A 1AKRA 1ZM9A 3KKPA 2HIGA 4QJ5A 3IPRA 1RRFA 3OETA 5EERA 4YQEA 3M83A 4Q3LA 1QV7A 2ONYA 5JPCA 1S8OA 3THWB 3H1TA 5AK3A 1GUZA 4F38A 1KPHA 4FONA 2E18A 4KN8A 1NQUA 2HQOA 3OU7A 4XGKA 3E23A 4Q7QA 3DFZA 3O2NA 2JAXA 1F2TA 1Q17A 3RIYA 2QE7A 1X8KA 1QG4A 1H6BA 3ORRA 2PCJA 1AKTA 1R5NA 3MBKA 3U7IA 4KHPB 1I4TD 2F3RA 2KW5A 5EHIA 1LPSA 2QI9F 1QB7A 3ZKAA 3PTZA 5EP1A 2W6ZA 3D5EA 2Z3VA 3AUFA 5E7QA 1H85A 5JDCA 2DHQA 4US2R 2OHOA 1QHHB 2F3PA 5HFAA 4IIGA 1Z7EA 2DUUA 3GF4A 4WNAA 4XQCA 5BSRA 1G7CA 4OUDA 4IV0A 1Y7IA 3FG9A 3NIDB 1KYIA 1MRNA 1XRMA 3WMGA 4RVDA 2VNAA 2YOHA 4IDQA 3C6ZA 1XMSA 4R05A 3WKCA 3D0KA 3G9UA 1A69A 5IRCD 4JYBA 4KXQA 4GYKA 2H7YA 3BMNB 4JBIA 3M3DA 5HDQA 1F0PA 3DBIA 3F4BA 1F51E 3K71B 3FW1A 1K08A 3UICA 5HZGA 3RT1A 1N2CA 5KTKA 3Q8KA 4M9ZA 2PJZA 5DTMA 2ZYAA 5E0OA 7ABPA 2WI8A 4MP8A 2PGAA 2WUGA 1YNSA 2AVNA 1KPGA 2Y1OA 1D1SA 2F55A 2JVIA 1N2CE 1B74A 2B92A 3A3NA 5A6VA 4FC7A 1PYGA 3HB0A 3VMMA 3ROPA 1CE8B 4GS5A 3G49A 1VSBA 1XLUA 1AM4D 2FLVA 3DB2A 5A71A 4C5BA 5CFMA 2N47A 4NJEA 1PJCA 2QQGA 5I9SA 2SHKA 3DVRX 4M1EA 4XD7A 3O8QA 2QE6A 1BOOA 3FHJA 2M1XA 3IPYA 2XJ4A 4Y6SA 3HRHA 3KL4A 2AG1A 2P6OA 4JJEA 1ENOA 3IB6A 1PNOA 2OZLA 1D6JA 4I7EA 4RD3A 4B0OA 4PYNA 2RGAA 2VJKA 4L0DA 3ESAA 3QLJA 3WG9A 1IATA 2PV0A 2JBHA 1ORVA 3NWEA 2JH8A 3O4FA 5F21A 5TXGA 1U1FA 3HL0A 3PLRA 1LI4A 3IPCA 2A9JA 3A1WA 2QMZA 5EYPA 3SX0A 5CB4B 4B32A 1N5LA 4KPYA 2EFGA 5HIIA 1JPVA 2P8SA 1TO2E 3A0UA 3Q15C 2XMBA 4R40A 3ZLTA 1LX7A 2VFAA 3W9BA 1QJCA 3RV3A 2XTJA 4BLRA 4FFNA 2J32A 3L0PA 4BRWA 4WLUA 1BC5A 1QGZA 1T15A 3ZJ5A 3DDZX 4ZAZA 4GO1A 2DKFA 2EBHX 4KWCA 5KBYA 5H68A 5AD1A 1Y4ZA 5BMVF 3D8HA 4NH0A 2YIVX 5TSDA 1XD2B 3U44A 4G0NA 3VRHA 2HJRA 3DT9A 4HQLA 4HQNA 3ZKWA 5F7OA 1JB1A 2CFIA 5KQRA 2Q3FA 1R4NB 1H6CA 2CW5A 3DZBA 3OPYA 2XADA 2YJ6A 3N7UA 2JCBA 3QBDA 4AN1A 2QQ5A 2C4TA 3ODGA 3T5MA 4ZI3A 1W52X 1JG3A 4LGCA 4Y2TA 2GM5A 4D45A 1P74A 3MWFA 4NYMQ 1IB0A 1UK9A 2FZKA 4N6GA 5A7HA 3R7DA 4F86A 1K7YA 2CNNA 2VHVA 2REQB 3KCQA 3W5UA 1K1EA 2C4HA 2GEDA 3GELA 2UYYA 3OQIB 1XDWA 4R51A 4PCUA 1CDZA 3RRBA 4QDKA 4H18A 2R1TA 3G1UA 2IV3A 3TGWA 2QD2A 3LQ4A 3R6TA 2B4TO 4ZT6A 1JDZA 3ETCA 4UBJA 2VQEB 4BNIA 3BWXA 4EMBA 4R0VA 3FOFC 1MQ8B 1W76A 1I6WA 2PUJA 2F8LA 2WAYA 3D5TA 3EIWA 4OPMA 2JEZA 2ZK7A 2BH2A 3A7EA 4HDRB 3PXEA 1WMDA 2CBZA 3REQB 3GJ0A 3QA9A 5DYGA 3V2GA 4WDQA 4XGQA 1ZO8A 3VTAA 5LM3A 2QK4A 3B3FA 4WOCA 3LBYA 1VJ1A 1SPBS 1M2VA 4CIWA 3R9IA 2OO5A 1SXIA 2J33A 3W8FA 1QC5B 3ZEIA 5B64A 2ZUDA 3RSQA 2VSQA 4D9MA 4QSMA 4KO8A 4QU5A 1KVRA 1S2NA 4DMRA 5DGCA 1CQIA 5TJ9A 3B6MA 4J16C 4B45A 2XTZA 1S9DA 2IHBA 3FIJA 4GU5A 3AVYA 5LOVF 2G88A 2JGMA 3TSZA 1JEQB 4CRWB 2GBCA 2XB6A 5IANA 1VHLA 1ZWLA 2COKA 2PFKA 4GG1A 2DFKB 1A8PA 3TZQA 1M72A 1NSTA 3I2KA 1ISHA 3JAWB 3LLMA 5EKDA 4QX6A 5CHEA 5AJYA 4Z4HA 1VCOA 3GLFA 1OXVA 2I03A 1J2RA 5KX5B 4J29A 2QMYA 4DC0A 2O5CA 2XNDA 1M5TA 1EDBA 1MDBA 3GLFE 3SQMA 1N8SA 1SC6A 1JHDA 1FTGA 2FPGA 3EDCA 4LXIA 3JQRA 4MWOA 2FEOA 1U0RA 4R3NA 5C3UA 3TLXA 3W2IA 4AVYA 4YRIA 2ZCJA 4QIHA 3DMHA 5ALYA 2BTQB 2GR9A 1FA9A 4K81B 3MFQA 4UC0A 5KDDA 1GPLA 2C9OA 3CY6A 1USKA 1U3VA 3ZTWA 4NP6A 5FWDA 1EM6A 2JIPA 3WMEA 2ORED 5DRYA 1Y9EA 3UC5A 3WJ7A 1BW9B 4QGHA 4EVRA 2IYQA 3MJRA 1ZJYA 2W8BB 4RHUA 3QFCA 4BZPA 3BRSA 1GTSA 1ICEA 1Z5GA 4WKBA 3LWNA 3WZLA 1E1DA 1BFDA 1SXPA 1RXCA 1HQDA 2JAOA 1ZRMA 5HMLA 1GNQA 4CL0A 1L4EA 1YE3A 1XZIA 1E2DA 1GUAA 1TK2A 2H0AA 3I04M 1II8A 3AKEA 1N0UA 3LBAA 1DAPA 2Q4BA 3BGSA 3FX2A 2ZULA 4Y2GA 4MO9A 2HCJB 4RY0A 7REQB 4AMZA 1CY8A 4HGPA 3T9CA 4CCAA 2JHFA 5LWQA 1YU9A 4GM1A 2ZT7A 4J1TA 4Z7NB 3K0FA 3ZDRA 4DCGA 3U1TA 2R66A 3LW7A 5LYJA 1O08A 4AMVA 5FBVB 2PJRA 3A3YA 3V3KA 3N58A 5DT9A 5L95A 2NGRA 5EZYB 2O7QA 4Q9NA 4NYJR 4Q37A 4MUAA 1D6MA 1XEXA 2C5BA 3VUEA 1ABBA 1A27A 1RQGA 2QGNA 4QFDA 3GJ3A 3TUJC 1T26A 5G4LA 3ZG6A 3H97A 4EMTA 4MV5A 4FDTA 1TLFA 4QO8A 4ITVA 5GGXA 2HF2A 1OVGA 1PO7A 3GPCA 4Z3KA 1VZ2A 4BN0A 3NVKI 3C45A 2MSEB 1WMSA 3RVMA 4JX8A 4QYXA 2PZ8A 3AM3A 3IPAA 1XQWA 4WBSA 1L3CA 4PG4A 4NAHA 1AXEA 3UHAA 2O7SA 5LVAA 1JWLA 3NOVA 1XCGB 4HUQA 2ODBA 2QEQA 3IT2A 3EVCA 4C03A 1GTRA 1SKYB 3ELYA 4RHYA 3ZBTA 3EHDA 3T3MB 2QNRA 5LIPA 2MIIA 5FTJA 2RGDA 4JJAA 4UM9D 1BXRA 5IUNC 3FTEA 3RSZA 3RBVA 2V1UA 2JJ2D 1LV8A 4W7IA 2OYCA 4BKQA 1XPJA 2FSHA 3QMMA 2B0CA 3SLRA 2XUJA 4BTLA 4CV0A 3JQ8B 1T6BY 3KJZA 1S0UA 3BZWA 2KJQA 1OX5A 4PHFA 5ESDA 2AXEA 1J7KA 2FCRA 2VYCA 3GYBA 1MG5A 2XB4A 3PPVA 1KMNA 3WADA 5ABPA 1J8YF 1I8TA 1JG7A 1W46A 3GLSA 1V37A 4OCZA 3AL0C 4RS4A 3RLIA 2WJWA 3NTLA 4R31A 5C34B 3FNQA 4C2BA 1TDJA 4BY9E 3PQ7A 1F2UA 4LAFA 4HUJA 3QJYA 2H4XA 2ASEA 1OX4B 1N2SA 1ZZEA 2I33A 4P7JA 4XYEA 5LZ8A 5IUJC 2YXNA 1N2BA 1UC5B 2WC1A 4RNCA 3RHFA 4LHSA 2Z0MA 5TRTA 1K8YB 2FN3A 3B1KA 4ZXPA 5KKNB 1LK7A 3EGOA 2X41A 2WQ7A 1FMLA 4ID3A 2GS9A 1WS6A 2P6NA 3FTCA 5ALSA 2WFZA 5EXDA 1U2GC 4H3SA 2BHLA 2HIHA 4M9UA 4CLOA 4C29A 4YALA 2B4KA 3F7TA 3O94A 2EL7A 2Q3DA 3KLOA 4DNPA 1BROA 1X1RA 2OOKA 3EW9A 4O1MA 4DV6B 4WW0A 3E1GA 2IYTA 2PUDA 3DZ8A 3W2EA 4M0MA 3K3PA 4YJDA 2C2KA 1O94A 2QTTA 1AZWA 2ILTA 5IWAB 1EUDB 4IIJA 5GJVC 3UAWA 4HO1X 2VJOA 4ZO6A 1UOEA 3EF3A 3K9LA 1CYDA 3ZDZB 1QH0A 3LIIA 1PV1A 3F4LA 4TMWA 5J2TB 1WTCA 1S7CA 2XVMA 2MYNA 4FHCA 4UUQA 4X90A 3IR6A 1ZC3A 2EGGA 3WIEA 5BNZA 2X7HA 1NX9A 3CINA 5JS2A 4V1CB 1SVUA 2E4ZA 5DTQA 4ZVQA 1XTPA 2UYOA 4XB6B 3DL0A 4C6RA 3IMFA 1SUCA 2H85A 1O0BA 1IPEA 4RAQA 2CLKB 4QVGA 1NC3A 4BO3A 3HBMA 2QTAA 3CZQA 1K6JA 3JVUA 4B7ZA 4E6PA 4FOLA 2FKNA 5K8CA 3RANA 4V1CI 2CNWA 4ZYWA 3CVJA 2ZREA 1S02A 1I7NA 2FPWA 4C0JA 4QNNA 4FX2A 3I2GA 3NORA 2AJBA 2GEBA 1PFWA 4PZZA 4TTAA 5AW2A 2H2WA 5AUOB 4MUMA 4AJKA 3DYVA 2X2OA 4PLHA 2WTBA 3NJ8A 4QD3A 2MYUA 4BFTA 1KI7A 1FTNA 4BB0A 3O1LA 2OD7A 2QVYX 2HREA 3EMKA 1PFGA 4KBYA 2CK3D 4Q16A 1BA3A 1H8ED 3MJDA 1PKEA 4HB2A 4M22A 2HJGA 1FDOA 5DM1A 3CUWA 3MILA 3K1AB 3H2ZA 3L82B 4ARZA 4RXUA 4KQEA 4DZZA 4NIMA 1XVUA 2VI5A 1DXYA 2M6RA 2ID9A 3HCDA 1JWAB 4INAA 4RFLA 4RXMA 3TG8A 3U3KA 1DAOA 5C2JB 2ID4A 4ZHQA 4AULA 1WXWA 1P3Y1 1PNTA 4J8PA 2TRSB 1PFYA 1UEIA 1XYVA 1U02A 4LS3A 1I10A 3RK4A 4ILEA 1MNQA 4OHRA 2C8JA 2G9VA 2ZEJA 1GZDA 2DCUA 1KI9A 3OP1A 2D0DA 2IHZA 2H2FA 2VT2A 3OF3A 4FOSA 5ELMA 5EWJB 4HN9A 5DNEA 2QM0A 4LBZA 3KT6A 1YI0A 4LWZA 5AVQA 2FR0A 1M2OA 1Q0LA 2GN8A 2XEDA 4G63A 2BFCA 2JIBA 1CUXA 4DBLE 1A9RA 5DHUA 2N42A 1HK7A 1QR2A 2E6KA 4HD8A 3FUCA 2OILA 1CF2O 2W8ZA 4Q15A 2EGUA 2Q49A 4MR7B 4MRRA 2E85A 3TUIC 2YNMD 1TF7A 1EZ4A 1HLDA 2A8YA 3ETNA 1QWSA 2XRZA 1V48A 2JJQA 1YQTA 3C24A 3K30A 4IS2A 2H59A 2FYTA 2FFJA 2FA9A 4KBFA 821PA 3T5PA 2DEUA 2VZEA 1Y9DA 2DPLA 3OQJA 2QTCA 4Q9HA 3PTAA 3O21A 2W4MA 1GCGA 3AHDA 1YRYE 3FYHA 3DZCA 3DMDA 2HD4A 1R0CA 2VJBA 2OXFA 4CFYA 2BFWA 3ISTA 1T3TA 4DYHA 3B3JA 2VYVD 4B87A 4O8CA 1FC0A 3KXPA 1V7CA 5LJLA 1TE2A 3WKBA 3SM9A 3RKRA 4BNTA 2IYWA 4TYMA 4YUAA 2P6PA 4GFDA 2WWVD 5JXJA 2WWWA 5ALEA 1IWPB 3RVLA 5C8VA 3QXCA 2C31A 2EW8A 3EE6A 4LCBA 2QY6A 3CRNA 4JEIA 2G25A 3NBUA 1NPDA 1XR3A 4ZEOA 2EKPA 1JDJA 1FRVA 1Y1SA 3LT2A 3NIWA 1W36C 1AV6A 1P7PA 4YCAA 4ESVA 5AXAA 4XA8A 5K0TA 2PYZA 1HNZB 2A7QA 3DO5A 3WV4A 3CZ9A 3F6SA 1NY6A 3AUKA 3LKVA 2DRIA 5ALRA 3T4EA 4DLTA 3GFBA 3C4JA 4HY3A 1AZSC 3FVRA 4MR9A 4B46A 3O1JC 2BP7B 2A5FA 5A62A 4K2HA 2FUNB 2DPXA 4R2WA 5ITSA 1N34B 2HCBA 4JWTA 2QGZA 5KJEA 1E3DA 4WESB 3GEGA 3G2IA 1CKEA 2FOLA 4PONA 1SOWA 2FFBA 3SQNA 3V2HA 3WE7A 3ZHXA 2NZ8A 2REOA 2GTPA 3B6EA 1OILA 1TVKB 3I28A 2YHIB 1IN5A 1KHTA 3WO1A 2RE8A 1QIIA 4TLMB 4N5DA 3GRCA 2VTBB 2C88A 5AHWA 4CI9A 3DBLB 1EMDA 5AI0A 1SXQA 4C0QC 3G6WA 5K7SA 3CVVA 4DB2A 3EIFA 3C6BA 1IZ9A 3EOBI 2COUA 5CITA 4MKGA 4FMDF 3GLIB 1O03A 4YRQA 4D81A 2JJ1D 1D7AA 1N1GA 2X0FA 3Q2KA 4HZGA 3GOQA 1RVV1 4BP1A 2CC2A 5AW8A 2FWPA 2IA5A 4N3GA 4DSAA 3FR7A 4J16A 1OY1A 2XB9A 4HQ6A 3HUUA 5FH9A 4C05A 4YJ3F 5LKRA 1XNHA 4S2EA 3V7FA 4NDAA 2ADMA 3ZY6A 3TCKA 4GW3A 1RE0A 4MUXA 2GN0A 4XR4A 2Z2JA 1G4AE 5DKFA 4NYMR 1LVUA 1R6UA 2ZRKA 2MSKA 3HCFA 5KVQA 1GPBA 3EQ8A 3NDRA 4E11A 4KQHA 4EKYA 1T9AA 4AYWA 4P8RA 1MB3A 4WLEA 3JASB 3ZDQA 2GEKA 3WA7A 2W6JD 5FUWA 2EOAA 2BN4A 2GEUA 4JSTA 1YT5A 2IZZA 4N8DA 4XGRA 2KQUA 1E3WB 2WPDA 3SEZA 4CNBA 1SR8A 2J41A 2FZCA 3IBFA 3RC9A 1GR1A 1DMRA 3K6SB 1I30A 1RZVA 1X9GA 3AJEA 1CJTC 3M6XA 1P3DA 3RAJA 1Y8ZA 1FSPA 1XDSA 1Q7EA 2HQBA 4I6GA 1W9HA 2JZOA 3DMPA 4OYRA 1XLWA 2OT3B 1XPRA 2QLMA 4UE3S 4LJAA 4WL0A 4BE7B 3FI0A 5JNRA 4QODA 3CHYA 3W9UA 4TLCA 1U0GA 3JQAB 3PIIA 4XIIA 2R5FA 1GRNA 1R4MA 4Y2YA 3GLGA 5KPJA 3DCNA 1E2MA 2VCEA 1N6KA 4TGLA 1ZOOA 1G6HA 3EVFA 1GCOA 4D5EA 3GLGE 4DR7B 2IPXA 2TSYB 4W4TA 1DKUA 1AU9A 5CPFA 3RVJA 4BPBA 4OXRA 3F7OA 3WJ2A 2G09A 3D2LA 4P54A 5JG7A 4YT8A 1NKVA 4JUBA 4M8NE 5E9WA 4ZDWA 4BJ1A 3HYTA 4EGAA 3UJNA 2EKBA 2QRJA 3IULA 3R4CA 3WYGA 1DZ3A 1GQRA 4W6QA 3H3FA 3TIIA 4Q34A 1KZYC 4BO7A 3LA6A 4INZA 5KTMA 2AQ8A 3FPLA 2IXAA 4RQTA 4ASUD 1JIVA 1R10A 3ETJA 4IS3A 1JFTA 3OJWA 2YZ2A 2ZAYA 4YJ2F 3UHJA 5DSZA 1L6IA 3IKTA 5TF4A 2FPPA 3NGXA 4JK3A 3IKMB 3K0HA 1E9EA 1GYPA 3COWA 4RA9B 2BMWA 1PT7A 3W79A 4EFMA 3ISVA 4D6YA 4E5NA 4YUWA 5JJCA 3LT0A 1HM5A 1F3LA 1DO0A 1TMGE 5AKJA 5TNXA 1P1JA 3RYIB 1MOSA 2EIXA 4F2DA 5JYCA 1YB1A 2Q1SA 4C9BA 2WLSA 4FVTA 5A4JA 3LDGA 1WB4A 2H1IA 4XQEA 5JYEA 2ZSDA 4NLLA 1P18A 2G5PA 4JI7B 3WAKA 3R7SA 4EL0A 4E5KA 3I4LA 5B30A 3H6KA 3FVVA 1SCJA 1VGQA 3IEXA 3O9VA 4CG2A 3L8ZA 1I3CA 2J3IA 1GM5A 3P9XA 4BRUA 4DQKA 1B8UA 1C1DA 1Y3BE 1IPHA 2REBA 2WV9A 4IYJA 3O31A 3WBJA 1CZLA 1WUTA 5KTTA 2BFEB 1NDHA 3PQEA 2FPOA 1LX6A 2W4IA 3HXKA 3EDMA 3FCAA 2QL9A 1T43A 3HADA 2XKBA 3EC1A 3GA0A 3IAAA 2W2OA 3D4NA 1WHSA 4K9QA 4KUGA 4LXGA 2F48A 1IG0A 2QAIA 2R8XA 4TS9A 4ZO9A 1FRFS 1P33A 2IEYA 3GJ7A 4P38A 5CYOA 1T9KA 5WRFA 5FTKA 3ZYCA 5JIBA 1YL7A 1J1ZA 3B1FA 3FWNA 3LHIA 4IHJA 3QU7A 1B76A 1I3KA 2DECA 5DI3A 4EGCB 3PRHA 5F2OA 3JATA 3WLKX 2A5JA 1V7PC 3OLQA 1EXVA 2V0GA 2R6R1 4LXTA 4X94A 1GCIA 1ORWA 1Y33E 3AR6A 3BD7A 3LWDA 3MJSA 4ZEWA 1NYRA 4R84A 3RK1A 3VTZA 4L50A 2XUFA 3BXFA 3HV2A 1TYBE 3NGLA 4A1FA 2HU7A 1M1XB 1WDMA 2WAMA 4B3SB 4MOWA 1FLAA 2XRYA 1NR1A 3QVGB 5CVUA 1G59A 2OBBA 2DQZA 1CEYA 1P2FA 3L7BA 5D51S 5TGDA 2PKWA 4IJUA 4IV8A 3BXXA 4PZAA 5JH7B 3KALA 3G1WA 2CNDA 2HF8A 1Y1KE 2YN2A 4WUVA 2RGRA 1VRWA 5EVJA 3NOQA 3UGKA 5IC5A 3LHKA 2C8KA 1E7YA 3BMCB 4OJQA 2E9SA 1R6TA 1Z35A 2WU8A 1FTSA 3PDCA 4QXOA 3VKVA 1J9GA 3T06B 4I4NA 1OTHA 4OJYA 1NN5A 1ULZA 3JD3A 2H2AA 4MVJA 3NALA 2AQIA 2QM8A 1A9YA 1Y6GA 3AR8A 2PH5A 1HYEA 1XKQA 5CTJA 5BUSA 4D82A 4MVJE 2Z6AA 1F8XA 1K89A 2RH5A 4QBIA 3VU3A 2IX3A 3URMA 3KQUA 3ZX4A 4KR0A 1UR5A 2QSYA 1DL5A 3O3MB 5FL7D 1P0IA 2B9EA 3HUEA 3W3AA 5E8RA 3UKOA 5C51B 1NXVA 2NZ2A 4FNOA 5BOSA 2YIJA 3TQCA 1N6IA 5HW0A 5L6LB 2R8YA 1ZR4A 3TE7A 5A3JA 2IS4A 3ZGZA 3WK8A 3ZC3A 1TA9A 4E5YA 3EA4A 5GJBA 3KB8A 4R01A 4G6ZA 4KO2S 4U63A 1QRRA 4F93B 1ZEJA 4BDSA 2AWNA 2JLWA 4OAPA 4UHDA 3DEAA 2JVKA 4NBLA 5IXYA 1KEEB 2J9FA 3EVDA 2W2PA 3HKBB 3S7TA 4DG5A 2D0PB 4R1LA 1N3YA 3DEFA 2I7DA 3PEYA 4KAAA 4L7VA 5F4BA 4PICA 4N76A 1MC1A 4B3GA 3H2BA 2JEOA 4RHEA 1U6IA 4F7DA 4JMLA 4L8GA 3UWDA 2I2CA 1NWCA 3E7PA 3QYPA 3FE2A 2FMIA 1CIVA 3EWAA 3IUJA 5CVDA 3PK0A 3AL3A 4WCDA 5LZ7A 4E30A 5DW0A 1DAIA 3BILA 4BLOA 3BXEA 5LZ4A 3OA2A 3K94A 4H2DA 4BQFA 1LK5A 4HS9A 4D8XA 4G2NA 3GFPA 3K9QO 3AIKA 4QOEA 4PXYA 2F1IA 2GERA 1NA5A 5GONA 4B4DA 1ISMA 1RCTE 1TRKA 4JLJA 3D8BA 1FFYA 3SF8A 1TMOA 2QP4A 3CZ4A 3D7SA 3HB9A 4YJGB 2FK8A 4JC8A 1GUFA 3LVRE 1FP6A 3I2FA 4ND3A 2XNCA 3G9ZA 4BJHB 3C6KA 10MHA 2VEDA 3WOVA 4P53A 4RKEA 3WSVA 3SJZA 4H17A 4E1AA 3GX1A 3GXOA 4DE5A 3VVCA 3AF6A 2JI9A 5FNVA 1JKFA 1K8RA 1BS1A 3DXZA 2DPHA 3GMSA 1W1UA 3V4PB 4E4YA 4HH1A 2XDQA 3PEEA 4F9EA 3MB5A 1CJSA 4KBGA 2AG0A 2VRCD 4OHCA 4GKJB 2MYTA 4F2WA 4DQ0A 3D6FA 4K3VA 1T8UA 2BGIA 3F97A 4A82A 5BSFA 2VJCA 4OMFG 4JI3B 3A9RA 1EX7A 4MWGA 1XDBA 2AZMA 2Q9UA 4RETA 3A1VA 3RVDA 4AZVA 1ODFA 3B82A 1U4NA 4QTZA 1KGSA 2R68A 3DTVB 3W4JA 3HNOA 3WGJA 1MUUA 3WY9A 1B26A 2GHTA 2D0OB 4FDLA 1W44A 3CEMA 3N5CA 1UDCA 1NMEA 3R7WB 1X1SA 2HHCA 3AWDA 2X0EA 5C46F 1RHQA 3TLCA 1IIRA 1OB5A 3GA7A 2V5AA 1FS5A 1SCKA 1W8DA 2BY4A 3HKEB 1FQOA 2ONKA 3UW3A 5JYBA 2DR0A 3GVHA 2XUHA 5LU8A 1BU8A 1S2GA 4DA7A 2I7XA 3QHQA 1A4UA 4MUKA 1MX1A 1J2YA 4X62B 2CXRA 4HEHA 4BB5A 5TQ2A 1VBFA 2VIIA 1PUJA 1R8JA 4GAEA 2GRJA 3CM0A 1SEPA 4IO1A 3USZA 4E2XA 4AW9A 1S5PA 3IQHX 1GG8A 1ZJJA 4ENUA 4C7VA 8LDHA 2WZQA 3KR9A 1W85A 4EUNA 1NW4A 3AC0A 1R15A 9MHTA 1FYFA 5J59A 5JSZB 4PLWA 4B8ZA 1E2UA 2BFBA 2X0RA 4AJNA 3A6ZA 3NVAA 3EPPA 4EHBA 2GDZA 5M29A 5T3UA 3UAOA 2VUTA 3PPIA 4DPLA 3CRRA 3B9PA 1AX9A 3B2NA 4QOFA 1JLLB 4B7XA 1EUCA 3A9UA 1SKAA 3T7KA 3MHPA 3TW6A 1U0NA 3MWDB 1SXJC 3RFUA 2MINA 3D0QA 4ILKA 1R3DA 1NVBA 1VZ3A 3L8EA 3R4VA 4V0NA 3INTA 1EQAA 4FYWA 4M0EA 4OBXA 4WADA 4Z9BA 2J67A 4BQPA 2KHZA 1I2ZA 4M0KA 3U7RA 4D2IA 2RHGB 3L0DA 3TLGB 4BMZA 1AH2A 1U0SY 2G6BA 5P8WA 3C6MA 2FOIA 1OH6A 2UXBB 3HFSA 2FQYA 3WWDA 3CGGA 3GFSA 5DI9A 3RTBA 1OD6A 3LQ2A 3O91A 2O7NA 4WOBA 4LJRA 1Y1LA 3T99A 1PJBA 4DQLA 4E2YA 1NYQA 4GC9A 1GARA 3ZHOA 3U6BA 1E5TA 3FYSA 4KIGA 2WMNB 1BRMA 1XU9A 3PFGA 4WFIA 3H2IA 3O2QB 3G85A 5KINB 3K09A 1TVCA 4L0QA 9LDTA 3FY4A 2VP3A 4MIKA 3ESRA 4ZKDA 4R4JA 3ASUA 2WJ4A 3UAGA 2JAPA 3TL2A 1J42A 3OT1A 4IO0A 4B2YA 5CLGA 1EINA 4HEA1 1FUUA 1XTKA 4RF2A 4F2PA 3D8UA 2FI1A 5EINA 5TR9A 5BR4A 1T3LA 3T5DA 4DCVA 4PZCA 4S04A 5EEGA 1SVSA 1OQAA 1X7HA 3A1EA 5LP6A 1ORIA 1CF4A 3UXEA 3KTOA 1U7UA 1I9GA 1U1DA 4XWYA 2F90A 2X14A 1WVIA 5C4MA 3DOHA 1VMAA 4PAOA 5KTRA 3ESYA 1C3OA 4RLQA 1VI5A 2C4KA 16PKA 4PXSA 1CD5A 1D03A 1VKOA 1YZGA 2O4UX 2VJLA 1J0CA 4CM7A 1Z4KA 2Z9DA 4FFOA 1FYVA 4FXOA 2QRUA 2GVZC 1O0SA 1ZNYA 3TW8A 4K1XA 1SUPA 4F4JA 2MT9A 1QONA 3DTNA 4R9VA 3I2HA 1E1MA 2D1QA 3ENNA 3QBVA 1XMQB 1M5RA 3V8QA 3KQWA 2W48A 1SIBE 2JFQA 3CUTA 3RIGA 1J49A 1XMXA 3SJBA 4EZIA 4NXNB 3VOBA 3T34A 5AP9A 1BNCA 4C0KA 3EG5A 3IMEA 2DQYA 4N03A 2HRBA 3B3QA 1Z7YA 1WXHA 3D6UA 3GAAA 4PGMA 4HEA6 4WASA 3AZQA 1F2TB 2FWRA 2OLJA 2BI4A 2QB5A 3FN4A 4L6IA 2GZ2A 3BL6A 2Y68A 1ISGA 4PAGA 4D9KA 4CIYA 3WA6A 1M8KA 4M8IA 4BVFA 4LXUA 1ZXBA 2DLDA 4HHEA 4RADA 4BMSA 1PJ4A 5MHTA 4DR4B 2Q8PA 1P29A 2QL6A 2ZVQX 3U16A 3RS2A 1AOXA 2QG4A 4Y6PA 1YA6A 2R8BA 1HH4A 1ZNZA 2AVDA 4BO9A 4EGSA 3PX7A 1OIVA 4CM8A 2EG9A 3IVAA 5CH5A 3GGCA 2V6FA 1IHDA 3PGA1 1L4UA 2AH5A 4QDOA 4LXYA 3KJNA 1Z0JA 3DXXA 3JYOA 3IBCA 4BNDB 4DR3B 2OBMA 4TVSA 4KZPA 2QRGA 1DZIA 3TMYA 3VZRA 1SVMA 3A6FA 1YZFA 2RAPA 4BFYA 4S1VA 3GJ8A 3BIXA 3RE1A 1OB2A 5IXSA 3L1KA 1GDDA 1N2CB 4R1OA 4RTSA 3IAXA 1WCIB 1ZRNA 1NURA 3ZE9A 4DRYA 2G7MC 3RPEA 1VCIA 4NU0A 3TD2A 4AYTA 1ZFNA 4FFMA 2R62A 2FMTA 3OZ7A 5LQKA 1CDEA 4DN6A 3GO4A 1LNZA 2PRYA 2NM0A 3G9XA 1HFKA 4O0LA 4TTVA 3DQZA 3RJTA 1YDMA 1D2RA 2X1VA 4GZLA 3MMZA 4Q93A 1P5JA 2RD2A 3CX6A 5GIPE 5C7OO 1M2EA 2Q1YA 2X19A 3K6JA 1P7VA 3KPWA 2PR7A 3DSRA 3TKLA 3B5IA 3FPGA 2NXCA 5FBZA 4EKGA 1DGQA 3O8QB 3PFFA 2E37A 3HJCA 2C99A 4PNEA 2HXGA 2POQX 4DR2B 1WXEA 2J3MA 4Y0VA 1VBMA 4GXTA 4Y18A 1NVAA 2V55B 3G13A 4DKJA 4ALNA 4GPAA 1ZH4A 1QHGA 3X2FA 2NXWA 4UARA 4PHCA 3BGDA 3UO8B 3SZUA 4GLJA 1E1RD 2LCFA 1L4BA 4V02A 3AU9A 4R81A 3V9PA 2VUIB 3IR5A 2EZ9A 1CS4C 2JLCA 2Q6VA 1HQYE 3LI2A 1IAQA 5EYPB 1NNUA 3QX3A 4WCVA 1XZLA 1Z15A 1TA4A 3FTPA 4M0DA 2OHJA 2B5OA 3BM5A 4F6RA 4PSCA 2QN2A 1PT5A 1PWYE 1QHIA 3QLEA 3W34A 1WPRA 4KSYA 5KYNA 1QV6A 3SJCA 5HP4A 1JS1X 2IYVA 1BTOA 1KQOA 5BYBA 2JNWA 1IUKA 1BJKA 1NFFA 1V4VA 5DTJA 4W63A 3DCIA 4C0LA 2ADFA 5IPFA 3U44B 4PZUA 1OI3A 2H2HA 4L4XA 5FFNA 3ZNQA 3ZKWB 1G60A 2EXXA 1G5HA 2WU1A 1AQNA 1XBTA 4IOJA 1X7XA 4JQYA 4N3NA 4EABA 3SMVA 3SS7X 2BCEA 5BUQA 4ZVVA 3U1BA 3AVQA 4ZK2A 4DMCA 3VU8A 5K6AA 1GHTA 3L4SO 3NNDA 2R2GA 4MEJA 1KSJA 3Q1KA 4TQGA 1VECA 3ZI7A 1S3GA 4D0SA 3N2GA 5FYQA 1G8FA 2P4QA 3AT1A 7ADHA 1N33B 3OE7A 3CUUA 4D4KA 1G5TA 2PVPA 1FDUA 2PT6A 3H4MA 4OOFA 2IX9A 4DIMA 1P4RA 1F0YA 1P75A 2Y6VA 4G8DA 4ER3A 2YHUA 3LLSA 5F4ZA 3SBOA 1I7QB 3UA3A 2K7ZA 2CL7X 3MQFA 1E2JA 4HH0A 4TT3D 4A8TA 5B7QA 1TQ2A 4YECA 3QVMA 3DDCA 2C2OA 3MUNA 3P27A 4P4GA 5H5JA 1UFVA 1M2VB 1EM8A 1YS1X 2RKOA 2OUKA 2JD0A 5DM60 2P5SA 1YRAA 2O2CA 1VJCA 3I6ZA 2BUBA 3DYIA 4I5DA 3AHGA 5B2ZA 2X5NA 3ZWWA 1BVHA 4INPA 5I9BA 1J0XO 1MHPA 1ZR2A 4K7JA 5IKOA 5GV8A 1D4ZA 4DV5B 4IBOA 3VDRA 2YXBA 4H1VA 2QENA 3ECAA 3ZIUA 2A0UA 2DUWA 5H81A 1Y6FA 3LRXA 1SUAA 2NUBA 2PZFA 1QRAA 3B6IA 3I9FA 3JSXA 4LYYA 3WFIA 3VTFA 4UUPA 2B3DA 3I53A 1DQZA 4JXZA 2BM0A 3E2PA 2QP9X 1ENPA 3NC1C 2W6CX 4K88A 5CU7A 5A7GA 4BJ3A 3GLFB 4PLCA 4WV3A 5IBCA 3BVPA 3H5AA 1PLJA 1ZW1A 2QL7A 2B30A 5IW8A 3A6HA 4L5CA 4MGIR 4G4SP 1COWD 2FPGB 1TJYA 2F67A 2O2IA 4NJMA 4UBKA 5CA1F 4V2UA 4HPJB 5I45A 2VR1A 1EEHA 3O9MA 4BS9A 1XNQB 1DWUA 3COVA 4KKXB 5BY2A 4GHWA 1YZHA 4DCPA 5K0CA 5HDBB 1NR5A 3KC2A 3P0EA 4HN2A 3DHYA 2A4MA 1GZVA 1I01A 2FW8A 2WWHA 2Z4TA 3DW3X 3PX3A 2DHRA 1Q1AA 1U90A 1UT5A 2RI1A 5FOTA 3V4VB 4DMKA 2OGTA 4BNYA 4JBHA 4ZVRA 1NZJA 1XZGA 1XCOA 1CUEA 2HDNB 1IMJA 3JALB 4PR3A 2I71A 1OGIA 1NVTA 1XRSB 1YZTA 1P4JA 2WUWE 4G97A 1BA2A 2B1JA 4E5SA 2ZJ7A 4PU0A 1T4CB 2C8VA 3BBLA 3F6PA 5F9MA 1QH1B 2IUSA 5CIWA 1XPOA 4EJSC 1GIAA 4DC1A 1RI3A 1X13A 3G5UA 4GRDA 4ENVA 1WQ3A 2BD0A 4A5OA 1DCFA 2C59A 3K0FB 4WERA 2AFIA 4FFRA 3PXUA 4RSHA 4HLCA 5LYJB 4YFVA 1MENA 1FSSA 2WYUA 2PS0A 1TZJA 1C0PA 4IR7A 5CGQB 3DUFB 2AFIE 1N0WA 3GRFA 1IJKA 4JBLA 4TTQA 3KYCB 4U3JA 4RPGA 1A8QA 2R8PA 4CNQA 3PXGA 4G67A 4YAJA 2Q2WA 5C8YF 1QZXA 4JB8A 4D4LA 1QKJA 2R7LA 4F91B 3IAFA 4RA6A 4X92A 5E4TA 2IE8A 2YW2A 2NTVA 2ZRQA 2HHJA 2VJNA 1BN7A 1WBBA 1DWPA 4LTDA 1RTTA 1FLVA 3GYGA 2CL6X 3T9FA 3LY9A 4DLYA 1PV4A 1YQEA 2J4FA 5IBPA 1QYIA 4LE1A 3RIMA 1FRQA 2O3TA 2CXSA 5EESA 2PY6A 2OUIA 4N3AA 3WGVA 3IP3A 1RLUA 2H4WA 1KQFA 2EG5A 2WP0A 1Z4OA 4NBTA 2VPWA 2K2QB 4XVQA 4B84A 4GGMX 3RT9A 1T5HX 2J0UA 2Y9PB 1NI3A 3HFRA 3T9AA 4TROA 5IKMA 4E5DA 1BZYA 3IKVA 1XVLA 4UEOA 3BORA 2OFFA 4C7OB 1F2VA 1AQUA 4PBSA 1LLDA 3V6LA 1BXRB 4RM3A 2NOAA 3I37X 3DR5A 1DRKA 4Q24A 4AD8A 5HQ3B 1AKWA 4RVUA 2PJDA 1SXJA 3IAS1 5BSWA 2R4QA 5CIQA 4Q4HA 4POOA 3TSCA 4YAFA 3ZDDA 2KPOA 2ZAGA 1H2RS 5EIXA 2Y1XA 5GJCA 4XLTA 1OV6A 1SXJE 2RJOA 3IOMA 4YEDA 2GPNA 3K70C 4EG4A 4ZZ1A 3K4HA 2NUPB 3CE6A 3R3ZA 3LECA 3SOPA 1E8NA 1SKUA 1F2UB 2OQ2A 5AESA 4FZVA 2WJVA 1VL5A 1RLJA 3DKPA 3GT3A 2WK1A 1RJDA 2MTBA 5C37A 5A2QA 1YA8A 2FQ1A 2ORWA 2W11A 1YE5A 1SCDA 2OP1A 2QN6A 3GRAA 3KQSA 2AOXA 2OSBA 2IXBA 5IEBA 5KYUA 4BLVA 3L0CA 5KS2A 3CE9A 2IXDA 2YRFA 5L6MB 3ABIA 3CW2A 4GBJA 4IXDA 3TX2A 4CLOB 5M7EA 3H4TA 3I01A 1KORA 1Z06A 2JGDA 1RHKA 2PZJA 4FNMA 1UJ5A 4MW5A 4Q3KA 4CMBA 5ITWA 1SURA 3I9V1 1E1KA 4KQFA 5HQTA 3UMMA 5DP1A 3KCNA 3F8SA 3OIWA 4GDFA 2YN4A 4OOEA 3LP6A 4JJ6A 2O0KA 4U5QA 1J6UA 4B73A 1XTVA 1Z39A 2J6IA 2XZDA 4IIJB 3TSYA 1SQGA 1V41E 2Z1NA 3BQ9A 3DQQA 2QX9A 4YXWD 5I7AA 1SMKA 1FXSA 4IJVA 4CMHA 4YCSA 1LVHA 4J0QA 2UUBB 2UVDA 1W36D 3KFVA 2XF8A 5KJFA 3RSOA 1VPLA 1WY5A 5EMNA 4TS1A 1KFBB 3JZAA 3IQDB 2EFDB 4JVOA 4R8RA 4F4HA 1E3MA 5JZMA 1CERA 5FUBA 3A9WA 4QREA 1ZN7A 1OBVA 4N0EA 1L8OA 1RW4A 1C1HA 3JYQA 2A9VA 1BKYA 4HNGA 2GSDA 2GUWA 1DBQA 2AZTA 2CNOA 2VYQA 3Q41A 4GQIA 3QJ5A 3TDMA 2NTNA 4LZWA 3X1KA 3D54D 2LNDA 2J0QA 3I9V6 3L01A 2IOQA 2C0QA 2V7WA 5F33A 2PWBA 3WC4A 3RJ5A 5IU6A 2VH5R 3WGMA 4GD3Q 3COYA 1U7DA 3KSDO 3H2YA 3CUYA 2CDBA 4EWLA 3H8SA 2XQIA 3NIBA 1Y34E 3D4LA 3P9NA 1J5PA 4QHSA 2WHPA 4TLDA 2XCRB 3GV0A 3NP7A 1C3XA 4WVLA 1X9HA 5FR1A 2NT3A 4EG1A 3DC2A 3WQBA 1KP2A 1EWRA 5DGXA 1SUEA 4DIKA 1HURA 3VNAA 3FHLA 4TMVA 2EQAA 3KV1A 4ZHQB 4LC1A 4BE4A 3DDHA 4GI2A 5B1SA 1XD9A 1JALA 2OO7A 3VO9A 2R6FA 1LUAA 2VAMA 4N4AA 4M7RA 1EVIA 4QRDA 4DR5B 4G37A 4MKFA 2O8CA 3TLZA 1OZGA 3IO5A 3MD0A 4BFSA 4FI3F 1ILWA 1GZHB 4HAXA 2L17A 2H5LA 1QORA 3PFHA 4PZLA 2X86A 2ZWOA 1LQTA 3LTEA 3SYMA 4RZSA 2A5DA 3OBIA 1WBDA 1LRLA 1LBTA 1M2OB 2IVZA 2EP5A 3NEJA 1N5OX 4URWR 2AJLI 5EQJB 4QU0A 2BFCB 2FF7A 4JVSB 5ENDA 3SSNA 1XJ0A 1JQAA 3PFWO 1TD1A 1MD9A 3R0XA 3CCFA 1Q7GA 3H42B 2DLNA 4K28A 5DFAA 3PXAA 4CLDA 1XNRB 2MJLA 1JR4A 1ZN9A 3FWPA 4JBXA 4O25A 4UBOA 3USES 4CIDA 1PVDA 4CN9A 2AUNA 4O2RA 1V8OA 4BC0A 1DXHA 1V8BA 3D3KA 2UZIR 2BLNA 2ZANA 4X95A 3IRUA 1KRWA 3RRMA 3AEQB 2GZSA 2QT0A 3LCVB 5T57A 3QFRA 3SVZA 2QS9A 1ZI6A 3A8TA 1T8WA 1LVGA 4MYCA 3ZGLA 2X40A 2IUTA 5G40A 2SCUA 4G24A 4F1JA 1JG1A 2A6PA 4IHKA 1RRVA 1EVQA 4DSZA 4ND6A 1F60A 3L93A 2B21A 1JIUA 2A84A 4HFNA 3FDFA 2EKQA 1L5ZA 3ERCA 1LLUA 2VHWA 2JFGA 4V03A 4ZKEA 4O4HA 1D0SA 3AKCA 2RONA 4LKRA 4RZIA 3WJAA 1SIOA 4EPXA 3CG0A 3H8VA 1Z2CA 3V6MA 3QXGA 4YRZA 3TQRA 5K3OA 3K20A 1JJVA 1WXQA 3IT1A 4RWZA 4E5PA 1VLZA 4RTPA 3KS9A 4FE4A 1FUIA 2AX4A 2LDXA 2ZBFA 3SR3A 5CB0A 3IRVA 3VPCA 1CUJA 5JRJA 1PR1A 1V1JA 1VJRA 3EQ2A 2ZT5A 1V5GA 4K8RB 2QQFA 1JHMA 2C7GA 5L51A 1ZGAA 1GSIA 1ZQ1A 1ILEA 2OKCA 4DXAA 5EIEA 2OLKA 3PUJA 3WI7A 4DCNA 4GE3A 3PJFA 2JIZD 4DUGD 5KYWA 5C5DA 1P5FA 1DIHA 4QWMA 6YASA 1XZCA 2DQKA 4F3RA 1SBCA 3I83A 1NJGA 1U1CA 4UHKA 2VHCA 1NKSA 1G6Q1 4YPFA 3PYLA 4BXOA 4NCXA 1QBGA 4OP3A 1Q12A 4AJHA 4CQLA 4E94A 1XEWX 2C00A 5ITZB 2H06A 1CUGA 3RS4A 1Q74A 1KY4A 2ZYRA 4S05A 2PT7A 4H7JA 3RI3A 3OKCA 4QARA 4NARA 3E9CA 2G1UA 2ZB3A 3OM8A 3QFFA 2C0CA 4JH0A 4P5EA 2LWIA 2OD9A 4HDCA 1JJFA 2W2LA 5JCJD 2PVCA 1GQ2A 3P2EA 5L7TA 2G9QA 2H17A 3ZWBA 3JPWA 2GXSA 2X7XA 2JCVA 2E55A 1ZUNA 3EJ6A 4QEZA 3TX6A 2FEKA 2FR1A 4R54A 3TQQA 4I1SA 2QJTA 2IQIA 2BF7A 1E59A 1HMPA 1Z4PX 2BFPA 2EBFX 3N0TA 4H35A 4EEXA 1M1NA 4UXJA 4CDRA 2FWIA 3CT6A 2AFHA 4ND5A 1MGPA 1N8TA 2VZ0A 2IPLA 5IBQA 1KWKA 3EZ7A 4ZVMA 2UZ4A 3FGNA 5KOHB 5AO9A 2GCPA 2OFWA 4EVSA 3W3ZB 2AFHE 3NCTA 1NUSA 3RU9A 3RQSA 2WAXA 3V4SA 1EFPA 1ODTC 2CKDA 2PLWA 1AQ6A 5E1BA 5J1SB 1UCFA 2BDTA 3IQEA 5AXDA 3RUHA 1HEUA 1E1CB 2ZVPX 1MJGA 1X70A 3J7TA 1CLUA 2RCNA 5EHGA 1N92A 1PI3A 1DJNA 1WXGA 1Q6ZA 2GF9A 2SICE 4YAWA 4DLBA 3FSGD 2PFGA 4JR0A 4DZTA 1UBCA 2Q0QA 4KV7A 2D5CA 1N1EA 4ON9A 5DK6A 5HFJA 3IURA 1G9TA 2VDPB 1K7CA 3DZFA 3MGGA 1N0IA 4J9UE 1RPNA 5EWLB 5F1OA 4P33A 3GUZA 1KEPA 3S2SA 1OV4A 3LLUA 1U9IC 2CE7A 1FF9A 1ZI9A 2CBGA 5EWMA 5H16A 4B2IA 4QLAA 3ULKA 1YK0A 4MVJG 3K92A 3PDWA 1G3IA 4C4YA 5THXA 4PRZA 2GASA 3GU3A 1IQPA 3C5WP 3L8HA 5LFAA 1R4MB 2EYQA 1BMFA 3ZD6A 5AM1A 3VR6D 1QFYA 1AC5A 2H9YA 1SD2A 2H1WA 2QN3A 3K96A 2GEJA 4RK1A 5CT8A 3HGMA 4BL5A 1AUOA 5EOVA 4TWAA 4NMMA 4EYQA 3V1YA 2ACKA 4BFVA 4HFRA 3CH4B 1JEEA 2AOTA 1CF9A 3EFOA 4L0CA 3VYWA 2BVNA 2JGEA 3A58B 5KHOC 4TMZA 4U2FA 3A10A 4I55A 4RANA 1JH8A 2OV1A 3ZCTA 1N8NA 4CM6A 4BB9A 4BU1A 4DCMA 4MR8B 3TZBA 1ZJ5A 1C30A 1R8XA 2CMHA 4AY6A 1U04A 1VMDA 3GK3A 3H99A 3OZCA 3RAPR 3RW9A 4BEBA 3H3JA 2HDOA 5I4KA 3GVXA 1J21A 1IM2A 3ESQA 1IY9A 3AGQA 3O74A 4UJ3A 1NR7A 2C9DA 2FPPB 2ZRNA 4ZPJA 1U0OC 4W7HA 1MG0A 3OU2A 3LPCA 4UNSA 1DI0A 2X8AA 4KLZA 5E4YA 1C81A 3OC6A 1CR0A 3QE2A 1YJBA 4KAFA 3G79A 4KR9A 1DKQA 3HYSA 2EDCA 4RKWA 2F9LA 2YHBA 3PZBA 4L07A 3EVEA 2Y0DA 5DO9A 4WAUA 4YT4A 3NU1A 1C0EA 2D06A 4YJ3A 4YQYA 4DLLA 2J3LA 1M2NA 1K68A 1XNGA 3DNMA 4BJ6A 4DCUA 1X15A 4EK9A 4A0QA 3M4ZA 2IYFA 3QPVA 4FE7A 1L4NA 4G1CA 1O6ZA 4QICA 3DS8A 3BGWA 4XPIB 2ZPTX 4Y6QA 3V48A 5HJEA 3AJAA 2P2CA 1CQWA 4IKPA 5DT2A 1XLTC 2C58A 5BT8A 1TTTA 2WJJA 1MCZA 3DEHA 1USGA 3VI4B 3ICWA 4IXTA 5JWRA 5A4IS 3QUAA 1MH1A 1Z22A 3FHOA 1WHSB 3UJDA 4ZI5A 3U5ZB 4MYTA 4IEIA 4HRYA 5JU6A 2YWHA 3PD7A 5G0VA 3SQWA 1FU4A 5AKYA 5CH3A 4FDMA 4FYKA 4LC0A 3DDSA 1TU0A 2XD9A 3ECSA 5DOVA 3WB0A 4MUYA 5BP7A 1ZJWA 3H5IA 3EC2A 2QY9A 2AB0A 3PVSA 5DI3B 1D4FA 3JATB 1UWLA 2AD1A 3NUZA 1NVGA 3FFXA 3R7NA 1MT3A 3HY4A 3LUGA 3AHJA 3TPFA 3D64A 3A6GA 2B1GA 3D3QA 1YNOA 3B1XA 2KYRA 3BB4A 3PNVA 4PRKA 5HPYB 2FU5C 4GH5A 2PT9A 2WYOA 5HF5A 3A6LA 3KD3A 3KKNA 3KWMA 1WHTA 5E4FA 1BKSB 1U0JA 2OZEA 3JS5A 3ROTA 4CZ2A 1YBVA 1XL1A 2ONCA 3GBVA 3NUGA 3NWJA 3QG5A 1NJ6A 2PKYX 5E1OA 2VDRB 1U8CB 4MGYR 5LMCA 2B69A 2CUKA 2BM8A 3T94A 3DLHA 1M6NA 1H2FA 1NULA 2P78A 3EBPA 2O6LA 2W90A 2NU7A 3PQ4A 4G5YA 4MMXB 4G0WA 2PUFA 5JOQA 4KVGA 1M6EX 1ZVQA 4ZI7B 1QUEA 1L3BA 1TQHA 3LFTA 1L1FA 1K9VF 4UNRA 4JVLA 4ZC1A 4BBZA 3AHCA 2FFQA 5EQDA 4ME6A 2Z30A 3B2EA 5FL7A 1QS0A 1C7QA 3H83A 2VTEA 1JQ5A 2X9NA 3EAFA 1DEOA 3CPSA 2BE9A 4JZKA 4KIJA 5KTYA 4YJ2A 3QJGA 5AHRA 3BHNA 1M8JA 5LN1A 3STTA 3INRA 3MM4A 3I23A 3BSSA 4EDHA 2HJHA 5AM5A 5EJ6A 4HGZA 1Z82A 4KZKA 4MVJI 4DPKA 1QQTA 3E5NA 4CKWB 4X91A 2I0FA 3E5RA 5LZ9A 3QIAA 1Q95A 4FMCB 4GMXA 4D9JA 5A7FA 4LHXA 3ZJUA 3ITEA 5EI5A 3G8DA 1AMOA 1YF3A 2VRWA 2L18A 3OWXA 4R7ZA 1HDCA 2R1VA 3ZS9A 4AKSA 1XZHA 1H2WA 5L3SA 1TPYA 1XVIA 3TF5A 4KUEA 4Q66C 1YQ9A 5CYFA 4BLUA 4CL2A 4K2AA 5ECDA 4EGFA 2BDUA 2C3PA 4D0NA 3H1GA 1QQAA 3EFHA 1BXZA 2O0JA 3ZY3A 1USWA 3BF8A 3H2GA 3NOXA 1UAGA 1W5BA 4LF9B 2ZJ4A 3WLMA 4TN5A 3R3YA 3AKYA 2WE7A 5COAA 4DABA 2Z04A 5CBPB 3PNYA 4G26A 3P9RA 2OXRA 3NHZA 4II3A 1O54A 3AUTA 3B7WA 4LQ4A 4WECA 5J5VA 2PBRA 5GZ6A 1RR6A 3L4BC 1TTPB 1BXGA 5K0ZA 1QP0A 4M1YA 1XKXA 3IS3A 1KETA 1NJ8A 2IDMA 2QRHA 3LC0A 2HHHB 4MS3B 1NJFA 3C6QA 3G5TA 3GP5A 3EF1A 4CM3A 1JUDA 5D3QA 3UN1A 2RB5A 5HUJA 3FD8A 3MNFA 2IGTA 5BWOA 2PZLA 1Z6PA 5K2MA 3U4MA 1HYHA 2QPOA 3BD6A 1LB1B 4PS0A 5ERGB 3BDAA 1Z12A 1QVRA 3EVTA 3MWKA 3WGUA 4G0MA 4QPJC 2X4LA 5GONB 5I9MA 2ZM5A 1YDGA 2PZBA 3DAYA 3LSTA 5JC8A 1NNEA 3SF8B 2WA2A 2R4UA 4N3CA 3MF4A 2ISCA 3RRFA 5IDVA 2B4YA 4LF6B 5FDFA 2GILA 5TV2A 4KI0A 5DM4A 5JJKA 1I0ZA 2ATXA 3TQIA 2OYRA 4L22A 2PMWB 3MRSA 4C1BA 1OT3A 3RWBA 2GN1A 3PC8C 1FP4A 5FNVB 1G3QA 1GZSA 1Y5MA 3HMKA 4Q1FA 3SNKA 5LC1A 4HWTA 5T4BA 3VO2A 3A1NA 1CFJA 4DQVA 2XDQB 3EXG2 5KQSA 1V8ZA 2BZ1A 3FBWA 4K05A 3RQIA 2GETA 1GLVA 1RKBA 3DA8A 4RJ2A 2LD4A 1TYZA 2IP4A 1NVUQ 1IXSB 5B3AA 3DEIA 2XIJA 4KE8A 1T25A 2YJZA 5I7WA 3FOCA 4XYGA 2CLLB 3GRZA 1EPUA 4I1PA 3B13B 4YRBA 2FPMA 1MQ9A 4EPTA 1Q11A 1J97A 1P5ZB 5L3RA 1MOPA 2FUCA 4QA9A 5TIIA 3MOIA 3MT8A 4BNVA 2IITA 4MJXA 2QTVA 1E3TA 3GDFA 1WUJS 3DVLA 4WEOA 3P9ZA 2H4YA 2X13A 2AZDA 4OD0A 5ALMA 3IVXA 1E0KA 2BMVA 1MQAA 1HC7A 4PG6A 1VSVA 1X7WA 2O5RA 3BRWD 4J90A 1TC2A 4ZOLF 1GL3A 1PK8A 1VE1A 2VJMA 2Z2ZA 1KO4A 1KO8A 1XXLA 3LC7O 4UAVA 3QVOA 4C5CA 4EX6A 2GM4A 2WFLB 4IX1A 1NY5A 1YO6A 3C3WA 5TQJA 3NVMB 4PVCA 5EJEA 1N77A 4HFJA 3TB4A 5IAOA 3UMVA 1KTVA 4UD6A 1C0LA 4YRGA 1OSNA 3HWSA 4XWAA 1G4UR 2ZRMA 3TBFA 3TYXA 2BKLA 3ONNA 3N8NA 2OMEA 4I50B 1NONA 2DTDA 3Q3CA 4ZZ2A 1B23P 4MCJA 4U7PB 1SEVA 2AUTA 4ZREA 3CYFA 4GSYA 3ZJYA 3ICOA 2CLSA 4IQFA 4KNVA 4PF1A 2W2QA 4YMIA 5DGTA 4AURA 1PAUA 3RYCB 1IBMB 3OLZA 3T0FA 1A8HA 3FSJX 1LQ2A 4UVGA 1ID8A 1W85B 5L8VA 5CUQA 1T5TA 3DVSX 3PUKA 1KJIA 3ITDA 2V4ZA 4NBRA 2G83A 4Y1RA 2QVLA 5F12A 3RJZA 2BFBB 2XNHA 3HCAA 4ZARA 1N9GA 1UMCA 2Q6LA 4TYPA 1YUNA 1EXNA 2FG7C 3W5HA 4J7AA 3P26A 2YCBA 4IUDS 2C7RA 1PNVA 2AEFA 3HKDA 2ZFUA 1IXKA 2PUWA 4H1HA 3EXHA 4HN4B 1RZRA 2QG6A 2DWUA 1O5TA 4C3UA 4C6HA 5CT9A 1U2SA 5D5QA 3TO5A 2R65A 1Z36A 4JMPA 3GJ4A 2MINB 2B94A 2BC9A 1K4YA 1SZCA 2QW8A 5HCIA 1IDN1 3SN6A 2XYQA 1US8B 3DAHA 1EVEA 1C0KA 1IEQA 2XODA 3LBNA 4PE5B 5L4LA 3E2IA 2QQEA 2ZTUA 2ZPUA 4PGHA 4MP6A 4BMPB 4DCTA 1BSVA 1PR3A 5C7IO 5BRNA 2BFOA 3P96A 3A27A 4AFNA 3JWHA 5M34A 1I5EA 1WMEA 4OY3A 1OA0A 2JDIA 3P4YA 3DVQX 2F4VB 1OAAA 3EGCA 1L5VA 1YKFA 1PTJC 1U9YA 4FGUA 5B7NA 1L4FA 2PX3A 3GJRA 4G1EB 3SE0A 1O8BA 1CS0A 4C0XA 2QBYA 1L4HA 4XJXA 3L8DA 2ACEA 2JLQA 4QRHA 2EFHB 1Z8DA 4C30A 4IIVA 2XQGA 2J1LA 4ZXFA 4EFDA 5M2QA 5T64A 3IPXA 3TTYA 4IGAA 4LRQA 4RH0A 1KOFA 1NX6A 3K4PA 3OT1B 4DMMA 4LXQA 3HY3A 3F96A 5KNDA 4MQUA 3A9VA 2B20A 2C5SA 2HWXA 5HGXA 4J7UA 5IJ0A 2P1DA 1Y9AA 2ZB4A 3JQ9C 4FC6A 5JEEA 3DE1X 1W0KD 1G3UA 3THYA 5LP6B 4IFTA 5CNIA 3OZFA 3RFFA 1SRRA 3F2VA 1HTBA 4NK5A 4X20A 1YI1A 3ZH2A 4CFSA 5KYXB 2GBLC 3Q3IA 3HBAA 3QUSA 4Q1EA 4M7PA 1TTQB 1G63A 3UWKA 1W25A 5D7NA 4CV3A 5CEEA 5A9SA 3U9TA 1C2YA 5CVVA 4EFLA 1T2VA 3B8HA 1OLOA 1U9ZA 1HSZA 2QTFA 2E4UA 3F6BX 4LYFA 2WAOA 4ZRDA 1OXKB 4UTRA 1G5IA 2WM9B 3EEIA 2QAGC 4FD2A 4BQOA 1IQUA 4TM8A 4R7GA 3NRJA 2YBDA 3IXLA 1H9CA 1YS6A 2H1SA 1LPBB 1QLJA 1VPDA 3E7FA 3EVAA 3F1KA 1OI4A 5DCUA 3OE5A 5J2UF 1CCWA 1PZXA 4Y9TA 4LRTB 1IK4A 3WYNA 1Y9JA 2CB0A 1J2JA 3AK4A 3QEJA 1DTWA 2ZPAA 4Q1VA 4EHNA 3ZJVA 1CU1A 1HNWB 1PZGA 2OR3A 2R7MA 4H77A 2ZI5A 3ACCA 4MPPA 1D8TA 1UZAA 3VZQA 3IBGA 2X8JB 3X1YA 3KQTA 4JXXA 4WKOA 3UK0A 2JLSA 3MB8A 4H9GA 5AVKA 5C5EA 4LX0A 4ZVUA 3FJOA 1PEDA 4LTMA 3AONB 1Z5UA 3VAZA 4AXXA 5BV7A 3QEMB 1Z6YA 1KEVA 4N0PA 3HCOA 3OJOA 1N1DA 3PJDA 4HZIA 4NULA 1VMIA 5CXSA 3CVOA 4CM8B 4YR9A 2N75A 2VBCA 3BWCA 4FCWA 4KFSA 1V25A 3ZH9B 5EPEA 2QVGA 2RGXA 1Q20A 4F5DA 1MABB 3UK2A