4QYWA

Structure of phosphono-chey from t.maritima
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
118
structure length
117
Chain Sequence
GKRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTMITMPEMNGIDAIKEIMKIDPNAKIIVASAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chemotaxis protein CheY
publication title Isolation, Phosphonomethylation, and Crystallization of phosphono-CheY from Thermotoga maritima
rcsb
source organism Thermotoga maritima
total genus 41
structure length 117
sequence length 118
ec nomenclature
pdb deposition date 2014-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qywA00
3Q41A 4YLEA 4XAQA 5IEBA 4MRMA 5DCLA 1CEYA 3P9YA 2QXYA 1S8NA 4HYEA 1D5WA 4FB4A 1LK0A 4MQEB 4NQRA 4W5TA 1CYEA 1Z26A 2L19A 4HNQA 1HEYA 5D2CA 4QYWA 1NXPA 1L5YA 3M9WA 3OQOA 5EWJA 1NY5A 2OENG 4RY8A 4IILA 1JH9A 5HKOA 3T6KA 4KV7A 5TPWA 1M5UA 5IULC 2V0NA 3RVRA 2JB9A 1SD5A 5CNIA 1URPA 4KREA 3M6MD 3GBPA 1W9HA 2LP4Y 3MYYA 4OTZA 2CWDA 3Q15C 1RZRD 1EFAA 3KYJB 1MVOA 4MLCA 3LUKA 3GYBA 5KI6A 4Z4CA 1JX6A 2QU7A 3HM9A 2IDMA 2WB4A 2NUBA 2PUAA 1KRWA 3HK2A 1R8JA 3UK0A 1ZHHA 4KQCA 4DN6A 3O21A 3D8UA 5HM6A 2QV0A 2FMFA 5EWLA 3FDFA 1ABFA 3OMXA 4MR7A 4Y9TA 1ZY2A 3EDCA 3RVJA 1JWLA 1QO0D 1GUBA 4HNSA 4MYRA 2MYUA 1LJLA 1ABEA 4OG2A 4WZZA 5CNJA 3KLOA 3N0XA 2PE5A 4MS1B 5I4CA 4MS4A 3C97A 1EWKA 1QP0A 2MYNA 2PJUA 3C3KA 5IUJC 3LFTA 1KGSA 2WJWA 3SAJA 3L49A 3ROTA 1BDIA 3T8YA 1LBHA 2PLNA 1M2EA 3KTOA 3MF4A 3BBLA 5JNTA 1FFGA 3UUGA 4N41A 2FN9A 5TQ0A 2FXIA 2GKGA 1SXIA 1DRKA 6ABPA 3Q9SA 3H1EA 3DGEC 3SM9A 1ZESA 5DKFA 4EYKA 3IPAA 3BILA 2CHEA 4ETMA 4ETIA 4EYQA 3QEMB 4QPJC 4IF4A 1ZGGA 1XHFA 1LJUA 1ZVVA 2A9RA 3CNBA 2FW0A 4L4UA 4LE2A 2HJ9A 4UHJA 1E6KA 1TMYA 3CKMA 3FFTA 1F4VA 2RDMA 4YV7A 3LUHA 4Z4HA 3TX6A 4MQEA 2XDYA 2QZJA 4EVSA 3NNNA 1C0EA 2PUGA 4RV5A 4N76A 2NZUG 1AB5A 4Z9AA 3O74A 4MLDA 3TMYA 4ML3A 1P6QA 2IPLA 4RK7A 3F6CA 1JF8A 3VNBA 4ZPJA 1DZ3A 1MIHA 4YO7A 3SG0A 3MQ4A 1FQWA 3N0WA 4WXEA 4Z4EA 1YK1A 2VK2A 4IMJB 3OO0A 2RJNA 4KMRA 1FFSA 3HXMA 1USIA 3EQZA 1W25A 2FEPA 1NXXA 3DLHA 5KQGA 2W42A 4Z4FA 4W5NA 3H6GA 3QX8A 3F6PA 4W5OA 1DCMA 3IPCA 4EGSA 3LUGA 3EQ2A 4GNRA 5CHYA 1RNLA 5JNRA 4XLTA 1E6LA 4RZSA 4XARA 2RGYA 1EWTA 5ABPA 1L5ZA 5ED4A 1GLGA 3DLBA 2FMIA 4ZYLA 1ZAYA 1WETA 2LUOA 1OXKB 3HEBA 3HJFA 2PKXA 3FFWA 5JS1A 5DTEA 4G0OA 1YVUA 2WJAA 1RXIA 4RY0A 3UKJA 4B09A 2MYPA 1Z2DA 3H1FA 1QP7A 2QVGA 3LUFA 3OLYA 3O75A 1JL3A 1QNLA 4RU1A 4JB2A 3OQMA 3GRCA 2QVCA 4MS1A 3I42A 1Z16A 3C3WA 1QPZA 2NT3A 1MB3A 3GT7A 4LX8A 1ZH4A 4DADA 9ABPA 1GCAA 2PUFA 1PEAA 1SXHA 4O5AA 4IRXA 3HO1A 3JVIA 1D4ZA 4LE1A 1NXWA 1D2AA 2I6FA 3EULA 3JPYA 4F11A 3LUDA 8ABPA 3T95A 2YHAA 2JBAB 3IDOA 4ZJPA 5KWSA 5JNSA 1EWVA 3Q7RA 1QKKA 4FE7A 4MQFB 4RK5A 2LPMA 2ZWMA 1JFTA 3LTEA 4MR8A 5CNMA 5TPZD 3QEMA 3RVNA 3TO5A 3GA5A 4UHKA 4F06A 4EY3A 3H5VA 4EYGA 1VKRA 1A04A 1YMVA 3LUJA 3N75A 1DCFA 1Z2EA 4MR9B 1FSPA 4NCAA 3S99A 1AB6A 2VUHB 3A0UA 4G0PA 3OM0A 1NXTA 1JFVA 1Y1LA 2HQBA 3H75A 2PUEA 4D6XA 3IP9A 2WMYA 3RVLA 4WWHA 1Z18A 2PUBA 3H5OA 4N47A 2FLKA 1RPJA 5IBQA 2QSJA 4D6YA 4W5RA 3IP6A 1QQBA 1PNTA 3EJWA 4XASA 5FWXB 1U04A 3F7NA 1JFSA 1YTUA 1A0OA 1GCGA 3BREA 3CLKA 1B00A 4LDAA 4RXTA 1JYEA 4YP9A 3ROFA 3O1HB 4XXHA 4RXUA 1EAYA 2J48A 2JVJA 3HCWA 1DJMA 1DBPA 1KRXA 3LKVA 3HVRA 5FBKA 4N0PA 2IKSA 1JYFA 1TJYA 1BA2A 2PMCA 1NATA 1Z15A 3C3MA 4KVFA 6CHYA 2MSLA 1J56A 3Q7TA 3RVKA 2HSGA 4MPTA 1SRRA 5FWYB 4G0MA 3CHYA 3MIZA 4G97A 1YIOA 4KNYA 4IMIB 1QMPA 2FVYA 3K9CA 2H3HA 2ZAYA 2O20A 3A3KA 4O1IA 2FEKA 2PL1A 4MS3B 4LRQA 3I09A 1BDHA 2ID7A 4ETNA 3CRNA 4NICA 4W5QA 2MSWA 3LUAA 4YCSA 5B3JC 2IOYA 3QELB 3N0RA 4HNRA 4M88A 3CG0A 4QICA 3ILYA 3SNKA 1YMUA 4RXMA 3H5LA 4RKRA 4KQ9A 3A0RB 4RWEA 3BRQA 3LMKA 2ID9A 4EVRA 2E4ZA 1LBIA 2NT4A 1F51E 4H3HB 2GBPA 4TMYA 3O2SB 1VRVA 4Z0NA 1QQAA 3CZ5A 3HUTA 4G0ZA 4PE5B 2FMHA 3LUCA 4MQFA 5F64A 3JS5A 4NCBA 4RK0A 3I5AA 3N8IA 1ZDMA 3HZHA 2PAFA 5KQPA 2FN8A 4CBVA 3JTEA 3H5IA 3NHZA 1Z13A 4OBBA 4WT7A 3KYIB 4MR9A 5TPWB 3R0JA 4XFKA 2AYZA 3I45A 3L6UA 2YHBA 3QLVC 4ZMRA 2PUDA 5JNWA 5C5CA 5C5EA 3KS9A 5BQ3A 4JAVC 2JRLA 4JP1A 5DGCA 1ZN2A 3EAFA 4JA2A 5TQ2B 1P8AA 3KG2A 3GWGA 5HQJA 3RH0A 3RVMA 5TQJA 3BRSA 4IGAA 4L85A 3JY6A 2FQWA 3DGFC 5FWXA 1RZRA 3KLNA 1JDPA 4N0QA 1QP4A 1TLFA 1T34A 5JNVA 2M98A 4YRZA 2HPHA 5HSGA 1E6MA 3C6QA 3QLUC 2GI4A 1ISRA 1XHEA 3JPWA 2IPMA 3OLWA 2FTKE 1RXEA 4LZLA 2L17A 2A9QA 4S05A 3KHTA 1U8TA 3OLVA 3MA0A 1QO0A 4MS4B 4YGXB 3OLXA 5T7BA 1M5TA 4KRFA 3QX9A 3Q7SA 3SY8A 3NNDA 2HQRA 5B3JA 5IUNC 1VPWA 1NXVA 1DP4A 2MYTA 5GOTA 1D1PA 3URMA 2E4XA 2BGGA 4D74A 1NXOA 1DBQA 3G1WA 2E4YA 3MMNA 1C4WA 4KK3A 3RVSA 3NBMA 3FMVA 3T38A 3HV2A 2MSKA 4KK4A 3HUUA 1USKA 3QELA 3O1JC 2FSPA 4F8JA 2E4UA 4EVQA 1FFWA 1U0SY 4Z9BA 1I3CA 1JBEA 2JK1A 4RK6A 4OATA 4PYRA 4RK4A 3RVQA 3EGCA 2VUIB 4N03A 5JS2A 5IEJA 2R4QA 4WXMA 2RJOA 4Z4IA 5FBHA 3DZDA 3W9SA 4NV3A 2F8SA 1GUDA 3FFXA 3QLVA 4YWHA 5GQSA 2PL9A 1BAPA 3IP5A 2GX6A 4P98A 2E4VA 1NXSA 1D1QA 4E7PA 2P4UA 4H3KB 1JHZA 3CFYA 3CG4A 1IIBA 5EWMB 4YR7A 2R47A 1MB0A 3HDVA 2FQYA 3CS3A 3GL9A 5TE9A 2FMKA 1P6UA 5TQ2A 2N9UA 3QLUA 3OLZA 4G0QA 4RK1A 3KSMA 3DBIA 2F8TA 2R25B 3E3MA 4Q7EA 3M9XA 3VNAA 3KCNA 5E3JA 3F73A 3LKBA 3TB6A 4PZ0A 5KC9A 5KQMA 4PEVA 2VYCA 1UDRA 2FLWA 3H6HA 3CZCA 3GV0A 4RDCA 1Z17A 4RKQA 1U2PA 3OQNA 2JVKA 3FGZA 1DC8A 1Z12A 2L2QA 2B4AA 2L18A 2IYNA 5DLEA 4EUKA 2FQXA 5KC8A 4RSMA 4KZKA 3KKEA 3RVOA 3NNSA 3O1IC 3JVDA 2WY2D 3H1GA 1XWWA 4EYOA 4KFCA 4S04A 2OQRA 3ILHA 4MRMB 4YS6A 3O2QB 3A10A 3EODA 2LIVA 1YS6A 4DQDA 4Q6WA 2CHFA 5T3YA 2IPNA 5IX8A 2JBAA 1A2OA 3MM4A 2FKAA 1DRJA 2NZVG 1PUXA 1CHNA 3NHMA 4Q6BA 1YK0A 4OLAA 5EWJB 3KJXA 5CNKA 4MR8B 3OO1A 3CTPA 1Z25A 5BR1A 5BRJA 1EHCA 5TPZA 1E2BA 4MAAA 1JLKA 1APBA 1DCKA 1TM2A 1U2QA 1JDNA 4RY9A 2AYXA 1ZGZA 3H5WA 4WUTA 1USGA 4LE0A 5BRAA 1K66A 1YS7A 2M1ZA 4G0XA 3HSYA 3RQIA 4G0YA 5JNUA 2JCGA 4H60A 2Q5CA 2R48A 4RS3A 2CD7A 1H9CA 3O2JA 4F12A 1DC7A 4TN5A 4MGEA 1M2FA 3IP7A 1DG9A 3SQNA 3TD9A 4FE4A 1SXGA 3OMWA 3N53A 1DBWA 3K4HA 3H5TA 3QEKA 1KMIY 1K68A 2WWVD 4OLBA 4JASB 2TMYA 1P2FA 3HDGA 3OM1A 5EWMA 4KPYA 1PEYA 2LBPA 3RVPA 2PUCA 1PHRA 2X7XA 2P9HA 3CU5A 5EWLB 4MR7B 2QW1A 2JVIA 1MAVA 3GBVA 2GWRA 2IPAB 2KYRA 4JOQA 1ZH2A 2FEWB 5FWYA 4TLLB 5IUKC 5PNTA 1PNRA 2H0AA 1ZITA 4LDZA 5IC5A 3QK7A 2A9OA 4QYMA 2E4WA 1NTRA 4Z4GA 1BVHA 2QR3A 2A9PA 4MS3A 3LOPA 3QLTA 4F3TA 1OXBB 4E7OA 3N6VA 2B1JA 1ISSA 2HQOA 4TLMB 5TQ0B 3HS3A 2DRIA 4O1HA 4ZMSA 3B2NA 4JB0A 4G86A 4PICA 4P1ZA 5KQLA 1VLZA 1BDJA 3D02A 4GPAA 2WRZA 3G85A 1TVMA 4Z99A 3E61A 7ABPA
chains in the Genus database with same CATH superfamily
2FWPA 1WB4A 1UJNA 3OECA 2FRXA 4MRMA 4N8EA 4MSUA 1ECBA 4BO1A 3GMTA 3SEZA 4C3ZA 4Q16A 2Y92A 4W5TA 1NY6A 1T8TA 4CG0A 3DBHB 1C2YA 2IX3A 4HUQB 3KP1A 3D3JA 4JBXA 3CYFA 5D2CA 5FH9A 1M2NA 3DOHA 1CJVC 2P65A 1PFGA 1RT9A 1WHSB 3I92A 4KWTA 2XJ9A 4O4IF 3SBDA 3BIXA 3IC5A 1ISIA 1NJ5A 3NPAA 3PHGA 4BWVA 1Q0UA 1Y6RA 1PJAA 1U3DA 2EKBA 1BXZA 2GYYA 2PVCA 4PU0A 5GM2A 1WVIA 5FQOA 4B80A 1AA9A 5HZHA 2WM9B 1GQQA 4LTMA 4MYUA 4XGIA 3ZLTA 4LRWA 5CNIA 4BLTA 5EKTA 4LNAA 1N36B 1EP3B 3R6TA 2HMWA 1RIFA 4NOJA 1NVKA 3MRSA 2JAUA 3JAKA 5B64A 2ARKA 2ODAA 3HWSA 2LXNA 3O8BA 2GVZC 4IIDA 1MVOA 4QYIB 4P2GA 2I2WA 5D3KA 5DTJA 3QVOA 3TLEA 3VAZA 4BQPA 1V8ZA 1ZVQA 2VWPA 3GYBA 5JEEA 4QRDA 4R98A 2HJVA 2V96A 1O94D 2RGDA 5ER6A 3BHJA 2WU0A 5I4BA 1MOSA 5EZ6B 1FP4B 2DR3A 3BORA 3D5QA 3D8UA 3EIFA 3N58A 2PWBA 3OZCA 4CN9A 5K8IA 2YJ3A 1H6DA 5JBIA 4WZBB 4RD0A 4ETWA 3IL2A 1OHHA 3BD6A 1B8NA 4GKBA 4FQ5A 4JOSA 4FX2A 4QUDA 5AKZA 2QE6A 2ZVDA 2OP0A 4MB0A 4N6GA 3RRJA 4NXNB 3NV9A 3FR8A 2OD9A 1AY0A 4YVFA 4DV2B 3WMEA 4FOTA 3S40A 2PXHA 2HV9A 1F06A 3C6ZA 1M8GA 4WNCA 4NBRA 1U2RA 5IUJC 1CPYA 2VAVA 2DYKA 3IOEA 4TRNA 4ZK6A 1Z29A 3PXEA 1UPFA 5I48A 1C3OB 3F49S 1S4MA 2GPNA 1RTTA 2WD7B 1RWVA 5AW9A 3KAKA 3LQQA 4EP1A 4M49A 4PGFA 4OP3A 4A0FA 2JBWA 1YQEA 3U4CA 3J7AC 2NU8A 1N8SA 1JN0A 1RJ9A 4AUNA 2W0SA 5DXAA 2ZJ5A 4EYKA 1E4EB 1QC5B 1E5VA 1FMTA 3ZX4A 1XQYA 1CS0B 4IO1A 2W6IA 2IYEA 4JGBA 4XPIB 2B8TA 3K53A 4JIMA 4KN5A 4PGHA 5KVSA 1ZVVA 2FW0A 3GDHA 1B8UA 2R6GA 1XTZA 3CNHA 3K96A 1NPTO 1TMYA 5CYPA 3CNOA 1ZCJA 2IJGX 4YV0A 1H1DA 3LXRA 3ETLA 4YV7A 1K6JA 5CFPA 3ZE0B 3IP8A 3OQHA 4L5CA 1Y1SA 1JFRA 3O2NA 5C52B 2PUGA 2YFQA 5B58C 1A5AB 4CKCA 1E79D 4MLDA 1MRZA 1PUIA 2VDKB 2OKGA 4QOIA 4C4SA 3G8YA 5CYOA 1DFHA 2HUNA 3RG2A 2JW5A 3EVGA 2FPRA 3BMCB 4IWYA 2IITA 4TMKA 4EJ6A 3KQTA 1RLOA 2E2WA 2VRNA 1FQWA 1QFMA 1TZKA 2DTDA 3ETNA 4OQPA 4RSHA 3RRZA 4BVHA 1W36B 2ZZKA 4F84A 2YMQA 4CIXA 5IT5A 4GI5A 1T5IA 5EE3A 4BIIA 2CXNA 2EJTA 1FU4A 3DG9A 4A03A 3N9IA 2VQ3A 3CRVA 5KQGA 3H6GA 2JGRA 3IVGA 3RW9A 4ZEMA 1HNWB 1WUHS 3EXG2 2AG0A 3KSBC 2WJ4A 4UPVA 3PNLA 3RFFA 3G13A 3TQIA 3VO1A 2PAAA 3VM6A 4AJ4A 3PE4A 1Y9ZA 4NDAA 4N5HX 4RZSA 1KJ8A 1CRLA 1MB2A 4M9UA 2RGYA 4RIIA 5HIJA 4KITB 5EIEA 3NZEA 2DFNA 3DA8A 4QFCA 2FP4A 2B34A 2FPSA 4LJAA 3RC2A 1T3LA 5KYKA 4X41A 2JGKA 3TVTA 2GH1A 2R79A 3HEBA 5DHQA 4JLSA 4GKJB 4LC9A 3I01A 4AJ2A 4BO6A 2P9QA 3OOHA 2C3MA 1AURA 1CY4A 4OJYA 3VC3A 1NURA 4DREA 2Y1KA 5JC8A 3HDHA 4ZO4A 1DJNA 4CKEB 1Y4UA 5DM1A 3AT1A 3WYNA 3F5FA 3P71T 3FY4A 4YAFA 5TMPA 3WFZA 2AR7A 3I42A 3KK0A 2DOKA 3IOCA 3NOQA 1R37A 1XTTA 5BPHA 1TTPB 1BCSB 1AMNA 3I61A 3LX4A 1MN6A 4LX8A 4WA8A 2NAFA 1WDTA 1X3LA 1AK9A 4Q1EA 3IQXA 3VR4D 5LQCA 5FPTA 5EJAA 5DNVA 4FE3A 4O5AA 2GFQA 5JLAA 5AVWA 3ZVMA 1H2EA 4WZ6A 3JPYA 2QUKA 4B0PA 3ND6A 4YAUA 1P73A 1M0SA 2ZBUA 2OZPA 1CETA 1RYFA 3EZLA 3GLRA 3VPXA 1DXOA 2A30A 3HNPA 4TYYA 5JCJD 1UPBA 3BSWA 1T25A 1Y5MA 1QKKA 1YZVA 4H4CA 3R76A 1V3TA 3W6ZA 4DMCA 4I55A 1L6RA 3TO5A 5IWCA 1CFJA 2BFCA 2HU7A 5LP6B 5CM2Z 1VIMA 2VDUE 2PXCA 4MR9B 2AQ8A 2R3SA 2XCIA 1UBNA 3JZMA 3ZVKA 4MMYB 4L8WB 2FUEA 2JG3A 3PPYA 4AZTA 2FWBA 4XJSA 1NAIA 4CM6A 3TFWA 4E1BA 3QJ5A 3NH9A 2VWQA 1T9GS 3NC0C 3W3ZB 3RC7A 2DGDA 3OP4A 3TAHA 3V46A 1DLIA 2EFDB 1G38A 4Q9AA 5HR5A 2HIMA 4MYHA 3K2BA 4XASA 3V2UA 1TQ2A 2F1OA 1PD0A 2QL7A 3E1KA 2BM8A 4IDQA 4M0PA 1U9IC 3HV0A 2ZS7A 1CQJA 4TMFA 4A0SA 2Y27A 2Z09A 2GPJA 2RK6A 5FL7D 3RJ9A 1XEXB 4IS3A 3VTKA 5REQB 1J00A 3DXZA 1JS1X 4YP1A 3EA5A 1J2RA 1SVLA 2Q3LA 3L01A 4N0PA 1K8QA 4RWZA 2Q5JA 1RYZA 2BI4A 4NMWA 3R3HA 4F9FA 3OOYA 3LOQA 1RMYA 1N6OA 1Z4NA 1SRRA 1PFKA 2H5EA 2GD6A 3O4RA 1YOVA 4Q9NA 4Q3EA 3OIVA 1PJRA 3U48A 2HQSA 5D00A 3CUYA 1QNFA 3ZWMA 1L4YA 1CQIB 1UAYA 3DEKA 5DVZA 3WQRA 5AJUA 4DMFA 3QVLA 4QNRA 4I4TF 1I5EA 4BKQA 1FSZA 1K7EB 4CM8A 1JQBA 3KQMA 4NICA 2AH5A 1GILA 3L6DA 1P74A 2GCEA 2RIPA 3PHIA 3L0BA 4KQHA 3I2JA 3IEKA 3IOMA 3ABRB 3KWMA 4TTRA 2Z9DA 2ZBRA 3A7EA 3N86A 5FBQB 3SIWA 2PMDA 4HH0A 2YNMD 4G37A 3B6IA 3RUFA 3BGWA 1TD1A 3OZBA 1PGPA 2FI1A 3H13A 1RHKA 4HNTA 4CHTA 4X00A 1CLUA 3I0NA 1GG8A 4CYMA 2FFRA 1GXSB 4PE5B 1DTWB 3LBNA 1E2PA 2CY0A 3DOEA 3NTLA 4J0KA 4ZT5A 3ER6A 3TLYA 3C45A 2WFLA 4AQDA 3LDHA 2OD2A 1DCTA 1Z8DA 1JI3A 1DQPA 4UDNA 3O8OA 3FDJA 4HX9A 3GEHA 2TMDA 4K9RA 3T7IA 5JFOA 1J8DA 2ZTLA 4IIBA 1XLWA 2VPYA 2AYZA 3IUQA 4TL6A 3TM5A 4IDHA 3VO2A 1MJGM 2LNDA 5K0EA 4RQUA 1NQXA 1MHPA 1BWSA 2BHSA 1SU8A 3BMQA 4RF2A 4G1EB 1NBMA 1PLLA 1UF9A 5B1DA 2J9XB 5JCOA 2DF8A 2G5CA 2Y1OA 2AN5A 3TLMA 2BDTA 2PUTA 2Y0PA 4OHMA 3JQ8B 1JHVA 2ZI3A 3JQGB 5A3SA 1XDUA 1UBGA 2PU7A 3V4VB 3MCWA 4KYTA 2EP5A 5JNVA 4HNHA 4LQCA 4WCVA 5J1SB 1IAVA 3B1KA 2WLSA 5JY6A 3IE2A 2YCBA 1S1CA 1XVAA 3KFLA 3PQEA 4K28A 3WRYC 4CKXA 4YT4A 1CJCA 4Z49A 2REOA 3AR6A 3KM0A 4N65A 3NGLA 4A6PA 2L17A 4RKWA 2BEJA 1I2CA 1A9TA 3G1UA 3ZNPA 4F6RA 3QMVA 3HYNA 4V0NA 3KOXA 3W3AA 2QQ0A 1ZNYA 3GRRA 4KGVA 1KZ7B 4RLSA 1EHIA 2O6HA 4NZYA 2CFSA 4J94A 2O8FA 3AQ4A 1J8FA 2P6MA 4WOPA 3P96A 3AG5A 4JXJA 4K9KA 2EQ5A 3BSSA 3HP1A 2OP1A 1BYUA 2LTAA 3FWYA 2FPMA 1WUTA 4IFEA 1VRCA 1ZICA 1DP4A 3KKZA 3FETA 4IGFA 5M5BA 4MP8A 4A0RA 5JRJA 1OV6A 5B58T 3D4LA 2JLVA 4DTIA 2BCJQ 3A1NA 5JO0A 1UMCB 3D2BA 1NUPA 2O8BA 4XSGA 2O8CB 4UASA 1DKUA 1U0BB 1IM2A 2AG8A 4AQYB 4EVQA 3MGKA 3P19A 2ZBFA 4ZT4A 1UMDB 1FVOA 3CUEF 2Q9AA 2FAXA 2ZDHA 3OFVA 2JGDB 4PG5A 4QBFA 4UFPA 5JYEA 4QEZA 5FHQA 5IXJA 3MT8A 2PFSA 1FX1A 5BWOA 4LOAA 4FZRA 3BDIA 5C8DA 3S2SA 5IHXA 2IVZA 3UCXA 3GP8A 1YI8A 2R4QA 2QUJA 1ZK2A 5ANRB 3AI2A 4BE4A 1HDXA 4ZCMA 1PS8A 1D2HA 1SKYB 5JAPA 4KQFA 3KLBA 3L4BA 4IDNA 2HJGA 4NV3A 4OB8A 5ARCA 4ZVPA 3FVWA 4TROA 3RSQA 2K5UA 1XP5A 3QBDA 1RHQA 4UUQA 1NW8A 2IHNA 5FPPA 5FQNA 4RPCA 4BQOA 1AV6A 3I6QA 5TMDA 3FB4A 3WR5A 4BRWA 1PG5A 1JDBB 1P5ZB 3ZWPA 2X4DA 3L7AA 5KX5F 3AFIA 2QRGA 3QI2A 1M67A 4P35A 5F7ZA 5JWRA 3EMBA 2EYQA 1EX7A 1KDRA 1X2EA 1J0DA 2W6MA 3M6VA 3FCSB 4ENPA 4EL0A 3WWOA 3N8GA 2LKDA 2WJIA 4BX0A 1A7AA 5HK8A 5TE9A 3RJTA 1OH5A 4B8WA 4EYSA 3PUJA 2IDKA 1KIMA 3VHXA 2X0JA 2X8BA 2AKYA 3O83A 4L74A 5AVQA 5K0TA 1J5EB 2HSEA 3RR2A 2VF4X 2GPTA 2RHHA 3VYTB 1UDXA 2YFYA 2JPDA 3KYDB 1H42A 4FMBB 5CM9C 2Z56A 3M70A 3UMYA 1DS6A 1ZD9A 2JKZA 2JJ2A 5EUMA 5JZBA 1Q84A 4F5DA 5KQMA 3ROZA 4C06A 3UFBA 1WW3A 3K3PA 2R751 1NBWB 3Q12A 4PZZA 4REMA 2PSEA 4GEKA 4Y2HA 3B3GA 1CDEA 1NA5A 1R3UA 2O5CA 2Y2VA 4WVLA 5IVKA 2WR8A 3QLJA 4RVGA 2B25A 4PYQA 3S2EA 3VDXA 1JZTA 5TGDA 2HRCA 1IXRC 1U9YA 1E2LA 3HNOA 3LHFA 5GONF 1E2MA 1C8LA 3H19A 5FBWB 1Z0DA 2HCJB 5C7LO 5KYUB 2AFRA 3SYTA 3UKOA 2WABA 2OQRA 4YS6A 3HU3A 3CZ9A 1HETA 2FRDC 3KJFA 5B53A 5D5PA 1TUBB 4MEAA 1YCDA 3O38A 5DWDA 1U6JA 2VDRB 3CLRD 3ZCPA 3RIMA 3TYXA 3ZHXA 1RBYA 1U1GA 2OCGA 1QSGA 3TEMA 4B45A 1C7FA 4CR8A 2GM5A 5EWJB 3UAVA 4AXBA 3O3OB 3TEFA 3OZSA 1ZMXA 3LQ1A 5K3CA 4RZIA 2WT9A 4C0AC 3RC8A 3C74A 1T4CA 1Q1ZA 2A9VA 3P32A 4LXYA 4NC9A 2AHOA 4RMGA 3IBTA 4UEWA 3FHTA 2ZXFA 2AEMA 3HG7A 4ZOBA 1CR1A 1E9EA 2WM3A 3C14C 3PDCA 4WUTA 2QT0A 4EHJA 4IG9A 4LE0A 2NVOA 4X91A 1IULA 2ZATA 3H2ZA 4PC7A 2MSCB 4U7FA 2IUUA 1Z73A 2JLQA 1VJCA 2AR0A 4AROA 2AW5A 1BOFA 5LQAA 1NNEA 1E96A 1NI4A 3GAMA 4RSGA 2QVBA 4H4EA 3W6UA 3OZEA 3H04A 2OBYA 4EPRA 2YOHA 3R41A 4PIVA 2FN4A 2AFIE 4R05A 4CNQA 1ZIPA 3AV3A 3ZS9A 4AUEA 2YY5A 4CXMA 1ODLA 2O6LA 2VYNA 4JASB 3T34A 4J2HA 4KPYA 1HURA 4JD5A 4ZK2A 1EUDA 2XUJA 3TR5A 3BJMA 1F2UA 2FCAA 2ZM5A 2G71A 5ALDA 3UCFA 1AM4D 3ISTA 3LFHA 2SECE 3GVHA 3FTCA 3GVCA 3QFSA 3BN3A 3WIDA 3W6PA 1HZJA 1P3Y1 1EIWA 1EHYA 3N2GA 1UFOA 1AUXA 1P0PA 1EPUA 1R0WA 1CD5A 1Z56C 2P2ZA 3MAGA 4KN6A 4N6OA 4E22A 5BSFA 4X8HA 4RGBA 3ETJA 1ZA2A 1LB1B 3AIMA 1Y1RA 2FZLA 2VWGA 3GLHA 2WU1A 3KZXA 4JLPA 2B1JA 2VAXA 3I12A 1A77A 4ZPXA 4A82A 2MSEB 3K8ZA 4LDQA 3LPDA 3R7LA 1YF3A 1PJ3A 1Z5OA 3ZK7A 1L7MA 1U6IA 4M53A 4QGBA 4UBLA 3IAS6 4WOJA 2VVTA 4DVGA 4KPGA 4UPDA 2A0XA 2ATXA 3EUEA 1UAAA 3G85A 1LS6A 1ISMA 4C0JA 2GEFA 3Q41A 4L6IA 4MW7A 4WSOA 5A6VA 5J2UA 3ZJ5A 4DV6B 5AVKA 4YAJA 1EDZA 1YAJA 2QIPA 4TKZA 3W1VA 2VJPA 4FB4A 1WCV1 3FBWA 1ZI6A 3TTXA 3ZXSA 4DKXA 3JALA 1QGZA 3D3NA 4EA9A 3T7DA 1FFXB 2X2EA 3AUFA 2QB5A 1L5VA 2FV8A 2W71A 5FT9A 1NTOA 3KQLA 4BLOA 3PC8C 3JVEA 5JTUA 3ZI0A 4NF2A 1IBMB 4MUAA 3T6KA 5EAIA 2XQVA 3DTVD 3U56A 1WP9A 3CLUC 1VCMA 3HCBA 2P5UA 2ZRIA 4IF6A 4LCEA 5EP4A 3S8MA 3TEJA 3VKUA 4D3DA 4ENWA 1T8UA 5FNVB 1NHWA 2QD1A 1DTEA 2VHEA 5SZJA 3NVDA 2FW7A 1OX6A 2HDWA 4RH1A 4PQRA 4OTZA 3PXXA 4EJ2A 3KRTA 3D8RA 3QMWA 1RI3A 3LC1O 2NU7A 2UXDB 2B61A 2HBYA 3RABA 1T2AA 4CDGA 4HMPA 3DXFA 1EVEA 4XUGB 3MTAA 4M8NE 3FUCA 1T6BY 3L8MA 1A9XB 1KYTA 3ICWA 4Z4CA 1MH1A 4RENA 5AWFC 4G4SO 3S0JA 3V4ZA 2JIZA 2R1TB 3K7EA 3ESZA 1QGOA 2F4VB 3BICA 5HM6A 2FMFA 4A10A 2Q5QA 1JWLA 1S3GA 2ZPTX 3QWFA 3MN1A 1ZRNA 3T7CA 1XZBA 3JD1A 4JBIA 4OHZA 5B12A 4ARBA 2WPDA 5ELXA 1XV5A 1XCMA 4EDFA 2O57A 3K5IA 5HG0A 3F4BA 2VT6A 2ZB7A 4HXEB 3M6XA 2HF2A 2PZMA 3T8YA 4ZV9A 2VHVA 4BUZA 4D9FA 2P6OA 2BPOA 2XZOA 3KTOA 3WAKA 2ATEA 3L7OA 1HT1E 4KQIA 4TV9B 3ELYA 2FXIA 1Y7IA 5ICCA 1CE8B 1ESZA 4KXVA 1EQUA 4JR0A 1ZUD1 4RKEA 5HDBB 5HX7A 1S3SA 4J0IA 1T4BA 1SD1A 4PSVA 1OXSC 3EASA 2N75A 4GZ5A 1L5LA 4EYQA 4TTVA 1W5FA 3U37A 4WV3A 4DVJA 3CEPB 4ZHQF 5HE9A 3B3AA 1KO8A 4CMIB 2I7XA 4MWGA 4X5OA 1OR8A 1TVKB 3SIPA 1QHNA 3HEAA 2WKQA 4DMGA 2QD5A 2FNAA 4MW0A 1OCEA 1JR6A 3B48A 1KFEB 5EQTA 4B74A 1X7DA 3KT8A 1XNJA 2YQ4A 4ZRNA 4OL0A 5F3RA 5FTKA 1M2KA 1DBIA 4PM4A 1AU9A 1M2OA 2IPLA 1PSDA 2RH4A 3EX7C 4YASA 3TWOA 3UENA 5K6RA 2NSYA 1UQTA 3KIPA 2VTBB 1SUSA 4WASA 3VVCA 4A0HA 2QVYX 1ZD5A 4H6WA 4Z2AA 1JYSA 2EFHB 3EZ7A 1KMHB 4TKUB 5L6MB 1OX5A 3DPSA 4S1VA 4CLOA 2OZLB 2J67A 2PWAA 1DEXA 4H16A 5KWJA 1G2IA 1NXQA 3THOA 5IN4A 3GG2A 4KIUA 3EOZA 1X9IA 3FPJA 5BYKA 1GN9A 1DMSA 3W8FA 3U80A 1ACLA 5CG2A 5DNUA 1D2MA 3HM2A 2VQEB 2PCJA 1KJIA 2H7VA 2X0NA 1GT91 5FL3A 1R4NA 3NRCA 1VLVA 3NAZA 4FFBB 1KE1A 2P2CA 3KO8A 4PRLA 4C4XA 4XJXA 3U40A 3V4LA 1IBKB 1WBBA 2PBLA 2C31A 3O75A 1QFXA 4HRYA 4L3WA 3N2ZB 5BUCA 4DLLA 5KWVA 2FJUA 1QU3A 1PT5A 4P4TA 1BO6A 1Y7LA 2ZRLA 4ZEXA 2E6KA 2A84A 3GT7A 4EG7A 3IEXA 1LNZA 3GEDA 4W63A 3UTCA 3BDVA 4H4DA 1NN0A 3O0DA 2FHSA 5IYZF 2YUTA 3SYKA 3PKZA 1YA8A 1YZNA 1CUBA 4MJLA 1P1KA 5IDWA 4JHXA 3BK7A 4KLZA 4UUAA 3VZPA 2PUVA 1EWVA 3HZRA 5JNSA 2WV9A 2QAGC 4P4GA 2WWYA 1B8OA 1XD8A 3P94A 1JFTA 5TPZD 2HMUA 2J6CA 2EX4A 2DSNA 2CCKA 5DK6A 3L4JA 1V3VA 2FWMX 4XE5A 4DC9A 1HLGA 3A9SA 1YJCA 2I76A 3LKDA 4OQNA 1MEOA 5M3BA 1HI9A 3RI3A 4DC0A 4ZDJA 5LU8A 2MHCA 3FZYA 3S99A 4AJNA 2GHTA 1N5LA 3UXHA 2WAAA 1VLMA 3KHSA 4OI1A 2I4MA 5K4AA 4Q4LA 3B6EA 1WUJS 3FYDA 3PC6A 5ALXA 3U7FB 4P7FA 1DBVO 1WD7A 3RVLA 3B13B 3HUEA 4GQAA 5E4FA 3M9LA 2OOSA 1TMOA 1G2OA 3ZV6A 2X3YA 4BV2A 1U04A 3A1TA 1FTYA 1MXHA 1ORVA 3QPUA 4O33A 1GCGA 1EFRA 4DRXA 1W30A 5F35A 4DWVA 3SC4A 3V4RA 3CONA 4NAHA 4PO8A 4LJ9A 4XXHA 3PNMA 4D9KA 4GXQA 5LQUA 3GNTA 1IN7A 2CE2X 2FR1A 4LA4A 1TJ5A 5FBKA 1EDBA 4N0MA 1RYEA 2M9MA 4M9QA 3ZDYB 2CJPA 2GT1A 1E0AA 3AEKA 2YIDA 3AEZA 3I83A 1XJWA 3ONDA 1ZN9A 4LHXA 4IEIA 1RAHA 3K2EA 3MJDA 1TW2A 3B52X 3Q2OA 4A5SA 2XB2A 2VPIA 4JYZA 2WTNA 1ND5A 2QMYA 4B85A 5J2TA 3SQDA 4UUPA 2VAWA 2BBOA 3F1KA 1CUGA 3FW1A 3DCJA 1N5JA 4O8ZA 4YCNA 3TOVA 3KZNA 3ND8A 3CX6A 2OO5C 3C24A 2Z2YA 4MYDA 1OXVA 2H4ZA 2HMYB 3MEQA 3R44A 1XG5A 4LZJA 4WL0A 5C5DA 3PYMA 4IX1A 4Q3BA 4C03A 3O26A 1IXYA 1OVMA 1X87A 2HA2A 3RTBA 1IJKA 2VDLB 3GI1A 1NOJA 3GARA 4EHBA 2UZ1A 5ADVA 2QRMA 1KOGA 1L5KA 4TKVB 5TMEA 4A1OA 4BB5A 4NPCA 2WNIA 1QGUA 2XQJA 3C0KA 2M6SA 1YR9A 3FCCA 3G9ZA 4K1LA 3CA8A 3WDLA 2ECQA 1SC9A 3FKSA 1I51A 4UJ5A 4P54A 1N57A 1XUOA 2FSVA 2XITA 4TMYA 1RDFA 1WMSA 1V6AA 4OP1A 3M5WA 1JU9A 2YV2A 4FI3F 4MCIA 4JI7B 2VP2A 4NP6A 5FWDA 2W4IA 1MQ9A 1DRUA 2HU2A 2Z83A 4Y18A 3RDPA 2QBYB 1QH1A 2COUA 2AMJA 2Y9MB 1W34A 3ZD9A 4C7BA 3T3GA 5C18A 2A9JA 2H2DA 2P9GA 3ZH9B 4DNOA 3KYIB 5TPWB 4CMAA 3NALA 1A9YA 3PCRB 4CTJA 3EBPA 3QLVC 4PV7A 4GECA 1BH2A 2D7CA 3FDZA 5C5CA 2HXGA 4G0NA 3PTLA 4ALMA 4J7UA 4OUDB 3DKIA 4PX9A 4RVDA 5CP8A 3ZE1B 5L4NA 3FTQA 5B2EA 4HDKA 1QDLB 2VHJA 1W7AA 2CL6X 4BVBA 1QE0A 2H3EA 2X4GA 3TPCA 5TQJA 4JUIA 1U3UA 2VUTA 3WIVA 5MGBA 3SIXA 1LI4A 4MI9A 4Q21A 2L42A 1CU1A 3GH3A 3EK2A 1EG7A 3PVSA 2OGZA 1R1DA 4JU8A 4YP0A 1BEUB 1N5RA 1WCYA 4F93B 2RH5A 1KJ9A 3V4SA 3VZQA 1GNQA 3JPWA 2IC5A 2IPMA 2CXUA 2XB9A 4NDZA 4EOGA 3E03A 5IJZA 1RXEA 2CT8A 1FFHA 1KK1A 4LZLA 1E2IA 2NUAB 4BB6A 4D9HA 3P27A 5I51A 1V4VA 3HKEB 4FYJA 4UVHA 1C29B 4EENA 5JD6A 5K0FA 4R2MA 3TL6A 2WV7A 3FXAA 5LD2B 4OMDA 3MWLA 3HXKA 1H2YA 3WLEA 4CMCA 3OWOA 2PRIA 5D3MA 5T7BA 4IDCA 3DYIA 4AUMA 4ZZIA 1DL5A 1Y5LA 3R0QA 3HCCA 2WILA 3PI6A 4K6MA 4UBOA 5DV9A 4AKSA 1ZINA 1CIPA 3M3PA 2A59A 5K3FA 1OPRA 1NVXQ 3FHLA 1I6MA 3SKXA 1I6WA 2CFRA 5DGDA 4I50B 3KQUA 5B37A 1G16A 5FA6A 3RVSA 4UOQA 1UWVA 2R84A 5BUSA 3DFZA 4EARA 3HUUA 4YPOA 1USKA 2ZIWB 3O1JC 3AVYA 2P5SA 2ZITA 3ANXA 2GNOA 3CRQA 3A25A 3LQ4A 3COWA 3OJCA 1EP1B 4MVJH 5TEWA 2OYRA 4DARA 3THWB 2QJFA 4D80A 2WU3A 4K2HA 1C1HA 3GA7A 4JCOA 2QX8A 4K6GA 4LNUA 2J4FA 5FOUA 3PJRA 1OTYA 1QQ6A 1RPAA 5FLKA 4Y1FA 5GV7A 1AKVA 3UK1A 4NAVA 5L7TA 4CV3A 2CXSA 4DBZA 5DP2A 3TSAA 3SIRA 2MDTA 2QJRA 2GM3A 1RKBA 2OQ2A 4LJYA 1OSNA 3D4PA 5IEJA 1DC4A 4MVXA 4HH3C 3L43A 2W2LD 1FZQA 4BLPA 4L3OA 4KE6A 5E9JA 1Q11A 5KAPA 1CQXA 2G4VA 2DQSA 5HEKA 2BEVB 4C3UA 1BAPA 2H31A 1ONSA 3IP5A 3NB0A 3ROQA 5EYPB 3ZWVA 5CAEA 1K3UB 4QPNA 4D3SA 3KUCA 4X7RA 3EGIA 1EJBA 3RFCA 1M1XB 3IJEB 3ULKA 1B41A 2C1ZA 4CPDA 3WISA 1LBSA 2CBXA 2F7SA 2FQYA 4C43A 4IIUA 4X45A 4OHCA 1V4NA 5D7BA 1KOJA 4GI1A 5LL6P 1W5SA 2IRWA 2X2FA 3DZHA 2BJWA 1GPMA 1M74A 2D7DA 3FZGA 1JLLA 3SR0A 3ZV3A 1YQWA 4HAWA 4POAA 3CURA 3OPXA 4N12A 3GJ0A 5BOVA 3NYWA 2FLWA 5DMHA 3RF6A 4XDHA 3PZBA 2HCRA 1N9GA 2GZAA 1ADJA 4DDTA 5G41A 5C32A 2WJZB 4AYXA 1VYUA 5CEJA 3NHLA 2OAP1 2HSJA 2AZDA 2H4YA 3IB3A 4XIIA 2ZBDA 3J81k 4GL2A 1ZIDA 1BS1A 3PS9A 1NIJA 3GZTB 5JALA 2VJOA 2FQXA 2G1JA 2PWYA 3B70A 3DVSX 4TWIA 4Q9LA 5ALSA 1Z28A 4X9XA 4RBNA 3W78A 3PFNA 2WYUA 3U3DA 1CUYA 3O1LA 2PBZA 2JFBA 3WB2A 2D1RA 3WFIA 1OTHA 3E15A 4O2LA 3E9ZA 3L8GA 4Q6WA 5IX8A 1A2OA 1YB2A 4LYEA 2QEQA 4Q6BA 3UG7A 1Z7WA 1NNI1 3ITDA 1TA4A 2SNIE 3K6RA 1U3TA 3MHPA 4M8SA 3IEUA 3DF7A 4W9NA 5CVEA 4EJ0A 2V45A 3S7ZA 4RTQA 2IP4A 3D31A 1Z2OX 2VRBA 1B1AA 2YN2A 3IUEA 3RADC 2XGMA 4XFJA 4QRHA 4ZQBA 1KNXA 2V7QD 4MTCA 5F5NA 2A1TS 5IDQA 1N77A 3ESCA 2X5KO 2NYAA 1EFKA 2AOTA 3E3LA 3G5AA 3GUHA 4JJFA 1ZGZA 2MMGA 4I1OA 3ICEA 2YZGA 2QN1A 4G0XA 1QHXA 4DPLA 3ZLUA 1QGAA 1FNMA 2C7VA 2JCGA 1MJFA 4IQ0A 1U7TA 4RS3A 2CD7A 2DAPA 2XD9A 3VZRA 3UMFA 3VR3A 4J1TC 1T24A 4S3MA 2NX2A 1FK8A 4FE4A 1RADA 3EVCA 2CFCA 5JEDA 2WT4A 3GA0A 4OHUA 5KNBH 5KSPA 4OA8A 5FLEX 1N7JA 1PJQA 4MW1A 5MN6A 2ACEA 1VHJA 1W6RA 1VBKA 2JFZA 1OKKD 2LBPA 2X7XA 1KI7A 4PSAA 1A4UA 2FY8A 2Z8YA 3BE8A 5AM5A 3RBZA 2BISA 1UDWA 2CBGA 4GM1A 5DSZA 2ST1A 4L1KA 3ORFA 3QVMA 2KYRA 3U1VA 5FOVA 1U2EA 2YKGA 1GGVA 2RHTA 1PK7A 4EFMA 2JRCA 5IUKC 2JC3A 5IF9A 5DM4A 1RLUA 3JQAA 1ZITA 4C1BA 3MTGA 5KO2A 3AVPA 3MCUA 1FLVA 3X2EA 4EK9A 2FG5A 4RY2A 3F9RA 1T5LA 3BHIA 1GITA 2RB5A 4ZDWA 4K81B 2JI8A 1R50A 1BCRA 1CF2O 4V38A 4UTVA 5KU7A 2XKKA 5F3WB 3AFOA 1OBFO 1Z4QA 1Z3IX 2BDUA 3IJPA 1EYZA 3R40A 3AVWA 4TXHA 3SFZA 3Q85A 2YS7A 3TIXB 3EVAA 5BOSB 4BUCA 3MIIA 4QGSA 3QU5A 1Q6ZA 3KOWA 4QTTB 5JXHA 3EXIB 3U81A 3SVLA 3Q98A 4GZ6A 3F5SA 2PA0A 3IAEA 4LJ4A 4CCSA 2OHFA 3A27A 4E31A 6REQB 2ZCUA 2A5JA 2XGSA 1CVIA 1VDZA 4TGLA 5A05A 3U7EB 2VLBA 1HFEL 1JLMA 1F6BA 3JYQA 1PWXA 3CX4A 4UJ3A 1NVMB 4YALA 4MQEB 4XVUA 4LJRA 1T5TA 1FA9A 3KVOA 1Y0BA 3B9RA 3KR1A 1NP7A 1F6WA 3RANA 4QDJA 4BNFA 4Z86A 3R1IA 1K97A 3TQCA 3OQOA 4NRDA 5DLYA 1IWBB 3DUFB 4FS3A 5K01A 3P9NA 4DNXA 5DM70 3TJRA 1LC0A 1G8MA 1W2WB 2ZXEA 3LLSA 4MYSA 1GZHB 4S2UA 3UUWA 3A4NA 3OTQA 4IJ5A 4ECAA 3IVCA 4AJ9A 5IT4A 1H6AA 3E8SA 4D57A 2GN0A 4OXKA 4IICA 5HWSA 1MC1A 3VR6H 3RJZA 1FCJA 4PNHA 2CWDA 3JYOA 4LWPA 4XA8A 1JSRA 3JYLA 5J63A 2Z6AA 2Z2KA 4QVIA 2AK3A 5ES4B 1FIUA 1A27A 4MLCA 5K8VA 3LT1A 4ENUA 2ZANA 5GJWC 3JV7A 4R51A 1R64A 4F2HA 4FJ2A 4OU4A 4UUBA 4DKJA 4KRYA 2NZWA 4JUAA 4EG1A 2XMQA 2CVZA 2VAPA 5EMHA 3OPMA 2FVXA 3IP1A 3ZDAA 3BXGA 3ANLA 2QX6A 5E4TA 2FPUA 3RC9A 3UAXA 1J2UA 3VDQA 2X1VA 4GLLA 2FB9A 1RBZA 4LYYA 1JEEA 4KWCA 4YAIA 1EJ0A 3AWIA 1KVSA 2HCBA 4FGWA 1PR0A 5I7WA 4XM2A 4DR4B 4BNJA 1P7VA 1PWEA 2I2XB 1DWPA 3ET4A 4JELA 4EHFA 3O4JA 1W52X 3VV2A 1SUDA 3H9CA 3WHIA 3L49A 4TL9A 3X1MA 2QVLA 4NEHB 4IRMA 3OKAA 4LFAB 2QG4A 1FBNA 2VSOA 3DFIA 3QYAA 4ZALA 1A8QA 4TUYF 5FOTA 4D5EA 4V2IA 1GUAA 4HDMA 1J97A 2YY7A 4LHSA 1NVTA 2EFCB 1PL7A 2G7MC 2Q46A 2VJKA 1GCOA 4O4HB 4FUQA 5FB3A 5TQ0A 4ZICA 2CMFA 1MFPA 2HNBA 3IMKA 5C3UA 1X1DA 4O4LB 3SJZA 1QIHA 2AS0A 3A6DA 1AKUA 1WV1A 2JFNA 3KDSE 4Q5IA 4Y9TA 3E6AA 2I3BA 4ETMA 2QRKA 3PWZA 1E63A 3COVA 5DPMA 1GZ6A 2UYOA 1U3CA 4PXAA 1TT5A 2GBIA 2JATA 3AB3A 3QHPA 3DDCA 3LYUA 4PG7A 4LF5B 4K6HA 1H93A 4NARA 4OYLA 4RJ2A 1G8SA 4DJFC 3K70D 3FCXA 4KX3A 1XWFA 4HAVA 1GAWA 4NXMB 1L7QA 4B81A 5DX8A 3DZ8A 2IVFA 1C0EA 1ISJA 4M4SA 4N5IX 4MWBA 3W34A 4D99A 5AFSA 4AKHA 3VYRB 3N07A 4PLHA 4RE6A 2JJQA 4FGUA 4KO8A 4KTTE 3M81A 4RK7A 5IBPA 2NPIA 5C4GB 1W75A 3AP3A 1KQGA 2OHOA 4OBWA 4YO7A 4R71A 2FUCA 1F38A 4KKXB 3BSFA 4KVGA 3SDBA 1LI5A 3EAQA 1IOVA 2QTBA 4D0GA 1Q0QA 2R5FA 2HXYA 2PGDA 2ZSDA 3OKCA 4KMRA 3K70C 3WGGA 2FEPA 4JMPA 3PR3A 2PGLA 1PG2A 4BNTA 4W5OA 1A8PA 3C6MA 3GHHA 4IYJA 3ZQJA 2H92A 4BQFA 4EGSA 3NUGA 1EX1A 1KYWA 4QFMA 4QOGA 2XCTB 3HFJA 1GZ7A 2PRKA 1L4HA 2C5FA 2YIJA 2AG5A 4ZYLA 1ZAYA 3PEYA 2Q2NA 5H83A 2Q49A 1JIVA 1Q15A 5KMGB 3HJFA 4MQ5A 2PKXA 1SQGA 4OQZA 4RSRA 2GS9A 4DJAA 2W6CX 3HR7A 2BIFA 4J0HA 1HL7A 4P34A 2O8NA 3K92A 5LBUA 4DUZB 1JPVA 1TD9A 4D96A 3HP7A 1RRKA 5ALLA 2C96A 1KYXA 4ZZ0A 4YRFA 1L8QA 3MCZA 4IDEA 3D3EA 3AIIA 4PO3X 4JXKA 3SBXA 2EBWA 8LDHA 4C1NA 4L9RA 2QZZA 4MQBA 3OQMA 2XH8A 2IS4A 2CJWB 1Z16A 1SCDA 1T1GA 5B55A 1T2NA 2VNHA 2PGNA 2VP0A 3FPSA 4LMAA 1O0CA 1MB3A 3NKLA 1FNBA 4JLNA 4GBJA 3F3SA 3EPRA 4Q02A 4O2AF 2RONA 2I2DA 4M98A 1M1YB 2NTYC 1RPZA 1PEAA 2CLSA 1DQZA 3LO8A 4E5YA 1NQ5A 5HCIA 1DADA 4BO4A 4LE1A 1UAGA 1JZQA 1YS1X 2O2GA 2P77A 3DBOB 1P0IA 4QODA 4AXXA 4B7CA 121PA 2EATA 3MD0A 4Q4DA 3A6JA 2PRSA 4K7JA 4PYMA 4Y6GB 3W6OA 2FEXA 2C1XA 5BSHA 3KQNA 5BV7A 5BV0A 5EC8A 2DX7A 2ZE5A 2ZZMA 3KYBA 1P9OA 1GGNA 1AIPA 2O7NA 3LUJA 1DCFA 3UGQA 1NRIA 3U0BA 3OM8A 5HRCA 3AHEA 4B3CA 1FSPA 2RGCA 2GD1O 2GPSA 2ZJBA 3A6LA 4AZ3B 5KTTA 1QHSA 5MFPA 4QDXA 1E8NA 1GT6A 1J06A 4AZSA 4G3XA 3DE2X 1JFVA 1T36A 3CT6A 4HJXA 2GTPA 3FLBA 1R6XA 2HLNA 1EZ1A 4HLUC 3RNLA 3JQQA 1Z8FA 3G2KA 3D9QX 2WIFA 3PYXA 1RAGA 5IBQA 4II2A 4QQKA 4OP2A 1CJKC 1SCBA 2QHXA 1EUCB 4MVJA 3GROA 5T4BA 3WX0A 3LECA 2BELA 3FE2A 5EEGA 3BREA 3L0YA 2QM3A 5SYAA 4KPFC 1EWQA 1KJJA 1W73A 1EDEA 2I1WA 2FSSA 1Q0RA 3N8DA 2JFOA 1BSVA 1DKNA 1EP2B 1P1HA 4ADSG 2XCQA 2PFKA 4KVFA 1VJ5A 1IHOA 4RH0A 2H1LA 1B15A 4HDSB 3RUHA 3WFJA 3OOEA 5FWYB 5L3QA 1DIGA 1Z88A 2ZYGA 5AI8A 5FO1A 1CUZA 4CCYA 1KQ3A 4CEJB 3QKTA 3NVMB 4KNYA 5KJ1A 2RB4A 1KZ4A 1P4SA 4XB2A 1PR6A 1NX9A 3HGMA 3T7TA 2QLLA 5EZQA 3F8TA 1RMTA 1ZI9A 2PL1A 3AETA 1ZC3A 3LWDA 4MS3B 4GR4A 1CW2B 4CM1A 3I09A 1MEJA 5CYGA 3WYDA 4BNNA 5TQVA 4R5HA 4KXQA 3WE7A 4HQ6A 3L8DA 3L8EA 2X4IA 4BGDA 1RW4A 2RE8A 1A97A 2PUHA 1MEEA 2RBKA 3WZMA 4OHFA 3ZZ1A 1SVSA 1OFUA 2XCLA 3H8SA 3HSSA 4FSHA 4NU0A 1FJGB 2JIMA 3ZK9A 3GY0A 4I7EA 2B1GA 4RZ2A 2W70A 4F1WA 3ZGZA 2NSDA 4P80A 2OHHA 1W4BA 1CVLA 2C57A 2GXSA 3A0RB 4LF4B 2C04A 2W6OA 3H2JA 3KL4A 5TJ9A 2GSWA 3DEFA 4YGYA 4IUYA 5DBHX 3O2SB 1G0OA 2JGJA 1P31A 4J91A 5KOJA 2QKYA 2A92A 2QAIA 2W43A 3MAJA 2FETA 3M4ZA 1MQ8B 3MTBA 3EPPA 3NM6B 3SF0A 4LJ7A 4QJ5A 3JS5A 3VNVA 5J40A 2PX5A 3IDQA 1N6HA 3N8IA 4LF8B 2G83A 1EXWA 2J09A 3H5IA 2VXBA 4RAQA 2OESA 3W1EA 5IU6A 2XZLA 5F2OA 2C5HA 1MV8A 2NXCA 3K0AA 3TZLA 3OCXA 1T5BA 4I4LA 4MYCA 5P8WA 1B8PA 2JRLA 2GAOA 2IT1A 2LD4A 1U9IA 2YS6A 3MTIA 3NJ8A 3CF4A 1N0VC 2JLWA 3HB4X 3LC7O 3EXEB 5LKAA 3GWGA 3SZMA 1HT2E 4IW3B 4YXWA 2E49A 2NPOA 2B82A 3QKSB 1NN3A 3L6BA 5EKUA 3DGFC 3ROMA 2VSXA 2AI1A 3RHSA 1RZRA 4CN8A 2WSBA 3VR1A 2E82A 2OM2A 1ZKMA 1HPLA 2ZE6A 4BLRA 2BUBA 5CEFA 3JARB 4ENSA 1W94A 1OJLA 2H63A 4M0FA 4IJVA 5DCUA 1VHWA 2KB0A 1V5GA 1YD7A 1V41E 2D62A 4D0SA 3MINA 2A9QA 2TMGA 2GLUA 4PLVA 4EHAA 4FQ8A 3AJAA 5JQGA 4R8RA 1ZOLA 2QGFA 3JASA 4U7PB 1GVHA 1AXGA 1X7YB 3ANMA 5D1NA 2G04A 1Z8HA 1ODIA 4R54A 3X3HA 3EPKA 4PF1A 5G40A 3AESA 4B3JA 2ZRHA 4DMRA 1UBSB 2QTNA 1LDBA 3IUNA 4TV8A 4YMSA 3TE6A 5IFKA 1J5XA 2XX3A 1YHZA 2DE0X 1X42A 3I8OA 4P08A 3WSWA 1HE3A 4QLBA 4TYWA 1UFVA 1R66A 3FLEA 2HADA 4P33A 4DEVA 2OC4A 2Q0XA 2VXCA 1YDGA 3DR5A 4PIMA 1DU4A 5KNBA 3A1FA 1RP1A 5BQ5A 1D1PA 1Y8QB 3PIIA 4EJFA 7REQB 1MX1A 2RKBA 3NCTA 2ZPUA 5D84A 3QHAA 1NI5A 1YACA 2C8VA 4Q4JB 5AOBA 5BXYA 621PA 2X22A 4KVAA 4LN1A 4WOBA 1YQGA 1WCIA 4DG8A 1AX9A 4HNAB 1II8B 4B3BA 4C4ZA 1FE8A 4PG8A 5EP2A 1PJ2A 1UPAA 1ZRHA 2Z2JA 4WY8A 4I5EA 3NO4A 1P2VA 4Y2SA 3Q7PA 3LNTA 1AF7A 1CUHA 2JI7A 2P0EA 3HCOA 1CV2A 1MPTA 4K6FA 4N03A 4WFIA 1MAWA 5IHPA 4PRZA 3PXBA 4ND6A 4PLGA 4WXMA 4BQNA 5CX1B 3I28A 1P81A 3DE3X 3WLHA 4JXXA 1NVFA 3V80A 5K0SA 1BG6A 3ZBQA 2EP7A 5DOZA 3WIUA 3A9TA 1J90A 1DAFA 3ESRA 5J5AA 1YC2A 3GU3A 3P2YA 1RQ7A 4OB6A 3L82B 4R9SA 5FP0A 3V7YA 4CMGA 1KQFA 4OSPA 5SV2A 3S29A 3KQYA 3IS3A 3PUIA 4RJTA 4PY2A 1GPBA 4DQ0A 2V7EA 3NUQA 3RCBA 5JYDA 1T9DA 4IVQA 3G5LA 2FWRA 3C6XA 3G2MA 4O6VA 2IW3A 5E7QA 4WKPA 4AW9A 2WWXA 5K4HA 1DARA 1QWOA 2BMJA 4P53A 2VKTA 3LX5A 2DKOA 4MZXA 4R8KA 1DBSA 3L79A 2E1PA 3WHLA 1FLAA 3NHKA 5DEIA 3E7XA 4L5BA 2GHIA 1ONPA 4OPMA 3RBAA 3WRYA 1WPRA 3GJ7A 1OYVA 4B3GA 2R25B 2CV1A 1JG3A 3FWPA 2YVUA 1PKEA 1KOLA 4ALNA 4BGVA 3MJSA 4MGHA 2FJ0A 5HIAA 5KTPA 3GBSA 3OIYA 5C7YA 2WDZA 5JH7A 3ZZTA 2AC2A 4J90A 3UW1A 4F72A 3UW3A 2PDAA 1IK6A 1WW2A 3RHFA 2CN1A 4KI0A 4WUVA 2WTMA 4TKLA 4MGKR 1SCUA 3UF0A 1QHYA 4OOEA 4GVPA 1C81A 1RLMA 3WL8A 1TB4A 2B83A 5TX7A 1C14A 1Z4PX 5K3BA 1SC1A 3IMFA 3M1YA 2LDXA 3RIYA 3VR6A 4YDRA 1MGOA 1NJ2A 1M6VA 1CY0A 5IC4A 3PFFA 2ZYVX 4D4KA 3MS7A 4RSMA 4F2GA 3ODPA 1TEZA 5CFOA 3HPRA 4ZOCA 5AK6A 3H1GA 3GD7A 5DTIA 5CBKA 5AI5A 1LTKA 4MRMB 5JNLA 3TL2A 1PT9A 3KQOA 4IJKA 1P0MA 2WJVA 2X0IA 4ARZA 2NTJA 1HZZC 2HK7A 5IABA 2XBUA 4ZAVA 3TXYA 1BH6A 1LCIA 2WAXA 1U90A 2O06A 2I6TA 5K09A 1VMAA 1BVUA 3DC7A 3T3HA 4R1PA 4UM8B 1RACA 2I2AA 3KJGA 4DLNA 1IPHA 3U9LA 4DLKA 1FLDA 1EVQA 4GE0A 2X8JB 5CNKA 5AP9A 3CTPA 5A02A 1H3EA 1GFWA 1Z25A 2WF6A 5A4JA 3HTXA 4X44A 2IYPA 1OWNA 3GWZA 3T9DA 2Q3MA 5CW1A 2FZEA 2R6AA 2AN4A 2CMGA 3TRHA 2G88A 3TM4A 4YCJA 3TW0A 5C5IA 2EAUA 4F92B 1NU6A 2VDQB 1X1SA 5HP4A 2B92A 3VSEA 4HB2A 3CN7A 4A4DA 2XQFA 5CDHA 3JAKB 3VH2A 4EJSC 5MFZA 3SYRA 2AOXA 3B1ZA 3MHTA 2G70A 2ZWIA 1ESDA 3WQQA 4TN5A 3LIPA 1IOLA 2OAGA 2O2ZA 4R2XA 5AESA 1WCXA 2J0SA 3JCZA 3HRKA 1KMIY 2XZDA 1E89A 3OTIA 5JZVA 2TMYA 4BJ5A 3VXKA 4YT8A 5EWMA 3NBZC 3BKXA 3DVAA 4QD3A 5H4HA 1DO2A 1MFZA 1ONOA 3PENA 3A1WA 3ONNA 5IJAA 4N9QA 4O2RA 4WOKA 3S1AA 1V5WA 2LWIA 2C9DA 4UOEA 6ABPA 2INGX 5IP5A 1TIKA 1U8UA 2PN1A 3FYHA 1BMTA 3TG2A 3Q8KA 2RKWA 2MWMA 3EB9A 1LZKA 4TTTS 2MSDB 2XTNA 4Q34A 3AFNA 3H9UA 4NCNA 1GPWB 3D6JA 1JT2A 4FTWA 1PNRA 1PAUA 4F4JA 1QFYA 2YC4C 4JI0B 1IY2A 2GK3A 2M6RA 1BVHA 4G1BA 1YRWA 1P45A 3ACDA 3MT9A 1U2TA 1AUVA 4KXFB 2F64A 5AVSA 1JHRA 2P9CA 3ILSA 2F3TA 1E2QA 2DRIA 2I33A 1HDZA 3DCYA 4O1HA 5G2OA 4ZMSA 3HFGA 3BQMB 2GEKA 1RJ9B 3IDSA 4CEHA 1UXHA 1K0UA 3DNPA 2FRDA 1N5OX 1ULHA 1RWBA 1B7GO 4YJ3A 3JD4A 3NXSA 5AW8A 2DQZA 4M87A 2NYUA 3PEWA 1IN5A 5LFAA 1WTCA 3LPAA 4YQEA 2HRBA 4HYEA 1CEYA 3Q6NA 3JQ9C 4DJEC 3OZRA 5ESXA 3PHJA 2D54A 1N6LA 1MABA 3DB1A 4CKCB 4DV3B 2YY6A 2AXQA 4K26A 2RG1A 5KVQA 3UGJA 4RY8A 1T5DX 1JFFB 4GF5A 4KSCA 4WH0A 1DTSA 4B6PA 2CLEB 2Y1GA 4IJQA 4BGIA 1W4ZA 5IULC 4I5IA 1GAEO 1GPLA 2X13A 2ZI5A 4UW9A 4RTPA 4S1TA 2IYFA 3DH0A 2QQ5A 3DTTA 1Z4LA 1WTAA 4YRBA 1SOUA 3RRFA 1IDOA 4BWYA 3C16C 3NGMA 4DA8A 5C3MA 1RYDA 5LKRA 1BE8A 1Z0AA 4KFSA 2P9TA 4IFIA 2BFEA 1RQGA 2FP4B 4N40A 4KSBA 3HEMA 5F7JA 1NDHA 3IPXA 4CNBA 2MU1A 2D5BA 3IBCA 5JAUA 2PUAA 4D41A 3DO8A 2DVMA 4MV6A 3UK0A 2WJ6A 3KB8A 3N8HA 3WTBA 4DLVA 2A8YA 2D0DA 1DQRA 2QMZA 2VPTA 3LG2A 3OG9A 1U3GA 1H8ED 3T52A 3VHQA 4B17A 1C8BA 3RVJA 2CLKB 3N7UA 1XVIA 5A4FS 4PFKA 4BZPA 3GB9A 3KAJA 4MNTA 1E0KA 1OI2A 1GZ5A 3CUTA 3A36A 3K1JA 2VP9A 4WZZA 2CYCA 4DXHA 1D0IA 1K2WA 4GWKA 1P2SA 1C9MA 1EB8A 3RS5A 2ZRKA 3LFTA 2WJWA 4F97A 1BDIA 4KOEC 5LLDA 1JA0A 2ZRJA 3U1TA 1XPOA 4EUHA 2PLNA 2CF6A 3PT5A 1N2BA 4IVNA 3C41J 3CPJB 3NEAA 1KJZA 5B3LA 3TNJA 4MDHA 4JT2A 4GMFA 3UUGA 1TQ6A 1KDOA 3IHLA 4UNQA 2W2QA 2FQ1A 2GR9A 1FQOA 1C3VA 4F3KA 2B6NA 1R6UA 5C35A 2R6JA 1PZFA 3S5UA 4O5OA 4MO2A 3IPAA 4ZOLF 3SGLA 2ZJ8A 4XIJA 4A9AA 1M33A 4D46A 4E14A 4NKRA 3EA0A 3NTRA 4P3XA 4TSRA 5EJ6A 3H87A 4ZC8A 2Z4SA 3ADKA 4F85A 3DAHA 2G6BA 2GN1A 2J33A 1H0HA 3FVVA 2ORIA 3T7KA 3VZCA 5B1YA 1GTJ1 1SVNA 2DJIA 2XNJA 3P9PA 1C3JA 1QYRA 4UMVA 3W77A 5D3ZA 4EUSA 4W6ZA 1QCCA 4CIDA 4Y2JA 3L02A 3TX6A 4P92A 1LVGA 1RI5A 4TTJA 1A8IA 2YWDA 1XYYA 2XECA 3ABZA 3BWEA 3PDIA 2WQ7A 3AKZA 2YJ4A 3AF2A 1RI2A 1UKBA 1YQQA 3JSXA 1Z0SA 2A94A 4BBPA 3NONA 2Q3CA 5TC4A 3WLMA 1TTTA 1I1QB 4PGGA 4RLFA 1NQOA 1UPUA 3WWPA 1CRWG 3S81A 5JVDB 3MQ4A 4PANA 2M6KA 3TVDA 3M6LA 3QW2A 1SXJE 2FR0A 3OQIA 2ZAGA 2H5IA 2QTVB 4RHUA 3OCUA 4NYMQ 2CXHA 4KDCA 4OHWA 5THKA 4R1TA 4EFLA 3F6PA 4IAOA 2J08A 5BVHB 3KXKA 5AHWA 1V39A 3D0RA 1D07A 1HYHA 2BRUC 2IEZA 2P4QA 1LW6E 2Z08A 1LS1A 3AUAA 3LUGA 3FCAA 5KYXA 2CSUA 3S8YA 2LIPA 5JJ5A 2GDJA 2YIVX 4CTOA 4X6XA 3AVXA 3KZMA 1PRYA 1EA5A 2LUOA 1YOVB 3CWQA 3WHKA 4MHOA 4W8GA 1DAMA 4FDUA 3VC1A 5AH0A 5DYWA 2A0WA 2ZVQX 3AOEC 3H1AA 4OGGA 4RY0A 1L4BA 2CZGA 2YVAA 4B09A 1KEEA 4R41A 4LXXA 1SC6A 3VGJA 1QP7A 2WT8A 2WUGA 3G2IA 5A5VA 4CM8B 5JARA 5IBCA 1Y8CA 3GO4A 2LCQA 2H0QA 4R1MA 4YN3A 2J0UA 5JANA 4JEHA 2W6QA 2NV2B 1CNMA 1E4VA 1M0WA 2C5GA 4ZIRA 1G5QA 4IIJF 4NNJA 3ZWWA 1KARA 4FFWA 2AFHA 3WNBA 1OLUB 1K7FB 1PV2A 1YQUA 4RHXA 4U9UA 1D4ZA 4Q1DA 5BYBA 3TCKA 1NXWA 1KEUA 1XU4A 1AT1A 3E18A 3EULA 4LPSA 4Q4CA 5KYYA 3N0TA 2H0RA 2B3DA 2FPIA 3MB8A 1U81A 2AG1A 2BMWA 4I9NA 4PTLA 4HD8A 2X77A 1G20E 1ST2A 4RF5A 3R8XA 3WYBA 3ZWNA 1K8XB 1Y6QA 4D1YA 4RTLA 4QJBA 1W1WA 3OHSX 4RK5A 1JA1A 1NMSA 1SR8A 3C8DA 1B4DA 1BKSB 2WFLB 4A6EA 3LE8A 2PL5A 1DWOA 1F3LA 1E3JA 1YMVA 3B1FA 4L3VA 3A70A 4CR7A 3TBHA 2BF7A 1NQVA 1T9HA 2VNJA 3C6YA 5I7FA 5A0FA 1AB6A 2HLHA 1JNYA 3OM0A 2CHVA 5EOVA 3QFRA 1G9TA 3A4TA 4KO3S 2HA5A 3V1UA 1XLVA 1NDQA 1JBQA 1E7WA 2XKAA 1LVHA 2V4MA 1KVRA 2WMYA 2R87A 4DWOA 2CV0A 1KSHA 1Z18A 1Q3TA 2F3QA 4MXDA 1KI9A 1JIXA 3C8ZA 1W0JD 4NYIR 1CUJA 4JVLA 1PT8A 3QENA 4WX2B 3EGWA 4RS4A 1PNTA 1ZN8A 4YH1A 5LDDC 3TS1A 4CMJA 2IU0A 1NVBA 1SBHA 2ISCA 2Y1FA 4AZWA 4ND4A 4R7GA 1U2GC 2JJYA 4YP9A 4AN0A 3YASA 4E07A 2DBVO 5C37A 2J48A 3TGPA 1UWLA 1IYZA 1L8LA 2V5VA 3ORSA 2XSZD 2Z98A 1TJ4A 2QYTA 4X6LA 3SF8A 4BE9A 3HVRA 3ZHSA 1MW9X 3ZQ4A 1GTSA 1JYFA 2PMCA 3RWOA 3BWMA 1MX9A 1XXHA 2WZDA 3EOAI 3GAAA 3FOAA 4JVNA 1TOAA 4OLJA 5THQA 4DIOA 4MPTA 1UBHS 3RASA 5HMLA 4WKOA 3TAXA 3GLSA 4R1SA 1IG0A 1JU4A 5B2FA 2O8FB 3X1ZA 4B4OA 1MENA 1ZCAA 3ZHVA 2GA9A 2JAOA 3KQHA 4I5DA 4DR2B 1Y48E 2J45A 4C14A 4A91A 4LYHA 4GMGA 1RFGE 1SBTA 3T3IA 4LRQA 2DHRA 1F5SA 4M1KA 2AXPA 3ECCA 4I5GA 2Q3FA 1M34E 4JLKA 3BXXA 1WF6A 3JWIA 4AWAA 4R2JA 1Q16A 4BY9E 1IB0A 2H16A 4LRYA 1SO8A 4ES6A 1VJDA 2JGEA 5DI3A 3EGXA 4MWSA 2O8BB 1XN4A 5H3LA 5FUXA 2HFKA 2CXOA 2WVHA 3SSMA 2E7ZA 3WWEA 3GK3A 3DMTC 4WZBE 1MC5A 3ZTYA 4EPTA 4FNGA 3WYAA 1L5OA 4MO9A 4G5FA 3PPWA 4M9SA 3EFOA 3UXMA 3REFA 2BD0A 4X6YA 4YJHA 1TT7A 2ID9A 5KHAA 2DUMA 1JVBA 2I66A 2HNKA 5T5QA 1X1AA 1RQPA 1SCKA 1Z35A 2A0UA 4G0VA 1OZGA 2G07A 1GYQA 1QBGA 4YHBA 4B3RB 1RYBA 1AXEA 1SRQA 1YGPA 3AOGA 3LUCA 3QU4A 4IHJA 5KOIA 3NM4A 1YCGA 5DULA 4EWLA 1UC5B 4DA7A 3I72A 4HQNA 4QDTA 1G1MA 4TXLA 1QTQA 5I7UA 4MW5A 5IM4F 2AMLA 4TS4A 4UEKA 3R5SA 4F3CA 5FI1B 5AJVB 4BNVA 5CDUA 4JV5B 1Z5PA 2G63A 4BU1A 1V2GA 1FDSA 1LPBB 4JAVC 4LS3A 2PS1A 3A6GA 3BIJA 1R3DA 2FWJA 3IQHX 4OYRA 1LQUA 1PFQA 2H5LA 4D2IA 4EHHA 3MLBA 4HLQB 2V74B 1GRCA 2JHCA 2NU6A 3TD6A 4EO4A 3SDZA 5KUTA 3GGCA 1GSAA 2FG6C 3Q5DA 3GX1A 2UYHA 1MC4A 3A4YA 3C1AA 5A6SA 5HSGA 3NKVA 2PT9A 1J7KA 2ERCA 1KGDA 2BGLA 1TZ2A 3VV3A 2UUAB 5JMOA 3Q88A 5DM2A 2X8LA 4BLWA 5K6AC 1ML4A 1XTVA 2X7HA 3KHTA 3W1WA 5BN1A 3PQ2A 4DEYA 3IIKA 2R1ZA 3CTMA 3K6KA 2OO5A 3C70A 2OE2A 2Q2VA 4MS4B 3F90A 1T6YA 1WY5A 1AKTA 1UMBA 2ACVA 1B73A 2I6SA 1JKMA 3SHOA 2C29D 1Q19A 2WJHA 4L8FA 1UBFA 2W00A 4QHTA 5K9ZA 3ORYA 5A5DA 3BWBA 5IDXA 3EW9A 1R4AA 3RJMA 3PX3A 2E4YA 1M8PA 5FJJA 1K88A 2GPYA 4MUIA 4WXYB 5CJ2A 2QP4A 3WL5A 1OY1A 1WL8A 1CUUA 4B34A 2AI2A 2H08A 1SKUA 1BXGA 1GNRA 2Q6IA 4GMHA 3OPYI 4MQUA 1EVLA 3STYA 2AJ8A 1J4AA 2OECA 3SZLA 2IY8A 4ATNA 3FTEA 1I36A 4ILKA 1UH5A 5SYMA 4ZA2A 2Q6VA 3EDOA 3M6AA 2GF0A 2XTAA 4AI6A 2GAAA 3P0FA 3IEPA 2OV1A 4L50A 3IGFA 4ASUA 4B71A 2EV9A 3UV6A 2HMAA 1PR3A 3E2MA 3PA6A 3AH8A 3VTAA 2QJWA 3TQHA 1VMEA 2A3NA 2PX6A 3E9CA 4KYUA 4C6HA 2OXEA 3RUPA 3ZE7A 2BFDA 4IVRA 1LNQA 1L5SA 4BTLA 4IV5A 3NHSA 1Q3KA 3W9BA 1NI4B 3FFXA 5CVUA 3QLVA 3B1XA 3U7QB 2WTEA 3NETA 1VG1A 1QS0A 3CSSA 4I4IA 2JCBA 4R83A 2Q4DA 1ONNA 4B4UA 3T5GA 1QYIA 3I6MA 3SZGA 2EEPA 4NIMA 1GM5A 5EVCA 1EUDB 4E13A 1HUQA 1F2UB 4Z9XA 3EXHC 1YWGO 2DECA 2RI6A 3G82C 1E62A 1N7IA 4FJ1A 4JYPA 2FSIA 2I4RA 2EG9A 3CLSC 1OFVA 3ROEA 2XNKA 3H16A 4MDEA 1P7PA 4I4TA 2N9UA 4I55F 1CDZA 4IBOA 1C9DB 3N2GB 1VL1A 4GYWA 4B32A 1Z39A 4P6VF 3BFKA 4JLBA 3TDMA 3PKIA 2X1HA 3H97A 3RK4A 5GIPE 3F73A 2UYGA 3DFUA 1CUXA 1KEPA 1CJUC 1H0KA 2CJFA 3CC8A 4OXQA 4BOYA 4EA7A 2HRRA 3H1TA 3VKWA 5L8VA 3K0CC 3ONWA 3GLHB 5JMPA 1T8RA 1H66A 2GO7A 4UBMA 5EXXA 3HDYA 4RKQA 2B5OA 2HYDA 1XAJA 4ND8B 3AG6A 3ACCA 3HU1A 4R31A 4Q00A 4V0OA 5AW4A 3A05A 1RC1A 4QIHA 4U7HA 1BFUA 5EE1A 3L8FA 1Z12A 4ARSA 1ZEJA 3UPDA 2F3SA 5CFQA 3LDGA 3KT0A 3TW4A 1T8PA 3GZNB 3NNSA 2DPHA 1ZQ1A 5AKEA 3ZDZB 1GV1A 3DCNA 1NPYA 1F14A 4QTZA 2G17A 4BIMA 1TUIA 3GJ4A 4H0NA 4K3VA 5F1PA 5EKSA 1G8YA 5TF0A 4KACA 2B7LA 2PT5A 2BC9A 1P18A 2J85A 2GZ2A 2HWWA 4MWTA 2H00A 2Q1YA 1NNUA 2QD4A 1PUXA 1U4OA 3OUTA 4KTVE 5ERXA 4IIYA 4Y8VA 3UT5A 4ACBA 4D42A 3QTLA 3M4JA 4OLAA 4PW0A 3G02A 1WXQA 3PX2A 3E48A 3FRIA 4IPTA 3WLRA 3WNQA 1G8KA 1E2BA 5F1KA 2ENUA 1JLKA 4RGYA 1OX4A 3PCTA 4ZTUB 3ZPXA 2HMVA 1U2QA 3KEOA 5AKYA 6PFKA 4EI8A 2UXBB 4Y9UA 2PBFA 4BNWA 4ZHSA 1WBDA 5PGMA 4Q3CA 1YBFA 5H5JA 5IVPA 1CK4A 3B9QA 5KNCD 2PYIA 4D44A 2FX5A 2AE1A 1M2VB 3GP5A 4JCCA 1GSHA 2GYUA 4U39A 5DT9A 2BN4A 5GY7A 1LLFA 2NU7B 3ZD8A 4KWIA 1KK2A 5E7MA 1SPBS 5D1HA 5LDGA 4MA5A 1XBTA 2M2IA 2P2GA 3CR8A 4LTDA 1XNGA 2P2NA 3DFMA 1JR3D 1OJ7A 1L3IA 1G17A 5FADA 1XEWY 1PP4A 4Y67A 1SAYA 2P9HA 3VR5D 1UFQA 2FPPA 2Q29A 1MIOA 1ZA1A 1VE1A 4HBGA 1DVRA 4OSEA 3ESAA 3CCCA 1SBIA 2CLHB 1F2TA 3F3MA 5F2KA 5CB6A 4ZEOA 4EB6A 1ODFA 3OH8A 1OZFA 2Z43A 4CHGA 4QYMA 4FGSA 4FW9A 1DKPA 3W5JA 1W46A 3BXOA 2QR3A 4WKCA 3BEDA 1AF4A 3SHVA 3DFFA 1XZFA 2HBQA 2JD1A 7MDHA 3U2QA 1JWAB 5FPKA 3V48A 1AD2A 2RI1A 2DFKB 3BIFA 5AKHA 4X7MA 3EZNA 3FVQA 3R74A 1WXDA 3M3HA 4MTLA 4RYLA 5HTKA 4GPAA 3U4GA 2WJGA 4MJ3A 2BI8A 4CV2A 1SC4A 4P5PA 4GBGA 5KDOA 5A4IS 1SD2A 2EKPA 2GEUA 2I4IA 3G1TA 1TVMA 5DBOA 3DC2A 2G6TA 3I2KA 4EA6A 4Q7LA 3SD7A 1LPMA 4XAQA 3CH7A 4UNNA 3TTTA 3ZZMA 1J9EA 2RK3A 3ONFA 4R0VA 5KX5A 5CCXA 4HNUA 3SWWA 3LK6A 4KFRA 4X1OA 4ZXPA 2CEKA 2GTHA 1O08A 3T1OA 4KFUA 2GJ4A 4GMXA 2QD3A 5L9AA 2NACA 2C78A 2SHKA 1ZC4A 3K72B 5D51S 2EFJA 5H7XA 3Q9NA 2XA9A 1M2OB 5JJKA 1R74A 2P30A 2G8LA 4ENQA 1XZNA 4BFYA 5FX2A 3B1WA 5K8LA 1AZLA 1LPNA 3M89A 4C4OA 4ODIA 1H5NA 2QM0A 5DXFA 3FI9A 4L9AA 5KOYA 1U8EA 3PQFA 3FPLA 2Q3DA 4J1TA 4TMZA 5AI6A 1BMFD 3MMZA 2CNNA 5ITZB 1NUHA 2X2OA 5JO9A 1W85A 1NVGA 3NIWA 4MCJA 2VF2A 4UZEA 4CLOB 1A1VA 1IWPB 1X1QA 1O96A 2VJNA 1DG1G 1BX1A 2Y0DA 4X93A 4XYGA 2J32A 1XQXA 4JODA 4FYHA 2VP6A 4G56A 5GONA 2VR1A 1SKYE 3LZCA 1GSOA 1RXCA 3C1UA 4DM4A 1U3WA 2D2VA 1MO6A 1ZHHA 1R4NB 2B78A 4J07A 4KQCA 3HDTA 4RPGA 3DOCA 3GDFA 3MOGA 4ND3A 1BRMA 1CUFA 3C3AA 1EDDA 3JTMA 2PX2A 4NS1A 1Z33A 4IGKA 1QO0D 2R97A 4JGGA 4H1TA 4EW2A 2MYUA 4N9WA 3STWA 3HMQA 4QT0A 5CNJA 1AHHA 5ALUA 4CG3A 2OM6A 4HLNA 1U0LA 1FSSA 3UY4A 3QSYA 2VI5A 3NTVA 4EBBA 1Z07A 1I94B 1FF9A 4CKWA 3Q8WA 1HNXB 3T9AA 2EOAA 3IV9A 1PDVA 4II7A 1KWKA 1M2EA 3ISJA 2IZ7A 5D87A 5JNTA 4CU5A 3RRMA 5KVCA 2GKGA 1SXIA 1DRKA 4E1VA 1L7NA 3D2LA 3Q9SA 3RSLA 4BV8A 2VN8A 4EATA 1CJMA 2B2NA 3B3FA 2XCSB 1OFTA 1ECJA 3DGEC 3GFSA 2D5CA 1DDIA 1BYIA 4RMIA 8MHTA 4J3JA 3PXGA 2XXAA 2PGOA 3QM1A 1CERA 2WD9A 3M2TA 4NX2A 2VJBA 3KB2A 2QM8A 1IRIA 1SXJC 2D1QA 2QT9A 4OIFA 2A0YA 4FXPA 3R3XA 3C6KA 3CR3C 3ZXYA 3PJFA 2V98A 1WDLA 1YRQA 1KYVA 3X44A 2D4HA 4C87A 1Z5UA 2ASVA 5I7SA 1GCUA 3RSGA 1T4MA 2AFIB 2DZDA 3QWIA 3V9PA 4JB3A 4C08A 4XGKA 1JBKA 4IYRA 4V0MA 2C7PA 5FFMA 3I6ZA 1KHHA 4PG4A 1MJ5A 2ZBQA 3NCHA 1JF8A 4HWPA 2LVBA 2HH9A 2QW0X 2Z4TA 1XZHA 3P0RA 3N0WA 1HLFA 1SOWA 5EIHA 4DRXB 3EPJA 3K0SA 2JAPA 4EZBA 2VZ8A 4QYSA 3EQZA 1W25A 3GXOA 5DYGA 3RUCA 2CW5A 3AV0B 3U60B 1G21E 3STVA 4BN5A 5HKBA 2IZ5A 4A6DA 2C7QA 3EARA 4F5YA 3Q4GA 5JNRA 2X8AA 2OK7A 3HBNA 4DLPA 3WL7A 4OQDA 3AEKB 3IEMA 1ZOOA 3EJ6A 4OREX 2WUFA 3CVOA 4TLBA 1ZUHA 1DAGA 2BWJA 3ZCUA 1WETA 3PNVA 3TECE 1BDMA 3AZQA 5J2TB 5KIAA 1M1UA 1GRNA 1X3SA 4G4SP 3X2SA 5DTEA 4DSAA 3O5AA 3QBTA 4WFQA 5BXQC 3SX0A 2CXQA 3EQ8A 1TLTA 3AHGA 3EXAA 5J5VA 5HHTA 2BGIA 4UMDA 1W8DA 2I4LA 3DZJA 1NQTA 1NFQA 2BCEA 4C4PA 4M1QA 1HA3A 2IGTA 4OF4A 2W2MA 4DEXA 1J9GA 3PHCA 3WLQA 5E7IA 4UTXA 2AD1A 2ZRAA 3BRWA 4YCAA 3VR2D 3W5SA 1C8VB 1YE5A 4MEJA 1JLSA 3FHOA 1QGUB 4EEZA 3DUWA 4ZVNA 3H42B 1RFLA 2FP3A 4PX5A 3K0EA 2C99A 2PZJA 4C76A 2O2CA 4EG5A 1X6VA 2YZ2A 2P90A 5J4LA 1Y8ZA 2BL4A 3SLRA 1I4EB 4G5YA 2AZXA 1KDPA 1IUOA 1G19A 1X0XA 3ES9A 2VA9A 2ATVA 3U39A 4FCWA 4ZZ3A 5EJ7A 2GBFA 2RHOA 3M6FA 3M33A 4LHVA 3TIGA 3K5PA 3L8YA 4XWGA 4DR7B 1RIIA 2BJVA 4W7HA 2J5XA 5BW4A 1F1JA 5FUBA 2IV2X 2ZSEA 1ENPA 1RAIA 3WLLA 4LZPA 2P91A 5JDCC 1I13A 4HX2A 5JU6A 4JQYA 4A2CA 4DZTA 4L51A 3FDZB 1Z8NA 2QM7A 3NXKA 3I37X 2EIHA 3GUUA 2I71A 1SHTX 4FYKA 3WICA 1LQ2A 4D6XA 2RBEA 4HDKB 4YQZA 4XSVA 1PD1A 3I3OA 4BWGA 1NASA 3FR7A 3IBSA 3HADA 4F2WA 4ZJZA 5LMZA 3W6NA 1TIPA 1YJ5A 3RAJA 2NO6A 4LUCA 1AHIA 4BN4A 5KTRA 2OT3B 1GAJA 4XYLA 5J2UF 1AVTA 1NW6A 1NE7A 1ETUA 1THMA 3OKFA 3SU8A 1NFRA 3SZ3A 4RNCA 2TECE 3CWCA 3MJRA 2C7OA 4COKA 1M75A 4PN7A 2FUG6 4Q48A 3PGMA 4KR7A 2ZJ3A 3EZYA 1M2WA 3K9BA 5CFRA 3R5TA 3Q9LA 1I1NA 3AEYA 1RKXA 1UKAA 2P9YA 4URFA 4YREA 1XTUA 5LYJA 2XQGA 3CUKA 3DBRA 4OK5A 4RTSA 1C0PA 1F7UA 3O8NA 4JBHA 2BT4A 1VCNA 5HIIA 1GG9A 1G4UR 1O87A 2CK3D 2VH5R 1H4VB 3A3KA 4JP2A 4Z0HO 5CA1B 3NDBB 5K3FB 1U0RA 2RH9B 3B53X 2E18A 1I7PA 1UPXA 2J0VA 2FXVA 1A9RA 3UV7A 1ZK3A 4HEHA 2ATCA 3P20A 4JYAB 1NUUA 2X5NA 2WSSA 1JA9A 3IQIX 1CBUA 1JXAA 1Y3HA 4XDZA 2GM4A 3OLQA 4FMCF 2BYTA 2JHGA 5FPYA 3LUPA 1RRPA 4HL6A 4FKZA 4YRCA 4JP8A 1SK8A 1E5QA 4FHCA 4M7WA 3WWYA 4B6SA 5AW7A 3RFVA 2W6JA 1WPXA 2R65A 4RPJA 3CNQS 1TCAA 2BTOA 5H3HA 1BIFA 1LI7A 1EK2A 1T3TA