4QYWA

Structure of phosphono-chey from t.maritima
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
118
structure length
117
Chain Sequence
b'GKRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTMITMPEMNGIDAIKEIMKIDPNAKIIVASAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheY
molecule tags Signaling protein
source organism Thermotoga maritima
publication title Isolation, Phosphonomethylation, and Crystallization of phosphono-CheY from Thermotoga maritima
rcsb
total genus 41
structure length 117
sequence length 118
ec nomenclature
pdb deposition date 2014-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qywA00
3MQ4A 3MYYA 1KRXA 2ID9A 3OLWA 4DN6A 3RQIA 1MVOA 1ISRA 1XHEA 4ETIA 3A0UA 4PYRA 2F8SA 3QEMB 4Z9BA 3S99A 4RY0A 1JX6A 2N9UA 3FGZA 1D1PA 3QK7A 4QYWA 3G85A 5EWLA 3SAJA 5C5CA 4KPYA 3EAFA 4OTZA 3NNNA 1QQBA 5CHYA 5TQ2B 3DLHA 2CWDA 2QVCA 3OM1A 4DQDA 1DBPA 4KZKA 3H1FA 4ZJPA 5JS1A 5KQGA 4KK3A 4RS3A 5FWXB 5JNTA 4JOQA 5CNJA 1B00A 2E4YA 2FTKE 2YHAA 1C4WA 1D2AA 1DG9A 3BBLA 5D2CA 4Z0NA 1JYEA 3UUGA 3G1WA 3N8IA 1H9CA 1M5UA 3QELB 1RXEA 3CHYA 5IC5A 5FWYA 2PJUA 1JHZA 3I42A 4XARA 5DKFA 1DRKA 3FFXA 1QPZA 4MRMB 4JP1A 1U2QA 3JY6A 1W9HA 1A2OA 1EAYA 3OQNA 4YV7A 5KQMA 1C0EA 4O1HA 1EFAA 4KV7A 4HNSA 5PNTA 3OLXA 5TQ0A 2RJOA 4DADA 5IUJC 4Z4FA 1CYEA 9ABPA 4N0QA 2IPAB 2FN9A 4EVRA 1YS7A 3JVDA 3IPCA 2FW0A 4ZMRA 3H5IA 3HDGA 3LUKA 5IX8A 2MSWA 3DBIA 4Z4CA 4G97A 1JL3A 1U8TA 3P9YA 1LBIA 1JFVA 1MB0A 2CD7A 2WB4A 5IULC 2FMKA 3O2JA 5DGCA 2QU7A 3CG0A 3CZCA 5FBHA 3RVMA 2GKGA 2A9RA 5TQ2A 1PUXA 4MLDA 2IOYA 2Q5CA 1IIBA 3SM9A 4G0ZA 1U04A 3HJFA 5JNUA 5BQ3A 5T7BA 1NXVA 3LTEA 3R0JA 1D1QA 2H3HA 4D6XA 1GUBA 4MS1B 1VPWA 3H5TA 3HV2A 3K9CA 5FWYB 1ZGZA 1EWTA 4L4UA 3RH0A 4UHKA 1MB3A 2BGGA 2L17A 1ZDMA 1QKKA 3FDFA 4N76A 1JFSA 5BRJA 5KQLA 3ROTA 3HM9A 1FFGA 2JVKA 3CU5A 1F51E 4F3TA 4RY8A 4WWHA 3HDVA 3LUGA 3A10A 1Y1LA 4RV5A 2P4UA 3CZ5A 6ABPA 3O74A 3O2QB 1JDNA 3RVOA 1OXBB 4ETMA 3C3MA 1FFWA 4JB2A 4QPJC 2QXYA 4F12A 3EDCA 4RK1A 5DCLA 1CEYA 3H75A 4WT7A 1TJYA 3OMXA 4HYEA 5HM6A 1Z15A 1QMPA 4EYKA 1Z12A 2DRIA 3K4HA 3URMA 4RU1A 4B09A 3RVKA 5TQJA 1EHCA 4EYGA 5EWJB 1E2BA 1SXHA 3RVRA 2VK2A 1BVHA 3BILA 3QLVC 2WWVD 4PICA 3MMNA 4G0OA 2ID7A 5KC8A 2MYTA 2FQXA 1ZESA 3L6UA 3CRNA 2FQYA 1RZRA 4MS1A 3KTOA 4N47A 4WXEA 4Z9AA 1Z2EA 3QEKA 1FFSA 5HQJA 2CHEA 4KVFA 4Y9TA 3KS9A 4Z4IA 1P2FA 4N0PA 4G0MA 1SXIA 1BDIA 1Z26A 1K68A 1PHRA 3H5VA 5E3JA 2E4XA 4PEVA 3O75A 2NUBA 1KMIY 5ABPA 2FKAA 4RK0A 3LMKA 4OATA 3MF4A 3IP6A 1BDJA 4MQEB 3ILHA 3KKEA 1U2PA 5KI6A 1DP4A 3OO0A 4IMIB 4KREA 2LUOA 1JF8A 1JFTA 2H0AA 2FMHA 4MR8A 2AYXA 2V0NA 4O1IA 2FN8A 2O20A 5EWJA 3FMVA 4RXMA 4FE4A 1XHFA 3NHZA 3H5LA 4LDAA 1JDPA 5JNVA 1DBQA 2PMCA 3DGEC 3KCNA 3MA0A 2OQRA 2HQRA 4EYQA 4LE0A 4TN5A 4W5NA 3SQNA 4GPAA 4G0QA 2FSPA 2LBPA 3CG4A 5BRAA 3ILYA 3OQMA 3GRCA 1SXGA 1RZRD 2PUGA 4IILA 4EVQA 3Q15C 4JASB 4KMRA 2MSLA 4RY9A 5IUKC 3CTPA 3HK2A 5GOTA 1GUDA 1PEYA 4IRXA 2J48A 4YCSA 2JBAB 5IEBA 2OENG 4MQEA 3A0RB 1JLKA 3F6PA 4HNRA 1DCMA 1PEAA 4YRZA 4W5TA 3QLUC 5IEJA 3KSMA 4RK6A 3QLUA 4MYRA 3H1GA 4MR8B 4F06A 4MR9A 3H5WA 4RK5A 2MSKA 5DTEA 1ABEA 2M98A 3JS5A 4RKRA 5JNSA 4YWHA 4N41A 3DLBA 1ZVVA 4JAVC 3RVJA 1WETA 4D74A 1AB5A 3OO1A 3Q7TA 5C5EA 3UKJA 8ABPA 1HEYA 2NT3A 4KNYA 1S8NA 3OLVA 4WZZA 1JH9A 3SY8A 4MAAA 1D5WA 2F8TA 2PUAA 1NXSA 2JVJA 2GBPA 1APBA 1DZ3A 1D4ZA 1W25A 3UK0A 1JBEA 2PUEA 4GNRA 1YIOA 3SG0A 2PUBA 3VNBA 1ZH2A 2PUDA 1TMYA 2L18A 3O1JC 4H3HB 4RK7A 4EGSA 2PLNA 1Z17A 3OQOA 2FLWA 2A9PA 1J56A 2JVIA 3GWGA 5FBKA 3Q7SA 1TLFA 3LKVA 1NXPA 4HNQA 3GBPA 3O2SB 2JBAA 4W5RA 1AB6A 3M9XA 4ETNA 1NXXA 1DJMA 1SD5A 1ZITA 3F73A 3D8UA 4MS3A 2X7XA 4JB0A 2PKXA 3TX6A 1Z18A 2MYUA 3I09A 3M6MD 4EYOA 2NZVG 2FVYA 2QW1A 4MR9B 4TLLB 3T6KA 2RJNA 3EULA 4W5QA 1VLZA 4H3KB 2B4AA 3RVPA 2FQWA 3JPYA 4RXTA 5CNKA 2PUFA 3VNAA 1YS6A 2HSGA 1KRWA 1NATA 3KHTA 1KGSA 1T34A 3HUUA 3F7NA 4RK4A 5HSGA 2KYRA 4QYMA 1VKRA 3TD9A 1NTRA 3A3KA 1NXOA 4QICA 1EWVA 2HQOA 4S04A 3I5AA 4RZSA 4LZLA 1DCKA 4F11A 4P1ZA 2PAFA 2JK1A 3JVIA 2L19A 3C6QA 2E4UA 2QZJA 4M88A 1LBHA 3IP9A 5IBQA 5HKOA 3OMWA 2HJ9A 3GA5A 3HZHA 2QSJA 4MR7B 3EODA 3T8YA 4OG2A 4XFKA 1LJLA 1I3CA 3OLYA 2QR3A 1QP4A 1K66A 3LUFA 2CHFA 4OLAA 4O5AA 3HS3A 1L5YA 4XASA 3CNBA 3F6CA 1YK1A 1NXWA 2WMYA 1ABFA 1GLGA 1FSPA 1USIA 1P6UA 4PE5B 1DCFA 7ABPA 4MS3B 4YGXB 3L49A 3LUDA 4FE7A 1E6MA 2QVGA 2E4WA 4KQCA 5GQSA 3LUCA 1USKA 1ZAYA 2WJWA 4LX8A 5B3JA 1URPA 5F64A 2L2QA 4EVSA 3RVSA 3RVQA 1JYFA 3N6VA 2XDYA 3Q9SA 3SNKA 3O1HB 3CKMA 5JS2A 1DC7A 3GL9A 4E7OA 2GI4A 2HPHA 1YTUA 3QX9A 4RSMA 2P9HA 3CS3A 2MYNA 4G0PA 4Z99A 2HQBA 5JNRA 2FMFA 3GBVA 1ZGGA 2R47A 3QLVA 4Q6BA 4G0XA 5TE9A 4MQFA 1QP0A 3HXMA 4KRFA 3E3MA 4MR7A 2LPMA 2R4QA 2WJAA 3NHMA 3H6HA 3LKBA 1PNTA 1QO0D 3RVLA 3H5OA 5CNMA 4OBBA 4MGEA 4RDCA 4YLEA 1U0SY 2R48A 3N0XA 4S05A 4NV3A 1RNLA 4KQ9A 1P6QA 3GT7A 3N0WA 2QV0A 4KFCA 3EQ2A 1SRRA 3FFWA 2FXIA 2JRLA 2WRZA 3GYBA 2FEKA 2IPNA 3N75A 4H60A 3N0RA 2E4ZA 3D02A 1ZY2A 4ZPJA 3HEBA 4P98A 1E6LA 1YK0A 3LUJA 1UDRA 4E7PA 3H1EA 4XXHA 3OM0A 1BDHA 4D6YA 1Z13A 2JB9A 1USGA 4W5OA 1ISSA 2ZAYA 2VUIB 4JA2A 3C3KA 3LUHA 4IF4A 1L5ZA 4MQFB 4ZYLA 3M9WA 1Z25A 4F8JA 4MPTA 5EWMA 4YP9A 2RGYA 3EGCA 2YHBA 1Z2DA 3EJWA 1NXTA 5TPZA 1XWWA 3HVRA 3DGFC 2GWRA 1VRVA 1JWLA 2NZUG 5T3YA 5I4CA 3IPAA 2FEWB 4LE1A 4EY3A 3CFYA 3N53A 1A04A 2IDMA 2I6FA 5ED4A 2LP4Y 4ZMSA 1M2EA 2E4VA 4ML3A 2VYCA 3CLKA 2B1JA 4LE2A 2IPLA 3E61A 2IYNA 4NICA 4IGAA 1GCAA 2NT4A 1PNRA 3QX8A 4OLBA 3HUTA 3C97A 3HO1A 1BA2A 4WXMA 1LJUA 2ZWMA 4RKQA 3RVNA 1RPJA 5CNIA 3T95A 4IMJB 1MAVA 2IPMA 3O21A 4YO7A 4G0YA 3I45A 2AYZA 3NBMA 3KYJB 4MS4A 4MLCA 2LIVA 3T38A 4LRQA 4WUTA 1R8JA 3GV0A 5EWMB 2GX6A 2PL1A 3EQZA 2IKSA 3HSYA 4UHJA 4Q7EA 1ZN2A 1YVUA 3KJXA 4EUKA 1E6KA 1GCGA 3HCWA 4N03A 1FQWA 5KWSA 3BRSA 1YMUA 3JPWA 1EWKA 3NNDA 3KG2A 4G86A 4CBVA 2JCGA 5B3JC 4NCBA 1QQAA 5TPWA 1M2FA 3IP7A 2RDMA 4L85A 2M1ZA 1MIHA 1LK0A 3FFTA 2W42A 1OXKB 2PUCA 1QNLA 1NY5A 4KK4A 3ROFA 3QLTA 3C3WA 3NNSA 3OLZA 1A0OA 1M5TA 4TLMB 3MM4A 1ZH4A 5KC9A 5DLEA 3LOPA 2A9QA 4Z4GA 2WY2D 3IDOA 3DZDA 3Q7RA 4NQRA 3QEMA 1RXIA 4MS4B 4YS6A 1F4VA 5BR1A 2R25B 2MYPA 5IUNC 3BRQA 5EWLB 6CHYA 1QO0A 3B2NA 1DC8A 3Q41A 1QP7A 2VUHB 3IP5A 1YMVA 1DBWA 4PZ0A 4XAQA 4XLTA 5JNWA 5FWXA 4FB4A 4LDZA 4TMYA 1BAPA 3MIZA 3TO5A 1TM2A 3KLNA 4YR7A 3BREA 2FLKA 3QELA 4RWEA 1CHNA 4Q6WA 1P8AA 5TPWB 2PE5A 3H6GA 4NCAA 3LUAA 3O1IC 4Z4HA 3TB6A 2FMIA 1DRJA 2FEPA 3JTEA 4MRMA 1ZHHA 3W9SA 3TMYA 4Z4EA 2TMYA 3KLOA 5KQPA 1Z16A 1TVMA 5TQ0B 2A9OA 3KYIB 4RXUA 5TPZD 3LFTA 2PL9A
chains in the Genus database with same CATH superfamily
3KQVA 1E0AA 1CJVC 1OJLA 4NYJR 3NJRA 1ZMTA 1XHEA 3EQ7A 4XOIA 4D99A 1L3CA 2R4TA 2F8SA 2YINC 5BR8B 3NYRA 1K0FA 2G4LA 3KWMA 3VBCA 4I0WB 1BYUA 2WYUA 1XDDA 3EXAA 3BDIA 2HTEA 3ICVA 4HATA 4N7JA 4A9AA 2BSAA 2ET6A 1POXA 2J6HA 3ABQB 3BEDA 2FG6C 3BCSA 2FWNA 5LZ8A 1NY6A 2WIGA 1E94E 5EIAA 2WC1A 5SY4A 2C9ZA 4DQDA 4D26A 4B3TB 3TM5A 4RCYA 4Q3DA 1L5OA 4LNUA 3IQEA 2XKBA 1WY7A 2F7SA 1Q1NA 4OJKA 3VPSA 1XRJA 1VGRA 2J85A 3BBLA 2CLFB 5DHSA 2GD0A 2GAFA 4C1NA 5KWEA 2IXAA 3CHYA 5FWYA 1G8YA 2RKBA 2I54A 4TRRA 5DKFA 2ZDHA 1L3BA 1J9ZA 1U2GC 5I3ZA 1TYZA 2I71A 2AEMA 2GGSA 2XCRB 3SJBA 1EAYA 3EH2A 4ALLA 2D7JA 5FLXA 5C7OO 3FF4A 2YL2A 3GT3A 1M1YE 4WOPA 3AP3A 3GOQA 2BUCA 3VC3A 3ZGXA 2Y1LA 5IUJC 1NDHA 5L7WA 3W34A 4CV1A 1D8TA 2FW0A 4A0GA 3BJIC 4C0AC 3RU7A 2MSWA 3DBIA 4PVCA 2OSVA 3DMPA 4HNHA 1N2ZA 3N6RA 3MRXA 5IASA 2H92A 1H1LA 1BEUB 2OP0A 1DOZA 3L92A 1G8AA 1SVIA 3E70C 1AT1A 1KH3A 5F2EA 3ZIUA 4OH1A 1QTNA 4IX9A 2YMQA 4LRSB 1MVNA 1QCCA 3EZGA 4GT1A 1I3KA 2FPKA 4DXHA 2P9GA 1Z2NX 1H3NA 2F59A 3AY7A 3SM9A 2FNAA 4K8RB 1TVKA 1GPUA 1YL5A 2B2CA 5BQ3A 2P0AA 5EGSA 3G5UA 3R0JA 3KZCA 1VMAA 4PG5A 2JLRA 5ARCA 5FA6A 2H59A 4P4GA 5JD5A 1JVBA 2P78A 3TTWA 3FKQA 3G17A 3IOCA 2YHIA 3K6JA 4GKJB 3DXZA 1F4PA 2IYVA 1KFJB 1ZHFA 3EFOB 5HIMA 1GILA 2JFUA 3AFOA 2EFJA 3IAHA 4JZKA 1W29A 2ECPA 3M70A 4NARA 3VDQA 3JSXA 2AG6A 5KJ6A 1DRUA 1S89A 1C1XB 3I1IA 5CFLA 3NCTA 2XIJA 3BA6A 3S0JA 4AMZA 3O83A 1KJIA 1E0JA 2QQGA 1VCMA 3OC0A 4RY8A 4WWHA 3NV9A 3S7TA 1KMHB 1L5QA 1X77A 1WCWA 1QGUA 1T0IA 2VTDA 4EJMA 5DP2A 4CF7A 1S2NA 5LB2A 1OXBB 3NTVA 2DGDA 5BMVB 2H4HA 4QPJC 1SPBS 2X15A 1V11A 3MJFA 1XR3A 3I12A 2ZRMA 4PGHA 2IT1A 5KNBA 3OKPA 4JEUA 1QIGA 3GVIA 4FZVA 4RV4A 4YUYA 2WQ7A 4LBWA 3MJCA 3S2ZA 1ESZA 2UYGA 5B5SA 2O8DA 2X0EA 3T7DA 2CZQA 1GG2A 2VNHA 4F5EA 1HUQA 2WWIA 3ZVLA 5AHXA 2BH2A 4B4OA 1J0XO 1W4AA 4QTYA 1XQVA 4M21A 3G8YA 3AF3A 1R88A 4LECA 4M9RA 2Q3FA 1L7EA 1ZL0A 4CQMA 4EJ6A 4RADA 4JGGA 4ZRDA 4N47A 1E9EA 1EK0A 3ME5A 1YJ5A 2VHXA 5F7JA 2WF6A 4UOQA 2WVHA 1L5WA 3ESRA 4YAEA 2ZBUA 2D54A 3SPXA 3W8FA 3WWEA 4B0OA 3QX3A 2IQ5A 2G9NA 2IHYA 3H5VA 1WXIA 5COAA 1XXHA 2E4XA 4UEJA 3FZQA 5CFZA 2JIQA 2P9BA 3DE0X 3L6OO 3MBOA 1NG1A 1CUVA 4M6WB 5GONF 4AECA 3KBBA 3IA2A 3IP6A 1TUGA 4ZAFA 5JE8A 5H4HA 3DZJA 4ZK6A 2O5VA 5CA0A 2H9AA 3DBLB 2OUIA 5HF5A 4KL8S 3IMFA 5EI5A 1F8FA 4MUGA 2Q3LA 2Q9AA 2DHQA 3AT1A 3FHCB 5EZ6B 1CFJA 1UK9A 4BZPA 1U8ZA 3F5FA 3UH1A 1SIOA 1B0ZA 1UP7A 2GN9A 5LP6C 3WGHA 5H3HA 4PLHA 4M89A 1PJRA 4WZ6A 5LXTF 4E03A 4US2R 5IM4F 4P86A 2IZ6A 4I1SA 3H5LA 4HX2A 1Q1GA 4XUCA 1IB6A 3VTFA 2B3DA 1RC1A 2KLHA 3V1LA 5JNVA 3ZW9A 2CLOB 1QGDA 3DGEC 4QEKA 4DCGA 4DQ0A 2LRHA 2OQRA 3AHGA 4R1SA 4B3JA 4OJQA 2P30A 5D8DA 3UANA 5JCXA 3E15A 1AS3A 2PZEA 2PZ8A 1LSSA 3HGQA 2FCRA 4CKWB 2XHZA 5BYAA 1P62B 4LXIA 1GZ5A 3FCOA 1G60A 5CYPA 4YCBA 2PRKA 3BDAA 2BMDA 2A5YB 1IHOA 3LH5A 4IILA 3SSMA 4AC9A 1RMTA 2P7IA 2XPCA 1AKTA 4PXAA 3TBKA 1Z0AA 3HJCA 2AS0A 4JQCA 4QG3A 1KKLA 3VAAA 1FJHA 1PBTA 2CNWD 2PGLA 3IOBA 1WDMA 2NU6B 4RLFA 1KDOA 2ZIXA 4HNRA 1REQB 3Q5DA 2HF9A 2NTNA 5GADl 1JKMA 1E2MA 1JKXA 4INOA 4OHCA 1UDCA 4IJ5A 3AG6A 3O31A 4M8SA 5ELMA 2C84A 3WFZA 1YUBA 3MBKA 5KWJA 4MR8B 4WBNB 4TV9A 3KDAA 2WG1A 2VLIA 3LNTA 3OHSX 2PGNA 2QX6A 2IV3A 4CLOB 2HCRA 2PFGA 5DTEA 4QARA 2BGJA 1Q0ZA 4L1KA 4P3NA 3WNDA 3I30X 2Q3JA 3SEZA 2GKOA 3G0HA 4YP5A 3H2YA 2OBXA 2JGDA 3HXOA 2CHVA 1CUHA 1JSLA 5DFAA 2Y1WA 1NI4B 1XRNA 2GF0A 4G4SP 4O4JB 1KFEB 3PGLA 2G0NA 3H1PA 4TYNA 3H2GA 3D9QX 1RAFA 2ENUA 1DG3A 2JI6A 3FCCA 4HAZA 3VR5A 2GQ0A 3A04A 4C0JA 2O8NA 1XNJA 1LKZA 1AGYA 3LVQE 1TMYA 2L18A 4ZVUA 2AWNA 5GM2A 1WCXA 4OXXA 3NH9A 1U8XX 4BP9A 1G21B 3A1WA 3UAXA 3E9EA 5BXYA 1XTUA 2GXSA 2Z43A 1W5SA 2HWXA 1GDHA 1OUMA 2ZSIA 3KVVA 1H2AS 1X80A 1SKBA 3NGMA 4K9OA 4Q1CA 4BY9E 3G1UA 3ID6C 1W2GA 4R9VA 4EMTA 4KKXB 3GYGA 1TT5A 4LZPA 3IBSA 3GHYA 4RIGA 5EEHA 1XP5A 4DYDA 1T2VA 3AJAA 4WY8A 1TZBA 1LUAA 3HJGA 3Q40A 4H7KA 4YCDA 3OA2A 4UE6A 1NVTA 1M3SA 3ZY3A 4FMCB 1E1QA 4GBJA 2GD2A 3DE2X 1C30B 1GGMA 2E37A 2YWGA 4HMPA 4R1UA 4WY5A 4XGRA 3QP9A 1VLZA 1ZN9A 2WHQA 5AIBA 3TJRA 2CL6X 1YS6A 5FNVB 3RHZA 5K6TA 1IHXA 5E3HA 1UWCA 3ROZA 4Z53A 1NN5A 1GYPA 1RRMA 3I4CA 1QQ6A 3A3KA 3MWKA 4Q1BA 1Z0KA 1E7RA 3I5AA 2FJPA 4EHAA 3WMWA 2PS1A 3U7QB 2P11A 5CT5A 1J1IA 2J9XB 3C6QA 3C3CA 4QNMA 2YV3A 1GA4A 3ZWKA 2H1RA 3IPXA 4KMMA 5IHXA 3ADBA 2EWVA 2H4ZA 3OMWA 4HDSA 5IW8A 1HNZB 4FCCA 1T29A 1F5NA 1LJLA 1LPOA 2AA3A 4M0KA 5T57A 1Q7EA 2CHFA 5I9MA 3CX6A 3EZYA 4OXQA 2I4MA 1NJGA 1TQHA 2HNBA 4CTNA 5KOYA 3CWZA 4PNPA 4PO1A 1AVTA 2I80A 2UYCA 4AF6A 3WBBA 4P7KA 4UHJA 4E1AA 4YGXB 4JENA 1WW3A 1ZRHA 3QXCA 4WN9A 4C7BA 1CUSA 1SHJA 2B5VA 3JQ7B 4NE7A 4HEHA 4RDIA 2NQ8A 4EPRA 1JSXA 4BNIA 2CMGA 3F67A 2CC2A 1GL7A 2PRZA 3BXZA 3RS8A 4BEJA 2DQZA 4L4SA 1THGA 1CX9B 4F96A 1QWSA 3DKVA 5HIJA 2NTJA 3Q9SA 3Q3IA 2H1FA 5JS2A 2HJHA 3KVRA 4PCLA 4ACBA 4YUZA 1QM5A 1AKYA 3S2FA 1EVZA 1JXMA 3JR7A 2E5FA 4OO3A 3DAHA 4D46A 1FY2A 1L4YA 2ZJBA 1S9HA 3O5AA 2HQBA 5FT9A 1JDJA 2FMFA 4JUCA 1A98A 4RJKA 3GRPA 4E70A 4AN0A 1R6XA 1ZUIA 1JBQA 2WABA 3D6FA 4IUBS 4II2A 4QA9A 4ZOLB 3V8QA 3WYGA 2DR0A 4KRFA 4E15A 1SCJA 4ER3A 3I2FA 3FCUB 4M7PA 4EY7A 1DE0A 1NPYA 3RVLA 5CNMA 1I9CA 2H4JA 4AG3A 2AVNA 5ENVA 1R6TA 3PPYA 5D3ZA 1L4FA 3L7CA 4RS4A 4C7KA 5HZMA 5HJ2A 3OURA 3BWXA 4NV3A 5KNCA 4JI0B 2HMTA 5IM4A 1XB2A 1J2RA 4LI0A 4BO9A 2PFKA 3JWPA 3WMGA 4BDTA 2ADOA 3N7AA 4Z9YA 1N0VC 2JRLA 4IEFB 1ODFA 5CDFA 4H60A 3I73A 5ECGC 4ES6A 2X23A 4Z7QB 3MLBA 4NESA 1Q17A 1JDVA 1UFKA 3UQYS 3PDWA 1LI5A 3D1VA 4INJA 2JPDA 4P98A 1AO3A 3G79A 1E6CA 1EG7A 1X94A 2I6GA 3IUQA 1DJOA 2ZJ7A 4NJEB 2FPOA 3UT6A 4G8CA 3ZNPA 4K9QA 1XPRA 3QE3A 2V6MA 3HKDA 1O6FA 3JQCA 4G9GA 5DNEA 3UJNA 2C7PA 1KJNA 1RQLA 1AF7A 3M3PA 4BEVA 3GFVA 1GNRA 4X94A 4EZIA 2W7TA 2RAFA 4LJ6A 3R3JA 2AEFA 2W22A 4RA9B 3KTDA 1YS4A 1NASA 2VPXA 2NMVA 4WXHA 3V1YA 3F90A 5ERYA 2JFYA 1FTNA 1GXSB 2ZJOA 1VCIA 1J23A 4E2YA 1L5LA 5EJMA 3C7TA 1A04A 4GWKA 1WCV1 4PM4A 2LP4Y 4BQOA 3C7DB 1QOPB 5AH0A 1G20B 1QQTA 2EBHX 1DDGA 2RHBA 4C01A 2NGRA 5DYTA 5EMJA 1K0UA 2BMFA 4K6OA 5C8YF 1IBSA 2RGUA 4NPCA 1NA5A 4KQEA 4AF7A 1LS6A 2AUNA 1RT9A 1RC0A 1UDWA 3ST7A 3SC6A 4XM2A 4BQSA 4DRZA 3QZUA 3TLJA 1Z4QA 2P2DA 3BVPA 4K9RA 1E1RD 3T4PA 4EHJA 2XMCA 4U0JA 1JQ3A 3TZEA 1BDMA 4KO8A 1E2QA 3G8BA 1OBOA 1VHDA 2IDKA 2W6ZA 2Y93A 3DV9A 3RTCA 2X0NA 5D3MA 1E2NA 1U0BB 1MAVA 4GYKA 4YO7A 2JGAA 5GGYA 1AUQA 5HUJA 1I80A 3Q9NA 4BEWA 1Q22A 3T3IA 4D9GA 4UUBA 3PGVA 3OZBA 4QAJA 4ZVOA 1DUIA 2K2WA 1JXAA 2HD4A 4PLZA 4Q9NA 2B8WA 4JBYA 1FXSA 1GUAA 4C0WA 4O1MA 4HDAA 4WINA 1N2CB 1U0LA 5J5AA 1L7OA 1N6NA 3QUBA 4B1FA 4CT0A 4V0KA 2H8KA 1QJ4A 2QGZA 1QIIA 1G59A 3DFFA 1GKKA 1I4EB 2EBWA 3R6GA 4KUEA 4DMMA 2I62A 3O38A 4B83A 1WNFA 3LHSA 5FX2A 4KB5A 2K2QB 5CW2A 3FBTA 3TUZC 4G86A 1JZTA 3I2IA 4HWTA 3VHXA 5LOVA 4BEBA 1U0HC 2KE5A 3S5UA 3WGIA 2VJKA 1M1ZA 3RTDA 1OXKB 4YJ2B 4DZZA 4GX5A 1RZVA 5CTJA 2BSXA 3SZ3A 5JQGA 2Q28A 3ADOA 4ZEMA 1L5SA 3CX8A 4RMHA 5E6SB 1UJMA 2PRYA 3RSOA 4AKTA 4TLEA 4DSZA 2REXB 2ZREA 3L3BA 4C07A 3LECA 2GEKA 4WSOA 4RPIA 4V1CI 5DLEA 1I7DA 2FQ1A 2WSYB 3EVNA 3BE5A 1E2KA 2ASVA 1F8GA 2PMWB 3CLSD 3TOCA 2UUCB 5KNCD 2HRDA 3BQ9A 3GZ4A 5IP5A 5EPUA 5AI8A 4BJHB 5B4UA 4TS3A 4P54A 1XLTC 3LF1A 3WLNA 1QGAA 4DANA 2QAGC 3TLAA 5T3UA 4CFZA 1WHTA 1ONOA 1WDWB 2A0WA 4U63A 2BGMA 3I9NA 3Q41A 4IOLA 3JALB 4LY9A 1DBWA 2OV3A 5HIKA 5CDTA 5EIFA 4R16A 3BMCA 5B30A 1SUCA 1B0UA 1TYAE 2UUBB 3KQYA 2BEUB 5B2FA 1W1IA 2VAMA 3W5AA 3TO5A 3ESZA 1A9YA 4FOPA 5KYTA 1DBSA 7REQA 1SKMA 3VPAA 4GYWA 2AN4A 3V4ZA 4RWEA 5C0OE 2C3UA 5LU9A 2IH4A 1F0YA 2H1CA 1R9MA 1GCOA 1M54A 3CR8A 3N74A 5F5XA 2VWQA 2BEKA 3MOGA 5AWFC 3WIBA 3KQHA 3WIUA 3G0GA 1QC5A 4FSDA 4M9CA 4F6RB 2SHKA 4GQAA 3H7IA 1T1GA 1V96A 2X3FA 1EI9A 5JVDB 5CJ2A 5F3RA 2F43B 2EJVA 2PL9A 1FFDA 1PSZA 5TMPA 2JASA 4PONA 2R8OA 2Q6TA 5E0OA 1Q95A 2WKQA 4MUAA 5B7NA 2QSZA 5ALXA 3V5NA 4BMPB 4YUWA 1VDZA 2AL7A 3FNIA 3RRNA 4F3KA 5CBPA 3QEJA 1DC5A 2DTDA 2QL7A 4KEAA 3WJAA 1LLCA 1T2DA 4D4IA 2W2KB 1LS1A 3AESA 3G85A 1OX4A 3P26A 2F3PA 4QRHA 1QQBA 1YONA 3NNNA 4OTZA 3VU9B 5H81A 5TQ2B 4BVFA 4C3UA 4CYMA 3CT6A 1RPAA 5DGHA 5T4HA 4X6XA 4RZIA 4JLPA 4K46A 3H86A 4UUPA 2ESRA 2RHLA 2Y9PB 3C6MA 2GK3A 2LV8A 3VR6H 4BLTA 1DG9A 1OVGA 1PZXA 4Z7OB 1G2IA 2VUTA 2AJ8A 3DDUA 1R12A 5LU8A 2GNAA 1XSEA 1E2HA 1ENPA 1R5OA 1M1YA 3KOMA 1BE8A 1VMEA 1K7SN 4O2BA 3AXSA 2VNKA 1H69A 3T5DA 5EE5B 3WLEA 3BXHA 4OMUA 3WTCA 4C7XA 2IK8A 2H0QA 2H0RA 3I6MA 4IKOA 1N6IA 1R0LA 1TCBA 2XMBA 3EBLA 4ITRC 2WUGA 4AQ7A 1MO2A 4NDZA 1YB6A 4MX8A 1G0OA 5JLJA 1KSJA 2P6NA 5LP6F 2G5PA 3GW8A 2VOEA 9ABPA 1CYEA 4N0DA 5A5DA 1UK8A 2MR5A 3I32A 1Y63A 1AY0A 2FRDA 4L57A 5A5VA 5KINB 3COJA 2P62A 2FR0A 1FJXA 1RLJA 1J0AA 1OCEA 1LBIA 1NUUA 2WB4A 3PRJA 4RESA 5IULC 1MQ9A 1NR1A 4GGMX 2X5NA 4LGYA 3WWZA 4YQFA 5CT8A 4CEJB 4GLFA 4DLRA 3MHPA 5K20A 1V25A 4O4IA 2G7ZA 1UBFA 3JV7A 1INLA 1PFWA 4WE3A 5FWDA 5KB3A 3JQEA 2D3WA 4M46A 5HR5A 5HVNA 1Z5UA 1RP7A 4CV2A 1V4BA 4QGHA 2ZI7A 2WR8A 4QPNA 1N8TA 2R751 3RFCA 2NAFA 3BICA 3AERB 2I6SA 1YIAA 3EA4A 4BVBA 4QPPA 2PNJA 3EWIA 3W2TA 4CCSA 3E27A 1POWA 3B6IA 3DDOA 3HR8A 3R6LA 1XQXA 4B8YA 5I01A 3I8SA 4IG4A 3WB1A 1T24A 3GH1A 2SCUA 5ALSA 3FZGA 3H9CA 4FPXA 3EIEA 4GSKA 4GM1A 1ZNYA 4IICA 1P74A 4PO3X 5EINA 4Q05A 1M10A 4D43A 1D2HA 3ZDQA 2Q7OE 2FEOA 2ZS9A 3AHJA 1ORRA 2CLCX 1V5WA 3ZVMA 3A1UA 3ONVA 4NBNA 1JR3E 1ZJWA 3VGJA 4IIJA 2HMWA 1T4CB 1Y5NA 4EHDA 2H1VA 4JUBA 3K8OE 4DKJA 2BFPA 3ZCRA 4CKEB 4NULA 1BVHA 3BILA 1IM5A 2AN1A 4PICA 4UHDA 5ADWA 2E55A 3TR6A 1HR0B 1KPHA 1WO8A 2D8AA 2X6RA 3CRQA 1D0VA 6REQA 3AGPA 5C31A 2GVNA 3TD2A 4FR0A 2P6MA 1XTVA 1Z2EA 3RV3A 5JXJA 3ADCA 1EB9A 1RE0A 3WK4A 5L51A 4YH1A 4RGVA 4E22A 3FPAA 5F3DA 3C7AA 3PC8C 4N0PA 4G0MA 3T5TA 1A9XB 2DT8A 2SKCA 2IVFA 3CEAA 4YV1A 1T4DA 4V0LA 1X0XA 1YZ3A 4YRLA 4ARZB 4D3XA 1M6NA 2Y27A 2H65A 1Q83A 3DZGA 3GPLA 4EW2A 3DQZA 3NORA 1G1MA 1FYFA 2C31A 3A6HA 2HIHA 3RS5A 5EZ5A 4EH1A 4JFAA 4K86A 1FLDA 4KAFA 1QYCA 2ZPTX 3DEYX 5KI6A 3FIUA 2HA5A 3QEBZ 2X9LA 3OETA 4FGZA 1OLXB 4L9SA 1NE2A 2GAAA 4R8RA 2ZIEA 4ZKDA 1NW8A 3BFXA 1SEPA 3PIRA 4WNAB 2OBLA 2XW6A 4MUXA 3ZNOA 3M6XA 1N6KA 2J33A 3I92A 4L7QA 2WOJA 4YJKA 3F6YA 3WA6A 4YYEA 5A02A 3PCRB 3DUFB 4IV0A 1KS9A 2CVFA 1Z0ZA 1EEHA 4FQ5A 2ONJA 1I4DD 3M8KA 1QKIA 3DFMA 5C8VA 2P4QA 4JJ4A 1I2BA 2I4RA 3GGGA 4DJAA 3FNBA 1P17A 1QLHA 3A32A 3AFHA 3N8NA 4Z54A 3GD7A 5EMLA 5HS4A 5A4MS 2HDOA 4FMPA 4W5NA 3GEBA 4ND3A 2PLWA 3J81A 5CFQA 2VH2A 1W5TA 4F3RA 4BO6A 3ANXA 4NQZA 5JUWA 1KYQA 3O0DA 2H4WA 4Q4AA 4KWIA 4O8ZA 2Q1SA 5KSPA 4OHOA 2BC9A 4EG7A 2EJBA 1N5IA 5GOTA 4XTCS 1E9SA 4GG1A 2WZDA 3ABSB 4XKJA 3VMMA 2HK6A 4MQBA 1TEZA 3SNHA 4HEA1 4FYHA 4Q9DA 1DCMA 2QRKA 4FZJA 1IJEA 3KKOA 4W1PA 3NOXA 4JJKA 4L28A 2VYVD 3O6VA 2GMWA 3R44A 3HCCA 3U81A 1RFLA 3ODGA 3OSZA 1E8NA 1R4AA 4HB3A 3PC2A 2W6ID 1WBBA 1ZCAA 2UAGA 2W6OA 3P0IA 4LXYA 5H5JA 2F55A 5C46F 3V1TC 1ZM3A 4RKRA 1ZUHA 4ZCQA 5DVZA 4ZHSA 2ZQ5A 1Y81A 4UTOA 3DVAB 5HP4A 2BSQA 5B6IA 2ATVA 4FC7A 8GPBA 3PFHA 4MEAA 5C5EA 4C6RA 4WK2B 4NU8X 3TZQA 5LPNA 4YI5A 2H08A 3G02A 4ESHA 2GOYA 1SU6A 2AQKA 3GLIE 2GAIA 3FZEA 2W37A 4FXPA 3R7FA 5FD8A 1ZUNA 2FPPB 1IN8A 5G53C 1JA9A 2V7QD 3PQ4A 3P0JA 2QTZA 4M0EA 1QYVA 3PTLA 2PUDA 4YTEA 3UXYA 4N9WA 3EC2A 1NAIA 2EZ4A 5I9TA 2A0FA 2A9PA 2JVIA 4HQ0A 2C2OA 3AEKB 1E7SA 4QUJA 3LDUA 1X0VA 4MVJA 1NXPA 1JI0A 2JHFA 4X6LA 3PNSA 2PVPA 1DWPA 4P82A 1Y6GA 4EELA 1S2GA 3ET5A 3RUFA 4QOSA 3W1EA 1CVLA 2XMQA 4ER7A 4JYCA 5ERGB 3CF6R 4YK7A 3H3FA 1GTG1 1JEJA 2D0IA 1BMFA 1FK8A 4CKZA 1S2MA 1Z56C 1A9PA 2I6TA 1BHO1 2AEEA 2FGJA 1QV7A 3C70A 4A2CA 2ZRDA 3GR6A 4EEZA 1Y5LA 4ZO6A 4JYZA 3EPKA 1OREA 3KAPA 1CK4A 3D6UA 3Q9UA 4PQYA 1JI3A 2OZKA 4W5QA 1VC2A 1KYIA 3GG2A 5ICEA 2R1TB 4KDEA 2C4UA 2H5EA 4WLVA 1CIPA 2XXAA 3KKZA 1NATA 5E6RA 5JMOA 4AKIA 1V8ZA 3TCXB 2WF5A 1FOEB 3AL0C 2ZPUA 3B3JA 3OIVA 1QRDA 2OUKA 3OJWA 4G1BA 4TL8A 5TS2A 2PAFA 3RC8A 4Q19A 2BEVA 3WRVA 1QUFA 1D7OA 4N18A 4G07A 4EKNB 2R79A 1QRTA 4PRLA 4MWZA 3EODA 4KR2A 1M6WA 2GN1A 1I3CA 1PL0A 4HXYA 3BIFA 1LH0A 3LUFA 1QMGA 3KHUA 4G25A 4O5AA 4R7ZA 2COKA 3O8OB 3UHPA 5L53A 4W6ZA 5K8TA 1UXKA 4HJRA 3ABRB 3WB0A 4OQ4A 2F90A 4LNHA 2VDOB 3LY7A 3SX0A 4IJ6A 5I9NA 3QVGA 2Z2JA 2YXLA 3OCVA 1N2EA 2G04A 2ZWPA 1FDUA 3MTQA 2BF4A 1R5NA 3AETB 2JGLA 1CR1A 3K16A 1AKRA 1JSCA 2W4MA 2BE9A 4DC9A 1OKKA 3QV2A 1W7AA 3OLQA 4QEZA 2C5SA 2LCIA 3FSRA 3LUCA 4D0NA 4N4AA 2G4VA 1R64A 1RI3A 4LX8A 1I5EA 4LMBA 2BEJA 2JL1A 4M8KA 4ETWA 1SAYA 1ZONA 2L2QA 3CJRA 1YKFA 4NMWA 4WDQA 4Q93A 2ZIVB 3MTEA 3N7UA 3RVSA 3HZZA 3V8EA 1ESDA 1T8YA 2NXNA 4EAQA 5KYKA 2QUJA 3ESBA 3KWLA 5JYBA 3CKMA 4G4IA 5KTRA 1T10A 1YTUA 5DJ5A 2MTBA 1KGDA 4ZGWA 4PGAA 4D4GA 1FFAA 1T0BA 2XWBF 2CHUA 4GM0A 4RPLA 1RWVA 4KXQA 1LK5A 3I0ZA 4JSYA 4HQFA 4C21A 3JYLA 2NP6A 3FLAA 4Q3EA 4MR7A 5DI3A 3UHAA 3DOFA 3NHMA 3H6HA 4BB6A 3SC3A 4KGZA 5TGTA 4RVNA 3IS3A 2CK3A 2CJYA 2QTTA 3IO5A 4F5ZA 2VUUA 1PAUA 3ZGOA 4XPZA 3LW8A 1E2EA 4FYJA 3ZJ5A 4TLBA 1O4WA 1N2BA 2J9RA 2R2GA 3B1VA 1Z36A 3ZZMA 1EFKA 4R2HA 4X54A 4X7BA 3OZCA 3MPOA 2JIMA 2QUBA 3E9ZA 4M0LA 3TTUA 1Q19A 4Y1GA 2PRIA 3IRUA 3L4SO 3IUYA 2NTEA 1ZY2A 1P81A 3LBAA 2BGTA 3K4QA 1E7QA 1L4EA 2BH9A 1L7BA 3KTFA 3PXAA 1GPYA 5E9QA 4DR3B 1XV5A 3W1VA 3HCRA 4DSOA 5EKUA 3FSGD 3UB4A 3M6AA 3WHPA 3WBFA 1I4LD 5IZCA 2V4ZA 3LA6A 4GLLA 4YACA 2NUTA 4WKCA 3TQRA 5JH7F 4H1HA 4JA2A 4W1SA 2X1LA 4BGIA 3NEAA 3ZUPA 1WTAA 1QYIA 1EA7A 1KDVA 4IF4A 3LUBA 4CKCA 5BUCA 3O8QA 2D1QA 2IW1A 2ROQA 3EXG1 5K3OA 4JV5B 1W6RA 2XJ4A 3CLUC 3PPVA 1DC3A 3ND6A 4Y6SA 4F86A 2G1PA 2JFWA 4BS9A 3DEIA 4Y6GB 1P4AA 1UBTS 1UOQA 4JXKA 1COWA 1SWVA 2VRBA 2DSNA 5I4CA 5BN4A 3EFBA 4WKBA 2B83A 1NQAO 3AHFA 3H8JA 4WOJA 2B1IA 3RSGA 1XMQB 3DAYA 1RI1A 1EGVB 4H15A 2C2WA 1Y6FA 4ML3A 2XTNA 2DLCX 3ZU6A 1WB5A 5AJUA 4LPSA 4NBUA 1PGQA 3ZHBA 4I2VA 1YKSA 4YECA 1QZUA 2B9EA 2ZRIA 4HLQB 3PR1A 3L1KA 4RMJA 3ZIAA 3BWBA 3K32A 1RZ3A 4NICA 1R3UA 2ZCUA 1M2VA 1SCKA 2IZ7A 1AZWA 3BWCA 3NP7A 5CGZA 2D8MA 3WOVA 3J80A 3TW4A 3BJRA 2Y66A 5LM3A 2XNKA 5IJZA 4JUAA 3W5SA 4ME6A 3PQ8A 4PXYA 4WA8A 2ZW9A 2H29A 4AZ3A 2RFLA 2X8BA 2E49A 3MCUA 2FDCA 3EGEA 1AA9A 4BMDA 2OLKA 1O94A 1OGYA 2YQ5A 3IIIA 4GLBA 4U7TB 2FFJA 4KKVA 1S01A 4LRQA 1VJRA 1R8JA 5FFFA 1YJCA 3VR6A 1CDDA 1LLUA 5ER9A 3TZCA 1TXGA 2YY7A 5E3IA 1ZJ6A 3QF7A 2CFIA 5ECDA 2QORA 3Q8KA 3JYNA 1SCBA 3LLSA 5G4KB 1YRAA 1HL3A 3L40A 4GO1A 3LZ6A 4MVWA 4TKUA 3ZHOA 3WL5A 2RHHA 4MV0A 1O9GA 3HJBA 1QIJA 2H4FA 4JSRA 5K0ZA 1FVXA 1EBUA 1WULS 1K89A 1EWKA 1DFIA 3KG2A 3X0DA 1I2MA 2WUDA 2YFYA 4B31A 4C6TA 2BELA 1OQAA 1B2LA 1SCNE 1XLTA 3L0PA 5JIBA 2Q3DA 4MW4A 1NVAA 2FHSA 3JARA 1RWWA 4FHCA 3QGMA 2ZB7A 1YZYA 3V00A 4XYLA 4DTCA 1XWFA 3MMSA 1MJHA 3DNPA 4KSYA 1SUAA 3JYPA 1XRMA 2GK7A 2ZXEA 3ZWBA 5B1DA 4CDRA 1II8A 5CDSA 3PUWA 5B7GA 3DOJA 4ZQCB 1GY8A 3PLNA 5CAEA 4U2BA 4LOKA 4Z8XA 2I2BA 5GJVC 5J23A 1YKGA 5ELXA 3NHRA 4IVQA 4MQ5A 5TJHA 2C4VA 3MIIA 3GEDA 1ML4A 1PJLA 1PFQA 2YWJA 3DZDA 3IT0A 3FNHA 3D6JA 4Z9XA 5B53A 3RTEA 2VTBA 2GCPA 3GHHA 3O7MA 4JOSA 5CVTA 1EDOA 3AEQB 1A88A 3ZVKA 2QP3A 4HWOA 4OQLA 5FV7A 3TIGA 5IF3A 5SICE 1FYEA 3B2NA 3L7LA 4CT5A 2HOQA 4BLOA 4B85A 5AYVA 3TJMA 1ZINA 1KEVA 1ST2A 1E3IA 3PUHA 4UEWA 2FXVA 1A5ZA 4AKHA 1TM7E 2Y0EA 4US1R 1CHDA 2B8NA 1HNWB 1A4RA 3HFGA 1E6WA 4RTLA 1H2YA 1ULSA 3WYCA 3QELA 2OZLB 3MCAA 1OBFO 3IILA 4FGLA 4KFTA 1K97A 1I3NA 3FYUA 5BYBA 1GJRA 3AIOA 4EGQA 3RYFB 4ZODA 4OLHA 4BTVA 5HQ3B 1TVMA 3SQMA 2ZIAA 3GPDG 2FW8A 1HDXA 221PA 3C24A 4ZVRA 4Y30A 3LQKA 4LZWA 2Z3VA 1QH1B 2E85A 4RJJA 4C4RA 3L4JA 1V8BA 4DN6A 4NJMB 5G1OA 1RMQA 2PHZA 3RQIA 2WEKA 4ETIA 4JR2A 5B64A 3ZJVA 3FPBA 3I1JA 2VSFA 4G0VA 3EXEA 3EXG2 2OL4A 3GMDA 4D98A 3PEWA 1N34B 1T8PA 3T9AA 1ZW6A 2PKWA 5EIBC 3RROA 2WU0A 4KVZA 5G40A 1F9AA 2FY8A 4XPIA 2FSVC 4BNMA 2RH4A 1WABA 3PWKA 3K6SA 4OJTA 2JI4A 1SULA 2NV0A 4UEOA 5FWXB 2VCEA 1DBIA 4MUBA 5CNJA 3RYTC 2GYUA 4D9EA 2BP7A 3U31A 2BZSA 3W0LB 3WKAA 4B3BA 3W3AA 2XCUA 3PNLA 1RBZA 4IGKA 4D4JA 4TKVA 1QHEA 4GOJA 4MEJA 1G8MA 1OIVA 2DMRA 2NACA 2UV8A 1H2ZA 3KQUA 3NKLA 4XARA 4NHOA 1Z0JA 3ESYA 1Z39A 3ENNA 4J16C 1OROA 1WCIB 1YNSA 2YJNA 4RE6A 5JO9A 2G72A 1G21E 4JNKA 4DJ5X 2C57A 1LCIA 5BMVF 2Y6VA 3OLXA 1MJ5A 1VI5A 3U0VA 3ZU5A 4BFZA 4YJHA 1I7PA 2PH3A 3ZY5A 1C7RA 2ZROA 2J6IA 3L46A 4C76A 2VWHA 5A4JA 1BJKA 2F8MA 4K9NA 2GTPA 3LUKA 2Q9CA 2VVTA 1KVRA 2VZ9A 3UYKA 3IURA 2EARA 4AJIA 3DV0A 3FWZA 3HB4X 1JTFA 3C3JA 4GXNA 2V3VA 5FQNA 2WAMA 3UWPA 4J03A 4D3FA 4AMVA 1ZD4A 1H22A 2O54A 4OAPA 1TQ8A 4NE2A 4EPWA 1DLIA 4TV9F 1TUBB 1A7JA 4C4YA 1IXZA 2OILA 1C14A 4O4LF 2ZI3A 4AAYA 3EOAI 2MSEB 1ONBA 4KR3A 1SGWA 2ZWVA 5HZHA 3CNLA 4DR1B 1SHKA 1D1QA 1FZQA 5CK5A 2FX2A 5FOSA 4D6XA 5LDDC 4MS1B 2Q29A 5E4TA 3S29A 10MHA 2FSSA 2QS9A 3K9CA 4BJ1A 5IN4A 1U5AA 1V1RB 2BFCB 2OQIA 1BU5A 2JFVA 4LDPA 1E7YA 2PH1A 3G0DA 4QOJA 4JWTA 3LY8A 4PS1A 3FA2A 4MVJI 2QPOA 5CDFE 1IK4A 4LI3X 5C1IA 4FW8A 2YZKA 5TJ9A 3WDKA 3EVZA 1MG5A 1PD0A 1XJCA 1QQ5A 3GPIA 3IAUA 3VKFA 1AO0A 2VJLA 3BZWA 3TRFA 5JMPA 2JKZA 1SD1A 1VMDA 3UK7A 1NLYA 5JADA 3O2QB 1T5IA 5JSZA 2JZOA 3NEJA 4BJ3A 3S2YA 2IS2A 4B4DA 5ICFA 3V7WA 3THRA 2HADA 4G56A 1B0AA 4RD6A 1TJYA 4S1PA 4NV0A 2X7JA 3STVA 1GTMA 2XMZA 4IQGA 1QMPA 3T3OA 2PS0A 4I8XA 5F7ZA 1KAGA 1BGVA 1FP2A 4IUCS 3E84A 1B76A 3LV8A 4DCPA 4URFA 3CEJA 4HDOB 3RSZA 3WS7A 3KQOA 2ZSDA 1C1HA 2ID7A 4FEGA 4CMGA 4YONB 4WI1A 4FONA 3LYAA 1DB3A 5HGXA 3H1TA 2B8EA 1I36A 4H1VA 3T7CA 5KTSA 5JO0A 3LCRA 1KO8A 2R2AA 1Z38A 4LTNA 3DVQX 4B0PA 2OBMA 4ZYUA 4D81A 2NW6A 1SHZA 2PZLA 3IH5A 3PSHA 5KNDH 3EC1A 3OQ6A 3PGA1 3A36A 2QN7A 1YQGA 4HTFB 2J3JA 3ZWAA 3PNVA 4DY4A 2AXEA 4IJUA 3U56A 3GEPA 5EJ2A 3U7IA 4HVAA 2AOUA 4HL6A 1Z34A 3DH0A 3I04A 3B9PA 3UKOA 4RDXA 4IYRA 1SCUB 5E4FA 2RHDA 1IVNA 1O5TA 4EJ2A 1J90A 1XA4A 1BCSB 3K94A 2QRNA 4QU8A 1P18A 4PZYA 3MFYA 1EK2A 1DO0A 4EFNA 4EJ0A 4ZZ3A 1C7QA 1VCHA 5IWCA 2C1EA 2CXRA 3F4LA 5JQGF 2ZSBA 3SXUA 4TL6A 2A57A 4HPJB 1WZNA 4MUNA 4QBTA 2O20A 1VSUA 2QVXX 3L1VA 1RAGA 5DX1A 3NHZA 2GUWA 3F9RA 1XZIA 2GBGA 4X3OA 3VSBA 2D2XA 3ELUA 1T36A 2YIVX 1XYVA 5H9VA 1GT6A 5BQXA 3BT7A 4F3YA 2KX7A 3EXHC 4AY2A 1OF1A 5CLLA 4I5GA 4OYLA 4ALKA 4EO9A 4YJFB 4G0QA 3MOIA 5GIOE 4ZQHA 3DFZA 5IAOA 4K7JA 1EMDA 3CM0A 4NZYA 1M2HA 3KYCA 4YJDA 4FLMA 1CYDA 1VIMA 3E4CA 5FRDA 1ZH6A 1J4AA 5KX5F 3HK2A 1PS8A 2WJPA 1XZCA 1Q15A 2C0QA 5ESXA 2R1VA 3KPUA 1GVNB 3OECA 1L5HB 5HQTA 1U99A 1XDWA 4J4TA 2B4RO 3IDAA 4OI1A 2FWAA 3HVJA 4OQFA 4HP8A 5DM4A 1F0KA 3B20A 1E3WA 1VA4A 3DT8A 5ALZA 1NXQA 1M6VB 1E9FA 1NLMA 3QU2A 1KMCA 4HF7A 4DBZA 5K3SA 4ZQGA 2MSKA 2VP5A 1DAKA 2OHHA 1KQ3A 2WFLA 2GBLA 3F6RA 3TNDA 1W8IA 2R6DA 1ZVVA 5FAXA 1IK6A 5CXUA 5EKXA 2DVMA 3Q7TA 1P0FA 2O5EA 4L0CA 2BGUA 4DG5A 1H8HD 1KFKB 4TXMA 4HN2A 1FMTA 1VLJA 4S1WA 1QPGA 1XDUA 4UTVA 3FHTA 4TV8B 2J0UA 3MTAA 5COQA 2QP9X 3GUYA 3LDFA 3WLKX 3ND9A 3R7AA 4DCOA 4FWTA 1UCFA 3IQXA 4OHRA 4G67A 4XGKA 1HZZC 2NOAA 3HA7A 3TIIA 4HTAA 1ZH2A 1ID8A 1UF9A 1I2CA 2D1TA 1SC3A 4Q1EA 5K3AA 1XMVA 1HE8B 2ZEJA 4GXQA 1M1NB 2R3SA 5MFZA 3AUTA 5HJ5A 1ACMA 1QH0A 1J56A 2VDVE 4BMNA 4DA9A 4DYHA 1EB8A 3MJEA 3QHQA 4NAUA 3ZCVA 2XQFA 1OLUB 2WJ3A 1WKBA 3OE4A 4JU8A 4W4TA 3MCZA 4HLUA 3HWX1 1A9QA 3O3NB 2OKGA 2VCYA 4OQNA 1QG2A 1TEHA 2RK6A 1KA9H 2X5KO 4ZV7A 5LQCA 4G85A 4RVCA 2B4TO 3KIPA 4MR9B 2TRSB 3MPUA 4TLLB 3VOAA 5FHQA 3DBVO 4PQGA 4FFOA 1N32B 4H3KB 2EIHA 4ENPA 4MVJM 1KEZA 3P20A 3PVSA 4R84A 4FFVA 1E3SA 2NPOA 3H3JA 4A15A 4GPTA 1UBEA 3RYHA 1UJ5A 4M7RA 3T1HB 3MSCA 1TMGE 2ZU6A 4LDNA 3QW2A 4XEUA 2CXSA 2WWHA 3H9GA 3CINA 3PT5A 3FHJA 1QHHA 5DCUA 1O3YA 2ZTLA 2BBTA 3IUMA 5GP1A 3VNQA 3Q7IA 5JMWA 3LQRA 3VVLA 4WH0A 2XXBA 1AA6A 4C2BA 3V97A 3MWYW 4DR2B 2IH5A 4WVFA 1EWQA 2DBYA 3EZ2A 4KYVA 1KDZA 2SICE 1OB2A 3NQ41 2I1QA 2ZE6A 4GMGA 4D3ZA 3AVUA 1VZ2A 2CCJA 4R2WA 4KITB 3LC1O 5I5EA 3JQ6A 5G0TA 1XVVA 5U4QA 4KRXA 4OVKA 4WZBE 2JKVA 1M2OB 1USIA 1P6UA 1HWYA 1NRWA 4MS3B 4TUYB 2Q0SA 4R1MA 4TTVA 1Z0IA 4C7MA 1J24A 2QX7A 1ZCFA 2W6CX 3AG5A 2PMBA 2VG8A 3CUTA 3QTTA 3NFRA 5CLIA 3ZCTA 1E58A 2Z2IA 2EW8A 2CV0A 1JG4A 5FI3A 2V5AA 5E2IA 4D8XA 4K6FA 1PG2A 4NVRA 3QVXA 4WTOA 1LEHA 3AB3A 1JXQA 1ZBQA 1QUEA 4R5HA 2X22A 4O59O 4CM1A 2BFFA 3V4VB 1SUFA 4FHEA 1CQIB 4H6WA 3AHCA 4DY6A 3EPLA 2OZEA 2X0KA 1HDIA 4Q4LA 2C92A 2D1SA 2ZBQA 4RLQA 3L7YA 4X8OA 4X95A 3X1JA 4F56A 4ZJZA 4IRUB 3V6MA 2H1IA 4LC9A 2VRCA 5ALFA 2XYPA 2FZKA 2J0EA 1KI9A 2QAIA 3X1MA 4X1KB 1VLMA 2HH9A 2LPMA 2R4QA 3I3OA 2Q6KA 4U6QA 4EPYA 3FLEA 4WBNF 1OVMA 2DTEA 5DN9A 3SSNA 5KMGA 4RA6A 2XX3A 2VNAA 1H42A 3FUCA 3HJHA 4Q34A 3UAVA 3H5OA 4HQLA 3O91A 4OBBA 9LDBA 1ZKDA 1X7ZA 2IHTA 1X7DA 4NLLA 1UBUS 5FTMA 5CB4A 1T6NA 3FDIA 1DEHA 1HX7A 1V7ZA 2AZTA 4IXDA 2A4MA 2RGDA 4ASUD 3OTGA 2ZYIA 2VAVA 3QHAA 5CVDA 4D9NA 3KJGA 2B5OA 4QGBA 2WTBA 5KQSA 3UMSA 1OV6A 1CQXA 1XGKA 2AFVA 3TK1A 1U6JA 3E3AA 2Z30A 3VU0A 1X86B 4US0R 4FFRA 4NF2A 1JFLA 5EJFA 3P2JA 2Z3WA 1YR2A 3T52A 4D6YA 1JEYB 3EVCA 1CQJA 2JIBA 2XOEA 3FPLA 3HBNA 1GFWA 4RVHA 5UKDA 3GROA 4ZYTA 1FNCA 3CA8A 1YGYA 1GN9A 4PCAA 2WJJA 1OBCA 5JT1A 1N0HA 4WCDA 5FLEX 3AGQA 3QVOA 4R54A 5HZGA 4F8JA 1XZDA 2V4MA 3KT8A 3A1SA 2YXBA 3EGCA 4GP7A 5EWMA 4MK4A 4YP9A 3V42A 1T1EA 1SU7A 3RM3A 4EY4A 5GZ1A 4UPVA 3NJ8A 3OF2A 3GGDA 1CD5A 1DT5A 2AD5A 4FDAA 3RE1A 4O4HB 3SDBA 2NZUG 3IPAA 2BMVA 3I53A 4CKXA 4M0DA 4B74A 1P2BA 1Z4NA 4DLVA 1US8A 2PIDA 1ZL2A 2OBBA 2WF9A 4Q39A 1TMKA 5ADVA 5L6MB 3QKSB 2CHGA 1GGVA 3GWZA 3E61A 1R9GA 1G6Q1 1NN0A 3UBMA 5BT9A 1GU7A 2X5OA 3IXMA 1FMJA 3KQSA 1ZGCA 2B78A 4I6JA 4QRDA 1JAHA 5EZYF 3H11A 4EA6A 4BB0A 1Y6QA 3B1JA 3ZDRA 1PNRA 3QBJA 1WU7A 3IV6A 1BA2A 3QY0A 4PLGA 3G5LA 2RARA 3MUFA 3RVNA 4RD2A 3BL8A 4IV8A 2XUGA 1ORHA 3T95A 4PAWA 1E6EA 1G7CA 2YFHA 3U5ZB 4L3OA 2VA8A 1GRRA 3N8KA 1CUJA 1F2VA 5DBFA 2EFGA 3I76A 2AC2A 4A26A 3QOXA 3KQPA 4BMXA 4DM4A 2FW9A 2AFHA 4CM8A 4YIHA 3GV0A 1E77A 1FSGA 1KJYA 5DISB 1MJGM 3PENA 1ZN2A 2OAP1 3OOEA 1U11A 3EXHB 4OMCA 3ROEA 2EKZA 1MT0A 1NQWA 2A1IA 5J2TB 1TRKA 2IDJA 5BSTA 1YVPA 5I3CA 2BM8A 3C5CA 3INGA 3HCWA 2FFRA 2D13A 3NH6A 3DHVA 5K0TA 4ZIRA 1EP2B 3NNDA 1E98A 1R8QA 2VQEB 4QPCA 2IKQA 1UBOS 1J20A 4QUAA 1FQKA 2O8VA 5LMNB 5JALA 3IUPA 2YY6A 1JFFA 1BFKA 5LP6A 3EHDA 2QSYA 3FAZA 4LTMA 3OX1A 5FI0B 4OK6A 5EXPA 3BCRA 3SX4A 3THSA 1KBOA 3KXDA 4IINA 4PQEA 4H3VA 2X0IA 3F6SA 3HVHA 4EK9A 1IWOA 1LPMA 4C4AA 2WIBA 1KS2A 1FDWA 2A9QA 3BULA 4ZHQA 3AI7A 2WY2D 3TAUA 3TZHA 5KYNA 1D09A 4RD0A 4D96A 3ZWNA 1UBNA 1BD4A 3OIYA 3QEMA 1ETUA 1RXIA 3PNPA 1VMIA 4KNVA 1YDHA 3SZOA 3S1SA 1IBMB 2AOXA 2GM3A 4MW9A 4MUIA 4G65A 3T7SA 2WIJA 1J70A 2FAXA 2GB4A 5CBKA 2APJA 3AWDA 4XIJA 5J2UB 5CDYA 3E18A 3T3DA 3KLBA 1VA5A 2WFAA 3ZNNA 3VO1A 5LWHA 3I37X 2FN3A 2P77A 4K6KA 4L2IB 1Y1TA 2OV4A 1NN3A 5BNWA 1YBVA 3CLTD 1JFRA 1HBJA 3CX4A 3S27A 3VR5H 2NO6A 3OMLA 3G2IA 4LJLA 4AZTA 4DMHA 5EP1A 4OB6A 4NZNA 1DHTA 1E4YA 5LMZA 3VRHA 1SUIA 3ZOKA 4DQUA 2CUNA 4QO8A 4N54A 2GFHA 1HXHA 4H77A 1PDOA 1ZHHA 5TARA 4MV6A 3AI3A 1Q1QA 2AF3C 1N6LA 1N77A 4FE3A 4Y98A 5T8KC 2LCFA 3RG8A 3VU1A 1LXCA 1X9IA 1XD2A 4YX9A 3EUAA 1ZM9A 2UVQA 1JT2A 1NYRA 3NHPA 1LI4A 1IXKA 1YE3A 2R4UA 4JLAA 1YHYA 3GLFE 1Q7TA 2ASEA 1GZ7A 1Q91A 2FZVA 3NTUA 4M99A 3RGGA 4AY5A 5J4YA 1MMFB 4Q3CA 1MQSA 1IWPB 3VTAA 5BPHA 3TVDA 4QYWA 4OHMA 3GDFA 4M36A 1BE0A 3C41J 5EWLA 3M4XA 1NR7A 3HWWA 1AQ6A 3DBOB 1IPFA 2A1UB 4PFKA 3USZA 3HA5A 4CL8A 2XBLA 5LB4A 1P7VA 3HBFA 1VB3A 3QKTA 4L5AA 1UP4A 4BNXA 2G83A 4A1FA 1LPBB 1RBQA 1RYDA 1UPFA 3FHOA 1XRQA 3GFBA 4FDTA 4ZOCA 3RFUA 3UUGA 1SEVA 2H5LA 2Y9MB 4TMVA 4WLUA 5ED0A 5EQDA 1H9CA 1XTJA 2CE7A 4W8HA 2PEZA 1QGYA 2AFIE 2ODTX 2FRVA 4DNFA 1YHNA 5CPFA 5F73A 1E1DA 1GO2A 1N25A 2LR0A 1U2EA 1A2OA 1UQUA 1UQTA 4F4JA 3RYCA 1R74A 1YDGA 3BAZA 3PD7A 4Q21A 3I1FA 3JCZA 1GR0A 1XTZA 5AKXA 1C3VA 4HUJA 1KYZA 3VJLA 2AZMA 3T3MB 1ISPA 3Q8XB 4DDKA 2I8AA 1S1MA 4RL4A 5F4ZA 1KJWA 5CDUA 1TTTA 2R8ZA 4UPDA 1HT2E 1QTIA 1OWOA 3T7AA 1CF9A 1MB0A 4CUJA 2XZOA 2CD7A 2ORWA 2FMKA 3A3OA 3WKDA 2C7VA 4F46A 1H94A 4GOLD 3RFFA 1OAOA 1HK7A 4V38A 1GPLA 2B2XA 3SEFA 4DAOA 2Q5CA 2QTNA 3RBXA 1BMDA 1MAAA 1IIBA 4KDRA 2O2YA 3UC5A 4CTMA 2XA2A 3WLHA 4D8YA 3W8EA 5DGDA 4U2DA 3TINA 1SUDA 4LNUB 4P7FA 2AG1A 3CRVA 1IONA 1C1YA 3SYKA 5K5EA 1LBTA 5COBA 3UWSA 4IJWA 3P5BA 2FWMX 4GYYA 5FWYB 4L4UA 1F1JA 1QH8A 2GT1A 1OSNA 3GT0A 3AF6A 1NU6A 4QXAA 4FBMA 4KLRA 3QVLA 4MW5A 3B85A 3LY9A 3OT4A 4KC0A 4RJLA 2X76A 1LC0A 2VZEA 2CDAA 2PANA 2PSDA 2XEXA 2ZBGA 5BOVA 3K2EA 1AKNA 3LCJA 1ODLA 2FZGA 3LUGA 2D2EA 1UWVA 1I33A 2XNHA 1BKSB 2IYTA 2WHXA 2FZ4A 1ZM2A 1L4GA 2WHPA 3E9DA 4MDHA 4XGNA 3TUIC 3RVOA 5A4AA 3W06A 3IRVA 1X3SA 2AJLI 4RF4A 5BRNA 3C5HA 3MWFA 3SJAA 4WV3A 5KIAA 5T4BA 1DQZA 3A4IA 3E0QA 3LHFA 3ND8A 4L6CA 1FB5A 2QJWA 3ZYZA 1CU1A 3CRRA 4B09A 3WLSA 2WYIA 1WCYA 1WZEA 3EUFA 1B6TA 3CZMA 3GCWA 4P81A 1H9AA 2Q49A 2XUHA 3WGOA 3X1ZA 1TVKB 2X77A 4BFYA 3MCVA 2BBWA 4IQFA 3RO7A 3H5AA 1P33A 1XA0A 1V9LA 3ON5A 3V3KA 3BIXA 4RACA 2QR2A 2GD1O 4CM3A 3OD1A 3K0EA 3P0RA 3R5FA 2EJTA 3QKIA 4DJFC 4UTPA 1CJKC 3UHJA 2W2LD 1FFSA 3PUXA 5A7FA 5C8XA 1YDEA 3EFOA 4JELA 4OIFA 2GPNA 4NBVA 4BAUA 4FOSA 1SXJA 5FUXA 1IH8A 4JFRA 2HO4A 1FXWF 3FMOB 1C1XA 2AGVA 1CNMA 2YFQA 5AW7A 4EI9A 4QDUA 2GCOB 3I3SR 1B8VA 3O75A 3DBHA 5ABPA 3D3EA 1TQDA 2FKAA 1QGUB 1CZKA 3MF4A 2NQ2C 3RFTA 3MWJA 3EIWA 3KKEA 3ZD9A 2WQ6A 1PGJA 2QN6A 3PDCA 1V11B 3ZJ4A 1AF4A 5GIPE 3M83A 4NSNA 2J09A 4EZEA 5BVGA 3RRBA 5BSEA 1XTKA 3EH1A 3W7BA 2C78A 2H0AA 2O8DB 3ZTYA 1R18A 1U81A 3JR3A 5FO0A 1EE9A 1EVQA 5TY0A 1M0TA 5DOZA 3S7ZA 1TA9A 2QYSA 2A7XA 3FJ1A 3HN7A 4QOIA 5EP2A 3U7RA 3W7AA 3SS7X 3A4YA 3H9BA 2ECQA 2ECOA 4G36A 4KWTA 5A2QA 3RUEA 4BDSA 1ULZA 1VKZA 2HYIC 1ECBA 1QBKC 2EGHA 5CRIA 3B3GA 4WK0B 2Q5EA 1IN1A 3JASB 4TN5A 1TD9A 3K53A 3ZLUA 2WA1A 1KY5A 2FUKA 2J4DA 3G9XA 4FYKA 2OV6A 1UEJA 4AWXA 1T5HX 3ZE0B 4D9BA 3Q15C 4CLHA 1RYZA 3GMSA 3VVCA 2HU5A 2I29A 3CZRA 3ENQA 1ZLXA 3KXKA 4M6WA 4A3SA 4HQRA 4AMBA 5F1KA 2I6XA 2UVDA 3E6AA 3NM4A 2VSOA 3QE4A 5IEBA 2HW8A 2BFOA 4PZAA 4YXWD 5CA0B 3BE4A 3Q5GA 3DBLA 2P91A 5EZQA 3ZG6A 4XTRA 4EFLA 4OYHA 5J43A 4HLNA 1W36D 1I51A 1YFJA 2RAUA 4PLPA 4KR7A 1YI0A 3PKZA 4GPEA 3RSHA 3S68A 1V8DA 3H1GA 5MF6A 3RASA 2QPLA 3QBDA 4P38A 5C18A 3VZRA 1ABEA 3WLMA 4ZDIA 1L7RA 3QKUA 1R1DA 4G5RA 4QYSA 5TXGA 5CK4A 4G81A 4HPWA 3MHTA 3D2LA 1D2CA 4JZYA 2GA8A 2WIKA 1GQOA 3NTXA 2ZTMA 3MTGA 4TROA 3V46A 1D2MA 3WLTA 5IPFA 1QVWA 4W6QA 5KOIA 4CKWA 1VB5A 2WM2A 3DO6A 4TTQA 1KZYC 4WAUA 1ECGA 4HRAA 4DA4A 5JPCA 2PUBA 4TYYA 3AU8A 1PF7E 2DFKB 1J0DA 3GVCA 4I4LA 2IIBA 4UMFA 1Z17A 4EGSA 1A77A 1HDEA 5JANA 5C52B 1NI3A 1S0UA 1BH2A 1XNHA 2YJ5A 1X2EA 4KFSA 1K6MA 2ZBRA 3FCSB 3IAAA 1X1SA 2DJ5A 4LRUA 2NU6A 4YMIA 4TL9A 2PAAA 5JWOA 1REQA 3KDSE 4X61A 4ADSG 1E1LA 1FDTA 4AL4A 2DTXA 4B84A 5ES3A 3M5PA 3PQ5A 2YNMD 1OT5A 3GRUA 4R7GA 4DR7B 2DAPA 1XNRB 4N8DA 4R9NA 2W98A 3BDVA 2RJ3A 2X8JA 3IPYA 4OSEA 2NNLD 2ZWIA 1K27A 4FNMA 3BRWD 3SYRA 1LVGA 1A1VA 3PHBE 4IZHA 4X93A 1DGQA 4NOKA 4CLOA 1I32A 2JAPA 3SCZA 3KHKA 3RF6A 4AU1A 5JCJA 5EJ5A 3WJ2A 1CFZA 1OBVA 5CGQB 4EOGA 2HLDA 3KHTA 1GTSA 3HUUA 4IWNA 2JD2A 1BTOA 4BVJA 2JGDB 3SEAA 2WINI 1UBLS 1JLSA 2FR8C 3B1XA 2NIPA 1NI4A 3JQAD 4MWTA 4E6PA 2GYYA 1ZD1A 3RS4A 3K0KA 2GS9A 1SQSA 1MC4A 1MH9A 1Z62A 1VE9A 5EA2A 1DCKA 1D9ZA 1TTHA 1UM9B 1KPGA 3HFSA 3SHOA 4J7UA 3R74A 1WOYA 2E4UA 3CNEA 4X6YA 5JROA 5TVKA 3L8MA 1G5TA 1TK3A 1QHYA 2IF2A 1G21A 4LRWA 3R4CA 3HZHA 1CE8B 2I03A 2XA9A 4GC9A 4XFKA 1G6OA 2EF0A 1X80B 4I50A 4MB6A 3TEJA 4D9CA 3AOEA 3K9QO 4LDRA 3BGSA 1TT5B 4JYPA 2WMYA 3MRTA 4BJ5A 5TV2A 1PQYA 4LWZA 5KVVA 4O0MA 1F12A 3FRIA 3SS8A 3PRYA 1R9JA 4CM6A 1MJFA 3VI3B 4CG1A 2PD3A 4DDVA 1ZAYA 2YYYA 4LHXA 5KVCA 3WWOA 3NDJA 4HFJA 1TZCA 3MJRA 5FNVA 5HF8A 5CDGA 1PCXA 1VJTA 1QG6A 1TA0A 3VNUA 1U6KA 1SA0B 4B7AA 4CHTA 3SNKA 2QF7A 2EOAA 3ZGZA 3GL9A 3I9OA 3PJEA 2GKSA 4K3UA 4B81A 3L8EA 1NSYA 5FPTA 3OPXA 3R3XA 4NCKA 4PBTA 4I9NA 1Y48E 3GRAA 4MRSA 2H2FA 3G88A 2J3MA 4UQLA 1JT9A 1LTHR 1XN4A 1ZK4A 1W0JA 3PC4A 2PSEA 1MENA 4G0XA 4J0JA 1XUOA 1SKQA 4MQFA 4ZP1A 4HDSB 1NTOA 3U3MA 5DGTA 3TBHA 1I13A 3EMBA 2A0XA 2ZE5A 2Q62A 1ZSYA 3E3LA 1UKCA 1RLIA 1F7VA 1PJSA 1I7LA 3FPSA 3ROMA 4JQZA 4Z4QA 2UU9B 2ZQYA 3LW7A 1FFYA 4Q1FA 3N0XA 1MD9A 3PXXA 2X14A 3MYRA 1VJ1A 1UOOA 2QV0A 3JQ7A 3N0WA 5FL7D 3FCXA 3E22B 4G1FA 3E0XA 3KWFA 1DEXA 1NAHA 3GYBA 3IAFA 4E07A 2DE0X 1W5BA 1T1RA 3N0RA 2RBKA 1JWBB 2QWXA 4KPFC 3QM1A 4M86A 1OGIA 1O95A 1C9KA 3U4IA 2QVBA 3AQ4A 3KEOA 3I01M 2A9JA 2QG6A 2PO7A 3K35A 3JYOA 1B6GA 4IH1A 3E8XA 2D74A 5T41A 1ISSA 4W5OA 3DE1X 5CG1A 2GCGA 3I0NA 4C0XA 4BFCA 2RK3A 3EGWA 4JDUA 4R2MA 1VP3A 3JYHA 1XU7A 3C3KA 3W5CA 4E2WA 4FDLA 1N0WA 2I33A 2MCFA 3QFCA 4ZOLA 2AKEA 2AHRA 1Q5PA 2G0AA 3RK4A 1B15A 1PFVA 4LJ9A 4DUZB 2XAUA 2WB2A 1YE8A 1P1RA 4KVGA 2FK8A 3GJQA 1U8YA 3ZWMA 1QRUA 2BOVA 3UNXA 1L4HA 1VRVA 4CNBA 2BFBB 5T3YA 2CGEA 1EP1B 4IHJA 4COOA 1QHXA 4FUQA 4OOEA 1R8YA 3LXUX 3AM1A 2I6FA 2WG2A 1JILA 8ATCA 3A1DA 3AEUB 2FUG1 3UJ9A 5H68A 3ETDA 3W5VA 2VZLA 4M1QA 3DOCA 3GP5A 1U1FA 3ECSA 2NVUA 1VHTA 5ALJA 2P4SA 1QFMA 1ZMOA 1L1RA 1TIKA 3LK7A 3QUQA 4UZFA 3STUA 3W9UA 1SBQA 2HCTA 4UQOA 3QVJA 2NT4A 4RJTA 1DIRA 1ISFA 1J42A 1N1DA 2REQA 1Y6ZA 1RXCA 1QFSA 1XP8A 4KXMA 1XX6A 2IE0A 1SR8A 3Q2OA 1K3TA 3DDHA 3REOA 3T5PA 3HKDB 1Y7PA 4TS4A 3RT9A 3RRJA 1P0IA 2AYZA 4KPEC 3SLRA 4EB0A 3OE7D 5BW5A 1MEEA 1UUFA 5CT6A 1VXOA 2O1SA 2IHJA 2WP8J 1CCWA 2PCLA 3PYXA 2VRNA 4K88A 4NS1A 3EMDA 3DE5X 5EQJB 1ZCJA 3WQHA 3VKUA 5FPPA 1S9DA 3EDYA 4P4NA 3UOGA 1KNXA 1NHWA 2Q3BA 3DTNA 1M8FA 3LPMA 1NMZA 2JH8A 3U9LA 2Q6LA 3I28A 1NC3A 4G4GA 4YIKA 3U7JA 3TW6A 4INPA 4BGEA 3D3KA 3TJZA 4F4CA 4NMMA 1GXSA 2ZJ4A 3MN1A 3DMDA 4ACAA 4F1JA 3AFNA 4EUSA 2Z8ZA 2B5WA 5KWSA 1EEXB 4DKXA 3PEYA 1F8YA 3JQPA 4OSOA 1M0WA 2YDXA 3QMPA 2GPTA 4LOLA 2VJCA 3RWBA 4Q12A 2HNKA 1XEWY 4F2DA 4YAUA 4TWZA 1VYUA 2J87A 4GMFA 4J8PA 5CUQA 2I4LA 2PR7A 3A70A 3BM5A 2P1DA 3LYLA 3HI4A 4P3YA 2Z2YA 1EXVA 3C3WA 2YWBA 1NE7A 2Z4RA 2A59A 4KO4S 3U4CA 1GDDA 3HBAA 1E3DA 3F47A 5J47A 2GN2A 1HQKA 2PH5A 1KMMA 2QX8A 3DCYA 1PZMA 2Z98A 4WY2A 1YQQA 4GUAA 1UC9A 5D3MB 5E9WA 4Z3DA 3WWDA 3NGXA 3EVBA 4MRPA 5G0WA 5HZKA 4A2QA 4REMA 1E5VA 1EXNA 3MCTA 5D5PA 1L7QA 1BWPA 3DA8A 3VVMA 1TO2E 2DSTA 1NBHA 1OV4A 4PVDA 4CEHA 5CVEA 2PSHA 5J1TB 4OP3A 4AJNA 1UT5A 1VCNA 3NIWA 4BUJA 1N2CA 2VUHB 1YMVA 3BMXA 5EGNA 1VGVA 3BPSA 4I55F 4S1NA 2JIRA 1KAOA 4OQDA 1ISMA 1CZUA 2R9VA 4PRZA 4WADA 3AUJB 3HU5A 3KLNA 2D5BA 3HE3A 4G4JA 3K70D 3E1KA 1OIWA 3STTA 4CR6A 1RVDA 4R71A 3VHXB 1U02A 1VSQA 5LOVB 1SKUA 4UVEA 3RLFA 3LUAA 1E3TA 5FOUA 1RVV1 4PNHA 4D8WA 4ZI2A 5JQGB 1B8UA 4J90A 1YR8A 4IIBA 4LFCB 2FX3A 3K0BA 3TI7A 4CMKA 3A37A 5LQRA 2HGSA 5JFGA 3FOEC 2QVZX 3HYNA 1NJ6A 1WNTA 1QH9A 1CLUA 3CBGA 5ITSA 1QR6A 4D0GA 3FPKA 5JLAA 5TQ0B 2FWJA 2A9OA 1KOJA 1W5EA 4LJ5A 5NLLA 3GGSA 4F2PA 4DSNA 5AD1A 3GNQA 3NW9A 3NWPA 3R41A 2O4UX 1ISRA 2O7VA 1L6RA 1TJNA 4GMKA 3BBPA 3E7WA 3CXRA 4PFQA 4KSCA 4CI9A 1GN8A 1JX6A 1TZJA 4Q01A 2M6SA 4WKPA 4WLOA 3RHTA 2WHRA 1TCVA 2JFXA 4BNKA 3A9UA 1WHTB 3FCEA 3PGKA 3SAJA 3ROPA 3AVOA 3L6RA 1YB7A 1FQJA 2DBQA 1N5KA 1SVMA 1RPNA 4MPPA 3ZZTA 3JVEA 4DCJA 4YMTA 4H4DA 3H1BA 4XDGA 3TTYA 4W5HA 4JGBA 2XB9A 2FTKE 1HLFA 2IWHA 3VR4D 1YZQA 1U9ZA 5AI4A 2QGFA 4HZGA 5C5IA 4F84A 1OHHA 1JNXX 1GAEO 4F04A 5DYYA 1U2QA 2P3QA 5H9WA 3DDZX 4RENA 4F6RA 2G70A 1X7HA 3QBVA 3MLEA 4O63O 2Q5HA 4MB0A 4MQ4A 5HCIA 3GUHA 5JVDA 3IB3A 2B21A 4S1TA 1GUZA 1NVUQ 3JRXA 2F43A 3QX7A 4D9IA 5AK5A 3A27A 3OWXA 2XTZA 4UREA 3UMVA 5J4HA 4AK9A 3AYXB 1ISHA 1ABBA 4IX1A 1TKAA 1NF8A 3EXFB 2F00A 2ZRHA 4PR3A 2BKUA 1MW9X 2UYYA 4HBGA 2D5LA 4KQMA 5ALNA 3U6KA 2AE1A 1GTRA 3QW4B 1TK9A 2Q3EA 2W2KA 3AESB 1OX4B 2H9YA 4IIUA 4CF3A 2V7UA 3VU9A 3CNNA 2FEAA 5TQ2A 2JGFA 1HG0A 4O2RA 2I65A 2O23A 3R3VA 2BL4A 3AM4A 3QLEA 3O8BA 3WYBA 3HJFA 2Y0PA 4R1QA 5T7BA 3GPCA 3O03A 4N7MA 2VPWA 2ZU0C 4JUIA 1VPWA 3NDIA 1XALA 1G7RA 1P3Y1 2OHOA 4YP0A 5KCZA 1SPXA 5HWSA 4FFWA 3ITNA 2FWRA 3MNFA 1XTPA 2HZ7A 4O2BB 1Y9AA 3DHYA 4DQLA 5ADHA 3DEZA 4RF3A 3I5XA 3D8SA 4CVNA 4PYJA 1PFKA 5IMSA 3CUVA 1UJCA 4BFVA 1AN9A 1U8AA 4CTOA 1KSFX 3T4EA 5D86A 5A3RA 2D59A 3T7JA 1IN6A 3VV2A 4Y2HA 2BVNA 2JIZD 3ZW8A 8ADHA 5LN1A 3HVUA 3OIGA 2PJRA 1RQ2A 2P4UA 3N3AC 1JR3A 4Z5XA 2C3OA 1RC8A 4MGZR 2G8LA 2HI0A 4FEYA 3WSVA 3IJPA 3D2BA 1O9HA 1XTSA 3FPFA 1CBUA 1A1SA 3G5TA 1HYEA 4B47A 2PD6A 1J06A 4WOCA 5AVWA 3OWHA 1L6IA 4HGYA 3URMA 4EMSA 1RFGE 2DBVO 3OU7A 1ZGBA 3DZ8A 2QENA 1G3RA 5DWVA 5TQJA 1EHCA 4EQ6B 4C5BA 1XIVA 5F1OA 4ZEWA 3UAWA 1LC3A 1Z0SA 2BCJQ 1NOKA 1XKTA 1ZBDA 4G0OA 1L5KA 4DLYA 1U8CB 3IP8A 1SXJE 1D9XA 3R24A 3RC2A 1IQ0A 3LL4A 4QUHA 4D56A 3K4PA 4JCOA 4ONEA 4LF4B 1PQ4A 3FUWA 1X1RA 1ZIPA 2WV7A 4JR0A 4HNUA 2WTEA 3R09A 3D6NB 2CLDX 3ZUGA 2ZVDA 5BSHA 1N8KA 1G1AA 1GTL1 1RQGA 1SXIA 2AW3A 5TEVA 1JG7A 2I6QA 2O3RA 2ZVPX 1SVLA 3TWOA 3L6CA 3DVLA 5E3JA 2AFRA 1ICIA 3HNRA 2D1FA 1UKBA 2ISSD 4BP8A 1JUDA 2PG3A 4HV4A 1ZIYA 1J00A 1R37A 2NUBA 4JL5A 5EG5A 3ZD7A 1OYVA 4RAOA 3KZVA 5I8ZA 3AU9A 2XQIA 1R0YA 2XY4A 3T9CA 3V80A 4HADA 1YR9A 3ILHA 5DWQA 1DP4A 4WXRA 5DF1A 4DSAA 1UJBA 4DUGA 2QDKA 5H7XA 4BQIA 4ZRNA 2ZJAA 1G8PA 4N7BA 1RJFA 1Y3AA 3E53A 1KYWA 2V0NA 3BFKA 3FROA 4MVJG 1MABA 3VVBA 2VN8A 4GWGA 3RIGA 4QUKA 1JAZA 1YZFA 1ZD2P 3I04M 4L4RA 4YPFA 5AVZA 2I9KA 2PSSA 4LJSA 3FKSA 1UMCB 2VWGA 3I2YX 4LDAA 4PSAA 5J40A 3OJ0A 1U2DA 2H51A 4KLNA 2YWDA 1ZA1A 2WP0A 4WL0A 6REQB 4AKEA 5JJKA 3PJRA 1QVRA 1F4LA 1VL6A 4EYQA 2YBEA 2WWYA 2ZSEA 3ZDZB 4YJ3B 4BWVA 2LBPA 2HK8A 2XEDA 4P32A 4QUIA 4JHXA 4R2JA 4ZCSA 4BQRA 1A9XA 4ARIA 3GAMA 2HSJA 1WDLA 3PHCA 1DT3A 4XI9A 1GUFA 2YR0A 4ARZA 5CB6A 3QG5A 3V55A 1RBMA 2MSLA 1S1CA 3HY4A 3UFBA 3SR3A 5I9LA 4LHSA 1KKMA 1YULA 4WNYA 1WHSA 2J48A 1XDSA 2WLTA 2G28A 2W2PA 5CT9A 4YMUA 1H65A 4J75A 4RW0A 1TK2A 1TZMA 4GD3Q 3VJMA 2QBYA 2F1IA 1VIDA 3IEIA 3D6VA 4HN4B 2ZGVA 2I22A 4FN4A 1MGPA 5MDHA 4JQSA 3HPRA 1Z6YA 1E3QA 3AY3A 2R8XA 1FJGB 3ZZ1A 4LRTB 5HFNA 4TOIA 5IK2D 4JQOA 3ZCQA 1U28C 1AB5A 3PCXA 2ZRAA 1AGNA 4CMCA 1WETA 3DM5A 4G5XA 1H3EA 4IG9A 1F2UB 3T1NA 3OLVA 4C87A 1JH9A 1HDZA 3ZBQA 3NOVA 2IEGA 2G6TA 5EY5B 2AJCA 1E96A 3ETCA 2E6KA 1W25A 1H4TA 3U49A 1YZLA 2PZBA 3ISTA 3NYQA 2G77B 2C0PA 2IZ5A 4I2NA 4OAOA 1YRWA 1X92A 5E1BA 3UTDA 2VDMB 3ZWQA 4DMRA 2FLWA 2I8LA 2JAWA 1FMCA 2Z57A 3OHPA 5FTJA 4TS9A 4C2TA 4OGFA 1C0KA 1UWLA 1IHUA 3KK0A 3HB1A 3QH4A 2FPGB 3SJ7A 4PX3A 4TUYF 4ZYWA 2QD1A 3QFHA 4HGOA 5KTMA 3C3XA 1A8QA 1SN7A 3EGVA 2JHPA 4KIFA 4BV8A 3EFHA 3F5DA 5D87A 3D8UA 5DEIA 2OWDA 4LV6A 4OHWA 1JW9B 1K92A 5HCUA 3I09A 4PR0A 1SBIA 1M74A 3CNOA 2B35A 2PM8A 4LNAA 4N8EA 2BEWA 2AMFA 2AV6A 3LWNA 1U1DA 5J9FA 3V8VA 2AW5A 3Q12A 4BLQA 5CITA 2O57A 3DP7A 4HR7A 2FQWA 3JPYA 1QIEA 2VSYA 1KRHA 1GSOA 2PUWA 1P60A 1TUIA 2NUPB 1TDJA 3QKWA 1MB9A 4KSBA 1CZLA 1UIMA 2QY6A 4MWDA 4OB7A 1GIAA 3IHKA 3NANA 4QICA 1FS6A 4LWPA 4V0MA 4YO8A 5IAJA 3W8DA 4D5EA 1XEFA 4B6JA 5I7VA 5L3QB 4AX8A 1I6KA 4LZLA 4P58A 3L0ZA 3LO5A 1ZUNB 5AKYA 5AUQA 3FMIA 3K72B 4KLAA 4UNPA 4B33A 3ANTA 4KRYA 1ZK2A 2CF6A 5LQUA 3ZTTA 5K05A 2C4NA 4C3ZA 2WYHA 4J1NA 3C1UA 5B7QA