2K87A

Nmr structure of a putative rna binding protein (sars1) from sars coronavirus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
116
structure length
116
Chain Sequence
MYTEQPIDLVPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDYRHYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 3 of Replicase polyprotein 1a
publication title Nuclear magnetic resonance structure of the nucleic acid-binding domain of severe acute respiratory syndrome coronavirus nonstructural protein 3.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein, rna binding protein
total genus 22
structure length 116
sequence length 116
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16251 NAR Nucleic acid-binding domain (NAR)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2k87A00
2K87A
chains in the Genus database with same CATH superfamily
4J3FA 4D92A 4BQFA 3TXAA 5EQFA 1A3CA 5E2AA 3JZFA 3M6IA 3ZI4A 5LDHA 1D1PA 2EG5A 4FEYA 3A7EA 1LZLA 2BFBA 2CKMA 1DXOA 2CMKA 5LYJB 1KERA 3HY4A 4ZT6A 1C5KA 2NYVA 3HI4A 4TUYB 4BJ3A 2FF7A 3ZCUA 5CXUA 2F8TA 4XGIA 1TM1E 1YE8A 1UQRA 4XD2A 5KCMA 1V43A 3CPHA 4KVZA 5KTMA 1GAWA 2NO1A 3VZDA 1TYCA 4EO4A 3G49A 1FFEA 3BMNB 3BL8A 2B8WA 1E2PA 3FBWA 3HVUA 4RZIA 5A5EA 1D07A 4Q03A 4IH1A 1CEQA 2EFJA 3CH5A 4YDSA 4C30A 1LSSA 3EBOA 1WXHA 2CK3A 2CMHA 3CT4A 3ICWA 1W73A 4XRRA 1WPQA 1ZUIA 3AKDA 3L7NA 4EM6A 3A1EA 3LDUA 4IF4A 3DB2A 4JODA 2E21A 3HNRA 4LXHA 4ZZ3A 1YQQA 1AUVA 3ORSA 4BFWA 2LCIA 3L8HA 3WISA 2FEMA 1O89A 2PSSA 2XECA 4MUMA 4YQEA 2I71A 3DVRX 3UM9A 4YHHB 4OLAA 4DNFA 5FR2A 1PJBA 4BJ1A 1C7FA 1IATA 3M6LA 3O9ZA 1E5TA 4MO9A 2J0SA 4A2PA 1JDBB 1GPUA 3VC3A 1UT5A 1Z47A 3A1TA 2VPYA 2CLOB 4ZVQA 3D02A 3ZW8A 2AOVA 5C5DA 4CQLB 1JG7A 2J5BA 4MWBA 4ARAA 2GM4A 1PGJA 4EJ6A 5BYAA 4EFNA 2AFHA 1OCEA 3TTVA 3V9PA 1Z6GA 4AWXA 4DLPA 1TVKB 2VR1A 3UK7A 1GV0A 1CULC 4G8BA 1GFWA 5T3YA 1ML4A 1J49A 3HYNA 5PGMA 5IN4A 3QLVA 4PO3X 3R9XA 2TMGA 4CUJA 3JQ7B 3PV0A 4D3FA 2WHQA 4GOOD 2HQOA 4I3FA 2IXDA 1P7ZA 3P2IA 2J9ZB 1NXWA 4HFRA 4IW3B 2E4YA 4PBTA 5CA0F 2XDWA 4ZV7A 4DBLC 3ND6A 3HTXA 1ECJA 1YDMA 3LXMA 3NBMA 1OH7A 1IIBA 1SK8A 1PUJA 2BV3A 1FS6A 1Z6ZA 3DBLA 3FHJA 3SN6A 1WULS 3H18A 2J48A 3KX2A 1I2AA 2BFCA 3PEVA 1JT9A 5HKLA 1YR8A 5I9SA 1ECGA 3M81A 4ID3A 1B0PA 2PK3A 3BXHA 3FDIA 2EJWA 3QUSA 1R88A 1E1CB 2ZBFA 4C04A 4RPCA 4GGPA 4IEFB 3U16A 3V1TC 2O52A 2AEFA 1U0SY 2XYHA 1DLJA 3KJFA 2PS1A 3AY3A 2ZTHA 5E7QA 1YWGO 4OQLA 1QIGA 4G09A 3W9YA 1U4OA 4RHXA 3K4QA 1JKXA 1FVFA 2WD7B 4M8LA 5EEGA 5HF9A 5TRTA 1I51A 1K7XB 4WESA 3ZBUA 2VWGA 3PQ8A 5DI3B 1CNEA 2MINA 5GWXA 3SF0A 2I54A 2GR9A 2ZRNA 4IDGA 4TM7A 4J2TA 3ZWQA 5IDVA 1FTYA 1HG1A 1VMIA 1YZTA 2BMAA 2PZJA 5C8YA 4GSKA 4JI5B 2CYCA 2HJ9A 5IYZB 3EZYA 1EVKA 1X15A 4ZU6X 2EWWA 2XUFA 5K99A 3OQBA 3OZ7A 4PLPA 4BFSA 1OD6A 3L04A 3SQWA 1J20A 2ZZNA 5FOWA 1OF1A 1FZTA 3G5AA 3U9LA 1IULA 4FS3A 3V80A 3OESA 4M0MA 3OQMA 4PEVA 5K0CA 3ZWAA 2O8CB 4LYAA 4L51A 2LDBA 3TINA 1U11A 4GDFA 2FKAA 3KQTA 5B4UA 2BKVA 3RV4A 2A0FA 5JMWA 1A96A 1X94A 4M87A 3RG8A 2OSBA 4H9GA 2P2GA 5JSZB 4WA7A 4LCBA 3GLIE 1RCUA 4B09A 1YUNA 5IK2D 3ZV6A 3D4OA 1EVLA 3QXGA 3C3YA 4G4IA 1K7EB 1K66A 2I3DA 2JHFA 2QZSA 3KV1A 4XJTA 4DLNA 1IBKB 3MJFA 4E32A 4LHXA 4OQZA 2BUCA 2ZTUA 3DOHA 4Q47A 3JWIA 2AX4A 2B82A 2HREA 2H6EA 3AESA 3FNRA 2BFDB 3KZCA 4GS5A 3BAFA 4NPAA 3DLPX 4FZVA 3K0CC 2P67A 1HT0A 4P0PB 1P0FA 3B3JA 2M9MA 1FP7A 4A9AA 1Z5PA 3QYPA 3K2QA 2Q4OA 4BZWA 2WF6A 4C43A 3ML1A 4YMTA 5LNK6 2GVZC 1XZAA 1QV9A 3L18A 1V6SA 1T5IA 4FC6A 1ZONA 1RWVA 4MRNA 4ZT4A 1I7SB 2J9YB 3NVMB 4D42A 1NI3A 2VDPB 2JH9A 2QMQA 3OZRA 1ZUNA 3CUVA 1P2FA 2AT1A 4DXHA 2BHTA 1RT9A 5DB4A 4EDHA 3AHIA 2D2VA 4ND5A 1V1MB 4UE3S 5AK5A 2H4HA 5EJ2A 4EHJA 1J7KA 1S2DA 5G0TA 3L8GA 5GOZA 1TF7A 3A1WA 1AXRA 2CSUA 1AGPA 5CITA 3FI9A 3B52X 3TCNA 3REQB 3UT5A 4LYGA 3UN1A 1VLVA 3IEUA 3KYDA 3GF4A 4JNCA 2WD9A 3U37A 4C7BA 4CKZA 2YCBA 2R6R1 4G5GA 4Y2TA 2RK4A 1ODKA 2GZAA 3BILA 1NP3A 1XDBA 3BZWA 3OCWA 1V41E 4FEEA 3TLEA 2WWTA 3TTTA 5IU6A 1XJCA 4JQZA 2D00A 3GA0A 3QWFA 4WN3A 4RA9A 2HV8A 2YQZA 1L7RA 4P3NA 1DKNA 3L4BC 4IVQA 2HWXA 3VH1A 4LJAA 1M9NA 3CNHA 4PLVA 1ZA1A 3BFVA 4Y1GA 1FX1A 3U80A 3OPXA 3WRVA 1U7DA 1V4NA 3DUWA 4N6NA 2H48A 5TPZD 4BX3A 3CBGA 5C8VA 1T5LA 2WP8J 1T1EA 5EG5A 4G63A 3O03A 4CDNA 1VOTA 1E2QA 1I33A 1U9IC 1RBZA 1ZOSA 3D59A 4FCCA 4INZA 1Q14A 1GAEO 1BH6A 1T1JA 2AJBA 3JQRA 4BB9A 1EWVA 3F6PA 3F98A 1Y5RA 5FBVB 3DVAB 4AJHA 3GRAA 4J4HA 4TN1A 4LAFA 4EKDA 1GWNA 3RABA 1S2MA 3N2GA 4UPEA 3PQ5A 4M1TA 1DMRA 1YZVA 1IAVA 2VS1A 2Y77A 5DJ5A 1EX1A 1GPKA 3EYWA 3JVVA 5CGQB 5E0KB 3FKSD 2B8TA 4KFRA 4HH1A 4MLPA 1T26A 5DYYA 2GERA 1RWXA 1ZVJA 2XHEA 2XJ4A 4BDTA 4D80A 4LN1A 3DBOB 4MHTA 3M82A 1PD1A 5M3BA 3WLTA 2LE0A 2P6UA 3MBIA 3LXUX 1WE2A 3VYVA 2O3TA 3DFIA 3ZC3A 1TO6A 1G3MA 3DWFA 3HADA 5KBYA 3A6PC 2VF8A 3PFWO 4BX9A 3M8KA 4B0OA 3X1YA 1Q0RA 1DJQA 2HYDA 4TMXA 4I8IA 1M2JA 4UTOA 2H4JA 5IANA 5JY1A 2O8FB 2PS9A 2XUDA 1A7JA 3EXIA 1JVBA 3A32A 4P4TA 4N76A 5DNEA 3HB0A 1T35A 1OQAA 1ICEA 2B9EA 4WEQA 1T8RA 1T0BA 3OIYA 5BMOA 1S6YA 5CDTA 1R8JA 3D4BA 4GDMA 3W5UA 4JJIA 3PXDA 5A5FA 4B7AA 3GGPA 1FTGA 3TMYA 4B31A 1PS8A 1IZ8A 2B61A 2NV6A 3IGFA 1XR3A 3MC1A 3ODGA 3PXGA 1XVAA 4F9EA 4PO9A 5B1HA 4QEDA 4RK5A 2Q4RA 1T0UA 2VOEA 4JFRA 2C7QA 4LWQA 1V1RB 2GN0A 2JGMA 4XVUA 1AT1A 1NFFA 3CUSA 4G1BA 4UDXX 5CVJA 1FDTA 2ZZKA 4L07A 2O7RA 4FYHA 4PYNA 3EOZA 5CP8A 2NAPA 3K0AA 4DB4A 1IZZA 1G8MA 1WCV1 1X7YB 2P40A 2QJFA 4TL8A 1V39A 3LT4A 1S2OA 3HGTA 3EY4A 4FMPA 3FCUB 4KQEA 4B71A 2W4MA 5BW4A 3QKTA 2LRHA 3EY9A 4JV5B 1Q6ZA 1Z36A 1AM4D 5EXSA 1L4KA 2NGRA 3ECCA 5H59A 4BZXA 4C05A 2R6HA 4XCXA 4HAXA 1CNFA 1RM4A 3VPXA 5JAHA 4N7RA 3WFIA 4ZRDA 1QDUA 3ZQJA 2ZKIA 3ASUA 4PYMA 1PL6A 3BMXA 5AVQA 4DR5B 1F2TA 1XRQA 5K3AA 2DKOA 4LQCA 3GT7A 3RR2A 1PWXA 4BRWA 5IH7A 1CQXA 2ZB7A 4EYSA 2BH2A 1AGYA 4EO9A 2E55A 3BMOA 3QW2A 1APBA 5BNTA 4QAJA 5C53B 2YRFA 1R0KA 5TT1A 1CUYA 1G8GA 2C78A 2VP6A 4EX6A 2HSDA 2QTZA 4NL4H 2BFWA 4X00A 1MCZA 2ZT8A 2QGZA 2BBOA 1JPVA 2CDAA 2DQSA 4UFPA 1IJEA 1W0JA 3LQ2A 5AOCA 4WZBB 1JQDA 2Z98A 2Q46A 2OG2A 4RDHA 3SLRA 2OBXA 4HB2A 3C6MA 2O07A 1PRYA 3EAFA 4XIFA 4WH0A 4UCWA 5H68A 5JYEA 5BV8A 1Z28A 3LGAA 2RHGB 1ZXXA 5KDOA 1WY5A 4Y98A 3K0BA 1OB5A 4GZLA 1D6MA 4TSFD 2IS2A 2E4XA 3K70C 4FONA 4CMBA 5JJLA 5FUVA 1Z4JA 5C5CA 1QAMA 2O2EA 2Q28A 4NH4A 3U3JA 1LVGA 4O08A 3K32A 3SIXA 2CDRA 3UPDA 4OM7A 2B69A 2B7BA 4FE4A 3ZW7A 3FKJA 2AE2A 4U6SA 4HVTA 3S2FA 5CYGA 1PFKA 3L7KA 1EDDA 2OCIA 4C4AA 3STVA 4RFVA 4I6JA 4MLDA 5A3VA 3R7SA 3U9SA 2HA7A 121PA 3EC2A 1FUEA 2J3MA 4DWVA 5JSUA 2D1RA 2PSJA 2H1VA 5E7JA 5BOSA 5JISA 4LI0A 4HI0E 1JDZA 1XNJA 1L8OA 4PHGA 4MV3A 4QRDA 4DCJA 5JS8A 3GLGE 4P93A 4JFAA 1EDEA 2BGMA 2IP4A 3OT1B 3SE7A 2EG9A 3OPQA 4E14A 3I83A 1NA5A 3ID6C 4R1TA 4RD4A 3PYXA 1OX4A 4MSUA 2H52A 8OHMA 3TR6A 3A1CA 1BD4A 5KYXB 1NBMA 1MO4A 2DBZA 2XXJA 1Y6GA 1QV7A 1COWD 4JVMA 1DE0A 2FDRA 5AVJA 2OCKA 1PHPA 3U0VA 4AF6A 4B3BA 5ALPA 5KNLA 2ZRLA 3JQ8B 1NZJA 4RMIA 2AOTA 4M1KA 5JSYA 3KXLA 3L93A 1IVYA 4RZHA 1MH9A 3AR9A 1JVNA 2C7PA 2DHCA 3K96A 3MIIA 3CIOA 4OH1A 4FBGA 4EGFA 5BO5A 5JMPA 3E35A 1Z4IA 3O91A 4OHWA 1HYBA 3H2BA 1JU9A 2P1RA 1N1DA 4I1UA 3EZNA 4FR2A 1IJKA 5HM8A 3HK2A 3MT0A 5JASA 3MUNA 3IJPA 1D5CA 5LL6P 2QV7A 2GYUA 3EQ7A 2FKNA 4KCGA 3VZCA 1G2PA 2AHRA 3G23A 3TNFA 1XQVA 2O20A 1MJ5A 3UQYS 3ZYZA 4QSMA 3DLHA 4KQCA 2V0GA 2Q41A 4FJ0A 3WLAA 2A57A 4MKGA 5E2IA 4YUYA 1J90A 1BJRE 1PS0A 2W90A 1ISRA 3OOWA 3P32A 3CSSA 4F46A 1SXQA 3KEGA 5IJAA 3SHVA 4H6VA 3QENA 5A6SA 1FRZA 4RO0A 3GNTA 1E2GA 1U7OA 4P58A 2M6SA 4AB1A 2ZTLA 4MQFA 4PS1A 2NPOA 3GG2A 3C16C 4Y2GA 3PHBE 4DADA 2EBWA 3HQ4O 1XRNA 3E1SA 1NOJA 3BZUA 1JMYA 4IKEA 5FP0A 5A5GA 4ARVA 1J1UA 3BGOS 4KJXA 2HU7A 1DIBA 1Y48E 1DS6A 1FB5A 4HB0A 4R2JA 3LY8A 3QPCA 4RE6A 3B51X 3QFTA 3QPVA 1XYVA 4LX8A 2VWPA 1PF7E 3WYBA 4DMRA 4ARIA 4YV1A 3R5XA 4F2DA 1R0SA 2QVYX 3CKYA 4EQ6A 2CXRA 4RZ3A 3ESXA 3T5BA 4GP7A 4Z8XA 2RJ3A 1KZ4A 5HXAA 1E6WA 3H9EO 1A98A 3O6VA 4OA5A 4V0ME 3PNKA 3KB8A 3L7YA 4XFDA 1E9SA 3C6QA 5C37A 3SFVA 1ZD3A 4HWSA 1CY6A 4O1MA 4DMFA 1XCMA 4R81A 2WMDA 1VL1A 2PHZA 2UYYA 5FLKA 3P2YA 3RAGA 4B44A 1BCRA 1WBDA 2J3QA 1KJ8A 1GGEA 3PXEA 4UMFA 1GQQA 4ABYA 3TE6A 1U8EA 2BFBB 2QHXA 2IKQA 1FXWF 5BSWA 5K01A 3S4YA 3IP1A 1QGUA 1YJXA 2NXNA 2QDXA 3IMCA 4FFSA 4OMUA 1JKJA 4GYYA 4BEWA 1Q0QA 4ZV4A 2CHFA 3QP9A 2J45A 4GFDA 2V8OA 1E58A 3SI7A 1KH1A 1QORA 5CA0A 3WHKA 4LCEA 1YF3A 1TO1E 3D4LA 3WG9A 1WO8A 2GKOA 4HNHA 2C8KA 4QVIA 1A4RA 4FYXA 2O2ZA 3L0DA 1V3VA 1G1MA 1QK3A 2P30A 3Q15C 1I6MA 2WYUA 1F14A 4YMVA 1XUOA 4H15A 4A5OA 3LW7A 5I9BA 3UPTA 1IWOA 2PAFA 1F0YA 2BE9A 3K9LA 1SZDA 2YIVX 4V1CI 4KXFB 2ZRAA 4QDKA 4EKIA 2BF4A 1N0HA 2J07A 3Q3JB 2JHCA 4KHPB 5FTKA 2O5RA 1K6EA 3Q7EA 4NJEA 1KVUA 4F4FA 3USZA 1C3VA 1DOAA 1QGDA 3FD8A 3FGPA 1NRWA 2OXTA 2FOLA 2C31A 3I6QA 4MB2A 3GRYA 3ZHRA 4GL2A 3PE3A 4B0PA 1MT0A 3DOEA 1WAMA 1SHKA 2F00A 1OX6A 3FMGA 1GZVA 1VM6A 2CLEB 4YJDA 4B3DA 3J80A 4H6WA 3AKYA 1JG3A 4JHXA 3PFGA 4ABTA 3IBSA 4WDQA 1QZXA 3A11A 4I1PA 3KHUA 1LI4A 3KJNA 5B1EA 2AFHB 3C2QA 5FUBA 3RJZA 1NUQA 1ZNXA 1IQUA 4TTAA 1P7CA 3D1JA 5FWAA 2E5FA 3UTCA 5DBOA 2R6DA 3B1FA 3AR2A 4EZIA 4LSWA 4F85A 4BGIA 1HE8B 4KDCA 5KQRA 4DJJA 3LCRA 2G9ZA 3CG0A 5G1PA 1XTUA 3GIWA 4WACA 5TMDA 1TI7A 1O3YA 4V03A 3R9XB 1CK4A 2C2MA 2VWHA 4MEJA 5HJ5A 1MGOA 1Y7PA 4PYLA 2L82A 3LQ1A 4E2WA 2XKKA 1U81A 1GZHB 3MOSA 3PQEA 1CD5A 5IXJA 4LY0A 3N53A 4FBLA 3ENKA 3DBLB 2PGAA 5JVDF 4B3FX 4R5HA 2BFCB 3ZZ0A 1K3TA 4JD5A 2B1QA 3T4EA 4P8RA 2V7VA 5G4KA 3NTXA 4FB5A 3IQWA 1ZD5A 2WU3A 3ASZA 3L49A 3NG1A 4S0ZA 4TS1A 4TRRA 1X7DA 3IKMB 4DANA 5KOYA 3MZ0A 4PXAA 5DZSA 4POOA 1FFDA 3OBBA 2CLMB 1G4AE 4MR7A 4Q6BA 2Q3BA 4JMPA 3P2KA 4IAOA 4U63A 4HQ6A 3OQ1A 3UYKA 4L8LA 2C42A 4UOQA 4ZVOA 2D2EA 5C46F 1EBFA 4FKZA 4L72A 3VYUB 4DUYB 1N3LA 3EZ6A 3LX4A 1X6VA 221PA 4WESB 2B92A 1FDIA 2YWRA 3PGKA 4MYCA 2MINB 3U19A 4UEJA 3ZD7A 2JFFA 5B6IA 1F06A 4HEA6 2MOKA 1H23A 1N2JA 1MJGM 2WJZB 1NVVQ 3FOAA 3PFFA 421PA 3QVGA 5C8YB 1F51E 2ZS9A 3CB4A 2V55B 4FB4A 5KNBA 3EVDA 4HRAA 3RS9A 2AMJA 3OKAA 5K8TA 2HRZA 2NZWA 2R4TA 4C2UA 2CXUA 4MVJD 4BQOA 3W6UA 2I8AA 2NZ8A 3UUGA 3NHMA 5JBNA 4RHCA 5HBRA 5AUQA 4YO7A 3UWPA 3UT0A 3ZJ5A 4HY3A 4Y6GB 4W9NC 4UM5A 2FFRA 3R9IA 2FPLA 2P0AA 4LISA 4JYMA 2NYAA 1L4MA 1M66A 5KUTA 3OZGA 4B5KA 1A9RA 3FCSB 4XUGB 2A1IA 2WQ6A 1NT4A 3F6EX 3M5PA 3N0VA 4DWOA 1HLFA 2VTVA 4ECEA 4AMZA 2DGDA 3OWHA 4Z1MD 2N1MA 3GFFA 2NZ2A 1QNFA 5LOVF 1GEGA 1KEZA 1N75A 3SE0A 5IKMA 4FZRA 4CUZA 4N47A 2FGJA 1SHTX 3MLEA 3BB4A 1T2VA 1ZW6A 4BP3A 2SBTA 5EQJB 2WTUA 3PFNA 3QRWA 4ZCRA 4MAMA 3RRNA 4P4GA 4CEIA 3AESB 4G9GA 2ZUTA 2Q9AA 4FDTA 3O2JA 4AP9A 2XXAA 3NHSA 3LT1A 2PA3A 3FNHA 4DE5A 2ZPTX 1DXHA 1SVWA 2JA1A 1YAHA 5DU2A 1DMSA 2AYZA 1N4DA 4K1LA 4KBFA 3O74A 3AUUA 3ICPA 2HCJB 2BGLA 4CEHB 1RLTA 1D9ZA 3B85A 2BKLA 4CF7A 1L7BA 3Q7QA 3SZRA 2O6LA 4EY8A 4K9QA 1ZUNB 3CLSD 5A9RA 2BSAA 1NLFA 1UPUA 1VJ1A 1OFUA 1Z8NA 1SVUA 2EDAA 3I3OA 1QVWA 4QFDA 4YRNA 1CVLA 2GEJA 1H9BA 2X22A 4CF3A 1UCFA 1W36B 4DDMA 1N5JA 2V0CA 3IP5A 3L9XA 1M6YA 4ND4A 1XLTA 5JBQA 4PU0A 5JZBA 1P7PA 3CXUA 4J0CA 3BMCA 4IJKA 2D1FA 4OCZA 3FNIA 3UT5B 4P6VF 3HDVA 3KYDB 3IMEA 4WK6A 1U99A 4GIBA 5G3ZA 2O7NA 2RAFA 3ZCSA 3S0JA 2HHJA 4G0ZA 1KVSA 3S1AA 5K0SA 3M3DA 2LIVA 2O3UA 2VJPA 3H2IA 4K6OA 3BCHA 1Z74A 3D6FA 2XRYA 4YRBA 4JZYA 1W5TA 1J0BA 4US2R 3P9XA 3VR4D 5DGHA 3I4FA 1QQ7A 1UEIA 1YQEA 4F5DA 1EP9A 3KP1A 5IC6A 3DXZA 2ACKA 3V4OA 4I2VA 2Q27A 3IO5A 4GPIB 4TTPA 1QP7A 3T5AA 2AQ8A 1RTKA 3PJDA 1TF2A 3LKDA 1T9DA 1P0PA 1HQCA 3LP5A 4UQOA 4WPGA 1K6IA 3QPWA 1II0A 1P6UA 1Q22A 3AC0A 4DMLA 4YMUA 2R4QA 2JIBA 2AHOA 3NWBA 3N2GB 3V46A 2PBZA 1YZNA 2ORWA 2QL6A 4LYDA 4YJ2F 3QTBA 5FPHA 1BDIA 4CLHA 4PX3A 1Q7EA 1ZZGA 2E3JA 5GGYA 4ZYZA 2RH5A 3F5QA 3PJEA 2G82A 3SR3A 2A4MA 2JAQA 4F3CA 5SZJA 3WLFA 3FUUA 3OT5A 4MUXA 2GVDC 3RC2A 1M7GA 3IEKA 1AUXA 5CDGA 2OPHA 4H3KB 3BTSA 1B43A 2I5PO 4IINA 4GLFA 4UEQA 4DB2A 5CCDA 4IRUB 2H17A 2G8LA 1TKRA 4ZO8A 3EXIB 4MQMA 1OPXA 5THXA 4CMHA 3VC1A 5I7RA 4RJLA 2QROA 4UEWA 4B2LA 3IP9A 5HCNA 1KDVA 5DNCA 2EVWX 4QQNA 1JG4A 3TIIA 3CVUA 2J31A 4KN9S 2F55A 5D3MA 4B8WA 2GZ2A 4S1TA 2ESRA 4BPBA 3JTEA 3CVWA 4ND1A 1GQ2A 4W7HA 4BQNA 1KIAA 2XUAA 3Q12A 3V7YA 2DX7A 1QZ3A 4G4JA 5AHWA 2JJ1A 2R68A 4ZANA 4ENVA 2BMDA 3UYLA 1J09A 2JFPA 1I2DA 2LZ0A 2AQHA 4RABA 1Q0LA 3K0AB 2X9NA 1C4XA 4GX5A 1XO1A 2IQ5A 1G38A 2FXVA 1AV7A 3ZK7A 3QVUA 3NORA 2OKCA 3P4UA 4E51A 1DKMA 3ZIAA 4DDHA 4X71A 3IV7A 3O2SB 4JKIA 5JTTA 2PMBA 1N8SA 4KE6A 3M3HA 3LL4A 4ZGGA 1JIKA 2GEDA 3HJBA 1NVDA 1NC1A 2BR3A 4HO1X 1F60A 4MPDA 2I9PA 1F2TB 1QXSA 4KZKA 2I6TA 1RR6A 4GMKA 3CZ5A 1AY0A 2BM8A 1EGQA 2R11A 3BMOB 2PZ8A 4JP5A 2H4WA 1YUBA 1QB8A 2O2GA 4UE2A 4YMSA 3OURA 4L5IA 4QBHA 1VIYA 4IFIA 1EDZA 2K2QB 5D87A 1NMSA 4CMGA 1DJPA 1O1YA 1SBZA 4AY3A 3RW9A 1MZPA 2H4YA 1Z2DA 1XU9A 3W2FA 3HSKA 4FE3A 2XQFA 2XWPA 3I32A 4YWJA 1QKIA 5AK3A 3RNOA 4WZBE 1WSBA 3OUUA 2WKWA 5H83A 1QR2A 4PRYA 1PL8A 4YCMA 1PX2A 4D3DA 2Q29A 3H5NA 4D81A 2QTMA 1JSLA 3BWYA 4BQQA 4LF5B 2G0TA 1ABBA 3HWX1 5EXEA 4L4ZA 4M46A 2X15A 3LLVA 4MVJM 3H9UA 1GT91 4LVOA 5AVSA 4NXMB 4NBSA 1QGZA 3D31A 1OY1A 5EMKA 1YCHA 1JU4A 4Y7DA 1HM5A 3F6SA 1GGNA 2C04A 1ZXBA 1OKKD 2QVLA 1W4AA 3ITDA 4US0R 1DRUA 3G13A 4ZVTA 4PIPA 4ZPJA 3ZE2B 4ASUD 1ONNA 5DHPA 4TKVA 1IDN1 4C4ZA 3N7UA 4L1KA 1W93A 3L4KA 5AVUA 1GDDA 1NN5A 1C4OA 1EZ4A 3IQEA 3NRBA 5J4LA 3AR4A 1B8VA 1F9AA 1YXMA 2Y99A 3WZLA 5JBIA 2Z9CA 2NLOA 1GITA 3IDZA 5FRDA 5CDSA 5FOQA 3IR7A 1N6HA 1N9GA 3JQ6A 1YMQA 2GHQA 1AQUA 1KOFA 4CQMA 3N75A 4LG1A 3D0RA 5BOSB 1I01A 3GEPA 2WABA 3P52A 4YT5A 3RU7A 1Z7WA 9GPBA 5K5EA 4BPRA 1EIZA 2EZ8A 4S1PA 2C8VA 1ZN2A 2H51A 2HMUA 3V1KA 4P84A 5BYJA 1IE3A 2CSXA 2JCXA 1XTRA 2H1HA 3U62A 1EX9A 1OX4B 1CFZA 2TYSB 4LGCA 1DAEA 2WWRA 2YV3A 3Q4GA 1VL8A 1NUTA 3CN9A 4E5PA 2A5FA 3INNA 2R5FA 4NEHB 1SUIA 1NV9A 2BHNA 2IYFA 2AZDA 2R65A 2AOTB 2ZDGA 3QPAA 3A6JA 1RAGA 4QXPA 4XEUA 4C89A 3LBNA 3ZQUA 1N7HA 3O94A 2B6HA 2D5CA 2FF5A 3FBGA 3Q5DA 3EGWA 5SYNA 3DLTA 3OJLA 1U28C 2NSJA 3GPBA 3SVZA 3FSGD 4NG4A 4WGFA 4DC9A 1IVSA 1N0WA 1DAIA 3JYQA 3IAFA 1VGVA 1K5PA 3EGVA 4G2NA 3MNFA 2BJHA 2FETA 3OLVA 5AXDA 3GA5A 4IJ6A 5A0FA 3RWMB 4F71A 5LN1A 5EIEA 1JHZA 3TEJA 3KM0A 4JUIA 2O0KA 1E2BA 1P62B 4ZYVA 1Z33A 1KZYC 1E4OA 1F4LA 2YC2C 4C4TA 3EEBA 4LZNA 1FXWA 1CUCA 1BNCA 1JKMA 1XTZA 2BMWA 2UYOA 4K26A 5LQSA 3FTFA 2UZAA 3MG9A 3HFGA 4G0NA 4GMDA 5ESRA 5H82A 4E08A 3L7BA 1DV1A 2GWRA 4IDOA 4N5LA 3UMJA 4D9MA 4IV0A 4DBVO 3KVOA 4O2AF 3FLBA 2UU9B 1RI2A 3BGVA 3W5DA 3GEHA 2WE7A 4R40A 5JCJD 3RT9A 1ZIPA 4D8VA 4WCFC 1JIIA 2L0XA 5K7SA 4MKIA 4YAWA 4DLVA 4MYHA 2JFOA 3E9MA 4B35A 2GPWA 3O2QB 3QBEA 4Q01A 4GP9A 2QNBA 4YALA 2BDTA 3B7PA 3E9NA 3O4GA 3VR1A 4RNDB 4WXEA 5CH3A 4RJ2A 2XMZA 4UOEA 2GPBA 3TEFA 4Z7NB 1P9LA 4FHEA 3FVRA 4WBXC 1TEVA 2I7DA 4ZEWA 1TC1A 3ZV5A 4JC5A 2WYVA 3C6KA 2YMQA 4MWTA 5K3BA 4EQ6B 2EF0A 4D9JA 2A35A 4AJ4A 1A8SA 1SZCA 3OQIA 4E15A 1X7GA 1P39A 3SC4A 3VI4B 4YYZA 4RPKA 4WNAA 4Y2VA 3ROZA 3T7CA 4C21A 2NU9A 4DLSA 2CNNA 1NHGA 1PLKA 2ZJ3A 3JQCA 3VR6D 2RC6A 1VLQA 1O08A 1PR9A 2VDLB 1OYVA 2BW0A 4YEDA 1BCRB 2GGSA 3NI2A 5IK2A 4XB6B 5T64A 4EHDA 1F3LA 1V4BA 5KINB 2QL7A 2FU5C 4QYTA 5I8ZA 5FV7A 5KCZA 4MQLA 3THXA 3KOXA 1NKVA 3EFHA 4JT8A 4BC1A 3CLRD 1TKAA 1EFKA 4QXQA 1QGUB 3UH1A 4UASA 4BMDA 5CB8A 1JKJB 1N92A 1Y5MA 3RT7A 2POCA 2YQ5A 2FX5A 4BLUA 1TXGA 1UWLA 1K88A 4P33A 4UMEA 3PRKE 3VZSA 2PKQO 5CA0B 3TG2A 1D2HA 4CM8A 2ZVPX 3D2AA 2VA9A 2HH9A 3AUAA 4DR7B 3QKIA 4CGZA 5C7OO 1H05A 1KDTA 3G88A 4LMBA 5JVDA 4FMDF 3ZKAA 3LS2A 1AG9A 3QLUA 1LNSA 2I7TA 3DVQX 1ISSA 2PWPA 4FSHA 2XV1A 1X1EA 1TQ6A 3FNBA 3G8YA 3O75A 1W85A 1D8TA 5KYTA 4OHOA 1GLNA 3IOCA 3FPKA 4MVJF 4NJEB 2Q4TA 3TPCA 3E23A 4JLKA 1UZUA 5B55A 4N6OA 1AKRA 2HLDD 2IP1A 2DR3A 3V2IA 4NESA 1Q91A 4O2RA 4U0JA 5D7NA 5D84A 1H8ED 2I1LA 2VF2A 1SVOA 3PFBA 3ZQ6A 4BGUA 1J2JA 5JY6A 2XUQA 4L8VA 3MCVA 1B6RA 1C7RA 2E6KA 3PPXA 4XE5A 5AO9A 3W9BA 1F5SA 5CJJA 5SY6A 3N2NA 3TTXA 4DR4B 3AP2A 3BFXA 1CEEA 4IHAA 4C1BA 4WEOA 2CF6A 4B7CA 5KTOA 1FUIA 2AFHE 4JLSA 3JATA 1XRJA 3T1OA 2PSDA 4IGIA 1UJNA 4Z7QB 1DKUA 2HX1A 4LWPA 1JHDA 1RQRA 3DDWA 4TROA 4CLXA 3ZY2A 3GVIA 4DNXA 2GZ3A 3CLHA 5JS2A 4ZJPA 1ZGBA 4DR1B 2QG6A 2L17A 1W49A 4WD3A 2OWEA 1W2GA 4P22A 1GGFA 5TPZA 5AKIA 2B2NA 4B9AA 5C1PA 4EHNA 4WNIA 2WEKA 1LPPA 2QRNA 1JUDA 5KYYA 2Z3WA 1WPGA 1JDBC 1G0OA 3GGJA 2P2LA 3GYBA 5KC8A 1HH4A 2WIAA 3HCWA 4KAXA 4A2QA 4BMYA 4ENUA 2XQIA 3MWFA 4KR9A 1XVLA 4MV1A 4DUPA 2GFHA 1DRWA 3SF8A 1ZDMA 4ENSA 4OU4A 5T3UA 1VPLA 1EXNA 2WJJA 5ED0A 1VMDA 2IXBA 3X44A 3HN7A 5K0BA 3OTIA 5DOVA 4CBVA 4Q48A 2DQKA 3A4IA 5G4KB 5JALA 3CG4A 2H65A 5LOVA 3FDZA 1FNSA 1RTTA 2OAQ1 3BFPA 4RW0A 5D00A 1JIUA 3HB9A 1L4EA 3EUEA 4MR7B 1ADGA 2JD0A 2PGDA 3CEHA 3HJNA 3AF6A 2FUCA 3F5FA 5DLDA 4ZU1X 5E9AA 1THMA 4XAQA 5A1JA 2H1WA 1MA0A 4AJPA 2C59A 4CLRA 1N5RA 3M5CA 5B30A 3QUCA 1M2OA 3ZLJA 1PWHA 1PW5A 2VSYA 3DAGA 3OHMA 1MPTA 1Z6PA 4E5VA 1GU0A 2V0NA 2BC9A 3C3DA 4Z7OB 2ADOA 2BEWA 1YJCA 2RJOA 4IIDA 3ECAA 3HV0A 2ZYSA 1ZVQA 3H5WA 4KTTE 1KO7A 1KR2A 1R6BX 5TSDA 3TTSA 4IMJB 1T9BA 4BECA 2YHSA 2M6KA 3AUTA 4KN8A 5C0OE 3WYEA 1XKXA 1PZMA 1SH7A 1XBTA 1ZUWA 2ZJYA 2ZJAA 4J4TA 5DULA 4XD7D 2V58A 4HGNA 5AM3A 5LQDA 3M3PA 3PQDA 3VGJA 3ON5A 4RXTA 4TT3D 3OM9A 3H5OA 4OI1A 1ZC4A 3R3ZA 5BQ5A 1JLLA 2P9QA 4UVDA 3C7KA 3EIFA 3KOUA 4WUVA 3KXIA 1SXIA 2HDWA 1J9GA 4JR1A 2OQVA 2VSQA 3HE3A 4B4UA 5EGSA 3ZU5A 4C0XA 4D6YA 4DLRA 4P53A 4KFTA 4V0SA 4AVYA 3ICVA 2OHGA 4KQ2A 4LJYA 4NDNE 1JFLA 1PR0A 3PP8A 1H2RS 1ZM3A 1HEUA 2ID4A 2KLBA 3A4TA 5CW2A 1BU5A 3CW9A 5HIMA 1Z45A 3UIEA 4RVFA 2V6JA 2JGKA 3NX4A 4N7BA 4EGAA 3T3NA 4NCAA 4RTRA 4OVKA 3TGLA 4I3HA 3HA5A 1KEKA 2FDCA 1KZHA 3A2KA 3MA0A 1WQ3A 1E2EA 3GRCA 1R3UA 2FPXA 2ACEA 5BWNA 4BZPA 1OFIA 1UAYA 4F93B 1BQEA 3ZX5A 2HSWA 3H9BA 3KL2A 4K87A 4BBAA 2LDXA 1ODJA 4KDEA 4ZOCA 3CVVA 5MN4A 1Q1EA 2YYSA 4DSOA 4X63A 3CJTA 4EJFA 2QJTA 4R8VA 2XXAB 3CCBA 3HA7A 4R8KA 1HYQA 4Z4IA 1U0EA 3CX8A 4ZC1A 2F1JA 3NEJA 3ZZTA 4F6CA 1YB2A 2ZRHA 4XVCA 2X7JA 9ATCA 3VTFA 4ESOA 2FFBA 4I1SA 5FBKA 5J1TB 1NRJB 2ID8A 4NIMA 3TDMA 3FVTA 4DGSA 3VPGA 2FRVA 2AF3C 2YV4A 3D6NB 2C2WA 1SCQA 2DPXA 2QE7D 2QZ4A 3MRVA 3QY9A 1ZS9A 4NBUA 1YJQA 4LYJA 1QOZA 1IPEA 4KO2S 1M8KA 2IVFA 2X2OA 3HYCA 4R7TA 4WK2B 5JYDA 3EVBA 2CLIB 4V24A 3ND7A 4C01A 4JXXA 3TVDA 3BHNA 4XASA 5HJ7A 4GBMA 3QXCA 2FPGA 2HMAA 2MR6A 4FYVA 4UAGA 2VNIA 3BMCB 1OVMA 4RACA 4ZVSA 2ECKA 2R8YA 4Z53A 4J16C 2ZCJA 4ZHSA 4KPUA 3WQRA 4ANFA 2P77A 3QFHA 1ZVMA 2FW0A 3ICOA 3AO0B 3JPWA 4F3TA 2FR1A 5SZHB 3OP1A 4V02A 2OORA 4HFJA 4ME6A 3SX4A 4YYEA 3JZAA 3PXCX 3ADOA 4HV4A 1SCIA 4XZ3A 2YASA 4BY9E 4KO1S 2YVKA 5ECWA 1XPRA 4BNTA 1Y3BE 3P7MA 4M1MA 1ILWA 2H2AA 3M89A 2OGZA 3BH7A 3KPWA 3HG7A 1IUNA 1CFJA 1HQDA 3IVCA 1AA9A 5DM70 4F5YA 4ZZ0A 2GWHA 4IKPA 2NUPA 2PT7A 4BC0A 2ZFUA 1TJ3A 3EDQA 1JWLA 2QSJA 3PFHA 1JNYA 4WFIA 2FCAA 2H1SA 2WZQA 3JQBC 3OZAA 5T67A 1I6WA 1UFVA 1RKVA 3N05A 1QYDA 2O8BA 3ZDDA 4RD6A 2YOFA 3R5SA 4Q1FA 2J6BA 5C5IA 5HKOA 2PTGA 1H2XA 1XQ6A 1Z38A 2G5CA 3C7DB 5BORA 5EN4A 3OZIA 4Q4AA 3AF0A 2ISSD 3DT6A 4N3AA 4TTIA 2AH5A 4GI3A 1VB5A 4BJHB 3GJ7A 1LBIA 2ZJ5A 4EVRA 4MVJI 2BLLA 5B1YA 1P4JA 4OAQA 1KYIA 3ZW9A 5ED4A 3BXXA 4PFJA 2XMPA 4URFA 2NSHA 4F11A 3FUVA 2HEGA 5HCUA 2CHEA 1TK2A 1KMNA 5CMLA 5EVJA 3LQYA 2NVOA 3EF1A 1RFGE 1T5SA 3HKBA 1EA7A 2CUZA 2GN8A 3G6KA 3WLKX 3ENZA 1AO3A 1WUKS 2BFFA 3HCOA 4NONA 3LQFA 3W5SA 4IS2A 5E3JA 1BCSA 4W82A 4OLBA 1HNNA 1F0PA 1WUTA 3C8UA 3LPCA 4AD8A 5D3MB 2HQRA 5KZMB 4K9SA 2E48A 2VPQA 5F2OA 2JFYA 1RE1A 1O6CA 2GUWA 4HN4B 2YVQA 2EAUA 1IWBB 3MAAC 3O4IA 4F2WA 4C1NA 5CCEA 2H1OA 4ZO6A 1H4QA 3I9NA 2ERXA 1SZJG 2ZYDA 5AKZA 1XVUA 1E2MA 4YRSA 1KBOA 1RYEA 4GKBA 5EJ5A 2W43A 5L6LB 2XODA 2IYSA 4NBRA 3SJ7A 3AL2A 1SD5A 5DCUA 4D6XA 1E1MA 1B2LA 2QLTA 2VBFA 1G18A 3VV2A 4ZIRA 2O14A 4KV7A 5T4BA 1SULA 4YDRA 3R23A 3D5EA 4B79A 1ZD9A 1XTVA 3LX8A 2PO7A 3Q88A 1UWCA 4HAYA 2C3YA 2KPOA 2XLBA 3NRCA 5IAJA 4IYJA 1QHIA 4L9WA 5GIPE 4KGDA 2F64A 5K4AA 1UXKA 3AOEC 1U5CA 3SDBA 2FSVC 3EVEA 4U2EA 5BRJA 1DAMA 2EKDA 2WKPA 2J67A 2GBLA 3PWZA 2GPTA 5DP2A 2PD4A 2VDVE 1OFGA 1EHYA 3ZKWA 2VKTA 3EFOA 4PHTA 1S2NA 2OPBA 3GPDG 4Q66C 3L4SO 3CM0A 2G25A 4OAOA 5IASA 3HGQA 3K8QA 4I1RA 3I5AA 4LDNA 3VR5A 2P0YA 1IOWA 2FCRA 1YBFA 1CERA 2JH3A 1IAQA 4BKQA 1M1NA 1R66A 1Z39A 1TLTA 3WIVA 1U1GA 3F1KA 3SEQA 4DIDA 1P29A 5B3JA 3S68A 3G2IA 4LX0A 2Q2OA 3J7AC 1KYYA 2JIDA 2ZDHA 3A9WA 5EJMA 1VXOA 2B20A 2HEIA 1PWEA 4EH1A 3OPNA 1XJWA 3SOPA 1FFCA 3B6MA 4NCKA 1KDZA 3WGMA 2BKUA 1DG9A 1O57A 1PQYA 2YVLA 1CJKC 2YYZA 1E5XA 4CODB 2P2YA 1ZEJA 2O2DA 1A0OA 3P9IA 1JEEA 1XCGB 1Y89A 3I6MA 3A4VA 4N3GA 4TKVB 3AP1A 4X94A 5AUPB 1GKIA 3CKMA 1LTHR 4ZQCB 2G9VA 5JWRA 3FTPA 1SN7A 3R7FA 2AWNA 5HTKA 3WADA 4HAWA 3PNPA 2D74A 3MMPA 2P90A 4IDHA 2PJDA 1TCBA 3WL5A 5DIZA 3WGQA 1RAFA 1NPTO 3TSWA 4YJKA 2RHLA 1N9GB 1PR6A 1A9SA 4O2AA 3IBCA 4A1FA 3I2JA 1X3SA 5AJZA 2CUKA 4XARA 3ZD8A 1Z7EA 4BN0A 1L1EA 1GNSA 2R25B 1CJBA 2NNLD 3T7TA 4F4DA 2YJTD 3BD9A 3FCYA 3E2MA 1HLPA 1ZAKA 4MXDA 2DOKA 2ZYWX 4YRRA 3Q8LA 3I9FA 3IOYA 2I33A 2EERA 4AM8A 4RMJA 4XIGS 2OZPA 4D9NA 2AG0A 2W6NA 4OGFA 1TO2E 2FPWA 1QPGA 1NBME 5IJ0A 1JFTA 4LFAB 2IIQA 1BG6A 4WT7A 1QYXA 4PG4A 3H5IA 2OCPA 2E5WA 3QU7A 3TLBA 2P4SA 3MPUA 2QG4A 3CISA 4AP5A 1OOEA 1L8XA 1LW6E 2FH5B 5SYMA 3NGLA 2H2GA 3FE2A 2VUSA 3RTBA 4CCWA 2AXPA 2B7CA 2Y4NA 4G23A 4Q9HA 8ATCA 2CY0A 1LB1B 3KLOA 1A2QA 1D7AA 1G59A 3LPNA 2MYNA 3U7EB 4MWDA 2IDZA 2C07A 2XAUA 2GCPA 2FQQA 2W11A 3EVTA 3RIHA 3T38A 4OJTA 4Q0MA 3KT6A 4Q5IA 3ICEA 3L4JA 1QNLA 1R9JA 3MD0A 5LQMA 1NQ5A 1BX3A 3FPHA 2FE4A 1SCJA 2GSDA 4GYWA 3MYRA 1DIRA 3LOQA 3UAZA 1R1DA 1PVDA 4RXMA 2WPDD 1U9ZA 3L1UA 3N2KA 1GRVA 2LVBA 2X8AA 3CHYA 1MNQA 2VBIA 3MRTA 4JUFA 2PKXA 3D7SA 4EA9A 1BEEA 3IL2A 1YR1A 4J7AA 3KR2A 1U90A 1K0FA 3X2SA 1E8NA 4BLTA 3H75A 5GADl 1Z5OA 1ZPDA 5DM4A 1EXDA 4Q15A 2E1PA 1C0LA 1Y5LA 4KO4S 4QASA 4ND7A 4YAIA 2FI1A 3DTVD 3G9ZA 2V6GA 3G2NA 1M0WA 1H3EA 1U0OC 4PS0A 1KH2A 4KK3A 2X4IA 3E9EA 1U3VA 3NOOA 3AVWA 4MVJA 1ORRA 4DQXA 5GVSA 1WLSA 1NNLA 4QU5A 1K8ZB 1QWSA 2XDAA 3BD8A 3DHWC 5HRCA 2VTKA 3CE9A 1VECA 3HKEA 2QD3A 2X8JA 3RRJA 2ZIFA 3CLTC 1YOBA 5TC4A 3OQIB 2W5UA 4KO8A 4X44A 4RIGA 3CY6A 4DPKA 1GUYA 4N3CA 3RFUA 2MYTA 4R9RA 1O0BA 5FBQB 3PSAA 2NU9B 1FSGA 1TEXA 4O2LA 4I2NA 3VYRB 4B83A 4X92A 4NDAA 3CF4A 4HPJB 3WHPA 1Z25A 2P7HA 3A2MA 3G5MA 4Z1MA 4DXAA 3HKCA 4G9EA 5CW1A 1DQSA 2YN4A 1GY8A 3KCQA 5AJYA 3VR3D 4KXLA 4ZQGA 3THXB 3P9PA 4OHUA 4XWTA 2JAWA 5F73A 3ZY6A 4JJZA 5K0JA 4CKYA 4LMPA 3CKLA 1AN9A 1UBOS 4HZGA 3IAAA 1USWA 2QMZA 1ISGA 1ZN7A 4KC0A 4EDFA 2UZ0A 2YS6A 1R5JA 4U7PB 4ER0A 3K16A 5B6JA 1QP8A 3D3KA 4CM8B 4YH1A 5LBIA 2Q3FA 2NU6B 4W5JA 2YZGA 2RG7A 4M99A 1MX5A 4WXPA 2I6QA 3AF4A 3SR4A 5MN6A 4G1UC 5JVDB 1ZVVA 3L0SA 1XI2A 1Y42X 2NV0A 4IMRA 2XRMA 5U4QA 1W85B 3KB2A 1CIPA 4LS3A 4E94A 3TVYA 1F20A 3OZCA 3PENA 1KXJA 5GJVC 5H70A 4BWGA 2O54A 1TDJA 2ZB4A 3H2YA 4GOKA 2OB2A 1WDLA 1DAKA 4EW3A 3VHQA 1PWZA 1EIWA 4E12A 3GELA 1NJSA 1FSSA 3E48A 4CMIA 2OFWA 1MW8X 2AZ4A 1RC0A 3WWPA 1R4NA 2JVIA 4I9HA 4U6QA 4WASA 4Y9TA 2C3UA 3RG2A 5LYJF 3H65A 3LRXA 3RF7A 3TTUA 1KQOA 2IHUA 521PA 2BLNA 4WBNB 2OL4A 1AQJA 4PW0A 1BKYA 1UDRA 2OVFA 4CM3A 1MHTA 3IV9A 3JATB 2YWDA 3FOCA 5KREA 1IQRA 2IYRA 3VR4A 2IF0A 2I1QA 3COYA 1RJ9A 3QSGA 3P9RA 4QUJA 4X8OA 1DFHA 3PXAA 3VQTA 2HBZA 2QGFA 3IUYA 3PI7A 1Q0UA 3IKVA 3VFDA 2FMIA 3B53X 4RGQA 1EHCA 2J5KA 2ASEA 8LDHA 2O0LA 3SR0A 3GQBA 3ZHVA 3REGA 1ODSA 4N49A 1DJLA 2J7KA 3QGMA 1P8AA 1T1GA 3BUSA 3E84A 4FFRA 4QRIA 4H27A 5DN6D 2DKNA 3KKZA 1G8AA 1KJWA 3F8TA 3SF8B 3VZPA 4F5EA 1AXGA 1UIMA 1O94C 5EUBA 4O8ZA 1BC5A 4LDZA 1YGPA 3WO1A 1QAQA 4PXSA 1LCIA 1TIKA 1C0IA 1TYBE 2WM9B 3UQZA 4R8LA 5JV5A 1HETA 2AK3A 4OB7A 3UANA 3FDZB 3NDIA 4BIMA 5LOVB 2C61A 2HTFA 2XGMA 1P60A 2F6RA 4HNRA 4LZPA 1Z0KA 3R6GA 5K9ZA 4IIGA 1J0AA 1O6GA 3GWGA 4IG4A 1DAGA 2YXPX 5HS4A 2NVBA 1IBLB 5JAIA 4MRMA 1VE7A 5BUCA 3A36A 3KVNA 4IL5A 4FSDA 1KNXA 4D2IA 2YJ5A 1TADA 2EX0A 4CLRB 2Q2QA 1M67A 3NBZC 3CBQA 5KOHA 1PK8A 1M2OB 5F3WB 4AZWA 4Y18A 3I4CA 1FNMA 4MRAA 4W1SA 1BXGA 1ZSNA 2R1UA 2AIRA 1XLUA 2V9PA 1HWYA 4HGYA 3GO4A 2BEWB 3BTOA 2XYPA 2QTAA 1AQYA 4HGRA 5J9FA 1EAYA 2P6NA 1QV6A 4U7WA 4JXKA 5BVHB 1RRFA 1FRQA 1KMQA 1WSAA 2HXSA 3H1BA 3KALA 5EY5B 3IPXA 4K9RA 4ZMBA 5HQ3A 4HLUA 4RTOA 3VKGA 3ANTA 1U0JA 2QJOA 2OV3A 2XCQA 4ZC8A 4D8TA 3U09A 1THTA 3ASVA 1GCOA 3FHCB 1TYDE 4HQNA 1JLLB 1NNSA 1KAEA 4M9UA 5IH3A 4YNBA 4C78A 3BCSA 3IUJA 3G2OA 5CAEB 1BS2A 3LKVA 4EEXA 2WU0A 5C4GB 2WTMA 5DTQA 4A8HA 2GN2A 1QHEA 3SM3A 2AMLA 2X5JO 4MGZR 1ZK3A 3KSZO 2ONJA 1E5VA 2XT9A 1YZQA 4UUAA 4CR6A 2AXEA 5AKEA 2QNIA 3EW9A 5TXGA 2GLTA 4FJ2A 4HQRA 5D5PA 3WDKA 1VPWA 4KQFA 1XCBA 4LDAA 1PT8A 5C4IA 5AT1A 2R7MA 3JQDA 4WI1A 5FPTA 2EWMA 1T3GA 5KHAA 1XZLA 2OCDA 3FA2A 2NADA 1M83A 2HBYA 4GI5A 4Q9LA 4CW7A 3ZCQA 1SG6A 3A6DA 4Q9NA 1UH5A 2Y4OA 2C2KA 3IESA 1Y1KE 1FJGB 2VZ8A 1SPBS 1H1LA 5F64A 4ALJA 1C81A 4MX8A 1HDEA 3H5RA 5K0EA 5HMLA 2BM1A 2JIRA 3X43A 5AYVA 1JL3A 1PUIA 4BVJA 3LC7O 5DGTA 4YPOA 4CMEA 3AEQA 4XVQA 4YJ2B 3H5VA 2FEWB 2VQFB 3HDQA 2J3JA 2JI7A 2MU1A 3DPUA 3JSAA 3RIMA 3FCAA 1A5SB 2W2PA 1JLHA 1EFLA 1OXKB 2BZ1A 3BWCA 3SQLA 2ZSJA 2QZ9A 3D6TB 3D7LA 2J3IA 1PDWA 3PQ4A 1O9GA 1Q15A 1T4CA 2CJXA 2OE2A 1E3DA 4M9QA 3OIGA 1JTVA 5DNWA 2OYSA 1OKKA 2FPGB 4EGQA 3GFRA 1UKVY 2EZUA 4IF6A 4ASUA 1XQ9A 4C87A 2I4MA 4RANA 3SFZA 3T0IA 4CT0A 4OEHA 3U3ZA 1ZP6A 3FIJA 1IXRC 4MMXB 1N2IA 2P0EA 3QSYA 3EF0A 3BWBA 4OLFA 1H2BA 1OC4A 4HJXA 5KNDD 2FZLA 1PNQA 3M2TA 3U6BA 2FPIA 1YFKA 4CDGA 3RRFA 1X7WA 3L7LA 3DMGA 3IUPA 1Z4NA 2GK6A 4NU6A 4Q9JA 2XCRB 1CEXA 4U7FA 5AQEA 5SY9A 3RI3A 3VU1A 4AJKA 4YUXA 3WGIA 3WAGA 4UJ3A 4JEIA 5JECA 1CP2A 3GGCA 3GOHA 2HK8A 4M8SA 3ZDZB 5I7SA 4XM1A 1E0AA 2VEOA 3ILVA 2WHEA 5HF6A 1DAHA 4CMAA 3BXEA 2H3EA 5LMZA 2NUPB 1BDBA 3ZDQA 5LKAA 4EMUA 2VF7A 5FHRA 5JEDA 3UV6A 2DEUA 1JBEA 2VZ9A 2GK3A 1VGQA 2O8BB 1L4FA 3IKJA 1Q1QA 3E9ZA 3HSSA 4QGSA 1X1DA 2YWHA 3B9QA 4JDUA 4MI1A 1I5EA 4FYPA 5DTIA 2JAOA 4Q4AB 4ZVUA 5BN4A 4NCBA 3TW6A 5AW0A 4QDUA 1BAPA 2BMVA 4ZRNA 3M7IA 1VKRA 5DLQC 3N0XA 4TS4A 3WAKA 1L7QA 3DLIA 3CTPA 1QJCA 5TQ2A 3FSGA 1VIVA 3ZQ4A 4A5SA 2RHJA 1MDFA 1NYRA 2JARA 4M8NE 4XOIA 2XD9A 4L85A 2IIPA 2V59A 4AK9A 4ZZIA 4DRXA 4RPIA 2I6FA 1VLZA 3HKBB 3KYBA 1NVGA 3F49S 3NAGA 4GI1A 2PMCA 4RIEA 3WQBA 3WQHA 4OK3A 3OQNA 1LLQA 4RQBA 2P68A 2OCLA 4Q1BA 3T99A 5NULA 2BFFB 5F77A 2X8WA 3RC3A 1ESZA 2HF7A 5DSZA 3VOBA 1TAUA 3L77A 4LNHA 1P44A 4M83A 1BCSB 1VP3A 3R7BA 2QR2A 4HPXB 4WFQA 4CNBA 5ECYA 3VDNB 2I3ZA 1NMZA 1UJ5A 2P41A 4AZTA 5IDWA 3ACCA 3DO8A 2ZW9A 1EVJA 3S29A 5CVCA 4D99A 3OF5A 3RU9A 1KP2A 4HWGA 5JCJA 5HTOA 4NE9A 1UKYA 3OE1A 1Z2CA 5LPNA 1X1CA 5ALUA 2JLYA 2VZ0A 1OAOC 4LBZA 2VSXA 3N8DA 4UU7A 3TZQA 3UMSA 5K0GA 4GICA 4GX2A 5D86A 4TWIA 1IEQA 3WK4A 4KUEA 4TLCA 4C0LA 4MCIA 5IG2A 3B1ZA 4AUMA 3UAVA 3UAGA 4N82A 3I2FA 4RGVA 3W2HA 4OGGA 3AI2A 2BRUC 1VTKA 5DHQA 3PITA 4X3OA 4ZIRB 1DX6A 4I50F 4PC1A 1N0UA 1PP4A 4JI3B 2W6ZA 2ONYA 1N5LA 1SHJA 3QE3A 3VVLA 1N77A 2IW3A 2R6AA 5ALOA 3NWEA 1J39A 3JQGA 4B33A 5C1OA 1U3WA 3ZU4A 3AEYA 3NGMA 1NBIA 1QM5A 4CJXA 5HJEA 2EFEB 4BLVA 4F92B 5TMBA 3DJFA 4L3VA 1QRUA 3ZV4A 1AKEA 1HFWA 1MC8A 2DC1A 1NR5A 1XTKA 2P1ZA 2A84A 2H5EA 2O0JA 2ZBEA 4P98A 3MWLA 4IDNA 3ZKWB 1PSWA 1KOJA 1UXOA 4BE9A 5B3AA 1FVHA 3KLBA 5I7AA 3WWOA 1YKFA 1AD2A 3O93A 4LC9A 2QM8A 4DY6A 1OXUA 4BBZA 3C97A 3DOUA 1M1NB 3MWKA 4INPA 1QRTA 3HN6A 3FFXA 1MW9X 4K6FA 3GMTA 5L3RA 3P97A 1XAIA 2AR0A 2RGGA 4KQ1A 4QBGB 4UHFA 2XB6A 1KWKA 5DTMA 4JB3A 2EGUA 2PKWA 1RQGA 4JLNA 5ITVA 1C4KA 3CZPA 5KSZA 4DAOA 1Y6FA 1U98A 3F9CA 3K8ZA 1XYGA 2O8NA 1OASA 3V8PA 1UXIA 3BK1A 3LY5A 2X4LA 3VO1A 4AROA 2PZGA 4M0PA 4E3WA 3ESYA 1UKAA 3OQVA 3RPEA 3B89A 3GP3A 3ITEA 1A4XA 5JR3A 3UJAA 4W5TA 4WKNA 4XUEA 1YBMA 4NX2A 3AY6A 4RTMA 4XCVA 1NXXA 1FLNA 3JYNA 1C3OA 3VRHA 3IPRA 1QVZA 2Q1SA 1ZR4A 3AZOA 3D6UA 1BVRA 2HLDA 5CD9A 2H8GA 1E1YA 1ZQ9A 4MMZB 4B5LA 1H8EA 4ETWA 3B1WA 2PUDA 1ZR2A 3OEHD 5ICMA 1P5HA 2OSVA 2E2WA 2H18A 3E9QA 3OF2A 4FT2A 2Z4TA 4GLLA 4Q3BA 3N07A 4O2AB 4XJVA 1Y5NA 4OQXA 3ROMA 4DJAA 1U3UA 1RXVA 4PWZA 2AYXA 3JVUA 3DW1X 4M0CA 3LMKA 3ZJYA 4ZHQF 1JFSA 4DBZA 4FOPA 3S2ZA 1L4BA 2DR0A 3PUKA 5GPBA 4A0FA 1BE0A 1R00A 5ESXA 5T57A 3U3OA 2DTEA 3MXTA 1WXQA 2O4CA 4L5CA 1JWBB 3KT8A 1ISHA 3J81k 5IJ0B 5J4YA 3CNLA 2X2PA 1E9VA 1T2UA 4R84A 3GJ6A 2Z8YM 4TSRA 1HT1E 4HWTA 4F3NA 1L5OA 4ZO9A 3W5VA 4DYHA 4ED9A 1JE0A 1YKGA 3LQ4A 3DDZX 1KI3A 4RQAA 3RM3A 5AUOB 1NSFA 1B3BA 3I92A 1XG5A 2PYDA 3CQ9A 4GRAA 1CSEE 1K08A 2OILA 5IM5A 3IT1A 4AG6A 4RULA 2A8YA 1GPLA 3OFND 2PU5A 1V11A 1H1TA 1EVEA 2LCQA 3VA7A 2DWPA 2EZ9A 4XKJA 4Z3OA 2PLWA 4MB0A 4QTUB 3K4PA 4ZAVA 1SCNE 2PAAA 2ODNA 4HZUA 3LCCA 5F7ZA 4E2ZA 4CR8A 2HIAA 3ILXA 4ARSA 3T5DA 5DXJA 1XTBA 1T8YA 1AKWA 5DV9A 3CV3A 1MX3A 5CLLA 3WSVA 1AVTA 3HXLA 2A0UA 1PQ4A 1NL3A 1SR8A 1IN6A 2RHMA 1E1QD 3FMVA 3N2KB 5F7OA 1E63A 1PJQA 2OFXA 1KR5A 2RGCA 3RYHA 4BN4A 1OLOA 1OV6A 1PV2A 2ZRQA 3B6IA 4PC2A 1PDOA 3AF2A 2YUIA 3G8AA 4L57A 4MKFA 2F17A 1L8QA 5AXAA 1JR4A 1JPJA 1ONOA 1YTLA 3IDFA 4LMRA 4BVGA 2WAOA 3UKJA 3DDOA 1OW3B 2P6OA 4FMDB 4LUCA 3ZNQA 5ISMA 4WGGA 5K4HA 1NONA 3ED5A 2EKBA 3UJHA 3AVPA 3AEZA 3ZE7A 1TM5E 1GRNA 1U7UA 3H2JA 3P0IA 3RVSA 4B7XA 4BYMA 2J46A 4NYMR 4O0LA 2Q8QA 2I6SA 4XQGA 2ERYA 5DYWA 2Q7XA 4G37A 5DM2A 1X87A 4KX5A 4XD7A 4YRJA 3DXYA 1KI6B 1VCNA 2B5WA 3K1AA 4UXIA 4TT3A 5FBHA 2I99A 1D0VA 1P45A 1WZEA 1DBSA 3RFVA 2X8JB 3ZHYA 4ZALA 1FQKA 2IXAA 5JMOA 4GQAA 5LYJA 4EG4A 2OO7A 4BMZA 2JD2A 1XZEA 4I5FA 5JXHA 1DL5A 2PX8A 4PPQA 1LI5A 4YLGA 5CNJA 3THOA 1C9EA 4N9QA 1ID8A 4YRLA 4E5MA 3H04A 2WIBA 1BS1A 1ODTC 3T9EA 3HKCB 1ND5A 2VHZA 3DXXA 2DXIA 2DFLA 3L7MA 4XQ9A 5JLAA 3OOYA 4CT4B 4F2HA 1OI4A 1QPBA 5IZ4A 3DE4X 1D1TA 3TOXA 5AVRA 2FYTA 4LZJA 3WNVA 1COZA 4R71A 1N25A 2PV7A 1L6RA 3QX9A 3A6EA 3IDAA 4EJ0A 5KWEA 2GJSA 1JIQA 4B74A 1QH8A 2LWIA 2WYWA 3ZLVA 1AXEA 4YP7A 4EHBA 5C8DA 3KAKA 5K45A 4R5MA 2WY2D 3UG6A 5I6DA 1Z8FA 1GPMA 1LLDA 2PLRA 1UFKA 1SJ9A 1JQ5A 4Q7KA 5FUXA 4ZVVA 2C9MA 2BF7A 2F3UA 4PQGA 4UU0A 5CU7A 1SZPA 5EAIA 1IBSA 1XCJA 3FMPB 1KRXA 3RBAA 2QE7A 2V7UA 5LQCA 3A28A 3NXSA 1TC2A 3GJQA 2IZ6A 4XQCA 3U39A 5JNRA 1OJLA 4P7GA 1QFYA 1Z83A 5M04A 1GPJA 3ZS8A 4B80A 4C7XA 4W5RA 3RHSA 2AD5A 2AJCA 1LDNA 3ETLA 1UP6A 2I80A 2GZHA 2HJHA 4H1HA 4JP2A 1U7HA 3HB5X 3W1VA 1R4NB 1L3BA 1ABEA 1KU0A 3KSBC 2JLXA 1RHUA 4UTXA 2CFIA 3PPIA 4L22A 4ENQA 4X8LA 3WTCA 5K3FA 4HH0A 4PE5B 3IXMA 4RY2A 3CB2A 4MCHA 1I0IA 4WA8A 4AW9A 2IK8A 4LXTA 2VDKB 4JLMA 4HF7A 4PLGA 4Q3LA 2X77A 3CH6A 4J3JA 3QJGA 1KWGA 2AX3A 1VPVA 2APJA 2D8MA 3HLYA 4R0VA 3IB6A 4WTOA 1X0VA 3DYVA 1RJ9B 5B2EA 1JDTA 3KQSA 1G55A 1ZJ5A 1F3OA 1UFRA 1XPJA 2VQEB 2QZPA 4LQ4A 4NR0A 3DD1A 3TRFA 1RADA 4YR9A 1K5GA 4IFEA 3LT2A 5IVKA 3A4MA 4HSEA 1Y1SA 1PTJC 3GQBB 1NM5C 4ZZ2A 1GDTA 2V54A 3RODA 2GD1O 3V34A 3G9UA 4UM9D 1D0IA 4QVKA 4AUNA 3MQ2A 3DOCA 2QN1A 3Q10A 4G0QA 1Q74A 4GR9A 1ZI8A 3KQVA 4H4CA 4CTOA 5K03A 1T9HA 4FEGA 2H7VA 4FDVA 1DGQA 1XNQB 1BYIA 3PJGA 5K20A 3I1IA 4LQLA 5CR9A 3IAHA 4NBWA 3I09A 4UBOA 2PNJA 3EEFA 3LT5A 2QDKA 3B1JA 3MCTA 5KQLA 2PGLA 4JN6B 3DMYA 2IH2A 1WCWA 4TMFA 4ZCTA 3K2EA 2QRVA 1FQWA 1WTAA 4MRMB 3L82B 4ZJYA 4DV2B 2CV0A 3ZVNA 1T10A 2Q6KA 1KVQA 1OLSA 1P9RA 1BQ3A 5CT9A 2GARA 1Z5NA 3OZFA 1GA4A 5CIYA 2QY6A 3EG5A 5H7XA 3RB8A 5KOHB 2FG7C 3N8GA 4LBYA 3REOA 1FDUA 1DBVO 1OZFA 4F45A 4OJYA 2YR0A 4KQHA 4MUYA 4C0QC 1ZM9A 2P35A 3JD2A 3HPRA 3P9SA 4GQIA 2V45A 5CM9C 1L1FA 1U2GA 2PR2A 4DHEA 3T0FA 2GAJA 1CR4A 2BGIA 5BSUA 1GGHA 5K8CA 3B3AA 4JYCA 4TVOA 1K6MA 4BFCA 3EIWA 5HQ3B 4WLVA 1DHTA 4LHYA 3L0CA 5DYGA 4CL3A 5JXJA 4M1EA 2KLHA 1JR3D 1JJFA 1JEAA 4IZ6A 1Q95A 4MPPA 1CJVC 2ZUSA 1XMIA 1Z2AA 1HFKA 4X97A 1EQ2A 1FNNA 1T4BA 4V0KA 4ODIA 1SXJE 4WK0B 1GR0A 1O97C 3DF9A 1QANA 1NVEA 2HL6A 2B30A 2V7QD 2WAYA 2Q3HA 4WOKA 4XI9A 2W6ID 2Y9MB 1I5RA 3NHJA 3SBOA 4C5AA 3I9LA 4CDMA 4M37A 2P4UA 1P4HA 3TIFA 3L1HA 2H31A 4YCSA 4E11A 3OEEA 3EW7A 1QLJA 1RWQA 3WZMA 1JSXA 1PJ2A 4ZEOA 1Q0HA 3AOGA 3S27A 3TBKA 3I05A 4OD0A 1U04A 5FFNA 1X42A 3LBHA 4GSYA 3X2FA 2QLNA 1TPYA 2A30A 1P4RA 3EN0A 3UVEA 2FPPA 3PDIA 4TKUA 2W2TA 3ZDRA 2Q6VA 1TZJA 2ZTSA 3ETGA 2PANA 2ILTA 1YZUA 2BMJA 4P4UA 5F3RA 3SZGA 4ZGBA 2LW7A 4N5HX 2A9PA 3SGLA 4ZYYA 1G6KA 1H1LB 4R69A 3E0QA 5IC4A 4I4CA 1GUZA 3HABA 1WDMA 4R1QA 4TWJA 2NT4A 4F86A 1LLCA 1TRKA 3Q5GA 1NE7A 3G0GA 4GR5A 3AEQB 2DP4E 3C48A 3LUFA 4R05A 1MUUA 4I46A 5DFAA 3RSFA 3VISA 4GPBA 5HIKA 5IAOA 4YR7A 1VP9A 1XVIA 1Z68A 2Q6OA 5C51B 5L7TA 5H8WA 5L3SA 2Y68A 1P61B 4DSZA 4RWEA 5ILQA 1PQPA 5KQMA 3NOQA 1WP4A 3H97A 3PE6A 4HLNA 2XT0A 1OBCA 1Z8DA 2YMMA 3MS4A 4FW8A 2PL5A 1AX9A 1SKBA 3TGWA 1T4CB 2ZJ6A 4GT1A 2BUBA 4IRXA 1EP3B 2IC5A 1K2VN 3MGAA 2WSBA 2I91A 3LY7A 2NSDA 3KCNA 3IB3A 2BMEA 4HC4A 5IVDA 4M89A 4PAWA 3UHAA 3N70A 4D4JA 2WJIA 1E1LA 2RK6A 2FPIB 1UBHS 3H1FA 4FPXA 1GZ6A 4IUCS 1X7WB 4CQMB 2HA6A 5EFOA 4F4UA 4YMGA 4KYTA 4YO8A 4ZQFA 1DWOA 4HVCA 1EDBA 4AX8A 3GXBA 3OU7A 4GPD1 2ZWVA 4QJ5A 5KPDA 1XLTC 3A6HA 4H1UA 1JHYA 5E8RA 1CF9A 1TNDA 4OFZA 1UPAA 1T13A 1XRPA 5TJHA 3S7ZA 4CG2A 3TL2A 1UQUA 2C2GA 3NR2A 1G4UR 1DC7A 1VG1A 2O1EA 4NCNA 1KAQA 1ZO8A 3RVJA 3TVTA 2ZTMA 2B94A 4I50A 1I80A 1TA0A 4TSKA 3KZOA 3KEQA 5LM3A 3F3SA 3BXZA 5A05A 4DLBA 1I3NA 3NWPA 1GOTA 5CH8A 1BXZA 1PFGA 2PZMA 1U2PA 1SQ6A 3KKKA 5CIQA 1G5IA 4GI7A 2FUG1 5TQ2B 1JLSA 1W5FA 4YJFA 3LBFA 4FTWA 2I78A 5YASA 4DYDA 5KS2A 2GPSA 3QHPA 4MUBA 1JMKC 4TL6A 4JQSA 1QKKA 2CGEA 4BQPA 2CB0A 5GAJA 4DRXB 2R8BA 1ZOPA 2R2GA 1RW4A 2FGKA 3IEIA 4MR9A 4E4RA 4EPTA 2C84A 3EH2A 4HAVA 2JFNA 2WPDA 1YQUA 3IOBA 4U8HA 1LK5A 3Q8MA 1Y3CE 3LCVB 4OA8A 2VJNA 4Z2YA 5EMJA 1WUYA 1NVFA 4FFOA 5E7MA 5J2UF 2GKSA 2OTCA 4BCDA 1ZCFA 4YREA 2X9VA 2V8BA 3VKWA 1JDPA 4U4AA 4KR6A 1E3LA 2IZ0A 2PXXA 3KFLA 1Z2PX 3ZLTA 3LAWA 1TEZA 1E4YA 4NZYA 1W4LA 3TD2A 3HCRA 2FE1A 2DWQA 3RIXA 3Q3HA 2HCBA 2G9QA 5EE3A 3ZVKA 3ZGVA 1AGXA 4C9BA 2BPOA 5AM1A 4CFZA 4DWJA 1GZUA 4X6XA 1NYLA 2I3BA 3JZIA 3U31A 1Y4ZA 1WETA 2Q9BA 3ZWDA 1J4AA 4ZWNA 3R3YA 5HOEA 1UPXA 3NIFB 3HYSA 4CLEA 1NAIA 1F12A 1X13A 2NO9A 2JGDA 2ZREA 4PONA 3KSDO 5GJCA 2BEKA 5H1YA 3B9BA 2JGIA 1GTSA 1I3MA 1VXRA 2VH5R 1A95A 2AWOA 1IY0A 1TGYA 1XELA 3GFOA 4IX1A 2A1TR 3IILA 3LHDA 4AZ0A 1RDFA 4DVGA 3ZLUA 3AGPA 1UKBA 3AHJA 4C4YA 3JQGB 2W6PA 3MYYA 5A4IS 2NVWA 3GGSA 4KITB 3OVMA 3PUIA 5BNIA 2OXFA 5AUNB 1C3EA 3D3QA 1S02A 3DLBA 5CJPA 1TM4E 1USUA 1XQYA 4XH9B 2BDUA 3DO6A 3I76A 4ZHQA 2CV1A 2GASA 2I2DA 3DYIA 4KXWA 1CTQA 4RCYA 2VJQA 2XTMA 4P7KA 1U7PA 5A3RA 1FFHA 2A5JA 2P9FA 2PFSA 3PD1A 1A7AA 1RWWA 5FUWA 3VR3A 4EF4A 3TGPA 5DW3A 1SQSA 1YB6A 3JWPA 3LQKA 3LF1A 3QU9A 5KYGA 1EX6A 4NPHA 1CLUA 2LTAA 1ZHOA 2OHVA 3OG9A 4JAVC 3IVMA 3FYDA 4LTMA 2BH9A 3S70A 3SFTA 4LOJA 3EA5A 3OTHA 2WB4A 3IP7A 2VQ6A 4F2GA 3RVPA 3L1IA 2E4WA 3H0CA 4CTMA 3A6FA 1OXXK 2J4DA 3C0KA 4YCCA 4LJ7A 1VHDA 1W2HA 2BJWA 3I8SA 3NFYA 5EPEA 4AJ9A 2C03A 1ZXLA 1RI3A 3LSTA 4G81A 2A3NA 5E95A 4E4YA 3KSUA 1UANA 1Y1PA 3C3XA 4WN9A 2P7IA 1XFDA 2CVFA 2Q6LA 4MVYA 4PLTA 4TPKA 1QRAA 3RD5A 3LDFA 3UK1A 4BNWA 1G7TA 1R8YA 4RF2A 1DTSA 3KC2A 4PX5A 2NTVA 4RSRA 4HADA 3VDQA 3ZCPA 2JAHA 2VHTA 3X1WA 1C3OB 2ZRJA 3QTTA 5DRYA 3TKLA 2CDNA 4ZD6A 1S3SA 3ZY4A 2F4NA 3B6EA 2SECE 3P9YA 4UBIA 2WWHA 1P72A 3JD4A 3ZH9B 3KB1A 2J1LA 1AS0A 5HNKA 3G9XA 5BT9A 3VC7A 3ZPXA 1JPNA 1DJNA 1L5RA 1FW8A 1N9ZA 1Z16A 2JEZA 1YHZA 2XQGA 3M6FA 1DKOA 4HEA1 3VVBA 2OCGA 5IJZA 1V9LA 4HL6A 2ZIXA 4HQKA 4KH0A 3V4VB 1JDUA 4RF5A 3FPJA 4EVIA 4QHTA 3VDRA 1U2QA 5EHXA 3VSCA 1NQTA 1YB1A 3IELA 1SD2A 4EL0A 3AM3A 2RGBA 3X1DA 4E22A 4EPVA 4DZRA 5AHKA 3HXQA 3VPDA 1O5TA 1L5YA 2Q5QA 4MWSA 4JLBA 4MKHA 3UGQA 2VK8A 2XX3A 1DEKA 5BWCA 3U5TA 4B6GA 1HTBA 5J47A 3A3YA 4WNYA 4TXJA 4UHKA 1LWNA 2ZKLA 2PQ6A 3TRHA 3UMFA 3ZY3A 4PZYA 4RUKA 4C7OA 4BVFA 1PJ4A 4MV4A 1YJBA 5K0ZA 1NC3A 4KKVA 2SKCA 5JAPA 2IA5A 3RYCA 2IE8A 1R8SA 3CMMA 1D3AA 5DN6A 3KPJA 3EJWA 3P0FA 5HP4A 1SVIA 2JI4A 1MVLA 3TX6A 3A2NA 3OX3A 1TJ4A 3DBIA 4D0RA 1J24A 3VV3A 3I12A 5CXXA 3IPAA 2C5FA 2J8ZA 2FZVA 3A2LA 1BVUA 1S9DA 3UZUA 2ILVA 3CZCA 4HZUB 1W6RA 3W2IA 3WDSA 3WX0A 1JALA 2IHZA 4F4CA 3BTVA 1CVRA 3NXKA 4IWYA 5TE9A 1FTSA 3U61B 2PRIA 3QMWA 1M2EA 2PUEA 5BNWA 1H3FA 1P1JA 3FOBA 4P81A 3A4NA 3WGJA 3A25A 1HGXA 3RYHB 2QX8A 2X0RA 3PHJA 1ODCA 1UP4A 3ZHQA 1NRXA 2QTWB 1JVSA 4IJWA 1ZNYA 3U48A 3WMEA 1Z88A 1UFQA 2X58A 2ZSAA 2W42A 1ULSA 1R8QA 5FJIA 1Q1GA 2B8NA 3RTDA 3WMXA 1M73E 3OTGA 3MLBA 2M1XA 1NLMA 2HI0A 1WV0A 3CN7A 4FEAA 4MYTA 4RLQA 5FH9A 1QDEA 3DDCA 1LJLA 1PLLA 2F3PA 3T0GA 1FU7A 3T15A 4PAQA 3K92A 4AI6A 2QW0X 2G6BA 1XZMA 4MVJE 3QF7A 2IYUA 4OSEA 1XQWA 1KQPA 3S8YA 2JJ2D 1T1IA 4MQBA 5CVTA 1RLOA 3K1AB 5EPUA 3OJXA 3LLCA 3OWXA 2OEPA 2WUDA 3F46A 3NHPA 4RM3A 2IUYA 2VTDA 2BGTA 1OI3A 2ZU6A 3K2IA 3P2JA 3QMVA 2OO3A 3OD1A 4QOSA 1KVTA 4Y0VA 3V6MA 4DMCA 5FX2A 3GU3A 3U60B 1T6ZA 3T3PB 3FBTA 4R51A 4AAYA 1OFHA 3ETCA 4Z0PA 4YAOA 3N0TA 4TQ9A 5HW0A 4Q12A 2D06A 2F62A 4KWEA 2ONZA 3RUFA 1T0IA 4BHTA 4Z9AA 2IPXA 1ORIA 5I8WA 1F2VA 3C5CA 1J2YA 3ESZA 1VBKA 4Q4JA 5AJWA 3U44A 2IEGA 3CPJB 3Q7RA 4PG5A 4MV9A 5CTJA 4PPYA 1YCGA 4RKFA 4Z9BA 2EATA 1QIDA 3U4QA 3MTEA 3HFRA 1RYHA 1OGIA 3NHUA 1PDVA 4MW1A 4P7BA 1QH8B 1SK9A 3N86A 2B99A 1NXTA 3KQWA 1TQ2A 1PEDA 1E94E 4TVKA 2H0RA 2Z8YA 4HR7A 4G5XA 3A6KA 1U0FA 4MWGA 4HB3A 1S7CA 4INOA 1VHJA 1YCFA 4GEKA 1BX0A 3EGIA 4NEQA 1E1RD 1ULZA 2P5TB 3KJQA 2L2QA 3NH6A 5FOSA 3KQKA 5E38A 1P5FA 2XCUA 4L0QA 1YL7A 2D13A 1G64A 3H2KA 3K9NA 1I32A 7ABPA 1LC3A 1WMSA 2EIHA 1UF9A 4BNLA 1LI7A 3KG2A 2Q9CA 1GZ4A 2WJPA 3GLFA 2NTJA 2QD5A 2C98A 3EDOA 4D4MA 5C4MA 5GIOE 1RIFA 4JH0A 4WECA 3A8TA 2OK7A 3FB4A 4N40A 4MYSA 5ICGA 5K3FB 4YRDA 1B8OA 3QLUC 4KWIA 4MGIR 4YI3A 1N2GA 4GOMD 5ALNA 3WNCA 2ZATA 4GX0A 5KNDA 1E98A 4DY4A 5BMVF 1TRHA 4EVQA 1EFHA 4MRRA 1RKXA 2AC2A 1EVIA 2IEAA 3QVJA 2FHPA 2VXOA 4QDOA 2IZZA 3RS4A 1QZUA 3DEIA 2EXXA 1NRIA 4M54A 2R7KA 4GXQA 4JLVA 3WI7A 2DHQA 4KE8A 1OZGA 2A5LA 1OA0A 1TE2A 4U8GA 4LSZA 3CLUD 3EIOA 4Q1AA 2JK1A 1RJEA 4NV1A 4BNMA 3ZD9A 3VTZA 1W7AA 1IM5A 4H4DA 4P3PA 1CDDA 2XVAA 4G0VA 4H7HA 2WT4A 4MUFA 4B6QA 1SQ0A 2W8BA 1TYAE 1NOKA 3HHEA 1JQJC 4M1QA 3R75A 3MMXA 1GKKA 4GMFA 1OWOA 3H7AA 4RKQA 1KSJA 3A3NA 4ZP1A 5I48A 2K5UA 2HRDA 1ZHFA 3L6RA 2ZU0C 3TR0A 1B2RA 3CRQA 4JI4B 3C5WP 3EZLA 5AW4A 4KP7A 3KVYA 2F1HA 2FZGA 1E99A 4MAFA 1QHXA 2CE7A 2WFLA 1NY5A 3C3BA 4DARA 3G0CA 2EKPA 4JVOA 4BUJA 2XMQA 4QA9A 4XPZA 5J5VA 4YUAA 3G9QA 3LWDA 3PC4A 2UZ1A 3ZXSA 1W46A 1W8DA 3CF0A 1HA3A 3TE7A 4Y6PA 4JS0A 2OD2A 2QZZA 1U80A 5EYPA 2QRVB 1E96A 2D0OB 4FZ3A 4G5RA 1OLSB 3H84A 4U7GA 4OY3A 1H6CA 4MDYA 4YV0A 2R9VA 1FFAA 1P7WA 3Q6NA 4RD2A 3N39C 4MVCA 1JZQA 2ZBPA 3D81A 3DW3X 4EG0A 2CLDX 3C15C 3AZQA 4OX9B 1KO5A 1VFPA 4GVLA 2HWWA 2J3KA 3GNLA 3P9CA 1KZ9A 2I6GA 4J0GA 1RYMA 2JRCA 3A14A 1AC5A 2YW2A 4FWTA 1LBTA 3M6VA 2ZWIA 3CVOA 5JCZA 1U2DC 2H9IA 4QJBA 3EA0A 1DC6A 1PT9A 2XNDD 4A03A 1WBBA 5F3DA 1NQUA 2HDOA 1U8FO 2IYAA 4I81A 4C5BA 5HQTA 1C2YA 1V6AA 2YINC 3B8EA 2DWOA 3H1GA 4R1LA 4EZBA 3D2CA 1EG2A 4N12A 5ALSA 3BJZA 4HLQB 1NHWA 1UJMA 5I9MA 5AVTA 1KOLA 1N6RA 1WCXA 3BA1A 4BLRA 1IB0A 3WNQA 2BFPA 4PCAA 1GL6A 1QTIA 3AB7A 4G5FA 2BFMA 1T36A 2Q4DA 4J90A 4OIMA 2PGOA 4ND8A 2CC2A 3AVQA 3B6ZA 3NDRA 4UTZA 4W5OA 3WIEA 3NHZA 3DMRA 5FOVA 1X8XA 5C3MA 1WRBA 2HCFA 3EGEA 4DQVA 4QFBA 3OLQA 2FPPB 1FNDA 2X5KO 3PDIB 3M83A 2HU8A 4TKUB 3TNLA 4CIYA 2JD1A 1VCHA 3CLTD 5FI3A 4W9NA 5IFKA 1HDXA 5EJ4A 1E79D 1GZDA 1M6EX 3GBSA 4ZEMA 3RVNA 2ZEJA 4DWWA 4ER5A 2PH7A 2VDUE 2Z2YA 3FHLA 3Q3IA 1Q84A 1LGYA 1O96A 4J4BA 3RQIA 2HF9A 1TIBA 2CLKB 2IDJA 1QAOA 2GJ9A 2PEZA 3P9KA 1Q1ZA 3GI1A 3QOWA 4Z51A 2EC5A 3P0EA 4OUKX 4JX8A 3DKKA 3PUHA 4DJTA 4MUEA 3B1YA 3AFGA 4RY8A 4AMVA 5L3SB 2D62A 2H54A 3RUHA 4TTTS 2CLCX 4BFZA 2TMDA 3QPDA 2ECQA 1CR1A 3C8DA 3C6BA 1Z0ZA 2JLRA 4JI1B 3ZGLA 3C43A 3COVA 4ILKA 3RSQA 5BSMA 3DG9A 3SJCA 2ATCA 4EG7A 1A9YA 3CWZA 4MTLA 2NXWA 1EE1A 2PT6A 4W99A 1NVXQ 1Z35A 1AE1A 5IEBA 3FUWA 3NANA 4I4NA 4F91B 2C5GA 5IC5A 2XYRA 3S2YA 3USES 3OEHA 5J2UA 4BX8A 1E2IA 5DSTA 4PLYA 1XSEA 2ECFA 1XL0A 2R96A 3OOEA 2QTGA 5HDBB 3QVTA 5B2FA 1A9ZA 1JHAA 2Z5LA 3BGWA 5JD4A 5F9HA 3PGMA 4Y1FA 1UC8A 3ZVLA 1H4SA 1G6HA 5I7UA 4E70A 2VCHA 4Q19A 4LOIA 4QOGA 4X61A 1D09A 1TUBA 3CRVA 4RA6A 2JVJA 2WNIA 2UYCA 2D5LA 3U7JA 4K7JA 1E2JA 1H85A 2QI9F 3QE2A 4OB6A 5HE8A 4ZTUB 3R7NA 4PGAA 1J7JA 1KAOA 4LJ8A 2G76A 2H4XA 4PZLA 2I2FA 1SRRA 4L9RA 3NAQA 4U3JA 4ZCIA 5FOTA 1WDKA 2AJTA 4FHCA 1L7PA 1NJ2A 4XPIA 4BOYA 5G0WA 5IABA 1DCMA 3TBFA 3HCEA 5BR8B 2IHTA 1L4GA 2D5BA 5AW5A 3STUA 3EEIA 3QZUA 3DE1X 2BKEA 3JQ9A 4LXQA 1T2DA 3AJEA 3HC7A 3PQ3A 5EJGA 5LUBA 4QUBA 3OAAD 4L4UA 3OFNA 3N76A 1FJXA 1YB4A 2PSEA 2BFEA 5ILOA 3H05A 1J9ZA 1XZDA 4YJFB 2ANBA 3WSTA 1X2EA 1HI9A 2C92A 2GZRA 2VRBA 2C7GA 3PEYA 4KREA 2YRXA 2D6FA 3I2KA 1OT3A 1V26A 5F2NA 4UAUA 4MR9B 1IM2A 5G41A 1UPFA 1TQ8A 1XNGA 2JZOA 4FGZA 3BAZA 3U4HA 3STTA 5AESA 3CA8A 3HU1A 1JAZA 2V7GA 1QTRA 3TPZA 4GZ6A 3WA7A 1E1QA 4R7GA 1MENA 2A0XA 1N6NA 2G1JA 1HX7A 4QYIA 5AW2A 5H80A 2VQ3A 4QXOA 4MKRA 2JEYA 5HUHA 2NXCA 3V6LA 1O94D 3KKMA 1MBZA 1JJBA 3AVVA 3DEFA 4R7ZA 4LSGA 1ZJ6A 1JW9B 1YE3A 2A9OA 4KI7A 4DQLA 3AV0B 2W6OA 3GAZA 5DNYB 3TQIA 1WPRA 4PLHA 4GNRA 4A0QA 3WB1A 1G21E 1U5AA 1G8HA 5TV2A 4YQZA 2WTBA 3RS8A 3EOAI 4QC2A 3UY4A 2NIPA 1OTYA 3DL0A 3L8EA 4DIKA 3MSXA 4PGGA 1RLMA 1A1SA 2V9CA 2JGDB 4L4XA 4YUZA 4PPNA 4M1WA 3U7GA 4Q1VA 5JSKA 3FDJA 1KMIY 4RXUA 4HTAA 4ZDKA 4NJOA 4UHBA 3WIBA 3EBPA 2G3YA 3E9CA 3ZNOA 1CY0A 1V5GA 3GUCA 4QNRA 4TWRA 2WINI 3K15A 4JR2A 2TS1A 4IVNA 3CO0S 2ZUDA 4RETA 3RVLA 3WK6A 4A73A 5KTNA 4C2AA 1SBHA 4PCUA 1K8YB 4LZZA 2PIAA 3SJUA 2Y1KA 3FTNA 1KARA 2Y1LA 4Q4DA 4DLXA 2PM8A 1J8DA 5KJFA 4QJIA 3W8RA 4GLOA 2EQAA 2IFTA 4MARA 4B6PA