2K87A

Nmr structure of a putative rna binding protein (sars1) from sars coronavirus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
116
structure length
116
Chain Sequence
MYTEQPIDLVPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDYRHYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein, rna binding protein
molecule keywords Non-structural protein 3 of Replicase polyprotein 1a
publication title Nuclear magnetic resonance structure of the nucleic acid-binding domain of severe acute respiratory syndrome coronavirus nonstructural protein 3.
pubmed doi rcsb
source organism Sars coronavirus
total genus 22
structure length 116
sequence length 116
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16251 NAR Nucleic acid-binding domain (NAR)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2k87A00
2K87A
chains in the Genus database with same CATH superfamily
1SU7A 1MAVA 3GJ5A 4TXHA 4F9TA 2XUDA 1AF4A 3WIBA 4TPKA 4LMAA 3NV7A 1MABB 1NZDA 4RJJA 3Q8KA 4R7GA 4A9AA 5C2JB 2VAWA 3L0CA 3KQOA 1KEKA 1XKXA 2LD4A 3PICA 4WH0A 3WIDA 2YN4A 1R9MA 1YZLA 4HDOB 4J94A 1VB3A 3MJTA 4XD2A 3G2JA 1KSFX 3TI7A 4B35A 4CM6A 7REQB 2AXQA 3ZJUA 4YRNA 3LRPA 4EG8A 4ARAA 5JWHA 1GQOA 4YAFA 2GXQA 1JHVA 1N0VC 3AEQA 3KLBA 4ACAA 3B7GA 4KYIB 5CXSA 1N2CA 3R3VA 1ECJA 3IILA 4UPEA 3QX9A 3AKYA 4L6IA 4BX2A 4EHLA 1KO4A 4RZHA 4XOIA 1Y1RA 1YL7A 1EFDN 1QYXA 4CKCA 4OLFA 4V1CI 3RFXA 1P44A 3ULKA 3OMXA 3A4MA 3H5AA 5BQXA 4J16A 2PD3A 2QRVB 2JZCA 4GQIA 1WLYA 3GWGA 1NYQA 2G4VA 4UQPA 3TSYA 3HBJA 2VF7A 4Q4AA 4ZI2A 5KYWB 4IIYA 3ANXA 3UOWA 4PZUA 2IYXA 3H0KA 3BD6A 3G2HA 4GBMA 3EDQA 5C7LO 2AUTA 2A1UA 2FRVA 2VNSA 1N1EA 2Q5EA 2V8BA 2GBFA 4CU5A 5DHPA 4MR7B 3UOAB 4HKTA 3UWPA 5CT8A 1SEVA 4B3JA 3V9AA 1KVUA 1CT9A 4LTDA 2J3HA 1RPJA 1TAGA 2ZB8A 3T94A 3W8NA 1XMSA 4BFCA 2JHGA 3JQGA 2BAGA 5MDHA 3KFLA 4MOWA 3BWVA 4GOLD 4F12A 5FUWA 2LCFA 2SNIE 4MPRA 4Z4QA 5JNLA 5LIRA 2R2GA 4ZYZA 1VHQA 2CNOA 3LW8A 2FG7C 2G1JA 5H9VA 3B89A 2Q2OA 1EHYA 5I8PA 4EYKA 1PGNA 3X1MA 1MB2A 2F59A 1VTKA 1J33A 1PVOA 3CKMA 3DE4X 3VKUA 1X1EA 3MERA 2QV0A 3DQZA 2QX8A 3R7FA 2AC2A 2WTMA 4RDHA 3RF6A 3EODA 4WGGA 1E32A 2QRPA 3L8CA 4Y2SA 5EC8A 5D5HA 1QFZA 4Y1EA 3U49A 1AO0A 2P30A 4BUJA 3LBNA 4GI5A 3SE7A 3AY3A 3TMKA 2CZCA 3C1TA 3F97A 1XIVA 2ECPA 2H9IA 3HUEA 5CM8B 5KQGA 2PEZA 2YV4A 2SHKA 3KPVA 4PANA 1IPEA 1RYYA 2C2MA 1U8FO 3CNOA 3ASUA 3I30X 1WG8A 3KG2A 2V98A 3PQDA 4G0UA 3J7AC 1PGJA 2EHJA 2OCDA 1PSDA 3MTJA 2GBLA 1Z15A 4N6OA 3TKAA 1M7GA 5LPNA 1WXWA 2E4AA 1OX4B 2G25A 4Z2AA 4OQLA 4JWTA 3CMCO 3EEYA 2FMKA 3IIMA 5KYVA 4YONB 3V3TA 2DT8A 4TV8A 2Z09A 5HA5A 1QSGA 3FBTA 2F00A 4QC2A 3NWPA 4ZDWA 4OYHA 1W47A 3T5AA 2A9JA 4F2HA 4FB4A 1G66A 3OSZA 4QA9A 4Y2HA 4ZYVA 3WKCA 5SYNA 2O8VA 3HWX1 3SX0A 4TYNA 3KSAC 3NC1C 2O2ZA 3OKAA 1LU9A 5IHXA 2BBWA 1IB0A 3IDZA 3W2FA 2JATA 1TTHA 3UKDA 3ROKA 3ZHXA 1YFJA 1VHLA 4IOMA 4YP5A 3DW3X 4B74A 2XGGA 3E7DA 1E6KA 2IL1A 2L69A 4I9UA 5GM1A 4DBLC 4PYNA 3I76A 3LO8A 4Y30A 4D96A 3TEMA 2XCQA 1RHUA 4PR3A 1OA0A 2GAJA 3B9RA 5AVOA 3BDVA 4MRRA 3X2FA 4F86A 4EGQA 4IJWA 4DKXA 3FR7A 1F2UB 1H85A 3LX6A 1ZSNA 4HC4A 4YUXA 3HKDB 3PD1A 3HV0A 5IUNC 4A23A 3N2NA 4NVRA 3JVEA 2RSLA 4ZT3A 3SBOA 1WDLA 3O4GA 1N9GA 1CY4A 2Q3LA 4XB6B 2QN8A 2ZCJA 1ZGCA 5E8RA 4LZZA 3WGLA 1XVUA 4M9QA 3RU7A 1MJGA 5D87A 5AJTA 4A5OA 3LRTA 1ZJJA 3PS9A 1RADA 2OZKA 4Y6GB 2ZJ5A 3WO0A 1NKSA 4F4HA 1WHTB 5GJVC 2HUPA 1WCV1 1CQWA 4ZN6A 4Q93A 1TUEA 4ARUA 1KOLA 4GUAA 3VR5D 1MHTA 4I55B 1WVGA 4FMDB 2I3ZA 3JQQA 3QF4A 5JAUA 2I91A 4RH0A 4P9NA 5C5IA 4D9GA 2SKEA 3KE9A 1SKAA 1ZQ1A 2NU9A 1QO0D 1QFMA 4L9WA 1GKKA 1P2VA 2IOHA 1LJUA 3I58A 1JAYA 5DM4A 1CS0A 3RAGA 4V24A 2AJTA 4I1PA 1VSQA 4Q4CA 3G1TA 3NUQA 3AUFA 4UTNA 3WZMA 1B0ZA 1AS2A 1ZYUA 4X41A 2IF0A 4TM8A 5DNCA 1DFGA 2ZANA 2NAPA 1Z68A 4PICA 1JQEA 4CFZA 2NO7A 3WL4A 1ZD1A 2ZSEA 1DVRA 2HCFA 1H6BA 2RGXA 3L77A 1P31A 2XDAA 4MV9A 4NBLA 4HDKA 3GNQA 5CBPB 2YL2A 3I1YA 5JFGA 1YA4A 2D8AA 4Q39A 5CPBA 1PDWA 4XGRA 4XCXA 2OXIA 3SC2B 1R50A 2UV8A 1E18A 4NYMQ 3RDPA 1F5SA 3GCXA 3PDIA 4A27A 2B4YA 1V47A 2G5TA 2FWRA 3ILVA 5DNVA 3W8EA 4YGXB 4C08A 5AQ1A 1J99A 2OGSA 1R27A 5DCYA 2JLSA 1CZKA 1HORA 2NYUA 2XQGA 3LX5A 5K20A 5JSZB 3EGVA 2JEYA 2X58A 2R25B 1KI7A 1VMDA 4E2YA 1LQUA 2C4UA 4TROA 4CMIB 2QLLA 3GEIA 3C0KA 3WJ1A 3OFJA 1U3WA 3LCRA 2JGKA 4RK6A 2MSWA 2HU2A 4HGOA 3PC8C 1QP7A 1VE6A 4YRIA 1WCXA 4XX1A 1CRZA 2GNAA 4GMKA 4GO1A 4O4JF 3DPUA 2ZTLA 3RTBA 1M34A 3IPLA 3TLBA 2PSDA 3QVSA 5FOVA 5A7GA 3CLVA 5HMLA 4BFLA 4NH0A 4IS2A 4OAOA 4OXNA 4Y9UA 4CI0B 3KAKA 5JEEA 4G24A 1MCZA 2PKRA 1UEXC 4IVQA 1VCMA 3G8BA 3RYFA 4DA8A 4CEIA 2R7NA 2IGTA 1BKDR 4M0PA 4IDNA 3DF9A 5FEMA 3T9AA 4BX8A 5BN1A 2NPIA 4NF2A 2Y6VA 1Z0UA 2UAGA 3PCRB 1YTUA 4JXKA 1W0JA 2YYAA 1USWA 1YT5A 4MUFA 3JR3A 1H9CA 1P2GA 2DC1A 2RG1A 1SURA 3CE6A 3D5TA 3U40A 4C2BA 5CIYA 5THXA 3G0DA 3KHSA 2IIBA 3BZBA 1JQAA 3PXAA 1NI5A 2JS7A 1NBMA 1XRQA 2EDCA 3QE0A 1LLCA 4FM9A 3KQTA 2ES4A 4HO1X 4QTYA 3EDOA 3UMRA 5AYVA 5BO5A 2E5WA 2Z2IA 3GH1A 1IVSA 4R68A 4FZ3A 3SZLA 1A69A 3JQ9A 1QZZA 4X7PA 3E3AA 1NF9A 1MZVA 1P77A 1RAFA 4JR2A 4P3PA 3FMIA 4QHYA 9GPBA 3M4XA 3I8SA 3PC7A 3BCRA 4I1RA 1IWBB 2FQQA 1HT1E 2D2EA 2IXEA 3TLKA 1KYXA 1OIVA 4RFVA 1EK1A 3COYA 1DTWA 3H2JA 2SECE 1NJ6A 3LWNA 2WR8A 1TM2A 3OY7A 2C7BA 4EEKA 1VCNA 3FR8A 2CHFA 2O05A 3ZHUA 5JARA 1KEEA 3EVFA 3L4BA 4CMBA 3ZIUA 5DV9A 3A70A 1RP1A 1RRMA 1WXQA 2QJOA 4WA7A 1T26A 3A7EA 3ZZUA 1SKMA 4U6NA 3VJKA 4GW3A 3K70C 1QAOA 3Q72A 5DMHA 3W3AD 1Z36A 4EPYA 1SU8A 5CDTA 3M6XA 4MQEA 3HB1A 3Q3IA 4KPFC 4J75A 1IQ0A 2DQSA 4N39A 3GFTA 1XO1A 3NBMA 3PE4A 4Q3KA 3RVOA 4IZHA 4WSOA 4F21A 3OA2A 1KOJA 2GJKA 1WUHS 3HKBB 3PYMA 2J3KA 1OOEA 4HQFA 2V3CC 1KP3A 2PWYA 5A0TA 4UC0A 4FOOA 4ENSA 3TB4A 2A14A 2O7QA 3S28A 1J2YA 1W0KA 4UHFA 1FA9A 2F3QA 2C8LA 2PUGA 3GF4A 4UCQA 4BWVA 2W6MA 4WNAA 4I5DA 4FZJA 5IJAA 1Y0BA 4LBVA 4YUVA 1Y6RA 4J3NA 5IC4A 3CRZA 4A8JC 5DBEX 4B3CA 2GO7A 1II8A 5J4LA 4CQNA 1EE2A 2X1VA 4INZA 2EGUA 5SV2A 3P0JA 2IHVA 1MOSA 3WNVA 2FB9A 2P27A 2WTNA 3CR7A 3KJEA 1S2NA 4HRYA 4IMIB 2QSZA 4MWZA 3PKZA 9LDTA 2R1VA 4IQ0A 2GWRA 3LLSA 4E7OA 3GMSA 2IX3A 3OESA 4UHHA 1ZCFA 5KNCA 2GZMA 3DE7X 1BXZA 1Z7BA 9LDBA 3WK8A 3UFXA 2YN0A 3U9TA 4D5GA 3S2EA 1H8ED 2C5EA 2QN1A 4ZK6A 2IYVA 2CXNA 4BAUA 1S8FA 1HK7A 3FMPB 3KUCA 3N8KA 4TVKA 4WV3A 3AMVA 2REQB 1XNQB 2Y99A 1KDOA 3AERA 1D2MA 3LBIA 4BB9A 1C1DA 4BLVA 5GJCA 3CURA 3VOTA 5I7HA 1VBMA 4EL5A 1G0NA 3VR4A 2G9NA 1GWNA 1MC5A 2R47A 3NDRA 3Q3HA 4M99A 1ZJ5A 4N3AA 1ONSA 5FCDA 2A86A 1CQPA 1OZAA 2OM2A 2VLIA 1NX9A 1BU8A 3Q9LA 2E82A 1YNOA 2GK3A 2R66A 2W5UA 4HAOA 1J20A 5JSKA 5I01A 2HZ7A 5KVQA 3O31A 2BFCB 3NDJA 4P4LA 4C1BA 3CZMA 2BBOA 3P9CA 2QTBA 1JBQA 2YMQA 4REQB 1MMFB 4UEOA 1FU7A 2I8CA 2HFJA 4F60A 4HLQB 1V96A 4PQGA 1Z8DA 3E9YA 1WM1A 1XL0A 2C94A 3QJ5A 3WE7A 4EW1A 3U60B 1T1SA 1ZGZA 4R40A 2AHRA 2ZYVX 3DZJA 4WZBB 4Q9NA 4DE5A 1IZ9A 5JNWA 3DB1A 1J06A 5L8VA 3A6EA 1E2JA 2QUAA 5CVEA 4CYMA 1VJ1A 1J8MF 1RI5A 4QBIA 3IGFA 5KNLA 5H0IA 3LP8A 1UF9A 2GVNA 2J30A 3KKNA 4XRRA 2X0DA 5KCZA 1KMQA 1SVWA 10MHA 1UOEA 3CJTA 2GYWA 3FUUA 4I46A 4I55F 4E2WA 5CYPA 3BE5A 2IV2X 3AXSA 5G0TA 3ZHRA 2MYTA 2OB1A 5JFOA 2CXHA 1X7DA 2QVXX 2FWAA 5ALHA 5JADA 2IIPA 4WKBA 5FI1B 1EVKA 1P4AA 2BKVA 1C30A 1K3TA 2YIDA 3G2IA 3Q10A 3LT4A 3QEOA 3RVKA 1KIFA 4CMAA 1N0IA 3D8RA 2P2YA 1HQKA 2A88A 1B8PA 2BY4A 1F48A 1IEQA 2VZ8A 1W4ZA 4FDVA 3TSOA 2J9RA 4CEHA 1MO5A 2G0AA 4MLZA 1Z4LA 1WPXA 1TUBB 4L9RA 4Q5IA 3RYCB 5B12A 4GWKA 3E23A 2XTZA 1P2BA 3WKDA 1BX0A 2QWXA 2JKVA 2WYOA 2V6GA 2G7ZA 2CMKA 3MWDB 4RPIA 2WIBA 1K88A 1YE5A 3VPHA 3TZ6A 2HNBA 3W8FA 1YDEA 4FEGA 5CFZA 1QTRA 5B1SA 4BLTA 3G59A 3VYUB 2B7CA 2C3UA 1M6EX 2MMCA 2XRFA 1SBQA 3AZPA 4Y1RA 5CH5A 5LIPA 2CSXA 1U1IA 4MVJP 1JHRA 2UZ1B 4ND2A 3HKCA 2B83A 4C76A 1JXMA 3DJYA 2R65A 4A8PA 1P6XA 4WMLA 3NYQA 3X1JA 1CW2B 1S89A 1FU4A 2O2DA 2BEUA 3HSYA 1BAPA 3RREA 5B6IA 2GQ0A 4HNQA 3F46A 1JWBB 3CZAA 1DEOA 4Z4IA 4RC9A 2R1UA 3B2EA 4JLDA 2PZAA 2H07A 2O8BA 1X3LA 1YB5A 1SXJE 2FEKA 3OZWA 2O7RA 1UJ5A 4LZAA 2E2WA 2H1WA 2LIVA 1SCNE 3MLAA 2OGTA 1VJ5A 4JENA 1MA0A 3ESAA 1CUAA 3Q0IA 5DNEA 3V33A 1NQTA 1LSJA 2VDNB 4HGNA 5E7JA 2AKYA 1OASA 4NULA 3S7TA 5CXQA 5LQJA 2CD9A 2Q2VA 4M9XA 4YDQA 3HDTA 4RKWA 1DCTA 1TJ3A 4BNYA 1EWTA 4DLVA 2IYRA 3RTGA 4JELA 2YWDA 3M9LA 4QVKA 4C20A 3ESCA 1RCTE 3EIXA 4BLUA 1N7GA 1ZI9A 4U6SA 1HFEL 2XUFA 1SKUA 4ZC8A 3KT3A 4HTFB 1EBFA 2HJVA 3ONWA 4F56A 4X6XA 2GCNA 1COWD 3PQ7A 4OP2A 4JBNA 1R88A 4WWHA 3W0LB 3UXHA 3ZWCA 2YWEA 3ZLJA 5ARBA 1ORRA 2VA8A 3ZJVA 4GG1A 3H1PA 2D1RA 1ZN7A 3LAWA 4I3FA 3SR4A 4DT1B 2OCIA 1DELA 1RXWA 3QMWA 2XTMA 4AKSA 1VHJA 4Z1MD 3THXB 1F14A 3ND8A 4AXXA 3I5YA 3QBVA 4GZMA 2G04A 3KYJB 1XHLA 1JEQA 1QGOA 2WD7B 3I61A 2AG6A 3COPA 4J6EA 4DW8A 1RPNA 3IEUA 4HLDA 3OF3A 4IP0A 1O95D 4YJ3B 4EPWA 5U1PA 2RHRA 4CTMA 3ZW9A 4A73A 3L07A 2PX5A 1V9CA 4BGEA 1AGPA 3U62A 5KYGA 3PQFA 2EG9A 3Q40A 1FRNA 1ZAYA 5DSXA 2XPCA 4UCWA 4JUAA 4YQZA 1RQLA 3SVTA 2JBAA 4EABA 1IJEA 2J59A 1JKJA 1KQOA 2G7MC 3IS3A 1R5BA 4TTIA 5T8KA 1ZFNA 2ARKA 1XROA 3MUFA 5JD5A 5JZ9A 5KTOA 3UA3A 3FKQA 2HWXA 2LIPA 5DX0A 2PUJA 1CJMA 4IZIA 4TLBA 1FUEA 1RQGA 2Q6KA 1RRKA 3O38A 4KLRA 5GAJA 2JI6A 1TKRA 2MINA 1NV8A 1OWOA 3M2TA 1YZUA 4RNDB 4C0AC 5KOJA 2R87A 5IM5A 2XR1A 1YJCA 1YQTA 3E70C 4EB6A 2RI6A 1IMOA 2TRSB 1WR8A 2G6BA 2XUIA 1XNRB 3AT1A 2FZLA 2XZOA 4L72A 4Y3UA 5JI3E 1P61B 2GK4A 1W5EA 3D6VA 3JVIA 3ZWQA 2JAOA 1C50A 3ZGYA 4HB4A 5F1KA 4DM4A 2EBWA 3PDUA 3PF8A 5KAPA 1JR2A 2GXUA 3AUSA 1EXWA 1JQKA 2QTNA 2JIMA 3RJ9A 3SLGA 4U39A 1L5MA 5M7EA 2V5UA 3UUEA 3TAHA 3UHOA 4EVQA 2C2GA 2OD7A 2VSXA 4IJKA 4IIFA 1ILEA 1X7WB 2XMGA 2YKGA 2FEMA 4AWXA 3E3MA 4ZCPA 4DYVA 1UKCA 3WX0A 1F9AA 1XYVA 4BRSA 2CL6X 5SY9A 5EE0A 3OY2A 5LUAA 5K6AA 1OVMA 1RABA 1XQ6A 1ZNWA 4FGSA 4FMCB 5TQ2A 2I7XA 3OPXA 3SJ7A 6PFKA 3FN4A 4BQNA 4UZFA 3GELA 1HETA 1B42A 2BMAA 4HWTA 3UG7A 3WBBA 1ADGA 4YGYA 4ZCSA 4BO5A 4I8IA 4JT8A 1UBKS 1GTRA 1ZCAA 1LSSA 3V7UA 3WTBA 4DUGA 2QR2A 3FLEA 3CH7A 2Z5VA 4QYMA 5KINB 3KSDO 1UDRA 4DZTA 2GCOA 1Y5NA 3VZPA 5ITZA 3SYKA 4CLHA 4RV4A 3ORYA 2VLBA 2VJBA 3A04A 1J6UA 4WKCA 2HK6A 2FWIA 4GMHA 2FN3A 4NBVA 3THOA 2ZRJA 3WP1B 3FTQA 2C5BA 1X8XA 2AWNA 3WSTA 3ZS9A 2QAGA 3UJ9A 1A71A 3R3JA 2FU5C 2FNAA 4YO7A 3MCWA 2I99A 2FHPA 3GJYA 1NXQA 3QVXA 2YYYA 2HXGA 2SKDA 1N3LA 3IV7A 1RC0A 3M6FA 3O8BA 4G5HA 5SYAA 1JA1A 3SS8A 3OEED 4TS1A 4PN7A 5IK2D 1VHWA 1XSEA 3EZFA 3PUJA 1E2NA 4ZK2A 3V1TC 2FEAA 4EW3A 1J2UA 2JLUA 2UYOA 4RTRA 5ENZA 1KAHA 2YOHA 2CWWA 3D2CA 1Q5PA 4DCGA 1QE3A 3K96A 4L5AA 2BUAA 3ZD7A 3HKEA 1SKBA 3C14C 3DULA 3MLEA 3NKLA 5AKJA 1L7BA 3RBZA 5BWCA 1EGVB 1CEEA 3UJAA 1N5IA 4C9BA 3E58A 4EVRA 2RJ3A 1OE0A 4OSEA 2P0YA 4Y9RA 2ZWOA 2ZUVA 4EJMA 1QIEA 1AS0A 1HYEA 4QJ5A 1C9MA 2PMCA 4GBJA 2OPHA 4NQRA 1UQUA 3PJRA 1DT5A 4H6WA 1V41E 2M1ZA 5IJ9B 4IQ8A 2BZ1A 1TIPA 5T6MA 2HOQA 3C4JA 2OD9A 2FDXA 3AUXA 1TMOA 5HE8A 4KXUA 1KI1A 2IHUA 1A98A 2CXTA 3QELB 4RD0A 2ZUDA 4J43A 5KREA 4Y67A 5HFJA 3BZUA 1HYHA 2NSLA 3F5MA 1QCDA 3KO8A 3PX2A 4HXFB 5E1DA 3KFXA 1Q7RA 1L7OA 4OAPA 4IRXA 4TQUS 1G55A 3OM1A 2QTLA 2BT4A 4TMWA 3B7PA 4P4NA 1FUKA 2WUVA 4Q4JB 4Y2YA 5F64A 3K94A 4F5YA 5I4CA 1PN3A 3USES 3VNBA 2WUDA 3ETJA 2QU7A 3LVRE 3E9DA 4IL5A 2IPMA 4N0MA 4XI9A 1GZ6A 5DWDA 3PNKA 4UM9B 1QNFA 2W2QA 4TRJA 3P45A 5AOCA 3TD9A 2BFPA 2HHAA 2JD0A 1OH6A 4MQ4A 2VXYA 3WGGA 3THWB 3IJ5A 2UKDA 1I5EA 5AM4A 4BFZA 1OWMA 2RGAA 1PZEA 1JHOA 3QM1A 3H2GA 4NYJQ 5EKXA 4IVRA 4N5IX 1G8AA 2PAFA 5JU6A 3WLTA 4RFSB 1L3CA 2RH4A 5IH3A 1ISPA 2PZLA 4L07A 1WW3A 4PCAA 1ORHA 2MSDB 1GQRA 4DPKA 3FH0A 3F6EX 3TXAA 3O4VA 4MVCA 4Y6LA 4MVXA 2LV8A 3VR2D 2O8EA 3OOJA 2J46A 4XTCS 4K40A 2ASVA 3A2KA 3I04A 3JYQA 4AZ0B 3W5DA 1G20E 1DTSA 1NBAA 1V4NA 3CVJA 3ME5A 3A8TA 2QAJA 3EBPA 1TRKA 3I9LA 5F77A 3IQIX 1ZICA 2CLFB 1K7SN 3AKDA 2Z1NA 3NASA 4KVGA 3ORRA 1U3DA 2O2GA 2AQKA 3K0AB 3U7EB 5KTMA 3SQOA 2ZRHA 2BHLA 2ZPUA 4M7PA 5HCIA 2LP4Y 5F9FA 4GC5A 4GWGA 1DO8A 1FSZA 1QIMA 1NF3A 1JEDA 1TZBA 4HZGA 4IGKA 3VPXA 4XYLA 1YB4A 4PCUA 1JH8A 2C92A 3Q3CA 5A4AA 2J7PD 2HT6A 5DGDA 5C7YA 2B7LA 3U31A 1WZEA 4IILA 5EP3A 4QUEA 1FDTA 2RONA 2Y27A 2FV8A 3CNBA 1YDHA 1QKJA 3DJFA 3GDOA 5HKLA 3H9JA 3EZXA 4BVBA 4Z51A 2PRKA 3L7LA 1NVVR 4IYJA 2R4UA 3GUZA 1KI3A 4BNLA 1OMOA 2J87A 1DJNA 1ZZEA 2PRYA 1NWHA 4G0WA 2JLYA 3CCCA 5REQB 4XDHA 2VJYA 3EVTA 5AKXA 1XKLA 2GZ1A 1GN9A 1UBMS 2VSFA 3DDNA 3SZ3A 1WDWB 3WLOA 3C3XA 4TXLA 3SEAA 5KWEA 1P7WA 4BXOB 5K0JA 2I87A 1QHYA 1L5YA 3NAZA 5A5VA 3UJPA 2ZSFA 2ADOA 1O0SA 5F5XA 4V0NA 1GCIA 3JYOA 3OCVA 4MRSA 3T7CA 2O19A 2OV4A 3BTOA 2HLDD 3EXG2 1XXHE 3PHJA 5B64A 2JHCA 5EHXA 1GU1A 2XLBA 4D4KA 3I62A 1B26A 5DBIA 1E7WA 1OI7A 1FCJA 4F6RB 3MQFA 3PJDA 1V4BA 3ROTA 2VDVE 5L3SB 1PJ4A 1BWRA 1HXHA 2IUFA 4YJ3F 5F12A 1MAAA 2CE7A 4W9NC 4WASA 1ISHA 3ZHCA 1WABA 5AD1A 1P19A 3GNTA 5H70A 1SIOA 4XQCA 3GU3A 4JL6A 1YFZA 1J8VA 2ZYGA 4FDAA 5AM3A 3B78A 1XZBA 5PNTA 3U5ZB 1RJFA 3W5HA 3KE8A 4CTKA 2NO1A 3EGDB 2Y1DA 3BREA 1JHUA 3D81A 1GQFA 2GD6A 3EC7A 1DXHA 1RRVA 2PGAA 3EQZA 1ZESA 2H31A 3F9CA 3PHCA 3RFVA 3RQIA 1YBMA 4OXYA 2BM1A 1PJCA 4YAEA 4CIVA 5FO0A 4RD1A 3FNRA 3AHIA 3E03A 4CMEC 2Q27A 2QP4A 1SB9A 1S1MA 3CQ9A 5D6OA 3M3DA 1YGYA 1K4MA 1YO6A 3K7EA 3R9XB 2ZIZA 1UC9A 1Z29A 1PW5A 2JPDA 2VJMA 2Y1KA 3ETLA 4JSYA 3GLFA 4KK4A 4ZANA 4JLOA 2NYAA 2BWJA 3KQHA 1E4YA 4P0QB 2AJDA 4HUQA 2QROA 2EW2A 5EPEA 3RRBA 3PQ2A 2XVMA 3GLIE 4WK0B 1FQJA 3E9RA 4UZEA 5FBWB 3TDMA 4A1OA 2C2KA 2H85A 1XTBA 1G17A 1FTYA 2O1XA 3AGPA 3STYA 3ZU4A 1D03A 5GY7A 3TQCA 1SQGA 4FBGA 3DTYA 4L27A 4LRXA 2I2WA 3GT3A 1FX1A 5JCOC 4HEA1 1ZUIA 2FX2A 2R62A 3O8QA 3BWMA 3ZQ4A 1Y5MA 2UZ3A 1R0XA 1E1LA 3HVKA 5JLJA 4OK5A 2FZCA 3V46A 3QXSA 4FMCF 4W5JA 3QFTA 4Q7JB 3BM5A 3I4CA 5J1TB 3D6AA 3DOOA 5HQ3B 3DMTC 4RXMA 4KK3A 4B34A 1DV2A 2AVDA 3QFFA 4QDXA 2PG3A 1K8RA 3IAHA 1EJ2A 1WD5A 1LFDB 3N2KA 3S44A 1MEEA 3VOAA 1TPZA 2CLDX 1ZWLA 4IVNA 3V80A 1NSFA 4DGSA 3UAYA 4U7WA 3QEKA 3X1WA 2VXBA 4ND5A 3ANSA 2FEPA 2Z30A 5C5EA 1QGUA 1Z13A 1Y1SA 3H9CA 4Q00A 5ECWA 5F73A 4YWHA 2MCFA 4Q21A 3RFCA 2EQBA 4Z54A 2V7PA 3VH4A 2BTOA 3MBOA 3R6GA 4N5NA 3VI3B 4ARZA 4C05A 4Y2JA 1NFQA 2FPLA 3H7AA 3A28A 1JHDA 3D2AA 4IGFA 5IWCA 1ICIA 2RGUA 3AXTA 1DBVO 1OFTA 3MELA 3IE1A 3SYRA 4G86A 4GVXA 1KS2A 3H2HA 3K0FA 2OFXA 5ALZA 5TVGA 4O63O 3AIKA 5A3VA 4PM4A 2Y76A 1KMMA 3SQDA 3WQBA 4UEKA 4RY8A 3L8FA 1SCIA 3HLTA 3I92A 2YV2A 5FBQB 1JL3A 1GGHA 5ELMA 3ADPA 4NCAA 4OBEA 2ZT7A 1UR5A 4GPAA 3ET4A 4TYWA 4HEA6 1TCUA 2EJVA 5BSEA 1UKYA 3A32A 1ZH0A 4UREA 1V43A 3WGQA 2PKCA 4L15A 4UMFA 5M3BA 3ETNA 2B4RO 3JXEA 2UYGA 4ZO9A 1EK5A 4FB5A 3CRRA 3V8RA 1PJZA 4P32A 5KX5B 1KMCA 2IUSA 3ZQUA 4EY6A 3M33A 3IR5A 2JCBA 3M0EA 3GJ4A 3U7JA 4WOBA 4P4TA 1T3ZA 3AEKB 3OHMA 4FEYA 1MD9A 2Q4TA 3AVQA 1EK6A 4G89A 4ZVRA 4C0WA 2CVQA 3KQKA 2Z5GA 1M6NA 3MGCA 5CVCA 1W7AA 2BBSA 3N28A 4OH1A 1QOPB 1T9GR 3VR6H 3BQNB 3EA4A 3QHAA 4ESHA 1SHTX 5IABA 3M7IA 3DKPA 2TMGA 4O5OA 1EE9A 2HGSA 3VVBA 3EFBA 4H1UA 3V1NA 1KGSA 3O47A 2ODWA 2PGIA 3PHHA 4HRVA 4ALNA 4L3VA 5L53A 1I7QB 4EFDA 4E88A 3AJDA 3RBAA 3BILA 3EPHA 4GEKA 3TX2A 2UUAB 1DKMA 2O8NA 4OM7A 2HX1A 1IY8A 1N78A 4NNPA 4KHPB 4R0MA 5A2QA 3RWBA 3CY6A 4HY3A 3OFVA 3N87A 3O0DA 4PPYA 3Q7IA 3Q8XB 5DM0A 3TKLA 1QU2A 2EW1A 3NDPA 3EIWA 2I7CA 1UKVY 4RUKA 1QFJA 1WDTA 1Z07A 4HATA 2W11A 2PHZA 5K3SA 4W8OA 5CAEA 4XIIA 2OLEA 3MCZA 3E35A 1P1CA 1OGIA 4ETNA 1GKYA 2GJ8A 4DLTA 5CCBA 3GJXC 1E9EA 1JIQA 2QXYA 2LCQA 5K3OA 1ZUNB 3R7WB 2YFYA 5ECYA 3SVZA 3RJTA 1WXFA 2PSSA 3L8HA 1RI3A 1HRKA 4UHBA 2B1JA 2PR7A 5FTKA 4Z5XA 2WEKA 6ADHA 4B4UA 4CLOB 3U80A 4DEYA 2Q6IA 4FT2A 2CFRA 2QVYX 2QLMA 2DY1A 1V95A 2RIRA 1GD1O 5DYYA 3SFTA 3M6UA 1U2ZA 1FFYA 1JJAA 1MORA 3HYTA 4PG5A 5F5NA 3ND6A 2VJCA 1VCIA 5HUJA 3IBSA 1JBEA 1XCGB 1YC5A 1B8VA 3RUIA 3TQIA 3IVXA 3V2HA 4BIIA 1OLUB 1PQWA 3WIEA 3IP1A 1QAQA 4AJPA 1M0EA 4AJKA 1DPFA 2I22A 4C14A 1E9SA 1V7PC 4WZAA 4MW6A 4ZVLA 1HDYA 3LXRA 5AW4A 1X8JA 1ND6A 4GKVA 4LYYA 4PAGA 3O1HB 5C18A 1W2HA 4CHTA 2Q3BA 3J81k 3CZRA 4G56A 1GY8A 1XTTA 2QTAA 3I0NA 2FPUA 1O08A 5HBGA 5I7VA 2B37A 1FDVA 2LGJA 2MYUA 2Q5IA 1YRLA 2GLXA 3ENZA 4BJ6A 3HB5X 4PONA 1K7YA 1HR0B 2FEWB 2VI5A 1F6WA 1L7EA 1M5UA 2HQ1A 5IJZA 1ECBA 4UDYX 5BV1A 1YF3A 4FHDA 1NXOA 1QTIA 5HTKA 5AVTA 4OXRA 2PUFA 3JALA 2JASA 1C3EA 5EE1A 4RETA 4KMMA 2Q2QA 2Q29A 2EJBA 2J4CA 3C3MA 1RHRA 3EGCA 3F0TA 1GPMA 1TA4A 2PBLA 3DZ8A 3TM4A 3GOHA 5BSWA 2G07A 1XMQB 2JD1A 4YY3B 1O5OA 1P2FA 2VRNA 1GG8A 4R1NA 1H05A 3L79A 4KFSA 2WU0A 3LTEA 4ZV9A 3TIIA 4D6XA 1W93A 3BCHA 3O03A 3R23A 1YB6A 5FBVB 2C97A 1W1IA 3QVKA 4M55A 3PUHA 1AOXA 3QYFA 4KWIA 4Z49A 2QB5A 2HD4A 1SUCA 5LMNB 4OTZA 2H8GA 2C5AA 1O5IA 4F84A 5TQ0A 1T9GS 3F6CA 3PGXA 4GXTA 1JS1X 2JCSA 1OX4A 1PJ3A 4DDTA 1XRJA 5A4JA 1U04A 1I2AA 4L8VA 5HGJA 4RKEA 1XA4A 3R41A 2GTPA 5FWXB 1SA0A 2ERXA 4LYDA 3WOHA 1BMTA 5HG0A 2QX9A 5EUMA 2BSQA 1SZCA 1ADBA 1MH1A 3ETHA 3SC4A 2VT3A 5HUHA 1F0KA 4BTLA 4CTOA 4PPFA 5C8XA 4EUKA 1OWPA 3EUWA 4HB2A 4TZKA 5EMLA 1G8FA 2IELA 2KW5A 3RLFA 1XVAA 5F21A 3CLTD 4RFLA 3BSSA 4J0CA 1J0BA 4ZQCB 3G2QA 2ZKLA 3LUAA 4FFVA 3LHKA 4WN3A 3DMFA 5CNKA 5EMNA 3AVTA 2VXCA 2W6CX 3ZWNA 4D9MA 2GS9A 4WDRA 1CUZA 2CY0A 3ZLBA 3ETDA 1E6CA 1V8DA 2VDRB 4TXMA 1BGVA 2VSOA 2YVQA 3N07A 2Z8ZA 4HTAA 1B7GO 3D0KA 3EF3A 3R2JA 4Q01A 3NETA 3VPGA 4DXHA 3HWSA 3ETEA 3E1SA 4U2BA 1WLSA 4HL6A 2X41A 2CV1A 4U9HS 2WYIA 3O3MB 1HO3A 3WKEA 4QQFA 3AY6A 4R2XA 5CA0A 1NAIA 5IF3A 5KQLA 4NOJA 1LQ2A 3MWFA 3EQ6A 3NP9A 4UU7A 4WECA 5JCZA 1ZC4A 2XEDA 2DFTA 3OUZA 5CG1A 3I9JA 3HHEA 3TE6A 1EUCA 3VM6A 4L1KA 4FSHA 4GM0A 4UVHA 5JAPA 2I2XB 2W9XA 4G23A 4TRNA 2JZOA 2OPBA 2Z57A 5CX1A 3C3WA 1YCHA 3UHPA 2C31A 2REOA 4IHJB 1LTQA 2PDAA 1DO0A 5D5QA 4R5HA 2B8TA 2OV8A 3IRUA 1WHTA 5CHEA 3O1IC 3IV9A 3FGPA 1TADA 1VG1A 3HV2A 1GU0A 2X19A 1CR0A 3WRYC 1XTUA 3NZEA 4OQZA 4BIMA 1U0NA 5JXGA 3BIJA 5KQMA 2HU8A 1K7CA 3LGAA 2GHIA 1XKQA 4D3DA 1CJTC 3CLTC 5F7XA 1KQ3A 3HUFA 3X2EA 3ZY5A 4CODB 3WI7A 1EXVA 3N2EA 2AF3C 2KI5A 4NBNA 3WGKA 1NLZA 5K8UA 2AIRA 3ONVA 3HNPA 2H0RA 2BMWA 2CBGA 1CNEA 5DHUA 3ZZ0A 2EHDA 4P58A 4F6CA 1LC3A 3M34A 4Y2TA 3AEZA 1KZYC 2VHEA 3DBRB 5LVAA 3GEMA 3RT9A 4DIEA 2GERA 5KX5F 1FYEA 4AO8A 1Y8CA 3QBTA 1Z18A 3KJGA 3ZBUA 3TR0A 1K7FB 4ENWA 1Q1QA 4PFKA 2B8WA 2CKDA 3I9OA 5TARA 3G3EA 4WLNA 4EFLA 5G0SA 4OI1A 4F06A 5CBPA 4ZZIA 4J4HA 3LT0A 4IMJB 3UWMA 1J8FA 2YYZA 3C39A 3HADA 4QYSA 3B48A 4XSGA 4DCJA 5A5GA 2X6QA 2UUBB 4TUYA 3JD0A 3PT5A 3ZLUA 3G8CA 2PMDA 3FSRA 3U39A 4WERA 2HLPA 2JGJA 2FXVA 4PLGA 2OHXA 4D6PA 1B0UA 1FBTA 5D3ZA 1XJ0A 5KSZA 5F35A 4M9CA 1Z6ZA 5KOIA 1YJ5A 1AZWA 4LJ5A 1RYBA 2DFKB 1TCBA 3ZK7A 2CJPA 4R1MA 2P5YA 2FX5A 3O7MA 5CTAA 2DHQA 4HB0A 5AR1A 2G82A 3DPIA 3FSGA 1FF9A 2J4DA 4ZICA 1XVIA 4WKNA 4ZJPA 4AMUA 1XT6A 2HDHA 3KALA 4YRMA 3UY4A 1ZLYA 3ZWVA 2ZJOA 4ZEWA 3UW3A 1PT6A 1ODLA 4LYHA 3VVCA 2AJCA 1R6AA 3B3GA 4BHTA 1RR6A 2J41A 3A1VA 5DHQA 4BNVA 2R3SA 1CDOA 1V6CA 3T61A 4D44A 4FOTA 1CRLA 1YHYA 4JFAA 3K6SB 1NZJA 3BUSA 5AM5A 5I7OA 2J9FB 1X7ZB 1RZRA 3ZZNA 2B94A 3HA7A 4L5IA 3AR8A 3JTMA 4AY2A 4W9RA 4FNAA 1JEOA 1LVUA 1STOA 5H83A 5K3DA 3K9NA 4KGXA 5C1IA 4BMPB 1TL7C 4CUKA 5FPQA 4LDJA 2WSLA 3GFGA 4LUCA 1L4MA 1Y82A 4IH1A 5HBRA 2JJ2A 2OMEA 3D6JA 1AN0A 1FYWA 1WDMA 4BMYA 4EZBA 1UZUA 3U7FB 5BYAA 1IPHA 2N9UA 2VQ6A 1CQJB 2XT9A 1OHHD 3O90A 3BA1A 1US8B 3HI6A 2OG1A 3DOUA 3JVUA 5DE3A 4A0SA 4BGIA 5HM8A 2A0KA 2NIPA 1CJVC 1QIIA 2OCBA 5BNWA 3HRKA 3DHWC 4IR7A 4U02A 5I9IA 3I4LA 3PC2A 2UXBB 2B21A 2GYVA 4B3XA 4DQDA 1P33A 4RY9A 3NOQA 3NATA 2QT1A 5BSTA 2GJ9A 1TRHA 3MINB 4QYIA 2X2EA 5AKLA 1D4OA 1L7PA 4E4RA 2FQWA 2Q6TA 3B3FA 3R74A 4F04A 1ZR4A 1Z2CA 1ZQ9A 1KI8A 1RXYA 4KH0A 3IELA 3KV3O 1XMOB 1MZPA 5LLDA 2DLNA 4XPIB 4E0BA 1BCSA 1FRZA 1H6DA 3AHJA 4Y9TA 2RK6A 4PZ0A 4PS0A 5DOVA 3S40A 3WGMA 5JCJD 1NM5C 3KL2A 5CCXA 3QKSA 2NZ8A 4KW7A 3ZE9A 4L0QA 1LS1A 4OK3A 821PA 2DFNA 2P11A 4WDQA 2HC9A 1B8UA 5TDHA 1I1NA 3DDWA 3P0IA 1E96A 1XCJA 4JLJA 3W4KA 3FFBA 4DSUA 4F3NA 5LNK1 5C8YA 1XEXB 3KKMA 1OFVA 1MAUA 4Q3OA 3SG0A 1H0SA 1DBQA 4DSZA 1CUXA 1Q11A 2DZDA 2X22A 4HG2A 3B6IA 1JG3A 3LBAA 2ZRBA 4Q7KA 2C9BA 2CXXA 3AZQA 4UEWA 5D3KA 1ZN2A 4QDTA 1L1QA 1JNYA 4ALMA 4F72A 1R8QA 3B13B 5ERXA 3RUHA 2BUBA 2NVUA 2BRUC 2R5NA 3I3OA 4WXYB 2Y67A 3KPWA 3V7NA 2OK7A 1M8GA 3H3JA 1N92A 1X2EA 1ZK3A 1JQ5A 2H65A 1J2JA 2CHQA 3V8EA 1EVZA 2OYRA 3FFAA 5CB4F 4RIEA 4TSRA 5AHRA 4RLQA 4OXQA 1FVHA 4CIBA 4QOIA 4FJ2A 3IQEA 4EH1A 4KIGA 3ZHTA 1E2EA 3OPYA 3OX4A 3ZVNA 3HUUA 1ZJ6A 4FGJA 4B3BA 1CETA 4YHBA 1C4OA 2YW9A 2QG4A 2QLNA 4GPTA 3OPQA 3SI7A 1HDZA 3PK0A 4ER3A 2OQ2A 4MK4A 3TBFA 2O2JA 2VDQB 1PZHA 4MRMB 4KGDA 1TQ6A 1ZHFA 5SY4A 3T8YA 2QLTA 2YZMA 3CX4A 5BR7A 1W5BA 1ZXBA 4QU0A 5FADA 3FNFA 4IJUA 3VBCA 3VZSA 5EEHA 3AR5A 3BMNA 2X5OA 4UBMA 4DPLA 4C30A 5IDXA 5CDFE 4AG5A 2HPZA 4RK1A 3R5XA 5E95A 2IWHA 1A2KC 4S04A 2P4UA 1MA3A 1EA7A 2MTBA 4YXWA 4CF4A 4WEOA 2Q21A 3KR2A 1GRRA 2AFHA 4TMTA 1A9QA 1H2RS 3GLHA 2B5OA 4BUZA 1FP4B 3VPDA 1HX7A 2WVAA 2W2KA 3KXPA 5LNK6 5B3LA 1Y8ZA 1LPNA 4D1YA 1J42A 3DL7A 1E3WA 1GUFA 4KBFA 4KXQA 2K2QB 2R1TB 3E81A 1XR3A 3LGXA 3ENQA 1RM3A 1AHIA 2NV6A 3ETCA 4JCOA 2XXBA 3RJZA 1JXOA 1X1AA 1DJPA 2RKWA 2WHPA 4G0YA 3JD1A 4PO9A 4Y1GA 5ITWA 5AI5A 2BCGY 2V7QD 2PRIA 4HXYA 5CLHA 4ZAZA 4IHQA 2V4MA 2ZYUX 2JCYA 4W5HA 1Q3TA 4QBFA 5BN5A 3GRUA 1JR3D 3HU5A 3VHLB 3KKQA 4B4DA 3NHWA 1M2VB 1U0TA 3ABRB 2QTCA 4KDRA 1LTHR 1ISGA 2W4IA 4L0DA 1NVBA 2IZ7A 3HJCA 3NTUA 4S12A 5DN9A 3ABIA 5IHPA 1PFWA 3MOGA 4IHJF 5H3LA 1TJYA 2CJWB 2VNAA 4EJ6A 5IVDA 1VDZA 3QPVA 4C2AA 5HUQA 3K0KA 1BROA 5JPIA 1EDOA 4TVOA 5IDQA 1W59A 2BMJA 1U9IC 1Q44A 1T35A 3V6MA 5JASA 1S5PA 1AKRA 2ZJ2A 5EXDA 1J56A 1U7DA 2BPOA 3K9FC 3C5VA 4MP6A 2X14A 1HNZB 3R3YA 2CNKA 1CNFA 1AURA 1MJFA 1QQ6A 5BQ3A 1FFAA 1H5QA 2FWMX 3EGOA 4KQ9A 1A9YA 4HMQA 4Y2UA 3RVSA 1WSBA 3VSAA 3OFKA 4GH5A 1RJ9A 3HFRA 4RK0A 1NFRA 1X7GA 3MOIA 4U3JB 3GMDA 4HQNA 1Q1AA 5A6SB 1FMJA 3O2QB 2DUUA 4JB3A 521PA 4MKIA 3B1FA 4F3CA 1GSAA 5FL7A 4MQFB 1RJWA 5DP1A 1I13A 5B3KA 1WV1A 3KEOA 4U6QA 5KCMA 3ZCSA 2I54A 4AKHA 1PUJA 4G0NA 4Q9IA 3OEHA 4I6JA 3FMVA 3SS9X 5TE9A 1BW9A 4B2PA 4XB2A 2ZXFA 5DASA 3A6ZA 3ESQA 4J0EA 4G1MB 3DG9A 1MV8A 2AOVA 4H0FA 1VIYA 3UB3A 1F0YA 2HEIA 4LV6A 3M9WA 3FVWA 2OXCA 5LKAA 4MDHA 4MW1A 4FFLA 2PGOA 1F9EA 4KU4A 2P77A 3I8OA 3CWQA 4GXRA 4LDQA 1QPGA 2CHUA 3I2IA 5I9BA 4TYYA 5KYUA 3W5IA 2ROQA 2PZMA 1TJNA 3FTCA 1ANKA 3D1JA 4IX1A 2Q9BA 4HRXA 4RZ3A 3BTUA 4IXDA 1PF7E 5A3SA 1HC7A 1E2DA 4JBIA 4JUCA 2FW9A 5EWLB 1G21A 1NURA 5IPFA 4X8HA 1J8DA 3AOEA 4ODIA 5L3ZA 4ZQBA 2ADFA 1B2RA 3K20A 5F1PA 3WLIA 2FN7A 4YV7A 1QWOA 2BHRA 5LCXA 1GCOA 1Y3AA 2BGLA 2DPHA 1W5SA 2Z08A 4CIYA 2WFZA 1YDGA 4LXHA 1FRQA 2QZSA 3MUEA 2N42A 4JIMA 2EX1A 3VYSB 1E4EA 2AN3A 1DXQA 1MHPA 3G8DA 3HEMA 3MMSA 3PNOA 4KREA 2RD2A 4D92A 3VDXA 1DIRA 3PRKE 1FE8A 4JHLA 2VIIA 3JAKB 1C7RA 1DQZA 4I2NA 3S55A 3RYIB 1XYYA 5K3FB 3VYVA 3Q7QA 3DMYA 1GAQA 3NIGB 4FZ5A 4OU5A 4BMNA 5LDGA 1SUPA 2XJ9A 2HFKA 4FFBB 1WHSA 2FW0A 2IEZA 1OXTA 1NI4B 5B2EA 1J39A 1NZFA 1QHGA 2QTMA 3NHJA 4MA5A 1C0EA 2QD5A 4TTVA 2H1CA 3AJ8A 1ID1A 4X1IB 1S8NA 3HJNA 3RRJA 4MIKA 1Z0DA 2VWPA 1C2YA 4M3NA 4HWOA 1OZHA 1U4SA 1YSCA 3WYDA 3QV1A 4JN6B 3KB8A 1I5OA 3KSZO 3NCTA 4JYCA 3S2IA 3CUTA 3VNRA 3TVDA 4E1VA 1YI1A 2HF7A 1CB0A 4D80A 1BXRB 2IHJA 3L49A 2HYDA 3ONFA 2VF5X 4QTTB 3MMPA 1L4FA 3B8EA 2V7XA 4YJ3A 5LXTA 1JLLB 4RX1A 3C7AA 2W6OA 4OBXA 4XCVA 2B4KA 2H5EA 2YQ5A 3OKCA 1RHKA 2DR0A 4L22A 3UK2A 5BN3A 1N5MA 2IT1A 1NQVA 4H4DA 2BEWA 3TFOA 5J2UA 4LOKA 4PAMA 4R2JA 1KK0A 2E55A 1Q6YA 2G4CA 2SCUA 1BGXT 4IV8A 2BTQB 2Z8YA 2P8JA 1JV2B 3EEFA 4XYMA 5MFPA 1TFRA 5KOHA 1CEYA 1CULC 1D0VA 4LC9A 1W0CA 3HR4A 3PVZA 3CUUA 1JPJA 1WMAA 1WKBA 5FWYB 4BEJA 3PX3A 4JP3A 1FDUA 1WULS 3SJCA 1RTTA 2D1FA 4ND8B 1G3IA 4QHTA 4JIGA 1JJ7A 3PPWA 3SICE 3OJOA 1GTVA 3ZWAA 4Z1OA 2CDAA 3KYDA 3N0TA 1E60A 4TGLA 1EZZA 1RLUA 1R4ZA 3IBFA 4UUOA 2B4TO 2WD8A 3VR5H 3CR3C 2V74B 4IOKA 4DSOA 2DVMA 3PE3A 1A2BA 2B5WA 2BGMA 2D1YA 1G38A 1EUDB 1KFCB 3QKRB 3R7DA 3LOPA 2YOFA 1TJPB 1UWKA 1BE8A 2DWUA 1LUAA 3LHSA 3WRXC 2OORC 3NHLA 1INLA 2ZEJA 4EUEA 3O74A 2NO6A 2XUHA 1LDBA 3OZCA 5DFAA 4YJGB 5LA6A 5ICGA 4M6WA 4FDTA 2ZRGA 5ESXA 3INRA 1J49A 1WUTA 1MQSA 4L5JA 2GK7A 1RYHA 4G8JA 1XALA 1MO2A 1YB2A 4L74A 4AZTA 1QG2A 1Y98A 1G8GA 2HWUA 3OJXA 2WB2A 5DNUA 2DTEA 5TMBA 5CFMA 2HCBA 4PRYA 2D5AA 3CUYA 4NYIR 4NDAA 1SC3A 3GX1A 4IAOA 4J3FA 2B9EA 1QQ7A 2JNWA 4LF4B 4L4UA 1SR8A 3FVTA 3OVMA 3W2GA 1Y7PA 4ZFNA 3UK7A 4AJEA 2OZPA 2VR1A 4FKBA 5TSDA 2CGEA 4Q1BA 2BR3A 1V8PA 3DBOB 3O8NA 4MB0A 3QPCA 4QJBA 1EWVA 4R2KA 1I24A 4JB0A 3PQCA 2BDUA 1N8KA 3MM4A 5HKAA 3MTBA 4WUTA 2A6PA 2AHOA 4MMZB 4GGPA 3RC2A 3VPAA 2V7EA 5KYYA 3CCFA 4P3YA 1KHHA 4BVFA 3LLVA 2HJ9A 5G0VA 3FZGA 2X0JA 3L9WA 1UBUS 2D54A 3IPAA 4NI5A 3A58B 4OPMA 3S1AB 1OSNA 1GILA 3M49A 5TPWA 2HRCA 4W7IA 1P7YA 5CURA 1U2GC 3BK7A 3CG0A 3IUBA 4EOGA 2NTVA 3QEMB 3QSYA 1G64A 3A27A 1FP6A 5H02A 3TW0A 1G5TA 3ZE2B 1LBIA 3BXGA 2I6XA 1OW3B 5K05A 2CW5A 2AMJA 2FK7A 3OIFA 3HABA 4JL5A 2PT9A 1R9NA 1FU8A 2FSFA 3KYIB 5HILA 4BEBA 4XLLA 5JZBA 2VQ3A 4G5GA 4LE1A 4DWJA 2OLJA 1A96A 2UVPA 3TW4A 2G5GX 3B7WA 4F1WA 3L0IB 2NYVA 2RB5A 2QGFA 2NZUG 1NOKA 2QYSA 3MPOA 4P98A 4AROA 5BY2A 2P6PA 4HGPA 2IYEA 4E94A 1LJ8A 5EJAA 1BXGA 2HCRA 3P2OA 1GRQA 1MVLA 4Q15A 3ESYA 3UATA 2Y05A 1XZFA 4M8IA 3IALA 1HLFA 2OE2A 3E9CA 4HNAB 1L7XA 4ZOBA 5JAOA 1OX5A 1R4MA 4JNKA 2GRAA 5K3CA 1H42A 3BTVA 1UJCA 1KAQA 1ZK1A 2QE7D 3D4NA 4KLAA 4PYLA 2HCTA 2IXTA 5J4VA 2Y4OA 1VYHA 3GA0A 3HP1A 3ZU6A 1AH2A 1ZIDA 1GA1A 1G8KA 2AR9A 4WHMA 3KZOA 1H4VB 4Q3BA 4PQRA 4AP5A 2AG0A 4DDKA 5LP6B 3AGQA 1TQ2A 1ID8A 1JHYA 5JO9A 4QGBA 3D9QX 4D4MA 2QQ0A 1ZOLA 2A9OA 3A6LA 3E22A 1H2HA 1LTKA 2J3LA 1G3UA 5L6LB 5CU7A 4UMDA 3AG5A 4I4CA 1GCGA 1QVVA 2WDPA 3FTNA 1NKVA 4MV7A 5FYDA 3THWA 2D5IA 3UWDA 4DGQA 5ALYA 1BDIA 1OFUX 1ZL0A 3OE5A 1WQ3A 4W5WA 2V3WA 4DPMA 1IQPA 3BRQA 3GGDA 1H4QA 3P2MA 3R3UA 1LSOA 1ORTA 1NATA 5AXBA 2Z2YA 3FF4A 6NULA 2AOTA 1RLOA 3EUAA 4C0KA 3IOEA 4C0HA 1XTPA 3G7NA 2H7XA 4OJNA 3SZUA 1EX7A 1AN9A 3W3AH 4BCDA 5BVGA 1J70A 3JASB 4JD5A 3PU6A 1T5OA 2JGFA 2WHRA 4MR8B 4CL3A 2FZ4A 5HIJA 4GMDA 3MG9A 1EGHA 2IXBA 3DW1X 2Q9CA 2YJ4A 3NR2A 3P9KA 5ILQA 2AG1A 4C5CA 3LC7O 4HNUA 3CBGA 4B6GA 1SXIA 2YY6A 2Q8PA 3RVRA 3H8SA 3D0QA 2BF4A 2BKLA 1RNLA 4LFAB 1DRWA 4XEHA 1XN4A 2XAAA 2BP7A 3D6FA 3GA5A 3K0AA 4JL8A 3DC2A 3PTZA 1Z8FA 4EKNB 3BF7A 4C01A 1ODKA 3CT6A 4YDHB 2Z2JA 2PX8A 2VATA 3N75A 3DCYA 2QVLA 4GZLA 2ST1A 3MMZA 1ORWA 4O1IA 5ALSA 4BKUA 1F8FA 1UZMA 2WWYA 2UU9B 3ZX4A 3RYCA 3QWFA 2J0UA 4GIBA 3KZXA 3NHBA 3LQKA 3UNXA 2J5QA 3DVAB 3UIEA 2H4XA 3KB1A 4P1ZA 1KQNA 4RWZA 1QV9A 2F6RA 1CYEA 4CI9A 1QF9A 4ZQHA 2VNHA 5IBQA 2WTUA 3QVOA 5D6NA 1YQUA 3URKA 1NP7A 3HYLA 4EKDA 2I4TA 3DL0A 3IEIA 3H11B 1V7ZA 5JRZA 3D3JA 4ZMRA 1RCUA 2CDBA 2G88A 4LYFA 1JBKA 1PQYA 5GTDA 3T7DA 4IM7A 1R6BX 4MUHA 1B16A 1F8YA 1HY3A 5I7UA 3NWBA 5BT8A 1NY6A 3EVCA 1DKOA 2ISSD 5JH7B 1L5FA 4M22A 1KI6A 3L1JA 2BZ0A 1QZTA 4CZ2A 4GQBA 3Q87B 3FNIA 3IDQA 1CQXA 1ZDMA 3N0RA 4EUNA 3CEMA 1AKYA 2VA9A 3I9V1 3RTCA 2YC4C 2GH1A 1JAHA 3ROZA 4AK9A 5C31A 1L3BA 2ZTMA 4EF6A 3GLGA 1WV0A 2C2HA 3O9VA 4YALA 4RW0A 1UDWA 1YU6A 3VVLA 2XHZA 5HRUA 1MJNA 4GX5A 1FTGA 3L1HA 1YKSA 2RHMA 2ZB3A 2O20A 2ZUWA 4FFWA 1Z88A 3L9XA 4QDJA 5G02A 1Z6TA 1R00A 2HMAA 3P0HA 4R1SA 5C5DA 4JKYA 5CD1A 1K89A 4F45A 4HMPA 1VLHA 4F71A 2H2WA 4ENPA 3RFFA 2GYYA 3KTFA 5CJPA 3EF0A 3QBJA 3TGWA 1LPMA 3ABQB 5T4BA 2H4ZA 2J45A 3AL2A 1REQA 3U4CA 3F4KA 1ACLA 5KTNA 2P90A 3DVQX 1PTKA 3TQSA 4CU2A 2O54A 1M1NB 1TGVA 1HG1A 1P4GA 3NLLA 5IAJA 2PVSA 4X3PA 2H1OA 2FDCA 1FRFS 3A1SA 1BQ3A 3QLVC 3IEKA 5K8VA 1KJ8A 4RVCA 5ICFA 1EFVB 1OYOA 2AH5A 1GHTA 1RKQA 1UQTA 3GCZA 4LJ8A 5EJ8A 1X1QA 2ZUCA 1CU1A 3B3JA 2BLLA 3IQFA 5EA2A 1JDJA 2ZJ8A 1JI0A 1MOZA 1UCFA 2HU7A 3HG7A 4BQPA 1NPYA 1H8HD 1J2EA 2C9OA 1RHMA 1P7PA 3G2NA 1JUDA 3DOIA 3VHXA 2FSGA 1RYEA 1TT5A 4MRNA 3RRMA 4ASUA 5JZOA 4R4JA 1ZMTA 4GX0A 2M1XA 4BRUA 3VR5A 2HJGA 1ZNYA 3SBXA 2GFIA 2ZS8A 2AW3A 1BDMA 4RPKA 3JZDA 3RHFA 3GDGA 2V9PA 4YVFA 1WW2A 3LZ6A 1S3SA 1T2EA 1U81A 1XZPA 2ZAIA 4RA9A 5FYQA 3RIEA 2FDRA 5EOVA 4PIMA 2C4VA 1F5NA 2ONCA 4LE2A 4FCCA 4U63A 4RTSA 4XVUA 4QUBA 2DF8A 1UP7A 2FSVC 2OK8A 1TM5E 3I9V6 1LA2A 3U4QB 1DRKA 3EOBI 1E7YA 2JFHA 2AEFA 4KITB 4Z0HO 3TTXA 4HFNA 5CG2A 2HR1A 3JVVA 3C2QA 2PT7A 3EXFB 4LY3A 3F5DA 3FDIA 1QUEA 1KORA 2R8XA 3QUCA 3TQQA 4DIKA 2WQZA 1WL8A 5HQJA 4HVLA 2Y9PB 3UJHA 4CF7A 2BFFB 3EVBA 3FSEA 3K9GA 4NS1A 1D6SA 1VI6A 4X24A 2PX0A 5A4DA 4P0PB 2QN2A 1Y8QA 2B3TA 4V2IA 3PGJA 1KF0A 4CW7A 1SVIA 3I04M 4CM8A 2R85A 3MVEA 5HWSA 3PXEA 2DU8A 3WIOA 2E3JA 2ZRCA 1Y34E 2DFPA 3B5EA 2RH5A 1R6UA 3TLCA 1TPYA 2PJDA 3LHDA 1WA5A 2EGGA 3P27A 4LOLA 5T4FA 2WJYA 1XEFA 1VECA 1PYDA 1RWVA 3QU5A 2RBEA 5DO9A 1CUIA 4Q1VA 4PLPA 4TTAA 2OESA 3WRWA 2UYCA 3V42A 1XZKA 3F4LA 4LOIA 1RBYA 2WZCA 1EP1B 4Q3AA 3EDRA 4RV9A 3N6VA 1X6VA 3RVLA 3R3SA 3UAGA 1FSFA 3QPBA 3KQUA 3Q9UA 2AFIE 3OBIA 1N6NA 3M5DA 3I6YA 4K1XA 5HF6A 2J67A 2WG0A 4PQEA 1LZLA 1KNQA 1N3BA 4KO3S 5KX5A 1H2EA 3BGOS 3D5EA 5EESA 3X0DA 3OZXA 5TGZA 2OV6A 3Q5EA 1IC6A 4YI3A 4KVFA 4GS5A 2OZLA 4Q9KA 4EM6A 4D57A 2IHNA 2EATA 1N5RA 3AUUA 1CC1S 4E2FA 3EPPA 3FDXA 4BVGA 4D5EA 2AZXA 1GPJA 3M70A 4QYXA 1M72A 2HHJA 4DV2B 5IBRA 1JNXX 1U2SA 2J09A 2QMHA 3ENVA 1R0CA 3QU4A 4M2LA 1K27A 4OA8A 5FUYA 3HI4A 2DR2A 4GGMX 2NO5A 3HDVA 3DBLB 3KCNA 5AKHA 1YA6A 3TX6A 2WKSA 1P6UA 3P5SA 5LP6F 1JAZA 1XG5A 1NKTA 3VR0A 4UVIA 2O8DA 3H5IA 4G4SO 5F2OA 3T7JA 2DR3A 1HA3A 3CF4G 3EXEA 4CDGA 2Q5FA 3MGAA 3T5DA 1WZ2A 1L3IA 3V9PA 3LL4A 4DG5A 1KYIA 3KXLA 3VNUA 2AI1A 2NUPB 5F3DA 4IS3A 4AC9A 2I2BA 4QLBA 3E2PA 5ED4A 1F2TB 1QB7A 3W7VA 3FI9A 1FW8A 1IN6A 1AZSC 4MUNA 1LJLA 2W98A 1BC5A 4JITA 4BBPA 4X92A 4LVCA 2EU8A 5MF6A 4YMUA 5AM2A 1IUPA 3G8YA 2AX3A 1MQ8B 4DJFC 2NO9A 4IDOA 1WS6A 3NB0A 3U81A 1CJKC 3FPCA 1IXSB 1W1UA 3IXMA 5JXHA 1IM2A 3K9QO 4YDRA 3E6AA 4RZSA 3CTPA 1YS7A 5FUBA 1LPAB 2FSSA 3IC5A 1SCUB 3HO8A 3PFCA 1CQZA 2QRGA 4KAFA 1YQWA 2JI8A 4IMRA 2XA2A 1XWWA 2FHSA 4UEQA 5ARDA 3HO1A 5EIFA 2IOYA 4EJSB 3P0FA 2E4UA 1KJYA 2HTFA 3A2LA 2ONJA 3RRFA 5CLQA 4PQYA 5BMVB 3K2QA 4ZI7B 3CRNA 4Q03A 4Y2XA 1CVLA 2VZ0A 4RVGA 2PXXA 3KKOA 4EGCB 1VJCA 4TTTS 5EJ7A 3EDCA 3ZNQA 3PFKA 3KTAB 1D09A 3IAM1 3OPNA 4QARA 4QBTA 4DLLA 1FJXA 4LK3A 1PEDA 2X8LA 2YS7A 4JK3A 1NVFA 3DGFC 4ME6A 3C7CB 4Z53A 1QFSA 4INJA 2JA1A 5T4EA 2PLWA 4M76B 2Q9UA 1AKWA 4LHYA 1ZP6A 4Z9AA 5BW8A 2P2GA 1WB5A 3LT5A 4XVHA 3TNLA 3S6JA 1ZUD1 1QJ4A 1OXXK 3IQZA 1RQ7A 1P29A 4O2LA 1E3DA 4MKZA 4OY3A 4YRJA 3AVXA 2RH9B 3B1XA 4WESA 1FSPA 1WQ1R 3L05A 5BUZA 4Q4DA 5AJHA 3EZ9A 2IWRA 5FPTA 1LWOA 2HDWA 2ZXEA 3LSYA 3P52A 4J2HA 5JH7F 5L7WA 2FN8A 2WLTA 3NT5A 3QVGA 3HA2A 1VPTA 2PEYA 3A6FA 3KYCB 3UB4A 3HB0A 2AMVA 1FFWA 3O5AA 3SR3A 1P1RA 2VWGA 3FD8A 1V11A 3KVOA 3P4YA 3EMVA 1L5HA 5A9RA 4CQMB 2QIPA 3DDCA 3I1JA 3KQQA 3H86A 2BIFA 1E0AA 4KN8A 3EB9A 4DNQA 2IEYA 4CKWA 3EGXA 4JLUA 2FETA 3BMOB 1LK0A 3KLNA 5JSQA 2BM8A 1GGEA 1FFGA 2EVWX 4GLLA 1ZJWA 2VYVA 1ZVQA 2HRQA 5BSHA 3W06A 2ACWA 2AR7A 5IN5A 4Q24A 1NRJB 2KS6A 4L3WA 1KWKA 4CEJB 5JYDA 3TYXA 2YV3A 2ONKA 3QU2A 4G26A 2DM6A 4MUEA 4BO6A 2WFLB 5KJCA 2R9VA 1RRFA 4PGAA 4KXLA 1NA5A 1IE3A 3IAM6 5CW1A 5TQJA 1SCAA 3NTQA 2GXAA 3D3EA 5AVVA 1CUBA 1T5DX 2OHFA 4Q3EA 3CA8A 5I9SA 3SD7A 1VKHA 1XD9A 3TK1A 4YRBA 2FFHA 4X1OA 3UFBA 4JASB 1JZSA 1L0BA 1YVUA 3L7JA 3TLXA 8ATCA 4EKYA 5DZSA 4YX9A 1MFZA 3A1CA 2PXAA 1HWYA 3EFHA 1CK4A 4ZC1A 3RU2A 1I32A 2EEZA 2FCRA 4RMNA 5AJWA 5H59A 3I6QA 3EGEA 1A4RA 3NFRA 2BKUA 3KWLA 3M6WA 3ZY2A 2QRZA 1SXGA 1X13A 3EXHA 4GP6A 4P4UA 4TYPA 2RHGB 3AFIA 4UBJA 5HQTA 3UQZA 1MEOA 4P3OA 1QH0A 4FLMA 2HA0A 5CM9C 3AY0A 1V8ZA 2PSHA 4E13A 5ICSA 3RYHB 4EG5A 2C9MA 1RYNA 4I9HA 2WIJA 3FTFA 2G80A 4LXGA 4DCUA 4R69A 2M2IA 3LC2O 3T9FA 3DV0B 2QGZA 1IK4A 2V6BA 1X80A 4D4GA 3ITDA 3AI3A 1JIVA 3QKTA 4QYWA 1PVVA 1DBSA 1KETA 1RAIA 2VHXA 3MGKA 2YY7A 2E4YA 4M7WA 3VFDA 1JR3E 3OM9A 4IUDS 1A77A 4MVYA 4WOJA 4YP6A 3SJUA 4YCMA 5FD8A 1JDBB 1YXMA 3QTTA 4CE6A 2XNDD 2ZDGA 1TLFA 2J7KA 2RH8A 1ISJA 1ENOA 3OC6A 4OJQA 5B37A 2OXEA 1I6LA 5CIQA 4DMFA 5AVWA 3A37A 4M1YA 5BSRA 3T1HB 4KPYA 3PPVA 4UUAA 4WXEA 3SHWA 5G4KB 4FSDA 4YMLA 3WLNA 2VDWA 3NGXA 3OX2A 2AWOA 4RJKA 1HLGA 3DL2A 1JMYA 1WX1A 3K09A 3AEUB 4ZREA 5JAMA 3G02A 3EK2A 5HTOA 3CZPA 4PVCA 4D9HA 1N3IA 3FUXA 3P2IA 3VSEA 2ATXA 221PA 2WFMA 1CUGA 3KB6A 4NBWA 4X20A 1Z4IA 5G1NA 4TM7A 3K92A 3MWJA 1IBLB 3IV6A 1IRXA 1LWNA 4KDEA 3BHNA 4CCWA 4BZQA 2OGWA 2WUEA 3D7SA 1M6VB 4YREA 5K0LA 4B47A 1ZSYA 2IUEA 2HV8A 3COWA 4ML3A 2RJOA 4RHEA 4X3CA 4YJFB 2HJHA 1IH8A 4U8GA 1HE8B 5HIKA 1E20A 2PM8A 1PO7A 3F49S 1IULA 2RIPA 3H13A 3N86A 2R00A 1QQTA 2I55A 1WE2A 3KQMA 4DQ0A 2I3AA 3DDHA 1N6LA 4X6LA 4OQ4A 1VZ2A 2GPNA 3AKCA 3E4DA 3JY6A 3KELA 3TOZA 2ZB4A 3VRHA 5B6JA 3MRTA 3ZDXB 5AW8A 4BVKA 2XUQA 2Z6VA 1ODIA 5C34B 4DJEC 3LCJA 3UK1A 4C0JA 3T3GA 3ZX5A 4B7UA 2GN9A 2WA2A 2NU8B 3LWBA 2VQFB 1W94A 1DAKA 1QWSA 4X7RA 1Y1QA 2G4LA 2Q5OA 4D4HA 3AL0C 3P9RA 3UJCA 4DG8A 2B78A 1VKZA 2ZJ0A 3FAZA 2I4NA 1SCDA 2PXHA 1R0KA 2WP8J 3NEAA 4NZPA 3IBGA 3UJ8A 3W6UA 5HZHA 2V5AA 3IIEA 4WGFA 4DLZA 3PHLA 1WBDA 3BFJA 1I1HA 4Z4EA 4MJLA 2CNLA 4PNZA 2JFWA 2OGZA 1P3DA 3R1IA 4TS3A 1XLWA 4Z9FA 3WB0A 1Y5IA 4KOEC 2EKDA 3NAGA 1VRWA 4I3HA 4QPZA 1GU7A 1U0HC 3TOVA 2Y1WA 4W1QA 1GITA 4M38A 3VMFA 3DOCA 2W4QA 1NTRA 4DMMA 3ED1A 1QMGA 2ZVJA 4FX2A 4KIUA 3OT1B 7YASA 2NN3C 3B3QA 4BC0A 4YV2A 1XJWA 2QSYA 1ABBA 2XE4A 1VHTA 1WXIA 3H9UA 2OL4A 3NBYC 1OBOA 4NKRA 3V7FA 3VU9B 2RK4A 2QTHA 3JQ8B 4AS2A 3EWAA 2WQ6A 3CRW1 5F3RA 2EP8A 5DIFA 4BV9A 1HZJA 3ZZTA 4YV1A 1OV6A 3NGLA 3LQ2A 4YRSA 1M9NA 2FLWA 3I64A 3SZRA 2ZI5A 5KJ1A 1AMOA 3TGLA 1KFKB 2QUKA 3WGJA 3HXOA 2GEBA 1RKUA 2VJNA 3F6BX 2NNWB 3LC0A 1QFYA 4FX5A 1DDIA 3HBNA 1XQVA 3G49A 1VLLA 4UUQA 1K5GA 3DWFA 4HWGA 3UAOA 4B48A 5BMVF 2OD2A 3DTVB 4NOLA 2EWMA 4BLWA 4O4IB 4ZI7F 1Q0UA 1YQQA 2GEKA 2HLNA 3JZIA 3GH3A 2YHIB 2BI8A 3PQ6A 2ZG6A 5EFOA 3BERA 4LMBA 3EZYA 4KBYA 1BQEA 2WAXA 1G2QA 2HSEA 4CKZA 3IQDB 4C6SA 3M4NA 1U0EA 4LCEA 4OQDA 3ICQB 3IIJA 2QX7A 3IODA 1NXWA 3KR0A 2IW1A 1V8FA 3GLKA 1O5TA 1SB8A 1FPQA 1AA9A 5IEBA 3BK1A 4AICA 2Q7XA 4CMCA 4CLDA 4DNFA 1E8MA 4D0NA 2FW1A 3WGYA 5G41A 4DC0A 3PNLA 5GP1A 2YMLA 5HFAA 3P9QA 1RXCA 2Y1LA 1A50B 1XFDA 2M6RA 2QTVA 2XMDA 2ZIXB 2P69A 3FI0A 3L0DA 5GGXA 2B1IA 3VNQA 5LZ4A 3IUEA 3LECA 3B8HA 1Z08A 2GF9A 2IEAA 1ZZGA 2WWFA 3GD7A 1UMDA 4CJXA 1ECCA 1Z0AA 3I39X 3PQ3A 4L7QA 2JJ1D 2VHUA 4PSDA 2E85A 2FW7A 5BRJA 1I8TA 2FPXA 1CUSA 1M2FA 3D43A 2XTJA 1Q1GA 1BQ4A 1RWNA 1UAGA 2OR3A 1IZZA 1E77A 1RPTA 3CRQA 3N7TA 3VZQA 1TCCA 2HO5A 4JLBA 1JDPA 3UT0A 5LN1A 5IK2A 2NSJA 1SD2A 3U37A 4LRYA 1XL1A 3LDFA 4Q05A 4G1BA 1SHUX 2C8JA 2C3OA 5B7NA 4IH9A 2BTEA 3LKDA 3BPSA 4HB3A 4FS3A 1OZFA 1CUDA 2QAIA 3ZN2A 1NP6A 3BICA 1LX6A 2VN8A 3WYEA 2R84A 1YK1A 1I0LA 3SXUB 3MTAA 1SG6A 4BLSA 3NT2A 4II3A 3Q8MA 3TQHA 4YNBA 4KX3A 1P62B 3OOWA 3SPXA 1KXJA 4GKKB 3NMUF 2IDZA 3W78A 2WSYB 5HCNA 2Q2WA 2GVZC 4XFKA 1UMBA 2X3FA 3NBKA 4IDPA 1FNBA 2G09A 4GX2A 1L1RA 3MQ2A 4NP6A 1WP4A 4FW8A 2AJ8A 1MX3A 3JZFA 2JHPA 2Q1SA 3KVRA 2I71A 4QDOA 4EG0A 5B3JA 1A82A 3MRSA 5IXSA 2GCGA 3AFGA 2VP6A 1QH8A 5AH0A 4H7HA 4BQIA 5T4HA 1P3JA 4LHZA 4D7AA 5B57C 4KYUA 4YLEA 1N5DA 4ARCA 1SIWA 4TMKA 5HIMA 4NHOA 1XCOA 1P17A 3SYTA 1KY3A 3U1BA 3NBZC 4S24A 1OI4A 1L6IA 3SSNA 3R8FA 1N2GA 3PA8A 4ZXFA 5BURA 2XRZA 3ZW8A 4JWKA 1GSHA 2RGGA 4NX2A 2QN9A 2Q3MA 4FR0A 2X23A 4KE6A 2JEZA 4ZVUA 1RSZA 4LKRA 4OGLA 5ALVA 3WC4A 2ZULA 1Z0IA 4C4AA 3ZJ5A 1KAMA 3WLKX 4C0BA 5I9MA 1EFLA 1X42A 1N2XA 1QV7A 3HQ4O 2VK1A 2YHAA 3SQNA 1Q2XA 1V1RA 3PGKA 4JUBA 4AY3A 4LWPA 2GOYA 2Z9BA 1MDFA 2YXEA 3WGTA 1PV4A 3DAFA 1AXEA 2CJWA 3HZOA 1QO7A 4KLZA 1ZOIA 2WZDA 4PE5B 4CGYA 4A0GA 1USIA 1KY2A 2Y9MB 1CG6A 1ZA1A 2BVNA 5CFOA 2BJWA 3D2LA 2X0EA 2KBEA 2YQZA 3DAGA 4LF8B 5FA5A 3UK0A 4CIAA 3KHUA 3OHSX 5DTJA 1FX0A 1SCJA 4F3RA 3CXUA 4H27A 1BWSA 1DC4A 1N5KA 5FB3A 3HUTA 1DKRA 1DWUA 3EA0A 1XVTA 4INAA 3FPEA 3QY9A 2FUG6 1CYDA 4IV0A 1NN5A 2PYZA 2XDQA 2XGMA 3L8YA 5DCWA 2H0QA 2IYLD 3BTSA 3IP8A 3CLRC 1V26A 4OJKA 2VBIA 1NR1A 2AVNA 2II6A 4EYEA 4EKEA 1CF4A 1BE0A 3M6MD 3NC4A 3U26A 4LJAA 2DAPA 1DTEA 2HQBA 3BMQA 1TXGA 3CU5A 3WYGA 4BNMA 1I4WA 1P9LA 4MLCA 4JBYA 1PEYA 1T8PA 1RXIA 2OCXA 4HDNA 2ECOA 5COAA 1SCQA 1KYQA 1ZPDA 4BVLA 4K6KA 4CWAA 1GKLA 2XUOA 3GFOA 4G01B 1CZNA 2DPGA 2R6JA 2FMFA 5EIHA 2VJQA 2WAMA 3T06B 3AYXB 1FW6A 5ULLA 3CNNA 4JI6B 5JJ5A 4K6HA 4OV6B 2ZTHA 1HOXA 3JQEA 1PTJA 4QBGB 5EXPA 3ZWWA 4EG6A 3G8AA 4L75A 1L7RA 3GFQA 3TMAA 4DQVA 3H83A 1Y9AA 2A9QA 4JJ8A 3OIUA 4NDZA 4P36A 1XUOA 4XSVA 5LBUA 5IS2A 2C7QA 3VBEA 2GGSA 2ZSIA 2HTEA 5HNKA 4C6RA 1TDJA 1UK7A 2HUNA 3NIBA 4H17A 5M04A 4BNGA 1C9DB 1G7SA 1AQLA 4L51A 4GOND 5CEFA 2WTXA 1Q0RA 2C29D 4J0FA 3KIPA 1A4UA 2IXDA 2X9GA 2D5LA 4WJZA 4M1WA 1F2VA 2XHEA 4UM7A 2ZRLA 5LP6C 3N9IA 2BFMA 1N1DA 1WW8A 5J5AA 1I14A 1YQDA 2ZBQA 3ANTA 3NQ41 3QI2A 2PKQO 4JMPA 3JWIA 2GVDC 1D9XA 4AKTA 1U0BB 2WKWA 2FH5B 2BF7A 1G2OA 5JUWA 3B51X 3BORA 2NPOA 1JKXA 3OHPA 1QIDA 5CGZA 2QM0A 3SKYA 4CFYA 2GNPA 4EFNA 1KH1A 2Q5QA 3PKIA 4ER0A 1JN0A 3COJA 3KUUA 4CM4A 3E05A 5IKMA 2OV1A 3DNMA 4XX0B 1W49A 3WIUA 3D31A 4ZT4A 3L7MA 1H66A 5CT5A 4AW9A 1NW9B 1VXRA 3F1KA 3HHPA 1LV8A 4O4IF 2WJWA 5DNAA 3SOZA 1Q50A 3EZGA 3J80A 3MJVA 2PN1A 3H5RA 3QVMA 4P4SA 5EL0A 5I7AA 4AKGA 1KEZA 2WMNB 4F4FA 1QP4A 1LLDA 3ZC3A 3ZHYA 1JVBA 3PENA 5KBYA 4GR4A 2YRFA 3STVA 3A6DA 3T9EA 4AN4A 1EFKA 1OD6A 1WUKS 2HAEA 4LJ9A 1Q21A 4GLJA 4ZAFA 3JQBC 5KVAA 1T0IA 1UADA 3AFNA 1T3SA 3U6BA 4JJ6A 1X15A 4DR1B 3GRZA 4GPEA 1B0AA 4LN1A 3A9UA 4EY4A 1VMAA 2PUWA 3K5PA 4LGVA 4ND6A 3V4OA 4JJFA 5B6PA 5K0CA 3EH1A 2Z6UA 3UK6A 3F7OA 4X1YA 1H94A 1N2OA 3MWYW 4ZZ3A 5L4LA 3PJEA 5EMJA 1OYVA 5BOVA 1PR6A 2Q3DA 3EIOA 2PMKA 4IO0A 3WBJA 1Z4MA 5AVSA 4MRVA 1HYGA 2OBLA 4FIDA 1AHNA 4N7RA 4C7BA 3V8QA 5CLFA 2VXOA 2ID9A 1RAAA 5IZ4A 1D3AA 4AN0A 2O1SA 2H2GA 5CVUA 4IZOA 3TTWA 4KXVA 1E9VA 2QUHA 1Z4PX 3OD1A 3E7XA 1ULTA 4AWAA 5KYKA 4J2OA 4Y9DA 2KYRA 7AT1A 1QAMA 3HZZA 2ID7A 4MKXA 5JANA 3L41A 4ISCA 1I4DD 3IDSA 4QTUB 1BWQA 1PHPA 1K75A 3NNSA 4DLUA 1RZ3A 3HXMA 1K66A 4FC7A 1L5VA 4Q1DA 2ZJYA 3TS1A 3U1TA 7ADHA 1DCMA 4MGYR 3GRKA 5C4IA 1NQ5A 1T25A 1L7DA 3WR5A 4CG3A 2NZVG 3AINA 2JGAA 3LNTA 4KQEA 1X14A 3JRWA 1W73A 4XQ0A 2QRJA 3U3XA 1K8XB 1IDN1 1TM7E 1XZLA 2VRWA 2GUWA 1DP4A 2XCSB 3GHHA 1U8ZA 2SKCA 3HBFA 3N74A 5DKFA 3INYA 2IYAA 3CINA 1E2IA 3Q0EA 5KJ6A 3F4BA 3IUQA 4L76A 3STXA 3PUXA 4LQ4A 4M46A 4BVAA 5I3ZA 2ZB2A 2QD4A 1YONA 3ZYZA 4X65B 2H1FA 2WILA 4H35A 1BRMA 4OL0A 1XN1A 2VAVA 1XMJA 1SBTA 4OUDA 2XBLA 2YZKA 5GMOA 3GLSA 1PE0A 1Z2DA 3EEQA 1GXSA 5EI5A 2Z43A 2D7CA 1E2FA 1HL3A 1CX9B 2JEOA 4US0R 4AUEA 2DERA 4OHUA 3VC1A 3T7RA 4B82A 4A6PA 3AEQB 1O3YA 5JROA 3ON5A 4QWWA 3WAGA 1AG9A 2BFAA 2VRCD 4MS3A 5EE3A 1A2QA 2DB3A 1I7NA 3C1AA 2CYCA 4DRXA 4PXAA 1NPTO 1XDGA 5BWOA 4CKCB 2I8LA 2PZ8A 2ZJ1A 2XWQA 4MI6A 1GT91 1BFUA 4JB2A 1J09A 4D46A 1FQKA 1GT6A 2WMYA 5ESDA 1T1IA 2JBHA 2R4QA 4Q4AB 4M83A 4K9DA 4XJSA 1FTSA 1P4SA 3V3KA 4P35A 4CRWB 1AS3A 1AZLA 1VPWA 2COUA 2F67A 3H5LA 2A1UB 4J7AA 1CV2A 1Z16A 2XX3A 3HM2A 2P40A 1VMIA 2G77B 3UKOA 3K71B 3TG2A 4DV5B 4XDYA 5TIIA 1LVGA 2HF8A 2WPDA 4NEHB 1JG2A 4PGHA 3ZI4A 5DRYA 1K8ZB 1KI4A 2AK2A 3UBTA 4MVJE 4U7TB 5FNVB 3JQFA 3JQGB 3NGMA 2CZGA 3MTGA 1P2DA 4BV8A 1VPEA 2WNHA 5B2ZA 3OLZA 3KJFA 3E3NA 3JQDA 3OOHA 1RCFA 5JD6A 3L6BA 4II2A 1JHAA 2R96A 3MT0A 4OIMA 4R1OA 4ZRMA 4EQ6A 1DAEA 1ZC3A 2X4GA 1T5LA 3IESA 5AK4A 5CXUA 4DLSA 4DCVA 1KRWA 4EHKA 4WZ6A 1QO9A 2C0PA 4B71A 4C43A 3NTLA 3VDMA 2QLJA 3T9BA 3AM1A 3EUFA 4LJ6A 4HYEA 4DC9A 2AA3A 3H87A 3OJ0A 1YNSA 2C88A 2M6SA 3L40A 3QHPA 4CLRA 4UQLA 5IWAB 1T8YA 2XY4A 2LR0A 2B8JA 4UAVA 4EX7A 1TYZA 5AJZA 4INPA 4GMGA 2V45A 5TRTA 3ZHSA 3PQ4A 2Z8YM 2CLSA 4B4WA 1NT2A 1U5CA 4G84A 1MX5A 3G79A 1YR2A 1DG3A 3DFKA 3P71T 3DF7A 2ECFA 1V5WA 1XZAA 3KUKA 3Q6MA 1AK2A 1U2DA 2CNWA 3CKYA 4PAOA 4W63A 4J8PA 3GN1A 3TLYA 4TV8B 3IJRA 1YBFA 3QG1A 4EHHA 2J6BA 4URUR 4MS4A 1GTL1 4IG4A 3TRDA 5MHTA 1R0WA 4JLVA 4TLMB 5GV8A 2H11A 1M7HA 3NPAA 5HK8A 3KAQA 4YMGA 1DKPA 4HD8A 2OZVA 4M53A 5JAHA 2GEVA 2WSIA 2FVXA 3JYPA 3E61A 4ZVOA 1BTOA 1R15A 2EJTA 3R76A 1AZTA 4YAKA 3P2JA 1ENZA 2JFPA 4MV6A 3WHLA 5CB4B 5KO2A 1U63A 3MWKA 3USZA 2IA5A 4UPVA 1Q0PA 3IT1A 1C7IA 3BXFA 1SVMA 2GZ3A 4P3NA 3Q7EA 3UT6A 5IEJA 1Q0LA 3AIOA 3C3PA 3JS5A 3OQ6A 4Y6OA 4JC4A 4JGGA 3P0RA 4OQEA 4XM2A 4Z3DA 4LXIA 3TTSA 4Y7CA 5K8CA 2ORVA 2WA1A 1MIOA 3VC3A 3DA8A 1WBJB 2E21A 1K97A 2DBVO 4ZDIA 4P7FA 4TXNA 4QG3A 1LX7A 2X1LA 4V3CA 3OZ7A 5KMGA 1A0OA 1UBHS 1VYUA 1YCGA 4P2GA 5JJCA 1ZJYA 3B5JA 4IFBA 4X0EA 3EH2A 4HR7A 2JAUA 4HNTA 3FRHA 3E2IA 5BNIA 1Z4QA 2GTIA 1FXWA 1LRKA 1N9GB 5HF8A 3ML1A 3PYXA 3GO4A 3ZK9A 5EJGA 3QXJA 3V1LA 1NV9A 1Y9DA 2E89A 4MMYB 3NU1A 1WF6A 4PZZA 2V59A 4M1QA 3Q88A 1BJRE 3KT8A 5LQRA 5HZKA 4DF3A 1NVVQ 4YAGA 2QL7A 5AW7A 2QTGA 3GPBA 4OQMA 1TTQB 3CLKA 3KZCA 1LFAA 4UUBA 2OKGA 4GSYA 2WBLC 1W5FA 3CF6R 4MGKR 4NWIA 3WADA 4CQMD 1EUYA 1BEUB 4A0FA 4UEJA 5KTKA 1K4KA 1VC2A 2XVXA 3QF4B 2P6OA 3E53A 3VZRA 4E31A 4EJSC 3G85A 5AOVA 3I4FA 1HQDA 3GLVA 2CLLB 1ONPA 4KL8S 2P79A 2VPXA 3LFHA 2P3QA 4DDVA 1Y80A 3IBYA 2NU9B 1TO2E 1BDBA 1C1HA 1QIGA 1YE8A 3LJKA 4YAWA 4DIMA 4DA4A 3C5CA 1CS0B 4ONEA 3HUDA 1DT3A 1K1EA 3ODPA 3WL3A 9ABPA 1FMFA 1OVGA 2EZUA 1J22A 4RIGA 1RBZA 2PGXA 3EZLA 2GA8A 4PY2A 4E4YA 3EPLA 2WZBA 3CNHA 4B3RB 2GZSA 1SOVA 4LY9A 3GCDA 1O8BA 2L18A 2H52A 1JA9A 1PZNA 1RACA 3CR8A 1H4SA 5AVQA 5C7IO 1ULBA 1W4LA 2I1WA 4JBHA 4M98A 4URWR 4Y6RA 4C5BA 1LSUA 4HDKB 4ZGWA 4LX0A 1PK9A 2AI3A 1QYCA 4ND4A 2BMVA 1QVZA 3CSSA 5KC9A 2HK9A 2WM3A 3N8GA 3DVSX 3GLRA 2XADA 4H7PA 4QUGA 1M1XB 3TPCA 3PDIB 4MTLA 5LZ8A 5F78A 1DO2A 1L8XA 3HVUA 3K9BA 4TLDA 4XAQA 1OH5A 1RWQA 2GILA 2P67A 3B1ZA 1V2HE 3QLTA 2G63A 4GWLA 3RB8A 5C7OO 1W9MA 2W6IA 1GV1A 3PI6A 2DHDA