2K87A

Nmr structure of a putative rna binding protein (sars1) from sars coronavirus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
116
structure length
116
Chain Sequence
b'MYTEQPIDLVPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDYRHYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 3 of Replicase polyprotein 1a
publication title Nuclear magnetic resonance structure of the nucleic acid-binding domain of severe acute respiratory syndrome coronavirus nonstructural protein 3.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein, rna binding protein
total genus 22
structure length 116
sequence length 116
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16251 NAR Nucleic acid-binding domain (NAR)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2k87A00
2K87A
chains in the Genus database with same CATH superfamily
3W78A 4DARA 4DZZA 1JR6A 1FDUA 1CDZA 2JBAA 3RTGA 3FYSA 2BYTA 1N3IA 1QXSA 3ZIAA 1ZIYA 1TAQA 2B34A 4BVLA 3CH6A 3T5TA 5KTOA 3U7GA 2JLQA 3I04A 5CA0A 5FR1A 2JHPA 4C0SA 2BFBB 4DM3A 4FLEA 5KNCH 1HMYA 4OF4A 3L6RA 3LX8A 3UFXA 4RK1A 1JA0A 3DAHA 4URVR 2E1RA 1UT8A 3PEUA 4ALNA 1L3CA 3RYCB 4UHBA 1P8AA 2PT6A 2ZJAA 1XALA 4BNFA 1KEKA 1WV0A 4JLAA 1W59A 2XMZA 1P7ZA 3S6JA 1CZLA 1L5VA 2DBZA 1ZL2A 2YXNA 3LG2A 3LLCA 4RPGA 1SIWA 2WKWA 1U3GA 4FDAA 2XHEA 2TSYB 4KV7A 5EZYF 4HVLA 2QT1A 4G9EA 4P3KA 2DWCA 1KJIA 4YAKA 5CJPA 3CTPA 4AO6A 2ZULA 3HCFA 3QKUA 5G40A 3TKAA 1YQWA 4H4EA 4BMXA 5CDYA 4PS0A 1U2TA 1E1YA 1K5PA 3H9BA 3C3AA 2VSOA 1R6UA 2OXCA 1KZYC 2FVXA 3ANSA 2P9GA 1R9GA 1RFGE 2YOFA 4LK3A 2YZ2A 1IM5A 5FTMA 1DAKA 1GNQA 2PD6A 3V1KA 3GT4A 1IZZA 4DDWA 1EVLA 1E79A 2GAIA 1H5NA 2HLPA 2WAOA 3EW9A 3TSCA 2R48A 5FYDA 1KO5A 2X8JA 1PZHA 1VXOA 4TQ9A 1C9EA 4JIMA 5H70A 3V8BA 1ZW1A 1IMOA 4ZOLF 4YMUA 4L6AA 4BECA 1H66A 4HFMA 4D9IA 1GRVA 4Z7QB 1R0ZA 2EJUA 2Z9CA 4CTMA 2HUPA 2JDIA 2NVBA 1Y4ZA 2VQFB 4ZKEA 4DJ5X 1PLLA 1J9GA 1HDCA 2FRDA 2VHQA 4N8SA 1L5KA 1OH8A 2P6RA 3UHAA 3O7MA 2D5IA 1UWKA 3NLLA 2ZUTA 5I9LA 4ZI3A 1Y6JA 2SKEA 5H9VA 1X7XA 4DG8A 1ZMBA 2GEDA 5LP6A 1XR3A 2J0SA 5JYEA 1WULS 1BN7A 3FH0A 4FINA 1HZZA 3QQPA 1XF9A 3DBRA 5JSZA 1ZN7A 4GFDA 3N53A 4R31A 4EQ6A 4AT1A 4UM7A 4C4AA 3KAKA 3EXIB 1I01A 2XHZA 1Z3CA 1CR6A 1FX0B 2ZUVA 1XTBA 4Q9NA 2XVZA 2D0OB 1I1QB 4YAOA 4E1AA 2ZPTX 6GPBA 1GTL1 2PRKA 1SUEA 4OP3A 3BERA 5HUQA 4OBEA 4KHPB 2PGOA 1HZJA 1HT1E 2P4SA 3GAMA 3HDQA 3H97A 4KFTA 2WJGA 3O9MA 4NU0A 4Q00A 3LPNA 421PA 4A91A 3FTEA 2AFRA 4CQMB 4CIBA 1L7DA 1AQJA 3SJZA 4I81A 3BCHA 1ZVJA 2FQ1A 2EQBA 3EOAI 3GEPA 1QP8A 5ITZA 3ELUA 4B4WA 4COKA 1HH4A 2B99A 3BVPA 4K40A 3AYZB 3HBMA 3IAFA 3RG2A 5K3EA 4EW3A 1CW2B 5HP4A 1I0LA 4B83A 4B3BA 4AQYB 3KZ1E 4K9OA 1VM6A 1U0GA 1N1EA 1ODSA 3RIHA 3VQTA 4BO5A 5T3UA 4MYRA 3R5FA 5DF1A 1M76A 3VMFA 1U2RA 2GCGA 3ZGYA 1Y1QA 2I8LA 3H9GA 3ZS8A 1ULAA 4G5YA 4LGYA 3SU8A 2WHQA 1U2PA 5D3QA 5AXAA 1U3CA 4DEVA 3HDHA 2R4UA 3THXA 5HIMA 3RC1A 1CPYA 1QF9A 1RHKA 2IHJA 3AOEA 3H5RA 3H6KA 4TSRA 2FPKA 3P4UA 2H1HA 4RY8A 3I39X 2QT9A 3FGPA 3X2EA 5ED0A 4JXXA 1ISGA 3CLRC 4JKIA 1LV8A 5GWXA 3KQTA 2C4NA 3JQPA 1CQZA 3QITA 3N0RA 4B75A 1VCHA 2G77B 1PJCA 4MW4A 5EPOA 1SD1A 3KKMA 1MF7A 4QYTA 5J23A 2YYAA 3DEYX 3BJRA 1JXOA 5JXJA 2O8BA 2IYUA 4RS4A 2L2QA 3OCZA 3H0EA 1ANKA 7MHTA 3HCNA 5FFNA 2ZTUA 1BXRA 4ZEMA 3N74A 3M34A 3IBGA 4LOLA 1QE5A 5EMMA 1E1NA 1LK0A 3PFWO 3WKAA 1EQUA 1K3UB 3FTDA 1D2MA 4JYMA 2A88A 3FNFA 3C2QA 3MM4A 3MLEA 4P34A 2H4HA 1BWSA 3NOVA 3NNSA 4GNKA 2REOA 2IHVA 2DFVA 2RG1A 1N57A 3K8YA 4ZP1A 2NMVA 1ICIA 3EG5A 3FUWA 2FN9A 2I78A 3L7KA 1DC7A 4G9BA 2FEOA 4ZPJA 5TB5A 5IARA 1RYFA 1WG8A 5DKFA 1ZUNA 2Q3FA 5IJ9B 3KYBA 5INTA 2W2VA 1OYOA 2XODA 3KUUA 1N8NA 1V3VA 2C7BA 2HJSA 3DQQA 1U2SA 1VHDA 2NM0A 3LLSA 2XXAA 5LYYA 3EUAA 2C31A 4NAHA 4BNHA 2O5VA 2E7ZA 2JEYA 3SVTA 4MTCA 1TC1A 2H31A 2W6PA 1EB8A 2KE5A 3FSGA 2A78A 4IOLA 4PC1A 4G8DA 4FJ2A 1A7UA 2HI0A 2IGTA 3LLMA 3OIWA 2DR3A 4OM8A 2YDXA 4F21A 2PPVA 1BGWA 2X40A 3KZVA 4RM2A 4L9SA 4KX3A 4MIYA 2XUIA 1J8MF 3B7GA 4XCQA 4PM4A 1DGQA 5E3HA 2VZ8A 1UQTA 5JI3E 5CJJA 2J5KA 4TROA 2PZKA 4DDTA 2HGZA 4LYAA 1DJNA 2Q0SA 2BM8A 1HT0A 1WWKA 2QYHA 5TF0A 5E1OA 1JR3E 1WS6A 1NQVA 3WYBA 2VDMB 1TK2A 3KTAB 2Q21A 3UJ7A 2AXPA 4HNVA 3BXGA 1N2CE 3G68A 1QX3A 4GL4A 4QBGB 4PRLA 4U7GA 5D7BA 3IP9A 3UAXA 3W7VA 5LBUA 1C1DB 4AZTA 5D5PA 4IWYA 4HAIA 5GONF 2QENA 3DLCA 2GBFA 621PA 1G42A 3UAOA 2VCHA 3AY6A 3IJRA 4HGZA 1RM5A 3OFND 4GL2A 1NQXA 3PEYA 2UZ1A 1S2GA 1JG6A 3A3PA 1GQQA 3P96A 3GDGA 1XWWA 3ZHRA 4K87A 1E5VA 1VJDA 3EY9A 4BJ6A 2I6SA 4PC6A 5JI2E 1MJNA 3QLTA 4KXYA 3N7TA 2CFRA 2RHTA 5KAPA 1D4ZA 2OR3A 2VDLB 2X0JA 4F46A 1EUQA 1IXSB 3G0IA 3QKIA 4UQPA 2JIBA 2C61A 3TM4A 4NWIA 3P26A 4FYHA 2VI5A 5J2TA 1NF2A 3KHSA 1IPFA 2XSZA 1DG9A 1ZDMA 1CUJA 2Q7XA 3HGQA 1ZRSA 3LQ4A 1BGXT 3Q2KA 3QU4A 2O14A 4Q93A 4E5DA 3HR8A 3QA9A 4BYGA 4L1KA 1F60A 4H7EA 2ZRPA 4KO1S 2J4CA 1NVKA 2GAAA 2I3BA 3JYOA 1MOPA 1XD2B 3LZ6A 3ZCSA 2J30A 4OIMA 1NA5A 4RTMA 4L75A 4TRRA 3UPDA 5BW5A 1ZNWA 1YHYA 5IM5A 3PV0A 4UCXA 1S89A 4NECA 1JHQA 2P91A 2C07A 3IEXA 2VJYA 3GGDA 3FI0A 1JLHA 1M8KA 1MORA 1N6HA 2FWMX 1JIJA 3JWIA 4JLJA 3RRZA 3QWHA 1A9OA 1QAMA 3C85A 1XZFA 3TLBA 1TTHA 4D92A 1MB4A 1JDJA 2GCIA 4I8XA 1FDVA 4NFYA 2Q99A 2UUCB 1U6JA 4AJ4A 4BP3A 1FSPA 1IOLA 3KXLA 3LU1A 2RG7A 3CURA 4JLPA 2IUYA 4N01A 2W2LA 4KO2S 5ED4A 1BWQA 221PA 3WLPA 4BMSA 4INAA 3D4LA 3NH9A 5CDTA 1RJDA 3ENNA 1YS4A 1B41A 3JASB 1IULA 1PBNA 4EJSC 1CHDA 3OCWA 3AB7A 1A96A 1H2ZA 3HH8A 4BB0A 5ECDA 4FS8A 2XE6A 3VZRA 4ZEXA 4B7AA 1L4YA 4EBFA 3I5AA 4BX0A 4F97A 2VRWA 5FOWA 1JG3A 1XT6A 2V58A 1RHJA 4XTRA 3RGWS 1KWKA 4TUYA 3C1UA 3ZV6A 4Q9HA 3WLKX 1SXJA 4FN5A 2W5UA 3W9SA 4AY6A 1ZWKA 4FC7A 1YDWA 1NXPA 5BMVB 1KGDA 4B4DA 1G20A 1GJRA 4DLRA 5CCDA 3OPXA 4U7PB 4QFMA 4LV5B 4UM9D 4BQPA 3DE1X 4K6KA 3NBMA 1IYZA 1OGIA 3VYUB 1JDNA 4HK4A 5EWJB 4CLEA 4C7KA 1J99A 3ZDZB 4IKPA 3SHTA 3ZWOA 4BU0A 4EB6A 4UBNA 3BRWA 2A5DA 3GF4A 1R4NA 1T8RA 4KIUA 3C7AA 3SVZA 1YZTA 2ZANA 3R6DA 4XYEA 5KTNA 2GK3A 3G9QA 1CIPA 3F3KA 4JEIA 2Q4EA 1E1CB 1RXYA 1Z47A 2PKQO 3GNQA 3H9UA 3MOGA 1D4AA 2AE1A 4G5GA 2R66A 2VK2A 5EHIA 2I9PA 2YRWA 1JQLB 3S28A 3ZBPA 3ZOKA 3HU3A 1CUAA 2NT3A 3O8OB 4ZCRA 4XQ0A 3DHNA 4BZQA 5EINA 4FJ1A 4FZVA 4Y2RA 4AW9A 3AKEA 3GLRA 2FP4A 2V4ZA 4RBNA 5KWJA 1ZN2A 2X76A 4DR5B 2AFVA 1ZW6A 3A1FA 4HD8A 3N7AA 1PNTA 2D1FA 3COYA 3ZDAA 3LXUX 4P4SA 3GG2A 2ZRIA 1FVXA 3K0AA 4U3JA 4E09A 3G9ZA 1D6NA 5K0CA 3ZKWA 3F6BX 1NNEA 4DSAA 1D7OA 1SBIA 4HXGA 5SICE 3U9TA 1L5QA 2XE4A 4GQBA 1NVAA 4YRLA 1FP4B 2FW0A 1GAEO 1PZMA 2FPIB 2LGJA 2WF8A 2XA1A 2VJPA 3MJFA 3N8IA 3ROMA 4ZV4A 5FUYA 4O1IA 3PD0A 2QTMA 4MA0A 2PKYX 5M29A 1NJ6A 4Z99A 1CUXA 3L6DA 4KN5A 2XUDA 4UVHA 4WH0A 2YHAA 5CB8A 5JAHA 2RARA 5L51A 3NW9A 1IXYA 4JOCA 4DE5A 4G67A 4OL9A 2QBYA 3IVCA 4CFSA 4L95C 2ZE6A 3NYRA 3T7JA 1N8KA 2R2GA 3UNXA 5I47A 3JQ7B 1SCJA 4HDMA 2QTLA 1C4OA 1G5PA 2P0EA 2WA2A 3V7UA 2J9ZB 3QMWA 1S6YA 5EJ7A 4Q82A 4IZOA 3WLQA 3C70A 3LYHA 5AHRA 2OLJA 2E49A 2COKA 3HB7A 3RC8A 5D51S 4AJ1A 5BNFA 4CQJA 3U13A 4IIUA 4FMDF 4GWLA 5I8WA 1K1EA 3LC7O 2XJ4A 2Q5LA 3TBKA 3WGQA 1NHWA 3B8HA 4B31A 4NZYA 2R5WA 2A5JA 2WZBA 1AT1A 1NDHA 5FT9A 1I3MA 3O4JA 3GCGA 3GRYA 3TR6A 3YASA 3I3SR 1H8HD 3WGHA 1USUA 2D13A 3OUUA 4KSBA 4TKVB 1SUDA 3ESCA 3WLEA 4HUTA 5H9WA 4Q4HA 2XZLA 4BLWA 4IZ6A 2VT7A 4MV4A 2ZBQA 2YN0A 3FSRA 3GGJA 3M9XA 3KQVA 4R9SA 4BFUA 4CEHA 5JVDA 5L4NA 3QMMA 4GICA 4EI8A 1VE6A 3TEFA 5AP9A 3FHTA 1J6UA 1VLJA 2FW9A 2Q1SA 3HRIA 3NETA 3EZNA 2F3PA 4OQ4A 4Z8XA 3CW8X 2OBYA 3L02A 2NU8B 2GUGA 1SOUA 5FBWB 1O5IA 1Q1AA 2N75A 3S44A 5ALMA 3Q8LA 4LUCA 1GTZA 3AUUA 1BHO1 1CVRA 3NHMA 1DBQA 2CHVA 4WRRA 3SHVA 3Q40A 3CC8A 4IDAA 4UDXX 4YV7A 3GGOA 2PLFA 3EW7A 1MQAA 4G5XA 2FFRA 3N07A 4DWVA 3RRJA 2X2EA 1PWEA 1IJBA 2PMWB 4OJNA 5D84A 3CRVA 2NO0A 3ZZTA 5LXTF 5JJLA 1NASA 2Y27A 4TM7A 4MB0A 1Q6YA 1WUHS 2AG6A 2PDAA 1Q2XA 1JIIA 2XCQA 4JBIA 4JVLA 5SYAA 4ZU6X 1XRQA 1JJVA 2X1LA 1W52X 3F4BA 3HI4A 4G0MA 6ABPA 5LWQA 5CW1A 2J87A 4MR8B 3NRCA 1NAIA 1E4VA 4QXRA 2FWNA 3OZAA 1C7EA 1EWYA 1SUSA 1YCHA 2J7KA 2IBMA 3CW9A 5F9HA 4OHWA 3TGWA 1TFRA 4HWKA 4D8TA 1JHPA 1P4GA 2Z09A 1Q0UA 5HIJA 3DVAA 4IDPA 3NIWA 4AG3A 2C7VA 1YAJA 4Z4IA 4KREA 1TZJA 3LLVA 3CUUA 1MC1A 4OXKA 4XQCA 3ZDRA 1Z25A 4ZV7A 3VI4B 4Z1MD 5LU8A 1DKLA 5F7ZA 3C3EA 2ZPUA 3A4YA 2XYRA 3Q3CA 4E2FA 2X5KO 1EUCB 3KL4A 4KYVA 5I01A 4ECAA 3U3DA 4D9FA 2XTAA 1P60A 1VJRA 1GKKA 3LM8A 4MDFA 3FCCA 2FZLA 1NJSA 1UH5A 3DEKA 4GI3A 1D2NA 3FCAA 1KY3A 5J59A 5KC9A 5LZ2A 1T3ZA 1I4OA 2QN6A 4JZKA 3NUQA 2A1TS 1LDBA 2PUBA 5KOHB 3OQIB 2A1IA 3GUUA 3JSXA 1L7MA 4KQ2A 3EBLA 2V7TA 4ZVQA 2D0DA 3OAAD 4J0FA 4RKEA 1X8KA 2GI4A 4J6FA 1GPDG 5AYVA 4QE3A 5UKDA 1URPA 4GX5A 4DDKA 2CXNA 2A86A 3H65A 4RVCA 3VUFA 5KMGB 5C53B 3TI7A 1J56A 1JSXA 5FPSA 2CL0X 3FHLA 3GW8A 3ZUPA 1E9BA 1KY5A 3S5JA 3HMQA 4B3XA 5BW8A 3CEMA 1LC0A 2BEKA 4DLYA 2BLLA 4LYHA 4QGAA 4S2UA 5EIEA 2OQ2A 1KSJA 1YZGA 1RYEA 3NVMB 4REQB 4CIVA 3MT9A 3WA6A 5K3BA 4LBWA 1JFLA 2W42A 2EBHX 3NYIA 5EMLA 3ZVRA 2WW8A 1EZ1A 4ITVA 2FPOA 4ND8A 3PWZA 4Q66C 1KS9A 3NT5A 4YS6A 3IUYA 1YTLA 5AW4A 8ATCA 3AHEA 2H17A 1KC1A 2X14A 1DBRA 1NW5A 4DJEC 5ALRA 1B15A 4UTVA 2JGDB 4HGPA 3JZIA 1T2NA 1SKBA 2QRQA 1H5UA 2G63A 2YJ4A 1ULUA 1XEFA 2H92A 3CX6A 1PJBA 4YALA 2X9NA 3W6OA 5MGNA 3CVUA 2N42A 1ONOA 3EASA 3FTPA 2O0JA 3H5VA 2Y1GA 1THMA 4GP6A 5KWIA 3KX2A 4F9FA 4D3DA 1W25A 2DVMA 4A0SA 4UXJA 5FHRA 1TK9A 4I9UA 3E9EA 4PHTA 1L8XA 1XZ8A 3RU3A 5A7GA 2HA3A 1M8PA 4YAWA 3FFXA 1JKFA 1GR0A 5ELMA 3NTLA 4ZJZA 3SMVA 4DLWA 3ED1A 4S3MA 4YJGA 1GTRA 1GQYA 4TTVA 1VE9A 4FYMA 5D00A 1KI2A 1OWPA 3QBVA 2G4LA 1W0KA 1XCGB 3DH0A 1L7PA 4K9MA 5H1YA 1XQ9A 4FNGA 1OFUA 5JSQA 1QG0A 2ECKA 3OQ6A 3NWBA 4XIFA 2Y76A 1Q91A 2G0TA 1GNTA 5LZ4A 1RPAA 4I1SA 4K05A 2LDXA 5B1DA 3IKJA 5IJWA 4MQFB 1LCIA 5CK4A 4ND6A 1NR7A 3HJNA 4PX3A 3BG5A 4QPNA 4RHXA 1SA0A 4QC2A 4F4UA 1ADFA 3C8DA 1O9HA 4XAQA 1RTKA 2VDWB 4MV3A 5CNIA 5FORA 3EHDA 1RXVA 1O97C 4NL4H 4WSOA 4DIEA 5KTTA 1E0SA 4R2XA 2WM8A 3IPCA 1T3GA 4NCNA 2VS1A 4OUKX 4FZRA 4G65A 3ZKAA 1LVHA 2QPOA 2C98A 1KNXA 4FT4A 2GKOA 4WERA 4CF5A 2GZ2A 5B7NA 2FXIA 4YXWA 3TO5A 1I10A 3GH3A 3RLIA 3S68A 2GYUA 2FI1A 3OBIA 4IUDS 3PHIA 1JUDA 1NXWA 4XM0A 3WTBA 1YTUA 4JJ4A 4TKLA 4LQCA 2RIRA 2WD7B 2XOKD 4YMHA 4J9VA 4TV8A 4MAAA 3WL5A 5FBKA 3F7NA 3GL9A 4UPEA 3WR5A 2HNKA 5FTNA 2R5NA 4HO1X 2AMJA 5K6RA 2ODQA 4LXYA 2X4LA 2Z8XA 1ONSA 1SB9A 4IHJA 4KOEC 2O23A 1RYMA 2QN1A 2YJGA 3AR7A 8OHMA 4CKCB 3QOYA 1W49A 3OQVA 3PJGA 1BE6A 1XVLA 3IVMA 3DTYA 3MTDA 3K1JA 4TZTA 5AOBA 1QCYA 2XCRB 1T0JB 1SBYA 1JU4A 2CF5A 4MX8A 1OC2A 1KJJA 1O96A 1T0UA 5CRIA 1OLUA 1TQHA 3NGMA 2FMIA 3WOVA 1HWYA 1MJHA 5CX4A 1TD9A 1ZUWA 2ADFA 4HYEA 3ZHCA 1CR1A 3IUPA 4ME6A 1ZJJA 5LUAA 3OH8A 1GAJA 2B1RA 1ZMOA 1FYWA 4BKRA 4FONA 3DMPA 4U6QA 5DBGA 1Z0JA 2P9YA 3NOXA 3P9RA 1S0UA 4HAUA 4M98A 4K86A 4NOMA 5AK6A 3S2SA 1HSOA 1LK5A 3BJEA 3LQRA 1QIGA 5JRZA 4P31A 521PA 5JYBA 3G17A 1ZY2A 3SKXA 4CLRB 1PCXA 2OBNA 1Z6YA 3PZBA 7REQA 4GM0A 3BX1A 4BFWA 5HCUA 4BNLA 2FWPA 2FSUA 1GT6A 3PX3A 1IXZA 3ICVA 4OYRA 4UU0A 5HKOA 5DCLA 5GZ3A 5FH9A 2FR0A 2I65A 4WWHA 2A5GA 2DFPA 3VAZA 3NVAA 3R4CA 3A6FA 1GPJA 1MXFA 1OWMA 1OLXB 1OX6A 2DTEA 4MOWA 2OXIA 1VHQA 3I92A 3X3HA 2UYQA 3O92A 2BL4A 3A14A 4YREA 4Z86A 5HWSA 5J58A 1BNCA 3VR4D 2D0PB 1CERA 4QQKA 1KHTA 4HS4A 4UHHA 3IE2A 2C5LA 1QHYA 1BW9A 2HOQA 2CKMA 3ZY3A 5G1PA 1P4SA 1E2EA 1ZONA 5TMEA 3P94A 5JISA 4UHDA 1KEEA 3GP8A 3C6KA 2X2FA 4MIOA 1EFKA 4NPCA 4QUBA 4HX9A 4QOIA 4REOA 1AGRA 3CONA 3UWOA 4RENA 5GGXA 4CF3A 1V16B 2PRZA 3HY4A 3M5CA 5ENZA 5K4GA 5TY0A 1H0HA 2QY9A 3GYGA 3LIIA 1GARA 1MAUA 3HFJA 2E4VA 3PHGA 2APJA 3CBQA 4PYOA 3PFKA 3SNKA 4ARAA 2O1EA 4K6CA 3TTUA 4YCSA 3V2HA 1P7WA 3RUAA 3N76A 5FIUA 4BFTA 3SE7A 1W9MA 4TLAA 2XA2A 5DBFA 4YLEA 2Q1TA 1KMHA 3M2TA 3PKZA 2I1WA 4RVGA 4A4DA 4A23A 1RS0A 4IV5A 1TT5A 2YTZA 3SPXA 4BB6A 1L4FA 1TK3A 1GPBA 2ATEA 3UHPA 1YI0A 3C3JA 2GN9A 3P97A 3KVNA 4P4LA 3VPAA 1O94C 1Y3BE 3D3WA 2D7CA 3G1UA 3O90A 4PFSA 1AQNA 2WQ7A 1DX6A 4B6JA 1PR5A 3TSAA 2WWXA 3GLHB 3ZLTA 5AI5A 5GPBA 1G2IA 2O2CA 1DJQA 2YHUA 2H07A 1BMDA 2XQJA 4FFSA 2FN4A 4KFUA 1PT8A 1U0HC 1JA1A 3PC8C 4OHCA 4QYMA 4RDCA 3HSSA 3PCXA 3IE0A 3KT3A 2RJOA 4NK5A 5JAZA 3DOHA 2B78A 1XDGA 2RCNA 3H0KA 1LJ8A 3LPMA 1CEEA 4XGNA 2QW0X 3FPSA 5BMOA 3WGZA 2HBZA 3K92A 3UXHA 2JH9A 2EGGA 4QQNA 1B43A 5BMVF 2AMLA 5H81A 1TZCA 2CLDX 3LHDA 2GOYA 2NU7B 5IWCA 1OI4A 1NONA 1RQ7A 1VIDA 1OFGA 4JB8A 4NOLA 4PYKA 4FR5A 5AK4A 1WZUA 3GD7A 3VH3A 4JJAA 2D4AA 2DUJA 2PGDA 1PT7A 3ADKA 3CNQS 4J7UA 5C4GB 3UAWA 1AF4A 3U4AA 1JYSA 4FDUA 1W8IA 4XDZA 1CR0A 1N9GA 3HHEA 1AKTA 1D6SA 1U5AA 2BEJA 3OBBA 2CJPA 4CT0A 2HW8A 4RD3A 3JCZA 1IG0A 1LFAA 3FDXA 3NC0C 3UMCA 5B3KA 1G7TA 3KZOA 1N5RA 2FMTA 2D5BA 4I3FA 5DWDA 2FQWA 2KPOA 2CZQA 1Z2OX 4I50B 4JASB 5CEJA 4FM9A 3L49A 2Y1XA 4C21A 1PWHA 3TOXA 4DA6A 5A04A 2GX6A 3GEBA 4Y6LA 2HSZA 1NNUA 2J5XA 4MS4B 2ZRDA 1THGA 4LK2A 3AVXA 4A26A 4RF3A 2HPAA 3OZTA 3VRHA 5BT8A 3DKPA 2NGRA 2GHRA 3AGPA 1I14A 1FVFA 2ZDHA 3AHHA 3F5QA 1F2VA 1SWVA 4KPUB 4TLEA 1KKUA 2RCYA 3VVBA 4YT8A 3RWOA 5HSGA 3U2QA 1G21E 2CVFA 3ANLA 4JQZA 2NO6A 3L0CA 2PZ8A 4E6EA 1ECPA 3I23A 5TVKA 1RP7A 4TSKA 3ES9A 3LUBA 3L7MA 3AETB 4N0MA 4R16A 4GOND 2GJ9A 2DQ4A 3SEFA 4G0OA 3QVTA 5CXSA 2HK8A 3PKJA 2JGKA 5B5SA 1OZ0A 4WMLA 3ZLVA 2C78A 2E6KA 2P11A 3NHAA 4CKXA 1A3CA 3CPJB 1TUBB 3SKVA 4G0QA 4Z49A 3KHUA 5CB6A 3DOEA 1G3UA 4ER6A 4F86A 4KWCA 3RVMA 4R8LA 4K8RB 4FZ3A 4FFMA 1R64A 4M9UA 3IILA 4GAEA 2XF8A 4HXEB 4M54A 3T0GA 2FFQA 4ZZ0A 4U7WA 4B3CA 5ADVA 3A6DA 5B6IA 3G6WA 3BOSA 4AU1A 3AUYA 3DC2A 1Z29A 2IYRA 2MJLA 5EJ4A 4HNRA 1AK2A 2V5UA 2H51A 3NDPA 5I7OA 3FKSA 4MRMB 4YRZA 5G4LA 4XX0A 2XYQA 1Z5ZA 4OOEA 3RS8A 3UT0A 1AMNA 2EHJA 2R87A 3NDIA 3PDIB 4N39A 3VVMA 2QLJA 5JJBA 4I4TA 2QK4A 2VBFA 1C3JA 1RQRA 1I30A 2AXNA 4HNGA 5TQJA 1SVMA 4WESB 1YL7A 4LW8A 2C20A 3NPMA 4PNZA 3BBPA 4K6HA 3DE2X 4IMIB 4LYDA 4F72A 3GEMA 4E30A 2WI8A 5IF9A 5T7BA 1G18A 5F78A 4W4TA 4BGIA 5AR1A 5E3IA 2H4YA 3P2MA 4FNMA 3OTIA 1YJ5A 1NUUA 2IU6A 4NH0A 1XXHA 2DPHA 4B4KA 3QEMB 5G4KA 2FMHA 4MP6A 4PINA 1P5FA 2F3QA 4N41A 2HHCA 3KJZA 4PPFA 3A9TA 4UEKA 1UBTS 1KEPA 2E4ZA 1CUCA 1L9XA 2D1TA 3HBNA 2YZKA 1GSHA 4OLFA 3X43A 1WNFA 1V3UA 3HGTA 4FI3C 3IKVA 4PZEA 5EJFA 3B70A 3F6RA 1PKEA 4OCZA 1JIVA 4WEOA 2V7QD 2P9ZA 2FOIA 3NALA 4ZCMA 3FLEA 2EJWA 3S2IA 2P30A 1RWNA 4ZGGA 3QY9A 5JNUA 4NU6A 3MZ0A 4J8PA 1C0IA 1RBMA 3OZCA 4CIXA 4DCGA 3VR5H 3UC9A 3O31A 5FPHA 4GQIA 1T9BA 3KR9A 2O54A 2BKXA 5L3QB 2G1KA 2R1VB 1S2LA 4H6PA 3FYHA 1YQDA 2DQZA 3A9RA 1B4DA 3V6LA 3CW2A 3OEHA 2WTBA 4NIMA 3UWSA 3L0DA 4X6LA 3WB9A 1ZK4A 5ADUS 2QV7A 1OFUX 1XA4A 1OXUA 3RQIA 3FYDA 1IATA 5H0IA 4CMEC 2HX1A 1EFVB 2WUDA 3CR8A 3EVNA 4LTMA 1P9NA 4X60A 1M74A 3HXMA 3MWKA 1XHLA 4PAOA 5KJFA 1H0KA 4V2UA 1T6BY 1Y5MA 1FZQA 4FMPA 4X65B 3TLEA 3FZNA 1XMIA 3D2CA 4FYJA 4QUHA 3CLTC 3UV6A 4ATNA 4JS0A 3IO5A 4DREA 3U48A 3LC0A 3X0DA 5KNCD 2A58A 1PL7A 1FXWF 1PZXA 3BSFA 3UMRA 2JFYA 2JKZA 3HU2A 2CXUA 4MR7A 2G1AA 1Z5OA 3H5AA 1KO8A 1XTZA 5DGDA 2AFHA 2XXJA 4P3XA 3WB1A 1UC9A 3MBKA 2PS3A 2FUCA 3EAFA 3HXTA 3TNYA 3RVQA 3OKAA 1L9KA 1RWVA 1MXHA 1FDTA 1YSCA 4M38A 4C1BA 4BFXA 1CNMA 1KFJB 3E1GA 4PYIA 2EYUA 3E3OA 3WWCA 4F5DA 2EX1A 5ADHA 1OYYA 3DHEA 2NPOA 4X85A 1ECLA 1D9XA 4B3JA 5EWLB 5TPZD 1IBKB 1XZMA 3JWEA 3W7BA 2AIRA 1S7CA 2W2MA 1T9GS 1YS6A 3GP5A 5AKIA 3UUFA 2IOFA 3VX3A 4ARSA 3EA5A 2EP7A 2IQIA 4FNAA 1Y3HA 4J16C 1KDPA 4MW1A 4OLHA 5COAA 2UZ0A 3QPCA 4IYJA 1QRTA 1Z8HA 5C8XA 1XMVA 2AWNA 4KPYA 1M2JA 3PGLA 4PZ0A 3MT0A 3X1WA 1BDHA 2A2ZA 3P0JA 3HP7A 4Y2JA 2IF0A 3V3KA 1FFWA 2VCYA 4G26A 3SIWA 1SCUB 4J3NA 3B36A 1UPFA 3IP8A 2ZR8A 3EPPA 1JHOA 1CVLA 2GK4A 3DYBA 5E38A 1QWSA 4GKVA 4IQ4A 4RLFA 4K46A 4WLFA 4X8HA 3O47A 2BP7B 3SZLA 3EXAA 4UARA 4LZJA 3NRBA 5FV4A 2R8RA 5FOVA 2OECA 1D2RA 3ZE7A 1DRWA 3F9IA 3GLGA 1U2QA 2PKXA 4A1OA 3C8ZA 3DA8A 1U8FO 3EIQA 3PUKA 1TCBA 4OHMA 4CDMA 1K2WA 3CWZA 3K8QA 5GIOE 3AR6A 3HM9A 2R8XA 1DZ3A 4NE2A 4C2TA 3B1VA 1FW6A 3HL0A 2F1RA 1ODFA 2UUOA 3PL1A 1TXGA 2BMVA 4YAJA 4GSLA 2CVOA 1U7PA 1UXJA 4MVJG 4D0GA 2C29D 1KI1A 2R4QA 1CF4A 2R9VA 1RHUA 1T8YA 3DVLA 4BUZA 3UAGA 3Q3GE 5C8ZA 4N48A 3I34X 5THQA 4M1KA 2GN8A 5JQGB 2JH3A 2VPXA 3PYLA 4YP0A 4EL5A 2WF7A 5EIHA 1V8DA 3AVOA 2DU8A 2VTKA 4G56A 1QYCA 4H6VA 2VDRB 4OQMA 3OKFA 1O0SA 1Q95A 4G63A 1Z6QA 4QDKA 3PK0A 5LQCA 2PZFA 2IP4A 5F23A 1S01A 4NJEA 5EMJA 4MHSA 4ZI7B 2GF0A 3GPLA 2HNBA 1W76A 2XKAA 3O8BA 1GZSA 4X66B 1EFPB 3GH1A 2GAOA 3EODA 4PLVA 4G07A 4XCVA 2GLTA 4YMVA 3GNTA 4IJVA 4KQ9A 4JROA 1QYXA 3EAGA 4WKPA 1N6KA 4XFKA 5CLHA 3A31A 2JFPA 2O2IA 2XB4A 1D8TA 3CZ5A 3M81A 4FYPA 1YIOA 3BMNA 2PXAA 1W5EA 5DM0A 4WOBA 1FDOA 2C9ZA 2GN2A 3F98A 3Q41A 4ECEA 1KSHA 1FDSA 3QVGB 4GWGA 2VBGA 4GT1A 5JTUA 3GY0A 1Y4SA 1YB7A 3I72A 3M2PA 4HDKA 4HQLA 4CMKA 1DCTA 4WLVA 3W79A 5A4KA 5ALYA 3VDRA 4BNYA 4BO3A 3ELWA 2F48A 2HK9A 3OJWA 2BI7A 4LXXA 1TF2A 3L7YA 2PWAA 4LYGA 1VCOA 1XTUA 1JKJA 1V95A 2IHTA 5AJZA 4CMIB 2ZI6A 5SV2A 4N3NA 3GPDG 1T24A 3HQ4O 1QV7A 2B4AA 3H1TA 1K3FA 2VPTA 1PGPA 2DHDA 2RGAA 3AH8A 2ALJA 2AC2A 2I1QA 3O91A 4TTSA 4AURA 1Q1EA 2FSIA 4KDEA 1B3BA 2FHSA 1SVLA 2YJNA 1TX4B 1X1QA 1JIUA 2G5TA 1M73E 4RNCA 3ULKA 1K06A 1BQ4A 3VKWA 1X2BA 1P7YA 3OPYB 4FOLA 5EIAA 3OLWA 2GF9A 1NSTA 4QXAA 2Z6QA 4IQ0A 2BFFB 3TSWA 3UJ8A 2ATXA 1OUMA 1IY9A 1VCIA 1E9VA 2P2NA 2VUUA 1UZMA 2P6UA 3A4TA 3BSYA 4IGFA 4EAQA 3CVJA 2PSHA 4DA4A 3B5EA 2Q3MA 4FOTA 1NNI1 1UBEA 2DQSA 2WFMA 1P81A 2W37A 4L27A 2FZWA 1AS2A 4O08A 4Q9LA 3SLGA 4E12A 9ABPA 3SC2B 5CCXA 4QHYA 3UKDA 2XEDA 3DT6A 1OBCA 2GVDC 1BFDA 3D0KA 3M1IA 3JQ8B 2OYRA 4KH0A 3VGJA 3ND9A 2VJNA 1VKJA 4Y1FA 2QZSA 1I8TA 3CZCA 2ZROA 4GX2A 4H7IA 5IJ9A 4G0WA 4NCBA 2VHVA 4L50A 4W8OA 1SRQA 3T3IA 4EDFA 4GVXA 4O2AF 4CM8A 3WLRA 4EP1A 3F74A 2AI1A 4AJIA 2HADA 3ZHUA 3WSTA 1BA2A 4XH9B 4IG9A 4JC4A 1LI5A 1K7FB 1UBUS 5TPWB 3N0TA 4EPVA 4YAUA 1N1MA 4HSEA 1HK7A 2W83A 4XYMA 5F2EA 3T7SA 1A7JA 1CULC 1SUCA 2Q27A 5A0FA 1HG1A 2H48A 4YUVA 4DXHA 2ZZNA 1CZRA 3PUJA 3ND6A 2ES4A 1P4RA 3IB6A 1NQWA 3R7AA 1C7JA 4KO8A 4R2WA 3R5HA 3EZYA 1TO6A 2CB9A 2B82A 2EP5A 2Y9PB 4GPAA 1ZJ4A 4MVJA 4FBGA 2GAJA 1YB5A 2ZWAA 4GZLA 1GYQA 5TSDA 1TQ4A 4GP7A 1X2EA 3MINB 4ZREA 5J4YA 4RYDA 4ZK2A 2OWDA 1EVEA 3B38A 4OXNA 3UB3A 3MYRA 3C4VA 4C0WA 5IAKA 1QNLA 4QBIA 4KIGA 1IG3A 2FW7A 3PUYA 3QVMA 2W2KB 2AOUB 3ODGA 3OZFA 5F21A 5EIBC 1IEQA 5EERA 4PNEA 1NU6A 2B1QA 4Q1FA 2EDAA 3L06A 2REXB 1HYEA 3FCOA 4Y0VA 3CJTA 2JGJA 3RARA 2LCIA 1VP9A 4AD8A 1DEHA 5CD9A 1MZVA 1NBME 3I1IA 3R6GA 5IK2D 1Z2PX 5I3ZA 4QVGA 2BGJA 5L7TA 1QHSA 1SCKA 5KOJB 3WISA 1R5BA 4D9NA 5HHTA 1E2BA 5JS6A 4GZ3A 2LNDA 2WJ6A 3EQ6A 3KKKA 1M2OB 3W9YA 2XY4A 3FWZA 3B3AA 1JHZA 2GFIA 4QUKA 5DRYA 3A7DA 1ISPA 1WDLA 3HBLA 3TRIA 4B2PA 4DZRA 1SVKA 4M7RA 3U49A 4A2PA 2PMDA 3ELYA 2GTIA 1NW4A 3DZKA 4AYXA 3OG9A 4ZYXA 5FXMA 4LWQA 2HJVA 3WADA 4IKOA 5DB4A 1V43A 2ZPAA 3GWGA 3NTUA 3WE7A 1NUSA 1ZCBA 3V7FA 4JI7B 1Q1BA 2IEBA 5AJVB 5EP2A 1ECGA 4NHOA 4U1RA 4EG6A 3BCSA 2OM6A 2ATVA 2C04A 1QIHA 4DC9A 1G4AE 4V0RA 3H2JA 2DPXA 1XD2A 1WEKA 4EZIA 3D8RA 4AXXA 1NI4B 5EE0A 4OBBA 2Z83A 1Q50A 4FSHA 2XZTA 1QKKA 5DLEA 1K9VF 5E1MA 1WU8A 3OJLA 2JCGA 2H9YA 4P5PA 2OGTA 1AUVA 4IGIA 5BV7A 4B80A 2IOFK 1HNXB 4OHVA 4HGNA 2NV6A 3A2LA 1RI5A 1O95C 2C42A 4ZO8A 1ORIA 3A1WA 3SG0A 4AICA 4JQOA 4I50F 5JNLA 4TL8A 4JI0B 1JN0A 4F7DA 3AR3A 2E0IA 3E22B 3FWPA 3TDKA 1C9MA 3I6YA 1IBCA 1MQ8B 1XAGA 2VUIB 5IBPA 2CK3A 3NNDA 3WXBA 3EVGA 3MPOA 2PL5A 1P45A 4M0MA 1GLGA 3R3HA 3Q8KA 3R3JA 1GL7A 1ZC4A 2PSFA 4FI3F 3CE6A 4IVPA 1CQPA 4EZEA 3TW0A 4Y2HA 3ZWVA 5LLDA 1I7QB 5JAQA 1V37A 5FUBA 3LMKA 3F9CA 1ESEA 3KJFA 4UNNA 3MMNA 4HLCA 4OOFA 1UBJS 4GOMD 1DCFA 3RTDA 4DHEA 1Q83A 2PUVA 4HPJB 1U8ZA 4F9TA 1W4AA 3L8YA 1Q22A 2FPPB 3B51X 2NUTB 4XW2A 5DCYA 5K2OA 3SHOA 3L40A 1TM4E 4CEIA 1K4MA 1BA3A 1E66A 1XF1A 2A0KA 2WDPA 1G2PA 2AXQA 2Z30A 2Q41A 3K05A 4K88A 2MYUA 4AUEA 4UM9B 3AM3A 3TQOA 2IEYA 4NX2A 2P4EA 3L2OB 1YMUA 1T8SA 1XL1A 1E8NA 3MYYA 4JB0A 4Q47A 1L6IA 4KODA 1UBRS 2C54A 3DZBA 3STYA 3VHRA 5BXQC 1PYOA 1I6KA 2RAVA 4X5OA 2ET6A 3FNGA 4BLPA 3LQ2A 4BZWA 3IDSA 1VYVA 4NKRA 4DEXA 5J2UB 4BMVA 1KAMA 2IKQA 3CLTD 4OHYA 4CEJB 3C8MA 3CH5A 3IP3A 2J6IA 1AH2A 3UT5A 1H9BA 3O38A 3CA8A 4HBGA 2Q2QA 5FUQA 3V4RA 4JJEA 2GUWA 3VTFA 3T5BA 4BQQA 3FUCA 3CMMA 1Q7CA 3ESXA 1E7RA 4L08A 3EFOA 3SJBA 3IO3A 1L1FA 4OU5A 2QSUA 1G9TA 1Y8RB 5H16A 1WPGA 4XGKA 2YOGA 3MWYW 1D6MA 5AQ1A 1L1QA 3KHTA 3TMKA 3IEUA 1AN9A 4D42A 4CM3A 4QYXA 2HYDA 2XB9A 3UBMA 3DZFA 4EITA 2B2CA 4YFYA 5DISB 1OX4B 3ZI4A 1UT6A 1RM4A 1OD6A 5BWCA 3J81A 1MRZA 3DE4X 4Q12A 3PLRA 5KDOA 2BRUA 3RD5A 1P4HA 1X1SA 1EDOA 1XROA 4LE2A 1SUPA 3I9MA 3LA6A 3N28A 5CD1A 2UVQA 2QTVA 4KGVA 4GS5A 1U8CB 1XCMA 3M1AA 2AL7A 4J2HA 3QHQA 1US8B 3H1GA 3I9LA 1XGKA 5LOVA 3HJUA 2HMYB 3QFCA 2X8LA 1VXRA 1KI6B 3OZSA 2ATIA 1WCV1 1N0HA 2JD0A 2NO1A 2VA9A 3IUMA 3QZUA 1JSCA 4N7JA 4RTNA 3KV3O 1P29A 3ODPA 2FMXA 4OLAA 1ORVA 1P3DA 5ALEA 2GHIA 4GX1A 3O3CA 4QECA 5EKSA 4S35A 3OU6A 5ICCA 3O4VA 2V6IA 4GXTA 2MYPA 4JITA 1T25A 4QGFA 1EHCA 5DE3A 1TL7C 1MABA 3LP8A 3WS7A 5THKA 9LDBA 3DLHA 5TS2A 4J0CA 3O1JC 1GZ4A 3MCTA 1KJZA 5IYZF 4MEBA 5K0BA 1XLTC 2RGWA 1FTGA 4WKBA 4YI3A 3VM6A 3ZGZA 1DIGA 3KTDA 3TIIA 4DMRA 4S0XA 1TRHA 3G85A 1NC3A 1X1DA 5DNEA 4MAFA 2HIGA 2VHJA 3ZE1B 3IAS6 4TKVA 1TD1A 2IEAA 3TAUA 2ZWVA 4P1ZA 2PAFA 1GLNA 2XYHA 5TT1A 3UXYA 4YT2A 1DJMA 5FBQB 3S8YA 4EMTA 1VSBA 1RYDA 2DOKA 5JU6A 1TKAA 2B9VA 3TL2A 3WLOA 4HH1A 1SHUX 3WGIA 2Y1LA 4NV0A 2R8BA 2PE5A 2FJUA 4LNUB 1EGQA 1Z39A 1ZZGA 4UU7A 3SLRA 1SVIA 2DPYA 5JANA 3PTZA 3UMYA 1CY6A 4I6EA 3FTNA 2NU8A 5DI3B 4BVKA 2QIPA 3QQ5A 3DBOB 2C2HA 4IGAA 4KN8A 4P0TA 4PRKA 4C05A 1FNCA 2I2BA 4F6RB 1OU4A 1T5DX 5KC8A 4IDNA 3E5MA 1EGMB 4V0QA 1FC0A 4H7HA 1BOFA 1Q3TA 2I29A 2IXDA 4FYIA 5CURA 5LWHA 1F3OA 1DBWA 1ZHHA 4KUEA 2JLWA 4TS4A 1ODTC 4P22A 2NQ8A 4IL5A 4U0KA 4YUXA 4C0BA 3CX8A 1XJQA 5MF6A 3RBZA 1UL1X 2OP1A 1UWLA 1J0DA 2IDKA 4YMGA 1C0EA 2PIAA 1LZLA 2Q2NA 1QE0A 5CBKA 4Y2GA 4A0FA 5JROA 1E58A 4MPRA 3GUHA 2QM7A 1LV7A 2F67A 3U61B 1AA6A 2YHIB 2QR5A 4BDSA 5IKOA 4BWVA 4DGQA 3AGQA 5C1DA 5JH7A 1N6NA 2WA1A 3N2GB 5MFZA 3VU3A 3ADOA 1L4EA 1QFYA 3T9EA 3B1JA 4KBGA 3PNLA 3WRWA 4B7ZA 3P4YA 1SM4A 1G8AA 1M7HA 3CN7A 1YASA 4DWJA 2I91A 4RTJA 3QRWA 4DCSA 2RBGA 1X80B 1DVRA 5G1NA 5LN1A 3RVOA 5F9FA 1COWA 3IAM1 4G1CA 1KIMA 2XUZA 4U8HA 1QOZA 3R6LA 4QZVA 5B30A 1UMCB 1MHPA 3O3MB 5AVJA 5LNK6 2I2DA 1T6ZA 4DMHA 1G59A 1K7EB 4S1OA 4OU4A 1B23P 3QFSA 4QXOA 5G1OA 3BDAA 3HFGA 3IB3A 3IRVA 4OTZA 3U3RA 4CBVA 1WO8A 2PJDA 3I5MA 3N6RA 4M46A 4WCVA 2R00A 1OCEA 2AFIA 4FP9A 5EE9A 5KOHA 2CV2A 2VHYA 1VA5A 3PD7A 4UHFA 3Q7SA 4GZMA 4MV8A 4E22A 4U6SA 1FLAA 2OYSA 4GPEA 2BJHA 4TXHA 4DLPA 3BJIC 2TS1A 4MYUA 2EX4A 3EXG2 1XZPA 5IUKC 1LB1B 2EKPA 2IYFA 2VJCA 1EWVA 1JQ3A 4IG4A 4KMSA 4RHFA 4P82A 1B16A 4EW1A 3VOBA 3FGNA 3DD1A 3EQ8A 4ONEA 4E4YA 2P1RA 1ZXXA 4UREA 3SXPA 2A1UB 4ZI7F 2IITA 2NXEA 4FC6A 2V96A 1NOKA 2JB9A 4D99A 5LZ9A 2F7SA 1XZHA 1RWWA 1H1DA 2FCAA 2EKLA 3HCBA 1JWBB 1CQIB 2QUAA 2FZVA 2JH8A 5CLIA 1E1RD 2A14A 5H68A 3MTJA 3WIVA 4Y6OA 1M2VB 2IELA 4XRGA 3VR2D 1I4LD 1U8AA 1W94A 3K9HA 1AX9A 4DA0A 2WRZA 4JHLA 3D2BA 1M6VB 2AJLI 2RGBA 2YUIA 4M1QA 2ID8A 1E9EA 4MKFA 4PXSA 4Z0PA 5IN4A 3MCUA 4Q6WA 3K6RA 3QX3A 1W4CA 1UANA 1M66A 1Y6ZA 2P2CA 3A37A 3AU9A 3V4FA 5JCOC 4HDCA 1N2GA 1CJCA 5EIBD 4I36A 1XMXA 3DULA 3PRJA 4CMEA 3JARB 1IVSA 2PJZA 4LI3X 2ZJOA 1PZEA 3NWOA 3QBTA 1GGVA 2XB6A 3FF4A 5MN6A 3IALA 5J3JA 5HM6A 5LMNB 3AR5A 4S2EA 4WVFA 1DT3A 1VL2A 1UMDB 2V7WA 2WWWA 2ZT7A 3RR2A 1FIUA 4OQDA 5IVKA 4LFAB 4AM8A 3SQDA 1SKMA 3TCXB 1PSDA 3E6AA 1ZRNA 1NPYA 2G09A 4MPTA 4MQFA 1Y9ZA 5AVQA 2JZCA 1IWPB 1RBYA 4C7BA 2G88A 4D98A 1IMJA 3HB1A 4TMYA 2FTKE 3I30X 1OIVA 3OMXA 3PNQA 1YZYA 1NV8A 4M55A 2X5XA 4F12A 1G38A 1PEAA 4C7XA 3NTRA 1M33A 2ZYVX 1HE2A 3BORA 3LCJA 4IJWA 4RCZA 4UNSA 1NW7A 3CUTA 4EG3A 1O57A 1T26A 1WXGA 4Y6SA 5K6TA 5AKJA 2BH9A 1PTJA 5ER6A 4KQWA 4DV2B 3LO5A 4DRYA 1PFQA 1DOHA 3AOGA 1F0PA 3IIJA 1VC2A 1SK9A 2WD7A 3Q3IA 4KIFA 4KVZA 4EY7A 3HB9A 5A0TA 1Z7EA 5JMTA 1U5CA 5DBEX 4ZJYA 1DDIA 5JNVA 4FKZA 1YVUA 3WK5A 2OP0A 3NHZA 4B32A 1YBVA 1GSAA 1CJKC 2WJZB 4IJ6A 5K8LA 4B5LA 3U5ZB 3BZBA 4ZCSA 1NGSA 2NSJA 2O1XA 5IEJA 2B3TA 1YNOA 4AF7A 5KTKA 4QPJC 2RH5A 2C3PA 5CFQA 3ESAA 4ARBA 4BTEA 1CUZA 3K0CC 2WHEA 3I61A 2UVPA 2HCJB 1T91A 2OUKA 4GGMX 1Z75A 2Q4RA 4XEUA 1A2QA 1DJOA 2IDMA 2Q4BA 2QDKA 1TEHA 1B1CA 4E5NA 4DYVA 5JXIA 5KJ1A 2QTNA 3P20A 4GMHA 1N3YA 1KPIA 1Q77A 3GT3A 4LJ9A 2MSEB 1CUIA 3VZSA 1QLHA 2HJWA 1SR8A 2WWGA 2BCEA 4R2KA 4ENUA 1D2AA 3H2HA 1EI9A 3QEKA 5JZ9A 4KR7A 2YBEA 3RHTA 4IO0A 1AN0A 1CE8A 2YY7A 2ZQZA 3K0FB 1GZVA 2QTZA 1OAOA 4GO1A 4NARA 2PVPA 4O4JB 3PHLA 3SJ7A 4EYSA 5DW0A 3AF0A 3I8SA 1YS1X 2GBLA 3P9SA 2O5CA 4RVDA 3QWBA 4GMKA 3ZIAD 4Y0AA 1VL6A 3KDAA 4RDXA 1P2SA 3BTOA 3A6PC 3V5NA 1AHNA 5KKNB 4DV6B 3DW3X 2F9FA 1M8JA 2HIMA 3EN0A 3MLBA 2XB8A 3C8HA 5CX1A 5ALNA 4ZVUA 3DB2A 1W30A 3AM5A 4C07A 1JHDA 2ECFA 2OHVA 2Z8YM 2ZB4A 1GPWB 3KXKA 3U0BA 3ENQA 3RS0A 3UPTA 1I1NA 1NE2A 2C5EA 3FJYA 4S1WA 3RHSA 3N6XA 2P65A 3T9CA 4DQDA 3KT8A 1T2VA 4HTFB 2A0UA 2JZOA 4Q3OA 1XD9A 2VXOA 1G6HA 2ZS8A 3BS4A 3KUKA 4A7PA 5AKKA 2CVHA 2FWJA 5GQSA 4RIEA 5GV7A 3SIRA 4JOSA 3K9NA 2JC3A 4MYSA 4D9HA 5BRAA 3OQNA 4Y2SA 3DDZX 2AS0A 2YL2A 1HA3A 4PTZA 2AEJA 5DM2A 3EGXB 3WMWA 1BJKA 4LISA 3KS9A 5CB4F 1FSSA 3HPQA 2D59A 1JALA 2E3JA 3L6OO 3LD9A 4JDPA 3VSCA 1VPLA 4BVAA 4ZK6A 4PSUA 1MX3A 1U8UA 5FLYA 1QVVA 2X19A 1XEWX 2QZPA 2VRNA 3P9XA 4GLJA 4JT4A 4N0EA 1E79D 2B1IA 3BXPA 3QE2A 1ES9A 3PQCA 4UDNA 2BGNA 1VBMA 2BM0A 2P5TB 2VP5A 4TWJA 1WTAA 4U63A 1JHRA 1UJ5A 3MTAA 4HP8A 1M10A 3UJDA 1BOOA 2I87A 3ZDBA 1YFKA 1NUTA 4J0JA 1L3IA 4Q6BA 4Z4GA 2XBLA 4X1OA 1NT2A 2WFAA 5FEUA 1UUFA 4PSAA 1SUAA 1C8KA 1K98A 3TQTA 5JS1A 4FIZA 3DONA 1QHHB 3GRVA 2L0XA 2FP3A 4BBAA 4EK9A 2AI3A 4N8EA 1XWFA 1NUAA 3HA7A 3QF4B 2AXEA 2VDVE 3AWIA 2C82A 4K6MA 2H52A 3GT7A 4AFNA 1P1HA 1GFSA 5BR4A 5AKZA 4LHEA 1WMDA 1KETA 2YXPX 5E9QA 4W8GA 4QSHA 4HVAA 3AU8A 5HDBB 1F20A 1JXMA 4PR0A 4QUAA 4IUCS 4XVQA 1RKQA 2VP3A 2IPXA 4ND7A 4HRXA 5DH9A 1RT9A 1DKOA 2LZ0A 2PUTA 2QVYX 2AEFA 4DLXA 5HJ5A 1GTG1 1M5UA 3MQ4A 3E27A 2CWWA 4N6GA 1PR0A 4JD5A 4NBSA 3V1LA 3BB1A 3U4QA 2H29A 3RYFB 1F12A 2CJWA 3DDHA 1V6CA 2H11A 1Y6RA 3LWZA 5B1HA 3CRZA 4QGGA 4TS1A 4BP1A 4CYMA 2C2WA 1FJHA 3R41A 4CIDA 4EVRA 5BN3B 1MV8A 4NI5A 2XNCA 4PYNA 4C87A 4CUZA 1XRPA 4RSGA 1PZFA 1SO8A 3I0MA 3WKEA 2CNBA 3CKLA 5J2UF 2RBEA 5GJBA 4BV9A 2QRUA 4CMAA 4DV3B 4TXJA 4AAYA 2QD4A 4NAVA 5JO0A 2ZSHA 4URHA 5F7XA 5CXUA 1HR0B 2NADA 4HDRA 3SXJA 4W5QA 2J0EA 1BX0A 1XRNA 4N6NA 5JCXA 1HDGO 2HRQA 3KPUA 2QAGA 3OX4A 2GHQA 4C20A 3HZHA 1H5QA 4H0FA 4HDNA 2ZJ3A 1FNNA 1ESDA 2OFWA 1T1EA 3OC6A 3QVLA 3DV0B 4HWGA 4YFVA 4FYXA 4J4BA 3PNSA 2HA4A 2B8JA 3L9XA 3PHHA 2ZRJA 4BNUA 3HDVA 3RROA 2RJNA 2HU8A 1V25A 4LJ5A 3LYAA 4DM7A 1CVIA 5F98A 1PL8A 2HIHA 4B09A 1EK0A 2E5WA 2ZBFA 3HVUA 4CV0A 2ZUFA 3D1LA 4JENA 3TUZC 1KIFA 1V3QE 1A69A 2XQIA 4OFBA 1QHFA 3AETA 5GJVC 3G8DA 1E2PA 2O0LA 1GNVA 3DPIA 3L07A 1ADBA 2RGEA 3RPEA 3WYEA 5B4UA 4NBVA 1UKVY 1M6HA 4JYPA 3R0ZA 3ASVA 4R81A 4NCAA 1H2HA 5BYAA 2C7GA 4KUHA 1TZMA 1I2DA 4WE3A 1JLMA 1IN6A 4K2HA 1K6XA 1C9DB 1DJPA 5A4FS 1E77A 1LUAA 2J0QA 2OCYC 4RTOA 3MTQA 1NDUA 1UXKA 3IV9A 3ZHQA 2GR9A 4RPLA 3LC2O 1JFVA 2X4DA 4YAEA 3ADDA 5I7AA 5DX0A 5KJCA 1HNNA 4YRJA 4DUGA 3VSEA 3WGKA 3QX9A 3BPSA 4XB2A 3MG9A 4EGCB 4OBWA 1OAAA 4QG3A 1BQ3A 1TCCA 5DJ5A 3ZLUA 2QG4A 2WLSA 3L6BA 2BOVA 3URMA 3O4FA 1YC2A 5EA2A 3AIIA 4D4HA 4YRMA 3NGLA 1TU0A 1V4VA 3NTOA 5EJGA 2J3LA 4I9FA 2JFQA 4I19A 3EWNA 1I5RA 2DY0A 3E23A 3HJBA 2R8YA 4FTWA 3U4MA 1CJVC 1Y8QB 4DG9A 3VSAA 3PXXA 2BFMA 5E6RB 4U8GA 4ZVRA 5EXSA 5FO0A 2IH5A 1O8BA 3A1DA 3V2GA 4LHWA 4QT0A 2WM9B 4CT5A 5CM2Z 1YR9A 2DJ5A 3ABOB 1Y1LA 1TGYA 4A2CA 4MVJH 5F4BA 4F8EA 3QEMA 1QO0A 1RLOA 3GU3A 3AB3A 2ISQA 2ZIGA 3N2ZB 1POXA 2PGLA 1I36A 5C4MA 4MJ3A 2V1UA 4ND3A 1H42A 1EQAA 1TMOA 2XLBA 3LA8A 2RHGB 2R62A 1XTSA 4UAVA 2Q2VA 2J0UA 1H94A 3I2GA 4W9NA 4XE5A 4ZQHA 1RJWA 3RRYA 4EA9A 2H1OA 3FWKA 5LC1A 4IIFA 2O8FB 4UASA 3D6HA 3DMNA 2HA6A 4H3VA 4NCKA 3ESDA 3P8ZA 2OQVA 5TEWA 3AXSA 1JQDA 3SF8A 4KI0A 4JI6B 3EEFA 1MGOA 4WBNB 1PNRA 3N0VA 2PKRA 1P17A 2AZMA 1T3SA 4PBSA 4AJEA 2H9AA 4PIPA 5L3QA 1E9RA 1TOAA 4E5MA 3R7DA 2CLCX 2A9RA 3K9GA 5AI8A 4YPFA 1FLDA 3VUEA 2JVIA 2O19A 1SZDA 1AIPA 3W4IA 4GBGA 2PGAA 1JTFA 1Q0HA 1QCZA 2Y8EA 4P81A 5TQ2B 1MB0A 1EFVA 3QELB 5JZSA 2PUWA 1NBIA 1TAUA 4X3CA 4LY3A 4ZODA 4KQEA 2D1QA 2XSZD 1UBHS 1CQWA 3HDGA 3SICE 2YV5A 1MRNA 2C2OA 2NSLA 3KD2A 3VDXA 4S04A 4TPKA 1P6XA 3LECA 3D4BA 4F5YA 1UM9A 3P0IA 4M8SA 2EWMA 3NOQA 3I6MA 3VPDA 2RGYA 5LIPA 1G4UR 2ZDQA 2FV8A 5C7IO 2Z43A 4UTXA 3PICA 1NVXQ 2V3VA 1II8A 4KCGA 4QJ5A 3T54A 2ONCA 1NQ5A 3M3PA 2QJTA 1K4KA 1RW4A 1Z7YA 4QSMA 3TRDA 3HY6A 1MO3A 1KJNA 1EE2A 1DRKA 1UC8A 4BJ5A 1JR4A 2W8BB 4NZOA 4OUDA 4JEMA 1J4AA 3ORHA 2ID9A 2QI9F 3A3KA 2O8NA 3QXXA 1EMDA 4FEAA 4OQPA 4R1UA 4YCBA 1M1YE 5EWLA 1CBUA 4JP3A 4Q7JB 4JC0A 4QLOA 1Y5NA 1JDPA 3GMDA 2H63A 4LBZA 1GNPA 5BWOA 1G7RA 2RHRA 4JP5A 3W5SA 3HVJA 4GG1A 1GHTA 2I67A 1RM3A 3OCVA 2FLVA 2IV3A 3CVWA 1HTWA 3PNOA 4CV2A 1CP3A 4DSOA 1ZNXA 3U7HB 2NACA 1XKXA 2JIDA 4JLDA 2G0NA 1T4GA 2FJ0A 4JGGA 4L9RA 3FOWA 2CD9A 1B2RA 3WYNA 1UM8A 4YCJA 2NPFA 5DASA 5ES4B 4Y6QA 1GY8A 3V4OA 4EEXA 3JWHA 1QF6A 2F8SA 3RUIA 5I8PA 1OKKA 2I4IA 1A9XB 1VFPA 4YGYA 3TINA 1TM5E 1E60A 4J7XA 5K8JB 1PWXA 5T4BA 1ZEMA 1L7BA 2LBPA 3DHVA 3FMVA 3IT2A 3GJRA 2NU9B 1DELA 1FJ2A 1PQ4A 2P79A 3B3JA 3HSKA 3VJRA 1N78A 1I4TD 2H8GA 4II3A 2VF7A 4RPKA 1KHHA 1QRDA 1TU4A 3FWHA 3PNPA 4CGYA 5BWLA 2RAUA 3D6AA 1Y4DE 3A9VA 1PJ2A 4TLBA 3JQAB 5ENDA 5I9IA 1TQDA 3JVVA 1NJGA 2IY9A 5CYOA 3EY4A 2HMWA 4LRWA 3BTSA 5IKPA 5TJHA 2IWHA 3W8FA 4C6TA 1XZIA 3BRWD 2ZRCA 3K4PA 3NQ41 1AKYA 5FADA 4C4XA 5KQMA 2G1JA 4R9RA 4YJKA 1CRPA 3LCUA 3L8FA 3AERA 3GP3A 4EVQA 1N25A 1SZPA 4B82A 5KSYA 4D44A 1YK0A 3T9AA 3P27A 1CU1A 2BHRA 2TMYA 1ITZA 1H6CA 3RAGA 13PKA 1HQCA 1OI3A 2VT6A 1KZ4A 1SXHA 1NBWB 3BGIA 3Q11A 4BIIA 2ZRMA 4GRAA 2FSFA 3QG5A 4JKYA 3OF3A 4D1YA 5K0TA 3VNUA 1WPXA 3BFPA 1QGUA 2QP4A 3L1KA 1XAJA 1YONA 4D43A 1JR3A 1LEHA 1Z5WA 3ZTWA 3ANXA 1N2CA 4G5SA 3KTOA 1U9IA 2HO4A 1GG9A 4H3SA 3QENA 1J21A 1UOOA 3NVDA 4G4GA 1OAKA 4LTNA 3X1MA 1GM5A 5C8VA 4L5IA 2FR1A 1EFPA 1EG2A 2JGEA 2R86A 3AL3A 1Z4KA 2QPLA 3LSTA 4EHKA 1XQWA 1YULA 5THXA 2EEZA 2BMEA 5SZHB 3W2IA 2FW1A 3GLIB 1CWUA 3OJCA 1XELA 2PD4A 2V98A 6YASA 3QY0A 3IULA 1ENPA 1NN5A 1IUNA 2A0FA 2HSDA 3K1ZA 4RK4A 3T8YA 5J1SB 2QD5A 3FOZA 4CQNA 2VN8A 2H7YA 2NQTA 3NASA 2NUAA 4K28A 4E32A 1M34E 5A4MS 2Z3VA 1F4VA 1PHPA 1YS9A 3FA2A 3BQ9A 4YV0A 1YJCA 2CLFB 4IEFB 4HAXA 5IVIA 2F8TA 1RHRA 3MJHA 3L6EA 1C3EA 2REQA 2LKCA 4MITA 5DFAA 3TPFA 1BAPA 1FFXB 3W4KA 1JMKC 4WCFB 5DSXA 2CE7A 2WJJA 5BYKA 1QYRA 3DBLB 1W0JA 4A8HA 2J41A 2PCLA 4UPVA 1LSUA 1JHAA 2DHEA 4MKHA 1IWBB 1KJYA 3G89A 4HH4A 3LRPA 5EXEA 5KUTA 4LC9A 1WMSA 5FULA 1JWLA 4LA4A 1X7HA 3IEKA 2P9FA 4XUEA 3B1WA 5CDHA 4JAVC 4Z2AA 4Z54A 1PK8A 3KWLA 3O8QB 3TJRA 2BFFA 2A33A 2YWRA 3BCRA 4K6GA 4M0UA 5L3VA 2CFCA 1O3YA 2NN3C 3K2QA 4QHTA 3DKRA 3UAYA 1JFFB 3FPJA 3PPXA 4GOXA 4RXMA 1A8IA 5MFPA 4U39A 2P40A 1LTKA 1EM6A 4Q4AB 4QUEA 4LF6B 4ENPA 2VH1A 3GAFA 4UZSA 1GQSA 1VG8A 3H1FA 3I01M 3JQ8A 2IZ5A 1QHXA 5JT1A 1FRQA 2LKDA 1U5BA 1E4EB 3QWIA 1CJUC 3O3OB 1I0IA 1USGA 3RC3A 4MGIR 1MAVA 4D4KA 1Y1KE 5IXYA 3NB0A 4B9AA 4FFOA 1TZ2A 2DKFA 2QS9A 3CIOA 3QU2A 2EC5A 3C1AA 5KOYA 3N75A 2VP0A 3L4BC 4UC0A 1M1XB 4BKOA 2WPDA 3ZYCA 5CT8A 1D7AA 1AK1A 5TPWA 5H3LA 4X6YA 2XKBA 3MBIA 2XCSB 3AVTA 2C94A 5ULLA 4ZGWA 1S9HA 2P4UA 2V7UA 3SBXA 1T1GA 3UOAB 4ZHQB 4YWJA 4E51A 4YJ3F 4TZKA 3N6VA 1XOIA 1AE1A 4O4LB 1F8FA 3WVNA 4YJ2A 2QT0A 4MWDA 3B60A 3DEHA 3R6TA 4H27A 2YBDA 1JT9A 5D01A 3SXUB 4EHJA 1CQJA 1FYXA 1C9YA 3HVHA 3OTHA 2J08A 1XRRA 2R6HA 1J2JA 3FDFA 3ROZA 4D4LA 1N6RA 2K87A 4EJMA 3B78A 1N2ZA 1Q14A 4V3CA 4A8JB 4C7OA 4NVRA 4R8SA 4IP0A 1CDEA 3TLCA 1PVOA 1EBFA 4ZJPA 1HDEA 5JCZA 1C30B 4NCIA 3CVXA 2W2KA 2AOUA 2JHGA 4QJ3A 4J1QA 4P0PB 2IHZA 2XT6A 4KYTA 4QATA 4JIGA 1BC5A 1FTNA 1SHTX 1TAHA 2WSLA 3R7BA 3ZOZA 1W88B 2SNIE 1P1KA 4B46A 4BC1A 4KR9A 3AHIA 1JI0A 1Y8CA 2WIKA 1PJLA 4A8JA 4QFDA 4BUJA 1A2OA 3FTFA 3LW7A 2OBMA 1AKEA 3ILVA 2ZIVB 4HKTA 4QPPA 3AF6A 2OGUA 1GCAA 4NENA 4NQRA 4OQLA 5LMZA 4Q9AA 3KJQA 2E82A 2OWEA 2X1HA 5E4JA 4R1QA 3R3XA 2GM3A 4ZTZB 4QTXA 1XCOA 5AUNB 2JIZA 3DZ8A 1F38A 2O8BB 3Q8MA 5CEFA 1XEWY 4MUYA 4B44A 1L3BA 3V8EA 5L9AA 5EUCA 2O0HA 1VG9B 3CKYA 1T1RA 4Y1GA 2OD9A 1E2JA 3DAPA 4LXIA 4KVGA 4MLPA 4QAJA 1Y33E 2CLEB 2BHLA 3JXEA 3W04A 5LKRA 3TGLA 2CSUA 3EUFA 4GMFA 1ZAKA 4KG7A 3TW8B 1FMFA 1YR3A 1VKHA 1SOWA 2KS6A 4DL9A 1EDEA 1CRWG 4YRGA 2A4KA 2PYZA 5IVDA 2B4YA 4KIWA 4MWCA 2CZCA 3B3GA 3DNMA 3EXFB 4PLPA 1NHGA 3C14C 4CU2A 3E18A 1QP0A 2OXRA 1NVDA 3VTZA 5GMOA 3BZUA 2OMEA 5ALXA 1HSZA 4I6GA 3SR0A 3SLKA 3V4ZA 1UKCA 3BF7A 2R85A 1S3IA 1T34A 5TGDA 3BMCB 2FPGB 4OO3A 4G6ZA 3UK2A 4UCWA 5DW3A 4CUKA 2Z9DA 2H9IA 1XA3A 1YCGA 4UJ3A 1V8ZA 2VPPA 3HB0A 2QRVB 2PT5A 2VP2A 4J2TA 1UMBA 2X0NA 3V2UA 3GA0A 4JSRA 5KREA 2SECE 3L8HA 4E13A 4XCXA 1A88A 4GW3A 4Q19A 1NLFA 3SR3A 4L8LA 4BE9A 1S2NA 4OIFA 3RAEC 1IPHA 1CY7A 4M1OA 2FF5A 4Y1RB 1WZ2A 1L1RA 1VBNA 2QVLA 2FVYA 2V0NA 1GPUA 4GEGA 4GR5A 4NYIR 4PPQA 2B83A 3KQSA 3PENA 4WZBE 4X94A 4DRXB 5AUOB 2D00A 2QRNA 1XZBA 3BH0A 4QREA 4I1YA 1UDWA 2CNOA 2J45A 2OG2A 1LFDB 1V41E 3MWDB 3OX1A 5IEBA 5ERXA 3ESRA 1GKLA 1G2OA 2FPPA 1X7YB 2ASEA 3VVCA 4BWYA 5F2KA 2FE1A 1ZSVA 3DOCA 1J25A 2Q1YA 2XH8A 4PIMA 1EDDA 4OXYA 4BEJA 1NBAA 1WOYA 2AJBA 4DV1B 1YDEA 1YUBA 1ZD4A 3LPAA 2GJKA 4LFCB 1DQZA 1TI7A 1XRJA 1E2LA 2I6GA 2VNJA 2EZ8A 4K3VA 4BLOA 2HH9A 4F3NA 4HZUA 3BHNA 4ZD6A 3GMTA 1LBQA 3FFTA 2NSYA 3NXSA 4E15A 4FVTA 4MICA 3TLAA 4O8CA 4OK6A 4C9BA 5JC1A 4Z4QA 1J20A 4L16A 1Z2DA 4R1TA 3FVWA 1AG9A 3O2JA 4J7AA 2WIAA 3RYCA 3H83A 3T41A 3T1VA 4I8DA 3ZE6A 4A6DA 4ZARA 3WV4A 4X1YA 5EE5B 2YWXA 5JEDA 1UJBA 2JA2A 3KT0A 1M72A 4WVLA 2XMDA 2Q6IA 4XX1A 2Y4OA 2J6HA 3QLJA 1UAGA 4W9RA 5AVTA 4LY6A 3MJEA 2YOHA 5HKAA 3UV7A 4FGLA 4QO7A 1E6UA 4ALLA 1CUVA 2RHHA 3HU5A 1E3LA 3BJZA 3CLUC 1Q21A 2QR3A 1B1AA 2QSYA 4I2VA 3WMRA 3N3BC 3OLVA 2Y0CA 1UBOS 1U7DA 2WILA 1OROA 4UBJA 1XDDA 1BCRA 1FUKA 2EZUA 3E9ZA 5ILQA 4Z3DA 3LPDA 5DDIP 1SIUA 2NO5A 3G79A 1GADO 1OX4A 4B6QA 3DOUA 2O3JA 2I6TA 4YX9A 3T3NA 3D6MA 4WKNA 3KYDB 1MB9A 1P7VA 3O1LA 4TT8A 3H2SA 3ZDCA 3ONVA 2IUSA 3KB6A 4MS1A 1R37A 2Y66A 5A05A 3A4IA 3BWBA 3VVLA 2BR5A 3ZXYA 2PSDA 3OMLA 3RVNA 1EHIA 4AS3A 4OYYA 1Q11A 2QDXA 3T7RA 2ZIWB 4J9UE 5LM3A 4ZO7A 2EFGA 2L17A 4YCLA 4ARCA 1UKBA 1V5GA 4KN6A 5FL3A 3KYCB 3S1LA 1ZBQA 1JE0A 2AR9A 5FWXA 2QR2A 2I99A 1FNDA 1EIWA 3VTAA 1ZXLA 2GJSA 3ETHA 1CR2A 3HPRA 4RWEA 3ET5A 1F2TB 1Z37A 4QWWA 4UCQA 5JUWA 4YY3B 3AVYA 5AJWA 3A28A 3GBPA 1RI2A 1CZHA 1KMMA 2NTYC 2OOSA 1VL1A 3R09A 4WY2A 2Q2OA 1PJRA 5F1PA 3WHLA 4MUFA 3ADPA 2P35A 4PZDA 3VR1A 4F3KA 1NV9A 5AUPB 4CKEA 4YIHA 4GGPA 3ZWKA 4B3IA 3MD0A 5BV1A 1GKYA 5IN5A 3O9ZA 1N2BA 1X7WB 4H7DA 2QSJA 3MWJA 3W0LB 2AZTA 4B48A 1G5IA 1GG8A 5TXGA 1U7WA 2AHOA 1I7DA 4JJ6A 3IE1A 2EJBA 2VWHA 5HOQA 3PEWA 1RD4A 2XNKA 3AJ8A 3ONWA 4PLCA 4K7JA 1AM4D 4HX5A 4KLZA 2B4QA 1X1AA 1XZAA 1PZGA 4G1UC 2Y99A 1RYBA 4AXBA 5AM2A 1MT3A 4CL2A 1S5PA 1CXZA 1P9OA 5FHQA 1DV2A 3WICA 4ZVMA 4MPPA 1WQ4A 1U2GC 4UVEA 4BO4A 5DEOA 3KK0A 4IGKA 4IZIA 1Z06A 4X8MA 4YROA 2GCOA 2FSGA 2Y77A 3R7WB 3QVSA 4KQCA 4MQUA 2P1DA 3M9LA 5DI3A 2OHGA 1PR4A 1P1RA 3TOZA 4IIEA 4L4YA 1IY8A 4C0QC 2WICA 2YCLA 1YUMA 1ZD1A 2EZTA 4DYDA 4GD3Q 4LV6A 2ZR7A 5HG0A 2BV3A 2EG9A 5CITA 1CUWA 1NQAO 2QKYA 1Y6FA 5F1YA 2QMZA 4NXNB 4OMDA 4NZNA 4CKZA 4IWXA 4AP6A 1SC4A 5ICGA 4FHDA 3MJ4A 1G1MA 2VYQA 1RPNA 3NIDB 3ZK8A 1XPOA 2R96A 1BD3A 3IT1A 3R2JA 4LC0A 2X0FA 1NYQA 3H4IA 2GN1A 2JAQA 5JPDA 4WLOA 4F3CA 5TGZA 2CLOB 2QGZA 2YHIA 4OREX 3FKJA 5A1TA 4TZ0A 1NJ1A 1ZVKA 2BGUA 2BJVA 3SF0A 1P44A 4N82A 4KH1A 2IEDA 4BXOB 5A5FA 5AI9A 2JAHA 3EXHC 4RVUA 1ZMRA 3DVSX 3FYUC 3DT9A 4CV3A 4KDCA 3T9BA 4QT4A 3B53X 4X3OA 3IXMA 5BQPA 5G0UA 4DXDA 5JCPA 1U3TA 3P52A 1PVVA 2I5PO 5DT9A 1M0EA 2PMFA 3J81k 1CIVA 1E8MA 1OMOA 2BE9A 3L7AA 1PFUA 1X80A 3PHBE 4Y1EA 5U4XA 4FW8A 4WFJA 3ZVLA 1FFGA 3OFVA 4OKNA 1WPRA 4C4TA 4CN8A 3G5AA 3QIAA 4GI1A 5EKUA 4XWGA 3UJBA 3ROQA 4OHKA 4ZFNA 4IY1A 2BFEA 1UWCA 4IQFA 1W2GA 4G5RA 5FCDA 3KPWA 5B2ZA 5IX8A 3D43A 3OICA 4BVBA 1SK8A 3PDUA 4BMYA 3JAWB 5FWYB 1ZH2A 5I3CA 5M7EA 2QMHA 4D02A 5I7RA 1JIKA 5JHGB 3ROGA 1FYDA 2ETVA 2NZJA 3R3ZA 4ILEA 4OXQA 4US2R 5FJJA 2YWDA 4ZQGA 3SOPA 5IAGA 1UBSB 3CNOA 2REBA 4MWTA 5KYKA 2QLTA 3D6FA 3TH5A 1OXKB 2R7KA 4I1VA 3B5IA 2IYEA 4JLMA 3K8OE 4MJLA 5HZGA 2WYVA 1EYZA 2IF2A 3FFAA 1BMTA 2VHCA 2WKSA 5CPFA 2QTCA 2WYIA 5EYPB 1NURA 1GO2A 2E5FA 3D2AA 4O4HB 2OO5C 4WY5A 5REQA 1YZNA 2J9XB 2R84A 1JIXA 2Q0HA 3ZCPA 4YQZA 5DLQC 2IX3A 1HKHA 1GXSA 2IEGA 4GBJA 4A0GA 5BSUA 1VB5A 3RSLA 4TTRA 2BTQA 2XYVA 3P2YA 4H1VA 5A9SA 1T3LA 3G13A 2YJ3A 3S8MA 1R0KA 3I5XA 1KJ8A 3PNVA 5LLSA 5FOUA 4CFZA 1ADYA 3SYRA 4F4JA 5DNUA 3S5UA 2CLIB 4WZ6A 4RAQA 2TYSB 1U9JA 3UGKA 2OCXA 1N2EA 3PGMA 2BDEA 1M6VA 3COSA 4WNIA 3ETNA 5G02A 2ZTSA 2O0KA 4U2GA 5GOTA 2VR1A 3S2FA 3U9SA 3TFOA 3U09A 2EF0A 1VLMA 4GC9A 2ONYA 3FDZA 2E89A 4M8KA 1BJTA 3PLNA 5HIKA 2V97A 2MINB 1LI4A 1IBRA 1S2DA 2DTXA 2I33A 3R5SA 4MQ4A 2UYCA 4UXIA 5EFOA 3BD8A 2XX3A 3U3KA 3VNRA 3GLFE 5K0GA 2AX4A 2FCRA 3I2IA 4UUQA 1H6DA 2VEDA 2XUJA 4LWPA 2ZVQX 1I2ZA 4AQ7A 5ALHA 3PFGA 3QTTA 4UXHA 3DBIA 4HWRA 5AICA 5E9AA 5IMBA 2F8LA 1UMDA 1SOVA 2FEKA 1OFTA 4Z9YA 4ZTBA 4DLZA 5C5IA 3GG9A 4Q3KA 4Q7MB 1S3GA 1HFJA 2WNHA 4RZXA 2CMGA 4AJKA 1XD8A 4R8KA 4BLUA 5E7IA 3MGGA 3RV4A 1R5NA 4X1IA 1V39A 3T6KA 1PLKA 3HJFA 2UKDA 4IV0A 5CLJA 2DH6A 1XMOB 4ZGBA 2UUAB 1QIIA 2O8DA 3EIFA 3C7KA 3QU7A 2HXSA 2FUG1 2WWRA 1W36C 1V1MA 2ZOSA 1QIEA 1HGXA 1SC3A 1IZ0A 2JIMA 4FHGA 3TQRA 2Z6AA 5A4JA 4FYWA 1GIAA 1O89A 4Z51A 4ISCA 1XVTA 1BXGA 1XU4A 2NTJA 2QLMA 5DSZA 5JV5A 2YY6A 3F6SA 4N3GA 2X3UA 4BGUA 2GM4A 1KTVA 2L19A 2PEZA 2YFHA 2Y0DA 4I1UA 1EH5A 1JJ7A 2VAMA 3TI9A 4DPMA 5AHKA 2C03A 3H11B 4KRGA 4QOEA 3WWOA 3SYKA 4EG7A 4YHBA 2H1LA 4ZHQF 2ZSDA 5DYIA 1Z4MA 4JBGA 3EZ9A 4HN4B 2X41A 3Q8XB 5C81A 2PX8A 3SN6A 1DSSG 4O4LF 4BPRA 1XTKA 2I3AA 1YF3A 3FM9A 4DR1B 4BAGA 2CNKA 5EJ2A 5EN4A 3Q1KA 1NJ2A 4QPCA 1HE4A 3P19A 5GM2A 5FBRB 2D2EA 2RJ3A 2VT2A 2XMPA 5HA5A 1S4QA 2A1TR 5KI6A 4ZVVA 5A5DA 4K9DA 4YEDA 2J32A 1ZVMA 2QZ9A 2WT8A 1ZR2A 4JODA 2GLUA 4EHIA 1GT91 1YZHA 1Y34E 4RJJA 2Z4RA 1C3OB 2DM6A 3P2JA 4IFIA 3M6VA 1CJTC 4LSGA 4DLVA 2O48X 1C1XB 4ZVKA 3KOYA 1KYVA 1Z12A 3U40A 2A0WA 2FFJA 1V7ZA 5G2OA 4YCNA 5L8VA 1EFAA 3LKZA 1DE0A 1MTOA 2FDXA 1FXUA 3AFIA 1U0NA 4NNJA 4R1PA 2JBAB 4JLOA 4QU8A 5K0LA 2NO7A 4EECA 3K0FA 4JVNA 4L8VA 1I7PA 3RJMA 3G9UA 1L7OA 2P4HX 3ECCA 3RODA 2A67A 1AOXA 4DVGA 4ENWA 3M83A 5GINE 1JVBA 4S1VA 2H0RA 5K2MA 1YJAA 2B7BA 3KU4A 4M1YA 1R66A 2IEZA 3KD3A 4CL0A 5CA0B 2PFKA 3EULA 5FPTA 3C3CA 3UWPA 5K3DA 4PC7A 1OZHA 4DIUA 5K8VA 1OZAA 3AR8A 2ZEJA 1DKPA 4MWZA 2JEOA 1JSLA 1R0SA 1H2RS 2C3UA 4QARA 5EHQA 5IU6A 3RTBA 4XJSA 5HMMA 1UCFA 1N3BA 1N6LA 2PVCA 3RTEA 3TF5A 1FPMA 3NKFA 4I8IA 4X6XA 1GTSA 4CFYA 1EBBA 3NBYC 3RV3A 1G21A 4DMGA 2J07A 4DA9A 2FZ4A 2X6TA 4IXMA 3VR4A 4F92B 2BGLA 2WJVA 2WHRA 1YVEI 4NC9A 4PYRA 1NVWQ 2GETA 4F4IA 2IK8A 3PXDA 3K5PA 1BN6A 3GQBB 4J91A 2QD2A 3B9QA 3WNZA 3STTA 4A0HA 4ZAFA 3X1YA 5LP1A 1A4XA 2AH5A 3FBGA 4J03A 3LVRE 4LAFA 3UQYS 2HXYA 1YB6A 4CLDA 4QRDA 1HOTA 4G8CA 4GKBA 1QORA 3NDBB 2P41A 4N0PA 4XVUA 4HGRA 5AKLA 2Z08A 4PZCA 1NDQA 4BX8A 4C7VA 2X8JB 2FEWB 5KX5A 3HO1A 2COEA 1YOVB 4LVOA 4K6OA 4S0ZA 3B3FA 5ECGC 1PEDA 1ZUHA 3GOHA 4GPBA 3Q15C 5E0KB 2FA9A 2G06A 3PXUA 3RUCA 1WKCA 3D64A 3R0JA 4CJXA 5H4GA 3IUJA 3AF2A 1GAWA 1U1DA 4N5MA 3S1SA 1PUJA 4Z2YA 1G63A 3B7PA 1HDRA 3LWNA 5CH8A 3SKYA 1JX6A 1H1LB 2QN3A 3ZR4B 3ADBA 5JXWA 2BUBA 1HLPA 2QROA 4ZVPA 3ZWXA 2ZWIA 4UE6A 2CUKA 5LP6B 4E11A 1YMQA 1I6WA 3M6WA 4FGJA 3NXKA 5JSZB 1NUHA 1N6PA 1WM1A 2H18A 2H2WA 1C14A 2BHNA 3K35A 1RC8A 2F62A 4EQ6B 4ESHA 4BFVA 4NAUA 2FK8A 3QMVA 5HYVA 3AJDA 4KXMA 4ENTA 1AD2A 4FHZA 1XB2A 1ZK0A 2JCYA 2ZWOA 3KJHA 3AFNA 4TWAA 1H85A 1E3WB 2F4VB 4G0XA 2E5LB 3MS7A 1I4WA 2H4XA 1T9CA 3GFTA 4JQCA 2J8ZA 1IK4A 2MOKA 3B2NA 3ZC3A 4KJXA 3RYFA 2IHUA 1S02A 4UBMA 1XQXA 5ICFA 1E63A 1Z4NA 2IU3A 2ORVA 3T3EA 1YNSA 3A2NA 4J4HA 2H08A 5F5NA 4JX8A 1SD5A 4ALIA 3AJRA 3CUEF 3DWEX 5ITZB 1BYIA 1FUYB 4MB2A 2F1JA 1N2XA 5F4ZA 1X42A 3IPXA 3C3WA 3K70D 1M83A 3ZGLA 4WOJA 5U9CA 3WL4A 3MQFA 2VATA 3S0JA 1T4CA 4XDGA 5IG2A 3SZGA 2ENUA 3IH5A 4TRNA 4KR2A 4DCUA 1SKQA 1FYFA 4Q4JB 1LF0A 2FJPA 3IKMB 1U0OC 1ZI6A 4PLFA 4ZMRA 3H75A 5HFAA 3BWXA 4RVNA 4PAGA 1NKTA 3I83A 1FMTA 3HYTA 3IHLA 3PRHA 4KIJA 2QQGA 1NIPA 4CTOA 4REMA 5K3OA 3EGEA 3T5AA 3OZRA 3AQ4A 2G3YA 4QEKA 1NG9A 4XVHA 1KERA 4CVNA 1JB9A 4KI7A 5DYGA 5B37A 5HUJA 3ACCA 5B55A 4GHWA 3CO0S 5J4KA 1YKGA 1XVUA 2QRMA 2IHYA 2OHIA 3U1TA 4YRDA 5F7JA 4HUQA 4B3HA 1QFSA 2GZ3A 3QK7A 4XGQA 5TVGA 1J33A 2IE8A 4WL0A 5D2CA 3G2KA 3N2YA 3MMPA 2ODAA 3LKVA 4U6NA 5JPCA 1FQJA 2NTVA 4OJYA 1JEYA 4JC8A 2EW1A 3UB4A 3WL3A 4J0GA 4GBED 4EY6A 3ER9A 5K05A 3EK2A 4E7OA 2AI2A 3K0HA 4CM1A 3ENZA 1JJIA 5JQWA 5KOIA 1RYHA 1BXRB 2JAXA 2PS1A 5F7OA 3E4CA 3K9CA 4GWKA 1SEPA 4L73A 4M2LA 2J09A 1ARZA 3DZCA 2QEQA 1E2QA 2SKDA 3K9LA 1YL5A 2BM1A 4IW3B 4IDEA 2Z4TA 2ZDGA 1XA0A 1ENOA 3HRHA 4JOQA 4OAQA 5TC4A 3RWMB 4LV8B 3JQ6A 4F8JA 3OVMA 5KNLA 1Z38A 1Z4IA 3K5WA 4AYWA 3IRUA 4KL8S 3ELDA 2QTGA 1T15A 1DO2A 2X77A 1ORHA 2BHSA 3R1IA 4XOUA 4B6EA 2JLYA 1ZUNB 2LCFA 3HABA 2CXRA 2XNSA 1AQYA 1NQOA 1T5BA 4HLUC 5JBNA 3WK6A 4M37A 4JL8A 1VPWA 3ZZNA 2HU7A 2G4CA 4N3BA 4LYYA 2X2PA 4QQRA 4RO0A 4LVCA 1VLQA 1YQXA 3I2JA 1RQPA 1UMKA 4K1XA 4KYIB 5KHOC 4TYQA 4RTPA 5PGMA 3MS2A