4MZDA

High resolution crystal structure of the nisin leader peptidase nisp from lactococcus lactis
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
424
structure length
356
Chain Sequence
SHDFWDYQWDMKYVTNNGESYALYQPSKKISVGIIDSGIMEEHPDLSNSLGNYFKNLVPKGGFDNEEPDETGNPSDIVDKMGHGTEVAGQITANGNILGVAPGITVNIYRVFGENLSKSEWVARAIRRAADDGNKVINISAGQYLMISGSYDDGTNDYQEYLNYKSAINYATAKGSIVVAALGNDSLNIQDNQTMINFLKRFRSIKVPGKVVDAPSVFEDVIAVGGIDGYGNISDFSNIGADAIYAPAGTTANFKKYGQDKFVSQGYYLKDWLFTTTNTGWYQYVYGNSFATPKVSGALALVVDKYGIKNPNQLKRFLLMNSPEVNGNRVLNIVDLLNGKNKAANNRNSRGAVSVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the nisin leader peptidase NisP revealing a C-terminal autocleavage activity.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Hydrolase
molecule keywords Nisin leader peptide-processing serine protease NisP
total genus 142
structure length 356
sequence length 424
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4mzdA00
1Q5PA 2PWBA 4NMXB 3PTLA 5CW1A 5I9SA 3UNXA 4NE7A 1YJCA 1BFKA 3DE4X 1NDQA 4DJ5X 1AF4A 2Z30A 1BFUA 3DW1X 4H6VA 1KE2A 3VHQA 3BGOS 3DVRX 4JP8A 1V6CA 1SBTA 1WMFA 2WUVA 5SICE 2ZWOA 1CNMA 3WIVA 4C3VA 2W2OA 3LPCA 3F49S 3WIUA 4CFZA 3CNQS 4HVLA 1BE8A 2Z2XA 2ST1A 4OMCA 1AQNA 3P5BA 1OT5A 3SICE 1T1GA 1ZVJA 3LPAA 4WOCA 1PFGA 3H42B 1SN7A 1TM1E 1TM3E 1TM5E 1GTG1 3DW3X 3Q5GA 3F7OA 3LXUX 1P7WA 1GTJ1 1GA4A 1SUDA 2SBTA 3WHIA 2IY9A 4RYDA 4MZDA 3VYVA 4DWWA 4H6XA 3GCWA 1P8JA 1TM7E 3D43A 3L1KA 5AQEA 2WV7A 1ST2A 1GA6A 2PYZA 2HD4A 4LVNA 1AU9A 2X8JA 3DE0X 1JEAA 1NLUA 2B6NA 3DE2X 4OV6B 1GT91 3DE6X 2ZRQA 1BJRE 1IC6A 4KPGA 1OYVA 1UBNA 2X8JB 1ZVKA 2XRMA 5FAXA 3QMPA 3BPSA 1Y9ZA 3DE3X 5JMOA 1IAVA 3ZXXA 5B1EA 1SUCA 2W2MA 4WOBA 1SBCA 3QTLA 5JXIA 4CFYA 1SUPA 1C3LA 1SCJA 1C9MA 1TECE 3EDYA 3HJRA 2P4EA 1KDVA 2G4VA 1WSDA 3VTAA 4DZTA 2ID4A 1BE6A 1KE1A 2SICE 5ARBA 3GT4A 1EGQA 5FFNA 3TI7A 2PQ2A 1VSBA 3PRKE 2QTWB 3OSZA 3VSBA 2W2NA 3I34X 3TECE 4AKTA 1Y4AE 1SIBE 2V8BA 3F7MA 1Y3FE 2WUWE 3A3PA 4C3UA 1GNVA 2Z2YA 1AH2A 2PWAA 3AJ8A 1SIOA 3SQOA 4Z2AA 1ST3A 1SPBS 1AK9A 2ID8A 3DDZX 3Q40A 1GTL1 2DUJA 1C9JA 1YJAA 1MPTA 1Y34E 4K8RB 5ARCA 5AVKA 4NE9A 1NDUA 1Y48E 3TI9A 2E1PA 3EIFA 1SCDA 5FBZA 1DBIA 3ZXYA 1P7VA 4LVOA 4H6WA 3DYBA 1HT3A 1TM4E 2PKCA 1Y3CE 3I30X 1BH6A 2IXTA 1LW6E 1SIUA 5AMXA 5B1DA 1TO1E 1EA7A 1Y1KE 1Y3DE 1A2QA 1SCNE 1AV7A 2XTJA 3A3NA 3BX1A 3I2YX 3AFGA 4B5LA 1SBIA 1XF1A 4GI3A 1R0RE 5AVJA 2TECE 5JXHA 1PJ8A 2Z58A 3GT3A 2Z2ZA 1R6VA 1THMA 1SH7A 2DQKA 1TO2E 1CSEE 1MEEA 2PMWB 2WWTA 3DE5X 1GA1A 3T41A 2SNIE 1TMGE 2W2QA 4I0WB 4ZARA 1WMDA 2GKOA 4BWGA 4ZOQI 1GNSA 1S02A 3DE1X 4FONA 3VV2A 3A3OA 1R64A 4YN3A 1SUAA 2DP4E 4OMDA 1S2NA 1Y3BE 4KG7A 1YJBA 1T1IA 1SELA 3VV3A 1SUEA 1OYOA 3DE7X 1DUIA 3AJ9A 1PEKE 2SECE 2HPZA 1WMEA 2W2PA 1SVNA 4M1ZA 4HX2A 1SBNE 3QFHA 1C9NA 4J94A 5K7SA 1GCIA 1T1EA 1YU6A 2PRKA 4KB5A 2Z57A 1S01A 3DWEX 1TK2A 3LPDA 3CO0S 3WQBA 5JXGA 5JXJA 1Y33E 1Y4DE 3EE6A 1SUBA 3D9QX 1KDZA 5ARDA 1SCAA 1SCBA 2ZWPA 3DVSX 1AVTA 1V5IA 3GCXA 1SBHA 4AKSA 1KDYA 3I37X 4CG0A 1WVMA 3DVQX 1PTKA 2Z56A
chains in the Genus database with same CATH superfamily
1UXHA 4JJGA 4UMVA 4HZIA 1ECPA 3GAMA 3UZUA 2A84A 5D3MB 5JOQA 2QX6A 2CLKB 3THWA 3BH0A 1QRUA 1KE2A 3RSLA 5E8RA 2K7FA 2QUIA 1QZUA 2JIZD 2EVWX 3GD5A 2I6QA 3GIDA 3TZEA 2PT7A 4C04A 4AVYA 2AR0A 2P9FA 2EJCA 5F78A 2XNCA 3SK0A 1L8AA 3EUEA 3L6UA 3EGXB 1DQZA 1XFDA 8MHTA 3QVLA 3CH4B 2NU7A 3EDQA 3VPFA 5ELLA 3H42B 4ZZ0A 2B6HA 4JJ4A 4N0DA 1CRQA 1PUXA 2Y71A 4F5DA 1NLZA 4IKOA 5K8UA 1NQAO 4WKPA 3ROKA 4Z4GA 2L19A 3MWEA 1VIYA 3UB3A 3LC1O 4Y9UA 1P5FA 2VDRB 3SYTA 1RPAA 3HVRA 3CTPA 3TW8A 2HRBA 4CDNA 4AZWA 3E2MA 3P0IA 1ND6A 4D9JA 2P77A 2QSUA 5D5PA 1JSRA 2XSZD 2QW8A 4N0MA 5CMLA 4C3ZA 5A3QA 4TOIA 5HIKA 5JC8A 3S2SA 1AF7A 1T2FA 3NNDA 3FPJA 4NCHA 4IHKA 1X70A 1RJGA 2ALJA 3FDIA 1SC4A 2GCNA 3RFXA 4GPD1 4MWOA 4QU0A 2HLDA 5M3BA 3D6UA 5K3FA 3EGDB 1GG8A 4Q1EA 3ADPA 5T4BA 3SE7A 7ADHA 3WQRA 5FNVF 3GEGA 3IXMA 3NBMA 5CU7A 1DG1G 2IKQA 3NAGA 2BEUA 4YDSA 3O0DA 5DBFA 1EI9A 4PQEA 3WK9A 2A8YA 2PLWA 3FETA 2HF9A 4JEUA 4L51A 2WD9A 3FIJA 3TQCA 2HT6A 2P3SA 2VZEA 2OHFA 3ANLA 1XDBA 2ZTHA 4RK7A 3H99A 4N3GA 3R40A 4FX5A 4QJ5A 4UQOA 4LF5B 1H22A 2WVGA 2PM8A 5IASA 4A36A 1XD2A 3AINA 3JATB 3NAQA 4QL3A 2OBNA 4RMIA 1GDTA 4BNLA 1JV2B 3TINA 4DAEA 2PN1A 1Z35A 1FJ2A 1NOJA 3EXFA 4J6EA 1OY1A 2CCKA 1NLYA 3LDAA 1JKIA 4R3NA 5E6UB 2GFHA 4INOA 3F3KA 1UC4B 1YXMA 3DT6A 5ILOA 1KVRA 1F3LA 3BK1A 1LNQA 2VBIA 3FMFA 1DAHA 1S3SA 3IPRA 2UYCA 5GJVC 1QP7A 4OQYA 2WFLB 2RC5A 1S2GA 4K03A 4XWWA 1AS3A 4HB4A 3SJUA 1Q15A 2XCOA 2XCQA 3ZDCA 3W9BA 3EX7C 1RI3A 3B51X 4HF7A 2FFAA 5CDFE 1B0AA 1NATA 4DBLC 4WH0A 3PQ6A 3ZHBA 1F1JA 1AQIA 2D0OB 1QK3A 3O8OB 4LRTB 4BEVA 3D4LA 1R64A 1ZMOA 4YN3A 4DREA 1W93A 1Y3BE 2OBYA 2C2MA 2Q2OA 4QUDA 3UK6A 1L4MA 3O93A 2QMZA 4BKQA 4DLVA 1QGOA 3CZMA 1WMEA 4DUGA 1QDLB 3G5TA 4BQEA 1YIDA 1WZEA 3QOXA 5CVVA 1E18A 3H3XA 4JBNA 1RZVA 4LV5B 5CURA 1H4QA 3PX3A 4PGMA 3JWPA 4DOMA 1PYDA 4E32A 1GY8A 3H1AA 1PFUA 2BZSA 4KKVA 3NASA 4M0MA 3DBLB 3KALA 3BD6A 2QPAA 3TTTA 4LY6A 3DXXA 1VLHA 3GWGA 1TMOA 2GFQA 3BUSA 3KVVA 4XD7A 4ZEWA 1TYEB 2PVCA 1E4EB 2QTZA 3JARA 2WNIA 1LWOA 5K3BA 4WEOA 2I1WA 1D2RA 5C5CA 3BL5A 4HI0E 3SC2B 1G6HA 2FW0A 3MTQA 2W2OA 3O82A 2AKEA 4LJ7A 3EJ6A 4J91A 2I3DA 4FNOA 2A59A 3HQ4O 1FUUA 4Y2YA 2D3WA 4RX1A 3P9SA 4Q03A 2Q7XA 3FWNA 2C88A 4RH3A 1P9WA 1J2TA 2HREA 1Q3TA 4HTFB 4RLHA 1GQOA 4YJKA 3SLRA 1ADJA 1EVQA 2ICAA 1W9MA 1QP8A 2H06A 4IAOA 3UMJA 3B6ZA 5A6SA 2GHRA 3IUJA 4DARA 3RYCA 2QT1A 3ZIAA 1TU4A 4P3PA 3M49A 1O0BA 4D98A 2OCKA 1V1MB 2X8BA 3ZV4A 2D2VA 3H9CA 3UFXB 3NX4A 5FAXA 3HBFA 2W2KA 3ZGNA 4AZVA 4I50B 2OKGA 5GP1A 2ATIA 3V7YA 3LFUA 3VKVA 4RTRA 5F7OA 2YW2A 3D6MA 2C7QA 1VM6A 1R8YA 3DTNA 2CHQA 1W35A 5FI3A 3BSWA 2A3RA 2B4RO 3WL7A 1VZ2A 1SHKA 2Q3HA 1JZTA 2E87A 1ISPA 1M2JA 4J43A 2GM3A 2W11A 1AUVA 3NBUA 4RHXA 2OAEA 5T57A 4O33A 1T0PA 5F4BA 1VPVA 2HSEA 3U60B 3H1EA 2M98A 3O2JA 5C53B 1ZQ9A 3CFYA 1MIOB 4U2CA 3DAHA 4P2GA 1YBFA 1YO6A 1XZNA 2II6A 2PL5A 2VXOA 4L8YA 1RM4A 1SCUB 3PNLA 5B3AA 3BD8A 4Z2AA 4EI7A 1Z4PX 5BN3B 2OSBA 4X3PA 2J1LA 3EFHA 3LECA 2H1CA 1KEUA 1U94A 1JA0A 1W4BA 2B5OA 3PKZA 3PYLA 4HSEA 3CH5A 4KUHA 4MYTA 4YAOA 4YDHB 4BBZA 4F21A 1Z8FA 3WB9A 2WFZA 1GGFA 4HSGA 4KO1S 4OHVA 4CI9A 5LYJB 1EGHA 1O2DA 4TL9A 1IHDA 4YMLA 2HB6A 4L57A 5HCUA 1ZM3A 2ZYUX 8ATCA 1CP2A 1W4RA 1WWKA 5B1DA 4GU5A 4HLQB 4TVOA 2WEKA 4DMRA 4XLTA 1AV7A 1T9GS 2H3EA 1GXSB 1OLSA 2PV7A 1Q92A 1SBIA 2WJJA 1T91A 4LDPA 5LZ8A 3ROPA 3WGZA 5KBYA 1TGVA 1IVSA 1F51E 2P40A 3KOUA 3UJAA 7MDHA 1E3LA 5HF6A 1AD2A 2Z2KA 4M8LA 4IH4A 4EHAA 4OGGA 4TRJA 4B6GA 4FONA 4Q5IA 1BGVA 5H9VA 1FDRA 2DTXA 3LSTA 4OFZA 4WRRA 3ZDFA 2KBEA 1DG9A 1ML4A 3WQHA 4NU0A 1IB0A 1XQ1A 2HK6A 3EBLA 3K7EA 3WX0A 1P2BA 2ZUVA 2YHUA 3DEHA 4A8HA 4D0NA 4QATA 1QIEA 4NOKA 1Z2CA 4DV3B 4RTNA 2V7TA 3SNKA 3ZN2A 1L6RA 3LBHA 4QUIA 1WUKS 5ULLA 4TYMA 3PB3A 4A7PA 1NAIA 4V0OA 4DR1B 4BUJA 2CUKA 2VYNA 3NGMA 1CQIB 4PU0A 5K3AA 4EHLA 4F7DA 3SQWA 1X1RA 4F5EA 4RS3A 4P5EA 2V1XA 4V0NA 3EOAI 1JL3A 3OT5A 1NU8A 2DHEA 3AVQA 1QORA 2BL4A 4IQFA 3QELA 4RZSA 4YJ2A 2F6RA 3ETEA 3TIXB 1L1QA 3RH0A 1MA3A 3ZJ5A 1AHNA 1TYZA 3GV0A 4DJ5X 5H4GA 3G8DA 2PD6A 1REQA 3LNTA 4BC1A 1RQXA 4A92A 3V9AA 4BJHB 3NDBB 3PL1A 1YQUA 1X7ZA 1RYYA 2BCGY 3I05A 1A69A 2Z2XA 1KH2A 1ZNWA 4MYHA 1G8YA 4IHJB 4RLSA 4YRNA 1FUYB 3FTDA 1S89A 2B8NA 2Q5CA 3LLVA 3IEVA 1LX6A 4XDGA 2FJUA 1KYVA 2EZTA 3K5PA 3OPQA 3VR6A 3QEBZ 3IE0A 2DBZA 4ER3A 1GQ2A 2EERA 2XQKA 3PNBA 1ZJYA 5CD1A 3WMWA 3A58B 4YJ3F 1RKQA 5AK4A 4DT1B 4Y0NA 2F4VB 2O2ZA 2UVQA 4BNKA 2P30A 3EGXA 2GPTA 1T26A 3W79A 4CM8A 2A0WA 2FUKA 5K2OA 2J3KA 5JYDA 4BNMA 2QX8A 1NLUA 3PI7A 4C3OB 4DLBA 1BJRE 2A1TS 2IDZA 3HN7A 3QOYA 4S1WA 2XTNA 4DYVA 3OQBA 4IR7A 1UXJA 4FYHA 4OXYA 4DSUA 1O6FA 3AUJB 4BNDB 5A3SA 3HO1A 1QU2A 1DRKA 1M3SA 3HDQA 1OU0A 1Z0KA 4R3UC 3ASYA 4GZ3A 3C14C 4MUNA 4JJKA 3RTCA 2BHLA 3H4IA 2X0EA 4P4GA 5A6VA 1IUNA 3DP7A 5K05A 5TNXA 4QDZA 2WDZA 4OO3A 5JIBA 2GXQA 2P3LA 1K2WA 2DHCA 2V5UA 4CMIB 4HH1A 5IZ4A 2NYAA 2YVKA 2H7CA 2D5CA 2JJ1D 4RSRA 3L8HA 2WVAA 5ADUS 2KI5A 3PR1A 1CEEA 1WXHA 4UU1A 1DFHA 3E9CA 4EDFA 1PSDA 1XZQA 3I5UA 1DXOA 3DJFA 1U7PA 2EJBA 4CXMA 3FPCA 2IHJA 1KY2A 4MV6A 1I24A 4BP1A 1OFHA 1V16A 2RAUA 4R5HA 4Z0TA 4ES6A 3BB3A 2H16A 3OZDA 4U8HA 5GMOA 5EMMA 3ZHXA 4E2XA 1CFJA 3NCHA 5IFLA 1IFXA 3ZWXA 2QAGB 2UUOA 4R05A 4EG5A 4RTMA 1WIWA 4HQNA 4S3MA 1OGJA 1XRRA 4FOLA 4JOSA 3WV5A 2F55A 1CRPA 2P5TB 1H2FA 3R3ZA 1N5JA 2FW7A 3RCBA 3RRBA 5F1OA 3R5KA 3DE5X 2C4WA 4IUBS 4MQUA 3QA3E 5C51B 1PR9A 1G5IA 1XDDA 2NV0A 1NI3A 3WGTA 3CF0A 5A3JA 1QTIA 3JZMA 4IUCS 5NULA 2OLEA 3CF4A 3E0XA 4K6KA 3TJRA 2DLNA 2WUDA 4A0RA 1JECA 1JQKA 1LPNA 2FPIA 2XZDA 4J2HA 3CISA 4U02A 3IV7A 1QO0D 4KAFA 2PO5A 4NONA 1SC6A 1YAHA 4Q4JB 2PKQO 3SR3A 1Y9EA 5FTWA 1XXLA 1GTVA 4BZWA 2JLUA 1DO2A 5L3ZA 2PT5A 1H2BA 3BXOA 3GDOA 4INZA 1JXQA 2BPOA 4NP6A 4QRHA 4DVJA 4AI6A 3VC2A 3MB8A 3IQDB 2REOA 2VDPB 4KEAA 2WB2A 9LDBA 5CLQA 1WVMA 1XU4A 3K0AA 4OQNA 1C50A 4RD6A 4Z3KA 4ZCRA 3ZHSA 2GSWA 2GM5A 2BM0A 4H0CA 4DR4B 2LKCA 2DTDA 1NU6A 1STOA 2CFRA 3FYCA 3FPFA 4NV3A 3TLZA 1VLLA 3KQQA 3ZW7A 1PJSA 5HZGA 4ZV7A 2CW5A 4OHFA 5HQJA 4DDVA 1YQDA 3ND8A 4CKEA 2HV9A 5H3LA 2J4FA 4YJ3A 1H8EA 1ZMXA 3QYPA 1OXVA 3P5BA 4U7GA 5ALOA 2MTBA 2QWXA 1OFVA 5JY1A 1M1NA 2E1RA 1RHMA 3DFKA 1C3JA 4NK5A 5A03A 2EZ9A 3PFNA 3SHVA 5AW6A 3KYCA 3LBNA 2CKDA 4BVGA 3SBXA 3F7OA 2ZJ7A 4P92A 4CTJA 2C1XA 1BTOA 3F3SA 2GARA 5ELMA 1HT0A 4EJ6A 1VIVA 3FUVA 4CKBB 3WAKA 1TUGA 1XKQA 3I1FA 3KKQA 3QUTA 2HC9A 4MS3B 3TTXA 2XNDD 4CEJA 3EXHA 2F90A 1BU5A 3L9XA 4CV2A 1FFXA 1IBKB 1A4RA 3AT1A 1XV5A 5C81A 2XEXA 4J2TA 5KNCA 2DT8A 4L95C 1IHOA 3ECCA 1SUIA 1KO8A 3T12A 4MW7A 3GRZA 4PQRA 1MXHA 1V1MA 2PGXA 4L76A 4XDYA 1CZUA 3H5AA 5FR2A 1PKEA 5CYFA 3NANA 1GHTA 3D1JA 1GKUB 2IUFA 1XDUA 3KPUA 3QP9A 4R2KA 2GXSA 4UPVA 4ASUA 4UD2A 3O8NA 1XEXA 2DY1A 3KJQA 4L28A 1FBTA 3ZGVA 1BRMA 3B53X 3EZGA 4AY3A 3ETHA 3RIYA 4DB4A 3JAKB 4G4JA 3UAGA 4I6EA 2OK8A 5HJEA 5FR1A 1RCFA 3DA8A 3V1UA 2CNKA 5KVAA 2OILA 1RTTA 3D4IA 3EY9A 1T4GA 1H94A 2FMUA 3PLAE 3FMVA 4E4RA 2FPRA 3BILA 3WI7A 3H18A 4RPLA 4D9IA 2X8LA 3IT2A 3EARA 4P34A 2WYIA 5FOSA 1NVVQ 1USVA 3RVOA 3TGWA 2K7ZA 1G5HA 1TCAA 4HMQA 1UBLS 2ATCA 4C7XA 3BQ9A 4N1AA 3PITA 4WBXC 2R4QA 3EGDA 1W1WA 4OXNA 4AICA 3TUZC 4DKJA 4XUCA 1E1QD 4I4NA 1NXOA 3EF3A 5IH3A 3VSEA 3HR8A 4KPEC 1DMSA 1KWGA 4C0XA 5AESA 4KUGA 3S68A 3CRW1 2GKOA 3L82B 1IHPA 4GRAA 2VI5A 1CDZA 3G8CA 4KE8A 1ZK4A 2IQIA 5FJIA 2YOHA 4FEEA 1R0CA 2GOYA 4RFSA 5JPCA 3VU9A 2CNWA 3HL0A 2HADA 1W44A 4HAWA 2P68A 1GZSA 2IJGX 3L8EA 4LGCA 5GZ6A 4CIDA 3CRVA 2C2GA 3MXTA 2O2SA 2BJWA 3PHLA 2C9YA 3NHYA 4V38A 1Y33E 4JL5A 2DY0A 2RG7A 5DLYA 2BGLA 3GW8A 3K4QA 2OE2A 2Q6KA 3KQNA 3RFFA 3HG7A 2WFMA 3ZI0A 1KO5A 4AN1A 1AQNA 4QUBA 1KJJA 4Q4JA 3UMVA 4L1KA 3PYMA 4M1EA 1YHYA 2QAGC 3FI0A 3GPCA 4NL4H 1QHSA 1ZGJA 3BZWA 4O2BB 4P82A 5AHWA 4AKIA 1EDZA 3K6SA 4JI4B 2J6HA 5ALFA 3A6GA 4V03A 1T9HA 3SYRA 1K86A 2FLVA 4HQRA 4WKBA 3A6JA 3DEZA 3LHSA 2BKAA 3ON5A 4JB2A 2OA0A 1MH9A 2A9VA 1TZCA 2GEFA 2X41A 3COPA 1N5DA 1WLYA 3INGA 1L8XA 2CXQA 2QRGA 1KK3A 2QUKA 4BBPA 1O9BA 2JBAB 2NVBA 2WIGA 3NYQA 3E9RA 1ZGCA 4WK2B 3OEHA 1AGRA 5IDWA 3PQEA 2QRVA 4NCXA 1RLJA 5JH7F 2YYYA 1MOSA 5IM4F 3UV7A 1QFMA 2GD6A 2PH3A 4NF2A 4P6VF 4A10A 2H9IA 2E5LB 3LXUX 4H7PA 4OYYA 2VSNA 1HF3A 3OBBA 4NMHA 4KR9A 4A3SA 1Z6XA 4Q0MA 2R4UA 2ZZKA 4NJMA 2NPIA 3ZQJA 2JI4A 2ZYSA 3Q3EA 1GM5A 4OHUA 4CU5A 4ER6A 2R66A 3JQ7B 4B3MB 2ZTLA 2V9CA 4Y7DA 5K0CA 2VHJA 4L6CA 1XQXA 3G88A 1C8VB 1FEZA 4AF8A 2WJ4A 4RKWA 1DIAA 3FFWA 5IDYA 4J0KA 3HADA 5KC9A 4MUHA 4QGBA 4D9GA 2PYIA 5BRAA 4LQ4A 3EEOA 3HJFA 4L7VA 5DGIA 3TZLA 4HR7A 4U8GA 3VTFA 5JSQA 2JIPA 2V6IA 5DCWA 2AR9A 2FGJA 2VJKA 4ZQIA 3LP5A 4J3FA 4Q1BA 4W5QA 4M1TA 1LTHR 2JCGA 1K97A 5AVZA 2WJGA 1RDFA 3PXAA 5BR8B 3ETGA 2X2FA 4B83A 1MIOA 3KYCB 3BL6A 5EUBA 3I04M 1ULAA 3TB4A 1EBBA 1JP7A 3QOFA 3ZDXB 4N39A 4JJ6A 3OQJA 4M0DA 5DH9A 5JCOC 3GPLA 1NXPA 3K0HA 1PZMA 5T5QA 5HM8A 1KJWA 3E1SA 3K0SA 2YY7A 1OAOA 3HA5A 3HVHA 1DDIA 4TLDA 4B09A 2NZ2A 2H00A 5I7UA 4FVTA 3LZCA 2BIFA 2X3FA 2Z04A 3LT1A 4FK8A 3IDFA 1U6IA 2VNIA 2ZU6A 1YKFA 3DBHB 4PSUA 1DRUA 5ALYA 1QWOA 4DLAA 3VKGA 2AN4A 1SFRA 3FTQA 4TWJA 2NTNA 4DGQA 3PUYA 3QNUA 1EK1A 4GI2A 1M54A 5JHGB 1BKSB 2D5AA 2GNOA 3STXA 3AUAA 5LNK1 3MD9A 3SFVA 4IVPA 2ZBFA 1CFZA 1FYVA 1NMZA 2A9KA 4G0QA 4MLZA 1WXXA 3IAEA 3RVLA 4TZTA 2P62A 1UBFA 2X9LA 3SEQA 1EM6A 3OMXA 1DC6A 4PSAA 4G0XA 3T4EA 2AK2A 3RQIA 1S0UA 2HBZA 2P6MA 5KYNA 5CCBA 4DIUA 2FETA 3PD7A 4EVRA 1S9HA 2ENUA 3HU2A 3MWLA 2XGJA 1FSPA 1S6YA 3RREA 4LMRA 2IV2X 3RG8A 1RC8A 1TW3A 1RYMA 4XZ3A 2FKAA 3WRYA 5ES4B 2CNNA 4AT1A 4YAEA 1VKRA 2VR1A 5HDBB 4FFOA 4IDAA 3RI3A 2QTTA 3K5HA 3BXFA 2LZ0A 5HTKA 2XY4A 4MW4A 4RM3A 1R2QA 1MOPA 4QG3A 4I50F 4E07A 3R2JA 1HY3A 1KI1A 1O87A 3KDAA 2ZRDA 4QGSA 1JU4A 1S7CA 2D5LA 2H08A 4OLJA 1QLWA 1EXDA 5ED4A 2C0PA 1HE3A 1PG5A 1ZRMA 3ILHA 1SD1A 4BKPA 2G40A 4NATA 5EJFA 1SKUA 2PA0A 3VHQA 1OV6A 4QHSA 1GUYA 4B8WA 3CPHA 5K9ZA 4TMVA 1J2RA 1JIUA 1AKVA 1Z6YA 2ZWOA 3HSSA 2FCRA 2RHBA 3FGZA 2QTVB 3PX2A 3ESAA 1TUBB 4FHFA 4JODA 4U7DA 2BFCB 3UKJA 3NFYA 2P35A 1KY3A 1K9SA 4E0BA 3FKSA 5E4JA 1VBFA 2F3PA 1I2BA 2PQ0A 3DBOB 1GUDA 3MTAA 3DKIA 3JYNA 3SJCA 1TJPB 4KVAA 4ZZIA 2EJVA 3LCJA 4D96A 3OQOA 2BGJA 4FIDA 2OFOA 1HNNA 2SBTA 3E7FA 3EAFA 2RGEA 3QXCA 4UM9B 3KJIA 4E03A 4MUEA 1L1FA 1I4WA 3DLIA 5FNVB 1I30A 1Y8RB 3JR3A 3GLQA 1KIFA 3CKLA 3FF1A 1CY8A 1V5FA 2AFIB 1KDOA 3HSYA 3K20A 2WK1A 3LA6A 3PXDA 4RJIA 1UL1X 2Q5QA 4KITB 3IV9A 4ICIA 4BLVA 3GLFE 2AXEA 4FI3F 5ALSA 3ETDA 3IO5A 5A5EA 1AOXA 4CFYA 4UTNA 2HA2A 4TLMB 2C92A 1RYBA 2IYPA 1U1FA 4LOLA 2EFDB 3IIMA 3VJRA 2CXTA 2P69A 3LT0A 4HL6A 1UC5B 4KSYA 3ADCA 4IF4A 3AHDA 4ATNA 2UVDA 3E1GA 4TMWA 4A8JC 2NNWB 4JBGA 1TQ8A 4TROA 4LZAA 2LCQA 5EL0A 1YZQA 2PZMA 4PPNA 2I80A 2GM9A 1I2CA 2QTAA 2WIFA 3IB6A 1T3HA 2B4KA 2I8CA 5CG1A 1WCIB 5KB3A 5TIIA 4NZPA 3SZUA 3WYNA 1Q0UA 1WHTB 3FMPB 4B76A 2HU2A 1IIRA 3HKEA 4JX8A 4X8MA 5EKUA 5IBQA 4B3GA 3V4OA 1VMDA 3PNQA 3PFHA 5MHTA 2C9CA 2X0FA 3UO8B 1QFYA 2ZIUB 4C20A 2J85A 2O8NA 1Y5IA 1VL8A 1YACA 1X94A 3U7JA 1KYIA 2YDXA 3TDMA 3LTEA 5KSOA 1SB8A 1PU2A 3OZXA 4D45A 3PDWA 5EI5A 1SCNE 2JAWA 3N7UA 2HV8A 3EZYA 1LVGA 1RQLA 2PZEA 5EMKA 5CBKA 3AUSA 2QP4A 3NH6A 1LPPA 2MJLA 3EODA 4DC0A 1TE2A 3R0QA 4KR0A 3GEPA 421PA 1LDGA 2BBTA 4PAQA 5FHRA 5I7EA 4NZ9A 2OAGA 3AONB 4E1AA 4YI3A 3NS7A 1D0IA 1QS0B 2YYAA 2E49A 4JVNA 5F33A 4YLYA 4G1MB 1PX0A 5IEJA 1EQAA 3QGMA 1SUFA 2IZ5A 2JVKA 3EVCA 1UPXA 5C31A 4HNSA 4NU5A 4D5EA 1QH9A 1WUIS 3CO5A 3AB7A 1UUFA 1HRKA 4I36A 1ZUNA 1OXUA 3M8KA 3LUDA 5HKBA 2V7EA 4XWGA 4DA6A 1I9GA 2C9BA 2RAFA 3D2LA 4QWWA 1FTWA 5BW6B 2C57A 3DULA 4HGYA 1E3JA 1KHHA 4TMXA 3VR4D 3PC8C 3E3AA 5K0LA 3HCCA 3LVQE 4F85A 4MIKA 1USIA 1XLVA 4RSHA 4BAGA 4D9BA 3AEYA 3L18A 4BAZA 5JSZA 3OJWA 3D4OA 4RENA 2JD2A 1F4PA 2LNDA 2Q8PA 2BT4A 5HCIA 1FBNA 1D7OA 3L2OB 2WTNA 3P5SA 3ZEIA 2CL7X 3UPDA 1T5LA 1CRWG 5C7IO 3EPKA 1L7MA 2ZE7A 1KYQA 2P7IA 1JR3E 3N5CA 1TMKA 3UJ9A 2X2EA 4HYEA 1L7QA 4XIFA 1EVIA 2FW8A 1TM3E 1NVAA 3DXZA 5KQPA 2B36A 1ULBA 4IP0A 1NF9A 3MINA 4HADA 4RY8A 4AP5A 3OTWA 5EIEA 4KBYA 3P19A 4UHFA 1G7RA 3JD0A 4GP6A 3LGXA 4W8HA 2C78A 4WXRA 4JEIA 4OKSA 3FROA 3W8DA 4EX7A 1I7SB 2ZITA 5CLGA 4LFAB 1ES9A 2AXQA 3BTUA 5CNKA 3CVUA 1OI2A 2J9RA 4KQ6A 2BKLA 4LRYA 4TTQA 3QPWA 1KPHA 1RWWA 2CF6A 2H4HA 3T35A 4BLWA 1P62B 1UCFA 2FWJA 3N39C 1IAVA 1WU7A 2QVLA 3A6PC 2GYWA 5DNVA 3U37A 4AFNA 3FNFA 3ORFA 4G4SP 1QONA 4C21A 3C8UA 3JQ7A 5DHFA 2A30A 2HGSA 3K6RA 3WA7A 2JLRA 4QNNA 1ECBA 4V2IA 1UMDA 1Y1TA 4E3ZA 1ZIYA 2R60A 4DIMA 3F8TA 1UBOS 2H2AA 2Q3EA 2OC4A 4FJ0A 3UYLA 5JS8A 4CEHA 4LYDA 4PNPA 2P6UA 4WCFB 1CWUA 3VR6H 5IAAA 1B8UA 4H7IA 5K51A 5I8ZA 1NP7A 3VPXA 4C3UA 1XK6A 4YB8A 4DR5B 2FV8A 3G17A 4NENB 5LBUA 2VDMB 1BDBA 1IZ9A 4WK0B 3BMNB 3ZBTA 4OIMA 2DUJA 4EUHA 1RLTA 2WSMA 4FFSA 4L5JA 4BUZA 5B6JA 4LJAA 1N25A 2JLSA 3F9RA 5I6DA 5CT9A 5JAPA 1YAJA 2C95A 4FB5A 1EK5A 2UXBB 4ABTA 4KIGA 3KD2A 1YV9A 3MFQA 1X7XB 3CNOA 2HDWA 2PX4A 2XUPA 3M9LA 4MVJH 5TQJA 3D8SA 2XUJA 1YRWA 3ICCA 5A2QA 4E3WA 1IXRC 1WBJB 3M6VA 1USWA 2FMXA 1YI1A 4REOA 2FFJA 2PLFA 4KWTA 3SM3A 2ZJ1A 4L08A 4E15A 3KFVA 4QX6A 1HLPA 1PVDA 3TWOA 5F52A 5K5EA 1XEXB 1K5GA 1RLOA 2HJGA 3AM5A 4PWZA 3HACA 4RLQA 4DL9A 5AM2A 5AVSA 4FMDF 1OMOA 2ZANA 1Z22A 3S2FA 2HPHA 3FGOA 5HOQA 1NUSA 4Q34A 1FVHA 2W4IA 3HY6A 4U0KA 4Y2QA 5JNVA 2DM6A 1I6KA 2C2OA 3FJYA 3GPIA 4G86A 4HWRA 2VTBB 1PKXA 1RVV1 1FMLA 1TZKA 2JAQA 2WUEA 4ZVVA 1XQ6A 3R7WA 4M22A 3W05A 4BO5A 2PL9A 1XZJA 4BATA 3FDJA 4Q82A 1UAAA 2EDAA 4DUPA 2NUAA 3EQZA 3I42A 2HSGA 1Y6QA 4Z0HO 4P3YA 2GD1O 4KK4A 4MWZA 2VJAA 2Y2VA 3ZQ6A 7REQA 2Z5FA 5KREA 2B99A 3FIUA 3SI7A 5DHAA 1SCBA 3KQUA 3FDZB 4GXQA 2XCRB 3P4YA 5EINA 4PZLA 4Z7OB 3LZDA 3ZWKA 3AR6A 1U8ZA 1XF9A 2GD0A 3EULA 3PFWO 3BERA 4DTIA 4EYOA 1TKBA 2BEWB 4YAGA 2D59A 3FCUB 4RTJA 1NVBA 2GAOA 5FTJA 3R7BA 3LY9A 4NXNB 2BZ1A 2REBA 1DTWB 1SXJD 1CUYA 1ZGBA 2B7LA 3NTOA 4EB0A 3T5BA 1KZ9A 4OMFG 3DV0B 4W9MC 3CRRA 4J2OA 3H5TA 4OBEA 3UC5A 1GLNA 1VKOA 1XCBA 3O0TA 1XJ5A 2KPOA 3F49S 2QUJA 3WIUA 5JAHA 5FBLB 4QM7A 3FCSB 2OC9A 4JDPA 5H80A 1U9ZA 1G20A 3H2SA 1N2JA 2IIQA 2UZ3A 4BQFA 1Y8AA 2DR2A 1KZGB 2HIMA 3OA2A 2ZOSA 1Z5NA 4OH7A 3PBKA 1GPUA 1MRSA 3EXAA 4GGOA 1YR3A 2O1XA 4R2XA 4YUAA 4M0PA 2G76A 5LN1A 1TYBE 2SKCA 1DRWA 2AQIA 2KBFA 1SQGA 1G98A 3CUVA 3EVAA 4FP9A 2OPHA 4WN9A 3UQYS 2MMGA 1ZKMA 2NV6A 2PKRA 3OUZA 1H2YA 2IYYA 2CFIA 1UBNA 3PUVA 3VTKA 2O14A 2O2JA 4H35A 1XVTA 4XRRA 5E9AA 1T29A 3E23A 4GRIA 2ZDGA 2I8AA 1RAFA 1D03A 1NVDA 2EKLA 3QUAA 1W1IA 1FP4A 2MSCB 2O0KA 3NATA 4JB8A 1XL1A 2LR0A 3B6MA 3K30A 4FTWA 1RHRA 2WKPA 4L72A 1TLFA 2PX2A 2X1MA 4WY5A 5JEEA 3NALA 3BG5A 2AW3A 4QOEA 2G70A 3O4GA 1VYUA 4KWCA 4BLPA 4CKXA 2NVOA 221PA 4BX9A 1VKZA 4FFBB 1T24A 4JYPA 1NT4A 3ZVLA 3E9QA 1XAJA 3SC4A 2HW8A 1SOWA 3WNCA 4GM0A 5ESRA 1E0KA 2HQOA 1F2TB 1JB1A 5CCXA 1BKYA 5DNUA 3GC6A 5CA1B 2XMSA 5DNAA 3WLLA 5KNBD 4RMHA 1BS2A 1M8KA 2GCGA 4IJ6A 1N7JA 4XSGA 1VCMA 2ZI9A 4W9RA 3MS4A 4QT0A 5FYDA 3Q7EA 5LZ5A 4JJIA 5LSAA 2PUVA 5C8VA 4QXMA 1AKNA 4XEHA 5JNTA 1IONA 1UKCA 1OI4A 3Q12A 4GLLA 3K8OE 4FZJA 4IQ4A 4AUMA 3FWKA 3LC0A 4D26A 3SS9X 1NN3A 4P3KA 4R1NA 1KJZA 4DV0B 3F6SA 1B3RA 1CHNA 2IYNA 2W6QA 1G8SA 3ELUA 1CQXA 4ZYTA 5B57C 3JQ8B 3H9UA 3OIGA 3Q4GA 4KAAA 5H16A 2C97A 4DA8A 3EUFA 2QMHA 2D1YA 4U7PB 3S7TA 3WGIA 5AOBA 2JFBA 5BYBA 3X44A 4C4AA 4IO1A 3AB3A 1CUUA 3FSGA 5IKOA 2X5XA 3O3CA 2EWWA 4ZYVA 2RHJA 1O96B 5TVKA 1M10A 2ZLBA 5FEUA 3EJWA 4OHRA 4A8TA 4QRDA 3B20A 1VP3A 2UUPA 3IP3A 3QNMA 3BWMA 1JDBC 3IFSA 1GILA 3GARA 4RGQA 4M87A 3WLSA 4DLLA 2R6R1 2RGCA 3FCYA 5G0TA 4IV0A 4C6HA 1MHTA 3QXHA 1C7IA 2I7VA 2WINI 3DBHA 1NMXA 4FE7A 3JARB 5BVGB 2YRWA 2EXXA 4B4OA 1M2WA 1SR8A 3M0EA 4BO3A 1ZJJA 3B2NA 3LWNA 1M74A 1Y89A 1G38A 1WF6A 3MRSA 3N6XA 3H16A 2QYOA 1WVGA 2O3TA 2O20A 3HO6A 3MIIA 1GPAA 1FNDA 3PPYA 4KQHA 1YBMA 2F59A 5M2QA 1NDQA 2I7DA 3BIFA 3K70C 4GW3A 5FNZA 1M7HA 3EAGA 3KQWA 3MEQA 5AKJA 3OEWA 3I01M 3ODGA 4DNQA 3DZIA 1BD4A 2JATA 3M2TA 1Q2XA 3HSKA 2ZBEA 1QLHA 2CYBA 3GMDA 5HX7A 3LPCA 2CL0X 3FDXA 1I4TD 3IB3A 3PIDA 1E9DA 4EBBA 1ZD2P 2JI9A 4PO8A 3GZ4A 4DCMA 2P78A 4E1VA 3T52A 3ZE8A 1NA5A 1QIHA 1PFGA 4OK5A 2G88A 2JI8A 2ZR9A 1HOTA 1GTG1 2R6GA 3DW3X 3E6AA 4I5DA 3D7NA 4JB3A 1XAGA 3F5DA 4AWXA 1N2ZA 1THZA 2GX6A 1HR0B 2HWXA 2WUGA 1YHNA 3L1KA 3QLVA 4FNGA 3QZUA 3F1LA 4Y2VA 4YJHB 4KOAA 4FDAA 3OICA 3I0NA 3UV3A 3WLNA 2GNPA 1FXWF 4D8WA 1HEIA 5MN4A 3O90A 3W04A 1ODIA 4BECA 1F0NA 2GR9A 1VECA 3HUDA 3JYOA 2EV9A 1T3SA 1RKUA 5A7HA 4L9WA 4JLVA 1FFGA 1Z18A 3RC1A 3KLPX 4AMVA 3THXA 4TKVB 4YRZA 1TAUA 4CJXA 1B8NA 1DKQA 2VTVA 4W6ZA 1O97C 3WFZA 4C01A 2FUG1 4AXBA 1F3OA 1DEOA 1WG8A 1FQJA 3S1LA 2WLTA 4DZTA 1HL7A 3TM4A 4RD3A 3WFIA 4UKDA 4PR0A 1EP2B 2KSQA 3HZOA 4OIFA 1VSBA 4X1YA 4B2IA 1V1RA 3C15C 2XCTB 3BIXA 1JHOA 2HJ9A 2MT9A 2FPLA 4BRWA 4BX0A 1G9XA 1P33A 4DA7A 3RIEA 1OWPA 2A0KA 3R76A 2C7OA 2WA1A 2XZPA 1UADA 3N5KA 4DCGA 4TM7A 3WP0A 4E11A 4WN3A 1XNRB 1W88A 2QNRA 4WOPA 3VYWA 2C1ZA 5DWDA 5AVKA 1FSGA 2W6CX 2PMEA 4IYRA 1H2RS 1IZ0A 4Y2UA 3V8PA 3WLOA 3QWHA 5EJ4A 3ZXYA 2Y76A 2O8CB 4ZYYA 1P2GA 2M32A 2PIAA 2AG0A 2WIAA 3BZUA 4FJ2A 1DV1A 3N0VA 1E5QA 3PUIA 4BWVA 4WBNB 3TJMA 1CT9A 1XGKA 4JP3A 1QPBA 1GEEA 2XYGA 1XA3A 4XM1A 5E9WA 1K4KA 3ZWMA 3UEOA 1TLLA 5KAMA 1E0SA 2PMWB 1V11A 2WWTA 4PZEA 2G4CA 3IAHA 3HRIA 3DLCA 4OUKX 2AF4C 4QVKA 4Z99A 2D2FA 2YMQA 1JMVA 1GNSA 1X1BA 4YMIA 3ZZ0A 3PV0A 2FRDA 4KX5A 4DC9A 1NXSA 5LOVB 4J0HA 3OU7A 1RM0A 4UHBA 3CX6A 2PXAA 4KO2S 4JJFA 5LQAA 3ZD6A 1CF2O 2AN9A 4X1IA 4EJ0A 2W2LA 4I7EA 4IDPA 1I3NA 5DF1A 1JDVA 2HQ1A 4C87A 3X0DA 4OCZA 4OH1A 3KOMA 4JUIA 4XVRA 3AIOA 4JYMA 3IIIA 1IJKA 2Q3BA 3ACDA 5CXQA 3IX7A 1MG0A 1P74A 2XYPA 1WPQA 4IJ5A 3P0EA 4WZAE 2PXCA 1I1QB 1WABA 3FDFA 1L4HA 3R20A 2J32A 1IWPB 4GC5A 3RKSA 3U9SA 5KDOA 1P17A 3JASA 3N7TA 4TYPA 1OFTA 2D4AA 1KQFA 5FL3A 5BN1A 2FK7A 1XLTA 5JYEA 2IZOA 2CNLA 1FQOA 4J3NA 3NVKI 2YFKA 4BLRA 4BEWA 3SEZA 1N9GB 1FRFS 2ZI3A 4J1QA 4OPMA 4R81A 4B7ZA 1OBOA 1IXZA 3CNQS 3HRHA 1KQPA 2FFRA 3DMRA 3BCUA 3E1KA 5IKMA 3NHSA 2ZFUA 1U0GA 1SCUA 3C3AA 2Z0MA 2NMVA 2QV0A 3QJ5A 4RA6A 5CPFA 3HR4A 1GGEA 3AF6A 2O4CA 3Q5GA 3BCSA 4LXQA 3R7SA 1VSUA 3LPMA 3A9CA 3NKLA 5HOEA 4OHBA 1IYZA 2AMFA 1LPBB 3FDZA 3GZNB 4WI1A 1YVRA 1YWGO 2BGKA 3IQIX 5B6IA 1J8QA 3ZU2A 1C29B 3LQQA 3TOZA 3DLAA 4NOLA 2VF2A 2YX1A 5EYPA 2OXTA 3RLFA 1GGJA 1OXKB 2VTBA 3ANYB 3N9IA 5G02A 1WB9A 3ZXXA 5JWHA 1MZPA 1YZGA 1WU8A 2Q1UA 2Q6TA 3SEFA 3T3MB 4CKCA 2HCRA 2IUYA 2Y2UA 5KMGB 3CSUA 1EPUA 1Q7RA 5CR9A 2BRUC 1QMGA 3ZDZB 1JU9A 5JU6A 2BGUA 4MEAA 3RJZA 2CLFB 3ER6A 4HLUA 1YB6A 2XMCA 4BVFA 1AA9A 4F2WA 3CN7A 2P9EA 3B5JA 3JQAA 5K0JA 3OQHA 3N70A 2ZBPA 3O1LA 1B15A 4WCFA 4YK7A 4WNIA 3OOEA 4REMA 2IYQA 2OENG 4P4NA 2GBFA 3GEBA 3LX6A 4HC4A 1LS6A 4MV1A 4ZYLA 1LC0A 2NGRA 4KRGA 1SZCA 4LC1A 4X63A 1S3FA 4DMKA 4EB3A 1Z0JA 5JAMA 1FP1D 1IU9A 1A4XA 3HUTA 5DN6D 3GQVA 4ZDIA 1GNPA 2MMCA 1XN1A 3KE9A 2I65A 4BXOB 1AIPA 2WICA 1IZ8A 4HDMB 4Q3LA 2CV2A 3KQMA 5DI3A 5J58A 1Y5LA 4W6QA 4PGAA 4FHDA 3GI1A 5LL6P 1ZS9A 2EYQA 2E3JA 4FS8A 3TJZA 3TXYA 1KZ6A 2A7XA 1MTOA 1YGPA 2ZIAA 4HQFA 5FV4A 3DS8A 1EEXB 3TOSA 3PC3A 3IEPA 4HBGA 1Y81A 3E84A 3FYSA 3MGAA 4EVSA 4HO1X 3LP6A 3CSSA 4M9UA 4DSOA 2UUAB 2GBPA 3L02A 1A7KA 4IGKA 3Q0IA 4OMDA 4R6XA 3ZLUA 3B1VA 5DSXA 1LBQA 1ENOA 1J00A 2ZETA 3FPEA 1H23A 2ZWVA 1PR2A 3HB0A 3OCZA 4WKOA 3JQBC 2ZRMA 3ROXA 1CXZA 3V9PA 4HX5A 5GGXA 5FCDA 4EQZA 2XUIA 5CT6A 3UMSA 3ZHOA 4BMSA 4D6PA 1DAMA 2V6JA 1DVRA 3M4YA 5KZMB 4DJEC 3UT0A 1I3LA 2BMAA 1Z4IA 4N12A 4WBNA 5KTPA 4DV7B 1AX9A 3JCZA 3B1KA 1IDN1 2O5CA 3MWFA 4H7EA 3ECAA 4UFPA 1II8B 4N4AA 4NQZA 1M1NB 3E18A 3PEUA 4O4HF 5J5CA 4CQJA 1WQ3A 3NIGB 4E2FA 1UPFA 2VN8A 4E5DA 4JBWA 4RWEA 4X24A 3EG5A 5TV2A 1SBTA 3FNIA 1T5DX 4M2LA 3R7WB 5HFNA 1LWNA 3FHTA 2RC6A 4JGBA 1WULS 1ZJZA 3EG9B 3G8AA 2BFEB 1DP4A 4EZBA 2QRNA 5TMPA 1ZGAA 7GPBA 2RB4A 5IRCD 1T2CA 4O8CA 5SY4A 2X0IA 2ZI4A 3EH1A 4BNFA 2SKDA 4FGLA 2V5AA 1A9XB 3BULA 4UM7A 2QLFA 4EF5A 2JLVA 2JFWA 1KEPA 1X13A 4LUCA 2I22A 3PPXA 2WG1A 1EMDA 4GKBA 3OJLA 1PX2A 2EIXA 4HUQA 4CLOB 2WV7A 4D7AA 4NMLA 5EVCA 5B58T 3VQTA 2DF8A 2P9JA 5KOHA 1FXUA 2P91A 3A6DA 3K9LA 2N9UA 3PJFA 2QLLA 2GZDA 5B1SA 2HSDA 5CBPA 3DF7A 4QFBA 2EW2A 2PUWA 3UUEA 4RF3A 2O8EA 1GQFA 3RHZA 2PH5A 2Y9PB 1XMJA 1ACMA 2EKPA 2NSHA 2NXNA 1QZ3A 1UJBA 2QTHA 4GEKA 3HB9A 4Y9TA 5DYTA 2NIPA 1OX6A 3GT7A 2F1JA 5J59A 3VO8A 2CN1A 3DPSA 4Y6QA 3VTAA 3Q3JB 5IYZB 5JV5A 4BB5A 5AD1A 3BWXA 3BGVA 5FFNA 2BSXA 1N5LA 2B9VA 4UQPA 4C03A 1W8DA 3U56A 1YB2A 2AF3C 2WHPB 1YONA 2PMCA 3GUVA 1IOVA 4K3UA 4OB8A 4NZZA 1AB6A 1S4MA 1U3UA 1SU6A 2A0UA 2GPSA 1EFDN 4IMJB 3O47A 5A5FA 1OB5A 1WTAA 2EF1A 4JR0A 1PS8A 1GTMA 1TKCA 2VNHA 2TYSB 3DT8A 1AA6A 2W93A 1AS0A 2BUCA 2EX4A 4YREA 4BO7A 3N07A 2F8SA 5L3SB 1JEQB 2JFHA 3C6ZA 1LPAB 3A0RB 2C99A 1RYNA 2Q5EA 3KUCA 5HK9A 1GPLA 2C42A 3VOSA 4CDRA 3OLCX 1SUSA 3AR3A 2OXRA 4JX9A 3TNFA 2H4WA 1Y82A 1VPDA 5IG2A 3S2ZA 1O5TA 4BNTA 5B7GA 3IEUA 4BFWA 3EEFA 3QX7A 2OM2A 4FUTA 3A04A 1P6UA 3WJ1A 5HE8A 3CS3A 1NBOA 3NDRA 1CSEE 1SKQA 2PKYX 3CW2A 3PQ8A 1T8UA 1NIJA 1OXSC 4M3NA 1FXWA 2IOHA 4MSUA 5F3RA 3TW6A 3TFOA 2IS6A 1H3FA 2Q4RA 1R18A 3ICOA 4U7JA 1F2UB 2WTAA 3NGXA 3HYNA 1FU7A 5DYYA 2QA5A 4CCYB 2BMVA 5DO9A 3GLIE 1IG0A 1UJCA 4GL2A 5JLJA 4D43A 3QITA 3OHMA 4OBWA 1JAXA 4G81A 1YVPA 3OQ1A 4OAPA 2FFQA 2QY9A 1JJIA 2QP3A 2VWHA 3KBBA 4ZMBA 2W4MA 4MINA 1CY2A 3TAUA 3U9LA 3EIOA 1QYCA 2CVFA 4LMBA 3ZKAA 1OR8A 1P0IA 4EAAA 1I0ZA 2AMJA 2DWCA 1E61A 1Q84A 2R1UA 3EWIA 1FDVA 3W6NA 1KMNA 1NBWB 1JTVA 3RANA 4XUEA 3A0UA 1JG1A 3NYRA 1JDPA 5IVHA 1YR1A 1N6IA 2FZKA 3KIPA 4UBNA 5JSUA 2UZ4A 3PEYA 1IUPA 1E2BA 4MRAA 1MDBA 5AXBA 3FNBA 3G1TA 2QXTA 1D4ZA 3IERA 4DQVA 1Y7LA 2GCOA 2X9VA 3IS3A 3NHRA 4DVGA 3EC7A 3NWJA 2I2CA 3IUYA 3T1TA 4FEYA 1T35A 2O4UX 3IP1A 1HG0A 2WBLC 3MCUA 3RYIA 4C3VA 5JRJA 2ZSJA 2WIJA 4AKGA 4L8WB 4BB0A 2R85A 4EF6A 1G5TA 3KPWA 2R6DA 4HWKA 3QF4B 4PPGA 5FHQA 4PFQA 3TH5A 2J31A 4ZQFA 3IVRA 3U1TA 5FTMA 1Z75A 4GHWA 4KXFB 4AYXA 3NGLA 4DMFA 4Y9SA 1LI4A 1JEJA 2Y0BA 5FI1B 1Y7PA 4FS3A 2QD5A 3MQ2A 5LBTA 3K4HA 1IDOA 1Y9AA 4Y6OA 2XVAA 3OM9A 3CRMA 4RHYA 4UAVA 5E7JA 3BFXA 1ULTA 1LDBA 3TBHA 4NICA 4BIIA 2GBCA 3O8DA 3BJIC 1QO0A 3CLHA 3ZWAA 3S8YA 3I5YA 4C7JA 3C3DA 5HBRA 1ZINA 1Q95A 2IPOA 5BSHA 3COJA 4F6RA 4UUMA 5LMCA 1ILWA 2OV4A 4ETWA 4UM9D 2CFOA 2FSVA 1R0WA 1OXMA 3KEGA 1ESCA 1TEVA 1KDVA 4E2WA 1GPH1 1R12A 3EDYA 1Z26A 2P4EA 3ANXA 1ONPA 4ZOEA 5DOVA 3SFZA 2FH5B 4ILEA 5CFLA 4UVIA 5KQLA 2JARA 3OZFA 2NP6A 3T0IA 2OFWA 1LBSA 1SNYA 3EVZA 1ZHHA 1T5BA 1GFWA 3PLNA 4XFKA 3MCTA 4M76B 3UT5A 2J5QA 2WWGA 3NTVA 3K70B 1Z12A 1J0DA 4IPTA 4FOTA 3I1JA 5EKXA 3L0DA 3G59A 3HCFA 4H15A 4AJIA 2V0GA 5JO9A 1GAEO 4YTEA 1UZAA 1KPGA 1L7PA 1PFWA 3OE5A 2VT7A 2IH5A 5I3ZA 4LDZA 3T0FA 2XECA 4OYRA 5EYPB 2OZLA 2Y0PA 5EMNA 1KH3A 3LUFA 2AFVA 2XOEA 4OU4A 3L46A 2BP7B 3K9HA 3NC0C 3A4LA 4I55B 4Z8YA 2HSWA 4PQFA 1DAOA 3RU3A 1ZAKA 2WSIA 1XTVA 4KXUA 5BYJA 1MEJA 3RRXA 3WRXA 2IPAB 3OOJA 5TGDA 4CT0A 5G0SA 4KQKA 5L95A 1J0AA 1Z6QA 4TKZA 4G5HA 2ZDHA 4M46A 1CEYA 3ROTA 4LQDA 1G41A 2OD2A 1RCUA 2QUZA 1E2LA 2TECE 2VF4X 3GA7A 1SQSA 4JGIA 2Y3IA 2QN8A 2NPFA 4C06A 4HDMA 1T0BA 2DULA 2KQUA 1C1HA 3D7RA 3RYFB 2W6NA 1UPBA 1H6DA 1OUMA 3GZNA 1SGWA 1XEFA 3RFTA 1VQ1A 3IBGA 2P0YA 1Y7TA 3LLSA 4MJLA 4ZT5A 2F8TA 2FMIA 5DCLA 1C5KA 1KO7A 2WHXA 2BJVA 1N5IA 1NNUA 1O6BA 1MVOA 1B0UA 2BDEA 2GF2A 2Z2IA 3QFSA 4TUYB 3W6ZA 5IT5A 3MRVA 4PRLA 5E4TA 3ZWDA 4MW1A 1NW8A 1SXQA 2OAQ1 4BMZA 1YR7A 4HX2A 4J49A 1X39A 2D1TA 4CIBA 2DPHA 4D9CA 5U9CA 3I58A 4DWVA 1RSZA 2A0FA 3DWEX 5LM3A 2Z09A 1URPA 2PZLA 3D9QX 1GIAA 3PUZA 5G40A 5HKAA 2O1WA 1P1BA 1RI2A 1OKKA 5ALRA 3IULA 2E4VA 4AZ3B 4L2IB 3U4CA 3ABZA 1ZK2A 2O7RA 2C29D 3D4NA 4GYJA 4QQKA 2D5IA 5CM9C 1NY5A 2AEMA 1PWHA 1QG6A 4Q6BA 2J0UA 2QS9A 3GLVA 1YRQA 5BWBA 1GWNA 3A4VA 4LHVA 3HVIA 1HGXA 1PSZA 2WPDD 1EU1A 3AL2A 3IAS6 4UBIA 1DRJA 3COYA 2ORED 4Q47A 3GP3A 1LZLA 3KQTA 4XQEA 5JALA 3DC2A 1JVSA 4P2BA 1N36B 3K94A 3O21A 4H3HB 4H27A 1CIPA 3L7AA 3INTA 5EC8A 1PBTA 3K35A 1GFSA 9ATCA 1WZUA 2B61A 1XX6A 2IHTA 3ODPA 1E6KA 1I32A 1VCOA 2I2BA 3O9VA 1NG9A 1ULSA 4MAFA 4A27A 1C4XA 1SZPA 1P4SA 4JYCA 2VEDA 1IIBA 3ZU3A 2V59A 2X1VA 1BN6A 3MOGA 1BWQA 1Z68A 4O2AA 5JWOA 3J80A 2WJAA 3HBLA 1U3CA 2LD4A 2WTEA 3RS7A 1GT91 2D7CA 3EXHC 3NHAA 1Q74A 3W3AH 2C5FA 1LLQA 4JUDX 4FGZA 4PYOA 2BFAA 2WC1A 2ZIEA 4KAXA 4JFAA 3TEJA 3ONEA 1RXWA 4HB0A 1F14A 1KIMA 1PR6A 1H9AA 3QYAA 1ZR2A 5ALUA 3THSA 3OMWA 4Y9DA 1JEYA 2X5KO 4O4IB 4QDJA 4O4JB 1BE6A 2AUNA 4CM3A 5ICGA 3I2JA 3DZKA 1Z17A 1TAGA 1Y1RA 5IJXA 2OSVA 4BV3A 7AT1A 4IEEA 4MEJA 4RK5A 2WWRA 3FOBA 2CT8A 1Z0IA 3BFJA 4RF5A 1KZYC 2WUWE 1YZYA 2X9GA 3W2GA 4IXDA 5FP0A 3HCRA 3OZEA 1T6XA 5FOWA 2FMHA 3BSSA 3NUZA 1DRVA 4HUQB 4QVGA 2NU6B 3RM3A 3V7FA 2EWMA 4I1PA 1GTL1 2AX3A 5BUZA 2Q2QA 2RGNA 2JH9A 2PSSA 5FBZA 5C1BA 5D85A 1U7DA 2EKZA 5J2TB 4KR6A 3FRHA 1NT2A 5EQFA 4C2TA 4TXHA 5EY5B 5EJIA 2O5RA 2IXTA 2O19A 2WMNB 1PBNA 3EVEA 4RESA 3IQZA 1U90A 1Z74A 1MTZA 2NZ8A 2NO9A 2VLIA 3A9VA 3FX2A 4FFPA 1TQHA 5CGQB 2XNSA 3GXBA 2A9PA 3TYXA 1B0PA 3HI6A 4N76A 2DFVA 3GLRA 5I7OA 3WK5A 5AUOB 1EZZA 5FRDA 1VPTA 3G9XA 4MLDA 5AH0A 1JHRA 2IF2A 1AXEA 1G3IA 3M9XA 1MAVA 2JG3A 1EVEA 2I6SA 5ADHA 3UMGA 5KCMA 3ZCQA 2HU7A 3GN2A 3NQ41 3ME5A 2A2ZA 1WXWA 3PXBA 1DFIA 1KAEA 2XR1A 2YJZA 2J6BA 4MLCA 4Q4DA 5MFZA 2GT1A 3O2NA 1DKMA 4HWTA 4M4SA 1PSWA 2SECE 1IHUA 1YIAA 4TUYF 3RSSA 1ZN9A 4Z9BA 1E2MA 4IJMA 1G19A 4LZWA 4UM8B 2B4YA 2X1LA 1U31A 2AI2A 4I9UA 1ZGHA 3RUHA 4DN6A 1JKJA 4CIYA 2YV2A 1J9GA 1EX6A 2IX9A 2YQ5A 1C1XB 4M9CA 1SXJB 4AZ0A 2ZWPA 3ZD7A 4BMVA 1QGYA 4KI7A 3ZDDA 3ZVNA 3TSZA 3A4IA 3EEQA 4KLRA 4ZTBA 4YAIA 1E3EA 1I2AA 4YXWD 4F4UA 5LXTB 3ACCA 4DCJA 1RADA 4HD8A 1EKXA 2F9MA 4BN4A 5LQMA 4MVJD 3ZGZA 4M99A 1R4MB 3M6WA 3V00A 4P4SB 3AESB 1KI3A 3OKAA 5IVIA 3C41J 3F7TA 1NMQA 1NQWA 1VJ5A 1K5HA 2HJHA 3LJKA 2XE4A 4PYKA 4QYSA 3TZCA 4Q7QA 1KYYA 4OMCA 2GVZC 3SQLA 3CCBA 3R44A 3SXPA 3ZV5A 4BFYA 1L5KA 2OHJA 3T54A 3UWKA 4CV1A 2ZPAA 4LOHA 4ZMRA 1E9SA 3QEAZ 1L8LA 1NBME 3N28A 3FA2A 4HPWA 4B4DA 5DP2A 1XPUA 4TLCA 4JYBA 3C6YA 2GZ3A 3O31A 4MKHA 4EHNA 1QDEA 1I4LD 4PRKA 4WKNA 1LS1A 3OTGA 2WP0A 5D6NA 2Q49A 4KHPB 4DEXA 3F6CA 2YW9A 2HMTA 2ZW9A 3DDCA 4I1VA 1C9KA 4II7A 2WLSA 1YCDA 4M49A 3BXZA 5T4FA 5U4QA 3RKRA 4D57A 2XADA 3AHCA 5BOSB 5DGXA 1ZVKA 1W4CA 4IOMA 1W6UA 4RGYA 5JDCC 4DCTA 1CP3A 4BGIA 2C3PA 4EFNA 1QV6A 2WZDA 4QGHA 5FWYA 2CDNA 2D54A 2P1ZA 3BRWD 3O3NB 3VX4A 3AY6A 2RGUA 4EX6A 1IY0A 1YNSA 1RAHA 3ZLTA 4ZAXA 4WIAA 1R6TA 1QRSA 1PR4A 3QA9A 4OD0A 1YS7A 1EHIA 2I4RA 5F35A 3NC4A 2DCUA 1NBEA 1V3VA 3AR5A 3DFIA 4XQ9A 2ZYDA 1XPOA 2HF2A 2AZDA 3L7NA 2OCIA 4FLEA 3IIJA 2RG1A 4W9NA 4CM9D 1SVMA 1VYHA 4HGQA 5FUWA 3AP1A 1DPFA 1Y4UA 3B9RA 3MHPA 4F1KA 4K0RA 3ZVMA 1IN7A 1NQVA 3MFYA 4K81B 3W1VA 1NDUA 1J33A 3FFAA 4U9HS 1JI0A 2OV1A 2XIJA 3I28A 2Q5OA 4WT7A 1VPEA 2IVZA 5DULA 3LLCA 3RKUA 4P4LA 3PWZA 1SEVA 4II3A 1KFEB 2IP4A 4A91A 3UQZA 2FZ4A 4I55F 1E3QA 3CNLA 4O2BF 3ICQB 1WUYA 4DTCA 4YV7A 3KSBC 3DBIA 2HA0A 3DSRA 1QB8A 3UOWA 4E30A 3VC7A 3TB6A 1EBUA 1W47A 2BI4A 1Q11A 2R96A 2VCHA 2XOXA 4UMFA 3QVKA 4QECA 4XQGA 4OHZA 5G1OA 4B2LA 1PJRA 1XDWA 2B78A 2HRQA 2OOKA 3BAFA 3GDHA 3OPVA 3W5JA 2FG5A 3TKLA 4MS1A 3LHDA 2IELA 1X7GA 1RKVA 1ZM7A 2NWQA 3AK4A 1N2CA 1O9GA 3IELA 1HRDA 4PZZA 3EYAA 4TMKA 4OJKA 5KSYA 1IBLB 4NEQA 4QUKA 4ZYXA 3C3EA 4KN8A 4XM2A 2H29A 3S7ZA 4AJNA 2RKWA 5IWCA 5HNKA 1QP4A 2R8EA 1TZMA 4BU1A 1OQAA 2FPGA 4FYWA 2O0LA 4TV9A 5AKEA 4DQLA 2Q4TA 4D1YA 3G7UA 4F2PA 1L5NA 1UOEA 1QRTA 1Z6TA 2DC1A 4IFIA 1B2RA 3KNZA 2DXIA 1G18A 4RZXA 1BYUA 1P1KA 1ZKDA 1SG9A 3EMBA 3GRRA 3N0WA 3CUTA 5EWLA 2GZHA 3W6UA 1WP9A 3I9JA 4KRXA 4ZQEA 4QVIA 2QVBA 3C3CA 2HHLA 3B6IA 1W0KA 3A2KA 4BX2A 5MF6A 3UT6A 1VMIA 3WO0A 4W9NC 1NUUA 1G3UA 3DE4X 1KI6B 1E79D 2I66A 3IRVA 3E15A 1C41A 1VJDA 2GYUA 2VRCA 1ZONA 5AKHA 3U7EB 4EUKA 2Y68A 1I7QB 4W5TA 1PLLA 1FUKA 4F3TA 4N8SA 1U8TA 3WL6A 4C7MA 2KB0A 3C1OA 4EG3A 4F4IA 5JWRA 2GPAA 2WFAA 2Y66A 3ND5A 4TX1A 3RWOA 2DGDA 4V0SA 1C80A 4DC1A 3DB2A 4I2NA 1AUPA 4EPYA 3CX8A 4V2UA 1ZVJA 5KTKA 5BQPA 3AVWA 1SZDA 3TSOA 2H8KA 3UTCA 5IN4A 2HDNB 1ZVMA 1OWOA 1Y1PA 4GMDA 1MC8A 3D0RA 5CYPA 1U9IC 3WLIA 3IKMB 4ARBA 1NTRA 3X2EA 4B82A 3C4JA 2JGNA 3RC3A 4F2GA 1EZ1A 3TFQA 4NULA 4YT4A 3UAVA 3AY7A 2OWDA 4H18A 2FW9A 2ZSDA 1FX0B 2EFJA 3O4HA 5KSPA 3KYBA 1NXQA 3F0TA 1YKGA 4PRYA 3ZW9A 2VIIA 5CDSA 4OOFA 3KHKA 1AHPA 5F9HA 5CD9A 1LI5A 4ZCQA 5JAUA 1ORIA 3DE3X 4RK4A 3UB4A 1WA5A 4MMZB 2WY2D 3QTLA 4F6RB 2I3BA 4HEA1 4XOIA 1IZ7A 1OWLA 1YOVB 2YBEA 2ASVA 4OA5A 4HLDA 4A15A 4UCWA 1IOZA 3VR5H 2VTDA 2X5OA 3R3VA 1IEQA 3EA4A 2FZCA 4HVTA 4R2WA 1KDPA 2FN8A 5D3QA 1PO7A 4FGKA 5BNFA 3UENA 5FH9A 1PJQA 3S99A 5A4FS 1J0EA 3G0BA 5AM3A 5ESXA 5F9MA 3LGSA 1UC9A 1Q14A 1V71A 4JY7A 4D9FA 5A5GA 4JI2B 3AEXA 2ZSUA 3GLSA 1L4FA 1J25A 1JF8A 1L7BA 2QTFA 2XAAA 3ANSA 1F12A 3E82A 3IP5A 2XB8A 3LMKA 4LCBA 4ZU6X 3ZG6A 2C5LA 2P2CA 2HXYA 4IFTA 3HHEA 3ZXIA 5B2EA 4FJ1A 3X2SA 1SCDA 1SC9A 3T5GA 1D2NA 3KSZO 3C7TA 3DZCA 3L1JA 4ESEA 5ICSA 2JLZA 4Z4EA 5HRCA 2YVQA 1V96A 4GWLA 4XB2A 2DQ4A 4MQEB 1KTVA 4I55A 4PLCA 4KPUB 1ONSA 1KJ8A 1ZC3A 3I2KA 4LJ9A 4EBFA 5D5QA 3RFCA 3ZDQA 3OLZA 1XQ9A 1E32A 1GZUA 2DFPA 5F2KA 1THMA 2QTCA 4CL0A 3VFDA 5CA1F 3W1WA 1U9IA 1Z25A 2B1GA 1J0XO 4MGIR 4B45A 4YDQA 1P7CA 1WZNA 1IBSA 2H5EA 1WRBA 3IP6A 4J16A 2VUIB 4JLNA 4OUDA 3U4GA 13PKA 1QB7A 3AVUA 4KNWA 3AEKB 2ZCJA 1E3DA 1SELA 5CDTA 4WHMA 4ZAVA 4F97A 1YDHA 1XMXA 4DW8A 1YE3A 5E1DA 1BQ3A 2X19A 1QVZA 2PVPA 1OJLA 2I3ZA 4DM7A 2B30A 5K7SA 2VDWB 2Q6LA 2C8KA 5BWCA 5BPFA 3RIMA 2XSZA 1RP1A 5ALKA 4TLAA 3DQPA 3EY4A 5A5VA 2NADA 4NDZA 1ZJ5A 1EDOA 1KMIY 2GYVA 3R4VA 2ZJ5A 3QWBA 1RWPA 3V1TC 1ZLXA 3ABIA 2P9YA 3T1OA 4E09A 3R5XA 3ORYA 2AE1A 2C7PA 1BRTA 4MH0R 4YJGA 5TARA 3CH7A 4P36A 2HF7A 2WTMA 2Y1DA 5AJTA 1EWVA 3N2GA 3ZU5A 5I7VA 4I81A 4IIJB 2EU8A 1VHJA 1FW8A 2PWYA 1SU7A 1ZIPA 2R86A 2WTBA 5FLYA 2AWNA 1MBZA 2BELA 1EWQA 1KVTA 1N32B 3WGQA 3HEBA 3M1AA 2J48A 1KJYA 5T4EA 3K9WA 4EIWA 4CLRA 1HMYA 2G09A 2H1FA 4AF6A 3DXFA 4D44A 1OH6A 3A27A 1V3QE 1MOQA 3ESZA 4HWSA 3UN1A 2ZDQA 4QXOA 3D6AA 4M37A 1DCFA 3BD9A 4Q3EA 4QU5A 2GFIA 2HRCA 3MJDA 4QFDA 1NUHA 1RC0A 3KTAB 4TYNA 4DRZA 1PJ4A 2BC9A 3CXRA 2GHTA 1A8SA 3PDCA 1DLJA 2AEEA 2UU9B 3MYRA 3SY8A 4JLMA 4YQYA 3OOHA 1U0JA 1Q0HA 2Q5FA 4OQXA 3ZNPA 3JXEA 3DMGA 4ENPA 2ANBA 1ZN2A 4KMSA 4XJTA 2GBLA 1D2GA 3NHUA 3C8ZA 4Z86A 1G2PA 4BNHA 2A6PA 3GHYA 3STWA 3PQ7A 3K9BA 3KV3O 1UBKS 1OH5A 5FPSA 4QYIA 1DS6A 1YBHA 1YE8A 4RXUA 3OX1A 2IQ5A 3AGQA 5EFZA 2H1VA 1AE1A 3GJ3A 4LJ4A 1SXJA 2QGZA 1Q12A 3RU9A 1CZNA 5EZ5A 3DUFB 3IKVA 4U39A 3UXHA 5FBVB 4TSKA 2BFBA 1ZNQO 2O57A 3ZUPA 1IQ0A 1Q3KA 3WGMA 3FTCA 5AVUA 1J9ZA 1ZOLA 1SC3A 1T9DA 2D8MA 2O05A 1YSCA 3AERA 1G1AA 1PGQA 1U1IA 1HOXA 3K9GA 2IPXA 4ER0A 1RRFA 4AQYB 3ND6A 1NSFA 5A71A 4AK9A 4EKEA 2IW1A 3LYLA 4GE3A 4DB2A 4EY8A 2Q2WA 2Q4OA 1QG2A 2ZBRA 5CFPA 3FTNA 4C6SA 5CDGA 3LT2A 1Z06A 4L5YA 3BDIA 4YC7A 4OFBA 1VTKA 3GNTA 1TCVA 4AO8A 3FJOA 3V6LA 4RTPA 1SVUA 1BCRB 4TMFA 1E8NA 1X80B 4G67A 4V0ME 2I6UA 3GJ4A 3WLPA 1MQ8B 3LQYA 2VNKA 2FJ0A 4MP3A 1YOVA 2F8LA 3INRA 1P91A 4KLCA 5K03A 2I99A 3KFXA 1FK8A 4UPDA 4I08A 2HJWA 4IDNA 3GJRA 3WGGA 3MMSA 3N76A 1S02A 3W34A 3ZHQA 4UVGA 1QCCA 4TV8F 2J4DA 4BP3A 1DNPA 1XO1A 2UZ1B 1COWA 3BBLA 1NUAA 5FUBA 2QP9X 3AZOA 3NBXX 4O02B 3ZOKA 5H82A 4YJ3B 4O63O 2YS7A 2R0QC 5T8KA 4M1ZA 1RRGA 4BP8A 1LQTA 2B9EA 3KYJB 1T0IA 2CL6X 2QUBA 2Q99A 4PLPA 5A3RA 4M1WA 5EESA 5F1YA 2PX8A 2VK2A 1LA2A 3WVNA 3H13A 5C4MA 5LMNB 2J08A 4EJSB 4BV9A 2XWSA 4LYHA 2QM0A 1NN0A 3H83A 1YHZA 3U3XA 2ZSBA 1YCGA 3HJGA 3QE9Y 3OAAD 1ADFA 3CNEA 3Q3VA 2D6FA 1OYYA 3ZOZA 2VXCA 3MNFA 1U63A 4YRJA 1N6RA 3FUUA 1JHXA 2QMYA 2PRYA 4RTKA 2OO5A 3F3YA 1RFLA 4DDTA 5A1JA 1M6VA 3KPVA 5D5HA 4PBTA 3IJ5A 3BZBA 3HDTA 5G0WA 3R0XA 5IJ0A 2NZVG 4QM6A 3COSA 3DWGA 1ZUIA 1R0XA 2FPSA 3MZ0A 3Q1LA 4MMYB 1FJHA 1SN7A 2GA8A 3HP7A 4HDNB 2PA3A 3DV9A 2I6XA 4I4IA 3PCTA 4KQ1A 1K7CA 4PS0A 1A1VA 2O8BB 3QEMB 4MRPA 2VBCA 2L17A 4CF3A 4JXXA 3GEIA 5FO1A 2DFLA 2P11A 3QVVA 1IJBA 1PT6A 4IRXA 3FRJA 4GZ5A 4AS3A 4BYGA 4DEVA 2G72A 1X3SA 3ZYZA 2X6QA 4RZ2A 2JBWA 4Z4IA 3VU0A 4R16A 2G9QA 4H9GA 1ADGA 2HZ7A 1LSJA 2HFKA 3IBTA 3LQ2A 3Q7TA 4KQCA 1IXYA 4KJXA 4ZOAA 5I4IA 2E4UA 3IJRA 1WDTA 4O8ZA 4GD3Q 5F5XA 2WSYB 3RFUA 3NLLA 5HBGA 5ISMA 4OGFA 1RWVA 1BXZA 2OQIA 1B8PA 1JHQA 1HQDA 1HXHA 1KORA 1PTJA 1Q19A 4OL0A 2VHYA 1TKRA 3PGKA 4K9LA 1E9BA 4YP6A 4XFDA 3KSMA 2NT3A 2X0KA 3ILVA 2OGWA 4A8PA 5IW8A 4DMHA 3F8SA 4AURA 3HUUA 3IESA 1ZMBA 2F48A 4MV7A 1QE5A 2Z9BA 1X9GA 3HV2A 4O4HA 4JAVC 5KTMA 1N1DA 1KSJA 3E61A 4PTYA 5E7QA 3NBYC 3FSRA 1QKKA 5LYYA 3ZJ4A 4DBLE 1A9RA 5JD6A 3L43A 1R66A 3VR4A 4EVIA 5IP5A 4NCKA 4QPPA 1BMTA 2AMYA 2BHNA 2AS0A 2XHEA 3DYBA 4OQEA 1YRBA 4E14A 4KR7A 1E3MA 3WTBA 3M1YA 1QFSA 2FPPB 2UYOA 1RYEA 2ZJ8A 3W5BA 3T99A 4BMCA 1UJ5A 4EMTA 3PSAA 3UXMA 3EZFA 1FRVA 1X1QA 5C4GB 3UAXA 5CCEA 3Q9SA 4CWAA 4RZUA 3RUCA 3AJDA 1PN3A 3GMIA 4JNCA 4UBOA 3WL8A 3WKAA 4BFVA 4LHXA 1TGYA 1ZDMA 4FI3C 2ZB3A 4PICA 5C7OO 1W36B 3KU1A 3I3OA 4FHCA 4PG4A 3L49A 1SUAA 1PF7E 3M3HA 1EFUA 1J56A 3B12A 3T7AA 2JZCA 3PEVA 1EUYA 2OYCA 1R9GA 3HS3A 4KXYA 3RVPA 2PTGA 2JS7A 5EZSA 1FFCA 1XPRA 1QIGA 2PDAA 1GVHA 4IKPA 3QYFA 4FQ7A 1K98A 3BMCB 4GR4A 3TN7A 4JN6B 2O2IA 3ZGOA 7ABPA 1X8LA 1AG9A 2E2WA 1WXDA 1SQ6A 4N5IX 4UNQA 3IJPA 5JNWA 1RE0A 4NJOA 3AI2A 2R65A 1EVLA 2IYSA 4ZGWA 1LK7A 1YQWA 2R2GA 4HDRB 4KXLA 4LJ8A 4MPDA 2DAPA 4P5PA 4BTVA 2H2IA 3FOZA 3BA1A 3USCS 3ZZ1A 4F93B 3ZPXA 1SRQA 1E7QA 2C3MA 2XUZA 1NYQA 1N6KA 3A9SA 4QPJC 1NJ8A 5BRNA 1QC5A 4KXMA 1DX9A 3KQPA 4GWKA 3MC1A 4HQOA 4P53A 5ALJA 2DQYA 3O4FA 1B43A 1E2UA 2A1UB 1YCHA 4L74A 4MUBA 3W5DA 4MUIA 4YCAA 5IZCA 3E4CA 2Z8YM 4HZUB 2NTYC 5GADl 3MS2A 4WKGA 1DPGA 5T3YA 3I6QA 3LW8A 3IHKA 3H97A 5D2CA 3OF3A 4TTAA 2C2XA 1Q22A 1EDEA 4K9NA 2DKNA 4YHHB 3CJRA 6LDHA 2XCUA 4C0AC 3B89A 1JW9B 4REQB 3I8XA 4YVFA 4KQ9A 1F9AA 1OJ7A 1VLMA 1U7ZA 1ISRA 2GN9A 3DCJA 4FFNA 1CB7A 4NNJA 1L5WA 1TF2A 3L1UA 4TL7A 3VU3A 3WWYA 1NBHA 1KQ3A 2W6IA 3DZDA 5EZQA 5BNIA 3H84A 3C97A 4MI3A 3V34A 3B1JA 4MDFA 2X4GA 1KKUA 4RHUA 3NV9A 2Z6UA 4AKHA 1O0SA 2V7XA 3GBSA 5HG0A 3STHA 4G0WA 1PWZA 2BMDA 1ACLA 1W5AA 2VQ3A 4KIFA 4RKRA 4X7PA 3U44B 2AN3A 4CR6A 4YPFA 4B9AA 4OAOA 1U0OC 3G9QA 3IC5A 1EX9A 2VPTA 4CLHA 1HDCA 3MT7A 1K08A 3K1TA 4K5QA 1OBHA 1M34E 1U3FA 4G1CA 1XTRA 5CW2A 1Z6ZA 5EHQA 2R47A 3TI7A 4LGVA 3WRYC 1AJEA 1HX7A 1MAAA 2YXLA 2LTAA 1CZLA 2XQGA 2ZIWB 1LEHA 5L51A 2BUBA 4JU9A 4YP1A 5JVDB 4X8HA 1KEEA 3QY9A 4IMPA 5KJCA 2PZKA 1ETHA 4RXTA 2RE8A 4N9WA 5FDFA 1B26A 1VYVA 2AFIE 3F9CA 3T3HA 1ZH6A 1E2IA 2V65A 3M6UA 4YALA 5DLEA 4YT8A 4JLJA 5I01A 4H7JA 5EWMA 3RC9A 2XLBA 3KBOA 4R9RA 1Y3CE 3RIHA 1LKZA 2EL9A 4O4HB 4RYLA 5T4HA 4HYTA 1ESEA 3DO8A 3N8HA 4MRMA 4Y2HA 4B5LA 2V6GA 3PRJA 1MO2A 5GGYA 4RAQA 2VP5A 3B13B 3KR9A 3ZNOA 3A1EA 2H1SA 3TO5A 3L0SA 1QGDA 1O97D 1DE0A 2QRHA 3Q7RA 3W5IA 1TVKA 2IUEA 5GJCA 1XMVA 3P2OA 4WECA 1VL0A 1IN1A 2YJNA 3BHNA 2FN9A 1W0JD 1LQ2A 2C4NA 2O0JA 2Q0XA 2VF5X 3CZ4A 2OL4A 1BOFA 4Q6WA 4X92A 1H6AA 4I4TB 4WCDA 2HU5A 3KVOA 2QN6A 1PWEA 3L4BC 4MWGA 3TPCA 3E5HA 5KHOC 5BR7A 3NDJA 4GL4A 1A97A 1ENZA 2R5NA 2C7BA 4MJ3A 3TRIA 4FIZA 2VDLB 2IUSA 1J22A 5AJUA 3PC8A 4FYVA 4L3OA 3DVAA 3N2IA 4G5SA 2C4HA 3GJ5A 5KU7A 3U49A 2ISQA 3GCXA 3ZTTA 4LOIA 1TZJA 5IFKA 4NS4A 5L40A 2PBZA 4A2CA 3DZHA 4YX9A 1I6LA 3LA8A 1BVHA 3LRXA 2OVBA 1Z5UA 3RBVA 4X61A 2JBAA 1YFKA 4MR7A 1GR0A 1PQUA 2VYQA 2OCYC 2TMGA 3H5NA 4PYJA 4DABA 4UZFA 4Q24A 4B6PA 5KNBH 3LC2O 4K05A 3HDVA 4X85A 3I9V6 1UZMA 4YO7A 4KRYA 1JAHA 1W5EA 4OQ4A 4RGBA 1YUBA 4N18A 4HJXA 3ILXA 3OCWA 5AI0A 1TM5E 3EIXA 5CA0F 1YFLA 1WMSA 2B83A 2FSUA 1E3SA 4WGFA 1FYFA 5JJBA 521PA 2NU9B 4QXPA 3BFVA 5AVXA 1H05A 4FE3A 4QPZA 4OXRA 4TV8A 2FSIA 2J5RA 4S1TA 4XUDA 3ZXUB 5AQ1A 4N5HX 5CHEA 3RTAA 4CMHA 3PQDA 1E4VA 4MR8A 1XKLA 4G6ZA 3WGKA 4HAZA 4CV0A 1JG2A 2PBFA 4MKRA 3OFVA 1W29A 1YL6A 3KLBA 4TWBA 4IXMA 1DKPA 3PGVA 1QYVA 1V1JA 4MVYA 4D4KA 1U80A 2I4TA 3HXQA 2Q9UA 3PA8A 2ORWA 2ZS8A 4I66A 3TLGB 2VS1A 4GECA 5IS2A 1CR0A 2F1KA 2JIOA 1GCUA 2W6JA 3HL4A 1V4VA 2R62A 2NSJA 3AEZA 4MGYR 5COQA 5L3RA 4B81A 4RMGA 1O8CA 4TLLB 4RPKA 1H1TA 2ECPA 5IK2A 2IH2A 2XKAA 4WK6A 3B5IA 1CD5A 3W2EA 2JGFA 2PAAA 3WY9A 2GHIA 2XA9A 3USZA 4ARVA 1W9HA 2D00A 1EDBA 3M81A 4L8FA 4N47A 3SZRA 3H05A 2JGAA 5D51S 2PK3A 3QUSA 2AI1A 5REQA 1OF1A 5YASA 4CMAA 3SZLA 4MUKA 1UM9A 3A1NA 4TTJA 5E9JA 1YS4A 4D3ZA 1Z5PA 4U3JB 3H8SA 5K0SA 2YN2A 2CMDA 5JFTA 2Q0QA 4CM8B 1WDKA 2R6HA 5K6AC 2H4FA 2YBDA 1VE1A 3A4YA 3EW9A 3KOXA 4Q16A 5KKCA 3B9QA 3WKCA 2JJ8A 4B3IA 5FLEX 3ZTYA 3OEEA 4IX1A 2YMLA 2RIPA 4OA8A 1L2TA 1JN0A 4EEKA 4C4SA 5KYWB 1Y0BA 2X4LA 2R5WA 4DNFA 2XYRA 4K9RA 3DAOA 3RIXA 4K6FA 5ECYA 2CVOA 5EPUA 4JA0A 3IUBA 4URXR 1AS2A 1ACJA 3V4PB 1MJGA 5L4SA 1F2DA 3CB2A 3PQCA 4F3RA 1NQ5A 2C96A 1W48A 2HAEA 2OGTA 1TUIA 4N3BA 3I9FA 4MV8A 4CF7A 4JT9A 3I6BA 3AR4A 1W96A 2YNMD 2OXIA 1FSZA 1Z0FA 3DO5A 5CDFA 1RJ9B 3HPRA 3KR2A 2OHXA 3N8GA 4BFTA 5JMWA 1R00A 3KPJA 4KHZA 2O2YA 3C8MA 3PK0A 1VL1A 2F00A 3R9XB 3M7IA 4FFWA 1N2BA 3QVUA 5A9SA 3DOJA 2Q1XA 3KSUA 4Q3NA 3W2FA 3ZY6A 3TF5A 2WMYA 4ZK2A 2GAFA 2DKOA 2CE7A 2GVNA 3U26A 5I7SA 1Z56C 3DVLA 3NEJA 1GKLA 1HZZC 3OA0A 1E6MA 3HXTA 1T8PA 5GM2A 1KL7A 3HLYA 3LCRA 1KDYA 2BM9A 3SMQA 1T9CA 2SHKA 1BVYF 1K0FA 4PLYA 3B48A 5B37A 3BF7A 1KZ7B 2PPLA 3DEYX 1GLVA 1W581 4FMCB 2VJQA 3KTOA 4UDXX 1T8YA 4OEHA 3AVOA 2ZBUA 4E7OA 5KPDA 3II6X 1WPGA 2FFBA 3P9XA 3Q1KA 1D4AA 4KQJA 1DDGA 2VF8A 3IDSA 4HVLA 2G9NA 4X1KB 1HTBA 5E6UA 1RD4A 3ZGYA 4EPXA 1W36C 2ZRJA 4M0EA 1NURA 2IEDA 5D3KA 3WLKX 3SPXA 4MRNA 4D6XA 2O7SA 4DJAA 1N5RA 4Z9XA 4BZQA 2JLYA 2XVXA 2GRUA 2IOYA 1P19A 2K6GA 2GUGA 4R6WA 3MOSA 1N6NA 2VWPA 3NKFA 1J21A 5DIFA 3HA7A 4QTYA 5C5DA 4YR9A 6REQB 4OP3A 3BCRA 4IHJA 3AF3A 1OC2A 1P9LA 5CTJA 3P45A 3RJ5A 5BT9A 4PNEA 3DMTA 3N2ZB 1YOBA 3TW0A 3HVUA 1TCCA 2XHZA 3NG1A 1V45E 4OV6B 3A14A 1E1MA 4EGFA 5AW7A 4W5NA 4MWEA 2X8JB 2YL2A 2M6RA 2XEDA 3BRCA 4MGZR 2DBYA 5KDDA 1E1YA 1A9SA 5FAKA 5B2ZA 4A2PA 2C0QA 1JWAB 2VYFA 4DNXA 1ISSA 5EXDA 3CIFA 3C1UA 4MRRA 1WP4A 2JH3A 2Z8XA 5HMMA 2C7RA 1Y42X 2VT3A 4WNAA 4DS3A 4RKEA 3BTVA 3L7MA 5ES3A 2R1TA 3DFUA 5ARBA 1H3NA 1NZDA 2PJDA 3CLTC 5FOQA 1LK5A 1RAAA 4QOGA 1GZ3A 2X9NA 3UHJA 3Q72A 2FEPA 1WEKA 1QNLA 2G6TA 1NZJA 2KM1A 4FXPA 2WVHA 2RB5A 2PZFA 4C4XA 1OSNA 3GNSA 4GFDA 4N7JA 5EJ9A 3A7DA 5F7ZA 1J97A 1AK9A 4R9SA 4AUNA 3DMHA 4IHJF 4TSFD 1RKXA 1KXJA 1L5VA 1Z39A 2B7CA 2CD9A 5G0VA 1M0EA 1CUEA 4XYEA 2FSSA 2ZTVA 4P3NA 5BQFA 3RT9A 1JT9A 3EXHB 3BJZA 2AZTA 3ENKA 3SGLA 5G3YA 5ICEA 1IY2A 3A28A 4ND6A 4GXNA 2UUBB 4K26A 1T0UA 3V32A 1XB2A 1Q0SA 2Q29A 2HI0A 1L5ZA 3QBTA 2AQKA 1TD1A 2YOGA 3MILA 4M89A 4QBHA 1UP6A 1DQNA