4MZDA

High resolution crystal structure of the nisin leader peptidase nisp from lactococcus lactis
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
424
structure length
356
Chain Sequence
SHDFWDYQWDMKYVTNNGESYALYQPSKKISVGIIDSGIMEEHPDLSNSLGNYFKNLVPKGGFDNEEPDETGNPSDIVDKMGHGTEVAGQITANGNILGVAPGITVNIYRVFGENLSKSEWVARAIRRAADDGNKVINISAGQYLMISGSYDDGTNDYQEYLNYKSAINYATAKGSIVVAALGNDSLNIQDNQTMINFLKRFRSIKVPGKVVDAPSVFEDVIAVGGIDGYGNISDFSNIGADAIYAPAGTTANFKKYGQDKFVSQGYYLKDWLFTTTNTGWYQYVYGNSFATPKVSGALALVVDKYGIKNPNQLKRFLLMNSPEVNGNRVLNIVDLLNGKNKAANNRNSRGAVSVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the nisin leader peptidase NisP revealing a C-terminal autocleavage activity.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Hydrolase
molecule keywords Nisin leader peptide-processing serine protease NisP
total genus 142
structure length 356
sequence length 424
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4mzdA00
1NDQA 1SH7A 5ARDA 1GNSA 1WMDA 1BJRE 4JP8A 1YJBA 5I9SA 2X8JB 1Y1KE 3DYBA 3BX1A 3WIUA 1MPTA 2XRMA 5AVKA 1GA6A 3QFHA 1BE6A 1AVTA 1Y3BE 1Y33E 1Y34E 3DW3X 5JXJA 1SCDA 1C9NA 4AKTA 1SBIA 3GCWA 4NMXB 3TECE 1TM4E 3F7OA 1S02A 1YJAA 1GTJ1 3QMPA 3DVSX 4LVNA 3WQBA 3ZXXA 2G4VA 3CO0S 2W2MA 1SCAA 2PWBA 3AJ8A 4H6VA 3T41A 3BGOS 1SCNE 1ST3A 3DWEX 3I30X 1ZVKA 3GCXA 3DE7X 2P4EA 2PQ2A 1SUCA 2PRKA 2WWTA 1EA7A 1Y9ZA 1EGQA 1Y3DE 2ID8A 4BWGA 2W2PA 4HX2A 3LXUX 1P7VA 2Z2ZA 3GT4A 1GNVA 5FBZA 3L1KA 2ID4A 2Z2YA 4AKSA 5JXGA 1SUPA 2ZWOA 3D9QX 1HT3A 2E1PA 3VYVA 2TECE 4DJ5X 1UBNA 1Y3FE 3DE0X 3SICE 1NDUA 3AFGA 1MEEA 2DQKA 3HJRA 3GT3A 3VV3A 3I37X 4C3VA 1T1IA 2QTWB 1Q5PA 1THMA 3TI7A 2Z57A 2ST1A 4RYDA 1P8JA 1CSEE 1DBIA 3SQOA 1GCIA 1SCJA 2W2NA 4C3UA 1GTG1 2SBTA 1YJCA 1A2QA 1BFKA 3A3PA 4OMCA 1Y4DE 5CW1A 5ARCA 3EE6A 1R6VA 1SELA 1SIBE 4ZARA 4LVOA 1PTKA 2DUJA 5FFNA 1TM7E 3EIFA 5FAXA 1BH6A 4I0WB 1IAVA 4J94A 3LPAA 4B5LA 1PFGA 3F7MA 4WOCA 2SICE 1SBHA 1OYVA 1SIOA 1SBTA 1JEAA 1C9MA 2GKOA 1AK9A 1YU6A 2HPZA 4K8RB 3A3OA 3DDZX 4DZTA 3OSZA 4MZDA 4DWWA 1AH2A 5K7SA 2WUVA 3A3NA 3DW1X 1S01A 4KG7A 1PEKE 2PWAA 3Q40A 4H6WA 3VTAA 1GA1A 1C3LA 2ZRQA 5AVJA 1CNMA 2PYZA 3ZXYA 1C9JA 4WOBA 1P7WA 2Z58A 1GTL1 3DE3X 4CFYA 2Z2XA 1S2NA 1AQNA 1R64A 3LPCA 1WVMA 2IY9A 2V8BA 1SBCA 2W2OA 1XF1A 1BE8A 5AMXA 3VSBA 2Z56A 4GI3A 1KE1A 1KDYA 5ARBA 4M1ZA 5AQEA 2B6NA 1WMEA 1KDVA 2ZWPA 3I34X 3DE1X 3DVQX 5JXHA 3BPSA 5SICE 1V6CA 5B1DA 1V5IA 3I2YX 2DP4E 1OT5A 1KDZA 4Z2AA 4YN3A 3DE2X 5JMOA 1TK2A 2W2QA 1R0RE 1AU9A 1SUDA 3DE5X 3DVRX 4FONA 1TM1E 2HD4A 4OV6B 4CFZA 1PJ8A 1SBNE 1SCBA 1SUAA 1SUEA 1T1EA 1TM5E 1TMGE 1TM3E 4H6XA 3UNXA 2IXTA 1SPBS 2WV7A 1TO2E 1OYOA 1ZVJA 1AF4A 2PKCA 2WUWE 4KB5A 1WMFA 1SVNA 4NE7A 4ZOQI 5JXIA 3P5BA 2SNIE 1Y3CE 1LW6E 3LPDA 1NLUA 1BFUA 3Q5GA 1VSBA 3PRKE 3WIVA 1SIUA 3D43A 3H42B 2Z30A 3QTLA 3AJ9A 3DE6X 3DE4X 1T1GA 3EDYA 1TO1E 1GT91 1ST2A 2SECE 5B1EA 1IC6A 1WSDA 1TECE 1Y4AE 1Y48E 3F49S 2X8JA 3PTLA 3VHQA 3VV2A 4OMDA 3WHIA 4KPGA 1SN7A 1AV7A 4CG0A 4HVLA 3CNQS 3TI9A 1GA4A 1SUBA 4NE9A 1KE2A 2PMWB 2XTJA 1DUIA
chains in the Genus database with same CATH superfamily
4PN7A 3PNQA 1HFJA 1R6BX 2P8SA 4ZQCB 2ZGVA 2DPHA 1NRIA 3BWEA 4RZ2A 3CRQA 3JQAA 4QTZA 3RBXA 4D43A 3ZLJA 5TPWA 4RZ3A 2R00A 4DCSA 1OXKB 3D3JA 1DIGA 4QJIA 1SVWA 1Z7EA 4HWGA 4OPMA 1Z6XA 4JC0A 2PGXA 5JY6A 3PWKA 3R5SA 5HILA 1OMOA 2QTNA 3PHGA 1LK0A 1A72A 1GUBA 1I6KA 2NTEA 2QORA 3UKOA 4LDPA 5F3RA 1CY4A 1YZGA 3MCUA 3GR6A 2GAFA 3C5CA 4MZXA 3AIOA 2IIVA 5P21A 3R24A 5BMOA 1U1EA 2NXCA 1KSJA 4G0NA 3CH4B 3B5EA 4CM9A 4Q5IA 4HGZA 2LTAA 1G3MA 1WWKA 1ZXXA 1EE1A 1FUYB 1XQ6A 3I0ZA 4RY2A 4CQJA 1P62B 3GFBA 2ZWOA 1P1IA 2DKFA 1ISSA 2R6GA 3WJ7A 1WF6A 2ZKLA 4H3SA 4UREA 5KTRA 1BW9B 3CXUA 2YNMA 1NMZA 3W4JA 3ZZMA 4BKOA 3LPMA 3FBTA 1QHFA 2Q0QA 3KHSA 3QFSA 2AX4A 1KP3A 5G3ZA 4RF4A 2DF8A 1KU0A 3VNRA 5KU1A 3R7DA 5LQDA 1XLTA 4ZV4A 5G4KA 3OPQA 3BCSA 5G1PA 3K2BA 1R50A 1XLVA 4HFNA 2WHPA 4HAWA 4TQAA 3B1YA 2R6HA 4KO4S 4MR7B 2BWJA 1YTUA 1F2VA 5K8LA 2L0XA 4HY3A 4PZPA 4N0EA 1AK9A 1VGVA 2PKXA 4CEIB 3V8RA 3ZWBA 1WV0A 2HNAA 4LV8B 2LV8A 1NONA 3RJMA 3VU0A 1ZUIA 5JYEA 5J2TB 1S4MA 4F71A 3JQPA 2QYHA 2ZSUA 2B8TA 2YVQA 4RD2A 4UPVA 3EX7C 2HY7A 3LOPA 1U02A 4PSKA 3PR3A 4XGNA 2Q4OA 1MX1A 3BKWA 1ZAYA 2XODA 1ZA2A 1J2UA 4FDAA 5E6RB 4XR4A 3VSBA 5ESRA 2KX7A 2VUSA 4XARA 3CX8A 1KMQA 3GP8A 5AQEA 3QM1A 4PXAA 4YALA 4OXQA 1DELA 1Z4IA 2P6OA 4KYUA 4ZC1A 2PGOA 3SZUA 2YOHA 1ADGA 3I01A 4BKUA 1SZJG 2CDBA 4KR0A 3OM0A 3NAZA 4BVFA 4A0RA 4Z3OA 2HUNA 4E14A 3HO1A 1OLUB 1QIGA 3DFKA 5LSAA 5CLQA 2GF0A 2JGMA 4MCAA 1O8CA 2UYOA 3K6SB 1EHYA 1V6SA 2WKWA 4RK6A 4I4TA 3RJ9A 1D2NA 2CLOB 1W25A 5EWJB 3U4GA 1B6SA 1AB5A 5IJ0A 2QTMA 4YC7A 3TR5A 3LLUA 4AXBA 4Q3DA 2DPLA 2QLBA 2PTHA 2YWDA 4AURA 2VHEA 4H4CA 5A4FS 3C6KA 4Y1GA 4Z7JA 2X15A 1FB5A 3L04A 3RI3A 4Q4AB 1EH5A 2XUPA 1OFUA 1K6MA 5KI6A 3T3NA 1KC1A 1CUJA 2H4YA 2Z4SA 3EPRA 3IDSA 3JD3A 3ZE2B 1W0JA 5IAJA 4M7OA 3D8RA 1WB4A 3JPWA 2N47A 4BBPA 1NUPA 4MJLA 2X40A 4JJ7A 2O8FB 4X7BA 2GDJA 3W3AH 3P0HA 2VP5A 3EY4A 4NJOA 2Q07A 2VI5A 3OESA 3V1NA 4A6EA 4YXFA 3A6PC 1T15A 2BN4A 2CHFA 4UBNA 4MOWA 1BMQA 1W4AA 3RVNA 1KDRA 3USES 2UVQA 3WKBA 2JHCA 3TXYA 1W2WB 5BN4B 1TRHA 4LZOA 4LOJA 1KJNA 3KL4A 2HA3A 4AY3A 3QYJA 4UEQA 4BU1A 1E77A 2P2LA 2JEYA 3TSYA 4UNQA 2GXUA 4P4TA 1LS6A 3QKSA 3Q3VA 4M22A 2BKAA 1XROA 3IBTA 2PT9A 3AP3A 4I4IA 5TDHA 3BMCB 4BMCA 3K9FC 2H1OA 2FWPA 4UMEA 4G84A 4N4AA 1Z56C 3NUQA 5E2IA 4ARIA 5DLPA 3LZ6A 2PZAA 4J8PA 1SC6A 1B43A 5TJ9A 2HBRA 4XGIA 4WZAE 1QTIA 4B83A 1IEVA 4GOMD 3QJ5A 1QE3A 1RBZA 1EFPA 1B0PA 3IMEA 4RD3A 2YHUA 2SBTA 2NU6B 2X8AA 3R6TA 1Y4DE 4OVKA 4NDAA 1GR0A 5HE8A 4BQPA 1GM5A 4GQAA 2EF1A 4R7ZA 5CFRA 3RADC 2BR3A 1C8KA 1I4DD 2CLCX 4FZ5A 4XXHA 2P67A 2F00A 1HMYA 1WXEA 4EQ6A 1FS4A 3MG9A 4E88A 4PHTA 2NSDA 3SQMA 5BYKA 2D06A 4EKGA 3WGVA 1OHHD 1CUVA 4DA8A 4DQDA 3Q11A 1I4WA 3HK2A 4PICA 3I6QA 3PKIA 3NC1C 3LSTA 4FX2A 2QQFA 1DMRA 3KZCA 2YR0A 5FUVA 4YV7A 3CW8X 3DR3A 3EFEA 4GI2A 1C9JA 2R1ZA 2WSYB 1JHMA 4N3AA 4XGKA 2E2WA 5EIHA 1VCHA 1F0NA 2G4CA 2PD6A 2QLJA 3G88A 1JQDA 3A3YA 4U1RA 5DBGA 3CS3A 4B6EA 2X6RA 1UWLA 3ENNA 3HFSA 4MUJA 5D8DA 4G5OA 1DC6A 5LBIA 5A04A 5FI5A 3P52A 3RS3A 4UHCA 4DIOA 4ZI7B 1YQ9A 3DULA 4MINA 2YWFA 1GCAA 3B3JA 4H31A 4CT4B 4F86A 2AGVA 2KM1A 2YJGA 3L8DA 1UK6A 4HB4A 1E6CA 4CMBA 4F56A 1GYQA 1R0RE 4JP2A 3R7SA 1Q17A 5B2FA 5IYZB 1QH1A 4ESVA 3WL3A 2C58A 3CF0A 1U11A 3PXAA 1QHYA 3AM5A 4YX9A 4F46A 4PTYA 5TNXA 3R2JA 2XXAB 2XKKA 1QKIA 3OWXA 3Q1LA 1N25A 3CLTC 4CODB 1M5TA 3RC9A 2Z3ZA 2DY1A 1UMBB 1LF5A 1PR0A 3H42B 3RYIA 4EPYA 4FFOA 3ER9A 1U0EA 3N7TA 8MHTA 3SDSA 3S99A 2BDEA 3UOGA 2B78A 2I7TA 1FNCA 2QI9C 3SBDA 1P8AA 3DC2A 2VH5R 1QGZA 2I2DA 3K9HA 2FKNA 2BW0A 1TA9A 2Y4OA 4YBRA 3F5MA 1Y8RA 2IEAA 3MMZA 2IYFA 4M60A 4HTFB 5JIBA 4IJWA 1RZRD 1Q0RA 2DKOA 3NT2A 2FWIA 2J0EA 4Q1FA 2QTTA 3RAGA 3SC6A 5AOAA 3DO5A 3DAGA 3O8BA 5AJXA 5ESXA 4KRXA 1VLJA 2O57A 2PS9A 3SM9A 2AG8A 3KO8A 4QJ3A 2V6IA 4XUDA 2AF4C 4TRMA 4Y9RA 5U4XA 3V3TA 1XCLA 1R18A 3M4JA 4ERNA 5D00A 5KZMB 3MRSA 2R4QA 3TQSA 3U3DA 2RSLA 1JHRA 2Q1WA 2ZT7A 4JGIA 2OCPA 4JCCA 4ON9A 5A7GA 2PYIA 2AH5A 1NW9B 3E4CA 4YAIA 3H5AA 2OZEA 2ZTLA 4E7PA 2R6FA 2EU8A 3CUUA 1VG8A 3M70A 2WKQA 5BSKA 2I1LA 1I1QB 1R0WA 1E32A 2IU0A 3ZI0A 4CKCA 4F2WA 3I12A 5I7HA 3TNDA 2OM2A 3NANA 1BQEA 1RNLA 2HZ7A 5TEWA 5FO0A 4BCDA 1WDMA 2PGJA 3G9UA 5ADHA 3ONVA 3CRRA 3NEPX 4J76A 1VPDA 2J4CA 3LT0A 3ROFA 4BNNA 1XEFA 3NVDA 4EYOA 4P4LA 4E5SA 1M1YE 2OBLA 3K0FA 4BHTA 4DLWA 2B94A 2W58A 1FFGA 1U7TA 1ZC3A 3CN7A 2QTBA 2ZSDA 1M2FA 2CJYA 1DEKA 3A1CA 3H9GA 5D5HA 5EZ6B 3RF7A 3T7TA 5BWNA 5ITWA 4OQFA 2HLDA 2QA5A 4C0KA 5DNVA 3NOQA 4GRIA 4RTMA 2XX3A 4RO0A 3DUFB 3EIFA 5JCPA 3RR2A 3OPMA 4GC9A 2ATCA 1VHLA 2G83A 5E8RA 4GKKB 3E5NA 1C9MA 4HK4A 4L4ZA 3U4QB 4WKCA 4QULA 4IXDA 3GFRA 2A1UB 1FNBA 3FTCA 3HP4A 1G291 3Q3GE 4FOPA 4EX6A 1MRZA 4BP1A 4D9CA 1XVVA 1JUDA 4LWQA 4FN4A 2DPMA 5THXA 3BSWA 2HBQA 1TKBA 3UHAA 2P0YA 2PFSA 3Q7RA 3UOAB 2DR0A 2B8NA 4BY9E 2AJLI 3B6KA 4RKWA 4EWLA 2CVQA 5JSZA 5KPDA 1WO8A 4FBLA 1HT1E 3R3VA 4YMSA 1GVHA 1L5ZA 3ZHCA 4IXTA 1MTZA 2Q8PA 3H75A 4K86A 3NYRA 4RS3A 1V11B 1GGMA 5IG2A 3II6X 1R37A 4Q6BA 1Z22A 3E0XA 5B57C 1X7DA 3QENA 1E2EA 3QYAA 4BVJA 3K0BA 3T7EA 1US8A 4BE4A 1PJAA 4AZSA 3WK7A 4ETNA 2V8OA 2XQVA 3PC3A 4UDOA 4Z5XA 3F8SA 4YAGA 5G0VA 4LX8A 5AI9A 3NOVA 4E03A 1EDEA 1QHXA 5T41A 3PQEA 1JDZA 2FEMA 2FPMA 4LVUA 3DV0A 1N1GA 3JQ6A 4W5HA 3IAM6 1EWYA 4R16A 1JR6A 4C7JA 1LW7A 1K6EA 3ADCA 1FA9A 4ZYZA 5JD4A 5LNK1 4TKUB 2HNBA 3RSCA 2XCQA 2R6AA 5EQJB 3AVUA 2X5JO 4OOFA 1JDUA 2XMSA 3AHHA 2C2HA 2V03A 3FPSA 2JL1A 3LL4A 1ISHA 4I36A 4XM1A 1OFTA 3QXHA 1YB5A 2XMCA 4Q4AA 3UAVA 3B60A 5JMWA 3C6ZA 3S4YA 3KZNA 2OBBA 7MDHA 3BULA 1PT8A 3KZXA 3PDIA 4QARA 5ALUA 1W8DA 3WXBA 1ULTA 1D2HA 3EG9A 5C4IA 1AMNA 1V5FA 2L69A 5NULA 5HFNA 1AE1A 2HKIA 5BUSA 1RRCA 1Z4JA 5FEMA 1BS1A 1ECJA 3UJAA 2ENUA 2Q9CA 3CGWA 1N8TA 2G7ZA 3FKJA 3IVRA 4YVFA 5DM4A 3UWPA 5IJZA 2X0IA 4JXZA 3TLCA 1QLHA 1SXPA 2D00A 3VGPA 3AV3A 3QVJA 4RMGA 2ZSHA 1U0SY 4F9EA 3RYIB 3FY4A 3ZZ1A 1JIUA 1NW8A 1Y3DE 4RJTA 3ZDQA 4HS4A 4WBSA 3WLOA 1P7ZA 4FKBA 2UU9B 1O97C 2F3TA 1TUEA 1MBZA 3PSHA 2WUFA 3FPCA 4FYKA 4QSMA 5H7XA 5C1IA 1H6AA 3ITEA 1COWA 1QE5A 3K5WA 4JJEA 2CLFB 4NLLA 5IAKA 5SY6A 2JGKA 4ARBA 4Y2QA 4BVGA 3WZ2A 2JGDA 8ABPA 1RFGE 7ABPA 1G7RA 2VHUA 3HYLA 2R1TA 2QTWB 4EJ0A 1L4GA 5FI1B 5IC5A 3WV5A 4BJ1A 1RAEA 2GARA 2BCEA 2CWDA 2PS3A 5CDFE 4RVHA 5FQOA 4N3CA 4FHGA 3LVQE 5JJCA 2NW6A 4AMUA 4WXHA 3VPFA 4XDZA 3RIEA 3K1TA 4IXMA 2WDPA 4M53A 3V5NA 5JO0A 2WVJA 3NV9A 2JZNA 3DT6A 5IN4A 2PUDA 3LQFA 4ZU3A 3ANNA 3MS4A 1T0HB 4WRRA 4KR9A 5KTOA 5L3VA 3C48A 1N9GA 3IIEA 3AP2A 1M7GA 3L0IB 4RTQA 1H22A 1QDUA 1PFVA 1R5NA 2NPOA 4EVQA 4CKCB 4WACA 5KNDD 4DV1B 4IKEA 4JZYA 3S2YA 4OB7A 4PAWA 3QXJA 3E48A 4YRDA 4N7JA 2Z5FA 1NY6A 1ATIA 2VZ8A 4JJ8A 1W0KA 2FTKE 2D8MA 1M73E 2P3QA 3ZJ5A 4TXMA 1ECLA 1AF7A 1TDJA 3M89A 1PFUA 4AJIA 5ICGA 4CI9A 2AXQA 2XQJA 1UBTS 2GN1A 2BMEA 3KE9A 4B8YA 4V1CI 5AVOA 5HKOA 3DXFA 4DKJA 2O59A 2BEKA 1YRHA 5A3VA 1LRKA 1YL5A 5JXHA 1HL3A 1C41A 1V5WA 1D7OA 4Q9AA 4FR0A 3LC1O 2I2CA 4WADA 4P92A 4KO8A 3H1GA 3W5HA 5GGXA 4RELA 1EM6A 2OCXA 3ZBTA 4BGIA 4FGKA 2VBIA 4YCDA 5BT9A 3UAGA 4EH1A 3QK7A 3B3GA 3K15A 3DOHA 3HVJA 1DO8A 3K30A 3PE3A 2LIPA 3SIPA 3FCEA 5KKNB 1VMDA 3DTVB 2OQVA 3LCCA 1SVNA 2JAHA 3CRZA 5JPDA 5D5PA 5EEHA 2R5NA 2PL5A 2XE4A 4JBNA 2WG1A 2XITA 2FK7A 5B30A 3ZQ4A 5D2CA 4U7DA 1I9CA 2IS2A 2BHRA 3KKQA 4KDFA 4DA6A 1E2HA 1IHDA 3ISTA 3DBLB 3JYNA 1DKMA 2PV7A 4KX3A 4E33A 3B6ZA 1TEZA 3UWDA 2P4SA 1VDMA 1JAIA 1PG0A 2YZGA 2O4UX 3LO5A 4K05A 4JS0A 5CPBA 3CNQS 2ZANA 8LDHA 1P31A 4NI5A 1DWUA 4PPFA 5K0LA 3SNKA 3QZUA 3H13A 5ALSA 3ABRB 1IPFA 3FSEA 2HA4A 2ZIVB 4IKPA 3ESZA 1NIPA 3QWAA 1YK0A 2E1RA 4B3IA 2Q2QA 5IWAB 3IERA 4HEJA 3AEXA 2P9ZA 5MHTA 3RRNA 1Y34E 2A5DA 4XWWA 3LUPA 4MAAA 1P4RA 2WKRA 3A2NA 3E70C 1Y3IA 3O7WA 3FVQA 3K9CA 3I9NA 2QZJA 2ZR7A 3N8DA 2MIIA 2DH6A 4DNPA 5KKCA 3Q2KA 3NHRA 3JQGA 3DWEX 2P6RA 1GU0A 3CR3C 1XLTC 1XRJA 2JGFA 4G01B 1XP5A 4AWAA 2BSAA 1Y1QA 2P5YA 4HYYA 3OJXA 1N2XA 2ZE8A 3FUXA 4RFSA 5F73A 3P9IA 2W2KA 3SJ7A 2DSTA 4Q05A 4DIDA 5KSZA 5E4TA 2JIQA 3OX4A 5IBRA 4QWMA 4CKYA 1WDLA 4Q7QA 5IJ0B 5JASA 5IC4A 1SZPA 3CEJA 2PE5A 3GZNA 4NBLA 2V0CA 5FO1A 1T5OA 1XG5A 5A0TA 2CHEA 1DPFA 4RADA 3CEMA 7YASA 4QU5A 3SHOA 2OGTA 3V8BA 4C4YA 1QZ3A 3PC8A 2ONCA 4HPXB 3IAM1 1ZSNA 3RFFA 1UXKA 2I87A 1P0QA 3L4EA 5C35A 3VC1A 1QYDA 2OXRA 4CF5A 5SV2A 1D1QA 5TR9A 3V4VB 4YRFA 3T1YB 2J5KA 2QTVA 2O5RA 5P8WA 4E30A 4EHJA 4ZK6A 1I2CA 4BPRA 4GNRA 2YXDA 3BF8A 4U7JA 3PDHA 3PEUA 4LXGA 2FFBA 3PS9A 1ICEA 1JKFA 5EJFA 1TD9A 2WMOB 4F9TA 2JI8A 4JI2B 4RZQA 1E4YA 1Z68A 3N39C 3QEBZ 1RP1A 3O84A 3FNEA 2O1SA 4MKRA 2NAPA 3B78A 3BF7A 4C7KA 5LQJA 3Q40A 2BEWA 1FVXA 4OQDA 3STYA 3VC3A 2XMRA 3U19A 5LZ5A 2QG9A 3NTXA 2Y92A 4DS3A 5A7FA 1V2GA 3UTCA 1DCMA 3GDHA 4QODA 1N4AA 2E4AA 2GSDA 5ICEA 5E95A 4ME6A 1EX7A 1YB1A 3PLRA 4J3NA 3O94A 1RI1A 3IS3A 1W5AA 2VJMA 3IUJA 4JLPA 3HN6A 4LGMA 3NHUA 4M6WA 4RM3A 5IYZF 1FFXB 3I34X 3QG1A 3PXGA 2PGDA 4CMEA 2HK9A 2HSEA 1JHDA 1H1TA 3AEUB 3BMQA 2PLFA 2P41A 2EFDB 4QGAA 1E7QA 1CRWG 1DNPA 2ZS8A 2Q50A 4G5YA 4X3CA 2VDNB 2XCTB 1TYAE 2FP4B 1NVTA 5AK0A 2XNJA 3IUBA 1Q0SA 5HSGA 4GIBA 1L7MA 2PH1A 1TQHA 1OZHA 2QL6A 2I6XA 4YRSA 4QX6A 3T3HA 1COWD 1OT3A 1VG1A 1WSAA 1V4NA 4KSCA 4CM4A 1LS1A 1NQAO 1T5SA 5BWMA 3MWGA 1CJCA 4K3UA 1E1MA 4NQZA 5ALYA 4FHDA 2I7XA 1E99A 2J0UA 3F4KA 4G6ZA 4KH0A 3HVRA 3FYTA 1N7HA 4L4YA 3OTIA 1V95A 3D7SA 3DH0A 3P0FA 4K2AA 1MCZA 4MUNA 4XIYA 1CUDA 1MORA 1PNQA 3NIBA 5DX1A 2CXHA 2YHAA 3FKSA 1C1YA 3DD1A 4BO4A 1DIBA 1KO4A 1VE6A 4BP8A 2CFCA 4MQ6A 3SHQA 2F3RA 5CK5A 3E7DA 1ORTA 3T1NA 4UBIA 1PYGA 3A0RB 3LU1A 4QGHA 4LJKA 2HV8A 2IYWA 3PGVA 3W9BA 1NVWQ 2YWJA 3WGYA 3AB3A 4R8KA 4YT4A 1GA6A 1T4GA 1XEXB 2BGTA 1Y4ZA 2RHHA 2ZLBA 3UJCA 4ACAA 5KYWA 3DBRA 3WX0A 4BO6A 1XL0A 2HRQA 2HRDA 2WNIA 5AM2A 5H8WA 1O8BA 2AG6A 3K35A 4QBIA 3GARA 3OTOB 1FE8A 3H18A 4E4RA 3DMYA 5B37A 4LHZA 4UHKA 2B7CA 1HZJA 3LO8A 5CB4B 1N2HA 1L4EA 1G8SA 1P80A 5BMVB 4M9SA 5KTMA 3EH2A 1Z17A 4FLMA 1LD3A 3C4QA 2WWGA 1XK6A 3LUBA 4EMUA 1QOQB 2ZI9A 4Q1DA 2H7XA 1PR9A 3NHZA 3NS7A 4Y0NA 3HJRA 3V4PB 3WB1A 4ER7A 1P4HA 4II2A 3VR1A 4G9GA 1O0CA 1IULA 1ZIYA 1ZOLA 4ZI3A 3T5BA 1GZDA 2UYYA 1BVRA 1D0SA 1W2GA 5TPWB 4MV5A 3HWX1 6GPBA 2RGEA 3GMDA 3TZCA 2F3UA 2VDMB 3TW6A 1OY1A 2MTBA 2R8XA 2QHXA 3ROPA 4BNMA 3EPPA 4M55A 3FH0A 5LQNA 4I1RA 3R7FA 5D1NA 1FIUA 1WZCA 3QPUA 3OLZA 2CK3D 5FWXA 2BCJQ 2RKOA 4C14A 4OLBA 3PQCA 3NONA 4TQUS 1JE1A 1Z88A 2YWHA 3TMYA 2BGKA 3OFKA 3R3WA 1F8GA 4G8CA 5A5FA 1OYVA 2AEFA 4KZPA 2FW9A 2BKEA 2FN7A 1Y7TA 2RBGA 3LXRA 2HIAA 1ZUHA 3GJ4A 4CKBA 3LC2O 4CL0A 2GRJA 2H9AA 3DHEA 3DOEA 3KX2A 4PQRA 2UZ4A 2O2XA 3B9RA 1SY7A 3A4LA 1ML3A 3OMXA 3TXAA 1N8NA 4YY3B 1VJCA 5CMLA 1KZHA 1RYEA 1U4OA 5EESA 5HMMA 2X0NA 4YP9A 4HDMA 3KKMA 2NO0A 3NHYA 3B82A 1ZRHA 3RQIA 3ZV4A 3NQ41 5KWEA 4A9AA 2HMSA 3EASA 4IIUA 4D3YA 1Y6QA 3CT6A 3OUZA 2FW6A 2NO5A 3DKVA 1S9HA 4ID9A 4WXRA 5EL0A 3RVOA 4D46A 4MGKR 5I8PA 3ADKA 2ZYDA 2H8GA 4MICA 2B37A 1AK2A 5A1TA 4LDZA 4W82A 5YASA 4ZVKA 5DTMA 3GGPA 4RXUA 1ODJA 4RPIA 5F76A 4Q4HA 4BC0A 2ATXA 3WK8A 1GZ6A 4X1IB 1RYHA 4KMOA 3SLRA 5EIEA 3QW4B 4M83A 3F4BA 1CY1A 2O3JA 3ESRA 4M0MA 1WLYA 1UDRA 1GNRA 1ATZA 1WMFA 3GEGA 3GHHA 1B3RA 1U5AA 3H7AA 5TQ2A 1THTA 4K9PA 2KQUA 4ZOLF 3IMCA 2HJSA 5D3KA 2WTXA 4F11A 1RMTA 3OCUA 3Q5GA 4OUDB 4KQCA 4BGEA 5L3SA 3EXIA 2QLFA 3B1JA 4XWOA 3RANA 4NEGA 1T13A 4XIJA 3O8OB 5HFJA 2HJWA 5DO9A 3ELDA 3ROMA 3SHFA 2OD9A 3QEMB 4NOMA 3UN1A 3P27A 1OAOC 2DJ5A 2FV8A 4XD7A 3UCXA 2ZDQA 1Z82A 3N8IA 4OEHA 3PNKA 2QN3A 4TMXA 4UDYX 3GLFB 1TZBA 1XZ8A 4IICA 4DR6B 4M46A 4DDHA 1CDZA 1GPWB 3EFHA 4ZEXA 1LPBB 2VNIA 1PX0A 3FFAA 4Y98A 2X58A 4TKVB 2ODWA 3C41J 3R7LA 1IHXA 4DSUA 4EVIA 2UDPA 5EJ6A 5KQMA 3KEFA 3AM4A 5BRAA 1O6GA 1Y3BE 1AVTA 1JRLA 3ETHA 4Z4CA 1A4XA 1LKZA 2WFMA 4EUEA 3D54D 4R6XA 1JHQA 1O1YA 4YAUA 1H2FA 5KAPA 1T9DA 1I6WA 2FVXA 4UBJA 4XWKA 1D4ZA 3FJYA 3PNMA 4OKNA 3AB8A 3AVXA 2JHAA 1Q19A 2XDYA 1N6KA 1A50B 3NVMB 1TJPB 2QSUA 4Q0MA 3CLHA 2QM3A 2H08A 1H2XA 5LQKA 4X94A 3BWXA 2J0VA 3GCXA 3F90A 4BVAA 5JQWA 1YR8A 5K3EA 3OZXA 3Q2OA 3A05A 3R09A 4F72A 4XR9A 2ONKA 1SHUX 3IXLA 4ND5A 5SYNA 2I4OA 1I6LA 1BOOA 4NATA 5DT2A 5HJ5A 3DTYA 4HAVA 1MEEA 4DNQA 1I01A 3K2EA 4C7MA 2HQRA 1KJQA 5C1PA 5AW3A 5JYCA 1ONSA 1TPZA 1Z2NX 2Q9BA 4B6GA 1VRWA 4RESA 5CLLA 5K51A 4FP9A 4LTMA 5T5QA 5C18A 1LDGA 1FRVA 1RYYA 2JH8A 2RC6A 1P9WA 3ED1A 5JSYA 3VO9A 2FZ5A 4XFKA 1HGXA 3ZOZA 2FUEA 6REQB 1EGAA 1RQPA 3QH4A 2QNRA 2QRNA 3HCPA 2Z8XA 4N9QA 4CLEA 2JI9A 2YIMA 3OE7D 1K7EB 4WNIA 1TM7E 5A3RA 2ANBA 3Q9SA 4JB8A 4K6HA 4F97A 1IWPB 1U28A 3QEMA 1KQ3A 2FDRA 2QR2A 3HO6A 2ZPTX 3U0VA 5IANA 1ZD3A 2E87A 1HE8B 4KRYA 3TSZA 3ZW7A 1UXOA 4FX5A 1RWOA 4R69A 3T06B 4AMBA 2OZLA 2EKZA 2VF2A 1G21B 3BTSA 3Q7IA 5HKAA 1NJFA 2O0MA 1ZW1A 3G2HA 3RVSA 3C8ZA 4CF3A 3AH8A 5GJWC 2PWAA 4LCJA 4LF6B 4TYMA 2PX5A 1OFHA 3K94A 3MB5A 4D8YA 2DFNA 2I91A 4F8JA 4BB5A 1DRJA 2J3MA 3HEMA 4G5FA 2F3SA 2APJA 1KEPA 2QTAA 3QWHA 1SXJD 2QMZA 4RPGA 5JG7A 1GPYA 3DBHB 4P83A 4GLLA 2ZETA 1P4JA 3N2GB 1C0LA 2X0FA 3D1JA 1HDZA 1YJ8A 2ZBUA 4GOKA 5ALJA 1EIWA 3L0PA 4YH1A 1E79A 3JD4A 4UATA 1ESMA 1NNSA 5A7HA 4M1QA 1E6EA 3NEJA 2KI5A 4Q9KA 5JZSA 4MI6A 2R84A 4FMDF 2WSLA 4HLCA 3FA2A 3TVYA 2JHGA 1DOAA 3QWBA 5D6OA 3SX2A 4C0LA 3ROEA 4DC9A 2JCSA 1IVNA 3GLHE 3Q7EA 1CHNA 3AF6A 4JJKA 1KHHA 2YH2A 5C4GB 2JLSA 2R00C 3LFHA 4EA8A 1N1EA 2EFCB 4EY8A 5TMPA 1N9ZA 1FDUA 2BZ1A 3MM4A 4JH0A 1DQPA 4NZYA 4Q3OA 4RIGA 4QHTA 3W8DA 1JF8A 3OFND 2YV4A 1K4KA 3OIUA 3A6LA 1U1CA 2W00A 5H16A 2JAOA 1JEQB 5L8VA 2JEOA 3PTLA 3QPDA 4RNDB 1X14A 4HVLA 4ARAA 3AFIA 2E5LB 1FW8A 4MW1A 1L5RA 3T3DA 4BEJA 1QZTA 3HO8A 2GCEA 4UQPA 3GQVA 3PSAA 3LK7A 9LDBA 4PW0A 4DZZA 2NNLD 3PHIA 1W34A 3NWOA 1YZYA 3DYBA 3OT5A 2NO7A 2DCMA 4FNAA 1C7FA 4FQ8A 3REOA 4ZKEA 1NBMA 1JHPA 2UKDA 2HDWA 3O8OA 5FP0A 1M83A 4HAYA 5F1PA 3FTEA 1FYWA 3NJ8A 1NP3A 2IYSA 2IODA 4E51A 3MBKA 3DZCA 1ZISA 4XKJA 2IBTA 3LBYA 1WLSA 4K9OA 4ZVMA 1UBUS 1A5SB 2GCOB 3QF4B 3OP1A 1QQAA 2J4DA 2HEIA 3KYJB 3TQFA 5G40A 1FTQA 4FGSA 4JV5B 2VAPA 3IT3A 3P2IA 4JVSB 3AV0B 1WPQA 3EVCA 4ATNA 1F9EA 2Q6IA 4EG3A 4GT1A 3LX5A 4S0XA 3SDZA 4X84A 3ZK8A 3PYLA 2AWOA 3DTVA 5AXAA 5EJ8A 2VBGA 2ZITA 3I1FA 3KFLA 2J33A 3A4YA 3OAAD 1GKUB 3FN4A 4OYRA 4EKEA 5K8CA 2A2ZA 1OE0A 1FNSA 2A86A 4KFUA 3BXZA 5AVSA 2XWPA 1JMVA 5C1OA 2NLOA 5HRAA 2OV6A 1PR5A 4LWPA 2ZJ5A 3JD1A 1G64A 1BFKA 3WAJA 1ZCBA 3MQFA 1MEOA 4II3A 4N1AA 5FFNA 5TQ0B 4F0JA 4Z9AA 2NX2A 4DXDA 4CKBB 4C2AA 4E31A 2A5FA 3F73A 2B9EA 2ZVJA 5FYDA 3RVPA 2I4IA 4R0MA 1V1RB 4G0XA 4KN9S 3EB9A 2QVCA 1JEAA 2JFNA 2Z1NA 5ESDA 5BSTA 1WHSA 1EINA 3CVYA 4UM5A 3SS7X 2ZJ0A 5EKTA 5LP6B 3MT0A 3ZWXA 4GH5A 5TQVA 4XUGB 3SGLA 3CF4A 3UK6A 1DUSA 5WRFA 4FT2A 1YVEI 3Q8WA 5FA8A 3W7VA 4MROA 5DX0A 1ODCA 2GOYA 3FNHA 4Q3KA 1U2GC 3N2KB 1VI5A 3E27A 4MW7A 3R7NA 1TZJA 1GZUA 3MZ0A 3LPCA 4URHA 5DTJA 3HR4A 2VH1A 1GLGA 2CJWB 2XUJA 3JQBC 1P1BA 1F5SA 1ZIXA 3GDOA 3FD8A 2ZKIA 5TT1A 3AXTA 1WY7A 1UPXA 1YKFA 2NZVG 4KWCA 3MGAA 2VK4A 3L0DA 3ESQA 4QNMA 5GP1A 4CR7A 5BN3A 1XTRA 5J4HA 2Q6KA 2YQ4A 3ZD7A 1FDIA 1JKXA 1SK9A 1ZI6A 1PR2A 1Z18A 2GEFA 2CXOA 3D3WB 3OJFA 4EHKA 3W2FA 1MKYA 3C3WA 4XCXA 3ZCSA 4PO9A 4F8YA 3I92A 1JHUA 1R9GA 4V0SA 1P4AA 3SFTA 1JZSA 1TYEB 1KYQA 1V41E 2SKDA 4J6FA 3T61A 4D45A 1SG6A 1PGQA 1HNWB 4EZBA 3GJQA 4RX1A 4A5SA 4LMRA 3U7EB 3NGXA 4G26A 1GQOA 1TEVA 3ZHZA 4WFKA 2FR8C 4C7OB 3JD2A 2AQKA 3FVTA 4YBZA 1PK7A 2VDVE 3GLIA 2I66A 3QNWA 5KYWB 3COZA 1Y7PA 3MUFA 2QRLA 3O95A 4X3OA 5J5CA 3NV7A 2BLNA 3OD1A 3TLBA 1TL7C 3M49A 4A10A 2QRZA 5IDQA 1Z2PX 2WSMA 4QL3A 1ZFNA 4MV3A 2QXTA 1OGIA 1Z5UA 3AL2A 1YQDA 3LHFA 1XQ9A 3NU1A 4HDRB 2AEMA 3L7NA 4UE2A 2IE0A 3UUFA 1WEKA 4Q37A 1QYXA 1JBQA 4PGMA 1PWEA 3EF0A 3OQNA 3C1UA 3W9SA 2G8NA 4WZBA 3W3AA 3EVNA 3G59A 3Q10A 1I3OA 3HMKA 5LKAA 1W9HA 1CVLA 3KVRA 3O93A 3R3XA 1OKKA 3EGEA 4OAPA 2F8LA 4MQLA 1N2CA 1KDOA 3EVDA 1E9DA 2I1QA 4PO8A 5EJMA 2EKDA 3VC2A 4GMFA 1XEWX 1W30A 2GM5A 1RAAA 4C04A 3IQWA 2IY7A 3GP5A 3WL5A 1FLAA 4DLYA 4L6IA 3O31A 3IP8A 5HUJA 4Q39A 2C5SA 3VH4A 4GX0A 2C2YA 5CH8A 5ALRA 1XVLA 2H9YA 3PFKA 3I73A 3D9QX 5F5XA 3T7CA 1PEDA 2Q5IA 3FUTA 5LB4A 2I7DA 3KTFA 2B3DA 1B26A 3FCYA 4BECA 1XNGA 4O1IA 2I34A 4XYBA 3OJOA 2C3UA 3TW8B 4V0OA 2GF9A 3V55A 4LGCA 4ZVSA 2VN8A 5JE8A 3TZKA 3EDMA 4ERXA 1IXRC 2ZDGA 3GVPA 3K53A 4GUDA 4RTRA 4OKSA 2ZI3A 4HPWA 3FSJX 3U5ZB 1DC4A 4I66A 1IU9A 4NULA 3VR2D 4D0NA 3QVSA 4JUDX 3TVDA 5IAAA 1WCXA 1VIMA 4DPLA 1R74A 5I5EA 2IOHA 3F7MA 5IHXA 5LOVF 2BELA 4GQIA 2B8WA 2ZRFA 2WY2D 2EX4A 3TLKA 4LOKA 1U8ZA 3FDZB 4IX1A 4CPDA 4YPOA 1J8VA 3OQJA 5TMBA 3P2OA 3WB0A 4DA7A 4DLAA 3L5OA 3LBAA 4DWJA 1UK8A 2PEZA 4J9VA 4L4RA 5F7ZA 4LXYA 4ZCSA 1ISGA 3WNZA 3ZNOA 1L9XA 1UJ2A 5F7OA 2QR3A 3O4RA 2EFYA 2D0DA 4TTVA 5JSKA 3H1TA 3BG5A 2IY9A 3LCRA 4TWZA 1BE8A 1C1HA 2GZSA 4US1R 5ARBA 2OORC 1MB0A 5BMVA 1SQ0A 1RS0A 2X1LA 3P4YA 2C2XA 4EECA 3OMWA 4KRGA 4UARA 3TB6A 4BKQA 3AETB 2ZTUA 3EJ6A 2VYND 4QRIA 3BS4A 2DG2A 2VTBA 3C0KA 2WHQA 3E7PA 2HA7A 4V0NA 3R5KA 4YN3A 3JXEA 5HXAA 1V4VA 3EUAA 4A82A 3C15C 4BMXA 1VIDA 3E35A 1WS6A 3K70C 4PNHA 1Z0SA 1GZ7A 3GH1A 2F9FA 2JARA 4WK0B 5DYTA 4CRWB 4EHFA 1TO2E 1R4ZA 2V54A 2ETXA 2WUWE 4J3JA 2XSZA 4NE7A 4UBKA 3SN6A 5MN4A 2IF0A 1VIAA 3DO8A 5H4HA 3H9CA 6YASA 1K9VF 3LWNA 3WLAA 2I7CA 3BMOB 5JC8A 5JPCA 5DNDA 5BSEA 2VRBA 1D1SA 1NX6A 3AM1A 1IC6A 1TQ6A 2FZKA 2Y6UA 3GJRA 3GWZA 3UC9A 3RUAA 2QE6A 3CUKA 4RGYA 3EUFA 5DNCA 2ZIXB 2VSNA 1T43A 4UTRA 4Q16A 1ZZGA 4LW8A 3R75A 1DG1G 4PBSA 5ENDA 2O4CA 4CDRA 1EDDA 2ZVQX 3K0FB 3O2NA 4KQXA 1R4AA 3T3GA 4DLPA 2OWDA 1T1SA 4PZLA 3ER6A 4D3DA 4ZANA 4CM8A 2O19A 1RBQA 1U80A 1NASA 2PA0A 2BFFA 2FW7A 3E22B 2VJNA 3NUZA 4JWKA 3PUKA 1ZPDA 1QVVA 4LSGA 4XLZA 3PHLA 4MUMA 4AQDA 3JQRA 4A4DA 5HYVA 1FMJA 4PWZA 4CFSA 3RRXA 2WF9A 2WTMA 1FFYA 1XLWA 3IQDB 5K0GA 4FDTA 4RGBA 1H2EA 3MAGA 5ILGA 3UFXB 1U0GA 1VI6A 3QOYA 3C5VA 3EWIA 3ZU2A 5FAKA 2PQ2A 5H9WA 4MLCA 3TGLA 3GLIB 1DO2A 4S0ZA 3A32A 1XCOA 3EZ6A 1RD4A 3A9TA 4LOLA 3T3MB 3T7JA 2H0AA 2OCYC 2XUKA 2WK1A 3PPVA 1O57A 2JLRA 1G21A 1O03A 1I7DA 4CIBA 2ZB8A 2EG9A 3BB3A 4TVBA 2UYHA 3PDWA 1QIDA 3HUFA 4BO7A 2BIFA 2PLWA 5ITVA 1YONA 4YMWA 2ZTHA 3D2AA 2VHWA 3GVXA 2BMJA 3EGXB 2RAFA 4PNPA 3AI1A 3LBIA 2Z57A 3OFSA 4MDHA 3KXDA 2BTOA 3RFTA 3T9AA 4C3UA 4CLXA 4F04A 4E5UA 1EAMA 2Z04A 4JI4B 1LDBA 2PS1A 3HYCA 2KHZA 1J5XA 2W90A 4QEDA 1IMJA 2HO4A 4R98A 4L5AA 1J1IA 2Q0HA 2ID7A 3RUFA 4MEAA 2V6JA 2B4QA 3INRA 1N2ZA 2A0FA 5AOCA 1XMJA 1JIIA 5HKKA 4IIVA 3S68A 3ZCVA 4CIWA 3W06A 3AVVA 4BWVA 4DGSA 1AMUA 4LDAA 3GD7A 4MZDA 3I62A 1A8PA 2IIBA 1N77A 4YCCA 3GLQA 3LKDA 2L82A 1IFXA 1V8BA 2RARA 2NUTA 4AZTA 4DWVA 4IRMA 3BB4A 4YAWA 2Z58A 5I9TA 4BEBA 2Y9PB 2GN6A 2ZRLA 3DNFA 1I7SB 3N2NA 3NDIA 4AKGA 5AVXA 3BXGA 3N7AA 1SBCA 4L08A 1ZIOA 4I6EA 3L7OA 1U0LA 2W8BB 2B6NA 4LSMA 4IGIA 1V3TA 2G36A 3KHUA 1V7ZA 4Q47A 2X4IA 3MIIA 5EP2A 4R8MA 3TEMA 3WHKA 3ZI7A 2P40A 3VNSA 4JQYA 2ISSD 4DMHA 1GITA 5HRCA 3WLHA 2FOXA 3SR4A 3GEDA 2YDYA 3PDJA 9MHTA 4M9ZA 3Q2IA 5BPHA 1ZD2P 3OHMA 1RLTA 1F5NA 1OV6A 2VJDA 1CNFA 1DQRA 4RVDA 2W70A 2BAGA 2NO9A 4A2QA 4J4BA 5K0FA 1PVOA 4XPZA 1KBQA 4EF5A 3OFJA 2BKXA 3NAQA 4OF4A 2PT5A 5EQFA 3AETA 4J1NA 5IK2D 3PYXA 1XAGA 4FIDA 4YCLA 2X23A 3OPXA 4QXRA 2G9QA 2QB5A 2Q7OE 3WGGA 3T35A 5DYIA 2B5OA 3E8SA 2CK3A 2P78A 1TQ2A 3L7JA 1E18A 1DRUA 2NNWB 4MHSA 3JCZA 3Q8XB 3V33A 3X1DA 1LSJA 3IDOA 4OJNA 1Q0LA 2R65A 2Z95A 3AUJB 4IXWA 4UD6A 3AUSA 3NYQA 2Q4DA 4O08A 2UZ0A 2YMPA 2JCBA 1NFRA 4OKIA 3CEPB 1FFBA 1H0KA 5LA6B 1R2QA 1DRWA 1R8XA 4MYUA 3DL2A 5CX1A 4E7OA 2BFDB 5BNWA 4KBFA 3LRPA 3UXEA 4LA4A 4M88A 4UXIA 3ZHYA 3LGAA 4ZYYA 3IA7A 4H27A 1LTHR 1T2VA 2CNLA 3MTBA 3GJ8A 3H84A 3QKUA 4JMPA 4LQDA 4M0UA 1FU8A 5JVDB 3FZYA 1YA8A 3RS9A 1E3LA 9LDTA 1NFQA 1WPXA 1FZQA 3BFVA 3BXPA 3NKFA 4NEHB 4ZD6A 4OHFA 2NU8A 5JAUA 2IOFA 4JB3A 5L6LB 5GIOE 1N5RA 4WLEA 3L06A 2BDTA 2RCNA 1FU7A 1CEXA 4BWFB 1V4BA 1WD7A 2V7VA 3ICCA 4D0SA 5AW4A 3EIQA 1W7AA 1Q44A 1US8B 4P0QB 2AOVA 2UUOA 1KRXA 1Y8QB 3ABQB 4RWZA 2H4JA 3VYVA 1GPLA 4B3RB 3PPIA 3VV3A 2FR8A 1S2GA 1LTQA 2KE5A 4NK4A 4DBVO 2ENWA 2HSJA 4NBNA 1IVSA 1M1YA 1Y4SA 4G4SP 1FDOA 3BH7A 1KR2A 1DU4A 2IITA 1EJ2A 3GLVA 3QKWA 1PS8A 4RKQA 2ZDHA 3D7RA 1UEXC 3ZHRA 4DG5A 1RVV1 4QUJA 3MT8A 3MCZA 1SIBE 1EJ0A 4TTTS 2XB9A 4MMZB 5E0OA 4KVGA 4BLVA 3BORA 4NPCA 4I55A 1NN3A 1LF0A 4J94A 5HKLA 4V0RA 4RE5A 3N0RA 1KK0A 3LBHA 3Q72A 3GELA 2JJ2A 4ONEA 4PO1A 5KJEA 3K05A 2HLDD 3JYOA 1FP7A 4WE3A 1QHGA 1MT3A 1Z8NA 2HPZA 2PWZA 4UCWA 4AICA 1N36B 3V4LA 2ZRDA 3PNOA 4MCJA 5T57A 3SQNA 4EIWA 2XAAA 1LC0A 5DRYA 2W5UA 4DV6B 3H0KA 4X6YA 1WPGA 1OILA 2BPOA 5EYPB 7ADHA 1E1NA 1F17A 2ODQA 4WLVA 3WSTA 1CF4A 2PKQO 4YEDA 3HU3A 2DLDA 3RLIA 4GD3Q 2HGSA 4G89A 1MFZA 4GRAA 3LIIA 4MV0A 1PJCA 1A1SA 4RVFA 4KHZA 1RACA 3N76A 5T3YA 3H5RA 3S2ZA 5KQSA 3JU3A 4JC4A 3IV7A 4DM4A 3MSCA 4TYWA 1U6JA 4LAFA 5BRNA 2VF4X 2YMLA 1JKJB 2FWAA 2B7BA 1NL3A 3EZGA 1A7KA 1PJRA 3WLFA 4ZIRA 1VYHA 2ZUEA 4BUCA 3HI6A 2OV3A 3FKSD 5F33A 1IK4A 1Z34A 2PRSA 4MKGA 3IOEA 2QN8A 3KXKA 3LJKA 3GVCA 1DO0A 3D6JA 4X8LA 4ENTA 4TMWA 5HR5A 4B0OA 4EHIA 1V3VA 1EFDN 2IU6A 3X0DA 3PCRB 1RQRA 5EGNA 5AVUA 3PRKE 1KFBB 5EE3A 4JOCA 4YLYA 1GZ4A 3WK9A 4E13A 4FBMA 5E4JA 1MNQA 3M5DA 4MQEA 4DLZA 5MN5A 2X8JA 2F1OA 2RIRA 4PRZA 4JK3A 1GG9A 1QQ7A 4LSWA 1TE2A 2YMMA 3JQ9C 2JATA 5FL3A 3PHJA 3ZLVA 4PNEA 3PUHA 3RB8A 2XB6A 3OT1A 5JCZA 4KE7A 4GMDA 4Y6PA 2XLBA 4GVXA 4YAOA 1QQ6A 4FFMA 4H17A 5CB6A 4GKVA 4RSMA 1X6VA 3FG9A 1PJ3A 3QYFA 1EGHA 1O94C 2OUKA 2DBRA 5GWXA 3EPKA 1LBSA 4GP9A 1WCYA 4YDSA 3RYCA 4WJZA 2WSSD 3CRMA 3VOAA 2EHJA 1I2BA 2C5FA 3IUYA 5IKOA 3WIDA 3ZKAA 1U0NA 2VP9A 4P93A 2ZTMA 4FDMA 1NMSA 4NCXA 5JPIA 1RHMA 4MP8A 3Q87B 1HORA 3ZGLA 3DVAA 3H7IA 1JQ3A 2IC5A 1E66A 3RUCA 3VZRA 3EXIB 2BGNA 3WK4A 3FBGA 3EBOA 1M2OB 4P4UA 1OKKD 4EI7A 3PX3A 5J1SB 4TMYA 4H4DA 3VSCA 2DCUA 5BN4A 2XTAA 4UXJA 2FR0A 4KIFA 4AW9A 1ZYUA 2Y9MB 2GKSA 3AFGA 3GCZA 1PGOA 3T12A 4OHBA 1XEAA 2XIQA 5A1JA 4PZ9A 5HZKA 1V1MA 5KX5B 4EF4A 2FAXA 4MS4B 1CK4A 4WNAB 2XH8A 3UMJA 2Y2VA 2W2NA 4DLBA 5I4BA 5DEIA 5AHOA 5J4VA 4KGVA 4XFJA 1W87A 3A3PA 2KPOA 4WIAA 2YVKA 3NJRA 2BISA 4CV1A 5J2TA 1KZ1A 1Q14A 1P17A 3FKQA 3QUCA 2PTGA 5FL7D 2AOUB 4PFSA 4E3WA 4EO4A 1YIDA 5HS4A 4W8HA 1JEYB 4KODA 3S5UA 3FUCA 1XB2A 1N8KA 4KXLA 3VZQA 2DQYA 1MXHA 3CMCO 5ALFA 4B5LA 4IRXA 5C51B 3P2JA 4IHQA 5A06A 2A92A 3COVA 3D0QA 4ZOCA 2PZ8A 1JA9A 5CH5A 5CCXA 121PA 1Y6FA 2IU4A 2V97A 4NCKA 1H0RA 2HHJA 4DMGA 3WYNA 2CWWA 2H5EA 1ZCZA 4NEQA 4U4AA 1GEGA 3OLCX 4YQZA 4UTVA 2NP6A 2Q29A 3EOBI 1ACLA 3JQGB 1Z4OA 4MGEA 4G1UC 3BGDA 1NM5C 2V9ZA 4YACA 3LYLA 2ODAA 3C8DA 3TR0A 1B93A 3NM4A 4DTCA 5E2AA 2VWGA 3VISA 3OZVA 3IAFA 3M6UA 4FR5A 2Y1LA 5JRJA 3ESBA 3DVQX 1B14A 1ECFA 2QRVA 5KOHA 4XEUA 1U0HC 2KWIA 5HIAA 5EIOA 4CV2A 5LLDA 4QFDA 2QD2A 1U2TA 2O5CA 1TF5A 2FSSA 2F67A 5DNWA 5JFOA 1IUOA 1KVUA 2NTNA 2MR5A 2ZJ2A 5FQNA 5IP5A 2YNMD 3QE0A 1J09A 3TEJA 4LN1A 3ZQUA 1ULUA 3GAFA 4HWTA 1QG4A 3BCRA 4AIIA 3UZUA 3QI2A 3TL2A 4DLNA 3O38A 4EG8A 1HETA 1PKXA 1JLMA 1VYVA 3F9CA 3TUJC 3O1LA 4BFWA 1X86B 4BMPB 4FOLA 5K0BA 3MYRA 3WKEA 4A8JB 2PV0A 3L0ZA 1OU4A 4CCYB 1RXWA 3C43A 3U60B 2PX6A 3OZUA 3PNYA 4OHUA 4RYLA 3AY0A 4JHLA 1D0VA 2HA2A 4PY2A 3HSSA 5CIWA 4Z1MA 4B40A 4JBWA 1RE0A 1OWLA 3F7NA 3B20A 3VHQA 5CXUA 4KPGA 4RZHA 1LPNA 3HYSA 2X9QA 1HKUA 3MJVA 4DIEA 4HDKB 1PT5A 4XWTA 5AR1A 1MQSA 1MC4A 1JL3A 1QHHA 4CCWA 1DKLA 2FUKA 4Q3NA 1JECA 1PVVA 1T8PA 1EZ1A 3HXQA 3ZWYA 1JB1A 3ITDA 4C22A 4D6XA 4QFCA 1C0PA 1D5CA 3IILA 4XD7D 4F5DA 3KIPA 3WJ2A 5EGSA 5EWLB 1W581 1PTJC 2K87A 3M4XA 4R9NA 4YP1A 4BNTA 4OBWA 5HF9A 4XJXA 1ZNZA 3CO0S 3HACA 4I7EA 1E2LA 1ZR2A 1QO9A 2C5BA 2OCBA 1WULS 2QUBA 1N2EA 3JATB 1E9RA 1Q3HA 2ES4A 3OZBA 5T6MA 2QIOA 1XD9A 4JXJA 3TG2A 3THYB 1C8VB 2B4KA 2IT1A 2VJPA 3ZY4A 3WNBA 3EMKA 2QX6A 1E7MA 2II6A 3ZVRA 3UQYS 1WZUA 1EFVB 3KEQA 3MGKA 5FWNA 1WSBA 3K32A 1PJTA 1B2LA 4MKIA 3AUAA 2X9LA 4H3HB 4HX9A 1LDMA 4X54A 2HDHA 4KIUA 4ZZ0A 3DAFA 1HH4A 4I81A 4O2AB 3EF3A 1ZM9A 4RK1A 4G1BA 3AY7A 2V3CC 3K6JA 5HW0A 2W6OA 1GADO 1I80A 2ZULA 3C98A 1AQJA 3AL0C 4RQTA 4Y9UA 4UEOA 3GPIA 4JR1A 1IBLB 3E2PA 3C16C 1E8DA 4Q1EA 3TFWA 1DJQA 1YBMA 1RCUA 1Z5NA 2QAGB 2JFOA 3G6WA 3PGLA 1G5HA 1CLUA 3Q41A 4NAVA 4Q34A 4NCAA 4C7OA 1C50A 1V26A 1CYEA 3EEIA 1OTYA 3IO5A 3GRRA 4B3SB 1KS2A 2A9QA 2EARA 2VNHA 1JEJA 2WE8A 5DCUA 4Z8YA 3GEIA 2BFOA 3DP9A 3KQQA 3INGA 3PCTA 3OUUA 3QLUC 4Q03A 1WZEA 3TW4A 4ZN6A 3OQVA 5A03A 3WGUA 2VUUA 1SQ6A 2GZAA 3UMFA 1U0RA 2IP4A 2QQ0A 1NHWA 1C8BA 2YJ3A 5DSTA 3TDMA 1K7YA 1X74A 2H06A 1C80A 2HNKA 1V35A 3ANLA 3H16A 5KVAA 2Q28A 3I9V1 3TAUA 4TRRA 2VF8A 3B6EA 3HCAA 4BLTA 4UHJA 2O5EA 1FX1A 3T5PA 3PFHA 4ZV9A 4QOFA 1P77A 1ZRNA 2XB8A 2Z56A 1XAIA 4OD0A 2G72A 2PY6A 5JS6A 3BCHA 1Z6AA 4R1UA 3AKEA 4B7ZA 4PLZA 2EBUA 4S2UA 4EJSC 1SBQA 1RAIA 3UJPA 3NHPA 1FP2A 5LMCA 3UJBA 2G1JA 2UXDB 2ZZNA 3COYA 5AK5A 3GNSA 4K46A 1RLUA 1FS5A 2PD4A 4H7DA 3VX4A 5C8VA 3JRWA 1NW7A 4OHKA 5GOTA 4P22A 2B4AA 4WINA 1GTRA 1D4FA 4BLQA 1YFKA 3PC8C 1PE0A 1R88A 1TMGE 1CZLA 1SD1A 1QUFA 4I1PA 2GN2A 1V16A 3I2FA 1C7ZA 3L7MA 2R2GA 3GN1A 1J33A 4O4LF 2OM6A 4H0NA 5TSDA 3X43A 5M7EA 1OR8A 4BYGA 3CWQA 1G3IA 3G17A 1P1HA 1K5HA 1XIVA 3TKAA 3ILYA 2C7BA 4OO3A 4XGRA 3ZEIA 4CMGA 5BVGB 3I9FA 4BIMA 4P36A 3A9VA 3C1AA 4J2TA 1XZHA 1TIKA 2R6JA 1SRRA 3KXPA 3VPGA 4OMDA 2Q2VA 3ZJYA 4JOBA 5AI6A 4LFAB 3OCYA 1WQ4A 4OQQA 1C2YA 4ZI2A 4X65B 1X1TA 3ZV3A 4G0WA 2H4HA 3D6AA 3S0JA 5A62A 5JNSA 3PFNA 4KKXB 2I2AA 5BORA 2GH1A 3A1FA 3FE2A 2VHCA 4QPPA 4A03A 1XZAA 1U81A 4ICIA 1UBJS 1ADFA 3E61A 3P4UA 4EUKA 2OHGA 3HHEA 4MVWA 3MUOA 1VE7A 3JWHA 3SYRA 4C1BA 1RJWA 1T35A 2X5OA 4RZSA 5C34B 2VBFA 3KLPX 4I3GA 4U7HA 4RABA 3WHPA 5IF3A 4UNSA 3W5CA 4QQFA 1PJ4A 5JNLA 3ZLUA 1G1MA 3I5YA 4BX9A 3MGCA 3QU7A 4D57A 4LJ4A 1M0EA 2X0KA 4ZDWA 1LFDB 1MO5A 4KTTE 3VDXA 2X4DA 2ID4A 2NSJA 5CCBA 3DMTC 1N6NA 3T9BA 1EK1A 2Y66A 4ZZ2A 2PZLA 1V45E 3AOGA 4HDAA 4X20B 1LBIA 5L3RA 1SPXA 3HH8A 3EW9A 5BR4A 3O3MB 3F5QA 1NMEA 3UJ6A 3ONFA 3ZK7A 2HU5A 1ZEJA 3CLVA 4FE4A 5GONA 2Z9CA 1DX4A 4LSZA 4MA0A 3QBTA 1N3IA 3CWZA 1S89A 4X6XA 5FFMA 4C06A 2X9VA 5F2NA 1VJRA 3DMRA 4M8SA 3F2VA 2GEKA 1VCNA 1ZESA 4G4IA 4J4HA 1ZOIA 4M98A 1WSWA 1L5FA 2VYQA 4P6VF 4WH0A 3VI4B 3W9YA 3X1ZA 3KBOA 3ML1A 1SCIA 1Y37A 2GJSA 3A3KA 5DI3B 3UH1A 2R6CA 3TX6A 1UQUA 4EUFA 2D5IA 1HT0A 1WPRA 1GEEA 5B6IA 4ZI7F 2I6FA 4BYMA 1P3JA 4BQFA 1G2PA 3M5CA 2FN9A 2NSHA 1JEYA 3TOZA 3A3NA 3S55A 1GN9A 1ZN7A 5KMGB 3DL4A 3T7SA 3E1KA 3SJCA 1SVOA 4CMJA 4ZK2A 4XGQA 1UAAA 2ZATA 3HYTA 1BIFA 2ZBQA 1KEZA 3N1UA 1RPZA 4GXTA 5K3FB 1AA6A 5JJLA 2DTXA 2IY8A 3ZLBA 3ND5A 4TSFD 3DJYA 5AVQA 1H2HA 1U8FO 1Z33A 5A4IS 3BFJA 1RYFA 4PE5B 4E08A 1E20A 1Z6PA 2CFRA 3ZIAA 2C7OA 2GASA 3ESXA 3M33A 4EGJA 4UFPA 3MWYW 1TNDA 3DDSA 3QPVA 2I1WA 3KT0A 2WU1A 1SKBA 3QEOA 1H9CA 4LDRA 4V3BA 2QJTA 3OKPA 1KAQA 4KOEC 5A3SA 3A2LA 2HMUA 3RTBA 4M3NA 5DASA 1QGUB 3PR2B 1C30A 1K75A 3DWGA 5AJVB 3OOJA 4WZBE 1DL5A 3WXMA 4W8OA 1ONOA 2AMYA 1FFXA 5EWMB 1HE3A 2P9TA 1CVRA 1FMFA 1LCIA 1XZPA 2ZAMA 4MCIA 3W6OA 1GPAA 3Q0EA 2AN9A 2JJ8A 4N0DA 3LD9A 4AYTA 1F4PA 1DHRA 2E18A 2XGMA 4X1KA 2RHLA 5B6JA 1YOVA 4EYEA 2JIPA 1IUNA 4Q7EA 3V6LA 4B09A 1CP2A 3KTAB 4PBTA 4PZYA 5DM60 3D4IA 2WEKA 4JR0A 5BOVA 5EJ5A 4XB2A 4FLFA 4O4JF 1KPGA 4JLVA 3UUGA 1COZA 1SCUB 2HJ9A 2RAPA 2WG2A 4O4JA 1FEZA 4TSFA 3RRBA 3U3MA 3WP0A 4D4GA 5AOBA 2IX9A 3FZQA 1CQZA 1QC5B 2MSWA 4J9UE 4CL3A 4M0KA 4YQFA 1B41A 3QEAZ 1JHZA 4P0PB 1GRQA 4EL5A 4MX8A 1FS6A 1OB5A 3VX3A 3C74A 2AOUA 3DR5A 1QZUA 5EI5A 2J30A 1ST3A 2BEVA 2FMTA 1M1ZA 2XWQA 5JDIC 1NP7A 3E84A 5IHPA 1IDN1 2CJFA 2YICA 4PPNA 1EX9A 1X15A 3CUYA 2EP7A 2RGNC 3AQIA 1QS0A 1UZLA 2C59A 1Z07A 3BWBA 3GI1A 3H6KA 4HMPA 5CGQB 5KHLB 3JZDA 2VSXA 3NRJA 3PNPA 2QUKA 3BA6A 2C5AA 2GT1A 4RQBA 4WMLA 2DQKA 3DM5A 3RE1A 1MIHA 4FNOA 1Y0BA 3SZLA 1BROA 2I76A 4KDCA 5FADA 4ZHQF 5CAEB 4UTZA 1XA4A 5J23A 1T29A 4ESHA 1B3BA 1E89A 1X8XA 2I4MA 2ZJ3A 4YJ2A 2J08A 3E3NA 3Q6IA 2I62A 3GRCA 3RK0A 1FRQA 3T7IA 3TR6A 1FP4B 1GL3A 2UUCB 3WC4A 1N2SA 3AJRA 4IILA 3PUVA 3KZOA 4L8GA 2B1RA 4QREA 1SKYE 2DT8A 5A05A 1U2GA 3U4AA 4BEVA 3A0UA 4BJ5A 3WRYA 1K7XB 4AF7A 5DNUA 4NL4H 4LF9B 4KCGA 4Z9XA 4K1LA 5J63A 4I46A 4P38A 4Q9LA 2OLJA 2C2BA 4G0MA 5AH0A 2B6HA 2WICA 3JAKA 4NJMB 4BRWA 3RYTC 4PYJA 1YU6A 4BLOA 3HTXA 3N53A 4WCFA 4M0EA 2NAFA 3AT1A 3JWJA 3UATA 3I0NA 1Q7CA 1NMXA 2B0CA 3A6DA 3QKRA 1NY5A 1CB7A 4DR3B 1CEEA 5KJFA 4JEUA 1J0XO 1MG0A 2EJWA 3V7YA 1QM5A 3BAFA 2R9VA 4Z8XA 4WUTA 2CV1A 2W2OA 3BCUA 1QANA 4V2UA 5ES3A 2XQFA 3GB9A 1I0LA 2CLSA 4R2MA 5C8YF 3ISVA 1LPPA 1YIOA 1DFIA 5BNIA 1TAQA 1WXXA 5IEJA 1TCBA 1H3FA 2B8EA 4FUTA 2WIAA 1C4WA 4Z0TA 2P35A 1VHTA 2JFBA 1E3SA 1XJCA 4GM1A 4B85A 1XZQA 3NEAA 5K0NA 2GI4A 2WP8J 2NU9A 1F1JA 3I2YX 3MFQA 2D62A 5TMDA 4R8VA 2J3JA 2F6RA 3WWPA 1I0IA 1TC2A 3JAWB 3V1YA 1PKEA 4MW0A 2IS1A 1NXSA 1T2EA 2NXNA 2JJ1A 3EAFA 5B7GA 1H4TA 1TM3E 1X1CA 4IHAA 2V1XA 5B1SA 3NC4A 4Z7NB 4ZQIA 5K0EA 3TSOA 1PBTA 4BQSA 2QM0A 3CE9A 3OU6A 4LHVA 1ITZA 2MHCA 4EF6A 2PCLA 5K09A 3Q3IA 4AO8A 2IYOA 1BFUA 1JXAA 2MSNA 3C7KA 4K6FA 3W2HA 3NI2A 4ENVA 1OF1A 1XQ1A 4EHLA 3N8KA 1S0UA 3U44A 4TVSA 4QUHA 1L5HB 3BRCA 5DHQA 3UH0A 2ATEA 5BY2A 4TKZA 1NJ8A 4OA5A 1I8TA 4EYSA 3MEQA 4NE9A 2LE0A 5IH7A 1JPJA 1N3LA 2WJHA 2OO3A 4QEZA 3GFGA 4G56A 3RT9A 4B3HA 4D9GA 5F23A 1DX6A 2I3ZA 3BMXA 3N2ZB 4NH4A 1AQLA 3U7RA 4CWAA 3D8TA 4WCVA 1B0UA 3GPCA 2CUZA 1CY7A 5CFNA 5IVHA 2EEPA 3ZCQA 4X0EA 4S05A 3C24A 1C9NA 2Q3BA 2WT8A 2NO1A 2OO5A 1JVBA 4AY5A 1RAHA 3E82A 2YJTD 3M5WA 4JASB 4Q93A 1WHTB 2N9UA 1QWOA 2PRJA 4ROTA 5DN6D 4UQLA 2W6IA 5A9SA 3DZ8A 3TRJA 3RSOA 4YPVA 2E7ZA 4A23A 4DMFA 3ZIAD 1JA1A 3B2QA 4G24A 1LLUA 4B4WA 1X2BA 3VAYA 3ONWA 3NX4A 3CWCA 1BVYF 3GT4A 3EYWA 3I8SA 3QUAA 3X1XA 2AV6A 1DTEA 4RTLA 1ENYA 2OXTA 1HMPA 2XCOA 1YAJA 3LFUA 4KDRA 2VOJA 3PQ7A 4GDFA 1HE2A 4IH1A 1JFFA 5TLSA 2BFBB 3UW3A 2BGRA 3EMBA 3FAZA 3KSAC 3KV3O 1Q91A 4I4TF 3KQWA 1O87A 4N0MA 4OB6A 4MIOA 4YMIA 1E6MA 4QNRA 3LCVB 1Q0QA 3O2SB 2PR2A 3ORFA 1BA3A 4BFZA 2QZ4A 1WE2A 3I2JA 4TTSA 3SSOA 4EQZA 3AJEA 4AG6A 3C1TA 4W5NA 1HNZB 4MI3A 2OBYA 3Q0IA 4IG4A 4JT9A 4ETMA 5H3HA 5EQTA 1GRVA 4OLJA 5L4NA 1M2GA 2LKCA 1VL0A 3EVGA 3LUAA 4P81A 4U39A 5CHEA 5J1TB 3WMGA 3MGBA 4O1HA 5JH7B 1S96A 3TLEA 4DR1B 3GT7A 1ZUWA 1S7CA 1YMQA 3E53A 3OA0A 3OPYA 2J46A 4KMMA 2GNAA 3BRQA 3F6RA 5T64A 3VDQA 5LFAA 2GN9A 4YIHA 2AHRA 1WM1A 2W42A 4O59O 4E5DA 4PX3A 4TVKA 3UICA 3VU9A 5I4CA 1EFUA 2XXJA 2OAEA 2WJVA 3TTVA 1S7GA 1QX3A 5T4FA 3WK5A 1JLLA 2X1MA 2PO5A 3E8XA 5JTUA 1L8LA 4RTSA 1AQNA 1GU7A 1JDPA 1NSFA 2ZS7A 3IEIA 5JT1A 3BBPA 2CKDA 3W1EA 5FI0B 2CYBA 3GBSA 3G89A 2FJUA 1XCBA 1W1IA 1P0PA 3LCJA 3QOXA 3W4KA 5IJWA 1AO0A 1IJFA 4JC5A 4AKIA 1ODKA 3AOEA 4P82A 3PE6A 4QAQA 1P2TA 2PZBA 1MOQA 3TIGA 5A4JA 3KU4A 1P9RA 2JFFA 3DVAB 4NABA 3WMWA 2JLYA 4L78A 2J6HA 5EHGA 3RWMB 3K5PA 3TN7A 5HRUA 1ZJWA 1UXHA 3F8TA 3JAKB 3MWFA 4NJMA 4UHEA 1TLTA 5ER9A 1EUCA 4MWEA 2Y93A 2QJOA 3P9XA 3QIVA 2IEBA 5ECGC 1V8ZA 1X42A 5J40A 4QRDA 3F8WA 2FN8A 4DMCA 4DLLA 5F64A 3ZDDA 4I8DA 3O82A 3VSDA 1XQWA 2X86A 5GZ6A 3D43A 2BP7A 5EHQA 4DMLA 3TLXA 2REXB 4N39A 3DOUA 3EDYA 3IOCA 3H05A 1R5OA 3PL5A 4F38A 2CUTA 4WUVA 2EYUA 3ZWVA 4FMCF 1OPRA 4CBVA 2DKNA 4C6TA 2PK3A 4L5BA 1L5MA 3IB6A 1MT0A 4YJHA 1U0FA 4HDOB 3SG0A 3T4PA 1W5SA 4NS1A 3ZTYA 5IZ4A 2C42A 1KY3A 3F5SA 3FSGA 1ODSA 5DTQA 1IY9A 2RGRA 2W6JA 3NBXX 4PPYA 3QITA 2O1XA 3CKKA 4Y2PA 4KPFC 3R41A 3MTAA 4ND3A 2WF7A 4FMCB 2ZYUX 4HAIA 4HNTA 2C4WA 1A9ZA 1CQWA 1DEAA 1SUIA 2IYLD 2PGAA 3O6VA 3WFJA 1KKUA 2AI3A 3DW3X 4G85A 5AM4A 1GNTA 3TYXA 1DAMA 1G66A 1G6OA 1O77A 2QUZA 4MV1A 3S8EA 4OP3A 4OI0A 2EIHA 3NIDB 2IZ7A 4OXXA 4BEWA 1TTQB 1U99A 2W2MA 4GPTA 1EFKA 1TA0A 3S1LA 1P1KA 3FR8A 3TPCA 4K0KB 4RPJA 3O0DA 5CLFA 3OO1A 4YRNA 3I0MA 5F9FA 1P1RA 4Y8VA 2AR9A 2D1RA 4LWZA 3DFZA 4O3MA 4E07A 4BRSA 2P7HA 3L46A 1PHRA 4QT0A 2GCIA 2CL5A 4MRMA 4P7KA 2JGJA 2FQWA 4YAKA 5C1DA 1D9ZA 2CNOA 4ZOLB 2O2HA 3A6GA 3JQFA 3N6XA 3S1AA 3CUWA 5IXJA 5KREA 2FFQA 4PAQA 5BSGA 3LGSA 3AGQA 4HB0A 1EU1A 3UK2A 3V97A 3GLGE 1LK7A 2BGLA 2QAIA 2XECA 3DEAA 4P7GA 4YAJA 3SR3A 1SU8A 3GGCA 1JTVA 4WN9A 4MQUA 2JIMA 3P1JA 1VJGA 4N6NA 3MIZA 2JFYA 1SELA 3A58B 4ZJUA 2IVFA 1Y89A 3RIMA 5GV8A 3WLJA 3DWIA 5K8IA 2ZBVA 1C4KA 1AZTA 1KFEB 2BEUA 1XMOB 2QTLA 2YFKA 3OJLA 5FBQB 1DAPA 2QJFA 4KC0A 2PSHA 4M1KA 3SZRA 4ZKDA 4HXFB 2K7FA 5KVVA 3NVKI 4TT3D 1P2DA 1F12A 1JLKA 3AI3A 4JLOA 5C81A 1WBBA 3EVAA 4KWEA 3VR3A 2JGDB 4KQKA 4B3MB 4I6GA 2AT1A 4QKQA 2DBVO 4CFYA 4DA4A 1QH1B 2J6IA 3GRVA 1Q92A 4EPVA 1M2KA 5BP7A 2QRUA 4NHEA 1R66A 3K8ZA 1RPAA 1AUVA 3HFRA 3KFXA 1E2MA 2EKLA 4YECA 4JENA 4CMCA 3IL2A 1LQ2A 3KT8A 4UHBA 1J0BA 5FJIA 3TMKA 4YRMA 4S2EA 4DW8A 1GXSB 1KI1A 3U1VA 3VJKA 4C7VA 2QV0A 5A4AA 2Q4EA 1EP2B 2QUHA 1AKEA 2REOA 4JVLA 2GTPA 4K03A 1PNTA 3IBFA 3PPXA 4OX9Y 1JDBC 1BHSA 5EKSA 1WUJS 3CB4A 3CNBA 5CLIA 4XH9B 2IUFA 5C80A 3FZGA 2PKCA 3CH7A 3OICA 1NPYA 4MA5A 2DUMA 4ROSA 4ZVRA 1HE4A 3KOOA 1M54A 4GBJA 2NZJA 3QLEA 5CBKA 4OJTA 1WP4A 4N82A 1OFIA 2I7VA 2HCTA 1VM6A 3C39A 3KEOA 3LL7A 3NP9A 4B6JA 4AJHA 3FOAA 2IYYA 1E5LA 3PENA 3EIHA 5K45A 4M0FA 1RJGA 1MC8A 1LA2A 3JS5A 4BMYA 3B1KA 1T2AA 4CR8A 4JIGA 3FNQA 1JSRA 3GLHA 1LSSA 1SUBA 1X8JA 1MQAA 2VP6A 3EGVA 4PZAA 3VHRA 3W0LB 3H2GA 1H85A 4LYEA 2A1TS 4QU9A 3BZWA 4XFDA 1H5NA 4LV5B 1OFVA 1HRDA 1DWPA 3KUDA 1BDMA 4HNRA 4N5DA 1QP0A 4Z9YA 2VDLB 1F8YA 4RDXA 2HIHA 1ULSA 1P44A 1NV9A 1JXMA 3Q88A 4ABTA 2G40A 3IVXA 5T3UA 3GEBA 3AW9A 1FRZA 4J0QA 4Y2VA 3F97A 5CR9A 4TWBA 3KSRA 4C6TB 3GCWA 3QTBA 3JQFC 4JA0A 4ZVUA 1WVGA 3GLFE 2VT7A 4KH1A 2HF7A 2FJPA 3ITKA 4YTEA 3S3TA 1JDNA 3HYRA 2C8LA 5DGCA 4FINA 1ZN8A 3IEKA 1JJ7A 4MI1A 2I33A 1OC2A 1L7XA 3B9BA 4GF5A 3SZMA 3WBKA 3LQRA 4PU0A 5DP1A 3NHWA 3UO8B 2W2PA 3L92A 3O8QA 3HXKA 3M6MD 3C8HA 3PD7A 1G1AA 1KHTA 2ZI6A 3N9IA 5K0TA 1R0BA 5BV1A 5KSYA 3EAQA 1M2HA 1CXZA 4PGHA 5KTPA 5LQRA 1T6YA 1EHIA 2QV7A 3BQMB 3EJWA 3QA3E 1HYEA 3N70A 5DGTA 3I28A 4QOSA 4CMIB 1KMMA 2RH8A 3EW7A 3W77A 1EFAA 1KFCB 1O4VA 3ABOB 4B4DA 3VR6H 1ZHOA 4LZZA 3P9CA 1CUSA 1YHNA 3IR7A 1RM4A 1K8ZB 2WM9B 3IOYA 4N3GA 5DM70 4B3CA 3QKTA 1KP2A 1OAKA 2K7ZA 4BO3A 4YYZA 3CZRA 3HYNA 1W85B 2QX9A 1T2FA 2MMCA 4HH0A 1KJIA 3KZKA 5FV4A 3U26A 2CL0X 3CVUA 2XVYA 3EMVA 4M89A 5ECYA 5F21A 1YDFA 4XM0A 1N0VC 4F4FA 1U5CA 3C6QA 3QE4A 5KNBH 1J2EA 2VH2A 4P8RA 3DBIA 4RLFA 4KE8A 2QTZA 1V39A 5ULLA 2FSVA 3VMFA 1WETA 2EIXA 3UAZA 4HV4A 5B3LA 1P2VA 1U7WA 1VPEA 1AKNA 1J8FA 4QFBA 2D2XA 5E1MA 4I5EA 4WXPA 1U8EA 1AQYA 1QORA 3T5CA 2QG4A 1VLQA 2FN3A 1GL9B 1R8YA 3FCCA 3JRXA 2XYHA 4IDDA 3PF9A 4H18A 4R9SA 4UAVA 5EJGA 4DJTA 8AT1A 1HTTA 1XU4A 2QLLA 2WJZB 4NH0A 4ALIA 2Q3JA 5CFQA 2TMYA 1IY2A 1NBEA 3L0CA 4WGGA 5HIKA 2XNSA 4LJ9A 2HCBA 5JCOA 4N12A 3TL3A 1OH6A 3FROA 1YNOA 1DKRA 2A84A 1PJQA 1W1WA 2AFIB 4IKOA 4IIEA 3JYPA 3CE6A 2MCFA 4J3FA 3LP8A 1NJSA 1E59A 3C3AA 1GNPA 2PBFA 3G0OA 2OWEA 2XA9A 3GROA 3OF5A 4KEAA 4BMNA 5B6PA 2OG1A 2AE1A 5AVVA 3FB1A 5EZYA 2N42A 2ZIFA 4P4SA 5JJIA 2Q46A 3C6YA 3WRXA 1RIIA 4P0TA 5FHQA 4BASA 1Q7TA 1CY2A 3OQ1A 5FV7A 5TEVA 1CPYA 4KXUA 4KR6A 3EVFA 3KWFA 3ZXUB 1DT5A 2AOTA 3F6PA 4G3XA 3PBKA 3DE4X 5HF8A 1GKKA 4I55B 3EXFA 4JQOA 4QYSA 5IMBA 6CHYA 2H1LA 2PSFA 5H83A 4N65A 4CTOA 1X19A 3DL0A 4QG7A 1P2GA 1OGYA 1Y6GA 1SN7A 2A9OA 1K3UB 1D8AA 1OLXA 5LKRA 4L57A 1SC3A 1Z83A 4OQEA 5CM8B 3G0GA 3GW8A 4YT5A 1QYVA 1Y5RA 1CIJA 2XZDA 2TMKA 3GPDG 3NBAA 1SM4A 3PJRA 1U4SA 1NR7A 4HLNA 4YJGA 1XK7A 1HKHA 1SC1A 3L7AA 1P19A 2CY0A 4ZO7A 1Q6ZA 1GL6A 2WTNA 4ZCPA 5C8XA 5D3QA 2X6TA 1A5ZA 1F0KA 1U8YA 4B44A 5A4KA 3V2UA 2V7UA 3CLUD 3Q9UA 5DIZA 1U90A 2C31A 3GL9A 2IWRA 1H4SA 1QIKA 5JLJA 1KRHA 2WB4A 3BHMA 5CNMA 4BTEA 5K8UA 2H2HA 1PX2A 2ACWA 2A1IA 2ET6A 3JSAA 2CFOA 2HIMA 1KYWA 2J8ZA 4R5HA 1NG9A 1BCRA 3CX4A 4QOGA 1J2RA 3M9LA 3SLKA 2EFHB 1NVGA 2P1DA 1KA9H 1FUUA 1Z5GA 1KK3A 3DLCA 3PNVA 3MJ4A 4MTCA 5LDGA 5LJLA 2BE7A 3HKEA 4M7WA 2O2CA 3E0QA 1LDYA 1LFAA 2HLNA 5BXQC 1G9SA 1T6ZA 5B7PA 1GAXA 1TU4A 2O7VA 1GQ2A 2O2SA 5AW2A 4GE0A 1NN1A 4JLSA 3KB1A 2JCVA 5TVKA 2WU4A 4C29A 4D41A 1WOYA 2O8CA 3K0CC 1NM5A 2GA8A 3UF0A 2OCIA 5FDFA 3D4PA 4BZQA 3DOFA 2V5AA 3VJMA 3RNOA 2DERA 1Y5IA 3X2EA 5LP6F 5LQMA 1YKSA 2JAUA 1SBHA 4NDNE 2D74A 1I9GA 1N92A 1IM2A 3CBGA 1RLOA 4EY4A 1V5GA 2PT7A 1BZYA 2HA5A 3CVWA 3IOMA 2ZT5A 3ECAA 2HK6A 2QRVB 1E0AA 3WB9A 5KCMA 1V9CA 2OECA 3JQQA 2GAIA 1ZIPA 4KV9A 2RHBA 2XE7A 4F3TA 2PVCA 1Y9EA 3PQ6A 3ROTA 3KPJA 4P3NA 4CLDA 2OFFA 3PKJA 1FSFA 3H11B 3HXLA 4G9EA 2ZJOA 1NXQA 1KQFA 3MTEA 4LG1A 1XJ5A 2OZPA 2XF2A 3EGWA 3HJUA 4ODIA 1VG9B 2WJ4A 2X2OA 4WNYA 5EHIA 3MJHA 2V58A 1CJKC 1C9EA 4AJJA 4RIIA 5E3HA 2VNSA 4GX2A 3I45A 1B6GA 4GR5A 1JIVA 3AEQB 3UK7A 4AY2A 3DE2X 4FONA 1FSGA 3FRJA 2VDKB 4MIEA 4OFXA 4R41A 1N0IA 4IMJB 2JJ2D 1X0XA 3AB7A 3CZ9A 3O7MA 4WNCA 4YIKA 4CE6A 4MWOA 2YZKA 5IDWA 1H8HD 4FW8A 4KB5A 5KYNA 2XE6A 3LF1A 5JSHA 3L1VA 2X2EA 2JLCA 2BTEA 1UPBA 4OHPA 2DBYA 1E1LA 4W9MC 3UMVA 2WYIA 3L77A 4R05A 1W75A 1KOJA 3NGMA 2O0JA 5JH7A 2LRHA 1GSAA 4GWLA 3QVGB 1GG2A 1M2VB 2ZXEA 4L74A 1LBHA 5AKLA 1BEEA 1UC8A 3HJGA 4MB6A 3VR5D 4IBOA 4QT4A 1LQTA 2FQXA 3E1GA 3LC0A 4HEA6 4M1OA 4QSHA 3USCS 1KOGA 2C5LA 3EWNA 4DV7B 2GTIA 4DLXA 1JILA 3ICQB 1OIXA 2XOEA 3ANTA 3DDCA 4YMHA 5L3QB 3A1UA 1X3LA 1J5PA 3D5EA 3QFHA 4G8JA 4HZIA 1C3OB 1YBFA 4DNFA 4HDNA 1OOEA 3HN2A 4ER5A 3VKGA 1QGUA 1RADA 2NVUA 1QF7A 2EATA 2L17A 2G6BA 3AU8A 3E7WA 1R9MA 4HKTA 5EYPA 5K4AA 3RS7A 4KUHA 4KLZA 4L5YA 1FQOA 3K0AA 5FNZA 5EJ9A 1YV9A 2FG7C 3D0RA 1S6YA 4H6VA 2D4HA 3F96A 3PDCA 3BGOS 3GGSA 4U7TB 5BO5A 3SEFA 4LK3A 3MS2A 1VOTA 4IWNA 4MV6A 3CZMA 2PRKA 5JADA 5ALNA 5KBYA 1L1RA 3VU1A 4MGIR 4MIYA 1W4LA 1Z4LA 3N2GA 3NDPA 4MRRA 3QVLA 3V4OA 1GLNA 3HB0A 4HHEA 4RFLA 2G63A 1E2DA 2Y3IA 4V0ME 4YUZA 5JAPA 2M98A 3RABA 4TLCA 4ZHQB 5GVSA 1WW3A 3U7FB 2FX5A 1E2NA 1X7WB 1HOTA 1TPYA 2H1CA 2WAMA 2YBEA 4MR9A 2DEUA 1IHPA 4CMKA 2VCHA 2OOKA 4B71A 3QMMA 1NAHA 4MUBA 1N7JA 1W93A 1NVEA 3SVZA 5ALOA 3DONA 2DAPA 2JGRA 4LRWA 4LXIA 5CT9A 3RSHA 3SQOA 3AIIA 2ZK7A 3BK1A 4RH1A 4DRXA 3KL2A 4QHYA 1N2IA 1YZKA 5A5VA 2XOXA 1JFLA 2VPQA 4G07A 4Y2JA 5DH9A 1Q7BA 4D56A 3ZZNA 1J0EA 1OXBB 3TQTA 2EGGA 4MR8A 3PD1A 4HQNA 4OQZA 3I9MA 2E5WA 4RFVA 1K0FA 1A9PA 1FLNA 4HQFA 3FMGA 2K2WA 4QNNA 1FMLA 4LQCA 1M3SA 3QLVA 1IB6A 4H7KA 3KUCA 1NVAA 1JVSA 5F77A 3F1KA 2H5IA 2AQHA 4IJQA 1IJBA 1PWZA 4XUEA 4X66B 2PPVA 4HNSA 4ES6A 1S2NA 4QBGB 1YS2X 4X63A 1Y4UA 1BFDA 1RRKA 4NCBA 1SHZA 1NUTA 2BR5A 3AUYA 3MT7A 4PLVA 3PGJA 3D02A 3OG9A 4TZTA 4F12A 2A1UA 4HOYA 4O25A 2Q9UA 1SZCA 1U63A 4S1NA 5IJ9A 2JLWA 3ANXA 3HXPA 3CYFA 5BQ5A 3GAMA 2GCOA 3OC0A 4CI0B 3V1TC 5B1DA 1UC4B 2D6FA 2BLLA 5AKZA 3UEOA 1OLOA 2I65A 1RI3A 1TK2A 1F38A 1NRJB 2AMJA 2BKLA 4MRAA 3VU8A 4ZZ3A 3QYPA 2ZQYA 3DBHA 4IJ5A 4YK7A 4DILA 4JIMA 2ZIAA 4E11A