4MZDA

High resolution crystal structure of the nisin leader peptidase nisp from lactococcus lactis
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
424
structure length
356
Chain Sequence
SHDFWDYQWDMKYVTNNGESYALYQPSKKISVGIIDSGIMEEHPDLSNSLGNYFKNLVPKGGFDNEEPDETGNPSDIVDKMGHGTEVAGQITANGNILGVAPGITVNIYRVFGENLSKSEWVARAIRRAADDGNKVINISAGQYLMISGSYDDGTNDYQEYLNYKSAINYATAKGSIVVAALGNDSLNIQDNQTMINFLKRFRSIKVPGKVVDAPSVFEDVIAVGGIDGYGNISDFSNIGADAIYAPAGTTANFKKYGQDKFVSQGYYLKDWLFTTTNTGWYQYVYGNSFATPKVSGALALVVDKYGIKNPNQLKRFLLMNSPEVNGNRVLNIVDLLNGKNKAANNRNSRGAVSVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the nisin leader peptidase NisP revealing a C-terminal autocleavage activity.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Hydrolase
molecule keywords Nisin leader peptide-processing serine protease NisP
total genus 142
structure length 356
sequence length 424
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4mzdA00
4OV6B 1XF1A 2WV7A 3DVSX 3A3NA 3DYBA 4OMDA 1SBNE 2Z30A 1BE6A 3GT4A 1WMEA 4DWWA 5JMOA 2Z2YA 1TO2E 3H42B 3DE6X 1UBNA 1V5IA 3DE0X 1LW6E 1S01A 2HD4A 1SUEA 1SPBS 2SECE 2DUJA 4WOCA 1TM4E 1PTKA 3GT3A 4FONA 5ARCA 1R64A 3D43A 1SCBA 3VV2A 3EDYA 1AQNA 2Z2ZA 1TM1E 1Y9ZA 1SIUA 5JXGA 1A2QA 3DE3X 4HX2A 1EA7A 1SBCA 1T1EA 2WUWE 2WWTA 3LPAA 3Q40A 1VSBA 4I0WB 3UNXA 4JP8A 4MZDA 1P7WA 3GCWA 1BFUA 3D9QX 4H6WA 3AJ9A 3DE5X 3ZXXA 3TI9A 1SVNA 4NE7A 3WIUA 3DVRX 1R0RE 1SUPA 3F49S 3LPCA 5AVKA 2PMWB 2PYZA 2W2QA 4ZOQI 5I9SA 3SQOA 3TECE 2IXTA 1P8JA 2SNIE 3DWEX 1R6VA 1YU6A 4B5LA 1IAVA 3EIFA 1AVTA 1SCJA 1S2NA 1SCNE 2ZWOA 3I34X 3L1KA 3WIVA 3WQBA 1AV7A 1BJRE 1TK2A 5JXJA 3TI7A 1TM3E 1CSEE 1GA1A 1GNVA 1GCIA 1TMGE 2GKOA 1PJ8A 2ID4A 2PQ2A 2W2NA 2Z58A 3CNQS 1TM5E 1DBIA 1Y33E 1Y48E 1GTG1 1V6CA 3AFGA 3BGOS 4KPGA 4Z2AA 1HT3A 1Y4DE 2QTWB 5ARDA 3I30X 1KE2A 1SUDA 1AU9A 1SBIA 2DP4E 2IY9A 2SBTA 3QFHA 1NLUA 3F7MA 4CFZA 1ZVKA 2ZWPA 4J94A 1OYOA 1WVMA 1TO1E 2TECE 4OMCA 2E1PA 3LXUX 1C9JA 1Y3CE 1YJCA 3P5BA 5JXIA 1TECE 3PTLA 2W2MA 1OYVA 1CNMA 1TM7E 1Y3FE 3T41A 4CG0A 5K7SA 2V8BA 2X8JA 1C9MA 1BFKA 3I37X 1Y1KE 1Y3BE 4LVNA 3DE2X 1OT5A 1SELA 3GCXA 4GI3A 1SIOA 1THMA 5FAXA 1GNSA 3OSZA 4LVOA 1MEEA 2SICE 1SN7A 4H6XA 1KDYA 1Y34E 5SICE 3VHQA 1Y3DE 4HVLA 3AJ8A 1AH2A 5FBZA 5AMXA 5B1DA 4AKTA 4H6VA 1SH7A 2PKCA 2P4EA 4K8RB 3LPDA 4NMXB 2W2PA 3BX1A 2W2OA 1BE8A 1EGQA 5B1EA 1Q5PA 1SBHA 3VYVA 4CFYA 3CO0S 4DJ5X 3I2YX 1P7VA 1YJBA 3DW1X 1PEKE 2PWBA 3PRKE 4KG7A 5JXHA 1YJAA 1MPTA 4RYDA 1KDVA 4C3VA 3VSBA 3WHIA 1ST2A 1SCDA 4WOBA 1DUIA 3SICE 2HPZA 4BWGA 1C9NA 1GA4A 1T1IA 1SUAA 2B6NA 3A3PA 3VV3A 3ZXYA 1GTJ1 1NDUA 1AF4A 1WSDA 3DDZX 3DE1X 1S02A 1NDQA 2XRMA 1GA6A 1IC6A 1PFGA 2Z2XA 3DVQX 4AKSA 3VTAA 2Z56A 3DE7X 1GT91 3BPSA 1SUCA 5FFNA 1SCAA 1WMDA 4C3UA 1ZVJA 4DZTA 3HJRA 5AQEA 1AK9A 1JEAA 3DW3X 3A3OA 3Q5GA 2WUVA 1SIBE 1GTL1 3QMPA 2G4VA 2XTJA 4NE9A 5ARBA 2DQKA 1ST3A 4M1ZA 4YN3A 4ZARA 4KB5A 5AVJA 1SBTA 1BH6A 1SUBA 2ST1A 2Z57A 1KDZA 1Y4AE 2PWAA 2ZRQA 3EE6A 1C3LA 1T1GA 2ID8A 3DE4X 5CW1A 1KE1A 1WMFA 3F7OA 3QTLA 2PRKA 2X8JB
chains in the Genus database with same CATH superfamily
1HFEL 2I6UA 1KFJB 1XHEA 2N9UA 3EOAI 4EGCB 3MCUA 2IE8A 2X1MA 4RHXA 4Y3UA 5FOTA 5DHQA 3WMWA 4PN3A 3IAUA 5B58C 2Y9PB 2WJWA 4C76A 3DDWA 2HY7A 4RNCA 3WJ7A 4ZU3A 4E6PA 3IUPA 1ZMBA 1LPAB 2I6QA 2W0SA 3PYMA 1SQGA 1E96A 3MJFA 2PUVA 2P7IA 5LJIA 4PCVA 5JE8A 2QYTA 2BGKA 3T34A 3S2EA 3TINA 1AA6A 1MUUA 3G2MA 1CUAA 1LNQA 5E0KB 4QGGA 3UFXA 1NUQA 1TMOA 1XEWX 3LBFA 5DF1A 2BYTA 1YD7A 1YR8A 3AEKA 3E58A 3MGCA 5DW0A 3I8OA 3TOVA 1UPFA 4OYLA 3HN7A 3CLUC 3QKRB 4TM7A 4WGGA 3EY9A 4TKUB 2LGJA 2YHUA 4WNCA 4GE0A 2GAOA 2YVUA 2QMYA 1EVLA 2DM6A 1VFNA 3GCGA 1WDLA 3QEJA 2FGJA 4P34A 1G21B 4PS1A 4L9AA 5DYNA 4LNHA 1C50A 4LBVA 4HDRB 2D2XA 3M6UA 2VQEB 2J9GA 4LMAA 2CWDA 3BMNB 1GA1A 3BTSA 3JWPA 1B2RA 3JYLA 4JQYA 5FWDA 2BFDA 1JIIA 1SG9A 3AOEA 1I8TA 2LDXA 3PVCA 4LHEA 1HT3A 3P20A 4HLUC 1BS9A 1VPLA 4FFWA 3PGA1 4I66A 4IJUA 3UK1A 2Q6IA 3DNFA 1X1TA 1T0PA 5DKFA 4DDUA 3RSOA 1VLVA 2Q2VA 1Q7RA 1RS0A 1JR3D 2VHWA 2XADA 1GY8A 3IUMA 4WWHA 3N39C 1UXIA 3W9BA 4B5KA 2QRJA 3EUFA 5T8KA 4HNVA 4CGZA 3GLFB 1FFHA 3UJCA 1YQEA 2FSPA 2HK7A 1AKRA 4WA7A 3SIWA 4D8UA 5LQRA 1FRNA 1T6BY 1AO0A 1VE7A 4II7A 2I4TA 1GUAA 2FWPA 3F73A 4TZ6A 1P2GA 2YXNA 5J2UF 1YULA 2OAP1 4H7HA 1DIOB 5L45A 2Q46A 4YRRA 2IU0A 4RLHA 5KS2A 3ZVKA 1EK6A 4YMVA 1AKQA 1I5RA 3OECA 2NV0A 1T9AA 4OSPA 2UVPA 4LI3X 3S6JA 5EMMA 3VSDA 4OU5A 1FTNA 1NQXA 2C07A 4G1BA 1O95C 4XTCS 1BWSA 4K9MA 1WVIA 1XRNA 2JI8A 3PPIA 1JQEA 3H3FA 2HA2A 3ESQA 1JQLB 4MYTA 4EHHA 1Q2UA 1WCXA 1GKUB 1T1IA 5FOSA 1KY3A 1Z0UA 3RAJA 1NF8A 4K46A 9LDTA 1FS6A 3CEAA 1XTRA 3LD9A 2ZRPA 4OK5A 3MEQA 4FMDF 1ISRA 4AJEA 2FW7A 4AW9A 1P77A 3CNLA 3GWGA 3BJRA 3PPXA 3V1KA 5B6PA 4O2LA 2RHWA 5JVDA 3PC2A 3D6FA 3K9CA 1SCUB 3L41A 1FTGA 4R54A 3LT5A 4PZLA 1F0YA 2J6IA 1QQ6A 4PG4A 1N2GA 3QWIA 3JQFA 1M2VA 3QA3E 5CNJA 2JLZA 3NUQA 3T9AA 1YRWA 2IBMA 3COZA 4DPLA 1WVGA 1DQNA 1N5DA 4P5EA 2RCYA 1O54A 1JECA 3O0DA 5FI3A 4XQEA 2PS9A 1EFUA 3KB2A 4P58A 3X1KA 4QHYA 4A6DA 1AGXA 4MJ3A 3A2NA 2X86A 1H0SA 4CL2A 1RQRA 2AJTA 4BHTA 2FV8A 1JQDA 4RAQA 2OGZA 4BGUA 5EJ6A 3LTNC 1E6CA 4OMFG 3ZWCA 1V6SA 3LO8A 1RXSA 3CE9A 3LY8A 1U80A 1UH5A 2J5KA 3ODGA 4WAUA 3BICA 3QKUA 4TOIA 5J2UB 4U8GA 2PKQO 4EO9A 1UP7A 1FUYB 2Y71A 3T5DA 3VZDA 2OFOA 1S9DA 2HCJB 5AVZA 1J49A 1W2WB 4UHKA 2OENG 4E5MA 5F3WB 3EPHA 4UXHA 3LRXA 2K7ZA 5LZ5A 2VWGA 1EXWA 3KKLA 2VWHA 3MGBA 4L50A 1J07A 4MLZA 5AXDA 3V34A 2O4UX 4BQPA 2JHAA 1EFRA 4JI3B 4WZAE 3COVA 1KDRA 2HUNA 1MJHA 3MUEA 4KLNA 1EK1A 2PYIA 3GRRA 2PGNA 3RAGA 1R0XA 3SF8A 1Q7CA 4C3OB 3DFFA 1N6RA 1Y7TA 2YCLA 1PBNA 3L8CA 2PT9A 3H1AA 2FXIA 4M9CA 1ZOOA 1H5QA 1SOWA 2HLNA 3HA5A 3HBJA 5LLSA 3PC6A 4DGQA 1FFGA 1JHMA 4DY6A 2J3LA 1OX5A 1KEWA 1EP9A 2Z5GA 3FBGA 3IAS1 5B1SA 5A9SA 4G5RA 5K0LA 1J8YF 3CR8A 1YCFA 1ICIA 4KSBA 1QRAA 3WYBA 4O8CA 1YCGA 1Q14A 1NJSA 2JDID 1G8AA 2D0DA 2VDQB 4Z86A 5BMOA 1QO9A 1IWBB 1LI4A 4U2EA 1Z4LA 3Q1LA 2I2CA 2ENUA 3QX9A 4JLPA 4P32A 4QTTB 3PIRA 2VTBA 3UMYA 4EO7A 2Z8ZA 3SAJA 3ZWYA 4B3JA 1ZRHA 5H02A 2EATA 2J4DA 3P0EA 1WPGA 3EQ8A 5HQTA 3K4QA 1YRLA 3TVTA 2C9ZA 3FRHA 3EXIA 3FF4A 3JQ6A 1WXDA 5HM8A 1QHHA 2R9VA 1UFKA 2DR2A 1IEXA 1G20E 2UYOA 4TS3A 3NGLA 1GPUA 4LK3A 1WOYA 2FWNA 2C2HA 3UK7A 4DUZB 1FDOA 3RFXA 1X42A 3VISA 1S9HA 5B36A 3WGHA 3QHPA 3MT8A 3UJPA 4CL3A 1M1YE 2P6RA 4IQ0A 1UT6A 1DRKA 1W93A 2XQGA 4I55F 3TTWA 2GA8A 3A3KA 1RYEA 3UIEA 3M0EA 4M89A 3R7AA 1CERA 3EZ2A 2BBWA 1EZ4A 1NMZA 1U0FA 4TYNA 2IBSA 4TTSA 4LDPA 2BZSA 4DR4B 2HIAA 1XDGA 4JASB 3ESZA 1P73A 2FW8A 2GCOA 4BZPA 5JY6A 1BXKA 1HYGA 2OWDA 2CDBA 3H16A 3K70D 2CWWA 1NIJA 1LVUA 3K1AA 4NENB 2Z3ZA 1N6LA 2H57A 4C5AA 3MRXA 1NUAA 3HL4A 2YR0A 3ML1A 4Q4LA 1J56A 2PS1A 5CDGA 3ZDFA 1TQDA 2CHUA 1K8ZB 3Q7IA 4Q3CA 4QRDA 1XMJA 3PLRA 5GM2A 1LW7A 1BKYA 3PDIA 1JKXA 2ZJ1A 3N2NA 4XVQA 5JCXA 4DMUB 2V9PA 4P7FA 1UXKA 2A58A 1DKPA 3K1YA 4N9QA 5ALYA 4OLBA 1KI8A 2QW8A 4X63A 4LOHA 4C4ZA 3QM1A 3HO6A 2P6NA 3GVXA 3JQBA 4GMFA 1RLIA 1X14A 4RD2A 4WKPA 1A7KA 2V9ZA 2HWUA 3F6EX 3KX2A 4MA4A 4R2XA 3KL2A 4R3NA 3THRA 2NPIA 2N47A 1Y9EA 1MC4A 5LPNA 3D2BA 1UQTA 3Q9NA 4QQRA 4DLXA 3UOAB 3W6NA 2X42A 4MROA 5BN1A 2G71A 3ZY3A 2ZIGA 4BO3A 2I2AA 4WPGA 4DLTA 1J0BA 1A9ZA 2QI9C 2WJ6A 2F17A 4D0SA 1W5FA 1PJLA 3PQ6A 1GPLA 1D4ZA 2XLBA 3H7AA 1OGYA 3GNQA 3S1AB 1GQSA 2I2DA 3NH6A 1UZLA 1VRWA 5C8YA 1H4VB 3ISVA 2CBZA 2BFOA 3OEHD 5DFAA 3U2QA 3L4EA 3OU7A 3QQPA 1PIWA 5T4HA 3VVLA 1VHDA 2VTVA 1M1NB 3BWDD 4X85A 1YS6A 2HF9A 3N0TA 4E5KA 3KEFA 1U2DC 4JBGA 4MJLA 4BC1A 2VTDA 4HKTA 3TYXA 1Z5OA 5BWMA 1MO6A 1XQ9A 1U1DA 3AERB 3KKNA 4UJ3A 3Q8WA 3K0HA 4AWBA 4CM3A 1I7NA 2I9PA 2ODNA 2VYCA 4BQIA 3ITNA 3JRWA 4G5QA 4KXYA 3GQBB 1NZJA 1Y5LA 3UFBA 1PEDA 4QXAA 2HXYA 2JFWA 3ELYA 3TQOA 3QOYA 4QUKA 1AHHA 2ZWPA 3AF3A 4K9OA 1YMUA 4ZCIA 3N8NA 2CUKA 2AE2A 1SVMA 4YRGA 1JEEA 1GUBA 1S4MA 3IV6A 4PAWA 3T5BA 1USKA 4MUEA 5LDGA 2I5PO 1HDIA 4HXEB 5DHAA 1KR5A 4L08A 1ISJA 2FMIA 3GDFA 2UZ1A 3DDOA 3DLIA 4GX5A 1GSIA 4NNJA 2ZBGA 3KTDA 5AK4A 1UJ6A 4YJ3A 2HWKA 4P93A 4PZYA 4HDMB 1CDDA 2CNDA 2NUPB 2QMQA 3HDGA 1XBTA 1XCPA 2Y3IA 2ZYDA 3TGWA 4H31A 4P2GA 4ZI5A 5I48A 5C37A 2HHJA 3RVJA 3ZHUA 2PHZA 4BFLA 2PXAA 2C99A 1PDOA 5FRDA 3WK8A 1ZJ5A 1WM1A 2HXSA 3CZ5A 3OE7A 1IB6A 4HRYA 4AY3A 3O3MB 1GL7A 2JAPA 2P9JA 3B78A 3RO7A 4TKUA 3BM5A 1B6RA 1IHYA 3IESA 1GA4A 4YQEA 1VJ1A 5GV7A 2PL3A 4GPIB 4N7BA 1CEXA 2ZT5A 2CLMB 5TR9A 3RB8A 3WYEA 4BB5A 1Q91A 4C7BA 5JCZA 1HLDA 3FTQA 2JH3A 1FBNA 3E35A 1U1FA 3NHPA 4PU0A 2HHCA 2HJVA 2MCFA 4B34A 2OFWA 1PTJA 3H1BA 3EQ2A 1R74A 2Z9CA 3U7JA 2PZLA 1XRPA 1W9MA 2YWHA 3O7MA 4LDRA 4N4AA 3U31A 1N77A 2QSYA 2FDCA 2C96A 2V98A 3N6XA 5K8CA 4YCLA 2AK2A 3QNMA 1QP8A 3AGPA 3KSDO 3MK31 4TS4A 4MP6A 2FWMX 2QENA 3H4IA 4IXMA 3KDAA 2ZUSA 3DE4X 4I5IA 5FPPA 3VH4A 1W4ZA 1A8PA 3EAGA 5DBHX 1ZM2A 2PX6A 3FPSA 5GAJA 2IH2A 4B1FA 3OIVA 4J7UA 1Z63A 3DLBA 2F62A 2VOEA 1W1WA 3LYHA 5F23A 4RKWA 3HVUA 3K9HA 3TDNA 1P19A 1Y9JA 4GZLA 1H66A 1HQKA 1LNZA 1XEXB 1YZ3A 1V9CA 1P0CA 1XPJA 2PU5A 4J0JA 2AYXA 3B6KA 3G59A 3G2LA 4RZIA 3AKZA 1ABBA 3RC1A 2IHBA 3SNKA 2W2KA 2EP8A 2XA2A 2GLUA 4TVKA 4QFBA 4C6HA 2XWQA 3DVLA 4R41A 4Q03A 3GUUA 4BECA 2NUBA 1UJ2A 5DTRA 3ANLA 3USCS 4CT4B 1QTRA 4LA4A 4YAWA 2OZVA 3MSCA 3V2HA 3WNBA 2RBKA 3QFTA 4NV0A 4A10A 2O5VA 4X54A 3VJKA 2CVOA 4BRZA 4ZZIA 4LWZA 2ODQA 5G1OA 3GLFA 2HWXA 1IN1A 5A4IS 1PNQA 4G2NA 3WRYC 2R8OA 1N92A 2IXTA 3DOOA 4FDUA 3LUAA 4O4LB 4S1NA 4XDYA 3BH6A 4KWCA 3N86A 5I7SA 3WLPA 5HRAA 3M6WA 3WA6A 1L8QA 2GM5A 3T0GA 1TK2A 4AY4A 1HRDA 1HDOA 1DG9A 1DWOA 1OXUA 2JAWA 2NLOA 2W2NA 1F6WA 1V11A 1V8BA 2JFBA 4NEHB 4KUGA 2O8CB 1Z6PA 4GI2A 3PP8A 1UDWA 2EEPA 3C5VA 5C52B 3ZY2A 2ORWA 4GSKA 2WF5A 4CMAA 2H2WA 3AI3A 3QVOA 5FPHA 1YFJA 2BD0A 4C2UA 5AK0A 3R40A 5HOQA 2IYPA 1RTTA 3OQ1A 1VL8A 3N7UA 4L8LA 4YV2A 1UKVY 1H2FA 3FDZB 1P6QA 4UNRA 1E0KA 1E1QA 5BXQC 4KN5A 2Q50A 4BUCA 3VPAA 1YH3A 4M36A 1K68A 1ZM3A 4HN2A 4Y2PA 2A88A 1Y3BE 4KLRA 4N3AA 3BIFA 3HXMA 4R7GA 2BEUB 1VMEA 1ZZGA 3CLSC 2XGSA 3L40A 4L5AA 3A6DA 5F7JA 4YRFA 3ZCUA 4FYYA 3N1UA 1UBRS 2IWRA 4IG4A 2Z8YM 4MQFB 3O4FA 1CY0A 3TOZA 2VH2A 5BW8A 4EYGA 1DNPA 4J6EA 3ZY5A 1YJBA 3OZAA 1RWKA 3RQIA 4C43A 2WTNA 3IBFA 4KPUA 1LPSA 3B82A 3IT0A 3RHZA 4BKMA 5JSUA 2EQBA 1LDEA 2HSDA 3FA2A 1E9DA 3QVSA 3U17A 1O4VA 1YS9A 1XU7A 2J9FA 1DBSA 1ZSYA 2V5UA 2TMDA 2WTAA 3PKZA 4G1MB 1FF9A 2RHCA 3HE3A 1XJ5A 1MB0A 3C3MA 4CM8A 4DCJA 1BWRA 5CM9C 3H1PA 3MTEA 1J90A 2YFKA 1CEQA 3DQPA 1J0DA 2AOUA 4AMUA 2OK7A 3ENKA 2DLDA 1ZN2A 5DISB 3U80A 2FR8C 3ICPA 3WLFA 4JQZA 3WVNA 5K03A 4LFAB 3TLJA 4C3UA 3JQGA 1KI9A 5L40A 2GR9A 4FMPA 4KIUA 4DQKA 4F91B 3GVCA 5EIWA 2XB2A 4MW6A 1MB9A 1DMSA 3F5MA 2XTJA 5ARBA 4KXUA 4B40A 1TZKA 1M34E 1OIVA 5KQPA 3FXAA 5L6LB 1D6MA 2IEBA 1ZVVA 1Q77A 4PO3X 5AJTA 3GZNA 1GTMA 2NO6A 1W4BA 4Y6LA 3F3KA 5ESRA 4P0PB 1QQ5A 2POCA 5DEIA 4WXHA 2XVYA 1R12A 4R6WA 4UHFA 3P19A 3RODA 1QWSA 4GMDA 4H16A 1WHSB 1M2JA 2OG1A 4QPJC 4YJ2B 3VPCA 5KJFA 2RHHA 1OBFO 1MD9A 3FLMA 4GM0A 2OYCA 2QM7A 1QGUA 5BN4B 2FSFA 2RAVA 4B6QA 2CFIA 3BJEA 3A06A 4OVKA 4RA9B 1ZK0A 3EIEA 3HCRA 5A62A 1U3TA 1XOIA 2G9ZA 2XNKA 4NBUA 2ZJ5A 3IO3A 3O92A 2OHHA 3OI7A 2H06A 2YMLA 3Q3GE 1RHJA 3AVUA 2Q1YA 4M99A 2RH8A 1ZNXA 2QAJA 2DKOA 3H8SA 3QX7A 2H1RA 3DE5X 3IAHA 1G8MA 1SVNA 4NAHA 1GL9B 3ERCA 3EWSA 5FNVB 3S8MA 1UOOA 4B6OA 4LY0A 3HXTA 3VC3A 3GGDA 3SJAA 3G2PA 5CMLA 1V3VA 3IDAA 3MWJA 3O95A 1ZJJA 4ARUA 1NXSA 4E1BA 4R2MA 2BJWA 4X1IA 3JQGB 1G7CA 4DMMA 3AEQB 5KCZA 3ORHA 4MDFA 2HDHA 4ZOCA 1O96A 4RORA 3WGYA 4BE7B 4GECA 2R7AA 3USES 2OYSA 4TMYA 2CF5A 3AUUA 3CZRA 4MVJE 2QE6A 1G3IA 1EDBA 1L5MA 2WYHA 2JJ8A 4LCBA 4PPNA 3QI7A 3T5GA 2GCGA 4M4SA 2OXTA 5KJ6A 1CFJA 3B51X 3CZPA 4ZT6A 4MW1A 3Q87B 1GPMA 1LPOA 1UC9A 3KKOA 2CJFA 4GGOA 3ZKAA 4ZVOA 1VL2A 3PJFA 3AB3A 4IAOA 4M22A 3VVCA 3HYTA 4CG0A 3W9SA 3DMRA 1ULZA 4PTLA 3AM3A 3PUIA 3KSBC 4A23A 3EF0A 4J1TA 5B7NA 1CVLA 1T8PA 4FDVA 1I6WA 4Q3LA 4XI9A 2Q3JA 2KI5A 1XWWA 4M6WB 2HA0A 2OVBA 2QLNA 1NW4A 4K8RB 3UMCA 4P9NA 4AG6A 3JQ7A 4BNHA 4KQKA 2H31A 3L6OO 3NIFB 3OURA 1KRXA 4MGEA 5TXGA 3CIFA 1II9A 3IAAA 4JY7A 3TB4A 4EHAA 3VR6A 2IUUA 4RGVA 4DF3A 4MVJH 1JTFA 3CLTC 2R1VA 4G56A 1G9XA 2GYWA 4ECEA 4EYOA 4Z7OB 5AH0A 4PHCA 2A0KA 1IQPA 5EJ4A 2ZRBA 3R7FA 1NKSA 1FP7A 1AM4D 1WSDA 4KQGA 5TJHA 5KWJA 4CF5A 4Y2VA 4FFPA 2NVOA 3KVOA 1SZPA 3F4LA 1LSJA 3SF0A 2X9VA 5KVCA 2IPAB 4QICA 1LVGA 1RC1A 3NP7A 4HGQA 5LLDA 5JPCA 2D7DA 2V9CA 4O08A 4RQUA 3TTYA 3DCJA 5K6TA 2B3DA 4ESHA 3HYNA 4H15A 3ZCVA 4AUMA 1YDGA 1W5BA 2YVLA 4DHWA 3OETA 2QTAA 2FW6A 4YDSA 3K1ZA 4TXJA 3QFCA 2B21A 2E89A 3RKUA 1QU2A 3HUFA 2W2VA 4M9SA 4R1TA 1NBEA 5DGTA 1EFTA 3BBLA 3O2SB 4HH0A 1TLFA 2QLMA 4G0ZA 4L5JA 2VXBA 1WXEA 2GBLC 2XE4A 2ZYTX 3QLVA 5DN6A 4Z9XA 4XWKA 3ICQB 3AZQA 4Z54A 1SBZA 2O0MA 3DEFA 1PVDA 2HL6A 4UBIA 3V00A 3I9MA 2FFAA 3LHDA 1G55A 2C2KA 2F1OA 3GK3A 3PIDA 5EUBA 3ZNPA 2PLNA 2CMHA 4GU5A 1J2UA 1E20A 4B3GA 2WI8A 3LZCA 1H2XA 3AWDA 3CC8A 3B2QA 4GKAA 1ORTA 2NTJA 3DUFA 2VDPB 1OI7A 3JQ9A 4FHZA 3MFQA 4RK0A 3TSCA 5CA0F 3A1EA 1GU1A 1N5JA 2NG1A 3KZOA 4M21A 2IYNA 4ZQFA 5FEMA 4DA6A 3T1OA 3E9ZA 1DSSG 4CV0A 3GFFA 3LECA 4IXDA 2FWBA 1CX9B 3AJ9A 1FPMA 2Z2KA 1L4EA 3OE1A 4L8GA 4AIRA 4CHTA 4CKWA 2C5HA 1R0RE 4MUJA 4G0QA 1VG0B 4UKDA 2OA0A 4AWXA 2E2WA 2PNFA 5F7OA 1CRPA 1T1RA 2NAFA 2QM8A 5CB4B 4IG9A 3KLBA 3IA7A 1K0UA 4I5EA 5DGXA 1REQA 3U3ZA 1C1XB 1IAVA 1O6GA 4YDQA 1X1CA 4XJSA 1T6ZA 3FUVA 4JMPA 2QB5A 5EERA 1C9YA 4HHEA 4TTJA 4GAEA 3GW8A 2IOFK 4NXMB 4P0QB 4INZA 2YC2C 1GDDA 4V3BA 4YRNA 4E5DA 2FWJA 4CCSA 2QROA 2HV9A 1W8IA 3AHCA 1LCIA 2EL9A 4ZTZB 2Z6UA 4KN9S 3EGXB 3L01A 4F3NA 1YQUA 3AQIA 1ADBA 5F5NA 5AVTA 3IIMA 3UANA 2YV1A 4DEVA 2Z4SA 4BKRA 2VUHB 2ZJAA 2W9XA 4LJYA 3WGZA 3D4IA 5JDCC 5HMLA 1M1YA 3H5WA 4B6PA 4OHOA 5HE9A 1NW5A 4E5UA 1FDTA 1FTWA 4JLAA 1ZU5A 3EFHA 3SQDA 4RMNA 4RLFA 3IUYA 4YASA 4L72A 1EUDA 3A1DA 1WF3A 3CW8X 4PNPA 3K0SA 4K6CA 3P0FA 1XLUA 1JG3A 4L8YA 4ZQBA 4YCJA 2NO5A 1E4OA 4JC0A 4KO8A 1E2FA 1B16A 3VBEA 1N0VC 2MHCA 4U7PB 4HVCA 4JLOA 4UBJA 2HGSA 2V4ZA 3I83A 4IUDS 1OILA 2D5IA 3KAQA 1D3AA 1RBMA 4I50A 3LMKA 4V24A 2EX0A 2Z1NA 3OEWA 2PUBA 4V1CA 1QYWA 2ISCA 4J3FA 4PV7A 4EUNA 4C7OB 2X8LA 3PVZA 1KJZA 3WWEA 2V6MA 1RFLA 1B74A 3ZU2A 2JIDA 1JAIA 5DIZA 1NDHA 5IG2A 5LWHA 4UREA 2ZIXA 4Q15A 4BDSA 3HUUA 1BE0A 4BRUA 3JAKA 4BP3A 2Z56A 3ED1A 2PMFA 1ISMA 2R60A 1KYVA 4N5HX 4ZIRB 1KZGB 2P3SA 1M1ZA 5K6RA 1EEXB 3EWIA 2JGEA 1NHGA 3FIUA 3KCQA 3LE8A 3OJWA 4RVHA 5DVZA 3UB4A 3ZTWA 4FEYA 3OM1A 5I6DA 1EGVB 3O1HB 1JEQB 1G42A 2QN7A 2GASA 2ZJZA 3A11A 2V7UA 4FMBB 2ERCA 6ABPA 5IANA 1JJAA 3E48A 3OOYA 1AQUA 3RSCA 2M9MA 2YFHA 3ISTA 3D8SA 4H59A 4RSHA 4RM3A 2C1ZA 3V33A 2ZAIA 5BUZA 4CEIB 3U4HA 2VBIA 4QATA 4RKQA 2WJVA 3IP8A 1Z0JA 4WLVA 3D0OA 5BRNA 3NBAA 2ZJ2A 4BMCA 3RSLA 3X44A 4B4UA 3AVTA 1EXMA 1SBNE 1ZLYA 4JB3A 4QGFA 3RWOA 1P1BA 2IRWA 3ZWBA 4ECAA 1FSZA 1AKEA 2WSSD 5E0OA 4PGHA 1PKXA 2WIJA 4Q4AB 3UTCA 2WHRA 3HEAA 4I7EA 1TM4E 1W44A 3BTUA 4HB2A 2CGEA 2YC4C 1C80A 1M74A 1ZHFA 2W90A 3NG1A 2BFEA 2IOFA 1NR7A 4OI4A 5JTUA 2VXYA 5FI0B 2B5VA 3OKAA 2H11A 4UNSA 3B2NA 2NXNA 1OKKA 4TLAA 1V16B 2K4MA 3EXG2 4JQOA 2VP9A 4MH0R 2B4YA 1JHPA 3ZC3A 5JS8A 4F6CA 4CPDA 3D1JA 3COWA 3LFUA 1IJKA 4WRRA 1US8B 4RTLA 1NJFA 4WY8A 1MIOA 2VSQA 3SE0A 1UPCA 2WVHA 2NU9A 4HUTA 4UBNA 2HRDA 4KGDA 5B12A 4KHPB 1BE1A 3E82A 3NONA 3H5NA 1XHFA 4NNOA 4F3TA 1W4AA 1LSOA 3EN0A 3VO2A 1GGHA 1H2BA 3C6QA 3J80A 2EHDA 1OVGA 2OO5A 2VK2A 5T57A 4IMPA 2ID4A 1BVHA 3JWGA 2EWMA 4P3KA 3KQSA 1EFHA 3P27A 3W3ZB 4HRXA 2PVSA 3Q9UA 3VMFA 3IMCA 1MGPA 4PX9A 4CKWB 1K0FA 2KSQA 4IM7A 2AQIA 5ALZA 3ROKA 4D8WA 1OV4A 5EQTA 4PZCA 3SHVA 4WLOA 1PHRA 2RGNA 1ZICA 1ZVMA 2YTZA 3C3XA 3PI6A 4HS9A 4JSYA 4P3XA 3V2GA 3G85A 3NDBB 1FA9A 2DULA 4I99A 3LA6A 5EUCA 5U4XA 2H1WA 1XTIA 3QPUA 3UQYS 1N5OX 2P90A 3HKDB 3QY9A 9ABPA 5HYVA 1AQJA 4HYTA 5JFGA 1GEGA 4LHVA 4DSOA 2Y0DA 5KYXB 3QEMB 2AOUB 3DE2X 1KFCB 1I1NA 3QPBA 1T9GR 2FRXA 4M9XA 4IUCS 4RA9A 4DV4B 3VYUB 1EUZA 2H51A 5SICE 2VAXA 3IPCA 4LGCA 2IV3A 4Y2QA 1G63A 2W6CX 4DLBA 4DDTA 3U19A 1YFKA 5TSDA 4UUPA 4GXTA 1EMDA 3B7PA 4BJ3A 1IY8A 2PIDA 3NKLA 4MRPA 3TSZA 4U00A 3GEBA 4RSRA 1N0UA 5HHTA 1EX9A 1QFSA 4HYQA 1HURA 1W34A 5AW8A 1R0LA 2FE1A 3GCZA 3GRYA 4Z8YA 3Q41A 3RS0A 4GWKA 5K05A 5ALLA 3ZK7A 5J59A 2YWFA 4DBLE 1Z39A 3E7XA 5J1SB 3ID6C 1TKRA 4IZHA 5HK9A 5IVPA 1G66A 1DG1G 2RGUA 5LKRA 2O5RA 3NDIA 4XPIB 3SHOA 1RZVA 3FGOA 2QN9A 4NFSA 1A9RA 3O8QB 1V8PA 4YCCA 3QMMA 3UVEA 2O2SA 1RWMA 1C7IA 4NMHA 4QLAA 2J3IA 2H1LA 2K6GA 4M53A 2FZKA 4ZO6A 2Q6OA 1XZJA 1RKQA 3ETCA 1KYYA 1Q0PA 2QG6A 2ST1A 4KV9A 4Z1OA 1GJRA 5DNCA 4PM4A 2JFVA 3R0QA 4TV9A 4D4MA 2C7BA 4RF5A 1LJ8A 1BROA 1G3UA 1CYEA 1ZUD1 1X1AA 3FF1A 4D44A 2C3YA 3DR3A 1MU0A 3HN2A 1H0RA 4FU0A 3U5TA 8ABPA 2O8DB 3VMMA 3ZJVA 3OMXA 3WGKA 4EFNA 4EMSA 1C3OB 2A3NA 1TVKA 3CUVA 2BGGA 3GPLA 4GBED 4H0NA 3KAKA 3UWSA 1Z13A 1N2SA 1CYDA 2UDPA 3BB3A 3I73A 4B6SA 4Q39A 4TL6A 1DEHA 4HI0E 1LDYA 4UOZA 1AQNA 1P7CA 2BGLA 2Y68A 1JEDA 1ZNQO 3P9NA 3LU1A 2YWCA 1OC4A 1T1EA 1VJ5A 4NBTA 5U4QA 5BMVF 3ZWVA 4YCSA 4YJFB 1C3VA 1V0JA 1E9EA 2AN3A 3O8DA 5CDYA 3JATA 3A58B 3TM5A 7ABPA 221PA 2FMHA 3T5PA 3TW8B 3A9SA 3UJ9A 3NHSA 3L6EA 3G88A 4B2YA 3FNGA 5IVDA 3BFPA 2Q1UA 2XECA 4ZOQI 4AI6A 1VL6A 1DAPA 5AW2A 2A1TS 4NBNA 2A5DA 1AURA 1BXRB 2DBVO 1Z29A 2WF9A 4M7WA 2E55A 3L1KA 3CPHA 5C8DA 4L0DA 1Q1EA 2OKGA 4EZBA 5K01A 3OLYA 1W9HA 1V6CA 4BBJA 2BMJA 2QX7A 2BMAA 2OD2A 5CLQA 1XMSA 3M6MD 3L8FA 4NJOA 1ACLA 1OX6A 2JI6A 3MMZA 2NVBA 4K6FA 1PT6A 4N6NA 3RV4A 3ZQKA 2YWXA 1ZVKA 3GYBA 1BOOA 4EHLA 3JVEA 5IBRA 5UKDA 3PLAE 2XMRA 5LBIA 4OYHA 4GIBA 3N0XA 3ZCTA 1NQAO 4DMFA 5CVDA 1VKJA 1UF9A 2GSWA 1WW2A 1OASA 1EWYA 3A9RA 1LFAA 3MRSA 4JC8A 3A6KA 4PPQA 3EXHC 1DTWB 2IP4A 2A1UA 4CM9D 3QEKA 4CIYA 1OGIA 3CBQA 4S2EA 2QN1A 2ZYIA 4LYYA 2ZRKA 5EXXA 1Y8CA 3DD1A 1SXQA 3C8UA 1RPAA 4XYEA 4XX0A 1VI5A 1BAPA 1LPMA 4DIDA 5I7AA 5JYBA 2GCPA 5I7RA 2ACKA 3FCEA 2FSVA 3DWGA 3ESBA 3H8JA 1PQWA 3JQAD 4ZI7F 3DL2A 4PR3A 4ESVA 5KYKA 2YVQA 3PX3A 5FADA 4BMDA 1P7VA 2X40A 3DW1X 1PZFA 1PNRA 3PWZA 3OFNA 1QCYA 2AT1A 2G9UA 2XD9A 3ZCSA 4YJ2F 5CFNA 1IL0A 3ZEIA 2NNWB 4F3KA 3STUA 4YJHB 4YUAA 4F4CA 1OLSA 5KEIA 1OFUA 4E12A 3MWFA 3FTEA 2IIQA 4YJKA 2BDTA 4TPKA 4BP1A 5A6VA 2QAGB 1QO7A 4AKSA 4MPPA 4D9GA 5KX5F 5HFJA 3Q9SA 5CG2A 1ZJZA 2BH9A 1ZDMA 1TRKA 3U7IA 1GP2A 3V80A 3MS2A 1GUYA 1CB0A 2A1TR 2ZIZA 5IF9A 4EY7A 3UB2A 4PAOA 2Y27A 3GPBA 3QVMA 4GGMX 4QWMA 4V0MA 4LFCB 3TFOA 4N6GA 1IN4A 2O8NA 3NBQA 3NTLA 5EMNA 4RK4A 2VJAA 1HPLA 4GEKA 1PR4A 2H1VA 4AVYA 1QJCA 2PRIA 3F7OA 3IDZA 5EP1A 1RADA 1BJKA 3EASA 4RXUA 2WIAA 1FMFA 3C6BA 4UBOA 4RVNA 3HFSA 2BEVB 1EFCA 3FZQA 3IQFA 3TAHA 1NV9A 1IY9A 1OWNA 3HJAA 5FHQA 4CQMA 4LTDA 1ECLA 2V55B 1LH0A 4DRXB 2FFQA 4MYCA 5A9SB 1UKEA 2P9GA 1MEOA 2GTHA 4LSMA 4WZBB 1NVMB 3SHQA 5JXGA 2ENWA 1CT9A 3VR4H 4QEZA 3F9RA 4XQGA 1TKCA 2WV9A 4IEFB 4QU5A 3AFMA 4PSKA 4HH4A 3AR9A 3CVUA 5FD8A 3HV0A 3ZWDA 2ZDQA 5KVSA 5INTA 3C3AA 1DCFA 1A8HA 1E0SA 1E4EB 5C1DA 4LFBB 2CLCX 1TT5B 3GFPA 1O9HA 3HXPA 2OV1A 1JLKA 4S1VA 1T2NA 1UCFA 1P0QA 4MDYA 1ULAA 3GRKA 1MEJA 1I94B 1H4TA 2QGNA 2HF2A 3DCYA 4F6LA 2PG3A 1V4NA 1D2CA 3H84A 4KN6A 4W7HA 1HGXA 1HLFA 1EBBA 1K1EA 1YRQA 2RGAA 3ND5A 4AIIA 4R9RA 3FOAA 3TH5A 3ABRB 1X80A 4WK0B 3OQMA 1CV2A 1AKUA 2O2IA 2IS4A 5DBEX 3IAM1 1JFRA 2OXEA 3BGVA 1ZIOA 4ZAZA 1EAMA 3ZGVA 3MERA 3UAZA 3ETNA 2FFRA 4EKIA 4PGFA 4KHZA 4P33A 1FCJA 1BHJA 2QW1A 4QBGB 2MYPA 5ENVA 4YFYA 2ZYRA 1DELA 2PUGA 5DM60 1N7HA 1X9HA 1Z33A 1Q3HA 3NR2A 4FPXA 3PXXA 4HY3A 4LBZA 4Y6GB 4Y7CA 4L1KA 4EDFA 2FETA 3PE6A 4JYBA 1FFXB 3ZV3A 1U1CA 2G5CA 3FMGA 4Q01A 4GD3Q 2QTFA 1CE8A 1Y3IA 3D0RA 3REOA 4CQLA 6AT1A 4JQSA 1BRTA 2C3PA 4JJZA 4LC1A 5DGDA 3S4YA 1X7ZB 4C4PA 4CR8A 4WXRA 2H5IA 3SDSA 1MO3A 4DLYA 4D4HA 5FAXA 1ACMA 2FPGB 1QOPB 2YNMD 3ZK8A 1Y34E 2A7XA 5ILOA 2JLWA 3ABQB 4UBLA 2AOTA 2BKUA 4F2DA 1HNNA 2DSTA 2ZSJA 4L4RA 1JLLB 1ONOA 4H6VA 5DLPA 1V39A 1P80A 2VHVA 2AF3C 1JDJA 4DSUA 3NRCA 1EGQA 1WDTA 2DCUA 1WUYA 1JIQA 2Q5QA 3C6YA 4JQCA 1KIMA 4LWPA 1GQ2A 3UWMA 2JK0A 1PJTA 2L19A 5BV1A 4WK4B 3DOUA 1CD5A 2EGUA 4C2TA 1L1RA 3OEYA 4BV8A 1V1RA 4ZALA 2B2NA 5TMPA 1R9GA 2PFGA 2C8JA 3WSWA 2COUA 1JPJA 2XRMA 3IOMA 3VU9B 1OAOC 4YV0A 4FFBA 4EEZA 1EM6A 4ZAVA 3WGUA 3HACA 3I0ZA 4DC1A 5IYZB 1K88A 1IONA 4UU1A 5J4HA 5DXJA 3TKAA 4UNIA 5KOIA 3V8RA 1I9CA 2BFEB 3D4NA 2HB6A 1JEAA 2BI8A 2GVDC 2ZBEA 4D82A 1FFYA 3D2LA 3I1IA 4MS4B 5DBFA 5TRTA 4N8DA 1RQ7A 1ODIA 3CLUD 4OIFA 2V0CA 1NVKA 3VJMA 4ZO9A 3UHAA 4BXOB 4YPVA 4Z99A 1WZEA 1SUBA 1MXFA 2YINC 1PT9A 1ZGJA 3NHUA 4M0CA 4B8WA 4NKRA 2I6SA 3KEMA 4W5JA 4AX4A 1C2YA 4D6YA 1VLHA 1M6NA 1WU7A 1XLVA 4XASA 3NT4A 4TKVA 1E5VA 2X14A 3KAJA 3PGMA 4A26A 5KDOA 5L9AA 1KZ1A 2IP1A 1DEAA 4G5HA 3ZJ4A 1ISSA 2ODAA 1A3CA 3DZCA 2AMVA 4LC0A 3VVBA 2E4WA 4LKOA 5CA1B 4XE5A 1S2GA 4OGKA 1JG6A 4DV7B 5FFMA 3AHEA 3BMNA 4MWGA 4IH9A 4RULA 4KYTA 2H4WA 2G06A 2A35A 4J0HA 3EK2A 4XUCA 4BUZA 4FW9A 1R3DA 3I9FA 3M1YA 1TE2A 4P84A 4X92A 3WK6A 1G7SA 4N7MA 3WZMA 4DXDA 4JYZA 2DBQA 1VYHA 5I51A 1G6HA 3MN1A 1CS0B 1UMDA 3GUVA 3WLLA 2CXHA 5CGQB 1Q0SA 1GXSB 2PX3A 1II8B 1ZA2A 2VRBA 2AZ4A 4RA6B 4LOAA 3VKUA 5JH7F 1HTWA 3RVBA 4HCJA 2C59A 4OQDA 5DX1A 1O7JA 4EY8A 1U81A 1SCJA 1IRXA 2FSIA 1JQBA 4DCTA 3GIWA 1NBMA 4V0ME 4A8PA 3M6XA 1P2UA 2HI0A 2WNIA 4DNOA 3DKKA 1XCBA 2PUFA 2LCFA 1L8AA 3DEIA 2GEFA 2GN8A 4HK4A 4MX8A 1LLFA 5DNAA 5FBLB 3PKIA 3LWDA 4E0BA 4EG0A 4CUJA 3UHFA 3EEYA 1I3CA 4MDEA 4EKEA 1HE8B 2I6TA 2H00A 2TECE 5AIBA 1DJOA 1FX0B 1WDKA 4RK6A 1VHLA 1JHAA 4EJSC 5CDUA 3KYDA 1QGYA 2QP9X 1OBCA 3C3CA 4BO0A 3U4CA 5ALTA 1A88A 4I1VA 1OB2A 2Q3EA 4M1YA 2PKXA 2QN6A 2IKSA 4NBRA 1UEXC 1LFDB 3CONA 1YS4A 3RKSA 3F6YA 4GI3A 5F7XA 3WHPA 4JHLA 5KNDA 2P9FA 5JIBA 2AFRA 1HKUA 2KW5A 2D4HA 2OESA 1C81A 3NO4A 4HC4A 2W42A 3ECAA 4NG5A 5M2QA 1OIXA 1SCKA 1DCMA 2LP4Y 4GC5A 3BXEA 2QAIA 4CFYA 1TAHA 4HPWA 1JJ7A 4Y0AA 3OCYA 4QNNA 4UTPA 2GHTA 1PWYE 4IX9A 5A3QA 3RUHA 1MOZA 4MQMA 4L4UA 2W6IA 5CHYA 1CULC 4RW0A 1A77A 3W8NA 4BKPA 1N2ZA 3RHSA 4RF4A 5F1PA 4NIMA 4US1R 2EV9A 3QUQA 1DBVO 2P65A 2EVWX 2VHQA 2A78A 2ZKIA 2WOJA 4J4BA 4C0WA 1C1HA 2BEJA 3FI9A 3PNOA 3U09A 4LWOA 1H3NA 3QRWA 4RJ2A 3HJRA 4CG1A 1TCAA 2ZRGA 4DTCA 2ZJ3A 3I2FA 3L8DA 4B3DA 2IV2X 5FUQA 1E99A 1PR0A 4WN3A 3PDJA 1V45E 3N74A 3NBZC 2JGLA 4BXOA 1T5DX 4XSHA 3MS7A 2GJ8A 4B2LA 1TIBA 2H29A 2R00A 3HVJA 3JWHA 4FFLA 2OBYA 3NAGA 5COAA 5H83A 4FB5A 3I8XA 1ZJWA 5LP6C 5HFNA 1DRWA 2JBAB 1E79A 3SHFA 2WWXA 4KXVA 4BMPB 3I05A 4GMXA 1BCRA 2HSGA 2V03A 4HMPA 4KWIA 1JAZA 4ZK2A 2QY9A 3LCUA 3TZBA 1BIFA 3GU3A 3LOQA 2M6SA 4L5YA 3BCSA 3H0EA 2Y4OA 3NOVA 3USZA 1I24A 3LY5A 5KYNA 4COKA 5TQJA 2JA1A 4OMUA 4Q6BA 4D96A 1WW8A 1U31A 3C6ZA 3C7CB 1XXHA 1RKXA 3NIBA 4K3VA 1NF9A 3UAYA 3T38A 5JQGA 1UBFA 3TCNA 5CD1A 1JXOA 4K0KB 4F9FA 1QVAA 2OUKA 1PZGA 1P3Y1 2DPYA 5JEDA 1P1FA 2FLKA 2YN4A 5MHTA 2UZ4A 3E70C 1HZZA 4G9BA 3LL4A 3BH7A 1E1KA 1X2EA 3VJLA 3ONDA 3F7NA 1XN1A 1W0JD 2G83A 2R1VB 2R66A 3IQXA 3KYDB 3LL7A 5D8DA 3ZE9A 1UT5A 4J49A 4F45A 2DGDA 3LGXA 3TGLA 4LF6B 4REQB 3T3EA 3OM0A 1NI3A 5CPBA 4LE2A 3DWIA 3K9WA 2TMYA 5C35A 5KSWB 1KA9H 3GLGB 3KS9A 3A9WA 2HZBA 1KS2A 4JODA 5BR1A 1SC6A 2J0SA 4PICA 5KTNA 2DYKA 2MIIA 4GDMA 2FRDC 1C5KA 3GQBA 1KE2A 1X1SA 3W6ZA 3N8DA 4MQFA 4XVUA 4X20B 4C1NA 3G5AA 5CTJA 1WB6A 2FEMA 3MG9A 2CVHA 3ANMA 1AKMA 1UDAA 3OJFA 1L5OA 4WFKA 3WGOA 4G01B 4YCMA 2EJTA 2XSZD 1H23A 1DKNA 3QPCA 1U0HC 1LQ2A 4WFQA 3HC7A 4J7XA 4TN1A 2V3CC 3V8NA 4YBRA 1H8EA 2C94A 3OQJA 4H3SA 4MMXB 4ML3A 1CQXA 4PHFA 3KZ1E 4UMFA 2VN8A 1H69A 2BMDA 2Z0MA 4PPGA 5BP7A 1USUA 3LO5A 1YZLA 2Q3DA 5FA8A 3P2MA 4DXAA 4RHEA 2D0IA 4DGSA 1OFTA 3FNRA 4MXDA 4BLQA 5KPJA 2NZVG 1ZIXA 2AFIB 4GXRA 3D4PA 4B74A 4UFPA 2JI7A 5DCWA 4AX8A 4KXQA 2FMUA 2AJBA 4D25A 4C78A 3EULA 3AGQA 5TMDA 5T6BA 1XZEA 3ZG6A 1XTVA 3GZNB 1QF6A 3AW8A 3JAWA 3BFXA 3G8DA 3GVHA 4FILA 3SEFA 4BN0A 2PVPA 2VQ3A 1DCTA 2BKAA 3D8HA 4I1IA 3NFYA 1VHTA 1AGYA 2Z2XA 2W71A 3CLRD 2VWQA 3K9BA 1J7KA 3DAHA 1SVLA 1DXHA 1V4VA 2VP4A 3OJ0A 1ZVQA 2JAUA 3A6PC 1MJ5A 3G23A 4HSEA 3FYUC 2GWRA 2O2HA 3SM9A 1IYZA 2H0AA 4BU1A 4CODB 2QVCA 3AUFA 4EJMA 5HKAA 4YRDA 3UM9A 4JOQA 2DH6A 2GJKA 2ZW9A 3ASUA 3C3JA 5JCJD 1I6KA 4AZWA 2C61A 1IM2A 1ZUNB 1QLWA 4AJOA 3KDPA 5D00A 5EN4A 4I4NA 1T0JB 5LQNA 1KEUA 2GJSA 1KO7A 1ONPA 2EL7A 2GAFA 3BS4A 3OMWA 2Q99A 4AJHA 4ENSA 5A06A 3LLUA 3QF4A 4OV6B 5LD2B 4XFDA 3DUWA 1SXJD 4R2IA 2QTZA 1YDMA 2VDMB 3D2AA 2RGXA 4NZMA 2ONZA 4UEJA 4IJKA 2D6FA 2AJ8A 5E38A 2B8NA 1SHJA 3EOZA 4DCOA 3B5JA 4HVTA 3VZBA 1W6RA 3K05A 2IELA 3VC1A 4AB1A 4KDEA 1ZINA 1GZ7A 1EFKA 4QIHA 1NMSA 2QXTA 3IUQA 4W5HA 5IC5A 5CFPA 2G1PA 1KI6B 3HZRA 3R4CA 4AY2A 1X92A 3GGCA 3MF4A 1W35A 2MJLA 1PT7A 1TO6A 4DR6B 4HG2A 3TQCA 2XOKA 4UTOA 3GJ3A 3VU1A 5E6RA 3STVA 3I23A 4HEA1 3LP8A 4OHZA 4UM9B 4DYDA 1OXTA 1ZK1A 2CKDA 4JU8A 1QORA 1BG6A 2Q1TA 3BWYA 5KJEA 2RI6A 2P67A 2ZWVA 4MIEA 4HX9A 1EINA 4E15A 5BOSA 3ASYA 3LUHA 4GM4A 3HRHA 4U0KA 2CSUA 2PAAA 3RNLA 3QEOA 5FBVB 3L7JA 4KVGA 5AFSA 1I5OA 5AR1A 1A1SA 1WBJB 2WHPB 3BDAA 3GEMA 4FDLA 3S5UA 1YO6A 1E9VA 4IQ4A 4M6WA 2QQGA 3T7KA 3PQ2A 3HYLA 3K4HA 3PUVA 5J2TF 3PQFA 2PFSA 3ZWXA 2WA2A 4M49A 5TVKA 4ZQIA 4Q05A 3GXBA 1YUBA 3UAVA 1HEIA 1WS6A 1Z18A 1X8LA 1Q92A 1PG5A 1NYLA 1K4MA 1QIDA 4MP8A 5K0EA 4URFA 3Q0TA 4GOLD 2QM0A 1W0CA 2D2IA 2X5XA 1KZ4A 1UZMA 2Q6KA 3TE6A 3U4AA 5J4VA 3ZWMA 4D1YA 4MUMA 2R65A 1QS0A 5AW3A 4CDMA 3IVGA 3FLAA 5FO1A 2Y1OA 1E2KA 2PM8A 1UJCA 5I47A 2XNCA 2QF7A 2FEWB 1XFAA 4CLXA 2BIFA 4KIWA 1JHOA 2FDXA 5A4FS 5AVSA 4G86A 4BVEA 4UTVA 1QOZA 1EAYA 1ZMRA 3KD3A 1ABEA 3KETA 2ZVPX 3EPLA 3QEAZ 3PL1A 4M8KA 4FLMA 4WHMA 4XLLA 1UBEA 2WWYA 2V54A 1E2MA 1QIKA 3FIJA 1XCOA 4I50F 1XC7A 2V7EA 4JC4A 3STHA 1GADO 1BD3A 4Z7QB 3CGGA 2GPBA 1YZGA 4ZVKA 4JUIA 4E4TA 1TAUA 4JLUA 1A95A 5ADUS 1GIAA 3G2QA 3W4KA 5A0VA 1T6YA 3B3AA 4REQA 4P38A 3W0LB 1XD8A 4DSTA 2BSQA 4LDNA 2G6BA 1NW9B 1U04A 4B33A 2SCUB 2OAQ1 1K75A 821PA 4RF2A 2BONA 3CZQA 3OU2A 1IBLB 4LIPD 2QMOA 4V0LA 2VHTA 3IDOA 5BW4A 4MTLA 5JJIA 4TTQA 2NIPA 3K09A 3DDNA 4DV5B 4OXRA 1XQ1A 2N1MA 3PA8A 5ANRB 1GXSA 5HKLA 1BGWA 1GPNA 4ZAXA 4D81A 2ZETA 1YVUA 1UMKA 3WKBA 1EHCA 1FTSA 1G291 3CF0A 3JPWA 2EZ8A 3QTLA 5ALOA 1AJEA 2CUNA 4ZAYA 3EYAA 5H59A 1ZONA 3WK5A 1R0YA 3ZQ4A 2ZU6A 1FNCA 3L4SO 2NTNA 1LF5A 3JV7A 3ND8A 4O6VA 3CVOA 2TYSB 3EWNA 2SECE 4ABYA 2BMEA 2FA9A 4LPKA 1GR0A 4K9SA 4E7PA 1UK9A 2BCJQ 2IQ5A 4F1JA 1ID1A 1ZCAA 3KIPA 3BWXA 2PD4A 4UNQA 4BQSA 3I09A 3OX1A 1VFPA 1DIBA 2Z98A 4OA8A 1NLYA 4RV9A 1T5OA 2ZBVA 3K0FA 4TWZA 1VC2A 1NTRA 3F5DA 4IFIA 5CIWA 5K3FA 5HUQA 5ELLA 1RI3A 2ZUFA 4XOUA 5DM1A 5ES3A 1RXWA 5P8WA 1I5EA 4MW0A 1XIVA 4F2WA 2ATCA 2VJKA 2ZK7A 2V4MA 3E3AA 4KRYA 3KJIA 3KTAB 5HX7A 4HQLA 1PWXA 1OH6A 5FWAA 4ZEXA 4N1AA 3FTFA 3WB2A 7GPBA 2OCLA 3KHTA 1DBIA 4JK3A 1V1JA 3BQ9A 3AUKA 1DFHA 1GZSA 2NACA 3CA8A 1C2TA 1PX0A 1ZBDA 3KR2A 4B8ZA 4BMNA 1JFLA 3DZGA 3O3CA 1P9LA 4LX0A 3TBFA 2COKA 2ZIEA 3TIFA 5A9RA 4MRRA 5LOVF 1PL6A 3BB1A 2QPOA 4O4IA 2P5UA 2N75A 1I6MA 1GZ4A 4G37A 1ECFA 4M8LA 4W1RA 1E0JA 1P3JA 4EG3A 4LV5B 3ETHA 4WE3A 2V6GA 3TRHA 3IPLA 3LCRA 3MTGA 5A5GA 2OL4A 3BT7A 1ISHA 4ID3A 4U7JA 3NHJA 2SICE 3DS8A 2DTEA 4OQPA 4BVGA 5K2MA 2YV2A 2OFXA 2E21A 4OJQA 2W2XA 4Z2YA 1NN1A 3E4DA 4NHOA 2EX1A 2FUG6 1H2WA 4PHTA 3SQMA 3T8YA 4E3ZA 1GTSA 4C0SA 1JA9A 1SKBA 4MKHA 1U4OA 3HWX1 1UP4A 1J25A 1I14A 1XALA 2JGJA 1KI6A 2J3HA 3U4QB 1G4AE 5FOQA 4IIJB 4LS3A 1ST2A 4HGNA 4EB6A 1XNJA 2X4GA 3AMVA 5EE1A 1UZUA 2VAVA 3I6YA 2EIHA 2PSFA 4JJIA 1F3OA 3RCBA 4N0EA 2WWHA 3PLNA 4AMYA 4OQXA 1E3WB 4UXIA 1Y7IA 1JQAA 3QHQA 4YS6A 4IVNA 2RI1A 3GRCA 3ICVA 2BZ0A 4OB8A 1BX1A 3ZQ6A 3AV3A 4KYVA 2XJ9A 4DBZA 2XNDA 3LWBA 3KQUA 4CMBA 3ANNA 1YK1A 1SXGA 3HKCA 2WC1A 3V9AA 1AY0A 1VL0A 4HLCA 4LZWA 4N0QA 3ZW8A 1R9MA 1Z17A 5IZCC 3FNQA 3P4UA 1L4GA 3C8MA 1QK3A 2AVDA 2A9FA 2XUQA 1F6DA 2LKDA 1Z6ZA 1J9ZA 2XUFA 3EMVA 3WK4A 3REQB 2JH8A 3AZPA 4O4IB 1WSBA 5AKKA 3BVPA 1R18A 1VCMA 3L49A 4KSYA 2F4VB 2M6LA 2Q6VA 1SZCA 3I28A 1E3DA 3BJMA 4MS1A 4W1SA 4BTLA 3L0BA 1GPKA 3LG2A 4G0WA 4DLSA 5BR8B 2CVQA 4EMTA 4HNAA 2I2BA 3ZYZA 2V7BA 4YI3A 1VMDA 1TJPB 1X7WA 2CLKB 2F43A 2VUIB 1ENZA 2Z5VA 3X43A 1PI3A 1W4RA 1PWEA 1YQQA 1RP1A 3SX0A 3OCXA 1FVOA 3O8NA 5K6AA 1RYMA 2YZNA 3ZXIA 4ZYTA 1XZHA 5DOVA 2UZIR 3M49A 3VDQA 5JNRA 2AYZA 3SR0A 1A8SA 3WIEA 4OXXA 1FJGB 3O3OB 3EVNA 3PFKA 2XUOA 4OXYA 4HQOA 2VRCA 4RVSA 1QH1B 5CK5A 3IO5A 1M2KA 4H17A 3JY6A 2XF2A 1XLTA 2O6HA 3MQ2A 4MQ6A 5DHUA 2QZ9A 2P30A 4R0VA 3BK1A 4QPDA 5JS1A 2JC3A 3ZE7A 2PCJA 3V42A 4KGVA 3DLCA 3D3NA 1SXIA 4RY0A 3WGJA 1AVTA 5LM3A 3HTXA 2B1RA 4B9EA 2N1BA 5HA5A 4QM7A 4ZCLA 4MARA 1D04A 3PGVA 3TI7A 2G1AA 2BUCA 2RHGB 4KITB 2JJQA 3CNQS 3K6RA 5EEHA 5DB4A 1Z7EA 4NJMB 1GKYA 4C0LA 1R6DA 3PB3A 3CO5A 4IKOA 3FNHA 1QVZA 1VPVA 3ZI0A 4H27A 5EPEA 1D2NA 1FVFA 3PQ5A 3S28A 3UXEA 1HLPA 1JVNA 3ESDA 5GONF 4Q1BA 3UY4A 1KI1A 1IM8A 3EIHA 2W6PA 4A2WA 4JBIA 1SXJA 3DC7A 3G49A 4JELA 3NC4A 2BFMA 9MHTA 1Y42X 2X41A 2WHYA 3GX1A 3M1AA 2BFFA 3MELA 5KNCD 1XZKA 5K0GA 3RLFA 5C80A 2Z1DA 1SELA 3H2IA 3QOFA 3S1LA 4Q9AA 5F3DA 1OWPA 4PRZA 4JZKA 3IHWA 5GINE 4A7PA 3TZ6A 3OJCA 4INJA 3Q12A 3DKRA 4LBWA 4UXJA 1U1IA 4G09A 4V38A 2JRLA 521PA 3WISA 3B13B 2C98A 3H8WA 3NHYA 3R0XA 4IO0A 4IICA 4DDVA 2VKTA 2R47A 5FLYA 4CKBA 1GAQA 3LPDA 1NBMD 3QWHA 3WR5A 2QNBA 4PSCA 5AUNB 1PFYA 3EOBI 1P0PA 4TSKA 2IFTA 5EJ9A 1JDVA 1UFOA 1UBKS 2QXYA 4ZWNA 5BSVA 1IG0A 1RAEA 2QWXA 2ZDHA 1F2UB 4JI8B 1E9BA 4F38A 3REQA 2UYQA 3TJZA 2IEGA 4ZTUB 1X1EA 2AG0A 2R751 4IHJF 1G1AA 4KH1A 4YHBA 4ZOAA 5FQNA 4PZUA 1WLSA 3PJRA 4GZ3A 3M81A 4F8EA 5E9AA 1ENOA 2QGFA 4KFUA 4A8TA 1VE9A 2FMFA 4CEHA 4EW2A 2PSDA 4DMGA 5DCLA 1R15A 1ZM9A 2NTYC 2YW2A 4L4YA 4LZLA 3W04A 2VQSA 5THQA 1V3TA 2PUJA 2Z9DA 3ZV4A 3AR8A 1DKQA 2ZTSA 3HB7A 4RV5A 1AO3A 5LLTA 1D6SA 1VLMA 1QRRA 1R27A 2B8JA 2PD6A 3ITKA 1KKMA 3JASA 4TTVA 4LXGA 4M1ZA 3GBSA 4DTIA 4XQ0A 2E6UX 1US8A 2X5JO 4JBLA 1HKHA 4Y1EA 4EHIA 3COSA 1M33A 1TADA 2GN9A 2Q2OA 3HZOA 3WLOA 2KX7A 1QHNA 2E18A 5KMGB 1QRSA 1KZYC 2PWZA 3ME5A 4RHFA 2HJRA 1XF1A 3KWJA 3ZBTA 3OFSA 1R9NA 3K0AA 1UBHS 1JG7A 4QDJA 3ODPA 3NC0C 3SLKA 2ANBA 5J43A 4AROA 4WLUA 5JAQA 3RVMA 2F1KA 4FVTA 3MMSA 3NH9A 2O8BB 3DB2A 4PAQA 4Q4AA 1ZQ9A 1ZD4A 4ZAWA 3EZYA 1BX0A 2BPOA 3EZFA 3JQAB 1DAEA 4BEVA 1CBUA 4ZK6A 3SIRA 3SE7A 2CEKA 4KEAA 3NDJA 2Q6LA 3P26A 1SBCA 3WX0A 3BXGA 3LHIA 4OK6A 1P39A 3TQTA 4R3WA 1VBFA 4HWSA 2ZPTX 2REBA 4U3JB 4PLCA 1FOEB 1D4OA 4WK2B 4D9EA 2I4LA 5LDDC 2C2ZA 2IC5A 1ZD5A 3F49S 3SC2A 2Z95A 3QYFA 3CB2A 2DXIA 2PEZA 1DIRA 2ECQA 2XCQA 3T3OA 1QS0B 4QFCA 5TGZA 4ZGWA 3A28A 4HZIA 2PQMA 2G8NA 4TZ0A 1DWUA 3KZVA 1M2EA 3BD6A 2H5EA 3O3NB 4RIIA 4UAJA 4YB8A 5EWMA 1S2NA 3V1NA 4CM4B 5EJEA 3N7TA 2P62A 1KPGA 4MR8B 3NDRA 4EATA 2DHEA 3S68A 4KVFA 3G9UA 4MJ7A 4UE2A 4EA7A 5CH3A 3PEYA 2WYVA 1BJTA 1M76A 2IL1A 2XT6A 4JGGA 2FP4B 4UUNA 2SBTA 2ZT6A 3F7MA 5A3RA 2VZ0A 3ECCA 2OHOA 5EHIA 3TG2A 4LJ5A 3SMVA 4V1CB 3LXUX 5CDSA 1CUZA 1C9JA 4IDFA 1DOAA 1SHTX 2DFPA 4U2KA 3ZIAA 1WZNA 4BFUA 1NASA 3U3JA 2IDZA 4ZI7B 1EWQA 3IMFA 2QS9A 4ZO7A 4BS9A 4F9GA 4YAIA 1ZH8A 1JDNA 1QYXA 2IIBA 4EHJA 1IN8A 3DMHA 4TTPA 3RRFA 3G5TA 4CF4A 2P91A 5IHXA 1MEEA 2CJWB 1WXQA 2OV2A 4O3MA 4MPJA 4G41A 4NEGA 3O82A 4NF2A 3VHQA 4FSDA 2HF7A 5B3LA 3FG9A 2I7VA 5LP6A 3BSWA 5GOTA 3PICA 3BKWA 1BDIA 4HFMA 1GT6A 3TIVA 5AK5A 3HU1A 1KF0A 5CFLA 2A84A 1SA0A 1DU4A 3DHVA 2YJ6A 5IUJC 3T3NA 4OFBA 4I6EA 1M9NA 3KYIB 5E3HA 2GPWA 5CB8A 2QRVB 4MRMB 4PFJA 4G67A 2A9VA 1YB5A 1AOXA 1FLNA 4NY1A 3MWDA 4QARA 3DE1X 4G24A 1BCRB 5I9TA 3M89A 2QMZA 2UZAA 4E1VA 4LQDA 3BMOB 3G79A 4PG6A 1NUUA 4N3NA 2HMSA 2OCPA 2VEOA 4M0MA 1QKJA 3F2VA 4EA8A 3JQ8B 3X2FA 2ZRCA 2W4MA 3NKFA 1GUDA 3VM6A 5BMVB 1WCYA 4HDOB 1L5WA 4D4JA 2P3LA 2IH5A 1XVVA 2SKCA 5HEKA 1T9BA 2D1RA 2L17A 1RZRA 3KSMA 2AFVA 1Z0DA 4TKMA 5JATA 1Q1NA 3CR7A 1GGMA 1HQDA 1B6SA 1F2UA 2IEZA 4GBMA 1X74A 1E1LA 4EA6A 1RAHA 2QM3A 2FOXA 1MTOA 2X5KO 3K53A 2L18A 2YUTA 4RQBA 2XMQA 1M2GA 3KJXA 4DARA 3E53A 4YNBA 2B36A 4ER0A 4QASA 4D5GA 3F46A 2Q4EA 1OXSC 2D1YA 3FI0A 3R5XA 4JB2A 3UOGA 3WYFA 1ZW1A 3JD3A 1R4MA 4LCJA 2H7YA 3ZU5A 1Y8ZA 3DVAB 1TO2E 1EFVB 1X2BA 1C4XA 1DEXA 3IPAA 4R8KA 5C34B 1IY1A 4MPRA 5H4GA 5CJ2A 4BNTA 1W25A 2VG8A 3ES9A 4PLGA 4WOKA 3C2QA 4EJSA 3EVTA 4TTAA 2QL5A 1OCEA 4WFIA 5B3AA 5B55A 3S55A 4U2DA 2B0JA 1JGTA 3WTCA 1G20A 2FFHA 1CW2B 3CWCA 4J4TA 1E6UA 3FYDA 3E2IA 2WLTA 3TX6A 2VHEA 4FGUA 3N6RA 3ZLUA 4ZYZA 4EWLA 3E2MA 3AHDA 1SUPA 5BNFA 1U3DA 1SRQA 5B7GA 2GD1O 5C1BA 4PO9A 2Q1XA 3F4BA 3L6RA 4MV0A 1OY1A 3BMOA 3FDIA 3S44A 3QW4B 4PO8A 4H6PA 1W19A 1L5LA 1W1IA 2O2ZA 3PXBA 5AQ1A 4U39A 3NRBA 4DEXA 3X3HA 1KL7A 3AUXA 2ZS8A 2XBUA 4KYUA 3B1ZA 4PGAA 4M9QA 2UZ3A 3K92A 1F5NA 1NFFA 2AWNA 2WAMA 3JALB 4GICA 1KI7A 2A67A 2KM1A 4V02A 5KYYA 4LRWA 3RREA 1U8UA 3ACBA 2AK3A 2BHRA 4FMDB 3LCCA 3PXGA 1PYOA 4QUBA 1WDWB 2O4CA 2A0XA 2LRHA 4RGBA 4G0MA 4R9NA 5IEBA 1O1YA 2R62A 2X4LA 4NABA 2G4CA 2R5FA 3ZNNA 3ZR4B 3I76A 2REQB 3GDWA 5ECWA 5EMJA 4CCYA 5JXIA 2Z8YA 1HT0A 1SOAA 3KZCA 4IVRA 3GDGA 1BFKA 4BLSA 4H77A 4LVNA 1KIAA 1X7WB 1XRJA 4RU1A 1V5GA 4OUKX 1B1CA 1EHYA 3OCJA 3ON5A 1R5JA 2EQ5A 1PZXA 2E37A 5BN5B 3HBNA 3N87A 4HTAA 4MVJD 2GFHA 2PX4A 1Q95A 4UVDA 3QELA 1DPFA 4RVOA 3HJGA 3BZBA 1EFRD 4FM9A 1SBHA 3ELWA 1T8WA 2HT6A 2VRWA 1GRNA 1F9EA 1FLAA 2ZANA 4Y2UA 4QTYA 1KJQA 1K7CA 2X0KA 4UATA 3AIKA 1FDVA 2BAGA 1JKJB 1TZJA 3L1JA 3TL3A 4BLRA 1HWYA 3LKBA 3OZVA 4OUDB 4BNUA 3IEPA 2WE7A 4TKVB 1HY3A 3KQQA 2P1ZA 4UOQA 4DRXA 4OQEA 2C42A 3VSAA 1LQUA 3U4IA 2F7SA 2AW5A 4H2DA 4Q3NA 3BDIA 1F14A 5CX1A 3VPXA 2AZTA 4FFDA 3BE8A 1DS6A 3ZVLA 3ZHQA 1IPFA 4WDRA 1YRHA 3L46A 2HLDD 2E9SA 4U9HS 2QU7A 2WZBA 4C5BA 4QPZA 3GJ5A 4G63A 4QREA 1CJTC 4DKJA 1CK4A 1VRVA 2HU7A 2ZVDA 5CM2Z 5EZYA 1RWXA 4CG2A 3FLEA 4PRLA 4YN3A 4D6XA 4MMYB 1GG8A 4AZVA 5HQ3B 3Q2IA 4H7FA 4S2UA 5JMPA 4WBNA 2HM7A 2NQ2C 4Y9DA 3ZDBA 3DT6A 1ZOPA 4ZZ0A 4E31A 3A6GA 3O4JA 4JEMA 4P7JA 3ITDA 3VHXA 4CCAA 5HJEA 3I5MA 5A04A 4M8NE 1LY1A 3NPMA 1JU9A 5EHGA 2FWRA 5EKUA 4EFLA 4GX0A 2Z2YA 1JFTA 1DX4A 3H5TA 4F06A 4YUXA 3F6SA 3KOOA 4AKGA 3WGGA 3UG7A 3W2EA 3FOWA 5A5EA 3F96A 1XWFA 3DXYA 2I2WA 2OUIA 4CMKA 2D1FA 3Q6MA 4HDSA 1FJXA 3SJUA 3UUWA 4NYMQ 3UGKA 3AY6A 4WJKB 1GG5A 5JRJA 2GO1A 4Q7JB 3N8GA 4S0ZA 3P8ZA 1DV2A 1O6CA 2X9QA 4B3IA 2OHGA 3GPCA 3QPWA 3L4BC 4L3WA 3W05A 4CM6A 3QW2A 2CXPA 2OV3A 5KVAA 5M34A 2VPTA 4ID9A 4G8CA 4PQFA 3WGMA 2W2QA 4GXNA 2NYAA 4G89A 2WWFA 3ADPA 3AEZA 3AONB 1I2DA 3BA1A 3WBKA 2P6PA 3TMAA 5EJ5A 3A1FA 1JR3E 5E1OA 1L9XA 3TLCA 3VNAA 3HM9A 5DHFA 1NN3A 1Y80A 5EXTA 421PA 4N5MA 2CXXA 2H2FA 1TM3E 2DT5A 3UMRA 2I7TA 3KYCA 3P9SA 1ORRA 4H7EA 4J75A 1YQDA 2QR5A 5G0TA 4F12A 4KQ1A 4DIEA 3WJ2A 3EDOA 1I2BA 5C5EA 2PR2A 1EFDN 2QTMA 2JATA 1PW7A 2IYOA 3QU5A 3T1TA 3Q3EA 4QGHA 1EVQA 1AU9A 1QYDA 3HSYA 4PFQA 4BCBA 3QE4A 1JSXA 2CYBA 3UV7A 1S8NA 2XGGA 1KK0A 3QY0A 1KJIA 5FOXA 2IOHA 1LA2A 3CNHA 3ZUPA 2NO4A 1IUPA 2VNAA 4N48A 2OCXA 4RZ2A 3JQDA 5HZGA 2QAGA 1ZPDA 4Q3OA 5AW5A 2HSZA 1QX4A 4Q19A 1Z74A 5LQSA 4JJ8A 2DPGA 1Q57A 2P2LA 1T2EA 4LXUA 3OTQA 4NRDA 4Q1EA 4AJPA 3IMGA 3IR5A 4P4LA 1HBJA 1G8SA 2C2XA 2DTDA 2QBYB 1L7RA 1M6YA 5SZJA 1QDLB 1JG1A 3L0OA 1POXA 3SHWA 2GZ3A 4AYTA 3I9V1 3HEMA 5AI4A 5TT1A 5DH9A 5JNWA 2Y93A 1Q7GA 4IL5A 4RH0A 4WJLA 2AFIA 4UVGA 4ITRC 2PPLA 4MDHA 3GEDA 2DF8A 3AI2A 3ADOA 3OKCA 5EMLA 4CF6A 3IUSA 2BGIA 4R7ZA 1E1DA 1ZD2P 4MWOA 2X9LA 3UWKA 4NS1A 3PNSA 4B71A 5JMTA 1QRUA 3DFMA 1R0KA 3EODA 2NT4A 1WP9A 3EWAA 4ZFNA 2JIPA 4DT1A 4BO4A 4INPA 3CIOA 1KJJA 3ASZA 3DR5A 2JGDA 5FWNA 4TLDA 1UP6A 3F6CA 3DXFA 4NBLA 5EESA 4DSAA 2NMVA 4JP2A 4GPBA 3KKQA 3ADDA 3G2HA 3KQVA 1I3MA 2QMEA 1SZDA 3C1TA 4UUQA 4BP9A 1CY6A 3O6VA 4R7TA 2EC5A 1JWBB 4JGBA 2GYYA 1U3WA 1TRHA 4NFHA 3NI2A 1XQWA 4YC7A 1A8IA 1JEYA 1THTA 1UK8A 1NVWQ 1WV1A 1U99A 2C20A 2NXJA 3IE0A 4D45A 1VDZA 2X3FA 1KBOA 5CX4A 1CQJA 4YCBA 1SKMA 3FYHA 1R37A 4YP1A 2RCNA 5FTMA 1VSQA 4WZAA 3VTKA 1WUIS 3I37X 3QU7A 3GAAA 1L9KA 4XM0A 2IXEA 3HGMA 1A9YA 2XQFA 1MGOA 1NAIA 3Q98A 4G25A 1E66A 3EHDA 4F4JA 1JHZA 2NGRA 3V2IA 3WLRA 3PSAA 4YUZA 3C74A 2GO7A 4DQVA 2H17A 4RABA 4QYWA 4WNAA 4PC2A 1NLZA 6YASA 4RHYA 4C30A 2ZZNA 2WTBA 5D6OA 3GR6A 3QVUA 1IK4A 1XJWA 1A2QA 1Y4UA 3ST7A 1JH9A 3NBKA 4IHJA 4B4WA 4BQFA 2ZWAA 1ZEMA 4JGIA 2IPXA 4IIYA 4BU0A 5A02A 1EIWA 1UWKA 4HXFB 4URUR 3ZDRA 3B9BA 3JAWB 1T4DA 1GUZA 4E07A 4JJ6A 1HT2E 4OQMA 4JA2A 1IN6A 3EPRA 3LCVB 3Q85A 1GYPA 2DUMA 3HCBA 2IHVA 3RKRA 1NVEA 4J91A 4YAGA 1ZAKA 2QT1A 2FX5A 3SC3A 1LX6A 1CSEE 4X8LA 2GEVA 3L8YA 2HEGA 5AM3A 4KPGA 2IT1A 1WIWA 3TOCA 1DINA 5CAEB 3ULKA 4DB2A 3QKTA 2WBLC 3BD7A 4OHCA 4GNRA 1R4NA 3JQ7B 1GAWA 2JHFA 1NQTA 2X23A 2FRVA 5J63A 2H5LA 2X3YA 3KKPA 4FHDA 1NVXQ 4BZQA 3QVXA 2VJBA 4EP1A 3UUGA 2RBEA 3OC6A 4HAUA 3PPWA 5K8VA 2IBTA 5MN4A 4QEKA 1QKIA 3EGCA 5CK4A 4TXNA 5AO9A 2Q21A 2YVAA 3T0IA 2OOSA 3GLIB 1PK7A 5HJ2A 4MYHA 3VZSA 2QLBA 3GRVA 4YJGA 3A14A 2QPLA 1HDZA 2BEUA 1NFRA 3EIOA 5EWLA 5B4TA 2J32A 4QJ5A 5CB0A 1N3YA 1P9NA 3DEAA 2HADA 2VJMA 3E3OA 3JVVA 2CB0A 1IVNA 4FHEA 3O21A 1RHRA 4NZNA 1Q5PA 3N75A 4B6EA 3THWA 4E14A 3I2YX 1ZWLA 2ZIUB 3IEXA 1UAAA 3SXUB 5TS2A 1ISGA 3U0BA 3I58A 1SRRA 1Q3KA 1UFQA 2J45A 2X9NA 3NTRA 4L6IA 4UAUA 4XCQA 3S0JA 4OHMA 4Z7JA 1FYFA 1HM5A 1W4CA 4X7BA 2CV1A 1LLQA 4J1QA 3V4RA 3CLVA 3DPSA 1W48A 3CPJB 4Q48A 1Z6GA 5K1ZA 3UV3A 5LZ2A 4JFAA 4EITA 4LXIA 4M0PA 2ZI6A 4WY2A 1S02A 2I66A 3RFCA 2HRZA 3SZOA 1GA6A 4EHDA 1U2ZA 1MLDA 4MULA 4CCWA 3IUJA 3O9ZA 4Z9YA 1OXBB 5ICCA 1CP3A 6REQB 4RGYA 4QVIA 2W22A 3EG9B 3ZE6A 3QV2A 1T0BA 4G0XA 5IJWA 1XFDA 2CK3D 2CCJA 4K9LA 4ZT4A 4Z0NA 1M6WA 1VZ2A 2QYOA 2WYIA 3MTJA 3RSFA 4BASA 4UQPA 3QMPA 2BTQB 4CV1A 2B7BA 3J7TA 3LT2A 1Z68A 2O2DA 2A1IA 4OEHA 4KXLA 4YALA 1MTZA 2X22A 5SZIA 3DTVB 4G1CA 3NWBA 5GONB 5FT9A 3HB4X 4KN8A 4ND1A 4YVFA 1AHNA 3E1GA 5DGCA 1JLMA 1JHQA 3O73A 3RF6A 3LUJA 4CZ2A 2HA5A 2QXUA 1RMQA 5ESWA 1P7ZA 1WMEA 5AI8A 2LR0A 2QE7D 4ND5A 1J97A 3SMQA 3MWKA 5JSFA 1G19A 3H19A 1MQAA 5G1PA 3ZDQA 3MJCA 3LOPA 4E46A 4JX9A 1AKTA 4B73A 2VHYA 2Q4OA 2CNKA 3RAFC 1TUGA 2GYUA 4X9XA 2CN1A 4B6FA 4DCUA 3EUWA 4QXRA 1T29A 4HX2A 3T12A 2YW9A 4IIFA 1MG0A 2H1HA 1ZISA 1Z06A 5LSAA 1QQBA 3AVYA 1X7DA 3U3OA 1IFXA 1XD2A 3T06B 2VJYA 1ZUIA 4FEGA 2EFCB 1L1FA 1MW9X 3ABIA 4NL4H 3UHOA 1HR0B 1JZQA 1Y8AA 3TXAA 1SHZA 4EHKA 1EWVA 1GRCA 3OUTA 1H0HA 2YFQA 1ZMOA 4LECA 3UJDA 2RHOA 4BGIA 4CT5A 2PE5A 2Y92A 2ZB2A 1M83A 2TMKA 3L02A 4DLUA 1KXJA 2CY0A 5IJZA 2WQ6A 4KMRA 1YB7A 2PJDA 1EUDB 1OXXK 1K63A 2GJ4A 5C4IA 4X1KA 3DDCA 3VH2A 1XEXA 5IH3A 3BFKA 1WW3A 4CMCA 2P9TA 3R7WB 2I3DA 3E9DA 3W2HA 1BMFD 3OUZA 2FHPA 4BCCA 3QLUC 2ZB7A 3ZEAA 2Z09A 1FP2A 2GS9A 1Z7YA 2XWBF 2AXNA 5B58T 3DL0A 1WD7A 2Z2JA 3D3KA 4GZ6A 1NR1A 2VYFA 4IIEA 5CPFA 3WWZA 1M8GA 2DBYA 2V3WA 2W2TA 4QDTA 5ALNA 5FCDA 3ZH9B 3DZHA 3RGGA 5H80A 3RBVA 4PGMA 2HZ7A 3T61A 1BU5A 3WNDA 3GN2A 4BYGA 4DANA 4ZYUA 5ISMA 1HO3A 3S29A 4HDMA 4LOLA 4YJ3B 1AH2A 3K9QO 2WPDA 1SPXA 1SNYA 3WLAA 5BPFA 1SH7A 3BH0A 2ODPA 4GR9A 2ZB4A 1RZRD 5AK6A 4MLDA 2C4HA 5AJHA 3A25A 3K8OE 1I33A 3G2NA 4ZREA 3N8IA 1NUHA 1E7RA 4EUHA 2RHBA 1RXEA 1EDDA 3SZRA 4WQMA 3BD9A 2IUYA 4HH3C 5IKPA 1I7SB 2BP7B 1E2EA 1G3QA 3MGAA 2VJNA 4M7OA 4XGKA 1TU0A 3G5LA 3L5KA 5H9VA 1WD5A 2ZUEA 2Q9BA 3DDSA 5EHZA 2FN8A 4O59O 5JH7B 4JEHA 4IJVA 2RFLA 3CBGA 1VIYA 2ZRDA 5CYPA 1WCIB 2ETVA 3KB6A 5AKYA 3U49A 1Z2OX 4IJWA 5BNZA 1GM5A 4X1KB 3BHIA 3C3BA 4HJRA 1SCAA 3RK1A 2H5JA 1CKEA 3I9V6 1E6KA 4A1OA 2JH9A 5E1MA 4X8HA 2XVMA 3M6AA 2R8BA 2R00C 5G0UA 3PYXA 5JSHA 4C2BA 4UVHA 1KMHB 4BV2A 4A92A 3W7AA 5AW7A 2EG9A 3KQPA 4AY5A 1ULHA 1FDRA 5H70A 3P0HA 2QJWA 3OQNA 2C5LA 3EE6A 3UAXA 4MVYA 4NLLA 4UMDA 1UJ4A 4HUQB 1PUIA 1WMFA 3SYNA 1WE2A 4GX1A 4ENVA 2DR3A 1BEUB 5BW6B 3SC2B 4FB4A 1BDMA 1DT5A 3A2MA 3CUKA 1RJEA 1QV9A 2YZGA 3PCRB 4FGJA 1BMFA 1CQIA 1CRZA 2VZEA 2W98A 1RM5A 1PG2A 3R41A 1GPJA 3ZLBA 2QTRA 1PTKA 2LCIA 3A1NA 4FNAA 2F3PA 4OBXA 4P6VF 4R1PA 3ZJYA 1XTUA 2XR1A 3H05A 4CTKA 5MF6A 2FOIA 3EF3A 4N7RA 2VJCA 5AUQA 1LC3A 3OQVA 3LRPA 5LBUA 1T9HA 2ASEA 2B8TA 3B60A 3X1XA 4GPD1 5CFMA 2W4QA 2B61A 2QVZX 1EWKA 1RSZA 4Q1DA 4NG4A 1T8RA 2WMYA 3GUCA 1N0WA 2AEJA 4X1YB 3FPCA 3TI9A 4DCNA 3U1BA 3VPDA 3WLNA 5B3JC 4V2UA 2WTXA 2ACVA 3CG0A 1M5UA 4EKYA 4BNLA 3IQGX 4GPAA 3E7PA 3M33A 2Y6UA 4XUDA 3AW9A 4FI3F 3IMKA 4LNUA 4UVEA 4KXFB 2VJPA 5PNTA 4ZT5A 2D2EA 2P11A 3A2KA 1RRKA 5I8WA 2IOQA 4KX5A 4ENTA 5REQB 4RDHA 4C2AA 2SKDA 1QC5A 2HWWA 3NV9A 4NP6A 2EXXA 2OXIA 4A0GA 5CEFA 3IVAA 2H63A 4CMHA 2UXDB 5DSZA 3KUCA 2UU9B 2QZJA 1SBIA 4ALIA 1L6RA 1ND5A 1IPEA 1LWOA 5JAMA 1NVAA 3HJTA 4L8VA 4I5GA 1CG6A 2QE7A 3L0SA 1RYDA 5KTYA 2FX3A 4JLDA 4CQNA 3JQ9C 4ND8A 1CJMA 1YHZA 5KNBH 2NYRA 2PD3A 4JI5B 3LUPA 2GF9A 3SLRA 1T3HA 5DTMA 1LK0A 1T9KA 1QQAA 5FI5A 4F84A 1DZIA 4HRAA 1B2LA 1CZKA 4QQ8A 4N5NA 1NRWA 4D4KA 2NU7B 1U2SA 1FUEA 1IEQA 1G2QA 4XB6B 4DIUA 3EPJA 1LZKA 1NMQA 1DXOA 2WINI 2HMAA 5JQGF 5EIXA 4YLYA 1NG9A 3D7KA 2BOVA 2Q8PA 5D7BA 4RENA 4OAPA 1NHWA 2PDAA 4Q5IA 4RXTA 5GJWC 3ZK9A 1F0KA 1ZI9A 2C9MA 2L2QA 4BC0A 3HM2A 4HLDA 4R3UC 3LS2A 2ZTUA 4ZYWA 9ATCA 1E60A 1FP1D 5JEEA 1IBRA 1GGFA 1DKOA 2GCOB 2ZJ8A 1KEEB 3K96A 3UH1A 4QKQA 3DA8A 5JNUA 1WUKS 4M0FA 2J4FA 3NT5A 2IUTA 4M2LA 4D0RA 3NUGA 1YQ9A 4NESA 4OTZA 3V5NA 1XKTA 3ND7A 2DVMA 5ALVA 2R6R1 1Z0IA 1VBNA 3KWMA 4OHRA 3S27A 2AUTA 5BN4A 3Q88A 4Q4HB 3DE7X 4Q7MB 4IXTA 4LJ8A 4Z4GA 1E2BA 4JYPA 4KE7A 5EWMB 1YE5A 3T15A 3VC7A 4EMBA 1Z6TA 1G0NA 1EQ2A 3DEJA 3NGMA 1IQ0A 4E21A 2EW2A 2OD9A 2JIZD 1DQSA 2P5YA 5GZ6A 3O4VA 2C9BA 2GVNA 2QY6A 3UT5B 4JLKA 2UVDA 2ZCJA 4K40A 1MKYA 2JNWA 2J3QA 1Z5WA 1SWWA 5AVJA 3WAJA 2QV7A 1R66A 4K88A 4L0CA 3RARA 4YRZA 4TT3A 5J9FA 3IYLW 3ZCRA 2C7PA 3V4VB 1F17A 1HZJA 1SZJG 4FYVA 4NCXA 5LYJA 2BR5A 3F6PA 4LRXA 5EIOA 4IWXA 4MA5A 4F5EA 2XPCA 3RC7A 2NPFA 3PUKA 1YBHA 3EQ6A 4J1TC 4J6FA 4LOIA 1IOZA 1NWCA 1OQAA 2JAOA 2H92A 2B1GA 5EKDA 2IOYA 3CXUA 3QNUA 2ZUTA 3Q7PA