2QSJA

Crystal structure of a luxr family dna-binding response regulator from silicibacter pomeroyi
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
120
Chain Sequence
LTVVLIVDDHHLIRAGAKNLLEGAFSGMRVEGAETVSDALAFLEADNTVDLILLDVAIDGLVRLKRFDPSNAVALIHELIRAALEAGADGFIPKSADPQVLIHAVSLILEGEIFLPRSYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding response regulator, LuxR family
publication title Crystal structure of a LuxR family DNA-binding response regulator from Silicibacter pomeroyi.
rcsb
source organism Silicibacter pomeroyi dss-3
molecule tags Transcription
total genus 37
structure length 120
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qsjA00
1ISSA 3IDOA 2FEWB 3QLVC 4MS3A 4XAQA 1QPZA 4Z9AA 3A0UA 2FMIA 1USKA 4KNYA 4UHJA 2PUCA 2NT4A 1CYEA 3HV2A 4RU1A 4Z99A 3RVLA 4WXEA 3RQIA 1I3CA 4G0PA 1YMUA 2VUIB 4XLTA 1SXHA 4KVFA 1P6QA 3GT7A 1QMPA 4YV7A 5KQPA 1QP7A 4QYWA 2MYTA 3BBLA 3KJXA 4OLAA 1USIA 4WT7A 4DADA 4KREA 3DGEC 3GWGA 2E4XA 5IULC 2O20A 3RH0A 3QLTA 1BVHA 5DTEA 4N0QA 4PE5B 2OQRA 3QEKA 3JVIA 3E61A 1DCFA 3HK2A 4O5AA 1GLGA 2NT3A 3LFTA 3HO1A 1SXIA 4Z9BA 3H1EA 1QO0D 3QX8A 1Z12A 1D1QA 3JTEA 3Q7RA 1ZITA 3CFYA 4PEVA 3C97A 1LK0A 1NTRA 1QKKA 1Z13A 1ZY2A 2WJWA 4RXMA 4OBBA 3O2JA 5IX8A 3TO5A 2YHAA 1D5WA 4OTZA 1L5YA 2PL1A 3A10A 5TPZD 1RXIA 1C0EA 3EQ2A 3KHTA 4F3TA 1FFGA 2WMYA 4G0OA 5DCLA 3QEMA 2WB4A 3NHMA 4RY0A 1JYFA 1M5TA 3RVKA 2MSWA 4HYEA 1QNLA 2HPHA 2L17A 3O75A 4WWHA 1U8TA 1TJYA 3DBIA 5CNIA 5FWYB 1YS6A 2PMCA 5GQSA 2L2QA 3RVMA 3H5LA 2IPNA 4TLMB 4E7PA 3SQNA 1P6UA 2ZAYA 3EAFA 1JBEA 4WXMA 1MB0A 1OXKB 2FMFA 3IPAA 4TLLB 1RZRD 4ZYLA 1QP0A 1ZGGA 4OLBA 4RKRA 5KQMA 4ETNA 1DCKA 2QR3A 3NNDA 2E4VA 3C3KA 3GV0A 3KLNA 2AYXA 5FWXA 3SNKA 5B3JA 3ILYA 3N0WA 4JP1A 5ABPA 3LKBA 3M9WA 5EWMA 3Q7SA 2FEPA 5JS1A 1JLKA 2JVJA 3IP7A 3LMKA 1KRWA 1EWTA 4FE4A 5TPWB 2R4QA 2JCGA 1PNTA 1DZ3A 3MYYA 5FBKA 3UKJA 3FFTA 3N6VA 3T8YA 5JNWA 3H1FA 4P98A 1KRXA 5T7BA 5DKFA 3OMWA 4W5QA 1J56A 1ZN2A 4EGSA 1CEYA 1P8AA 3HSYA 5GOTA 1UDRA 4G97A 4N47A 1FQWA 2QSJA 2FVYA 3LTEA 4L4UA 2MYNA 3Q41A 3VNAA 1LBHA 4Z4CA 1XHEA 4G0ZA 4YLEA 1DBQA 4JA2A 1VLZA 1U2PA 1W9HA 1JWLA 1ZH2A 2PLNA 1AB5A 1KMIY 4KK4A 3RVOA 3TX6A 2QVGA 3N8IA 1VKRA 2B4AA 2TMYA 2PUDA 2FEKA 2P4UA 2PAFA 1JFVA 5I4CA 1E6LA 3H6GA 1ZDMA 3RVJA 5T3YA 3KYIB 1QQAA 1RNLA 1U04A 1ZH4A 2FN9A 3KSMA 3LUKA 3O1IC 4MQEA 1DBWA 2E4ZA 3C3MA 3W9SA 1YMVA 2FQWA 2FQYA 1B00A 1JDNA 1F51E 2GWRA 1U0SY 4RWEA 3URMA 4D6YA 2OENG 1Z25A 4MR7B 5EWJB 3Q9SA 4G0YA 3NNNA 4IRXA 5TQ0B 3FFXA 1FFWA 4HNSA 5EWLB 4IMJB 4Y9TA 3KYJB 4OATA 1APBA 4RXUA 5ED4A 4KZKA 4Q6BA 1T34A 1R8JA 5E3JA 1EHCA 3JY6A 3TMYA 1E2BA 5TQ2A 5JNVA 4N76A 4JOQA 3F73A 3LUHA 1LJLA 2VUHB 3HXMA 1A04A 7ABPA 4N0PA 4XASA 4LDAA 1DCMA 4MQFA 2RJOA 2LPMA 3LUJA 4QYMA 2CD7A 3OQNA 3L6UA 3LOPA 4YR7A 2FSPA 2J48A 2JVIA 4MRMA 3BILA 3HDGA 2ZWMA 2A9QA 2FTKE 3I09A 4H3KB 4IMIB 4RS3A 4CBVA 3CKMA 2IKSA 4O1HA 3P9YA 3OO1A 1MB3A 5CHYA 3SG0A 3Q15C 1ZAYA 2CHEA 3H5IA 3LKVA 3QLUA 3NHZA 1DC7A 1Z16A 1Z17A 4JASB 4RV5A 2GX6A 4IGAA 5KQGA 2JVKA 4RKQA 1JF8A 8ABPA 1GUDA 5IUJC 2JBAA 1NY5A 2NZVG 2R47A 3K4HA 2FW0A 3JPWA 2LIVA 3CTPA 2JK1A 3F6CA 4F8JA 2PUEA 2E4YA 3RVRA 1JDPA 2F8SA 5B3JC 1YVUA 3H5OA 4HNQA 5JNRA 2V0NA 3N75A 3UK0A 2M1ZA 4LE0A 3OLZA 3HVRA 1F4VA 4QICA 2LP4Y 2RDMA 2QU7A 3C3WA 3FGZA 1P2FA 4MS4B 1TM2A 2MYUA 2A9PA 2B1JA 3R0JA 2FKAA 1MAVA 5JNUA 1EFAA 2VK2A 3EGCA 2AYZA 3A0RB 4F06A 2I6FA 4MS1B 4WZZA 3F7NA 4NQRA 1L5ZA 5KC8A 1EWVA 4FB4A 3O1JC 3QLVA 4RK5A 4KFCA 1AB6A 2GI4A 1NXSA 1DP4A 3IP9A 3MM4A 1A0OA 3E3MA 3QELB 2L19A 1ABEA 4L85A 1A2OA 2MSKA 3RVQA 4MR9B 3K9CA 2H3HA 2LBPA 1HEYA 4Q6WA 1VPWA 2R48A 2QW1A 4G0QA 4MR8B 3OO0A 4YRZA 3MMNA 5JNTA 4D74A 3KCNA 2RGYA 4EYKA 3LUCA 1DG9A 3D02A 1PHRA 4JAVC 4RY8A 1BDJA 3H5VA 2HJ9A 3CG0A 3OLXA 5CNKA 2VYCA 3QX9A 4H60A 5BQ3A 4ZMSA 2IPMA 5BR1A 4QPJC 1TMYA 4MS3B 5IC5A 2E4WA 2FQXA 4PZ0A 1Y1LA 1C4WA 3SY8A 2YHBA 4W5NA 2HSGA 1YIOA 2LUOA 1GCAA 4MPTA 3ROFA 2F8TA 4KPYA 4KMRA 4RZSA 4FE7A 2QXYA 1S8NA 4KK3A 3VNBA 2PUFA 3OLVA 5CNJA 3C6QA 4LE2A 1PEYA 1Z26A 3TB6A 2BGGA 2FMKA 4JB2A 1ZVVA 2KYRA 4G0MA 3T6KA 1JFSA 5TE9A 3HCWA 3JPYA 3KLOA 4O1IA 3H6HA 3N0XA 3M6MD 3A3KA 3LUAA 2IYNA 4XFKA 5C5CA 5KWSA 1WETA 2WJAA 3HDVA 4HNRA 3CS3A 3KG2A 9ABPA 4YWHA 2H0AA 4MLDA 4RXTA 3OQMA 5KQLA 2HQOA 1M2FA 5FWYA 1DRJA 3MQ4A 3QLUC 1XHFA 1SD5A 3DGFC 3O21A 4RSMA 4EVQA 3CRNA 1DJMA 3HJFA 2X7XA 4DN6A 1Z15A 2A9OA 4IILA 3S99A 1JFTA 3FDFA 3KKEA 1TVMA 4MLCA 4RY9A 2QZJA 1RXEA 3F6PA 1FFSA 3RVSA 1YK1A 1E6KA 1VRVA 3H5TA 2P9HA 4EYGA 1SXGA 4RK7A 5C5EA 2QVCA 1OXBB 4NICA 3UUGA 2IOYA 3EQZA 3O2QB 3O1HB 2PJUA 3QEMB 3EDCA 2HQRA 2CWDA 3EODA 3SAJA 3CU5A 1D4ZA 3CZCA 4YCSA 1NXTA 5HQJA 5BRJA 4ZMRA 4OG2A 1JX6A 4LZLA 5TPWA 4P1ZA 4G0XA 1RPJA 1USGA 4ETIA 1JL3A 3OQOA 3EULA 4JB0A 4EUKA 1Z2DA 3QK7A 4UHKA 2L18A 3GBPA 3LUFA 2RJNA 3M9XA 5FWXB 3MIZA 2HQBA 3HEBA 3LUGA 5EWMB 3LUDA 4Q7EA 4KQCA 1PEAA 3GBVA 4NCBA 1Z2EA 3JVDA 5HSGA 1BAPA 2Q5CA 4KQ9A 3RVPA 5JS2A 5JNSA 2WY2D 1NXPA 3GRCA 3HUTA 4XXHA 2PE5A 3DLBA 1DBPA 4EVSA 5KI6A 4MYRA 3FMVA 5IUNC 4YO7A 2GKGA 4EYOA 2MYPA 4YP9A 3ILHA 3BREA 2PL9A 4Z4IA 5IUKC 1M5UA 3OLYA 4DQDA 4ZJPA 3EJWA 2WWVD 3CNBA 3CG4A 3I45A 4MR7A 5EWJA 5PNTA 1D1PA 4W5TA 4GPAA 1JHZA 3HS3A 4MGEA 2A9RA 2FN8A 5TQ0A 4E7OA 4W5OA 5IEBA 4LX8A 2M98A 3NNSA 5EWLA 4TMYA 1JH9A 2IPAB 3TD9A 3OM0A 4RDCA 4N41A 2GBPA 1NXWA 1URPA 1M2EA 3G1WA 2NUBA 5D2CA 1YS7A 4ETMA 4MQEB 1BDIA 5TQJA 3IPCA 5CNMA 1NXVA 3I5AA 3DLHA 4S05A 2CHFA 2W42A 1IIBA 3G85A 4RK1A 1EWKA 2IDMA 1FSPA 3KS9A 4LRQA 3I42A 3OLWA 3NBMA 2JRLA 4ML3A 2R25B 1MIHA 4N03A 3GYBA 3O74A 1ZESA 1XWWA 5DLEA 2N9UA 1YK0A 3Q7TA 4W5RA 2WRZA 1NATA 1QP4A 5TQ2B 1ABFA 1DRKA 3D8UA 4H3HB 1PUXA 1LJUA 3T38A 3GA5A 1EAYA 3GL9A 3JS5A 1W25A 4EY3A 4S04A 1ZHHA 1ISRA 3IP5A 4MAAA 4B09A 1LBIA 1SRRA 4Z4HA 2XDYA 3O2SB 1D2AA 4MQFB 1DC8A 1ZGZA 4NCAA 5HKOA 1H9CA 4MRMB 3HM9A 3T95A 2FLKA 2NZUG 4GNRA 4LDZA 2JB9A 5KC9A 3H75A 4MS4A 1QO0A 1Z18A 3IP6A 3HUUA 1K66A 5HM6A 2ID9A 3B2NA 3CHYA 5IBQA 4MS1A 6CHYA 3CZ5A 3ROTA 1BDHA 2PKXA 2JBAB 3CLKA 4Z4FA 4F11A 4YGXB 3SM9A 1TLFA 2PUGA 1MVOA 3KTOA 1GCGA 3H5WA 5TPZA 3H1GA 3OM1A 4PYRA 1E6MA 4RK4A 4Z0NA 4F12A 4Z4GA 4IF4A 2E4UA 5DGCA 3BRQA 1JYEA 3QELA 2ID7A 4EYQA 3N53A 1NXXA 5BRAA 3MF4A 1BA2A 2FLWA 4RK0A 4LE1A 5F64A 4EVRA 2PUAA 1QQBA 3RVNA 4KRFA 4Z4EA 1U2QA 3FFWA 2FXIA 4MR9A 4G86A 4ZPJA 4M88A 4MR8A 1KGSA 4XARA 4YS6A 1GUBA 2QV0A 4NV3A 4TN5A 3OMXA 3L49A 2IPLA 4RK6A 1NXOA 6ABPA 3DZDA 2DRIA 1CHNA 1RZRA 4PICA 3BRSA 1K68A 4KV7A 1PNRA 2MSLA 3MA0A 4D6XA 5IEJA 2PUBA 3N0RA 4WUTA 3HZHA 5FBHA 1YTUA 2FMHA
chains in the Genus database with same CATH superfamily
3ZY2A 4JBXA 4DNXA 1HDXA 1AIPA 1MFPA 1GO2A 4L51A 1YASA 5CT8A 4ZARA 1AZSC 1KL7A 2HK9A 5H4HA 3FTPA 4B0OA 4HDKB 3PHGA 3U62A 4F2GA 4UDOA 4C0BA 5CT6A 1WKBA 1WP4A 1KIMA 2GPNA 3LSYA 5JJKA 2V74B 3BFPA 4LZZA 2OBYA 3H84A 3OHSX 1CYEA 4WZBB 4LRTB 4EHIA 1NYLA 5AVQA 4IXTA 1A4XA 3ZEAA 1XTIA 1KBQA 3PD7A 2EGGA 2GZHA 1QYDA 2ZSEA 3LRPA 4KVFA 4R0MA 4GOKA 2NXNA 2RH9B 4HB3A 4KG7A 2GN1A 3DT9A 4R7TA 5HJ5A 4QYWA 5K20A 4TZ0A 3MJDA 2CCKA 1O95C 4TTQA 4WT7A 3VPAA 1O96A 1MLDA 4P2BA 1JB9A 3VJKA 4QU5A 4S2UA 3NT2A 1TO1E 4NKRA 4UHFA 4Z8YA 4BE9A 3G68A 5DN9A 3KKNA 3I1YA 4X41A 1Y6FA 5HG0A 4KUGA 1P5HA 2C82A 3OJEA 4MA4A 3WQHA 4HQLA 1XVTA 2R6GA 3P27A 4G84A 1IULA 1CS0B 2JLRA 1FPMA 2WU1A 4OIMA 4BQSA 4CQLB 1DWOA 4PQFA 2OQIA 1KDZA 1INLA 1EJ0A 4ZRNA 1CUSA 1H1DA 1YZYA 2DKOA 2QTHA 3SXJA 3W8NA 1CDZA 2CDCA 5BNWA 2O8BB 4FTWA 2ORVA 5TMBA 1KMHB 1JMYA 1NTRA 4EQZA 4R2KA 3PGKA 5IX8A 1NNEA 3EW9A 1IG3A 4MVJP 5DBGA 1B8UA 1VSUA 2XADA 1QRTA 1J8VA 3NT5A 4BO9A 1QIFA 2VT6A 4Y2RA 4Y0AA 4B6OA 3T7IA 2GCGA 2X8LA 2RGDA 1NNI1 2NZ8A 3HBNA 3A6GA 2YR0A 3PV0A 1NG1A 2V6IA 3UN1A 4AFNA 3U5TA 4DREA 2WNHA 2O23A 4R9SA 3ROXA 5AKYA 1IONA 2P9TA 4ETMA 2OPBA 3A28A 1RW4A 3COZA 3QVJA 1DOHA 4PSDA 5CNIA 2GNOA 4Q5IA 5BSGA 2Q5HA 2P9ZA 1P6UA 3VC1A 2DWUA 2ZAYA 4QG3A 3AWDA 3DKPA 4NZZA 1DIGA 2OV4A 3VRHA 3VVLA 3K73O 5AVYA 1MB0A 2HPAA 2IPXA 3WL6A 4Q1BA 1JXMA 1MAHA 2DFNA 1XYYA 1H6AA 4HK4A 4Q24A 5KTSA 2GEVA 3JWEA 4TQGA 1T1JA 2JJ2A 1NJ6A 3UC9A 1K5DA 4MDEA 2QD3A 3ZWPA 2XA1A 2Q21A 1NW3A 1UQUA 1P0FA 2I54A 2YY7A 4PLWA 3IKLA 3UBMA 3CWCA 1AKMA 2AVDA 2FOXA 1GV0A 3ESDA 5DP2A 4KPFC 4JP1A 4GDFA 3NHJA 4N6OA 1WDTA 4KGXA 3SFVA 1Y5IA 2ZB7A 5KOYA 3EZ6A 5AKGA 4KQKA 2FEPA 3D43A 4LJAA 3J7TA 5BOSB 4DQVA 1NRIA 1EVYA 1O0BA 2FG6C 2NO5A 3IBFA 4PXYA 1YZFA 5LWQA 1DKRA 1GR0A 1GZ6A 1FA9A 1Q74A 1YDMA 1QOPB 3GRVA 4Q12A 3B2EA 2HTFA 1PZXA 4U6SA 4HDAA 2I66A 3KBOA 4B6FA 5DT9A 4EKYA 3THXA 4F0JA 1WBBA 3M8KA 1KRXA 1SVIA 1KAGA 5KYKA 3ZLUA 3RIMA 1K2WA 2YIVX 2N1MA 5K8UA 2XLBA 4ABYA 1ZN2A 5C4IA 5J5CA 1HF3A 2Z5GA 4ZI2A 1JHOA 3G2OA 4RVGA 3P9NA 4YROA 4N47A 3VR2D 1AN0A 1P73A 2VXBA 4LDPA 5D6NA 1PR6A 1JKIA 2ZYGA 3CVJA 2VTDA 3IO3A 3L06A 1J1UA 1XHEA 2Q3MA 1E1CA 3F6EX 4JXXA 3K70C 2QAGB 4CIWA 521PA 2ODWA 4UCXA 1NN1A 1NR7A 2GCOA 2GTHA 3LLVA 1VMKA 3IUEA 1WBJB 1S8AA 2Q8QA 4TXMA 3MJFA 1JZQA 1ZDMA 3ZE6A 2GRAA 3EZXA 1KK2A 4WY2A 4F2DA 1QQAA 2MMGA 5K0FA 1NMSA 1Q7TA 5JVDA 4AG6A 4HF7A 5JV5A 1U0GA 3AYXB 4MMXB 3O93A 2IUSA 2GZDA 2A7QA 3Q1LA 4RWEA 3Q3EA 3WGYA 4C0KA 4UTXA 1YQUA 3BJRA 4F5WA 4BVEA 1LXCA 2OENG 4EA9A 2AL7A 3AEQA 2DFTA 1R15A 4MR7B 3SYRA 4RTQA 2HSDA 1KOJA 4DDUA 2W6MA 2OV8A 2WSBA 3PFWO 1G8YA 4FFPA 4LJ6A 1L1EA 2BTOA 3Q9LA 4B4DA 3UQZA 3A6LA 4EYEA 1AMUA 4OATA 5SICE 5DTJA 1L8QA 1KVTA 2OE2A 5G0TA 3G02A 1E0SA 4N12A 1WMSA 3Q6MA 1BC5A 1OH7A 1NW8A 1E1QD 1DPFA 3ILXA 4FUTA 4MIOA 1YVRA 3DDUA 1EK6A 1CULC 2NOAA 4AS2A 5LLTA 3HXMA 4LHEA 4HEA6 4NH0A 5FOXA 5A7GA 2DHCA 3ZXUB 3LT2A 2I4LA 5CX1B 1KH2A 1JQEA 2PKRA 2XW6A 1UOQA 4JC0A 2IYQA 3ZU6A 1KYXA 4MRMA 1NDHA 1RHRA 2RKWA 3A6EA 3I09A 4IMIB 3W9YA 2AXEA 1FU4A 1J21A 4N7MA 1Z6XA 2O05A 3G1UA 4X6LA 2XYGA 2DBYA 3W1EA 1FJGB 2QTAA 3OA2A 5EIXA 1A1VA 4ZALA 1MO4A 2XWBF 4LV5B 4M8KA 4HVCA 3NDRA 3ZGNA 4RV5A 3R3YA 4NTZA 4ZAVA 5LA6A 4RTJA 2X8JA 4WN9A 1LDYA 5LQRA 1SEPA 4RTKA 3DOHA 3NP7A 1R6AA 3H2JA 2CJWA 1FXUA 1NNLA 3BSYA 3EZYA 3HVIA 1AUXA 5MDHA 1BKSB 2FU5C 3NM6B 4KDFA 4PC3A 5D85A 3GFBA 3N2ZB 3WLJA 2H51A 1KH3A 4JYZA 4P7BA 5GJCA 1GSIA 4ZI3A 2AOTB 1SCNE 3HB1A 1LLFA 1S0UA 4MS4B 4OUDB 4U7PB 1U28C 4K6GA 5AYVA 5H81A 3U9SA 3K6SA 2WA2A 3DMPA 4G5RA 2UZ1B 1M7BA 3OJ0A 3L8FA 3QKWA 4P6VF 1JQAA 1U0HC 1DT5A 2F8MA 2HIGA 1WR8A 3GMIA 3ZOKA 2NU7B 3O1LA 3I6IA 1WP9A 4BZWA 3F2IA 1X7WA 1Y42X 1QOQB 1ZH0A 1ZK2A 2PXXA 3CEPB 4BYGA 1E2JA 4DARA 1X7XB 1WA5A 3O1JC 4H1VA 5CHEA 1QQ5A 4QEDA 1F8GA 4YQZA 2V4UA 4TMXA 1NSTA 1PL0A 4UQLA 4AN1A 2Y0PA 5HS4A 3RIEA 1A0OA 1PBTA 4GVLA 1Z73A 3DO8A 2XEDA 5C52B 3AHDA 5L3SA 1COZA 4QRDA 3UAOA 4HDKA 4FSHA 1CR1A 2P5TB 2H3HA 2HBZA 4KLRA 4MWZA 4UDXX 1MJ5A 4I6JA 2R48A 3NOXA 1V2HE 2O0KA 4MR8B 1GGJA 4PLHA 4X6YA 3STHA 3T9EA 2SNIE 4WZBA 4AY5A 4ZK2A 5DSTA 1IZ7A 5K05A 4AF8A 1GCIA 1TZMA 4JUCA 4RF4A 4EYKA 4EUEA 1X13A 5JZOA 1PR2A 4UXIA 4LISA 3VYSB 2JHPA 2QRKA 5DTIA 1K8RA 5FLYA 5IJAA 5K51A 3X1DA 4CT5A 1Y4DE 2HF2A 2KPOA 3H5VA 3QVVA 3CJRA 4OB8A 2EZ4A 3IQEA 3JVVA 3SU8A 4YXFA 1GJRA 1EK0A 1HNZB 2YYZA 2QP4A 4QPJC 2ZE5A 3B8HA 3AOGA 3G2MA 2E4WA 1JE0A 1QFSA 2FWIA 3BAZA 4MQ5A 4BNNA 3AG5A 3WWYA 2HIMA 1WLSA 1CS0A 2C78A 1J1IA 1RIIA 2Q5OA 4EI9A 3P4UA 4W7SA 4CQLA 5JS7A 1N34B 1K7EB 1ADCA 3G2IA 3OCUA 3W5IA 1V8ZA 1UKBA 3ANSA 5A3SA 4PR0A 5IVHA 3TQRA 4NAUA 5BV8A 2I22A 1BWRA 3NCHA 6YASA 2O8BA 2JIRA 2V96A 5AT1A 1Z26A 2DCMA 1KMHA 1EUDB 3LU1A 1Q1NA 3MWGA 3B6MA 1PD0A 8ADHA 1M2OB 3JZDA 3JPYA 3KLOA 1HLFA 2XUHA 4LY9A 5C8XA 4L27A 2BSAA 4XLZA 2Q0HA 2P75A 1UWCA 5ITWA 3V4VB 4JK3A 3R0XA 1G18A 1U0OC 1QOZA 3CN9A 1N5RA 4IRMA 2W9XA 5E0OA 1CUZA 4LK3A 4IIDA 3NHBA 3GDOA 3FWYA 4MLDA 4RPHA 3RIXA 4KSCA 3UMCA 2BFFB 4PR3A 3NHUA 4MVCA 4UNPA 1TO6A 3QLUC 4J29A 3UWKA 5CB4B 3E9MA 1HDIA 2BI7A 2WYVA 1N9KA 1RHUA 5DE3A 1F0PA 3HJFA 1C7QA 2CFCA 4KI0A 4LGVA 4MLCA 5T41A 3QKSB 2AZMA 1LSUA 4L75A 2C4TA 3DO5A 3ICPA 4XUDA 2D00A 4ZVLA 2C84A 5ALFA 4COKA 3Q12A 1GEEA 3W3AA 4WKPA 2YHUA 4RADA 3WHKA 2PJUA 2C9ZA 3UC5A 3S3TA 5JRJA 3GVIA 3O3CA 3T5TA 4BECA 2O2DA 1NLYA 3NTLA 4GOJA 1D4ZA 4JJEA 5JBQA 5HQJA 5BOSA 4D82A 2POQX 1HY3A 3R7FA 3GHHA 4YJDA 3OZUA 2HLDA 1XFDA 4GDMA 4MCAA 2XNSA 4TMKA 4E2WA 2JC3A 5KYWB 3ZHVA 5M34A 1SD1A 4TM7A 2O6LA 1C3LA 5ESDA 3A9TA 5C31A 1FFHA 5B4TA 3RJ5A 5IYZF 3GB9A 3EC2A 1TM1E 1LDBA 4G0WA 1Z2DA 1FSFA 2FSIA 2VDNB 2L18A 2ACWA 3EOBI 4P3PA 1AV7A 3BMXA 4I50B 4RVOA 3V2HA 1SURA 4BQFA 3NJ8A 2QT0A 4L9SA 4R69A 2QLFA 2GCIA 3IOEA 4GPD1 3D8SA 1IPHA 3F78A 4Q7EA 4YFVA 4BCDA 2PH3A 3RF7A 3KKMA 2IS6A 3GXOA 2QAGA 3H42B 1VSVA 1ZHOA 2I3DA 4ZFNA 4LSWA 1O03A 1YOVB 3G1TA 4BB9A 2J8ZA 2ZRNA 3A3OA 3DD5A 3NYWA 4ARSA 3KV3O 2I78A 5CCEA 2R60A 3I9LA 1EDBA 3AR2A 3C6MA 1OTHA 3BL6A 1J0CA 1DAFA 3LCRA 2HCTA 4DLKA 2CVOA 5KI6A 3DKKA 5GWXA 1GU1A 1EU1A 3GDWA 4YP9A 2F67A 3DF9A 4YDRA 3I23A 2VYFA 3TR6A 1SHUX 5ESXA 3I5XA 3I45A 4MR7A 4EWLA 4XOIA 1F38A 3CSSA 1WB4A 1I3KA 3NM4A 1EAMA 3KJGA 2PUTA 1UBTS 5CG2A 2VEDA 4YC7A 3L7AA 4KUHA 3CMMA 4L6CA 1JH9A 2VHJA 1Z6AA 3C4QA 3M6AA 1ULTA 4LOIA 2TSYB 3RRXA 1K27A 5LBUA 1O97C 2OFFA 3RUEA 1EBBA 4HY3A 3TIXB 5AKXA 2I2FA 2P8JA 2H1LA 3E84A 4GQIA 1P1KA 3D4PA 2VHVA 5FJJA 3FNBA 3FSRA 4BIMA 1THZA 3SDBA 3G85A 2R7AA 5CXSA 4PRZA 5IM4F 5CX1A 4EF4A 1RT9A 3L4EA 3Q6NA 1LBSA 2NW6A 2VPPA 1NMYA 4DG5A 2QUKA 4QECA 1WPXA 3GLHB 2VSYA 4C78A 1LKZA 3B1FA 3IPYA 5ALDA 2ZYDA 3X2FA 2F8LA 4ZQFA 3A4LA 1VZ2A 2A92A 2V65A 3Q8WA 3AF1A 2ZSFA 4PG4A 5DLEA 5D87A 3SC4A 2JLXA 2PNJA 4M86A 2P65A 5LD2B 3K7EA 1IFXA 4OB6A 3T38A 5J3JA 1RIFA 3B36A 5AKLA 3ZUPA 2CSXA 4HD8A 1IUOA 3E81A 3ZS8A 3I39X 4ZOQI 4G0VA 1UJ5A 3B12A 4MAAA 2DKFA 1E0DA 1R3UA 1KI3A 3LY9A 2Z8YA 4J49A 5B6IA 1EHYA 4ZVKA 3QE2A 5D3KA 4CQMD 1B6TA 3RLIA 3H4TA 3LF2A 3BH6A 1SCIA 3JQAD 3ZLBA 2FB9A 4LC1A 4NYJR 3UUWA 4MZXA 4D25A 2AOTA 1E1RD 1TM7E 1JAIA 2GBFA 4MS4A 4OUDA 3S81A 2EBWA 4MROA 3KSAC 2UZ1A 4WOCA 2VAPA 1HRDA 2ATCA 1LX7A 2JGNA 3MNFA 2I80A 4OM8A 2NSDA 4GPEA 3UW3A 4A1OA 2NU7A 2DH6A 4Q1EA 4L78A 1CWUA 1OCEA 3SM9A 1IXRC 1RKVA 3ECSA 1X7XA 1C41A 5T4EA 4W82A 1ZOPA 4HGNA 5AVWA 4X66B 3WLPA 4U1RA 2O8CB 1OIWA 4RKFA 1CD5A 1CQIB 4MV3A 2E4UA 2GJ9A 3BRQA 3FUWA 3QU4A 4RMGA 5CM2Z 3DPIA 3N5CA 1BA2A 4RK0A 2PUAA 4LE1A 2HLPA 1CF9A 3PVZA 5BUCA 1I80A 4R4JA 1C8KA 1YDHA 3B7PA 4Q9JA 1V5GA 1RPAA 4MR8A 4LV8B 3ZN2A 2XBMA 2PT9A 4K1LA 2J3QA 4MEBA 2JLQA 721PA 1E2IA 1JXQA 1TVEA 2C92A 2Y6UA 3O31A 5B2ZA 5ITVA 4FX5A 2H52A 2VRNA 1JTFA 1OXVA 3GA7A 1KERA 4O2AB 4QPCA 2PX4A 4DYHA 5JU6A 3VO9A 3FTEA 1OXMA 1UFKA 4D6XA 2D0DA 2VPIA 2D8AA 3L1UA 4NCNA 2HA4A 2H5LA 4WUTA 1Y48E 4ZVRA 1LFDB 1X86B 3AMVA 3WKEA 3KVYA 5I7AA 4E2YA 3QEBZ 3P2KA 4BEBA 2JI4A 3RWBA 3ZWMA 3R41A 1I6LA 3KQNA 2WHPB 1PQWA 2NT4A 1UOOA 3I52A 3QPWA 1PNQA 3Q7IA 4WXEA 2XUAA 5KOHB 5C7IO 2AMJA 2Z57A 4QXRA 1YMUA 2WNSA 3A1TA 2BISA 3CE6A 4H0CA 1BVYF 5B7GA 1RBZA 1WPRA 4AZ0B 5KQPA 3FYDA 4C03A 4HPXB 4QM6A 3LFUA 2QTTA 4Y6SA 5B57C 3MTJA 3HP7A 1EUDA 3QVLA 1XA3A 3CVYA 3S2IA 1M2OA 1Q44A 1Y9DA 2EW1A 3KVRA 1E1LA 3GPDG 3MD0A 4CMEA 4ZRMA 3FZYA 5ALYA 1AHNA 3QEKA 4GLLA 2HREA 2J6IA 1W46A 3AERB 5FI0B 5T57A 4BO3A 2CCGA 2IOFK 4KH1A 4PHCA 5EIAA 4C5BA 2C3UA 4D8XA 1QH8B 2XNJA 1P7PA 1UPFA 3LXUX 2ZDHA 3D7SA 4C22A 3RSQA 2BFFA 3EBOA 4PLPA 1UKVY 3EYWA 4EBFA 3L8ZA 1CR6A 3QX8A 3M1AA 1JA1A 4JU9A 2WJZB 4OHUA 5F7ZA 4ZT5A 5CB4A 4LKRA 5AJXA 1Q7EA 1LK0A 1QKKA 4LFCB 3OEWA 2MR6A 2GZRA 3OPQA 3QKSA 1H5QA 3DMTC 1Y9EA 1UQTA 5TR9A 2X15A 4MUFA 1CZLA 1FBTA 2WWRA 3M5CA 1NN0A 1N7IA 4ZU1X 4DILA 4DR1B 3ZDQA 2O3QA 1JDUA 4UE3S 3NWOA 3DZGA 3QUQA 4G41A 4KXLA 4NCHA 1MZPA 4JIMA 2YASA 1XCBA 1EB8A 3L7KA 1LV7A 1G2PA 5J1TB 4JLWA 3SC3A 2JGLA 4YXWA 5ARCA 3TRJA 1PL8A 2FWPA 2OZVA 3KALA 3SP1A 3UIEA 5BR7A 5ISMA 2HK6A 1QF9A 5TS2A 2IXDA 1RYDA 4JXKA 1YI0A 4M9SA 1JBEA 5CW2A 1QX3A 3SEAA 4D3SA 5KYWA 4IY1A 4CGZA 4C4ZA 2Z4TA 1EFKA 1PE0A 1U7PA 5CM8B 1YBHA 3PZRA 4HGZA 5E6RB 1OI3A 3U1VA 4WHMA 4KRGA 5I7OA 3EWAA 1Z6TA 3FPAA 5TVGA 3H0EA 4I5GA 1WUTA 4RTMA 5GJVC 4I50A 1BXKA 1I7QB 3FI9A 1D0SA 3FRJA 5BWOA 1XDSA 2GJKA 2QUIA 1IOLA 3R3UA 3ILYA 3MQ2A 1W73A 1G8JA 1Y3DE 3IVCA 4ER7A 3L4BA 4ENVA 1T4GA 4N65A 1TZCA 4WX2B 3GNTA 2GOYA 3ZNQA 4N3AA 3FZQA 1KRWA 1EWTA 4QWMA 5TPWB 2WUGA 1C30B 4NE9A 3BWYA 4EA6A 3EVAA 3PNBA 3HB7A 3MLAA 5JY6A 3R0IA 5FPSA 2H1RA 4XWKA 1IM5A 4MQMA 5FUQA 3S70A 2O3JA 4LHZA 1XCGB 5IFKA 4F3CA 4DANA 2HMVA 1L4EA 3N0VA 1J2RA 3HU1A 2H2WA 1P8AA 2GXUA 3GGJA 1FQWA 1R66A 2QSJA 1V9LA 3GC6A 3IJEB 2EQAA 4IWXA 4JL5A 2OP0A 4RD4A 3Q11A 4W1PA 4LJRA 3X1YA 4U63A 3AO0B 3QRWA 2ROQA 2I6UA 2YMMA 3I3SR 1Z0ZA 2V55B 5FOWA 4II2A 3TQTA 2PGXA 3ZDBA 4LYFA 2VP6A 4I8XA 5K4HA 5J5VA 3DT8A 1S2OA 4NATA 2EJWA 1OFUX 4U9IS 4AKHA 2YV1A 3W1VA 5AW7A 2HU5A 5E6SB 1BWSA 3MSCA 2AG6A 2P2ZA 2VBGA 2VQ3A 4OIFA 1N77A 4ZDWA 3KHUA 1U1EA 3CLUC 5SZJA 2ZPUA 2XUIA 1KU0A 1U0SY 1YWGO 2EFGA 2VF4X 3GNLA 3L7OA 2NZ2A 3PQ6A 3KD3A 3R3SA 4HR7A 4CCSA 4FFNA 1H3FA 3AHJA 4IG4A 2BHNA 4RLSA 3LHFA 4RHEA 4F7WA 1OGJA 2AV6A 1TTQB 2DPHA 3GLHA 4RENA 4DM3A 1IUKA 3ZD7A 2ZATA 2YWRA 5F2KA 5TQVA 2W2PA 4MZDA 1YMQA 1CRQA 4Q4DA 3E1SA 4IJVA 1GPUA 2AX4A 4IHQA 1CF4A 1QJ4A 2XRZA 3Q8KA 1Q1EA 4IO0A 2Q6IA 4DPLA 1U3DA 2EJVA 2PX8A 3UHFA 2ASVA 3GQVA 3J7AC 2YZGA 2WF9A 4DCMA 3V1MA 2AZTA 4BO7A 4D9JA 2WICA 2XB9A 1FTYA 2XYRA 4URUR 3ZIUA 4TXJA 5K3CA 1T8SA 2FTKE 1KO8A 5CPFA 1FDSA 1YRQA 1T5BA 2VATA 1QV9A 3FCAA 2C9MA 4H0NA 1JECA 4ERXA 4UTPA 3E2IA 5K6AA 1QFJA 2H7YA 2QJOA 5K3FB 1PLJA 2QM7A 2YH2A 4QA9A 1FDVA 1QGZA 4O08A 1Y3AA 5KQGA 3PNYA 2IHZA 2ZB3A 3TPZA 3KZ1E 2NZVG 4GOXA 1ZINA 3P0IA 2JK1A 5HIMA 5DJ5A 3LIPA 4F8JA 1T3SA 3OZ7A 1J8FA 3GCGA 2QL9A 4CWAA 4E13A 1KIFA 2DOKA 4YP7A 1ML3A 1ZC4A 2O8CA 1CQIA 2XMDA 1G8HA 3TTUA 4FKMA 4WK0B 3WDSA 4KYVA 2ICAA 3ML1A 1DO8A 1SHZA 4MVJG 5LSAA 1KK1A 3LC7O 3SN6A 4Z7QB 3N3BC 3QOWA 5A5VA 1QF7A 2SICE 3H86A 4O3MA 2A4KA 2DEUA 3N1UA 1ZOLA 1G4UR 3A0RB 1J0DA 2IS2A 2YN2A 5CMLA 5FL3A 3ZQUA 2RHDA 3ZJTA 2C9CA 3FWKA 1RRFA 4GC9A 2E48A 5CITA 1VA4A 1XNHA 1MA3A 4GXQA 4O2AA 5K0BA 5TMPA 3ZJYA 3UV6A 2I34A 1XZCA 3G2QA 3E9RA 4LRYA 3IEVA 1XROA 3HBJA 2Z30A 2Q1TA 3B1WA 1PFYA 3U4AA 2Z2KA 3DBLB 3ROEA 3BHNA 3UJ8A 1UF9A 2Q3LA 1ZI9A 3F7MA 4L85A 4EJSB 3RM3A 3BIFA 2BJHA 4QM7A 2WHPA 2LBPA 3F7OA 3GT3A 4LA4A 4DSAA 1NW9B 4G0QA 3MBIA 4W5JA 5KOHA 4FLFA 4FT2A 2B9EA 4E31A 1IY0A 2H1VA 2GJ4A 3ITEA 2H4FA 3NJRA 1MJHA 1XCMA 3CBQA 3BSWA 3ELDA 4AZ0A 5IKPA 2UYQA 1B73A 3IULA 4JAVC 5DX0A 1A9ZA 2ZWVA 1BG6A 1O9BA 2CFOA 2ERCA 3L79A 4C4AA 4DCTA 4GRAA 3KZNA 4YLGA 5A9RA 4Y6GB 2DR2A 1EE2A 1W2WB 4AF6A 1I6KA 2OT3B 4IQFA 4W4TA 3U9TA 2XQFA 4ANFA 4HAWA 4C43A 1UADA 2MOKA 3AERA 4G09A 3H11B 1NLMA 2PEYA 1QH8A 1CCWA 4P7JA 2QRZA 1HTBA 1XP5A 3AZQA 3PX7A 1IZ8A 1Y8AA 4MYSA 3GLHE 3TOXA 1UBSB 2H4YA 3OLVA 4MRVA 1NVXQ 4Q03A 1FNSA 4D9BA 1W5EA 1IBSA 3TLAA 5H0IA 3PRKE 2KYRA 3I6BA 4CHGA 2R65A 3VR3A 1IJEA 5FORA 5A0TA 3IAS1 3KT6A 1C3OB 2BFMA 2BGMA 1HG0A 2CYAA 3DTTA 4BJ5A 4BRZA 1P9NA 4HNRA 4FWIB 4NQZA 4EA8A 4U2DA 1SOVA 5EHXA 1JT9A 3WQQA 3OIUA 3VJLA 2Z1NA 3D6AA 4CMEC 1J7KA 5KQLA 1UKEA 1OFVA 2GR9A 4HWOA 2ZIXB 3TUIC 1U0EA 1P1CA 4BFXA 4EHDA 3PDJA 3WG9A 1L4NA 1R6BX 1XVLA 1KZ9A 2R11A 2YY6A 4RQBA 5E3HA 3GWZA 3K5HA 1P4RA 3N58A 4L5CA 4NARA 4QC2A 2BZ1A 2D2XA 3H9QA 4UU0A 4DLTA 3KKEA 2P78A 1KNQA 5KVQA 3AUUA 3FHJA 3BT7A 3ZQJA 1ATZA 4L95C 1TCBA 2ZTHA 4ZQHA 5E6RA 2W48A 4UOEA 3FOCA 1OX5A 4G56A 4IS2A 4O29A 3N2KB 4QXMA 5ALRA 5LBTA 3E9ZA 3QBVA 1NW4A 1U4OA 2HBYA 4HN4B 4IQ4A 3M6WA 1XZIA 2GYVA 3Q40A 4PHHA 3CX7A 2PXHA 4L57A 4YBRA 2CDAA 5FV4A 2MSCB 5KSOA 1MB9A 3DM9B 5CXUA 3L4JA 2A1UB 4KRYA 3NS7A 3EPLA 1SBIA 2DJIA 1AVTA 1IZZA 2Z6VA 3AVOA 4UATA 2RIPA 5ETJA 4MQ6A 1MEOA 1L5WA 1Z7BA 3QWAA 4IOKA 2J41A 3H3JA 3KR0A 1QMGA 3ZLVA 5TPWA 1C30A 3ZVKA 4RH1A 2PGNA 3K8OE 4F7DA 1JL3A 2D1QA 1OVGA 4BCCA 2PQ2A 4QGGA 3NOVA 1V45E 3KOMA 1FF9A 3PKZA 3A32A 4UHKA 4BNXA 2E6KA 2FR0A 2WG2A 2PCJA 3CB2A 2OCXA 4QT0A 1T5LA 3CPEA 4M2LA 3RBXA 3KEFA 3D5TA 1MC4A 4L1KA 4CM3A 3OT1B 1WMAA 2W6PA 2BJWA 4NCBA 4ZU6X 3SICE 4B8ZA 1XJQA 1KF0A 2WM2A 3E0QA 3I92A 5BXQC 2ARKA 4K86A 4OP1A 5C1IA 2P2NA 5YASA 1OKKA 1YR3A 1GTG1 1I2ZA 2O5RA 3O91A 4M3NA 4AIIA 3L4BC 1V2GA 4Q1AA 5JFTA 5AVZA 2NVBA 3GJ4A 4DHWA 2HJSA 4F9FA 3Q3HA 1CUUA 5CD9A 4ZWNA 5FRDA 2ZE7A 4MW6A 4A0SA 4EITA 5E6SA 4ZA2A 2IVZA 5KOIA 1E69A 1MG5A 2RKOA 4DNFA 5JD5A 4AO6A 2WW8A 3ILHA 4KITB 4G25A 3HJHA 2PT5A 4H7PA 3TNDA 3PUVA 3WNCA 1VI6A 4PVCA 4ODIA 2WWVD 5KKNB 3L0DA 2CFRA 3K9QO 1PVOA 1P5ZB 2OGWA 2I6QA 4XUEA 2C7QA 1K6MA 2B92A 5IEBA 3OKFA 4CMKA 1M1YB 2QTZA 3IS3A 3L1IA 5JC1A 1HEUA 1OH6A 4WJLA 2DLCX 4MUMA 5CVJA 1TK3A 3K1AB 5FNZA 3NHWA 2FKNA 4GBED 2YWXA 3G2PA 4JFRA 2QLNA 1M2EA 3DQZA 3TZ6A 2A9KA 4RQTA 4M7OA 3WGUA 4M46A 1QU2A 2NV6A 1F0KA 2RSLA 3G5UA 3LO8A 3A4VA 3CT6A 3HABA 2RGGA 3I04A 5A4IS 2C29D 1ODJA 3IGFA 1QIJA 4KLZA 2W42A 1ENOA 3W6OA 1A97A 5LYJB 3A6DA 1VSTA 3EZLA 4HAZA 4QX6A 2RI0A 1T4CB 3WK7A 4ME6A 4WTOA 3FMPB 4G1EB 3NRCA 5D3ZA 4LPSA 4LYYA 3IC5A 5K0NA 1BGVA 2EZUA 2DGDA 3RUDA 2QRQA 3M2TA 3H2BA 3D3KA 3WNVA 3SFTA 4D9IA 1Z22A 2D1TA 4MIKA 5K3FA 3A8TA 1G63A 4P34A 4AJIA 1KYZA 1EAYA 4KQMA 1DKQA 4QDKA 4ROSA 2VYVD 3ZDZB 3GLTA 1KR2A 2PH7A 4JJKA 4UJ3A 3TSWA 4B3BA 1BWQA 2MR5A 3IJPA 3BA1A 3LOUA 1USWA 2B6NA 2X5JO 5CFQA 3AJ8A 1J2YA 3SHQA 4EVIA 4IIHA 3RW9A 1FYDA 1Z4KA 4YV1A 3A4TA 1MH1A 3V4LA 3GDGA 5FTMA 3ACCA 3MT9A 5E7IA 2IY9A 2QLBA 4G1FA 5G40A 4E5VA 1C9KA 5BVHB 3FWZA 1QG2A 1GPH1 2JFVA 2ZT6A 5DGXA 4E2FA 4O0MA 1N32B 3M70A 3HYLA 1V6CA 2MTBA 1IXSB 1EP2B 2EVWX 2UZ0A 4KJZA 3ZI7A 4CI9A 1WU7A 2M6RA 3CZ5A 3UJNA 1WDMA 4YRMA 2G25A 4IIJB 1D04A 4EF5A 3SSAA 4QJIA 5TPZA 4BVHA 1KQGA 3KHKA 3T34A 4AJHA 3VI4B 4CYMA 1AHHA 2PU5A 4PGGA 4R51A 1BHQ1 3V1LA 4P4SB 1COWD 3DBLA 2CXQA 1JXAA 1X2EA 4EG0A 4EJSA 1TCUA 5EVJA 5LMZA 2FXIA 1JU9A 2JIZD 5EJ7A 2Z95A 4MCIA 5KWVA 3KWJA 2XVMA 1TVKB 4JLUA 4M88A 2D0IA 3OOEA 1JW9B 4XARA 5FNVB 2FVXA 4X64B 4BGEA 5DCUA 1ZEJA 4DDVA 1FCJA 2XZPA 1E3IA 5EPUA 3RGWS 5JROA 1I24A 1WXXA 1CK4A 1SFRA 3F71A 3HMQA 3PDHA 4I99A 1PK9A 4DLWA 5CJPA 4D4GA 3WGIA 4GQAA 1ZW6A 2OKCA 3DXFA 3NEJA 3OOSA 3HRHA 2R1VB 4I9UA 3MA0A 4I6GA 4ND1A 4RPIA 5JCJA 5M29A 4DA0A 1ZGJA 3PR1A 2Q49A 2JARA 3MT7A 3B9RA 1OZAA 1Z29A 3X1ZA 4JI3B 3V6LA 1SZJG 3A0UA 2FZLA 3S27A 1A5BB 4RVDA 2X9GA 1R16A 3H11A 4PFJA 4TL8A 4BBJA 4D5EA 1N78A 3NWPA 3VU3A 3ZTYA 3W77A 1YQGA 5DNUA 1V5FA 1XZFA 1MXHA 1S01A 1JSLA 2VCYA 4LJ8A 1U7UA 1XTVA 3KIPA 1E3JA 2A30A 1QMPA 3H0KA 3BXGA 1NC3A 2PQMA 2YOGA 3SC2B 1A5SB 3KUKA 1WZEA 1KH1A 3OA0A 3WGKA 2QT9A 4RLQA 2NTNA 3PYXA 4L6AA 2BHSA 5JAUA 5EG5A 4A0FA 4DLZA 4CV3A 2E6UX 1C3OA 3EWIA 4XIYA 1HDCA 3AM4A 4HJXA 1YBVA 4DTIA 3EHDA 2IEIA 3E61A 2VTBB 4BX3A 3LFTA 3M4JA 4P0PB 1NIPA 4DBZA 4DV2B 1VRCA 4QVGA 2RJ3A 2ZIXA 1XTTA 2Q5FA 2QAIA 2Z58A 3EZFA 3IQFA 1J0BA 3NXKA 3PHBE 2VK8A 2AQIA 4F6RB 3AUYA 3WLOA 1W5AA 3GUZA 1MA0A 2B36A 2NZYA 1X7GA 1Q92A 3O9ZA 1FNMA 1RU3A 3OEED 2GZ3A 4JJ6A 4MDYA 2BDUA 2CXPA 2VPQA 1G38A 4LHYA 4CT4B 2CLKB 4I4TB 2O7QA 3N2KA 2AXQA 3BTUA 3IMCA 4MYUA 1JS1X 2QTFA 2DE0X 5EHQA 3JYLA 3IR6A 4MUJA 2QPOA 3TI9A 4XB2A 3EA4A 4P3NA 1HTTA 3I5MA 4EJ6A 1PKEA 2A1UA 1UKCA 4AMBA 4CPDA 4WWHA 1U8TA 4GKVA 2PGJA 5FQNA 2QZ4A 2AFRA 2R00C 4R5HA 3ZDDA 2I6SA 2GDJA 3F6YA 3DC2A 4OLFA 3SQNA 5IDWA 4HMPA 2I9PA 4I14A 2P3SA 1E18A 3A7DA 2ACVA 4FI3F 4I2NA 3JD4A 3UJAA 4C6TB 4UD6A 4HJRA 2C7OA 4DG9A 4R7ZA 1HSOA 3C43A 4TLLB 3I34X 2FA9A 1RZRD 3NLLA 1CJKC 3BXZA 2JF0A 3QFFA 4E6PA 1LNQA 4RDHA 1NQVA 3C3KA 3HYSA 4XJVA 2RGAA 3TQOA 2AYXA 4UXJA 3AVWA 3ONDA 3SNKA 5KNDD 4RIEA 2YDXA 3TTXA 3OT1A 3N2YA 1DJPA 3INGA 3NTXA 4PQRA 4ND2A 3UTDA 3IQXA 2LDBA 2BFNA 4XYEA 4YRNA 2ZANA 3JR3A 1Y8ZA 4BQNA 4ZANA 2EFJA 1AKUA 1WCYA 1XQWA 2FR8C 2VT3A 4GWKA 4N7BA 5EI5A 3T8YA 3L1KA 1HPLA 3DDNA 4ONEA 3H1FA 1WULS 4EZEA 3QF4B 3PXAA 1CHDA 2B1RA 1XI2A 4BP8A 4ZHQF 2O1EA 4ZAZA 1D9XA 4JT4A 1ZC3A 2ZRKA 3O8LA 1JJIA 2IXBA 4H0FA 3L05A 4ITVA 3MCTA 4O2LA 3TEFA 1XHLA 2J3EA 2J3LA 3FPLA 2OBBA 2OO5A 3FXAA 1TVCA 1E5LA 1KFKB 2R8RA 4EMTA 1I7NA 2UDPA 3CR3C 3ONNA 1C8VB 2ZTVA 1MV8A 3R5SA 4JA2A 5B55A 4Y2PA 4DZRA 4X85A 2WVJA 2R2GA 3RGGA 2PLNA 2FN3A 3JQ8B 3MUOA 1QZ3A 2X86A 3O3MB 1M1YA 3PPWA 2FFAA 2WJVA 4KX3A 3DWGA 4IIXA 5L40A 3X1JA 2TMYA 3UHPA 1A5AB 3D4OA 3F5SA 4KQXA 4OQQA 4P35A 3K1AA 4XRGA 2P2CA 3DONA 4QUIA 5ALSA 2YDYA 3ZJVA 4M7RA 1P3JA 1G5QA 2CJYA 2FN9A 4FBMA 4I1YA 3KLPX 4N8SA 4YRQA 4COOA 4TTJA 4Q3AA 3C3MA 3LHIA 1ZP6A 1E7WA 4L3WA 1E4YA 5DNCA 1BE6A 1TXGA 4LF5B 1Q5PA 5I3CA 3HFJA 3JAKB 3SHFA 2QG9A 1AKVA 2XLCA 5JO0A 4TRRA 3L0SA 1RAHA 2Z2YA 5LYJA 1T4CA 3KL2A 5BQ5A 1U4NA 5FR2A 2ASEA 1NJFA 2FJPA 2O1SA 3HBMA 3LV8A 1X80B 2VDLB 2YX1A 3FSJX 1E94E 3J81A 3ETDA 3NVAA 4G4SO 1U0LA 5F35A 4LMAA 3L77A 1E2BA 4PY2A 3RRFA 1H93A 3AP3A 2QRLA 1YCFA 2JIPA 5JG7A 2R62A 1K8QA 5JPDA 4G07A 3C3XA 5JHHB 5IT0A 4X00A 4QXOA 2XZTA 2P1RA 2HK7A 4RY9A 4BAUA 2IS1A 4JX8A 1VFNA 2F17A 4JLBA 2IXAA 1KJWA 2PAAA 2CD7A 4DJFC 1A7AA 2B4YA 3MGKA 3EXHC 3SEQA 4YR7A 5BUSA 2VVTA 4JEUA 4TTRA 2ZJYA 4EX6A 5K2OA 2PKQP 1LW6E 2NWQA 4KYIB 5DN6A 3W4IA 3STVA 3CKMA 3OFNA 3VPSA 2IKSA 1UIRA 2Q5EA 5B1EA 3P9YA 5JZVA 3I3OA 2ZI9A 5BVHA 3BOSA 5JDCA 3FNHA 2CHEA 3GIWA 3O6VA 4MHOA 1JKFA 3NHZA 4IGEA 2JBWA 1Z16A 1HK7A 1KMMA 4N5DA 1N6NA 1P7VA 1JF8A 2IUTA 8ABPA 3ITKA 4ZXFA 2R47A 4IIJA 4O2BF 1B0ZA 2LGJA 4MXDA 4NG5A 1NF9A 2CW5A 2LIVA 1OU4A 2WFAA 3MJEA 4NFYA 4XDZA 1CNFA 4B3MB 3O03A 1N33B 5TSDA 4HFNA 3C39A 3UK0A 2O5EA 1QWOA 4QASA 3GNSA 4C76A 4F96A 3KLBA 1M8JA 2IYZA 4JBYA 1JZSA 4P4SA 1Z2PX 3O73A 4OY3A 3BIOA 2GLUA 4HH3C 1JALA 5HBRA 4S1NA 4YRSA 4PBSA 3SZOA 1ISHA 1C9JA 2H2FA 5I9BA 5BPFA 5B4UA 5LVAA 5IJWA 1EX9A 3QFRA 4YBZA 2Z0MA 1TVKA 4L15A 5FNVA 4DLYA 4EI2A 1JAZA 3N9IA 1GTJ1 1SIUA 2X42A 4JQSA 1CDOA 1L5ZA 4QTYA 3IBSA 1W2GA 3PX3A 4CL3A 4DA9A 3F97A 2XOKA 5EMHA 5EIBD 4B4WA 1JTVA 3NXSA 4AJLA 4BRSA 4CR8A 4DCNA 1FB5A 2R1VA 2X5KO 2VEOA 2J3DA 4DRXB 1ORWA 2XYHA 3KE9A 1B23P 3MB8A 2D8MA 4OK6A 4Q00A 3TB4A 3VOAA 1LQUA 4WFQA 5EJIA 2F4NA 4DBLC 1B14A 2DQZA 1G3QA 4OF4A 2A1TR 4XM0A 3LBHA 3AWIA 2RGBA 2RG1A 5H4GA 3E8XA 4GR5A 3S4YA 1FDWA 3GEIA 4YRZA 4A3SA 3MMNA 1H1TA 2G04A 2ZYUX 3CRRA 3UT0A 3FYTA 4EJSC 3DBVO 1JH8A 3EVFA 3FB4A 4L9RA 3UXEA 3P5SA 5H68A 4D8YA 3O94A 3SC2A 1KFBB 1M1YE 1YUMA 2BEVB 2J08A 3CCBA 1PHRA 1TEVA 3QYJA 1QRRA 1U3GA 5TARA 3ILSA 2R8EA 3D8RA 2QN3A 1PW7A 4GPTA 1T6NA 3RE1A 2QTGA 3BIJA 2IPMA 1LPMA 5CDYA 3RS8A 4E51A 2WYWA 2GKSA 2O4CA 4GX1A 1GG9A 2FQXA 2A5DA 3PYLA 4KBGA 5B37A 1ORHA 2P5SA 5A4FS 1CY4A 2OY0A 2HA7A 4MJXA 4MRRA 4YAUA 3CYFA 2VTBA 2GESA 2H5EA 3I32A 3NU1A 4ZI7F 2CB0A 2Q2WA 4H1WA 1QDEA 1S8NA 4FS3A 3PNLA 2BN4A 5B7NA 2W93A 3K8QA 1NONA 4A8PA 3K71B 2WV9A 4FHCA 2IEYA 4F6RA 2J0UB 1YHZA 3G59A 1JEQB 3K5WA 4F1KA 2IKQA 3GW8A 3L84A 4R16A 3T6KA 1EUQA 2OZPA 4C2BA 4R40A 1PGQA 4HAIA 3KT3A 3P2MA 4L0MA 3F96A 4EAQA 4YUVA 1R0RE 4I4TA 4QFMA 3GAFA 1SAYA 3CX8A 3VPXA 5DP1A 3ENNA 1XVUA 1GV1A 3HXQA 2IGBA 1N2XA 4RXTA 1PDWA 4JBLA 2DM6A 5BN4B 2JCVA 2XMSA 3FCCA 5TJHA 3LK6A 4BPBA 3PEYA 1KAMA 4BMOB 3UWPA 5JEEA 1SD5A 4X92A 5A02A 4WH0A 3OSUA 1XDBA 3FM9A 1HURA 3W34A 3IMFA 4QRIA 3RT9A 4BWYA 2Z9DA 2YVLA 4WUVA 4C6TA 1WCV1 2YRFA 2FHSA 2I7XA 3HGMA 2O54A 1H3EA 2I4MA 4CKZA 2IYRA 2J9XB 3QEMB 1C8LA 5DRTA 4XM1A 1KP3A 4P2GA 2H4JA 1AQYA 3HG7A 1V3QE 1YRAA 4IYRA 1FLVA 1L7PA 1ANKA 2ZEJA 3VR4D 4BO0A 4KWTA 5E1MA 4UAJA 3F3KA 1KZ4A 1Q15A 3H04A 5A3VA 3JRWA 2PPLA 3C8DA 1G8FA 3UEOA 1IIRA 2EZ8A 2BHRA 5CDUA 3IFSA 2R6CA 4ASUA 4P1ZA 1GTRA 1A2QA 3WXBA 4WBXC 4HMOA 1RWPA 2NYUA 2WIKA 3QF4A 1XTBA 2G7MC 3ZHCA 2V45A 2CLCX 1LF0A 3WAGA 3ORRA 5A7FA 1XMIA 1I01A 1XRRA 2NSLA 1EGHA 1E2KA 2PA0A 3BSSA 4N8EA 4RZIA 3B9QA 4RULA 4RDXA 1W7AA 2J5BA 2BL4A 2I67A 1ZM7A 5BNFA 3R7SA 2AR9A 2W11A 2FFJA 1FU8A 1N2GA 1BCSB 3ID6C 3IVRA 4KQCA 4Q9NA 4TT8A 4B3IA 5K3EA 1BAPA 4J6EA 4MGIR 2HL6A 3SEZA 3JQ8A 1Y7TA 3CBGA 3AUTA 4Q39A 3C16C 1RQRA 4G4JA 3GEBA 5ENVA 4MPRA 1ECFA 1Y8QB 4X54A 1Y1SA 1F3OA 3JQQA 2D5BA 4DUGA 2IEDA 4YO7A 2E49A 2FZGA 5AW9A 4EFNA 1F8FA 3ONWA 3PGA1 4LHSA 1G6Q1 2PV7A 3N76A 5L4LA 2Z6UA 4EHHA 2QTNA 4UHEA 2R5WA 5AHRA 2HN9A 5JYBA 16PKA 1HGXA 2WM3A 2XV1A 1JEJA 1T0HB 2GPTA 2GN6A 2OMEA 3JAKA 3BH0A 5J59A 4ZDIA 3P0RA 2PSSA 4C2TA 1JHZA 3ASYA 2D6FA 2C1XA 3LPMA 2FWJA 3IP3A 2OO5C 2ZWOA 3WOVA 2OFOA 1LY1A 2Q9AA 4EPWA 4IDAA 5TS3A 3V80A 3HJGA 4DSTA 2A4MA 2E4AA 4DQXA 1WXHA 1SUWA 1X80A 1X9GA 4XUGB 3BB1A 4FNAA 1IDOA 1EIZA 1K7CA 1PGNA 4D9FA 5D2CA 4PTZA 4Q21A 4BLRA 4F2HA 1FRFS 3WWOA 5CLLA 4TOIA 2CWWA 1EDDA 5DNWA 3W6PA 4K0RA 1CTQA 4QAJA 5IBPA 3M83A 5PGMA 1LTQA 2HPZA 5CIYA 3P26A 1RFLA 4ND8B 1EA5A 1MIHA 3KSZO 2Q7XA 2VH5R 3PD1A 3WLIA 3PG5A 1XZQA 2DULA 4K88A 2ZI6A 3IE0A 3S29A 3DMYA 4E70A 3E53A 2I7TA 3EDRA 4JSTA 3OZBA 4F1WA 1M6NA 1DRKA 1LZKA 2XD9A 1J7JA 1OUMA 2RK3A 3RASA 1F4LA 1FMFA 1L4MA 1PVDA 1YCHA 3G17A 3PBKA 4EELA 3SIPA 2HF8A 2ZJBA 5D1NA 1SRRA 1MH9A 1MQ8B 4MQFB 4V1CB 1ZR4A 3D4BA 1PT7A 3FZNA 4OGFA 1U2RA 1AS2A 1Y6ZA 2WQZA 2C59A 2B0JA 3DAPA 4Y0VA 4R83A 3HM9A 2ZLBA 1H94A 2OC9A 2ZJ6A 3AB8A 4LYEA 3NANA 3PDUA 4L4SA 3ZCTA 4XGKA 4H31A 4F9TA 2ISCA 2CZQA 3H75A 4B2IA 4B34A 2BM8A 4BMCA 2P2DA 4LVOA 2ZIAA 2RHWA 4XYBA 2C00A 1AXRA 2D1RA 3GMTA 3QWFA 2JJMA 1ZHFA 3V7FA 3LHSA 3HGQA 4M9ZA 3A6HA 3QW4B 1Z6PA 4QOSA 3USES 2M9MA 3G2LA 1EFDN 4YTEA 2H2AA 1OXSC 3MOIA 1B8VA 1DDGA 3I05A 1G291 1KDOA 5AJYA 1TPYA 3W5DA 3ZNPA 1YFJA 3LLSA 1C1DB 3Q3VA 2O5CA 4D0LB 4GGPA 1OB5A 3QE4A 2WU8A 4IZIA 5FCDA 2EZ9A 3W2IA 2R5NA 4KHZA 5A7HA 3SZLA 2HUPA 2WT8A 4JVLA 2RI6A 3A3NA 3JD0A 4W8HA 3WBKA 2Q5QA 1AZTA 2P9QA 3RS5A 3EPHA 4IDQA 1KDYA 3IL2A 2JPDA 4M9QA 1U2QA 4OXQA 2QOEA 5KIAA 3DPUA 3LUPA 4OQEA 4EY7A 3PC8A 4NECA 4BFZA 3DS8A 5FPQA 5KNBD 1U31A 1XLTA 2RK4A 5B3LA 1Q12A 1VG9B 4P86A 3TSOA 4B2YA 5BNTA 4H3SA 1K68A 2EP7A 1MABB 2BEVA 4EENA 4DLPA 4EO7A 1LF5A 3GUYA 4MWBA 5T4HA 3W5BA 3QKIA 3ESCA 3HADA 2C7BA 3TDKA 2PS9A 4YYEA 4Q9AA 3QITA 2FMHA 2RH4A 4HC4A 1ISSA 2FX5A 3WLAA 1TCAA 1PJ3A 4PTLA 1Z83A 4Z2YA 3ZK9A 3LBYA 5AVJA 3L02A 2WAMA 5BNIA 3UWMA 4G65A 5F33A 1I14A 3MXTA 1C1YA 1CETA 1USKA 2D3WA 4GOMD 4UM9D 2BMDA 3ABZA 3DYVA 4MINA 5JS8A 3STUA 3W3ZB 2VL7A 3RQIA 2ZVQX 2GYUA 2JHCA 1WZCA 2XQVA 1NOJA 4TMVA 5DX1A 1F1JA 1WD5A 4DZZA 1DJNA 2E89A 4XKJA 1RKXA 3SQMA 3U37A 3V6MA 2XQJA 1D0VA 5JT1A 2P2SA 3UV7A 5KTNA 2J0UA 1VE1A 3C1UA 3E9CA 1BDMA 4RAQA 4DJTA 4DXAA 1JEQA 5LQDA 4UJ5A 3HN2A 4XQCA 4DQUA 1I5OA 3B7GA 3NT4A 4ZVVA 3LP5A 3VR2A 1BXRB 4XR9A 2X0NA 1G7TA 4RJIA 5A4JA 4B33A 1QM5A 4O0LA 2LCIA 4WLVA 4D8VA 3OQPA 3A06A 4H35A 3BXOA 1QRAA 2AWNA 4ZVUA 4AS1A 5BN4A 2OLJA 2VBFA 2G1UA 2JCSA 3GMSA 1XEXB 4FFDA 3TJZA 1Z12A 4NK5A 5BW8A 2XKKA 1GAQA 2CLOB 5ALKA 3U4IA 5EJMA 2GK3A 2WINI 1PJQA 3K0HA 3NYRA 2MSDB 4Z3OA 2O8EB 4GM0A 5M04A 1II0A 3L8EA 3W7BA 4CDNA 1GRCA 1P0IA 2C5SA 3QWIA 1YB2A 4OTZA 1GP2A 1IG0A 1XWFA 4US1R 4XQEA 5FOTA 3SM3A 4YV2A 4X9XA 3RRYA 2C3PA 1RXIA 2GD0A 3T3EA 3DW3X 3M9LA 4QFCA 4V39A 5JMWA 4HYYA 3QEMA 3VR6D 1ZA1A 1II8B 5DMXA 1RHKA 4Q9IA 1YAJA 3NHSA 4JLDA 1BGXT 3QPBA 2ZJ8A 4O5OA 1HOXA 3O75A 1KBZA 1FVHA 2YFKA 1VIYA 3T1NA 2OZKA 2VZEA 5ITSA 3EAFA 1K7YA 2FMTA 3T3OA 4IHJB 3C6YA 1K1EA 4AX8A 4OYHA 2MCFA 2RBEA 4CDGA 1CRWG 4NPAA 3TEMA 3ZLJA 1PW5A 3P71T 5EJ5A 3QP9A 2GMWA 3MG9A 3HXPA 5E8RA 4KE7A 4ZU3A 1K5HA 1T9GR 3E4DA 2XOEA 2HKIA 3ZHOA 4A26A 5BSHA 1R5BA 3TLEA 3D2LA 1ZFNA 3ULKA 2JA1A 1G9SA 2Y76A 3E58A 1L2TA 4HDMB 4MUIA 1ZSYA 4ZGGA 1UBFA 4R8VA 3TXXA 1BCSA 4FFBB 3H83A 4TZTA 3W5VA 5COQA 4DKXA 3QVGB 1PNTA 1Z8HA 3FOAA 4YMTA 3H8WA 1Q1GA 2WIJA 4KR2A 1IQPA 3T4PA 1XO1A 1N92A 1Y8QA 5C1BA 4X1OA 4HGQA 3DDSA 5DKFA 4BO6A 2YYAA 3NIWA 3OPVA 5MHTA 1MEEA 1I3MA 4PO8A 4H6WA 1QONA 3LTEA 4FINA 3HEMA 1GUAA 2NO0A 2H9AA 1ZJYA 1NRWA 3CT4A 5CXQA 1N5JA 1E9CA 2GVZC 5CFOA 2VNAA 3ESAA 4MW2A 4YP0A 2BCGY 3QG1A 1TMKA 1GFIA 1E6UA 2AKAB 4LECA 5JD6A 1SU7A 5IJ0B 6Q21A 5KHLB 1U99A 3UGTA 2JGDB 3CSDA 3CSUA 4DYVA 2PUDA 4M9RA 3PPVA 2OUKA 2CXHA 3AFOA 1X92A 3H6GA 4U8GA 5HKLA 2ZT7A 1S3SA 2IX3A 1HX7A 1HT1E 1KEUA 3VTZA 1RQXA 4M1MA 4WL0A 3VH4A 2SCUB 3C15C 4HWKA 4EG6A 3NYIA 3ND5A 3BMCB 2XDQB 4MOWA 4B4VA 4F6CA 1I94B 2VDRB 3V4FA 1P3Y1 2WT9A 3R7DA 2PMKA 4MWOA 5C35A 5TQ0B 4ND8A 3F8TA 1L0BA 1CUBA 5DWDA 4JLMA 3R9KA 4WLNA 3NKFA 1CNMA 2VHZA 4CMAA 4G9GA 3T61A 1PGPA 2PY6A 3PSAA 4NFLA 5E3JA 1Q14A 4HQ6A 3B51X 3OC0A 1QTQA 4O63O 2HSWA 2QUHA 1NN5A 3PFBA 2FZKA 1ODCA 3GQBB 1J2TA 3KFLA 3QLJA 4FONA 1KYTA 4PG8A 2HLNA 2R7MA 2HWUA 3A26A 3R6TA 3S6JA 1PCXA 1X87A 1QUEA 4MQFA 4WA8A 3ZVLA 2R8BA 2YFHA 4V1CA 4PN3A 5EJ8A 4DHEA 1KHHA 2ZWIA 5CLHA 2X1VA 3N8HA 4KOEC 5AXCA 2NUAB 4JDPA 2A9QA 2RH8A 4GPZA 1U8CB 4KPEC 3VJRA 1ZIPA 1KXJA 1XRLA 3BMOB 1VSQA 2QT1A 1ZUIA 4H3VA 3OO1A 3ZG6A 5AW6A 3DFMA 4LW8A 1L5HB 2EARA 4K6OA 1ID8A 3KQVA 3LKVA 4MDFA 5EINA 1S7CA 3S2GA 3WK5A 1XLWA 4N5IX 3VI3B 4GR4A 3HWWA 3IHKA 2KBEA 2TS1A 1GUDA 2VUTA 1NY5A 5EE3A 4OI1A 4PZZA 4AG5A 3F6CA 4E1AA 4MEJA 1M1NB 4MVXA 4Y9DA 4EY5A 1C1DA 4FE3A 1ZNQO 4UTZA 3AR8A 4MIYA 5CM9C 3WYDA 3RD5A 5HUQA 4DCGA 3DLTA 3IUMA 3Q7EA 4XGQA 1UP4A 1MDFA 3B52X 5TF0A 4RHTA 2F1OA 1EDOA 3PB3A 3T4UA 2FKAA 4LJ4A 2GFQA 1NVVQ 2PRSA 4YUZA 5JNUA 4BWGA 2E55A 2UU9B 2IFTA 3UV3A 4FWBA 1DJOA 2OKGA 2ZUVA 3ZUGA 3LG2A 3VBCA 4WE3A 4OHXA 3K9HA 1FOEB 4GBMA 3OQVA 1HT3A 1MABA 1N5LA 1NI5A 1C5KA 2BFPA 3BRWD 3CV3A 4LCBA 3AW9A 5E4FA 3CZ9A 5MGNA 1XDDA 1PD1A 2WR8A 5ILQA 3WWPA 4EJFA 3PL1A 1ZGAA 5CYPA 3TH5A 3QA3E 4LMPA 4L72A 4B6PA 4I5EA 1IMOA 3NV7A 1NVKA 4D2IA 1BS1A 1ECPA 3D6VA 1HT0A 1L1QA 2V7QD 1JKJB 4YP5A 4NRDA 1QQ7A 4LQ4A 4EHJA 3LNTA 3OY2A 3LT1A 2F3TA 1ML4A 5FADA 1KNXA 3P9PA 4D74A 1CUXA 3BORA 1P1JA 4HDOB 4HQOA 3UF0A 3MB5A 5I9IA 1IN6A 1Y4ZA 1V26A 2AR7A 3D7KA 3LUCA 3P19A 3WAKA 3SYMA 2AHOA 2YWGA 4AS3A 2OAQ1 3M6IA 3MS7A 4Z53A 1TNDA 4H60A 4ILKA 2JJQA 3LVRE 3LQ4A 4PNHA 4RLHA 3HC7A 1VLLA 3QI7A 3TF5A 1LPAB 1BXRA 2X3YA 1U63A 2G70A 3E6AA 3RVBA 4HWPA 2I3GA 3C70A 1I7LA 2WG1A 4U3JB 3AINA 3F6SA 2HU8A 4DY4A 4F9GA 1ADGA 3AVUA 1Z62A 3GGDA 4PRKA 4Q3KA 3LDUA 2JK0A 5D84A 1U2GA 3I01A 1OX4B 2R9VA 1XEXA 4B7AA 1OAOA 3BGOS 4NYIR 1YDFA 3TB6A 1NVFA 4DWJA 1TYBE 3B1VA 1XNRB 4A5SA 2BGGA 1SMKA 2O8EA 3RV4A 1JFSA 1T9CA 1NUUA 4L2IB 1JVSA 1Z38A 2G1KA 4OGKA 1MOZA 3GZNB 3RBAA 2C07A 2V7BA 2AI1A 1BHO1 2JI9A 3W2GA 1WKVA 4B9AA 3EF0A 2DT5A 4M1YA 3AZOA 4KO4S 5C1OA 1II8A 4MICA 5JJ5A 2PD3A 1NYRA 2DU8A 1YTLA 1T43A 2QTLA 3K30A 1TIPA 4L76A 2PGDA 5KYNA 3GFOA 3VPGA 3RYIB 3TCXB 5E38A 3CZPA 4IILA 5FFMA 4IHJA 2YS6A 1VRVA 4U2KA 2FF5A 3DAOA 3WWDA 5D7NA 5JCZA 3VKGA 3CF6R 2Q5IA 4AJOA 5KJEA 3TLJA 3UUGA 4BKRA 3UG7A 5KQSA 4UEOA 1UBCA 1ZXLA 3QQPA 1PFQA 1JHRA 2W58A 4TZ6A 2IPOA 3DE5X 4XJTA 1TQ6A 2IOHA 1R27A 2FK7A 3IHTA 4RHFA 3TM5A 3VSBA 1SVMA 4HDMA 4HXYA 1D09A 1WEKA 3H5AA 4FFBA 2XXBA 1NQOA 1UPAA 1OH8A 3O4FA 1J0EA 1E3QA 1J2UA 1Y3IA 4HQFA 5AW1A 4EK9A 2QMZA 3QVGA 2VKTA 2HLHA 1GSHA 1XL1A 4PYIA 3B6IA 1GQFA 1Q91A 5SYMA 2C4WA 1XMXA 1OI4A 3KU4A 4IDCA 5ALWA 5ARBA 5BV0A 3GCXA 4DRZA 5B53A 3WKAA 3L5KA 1L4FA 2YBDA 3CW2A 3IA2A 1RWXA 4KNVA 5JCXA 1S2NA 3WYNA 4X6UA 1YQQA 1JVNA 4JYCA 2MINB 5EIWA 3D6JA 1T4MA 2DPXA 3LC1O 2VSNA 3IUNA 1GPWB 1T0IA 3P0HA 1TZKA 3MS2A 1JEYB 4UVEA 2X0EA 1IWPB 1H3NA 1FUIA 2CVHA 3K31A 4F2PA 1SIOA 2HJHA 1P9LA 2P40A 4KWCA 2QBYB 2YV2A 3N8NA 2EBHX 5IKMA 1PT6A 4P83A 3RHFA 1SC3A 3R0VA 5IJ0A 2JGDA 2R6FA 2E5LB 1E2NA 4CQNA 2EJCA 1ECLA 3OM9A 2CK3D 1UJNA 2BHTA 2EXXA 2GGSA 4S3MA 1V39A 1TECE 1KVRA 1T4BA 4J0GA 4JGBA 1E3TA 2K7FA 2SCUA 3KWFA 2Y27A 1T3HA 1JGTA 1LB1B 2OV2A 4R68A 1SCKA 2GAFA 5IUKC 3FRIA 3SKYA 3BMCA 2CHGA 2XDQA 1NGSA 3KB6A 4LRXA 4W5TA 2VPZA 1P75A 4B1FA 3HJTA 2NPOA 3K8ZA 3D9QX 3G49A 2XQKA 3PQ7A 4GP6A 4OAQA 5TQ0A 2FH5B 3V4OA 1A5TA 5CBPB 1HE4A 1QGED 3AB7A 3FNGA 3PHIA 2FWRA 5K1ZA 3STTA 3N7TA 2R6AA 1R0LA 1Q17A 1KU6A 2FF7A 2Z9BA 3B60A 4XVCA 2R8PA 2XDWA 2AZDA 3ER9A 1RJDA 2DETA 3DDZX 3GGCA 2X1MA 1OYOA 2EBFX 4HX2A 1EUZA 1T8RA 2YVUA 5F5NA 5K3AA 3L1JA 1BDIA 1IUNA 1NXVA 1PR5A 2BMJA 3IMKA 3THRA 3GQBA 2BGUA 2Z3VA 3GPIA 3KJQA 4C21A 3EBPA 1KY5A 3CO0S 1OROA 2YZ7A 4NNJA 3UNXA 5H3LA 2GF0A 2LTAA 3KS9A 3I42A 3JTMA 2ZE8A 2NUAA 4B3TB 3OJFA 2CV0A 2ORWA 1OXUA 4LWZA 3BMOA 4LXQA 1QZUA 4R2LA 4H15A 1A4IA 4DSOA 2N9UA 1JIJA 3AVVA 4IJKA 1L5HA 4M7WA 4YHBA 5E1DA 3TX2A 2IYEA 2AG1A 1JFFB 1MRNA 3G9QA 4ISBA 4LF8B 3WL8A 4BNDB 3MLBA 4YJFB 1JUDA 3DEFA 5DCYA 1LBIA 2OFWA 3EIFA 3UTCA 3THYB 4MUBA 1D2AA 3IRUA 1M1NA 4JJ7A 3TUJC 1XRPA 4CLEA 4BWVA 1WXQA 3DXZA 4MA5A 3P0EA 2BR4A 4QDJA 2R4TA 1E2MA 5LOVF 3SBXA 1SQ0A 2NLOA 3IESA 4D4MA 1KI8A 3CXUA 4I81A 1OFGA 2YJGA 4OKSA 4WKBA 4AUEA 3B5IA 1QB8A 3L0ZA 1TAHA 4HPWA 3ZX5A 1BE8A 1QHFA 5EUBA 4PSKA 3G2JA 5L7YA 5CDTA 1GNTA 1E62A 2JBAB 3N86A 3V9PA 4RH0A 1BCRB 1CQZA 4CJXA 4BQIA 1MVOA 3QZUA 4DIBA 1IBRA 1VSBA 4BX9A 3DV2A 4EF6A 2GYYA 4R71A 1JE1A 1Q1BA 4BNMA 2PUWA 4FIDA 3ND8A 5FEMA 4ZJUA 2V7GA 5JAQA 1AUPA 1WZUA 1T3GA 2P2GA 2RHRA 2YN0A 3HBAA 3IP8A 4V38A 5EUQB 5EJEA 2QVZX 1NSFA 1QBKC 1JYEA 1U5AA 2AJLI 2BP7B 1Z6ZA 2ISQA 2R7KA 3HH8A 4PPNA 2IUUA 3KOXA 4M1EA 5IS2A 4G6ZA 3OKAA 3GMDA 1VJRA 1IK6A 2JHAA 1OQAA 4ZQEA 1JKJA 1QE0A 4YMSA 4HRAA 5IC4A 3RIYA 1JJFA 4HLNA 1KAEA 2KBFA 2OCPA 3KZVA 4IOJA 2IPLA 4KAXA 2O07A 3W7VA 5AM2A 5LQMA 2XCLA 4KWHA 1GDTA 4M8IA 4NHEA 3RFTA 5DM4A 2JFUA 4EA7A 4JOSA 4RQUA 2OYSA 4DJJA 1OT3A 2QSUA 3WIUA 3SOZA 3WOHA 1L8LA 5FF9A 3OTQA 3CF2A 1QX4A 3LWBA 3MHPA 2FX3A 1UBEA 1FLNA 2FEWB 3KOYA 3KR9A 5IZCC 5GADl 2I62A 3UJDA 4OL9A 1QPZA 1QHGA 2JKVA 1EP3B 3C98A 2QR2A 4XW2A 5J2UB 2UUBB 1IN1A 3LVFO 4U3JA 4KNYA 1QIMA 3PXBA 2KJQA 4UHJA 4ALLA 4B79A 4QNRA 4DCCA 4YRGA 2JAXA 1T3LA 2C77A 1OX4A 4DBVO 3AEUB 4UCWA 1LU9A 1E79D 3ZWYA 4S24A 1MRSA 2IC5A 2VLIA 2QLMA 1R12A 3BBLA 3KJXA 1W29A 1U9JA 1FQOA 3MINB 3GJYA 1K63A 4XX0B 3UGQA 1CS4C 1I32A 4L2IA 5HW0A 3AQIA 3EPPA 3GZNA 5DTEA 3U3XA 4NS4A 4JP8A 4N0QA 2OQRA 5IANA 4BLOA 3J80A 4NX2A 1G64A 2IZOA 4QAQA 3IXQA 2C1EA 4MGZR 4ENWA 2V6FA 4HNTA 4G4GA 1U2ZA 1SXJD 4UVGA 1N5KA 1EVIA 4L9AA 3HB0A 5HE8A 5JWOA 3L8DA 4LYDA 1PTKA 1QO0D 1I3LA 2JL1A 3LQ2A 1Q0HA 1JILA 1U4SA 3NDJA 1ZITA 3KV1A 4JD5A 4YEDA 3X1MA 3RYIA 1O77A 3R5JA 4K6MA 4I1OA 1T3ZA 3WSTA 1W34A 4ZI5A 4DV6B 2DUJA 3BQNB 4Q3NA 3HCNA 4PAMA 2CT8A 4AM8A 1Q1QA 2C8KA 3A10A 1E4VA 3HL0A 4I1UA 4A6EA 5JY1A 3U5ZB 3OLQA 1Q21A 3JQBA 4GI3A 3R40A 3NTRA 2GK4A 1KVUA 4U8HA 1Q7RA 3MQFA 3PQ4A 2C98A 5A9SB 1FMCA 5HTKA 1MKYA 4C0WA 4E12A 4BX2A 4YN3A 1PV4A 3H05A 3UJ7A 1QNLA 1Y98A 3ZQ4A 5CEEA 1TI7A 3Q10A 2D4HA 2IWRA 4R31A 5DHUA 1T5SA 3SS7X 1R6XA 4E7PA 1UMKA 3HCDA 3E05A 1VGQA 3I30X 2XNKA 5FAKA 2BKUA 5GAJA 1ODSA 3GFGA 4R8KA 1EXMA 4X7MA 2DHEA 1Z5OA 3GD5A 4Z1MD 2BFCB 1YULA 1DFHA 2PLAA 3PI7A 4G85A 4TTTS 5HIJA 3WQRA 3U26A 3NIGB 3RFFA 1WIWA 5IC6A 3I58A 2ZIVB 4BJ1A 4EAAA 1MB4A 4MV0A 5CA0F 2IH4A 3BGWA 2F1KA 3IIJA 3D3WB 3ZHXA 4KXNA 5BW6B 5DM60 2ZREA 3DHNA 2MINA 1P4HA 3F6RA 1Z7EA 1BHSA 5TT0A 4BKMA 5CA1B 3OQJA 1H0KA 3SXUB 1JEYA 2YS7A 3CLTD 1IY2A 4BEVA 4F91B 3UPTA 4DSNA 1SCJA 2FZ4A 2QBYA 3DA8A 1P5RA 3C1TA 5AW2A 3P9IA 2X6TA 2AVNA 2IYUA 1PJZA 3NAQA 3Q3GE 5TX7A 4XH9B 5IVIA 3RHTA 5T7BA 1YE5A 4KO2S 5MGBA 2PIAA 3OM8A 5A6VA 4RVCA 1F3LA 3BQMB 5HIIA 4N7JA 4NOJA 4OJKA 2AKYA 4E30A 3IRVA 1E1YA 2QS9A 1BE0A 3QEJA 4HB2A 4QTZA 1Z2CA 5FWAA 1L7BA 2Q3HA 5G1NA 2QRGA 1VDMA 1UBUS 2IZ5A 3A4IA 4ZEWA 3QX3A 4M0PA 1YFZA 1ND6A 4YLEA 1YFKA 2OAEA 3ZI0A 2BGIA 3ZK8A 3I64A 3DE6X 3GLRA 3KPJA 4NDAA 4R9VA 2VWGA 5ESWA 3QBDA 5G0WA 3D8HA 4OO3A 3SYLA 5CBPA 2HRBA 4AJ2A 5K01A 1GPDG 1P1FA 2QY6A 4GM1A 2YC4C 3G89A 4I4TF 3A2LA 1JNYA 5D5HA 2P68A 2RGCA 2VA8A 3I62A 4K81B 3TPCA 4MI1A 4RKWA 4UBLA 3O8BA 3SJAA 3WRYA 1WQ1R 1S6YA 2PKWA 2XMGA 3PUJA 4FW9A 5EJ9A 2NZWA 4DJEC 1JDNA 2CCJA 1Q19A 1Y3HA 5AI8A 4IZ6A 4F5ZA 1Z25A 2ZBQA 1GAEO 2P27A 2W4MA 5ALUA 2GD2A 3MWJA 4JKOA 5LB2A 4UHDA 3K72B 1L7OA 3PL5A 3HHPA 3GRUA 2H1FA 4IJWA 3ZBUA 1FYFA 4I08A 3JQPA 1NMZA 4WLEA 3UXYA 3RT1A 5ILOA 2CYCA 3PGJA 4YRIA 1QSGA 3JY6A 1P1IA 3AEZA 4BVKA 4RTPA 3ZU2A 3W05A 4ZAYA 3ZY4A 3RARA 4LHWA 1RKQA 4ZJZA 3D81A 5C0OE 1JFFA 1JHYA 1H9AA 4K7JA 3K5IA 3DVLA 1TFUA 4J76A 4K6CA 5JD4A 3GLIE 1WSAA 4BNDA 4YJFA 1PG2A 1TJ3A 2PZGA 3NB0A 2VWQA 4K03A 4KFUA 4Y1EA 1E2UA 1A7UA 5JYDA 3THYA 1ATIA 2RJOA 1XC7A 2YMLA 1JSCA 4AIRA 2QMYA 4RBNA 2OCBA 1D03A 3JWHA 2ZWMA 3EB9A 4AC9A 5AHKA 2J33A 1QANA 2WJGA 1J0XO 3UXHA 4I9GA 1JFLA 4K46A 5D3QA 1ARZA 3ESQA 3X2SA 2P6NA 3JQDA 1VQ1A 4KIWA 2C8LA 4NFHA 3FMIA 4B4OA 4YYZA 4DV5B 4Q3EA 1M75A 3ZWBA 1JIIA 3CF4A 2JANA 1Z17A 3G8CA 4BZZA 4BO1A 4AB1A 1TDJA 2JBAA 4RFVA 1W0CA 2NO1A 1BCRA 4OFXA 1NHWA 2E4YA 1H6BA 4GSKA 5BVGA 5B3JC 5IXYA 1XZEA 1VHLA 4TYPA 3AF5A 2M1ZA 5C7YA 3UPUA 1SR8A 1WY5A 3LK7A 3L8YA 4P82A 2BP7A 3RROA 1KGDA 4DLLA 1R0YA 2GXQA 3FTNA 5CK4A 2XF8A 4N40A 3S1LA 1Z75A 2WA1A 3B8EA 4X24A 4UPVA 4UBJA 4ZQIA 1JSXA 2Q4BA 5KPJA 5LCXA 4F06A 3W6UA 1L7XA 2H59A 1OYVA 1NURA 3LZDA 2HNBA 4LCEA 2UAGA 4DR7B 2VQFB 1K0UA 4WZZA 4PLZA 2QNBA 2HB6A 3F7NA 3EHEA 5EPEA 4MP3A 4IDEA 4C6HA 1PJLA 3OX1A 3EGOA 4J0DA 3ETEA 2P0EA 3LP8A 1CJVC 1D8TA 3FVTA 4V0NA 1X1EA 2MT9A 3WX0A 1R9NA 3OZIA 5E9JA 5JBNA 3WISA 4D0GA 3N2EA 3OC6A 2P9JA 1GPLA 2EATA 4CFZA 1UPTA 2DQYA 2Y1FA 1Z5PA 2E1RA 3OZGA 5J2UA 2K5UA 4OK3A 4XFDA 3AUSA 3CZ4A 1Q22A 2IP4A 4P3OA 4XJXA 1SOMA 1PT8A 1V8FA 5JALA 2EKBA 3EUEA 1DLJA 4D4LA 4X65B 5JADA 3AEUA 4FU0A 3V4RA 2GN8A 2XYVA 4IICA 4DPKA 3MTGA 4B44A 4MW7A 5IF9A 1W4RA 2YIMA 3MELA 1N2CB 4RCZA 1GADO 4IH9A 4AULA 3TOVA 1I4WA 3U13A 2FYTA 3AHHA 3MINA 2YWBA 3LQYA 3SMVA 4XX0A 4ZEVA 5J9FA 3THWB 2UXCB 3QMVA 2SKCA 3D7NA 3SHVA 4K05A 3PCRB 3PGLA 2OGSA 2PKCA 3TMAA 3D64A 1FL9A 1YIOA 1U0NA 2ZYHA 5A3RA 3FCOA 3NEPX 1YIAA 2C2MA 4Z54A 3O4HA 5C8DA 1NP7A 2J32A 3OPYB 4QZVA 2CDBA 1WZ2A 4LSGA 5AVVA 4OXXA 1EIWA 4RYLA 1LWOA 2B99A 2I3AA 4KK3A 2LKCA 2NPFA 4A2WA 1G4AE