2QSJA

Crystal structure of a luxr family dna-binding response regulator from silicibacter pomeroyi
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
120
Chain Sequence
LTVVLIVDDHHLIRAGAKNLLEGAFSGMRVEGAETVSDALAFLEADNTVDLILLDVAIDGLVRLKRFDPSNAVALIHELIRAALEAGADGFIPKSADPQVLIHAVSLILEGEIFLPRSYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding response regulator, LuxR family
publication title Crystal structure of a LuxR family DNA-binding response regulator from Silicibacter pomeroyi.
rcsb
source organism Silicibacter pomeroyi dss-3
molecule tags Transcription
total genus 37
structure length 120
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qsjA00
3SQNA 2XDYA 1YK1A 2V0NA 2QZJA 3QLUA 1QQAA 2IPNA 2MYUA 5B3JA 5HSGA 3CRNA 5FBKA 1U8TA 5IUNC 3H75A 4PICA 4Z9BA 3GA5A 3RVRA 3ROTA 4Q6BA 4IGAA 4MQFA 2IDMA 3K9CA 1JFVA 4RKRA 2FVYA 3GL9A 4WXMA 2IKSA 2AYXA 3M9XA 1SXGA 3GT7A 4IRXA 5JNRA 2N9UA 3N0WA 3OM1A 2W42A 3IPCA 3H5VA 1ZVVA 1JYFA 4W5QA 4MPTA 3E3MA 5C5EA 1QPZA 1A0OA 4MS3B 4G0YA 3KTOA 4ETMA 3FMVA 3HDGA 2NZUG 1L5ZA 1A04A 1GUDA 4EYQA 3OQOA 2FEPA 4KREA 3IDOA 4KV7A 4N47A 3LUDA 1L5YA 2PL9A 3H5LA 4JB0A 4MLCA 3O21A 2CD7A 4F8JA 1NXTA 1MIHA 1PEYA 1VPWA 4IF4A 3FFTA 2CHFA 2DRIA 2FLWA 4NQRA 4QYWA 5DKFA 3F6CA 2R47A 1M5TA 4EUKA 4MRMB 1JDNA 2JVJA 2PUCA 9ABPA 2JBAB 5JNSA 6CHYA 1DG9A 3O1JC 1QP7A 2FQYA 4HNSA 4WWHA 1JYEA 4IMIB 5EWLB 3LOPA 4RK5A 4Q7EA 4YRZA 4Z4GA 3O1HB 2IYNA 4W5NA 2FMKA 4ETNA 3HM9A 3C3WA 4OLBA 3F7NA 2YHAA 4JP1A 4YS6A 3KCNA 4MQEB 3NBMA 5JS2A 1NXSA 5TPWA 5TQ0A 2PL1A 1Z16A 1QP4A 1D5WA 1HEYA 1YK0A 5EWLA 1SXHA 2MSLA 4DQDA 2O20A 3ILHA 1DC7A 1EHCA 4PEVA 4RZSA 4FE4A 1C0EA 1ZAYA 5FBHA 1FQWA 1NXVA 1GCAA 5HQJA 2LIVA 3KLOA 5HM6A 4KQCA 2E4VA 2NZVG 4YP9A 2GKGA 3LUJA 3UUGA 1AB6A 3BILA 1P6UA 2QU7A 3I45A 3LUCA 1QP0A 3UK0A 1BDJA 4EVSA 4Z99A 4EVQA 1DCMA 5IX8A 1APBA 2H0AA 4RY0A 2HQRA 2R25B 1EAYA 1BA2A 3Q7RA 4LZLA 3OLVA 3LTEA 3RVPA 4MS3A 3EJWA 1TVMA 4G0QA 3HJFA 3C3MA 1DCFA 1K68A 5KQPA 3DLBA 3KLNA 5EWJB 5TQJA 3H5IA 4RXTA 2FSPA 4EGSA 2PUAA 2MSKA 3GWGA 3KSMA 4EYOA 2KYRA 1T34A 1FSPA 1M2FA 4IMJB 1TJYA 5B3JC 5KI6A 2IPLA 4G86A 3BRSA 4MRMA 2FTKE 1M5UA 2FEKA 3NHZA 4B09A 2ID9A 2FN8A 1D4ZA 2JB9A 2JBAA 3QK7A 5IEJA 3EGCA 3OO0A 1YTUA 2WJAA 1JLKA 2CHEA 3G1WA 3H1GA 4RY8A 3DGFC 3UKJA 1LJUA 3TD9A 1PUXA 4O5AA 1DC8A 5TPZD 1ZDMA 2PLNA 1C4WA 4W5OA 4N41A 3KYJB 5BRAA 2YHBA 1RZRA 4ZJPA 3MIZA 4RDCA 5FWYB 4E7PA 2NT3A 1P6QA 4KK3A 1ZITA 4FB4A 3JVDA 3SAJA 4XARA 3GYBA 1JWLA 5T3YA 4MGEA 2QSJA 4LE0A 3VNBA 1QMPA 1DCKA 4UHJA 4KNYA 1U2QA 3BRQA 4Y9TA 1D1PA 4HNRA 3TB6A 3Q15C 4E7OA 2L19A 4LRQA 1MAVA 4KMRA 4RXMA 2B4AA 5DCLA 5IBQA 5IULC 1PNTA 8ABPA 1XHEA 4H3HB 3LKVA 3JY6A 2ZWMA 5T7BA 1DBPA 5EWJA 3IP7A 4N03A 1Z2DA 4D74A 1E2BA 1YIOA 3RVMA 3MF4A 1JH9A 5JS1A 3EQZA 4KPYA 4YV7A 3CNBA 3GBPA 3C3KA 2PKXA 1AB5A 3NHMA 6ABPA 3JPWA 2FEWB 3RVKA 2NUBA 3T6KA 2OENG 1JDPA 1UDRA 1PEAA 3HVRA 4Z4HA 3NNNA 1VRVA 4EYGA 4Z9AA 3H6GA 3RVQA 2HJ9A 1JFTA 4JA2A 4PE5B 4TN5A 4YLEA 1FFWA 5CNJA 1F51E 4H60A 4MYRA 1U0SY 3N8IA 2CWDA 5IUJC 3I09A 1CYEA 3LKBA 2FN9A 1E6MA 1GLGA 2IPMA 2R48A 3O2SB 2PMCA 3CTPA 5FWXA 2A9OA 3A0UA 3KHTA 4F06A 5PNTA 2WJWA 3VNAA 1DZ3A 4MR9B 2FQXA 5DGCA 4JOQA 4QICA 2E4UA 5FWYA 4XXHA 3LUHA 5KC9A 2L18A 1NXWA 1QO0A 3BBLA 5JNTA 3JVIA 2HSGA 3EAFA 2FW0A 1RXEA 4RY9A 3RH0A 2QXYA 1BDHA 5ED4A 2HQOA 2MYNA 3O2JA 3NNSA 5EWMA 5IC5A 2J48A 3B2NA 3F6PA 3JTEA 3MMNA 4O1HA 1BVHA 3Q7TA 1VLZA 1ZH4A 3DBIA 3OQNA 1RNLA 4WXEA 3A3KA 5CNKA 2JVIA 3RVJA 3KKEA 4MR7B 3HXMA 1ZHHA 2I6FA 5JNVA 1QNLA 3CU5A 1SXIA 4TLMB 1KGSA 2VUHB 4YGXB 3QLVA 2OQRA 4KQ9A 2FKAA 3URMA 1NXPA 4F3TA 4GNRA 4W5TA 2QVGA 3DGEC 3L6UA 5BRJA 3M9WA 1YMUA 1D2AA 5GOTA 4RSMA 1U2PA 1ABEA 3EDCA 2GWRA 3IP6A 3N75A 2A9RA 3Q41A 5IUKC 5TQ2B 4N76A 3OLZA 3OLXA 3H6HA 4G0OA 4RK7A 2E4XA 2L17A 1WETA 1ZESA 3OLWA 5CNMA 3EULA 3RVOA 1URPA 2TMYA 3HV2A 4Z0NA 1JL3A 1VKRA 1ZN2A 3LUGA 3ROFA 1Z25A 1DRKA 2VYCA 3QEMB 4F11A 4WT7A 1USIA 1NATA 3DLHA 1M2EA 2F8TA 1JFSA 3CS3A 4OBBA 1JX6A 3T8YA 4MR9A 3GRCA 2FLKA 2GBPA 1TM2A 4DADA 3O2QB 3CG4A 3N6VA 5DTEA 1P8AA 2A9PA 1I3CA 1Z26A 2FQWA 5FWXB 1LBIA 1Y1LA 2FMFA 4TMYA 2PUEA 3TO5A 3HCWA 3IP9A 3LFTA 2E4WA 2PE5A 4G97A 3N0RA 5D2CA 4WUTA 4WZZA 4EYKA 1BDIA 5BQ3A 4JASB 2JVKA 4G0MA 4RK0A 4NV3A 3QX9A 1OXBB 1CHNA 3GBVA 4KZKA 5EWMB 4MR7A 1KMIY 3OQMA 3HS3A 1OXKB 1QQBA 3N0XA 1U04A 4RK4A 4S04A 4RK1A 1B00A 4ETIA 1Z15A 1KRWA 2E4ZA 1GCGA 2RJOA 3HK2A 1E6KA 3RVSA 4EVRA 5JNUA 3M6MD 1ZGZA 4N0QA 3KYIB 4S05A 2PUGA 4HYEA 2RDMA 4QPJC 3QELA 4D6YA 1TMYA 2H3HA 4L4UA 1LK0A 2QW1A 4KK4A 3CLKA 5TQ2A 3MQ4A 1MB0A 1F4VA 4OATA 3KS9A 3RQIA 3RVNA 2ID7A 1KRXA 4MAAA 5BR1A 1P2FA 2ZAYA 4FE7A 2LP4Y 4MS1B 2WRZA 3C97A 3HUUA 5TE9A 3T95A 7ABPA 4YWHA 4KFCA 3OO1A 4D6XA 1MVOA 3KG2A 4YO7A 4XFKA 3OLYA 3QEMA 4ZPJA 3CZ5A 3W9SA 2PUDA 4Q6WA 1S8NA 4OTZA 3BREA 4LX8A 4EY3A 4Z4IA 2PAFA 1ZH2A 2JCGA 3MYYA 3MA0A 2M1ZA 3QLVC 3GV0A 3I42A 2RGYA 2PUBA 1GUBA 3MM4A 3Q9SA 3OMWA 3HDVA 1EFAA 3OMXA 4P98A 2E4YA 1R8JA 4RK6A 3LUKA 4KVFA 4Z4EA 2FMIA 2HPHA 3HZHA 3A0RB 3G85A 5KQMA 3QX8A 3OM0A 2RJNA 4XAQA 5CNIA 1USKA 2MSWA 4UHKA 1RZRD 4G0ZA 2LBPA 4ZMRA 2FXIA 4LDZA 2QV0A 3A10A 3NNDA 3HEBA 3QEKA 4G0XA 1Z13A 1FFGA 2QVCA 3FDFA 2L2QA 4RS3A 3HO1A 4NICA 1CEYA 1H9CA 2LUOA 5ABPA 1JHZA 3E61A 3JPYA 4JB2A 1TLFA 4XASA 5TPZA 4YCSA 1ZGGA 1NTRA 2R4QA 4MR8B 5DLEA 1Z2EA 2WMYA 1XHFA 1Z12A 4RWEA 1SD5A 1LBHA 1YS7A 1RPJA 1EWKA 3O74A 4XLTA 3SNKA 2BGGA 3Q7SA 5F64A 1RXIA 2Q5CA 2M98A 4IILA 4RKQA 4GPAA 4G0PA 4RU1A 4MS4B 4CBVA 3H5OA 4QYMA 1FFSA 3QLTA 3ILYA 1NY5A 1Z18A 3CZCA 4MLDA 1D1QA 4RXUA 2WY2D 3QELB 3F73A 3KJXA 3T38A 2F8SA 3TX6A 1DBWA 3HUTA 3O1IC 4MS1A 4P1ZA 2JRLA 4YR7A 2PUFA 3H5TA 1JBEA 1K66A 5C5CA 1YMVA 2MYPA 3EQ2A 2PJUA 3FFXA 2P9HA 4M88A 2AYZA 5IEBA 3K4HA 4KRFA 5KQGA 4MQFB 4PYRA 1J56A 4F12A 4ML3A 3CG0A 3JS5A 3LUFA 4Z4CA 4H3KB 4O1IA 3N53A 5JNWA 1JF8A 1XWWA 2WB4A 2IOYA 3D02A 3C6QA 1NXXA 2NT4A 1A2OA 2HQBA 3L49A 1USGA 4L85A 5KWSA 1PHRA 4LE2A 3I5AA 4RV5A 1SRRA 1BAPA 1EWTA 3D8UA 3QLUC 1YVUA 1ISSA 1DP4A 5E3JA 2QR3A 4DN6A 1PNRA 2VK2A 3CFYA 1ZY2A 3FGZA 3R0JA 1QO0D 3CKMA 4Z4FA 1W25A 4OG2A 1QKKA 4ZMSA 4W5RA 1LJLA 4TLLB 4N0PA 1E6LA 2A9QA 4NCAA 4MR8A 2X7XA 5HKOA 1EWVA 5CHYA 3RVLA 3SM9A 2FMHA 1DRJA 3CHYA 4ZYLA 4NCBA 1W9HA 3P9YA 3SG0A 3H1EA 4MQEA 1MB3A 2WWVD 2JK1A 4LE1A 1ABFA 1IIBA 3IP5A 1ISRA 1NXOA 3EODA 2VUIB 3HSYA 1Z17A 4MS4A 1DJMA 1YS6A 2LPMA 2MYTA 3FFWA 4JAVC 2IPAB 3DZDA 3IPAA 4LDAA 3O75A 4HNQA 5GQSA 5I4CA 5KC8A 2P4UA 2GX6A 4OLAA 3TMYA 4PZ0A 5KQLA 2B1JA 5TPWB 5TQ0B 3LUAA 1DBQA 3S99A 2GI4A 3SY8A 3H5WA 3LMKA 3H1FA
chains in the Genus database with same CATH superfamily
2NSLA 2XDYA 1WXQA 3LSTA 2WYUA 4JC0A 4KXFB 4OHVA 4H2DA 3CJRA 5LQRA 2CSXA 4HNAA 5CDYA 1IEWA 1YU9A 2ATCA 2SKCA 3VGPA 2ZJBA 4LF6B 4YRKA 1HDOA 2WG0A 2EP7A 2IDMA 2VAWA 4RKRA 2C4MA 1SQ0A 3ROXA 4HQ0A 1Y6QA 2KX7A 1XCJA 3NDRA 3Q3IA 4G1VA 2RGXA 5EMHA 1TT7A 4UPEA 2PKCA 5LCXA 3DEJA 2FSIA 3IR6A 1AH2A 2Q7DA 1ZVVA 1T2DA 2LNDA 4ALKA 5AUNB 1WUTA 4OXIA 1O08A 3PEFA 2HCJB 1AK9A 4KR9A 2QJOA 2PSJA 2XRMA 4KUGA 4MKFA 3TWOA 1CY7A 4TQ9A 4W5HA 3HDGA 4B8YA 1L5ZA 1KYQA 1I5OA 3VPAA 1PT8A 2QLBA 2OPHA 1KU0A 1NV9A 1E9EA 1AUQA 1HQCA 1LF0A 2G72A 1FVFA 5DN6A 3DZKA 2A86A 2CMDA 3V1LA 4CDRA 3BHNA 2OMEA 4ONEA 5FULA 3UAWA 1HF3A 3U81A 2ISQA 2O1WA 2GD6A 4YJFB 1F6WA 1CF4A 1SUAA 1M2JA 3Q85A 4XUGB 3GLHB 4F4FA 4FBMA 4HWGA 3PSAA 5JNSA 2DXIA 1UJNA 4D4IA 5K8IA 4R1SA 5KS2A 2BM9A 4RD0A 1PBTA 1H8HA 4B5LA 3STUA 4Z4GA 3QBJA 3KWFA 2PLFA 4Y1EA 4I1SA 3IIEA 3PFNA 4KE6A 1MB2A 4UOQA 4QX6A 4M8SA 4CN9A 4OLBA 4QFMA 2H2IA 5C7YA 3G2KA 4L78A 3DHEA 3BC1A 3JQ9A 3OC0A 2FR8C 4HRYA 3BDIA 3DDHA 3K9QO 1VJ5A 1JBQA 3CXRA 3OUTA 2O2IA 3TTSA 1SXHA 3WAKA 2V3CC 1EVEA 1MDFA 4AECA 3BAFA 2WBLC 2Z30A 3LI2A 1UBHS 3PD0A 4IXDA 4EGCB 3D4PA 5FUMA 1WP9A 3DEHA 1E8DA 4H17A 2O7VA 4EARA 4XCVA 3PLNA 1RPTA 2ZIZA 4HADA 5BRNA 3FBGA 5ALHA 4YRQA 3A25A 1SCIA 1Q50A 5GV8A 1N33B 4TUYA 3SHWA 1U7HA 4NBVA 4EFDA 1ZUHA 1S3GA 4UM5A 3KKKA 4K6GA 3UXMA 1J39A 1OYYA 4MIKA 1HOXA 3K9HA 1U6JA 1NN3A 1YI1A 3QTLA 4RD6A 4U5QA 4TV8A 3AEUA 4U7TB 3Q7IA 4Y1GA 4DTCA 4HGYA 1R6TA 4OYLA 1TVMA 3MGKA 1CUDA 3C1TA 3L8EA 3E23A 3LBNA 2B8EA 4IGEA 5L3SB 3U4CA 3IEKA 3LRTA 5TQJA 3QBTA 4Y67A 2J1LA 2G9NA 4EAQA 1DJNA 4J0JA 1D4AA 2VDWB 3F5MA 2NVWA 1DC3A 3V9PA 3U60B 2ZJ3A 4WVFA 1BA3A 2VSOA 5IKEA 1FSPA 1Y63A 2EG5A 5GM2A 5CDFA 1I2MA 4WBXC 3ZE1B 4JELA 4XQEA 1FUUA 1RWBA 1EVKA 4BV2A 2JFBA 1PQUA 2A0UA 5FJJA 3QXXA 4ZXFA 1N6IA 1U7UA 4RF5A 5IC4A 5LOVF 4ALJA 3H2ZA 4ZC8A 3TR0A 2EZ4A 2O3JA 1GADO 4V3CA 4J91A 3QH4A 4AAYA 1NE7A 3QVJA 4G1BA 1Z0UA 4E21A 3VR4D 5LOVB 1XTPA 1QBGA 3A2MA 4KIGA 2G70A 1MC4A 1W48A 1VXRA 2WJAA 1NW6A 1ZD5A 4JJ6A 4PSCA 3TFQA 3VKFA 4BEJA 1WW3A 1S2LA 3PJEA 3ASZA 1OBVA 2R65A 3ADKA 1O97D 1YVEI 4ZCQA 1VSBA 2AG6A 2AOTB 1JG7A 2PD6A 2R6GA 5HEKA 2VH2A 3O4JA 4TMWA 1YCGA 3RC8A 4B6OA 2XE6A 2HU7A 4UE2A 3ZV6A 2EW1A 3VSCA 4DT1A 3KP1A 2JGNA 3QKSB 4FUTA 3NEAA 3CB4A 1AS2A 1EFVB 1BCSA 3G2PA 5FAKA 3HY4A 3JZFA 3IC5A 2ZM6B 1YASA 3X1MA 4EY6A 3NI2A 1UPTA 2CFOA 4WW0A 2WAYA 2I34A 1EUDB 2Q1WA 3D59A 3IMCA 4HC4A 4XWGA 5HVNA 4JITA 1UZLA 3S1AA 4AX4A 3WWYA 4FC7A 4BNUA 2DLDA 2H07A 3CMMA 1L1EA 3S8EA 3QXJA 4AY3A 1KF0A 2R1ZA 2IYTA 4H1VA 1XHEA 2O2JA 2ONCA 1EVIA 1QIDA 1JNYA 4TV9F 5ESWA 4HTFA 2ZCUA 4IVRA 4WESB 1E92A 4ZQHA 5EWJA 4KPGA 1YULA 4TV9B 4AZ3B 3E15A 3HKCB 1RZVA 1FX0A 3DEZA 1S6YA 2VATA 3U7JA 1RI1A 2L0XA 3IB3A 3PEUA 4YYZA 3VR3D 1FE8A 5KNLA 2YL2A 3BCUA 3LLVA 1I2ZA 1X74A 4PYQA 4YXWA 2YRXA 3D8TA 4FSDA 1T5DX 3KR1A 5CT9A 2NUBA 5IMBA 3DFUA 5HXAA 1YBHA 4PQFA 4EJ2A 4IV0A 4XD2A 1QV6A 5DLYA 2VF5X 3ZLJA 1CWUA 1P39A 1I0IA 2QRHA 3PFFA 1DEAA 2OXRA 1OFGA 2F1HA 5B6IA 4E5KA 1TF5A 1TAQA 2CF5A 5C52B 2ZRGA 2WUEA 2BCGY 1ZMTA 1N6RA 1RYMA 3G2IA 5AK6A 2WD7A 1YR8A 4GVPA 3ZKAA 4AUMA 4D9IA 3WLOA 3BT7A 1KI1A 3RRBA 1JFRA 2HSWA 2PH3A 3K5WA 1UK8A 3WNCA 1G4UR 5YASA 4DCTA 4QO8A 3PENA 5AXDA 1I2DA 2DX7A 3FUXA 3IT3A 1Z0DA 4DQVA 3GLFA 3H9EO 3JAWA 1UAAA 2GVZC 1RBZA 3SN6A 5DT2A 5A9SA 4CXMA 3ENVA 3S28A 4CF4A 4YUWA 4HLUC 1Z37A 2HDWA 3E03A 2PRZA 2PDAA 4JQYA 4MZXA 3WGGA 1J06A 1NQWA 4BMVA 2H1HA 2QI9C 1HKUA 3GUZA 3R7BA 2C5HA 4AF7A 1UK6A 4MGZR 1RNLA 1H05A 2BI8A 1QH1A 1UJ5A 3RFUA 1I4WA 4WN9B 2UYGA 4R1PA 1JT9A 4FQ5A 3W7BA 4E5DA 5TLSA 4NV1A 1QK4A 1TK9A 2PXCA 1YRHA 3L1JA 3WC4A 3HWWA 1DO2A 1SXIA 2I6SA 3M89A 4Q4AA 5D3QA 4M98A 3H1AA 3REOA 3RS7A 2Y27A 2QDXA 4DLRA 2O2XA 5LKRA 3R6DA 2Q4EA 3OKPA 1FDOA 5KSYA 1A7JA 1RQNA 1T9GS 2NTJA 1SXJD 3FPEA 3LT5A 4AJ9A 2FZVA 5ARDA 1KXJA 1PW5A 3K0EA 4TWAA 3B12A 2IITA 2XGSA 1VLLA 5KB3A 1ZJYA 3NGMA 4TN1A 2KM1A 1K89A 1NBEA 1QO9A 3EDCA 4YROA 4AJNA 4D9EA 4DV6B 2HOQA 4N76A 4NMLA 5J47A 1M1NA 1Z4IA 1BE8A 2CXPA 4IWYA 5COBA 1ZESA 2IYFA 2GBGA 2JJMA 3EFOB 1VPEA 3H9QA 4EK9A 3T3NA 3FLEA 1TYCA 1WV1A 2OV6A 4LRYA 1MIOA 3BXFA 2P69A 3RKUA 4DM4A 3ZBTA 1ZKMA 3DHNA 1EZZA 3K16A 5C4IA 3L7AA 3HFRA 1FA9A 1NVVR 1KO1A 2E4AA 3RG8A 4D9GA 2EVWX 2EHDA 2TS1A 1E9FA 3SEAA 1KY4A 1H0HA 4KXLA 4MWCA 4DM3A 3O3CA 4LXQA 4OUDB 1T8UA 3RI3A 2FFHA 2M6SA 2J0EA 2BBSA 5DTEA 4QEKA 2QD4A 1Q91A 5G0TA 5FUXA 2BZ1A 2YNMC 3KC2A 1M2OB 1VL2A 3MERA 3A4TA 2Q1SA 2NZWA 1T36A 2WHPA 4R2LA 5DZSA 2EFYA 1USVA 2WM2A 4AICA 3OY7A 5LZ4A 2RKBA 1P4GA 5B1YA 1NG1A 3H11A 4AMZA 4XVQA 2XW6A 2QE6A 3GZNB 2BLNA 3HCRA 1BX0A 4BO6A 6REQA 2DHDA 1LBSA 4DR6B 1AUXA 6AT1A 3RW9A 3GXBA 4EDFA 1N5OX 1HYBA 2EFDB 3WDMA 4EHIA 3P1JA 3L6CA 4NFSA 1I4OA 3U4MA 2HUPA 3F5QA 1U04A 1X8JA 4TWJA 3WLFA 3NHBA 1L6IA 3PDCA 1H6AA 2FW8A 4RK1A 1OLOA 3BRWA 4Z54A 1CVRA 3OM9A 4PXSA 3ROZA 4V1CB 5KYXB 1NRIA 4BVJA 4EPRA 4CFSA 1TW3A 3EWNA 2YFKA 4RS4A 3ZWDA 4E32A 2D8MA 3B51X 4UFNA 3VC1A 4EVIA 4EGAA 1UKZA 5DCYA 1DAIA 1E79A 2H3HA 4GSLA 1G18A 2Z8YA 1WD7A 4TVBA 2QW1A 1ZJWA 2I4NA 1K6JA 3GFSA 4HHEA 3D8HA 3UHPA 4A92A 3H2YA 1CUXA 4KIFA 1JG3A 2GN1A 3LDHA 1W2HA 3O7MA 3GB9A 4ENSA 1QRUA 4IQ4A 4Q1AA 4N49A 2XODA 3GJSA 1P2TA 1P2FA 1PR0A 2D1FA 3VBCA 3IIKA 4DEXA 4ZQCB 4ZVLA 1H4SA 1NR7A 2I2AA 2HJRA 2JJ2A 4XFKA 1KE1A 1V35A 2Q6KA 4DOMA 3MB5A 4ZOLA 3W9SA 1G0OA 4YMWA 4LI0A 3PDUA 4FYIA 4ZQGA 4Z4IA 1YRAA 4YAWA 4DG5A 4JSYA 3DHWC 3B85A 4MW7A 3LIIA 2FMTA 1GP2A 3FW1A 5JAZA 3SHQA 1SXPA 2IT1A 5ICSA 3V1NA 2PQ0A 1DIHA 3WB2A 1OYOA 5AHWA 2Y1WA 5K4HA 2UYQA 2SKEA 3PLAE 3RUIA 2HSDA 2JI6A 4S0ZA 4E14A 1K5PA 1ULTA 4ZTUB 1YD7A 4RZUA 2ERYA 2B6NA 5IM4F 1YONA 1ECJA 3M33A 1LQTA 3UAVA 1XDSA 1H6DA 1SY7A 4LDJA 4GKAA 2PBRA 4AO8A 3VYSB 5HRUA 1Z5PA 3SIPA 4JLOA 3ICQB 4BMSA 3KQSA 1A8IA 1U9IC 2WJHA 1JQLB 2B92A 3TECE 4Q3DA 2F59A 3HCCA 3KTAB 1LNSA 1QGDA 4BY9E 1ZGCA 3K72B 1TM3E 3PQFA 4FOLA 2WZBA 4MJLA 3A1CA 3R3XA 1UBKS 5H81A 3B9QA 1EA5A 1SHTX 1WULS 1VHJA 1E9BA 4OQZA 2R66A 1Z0ZA 4F6RA 2FG7C 3HKDA 3ZG6A 3I6ZA 2B8NA 1JJAA 2BEKA 3VO2A 5BO5A 1XJWA 2KPOA 5IXSA 3CF6R 1MNAA 3WLLA 1RVDA 4RU1A 3M1YA 2I6TA 1PGOA 3AF0A 2VPTA 4K6HA 2CL5A 3NCTA 2HLHA 1DLJA 1HYQA 5CT8A 1X9GA 3EFHA 4REOA 1MPXA 1Z33A 2O3RA 2IH2A 3H2HA 1XJCA 3S2ZA 3JQGA 4P7GA 3PI6A 4ZK6A 2VJBA 1B26A 3N7TA 3EZFA 4CU5A 1E3LA 4LTNA 5DH9A 3O26A 1O89A 4Q34A 1H6CA 1ARZA 1ZIPA 2PQMA 2UYHA 2PJUA 3CUYA 4IDOA 5DCUA 5FA8A 1YR9A 2P9HA 5B36A 2PGXA 4XQ9A 2O8CB 1I8TA 3FTCA 4W4TA 5I7EA 4MQFB 1KJJA 4F12A 5IJ0A 4PPGA 2M1XA 2AN3A 4B79A 1HQDA 2ZITA 4NJMA 5CT6A 4CMBA 3ESBA 4BE7B 2WYWA 2XZLA 1JF8A 4RVOA 4I8DA 1XZJA 5TJHA 1XTQA 4WNAA 2R6ZA 4YRCA 2VZ8A 3L49A 2DUUA 4RA9A 3WISA 3NEYA 1FL9A 4IDDA 4RV5A 1KE2A 1F6BA 3VZDA 2PYIA 4HEJA 3IHKA 1J8QA 3M2TA 2GXAA 4YAEA 5HOQA 1GGJA 4HK4A 1V5FA 4I19A 1MAWA 3E18A 3E2PA 1U80A 3N5KA 1S1CA 2J4DA 1ZY2A 4FX5A 4BFWA 3FKSA 4QUAA 1YJXA 1H9BA 1XZFA 4POAA 1LTHR 4LHSA 4I4CA 5AKXA 4E6EA 1HNWB 1EVZA 3AERA 3NP7A 1K7CA 4EITA 2X2OA 2WJIA 3UK1A 2QYOA 4UDYX 3SS8A 1KA9H 2PUTA 2BVNA 2R1UA 3HN6A 3PXCX 2YIVX 1GT91 4IP0A 4QELA 4S35A 3PJRA 1V8BA 1L7EA 2PSSA 3KT3A 4NS4A 1ABFA 4DLYA 2PZEA 3HSYA 5JS7A 2C7PA 3DZDA 3Q7PA 1EZ1A 3I9JA 1H2BA 2II6A 2C4TA 2XRFA 2QL9A 4YB8A 5IMSA 5KC8A 4QAJA 4PZ0A 3WL7A 3X1XA 1EBFA 5DM0A 1RXCA 3E82A 2H00A 4Q16A 1V5WA 3U7RA 2YASA 4FS3A 4CL8A 1SHJA 1ZOOA 3LLCA 1YK1A 5DBGA 3ZQUA 3KKNA 2BMAA 2G09A 1JDZA 3CF2A 1U1FA 4AK9A 1WVMA 1XKQA 2CXXA 2D7CA 5DI9A 4J3FA 4BQOA 5GGYA 2JLWA 1TCCA 4UC0A 4H0NA 1C3VA 4EY5A 3UCFA 2WU0A 3GCGA 1N8KA 3D4IA 3C48A 1N2IA 3QFFA 4HNHA 5GMOA 3VVLA 4ZI3A 2EGUA 1R0YA 3M9XA 4DLNA 2GFHA 3HBNA 3JQAB 5CPBA 5CM8B 4OM7A 3ZW7A 4DIKA 3LPCA 1DKLA 5C7LO 1FNMA 3GLSA 5FBVB 3FROA 5A05A 4QU9A 1Q95A 4W8HA 2C4KA 1PSZA 3AEQB 2BFCB 1USUA 1M7GA 1Q3TA 3C43A 3WP0A 1ZJ6A 2H17A 3ANYB 4Q93A 3EA5A 4ADSG 4YMLA 5HE9A 3H8VA 3B60A 1LS6A 4XIJA 4O29A 5KJFA 2QV7A 2A7XA 3UUGA 4IWNA 3ZU2A 5KTMA 5ELXA 4O4LA 3QTBA 4GR5A 1EHYA 1CUYA 3QHAA 4F92B 3O83A 1M2VB 3RARA 1ZRMA 4XI9A 4V0KA 4UASA 3REFA 3HLTA 2Y1FA 2OOKA 4KE9A 5E2AA 4AN0A 1TO6A 1AC5A 1MB9A 2DRIA 3Q3CA 5KTYA 3UFBA 4GL2A 2ASEA 4M55A 5AW6A 4QFBA 4TL9A 4GGOA 2GK6A 2NO4A 5AJYA 4YUYA 4Y7DA 1D7OA 4HD8A 1P2UA 2ZE5A 3I01A 5JE8A 1FP6A 4S1TA 1EPUA 1AS3A 3NANA 1G4AE 3EVNA 3P2JA 4JN6B 1HYGA 1FDTA 1PYDA 2R11A 3A28A 3GJ5A 2XOKD 4P0TA 3R3VA 2IP4A 4DARA 1QUEA 3FCUB 1U0RA 4CMEA 5CLQA 4BDTA 3KCNA 4NFLA 3MCAA 1G5FA 4MQEB 5IT4A 1XPOA 2ID8A 1C7RA 3AHJA 3MN1A 1TZ2A 2DKFA 2OHFA 2XTMA 3KAJA 4MTLA 4UD6A 5LA6F 4BJ3A 5AW2A 1L5RA 3P0JA 2O20A 3ILHA 2XITA 3LQ4A 1WMSA 2C3UA 4V0QA 4LOAA 1HZZC 5LA6B 3B5IA 3ZWXA 3PTZA 2DLCX 4KXNA 2AF3C 1C7FA 2E18A 2WTXA 2F64A 1G55A 1KKUA 1L5WA 3F46A 3ME5A 3UJ7A 1V5EA 2Q1XA 3W5UA 4IIBA 3T5AA 1EX6A 2HWYA 1DC6A 2JLVA 3WWCA 5DB4A 4DDUA 3UTDA 4R1LA 4DIFA 3QYAA 4Q1DA 1T3HA 2HM7A 4MB6A 1GFWA 2O2HA 1WXHA 1LW7A 1P5ZB 2XUFA 4AIRA 3OETA 3EVCA 4DCMA 3LK7A 5TGTA 2O7SA 1AZWA 2H0AA 4K9RA 2V8BA 4RL4A 5A4MS 4R4JA 4BO2A 4PZUA 3X1ZA 2EHJA 1ODJA 4G4IA 4YRNA 1J0CA 2GZMA 1BX3A 2D5BA 4QJIA 4XDGA 2NG1A 4D4MA 4QATA 4IS3A 2W43A 3I3SR 1LQ2A 2FSPA 1H2XA 4J0KA 4P84A 4PO8A 2H0QA 4WDRA 3JCZA 3A27A 4ERXA 3DT9A 3RCBA 1W1WA 1J70A 4G89A 1SRQA 3NRCA 1HSZA 1SA0A 2ZROA 5IAEA 3KEGA 2ZG6A 4ZAZA 2ZIXA 4PYJA 5LL6P 4Q39A 5JRZA 3HB0A 2ID9A 4TTIA 2QM3A 2ZS7A 3WLRA 4U9IS 1WPQA 3IEUA 1OA1A 1SVUA 5KMGB 2FZGA 2JEOA 4MKRA 4WNCA 3F97A 1DX6A 2JBWA 5EG5A 3SHFA 2JPDA 5ALYA 4CEJA 1JHMA 4QVGA 1EVJA 1HT2E 1NRWA 1F8YA 2CNBA 2IUTA 3GJ6A 3FOEC 4NHEA 1QANA 2REQB 3PQ5A 5AVKA 4IKPA 1Q0LA 1GQQA 3TD9A 4BLUA 1XNQB 3L1UA 1GAWA 1JXAA 1V4VA 1Y3IA 2QN7A 4G5RA 3PC8A 4D43A 4N41A 4L15A 3EQ7A 1RMQA 1YBVA 2C58A 3TDNA 4IW3B 4F4DA 4RDCA 5FWYB 3DZBA 1HDZA 4DVJA 4TT8A 2WTEA 2CNWA 1H4TA 1F48A 1CE8B 1LBTA 3DBRA 3DXXA 2ODBA 3ESQA 3GYBA 3CEPB 1EE9A 3IMGA 5KDOA 1M7BA 3HZRA 1JBKA 2DKOA 4H15A 4J0DA 1RXSA 3LC2O 4Y2HA 1BRMA 2HFJA 5GIOE 4KNYA 1HK7A 1JEYB 2UZAA 4TZ0A 1XZPA 1JP7A 1L5SA 4MMXB 2O06A 2EKDA 3GT4A 4MWBA 4OQ4A 3F5DA 3BOSA 4E7OA 1RAGA 4PRYA 1MAVA 4RXMA 4Q1VA 4NMWA 4ARZA 2GDJA 4KPFC 4CMKA 4BV9A 4GI3A 5LC1A 5LZ2A 4RKWA 1TA0A 2WFLB 3HLKA 2AV6A 5KWVA 2P27A 1Q22A 1E1DA 4JL8A 1ZOSA 4GG1A 4BO3A 3GIWA 1X1BA 2W93A 5E9AA 1KPGA 3K5HA 4QSHA 1TTPB 4CLOA 1E3WB 2WB2A 1H8ED 3T35A 4BXOB 4OLHA 4KQJA 5ALPA 3ILSA 3UMRA 3WYFA 4FMCF 4HMOA 4MO2A 3V4FA 4C7BA 3UW3A 4UNRA 4L73A 4AJEA 5CEEA 1OD6A 3IA2A 5EJ4A 2UUBB 3VHXB 4FMCB 1X8LA 4C0KA 3IE0A 2AA3A 4RDIA 3GEGA 1E18A 3VC2A 1Y98A 1YRYE 5C4MA 2PZKA 2ERCA 2PMWB 3NNNA 3EG5A 4GLJA 4Z9AA 5F23A 5IXYA 4BLTA 2OZLB 3D0OA 2QT1A 2XVXA 5E9WA 3S6JA 3INTA 4GI2A 3Q3EA 4KI7A 4TTAA 4US1R 3I09A 1NQXA 1WTCA 1X7HA 3LKBA 2FN9A 4B46A 4YRFA 3D8RA 2OGSA 3VZRA 1DIAA 1QPGA 2W9XA 3LX4A 2OHXA 7GPBA 3VNAA 1QYDA 1XO1A 4IFTA 2HFKA 4ESHA 1EHIA 3NUZA 5EXTA 1FIUA 4KPEC 5JZ9A 5J1TB 621PA 3ESRA 4YCNA 1TZJA 4TYNA 1NXWA 1W47A 1M10A 2UDPA 2XE8A 3LCUA 3QVTA 4XGNA 2ZI7A 1G4HA 2ODTX 3LRXA 3KVYA 2QXYA 2Q5HA 3VQTA 2P8JA 1OZGA 3QWAA 5EMKA 5AUQA 1RAHA 4IJWA 5KEIA 1R9JA 1TEXA 2C0QA 2KHZA 1RZ3A 2OGUA 5EKDA 3T5BA 3L0BA 3VM6A 5IC5A 5FPQA 2EG9A 2EW8A 4GKJB 3F6PA 4F2WA 3BVPA 4FFBB 1B3BA 1GWNA 3K09A 2D7DA 1N2XA 1A9RA 2LIPA 4CG3A 2C95A 3A3KA 1SBCA 5H9WA 5I3ZA 4QUIA 3I39X 3JW8A 4JJ8A 1EK5A 1SKQA 3VO8A 3RS5A 3WIVA 3HXMA 1VMKA 3C8DA 4YQYA 4DUYB 1DAMA 2AG1A 1SFRA 1E7RA 2CLCX 1BIFA 1FYEA 1RI5A 1THMA 2IXDA 1NUUA 3IMEA 3P2EA 4NEHB 4WFIA 3T3HA 3CC8A 3PU6A 3ZGYA 4DJJA 3JD1A 4LCJA 4EG0A 1EE2A 1OLXB 2P5UA 1CUWA 4U1RA 2PM8A 4DDTA 1Q0ZA 4UM8B 4KQ9A 1XBTA 3O4RA 3K9GA 1R0RE 4FS8A 2FPPA 4D5GA 3THYA 1O9GA 2WSSA 3TLEA 2W2MA 2NQ8A 4IICA 3UG7A 4YJ2F 3HFJA 4R9UC 2ZATA 3ZD7A 4QUKA 4YJ2B 3N75A 3DMPA 4FEYA 3WMFA 3Q0IA 1RE0A 1ZOLA 3KQOA 2ATIA 2FZ5A 3IOCA 3LKDA 2L17A 1W8DA 4RORA 3B3JA 3AF1A 1ECCA 1PS0A 4D42A 4M7RA 4NMHA 2GPNA 5EFZA 4DV0B 3ROFA 4Q9KA 2DVMA 2FETA 3T1NA 3VV2A 1RWXA 1UBJS 2ZYWX 4RY2A 1G5HA 1J7JA 1E1YA 1GOTA 3A1TA 3IOBA 4ZO9A 5CP8A 2HAEA 4RTSA 4IHJF 4E1VA 4I81A 3OE1A 3S27A 4B4UA 2IYUA 1NR1A 4L07A 3OA0A 4DYDA 4IHJB 4IY1A 5FTLA 1X19A 3CRZA 3B1VA 1WUJS 3VUEA 3IIJA 4DRYA 1XEWX 1DTWB 5FBZA 1MGPA 2ZAIA 4CT4B 3OPNA 4A5OA 4DZTA 5BXYA 3KQTA 3VSAA 3P9QA 1P44A 1H2EA 1Y7LA 4PGAA 3P45A 4MVJI 5CA0F 2IYAA 4F0JA 5L95A 3SYTA 1Y7TA 3O4FA 4OM8A 3ZE7A 5CA0B 1MO5A 3SKXA 3ZWCA 4BTVA 1GL3A 2H4JA 1NHWA 3AF2A 4ZT6A 2V6JA 3AFNA 4L95C 2HCFA 4KZKA 5ALGA 1XX6A 1PZMA 1XFAA 3R0VA 4PCUA 3EZ7A 4YCMA 1DRUA 1EP1B 3NBZC 4ZCSA 2CUNA 1ML3A 1QNFA 2ENUA 4YX9A 3PGKA 4BKOA 5F9FA 3VX3A 4BWYA 4L75A 1T8WA 1XD2A 4O4JA 4S04A 3RC9A 4L27A 4ESOA 4OLFA 4FWTA 4S1OA 3DVAB 2V3VA 5CMLA 4WVLA 1V1MA 3B38A 3T0IA 2QG6A 3O2NA 1YCHA 4K3UA 5L3QA 2PSHA 1JYSA 2C84A 1I32A 2FSSA 1M75A 3KOZA 3TR6A 1PJRA 3B6ZA 4UUOA 4H1WA 2Y1LA 1CLUA 3B1ZA 4IVNA 3FFAA 3RR2A 4EMUA 4F3YA 4E1AA 5TQ2A 4P22A 5HZGA 4JLVA 2NSYA 3MWEB 4X97A 2FH5B 4GOLD 2H2FA 1QFJA 3LWDA 4N7RA 4C0HA 4X3OA 2IQ5A 1QTNA 3NPMA 1DPGA 5JCPA 1NVKA 2ZAYA 4ZOEA 3M6LA 3BCSA 2IVZA 1NUPA 2EAUA 4FDMA 4M46A 1MVOA 3VU1A 2Z2XA 4B7AA 3TLYA 5GADl 3NOXA 1EQ2A 3BGOS 1K5GA 1S8NA 3MJDA 3NWOA 3SR0A 3ZDAA 4XGKA 3WWEA 2LR0A 3HUDA 3U4IA 4U00A 4D9HA 3EZYA 3K0BA 3SVTA 2GTPA 2PUBA 3QUAA 1EXMA 5KTTA 2YWFA 5LWQA 3FF4A 4UUAA 2J9FA 3U5TA 2Q1UA 3BMQA 2P2DA 3AGPA 4AMBA 4NLLA 2RH8A 2D5AA 3SOZA 3S5UA 1GGKA 4X94A 3GLIA 2AB0A 4MYCA 2DHQA 4F5WA 4F45A 2XLBA 2GBIA 2V03A 1WPRA 4DV7B 3EAQA 3OQBA 3D3WB 4ZPXA 2OORA 3RUPA 2WJJA 1JIJA 2J3JA 5DWVA 2G9ZA 1L4LA 3PGLA 4Q9HA 4RLHA 4C4PA 4KZPA 4FFVA 1EAMA 1FFGA 2GESA 2QVCA 4YRBA 1I1NA 3UMMA 4HEA1 4QQFA 1AGXA 2OD2A 3KQKA 4C2TA 1CP2A 4Z86A 2JFUA 3L6BA 3W2EA 4G25A 1NM5C 5C53B 1NTRA 1BHSA 5JWHA 4WJKB 2F9LA 2VC2B 3H99A 1L3IA 2WTNA 1KQGA 3T1QA 1DQYA 3ADPA 2H08A 2MSNA 4LTMA 4PGMA 3TLBA 5AW7A 1I7SB 2DETA 4RKQA 1FJXA 3H4MA 4JYMA 3ZCVA 1P5HA 1KP3A 1OWPA 3LBYA 4QJ3A 4QYMA 3ESAA 3LNCA 2WTBA 1F0NA 2EZ8A 3ESXA 4O2BA 1JQ5A 1L4YA 5JCJD 2B9EA 4NJOA 3AY3A 2Q6OA 1M73E 5CJJA 4PG7A 3RUEA 3L6OO 1FVOA 4MWDA 4LTDA 1H42A 1W35A 1WU8A 3ZK8A 4E4YA 5THKA 3F3SA 3DMNA 5GONF 3SDBA 1V0JA 3U7QB 3PHLA 2EWWA 3OAAA 4UXJA 5GONB 3ZN2A 3LWBA 4OY3A 1QCZA 3C6KA 3DZJA 1Z4MA 4ML3A 4B45A 3JYQA 2BFBB 2IK8A 5TRTA 4HN2A 1KDOA 3BUSA 4FFNA 6NULA 1SKYB 1K97A 2WJPA 4ICIA 2FRDA 2OHVA 4J1QA 1UKYA 2FWPA 5HK8A 3URKA 2GZAA 2R6JA 2VKQA 3OIDA 1M1YA 2HBZA 3L8CA 2RFLA 1QLWA 3KAQA 4LJLA 4MVJE 2JATA 3B6JA 5JJKA 3U7EB 1GPAA 4GL4A 4DSZA 4ZTZB 3QUBA 1N0WA 2VUTA 3QPVA 1AQUA 1UL1X 1YVUA 3I04M 2QEQA 3MXTA 5A5EA 4YAUA 3I5XA 4K9DA 1QH8B 4LJ4A 3D6HA 2W2KB 5LUBA 5HJ7A 5IT5A 4IX1A 1WX1A 4HUJA 3NX4A 3WGMA 1P1IA 1QU3A 3R0JA 5ILQA 3GRKA 5EIFA 4U7HA 4CDGA 1BWSA 2ZBPA 2DWOA 4G5SA 1LI4A 2BISA 1RYFA 4M9XA 1ODKA 3M6AA 1M0SA 4AU1A 2O8EA 5B1DA 1LC3A 3C15C 3PHJA 4JYBA 4XWAA 4NCAA 3P4XA 3RTAA 4KYTA 2XOKA 4XPIA 1EWVA 3V1UA 4DRXA 3QXCA 4JYZA 5HDBB 4HQKA 2Q2WA 5HKKA 2O2EA 5L3ZA 1TLLA 5JAUA 1LI5A 1FW6A 3L6EA 3KZMA 5BRJA 2O3UA 1DMSA 5C1PA 5DM2A 2ZT8A 2PXXA 2Q28A 4LE1A 4AYTA 2VJMB 3AR4A 4DCUA 1J99A 2QYHA 1CQIA 4G81A 4Y9UA 2DLNA 4LYGA 3SBXA 3U9LA 4KSBA 2EEZA 2VJOA 5ARCA 3D3EA 4M1QA 5BSVA 4V0RA 1NPTO 3DMTA 1RBQA 4IUDS 5CIYA 1C4OA 4RTKA 1CIPA 1FBTA 2CFSA 3IKMB 5ILGA 3ZGOA 4BL5A 4H18A 2DWCA 1EGVB 2H7XA 3OWHA 2OO5A 1T4DA 3AHGA 4HRXA 2ZPUA 4V0SA 3SQNA 3T3PB 5A4AA 1G7RA 1WP4A 1OPXA 4E3WA 1CQXA 1QV9A 2BEWB 2NZJA 3EEQA 5TMBA 3ETNA 3PDHA 5AKIA 2NM0A 1CZNA 1NZDA 2GDZA 3LOQA 3OU2A 5HGJA 4RTOA 1XKLA 2R7KA 4LVOA 5C51B 5BPHA 1M67A 1EFUA 3E3LA 3JQ7A 2UUAB 2H7YA 4DG9A 2VWPA 2FGJA 3SX4A 1NAIA 1WCIB 3C14C 4X0EA 3AQ4A 1JFLA 1FSSA 3IV7A 4GIBA 2ROQA 3IODA 2YN0A 4X1YB 3U17A 5JBQA 4ZYUA 2C2BA 2IUSA 3HHEA 3P4UA 5LN1A 4MARA 3KPVA 4PZEA 3DOFA 1KYXA 2BJVA 4POOA 3OLQA 3FUCA 1NMSA 1CETA 5A4JA 5KYUB 3ELDA 1TIPA 1J2RA 1L8OA 1RYEA 2WTMA 1TGVA 1YQXA 3ONDA 3FB1A 4PAGA 4AO6A 3KJZA 5A2QA 4QOJA 1PTKA 4YJ3A 2XE7A 2I76A 3NOQA 2OB2A 5A71A 1KP9A 2WTUA 1WSDA 5DXJA 1K9VF 4KV7A 2M6RA 2X41A 4MLCA 1ZICA 4ZANA 3FDZB 4X54A 4NU8X 3VVMA 3GA7A 4F8JA 1V3VA 4F46A 2OG2A 4QYWA 4ZI7F 2RH9B 5EHZA 1OLUA 1RAIA 4P36A 4UHBA 2F1RA 1NT4A 3ECSA 1N5RA 5LMNB 1Z6XA 4ZI7B 5AOAA 3RYCB 1REQB 2BFFA 3NH6A 4CKEA 2AFIA 5ETJA 1DG9A 1JKJA 4M3NA 3ORHA 1TM5E 4HNSA 4B3HA 2ZAMA 5FH9A 2IXFA 4I9HA 5DBFA 1IJFA 4W5NA 1NMQA 4LZZA 2PAAA 2FMKA 2RHGB 3JRNA 4UVEA 4B3MB 1IMOA 3VFDA 1T3GA 2YHAA 4NV0A 4RLSA 3NORA 1N2HA 4YS6A 2HF9A 4JT4A 4L8YA 3UUFA 4CCYB 4JBNA 4ETWA 4F2GA 4KR7A 3KT8A 3KXLA 2YJNA 3HDHA 1U8UA 1DJOA 1PVVA 3ABIA 1E0JA 1V1RA 4B6QA 3PGVA 3P9IA 5G2OA 5CM9C 2XV1A 3H0CA 4DQDA 5LD2B 3FCXA 3WAJA 4ARAA 4GI5A 1C0EA 1CUGA 2NNLD 4MRVA 1Q3HA 1JECA 3E9ZA 5HM6A 2ORYA 1KO7A 1PWYE 2ZWOA 3L82B 3LLSA 1RYNA 3HACA 2JFQA 5C3UA 5T8KC 5AHKA 1E4EA 1K98A 5K8LA 4OHWA 3WGNA 1GG9A 1P6UA 4PNEA 3FBTA 1Z2OX 2B78A 4UHHA 2H57A 2WVJA 2NYRA 3IAS6 3D3NA 4OI4A 4RY0A 2IDKA 1BDMA 1UCFA 3VR3A 3A4LA 4DC0A 2D4AA 1I3LA 4YCCA 1E5VA 4WK0B 1A27A 1Z2CA 3WQSB 1M8KA 2W0MA 3LL7A 2VWGA 5DXFA 2Y1CA 1XRRA 5DNWA 1BWRA 1MOQA 1PT7A 3QIVA 1L5FA 3OEHA 1SBHA 4I3FA 2G17A 3EXHA 3QVVA 1P80A 4Y1RB 3W8NA 3WVNA 3QG1A 2D2VA 2QW0X 3PV0A 3UCXA 3ZQ4A 2ZSBA 2YRFA 3BFXA 5FL3A 3VISA 2WM9B 1F2UA 1BXRB 2KBFA 3BRSA 2CLIB 3H3JA 5TMEA 2HN9A 4MV5A 2QTLA 1AKRA 2D1RA 3KL4A 5LBUA 4J0QA 3H2IA 1EDZA 2V1UA 1NBHA 3IRUA 1Z4LA 1W88B 2G5PA 2PKEA 4TMKA 4UM9D 3VHQA 4E31A 4H7EA 5KOHA 1XGKA 3B6KA 2QA5A 1SOVA 4ZKDA 4JQZA 2GXSA 2VXBA 5J5VA 1QAQA 2QUHA 5DHTA 4DIOA 1DIBA 2R6DA 5HJ2A 2K7ZA 4ESEA 4H0FA 5I48A 2I2CA 3HBAA 4D4HA 4WBNA 4BO9A 2V96A 4X45A 3PPIA 1L3BA 2XAAA 3Q6IA 2YCBA 1LPNA 2G88A 2G08A 3ZI7A 1UWKA 1V7QA 4JLMA 5EERA 4BRSA 4ZJPA 3AZQA 1G16A 2ZIVB 3UT6A 3H3FA 5LFAA 3LM8A 3HY6A 4EI9A 1TAGA 1FFDA 2ZFUA 4D4GA 4F1JA 1WUIS 1CJSA 4MUHA 3AV0B 2C9OA 3AP3A 3P32A 4RWZA 3PEVA 4BN4A 1JAZA 2ZVJA 1WE2A 2BR5A 2V7VA 5UKDA 4GLBA 1OYVA 3T5CA 2Q6VA 5J2TF 3H4TA 1YACA 4XDZA 3NV9A 1P9WA 4C1BA 3E9EA 1TM7E 3BRQA 1HOTA 2Q99A 3CW2A 4LBWA 5FT9A 1ADGA 4DJFC 5J2TB 5LMUB 3MCWA 5DX0A 1FMCA 1V3UA 2QD3A 3BB4A 4BMYA 5G0WA 3NG1A 5EVJA 4DE5A 1XE3A 4DA6A 1WAMA 1E6WA 3MGAA 5AVJA 1JJFA 1U0TA 2B34A 4QPNA 1GPWB 1LSJA 3VYVA 3DR5A 4NX2A 3ZHXA 4C5CA 3H3XA 3TN7A 3LKVA 1YAJA 3JY6A 1FP1D 4WKOA 4Y9RA 2BUAA 3P26A 1DBPA 3KCQA 4C76A 3PITA 5BQFA 3L3BA 4FNGA 4UFOA 3RHSA 3QOXA 4N03A 3RS9A 1F5SA 1FUIA 1VE3A 1BW9A 3QW2A 3RVMA 1PJQA 3S2IA 5C5IA 4O02B 4QTTB 3WK6A 3HMQA 5AVVA 1KI6B 2AQ8A 2JDID 4U0KA 3RS3A 3VZQA 1CDOA 1XAJA 6ABPA 4ZYVA 3O91A 2ZJ8A 1FLNA 4QYTA 5DNAA 1IXYA 3NWJA 3LY5A 1WKVA 1TK3A 2J59A 3PB3A 3TRDA 3VJLA 2H1OA 3P0FA 4HWTA 3FVVA 4NEGA 2Q9AA 1HRKA 1W30A 2F9FA 2XCQA 4JXKA 5EVCA 3RVQA 3TTWA 3WK5A 4DB2A 4P0QB 3HE3A 4M6WB 2QLNA 1Z7WA 3EW9A 3FCOA 4MYRA 2YOFA 2X4IA 3F4BA 5AHXA 4B4VA 5IUJC 2WF5A 1O95A 1P2DA 5C8XA 13PKA 2EFEB 3KJIA 721PA 2J4CA 1PGJA 1OLSA 3TG2A 3CX8A 3H18A 3ABOB 4FW9A 1AIPA 1RWNA 3IHWA 3BL5A 1V2HE 2G6BA 2DU8A 3HR8A 4M1SA 1YBFA 1CR2A 2VBCA 1GUYA 1B1AA 2BPOA 3EVAA 4DV3B 2G1KA 1WNFA 2ZJ2A 4JJ7A 2GSDA 4OHYA 5JNTA 5F7ZA 1BMTA 4MIOA 2J67A 4LC1A 1CJVC 4URFA 3D5TA 1GNRA 4YHHB 3GXOA 1Z47A 5EJGA 2MYNA 2MSDB 3T7TA 2DPGA 3NNSA 4IMPA 2QUJA 1OXMA 4RZ3A 4D3FA 4KW7A 1UXIA 2WTAA 3E1GA 4XW2A 1KARA 3D8SA 5D00A 1IQ0A 4K3VA 4D3SA 3ZE0B 1GSOA 3TL2A 4C0JA 2RD2A 1U3VA 1VGRA 4WXEA 1UBRS 4J4BA 4E3ZA 4DWJA 1E7WA 4HDSA 1T1JA 3M4YA 4NVRA 1U4OA 1NP7A 3E9MA 1WO8A 3O9ZA 1VBFA 4YRJA 1XTSA 2H52A 1W4CA 5IANA 1G8JA 4IINA 4QDJA 2CKMA 3V1KA 2Q3HA 3ZLBA 2XEXA 3ORFA 3KXKA 3PQ2A 1Z6QA 1VCNA 2JHAA 1MOSA 1Y37A 1Y33E 4KR3A 3WGVA 1HNXB 2OQRA 1AKYA 3URMA 3KD2A 2W2QA 2NACA 2ZE8A 5E4YA 2XMQA 1ABBA 2AFHE 1QIMA 5E0KB 2XB2A 2VT3A 2CY0A 3ZBPA 4HX5A 3HP1A 3HG7A 1XZQA 2A1IA 4AZ0A 2IYPA 5FUYA 1U2PA 3ASVA 4G84A 4BNNA 2NOAA 5EEHA 2IGBA 3V7UA 5TS2A 4WFJA 1K88A 4BPBA 3A06A 3JAKA 2XVYA 1ESCA 3OLWA 4ZU1X 5SV2A 2ALJA 3SJUA 4HB0A 2PU7A 3DB1A 4AKEA 1XPJA 4D1YA 4UAUA 4MJ3A 2ODQA 1FNBA 3NPAA 4AJ1A 3W8RA 1RLUA 1U7PA 4JDPA 2O2DA 3K4PA 1H2YA 1NQTA 2JRCA 3O8OB 2XMRA 1KMHA 3NKVA 2SECE 1D1TA 4OBBA 5JDIA 1MABB 3LDUA 3GG2A 3KQHA 1FSGA 1ZH6A 2O1EA 4HUQA 1TM2A 2CMGA 1WXGA 2VSNA 2WM8A 5AJVB 3MBOA 4PG5A 4ZO7A 3T54A 5JXWA 4E22A 1GKKA 1U2GC 1WBBA 1IRIA 4D6PA 2RGGA 2O0JA 5FHRA 4KE8A 4BYGA 1J2EA 2QLJA 3HCWA 4X8LA 3VR6A 3O93A 1A71A 2WIJA 4X65B 1O54A 2AYYA 4TL6A 4BNFA 4PANA 1QMGA 5FF9A 4JHLA 1JB1A 3VI3B 2IHNA 1WEHA 4URHA 2CFRA 1EGHA 3QX9A 4A1OA 4CTKA 3UFXA 5A4DA 3U61B 1QR6A 3NT4A 4YDSA 5M2QA 5K03A 3LAWA 3KYDA 4O2AF 3SWWA 4C0LA 3IPXA 3COPA 3GJ8A 2XY4A 5C46F 2I3ZA 2I4OA 4O2AB 4KPUB 4J0CA 3OCJA 4JLUA 3T1YB 3C41J 4OOEA 4F5YA 2JAUA 4KQEA 1S3IA 4A0HA 4LYFA 1AGNA 1U9JA 2AS0A 4B3XA 4S05A 4D79A 1Q1EA 4C2AA 2RDMA 2HJGA 2NXEA 5LU9A 1PGQA 5EZ5A 2DH5A 2DSNA 2P7HA 1ODFA 5D01A 1OI3A 2GHIA 4QIHA 4KAAA 5A3JA 2DWQA 3MQ4A 1RAFA 4NAVA 2VRBA 1MX9A 4JBWA 1V8OA 1EH5A 4AC9A 3TL6A 4BC0A 3EJ6A 5D7NA 3ZZ1A 2ZDQA 5MGNA 3AKCA 1N9GA 3I4CA 1B23P 2A2ZA 3C97A 4C1NA 5IJ9A 4GRAA 4CQLB 3ITDA 3OLYA 1HLDA 1RACA 2A0YA 2AXPA 4R7TA 4YCAA 3IOEA 4OQXA 1YC2A 1BEEA 1UMBA 3K9WA 4HWRA 4OHFA 3TM4A 1EGMB 3CX4A 1K75A 3T5PA 4KRXA 3KQVA 2P79A 4TGLA 1SUSA 1CFJA 2IF0A 2OSBA 1Q44A 3BWCA 1KSGA 4RABA 3QNMA 2VO1A 1FTQA 4RHCA 4V0NA 4BKUA 4FT4A 1PR5A 2Q4DA 1A50B 3HJNA 2BF7A 4Q1FA 3MLEA 1UC9A 1VG1A 2A3NA 4Y2JA 1YI8A 5DW0A 3L0CA 1YZ3A 1AT1A 1QOPB 1E2LA 4I6EA 5CURA 5CAEB 4FEGA 2PVSA 2W98A 3WL5A 3ZE9A 1HE1C 1PTJA 2CVQA 1XMOB 4Y2XA 4BYMA 5LM3A 2KS6A 3TSCA 2HA3A 4AMUA 5IVHA 5BWLA 3BJMA 4M76B 3DXYA 2JIBA 2Z6VA 1P81A 3O90A 4L22A 2IYLD 2VHYA 2Z5VA 1G8KA 4IDGA 4KLNA 3WNBA 3R7WB 2OGTA 3FRHA 5CU7A 5L6MB 4G0XA 2RGAA 3K0HA 1ISMA 1VI6A 5SYNA 5DP2A 4RV4A 2DG2A 2LUOA 3RDPA 3VUFA 1OU0A 1MGOA 2JD0A 2WSBA 3JPYA 4EI2A 4UBKA 5EIEA 2WZCA 3T5MA 2FOXA 4P93A 1L6RA 2WZQA 3AUXA 3VXKA 1U2DC 1LBHA 2XD4A 4HDNB 1WHTB 4LRSB 5KCMA 3RTCA 4DYVA 4IJ5A 1GSHA 4R5MA 5F64A 3SIXA 5A02A 2RCYA 3FSGA 4NOJA 3ET5A 1I7QB 1K7YA 3PD7A 3DHVA 3HI6A 3IESA 1FFCA 4C14A 3N05A 3OQIA 1ORDA 2C7VA 2Q3LA 2YFYA 5E6RB 1WLSA 2XMZA 5CDGA 1YDGA 3DV0A 3G79A 1O94C 2YZKA 3I2FA 3K1TA 2CXOA 3HJAA 3COSA 2FN7A 1MXHA 2F8SA 3IE1A 4DUZB 5EKXA 4ENWA 2FSFA 4MS1A 4BN0A 1YVDA 2FQQA 4TL7A 4W1RA 2PK3A 4CKYA 2CJYA 4WE3A 1TE2A 4EA9A 4FD3A 1UMKA 5EGNA 3UHOA 3SJCA 3D6TB 3O8QB 3OIFA 5L3VA 2KSQA 3MT7A 1THGA 1N3IA 2C2OA 4I14A 4PPYA 3BJRA 4RCZA 3EF1A 3PQCA 1H94A 1PG0A 4MPDA 5IAAA 4FZ3A 1ADBA 4KJXA 1OIWA 4KRFA 4CHGA 5AIBA 3UMJA 2I2BA 2C2YA 3EY9A 3RV3A 2IP2A 1HTWA 2XMGA 2Y1DA 1QGUB 2XMPA 1NUHA 3HPRA 3L7NA 4Q0MA 4B8WA 1K0FA 4CCWA 4M60A 2FN3A 2QTMA 4DWVA 1Q57A 2PRIA 3DLTA 1FSFA 5CB8A 1Z35A 2ZS8A 5LLTA 2F2TA 1USGA 4L85A 2HO4A 2DULA 4HB4A 4S1WA 4ZGGA 3U39A 3AQIA 3G7SA 3GHHA 4A2WA 4PGHA 5G3ZA 3TTUA 1EWTA 4HVCA 3WDKA 1RQ7A 2FR8A 1PYOA 3E4CA 3FLMA 3I4LA 1ISSA 2VJNA 1ZM9A 1O9BA 2XNCA 1ZK3A 3OJ0A 4GEGA 4IG4A 3U1VA 5K3OA 2EKZA 4KXWA 5K8VA 4M9QA 3GZTB 2BONA 3FR7A 3KQQA 3W6NA 3IULA 3W6UA 3ZHBA 1JDVA 2ZXFA 5CG1A 2JCBA 3QTTA 1AJEA 3CKKA 4KQMA 4CKZA 4L3OA 2QMUA 4Y2TA 2Z5GA 1UJ4A 3EA4A 4G01B 4PYKA 2IHTA 4R1UA 2IHKA 5CHYA 4LXYA 5H7XA 1F8GA 1LRKA 3OY2A 5K01A 4TLEA 5JIBA 3OZRA 2RAPA 5COAA 4ZALA 5DNYB 1WDTA 3KDSE 1K6MA 3O5AA 3FNGA 3IP5A 3QG5A 3CTMA 3EODA 4D0LB 2YWHA 1ZCZA 3ZX5A 3QFCA 5KNCA 2A1TR 2I4RA 3EXFB 5A5FA 3WLTA 2DH6A 3R8CA 1A2KC 2BV3A 5BQOA 1NDHA 3G9TA 3SYLA 2FPKA 3DVLA 4CPDA 4QPDA 5AVOA 3SKYA 1QAOA 1WY7A 5TQ0B 3UHAA 4CF3A 2IRWA 1TKRA 2QTZA 3KQPA 4MVXA 3WBFA 1D9XA 1X6VA 1QHXA 3FVWA 3QW4B 3O03A 3ZWKA 2GD0A 4F91B 1BVYF 1JQJC 2GLXA 1GAJA 2DQ4A 1JDJA 3BSWA 4QL3A 5AI6A 1QQAA 2OHIA 4KXYA 2Z1MA 5IAOA 5FBKA 3PTAA 4KIJA 2OV1A 2V0CA 4RFLA 5HZKA 1UMDA 2QIOA 3ROTA 1NZJA 1WA5A 3OBIA 4JUIA 2C5GA 2K4MA 3OIGA 5DK6A 3UV7A 1E64A 1NJ6A 3SJBA 1TEHA 4N0DA 4JI7B 4HEHA 5JWRA 2C8JA 2FP4A 2W42A 1XCGB 3LV8A 4LXUA 5DULA 4Y3UA 4EL0A 4ZARA 5L7YA 5B4UA 1VGVA 3M1IA 1W9MA 4YJHA 5JT1A 2GS9A 1VKHA 4JVNA 4RD3A 2R7LA 2N1BA 1A4XA 4U0JA 4FMBB 4YJGB 1A04A 3WLHA 4MWSA 4FHFA 3R6WA 3UPUA 3OESA 4JYCA 3WJ7A 2CT8A 3GLVA 5AKLA 5HW0A 1BFDA 1JIQA 2TSYB 3GWZA 4HWKA 4OA8A 5I4IA 1PEYA 1ORHA 4MTCA 2ZT5A 4PGGA 2IWRA 2ECOA 1JZSA 4NQRA 4BFCA 3BTVA 1R8SA 4URXR 3NOOA 4HPWA 3V1MA 1RXVA 1JDNA 1Y81A 3TPFA 3HB4X 4GDFA 3TEFA 2O7QA 5GVRA 5FI0B 2HBYA 1FUYB 2WMOB 2PS3A 4Q18A 1A8SA 2H4FA 3DAOA 1Q6ZA 3IFSA 4Z0TA 3R9IA 4DCSA 3THWA 4OSPA 16PKA 4XH9B 5DN9A 3NC4A 3NBAA 2Z6QA 3C6YA 2ODWA 3G02A 2HWKA 3VOSA 1MG0A 5J5AA 4D96A 4QXAA 3R7FA 4RZXA 4MITA 4OXYA 1T13A 1UAYA 4LNAA 1PR6A 1TD1A 2MR5A 2WUFA 3I01M 4C06A 4E2ZA 2Y1XA 5CRIA 3O31A 5IBCA 1Z6PA 3FZQA 3GMIA 4RC9A 5I4KA 5FOWA 4AZVA 3NIWA 2RI6A 1A9YA 4MQUA 1P7WA 1ACLA 1I1HA 1ESZA 3CVJA 3DMHA 4RPGA 1L4HA 2MTBA 1ONNA 2D2XA 5D3KA 3W9YA 2NO9A 4HGQA 2IHUA 2W8BB 3U13A 4G07A 3V5NA 5KWJA 3CH7A 1B14A 4KVZA 1JKIA 2FPIB 2QRVA 2E2WA 2R8OA 1RTKA 3BH7A 1K3TA 3II6X 5ECDA 4CCAA 1JT2A 1AKWA 4XYMA 3AG6A 4K5QA 4BU0A 2QTCA 1II0A 4PG4A 1EB8A 3BTSA 5BQ5A 3RASA 4EVQA 4II2A 3ZBUA 3S7TA 3CLVA 1BQ3A 4Z8YA 3NQ41 1NFFA 3R5KA 3GP3A 2B4YA 4OB8A 2Q1TA 4UBIA 1I1QB 4CV0A 4DMCA 2VTBB 1Y3DE 3HA5A 1UIMA 5JRJA 2IZZA 1E5XA 3R3YA 3R23A 2W4MA 3M5CA 2NMVA 4EZEA 5AESA 3IVCA 3UBTA 4WK6A 1T91A 3HKEA 4TRJA 4JI8B 1NI4A 4FCTA 4COKA 1KAGA 3UT5B 1NI3A 4IMJB 2ZBRA 1U8ZA 3BXPA 4RH0A 5A03A 3F8TA 4G86A 2Z3VA 1LKZA 4HLUA 3A6GA 4HP8A 5CVCA 3SEZA 5AKZA 2V8OA 3FPBA 3ZDZB 2WJYA 1D4ZA 2PGOA 5AW8A 1HBJA 4HWOA 4RJKA 1AA6A 4ZN6A 4TQGA 4FILA 2Y6VA 4JV5B 2HA6A 4V03A 4WZBA 3ED5A 3IDFA 4AZTA 1A1SA 1G8YA 3K1YA 4KC0A 4X1IB 5KTRA 1U1IA 5KKAA 4P3NA 2J32A 1HT1E 3GQVA 2DP4E 4AS2A 3UJ8A 1WPGA 5F9HA 3R5FA 4AQDA 5BRAA 2FPXA 3IVRA 4BAGA 3ZS9A 4P7BA 2I22A 3ANMA 5A6SA 5MDHA 4QGGA 1UC8A 1V1JA 2NT3A 3BGWA 3KR2A 4RJLA 3DG9A 5CYFA 4PTZA 1VECA 1WMAA 2BM8A 3DM5A 4RL6A 1ODIA 3BPSA 1S9DA 1C1DA 1PD1A 4RVDA 4ZI5A 5ICMA 1K8ZB 3G5AA 2GILA 2ARKA 3I92A 2DUJA 4H08A 3ZWVA 4BC1A 3OCWA 1GARA 2IIBA 3FCSB 4RZQA 5BR7A 3AR6A 4F6CA 4WOPA 2RG7A 4YAJA 5EMJA 4G09A 2RMKA 1WXWA 3RJZA 4RHXA 3IV6A 2O5RA 3HZOA 4KMRA 3ZDXB 4KNVA 3ZWBA 3L0DA 4I50F 4DA7A 1M8PA 3MWKA 1R64A 5CXQA 4N3NA 4GMHA 3RODA 4EW3A 3VYUB 4I50B 1O57A 5JD4A 1LPAB 1OH6A 1L7MA 3I6QA 3H2JA 4OL9A 2JGDA 4P82A 2KMLA 2D06A 2Y2UA 4CTNA 3WGLA 5K8JB 2OCLA 1IYZA 3SZRA 2BKLA 2C03A 1VLHA 2N47A 2CNOA 4ITRC 1GCIA 4N8EA 2J3KA 2YNMA 2PKXA 1SOUA 4C9BA 4DBVO 2V45A 4GOJA 2XYRA 3UAYA 1FLAA 5K4GA 5DYNA 4YMGA 2HK6A 1IPEA 2LTAA 2VHUA 1AQJA 4BV8A 1G8AA 4US0R 1VBNA 1MTOA 3LBIA 5KZMB 3HVRA 4Z4HA 1MZVA 1XD8A 2PX4A 1YC5A 4KI0A 3HA2A 4D3DA 5LQDA 1JFTA 4GLOA 4V38A 3VGJA 5IBPA 4JJIA 4EG8A 3LOUA 4NQZA 3S40A 3A6HA 1GAEO 1QIKA 2JLRA 1A9XA 1U0SY 4J49A 3ZHQA 3V48A 1R10A 2NXWA 1E9CA 3DZFA 1IM5A 1QLHA 2YY7A 3N8GA 3WX0A 1RM0A 3JU3A 5CLGA 2PRYA 5FUBA 3A3YA 2I65A 3Q3JB 1A5BB 4IGKA 4L0DA 5ADHA 4HR7A 2FQXA 4JUBA 2CWWA 4H6PA 3GQBA 3ASYA 4Y6SA 1VLVA 4X85A 1AKEA 4DR4B 4RH1A 4PC1A 2HNKA 4P5DA 4B6SA 5JR3A 1VL0A 1I80A 4INAA 3WZ2A 2TRSB 3K2IA 2F1OA 3IT0A 3FPHA 3BXXA 3LXRA 4GVXA 4K9SA 1F7UA 2JASA 2VCHA 2Y0BA 2HDNB 1M2GA 1KI4A 2G83A 2ZUCA 1J42A 2A1UA 3DAPA 5JAPA 5LJLA 4XEUA 3CXUA 1BRTA 1LDYA 5JJ5A 1II9A 4GR9A 1V16A 3IHLA 3KWLA 4O1HA 4OBXA 2BM1A 3WK8A 2HA5A 1WSBA 4F1KA 3GRUA 4JODA 5BQPA 1VLJA 3NW9A 1OIVA 2WAAA 3ZGXA 4YUAA 2HRRA 2DM6A 2NTNA 2Y99A 3H04A 2NXJA 3CU5A 4LY3A 1E69A 3CZ9A 4R8RA 3WWZA 4C78A 3U09A 2QBYB 2EBWA 2XYPA 1E1LA 3IQEA 3TB4A 3AF5A 3MBIA 1C3OB 4N54A 5FOXA 2P77A 4DNOA 1IHYA 4OU4A 3JWHA 4K9MA 5LD2C 1EU1A 3DONA 2IBTA 2GCOA 3TJZA 4BKQA 2P2LA 3SZ3A 2HMWA 2HGZA 5IAKA 4HPXB 1JR3E 1A5TA 4U02A 4ALIA 3SJ7A 5H82A 1KQOA 2A9RA 3L8MA 2R6AA 1DT3A 3OLZA 4ZYXA 5EIBC 4RK7A 2VP6A 4U39A 2EC5A 1CSEE 3E5RA 2ZLBA 3ABRB 2ZXEA 5CNMA 5P8WA 4CR7A 4Z0NA 1R6VA 2DHRA 1NVXQ 5CBKA 3WADA 5K99A 3RANA 1EFDN 4G23A 5BUZA 1U9IA 3A2LA 2ZTSA 1P62B 1OZFA 1N0IA 5IARA 2H6EA 4MCHA 2GPYA 3U37A 2GMWA 3UKOA 3DLHA 2ZRFA 1FP4B 3OJEA 4NYJR 3VPXA 5EE1A 2VP0A 1X9IA 4F2HA 2G0TA 5ITSA 4DSNA 3B3QA 1RKXA 2PGAA 4FXOA 2OCAA 2OFXA 2YHIA 2YIDA 4NJEA 2XEDA 4PHHA 5EKTA 1UPCA 2ZSIA 4RSHA 4BIIA 4GPTA 3ZLTA 4BNIA 5AXBA 3EOAI 1SVNA 4QEZA 1VI2A 2ZYUX 2NN3C 4L6IA 1BGWA 4TOIA 4CIDA 4A10A 3ROEA 2ZR0A 3TO5A 4L0QA 2IHYA 1T1GA 3NP9A 2CUTA 2OCDA 3MAAC 2WJGA 4LV5B 3O6VA 4WZZA 3I4FA 1GD1O 3TG8A 2RHWA 3TZKA 1RP1A 2EZTA 2IPXA 3FIUA 5BPFA 2CCGA 1TADA 3KVVA 3ADOA 4LRUA 4MSUA 5TR9A 3LCRA 3KX2A 4ZJZA 2DECA 4ZYWA 2DBQA 1RIFA 1FQJA 3WGUA 4U9HS 1GAXA 4MUGA 1X7XB 3QPDA 3IAFA 3IXQA 3N6XA 1KAEA 4OI0A 3EGEA 1H6BA 3QMMA 1N2CA 1W5SA 3FPGA 5G41A 3MINB 3AFOA 5EZSA 6GPBA 4JVSB 4DCCA 3FZGA 4KYIB 5KQRA 3WJ2A 1SC6A 3MTEA 2X8JA 4R0VA 5BVHA 1FXUA 3JQQA 2LWIA 3T7AA 2XVMA 1Y4AE 1ZIOA 5AJZA 4NBLA 1E32A 2BFMA 2XWPA 3CR3C 2X5OA 5JATA 1XPRA 1T4MA 1EUCA 4MMZB 3BYZA 1QG6A 121PA 3FMOB 3S2EA 4NSNA 1D8AA 4G37A 1YBAA 4C7MA 1OJ7A 3Q3HA 1VL8A 2GK3A 5CG2A 2QRQA 3L7OA 4G4SP 1VG9B 2YWXA 1XU7A 3EWIA 1RWOA 2C9MA 3FIJA 3I8XA 2ZI9A 1PJBA 3EF3A 4HLNA 4JBIA 4YRDA 3OECA 4E4TA 2VNIA 1OVGA 3NYRA 4R2MA 1PSDA 1UODA 2PY6A 3OCCA 4I55F 2NVUB 3UUWA 2PTHA 1M2NA 4IIUA 1QVAA 3PJGA 2QJRA 4I55B 3QFHA 1CUBA 1SC9A 2FA9A 3NT5A 2PT7A 3VPCA 4EG6A 1VHTA 3VKVA 1MEOA 1T5LA 3F98A 1N25A 2FUNB 1KJYA 5KTOA 2HIGA 1YCDA 2YY5A 1TU0A 1U2SA 2F1IA 3ZXYA 1F4PA 3NFYA 2UUPA 4GBED 4RIFA 3ZDBA 2G07A 4LOKA 5DASA 5ERYA 1YR7A 3F3MA 4CNBA 2R7AA 1N8SA 3UICA 4XTCS 4X00A 2IZ5A 1DAPA 1I5EA 1YL5A 3G0CA 2FNAA 2ORIA 3EE6A 3BKWA 1WZIA 2P6MA 3DL4A 1MOPA 1XD9A 4CODB 2VNJA 5ADWA 4OX9Y 2IEZA 3WBKA 3N7UA 4LDZA 1ECFA 1L4KA 1L9XA 1XLTC 2GK7A 3EVZA 2L2QA 3GRYA 1NW5A 2VDPB 3MWGA 1EKXA 3IB6A 4JB2A 5F2KA 3S68A 1ISPA 2LRHA 2CHVA 1UWCA 1DEHA 2E37A 5AT1A 4YCSA 3GEEA 4CIAA 5JAOA 1TQ4A 4MR8B 1T9GR 5DLEA 3I2KA 1XMXA 2GK4A 2CEAA 2WDPA 4DR2B 1NR5A 4DJAA 1C1XB 1ND5A 3KT0A 3EVFA 2O23A 2XR1A 3RYHA 2GPBA 3B1YA 3JAMA 3W05A 10MHA 1T15A 3KB8A 2BOVA 2C59A 2GCGA 2FK7A 2OA0A 3LPDA 4NNJA 4D26A 5J2UF 1XEXB 3DDSA 1J0DA 1T25A 1VP9A 1JEQB 4HDAA 5BSRA 3UWDA 5BOVA 3WRVA 5J2UB 3JATB 1HL7A 4RHYA 1CY2A 5KQSA 5AJXA 2OWEA 3OPYA 2PS1A 3FMIA 3QBEA 3AHCA 1QH0A 1E60A 1G6Q1 3AF3A 5REQB 1WTAA 4GXTA 4AYXA 1BS1A 4D9JA 3I1YA 1GFZA 2A9VA 5EPOA 2AN5A 3QQPA 3UK7A 4GLFA 1Q7EA 3FFXA 4MV1A 4N3AA 1JNXX 2QG4A 2WPDD 5G1NA 5IEBA 2JHPA 4R1NA 2GRUA 2PX8A 1PK7A 3M1AA 4WADA 5E6SA 2XUPA 3FLAA 1SB8A 1KVUA 3EXIB 2IOFA 1SXJB 1M6HA 3AUSA 3MS7A 5EJIA 5CFMA 5JNWA 4KGVA 2PXAA 3VZCA 1B8OA 4LF4B 1PJZA 4X20B 3UHJA 1A2OA 2NT4A 4WEOA 4ILEA 3UN1A 1MW8X 2HY7A 1SOAA 5B30A 3ZCXA 3K9FC 3D6NB 4Z4FA 3AVYA 1EM6A 4LE2A 3WK4A 4GMDA 1YBMA 3EXG2 1TJ5A 1MMFB 4GWGA 5ENZA 1DCTA 2ZRHA 3BAZA 4EJ0A 4R9RA 2J5RA 3TZBA 4R54A 1QS0B 2HCTA 3K2EA 3MWYW 5KYYA 4QHYA 2EEPA 2GM3A 2VK2A 3AU9A 1PVDA 4ID9A 1U02A 4MW2A 3LPAA 3I2HA 2RC6A 1ZWKA 5FRDA 1WVIA 2NQTA 1BXZA 1QYIA 2A33A 3R9XB 1CW2B 1X7WA 2CCJA 4WSOA 1TQ8A 1ZWLA 2VPXA 5B64A 4N1AA 4PYOA 1YTLA 1JHQA 1RRGA 1W9HA 2XUQA 1H2AS 2CVOA 4B87A 5BUSA 3CRW1 4PLVA 2WU1A 3MD0A 3OMLA 5CA1A 1Z17A 3HCPA 1JWBB 4I66A 2M9MA 4OMFG 3U4HA 4DZZA 5FFFA 4D9MA 5C37A 1NBME 3AETA 3SBEA 4BFUA 1TA4A 3TQIA 2CK3A 3PIDA 2HJHA 1MXFA 4UJ3A 2FWNA 3FTQA 1YIDA 4BCCA 4PZAA 3B5EA 1QGZA 4OHBA 6CHYA 5J58A 5EWLB 1LV8A 1WZUA 3H1FA 4TSFA 5G4KB 1EFRA 4KFUA 3W5BA 2E5WA 2QZJA 1GUAA 3QLUA 4FEAA 1SCNE 4J4HA 4NCIA 4BKRA 4RLQA 3BMNA 1QSGA 3FOFC 3LJKA 1RC8A 3AFMA 3OOJA 4Q6BA 4TM7A 4EKDA 4NZYA 3HCFA 3UVEA 1UOOA 2BEUA 3C16C 3EUEA 4G0WA 2WIFA 4MGIR 4C89A 5JNRA 2GAAA 4XM0A 4YECA 1YS9A 3OM1A 1FFAA 5EP3A 4JIGA 1OCEA 5BP7A 5IHPA 1WDMA 3ADBA 3N2KB 2ONJA 2CDBA 2VPZA 2O1XA 2AMYA 3JQ9C 3ONVA 1C3XA 3W1EA 3E3MA 3G6WA 3KU1A 2C4NA 4GEKA 3N2LA 4NESA 3BMCB 3LY7A 5EUQB 2ZBGA 3B1WA 4WCFB 4R0MA 3WRXC 2D5IA 4XSVA 1GUDA 3EBPA 3FJOA 4YIKA 4OQQA 1JHVA 2G04A 4EYQA 2XZOA 1TUBA 4UATA 1E3DA 2COEA 5M5BA 2YVUA 2K7FA 1A8HA 4OHMA 3DTNA 3NCHA 5AP9A 5A2GA 5FR2A 1V9SA 1OBHA 2IBSA 1DL5A 1OUMA 1W73A 2HC9A 3C5HA 4FLMA 3WYNA 5BWOA 1KTIA 2I54A 1YGYA 4L5YA 1PVOA 2YVQA 1VIVA 2YIJA 4E5PA 1ZH0A 3ID6C 4KCGA 9ABPA 2W90A 1SIBE 1UM9A 2QMEA 1JYEA 2VDVE 3AB3A 1JQ3A 4O4HA 5LQKA 4Q7EA 3ZUGA 2M2IA 1Q21A 3EGWA 4NAHA 3L9WA 1H9AA 3CRVA 2QP9X 1KOLA 2GM9A 2P1DA 4JP1A 1SCJA 1I10A 1K7FB 3QZUA 3PUWA 2E55A 3QF4A 5AFSA 1NXSA 2W5UA 3TNFA 1DOAA 1PQ4A 5A7HA 3TKAA 1O6BA 2QGFA 5CB4F 3LPNA 2DF8A 1Q2UA 4LIPD 1ETHA 4HL6A 3D2BA 2GARA 1E1KA 1IWOA 2DUNA 5CB4B 4DB4A 4K6OA 3OQJA 1I13A 3OX4A 1ZYUA 3QYPA 1RPNA 1T10A 1F0YA 2EQ5A 2XF2A 4Q4LA 2GKGA 5FOQA 1E98A 1GUZA 1Q0QA 4Z1MD 1MKYA 3WE7A 3STXA 4NRDA 2VHXA 4QUGA 1B6TA 1YXMA 1ZG3A 2X0RA 3H65A 4KACA 3HV0A 4E5YA 3RGWS 5GJVC 5AVZA 5FPKA 5FNVF 4MRNA 5HIMA 1KZ6A 4RCYA 2C5AA 2X0IA 3R9KA 1RW4A 1HLGA 4FZ5A 5H4GA 2ZK7A 2IYRA 3BL6A 3EAGA 4CE6A 1KJ9A 3CLTD 3DLAA 2BHSA 4HLCA 5AKYA 5K3AA 1PDOA 1Z5NA 7REQA 2J33A 3D7RA 4QM7A 1BG6A 3EPPA 3ELBA 3ZIAA 4EGSA 2PUAA 2XXAB 4B75A 3KSDO 2ZYIA 3LH5A 4EQ6B 3HH8A 1ORRA 2G67A 4Y6GB 1IFXA 3N2GB 1M2FA 5JZVA 4CQNA 4BNMA 3D7LA 5A9TA 1ZCFA 3IYLW 1UBFA 4YJFA 5LYJF 2IEYA 4JHXA 1RQXA 4PC3A 1ULZA 3NHZA 4GMKA 1P9LA 4ISBA 1SQFA 2QM0A 3GLHA 2XZTA 4LJSA 5CTJA 5TF0A 1CB0A 1JUDA 3WHIA 4BVFA 3DCIA 2D5CA 4QUHA 4H7KA 1OC2A 1G20E 4P08A 5FR1A 5TMPA 1E9DA 3RU3A 4MHTA 3KUCA 4N01A 2AMVA 2FMXA 1RM4A 2YINC 4MKXA 4OXQA 3VR0A 1DXOA 3K2QA 1QWOA 3MJ4A 2BGMA 5B3LA 5KKNB 2VZEA 4X93A 1DTSA 1R7RA 3S55A 1Q0UA 1TK2A 4IJVA 4QARA 5LB2A 1AK1A 3W4KA 4FGWA 4N6OA 1S2OA 1SK8A 221PA 3TINA 2W11A 3A31A 5I5GA 2GWHA 4FGLA 1S2DA 4BVGA 4DMKA 4U2CA 3ADDA 4OKIA 4XVUA 1JH8A 3ETLA 3D1LA 5DNDA 2GN6A 4V2UA 1OT3A 3CZAA 3HB1A 1C9DB 3B7WA 3H9GA 3PXXA 3AY6A 3DV2A 3GOHA 3TJMA 2ISSD 4LPSA 3DNMA 1KI7A 5DEOA 3W1WA 1T2UA 1P1CA 2O1SA 3CBGA 1Y8QB 2BMVA 2AGVA 2VS1A 5FI3A 4AXXA 5AM5A 3ZWNA 4DAEA 1D09A 4B3JA 2QY9A 1JLLB 4MO9A 2CKDA 4YGYA 3TB6A 4H59A 1EGAA 4BVLA 5EJ5A 1UOEA 3B8EA 4Y6LA 5E4JA 2JAQA 4HMQA 1X86B 1ONPA 2IYZA 4BV3A 3KELA 1CERA 3S81A 4Q3EA 1KQ3A 1ORIA 2AKEA 3ZTWA 3FPCA 3Q8WA 4E33A 2QPAA 3UXHA 5C1BA 4N5IX 1VFPA 3DEIA 1GTSA 2WT9A 5L3SA 2QZ9A 1Z9BA 1R6BX 3OCXA 3N5CA 4GE3A 1XV5A 1C8LA 3OZGA 4X9XA 4KUHA 3CEAA 4KN6A 4A9AA 2VDWA 4M9RA 1IZ8A 2DE0X 2HWUA 3X2SA 3QE2A 3VPDA 3CNBA 2OWDA 4XCQA 1S5PA 1C3EA 4F9GA 3NHMA 4Y0VA 4Q4JB 3B9RA 4G6ZA 5KTNA 1LLCA 2QLMA 5SYAA 1JDPA 3Q9LA 5BN5B 4MYSA 4P7KA 1XXHB 1GTVA 3THRA 3TLKA 4B33A 3GHYA 4C0XA 3BSYA 5FV7A 4X66B 1VRVA 1OXXK 4GPD1 4GXQA 1PS9A 5LOVA 5ILOA 3KU4A 3SXUB 3RRNA 3FAZA 4ENUA 5LU8A 3GDGA 3HYNA 4KDEA 5FWXA 3CTPA 3IDAA 2FU5C 2GYVA 4CL0A 3ZNOA 2WSYB 4S2EA 4G65A 2LCQA 1ORTA 3IQXA 3Q6NA 2O8NA 3ZY4A 3AI3A 4DJEC 3HMKA 4ZYYA 5KNBD 5H8WA 2QVZX 3EIQA 4BQQA 5LBTA 8MHTA 4RY9A 2C8KA 2QTNA 4ISCA 3QKSA 5L6LB 3PFGA 1BDHA 1NIJA 3LZDA 2QWXA 1EFVA 3M4XA 5F7XA 1S7GA 1ZK4A 4E88A 3JSXA 2HCBA 2OP0A 5L3RA 1QQTA 2NWQA 5JSFA 4PS0A 1NOJA 5FKJA 3EY4A 1H0KA 2EBFX 4GMXA 1BVHA 4N5MA 4DQKA 1M2WA 2A8YA 3MPUA 4BZQA 3BE8A 3GF4A 4EW6A 4FFDA 2XNJA 3GYGA 3KKEA 1M34B 4FDVA 4X6YA 3HP7A 3RVJA 2ADMA 3BG5A 3IEPA 4JP8A 2FPLA 1T4GA 1RQPA 2GGSA 4OSOA 1Z45A 3PPWA 4WESA 1M6EX 3FPLA 3G6KA 5JD6A 1TEVA 4QUJA 1MT0A 4TV9A 5DO9A