2QSJA

Crystal structure of a luxr family dna-binding response regulator from silicibacter pomeroyi
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
120
Chain Sequence
LTVVLIVDDHHLIRAGAKNLLEGAFSGMRVEGAETVSDALAFLEADNTVDLILLDVAIDGLVRLKRFDPSNAVALIHELIRAALEAGADGFIPKSADPQVLIHAVSLILEGEIFLPRSYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-binding response regulator, LuxR family
publication title Crystal structure of a LuxR family DNA-binding response regulator from Silicibacter pomeroyi.
rcsb
source organism Silicibacter pomeroyi dss-3
total genus 37
structure length 120
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qsjA00
1AB6A 4WXMA 3RVQA 1SRRA 2X7XA 3GA5A 1DJMA 5TE9A 1JBEA 4HNQA 4RK4A 4EY3A 1EHCA 1ZVVA 4JOQA 2CHFA 2IYNA 1RXIA 3D8UA 3FGZA 2I6FA 3C3KA 4DADA 4RK5A 4KK4A 4WXEA 3D02A 3O2QB 4KREA 1VRVA 3KYIB 3LKVA 1Z26A 2V0NA 3LUCA 3MIZA 1DCKA 4S05A 4NV3A 4RY0A 3LUGA 2OQRA 2FW0A 4YR7A 1AB5A 3CZCA 1ABEA 1BDHA 3LMKA 5IBQA 4NICA 2FLWA 3OQOA 1C0EA 1PNTA 4B09A 3JPYA 1ZDMA 3SM9A 2PL9A 3KLNA 4YWHA 2JB9A 3LTEA 1TMYA 2QSJA 3GRCA 4WUTA 3T6KA 3OQMA 3CFYA 3ROTA 3URMA 3NNDA 1CYEA 5CNMA 2RGYA 3RVRA 4F12A 3UK0A 4O1IA 4LE1A 2MSKA 1SXGA 3IPAA 1ZY2A 2E4WA 3EODA 5JNUA 3UUGA 4Z4HA 2GKGA 5KQPA 3FMVA 1NXPA 1L5ZA 4QPJC 5EWJA 5EWLB 1E6KA 1BAPA 5F64A 1H9CA 1FQWA 1CHNA 4EYKA 4E7OA 2R25B 3KS9A 3CNBA 6CHYA 5BRJA 3CZ5A 4N41A 4XFKA 1KMIY 1YK1A 4KQ9A 1QPZA 4OATA 1TVMA 5TPZD 4PYRA 5C5CA 1KRXA 3DBIA 4MR8B 3ROFA 3VNAA 3OLZA 5IX8A 4ZMSA 4ZJPA 3LUDA 2WJAA 1E6LA 4HNSA 3HJFA 4LRQA 3H5OA 3KHTA 4EGSA 4P1ZA 2FEKA 5FWYA 2ID9A 3R0JA 1F4VA 4MR9A 3HO1A 2M1ZA 3OLYA 2J48A 3H5VA 1A0OA 3O1HB 5JS2A 4RXUA 4LDAA 4W5OA 5PNTA 1EFAA 3QELB 4G0YA 5B3JC 3M9WA 2VUIB 5JNRA 1MB3A 3BREA 1ISSA 4E7PA 3RQIA 3T38A 3N0RA 3LUKA 1JDNA 1K66A 2WRZA 4XASA 3OM1A 3A3KA 3LUHA 2IKSA 1USIA 3H5TA 1ZH2A 4JB0A 1U0SY 3W9SA 1JFTA 3MYYA 1PHRA 2VUHB 4RK1A 5TPWA 4ZYLA 4Z4GA 3MF4A 4PE5B 4ETNA 2FKAA 2LBPA 1QP7A 2FN8A 4F11A 4W5RA 3RVPA 3I09A 3LOPA 4YGXB 4W5TA 2ID7A 3N75A 1EWKA 2XDYA 1QKKA 3HXMA 4LZLA 1I3CA 2E4YA 1ZAYA 3O75A 1JLKA 4EUKA 1MAVA 1YVUA 4N0PA 1Z17A 5FWYB 1RXEA 1JYEA 1SD5A 3KLOA 3Q15C 5IEJA 2PE5A 4KZKA 1S8NA 2OENG 4MR9B 5KC9A 4KMRA 1BDIA 3JVDA 3N0WA 2PLNA 3GBPA 3OMWA 3A0RB 3T95A 3RVLA 5T7BA 3CS3A 3OO1A 4D6YA 2PKXA 5KC8A 1D5WA 1NXSA 2F8TA 2FSPA 2HQRA 3RVSA 4FE7A 4N47A 3TMYA 4OLAA 1NXXA 4WWHA 5KQLA 4MRMA 1U04A 5HKOA 2PUDA 3HCWA 3O2SB 1P2FA 4RZSA 4YLEA 3F6CA 1P8AA 2CHEA 5FWXB 3M6MD 3O1JC 1TJYA 2FMFA 4MS4A 1JWLA 1EWTA 3JS5A 3HDGA 5C5EA 5D2CA 5TPZA 1NXTA 2PUEA 1M5UA 2L2QA 1F51E 2MYUA 4MS1A 4OLBA 4EVSA 1D4ZA 1XHEA 1Z25A 5DGCA 2QV0A 3SQNA 5KQMA 1PUXA 2QVCA 3RVKA 3M9XA 1D2AA 1QNLA 1DCMA 1USKA 2CWDA 3TX6A 1C4WA 2HJ9A 2LP4Y 1FFSA 2LIVA 5KI6A 4O5AA 3S99A 2JCGA 3EULA 4KPYA 1DG9A 2E4UA 1HEYA 3IP7A 3O2JA 9ABPA 2VK2A 4LDZA 4Q6WA 2H0AA 2JVJA 4IILA 1MVOA 4H3KB 4KV7A 3G85A 3MM4A 1R8JA 1W25A 2NUBA 4RKQA 1P6QA 4OTZA 1Z13A 4OBBA 3KKEA 2WMYA 4JA2A 5HM6A 1GUDA 1DBWA 1JFVA 2L18A 1BDJA 3HS3A 5CNJA 3H5LA 3T8YA 1JHZA 1DRJA 1MIHA 3H5IA 5TQ0A 3QK7A 2DRIA 3HEBA 3RVMA 3QEKA 1M2EA 3QEMB 2MYNA 5GQSA 1BVHA 3FFTA 1D1QA 3GYBA 4PEVA 4YRZA 4EYQA 4LX8A 5ED4A 3MA0A 4EVQA 2NT4A 4JP1A 5HSGA 3IP9A 2WB4A 3FDFA 3LUAA 3A10A 3C3WA 1YIOA 3CU5A 3KJXA 5CHYA 1CEYA 4JAVC 1DC8A 3OQNA 2A9QA 4NCBA 1XWWA 4Z4FA 2FQWA 4L4UA 2O20A 2RJOA 3IDOA 3SAJA 3CG0A 1U2PA 2A9RA 3C3MA 4YO7A 1NTRA 3KYJB 1USGA 4KVFA 1QMPA 1RZRA 2PL1A 2L17A 4RKRA 1ZH4A 1YMVA 1Z12A 3Q7SA 2FXIA 4H60A 4YS6A 2RDMA 2H3HA 4G97A 4PZ0A 4Y9TA 3OLXA 3I42A 1GUBA 1JYFA 5T3YA 4EYOA 4KRFA 4OG2A 3ILYA 3RH0A 1M2FA 3JPWA 4Q7EA 3L49A 2L19A 2FEWB 3HUUA 4RK7A 1APBA 2FQYA 3NHZA 5IUJC 1D1PA 4Z4CA 5TQ0B 2PUAA 3IP5A 5IUNC 3VNBA 4GPAA 1SXIA 4QICA 2P4UA 4MS3A 1ISRA 3SY8A 3CHYA 3BRQA 3HV2A 1JL3A 4IF4A 3HDVA 1NXOA 4XAQA 4YP9A 3N0XA 3QLVC 5EWJB 2LPMA 2IPLA 3C97A 4MYRA 1MB0A 2YHAA 1B00A 2FMIA 3O74A 1BA2A 3KCNA 3GL9A 3OO0A 4Z9AA 3HZHA 2HQOA 2M98A 2FMKA 3FFXA 4JASB 1JH9A 1QP4A 2WJWA 4Z0NA 1T34A 3Q7RA 5BQ3A 4CBVA 1NY5A 1URPA 2FMHA 3F73A 3EDCA 4P98A 1YS6A 1ZHHA 3LFTA 4ML3A 1YS7A 3MQ4A 1J56A 2AYXA 2IPAB 2JK1A 1ZN2A 3H6HA 4MR7A 4HNRA 2LUOA 2NZVG 3RVNA 3H1GA 3O1IC 3E3MA 2WY2D 1WETA 1NATA 4ETIA 4S04A 3DLHA 3EAFA 5ABPA 1RZRD 2IPMA 1K68A 4MQFA 4MQEA 5JNSA 4LE2A 4WZZA 4DQDA 1TLFA 2GI4A 3LUFA 3E61A 1Z18A 3DGFC 3GV0A 2HQBA 4MLDA 3DGEC 4MS3B 1NXWA 1VPWA 5DKFA 5JNTA 4FB4A 2IDMA 3BRSA 1ABFA 1RNLA 4RY8A 1LJUA 2P9HA 4NCAA 1PNRA 2JVIA 2ZAYA 3ILHA 6ABPA 1YMUA 2MYPA 3GBVA 4RK0A 3SG0A 3F7NA 3HUTA 3TB6A 3KTOA 4G0PA 4RSMA 5TQ2A 1LBIA 1DC7A 3IPCA 1JFSA 3LKBA 2TMYA 4Q6BA 5TPWB 4RWEA 3H6GA 4IRXA 7ABPA 1FFWA 2W42A 2PUBA 1A04A 3Q9SA 3B2NA 1QQBA 4W5NA 5I4CA 1GCAA 3Q41A 1PEAA 4G0OA 2B4AA 4MPTA 2HPHA 4KQCA 4MR7B 2R48A 1VLZA 2WWVD 2FLKA 1DRKA 3OM0A 5B3JA 2JBAA 4M88A 4MQEB 3MMNA 3HM9A 2E4VA 4EYGA 5JS1A 3LUJA 4WT7A 2RJNA 2QU7A 1KRWA 3OMXA 4MRMB 2MSLA 2AYZA 5DTEA 3NNNA 5IUKC 4IGAA 4ETMA 3JTEA 4Z9BA 3HVRA 2B1JA 1QQAA 3O21A 3NBMA 3KG2A 4MS4B 2FN9A 1QP0A 5TQ2B 1YK0A 5JNWA 1DBPA 3CRNA 3FFWA 4MS1B 4MR8A 2QZJA 3Q7TA 4N0QA 4KNYA 3TD9A 5CNKA 2BGGA 4KFCA 4F3TA 3SNKA 3A0UA 1PEYA 4G86A 2N9UA 3N6VA 2YHBA 2FTKE 3H5WA 4RXTA 2Q5CA 4NQRA 2GX6A 3RVJA 1XHFA 2PUFA 4DN6A 3QLUA 2F8SA 3QELA 2R47A 2JBAB 1ZITA 5CNIA 1IIBA 3EQ2A 4HYEA 4F06A 4TMYA 4L85A 5GOTA 2FVYA 1NXVA 1JX6A 3HK2A 1QO0D 2NZUG 4UHKA 1Z15A 1P6UA 3JY6A 1Y1LA 5KQGA 1GCGA 4RK6A 1E2BA 3GT7A 4G0MA 4GNRA 3QLTA 5E3JA 1SXHA 5EWMA 1JDPA 2PAFA 4RU1A 3G1WA 4XXHA 4MLCA 4TLMB 4D74A 2HSGA 4MGEA 1ZGGA 4IMIB 1DP4A 2KYRA 3RVOA 3CTPA 3N8IA 4N03A 2GWRA 4EVRA 5JNVA 1A2OA 2R4QA 2VYCA 3H75A 1L5YA 3KSMA 1Z2DA 3EQZA 1EWVA 4IMJB 1M5TA 4FE4A 5DLEA 1RPJA 2IPNA 5BRAA 1GLGA 2CD7A 4G0XA 4UHJA 5FBKA 4F8JA 2PUCA 4LE0A 3DZDA 4QYWA 1DBQA 1EAYA 4ZMRA 1W9HA 2QW1A 4RS3A 3DLBA 2FQXA 1JF8A 2ZWMA 1LBHA 2QXYA 3TO5A 5FWXA 4H3HB 3HSYA 5IEBA 2QR3A 1E6MA 5KWSA 1FSPA 3N53A 4KK3A 3I45A 3NNSA 4N76A 1DZ3A 1YTUA 1DCFA 5EWMB 2A9OA 2NT3A 4YCSA 1LK0A 2E4ZA 4D6XA 1KGSA 4JB2A 1ZESA 1OXKB 1Z16A 2FEPA 5HQJA 3QX8A 1U2QA 3EGCA 5DCLA 1ZGZA 1U8TA 2E4XA 3GWGA 2JRLA 3L6UA 2MSWA 4RXMA 4O1HA 5TQJA 3UKJA 4TN5A 2PMCA 4Z4IA 1OXBB 4Z99A 2IOYA 2A9PA 3C6QA 2PJUA 3QLUC 3I5AA 4MAAA 1QO0A 2GBPA 3OLVA 4ZPJA 4PICA 3K9CA 3P9YA 3EJWA 3QEMA 3K4HA 5IC5A 3CLKA 1UDRA 3H1FA 2QVGA 3H1EA 4RV5A 4TLLB 4YV7A 3CG4A 3NHMA 4Z4EA 3OLWA 3BBLA 4RY9A 4RDCA 3IP6A 4XLTA 1TM2A 4G0ZA 4MQFB 3BILA 5BR1A 3JVIA 1Z2EA 2JVKA 8ABPA 5IULC 2MYTA 4XARA 2PUGA 3QLVA 1LJLA 3CKMA 1FFGA 5EWLA 5FBHA 4W5QA 4G0QA 1VKRA 4QYMA 3QX9A 3F6PA
chains in the Genus database with same CATH superfamily
1D4AA 4WXMA 1OA0A 4YHBA 1ZK3A 4N8SA 4R40A 5AOAA 1PZXA 3HN7A 5JJLA 4YRSA 1N7IA 5CJPA 1OGIA 4CETA 1O87A 1Z4QA 2GN6A 1DJMA 3LAWA 4PZZA 3OJEA 3RFFA 3RIYA 1A2BA 1M10A 4BKOA 3D8UA 3SQXA 3ZKAA 4C6TA 3COWA 3D02A 1XLVA 2I3BA 2BMAA 5K3FB 3S40A 3MIZA 1P4RA 3EXG1 3LK7A 4EJSB 3BTVA 2G8NA 2NO0A 3K1TA 4MB0A 4XR9A 4FTWA 1VJ1A 2P5UA 2BEWA 2PWBA 1RI3A 3CZCA 4Q3LA 4MW1A 1TM4E 2BFFB 3Q5GA 1YCHA 4FD3A 1YQEA 4MJLA 3SM9A 1K8YB 1MN6A 3Q4GA 4TWAA 1G5PA 4FCWA 2ECPA 2NTEA 3R0VA 3WGMA 2QSJA 4UJ5A 2W2VA 1D2MA 3PHGA 1VMAA 3D31A 2AUNA 1SAYA 1EG7A 3ZDDA 3T9BA 4BLTA 1SCJA 3BB1A 1W94A 2EWMA 3EC2A 3LQYA 2DFPA 4FMCF 3ZQJA 3LV8A 1PIWA 2F3PA 3NYIA 2ZRLA 3PNBA 4REMA 4Z4HA 4AS3A 1ZSVA 5SICE 3L84A 5EZQA 4JXJA 3QUBA 5HK8A 3R74A 3VSBA 5EWLB 2REXB 3EMKA 3M6UA 4NZ9A 2JJYA 3NXSA 2OBXA 4QUEA 4AL4A 5CIYA 5JTTA 3L1IA 3JRWA 3ZBTA 1J99A 5IHXA 5ALZA 1KL7A 5KPDA 3S2SA 1KC3A 3WGVA 2C7VA 5DDIP 5IH7A 4DAEA 3OPYB 2ZTSA 5AJVB 4BWFB 5CG1A 1J1ZA 2O19A 3CCFA 3I4LA 2DGDA 3G7SA 1VG9B 3A70A 3DBIA 2D8MA 3G2IA 3LUDA 1E1QA 4HLDA 4BNXA 3I0MA 4MUYA 4Q3CA 1BJTA 1NW9B 2XE8A 3N76A 1FDVA 1UC5B 1ZOPA 4OREX 1YIDA 3I5UA 4EVIA 2C61A 1HMPA 3R8CA 4XA8A 2FEKA 1IN7A 3NUQA 5JQWA 3AF6A 1U2EA 1XL1A 1Q7EA 1CJMA 4KXWA 2IF0A 3QXCA 1RKXA 4RGVA 1TU4A 3WSTA 3PJRA 4W5OA 2W71A 4E5KA 2H9YA 1HH4A 1VKZA 2C9CA 3HDYA 1LLCA 2HLDD 4LS3A 3UHOA 5I9BA 3ZDBA 1Q1BA 3L9WA 2R7NA 3RPEA 4FLFA 4AC9A 4P5DA 4FJ0A 2CHVA 5E1DA 2CE7A 5AOCA 5GJWC 4E7PA 5CVJA 3EXHB 3T38A 3V1LA 1U99A 2QTCA 5IJZA 2O3QA 1JDNA 4KIFA 3P9PA 5C1BA 1QWSA 1Q19A 2BWJA 1GARA 4FS3A 2XCTB 3CLVA 4ARZB 3KPUA 5F78A 2NGRA 2I5PO 4LRTB 4BNUA 1U8UA 2OFXA 3UYLA 3ELBA 3T3OA 1U0SY 1G64A 3IH5A 2RKBA 3ESAA 4YQFA 1QFZA 2AR0A 1LH0A 2C88A 3CNQS 2CDAA 3GP8A 4HQ0A 5LCXA 3L0OA 2P30A 1MOQA 4MLPA 3J81A 2FRXA 3R4CA 4YAFA 5LSAA 1E3LA 3WK7A 3RTAA 4EA8A 3WYBA 4A0SA 3VMMA 3OF5A 2BEUB 4FPXA 1SXJA 5ALLA 3TDMA 1ZAYA 3AHDA 4M0DA 3SKYA 2WM9B 4TZKA 5JPIA 1PAUA 1QR2A 1R74A 2ORWA 2WWRA 4KFSA 5BNWA 2A0YA 5LDHA 5LKAA 5G0TA 3ZHYA 3T9FA 1I7QB 3JVDA 1Q91A 1NRJB 1ZQ9A 1BFKA 2W93A 5DN6A 2CLEB 1KKUA 3FNIA 4TTTS 3C5WP 2IW3A 2Q0HA 4JT9A 2FSPA 2JIOA 1BRTA 3SWWA 1OGYA 3DVAB 3NOXA 2XUFA 1AKRA 4OQFA 4CF4A 3HJAA 4MGIR 2E49A 2PQMA 1BJRE 4MO2A 1FPQA 4UU1A 2LDXA 5A7GA 2GZMA 2KI5A 2FPGA 3KB8A 1V9SA 4JC0A 3VYTB 3MQFA 5K8IA 3TLEA 1P4GA 3LFUA 4JUBA 3FR7A 2X9GA 3I3OA 3TKLA 1CR1A 1JE1A 4LYAA 4BB9A 2EW8A 1SG9A 2A3RA 2XT0A 3AR8A 3H3XA 4JXZA 3UK1A 3TCNA 1ZGJA 1XRLA 3D3WA 4RD4A 2XMDA 3GLTA 2HDHA 1IG3A 3JQGA 2D2EA 4FVTA 1Z25A 2E1RA 4KYTA 2QV0A 1RMTA 1YU9A 4Z86A 4DSTA 4EB6B 4NK5A 4YI3A 4LJRA 3LXUX 1D2AA 4MV7A 4LC9A 4HAVA 4HQLA 4MHOA 3U48A 4CUKA 1YZHA 4LYYA 4IUDS 4AXXA 4BLRA 3IPLA 3S99A 1SELA 5KAPA 4CEJA 4N48A 2DR3A 1M67A 3WWYA 2WIAA 4JD5A 2JVJA 4IILA 4O0LA 1RXSA 3HBNA 3MAGA 4MWOA 5JMWA 1QAQA 2GNPA 1J4AA 1WZCA 1U7OA 4O2BF 2Z3WA 1NU6A 3S2EA 2F1KA 3CF0A 4TZ6A 2BR4A 4YUYA 4F5YA 2HDWA 1P29A 1I36A 1ULUA 4DDHA 3FB4A 4B45A 3KZKA 3UJAA 2CLCX 5F76A 1DFIA 3AW9A 4E2YA 4H7IA 4FB5A 1YTLA 3FYUC 4E0BA 2NWQA 1IEWA 4KO1S 4ZT5A 3UXHA 2WD7B 5GQSA 4QLBA 2M6KA 3QFRA 1PZEA 5DGTA 3KSAC 1PW5A 4K0RA 5LYJA 4JCOA 2W11A 1UKYA 3CUYA 3U62A 1M8JA 4BDSA 1EM6A 1E2MA 4B4UA 3NIWA 1KEEA 1LTQA 1J0BA 9GPBA 2MSEB 2Q2OA 3QI2A 4L2IB 3ZE8A 3HL4A 4U6NA 1ZJYA 3GFFA 3AUUA 1BXZA 1M7GA 2DM6A 2MMCA 3EF0A 4L4UA 1Z0SA 3RT7A 2QT0A 3KVYA 2VSFA 2HIHA 3PD7A 1XJWA 2YMPA 4WZBA 4YO7A 4E13A 3DR5A 1OLXA 4WL0A 2PL1A 4JQYA 4R8VA 5U4QA 5DTIA 2BBOA 4GYJA 1NT2A 1F0KA 1RC1A 1G98A 3QPBA 5AM1A 1YT5A 2RDMA 2RGAA 2H06A 2VQDA 3BPSA 1IBSA 4PZ0A 4E2ZA 1GNLA 3THXA 5LM3A 4QFMA 2DKOA 4X1IA 5KNBH 1EEHA 4TZ0A 4JJIA 1EVIA 3VSCA 1H0HA 1QRSA 1NVTA 5JAIA 3QE9Y 1I7SB 1C0LA 1X7WB 3OMLA 2BTEA 3LWNA 1KRHA 1SU4A 3C3XA 3SSOA 1YA6A 4R8MA 5IUNC 1XCJA 3GG9A 3HUFA 4D4JA 1EJ0A 2Y1FA 1R64A 5LYYA 3N28A 1TZBA 1A7UA 2DECA 4OKIA 3HMQA 1FVHA 4HN9A 5CM2Z 2PH3A 5LN1A 1IAVA 3HV2A 4LF7B 1OWMA 2Y0BA 2J5BA 3BXOA 3KKNA 5G0WA 2GRAA 1E4VA 3TQSA 2BV3A 1Q11A 5BUSA 1HG1A 3N0XA 3H13A 3IQGX 4BRZA 3NRBA 4EG0A 2BFPA 3VX3A 3A6DA 3I6MA 3KZ1E 1HNXB 5B4VA 1IJBA 3ETEA 3TSAA 5ARBA 2PL3A 2IUYA 2ZSUA 1BA2A 1WMEA 1MO6A 4GG1A 5BW4A 5L4SA 4JX8A 2FR8A 5CFLA 1AUVA 4LG1A 1EJ2A 1HDXA 2UZAA 4LDQA 3DD5A 2VP5A 3IQEA 1RAFA 2W6OA 3OEEA 3NDJA 1CVRA 4Y1RB 4MCJA 5DNEA 2Y66A 2C2KA 3K1JA 1MX5A 1XMXA 4FR0A 4ILKA 3C3BA 2ZB7A 1U2GC 3HY3A 3L02A 5CVCA 1R9JA 5DJ5A 5HPYB 2KWIA 4KXXA 2B83A 2GAIA 5EIEA 3V8MA 3OTIA 3FTEA 4I4LA 4XVRA 3COPA 4RPKA 2WJIA 5B4TA 4S1TA 5CIQA 3F5FA 2GI4A 4EX6A 5LIPA 4X8OA 2ZVJA 3VBCA 2Q21A 1R0CA 1RAAA 4C06A 1QH0A 1CJSA 1XJQA 4ZVOA 1V8OA 1T3GA 3K70D 1O6BA 3DHVA 3OIVA 1IHPA 2B9VA 2JGFA 2XE6A 1AGRA 1HNNA 6ABPA 1NFFA 1KDVA 4X45A 4KXYA 4P7BA 3SG0A 1IOWA 1H2BA 3NKVA 1CQIA 2JI4A 1BJKA 2PH1A 3CX4A 3PITA 1SB9A 3MTGA 5ALMA 4BO8A 4ER0A 4BFSA 3WDLA 4F8YA 1GQ2A 2RI0A 1CR0A 3D2LA 3LKBA 4AUNA 1KDYA 3UJDA 4KO8A 2JAPA 5EA2A 5TNXA 1F3OA 1RZUA 4D45A 4YMUA 4QX6A 3U6BA 4C5CA 3CNEA 1QCYA 2D0DA 2XRMA 4ENUA 1QLHA 3QP9A 2DZDA 2G06A 4W5NA 1CIJA 1QIIA 2ZR8A 4A0HA 4S12A 1XBTA 4INAA 2HPHA 1B6SA 2I7TA 2MR5A 2NLOA 4IZHA 3OP4A 4KN8A 1J0DA 1ZMTA 3NT2A 3RF7A 4E5MA 4ZDKA 5DX8A 2Q4EA 4TRRA 1QG2A 4DDWA 4ZI7A 3JR3A 2YDXA 3U7QA 4BX2A 2C58A 1YR6A 3M6XA 5IZCA 2QBYA 2YWBA 1MF7A 5JLAA 3GCDA 3T7EA 3BERA 1X86B 3RAPR 4CKYA 2P9BA 2W6PA 3FSGA 4WT7A 1BU8A 2ZB8A 3A6FA 2HV9A 4CM8B 1H23A 1DAOA 2OOKA 3QXSA 2NQ8A 4PAQA 4B2YA 4M9XA 4QJ5A 1PR9A 1JI3A 1UK7A 2LNDA 4GHWA 3WGYA 4CGZA 1F6WA 3D7RA 1JXQA 1WHTA 2G1UA 4OXYA 1UFKA 1UPTA 4RBNA 5CA1B 1NW4A 2NYUA 2EBUA 4KYVA 1NJFA 1PS8A 4PYQA 4YBRA 1FP2A 4F4DA 1A71A 1UBOS 4H1VA 1Y3HA 3LX5A 1Y5RA 2HJWA 2R3SA 3IMFA 3KL2A 4IJKA 4N0QA 4KRXA 3R8XA 5BMVF 2QS9A 1W2HA 3B1JA 5BV0A 2CNWA 4TL7A 1JR3D 4KFCA 2GTPA 4M1YA 3VR6A 1P39A 1P3JA 4U63A 3RHFA 2ZRHA 3G8BA 1X8KA 4D92A 1U4SA 1B43A 2CXQA 2J07A 2JI9A 2OYSA 3FLMA 2PPVA 2IXBA 3JYPA 1ITZA 4TSFD 4TYPA 4YRRA 5G1PA 3VR4D 3WJ1A 4MSUA 3RYHA 2V8OA 3WWEA 2R47A 1ZITA 2OC9A 3QJGA 2ERYA 1O89A 3DTVA 4J2OA 2ZRPA 4M8NE 1FJXA 1FNSA 3C41J 3EPRA 1PV2A 3EQ2A 1JBKA 5B1IA 1L4EA 1UZNA 2R2GA 2XTNA 4JJKA 4DC0A 4F04A 4WNCA 4RD2A 3WLMA 5HKKD 5J2UB 3ETDA 3KNZA 1GT6A 3VPGA 4P2GA 2ZANA 1ZJ6A 3B13B 5H80A 4DCVA 4P36A 1VPDA 4DV5B 5DZSA 1N78A 5AKYA 1OROA 3MUEA 4A27A 2VH2A 3HVIA 4AQDA 1U63A 3CTMA 4L8LA 1ZL2A 3GT7A 4EHHA 4R8KA 4M0LA 1O6ZA 4OP1A 3QFCA 1KDRA 4MVCA 5E3JA 1SXHA 5JUWA 3WWDA 5IAGA 2RC5A 3VZPA 2HJGA 5FH9A 3WRYC 3EEYA 3PC8A 5FOTA 1GFSA 7AT1A 3OICA 2CVQA 3QPDA 5LQAA 2B1QA 2NZYA 3AYXB 1L5QA 4HDNB 5CRIA 1FC0A 4BPBA 4JJ7A 1Z6YA 3I32A 4LF8B 1QE0A 5CLHA 1XP5A 1BC5A 4ZK6A 4YR9A 2AF4C 4C9BA 5C46F 1XMIA 2OFWA 3KUUA 5ESWA 1K06A 2GFIA 2ZIVB 1Q14A 1MAWA 3T34A 1GSHA 4XEHA 2FFHA 2OWEA 1DJOA 3ZNOA 4F4IA 2FPOA 5ADVA 5IFKA 4Y2QA 1RWPA 1L1FA 5CX1B 1SY7A 3LUBA 1R7RA 5F7ZA 5TDHA 5DSTA 4PR3A 1E3WA 3UG7A 4ZT2A 4GH5A 2AJBA 2UZ0A 1AQ6A 3RFTA 4I99A 4AZWA 2RHWA 3H4VA 1JDUA 1L4MA 2DFNA 3LHDA 2BJHA 4NZPA 3DL0A 4HRAA 5FLEX 3S2IA 1HDZA 2VCEA 1MJGM 4UMDA 5ITWA 4ER6A 5AKXA 3H42B 1M2HA 4M7OA 1WPXA 4Q93A 3TEJA 4A82A 1K63A 2POQX 2PX5A 4HB0A 1U65A 1PHPA 2YXPX 4TLBA 2V7TA 3ZIAD 2Q4DA 3UK7A 2QLJA 1WCYA 2ZG6A 3RFUA 3D1VA 4P38A 1AZWA 1NOKA 1RD4A 1NL3A 4PFJA 4U6SA 3V9AA 3DAOA 2GXSA 5JS7A 5ALPA 3QMMA 4ZVKA 2FN3A 3IAAA 3HKCB 5LZ5A 1QZZA 4P5PA 4B33A 3GWGA 2AR9A 4QDOA 3AWIA 4HYQA 5C53B 1GPDG 3WP1B 4MUNA 1QBKC 1XU9A 2CK3D 4O1HA 5E6RB 2K4MA 1EIZA 2KQUA 3CLHA 3KEGA 4MKGA 4OXKA 1MX3A 1NUPA 2JDIA 4ZT3A 5AVRA 3OPVA 2IDKA 2ZJ3A 3C1UA 1H4SA 2B25A 3IA2A 421PA 2UZ3A 1W59A 3NBUA 4P4GA 2O3RA 3CVOA 2VS1A 2QV7A 1VIMA 3E8SA 5DX0A 4MR8A 4AIRA 4O4IB 1ZC4A 5DCWA 3QEOA 4AG3A 4FGWA 2P4SA 2GZRA 3H1FA 2AD1A 4I9FA 1J21A 4NJOA 1QTNA 4CG0A 2Q5JA 5KJEA 3JALA 1OOEA 3EPJA 1UM9A 3KKOA 4XLTA 2ZDHA 4YJFA 4UMEA 3WQHA 4BGUA 2PQ0A 1SCNE 3PXXA 4OM7A 4U7TB 4KB5A 3M1LA 1YS2X 3D4PA 4UDOA 3H05A 2G07A 4EKGA 2R6FA 3FOAA 1LVUA 1ZJ4A 3QOXA 5LA6F 5AI9A 1Q0LA 1JFFB 1OJ7A 3RVQA 2R1UA 4K8RB 3T41A 3QLEA 3UMBA 1C9EA 4MP3A 2BEJA 5CX4A 2X13A 1MB9A 3ROQA 4WZAA 2G1AA 2I4IA 1QC5A 2O2EA 3RI3A 4DLXA 2V6IA 3BA6A 3S27A 3KDPA 4I1IA 1RRPA 1RYYA 2V0NA 1E2UA 2XLCA 4TXLA 3D4OA 4LXTA 2G9ZA 2M32A 2QTFA 4LRXA 1BDHA 3LMKA 5IBQA 2WUDA 2HPVA 2P6PA 3JQFC 3ORQA 5G0UA 4MH0R 3E03A 3JPYA 3QV1A 3UENA 4BGVA 4BC0A 5BW6B 1AN0A 1YE8A 3HR8A 3PCRB 1V3UA 1YZQA 1FP6A 3P9KA 4ZV4A 2G1KA 4E09A 4L6AA 4K86A 4PPQA 3URMA 3TLMA 1DG3A 3B3GA 4ZCRA 3PJDA 1NSTA 2AUMA 2NSLA 3WI7A 2WJ3A 4PG7A 2RE8A 2R66A 2BBSA 1HL3A 3NRJA 3UUGA 3F97A 2AFHA 3JYNA 4KCGA 3VAAA 1OLUA 2XLBA 3OZSA 3WQQA 2J6BA 1RPNA 4LOHA 2XECA 4R1NA 1JQ5A 4BGIA 5JJBA 3CUTA 2VAWA 4PPGA 4BEJA 5KYXA 3ZXUB 5LDDC 4IL5A 5GM1A 3TLAA 3WGTA 2G4VA 3IEMA 1B14A 3W6UA 1OTXA 4H4DA 4TWZA 4EJMA 1GRCA 2E3JA 2RHRA 4OUDA 3AY3A 2Q3JA 3IMKA 3OIYA 1MH1A 4RESA 1N34B 3TZQA 2QTVB 2LZ0A 4ZTUB 1Y8QB 3S8YA 1PT7A 5K01A 4BE9A 4MJ7A 3QKRB 5JADA 1YE5A 2JA2A 2ROQA 4LRQA 5AKJA 4P1ZA 3SEAA 4EGSA 5KNDA 5FWYA 3DULA 4HRXA 5BSTA 3UV7A 1CE8B 2ZT8A 1NI5A 5H3LA 2J48A 4R9VA 3D6HA 3D6TB 3O0TA 1OZGA 2IKQA 1YOVB 3AB3A 3AUAA 2I71A 4LZOA 1ZD5A 1FRNA 5AW9A 3GGOA 1ZJ5A 4BDTA 4C30A 4MB2A 3L0YA 5DH9A 5HXAA 4B82A 5JNRA 2ZZKA 1FSSA 4NNPA 1XZMA 4JC5A 1E1NA 1VBFA 4J0GA 2JATA 1F2DA 3GU3A 4CV0A 4Z3DA 4CCYA 3ZUPA 2MHCA 1IC6A 1JPVA 1LS1A 3VKWA 5K0CA 3FPFA 3TNDA 1AUPA 1TYBE 2QW0X 3WGHA 4H7JA 6Q21A 4AQ7A 4FFPA 2HWWA 2RG7A 3TUJC 1BGVA 4UPEA 3V4FA 5JAZA 1QGDA 5FFFA 4OIMA 5BQFA 3I09A 2UKDA 2VWHA 4UM7A 2X1HA 3ND5A 3VH1A 2IXAA 3K0HA 2VPWA 4BN5A 3ZWBA 3IV9A 4WGGA 3ZW9A 3MINA 4R1TA 3SEZA 1MJ5A 1O54A 2C59A 1OKKD 3ESQA 1WU7A 1VJCA 2CXTA 2GHTA 1K5GA 4BQQA 4EHBA 1XMPA 1PYGA 1Y7LA 1S8NA 2WUFA 2V7EA 3DEJA 5HFAA 1PEKE 3L1VA 3TMKA 5T7BA 3BH6A 4Q9AA 3TL3A 1S3GA 3GCGA 3TDNA 3BB3A 2Q1UA 1QMGA 4CUZA 2YFHA 4HB4A 4ID9A 5C5DA 2FWJA 1E1QD 1Z7YA 1F8FA 2BGRA 2AV6A 2H1RA 4KQ1A 1W0CA 1Q17A 2GK7A 3K70C 1P4AA 1RQRA 2QMQA 3BTUA 1LV8A 3TNJA 2CHEA 4PIMA 3ZGZA 2I67A 4AKGA 4JWTA 1C8VB 3PPVA 2EDCA 2PMFA 1E9BA 2ZBFA 4N54A 2X2EA 4LJLA 3IA7A 1VHLA 5IK2A 5JCJA 2L2QA 1ZWLA 2HMUA 3C7CB 4HGRA 3ZDFA 4QVIA 3THYA 3SBDA 1UXOA 3U39A 1GFZA 2ZYUX 3F6YA 3TB4A 3TM4A 1OREA 4TS3A 4KR6A 1PUXA 4URWR 1EBUA 4DV6B 1FTYA 1KYIA 2UUAB 3EZ6A 3G82C 4PLHA 2J09A 2IYZA 2GPJA 2BCJQ 3IYLW 3PLNA 1KBQA 4UEWA 5I45A 3GHHA 4RTRA 1XAHA 5FWAA 4FX2A 4YQEA 1W4CA 3CUKA 5IN5A 3SYRA 1UL1X 5IAAA 3R3HA 3QQ5A 4H3KB 3COZA 4NYJQ 5KYYB 4GRIA 1C1XB 4D8YA 2QN2A 2Z1DA 3OZXA 1M6VA 3B6IA 3W7BA 1M7BA 3G02A 4HDKB 4EMTA 4CMIA 5DNYB 1GNPA 2J33A 3K05A 2QN7A 1U2GA 1TW3A 4AKHA 1ZK4A 2VHXA 2I3ZA 4OJTA 4LQDA 3AONB 3TQQA 1T9CA 1SXJD 5DX1A 2POCA 2O1EA 2ZYIA 4LK2A 3FF1A 3DP9A 3H8SA 3I4CA 3VDXA 4RPCA 1TRKA 3CVXA 1EP2B 2V3VA 3SHQA 3CVUA 1EDZA 3L0CA 2AD5A 4ARBA 3DHNA 3C6ZA 3BWXA 5DN6D 5GONB 4O2RA 3M5PA 5HRCA 1DQZA 1GLVA 2OZVA 3BDAA 1L4FA 3ZCRA 4KLZA 1IDN1 1NNI1 1JWBB 3KLPX 2OZKA 3L1UA 2BFCA 1NZFA 1M6YA 2ZIXA 3WGNA 1PJSA 3ETLA 4DRYA 2PWYA 2VAVA 2FPKA 4HZUA 2D1RA 2FQWA 2NO1A 2O20A 3IJEB 1BXKA 3OFSA 1NONA 3D7MA 1LLQA 5BWMA 3R6GA 1ZD9A 2ZJAA 4GEKA 2I1QA 1B2LA 5H3CA 3D43A 1YCGA 2SKCA 2YDYA 1XRPA 1INLA 1NKSA 2GVZC 2J4CA 2OQ2A 2ZS7A 2ZXEA 3D64A 3GN1A 2FXIA 4ZA2A 2PGDA 1C30A 3RTCA 3ZV4A 2GWHA 2VTBB 3C7AA 2AG0A 4C0SA 2JCYA 3JWJA 3OM9A 4IMPA 1MNQA 4R51A 3Q6NA 3KUKA 3IAM6 3L49A 1SM4A 4DV2B 1I2CA 1R5JA 5IUJC 3ADPA 1W34A 2PT6A 4ZIRA 3ZE1B 4U8GA 3OT1B 3GW8A 3GLHB 2JBHA 2UZ1A 3A8TA 4PGFA 2WWIA 5FV4A 4QNRA 1IQUA 2I2FA 1J8DA 2VF2A 2RH8A 5DE3A 1U31A 2GVDC 3NGMA 5EKDA 5FEUA 2Q9UA 3BRQA 2PX8A 5K8VA 1C3OB 1SQSA 3AJAA 2J0UB 3IQZA 4PLPA 2J87A 1LPMA 4Q34A 1CWUA 5JLJA 5F3DA 2Q3FA 3QYJA 2W2TA 2QE6A 3NLLA 4HGQA 4B44A 3R8FA 2WSIA 2Q7OE 4B73A 5ALFA 4DMUB 2EIXA 1MB0A 2C4KA 3GQBA 5CFRA 3R23A 5A6VA 3M1AA 2IEDA 1DPFA 3IC5A 4WESA 1KWKA 5JCOA 5E4TA 5FJIA 3ZX5A 4QTZA 2M98A 2FMKA 3RRFA 2P78A 2JGDB 2ZR0A 3QHPA 3QKIA 3LBYA 2CSUA 4IFTA 4GLFA 3UV3A 2WYVA 1GUZA 6YASA 5AR1A 2R87A 2OV6A 1XEXB 4OB7A 1UWCA 2HPAA 3VU9B 4AQYB 1KEVA 1JAXA 2VRBA 3V1TC 1OSNA 3H6HA 4LRWA 3RVNA 2P9FA 5J2TA 1VXOA 4DR4B 1FA9A 1RYEA 3V4ZA 3EAFA 4A1OA 3GEPA 2A88A 3FCSB 3K2EA 5FHQA 1K68A 2E21A 3NDIA 3SF8B 4BMVA 2XZDA 3W1VA 4AIIA 2O2YA 3EY4A 3P9ZA 1UT5A 2C9YA 3O3NB 2HIAA 1V0JA 4MXDA 3OEYA 1DV2A 2JLAA 1S89A 1G8MA 2WWHA 2PH7A 2PMBA 1II8A 3E9ZA 4RVHA 4YAWA 3U3ZA 2ZYAA 4DJEC 3ADCA 1L4KA 1FFXA 1MJHA 1W46A 1FMFA 2CFOA 3VMFA 2J5QA 4G0PA 4RSMA 5KZMB 4OI2A 4H6XA 4GXTA 3DPUA 4MRAA 1B26A 3GH1A 4S1NA 4TMZA 3IQXA 3WLOA 4FQ8A 3FDIA 4FDMA 2A6PA 1JFSA 2TMYA 5LP6B 3ZH9B 4RVUA 3FUTA 3TW6A 1MFPA 1UAGA 1MAUA 4OCZA 4RMGA 3WVNA 2X5XA 1E2JA 4HI0E 4HLCA 4TRNA 1PSWA 2XZPA 4G5RA 3GUVA 3IBTA 4E3WA 4J0DA 3HCRA 3NTOA 3ZJVA 3DUFA 3G68A 5AJTA 5HCNA 1G3IA 2NO9A 5F7XA 1FXUA 4G56A 1UBJS 3HPRA 4RFSB 5HK9A 1U9JA 5HEKA 4AKEA 4BFLA 5A1TA 3UMCA 3ZWNA 3ZHRA 4BO3A 3OQJA 4ON9A 4BNKA 2CHGA 2IZ0A 3L01A 1AURA 4B6RA 2NXWA 1I3NA 1CEQA 1T8UA 2C78A 2AFVA 2OZLA 4I3GA 3TQIA 2RIRA 1HO3A 4G89A 1GLNA 1VDMA 2A5DA 2AFIB 4ZD6A 1V8DA 4QECA 5K0TA 1HORA 4DR2B 4GS5A 5F1PA 4BQRA 3VR3D 4ZREA 4DIEA 2QQ5A 5HQ3B 2E5FA 1P8JA 2JASA 1RI1A 4WE3A 3UHFA 3WLIA 1JLSA 2FN9A 1J42A 1IULA 2VQ3A 1VCMA 2JAWA 4PAWA 4RAOA 2QZPA 3G1UA 4ENTA 3DDZX 3NV9A 3MJCA 2XUPA 3EARA 4NU8X 2RAVA 3RQSA 4FGSA 2XUKA 1ID1A 3KQWA 3EIOA 4QYIA 3NM5A 5CNKA 1NBOA 1DBIA 4F3TA 1A88A 1ZCJA 3BB4A 3DV0B 4LCEA 3ZCQA 1DKOA 1E1RA 1EP9A 3KQQA 1TJ4A 1JJIA 3ZDCA 4LHEA 4KRGA 5C8XA 2WF8A 4HDSA 3RHZA 1JYSA 1RIFA 1DQYA 1JHAA 1WLSA 3NHWA 1ECCA 2EC5A 2O8DB 1B1AA 3V7WA 2R6JA 3UB4A 2AI2A 5CB4A 4E4YA 1G60A 4ZGGA 3U1VA 3FXAA 2H7YA 3QEBZ 4JUDX 4N1AA 3ONNA 4UUNA 3FYCA 4KWTA 4WBSA 2N3ZA 3DEHA 1CB0A 1VYVA 1N8NA 3F9RA 3O1LA 4YMIA 2I1LA 2ZI6A 4PYOA 5BVGA 1ZIPA 3Q9NA 4C3UA 3N2YA 5DYIA 4NWIA 3ANNA 4ZU6X 1BE8A 2WT8A 2PEYA 1TJPB 1IY1A 2NV2B 3QZUA 3HZZA 4EF5A 3OPYI 5JCXA 2XMBA 1CC1S 3O82A 5FBLB 3V8QA 3P2IA 3TRJA 1WB9A 2VOEA 4JLOA 3WYAA 4DZRA 3GAMA 4H27A 1CZOA 2WU4A 3EXIB 4K7JA 3ZUGA 4L4ZA 5K3CA 3WWOA 1FFEA 3IV6A 4GXNA 4TLMB 1EFPA 3O0DA 4XFDA 3O7MA 2HSGA 2JI8A 5HBGA 1HEUA 2C3OA 4B80A 4DCMA 1LQUA 5I6DA 2NVUB 2XB6A 4JROA 4G1VA 4HN2A 2HUNA 1YJAA 4KPFC 3U13A 3RNOA 3ZWCA 1EE1A 2YR0A 3TLXA 2FA9A 1J2JA 1XK6A 4F6RA 1PK7A 2VIIA 1U2ZA 5L3VA 2PMDA 1XZJA 3AOEC 5SY4A 1I7NA 2H16A 2XVXA 3SNHA 1BKDR 1X8JA 2PV7A 2R6CA 4CR8A 5K3BA 2CVOA 2VBFA 4P4UA 2AI1A 2QD5A 2JZCA 2Y6VA 1GLGA 3JQFA 4UHJA 3T0FA 3UMSA 3DOHA 3HKBB 1GZDA 1DX4A 2CNWD 3M5DA 3HBMA 4X84A 2YJGA 4JP8A 3TQTA 1CNFA 2C2OA 1UBMS 1EFDN 5FWXA 3EUWA 3ZVLA 1LUAA 2ZTHA 4RV4A 4XWWA 2JLCA 1OVGA 2UUOA 4BV3A 4G36A 4I1YA 4L8FA 5DMHA 2C7RA 1DS6A 4HNUA 2D0OB 5K8JB 1ZR4A 1BYUA 4QRHA 4G9GA 4MQ5A 1RVV1 1T4CB 5FWDA 2W43A 4OO3A 3V80A 4CFYA 2HLNA 2NT3A 4BY9E 4ZYVA 4LPSA 2XB9A 1MB4A 1T5OA 3R20A 4UBNA 4PLCA 1XAJA 2GUWA 4GGMX 4NP6A 5DNAA 4B3DA 3JASB 2Q3MA 1U8TA 2I3AA 4S24A 2AT1A 2WIBA 3MGAA 4LNAA 5TX7A 2EQBA 2NNLD 5EMNA 4PPYA 4KN9S 3WGIA 4PONA 4NL4H 1TIBA 2HO5A 3ZHOA 5A4JA 2O6HA 3TS1A 2VJMA 1RPTA 5CT8A 3I76A 1Z34A 1LVHA 1P5RA 2EXXA 1RLOA 4DG9A 4Z4IA 2WDPA 3SX2A 1U6KA 4KDRA 2IOYA 4I4TA 4CT4B 5BSMA 5DK6A 2GBPA 2JGKA 1KZ4A 3IHTA 3NW9A 5F12A 4AJIA 1I4WA 3HSSA 3PC3A 1LRJA 2OK8A 2J9RA 4MW4A 2X8JA 1P3Y1 4PLVA 4EJFA 1Z8DA 1Z68A 3K96A 5FP0A 1GQFA 4RV5A 3CG4A 3ETJA 2Q9BA 5KTYA 3BBLA 1S2NA 2FP4A 3K35A 4J3NA 4EI7A 1L5RA 2OV3A 1RQ7A 3DNMA 4FU0A 3TXYA 3IB3A 3OLQA 4LBYA 4ARIA 3PGKA 3TLCA 4C4ZA 4KNWA 4BNHA 2O2CA 2OAGA 3QVSA 3L5OA 4PG6A 4V0MA 2QZ9A 1WHSB 3TKYA 2OSBA 4QUDA 4QSMA 3TLJA 3GD7A 5K3DA 2UU9B 2ZYHA 1IN6A 3U4HA 2BKEA 1SIBE 3C3JA 4RS4A 2CVHA 2NU6A 3FGPA 3KWFA 3N70A 1N9GA 2JLVA 1QB8A 1Q1QA 1L5LA 4E08A 1S4QA 1OV4A 5IJXA 1RJEA 3D3KA 1E2IA 1VE1A 3K0AB 3PUZA 3IAM1 3LC7O 4BVHA 2JGLA 4MQBA 4W63A 1ABEA 3KBOA 1ORWA 3G2OA 4B09A 2O4CA 3LZCA 1WDMA 1XZKA 4OOEA 1PD1A 1JHPA 2YIMA 3FOFC 1XVVA 1BFDA 3INNA 4UUBA 3INTA 3GARA 3L05A 3AOGA 3T6KA 4TROA 4CVNA 2Y1EA 2XBUA 3CFYA 3NIBA 4CGYA 4DMFA 5JCZA 1T1RA 5IXSA 1RAEA 3RVRA 3PWKA 4EELA 3NKFA 1OFVA 3A1DA 3UWOA 1SQ5A 1WF3A 3E1KA 4IDDA 4O1IA 3WAKA 5FI3A 5DI9A 4PZYA 4GOLD 3IT1A 1OX4B 3L6DA 4MVYA 4W1RA 5DSXA 1M8PA 2FB9A 1MP0A 3HVJA 1BAPA 3AVYA 4L74A 4R8SA 2QRPA 4HG2A 1W36D 2DQYA 1Z2CA 1FVXA 4AICA 5BV8A 1TVKB 3I64A 2R25B 4XPIB 3FOWA 3BFJA 2X1VA 3CZ5A 4ZYXA 3LPAA 5JI3E 4XWYA 3A4TA 1MUUA 4JIGA 4G8BA 5I7HA 4B3GA 4B1FA 5TPZD 3DZHA 4CIAA 1HYEA 2C5BA 3KJGA 1O6CA 3QJ5A 2XRZA 3WP0A 4A0QA 4L5IA 2DWUA 1XZDA 1I2AA 2B37A 2L42A 4HQRA 4D02A 1E4EA 2XUQA 2UYYA 5D3ZA 1FUEA 4QASA 1TA9A 2ACVA 2B21A 5DM2A 2DVMA 5G1NA 3PI7A 1F8UA 1TGYA 3C4JA 3AUJB 3LECA 9MHTA 2QP3A 1T35A 1DBSA 4X1KB 2GB4A 2YUIA 4IMRA 4YRQA 4RGBA 1T9DA 3LDHA 5TMBA 4F3YA 4DDTA 1U7UA 2YZ2A 4BWVA 1A8SA 4INJA 4PRKA 1IE3A 2AOUA 3I0NA 5AVSA 4K9NA 1SIOA 1DO0A 4LDAA 4KIUA 4S2UA 1U1EA 1DAEA 4OJKA 4E6PA 5KDOA 5BV1A 1HNZB 1UFQA 1U9IA 3ZE7A 1FRQA 4BL5A 1UBEA 4Z3OA 1JA9A 2O0JA 5IW8A 3OQHA 3OU6A 5EUMA 2VF8A 2H54A 5G0SA 3VZRA 5HS4A 1ISSA 4MKXA 5DHFA 4CL0A 4BEVA 3KSZO 1ZRNA 3UTDA 3AYZB 5ALEA 1P0QA 5C80A 4ZRNA 1P5JA 1H2EA 1I6MA 3E35A 4Y0NA 5EGSA 5HG0A 1E99A 5G4LA 1SD1A 3ZXIA 3UIEA 1ZH2A 5EHNA 2CBXA 4OHFA 3T3DA 2VDLB 2DBQA 3WNBA 5JZMA 3BHJA 4ODIA 4ZI3A 3WZMA 4WCFC 4CDNA 2W6ZA 2O57A 1N25A 4EGCB 4X62B 1R4NB 4NABA 1S9DA 2QZSA 5AM4A 5JAQA 2AZXA 3BDVA 3QITA 4PTZA 2HF7A 4G67A 4OHUA 4H7FA 4WXPA 5SY6A 1UF9A 4U4AA 1QV6A 2IEAA 3G6WA 4QJ3A 4Q9NA 4Q9HA 1GDTA 4N7BA 1XQ6A 1DT3A 4KVAA 1P2DA 4P54A 3MMZA 4MCIA 2PUDA 2QM7A 3EUAA 4HMQA 4OD0A 1G3RA 4W1PA 2V1UA 3WGGA 3QX7A 3OMWA 5CT4A 3FCAA 4ACAA 5DHSA 3W79A 5U1PA 1WA5A 3IHWA 2ZYTX 2F8TA 1UBNA 1U2SA 1WP4A 4RZ3A 1NXXA 2Q6TA 3CVVA 4ABYA 4YCBA 4MRMA 4IWNA 1J06A 1GFIA 1ST2A 1EP1B 3CF6R 4GOOD 1JLRA 4QDKA 2FDRA 5L7YA 3WR5A 2Z4TA 4K6GA 5EZSA 2ZATA 4BP9A 3FWNA 4W9NC 1BS1A 2A9FA 1H2ZA 1K6MA 2CCJA 4MVJE 4NPHA 5EP2A 3BSWA 1M5UA 2OFOA 1VIVA 2AWNA 1E3EA 1TYZA 2IW1A 1JNYA 3DAYA 2HRRA 3LX8A 5H4HA 3C87A 1HDOA 4F8EA 1EESA 4MHTA 4AY6A 3N07A 2C4UA 1ZVJA 2YZGA 3OECA 3ISVA 4HXEB 2ZCJA 4DIUA 1QNLA 3GDWA 1V3VA 3FOEC 1XV5A 2GNAA 4HDRB 4QTXA 1RJ9B 4XKJA 3ZG6A 4PLFA 4X9XA 2Z6UA 1Z6ZA 4RHTA 1E79A 4K8OA 3AY7A 4Y9SA 4B8WA 4UTNA 1DEXA 2BEVA 3ENQA 4KJXA 4TQGA 3GLGE 3U3MA 3PR3A 3AM1A 3FNGA 2LVBA 2WFZA 4JITA 4NCJA 5LZ9A 1E1YA 4DWOA 1OIXA 4UREA 2CL6X 4DBLC 3ZWKA 1SBQA 3ANSA 4CR7A 4K9QA 1MTZA 1KVUA 1KI1A 1R4AA 4U7PB 4ZC8A 1UBTS 1TUBB 2QM0A 2WBLC 2V7QA 5GJVC 3U31A 4BZQA 5AW6A 1HETA 1OQAA 4J0FA 2VDQB 4X8MA 3NR2A 1KQ3A 2DSTA 3RANA 3N7AA 1Q0UA 1WNFA 3QEKA 1Z6TA 1HFEL 3KX2A 3OKPA 1D1QA 4ZCSA 3N1UA 2GXUA 4X6YA 2QTTA 2QX6A 5ENVA 3SDBA 4AJNA 5L6MB 5ED4A 3REFA 1A50B 5FJJA 3UAWA 4EEZA 1B3BA 1DKUA 4KQKA 2HRCA 5KJFA 1HM5A 1NW3A 2A78A 2X41A 1MHPA 2WB4A 3X1YA 4DEYA 3MJFA 2PSSA 4JAVC 1II9A 2N42A 1QOPB 3R2JA 4IDHA 5K0NA 3IE1A 5EIWA 2D5AA 3LFHA 5J4HA 1QPGA 2ZGVA 3HWSA 3KEQA 4RELA 4MPPA 3TJZA 1JN0A 5I7FA 2L17A 1XG5A 3VR2D 1D2NA 1WEHA 1YR3A 4TUYA 4C21A 5JCJD 1M8KA 4DCTA 2I91A 3O8OA 1SKYE 3AIKA 3Q6IA 4C78A 1ODIA 3NEPX 2OXCA 16PKA 1KU6A 3UAYA 3X3HA 2PCLA 5HVNA 1C8LA 2NP7A 1AO3A 1RI4A 4IHKA 5KKNB 1M2FA 2IYVA 4X1YA 1K5HA 2FUG6 1NBMD 2VZLA 4H77A 2XCQA 5BXQC 5KNLA 4YTEA 2FQYA 5SZKB 4YAJA 5KMGA 4XQ0A 1T6BY 3CJQA 3KQLA 4FMDB 4LXIA 3PJGA 1KMMA 1PWEA 3N3BC 3BCSA 4GVLA 4L76A 2AEJA 2CD9A 3VPFA 5BN3A 1Z0IA 4DWVA 3E84A 5AW1A 3DR3A 5TEVA 5BOSB 4KWIA 1V5FA 3BMOB 4Q1FA 4TV8F 4MQLA 3MWLA 1JL3A 2TYSB 5JAPA 4D3DA 1H3NA 1PL8A 1FYDA 3THSA 2X0JA 1WULS 4CG1A 1QCDA 1R4MB 2CLKB 4MROA 2WIKA 2LPMA 3B36A 5JEEA 2PA0A 1QZTA 3JRNA 2LCFA 3GEHA 1SXQA 1WBBA 2NPFA 4U7FA 1K97A 2DSNA 2YV3A 3DZBA 1WY5A 3KFVA 1M1XB 1D7OA 2QRVB 5AIAA 5AW0A 1U6IA 2IH2A 2WILA 3TGPA 5DHAA 2I33A 1KEPA 1GXSA 1WSWA 5JXIA 1XRQA 3BVPA 2BDEA 4J16C 1V4VA 3C3CA 4DCCA 3CRRA 2GN8A 5A3QA 1QP4A 4R2LA 5SYMA 3BXXA 4QUGA 2H5EA 4DLZA 2JH9A 3GUYA 4ML3A 4M0MA 3ZDRA 3P2JA 2XUOA 1GNRA 1Q84A 5A5DA 2ECOA 2IXEA 1H9AA 2Q45A 4M1TA 1AN9A 2E6KA 3PIIA 4MDYA 4BNDB 5CVEA 4EL0A 1GKYA 3I34X 4IWXA 1U0EA 1JSLA 4FEAA 3R6DA 4LQLA 3L4EA 2IPMA 1Y6GA 3ZOZA 4IW3B 4D80A 5CYGA 4BNNA 4Q9DA 3DGFC 1LSOA 5EE0A 2C9MA 2JH3A 4Z6KA 1XXHB 2BBTA 1NF3A 2BFBB 2EG9A 3KALA 2HF8A 1KJZA 2HBZA 1KH3A 3EG5A 1KSHA 2VDRB 3GRPA 3QA9A 3HWX1 4QDZA 3KWJA 3PR2B 5DEIA 3INYA 3Q1KA 5HMMA 5IKEA 1RMQA 4RK0A 2WNHA 4IZIA 3U17A 1OXTA 1QIFA 5E9AA 4US2R 4LKRA 2I66A 1U7TA 4LRYA 1TECE 1XVLA 1QHFA 2WPDA 2A84A 1LX6A 5UKDA 2I34A 4MYUA 3M5CA 1K2WA 1PNOA 1W581 4RVFA 4YMTA 2O1XA 5JDIC 3MOIA 3V8PA 4TKMA 4ZOBA 5M3BA 4P5EA 4GC5A 1QQBA 1HG0A 4FHDA 5EXSA 2FZ5A 3WBBA 1I6LA 3DVRX 3ORSA 1RBYA 1T0UA 3GJTA 5HWSA 3DEZA 1E89A 3H7AA 2NACA 1RAIA 4IICA 4M0FA 2R48A 2WWVD 3RBXA 3TZLA 5HKLA 2FWAA 5LQMA 4KX3A 1X7DA 1ZFNA 3OZRA 4MUXA 1QUFA 1FRZA 1UXHA 3LP8A 4OLJA 4AAYA 5D86A 4YEDA 1JPUA 4A2WA 3WK4A 4RTQA 1GTJ1 2C5HA 3WG9A 2JD1A 4EMBA 4XCXA 3H2IA 4MCHA 5DLYA 3T1TA 2W8BB 3NALA 1Q92A 1COZA 1KYXA 1QVVA 5J4LA 2AMLA 2IHTA 4C0HA 2IHZA 1A9OA 4DVJA 5HZHA 5JATA 1GSIA 4UHBA 2OCGA 3KQYA 5LDGA 5DB4A 1QQAA 2YWRA 3SXPA 5AK0A 3LCCA 3CZAA 3A9TA 4DBVO 4M98A 2QZZA 4I6EA 5AYVA 1M83A 2O50A 1TO6A 5CFOA 1AKEA 3GHYA 1ZEMA 4LGYA 5I8WA 2O5EA 1DLIA 1IVNA 2ID8A 2OCKA 5AW3A 3MJDA 5JWOA 3TRDA 4N9QA 4LFCB 2CVFA 4QATA 2HA2A 3LBFA 2GQ0A 3KXIA 3ESXA 4GVXA 5K2MA 2AIRA 5B3KA 1C5KA 2FTKE 3KAJA 4KSYA 4RXTA 1CDZA 3KJZA 5GIOE 1EQAA 4NSNA 1GTVA 3UQYS 3WYFA 1LTHR 5A9SB 5E4FA 5BWNA 4QSHA 3RLFA 2AOVA 4MUHA 1VIYA 4B5LA 5EJ6A 1MRZA 3ZTTA 3SVLA 2P7HA 3W5UA 3PQCA 5G2OA 5B1YA 3JVVA 5IHPA 1YB7A 3IEXA 1IIBA 1CZNA 4HYEA 3LCMA 1V39A 2NTJA 4F2GA 2RFLA 3UCXA 5CGZA 1V7QA 1Q12A 3EXHA 1ECBA 5C7YA 2F3UA 2PZEA 3DOFA 3OBIA 2PGAA 3CNOA 4LCJA 4Q1AA 4EZIA 3RT9A 1Z4NA 3IILA 3M6AA 1Z15A 1YB1A 4U8HA 4BJHB 5K8CA 2LKCA 4LZAA 1PTJC 2X5JO 5JXGA 3KOXA 2JKYA 1VSTA 1SQ0A 2G7ZA 2IYUA 3ECCA 3PKJA 2ENUA 3AR6A 1W48A 2C5EA 5EJ5A 4QYXA 3TZCA 2OGZA 5HJ5A 2XA1A 3C6YA 2E18A 5LFAA 3VV3A 3AVVA 5KJCA 1R6TA 1EK0A 2F64A 3RTGA 4I5FA 3PDIB 3MC1A 3ZU5A 2YYZA 1E9VA 1GCUA 1HFWA 2GCEA 1SC3A 2BEUA 2Q2NA 4JB3A 2XPCA 3QVGA 4JYCA 1UXKA 1Y5IA 3CUSA 4D9IA 1KS9A 1XZAA 5D6NA 4BQFA 1G59A 1AOXA 2RHHA 4EVRA 4S1OA 4C0QC 4FFMA 4FWIB 4EWLA 1WJGA 3WKEA 4JEMA 1D0SA 3HZRA 3R0IA 3C1AA 2WUVA 2HU7A 2ZXFA 3L0PA 2DTEA 3SC3A 4IYJA 3PUKA 1P75A 2P91A 1G9TA 4A2QA 2PUVA 4KREA 2AK2A 3H2HA 5DPMA 1HYBA 2UVQA 3DZDA 5AQEA 3WHLA 4CTNA 3EE6A 4B8YA 2H2IA 4RS3A 1E1RD 1IXRC 3ONFA 2ZWMA 4LRUA 3TGLA 3FTFA 2XGMA 2WYOA 1NAIA 4HTFB 5DP1A 5F77A 1SN7A 3WLSA 1E7SA 4FGLA 2NO7A 4BLSA 4LMRA 2D59A 4RMIA 5EFOA 5K6AA 1W93A 2XMCA 1XTTA 1AS2A 2XB2A 2WIFA 1A1VA 3WYGA 1IM8A 4JMPA 2F1HA 3NH6A 1U3DA 1X92A 1H9BA 1CX9B 4L07A 1J0AA 1UC8A 4XR4A 3V8RA 1ZESA 1DLJA 1OXKB 2WM8A 3EWIA 4KPGA 4NJEB 4XGIA 4WKPA 3ZKWB 3CPSA 3R41A 3BMQB 5ALOA 1ZGZA 3DVSX 3PQ3A 2YXEA 3MB5A 3TF5A 3JD4A 4R84A 1IIRA 3IOCA 3PHLA 3SYTA 5K4HA 1T29A 4TS4A 1QFSA 2VJQA 4DDVA 2HWXA 1UBUS 2PBZA 3RARA 5EXEA 4KAFA 2CV0A 3AEKB 1N1MA 3N05A 3KR0A 3KTDA 5B53A 4R98A 2A92A 1CRQA 4YIHA 5AVJA 5JVDA 4KOEC 1Q83A 2H1WA 4W9RA 3TK1A 1E64A 3LF2A 3LGAA 1PK8A 3DO6A 2WD7A 2HCTA 5HUHA 4F1KA 4ZAWA 2UUCB 1HLGA 3F3SA 4MEBA 4PG4A 3KHUA 3PD1A 5JSUA 5DLDA 2VZ8A 1BCSA 3P9NA 4RIIA 5ULLA 1I9CA 2O23A 3I8SA 2IP2A 4RDCA 3T7KA 5AVXA 1KPGA 2BZ1A 4H2DA 2YV1A 5KEIA 2JLZA 3W3ZB 5FI5A 3DONA 4LJKA 5F2EA 4U5XA 3G13A 1YFZA 4BB5A 2MT9A 2LWIA 3ZWAA 4DJTA 4OGFA 1XZIA 4CL3A 4DXHA 5K2OA 2XV1A 4MUIA 5H1YA 1SGWA 2HK8A 4WCFA 3ZLTA 4NYIR 2YXLA 1WB5A 1TZKA 1ESEA 2YVUA 4BMXA 4M0KA 2P1RA 2W0MA 1RXIA 4OYYA 4EFLA 5FCDA 1Q57A 4EHAA 5FDFA 3Q8MA 5SY9A 1G20B 2WFLB 4RF4A 3LLVA 4JI6B 4S3MA 1Z8FA 1HWYA 3VHXB 5J63A 2C98A 1R6DA 1X39A 3C7TA 4RY0A 3PFKA 3SEQA 3DEIA 2C1ZA 3AFIA 4HWKA 1XSEA 5LYJF 4HH1A 4NICA 1EBBA 3HU1A 3ZEAA 4NATA 1J2TA 1YNOA 1ZL0A 2EVWX 3UFBA 2JRCA 4WOKA 3VYVA 3RG2A 1HDGO 5B37A 5I7AA 2M9MA 3G9QA 1Z45A 1GV1A 1ZBQA 3B51X 2PYDA 1CYEA 4Y1EA 4AJJA 1GPUA 4TVSA 3OZEA 2ZE8A 4GLLA 4PYKA 3ZZ1A 4CM1A 4WCVA 2FNAA 3E5HA 2EFGA 5HRUA 3F9IA 1HKHA 1T5DX 2CY0A 3V8VA 2GKGA 4NOJA 5M5BA 1SC4A 3B6ZA 5AJZA 1E2PA 4U9IS 5IAOA 1EFKA 2NVOA 5EIHA 4PV7A 4JJGA 4BUCA 1H9CA 2C1XA 3K6SA 3A1VA 3DFMA 4MV8A 5FO0A 1H3EA 4JP5A 4WV3A 2SNIE 3FTDA 1Y4ZA 2V7BA 4WW0A 3EZNA 4TMXA 5A4KA 3R3JA 2VN8A 2Q46A 3OZ7A 3GJ7A 3GFTA 4RZUA 4G65A 4AT1A 1GTSA 1PCXA 1VP3A 4G5SA 4PYRA 5C5CA 3KZXA 1NP6A 1YRLA 5JQGB 4BNMA 3Q8LA 4Y1RA 3W6PA 1XYYA 5IS2A 3I4FA 1JLLB 3RJ9A 1B16A 2WJAA 3AHEA 4FJ2A 4WCDA 4O33A 1X7XB 5JR3A 3JAWA 2XX3A 3VR5A 2WTEA 5K0ZA 1G8SA 2IDJA 4LISA 1WCXA 2VRWA 3MGCA 3BWYA 1C1DB 4YJHB 1N6PA 2VP3A 3B1YA 5E0OA 3BJIC 1MZPA 1AKWA 1M54A 2QGFA 3EFBA 4DOMA 1SBTA 3AINA 4R0VA 4WKGA 3GJ6A 2VDMB 3F7OA 3D4LA 1JDBC 4C2BA 8ATCA 5E6UB 3EEFA 1BHSA 1LBQA 1YZFA 2HJVA 2EHDA 3EVDA 3HB4X 4FBLA 1W4AA 5I48A 2QRZA 4G4SP 1M73E 4DAOA 1EVYA 3OM1A 4JLUA 4RC9A 3JZAA 3OIUA 3PPXA 1E0AA 2DJIA 5DW0A 1BROA 2X0DA 1NI3A 3EASA 4K9RA 4M99A 1PHRA 2B99A 2EU8A 5EIXA 3C3PA 1G21E 2XYPA 1L7XA 3T7AA 3PUVA 4LZWA 4DSUA 4PZLA 2FN8A 3EMBA 3T54A 1D9XA 2C82A 1C80A 3KSRA 4F11A 2VYVA 3KVOA 2NYVA 5L3QB 2NG1A 2Y1GA 3LSTA 1YFJA 4Z54A 3I8XA 5AD1A 4MI6A 4QULA 1ZIYA 3STTA 4LZLA 1GGVA 1I3CA 5HE9A 3S2FA 1EKXA 1WDWB 4YCJA 3UJNA 1YVUA 3G88A 1XR3A 5CPBA 4RKWA 1SD5A 4AO8A 3ZVRA 1RQXA 3UC5A 4IIUA 4N5DA 1PZGA 2OB2A 2R5NA 2XOKD 2FSFA 5HF9A 1UJ2A 4AY3A 2JFZA 4NR0A 1TE2A 4W8GA 4WFQA 3RK0A 5L40A 5BNTA 2QRKA 3S1AB 3L7CA 2B6HA 2JFVA 3P45A 3TMYA 1DI0A 1N3YA 1KVTA 3U40A 1LV7A 3W8DA 2NU9B 4CM8A 2ZRJA 4ZK2A 5A62A 2C5FA 1H1TA 2BL4A 1KO8A 2XCUA 1DC5A 5JV5A 3DBLB 5JYDA 4RZSA 3DVQX 3NHFA 3U44B 4G09A 3FOCA 2OILA 4JZYA 4B0PA 4XIJA 3TXAA 1Z6GA 4F6LA 3PUXA 3B53X 5AKGA 1LC3A 1RTTA 1YHYA 1LPOA 2B35A 4BASA 3EXEA 3GYGA 3IBFA 3B5IA 2YHIA 3R3ZA 2IFTA 2C7OA 1GGNA 3OSUA 4DFDA 2GM5A 4RZXA 4KV9A 4NYJR 2R84A 3MHPA 4QQKA 4EF4A 4ZI7F 1WPRA 1REQB 1USKA 2GHIA 4CIVA 1KAOA 2OV8A 1HDCA 1FFSA 1XZGA 4GBMA 3TLGB 1Z6PA 3ZWPA 3SX0A 3B1WA 3G2MA 1SVLA 1QF7A 5K3OA 2GFQA 2P4QA 3CEAA 3BFPA 3IT0A 3Q9LA 3DB2A 4GYKA 3C8UA 5F33A 4AS2A 5HGJA 2P27A 2ZVQX 4ALIA 2YVKA 4E5UA 5IYZB 3FETA 1FFHA 4IRMA 3L8CA 5FOUA 4KFRA 3A9VA 1Q7TA 3B7PA 4IIHA 4G1CA 4A8TA 1XCBA 1NG9A 1IXZA 3SS7X 1L5HB 4BNFA 2RIPA 5FLKA 2CMFA 4MGZR 2XNSA 4MPJA 1GSAA 3NTRA 4KX5A 1MIHA 1G3MA 2X4LA 5C37A 1TD1A 5DYWA 4TX1A 4B6FA 3DXXA 5DCUA 2G9QA 3TMAA 3FFTA 4JSRA 2ZJ0A 2A59A 4FXOA 4QUKA 4LBWA 2PH5A 3MA0A 4DCPA 2YOHA 1SU6A 2FJPA 4FHZA 5GADl 3T15A 1WSAA 3N74A 2ZUCA 4RZIA 3BL5A 4AJ1A 2GJAA 5FPKA 2CXOA 3I9LA 1TF7A 3C3WA 1N0HA 1YIOA 2FZLA 2QMHA 4NCNA 4C5AA 1ELOA 3VZDA 4AG6A 4UBKA 4XQ9A 2A30A 4HAWA 3OQNA 1F2UA 1XWWA 1HE3A 3C3EA 1KYTA 3GGGA 4QL3A 3ZTWA 4DRZA 3ER8A 2X2OA 4EGJA 5IVHA 1QKJA 4KHZA 4DW8A 2FK7A 4J76A 5CR9A 3OCWA 4JUIA 5IPFA 4HQOA 3FR8A 4YRPA 1YMVA 4NNJA 1CLEA 2GAJA 1UEJA 2FG6C 3L7AA 4IINA 3NHPA 1JG3A 4Y9DA 4GKBA 1P1IA 3M1YA 3LL7A 2EYUA 5I8ZA 5TS2A 3UTCA 3R7DA 2BM8A 3DKVA 4NMWA 3TI7A 3IUNA 1WVIA 1ETHA 1XRNA 2PZLA 2WIJA 3U3RA 3ZC3A 2QAJA 3NZEA 3V7UA 2R1VB 2GF0A 3ESCA 3KE8A 5HJEA 2GK4A 1LW6E 4D3SA 4XB1A 3I9OA 5EI5A 2F55A 1D6NA 1BN6A 3A6HA 1HMYA 3L7IA 4K87A 5TQ0B 1TAQA 5CLFA 3GVHA 2AE1A 3DUWA 1QU2A 4KXVA 2VTEA 2Q2QA 3RRMA 4FFBB 2P9QA 4QICA 3UT5B 1YRAA 4M83A 5AHWA 1IBMB 3U4QB 2C8KA 3IL2A 4L7QA 4TKVB 1HE8B 3UWPA 1T8PA 4XAQA 2PANA 2V7QD 2ZTUA 1IQ0A 4AWAA 3C8HA 4P7FA 1M1ZA 3VR6H 2DJ5A 1T36B 1Q2XA 4R2KA 1LI4A 1YBHA 2PRIA 4G4SO 4UUMA 3AF2A 1N2CB 2JIQA 1HR0B 4BQEA 2Q8QA 3Q87B 4YAGA 1U7HA 5A3VA 2O5VA 2OLEA 3AUKA 2WJWA 2FX2A 3B8HA 4HB3A 4XWOA 2Q9AA 4CM3A 3PP8A 3PDUA 2Q29A 3U7GA 1PD0A 5CH3A 4LOKA 1YS6A 1KS2A 4H0FA 1L5FA 4P98A 3UWDA 2PDAA 3MQ4A 4TMTA 4EBBA 2K7FA 2IPAB 1XCGB 4HVAA 1Q22A 1XU7A 4O4IA 3SVZA 4C22A 4IHJF 2GR9A 2H2AA 1T9HA 2DFTA 4LZPA 4L78A 1H93A 1N5LA 2VUUA 4PLYA 4U7HA 5F5XA 4J1TA 1QONA 3DLHA 2DERA 3ONWA 4PWZA 4BBAA 5E1OA 4ABTA 4QWWA 1UEXC 4URFA 2B0CA 4QQRA 1QHXA 4MDFA 1H8EA 3KV1A 1SCAA 3SXUA 4ZOCA 3MAAC 4MKHA 5GPBA 4INPA 1JDJA 1JQLB 2P2YA 4K0KB 2CV2A 1I6WA 2PBRA 2FFJA 1S1CA 2B1IA 2H6EA 1N2GA 5BSWA 4JLBA 3DDOA 1LJUA 2P9HA 1QVAA 3E9YA 1A5AB 1GNVA 3OHSX 5E4YA 3A9WA 5AVTA 4QU0A 4KGDA 4YCDA 3VYSB 2IZ1A 1FTGA 3NWOA 1T9AA 2XQFA 1IY2A 3MTQA 4A03A 1RLUA 1ZCZA 1RP7A 2EFDB 2G4LA 2AKEA 4RYDA 4DR7B 3KR2A 2DHQA 2XWPA 4RANA 4UBOA 4S0XA 1PWYE 3H19A 4O2AF 1N9KA 3AR9A 3OIDA 3O03A 4D8UA 1A9XB 2NUTB 5EZ5A 2QMZA 5JBNA 4RABA 3Q9SA 4UU7A 3FVVA 4X93A 2AG6A 3LYHA 1O5IA 5B6JA 3HB7A 4MW5A 3ML1A 3O9MA 3PQ6A 4G0OA 4JVMA 1MA0A 1SVWA 3ZU3A 4D79A 1ZRHA 2GA9A 4WK4B 2Z2KA 5BSFA 3N2NA 1VLZA 3ADKA 2DCUA 2YJ4A 2WIGA 4IYRA 3MMNA 2ZJ4A 2V6BA 1IZYA 2EARA 1NLZA 1NOIA 2MSNA 1OGJA 3KHSA 3JSXA 2G7MC 4UBMA 1U3GA 2XKAA 4V0KA 5LC1A 3WK6A 2OM6A 5F98A 5IKPA 3PLAE 4PZUA 4R3UC 2AJ8A 3QXHA 1PP4A 3TOZA 3B12A 5ICMA 2VBIA 2P41A 5DGDA 5ESXA 5CDYA 3Q40A 3UN1A 1PVVA 3DSRA 5P21A 1UMBB 2R1TA 4JYZA 1M66A 2Y67A 5EXTA 2HZBA 3B8EA 1S2IA 2QAIA 2HMWA 1NYLA 3GDHA 4A4DA 4BU0A 3OQ1A 1VRWA 2K2WA 4MAMA 1OLSA 4UEJA 3GFQA 3DWEX 3CN7A 2QTVA 4JYBA 4IIFA 2J9FB 3NVAA 2H1HA 4I36A 4QBFA 4FHCA 4NFYA 1MDBA 3R0ZA 1UDWA 5C18A 5B6IA 4Q4JA 6AT1A 2XMQA 3QKRA 5A05A 4G86A 1WV1A 1G291 3EQ6A 4K88A 4DCSA 5B12A 3VKHA 1FXWA 3H5WA 4JVNA 4LJSA 3FUVA 4RF2A 1N5IA 1CY8A 4HEA6 4EPYA 1CE8A 2FUEA 1DMRA 2VUSA 4ALNA 4HPXB 4KAAA 3IBCA 3G9XA 1RJWA 1F14A 1YOVA 5I9MA 4PRYA 2PUFA 1CQXA 2WPDD 4JXKA 3N9IA 4N5HX 1XKQA 2WWFA 5FKJA 1X1EA 2H2DA 4JBLA 1DRUA 1Q16A 3DF7A 1N6NA 2ZJ6A 1SVUA 3QE0A 4KH1A 4P80A 3TL6A 4WFJA 2P5YA 4PPFA 3OT5A 3ZY6A 4ZZ0A 4TSRA 1CTQA 4RTLA 4C88A 4URVR 2Z8XA 3J80A 1ULSA 2EKQA 3ACCA 3I9JA 4UCFA 4ZVQA 4WX2B 1JVSA 5TSDA 1HFKA 3P9IA 1B76A 2I22A 4MRNA 4B76A 4BXOB 2PUJA 4PHHA 3DL2A 2WABA 5FI1B 1I24A 5KREA 1Z4PX 1HA3A 3TEFA 2C1EA 2VNHA 1N7GA 2I76A 4ZYYA 2FVXA 5DBIA 3NIGB 2B34A 4XTCS 4GOMD 4LNUB 2X4DA 3AESA 7MDHA 2ASVA 1NVFA 1E77A 1C3VA 4OHRA 3MT0A 3IKMB 1O08A 1KVRA 1RXCA 3K5WA 3M6IA 3QKSB 2BKXA 1USUA 3EBPA 3LOUA 4XIYA 5KVSA 3BGSA 1L7OA 4B0OA 3LA6A 2R2AA 4KAJA 3JR7A 2H11A 1RYNA 2CKMA 4KJZA 4DWJA 3PE6A 1YQDA 1S8OA 1CUHA 3EN0A 5AKLA 2QRMA 2PU7A 4HUQB 2IEYA 1L5YA 3KSMA 4JHXA 4KUEA 2ZYRA 2CT8A 3TVYA 2ZIFA 1D8TA 2PVSA 5I5EA 3MG9A 2EFYA 4WNIA 4DHWA 4AF6A 3RHSA 3VC7A 3FBTA 4KPUA 4QAQA 2OXRA 1C4OA 2FYTA 4YJGB 4EDFA 2XKJE 1MR3F 1QYRA 2F1RA 3D4NA 2OFFA 1TQ6A 3BTSA 2F1IA 4WIAA 1GPH1 1XMQB 3P71T 2EBFX 1DZIA 2XNDA 2GEJA 4EHFA 4P3YA 1KVSA 3BWBA 2IL1A 3DQQA 2VWPA 4RPIA 3RU9A 3AB7A 3DCYA 4GLJA 4EW3A 4F4CA 3FVWA 4MMZB 2VJAA 1WUJS 4FHEA 4X20A 1BOFA 2RHGB 1VCOA 1D3AA 1TTQB 3PFIA 1DCFA 3PVZA 5EWMB 3TAUA 3TTXA 3RBAA 3LBAA 2DBRA 2GCOB 5ERYA 3VHQA 3UT0A 3VOBA 1P7PA 1QFJA 3BJRA 1TB4A 4F9TA 1D4FA 5BR4A 2OUKA 3W2GA 4CMGA 4B7CA 2Z4RA 3O83A 1VL6A 1V1RB 5KNDH 1Y82A 4OHBA 1QHGA 1G1AA 2OMKA 3T9DA 1U3VA 3LUPA 4RPHA 1KYWA 2C94A 4K2AA 1C1XA 1Y1KE 3O3OB 4PY2A 3D54D 4BZXA 5IULC 1MW9X 2PBLA 3BS4A 1GAEO 2R6AA 4Y6OA 3ILVA 4TN5A 5LZ2A 2A9PA 3MILA 5LD2B 3EEOA 4IDFA 3BJMA 3EFOB 4BCBA 1XD8A 1YD7A 3BCUA 2KMLA 4CTJA 1KYYA 2Y0PA 3L6CA 4W7SA 3P9YA 2OXTA 3JQBA 1W87A 2C31A 2GRUA 4GEGA 2CDNA 5KOHA 3ESDA 3A9UA 2BGIA 2FUCA 4F92B 1MEJA 2ZPTX 4DA4A 3TKAA 5KOJB 1YGPA 1PQYA 1OA1A 3KIPA 4TMVA 4G0ZA 3BILA 1PR5A 1U11A 1X1SA 3GLVA 4REQA 5IM5A 4D5GA 1UEIA 1EE2A 1V2HE 3R40A 3QLVA 1JU3A 1SVMA 4ZQIA 1LBEA 1A5ZA 2IXGA 3C39A 4XOUA 5C4IA 1HRDA 2X9NA 4AB1A 1PQ4A 3QKUA 3QJYA 1I2BA 1M6NA 4XVQA 1OX6A 1J2RA 4MV5A 3QX9A 1ZLXA 3ACBA 4LY0A 2WQ7A 1T3SA 2WINI 5A2GA 2R7MA 4L95C 1N3LA 2CFIA 821PA 2G9VA 4WXHA 2QD4A 4Z4QA 4QA9A 2C0QA 1AY0A 1EHCA 2D0IA 2CJXA 2JZOA 3NM6B 5EMLA 2CHFA 2WTUA 1ZVVA 3WB1A 3BXFA 2BD0A 4BN4A 1GZ7A 5BWLA 4ECEA 2VTBA 3LUCA 2P2GA 4MULA 1X7GA 4K26A 2ZLBA 2XBLA 4MV1A 4OHWA 1OR8A 3JSAA 4UHDA 3E9DA 1J49A 3UAXA 3OIFA 1A8IA 1G8GA 1EX7A 1LB1B 2IUEA 1LFDB 4Y2YA 4Q82A 1YVDA 3PDJA 5FLYA 4AECA 2JLYA 3KLNA 3OT1A 2CMDA 3FM9A 3EAQA 4IM7A 1E1KA 3B3JA 3OE1A 3GEMA 2FRDA 3OZDA 3EJ6A 1ODJA 3SQWA 1K7FB 3W5DA 2J3LA 2H1SA 2X6RA 3A6ZA 3H65A 1NJGA 3V46A 1PUIA 3S1SA 2XE4A 3HZOA 1B3RA 1PFYA 5FIUA 4KH0A 1C3OA 5JAOA 3ILXA 2DTDA 5JDCC 2XIJA 2QUBA 3QUTA 3FOBA 4IDCA 2QL7A 1U7WA 2W83A 4UM9B 3FCEA 1ATIA 3C48A 1YSCA 1LW7A 1GGMA 3SJZA 2J3HA 2H1LA 2E0IA 2C4NA 3CX6A 2I7DA 1AHNA 1JB9A 1FQKA 4GBED 3RYIA 1ZX1A 2VQ6A 3ZI0A 1WPGA 2ZSBA 3AL3A 6CHYA 4CIBA 3NBAA 2BKLA 3DKKA 4NZNA 4J0KA 5C32A 2TRSB 1NUSA 4HQNA 4N41A 1AV6A 4A92A 2C2ZA 2Z1MA 2JGDA 4RJKA 4AZVA 2OBMA 3KXPA 4NTZA 4KP7A 4N3GA 4ZQHA 4C6TB 4QDXA 1L3CA 2A14A 2VKTA 3IUBA 4HDMA 5TR9A 3VU9A 4HJXA 2VSXA 4IGIA 1MQ8B 3DZGA 2WYUA 2BEWB 2Y4OA 3E9CA 5K6RA 2B7LA 5BRNA 2FRVA 1O95C 5CU7A 1BTOA 3BUSA 2QT9A 3TW4A 4AWBA 3AHGA 5GZ3A 1AUQA 1M34E 1ORIA 2FPLA 3FI0A 3I28A 3QSGA 4RXUA 3SF8A 2W0SA 4MX8A 3QELB 2EW2A 1VL5A 2BR3A 2FEMA 2Z5FA 4X94A 3IELA 3HRIA 1SCBA 1I30A 3G2PA 1GOTA 5EQTA 4V38A 4TMFA 3SP1A 1NQAO 2WTMA 3CZMA 1DIBA 1FL9A 1XEWY 1BX1A 4QYSA 4WXRA 1V1JA 2FSVA 4LHVA 3JVUA 1FDRA 3RT1A 5CDFA 1J5EB 1JSCA 5KOIA 2B8TA 2G09A 1LY1A 2NXJA 4NYMQ 2PZJA 3C6BA 4EI8A 1OTYA 1N1EA 2V5UA 2RGDA 3H5TA 4RH3A 3VUEA 5TS3A 1BO6A 1K6XA 1OBVA 1SUEA 4BRWA 4ZCMA 5BUZA 1BXRB 4HY3A 3C1OA 3VTKA 5LP6A 1FXSA 3TCXB 4D41A 2LBPA 4KE7A 4BS9A 4EOGA 5J2TF 3BN3A 2NN3C 5MN5A 1DAMA 3OP1A 1GRVA 2V1XA 3QNMA 3RVPA 3EGEA 2P9JA 2YXNA 3FNHA 3ZOKA 1PJ4A 5T6MA 1NFRA 2ZWVA 2VK1A 3EZXA 1L8OA 3FDZA 4TLEA 1TK9A 1BE0A 2MSCB 4NDAA 3ZCTA 4E15A 3ABIA 3OCCA 5DN9A 1ZD2P 1RXEA 2HHAA 2IYXA 1SBZA 1PO7A 3CEJA 4RFSA 1BDIA 2A2ZA 3GNSA 2QM3A 2XNHA 4AO7A 9LDBA 1QP7A 4MARA 3A0RB 3V3KA 3RWOA 2NP6A 3EIXA 3AG6A 4XJVA 1CJUC 4BJ1A 2AZMA 3ZV5A 3GLGB 4C6SA 4R16A 2FPPB 3QUAA 4DMRA 1AVTA 1EINA 4K9KA 4XUDA 3W2FA 2AFIA 3QQPA 4YV2A 1DUSA 1LDMA 4X63A 4CTMA 5HQ3A 1PF7E 1KYZA 3T1VA 3VR5D 3ADOA 1A8QA 3VTAA 5DTJA 3WIEA 5BV2P 4C0WA 1NXTA 1G16A 1OFUA 4WY2A 5HDQA 3EGWA 4J7UA 1T8TA 2BGWA 1GG5A 5KNCD 4IIVA 2PN1A 1CD5A 3LT5A 4HEA1 2QLLA 1R5NA 1DXYA 2G1JA 1OBOA 4UEQA 2LIVA 3UANA 3L7JA 5DIFA 1L7MA 1CY6A 4YK7A 1NGSA 2HIGA 2W2OA 1J8QA 1TT5B 4LRSB 1WS6A 4JU9A 3VJKA 3MCUA 3OLZA 4BO0A 1J1IA 3NWEA 4Q6WA 1P91A 1N8TA 2CN1A 3LPLA 3QM1A 4LXYA 5HE8A 4RHFA 3FUXA 4CF6A 3GVXA 3QYFA 5EEGA 5FBVB 4AP5A 1XAIA 3QW4B 3EB9A 4MQ6A 2PXHA 4FOSA 4HHEA 2ONJA 3SCZA 1DBWA 1JFVA 1I3LA 4GXQA 2D6FA 1BDJA 2VYVD 5F73A 5CNJA 3S44A 4CKBB 4JSTA 3A06A 4XB2A 3ZD9A 3AG5A 3PK0A 4MZDA 4GZMA 4G5XA 1KK1A 3F5SA 1SKYB 2PQ6A 1KIMA 1PLJA 1UXJA 2PWAA 2FPGB 2NU7A 3F5QA 3FMOB 1VCNA 2O8EA 2YJ6A 1JR3E 5DWVA 4YRJA 2JGEA 2ETVA 3OJWA 4L0MA 4EYQA 2O3TA 3ZQUA 3NCHA 1SRQA 3QWFA 5KYGA 4ZN6A 5I7UA 3HYNA 2PZGA 3EXIA 3OY2A 4JNCA 4NHOA 4Q15A 2HSZA 1MOPA 4LXUA 5IJ0B 2JFGA 3F8WA 5LKRA 1EA7A 4QFCA 5CT6A 3JQGB 5C3UA 4UXJA 2C83A 2ZE7A 5CB4F 3Q9UA 4DPMA 4OK5A 3COSA 3PVCA 2RHLA 2DFLA 4LZZA 1CJCA 1W0KA 2C97A 4EUNA 4G5QA 2VNJA 5TGDA 4RGYA 2A9RA 2CCGA 1IUOA 3TOSA 4WVLA 2AG1A 1USGA 1XVTA 4CEJB 1UFRA 1WUTA 4HFMA 3D8HA 1M76A 2HA4A 3U3JA 2GN9A 4H60A 2WE8A 5CFNA 4NLLA 3GG2A 3NB0A 4PLWA 2P3LA 1YJBA 3HKBA 3ZCVA 4GR9A 1WV0A 2V97A 2DPYA 1QGED 3R76A 1R18A 5EJFA 1TVCA 1ZQ1A 2OCLA 2IEZA 5E9WA 1YVPA 4I4CA 3PQEA