4F1KA

Crystal structure of the mg2+ free vwa domain of plasmodium falciparum trap protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
200
structure length
200
Chain Sequence
b'EVCNDEVDLYLLMDCSGSIRRHNWVKHAVPLAMKLIQQLNLNENAIHLYANIFSNNAKEIIRLHSDASKNKEKALIIIKSLLSTNLPYGRTNLSDALLQVRKHLNDRINRENANQLVVILTDGIPDSIQDSLKESRKLNDRGVKIAVFGIGQGINVAFNRFLVGCHPSDGKCNLYADSAWENVKNVIGPFMKAVCVEVEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thrombospondin related anonymous protein
publication title Structure of Plasmodium falciparum TRAP (thrombospondin-related anonymous protein) A domain highlights distinct features in apicomplexan von Willebrand factor A homologues.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Cell adhesion
total genus 82
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4f1kA00
3TW0A 1FE8A 3M6FA 1TYEB 4MMZB 4JDUA 3BQNB 1IJBA 3NIFB 3EG9A 2VDMB 2VDKB 1IDOA 3BQMB 1MQ8B 1M2VB 3EG9B 3NIDB 3PPVA 5E6SB 1PD1A 3FCUB 1L5GB 4HQLA 5HDBB 2VDRB 1M1UA 4M76B 3F78A 1OAKA 3Q3GE 3V4PB 2NUPB 2O7NA 3TXAA 3EOBI 2WINI 3K6SB 2I6SA 2VDNB 3TVYA 2VDQB 2XGGA 3EFOB 1NA5A 3VI3B 5KYNA 4G1EB 4UM8B 1DGQA 3PPWA 3NIGB 3HI6A 1BHO1 3T3PB 5LN1A 4Z7QB 2XWBF 1DZIA 4HQNA 3E2MA 4IXDA 5E6RB 1M2VA 4HQFA 5E6SA 4HQKA 3HXOA 3V4VB 1JEQA 2IUEA 1AO3A 1N3YA 3EH2A 2B2XA 1JEQB 1ZOOA 2XWJI 2NUPA 5KYYA 1MQ9A 4WK4B 2NVOA 5KYYB 3K6SA 1RRKA 4FX5A 3PPXA 1SQ0A 1U0NA 4CN9A 5KYXB 3F74A 5KYUB 3K71B 4C2AA 4IHKA 3EFOA 2VDLB 4PN7A 4MMYB 4DMUB 2VDPB 1YVPA 1PD0A 1BHQ1 5E6UB 3FCSB 1MJNA 1M1XB 3ZQKA 4Z7OB 4WFQA 4BJ3A 1CQPA 3T3MB 3QA3E 5BV8A 3GXBA 4O02B 5E6RA 2I6QA 5ES4B 1QC5B 4IGIA 1XDDA 5KYWA 2NUTA 1V7PC 1U8CB 1IJKA 3HXQA 4F1KA 5KYWB 4UM9D 1PT6A 2NUTB 1M2OA 3IBSA 4HQOA 1Q0PA 4G1MB 2X5NA 1IDN1 2ODQA 3K72B 4MMXB 4XW2A 5HJ2A 1JV2B 1YVRA 3EGXB 1MQAA 5KYXA 5KYUA 2QTVA 1PCXA 4CN8A 3EH1A 1MF7A 3ZE1B 1ZONA 3IJEB 1SHTX 3ZDYB 1AUQA 3N2NA 5E6UA 2I91A 4WK0B 3ZDZB 1RTKA 5HGJA 3BN3A 1QC5A 1XUOA 2ODPA 2VC2B 3EGDA 1JEYA 4WK2B 3EGDB 4WJKB 4Z7NB 1JEYB 4A0QA 1M10A 1RS0A 1XDGA 3VI4B 1N9ZA 1FNSA 1LFAA 2WW8A 1CK4A 4NENA 4C2BA 1ZOPA 1T0PA 3TCXB 1ATZA 1JLMA 4NENB 3EGXA 2ICAA 1RD4A 2VDOB 3PPYA 2ADFA 3ZE2B 4NEHB 1QCYA 1MHPA 3ZE0B 3RAGA 3EOAI 1UEXC 4C29A 1SHUX 1U0OC 4CNBA 4UM9B 1AOXA 1T6BY 3ZDXB 4F1JA 2M32A
chains in the Genus database with same CATH superfamily
3TZBA 4OXYA 1PL8A 1KAGA 1WRBA 4N48A 1A9QA 1H6BA 2IYWA 2MYUA 1E0SA 3HQ4O 5K8JB 1JQAA 5I7RA 5CM9C 4LJRA 1WXEA 1EGHA 3T1HB 5A5VA 4XWOA 6REQA 1KYTA 3OT1A 1UDWA 1PNOA 4FINA 3AV0B 2BJWA 2VFAA 4MQMA 1X14A 3PEFA 4NF2A 4RD0A 5AI8A 1V6SA 4KVGA 3AJDA 1EVKA 4NU8X 3AKYA 4WESA 4XUCA 4PLHA 4Y0AA 5IAGA 5IKMA 2JATA 1VJRA 3EIUA 2DUWA 5AVKA 5J4KA 3AOEC 3KL2A 5LP6B 1Z6GA 2PS3A 3Q7TA 1D1QA 2AG1A 1ZISA 3P2JA 1XFDA 2WSBA 5LP6F 2QL6A 1FL9A 1ABBA 2ZRKA 4BO1A 4AKIA 2C82A 3MOSA 1PJQA 4OU4A 3SIPA 1AT1A 4QQNA 1AX9A 3HGTA 4PR0A 3WXBA 4FNAA 3KE8A 3VPSA 1F7UA 1PJ2A 2Q9UA 4RZHA 2IODA 2XOXA 1D9XA 3ADOA 3O3MB 1HYEA 2XWBF 3Q12A 2ODAA 5CD1A 1K2WA 3Q7EA 3OIGA 2WJPA 2PGDA 3EH2A 4WOPA 4Z5XA 3IQIX 1JA9A 4J0CA 2VSXA 2GAIA 4QNMA 5JS1A 2G4VA 4NULA 5GZ6A 2IOYA 2QHXA 3BTSA 4DCPA 3C45A 3PC8C 4I3GA 2FUNB 4L95C 5DTEA 3SJCA 5BMVB 1SELA 1XAHA 4QJIA 5BMVF 3C14C 2VDLB 3B13B 1N7JA 2HJ9A 3T9BA 1KE2A 5KB3A 3RK4A 2B61A 2ZVQX 2BBTA 2EU8A 3U3KA 4CLHA 2X2EA 4JASB 4AZ0B 2WAXA 3KELA 2B7CA 2GAOA 1GTVA 4EQ6B 5LKRA 4EG4A 1Z7YA 1THZA 1W5TA 4XJTA 1PWHA 5DCLA 5GGXA 3VOAA 5JAOA 4FS8A 4W8OA 2QIPA 4ZT2A 2OAQ1 5CPFA 3VKWA 1KSFX 4W9RA 3S5JA 3I3OA 3QX3A 1E69A 1H69A 3D5EA 4CETA 3LUGA 4IDPA 4E5NA 3AR5A 1XLTC 4AURA 2HX1A 4Z4IA 2QLBA 3K09C 4QA9A 1C1HA 1FPMA 1CB0A 3FHTA 3O9MA 1HF3A 2QTHA 3U44A 3BJZA 2FPXA 1YS2X 2VJKA 1YT5A 2GBGA 1OBVA 3MRSA 3I3SR 5HZHA 4UEWA 3M83A 4ERNA 1I1QB 2GTPA 1LSUA 5D5HA 3Q3JB 3VR6D 1X7XA 4M60A 1L1QA 2GJSA 5BQXA 3IQDB 5I5EA 1KMHB 2BFPA 2BSAA 3CEPB 1Z0SA 3LCMA 2NYUA 4YAWA 1Z68A 2H17A 2V3CC 2NO9A 5IDVA 2ZI7A 4JI1B 3T5PA 1OXBB 4LKRA 1F3OA 1A97A 4KO3S 4P4LA 1U5CA 5BOVA 2I7CA 4E5VA 4LYFA 3MINB 4EDFA 2CV1A 1P61B 3CBQA 1NYTA 4L76A 1T9KA 5J43A 3C39A 1IN5A 2PXXA 4JIGA 1KTIA 2SHKA 5GV7A 1W581 2ZIXA 5DPMA 3ZHUA 1LS6A 4I4TB 4K9DA 3AKZA 2P3LA 3UG6A 1JFLA 2IQIA 4DWWA 2GRJA 3GLUA 3O2SB 4GOMD 1KZ4A 3H4IA 3L5KA 1GRQA 5DYNA 4MCIA 3FZQA 5JRZA 1UEXC 3AY3A 4QARA 2H1WA 4C29A 2EKZA 2GM4A 3M5PA 4N65A 4MQ4A 4TV9A 4BYMA 1MJHA 4ZC1A 2X2OA 2Q5QA 2D59A 3TKAA 3G0HA 4DMLA 3ZBQA 1T35A 2FW1A 3HJCA 3OIYA 5CK4A 4OD0A 3ONFA 2CDRA 3KQVA 3Q3HA 2B99A 4JJZA 4AO6A 2OLEA 4B1FA 5F2OA 1AB6A 5ELMA 4YONB 1R9MA 3CY6A 2QRQA 3OKFA 3DLBA 3O0DA 1P7YA 1X86B 1YMUA 1SO8A 3IT2A 3QY0A 1V0JA 3Q8MA 2QTCA 2ZVPX 5JJKA 4CKZA 4MWTA 4MDYA 3C97A 5C81A 4YBZA 8AT1A 5K05A 4ND4A 4L6IA 4ETMA 1GT91 1JPJA 3JYQA 2VQ3A 4X7PA 2HXGA 4BU0A 5B3JC 1TYZA 1Z8NA 3EWNA 3I04A 1G8SA 1RI2A 2JZNA 4X95A 5KTPA 2EGGA 4RKYA 2PV0A 4RZUA 4ALKA 1JEDA 1UBEA 1INLA 3GJ8A 5B1YA 2BMFA 2GEJA 3BMQA 2IRWA 4A8PA 1LDBA 4LPKA 5BWLA 1LK7A 5BYBA 1H3FA 3V2IA 4EEKA 1QLJA 4CV2A 4AXXA 2C3YA 3A3KA 3H8VA 2OC4A 2EG9A 4QYMA 1VJDA 1DRVA 1P8AA 5J40A 5LYYA 4OX9Y 1Z39A 1THGA 1P19A 4RXUA 4YPFA 4DVGA 1LCIA 2FDXA 3GLIB 4EPWA 3WWPA 3W7VA 1E1CA 1G8PA 3WKEA 1U6KA 4NC9A 3WGJA 1OWOA 5BSHA 4DLAA 2O5CA 3N87A 4GP6A 4IHKA 1YQDA 5DNAA 4Z0TA 4BC0A 2IY8A 1DFHA 2PZBA 1K1EA 3GUCA 3HU1A 4XR4A 3WDSA 3N07A 3PEEA 3VYVA 2OCKA 3W6OA 1GM5A 1M6VB 3ZQKA 3LDFA 3RUDA 5REQB 4LF7B 4U5XA 4WNAA 1U0SY 2AI3A 4NDNE 1FRZA 4UATA 1LPNA 1YBFA 3PCRB 4BB6A 3VSCA 5KOYA 1TYAE 1NC3A 3THYA 2WMYA 3GDWA 4L72A 1ZNQO 2XAUA 4HNQA 4B3HA 1GNRA 1RJFA 1FP6A 1PZEA 1YSCA 3OIUA 1GQ2A 1M2NA 2IE8A 4FN4A 1VLLA 3IXLA 1DAPA 1SUIA 5E3IA 1NQAO 5EE0A 5GWXA 3URMA 4F1JA 2BFEB 4U3JA 1QYCA 3FUCA 4IG9A 4ZOLF 3W2TA 2B8WA 1LRKA 4L2IA 4JDPA 5KO2A 5IK2A 1C3JA 3BZUA 3CUKA 4MA5A 4Q21A 3AESA 2XWPA 1FDWA 2BPOA 3GJXC 3K6KA 1U2EA 4OXQA 2POCA 2YCLA 4MV1A 2IWRA 1XMQB 2P4SA 3BN3A 5LBIA 3BD8A 4ZCIA 5LDGA 3HG7A 3I4FA 4IZIA 4G4SP 2V5UA 1THMA 3EJWA 3RVJA 2X5OA 4P31A 2OFWA 4M0LA 1RXVA 1LI5A 4C89A 2OV3A 4DV4B 3N2GA 4LTMA 2QMUA 2Y0DA 1JHZA 4EK9A 3HYCA 3L1KA 2OM6A 8OHMA 2P2YA 5IG2A 5ECGC 3SJ7A 2PSFA 1XQWA 3PNLA 1UOPA 1R5BA 4CDNA 1TU0A 2CZCA 2VAPA 2Q6KA 2V03A 3VHQA 4LXHA 3NVKI 1WXXA 3OPNA 4P7BA 4GQBA 3DONA 1FW8A 4TLLB 1DDIA 2QLJA 2M9MA 2RGDA 3N2KA 4Y2GA 4GL4A 1L7RA 1TLLA 5THQA 2QP4A 3WS7A 5A5GA 4LXQA 1N77A 2DXIA 4MWZA 3HBFA 4ZCSA 2CHUA 3WLHA 3CLSD 4V0KA 5C1IA 4OB8A 4B40A 4BN0A 4JOBA 5HM6A 4ZFNA 1FVOA 3QI2A 3GELA 1V35A 3ITKA 3JYOA 3MLEA 4WLNA 4GZMA 2OENG 4KIUA 3TS1A 5KJFA 2O8FB 2BFDA 2P7HA 3AKCA 1NURA 1FJ2A 4GMFA 4HB3A 2K7ZA 5GVRA 3NEAA 3VHLB 1SOVA 3I2IA 3O8LA 4QXQA 5JJLA 5F5NA 1OIWA 1PZGA 2WZCA 2ZJ3A 3H3FA 4X66B 4U2CA 2CYAA 4ALMA 1M1YA 2HMTA 5SV2A 3CC8A 3OC0A 5HRCA 3RYIA 4B2YA 2R8ZA 5C80A 3EDRA 3I8SA 2GJKA 4HNUA 2QE7D 3CUSA 5FWYB 1ZW6A 4CDMA 4YLYA 2O14A 1TL7C 3TD6A 1YE5A 3D2BA 5B3LA 1X3LA 2QUBA 1Z3IX 3TTSA 2ZIZA 1L5RA 3MK31 3N2IA 2ZU6A 3TUZC 3LECA 2ZCUA 3EVAA 2QV7A 4IDFA 4OQYA 4EHJA 5JISA 4TT3D 4Z4EA 1NQWA 4MGKR 4N3CA 2II6A 5C7LO 1UK9A 3QVKA 2LCQA 4DMCA 3PEWA 2GVNA 4K9MA 4QU5A 1CR2A 3UO8B 3ZY5A 4Y9TA 2PDAA 3DBOB 3K3PA 3WGOA 1MDBA 3TSWA 1X38A 2IXFA 2O1XA 2DQSA 2VUSA 3GVXA 4LVCA 3TRJA 5A0TA 3N2EA 3QA9A 1J4AA 1RXYA 4MR8B 4ACAA 2G9NA 1YOBA 4RZIA 5I4IA 5JXWA 1E2JA 4NNOA 2PLWA 2NVBA 1S9HA 3PTZA 4DZTA 1KQFA 3R0XA 3RYHA 2DEUA 3RSCA 3AFMA 1H1LB 1SBIA 4W9MC 4OA8A 1II8B 2KSQA 1B8OA 2BGRA 5F76A 3NFRA 2VQDA 2XTNA 3C6MA 3ZKWB 1V16B 3I4LA 4M9RA 4IV5A 4YT2A 1CC1S 3ZHCA 2Q1UA 1OFIA 1E9VA 1F2TB 2FETA 2IVZA 2YCBA 3A1CA 3LK6A 3TR6A 4ZJZA 1X1AA 1W29A 3EEQA 1N5RA 2VYCA 4BNXA 1Z0FA 1DX9A 1QO7A 2NPOA 1C1XB 1G66A 2RC5A 3GRVA 1N6NA 3QVTA 5KX5B 4RADA 5KX5F 2B20A 3B1VA 1C8VB 1XQYA 2VJMA 3GFGA 3ZZUA 4YUXA 2XIJA 3F5SA 2V58A 3MGKA 2IYPA 1M1YE 4AICA 1R7RA 2HJGA 5CG1A 1A1SA 1Q0LA 2A59A 2R6HA 3BGVA 3KLMX 4XIYA 4TOIA 1E96A 2O1EA 1SA0B 3BUSA 2NSYA 5IVIA 3IE0A 3K2QA 3DTVD 5FUVA 4ZVMA 4E2ZA 1T4CB 3FCAA 4XM1A 3C70A 3R5FA 4TRMA 5DTQA 1LVGA 5IJAA 5C5DA 1EIWA 3HKBB 3WJ7A 4OKNA 5LU9A 2W83A 5AXDA 3BWMA 2OC9A 5DLEA 1DV2A 4WA7A 5E2BA 4NBSA 1RKUA 1NVUQ 2C9CA 1BKSB 3SYMA 2LIPA 1B0AA 2J5KA 3TTVA 1EBBA 1DTWB 2VNJA 2XBLA 3GNQA 2VH5R 4KPUB 1EFPB 1M0WA 3QXGA 5H9WA 2WTEA 3PQDA 4P82A 3AM3A 4ESEA 5LCXA 3GEDA 3UCXA 3V8MA 4ZI3A 4HLUA 4JJ4A 1IZZA 2NG1A 2Z3WA 2OQVA 2VUHB 2BM8A 5D3ZA 4JBYA 4HDSA 2B1RA 1X1BA 3SKVA 4CKEB 2O8BB 5L45A 5H4HA 4PLPA 4ZKEA 2OHFA 1T43A 1GGNA 4OG2A 2UYOA 3AR2A 4G01B 2DFLA 5F2KA 5TT1A 3VAYA 3LMKA 2IEAA 3EPKA 4QJ5A 4RFLA 2YVLA 1O94D 3GDGA 5K8IA 5IM4F 5LMCA 3K15A 4BKPA 2N47A 3EIXA 1N2CA 5EWLA 1MJ5A 3TNYA 2UYHA 1ORRA 3H5IA 4ZA2A 1ETUA 5KDLA 1H6AA 2HGSA 4O25A 4CMEA 1H9AA 1O95D 1G6OA 5DHRA 1YRHA 1NVAA 3SYLA 4YV0A 1FDIA 3EA5A 4RPKA 1CVRA 5AOBA 1WB9A 2GO1A 1CZOA 4X1YB 3MQ4A 4J91A 4Q3NA 1ZNZA 4G0XA 1I94B 3O82A 1QBKC 2V8OA 2XUPA 4N8DA 1UBMS 4HATA 1QHIA 1VE6A 1EFKA 4MP6A 1JKIA 1U5AA 3KXKA 4AJOA 4F97A 3MT0A 2FMTA 2QZZA 3RT1A 5DKFA 3OQPA 1P17A 2QROA 4YI5A 3LKVA 5IMSA 3PL1A 2J5XA 5AVRA 3QWBA 4AJLA 4YJHA 1D6NA 3ICVA 2G8LA 3THWB 3U4MA 1XQ1A 5AW4A 2MSNA 4KXXA 1E3IA 5D1HA 3RS2A 1MX5A 4NMLA 1OA1A 1LV7A 1M2HA 4UCQA 4BLTA 1DUVG 1FXWA 2QPAA 1EK2A 2XQKA 3NGLA 4BO4A 2YH2A 1O77A 2H1FA 4DWVA 1TXGA 2FLKA 1I9GA 2YWJA 4I1SA 1OR8A 3L7OA 5AT1A 4BNVA 1OX4A 5IASA 2RGXA 3E3OA 3VO8A 1N7HA 4I5EA 2UUBB 1I2MA 2DHCA 2RGAA 2ZI9A 5ILQA 3CZ9A 1C7FA 4EUSA 1QGYA 2O8CB 4ZANA 3NHFA 5LYJB 4GWLA 3ONDA 5EHQA 4ENUA 4BB0A 4D9HA 3QWAA 5LYJF 3CR7A 3L02A 3W4IA 2Q3CA 4YRJA 5IBCA 3EVEA 4JR1A 3INRA 3DJFA 2B35A 2VZ8A 1IPEA 4NPCA 3KKEA 2FW9A 1IXSB 1N1GA 2VPTA 3VZSA 5A6SB 4OHBA 4PS0A 1KQ3A 2C4KA 1YZ3A 1YZVA 2OCLA 5FA8A 3SQOA 3LKZA 2E87A 5FBZA 1JW9B 3E8MA 4EB6A 4F2PA 1K88A 3JAWA 3MWEB 3BWYA 4QYIB 3VV2A 1K4YA 4Q7EA 1L0BA 2C2GA 1YB1A 2Y1OA 1Q0SA 1CQIA 3CW2A 4M1WA 4YDRA 3RFXA 3TD2A 3WKCA 1JFRA 4ZQIA 5G53C 2QTZA 3CEMA 2Z58A 1R10A 4CM4B 4JLDA 1HOXA 2IEYA 2CMHA 2L2QA 4XGKA 4JBXA 1OFUX 3LP5A 1PT8A 1W4CA 2WD9A 3DMGA 3LUPA 3PXBA 2JAWA 2OLKA 4GYWA 4KPGA 4II3A 4P4SB 1GNPA 2AL7A 2X0IA 2R85A 3Q0IA 4LJ5A 3X1ZA 3NHRA 1RWVA 2WOOA 3A1DA 5TV2A 3KU1A 4X41A 2JFOA 1N9ZA 4LHXA 4U8GA 4JI5B 1YR1A 3ZE6A 4B9EA 4E5MA 1SUSA 1JRLA 1T2NA 3B5JA 3NVAA 4FU0A 1FFXB 2H06A 4RTSA 1ECPA 1NFFA 2R68A 3ZZ1A 5KQSA 4CEJB 4AK9A 4INPA 4WY8A 1MHTA 2FSFA 2QX7A 4CQNA 1V1JA 2PZKA 3NC1C 3W6ZA 1Q7BA 1SHUX 3MA0A 2J07A 4XDYA 2B2NA 2WJ6A 1XYYA 3JQ6A 5TGZA 1YZTA 4FIZA 3KWMA 3CF2A 3OZAA 1SXJC 5CX1A 2LRHA 3GA7A 1X94A 1TF7A 4TGLA 4QOHA 1IHDA 1JHOA 3C6XA 3AZQA 3OMWA 3T5MA 4A2QA 1PJ3A 4UVDA 4PYKA 1Y1LA 1QKIA 3CUTA 3G0OA 5ECDA 5CDHA 1TUGA 3DGFC 4DAOA 2A94A 4EBBA 4FCCA 1BKYA 1OWNA 3DQPA 4GU5A 3UB3A 1LWNA 5D51S 1VSQA 3HU2A 5FTWA 1I2ZA 1PGQA 3OI7A 3DEZA 5BT9A 3VBCA 4DJAA 1UFQA 3MJEA 2X77A 3SEAA 1PNQA 4N18A 1SK9A 1K7FB 1KMQA 2C42A 3S81A 1EX9A 3HKDB 3M70A 3RWMB 2VBCA 4M7WA 4UU8A 4JP8A 3SX2A 4FE4A 3KHSA 4G1VA 4F2HA 1Y6ZA 2H7CA 3E1KA 2QWXA 2C07A 2WAYA 4FHEA 4HB4A 4JYMA 3HMQA 5IH7A 1KDPA 3O93A 2YYSA 1KYVA 4D9CA 3QFCA 2VDJA 2OV6A 2JJ2D 2VLIA 1N0IA 1NJGA 3WNQA 4YMTA 4CTNA 3UKOA 1WP9A 5SICE 4YASA 4EB0A 4RDIA 4O0LA 1SIOA 1LBSA 4KYTA 3WA7A 4GUAA 4R83A 3VPGA 2RONA 4WXPA 2DLDA 2JGLA 3OEEA 5J1TB 4ZPJA 1KSHA 1UMDA 3G49A 4N5NA 4OH1A 2EW8A 2P62A 1NLUA 2H5LA 4DR2B 4Y67A 3B6JA 5DEOA 3WLKX 4D9EA 5M2QA 2Z3VA 1TZBA 5FEMA 4QQFA 3JW8A 2WSMA 1W44A 1EG7A 1JDBB 1NTRA 1JFFB 1VKNA 2HMSA 2PANA 1Z0UA 1QK3A 1ZINA 2DH6A 4BJ3A 3BMCB 4RIGA 4L5IA 3TLJA 3H7AA 4CG0A 5ES4B 3KQMA 1ODKA 4HLCA 1E60A 1VG9B 2EFGA 2AH5A 1SH7A 1KFJB 1ZJJA 1N92A 2F1JA 2I99A 2NTEA 2WU8A 3F96A 4TUYF 2Q50A 1M5TA 4E11A 5CDUA 4C4SA 3IVGA 5EXEA 4IIGA 4D5EA 1OF1A 3O6VA 2HHCA 2D62A 4EPTA 3FF1A 2WSSD 3ED1A 5J4LA 3AINA 2P2GA 1FMFA 3UKJA 2Y27A 3A9UA 2B9EA 5JT1A 3F3KA 4O08A 2PN1A 2YIVX 2ZQYA 3L9WA 1U2DA 1DTEA 1TQDA 3GLHA 2RGBA 1XZMA 3H18A 4PX9A 1QGOA 4AROA 5ITZA 2CLSA 1NP3A 2UUOA 1I6MA 3K2BA 4AZTA 5HK9A 1PV2A 1WZ2A 1SVIA 2PS1A 3O73A 3U3MA 3IUPA 1G42A 2C92A 2FYTA 5IVPA 3CE9A 3TMAA 2GPNA 4X1KA 1TEZA 1RC1A 3VZPA 3FI9A 2JVKA 1XTIA 4B43A 4B6JA 2E1RA 2AI2A 3Q87B 1J07A 2DFNA 3QRWA 4DV1B 2SBTA 3LT2A 2OBXA 1A7AA 1QVVA 2WF8A 3RLIA 3IIKA 1QHHB 1T0PA 2FPUA 2Y1WA 4C3OB 4K2AA 2KJQA 2Z2XA 1BCRB 1NE2A 2H29A 3HEMA 4U9UA 4PYMA 5K0TA 1YS9A 3GJ3A 4F21A 4MS4A 1A5AB 1BVRA 4TLDA 5G4LA 1QDEA 3JWHA 4MTLA 1RP1A 1VYHA 5BRNA 1PJBA 1WDLA 4YJGA 2H0RA 1QK5A 3WB0A 3AVPA 3EASA 4ND6A 1KFCB 4NCJA 2FXIA 4R01A 2XLBA 4FOSA 1DFIA 1MB0A 1FFDA 2IDMA 1DBWA 5AKZA 4BDTA 4A82A 4RF5A 3GD7A 2HXSA 3UFXB 1YONA 1UKZA 5EESA 3NIDB 3N8DA 2ZWMA 5HBRA 3JASA 3JY6A 1BOOA 3PNSA 1BMDA 3JWGA 4HX9A 3L93A 4B4VA 1VI2A 2Z3ZA 3G2IA 3L7BA 5A05A 3OU2A 1I5EA 2ERCA 2Q7DA 4C4ZA 3GLHE 2Y93A 3NZEA 3V34A 4R8SA 3WHLA 4L7QA 4N82A 4UAGA 3W2HA 1LK5A 2CHQA 4ZHSA 3OQMA 3Q7IA 2FQYA 2PGNA 2D3WA 2ROQA 4NR0A 3OHPA 4JNKA 4OK3A 1EWRA 2OZVA 1O54A 1TCBA 4TM8A 4H1UA 2RG7A 4YRIA 1ZCAA 4HGNA 1QRUA 2DQYA 2HF9A 5GGYA 4EAAA 1LBTA 1J0XO 2R5FA 4MJ3A 3ZIAA 2PSDA 5EJ6A 2P35A 4IIUA 5KVQA 1XAGA 4BNDB 1ULTA 1B7GO 2JEYA 1SVWA 4JHLA 2VTDA 1NX6A 4G65A 1BX3A 3DM5A 3QOYA 4NESA 1DFGA 2PGJA 1RWXA 2XNDD 5HBGA 2GCEA 4RD2A 5BNWA 2PSSA 1ZXLA 2YDXA 1NPYA 1Z15A 3JQ8B 3PNOA 4X54A 2IXDA 1YBHA 1EFVA 1WEHA 2DY0A 4R84A 2FEAA 1TKBA 3KRTA 3SICE 1L5OA 4KQ9A 3C5WP 3GXBA 3LH5A 4JNCA 1AS3A 2CWDA 2QQ0A 1G8JA 4HMOA 3OBBA 3X2FA 3H6HA 3LKBA 4OA5A 5A7GA 4WNIA 2VXOA 3PQCA 4F1KA 2WIKA 3KOMA 3W05A 4PHFA 4KXUA 3ABOB 1DU4A 2FPRA 4UVEA 2EZ9A 2NYRA 5HTOA 3UEOA 2AZMA 5GONF 5KYUA 4GC5A 4XWWA 4W9NA 2ZJ4A 3PNMA 1WSWA 3RU7A 4CTMA 4HDNB 1GSIA 4GR5A 2ZYUX 2WUEA 2O52A 3P94A 3UOWA 5C3MA 3O8QB 4DCOA 5MHTA 1FRFS 3OTIA 1JI0A 5E1BA 3CLUD 1MVNA 3RJZA 3USZA 4E70A 2PSJA 4EG0A 2DBVO 4KFTA 3LUDA 4Q05A 1HT3A 5B6PA 5CFMA 1XZKA 2ZU0C 4EGAA 4EUNA 3JQBC 2ODBA 5BUSA 1HDIA 4RVHA 1P39A 4HNRA 5FR2A 1BDJA 3GRYA 4WINA 4FDTA 1TVCA 2BR5A 3GLVA 4D6PA 4DCGA 1E79D 5TF0A 4E33A 1P2BA 5IU6A 5C4GB 5AMXA 1Y6FA 4KN6A 2GN2A 3H5OA 5SZJA 3W0LB 3D3QA 5JHHB 4JI2B 3NAGA 4ENRA 2GYYA 3AHFA 1KXJA 2HF7A 2HA3A 3RTDA 3LPLA 1CE8B 1XNQB 1JHYA 3RAGA 2IGBA 3KCQA 4FXOA 1FP4B 2ODWA 3OZ7A 4H08A 5IC4A 1RMQA 5FHRA 4CM6A 3UCFA 4TS4A 3MTQA 1T1EA 2VXYA 4LY6A 3D8SA 5L3RA 4Z0PA 4EITA 1XEAA 2X2PA 3CQ9A 2AI1A 1C3EA 3NR2A 1A8HA 4YA6A 1EP1B 5CA1B 2VDKB 3QYFA 3W9UA 3H16A 4K6KA 3KZMA 4K3VA 4Z2YA 1H2WA 1G291 2FPKA 3TECE 1T36A 5JAZA 1C9EA 3GVPA 5IAKA 3L7IA 1FA9A 1LI7A 1TJ5A 2D00A 2ECKA 2QVGA 1JHDA 1XRRA 4J2HA 4M53A 4YMUA 5I9IA 1AF4A 1FYWA 2GBFA 3ZJYA 1NI5A 1N2EA 5BYKA 1XHLA 1IXZA 4RORA 1I2AA 4RH3A 3R7AA 4AG6A 3QNMA 4D3FA 1NW9B 2GAJA 3JWJA 4MWSA 2CMDA 2NUAB 4IOJA 4ALLA 2H6EA 4UXJA 4IGKA 4ZO4A 1Z6AA 4MI3A 5EJGA 1GKLA 5FNVA 1UC5B 3R9XB 1V2HE 2WPNA 2HPZA 1Z2DA 2IS2A 4U9IS 2PWBA 3KZ1E 1OJLA 5A1JA 2FSVA 2GNPA 3BMNA 2JAHA 4Z4GA 1T2DA 4Q15A 3GA0A 3D2AA 4HJRA 4I99A 3WYNA 5HRAA 3O4GA 1G8GA 5CXSA 2W2QA 1SCUB 3LG2A 4MAFA 5EMNA 2R1VB 1T2UA 2E4ZA 2W37A 3CG0A 4HL6A 4LQCA 2I6FA 3LLSA 1O6GA 2M1XA 3IVXA 3PFIA 4I1YA 4KH1A 5JPIA 1XVTA 2Z4SA 1G7SA 1WVGA 1WNTA 2R00C 1JIKA 1KDYA 4AN1A 5ABPA 2ZZNA 2RMKA 1F2UA 1G5HA 4KTVE 5DCYA 3LUAA 3LTNC 1OFTA 4CT4B 4F38A 4A8HA 1A4RA 2C9DA 5JRJA 1PJRA 1REQA 1SOAA 2Y0CA 4BXOA 5C8YB 5JSFA 4UKDA 9ABPA 5C8YF 2JFPA 1BZYA 2FWNA 2PKCA 3PA8A 2QL5A 4CIXA 3C4QA 1DEOA 1DEKA 4L74A 4GMGA 2ZB8A 1F2DA 1NASA 4HVLA 5IAOA 1AQ6A 1PL6A 3LA8A 3AVXA 4F3NA 5AVVA 3FIUA 4EHFA 2QMYA 1U2GC 3Q7QA 4ZJYA 1W48A 3NORA 3ZWQA 4EW1A 4BO0A 2I66A 4HNHA 2J6IA 5K0JA 2Q5IA 1OWLA 2Q4DA 2QT0A 2GERA 4I2VA 1GHTA 1NU6A 1PR4A 2CD9A 5CDYA 1ZONA 1BX0A 3CGGA 3T9EA 1X1EA 1I14A 4CMKA 1JJIA 3THXB 2ZAGA 3KS9A 5JDIC 5I7AA 4BO3A 1E20A 1K27A 1Y1TA 3FNFA 4ZEVA 1ZCJA 1U1IA 3TFOA 1OHHD 2QGZA 2WUWE 2I7XA 4GI3A 3TQOA 1QZXA 1YUNA 5D8DA 1D9ZA 1QOZA 4INJA 2EQBA 4FFDA 2WSYB 2GXUA 4EG8A 1CUJA 4BFTA 1R4NB 3AERB 2BHTA 2A8YA 3QUAA 1WHTB 3TQFA 5J1SB 4A91A 1DC7A 2R11A 3GH3A 2W90A 4U0KA 3OO1A 2QG4A 3HNOA 3V8VA 1GJRA 3ETEA 1FTWA 1MEJA 2AZDA 3OZUA 4K03A 4OI4A 4OQDA 4Q7QA 3WVNA 3TBHA 2FG7C 3FE2A 2R66A 5FPQA 4JI3B 2YQ5A 2UZ0A 2CEAA 2J46A 3GEEA 4K28A 4ZRNA 1NR7A 4AQ7A 4PM4A 2H0QA 5SZKB 1N2XA 3WIOA 5IT4A 5AM5A 1RXIA 3EQ6A 3OMLA 1T3HA 2FW7A 2AKAB 3DXXA 4ANFA 4WXRA 4DCCA 1KR2A 3OZXA 1EUCB 1Z7EA 2HBYA 4C06A 3MWLA 4PFJA 1PWXA 1AUPA 1GV0A 2QZ9A 3QVGB 5DLDA 2JK0A 1GLVA 1ZN2A 3NI2A 2ECQA 2EGHA 4IQFA 5THXA 1ZHOA 2NUPB 3R74A 4XEHA 7REQB 1A82A 2I7DA 4EP1A 4UQOA 1YACA 1S5PA 3KEFA 1KZ9A 3R7WB 2GSWA 3HVIA 3NKLA 3OIFA 3MOGA 4N54A 1A77A 1FJHA 2EGUA 2YFYA 3RREA 1SJ9A 4CIBA 1I0IA 3GC6A 5IBQA 4AKHA 3ZVMA 2Y2VA 10MHA 4JU9A 3EUAA 4XE5A 4K0KB 1U04A 1G98A 2WEKA 3EAFA 3HKEB 1DJNA 1WKBA 5JH7B 4KOAA 1Y6QA 4GBGA 3MWGA 4IO0A 5JH7F 1JIUA 1B6GA 1KDRA 4UBNA 2DYKA 4CL8A 2IGTA 2XUFA 3HZOA 2AOXA 2G1PA 1KWKA 4PYLA 4UD6A 3FUWA 3VTKA 3FH0A 4N0MA 1SRQA 2BJVA 1ATIA 3ANMA 2ZRFA 3L0BA 4YY3B 2QM0A 3DYVA 2FHSA 1IQRA 2OAP1 4L0MA 2IHYA 2XADA 5CU7A 3PSHA 2GYUA 2HCBA 1TVKA 1TAUA 1EVJA 2PUVA 4IEFB 4MV6A 2AOUA 3PGMA 3ZLVA 3EFOA 2HDOA 5F3DA 1RP7A 3EYWA 4ZAZA 5IARA 1NWHA 5A02A 3GBVA 1V9CA 4E32A 3FWHA 4Q1DA 2FUG6 2AFHB 5ERYA 2QVLA 1VSTA 4HEQA 4O4HA 3KQLA 2GM9A 1GKYA 1U2QA 4YYEA 5GVSA 4C9BA 3IA7A 1XU4A 4P83A 3ICWA 5A9RA 4GEKA 2VVTA 3QTBA 1DTSA 3E05A 1L7EA 1MPTA 1FP2A 3FROA 2P1DA 3A4MA 1A2KC 2PMBA 3W2IA 2GJ4A 4UBIA 1G8AA 4EVIA 3DO8A 2OV1A 2LR0A 4WXEA 2O2DA 1ECBA 4R2IA 4GI2A 1IY1A 2YV3A 2JFVA 3UENA 1B73A 2A1UB 1DHRA 1YL5A 4HZUA 1XXHB 1GGVA 3AU8A 2VKTA 2WJAA 5E0KB 3GRKA 3KT3A 3EPRA 3MS4A 4NBWA 4WZ6A 3ZEAA 4JR0A 1G55A 1W7AA 3FSRA 4KQMA 2VR1A 2BVNA 2OOKA 2VRBA 1EQAA 2X7XA 4Y7DA 4LOIA 3QHPA 4RLSA 1NJSA 1Z4JA 3BG5A 2WVJA 3DVAA 1TO6A 3FFAA 4KQIA 4X3PA 4A0SA 3CVYA 4OX9B 2XTMA 1L1FA 4BJ6A 3U61B 1FC0A 4BUZA 2JG3A 1WCIB 2XYQA 1KH1A 2XZTA 1NQOA 3AOGA 4HN2A 4XTCS 2CJYA 3GI1A 1KEEA 4B3SB 1E98A 1JDJA 1RW4A 3I92A 4RV9A 5HG0A 4B33A 3C1UA 5LA6B 3D0RA 1Z4IA 2XE7A 2D1FA 2OTCA 2PVCA 4OP1A 4AS1A 1GZDA 1IOVA 2GN1A 2I80A 1UAYA 3I83A 4BVGA 2J4DA 3LLVA 3I73A 5CW1A 4D25A 2OV2A 2RG1A 2FX2A 3DPIA 2AIRA 3IP5A 4QPPA 2XCLA 3BM5A 2JBAA 3I28A 2VP0A 4GM1A 1EFLA 1R0ZA 2C7GA 3EG9B 5FULA 3MF4A 5KVAA 2WHPB 4KACA 4LVOA 3RFCA 4KPYA 2BFAA 1FRNA 4K81B 1J2JA 3Q3GE 3TDKA 1RYBA 3SM3A 3BGIA 3DLTA 4MKZA 1OLXA 4RPGA 3VH2A 4CFZA 4X65B 3K0FA 3QIAA 1U1FA 4NOLA 2DFTA 4LWPA 2AC2A 4HQ6A 1BOFA 2NLOA 3HYSA 4LZNA 3WTCA 4IIBA 1N3BA 4XYLA 2ZUCA 1BWRA 2JARA 2VAXA 4YR7A 1UP6A 1W19A 3EXFA 3GRZA 3JWEA 3O8OB 1IAQA 4G1EB 4PZDA 4RLQA 4MW9A 4X85A 5A3RA 1GTL1 4HGPA 1ISRA 5JZBA 3JALB 4JZKA 4XGQA 3UAWA 4YEDA 4E12A 4MS3B 2ZTUA 2Q3EA 1P0PA 3QUQA 2CHFA 2ZDQA 5JRDS 1KHTA 3H4MA 3ACBA 4FFSA 1EAMA 2K2WA 3MC1A 4GHWA 3OZGA 5TE9A 4PSKA 4B3DA 1R9GA 1M74A 1QDUA 3PFBA 3IPAA 4J29A 1FQJA 3EGEA 4U5QA 4E46A 4WN9B 3DHWC 3VAZA 4YT8A 3A2MA 1E5TA 2EF1A 2QAGC 5JZVA 1VG0B 5K2OA 1V3TA 1EINA 3U6BA 1BTOA 2Z43A 4FHZA 6Q21A 4ZZ2A 3NG1A 1JQ3A 1XZBA 2HA0A 3UW1A 1QO0A 2BSQA 2IX9A 1Z6PA 4MR7B 3SSNA 3ZNQA 5IJXA 3M1YA 4BNKA 3JYHA 4FFLA 2YX1A 5ECYA 1EA7A 4CMJA 4FSXA 3PRYA 3KD3A 1U8EA 3ER6A 3ECAA 5LZ4A 4LVUA 4PHHA 3WNCA 2ATIA 3N2ZB 1SCKA 3NANA 2VN8A 4MUBA 3OZBA 2X5NA 1KO4A 4XPIA 4BVAA 3ZYCA 3L4JA 2WIDA 3JQ9C 4HX5A 4G0VA 2H11A 1SHKA 4YGYA 2Z5GA 1YAJA 1HYQA 2QIOA 3BSFA 1K8XB 1VBFA 2A1IA 2JA1A 2XB4A 4JT4A 4MKHA 3BORA 3AI2A 5DYGA 3L6CA 4AO8A 1BU8A 2I2DA 2VSNA 4BFXA 5FBRB 2W6OA 4TSKA 4FMDB 2VK2A 1FTSA 1QMGA 1J5EB 1CKEA 3GGCA 3QITA 1H2RS 3FGPA 3PK0A 4UCXA 3WLIA 2PR7A 3DEKA 5KOHA 2ODPA 2K87A 2UU9B 4G0UA 1ODJA 1IJEA 1ZC4A 2Q1YA 2WDPA 2VPQA 1JZSA 5F73A 2D2FA 4KIWA 3WQQA 4Y2QA 4CIVA 2PL5A 3OOJA 3FJOA 3O1HB 4LRWA 3T12A 4Y3UA 3EXHC 4OB7A 2BI8A 2X2FA 3NPMA 3PE3A 4L28A 3UM9A 5FCDA 3UWDA 2ARKA 4D9BA 2XRFA 4FC6A 3C7AA 4IUDS 4LHEA 3ZH9B 2RJOA 4JWTA 4ZYUA 4JLWA 2D2EA 4RFSA 3TW6A 4KE7A 3BOSA 4DREA 4RVNA 1BRMA 4KE9A 5C31A 4YRTA 1F9AA 1Y98A 5BYAA 5C4IA 4Y2XA 4LMRA 3ITNA 5A9SB 5B30A 3K96A 4OBXA 4JENA 3IILA 1WXIA 3A7DA 1BDBA 2B1IA 3WTBA 2HJWA 4E5DA 2F8MA 5IBRA 1Z4MA 1OGIA 1G8YA 2ZRLA 3N7AA 5DK6A 2DKNA 2ZJ0A 3A1VA 3GJ0A 1DAKA 4JC5A 1Q0QA 4KXYA 5TVGA 4OMFG 3NWOA 1HFKA 3OHSX 1XALA 4MW1A 3BEDA 3CJTA 3FCYA 2OGWA 4UM5A 3ROEA 3HXTA 2AYXA 2IT1A 3NTOA 3Q2KA 2XBUA 3QSGA 3V48A 4DDTA 1Z6QA 3QE4A 1VIVA 2JDIA 4CKWB 3T5GA 3O4IA 3M82A 2SICE 3NBMA 2GBLC 4QZVA 1RWMA 4IDDA 1NUHA 3CNLA 1L1RA 1CVLA 1ECJA 3L6EA 3W5IA 3P45A 3MHTA 2QSUA 3TIXB 2GLTA 3Q3IA 4IHJA 3GJQA 5CLHA 2VXCA 3U3JA 5E4FA 2PNFA 3CV3A 1PIWA 3JWPA 4AY3A 3HJNA 2AHOA 1QR6A 4EGJA 5KTMA 1T4DA 2JGAA 5TPWB 4BTVA 1W36B 4KR6A 2X8WA 3UANA 4PZ9A 3L7MA 3PGA1 16PKA 1DO0A 1JSCA 3BIXA 4BMPB 1XRQA 1JFSA 4QFCA 3D64A 5DHPA 1NV9A 1X2BA 4MRMB 4N4AA 3PPIA 3OM0A 4EHDA 4CM5A 1DBVO 2ZKLA 1BDIA 2QJTA 2CNWD 1LSSA 1N2GA 1YDMA 5CJ2A 4ZU1X 4ZXFA 5KQRA 5AVZA 1E18A 4JBLA 3SEZA 4OUKX 3BDIA 1FDRA 3I9FA 4MZXA 1ECCA 5G4KB 1LBHA 2VAVA 4JY7A 2I78A 1M75A 2QUIA 3F7OA 3OUUA 3Q7PA 4FNMA 4QQKA 1QIMA 1G18A 1VDZA 2BGIA 3D8RA 2DWCA 2WIGA 3RFUA 3QZUA 5CDGA 2ZJBA 2X13A 1QC5B 3CFYA 3G3EA 1ZEJA 3CNQS 4HFMA 5J2TA 2V3WA 2RGGA 4MGIR 2WAMA 1IZ7A 1I24A 4BO2A 1L8QA 2BE7A 3CEJA 5HJ5A 4H31A 1DO8A 1PT6A 3L05A 3TQHA 5C9ZA 4AD8A 1ZJYA 2R97A 3VBEA 3AEYA 4E0BA 2NO5A 3UNXA 2IYOA 3CZPA 2GZ1A 4XYEA 2OVBA 2H85A 2IK8A 2JFBA 3GCGA 3FFBA 2AF4C 3BXEA 1C9JA 3KDSE 3VGPA 3VH1A 5CBPB 3HO8A 3C8MA 3ZY4A 2OGUA 2WYVA 1D1PA 3AFNA 4IIVA 4OLAA 1J0EA 1FBNA 1H2EA 2RHMA 2WIBA 1IONA 2K6GA 3MFYA 4G5RA 4N3BA 1RPZA 4OKSA 3OJWA 3KEOA 4NS4A 4YJ3B 3LI2A 2PHZA 4B0PA 4OH7A 5JJBA 1VQ1A 2OHIA 1QH8B 4QC2A 3IT1A 3V4FA 3O1IC 4RD6A 4R51A 1LDEA 1Z26A 1DKUA 3AI1A 2BEVB 4GP7A 3IFSA 2QJWA 1SRRA 1STOA 1Q3TA 1U8FO 1UDBA 1YH3A 3D7KA 4JC0A 2BR4A 4Q3OA 1OXXK 5HIJA 1GXSB 3QMVA 4YJ2B 1ZAYA 3FJYA 1J8FA 1WW2A 2PZGA 4MJXA 2OD2A 1QIHA 1XEXA 2G3YA 2P5TB 3A36A 2BYTA 4CEIA 1EMDA 1XTTA 3HCPA 3P2OA 5FQOA 1CRLA 3RJMA 3ZS8A 3P2EA 1TA9A 3QVLA 2CL0X 4MH0R 4BGDA 2IEBA 2QLMA 1FLAA 1PQYA 3KSMA 1CUEA 1R1DA 3BJIC 4LGYA 4ZQEA 1V71A 5ADWA 1U5BB 5KJCA 2G9RA 1H2ZA 4K9SA 1U9IA 3WLSA 4ENTA 1ADGA 3IV9A 3D4LA 4EPXA 3OU7A 4HPJB 3AM4A 2WA2A 1CR0A 3CF4A 4NV0A 3UJBA 3NWEA 3O4HA 5JCXA 2VTKA 3CPHA 3TLGA 4Y2RA 4QGFA 1D7AA 1ZEMA 2PX2A 4HYTA 3TOCA 4CU5A 2QSJA 3VR5D 1S3GA 1J2TA 1Q1NA 2XA1A 4U6SA 2PZLA 4IQ8A 1CQJB 3OSZA 1H5NA 4R9NA 4PIVA 4PNHA 1A69A 3N05A 2X0NA 4BNHA 4OF4A 2H8KA 1PNRA 2FPSA 2KPOA 3N8NA 1N0WA 1ZNYA 2HRDA 4B0OA 2XGGA 1VL1A 3AI3A 4MPDA 4MYRA 3OPMA 1W5SA 1VCNA 4N8EA 1P1FA 2J0UA 5COAA 4RK7A 5AHKA 1LPBB 4Z9BA 4E30A 5LQKA 1QKJA 3HYTA 1T9CA 5KTTA 4I08A 2BKAA 4Z8XA 4YX9A 3K92A 1W4LA 5KHAA 3H87A 1HZZC 2FSGA 3L8MA 1KS9A 2OXEA 4FYHA 4N6NA 2WWFA 5F5XA 4C6RA 3COSA 3QF4B 1JVSA 1MIOA 1VGRA 1J0DA 1M2OB 2PUDA 2F8TA 1TIBA 2XOEA 1P0MA 3SFTA 3P8ZA 3QEMB 2XVMA 1VLJA 4MR9A 1I5OA 3RT9A 4E22A 4HB0A 1F8XA 1LC0A 1NDHA 1SUEA 2PRKA 3H42B 4IF4A 5FB3A 5KCMA 5SYAA 4MV4A 2A5DA 2VK4A 3RF6A 1J1ZA 4CNQA 1QAQA 4HSEA 2GEDA 1UM9A 3KZNA 4G0PA 1T8YA 1W46A 2JD2A 1HT0A 4QRIA 5H0IA 3RAFC 5DWQA 1QX3A 1EIZA 2N9UA 3ACDA 5CD9A 1QGDA 2GUWA 1HE5A 1OPXA 1KPHA 4OJMX 1XRPA 2EL7A 1EZZA 4X6LA 5JVDB 2W43A 2PYIA 4D1YA 2QTMA 5ALYA 5KKNB 1AHPA 3U4QA 2OCDA 2LPMA 1ML4A 2PZFA 1T9HA 3QFSA 3SC2A 3OX2A 1BCSA 1XKXA 4J0HA 1BS2A 4RBNA 1KJQA 2QTVA 1DWOA 1PG2A 1GUAA 1LPAB 3R8XA 4UQLA 2HR1A 5C5CA 2RAVA 2Y1DA 3SVZA 3WZLA 5WRFA 1ZI8A 1JVNA 3ONWA 1QLHA 2Y6UA 1WZIA 1AHHA 2PLRA 1KI8A 1RTKA 4DV0B 3DR5A 1Z73A 4TTJA 2Z04A 1JL3A 2GEBA 4WKNA 4EYGA 4X91A 3ZY6A 1T3LA 5I4BA 2Y1GA 5H70A 5HFAA 4WXYB 4XFDA 2OR3A 5HW0A 4ZK2A 4HSGA 4R31A 3SR3A 1LDYA 2VRNA 4IJMA 1I33A 2W2KA 3RUIA 3CEAA 3T3NA 3G2LA 3OPXA 4L1KA 5IAJA 2AX3A 3TLZA 4PZUA 1Y4AE 4O2AB 4KYIB 4ADSG 4L5JA 1MG0A 1MAVA 2EBHX 1YGPA 5JQGF 1C5KA 1VJGA 2DGDA 3HB4X 3HYLA 3NALA 2M32A 1TRKA 2PQMA 5HDQA 1FNMA 3ML1A 4F4FA 4RMGA 2QD2A 4BO5A 2HHAA 4EKYA 3NDBB 3RVRA 3OFSA 2OPBA 3AEUA 3P0FA 2OLJA 3SFZA 2KYRA 4B6FA 3AL3A 4PQEA 5CH3A 4F84A 3I2KA 3OTHA 1JILA 5ICSA 2JD1A 2QL9A 3U13A 3RWOA 5KOJA 2B25A 2EBWA 2KLHA 2ZYTX 3GARA 3OEHD 4P81A 3G1TA 4PO8A 4BDSA 2D0IA 4I4IA 3TQQA 3KXIA 4ZD6A 1H8EA 1MMFB 2J5RA 4KWHA 1Z74A 4LUCA 3RC9A 1XDBA 5B64A 1JS1X 1AJEA 1JAHA 3L4KA 2IF2A 2Y05A 4NMHA 1G20E 4WZAE 3SS9X 3W90A 1V8OA 2CN1A 2HLHA 2R8OA 4JYPA 4KVZA 3WICA 5DNWA 3K05A 3DAGA 2OHGA 4PSAA 2YBEA 3W8NA 1ACJA 3CLRD 1XO1A 4GGOA 3DMTA 2A3NA 1QYVA 2C2YA 4UAVA 3UK0A 4MQ5A 4ARAA 5BN3A 3FTEA 1F6BA 2DWQA 3V4OA 4KKXB 5EJ9A 3C3KA 3L8CA 4C08A 1R18A 3EA4A 3MFQA 2RHTA 4NYMR 1SU7A 3DA8A 5IW8A 5UKDA 2E85A 1PAUA 1KY4A 1YC5A 3IEXA 3PXDA 1SULA 1YBMA 4MDHA 1RYDA 2DB3A 2VSFA 2V7TA 3Q40A 5IH3A 2FAXA 4H3HB 3PVSA 4Y0VA 4M7PA 5EWJB 3JQPA 1GZ4A 5LC1A 3SBXA 3TZEA 3VC1A 4KWTA 1N3YA 3REOA 2NOAA 1K86A 1ODTC 5F64A 1P2UA 1E2PA 2NUBA 3R3JA 4MUNA 3SX0A 1JIJA 5KHLB 4GVPA 3L7NA 2FWMX 4KIJA 4XWYA 4EUHA 2PGOA 3T99A 1QHYA 1NBOA 3COYA 3ZCTA 4JB0A 4ER0A 4FMCF 5HE9A 5GIPE 5K8TA 1KK0A 1BJKA 1L7NA 2PSEA 5K2MA 2AJTA 2QT9A 4JEUA 3I32A 2CY0A 4QRHA 1YR8A 3TYXA 1LA2A 1YIOA 1UQTA 3IJRA 4REMA 1JAXA 3DL7A 4RMNA 4UNNA 3D4IA 4HCJA 4XVHA 4NFLA 4WK6A 3SEQA 4CF4A 1KMIY 3I2FA 3L07A 4JUIA 1QNFA 4P7GA 5GMOA 5KSOA 2XODA 4EWLA 1LVHA 3H9GA 5F7XA 3K0AA 4NL4H 5DSZA 5DGXA 1A8QA 5C5EA 2WHEA 6NULA 4LWZA 5I5GA 2HJRA 1K6MA 1C4XA 3VUFA 3EGXB 5I9TA 2FDCA 2BWJA 4FCTA 2GS9A 1A9OA 5LD2B 1W88A 1W4BA 1D1SA 1B0UA 1XTSA 5DNVA 3ZE1B 4XOUA 1IN4A 4F4DA 2OKCA 3Q0EA 3C3AA 4QTTB 3USCS 4TX1A 3SXUB 4E2WA 3KXLA 3DQZA 3FWNA 4QUHA 4JQCA 4QE3A 4NRDA 4EY5A 3IUQA 3VGJA 3PC6A 2C84A 3ANNA 4K6MA 1B3BA 2ZWIA 1M6NA 2Q3HA 3M4ZA 4M87A 5FPYA 1SQ6A 3T38A 2HRCA 4ZQGA 3CUEF 4QATA 4X6YA 1ZJ4A 1SIUA 3A6LA 2WABA 1T8SA 4L85A 4NEQA 1GFSA 3D5TA 4Q4JB 1Z5NA 1XLVA 1SHJA 4Q9AA 3U4IA 4I4CA 2B3TA 1FNBA 5HJEA 2ORED 3LBIA 3E9ZA 4QYXA 3AP2A 2W2VA 3BQ9A 3PPYA 3WGGA 1A96A 2HPAA 5AW7A 1H2YA 5CGZA 3S0JA 5AHXA 4NATA 1FBTA 5JJ5A 1GARA 4JBNA 1V8PA 2YDYA 1E7YA 4FIDA 5KQMA 1FNNA 2KHZA 1LF0A 2VYQA 1DWPA 4L6AA 4IXDA 3WV4A 4DLNA 3FCOA 5FPTA 3NC4A 4V3BA 4GOND 2KI5A 4QFBA 3RJ5A 5HEKA 4BIIA 1QGZA 4BY9E 1BMFD 4D82A 3OTGA 2NZXA 2H0AA 2IOFK 1QVZA 4JYAB 5CW2A 1B6SA 3QKRA 4K8OA 5AIBA 3GIWA 3TLXA 1IIBA 4GKJB 1UL1X 2Y8EA 3HVKA 3IPLA 5U4QA 4HD8A 3D6AA 2JCGA 2E18A 1CR6A 5D01A 2NO1A 5HWSA 1CJTC 4TKLA 4PRZA 4WUTA 1CUXA 3D8BA 2G6BA 3ECCA 2PCJA 3FWYA 3HA5A 3U3RA 3WO0A 1E2DA 2VSYA 4U2DA 3CNBA 4PS1A 3AILA 2ZZMA 1RAIA 1IPFA 3B9BA 1T8RA 3IMFA 4NKRA 1SBCA 1ZXXA 4RELA 5J5CA 4D0GA 1LNQA 1NSYA 1PFWA 1YR6A 2D5AA 2EJUA 3REQA 4L3VA 4I8DA 2FCRA 4AMZA 1P0CA 2VHYA 4ZT7A 3A10A 2CL7X 2ZRGA 1MABA 2JAPA 4Q1AA 4XI9A 4XEUA 3ZH2A 2VA8A 3H5LA 2RI0A 3GCDA 3IP7A 1FFWA 2WOJA 3K0HA 4FB4A 1OREA 4RTJA 3SZMA 5ICEA 2LZ0A 5FPHA 2IP1A 2WWWA 3L6RA 3JPWA 1XA3A 3STTA 5HVNA 1GY8A 1PV1A 1DCMA 3UTCA 4NBKA 2AB0A 3QPWA 3VNAA 4XLZA 4MK4A 2G9ZA 1XV5A 1QOPB 5C8XA 1JA0A 1E2KA 1HBJA 3PS9A 1HWYA 4BECA 3ITEA 4EY6A 4ECEA 3RT7A 4JKIA 5BV1A 1P2VA 3QWIA 3FETA 2OO5C 3PDWA 4EJSC 2WTNA 2HMYB 3WIBA 2VYVD 1SZCA 4YDSA 3TTYA 4D6XA 1AZTA 1T25A 2WJZB 3KFXA 2QN3A 1MEEA 3KYCA 5CP8A 1U8CB 3JQFA 1JQKA 2XZPA 5AUOB 4QHSA 1I1OA 3IUYA 1HMYA 2XB2A 4M54A 4YAFA 4Q1CA 3RYTC 1B1AA 1XTRA 4M0PA 4K86A 1CHDA 2M2IA 3C3CA 3RC8A 3AZPA 3DZBA 1S2MA 1IM8A 2YNMD 4WT7A 4FS3A 2QRLA 3WMWA 1V5GA 4NOJA 3HGMA 2EERA 2H59A 3I9LA 1JHXA 4ZV9A 1FFEA 3CE6A 2PL9A 2XDAA 5FPKA 7AT1A 3P5SA 2IZZA 1VHLA 4TVOA 5ALQA 1GGKA 1BQ3A 5TVKA 3FMVA 2JLRA 3L4BC 5K0NA 1T5LA 4K05A 1V5WA 4LTDA 3EXG1 2ZI5A 5CNKA 2O2SA 1Z5GA 2OD7A 3K5PA 5DDIP 2E49A 2Z6QA 3FYUA 4FFBA 5BUCA 4L73A 2BAGA 2VT3A 1Q95A 2PBFA 3FFTA 3VJLA 3G7UA 3LHFA 3QGMA 2UXCB 1VGQA 4B2LA 1AV7A 1CDEA 1HYBA 4IMJB 1IRXA 1NVTA 1X1DA 2REXB 4TROA 3WZMA 5IVHA 1FS6A 1J2UA 4OQEA 2XCIA 1JKMA 5JS2A 3ZR4B 3AL0C 5KEIA 4MTCA 2NSJA 1BEEA 1E6WA 2C8VA 4TWRA 3FCCA 2G9VA 3GG2A 1FFSA 3DULA 3A28A 3MRXA 3M33A 3FDZB 5AKIA 4BP9A 2PE5A 3HU3A 3HSSA 3ND6A 4N7RA 2AS0A 5TMEA 3BKWA 4YAEA 2ZBRA 4XCQA 2A9KA 1WKCA 3AEZA 4J76A 4A15A 1F9EA 3I05A 4LQLA 2FXVA 3ETCA 1YIAA 2MSCB 3FKSD 3WGZA 3PUWA 4Y1EA 5EIBC 2R6ZA 3VO1A 2CLKB 3DLIA 4DMRA 5AW2A 5A4KA 3STXA 4B84A 4RK4A 1DKOA 3R0ZA 4J9VA 3HLTA 4UHFA 2WJ3A 3HVHA 4IXWA 3O83A 3VU1A 2OBMA 2B0JA 3T95A 4F5DA 2X5KO 2FFJA 1YU9A 2P3SA 4G97A 4A1FA 2A9JA 1F0NA 2HIAA 3OZRA 3BJMA 3CM0A 4PRYA 3I34X 1QHEA 1LU9A 4LFBB 3VR6A 3NC0C 2PJZA 2WD7B 4HQFA 3HPQA 2C78A 1K0FA 1QE5A 4NDZA 4MWBA 3VYRB 3GLGB 3PGKA 1Y89A 1R8YA 4K46A 2UV8A 3E7XA 3JTMA 2VCEA 5L4SA 4RANA 5K3FB 5LZ5A 4XVUA 4MPRA 1BW9B 3BULA 1D1TA 1PR2A 2CLOB 4WI1A 1R0BA 4Y1GA 2R7NA 2ZITA 1EP9A 3S1LA 3ROMA 4CKBB 4PN7A 5BPFA 3D8HA 2VRCD 1WCXA 2FI1A 3CIOA 4NTZA 2AQHA 4B17A 2BP7B 4I5DA 3L0OA 4GW3A 2PX3A 2Q29A 1OMOA 1OVGA 3V55A 1UPUA 1TQ4A 2FY8A 3C3EA 3SYNA 3BBPA 1U8XX 3LLMA 4E5SA 1ICEA 4ZEXA 3I6ZA 4YCJA 2DWOA 4H18A 3H83A 1TK3A 1Z6TA 2A5JA 3RB8A 1IOZA 3COZA 3TQIA 4QVIA 1WF3A 3NO4A 1PVDA 5CIWA 2OXRA 1H65A 2NXCA 2ZZKA 5LMNB 1C41A 4HLQB 5K8VA 3LXUX 2DBQA 2QN9A 3E35A 1UPXA 1JPUA 1H42A 4O1MA 4EM6A 4TTSA 2A0UA 2WWGA 1H1DA 3D31A 3L7KA 3HL0A 4JT9A 1IBRA 1T6YA 4DNQA 5A5DA 4XGIA 3TF5A 1JT2A 4J0QA 1AK1A 5FQNA 3PL5A 1V1MB 2JLCA 1C30B 3B3GA 3H0KA 1HK7A 1NW3A 2RHWA 1JEYB 4GPZA 1MENA 1RYNA 4CLOA 3PQ3A 3GOQA 2H2FA 4P0TA 4Y6QA 2QJRA 1CS0B 1ZS9A 2CNKA 2WF7A 3MN1A 1JSRA 1QGUA 1NC1A 3DBVO 4R2HA 2QVZX 4TLMB 3QLUC 2YWGA 4YIKA 1X92A 2COUA 2JCYA 3D3KA 2VHZA 5F9MA 5BN5A 3N0XA 4UXIA 1TECE 3O1JC 2J9FA 3HC7A 5JWRA 1AZSC 4D4GA 2HM7A 4E14A 3AYXB 1VHJA 1UQUA 3E18A 1SXJB 2NV0A 1N32B 2PH1A 1MN6A 4EL5A 1UJ4A 1ZM9A 2QXYA 4JDUA 3T5TA 3JATA 4LPSA 3VSDA 1WW8A 4QJBA 2A0XA 4IWYA 2Q7OE 3A0UA 4E5YA 4G8BA 1SUFA 4MYCA 1CQXA 1SOWA 4HBGA 4NVRA 3FFXA 3SSOA 5GJCA 2AQKA 3BRWD 2WYHA 5H83A 3RRFA 4BBZA 2Q2NA 1CWUA 3E2IA 4Y1FA 2FSHA 3A9SA 1VKZA 1AMUA 3RNOA 2G7MC 1QH9A 1DEAA 2A58A 4G86A 4MKFA 4V2IA 1P0FA 4A26A 2JLUA 4NH0A 3LUJA 4AZVA 3RRBA 5K45A 3WGQA 1QWSA 1MA0A 3DEHA 2EEPA 5BN4B 2IYXA 4LE1A 2ZJ7A 2O7VA 2GOYA 2OYSA 3VZDA 1RQGA 1UKYA 1UT6A 3QBJA 4RDHA 3TTUA 1NVWQ 2WE7A 3HV2A 2ZBGA 2CJWB 4MVJD 3FTCA 2CDCA 3RVMA 5JMOA 5JV5A 3P2KA 3E0XA 5I9NA 2DETA 1ZMXA 1WXGA 2GK4A 4N40A 1WQ3A 3BH0A 4HUQB 4PRLA 1BA2A 5LP6A 1G59A 4KXFB 2O2EA 1NQVA 4EF6A 5ITVA 2D0DA 1I7NA 3N9IA 3IAUA 4QPJC 5KSZA 4GX1A 2YUIA 1KGDA 1JE1A 2X4IA 2XYPA 1M34B 3PGJA 1NUQA 3PYXA 3QBDA 5DK4A 5FORA 5AUQA 1NN0A 1XCMA 3B1JA 3QX8A 3RAPR 3S2SA 3W7BA 3ZV6A 2GZ2A 1G3UA 3T0GA 2WZQA 4GLJA 2XYVA 2ZRCA 4YHBA 4C0HA 2JJ1D 5FTJA 4JAVC 2VWGA 3ZD9A 2I6QA 2GI4A 1Q0ZA 1CX9B 2E6KA 1Z4PX 3KYDB 2WYOA 4G8CA 4GXNA 4IGIA 2Q0SA 4U1RA 4B45A 1CG6A 4IQGA 3W5HA 3HUUA 1UJ6A 1VOTA 2VJLA 2HHLA 1QFSA 5T5QA 3HVRA 2WFZA 3KJZA 5CXQA 1ESNA 2XMSA 4EB3A 3ABZA 4QPCA 5DW0A 5BMVA 5BOSA 2O54A 3UATA 1IQPA 2O6LA 3SM9A 3N59A 1RWWA 2PX0A 4DQDA 1N6OA 2N75A 1AQUA 3I9OA 3UAVA 1SCBA 2ZT6A 4AIIA 4ZTUB 1KY3A 1R74A 1VRWA 4ZI7F 1L7BA 3DDUA 1QLWA 4AZ0A 1MNQA 5BSEA 1BO6A 4CMIB 1AKRA 1XZCA 2QW1A 1JU4A 3AV3A 4QVKA 2QE7A 3NATA 2ZJAA 3UMSA 3W5UA 3EEOA 1IVSA 3TPFA 1LNZA 3HCBA 4AP9A 4D8YA 1HH4A 1J7JA 2O3QA 2BDTA 4ZPXA 2ACVA 1DT3A 1JG6A 2HDWA 4BFYA 5K8LA 1FFAA 1JQLB 1T3ZA 3L0DA 4NENB 1MRZA 1YOVB 1M8GA 1SPXA 1YZQA 3UHPA 3AJAA 2JLVA 3GV0A 5JC8A 1U3GA 2HU8A 4D74A 3SMVA 1GGMA 1CUSA 1Q74A 3MLBA 1RHUA 4UFOA 5KNCD 1RXEA 5DM70 3HY4A 3PZBA 1KMHA 1EH5A 4M7RA 1PEDA 4U7GA 4B6EA 5ED0A 4ZAXA 1SUDA 5KWJA 2CFOA 2IUTA 1OH6A 1U4OA 2R2AA 3MTAA 4D9FA 1FPQA 1UT5A 1RAEA 2H2GA 2KX7A 4XYMA 5F1KA 4ZC8A 1NBME 3WHKA 3ZWCA 1KWGA 2WVGA 3CYFA 3MINA 1KH3A 2FEXA 4R1NA 4RHYA 1NI4B 1ZU5A 3E9YA 4BNTA 4DLRA 4CKCB 3G5AA 2YQ4A 3QEOA 4F9FA 4I4TA 4DPKA 5FPPA 4YECA 1PVVA 3PUHA 1DVRA 3WB9A 3T1QA 1WW3A 4KKVA 5KNDH 3EPLA 4C7BA 1JUDA 3E23A 2C2OA 3FRHA 1VXOA 3IV6A 3PKIA 4M21A 3FCEA 4P7KA 5EIFA 3T7KA 3CGWA 5JANA 3CONA 1XMOB 3BWBA 2EX4A 2O3UA 2GT1A 3K0SA 3RTBA 3HDJA 1RC8A 1NUUA 3S8EA 1BU5A 1OZFA 3CVJA 4YPVA 1HDCA 3GOHA 3TDMA 1ZUNB 4EL0A 1UC4B 2H08A 3LZCA 3F5DA 1DIAA 5EZ6B 1G6Q1 2I2FA 3K5HA 4LXIA 4OUDB 3L9XA 5A5EA 5KNBD 2VF7A 4L0DA 2HO5A 4KR9A 4PO9A 3DTVA 4RVFA 1A7JA 3PHIA 3H9CA 3OHMA 4QFMA 5H3CA 3Q6IA 5BV2P 1FJGB 1YZFA 5JI2E 1IBMB 2IYAA 5TQ0A 3WMGA 2C2ZA 3GFFA 4NCBA 5IFKA 2YFQA 4KPEC 5KYYB 2ZK7A 4LSZA 4Y2JA 4DQKA 3DE3X 4JI7B 2YV2A 1EHIA 1Z4OA 2CXQA 2IDJA 4Z9YA 3GRCA 2CUNA 5EVJA 5CMLA 2R751 3UCEA 2V4MA 5EP3A 1Y9DA 4EGSA 4I1PA 2PH3A 3P9IA 4Q9NA 4L7VA 1QZUA 1TEHA 3MELA 5BPHA 2HK6A 3RRXA 1J9ZA 3G2NA 3NOXA 1Q17A 1RYZA 3PQ6A 4Q4AB 5HMMA 2W4QA 5CXXA 3HV0A 3TEJA 1W9HA 2ZXEA 1Y0BA 3E53A 5I4KA 1YK0A 4BKQA 3KTAB 4NOKA 1A8PA 1AKVA 1L7DA 1QV6A 1O94A 3BH6A 3ZCXA 3GMIA 4OYLA 3NCTA 4QGSA 3C3PA 4HAVA 4CHTA 4TN5A 3GLIA 1AHNA 1Y42X 3QWHA 4RSRA 3SQNA 4M2LA 1IHOA 1FCJA 3QJ5A 3LBHA 4ZOAA 1O95A 2I87A 3B9PA 3BIFA 2UZ1A 2VF8A 2RC6A 1FFBA 2OBFA 4RM2A 1F4VA 1PJLA 3R6GA 3QEKA 5EIXA 3ZGZA 4FUQA 3X44A 3ETHA 1DEHA 1HX7A 4O2BB 4I6JA 4UUAA 2X6RA 4O2BF 2PMDA 2ZBUA 3NV9A 4H7IA 2PH5A 5FUMA 1XI2A 1VSBA 5LSAA 2NP6A 1HE4A 1JG1A 1MJGA 1OW3B 5B58T 1YD7A 3LY8A 4A0QA 1M10A 4A1OA 2RH4A 4BMVA 2OHVA 3MXTA 4L8VA 1FNSA 4XQ9A 5DN9A 1JBEA 1WDWB 1CFZA 1NW6A 2V7UA 4IW3B 4RXTA 3SEFA 5J47A 3HWRA 4XOIA 5IP5A 3AF4A 5AUNB 1XTJA 2IYQA 4FW8A 3ZU2A 2BFEA 4ZOLA 2IPOA 4QFDA 3PFNA 1NLZA 4NEHB 1NNI1 4B09A 2P9YA 3EEYA 1TQ6A 3I37X 3A06A 4L8GA 2RBKA 2C5EA 4CM8B 2J08A 3CSDA 3FPBA 4QDXA 5DHQA 3W6PA 2AD1A 2ZWAA 4YCMA 3IT3A 1CZRA 2ATXA 1LJLA 2V7QD 4YS6A 5DHFA 2ZJ1A 3CG4A 4IKOA 1PYOA 2V6MA 2VHUA 2WJJA 3MWFA 2D2VA 5E95A 4S35A 4BAGA 1O7JA 2HFKA 4YRFA 2ZXUA 4MLZA 1D4ZA 4K1LA 1P7CA 2FGJA 2QR5A 1YQTA 2Q1TA 1XHEA 3IJPA 4LX0A 4G3XA 3U7QB 4OI2A 4CMEC 3SF0A 3IALA 2VJQA 3DDWA 3LKDA 4PZZA 4EA9A 1TM3E 3PEVA 3GLIE 1EWYA 5AVYA 3B85A 4OL9A 3A1EA 1Z6YA 4OLJA 5ERXA 1FLDA 2VG8A 1DL5A 3MD9A 5DLQC 3VTAA 3ZWKA 4U7DA 2J3EA 4LCJA 2FK7A 2ECOA 3RJTA 2XZLA 2IUFA 2V55B 1XWWA 2EW1A 2I3ZA 3L8DA 4BNFA 4YMVA 2YMQA 3RYFA 2GXSA 4WFIA 3GCZA 2ETVA 1BE0A 1ESZA 1JIXA 3O75A 4I2NA 4BVLA 2PD4A 3P52A 1DIHA 2OFOA 4H60A 3OQNA 5K0BA 2PTHA 3GRRA 1SBHA 3IUMA 1OVMA 5TQVA 1D0IA 2VJYA 1O3YA 1GADO 2X8JB 1Z25A 3BWCA 5EG5A 4Q66C 2O8FA 3O21A 3KQYA 1WDKA 2XH8A 1BWSA 1QMPA 5TS2A 1S9DA 1MLDA 3FDFA 1ZLYA 3ESZA 2GDJA 4N3NA 4R0VA 3RC7A 3TSZA 3UJ6A 5AK0A 5J3JA 2XWQA 1W1WA 3CT6A 4KXVA 1WX1A 5AOVA 4YMWA 5DHUA 2RBEA 1C9YA 3I9MA 2IV2X 4Q37A 5A3JA 4LSMA 4KU4A 1M6WA 2AOVA 1WBJB 4QTUB 1ZPDA 3OQIB 3PPXA 4PXYA 2HAEA 2D5CA 4Q5IA 5F78A 1UWLA 4A2WA 5B4TA 1AGXA 4PYIA 2RHLA 2LDBA 5FWYA 4UE3S 5FL3A 2VTVA 1RRFA 3P5BA 4H7PA 2RH5A 1R3UA 3TG8A 2JW5A 3D6JA 3AUKA 2W11A 2MWMA 3R77A 3RF7A 5M34A 4BE4A 1WNFA 1P7VA 1TQ8A 3N75A 3IXMA 4ONEA 3RO7A 4DNXA 3WGKA 2OCIA 3F73A 3PVCA 1XNRB 2ZDHA 3F5FA 3G8BA 1NULA 5F1OA 2HQ1A 2A0WA 3HNPA 3IBSA 3FKJA 3ZJ5A 3OCVA 1RAGA 3BVPA 1IUNA 4FE3A 4EO7A 1W59A 2YXPX 1YVRA 2BGUA 3QV2A 4GRAA 4RK0A 4CM1A 4GPD1 5BVHA 2HT1A 2HIGA 5LPNA 3B8HA 4CN8A 4YT5A 4YCCA 3J81A 2B34A 2FW0A 3HWX1 4D4HA 4TKUB 1Q0RA 4YV1A 3KQPA 1Z5VA 2EFHB 4LTNA 5CVCA 3IYLW 1SVSA 1ZOIA 1A9ZA 2C3MA 4G24A 1H1LA 2F1KA 3K9QO 4AN4A 1DQYA 1II8A 4D97A 4U39A 2PM8A 3WWEA 1ZSYA 2EAUA 1OTXA 3CISA 2PUTA 1U6JA 3EOZA 2AKYA 1F2TA 2GGSA 3QX7A 1VHWA 4UBJA 4WJKB 2MCFA 4EY4A 5F52A 2WIAA 1WD5A 1ESCA 5G0TA 4DGSA 4DMGA 2LV8A 5KX5A 3WQRA 2ZJ6A 3UV7A 3DE7X 2ZBQA 1RPAA 2JJ2A 3PC3A 1T9AA 4TPKA 4EF5A 3UJ9A 1QP8A 5PNTA 4CL3A 2EF0A 3QPUA 5JCOC 2I4IA 5GJVC 4GZ3A 3BGOS 5ALEA 3IH5A 1SA0A 3UMCA 1XKQA 1Q1QA 3F98A 5EJ5A 5K8CA 2J0QA 1CJSA 3L1IA 3V6LA 1NXSA 2UYGA 3MAGA 3HKBA 2P2LA 4CCWA 2ZI4A 4JJ6A 4B3GA 1ZGCA 3AHCA 1LQTA 1JLKA 2BMVA 1Y6GA 3OSUA 4WLOA 2VDMB 6CHYA 3K9BA 1MQ8B 1A7KA 1EFPA 1F06A 1N2SA 2CCJA 2CVOA 5J63A 3SHVA 1FZTA 2PG3A 3G6WA 4P3PA 2PAFA 3NKVA 1OPRA 3RU3A 4R6WA 3RAJA 4E7PA 4LCEA 4NJMA 4NK4A 5K0LA 2UUAB 3JD0A 2G1JA 4V2UA 4YRNA 1GO2A 1M7GA 4GP9A 2O8BA 4LHZA 3OZSA 2CBXA 3TLBA 1T9ZA 4CKEA 1QP0A 4ZU6X 4D92A 2A0KA 4F86A 1QVRA 3U4DA 3G7NA 4BO7A 2H1IA 1VIMA 5FNZA 3V8EA 1KBZA 4JB3A 2OILA 1F60A 2WSSA 5IM4A 2O23A 3IP6A 1T34A 4HRVA 2XCRB 3B2NA 1PL0A 3T1NA 3FPHA 4KBGA 3CRVA 1L5FA 3FXAA 2NTYC 3EGOA 3B20A 3QLEA 4KNWA 3R6WA 4CQMD 5IYZB 4WLEA 5U9CA 4A7PA 2E4XA 5IYZF 5JD4A 4FZJA 4S1WA 5FO0A 1MVLA 2J31A 5DXAA 2NTJA 2ZWOA 4X1YA 2XWJI 3HS3A 3B6IA 1GZ3A 1W85B 3AUJB 3B53X 3OIVA 4DDMA 4ZDIA 1IU9A 4O4JB 1CDZA 1K9SA 1TCCA 1T0BA 1XRNA 2DHRA 2I0FA 2B2CA 3GLRA 4OHPA 4RE6A 5E2IA 2HWYA 3KPJA 1QIIA 3ZTWA 1ACLA 2GPWA 4DCUA 6REQB 4XVCA 1YC2A 5JADA 3DOUA 1D2NA 3W5DA 3LQ2A 1MFPA 1ZMOA 5JDCA 1J99A 1UZNA 3RUHA 1R2QA 2R6JA 1FU8A 2Q2QA 1NX9A 1RRVA 4L4ZA 4LNUA 3W7AA 3ZLUA 4B3XA 3NWPA 3THWA 4MLCA 4BBAA 4Q01A 4V1CB 2QK4A 3ZZNA 1UPFA 3EW9A 3C7TA 1OI7A 2M6LA 4EMUA 2IW3A 5JROA 1DNPA 4C0BA 2QN2A 2H63A 2VUTA 2RAUA 3BSWA 1MOZA 1KEWA 4W99A 1PCXA 3E27A 4X92A 2R1TA 5ALUA 3RS9A 3A1WA 4AJJA 5FAKA 4WKPA 4DNOA 3I1IA 1VE5A 4CMGA 2W93A 1Q1AA 4RKQA 3RYCA 1U2DC 4LY9A 5LYJA 5BNZA 2I91A 2B36A 4R7GA 1QBGA 1PT9A 2DSTA 3JPYA 1C3OB 3N5CA 4FP9A 5JCJD 1CJMA 3VDXA 4WHMA 4UTXA 3KUUA 1QXSA 5A6SA 3EGDB 2HREA 1ENYA 3ZW7A 1G8HA 2ATCA 3U09A 3T5BA 1FY2A 3BERA 2MSDB 3NJ8A 1BROA 1IHUA 1OUMA 2Y4OA 1NKTA 2YY5A 4IBOA 5EE1A 3MWEA 4QYIA 1BH2A 3LYLA 4XD7D 4CUJA 1DXYA 1DG9A 2FZEA 3COWA 4CG2A 4P4NA 2GMWA 4CM4A 2RKOA 1PWEA 1CSEE 1SWWA 4ENQA 3IEVA 1YS7A 1KYWA 2FEWB 1FB5A 3A0RB 3C1OA 2XNDA 3MWKA 3PA6A 3HH8A 4P4SA 5KJEA 1EYZA 2J0SA 4RZXA 2BMDA 3N3BC 1MO6A 1PNTA 5DI3B 4OHVA 1XAIA 3DG9A 2QA5A 3IOMA 4XQGA 4BLQA 4C6TB 3WIVA 1DLIA 1ZA2A 2TMYA 2ISQA 4TM7A 3KLNA 4ZVVA 5I7UA 4L9RA 3TD9A 2OG2A 3AWIA 4CEJA 3WQBA 2O19A 4MYSA 3OD5A 3WRXA 1WMBA 1HORA 2CVZA 4O4LB 4RJLA 1QH1B 2GN0A 1PUJA 4O4LF 2PNJA 4ZODA 1RQXA 1KEUA 3FM9A 4CHGA 5EJ8A 4AM8A 5GZ3A 1K4MA 1SU4A 1RACA 2QW8A 2C20A 1JU3A 3OCUA 4K6HA 2RGUA 1X8JA 3AW8A 4PGAA 3SSMA 4YXFA 3FA2A 2YQZA 1G2OA 2CDAA 5CDFE 3A05A 5DYIA 2Z5VA 4JGIA 5TRTA 3LBYA 3FNBA 4DLZA 4N7JA 2DTDA 2HCRA 1CUIA 1D2CA 4IFIA 1YASA 2OCAA 2RJ3A 1C0EA 3OG9A 2YINC 3WGMA 2P27A 5TY0A 3C3WA 3W04A 1J8VA 3QHQA 1KH2A 1R5NA 4A73A 3AHJA 5L4NA 3QVJA 1A95A 2INGX 2R6GA 3LW8A 4FYPA 4IV8A 3OPVA 2X3YA 1WLSA 3F74A 1E79A 3N0RA 3S27A 2F4NA 2PBZA 2AE2A 1Z0DA 2IITA 1AUXA 2QAGB 1YVUA 3R2JA 1APBA 3T1TA 2ZJOA 4WBNB 2BFMA 2PT9A 4PSUA 3IBGA 3R23A 5HZMA 1QHSA 1E62A 3IR7A 4K5QA 3T61A 2YYZA 3T3MB 4DLLA 1ONPA 4EVQA 3ZXIA 3D3WB 4AYWA 1WULS 4YQZA 5EKXA 4QLOA 1YDWA 4I1RA 2ZUBA 4O5AA 1OGJA 2JASA 2QD1A 1PW5A 3C3YA 4FQ5A 1T2CA 2ZJYA 3S40A 4GPTA 1R4ZA 2EP8A 1GQOA 1R8XA 2H4YA 4FKBA 3AHHA 1C2YA 1BGVA 1ZVJA 2F1IA 4DTIA 5FBVB 2JGKA 1SVLA 2C4NA 1YJ5A 1U81A 4KVFA 2PPVA 3ZDEA 3ELDA 3OIDA 4EY3A 3BL6A 4QGAA 3OWHA 4W9NC 4S1NA 3RSQA 1GPUA 1LLDA 2UKDA 3H2HA 1KTVA 1RI1A 1YQGA 2HFJA 4YO7A 5AK5A 5KWSA 2LCFA 3QPDA 4MLDA 2BGMA 1G6HA 3H0EA 4CLRA 1PQ4A 4ODIA 4Y2PA 3EXHB 4G0NA 4QDOA 2RE8A 4MB2A 4JLUA 1T1RA 1E2IA 3O0TA 1LDNA 4JP2A 2IV7A 1XA4A 5KHOC 4U00A 4BV9A 1KI1A 3PHHA 4MULA 2CFRA 3MRVA 3IAM1 2DQ4A 2IS4A 1FTGA 2Q21A 2VDOB 3K5IA 4LDJA 2IP4A 4YCBA 5HA5A 2W6NA 2F8LA 3GCXA 3ZUPA 4G4IA 5DT9A 4X63A 1XYVA 3HO1A 4ZT4A 1DO2A 4B32A 5F9FA 2DU8A 2HOQA 4M9XA 1VTKA 4GICA 3WZ2A 4X60A 2XGMA 2XT0A 4M0KA 1T5IA 1VL2A 4Y9DA 3T5AA 1ZD1A 3I2HA 4G81A 5ADVA 2P9QA 1ZYUA 3DDSA 2QZ4A 4UEOA 4R4JA 2WP0A 2AXNA 3MMXA 3LDAA 3JVVA 3IKVA 4F2WA 4H4EA 2QTNA 4OJKA 5AJHA 2QOEA 2XJ9A 4GGMX 4KMMA 2FPOA 1QHHA 4UXHA 2BBSA 1XNGA 4HQLA 1EP2B 3VYSB 4Z4HA 1E1RA 4OGWA 3S4YA 3EISA 4UPEA 1NIPA 5EZSA 2PT5A 1J8MF 4E2XA 2P2CA 3KJNA 4J7XA 3RFTA 3P1JA 2M6SA 1JFVA 4KHZA 4LV8B 3SNKA 5HKAA 1CNEA 5JY1A 5EXPA 2E48A 2XA2A 5LNK6 4UBMA 2DQKA 4C5AA 1X1SA 2ZBDA 2IWHA 4FGKA 1HSZA 2HEGA 3DW3X 3GZJA 2FZVA 2P9HA 4MGEA 1NMQA 2IZ0A 2ZTVA 3AF1A 3ASYA 4Z86A 5DV9A 3TBKA 2EVWX 3KKQA 3VDRA 4CTJA 2JD0A 2YXLA 1CT9A 2WMDA 3AVQA 2XY4A 2IYYA 4KMRA 3LT5A 4JELA 4KZKA 3TUIC 3UFXA 2QMZA 4I19A 4P80A 3ZDDA 2BTQB 2PL1A 4MW0A 4NHEA 1ZWKA 2E82A 3OQ1A 4BNJA 3KQUA 2FPPB 3WRYA 3EPJA 3LP6A 3IMEA 3HDTA 5TARA 3T0FA 1F8FA 1OU0A 1R8SA 4YRBA 4TS9A 2QRMA 5K0ZA 3LHDA 1X7HA 3KQSA 1OHHA 2ANCA 4LDAA 2IS1A 2QLFA 2CEKA 2YBDA 421PA 5CFPA 3WFIA 3UXMA 1PI3A 4HY3A 4C0QC 2I6UA 5F2NA 4CE6A 3D59A 1YA4A 2W2TA 2HMVA 3DL4A 3U3OA 5I7VA 5EIOA 3WL5A 3CT4A 5JXIA 3RS7A 1UQRA 2KW5A 3HN6A 3RVDA 3SE7A 3STWA 2XKKA 2H1HA 4O02B 3O5AA 3OM1A 4ZVKA 1LW7A 1RT9A 2FX3A 2X41A 3DE1X 3G13A 4R16A 1BXGA 4A8JA 3Q3EA 3ZV5A 2XV1A 4YAIA 5U4XA 2XCQA 5J4HA 1D2RA 1IY0A 1HDXA 2EJVA 3QFFA 1RRGA 1IDN1 3FMFA 3SD7A 3V3TA 3P20A 3ZWAA 5L3VA 1AXRA 1RBQA 1JJBA 4FFRA 1R0YA 5FUWA 1F8YA 1KDZA 2OYCA 1IZ0A 3SZLA 5C52B 3OCCA 2PZMA 5JARA 1MC4A 3JQ8A 1ZM7A 5CJJA 2PGXA 3GFSA 3MGGA 4L3WA 1E2UA 3V1NA 1R15A 1HTWA 3OJEA 4GYYA 1TJPB 1Y1PA 5T3UA 4BVKA 2E55A 3K0EA 1X1TA 1YCGA 3KEMA 4PZPA 1DADA 2VC2B 1A5ZA 2YL2A 4BTEA 3WNZA 3CSUA 3U7EB 3W2EA 3X2EA 2QYHA 1QRDA 2HLDD 1CTQA 1T5DX 2FMIA 2CE2X 2OK8A 3BIJA 3AY0A 3FJ1A 4JN6B 5H1YA 4HTAA 1GCIA 1TDJA 1Z0IA 2QY6A 1YFJA 2ILVA 5DO9A 4KFSA 4RD3A 1DOZA 5EFOA 4GPBA 3W1VA 3RSHA 1AA6A 5FOUA 1GNVA 1XZ8A 5GONA 2ZGVA 4QPZA 1D5WA 5T4FA 5BW4A 2A9OA 4EYQA 3ZWNA 1NY6A 2I6TA 4DRXB 4JOSA 2X9QA 1LY1A 4M1OA 2HCTA 2VJOA 2DVMA 2VXBA 3OP1A 1U0OC 1V11B 4CQJA 5I9BA 5BW8A 1C0KA 3O8QA 4FFWA 3PFGA 5EQDA 1FS4A 2DAPA 4P92A 1VPVA 3N8KA 4I5FA 3PCXA 2EARA 1L5YA 5G40A 4YLGA 1ZOLA 4ZTZB 4OK5A 3V32A 4G8JA 2WMOB 2KE5A 4XZ3A 1Y7TA 2JIBA 5KMGA 3GLFE 2ZI6A 2BBWA 2FJ0A 1XNJA 4QPDA 3RVSA 4IRUB 1E1DA 3EBLA 4BMXA 4EFKA 4ER6A 4E6PA 3BT7A 1ISMA 3T7RA 5AM2A 2EG5A 4E07A 4TV8B 4KRFA 3SXJA 1AKWA 2ESRA 2Q9BA 4TV8F 3DBIA 2HA6A 1KJJA 4TTVA 2BM1A 3IPYA 1L5MA 1YVEI 2QAJA 3DUWA 1M7BA 4YH1A 1Y5IA 1JXOA 2FSUA 4JL8A 4QOFA 1FP4A 3ON5A 5AI4A 5EGNA 3KJGA 5DMHA 3WJAA 1DP4A 3Q5GA 5TEVA 1VI5A 2HF8A 2Z4RA 4JLSA 3QKSA 5K09A 1I8TA 3NAQA 2VJDA 5EHZA 4CEHB 2Z4TA 3ACCA 3WK7A 1Y80A 3TI9A 3AFGA 3Q7RA 4L8FA 2Y3IA 1GAWA 1XJCA 2FNAA 5JCPA 5I7FA 5LQMA 4GNRA 4PG4A 3U0BA 1JIIA 4RMIA 3ZCUA 4BKOA 5HOQA 5H9VA 1QJCA 4R81A 1Z47A 1CZHA 1Q1ZA 1ZRHA 4MIKA 3WADA 4EPRA 2YJ3A