4F1KA

Crystal structure of the mg2+ free vwa domain of plasmodium falciparum trap protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
200
structure length
200
Chain Sequence
EVCNDEVDLYLLMDCSGSIRRHNWVKHAVPLAMKLIQQLNLNENAIHLYANIFSNNAKEIIRLHSDASKNKEKALIIIKSLLSTNLPYGRTNLSDALLQVRKHLNDRINRENANQLVVILTDGIPDSIQDSLKESRKLNDRGVKIAVFGIGQGINVAFNRFLVGCHPSDGKCNLYADSAWENVKNVIGPFMKAVCVEVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Thrombospondin related anonymous protein
publication title Structure of Plasmodium falciparum TRAP (thrombospondin-related anonymous protein) A domain highlights distinct features in apicomplexan von Willebrand factor A homologues.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 82
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4f1kA00
5E6UA 4MMXB 2VDRB 1Q0PA 1DGQA 3F78A 5E6SB 3TXAA 2VDOB 3VI3B 1V7PC 3T3PB 1XDGA 3ZDYB 1MHPA 1RTKA 4G1EB 4HQKA 1XDDA 1M1UA 3NIGB 3E2MA 3NIFB 4UM9B 4CNBA 1T6BY 1OAKA 3EH1A 3ZQKA 5HGJA 3ZDXB 1AUQA 3K6SA 1CK4A 1PCXA 1M2VA 4UM8B 1MQAA 1CQPA 3FCUB 2VDNB 3K6SB 3EH2A 1M2VB 4Z7QB 1JV2B 4HQFA 3VI4B 5KYWB 1PD0A 1U0NA 3K72B 4NENA 1LFAA 3EGDB 3EFOB 1YVRA 1QCYA 4IHKA 4BJ3A 4NENB 1JEQA 1DZIA 4C2AA 1TYEB 5E6UB 2XWJI 3BN3A 4PN7A 1SHUX 3ZE2B 3TW0A 3T3MB 4HQNA 3K71B 1SQ0A 2VDPB 2VDMB 2VDKB 1YVPA 4M76B 3PPXA 1PT6A 3M6FA 1QC5A 2WINI 4C29A 5LN1A 1N3YA 3HI6A 4XW2A 3ZDZB 3ZE1B 2ODPA 3HXQA 1ZOOA 1UEXC 1MQ9A 4O02B 4Z7OB 1RD4A 1QC5B 2I91A 4A0QA 3EGXA 4MMYB 2XWBF 1U0OC 2B2XA 3V4PB 3IBSA 4DMUB 4MMZB 5HJ2A 2O7NA 1JLMA 4WJKB 3FCSB 3EGXB 1BHQ1 1M10A 1XUOA 4HQLA 5KYNA 1IJKA 4F1JA 1RRKA 1ATZA 2ADFA 3EOAI 1U8CB 5ES4B 1JEQB 1RS0A 3BQMB 3PPVA 3PPYA 4WK4B 2NUPA 3BQNB 2XGGA 4WK0B 4Z7NB 3TVYA 5KYXA 1M2OA 4UM9D 2NUTA 2IUEA 5KYYA 3EG9A 1ZONA 4CN9A 2NUPB 4IGIA 5KYXB 4F1KA 2NUTB 2QTVA 2NVOA 1M1XB 2WW8A 3EG9B 3EOBI 1N9ZA 4FX5A 2ICAA 3TCXB 3PPWA 1BHO1 2VDLB 1IDN1 3F74A 1JEYA 4WFQA 2X5NA 1AOXA 2I6QA 4G1MB 1FE8A 4WK2B 5BV8A 2M32A 1L5GB 3QA3E 4CN8A 1JEYB 2ODQA 4NEHB 1IDOA 3RAGA 3Q3GE 3N2NA 3NIDB 1IJBA 5KYUA 3GXBA 1MJNA 4IXDA 1FNSA 3V4VB 1ZOPA 1AO3A 5KYWA 5KYUB 3EGDA 3IJEB 5E6RA 3EFOA 5HDBB 4C2BA 1MF7A 1MQ8B 1NA5A 1PD1A 1SHTX 2I6SA 2VDQB 5KYYB 2VC2B 5E6RB 3HXOA 4JDUA 5E6SA 4HQOA 3ZE0B 1T0PA
chains in the Genus database with same CATH superfamily
1B3RA 2JLRA 3IR7A 2FPXA 2BN4A 4O4IF 1X1QA 3UT6A 1GTJ1 3FROA 1NUHA 5BSRA 1LPOA 3HO1A 1ANKA 4DM7A 1XG5A 2F7SA 1I0IA 3AP2A 2MHCA 1YQDA 3X1YA 5IJ0A 3GIDA 1DBRA 2C54A 3AYXB 3E7PA 1NUPA 3MTAA 3DUFA 4BMNA 1E4EA 3K6SA 4S04A 3TB6A 4Q3CA 4LGMA 4AY3A 1OCEA 5D6NA 4MJ3A 3T52A 4Z51A 4TYWA 1XD2B 4WSOA 5AIBA 4UCQA 1SG0A 1E7WA 2P67A 1LH0A 1AKEA 3O1IC 2X0FA 2ZBRA 1H0HA 1C9NA 3GO4A 2CLEB 1I4OA 1A9XB 2E85A 2J1LA 5KTSA 3BWBA 3M1IA 2O59A 5JNLA 5EZYA 1KC3A 3KAQA 2L2QA 3PKZA 4PHCA 1MCZA 2FPKA 1HLGA 4MW0A 5H3HA 4QGAA 3SC2B 3PP8A 3HZZA 3DVAB 2ZB8A 1H2XA 1QQ6A 1GAEO 1O5OA 4BAZA 4ZCLA 1JHYA 4JLSA 4LSMA 1G21A 4FCVA 2C2KA 4E51A 2WHXA 4A0HA 4DCPA 3NM4A 1VL8A 2FW0A 3FYDA 3H4TA 4BQPA 4DGQA 4HI0E 2V8OA 4XDHA 3MERA 1ZM3A 3MS4A 1MDFA 3BSYA 3L7AA 1XT6A 1WHSA 1AGNA 4MWBA 3DBRA 1BHJA 2I91A 4HT3B 4AAYA 3ROEA 1E1CB 1SCKA 3SQWA 1UWLA 3O3CA 3QVTA 1CV2A 4PBSA 2FRXA 2FWMX 3QG1A 2M6KA 3KX2A 4H3HB 4M89A 2MWMA 2GHQA 2DPYA 2QUJA 5ICMA 1EK0A 3HJTA 4JT8A 4GU5A 3E82A 2ZUWA 1JHRA 1CUFA 3X0DA 2BD0A 2FSGA 3EJ6A 4WNYA 3S68A 3WK8A 4AL4A 4HOYA 4TV8A 4K0RA 4L4YA 2B4YA 3UKDA 3D7NA 3W9SA 2PM8A 3MCZA 5L7YA 3BK1A 3BJZA 1GILA 3A05A 3P27A 4W5RA 5BN3B 1S3GA 3QNMA 2KYRA 1ESEA 2O3TA 4X64B 2AWNA 3JR7A 4PZAA 1Z2OX 2AL7A 4E70A 1S3FA 4IF6A 1J2RA 2A3NA 5DT2A 5EWMB 3T9DA 1EZZA 5CVDA 1SVUA 3IQFA 4Y1FA 1PL0A 4G0VA 1MD9A 2WA2A 2WEKA 3T3EA 4D44A 1A2OA 1VHQA 4N8SA 3U56A 1X6VA 3QEMB 2I62A 2Q4TA 3LX5A 4GZ5A 3DAGA 4RANA 1B00A 1GPKA 1IBCA 5EY5B 5JANA 2ONZA 1VL1A 5A4JA 2HFKA 4Y2XA 4KK3A 2E5LB 1R6XA 4H6PA 3UJ6A 3UO8B 4GR9A 4KQMA 4P35A 1E2HA 2H57A 3C2QA 1I14A 1WDWB 4DAOA 5AKXA 1XN4A 2X5OA 3GAMA 5HKAA 2MSKA 1GPNA 1QYRA 4OSPA 2VYVD 4PYQA 3EPLA 4C4TA 4JXXA 3ZDDA 4OI2A 4BTVA 3WDMA 4LWZA 4DA6A 1GCIA 1N0UA 1U04A 3BGIA 4IWXA 2HCFA 4PXAA 2C5HA 4D74A 4OP1A 3LLMA 1XDBA 4H3SA 1L8QA 1UJCA 4XXHA 5IJ9A 5GJVC 3ZWQA 1OAAA 3A1VA 4IXNA 5EKSA 4Z9XA 3Q3JB 1QHYA 1Z15A 1N1MA 4P5PA 1S01A 2ZM6B 4MHTA 3DT9A 3NVAA 3W2TA 5AW0A 1WBDA 4F4CA 1K27A 1UJBA 3I01A 4BLTA 1C9KA 4M0FA 4QLAA 4RDCA 2CNDA 4G1VA 4FT4A 4A8PA 4Z4FA 1PFKA 1DVRA 2CYBA 2JZOA 3CZ9A 1EXWA 4MRVA 1TYBE 4Z3OA 4BKOA 3FTEA 4WN9A 3OMWA 4RAOA 5AXBA 3ILSA 2XHZA 4ENQA 1W36D 1ZH6A 4J76A 2PSEA 4GLJA 4OK6A 1UBMS 2QZPA 1U9IA 2JI9A 5GAJA 2GVDC 5DMXA 3I83A 4R2JA 3JV7A 4GPD1 2J7PA 3GEIA 4LXYA 3TX6A 3KWLA 4IFTA 3KB1A 3WZ2A 3F4BA 2RK3A 3OE1A 4LRSB 1P19A 1Z26A 1ZIXA 1SBYA 4EYEA 1B93A 3T3OA 3FMVA 1XEWY 1PLJA 2ZVPX 4M1TA 3UCXA 5CBPB 2XWJI 5I7UA 3FTCA 1CUSA 5FBVB 1EQAA 4KIJA 5FI3A 4EKNB 2V8BA 4YRRA 4TM8A 2CV2A 3DEJA 3OHPA 1W94A 1A9ZA 3P9XA 4YRLA 4KI0A 2D2FA 1CY7A 4RPIA 1RLJA 1CR6A 4LGVA 3ZNNA 2IZ0A 1TU4A 1J06A 1LS6A 1W85B 1CKEA 2ZWVA 3R7LA 4UEJA 4JJEA 1PEAA 2ODPA 2RB5A 1TRKA 1P75A 2PZLA 4YQZA 3BD9A 3ISVA 4EH1A 3WGYA 1PV2A 3LHDA 1L5SA 2WZQA 4C0JA 1CJBA 1RJDA 1YS7A 4GHWA 3P0IA 4O2BF 5BVHA 3RKUA 5AR1A 4ZGGA 3F67A 4AIIA 2WAMA 4M38A 5FFMA 2KW5A 4YRCA 2ZRJA 3ENWA 3LZ6A 3I01M 4NOKA 3ZE7A 4EVQA 4ESEA 5JPCA 1OAOC 4OLJA 3BRWD 1F48A 4YAFA 3VC2A 1RQPA 3K4PA 4F5WA 1QU2A 2JBAA 4MV9A 4NBVA 3QTLA 1H1TA 3KJXA 4E2WA 4GWGA 1KJWA 1YJBA 2Y6VA 3R41A 2HZ7A 1T2VA 3B1VA 1T6YA 4JYPA 3VAYA 3VYRB 1XTZA 2I7XA 4H77A 3WIUA 1PJLA 1QO9A 2P90A 4BB6A 3FGOA 4DV4B 4W63A 4Z0HO 3RFCA 5ES3A 2RHOA 3HVRA 2KI5A 1YQ9A 3QKRB 1GGHA 1U1EA 3FCAA 3GAFA 5DLDA 1Z6YA 3LE8A 3KWFA 4JI3B 2WAOA 1XU9A 4YQEA 4MI6A 1GITA 3V5NA 4ENSA 4I1RA 1U0JA 5LU8A 1KH2A 2A88A 2JCXA 2PLNA 2C4VA 3JZAA 1J2TA 4HDMB 3T8YA 3QUSA 4O33A 2ZLBA 1JJBA 4U7WA 1I2MA 1XNJA 2BFFB 1AKWA 3U7RA 2BL4A 4WESA 5FT9A 5A2QA 2C0PA 3B52X 4KO4S 4P3PA 3NU1A 4GH5A 3AT1A 1IMOA 3T7KA 3UKOA 5K9ZA 5JJLA 1V71A 2FKNA 5M04A 5FUWA 1MB9A 2GJKA 1VJ1A 1SCUB 4CKXA 5E6RB 2X0NA 2QR2A 2JLCA 1ORVA 2P4UA 4ITVA 4NCJA 3GC6A 2GR9A 1JYFA 1EEXB 3AW9A 4MWGA 2PRJA 5DGTA 2C1EA 4AJJA 1BDHA 4CF4A 4ZANA 1V3QE 2G5PA 2YL2A 2Q5CA 1B73A 4KNVA 2PUTA 3JD0A 2A9FA 3WKAA 3I0MA 2OV1A 4EHIA 1C2YA 1JFSA 4IIDA 1N32B 4EL0A 3OCZA 1PDOA 1JS1X 1VMEA 1T9ZA 1GNVA 2G9UA 1BKSB 3FJ1A 4Q9NA 4WKBA 5FYQA 2P27A 2EFCB 5ISMA 3FI0A 2CSXA 2OD2A 1WMFA 4HX5A 2BGLA 4IO0A 3RC3A 2F48A 3RI3A 4ZI3A 3EH2A 3HKBB 1DO8A 3GP8A 3MM4A 2HXYA 2K6GA 4DNQA 2N46A 1Y6JA 2X0EA 4DWVA 1Y82A 4GC9A 3OVMA 4GXNA 3V97A 2YQ5A 3ZJ5A 4XWKA 1XZKA 5BWOA 2B92A 5DI9A 3A1FA 1TW3A 3BXFA 3C7CB 3PEEA 2VPXA 3UGKA 4YMTA 2HA7A 3WLJA 4KR7A 2VYND 1RWVA 3WRXC 5BQ3A 1W96A 4KTVE 1GM5A 1GN8A 1EWTA 3NYQA 5LA6F 1P91A 4BZWA 1OH7A 4AQ7A 3R5HA 4LRQA 3CRZA 4BO1A 1FFYA 5HCNA 5CB4A 1C1YA 4PQRA 5KJEA 1OXBB 5TQ0A 3UMCA 3UY4A 3VR3A 2P0YA 1E92A 2EKLA 2IEDA 3RV4A 3GHHA 1JQLB 1U1DA 2AFIA 1VB5A 5JNWA 1JWAB 1NM5C 4X61A 4EBBA 5JAHA 4EF4A 2NOAA 1NR5A 1WW8A 1Y89A 2ZTLA 3PDIB 2WBLC 3KLMX 5JUWA 2PA3A 2XE4A 1IAVA 1CHDA 3WMXA 4E09A 4B46A 1M1YE 1XRRA 2JD1A 2QN2A 2W6OA 3KL4A 3WGKA 2ZK7A 2WMOB 3B9PA 3EDOA 1PSDA 4JJKA 4YLEA 3DBVO 4W7IA 4C0BA 1SUPA 4D9EA 4JN6B 1M2FA 3LXMA 4TKMA 2RGYA 3E61A 4QWMA 3JQAB 5FUXA 5BMVB 5JC1A 1ZD8A 2C7RA 3CLHA 1NF8A 3DCJA 4XB1A 4D6XA 1N8NA 1E9BA 1T35A 2FAXA 1D6JA 1ZGHA 4LYEA 3VYSB 1QPGA 4QJ4A 5EAIA 8ATCA 2CNBA 3CVXA 3WWEA 4O59O 3EXHA 2ECKA 3QELB 3TNYA 2ZUDA 2BFDA 1EFHA 4L3WA 1EVQA 3GL9A 1SKYB 1NX9A 4QWWA 3RJMA 1EAYA 1K06A 1W46A 5BUCA 1PF7E 3DMRA 3EWSA 3KZVA 2HLDA 2YHIB 2UVPA 4OHZA 1Q1EA 5IK2D 5L3SA 1JG3A 3EVCA 1TCVA 4BMSA 2CXSA 3D3WB 2ZKIA 2YTZA 1LBEA 3L05A 1EFVB 1BFUA 2LD4A 3VM6A 3FLAA 5LZ4A 2Q5QA 2ZPAA 1RTTA 3FPSA 2IV3A 5I7AA 4IV0A 1F2TB 3S2IA 1C7EA 1C8KA 4HDCA 5HMMA 4ZTZB 1ENPA 2WJVA 4FW8A 4LNUA 4XDYA 4AUNA 5INTA 4TWIA 3GGDA 3GMIA 4MYCA 1QTRA 4D26A 3FGZA 2J9RA 3N2LA 1TU0A 2X22A 1BO6A 1T5BA 2QGFA 4XUGB 3T95A 2I55A 2O0HA 2RHDA 4HVAA 1FBNA 3SQLA 2FMHA 3QLVA 4XA8A 1GTL1 2QVGA 2FN8A 5KNDD 4RJJA 3HCPA 1I32A 1BYIA 1DBQA 2QRVA 1HFJA 3UK0A 1TVEA 1MABA 2VDOB 4EELA 1PHRA 3IUMA 3CSDA 1N2HA 1R6BX 2WY2D 2X1LA 1BS1A 3KB8A 4URWR 1X7DA 1P0QA 5IZCC 3I30X 4PM4A 1EFRD 1T13A 3BMNA 5CK4A 2WD9A 1DXYA 2Y1GA 4AZ0A 4HB3A 5MN6A 2GSDA 3JQFC 4QD3A 3TD9A 2BHNA 3R0IA 1BTOA 3L6DA 4IHJF 5ELMA 2Y71A 4LS3A 3G8DA 1GUFA 4N6OA 1PL6A 2Z8ZA 4UNSA 2ZBUA 5EKXA 1Y3BE 2E21A 2OOKA 1X9IA 2BKLA 4IJKA 4TKLA 1KGSA 3N3BC 4QJIA 1SZCA 3KVVA 3IAXA 3RAFC 4MR9A 3SS8A 5KDOA 4ITUA 1QHXA 1OREA 3E5RA 5JNUA 5HUHA 1FFBA 1W5TA 1RWPA 1EHYA 5FQNA 3ESRA 3HA7A 4K8OA 4KYIB 4ESOA 1IN4A 1KVSA 1OA0A 3BRSA 3LSYA 2OAEA 4UQPA 1DT3A 5L3RA 4JI2B 1PGNA 1T9GS 3HHPA 1ZQ1A 5BT9A 2DR3A 1PDVA 2R2AA 5LDHA 4LI3X 1QM5A 4JA2A 2OHGA 3KR1A 1L4NA 2BHSA 1VHDA 2FFRA 2KM1A 1IH8A 1JEJA 1VG9B 1YI1A 3DBHA 4FK8A 2JF0A 1YBFA 3OM9A 4D9FA 4EAQA 3AVOA 2REBA 4O8ZA 4QO7A 3U7IA 5LLDA 3WTBA 1LC3A 3O38A 3PI7A 3CTPA 1JI0A 3Q98A 3NATA 4EX7A 5AVSA 2J7KA 4DB2A 4OHBA 2ZG6A 3QYAA 2OV4A 4DLWA 1KIMA 5DYIA 4HXEB 2GEUA 5ILQA 2CL0X 3EIQA 3NDBB 4DCSA 4Y2YA 3ENVA 4L4SA 4B34A 1A4XA 4BZQA 3LCMA 4UE6A 1A88A 1IN5A 1COWD 3FBTA 3K1AB 3LOUA 4G5FA 2AG1A 2QSZA 1E3EA 4KO3S 5BRAA 3WL4A 2IKSA 1RI5A 3V7YA 1IY8A 1QANA 4F45A 3NCTA 4HFNA 2GQ0A 1JL3A 3ESQA 3TQTA 1WCIA 1WMAA 3UZUA 3H3XA 3DF7A 3KIPA 4URFA 1U6JA 2I6TA 3BGWA 2PZAA 3QXGA 4L7VA 2J9FA 3WZLA 5JEDA 2WJYA 3EVNA 4C07A 3PPWA 4S12A 4S2EA 3AFMA 1NRIA 4GDMA 1OPXA 5IZ4A 3SU8A 1DBPA 5TPZD 4OJNA 2VNKA 1VZ3A 4A8JA 4DRXA 4OQLA 4US0R 2HJGA 3AUUA 1DPFA 3HEBA 1OMOA 1JKMA 3AWDA 1E9AA 1YCDA 4A36A 3NBUA 3ENQA 3GLGE 4N40A 4DUZB 2G8NA 3JQ9C 3N0TA 2FQXA 5FWYB 4BNJA 1V47A 1KOFA 1Q16A 2VKQA 2XECA 3JX9A 4IDDA 1V7ZA 1K5GA 2YJ3A 3R6WA 2H1LA 3FZGA 4TGLA 2PZEA 2C2WA 4AJLA 4PQYA 2HPZA 3NTLA 4JJZA 4K9NA 5KNCA 1YR1A 2EWWA 5GMOA 1SZPA 2JVKA 3FOFC 3IQEA 4CFYA 1T4BA 5C4GB 4W5QA 4BUCA 2VTBA 1QF9A 2C95A 1OB2A 2P65A 2W11A 4GM0A 3SIWA 3LWDA 3E22A 1KDTA 3IE0A 5HX7A 1VTKA 2BFBA 4C22A 4EJ0A 2VRBA 4ZPXA 5A5EA 4UCFA 1BXGB 4BP8A 5HK8A 1IWOA 2G5TA 3KXPA 5EPOA 1P5JA 3AVQA 2DH6A 4OU5A 3BT7A 1NQOA 2WWRA 4R8LA 1J0AA 1E6MA 2MMGA 2OYSA 2ZYVX 2FDRA 2IEYA 2OD9A 3SEZA 4NFLA 4P22A 3L02A 1UXGA 4P7FA 3C5CA 5DLPA 1IUPA 5MF6A 2W22A 4HYQA 2XUKA 2QW1A 3ICEA 1EAMA 3QBTA 1PYDA 1ZD3A 1G7SA 5C0OE 1PD0A 3P8ZA 4B3MB 4H0FA 1S1CA 3C3DA 3U3KA 1P77A 3P2EA 2HSZA 2FZLA 1XQ9A 3IP7A 3QY0A 1VSQA 1D8AA 1G8SA 5CA1B 1F5SA 1F8XA 1WO8A 3RANA 4KLAA 3QFRA 2WB4A 2WICA 5DX0A 3FDJA 1XZHA 2G4CA 2Z5FA 3U7QB 1CHNA 1OE0A 1C81A 1D0VA 1US8A 2FWJA 3P0EA 3RBXA 4MQBA 4WJLA 1GAXA 3R3XA 2A84A 1TT7A 3PQ7A 3TJMA 1L7MA 4OK3A 3UCEA 1I7PA 1R4MB 2OCXA 3L7KA 3RLFA 3ZK9A 4BB0A 1YONA 1LV8A 3CNOA 3OQJA 2V6JA 4UNIA 1U7WA 4CM5A 1TF2A 2NLOA 4HC4A 3E3OA 1IK6A 3LG2A 4OHCA 4DT1B 2FWNA 2B7LA 2JATA 3PQCA 5AVTA 1I7QB 4OUDB 1XF9A 5GJWC 4ILKA 1FLAA 2H4HA 5I7VA 3WO0A 2F1JA 3I1FA 3N70A 2PV7A 1XBTA 4PO9A 3GYGA 3BB4A 3EGXB 1CUWA 3ZGNA 4YT4A 2A1TR 4REQB 3UPDA 3MJFA 2WILA 3TRKA 4KC0A 2C29D 3UGTA 4PYJA 2JLZA 3TKYA 2IU4A 4QYXA 1VQ1A 3RG8A 5LA6B 2GYVA 4I3FA 1KJ8A 3SSAA 3UW1A 3PHIA 2PZ8A 2GPTA 4FLFA 1C29B 3AP3A 2G71A 4LE0A 1QIMA 5DBHX 1ICIA 2DEUA 4W8HA 5ANRB 3V4ZA 1NQ5A 2G25A 1GHTA 1Y4SA 3LIIA 2I7DA 4U00A 3I45A 2GN8A 4WADA 3SP1A 2F3TA 2EU8A 2XE7A 1ZFNA 2D2XA 2GERA 3KHUA 4O63O 5DGCA 5BNIA 4TVKA 3QF4A 5LQNA 5D2CA 2XCOA 1SB8A 4TKUB 4KJZA 1O5TA 1CERA 3QVXA 4MW9A 4TMVA 5CH3A 2A33A 4OXXA 5J5CA 4ZIRB 5LQUA 1MOQA 3NHAA 5A9RA 1E0SA 2B69A 3COZA 2YR0A 3E7WA 4I3GA 3E8MA 3OP4A 2PT7A 3REOA 2R86A 4XPZA 9GPBA 2ZSEA 1GT6A 1VPLA 1D3AA 3DTTA 5F1KA 4BZZA 4YP9A 1ODTC 4CUZA 3BGOS 4DZTA 1KWGA 5K0NA 1JRLA 2IF0A 2XSZD 2HPVA 5HS6A 4TTTS 6LDHA 1XXHE 4OQXA 2QMOA 1QG6A 2YY7A 4JDUA 3FKQA 4LCEA 3MS7A 4O3FA 1RNLA 2R7AA 2G88A 2QTFA 3RT7A 3RQSA 4B6PA 1E58A 2M2IA 5ITZB 2PT5A 1TQ2A 2CMKA 3IIMA 2Z3WA 4OJTA 4MA4A 5DBEX 1Z88A 1WXIA 1J99A 3O4IA 4R6XA 5P8WA 4MW6A 3SKXA 5I7OA 4LJRA 2I2DA 1KMNA 1SJ9A 2Q0QA 4DR1B 2H1SA 2NMVA 2PWYA 1M8JA 2AS0A 3BXPA 3PD1A 4JDPA 4UZFA 2GA8A 1DIBA 4DYDA 3WADA 1IRXA 3UJNA 4ZALA 5LYJB 4MHSA 1PWYE 3ETDA 2GWRA 2FW8A 3U26A 2QN9A 3S8MA 1ONBA 1PW5A 3NAZA 1MQAA 3MF4A 5EHGA 3TD6A 5BOSA 5CDFE 3V4OA 3NT5A 3K16A 4HYTA 1DWPA 2ZIFA 1KY2A 5F2EA 5L53A 1H8EA 2OO5A 2QRUA 2PEYA 3EGIA 3Q15C 3U81A 7GPBA 1DEKA 1OZAA 4KVZA 3D43A 1QCYA 4M2LA 4Y1EA 6REQA 1Y7IA 3HDVA 3NEPX 3V2IA 1E1NA 1NPYA 3G2IA 2FPWA 2H4JA 2HWKA 2UYCA 4UE3S 3KKOA 3ZY5A 4KB5A 4ES6A 3Q10A 4XWAA 4AJHA 3FYUA 2EFEB 4RF5A 4AKSA 1IVSA 5F4ZA 3V4SA 1MFPA 3EXIB 1VA5A 3KJHA 4IOKA 4RIIA 4X8MA 1K7FB 3VNSA 1TM1E 4ZDIA 2QXTA 3F98A 4ZVPA 1T2DA 2B8WA 3WIDA 1GGJA 1DTSA 2WHQA 1ZNZA 2VO1A 3RAPR 3OLQA 2NV2B 1E2IA 3H8JA 5AP9A 1TVKB 2H2HA 4WD3A 4ZO9A 1FZTA 2ZT5A 3KT0A 1RRCA 4D25A 1RQ7A 1UFOA 1Z0UA 1Q1QA 2A7QA 4UOZA 1PJ8A 1SK9A 1D4OA 4DWJA 1DCMA 1DWUA 1YJQA 1T15A 4BWFB 1PSZA 3H9GA 4BKQA 4X7MA 2C99A 1VDMA 2MOKA 2CNOA 3C45A 3K4HA 3LHKA 3P7MA 1MT3A 5CVUA 1VIAA 3FVTA 4X7BA 4I4CA 2Q99A 1N0IA 4MIYA 4O4JA 1CJTC 4WLFA 3PHBE 2NSHA 4OB6A 3A6GA 5LXTF 4EF5A 3PBKA 2DETA 2E1PA 2DRIA 3IKVA 3TIGA 5KNBD 3GGJA 4AJ4A 4TL9A 5KKAA 3PGLA 3UIEA 2X4IA 1E2UA 4ZMSA 3C41J 3KVYA 3GXOA 4UUNA 4N03A 4F4JA 5FADA 3WYBA 3AEUB 1QSGA 4XPIA 1K9SA 2H92A 3OU6A 2NU7A 4JEMA 3KDSE 4UUMA 5D85A 4A6XA 2FETA 1B6TA 2W00A 1WF6A 2FU5C 2QLFA 1ZK0A 2C2GA 4GOND 3IPCA 2ODEA 1IDN1 1YZNA 2PD6A 3ZD7A 4IGKA 2PVPA 3B5EA 2X7HA 2VA9A 4CKYA 1OLXB 1Y33E 1W2WB 1Z75A 2YJZA 3QOFA 4V0QA 1NG1A 2G6TA 3RAGA 2A1IA 3K2EA 3A6LA 3ONWA 4JLDA 4MYTA 4N7MA 1MTOA 2D00A 4KXWA 4JLVA 3GXBA 1WPQA 2DBRA 3B20A 2VDWB 3E7FA 1L7BA 1U11A 3DMFA 2XMZA 3CLRC 4QXAA 1KORA 3W1EA 2W2KB 3DDZX 4OP2A 4COOA 5KVAA 1L8OA 2DTEA 5F3DA 4L9SA 1W47A 4R68A 1B2LA 3BJRA 1WVMA 4CUJA 1Y1LA 1ZM7A 2ZJYA 3QU5A 3V3KA 2OM2A 3A3OA 3CKYA 4KBFA 4OGKA 5DYYA 3KT8A 2H59A 3CUKA 4YRJA 2YRWA 1Z13A 4H4DA 4RLFA 3WICA 4PNEA 1GKUB 2VF2A 3AXSA 4BFVA 1FJXA 3RS7A 2CMDA 2ZT6A 2FG5A 2JHGA 3L49A 1LK5A 3B1JA 3GUYA 2NU6A 3EWIA 3QJGA 3TKLA 1AS0A 1GQQA 4QTZA 1LGYA 2W4MA 4JUIA 4W5HA 2IC5A 3W5HA 2PBFA 4BNHA 3S8YA 2XCLA 1OHHD 3EAQA 3H2GA 5DW0A 5FPSA 5BWBA 4UBMA 2VTDA 1F0YA 4H18A 3NI2A 5SYMA 2LW7A 2UZ3A 5F7ZA 3RT1A 4JSRA 8OHMA 2ZJ4A 1TVMA 3GLHA 1NI5A 3AH8A 5DM4A 1L5LA 3UJ7A 4EW1A 1UZMA 4EY7A 8ADHA 2LWIA 3ZWYA 5JRJA 3TPCA 1XZBA 2G4LA 5EE1A 1KU6A 1FYXA 4EB6B 3GCXA 5HRAA 4C4PA 1PJZA 2C5GA 1EA5A 1NKTA 3HYCA 2JCSA 3PLRA 4FGZA 2RGGA 1L5HB 3LUCA 5F1OA 1WSDA 3A4TA 5DNDA 5LBTA 5CXQA 1QLHA 5KTKA 2ZSDA 3OT1A 3FW1A 2VJYA 5I45A 3IQIX 4MH0R 2R6CA 1XLWA 2DWPA 4IDPA 1GCGA 2UVQA 1XAJA 4B1FA 1R74A 4BN0A 3U19A 3GLIB 4P33A 4I1OA 3O8NA 5EP1A 1KR5A 3P2YA 4LBWA 5A5DA 4E14A 1T8PA 3GJ7A 4HDAA 3KKEA 1NGSA 5JW6A 3ND5A 2RAVA 1CQJB 4LHYA 4EIWA 1AKYA 2XF8A 2DAPA 1KQOA 1QBGA 1W4ZA 2HK6A 2PRZA 2QYOA 3GDGA 1JEAA 1M54A 1MIHA 4CU2A 1S7GA 1IIBA 4PQFA 2C94A 4HWKA 3WYAA 1PZFA 2C9DA 1CZKA 2EATA 2DMRA 3WSVA 3J7TA 5GJBA 3FVWA 3IS3A 5A0VA 4ZYTA 1ZUHA 2RHJA 3S2FA 4WDRA 2IPAB 1Z5NA 2AOWA 1SUWA 1QV7A 1R5BA 1RYMA 2Q2QA 3CU5A 3KQOA 3QFFA 4M7WA 2WFLA 3O83A 1QWSA 2BMWA 1I30A 4MWEA 2PWBA 3K9HA 1H6BA 1V45E 2R0QC 1IOZA 1YRHA 3HR8A 4RQBA 4YV1A 1KAEA 3PCTA 4JI5B 3ZXXA 4ZT2A 5A7HA 4UHFA 4L4RA 3UV6A 3VNAA 5BVGB 3PQ6A 1SY7A 1PFUA 1U0HC 1A9TA 2REQB 2X5NA 4EJSB 5JISA 5EN4A 3H5WA 5I9LA 5TE9A 1OGJA 4P7GA 4GZMA 1XVUA 1RU3A 3QW4B 5COBA 5DNEA 1D4ZA 1EDDA 7REQA 4AN1A 4WFKA 2DH5A 4IMRA 1WDLA 2HEGA 4L27A 3BG5A 3G9TA 4CKEA 4TQ9A 2Z09A 1NASA 1U2RA 4AS2A 1KKLA 4W5WA 5CIYA 2VHQA 5G0VA 3UWKA 2KQUA 1I0LA 2C8LA 1YJCA 2D1YA 2IPOA 3CJTA 4QOJA 1DB3A 1MH1A 5FNVB 4DUYB 1JBKA 4C7OA 2CLHB 2Q4EA 1Y6ZA 2R85A 2YZMA 3TAUA 5AJYA 3VO8A 5H80A 4RIFA 1QF6A 1IHUA 5A6SA 2P2SA 2ZBEA 2JGFA 2YXBA 4G86A 3EZYA 2FEOA 4EKGA 3A3YA 1OH8A 5DK6A 1H6CA 2ZIXA 1M5UA 1XLVA 5EFOA 1HWYA 1A95A 1GT91 1HLFA 2Z2XA 5C34B 5LLTA 1GSIA 3OWOA 2CZCA 1QCDA 3DHYA 3VNRA 3PVZA 3BICA 3ZU2A 1PZEA 3KPUA 1URPA 2DGDA 4RO0A 1E1YA 4TV9A 3OURA 4H59A 1GARA 3A4VA 2C20A 4ZAGA 1C1DB 1CLUA 1U0NA 3K72B 3KLPX 4R1OA 1AGRA 3OSUA 4U9IS 3ZWAA 2DPMA 2YOGA 4FYWA 3OTQA 1XMVA 2XDQA 4M83A 2PU7A 4K2HA 5H9WA 5LU9A 2VT7A 3A6JA 1NLUA 1ZWLA 4UVGA 1Y5RA 3J81A 2GN0A 2OHVA 3BAZA 2AOVA 4FFMA 4NOMA 5F33A 3AUSA 5FWXB 3G1TA 5ICFA 4YV2A 4WI1A 3OHMA 4RVGA 3SBEA 1DQNA 2J09A 1ZUIA 4GDFA 1XKXA 5F7JA 2IXDA 3JAWB 2UYOA 3DZGA 3GPBA 1W6RA 2WG0A 1NBMD 3O9VA 1XTUA 2PNFA 1JMKC 4QM7A 4IJVA 1ENZA 4IIGA 1PG2A 5EWJA 4RDHA 2Q6LA 4RL6A 3SS9X 4ZQGA 4CIVA 3NM5A 3E2PA 1W7AA 5LCXA 3BFXA 1M6YA 2GUWA 2ERXA 1M33A 2H1IA 4QDOA 1W1UA 5ILOA 3E9QA 1JFTA 3D5TA 3IESA 2QMQA 1ISJA 3IJPA 2VHUA 2CLSA 2GNAA 2IP1A 3P4YA 2V54A 3EBOA 3R7BA 1NIPA 1WEKA 3S28A 2AOTA 1H2BA 3IDQA 4IMJB 4Y0AA 4RD0A 3RS2A 4Q9LA 4LE2A 4QSHA 3AUFA 2PMDA 5ALWA 1UUFA 2XUDA 4O4HF 3ICQB 2VJNA 5KOIA 1JIJA 4B5KA 5C7LO 1W29A 4R9UC 3T7IA 4UUAA 1TC2A 5EVCA 3GLVA 3TCXB 3CISA 1DAPA 2SKDA 5AWFC 1I8TA 2TECE 2PUFA 2I1LA 3Q4GA 3FOEC 1JF8A 1MW9X 2Q7XA 1NPTO 2O50A 2P3OA 2X8AA 3ESZA 3L04A 3LQ4A 4WFQA 1G21E 1R6TA 3U4CA 2QHXA 4MQFA 2ZR0A 5JDCC 2FW7A 1F4VA 4EENA 1CIVA 1HYQA 3LK6A 4NJOA 2AYZA 3AJEA 4Q4HA 3H5NA 1P7PA 3DBIA 3AHIA 3PD0A 5LXTB 3EDQA 3LKBA 3U5ZB 4BKUA 5H5JA 5DEOA 2NUBA 3HO8A 2CNWA 4EG0A 3B6MA 2NGRA 1H9BA 1PI3A 2QEQA 1ZL0A 2AG0A 1CUAA 1NF2A 4ZRMA 4ARZB 1LFDB 3NWJA 5IAAA 1OWMA 1QMPA 1HH4A 5BN4A 3QLUA 1DOZA 4WH0A 3WLPA 1P61B 4EHBA 1WAMA 1I9CA 2PAAA 1JHDA 2FXIA 4Z0TA 4Q24A 3CVWA 1V8DA 3BL6A 3FHCB 1DIRA 2KLHA 5U9CA 4NCHA 1SOVA 1OI2A 3CUWA 1XZCA 2XUQA 4GUAA 4EPVA 3AEKA 1YJ5A 4L08A 1QJCA 2GXSA 1GA6A 1RYFA 3HDGA 4IV5A 4MA0A 4X1KB 4LMAA 4YUZA 3QK7A 4UM7A 2I7CA 2BC9A 3H2JA 3MCWA 2VDVE 4GOXA 4RE5A 4Y9UA 5LB4A 3VHXA 2GHRA 2HXGA 3OCJA 2J30A 3W2IA 2X9LA 1UDBA 2V7EA 4FXPA 2GAAA 4A9AA 1N8KA 3L93A 4MUKA 1MAVA 4Q1BA 2QF7A 4DUGD 1QHFA 2V98A 4O2LA 3SQMA 1G8HA 3E7DA 1IHOA 2PAFA 4FFLA 4IYRA 3FCYA 4C2AA 1CVLA 1P3Y1 3U49A 1EGVB 3B7PA 4WXRA 2AVDA 2B4TO 4OHPA 3UG6A 1CBUA 3ONDA 1XZQA 1M6VB 2VVTA 3FSJX 3P26A 2ZJ7A 4JV5B 1C3VA 5K3OA 1XGKA 3VA7A 4U63A 2TSYB 3ABOB 3AR9A 4NOJA 1M7GA 1SC4A 2OO3A 1L4UA 2HOQA 4R81A 5ALNA 1YA8A 4QXMA 2X5KO 1CUIA 3RYIB 5KTNA 1UEXC 4A82A 1H5UA 2QTZA 3CXUA 5K4HA 2W37A 3E7XA 4E5MA 4DYVA 4FJ1A 2G5GX 2KX7A 3CZCA 3G2HA 3HCEA 4QG3A 1FJHA 1UBOS 3RM3A 1AURA 1FLDA 3FWYA 2IUFA 4LJYA 2Y1OA 3E48A 1Q5PA 1U8XX 3BDVA 3EOAI 4JU9A 5DIFA 1KZHA 3DE1X 5B1SA 2GJ9A 2XB4A 2GBPA 1ZUWA 2B99A 4CLOB 4KUHA 4X9XA 2RJOA 3L6BA 4XFJA 1KDYA 5KTMA 3BKWA 5KYYA 1TCUA 4KMRA 3WV4A 3GZJA 1LLUA 1XRNA 4AJNA 4YC7A 4QX6A 2XBLA 1KS2A 1IWPB 1YZKA 2Y3IA 1BCSB 4OHUA 2DT8A 4FVTA 3PNYA 4NU0A 4PAQA 3NV7A 2EG5A 1LW6E 3A28A 1AGYA 1CQXA 4MKZA 3V80A 1ESDA 4NNPA 2QA5A 4DIFA 5A6VA 1LI7A 3CIOA 4YDQA 2JVIA 4FYXA 2A67A 3HUUA 3S70A 4EHHA 1E79A 3RRNA 4IDBA 3E84A 2DTDA 1IULA 3KJQA 4YRAA 5IDQA 2FFBA 1KE2A 3DDUA 2IYXA 3HJRA 4C4XA 3Q3GE 1R6VA 1FP1D 1H05A 1LBHA 2WKPA 3GB9A 4JLAA 3CVJA 2QE7A 5AM4A 4L07A 2O1EA 4KUEA 5F35A 4EJFA 4KV9A 4IR7A 4ER0A 3SI7A 1SUBA 1S1MA 1FUUA 1EZ4A 2ILTA 4O0MA 1I33A 2WPNA 4LHEA 3UJCA 2WJJA 4DLAA 3QBVA 2A30A 4YAUA 5ITWA 3K2QA 1QX3A 1H2RS 3V8PA 3C3AA 4KXFB 2IHZA 3LC7O 5K5EA 4LZJA 5CAEA 3HJCA 4UQOA 1Q1GA 3ZE0B 3D31A 1MRSA 2QLTA 1MG0A 1NVVQ 3NJRA 4LHXA 4G0XA 2AX4A 1PBTA 2KMLA 4E33A 1OIVA 4MGZR 4PF1A 2RG1A 2OK7A 2AWOA 4R6WA 3S7TA 4US1R 1R0XA 1YZFA 1ZI9A 3T3NA 2P0EA 3UUWA 2YZ2A 1G3RA 3I1YA 2P3SA 4EOGA 1EUCA 4UREA 4IQGA 3DAYA 4Q47A 1WLYA 3HGQA 4K9LA 5DKFA 4YMVA 5A3QA 4LDPA 5ULLA 4BO4A 3T15A 5JBIA 4BFWA 4EEZA 3RTEA 1U2PA 1V1MB 2Y1LA 3LJKA 2Z1MA 4LOLA 5FO0A 2VXCA 5C8VA 5JV5A 2HF2A 1UJ4A 3ETCA 1UDWA 4P34A 4EDFA 3OWXA 2EAUA 3B1XA 5DK4A 4FFBB 4G37A 1R3UA 3WBBA 4CTMA 1SXJC 2PUEA 3GEDA 2GKGA 3OOYA 4UDXX 2PR7A 4LJ7A 4C6SA 1RWOA 4GI3A 1NYQA 1CFZA 4XIYA 4A0SA 4RSGA 4NV1A 2O0KA 3OT5A 3SF8B 3OD5A 4QYIB 1Q77A 3K0FB 4D8WA 3C7KA 2VZ9A 5KSWB 3T9EA 4MKFA 3KUUA 3FNBA 1N1GA 3AHEA 2WU1A 3THOA 1ZMBA 3RC8A 2A94A 3GT4A 2O1XA 3F71A 3HHEA 1EINA 5ALZA 4LSGA 5ECDA 5DCYA 1DAOA 5B1IA 2B94A 2JIOA 4KXMA 3TTWA 4CTOA 3DE3X 3DC7A 5KO2A 3IQDB 3GUZA 1Z35A 1BHQ1 1SIOA 2I34A 4ARVA 3C3MA 3BRCA 3SJZA 2BJWA 1G7CA 3T41A 2FX3A 2J3KA 3DLIA 4R1UA 5TMDA 4EA8A 3UB4A 3QVMA 5GGYA 4ZHQB 4B4OA 4Z4QA 3ER6A 4DIMA 1U7ZA 3X1ZA 1XCGB 3RF7A 2C04A 3I1JA 4A6PA 4C4SA 3K2IA 3EARA 1G4HA 3NWBA 1WZIA 4G0QA 1JU9A 3DKIA 3PVCA 2DUJA 3RNOA 3PX7A 1RT9A 2BHRA 3NTVA 4HTFB 2O5VA 3FIUA 1G63A 3CUEF 2CF6A 4KFCA 5DSZA 1NY5A 5EYPA 1THMA 4YJ3F 3PNVA 4WLUA 3VNBA 5BQFA 1AKUA 2K4MA 3MLEA 2EEZA 1JLHA 5DNWA 1T5TA 3W5IA 5AMXA 3CV3A 3HB7A 4LJSA 1BQ4A 1TQHA 4ICIA 3RYFA 2Y68A 3H7IA 3OEEA 3WG9A 5TLSA 2XIJA 4B33A 1B2RA 5L4SA 5IEBA 1OLUB 2AV6A 5A7GA 2H65A 3QNWA 4YCBA 4PLCA 1PFVA 2C58A 2COUA 5KHOC 3U4IA 2O6LA 2QRPA 4W5JA 4YXWD 4KO2S 1VJGA 3OSZA 3CB2A 4IG4A 1WCYA 3ZVKA 3AONB 4O4HB 5DPMA 2DBQA 5E2IA 4EY6A 4RHYA 3AUTA 1YV9A 5HDBB 2BGRA 2Z2YA 4C2BA 5DP1A 5A9SA 2L17A 4DG8A 2I6SA 3QFSA 1CDOA 2AQ8A 3S2GA 3DDCA 2BZ0A 2IEBA 1D1TA 4TROA 2FWPA 4J7CA 4PLZA 4F5YA 1PEKE 4D8YA 2PUDA 1NX6A 5CT6A 4DA0A 1TECE 2J3HA 3A4YA 4EVIA 2QKYA 2LKCA 3V1NA 1LPBB 2W2LA 1VKNA 4ODIA 3V1TC 1EQUA 4Q4AB 5I7HA 2HFJA 4M1OA 3WLSA 3JAKB 3ZWXA 5C35A 1T10A 3PHGA 3O4JA 2CXNA 2V74B 4PGAA 5JYBA 5C80A 4OKIA 1Y8RA 3SMQA 3UMSA 1J1ZA 3Q41A 1YRYE 2XNCA 1JV2B 3HZOA 2ISQA 3ENNA 3IIKA 3FZEA 3HBFA 1BDIA 2O8NA 5BQOA 2UUAB 3DFUA 4QXRA 3QKTA 2WWVD 1YL6A 2LDBA 4MYHA 3T5BA 3VSAA 1UIMA 2INGX 1PYOA 4BNGA 3BEOA 2GN1A 1E63A 3FF4A 3RV3A 1Z34A 1KIFA 4WXPA 2QX7A 1BAPA 5F2OA 3R7SA 3TIIA 2K7FA 3N07A 1TYEB 2G1PA 1L4MA 2FP4B 2VK2A 1W36C 2UAGA 3ON5A 1U94A 5G4LA 2P78A 1T0JB 1NUAA 4B2YA 1TD1A 4QM6A 1DWOA 1ZXBA 3CF4A 5EJ2A 2G3YA 2OE2A 1Z0ZA 2NXNA 3W5VA 3JRWA 3CH6A 2CEKA 1DWQA 1DTWB 3GFBA 4R41A 4RX1A 4KQXA 1YB5A 4UDOA 4DV2B 2HTFA 3ZHTA 2QTCA 3KVNA 1BWRA 4IX9A 3PGVA 1XMQB 1BIFA 3AI3A 2F64A 2OENG 3AGPA 4J91A 3W1WA 4IYJA 4ZYXA 2QW8A 3ZJUA 5EESA 2V6FA 4TS4A 4F21A 2ZSAA 3MTBA 3P5SA 4LDAA 3L7OA 1R16A 2B6NA 2PIAA 2Q5OA 3TLGB 1JKJB 5A3VA 1OX4B 4I6EA 3LHIA 4HEA1 1G6HA 1P5FA 3EDYA 4RZ2A 4QPPA 4EI8A 1SHZA 4UNQA 3TQSA 1O95A 3GF4A 3Q9LA 1QFMA 4KQIA 1PT5A 1SG9A 3EG9A 1GZ7A 2BBWA 4QECA 2EJBA 4NV3A 1O08A 5TQJA 4YGYA 2GAOA 1G41A 2CHEA 2X0KA 2Y67A 3AFHA 3JWHA 4URHA 4DILA 1AG9A 3B53X 3SY8A 2I66A 3D3KA 3VPAA 1JIVA 5BXQC 4I6GA 4YP6A 1UINA 3PQ2A 1YO6A 5B53A 2O23A 4XZ3A 1PR0A 1ODLA 3PHCA 1C9JA 4DC9A 1QH8B 4K1XA 5SZIA 1PL7A 2GAIA 3IT3A 4G4IA 3KKLA 4HDKA 4MS3B 4NDAA 4Y7DA 5BUZA 2D0IA 3PFWO 1QFZA 3STVA 1NP6A 1M5TA 3K0BA 2OVFA 2ZRBA 3GBPA 3QI7A 4XM0A 1N77A 2IBSA 3FLEA 1RXWA 2JFYA 3B9RA 5DI3A 5D01A 1VPDA 1L9XA 3FFBA 3O31A 5KYWA 1UKBA 4MP3A 1NP7A 5IWAB 2GLTA 3N2KB 1Z5VA 3WMGA 4FOPA 1J20A 1JVSA 5K3SA 4C5CA 1JKFA 4NJMB 1WXQA 1KP3A 2NO5A 1HC7A 1TNDA 4PYRA 1VJRA 1OU0A 1DEXA 2VWHA 4XGNA 1EVJA 2YQ4A 2BP7A 1CE8A 5T67A 3USES 1EM8B 2NP7A 2FNAA 2O2GA 3CA8A 2VPQA 3IQXA 1MDBA 2P6RA 1FFCA 1OAKA 2IXBA 3EH1A 3F6YA 2O3QA 4H27A 4LY6A 4RHTA 3VR5D 3ANMA 5KS2A 1O8CA 1OTXA 4L4ZA 3F3MA 1Y0BA 1CQPA 1WY5A 2ZIEA 1N33B 1QZXA 1RMYA 3WTCA 5CDGA 1GO2A 3N9IA 1SCIA 3FMGA 3M9LA 2VJAA 2X77A 4MKRA 3WY9A 4C9BA 3REGA 2V3CC 2VAPA 5D5PA 5LVAA 2DQKA 3GP5A 2R8BA 3HFRA 4MQMA 3S2SA 3SYRA 1CUEA 4DJTA 1G7TA 1HE3A 3D3NA 3T5AA 1WMDA 3H97A 4KQEA 1ZRNA 3DDOA 4XLTA 5JARA 2PJZA 4ND5A 1HY3A 1CD5A 3RIGA 5K0BA 3ER8A 4N0DA 2O8CA 4V0MA 4M0KA 3RDPA 4FQ7A 4GGPA 4KQ9A 1K6MA 1KHHA 1W0JD 5JCPA 5TVKA 3G6WA 1NQAO 3K09A 1NV8A 4QKQA 1ORWA 1RXCA 2CLLB 2I3GA 2Z0MA 3EVBA 4F4UA 4CXMA 3K31A 3UHJA 3IDOA 5LP6B 1R0CA 1F60A 2D5BA 2WPDD 3DEHA 4LSWA 5FLXA 4BX8A 1W5AA 4GRDA 1WV1A 4Z0PA 3I8OA 1RWMA 2DXIA 1IJEA 1FQOA 4QUEA 4Q3LA 2IY9A 3GD5A 1E4YA 1X7GA 3PKIA 4KN8A 4BVJA 3TL6A 4X92A 4Z2AA 4NK4A 1NZDA 1KFCB 2VZ8A 1FB5A 4G0PA 1MGOA 1MAWA 4KXLA 3CPJB 2Y9PB 3L40A 4OI4A 3MTIA 4GX5A 5KNCH 4P3NA 3U7JA 1G8KA 1I3NA 1SBNE 1Z6TA 1EH5A 1JEQB 4EHNA 1ZYUA 3K9WA 1WUJS 5EA2A 1W2GA 2FUCA 2XQIA 2H48A 5IKPA 2LTAA 3O8RA 3JZMA 5BWNA 4L2IB 1IY2A 2XTNA 4MQ6A 1ONOA 5IHXA 3PK0A 1QHIA 2BFWA 2NVOA 4I46A 3IEMA 2I8LA 1HBJA 2VPTA 3F9IA 3BRWA 2XGSA 4D7AA 2XMPA 1FJ2A 2HNBA 2ILVA 3M89A 4J0HA 4BXOB 4YQFA 4N7JA 4UBNA 3UT5B 3TWOA 1IUOA 3OTIA 2HV8A 5HVNA 2UDPA 3R3SA 4XSHA 4CHGA 1NNLA 2ST1A 4PBRA 4DW8A 5DH9A 2AXNA 4MEJA 4YUYA 3QLEA 4N76A 3SM3A 2ZCJA 1J1IA 4BO8A 1XTVA 3NWEA 1H1DA 5D3KA 2G80A 3H9EO 3EE6A 2F3PA 4K6HA 5C8XA 2EP8A 2I03A 4DPKA 3E6AA 3KC2A 3R3UA 2IEGA 1V3UA 1YMQA 1QONA 2IA5A 2E7ZA 3DVRX 1G64A 3I9KA 4YJ3B 2OGWA 5BV7A 1BCRA 1YOBA 2G0AA 4RJ2A 1ECFA 1YMUA 1ZM9A 1XCJA 2J3IA 2ZT8A 4MWSA 4WXYB 3OX3A 4RYDA 4CETA 4C30A 1S2MA 4IS3A 3D8SA 5JOQA 4ZDWA 2UU9B 1DFHA 2ZE7A 3COPA 2BELA 1G9SA 4L7QA 1RR6A 1X2BA 2A1TS 1RHKA 3BGVA 3NIGB 4PLPA 3MA0A 1WSAA 1O94D 3K0KA 4GR4A 5ALLA 5H82A 4BGEA 5FUQA 1HR0B 2AGVA 4X84A 4CNBA 2BFPA 2EGHA 2VJKA 2XNSA 3SOPA 1EVZA 1ZGBA 2C2HA 2EKDA 3AY7A 3BA1A 4Y1RB 5JDIA 4GZLA 4WUVA 1GA1A 2HHHB 2VHYA 3OJFA 4M1YA 2XWPA 4TZTA 3LUFA 2LUOA 2B5WA 3M6LA 4F9TA 7ABPA 4PSUA 1W4BA 1GFZA 1XZAA 4Q1CA 4JB8A 3D3JA 4HWTA 4NEQA 5EIBD 5J9FA 1SXGA 2YWDA 2OHJA 3D8TA 1H3NA 1MEJA 1L4KA 1M7BA 3E58A 3ZE8A 5EKTA 4HWGA 3H2YA 2VHCA 3FNFA 4MQ5A 4MW7A 2HHJA 4TTPA 3W8NA 2AN3A 3VVMA 1W5SA 1TJNA 2RHRA 2WT9A 1JECA 4KIFA 4MGIR 4QPCA 4HGNA 1A5BB 2JIBA 3TQOA 4MV0A 5EZYF 3V1UA 1AM4D 2V5AA 4Q4DA 3E3LA 4BNUA 1B3BA 4WX2B 2HREA 4KXQA 4HAOA 2CKMA 2B3DA 2Y1KA 3U4HA 4XQ0A 5LQMA 5G40A 3K71B 1ECGA 2PXAA 2Q3HA 1X1SA 4JCOA 1F12A 3Q0TA 2BTOA 2HU7A 2V1XA 1H1LB 5LN1A 2V6BA 1P3JA 5FH9A 3QIVA 1F8YA 4NSNA 3I5MA 5B2EA 4YRTA 3Q87B 4ZCMA 2CLMB 1PR2A 4KJXA 1K6JA 1U7UA 1XAGA 4NARA 3TNLA 3OD1A 1OZGA 5NULA 1E7RA 4NESA 2YKGA 2O8DB 1X7YB 1A71A 4OEHA 3PJDA 4QA9A 4FSHA 1ATZA 3A9UA 3BIJA 4YCAA 3SXUA 3BQ9A 4JQZA 1QIHA 2VYFA 1CETA 5AT1A 2HCRA 4C2TA 3LRTA 1X87A 3OY7A 1D09A 4I55A 3ROGA 1TIPA 5L3QB 4TV8F 2ZYRA 3CRW1 4UVDA 2H2FA 1Z5ZA 2V9PA 4ZRNA 1EUYA 1G8MA 2VBFA 1DTEA 2FSFA 2VT2A 4MI3A 2DYKA 4L8YA 5EE0A 4J16C 1EP2B 4FLMA 1FYFA 1SKUA 2FOIA 2HGZA 3EAFA 4WW0A 2CHVA 3ETHA 4H3KB 2H07A 1CB0A 4ETMA 4CG3A 1GP2A 3PWTA 1G8YA 1KEUA 1P2DA 4H7FA 2V6GA 4NJEB 4OMFG 5CPBA 1BQEA 1ESMA 2P2CA 4L2IA 3BMXA 4P6VF 4KREA 4MGYR 4CW7A 4ETWA 5KYKA 4M8NE 3IHTA 4X41A 2YWGA 5HCUA 3ZCVA 4AWBA 1IK4A 2QU7A 5EJAA 3W04A 3JVVA 6Q21A 5IK2A 4DBLC 4O0LA 2GN4A 1MVNA 1WD5A 2HA6A 2P1RA 5TR9A 2OYCA 3ZTYA 2CWDA 5JNRA 5JS1A 1AMOA 1SU4A 1SUAA 3EVZA 5C7YA 4GLFA 5G4KA 3QLTA 1OGIA 2YINC 1P2FA 1REQA 3RAJA 2BLNA 2JW5A 2W6JD 1MOSA 3WNBA 2EKZA 3R3YA 1GVHA 3A6FA 3FSRA 3OBBA 4QTTB 1SIWA 2J0SA 1WXDA 1RMTA 3ZKWB 3X43A 5C9ZA 2CE2X 2R1TA 3IVGA 1WVGA 4OG2A 1RIFA 1ZH8A 2VP2A 3ESDA 3WA7A 5J4YA 1P4SA 2UZ1B 2QN3A 2GETA 5F2KA 3ZZTA 4UMFA 3LVQE 1A5SB 1IOVA 2WSYB 4A23A 1GTVA 3DCNA 3AESA 1X7ZA 1R8XA 3OLVA 4D9MA 2QS9A 1VE6A 1JMVA 3TTSA 1FF9A 1VPVA 4LQDA 5KNDA 3FWNA 4KUGA 4DTCA 4MUIA 4OB8A 4UUPA 5KJ1A 4I4IA 1R0SA 3T3HA 1SC6A 3D0KA 1TT5B 4R9SA 3AHJA 3FETA 3CR8A 4J1TC 4JBXA 4BLUA 4H4EA 4TRNA 2Q29A 3D8NA 1JLSA 3T94A 3RSOA 2SCUB 3K9BA 4R3UC 4W5TA 2BMJA 4BVLA 4CEJB 1DAMA 1SEVA 2YV4A 3HV2A 1ECLA 4CQMD 4OQZA 5LIRA 3CRVA 3O2QB 4Q1VA 3HCOA 3N8DA 1PS8A 4TYNA 3PEUA 3IUYA 4O1HA 5CM2Z 1DIGA 5L6MB 1FUEA 1MRNA 2AUTA 3OT4A 4DR5B 1MPXA 2P4EA 4ZT3A 1DAKA 1G6Q1 4KN6A 8GPBA 4C03A 3WAKA 2VUSA 3OY2A 4GYWA 1EB8A 4UPVA 5IVKA 3UXHA 1GZVA 4HGPA 3CE9A 2O7SA 3S2EA 5JYEA 3HL4A 2W48A 2NAFA 3DOJA 3O94A 1MZPA 4GT1A 3KQNA 5KQRA 1ODJA 3O95A 5DIZA 1X7XB 2R1VB 3W3AD 2LKDA 4GPEA 4KIWA 4OHRA 4Q7JB 1FFGA 3TZBA 5LJLA 3SDSA 1AF4A 3AHFA 4UTNA 1BWQA 2MSDB 4J6EA 2O7NA 4TMKA 1XKLA 2N3ZA 3HRIA 1O9BA 3IRUA 3NV9A 4M8KA 4WWHA 4CEHA 3F49S 1EUZA 2Q4DA 1MBZA 1YAHA 3HS3A 1J8YF 3IVRA 1YS1X 4JSYA 1HG1A 1L5VA 1PE0A 4MLDA 5DF1A 1RRKA 5KC8A 2QJFA 4XH9B 5KPJA 1U8CB 1T1RA 1ZH4A 1I7NA 2ZIGA 3NEJA 4KFSA 3NBAA 4P31A 2FVXA 2M6LA 3RVLA 3SEAA 2MSWA 2ZI9A 5BURA 2I2WA 5JNVA 3IT1A 3OCXA 3D81A 3IP3A 4HQ0A 4K86A 4PG7A 5ESXA 3RHFA 2DHCA 1M34A 2R47A 1V41E 3BD7A 3FAKA 3P2KA 4IIYA 1O0BA 4H08A 4EB8A 4Q37A 1I94B 2NN3C 4J16A 4N65A 1COWA 1A50B 3ZWKA 4KAXA 2V45A 4I5EA 3LCUA 4JQSA 2NPIA 4UCWA 1VLMA 1W8DA 2GSWA 3MLBA 4BQQA 1TIKA 5C37A 1UBTS 5M34A 3EXFA 4RQTA 3UATA 4V0LA 5TNXA 2FZEA 2WF7A 3QUQA 3UJDA 1QG2A 5BUQA 3DEKA 1KAOA 3OFVA 1J07A 1QYIA 3OZDA 4U5XA 4LFCB 1CNMA 3CINA 4HDQB 2ZITA 2IIVA 3PA6A 1JXAA 3GQVA 1IJBA 4QARA 1JFRA 3C7AA 1VYTA 1JR4A 2R79A 2X4DA 3QMVA 3UB3A 2YVKA 1V5GA 4G1FA 3HP1A 5FX2A 1L8LA 5CEEA 1VHTA 4Q9KA 3N2GB 5C1OA 1NVFA 2BWJA 2Y1XA 3BZUA 3C3PA 1D2GA 5D7NA 2WE8A 4JL5A 4EMBA 2OHOA 1N9KA 3FFWA 1CZOA 2H0AA 4U2KA 5C3UA 3WISA 2XCSB 4IUYA 3N8IA 3JWIA 1Z6QA 2ECPA 5IJAA 3BIOA 4YYZA 4FMDF 3OE5A 1XO1A 5I4IA 3L8DA 2ERCA 5IBQA 1QHGA 3ET4A 4JLWA 4XD7D 2RK4A 1V0JA 2JD0A 4KBYA 1UZUA 1N5OX 2BEWA 5HQ3A 1YB2A 4KLCA 1YQTA 3FLBA 1KYIA 5EUBA 5ABPA 3HXPA 1USUA 4XM1A 3ER9A 3RRFA 1DFGA 1G2IA 5C18A 1NW3A 2ZCUA 4QASA 1NYRA 4XD2A 5GVSA 1QS0A 2X1HA 3HEAA 3LPLA 2FYTA 4R51A 4DJEC 1FRVA 3IODA 1N2XA 1P5ZB 4BUZA 2B82A 4GXQA 1R5JA 5FP0A 2AR9A 2F3RA 2X76A 2E37A 4JUFA 4BN5A 3GJXC 4DABA 2ZAMA 2P6PA 3EGDB 4ZT5A 1AVTA 2PLRA 4WFIA 2WD7A 4G81A 5GZ1A 5KIAA 2BPOA 1S8AA 1U2SA 3LCJA 4M9UA 1C0IA 2WTNA 2WNHA 3WR5A 4GKVA 1HDRA 4HEA6 1X15A 2C2MA 1XPRA 1Y9ZA 3NHMA 2P11A 4BPRA 3MFQA 3GVCA 1C9MA 1ZMTA 4TLMB 5G3YA 4Y1GA 5CGZA 4CMGA 4IY1A 2JAQA 5EVJA 2XZLA 4DNPA 4BO3A 3KQWA 4ZV4A 3CKLA 2BTQA 3GDHA 1E4EB 1AD2A 1UBFA 3GZNB 2EDCA 3ZVLA 4XW2A 1G2OA 4B7UA 4YX9A 4B84A 5G2OA 5CB4F 4MWTA 5AW3A 1FFDA 3KEOA 2G9QA 3T12A 2JFVA 2FP3A 4IJ6A 2BHTA 1NG9A 2BIFA 3OPYA 4L5BA 5EXTA 2VP6A 1XTKA 2RKWA 1A8PA 2QVXX 3I72A 2IU3A 5FF9A 1ESZA 2G70A 2OQRA 3GA0A 2C3UA 2ZTSA 3OCCA 1DG1G 2J0UB 4FU0A 1LI5A 3VKFA 3K30A 4MPJA 3TCKA 1NPDA 2Q2VA 3GG9A 3KPJA 1B8VA 3KZKA 4KQHA 5C5EA 4HRXA 4JODA 3R5SA 3CCBA 4FX2A 4PYMA 1G5QA 2OBYA 4QQNA 1ZBQA 5EUQB 2ZSIA 3U4QB 3KQUA 2JKVA 2ZIWB 2RJ3A 2CHGA 2BCGY 2IH5A 5FTMA 4J6FA 2JH3A 4GYKA 2XBUA 2C2YA 2OBBA 1C3OA 2J32A 2PVSA 4BGVA 2ACVA 4LMRA 5CM8B 4YFYA 1LRKA 3S99A 2RKBA 3UA4A 3FI9A 1VMKA 5HBGA 4R7GA 4UTXA 4KRGA 4YJHA 5SICE 4EJMA 3FNRA 3D1LA 4XAQA 2QUZA 5ENZA 5IUKC 3SFTA 1QIEA 3CZ5A 3MTQA 3ZZ0A 4C0HA 1NXOA 3BXGA 3GLQA 2VPIA 1D6SA 4L50A 4XARA 4NBTA 5IFLA 4CGZA 5FPKA 4TV8B 4JS0A 2CEAA 5HFAA 2OL4A 3UH0A 4O4LA 1QO0D 2VXOA 3C0KA 5FFNA 1A2BA 3HDYA 4FYKA 3M33A 1ZM4A 7MDHA 3QLJA 5LD2C 4RA6A 3OQHA 3TRHA 3I9LA 5AJHA 4MMXB 3RSLA 2D5IA 2J59A 3JWGA 1ISIA 4B6RA 2XSZA 4FZ3A 1DRKA 2JLXA 3WKCA 3V48A 1A3CA 2HXSA 1BD3A 3F6RA 2B20A 1HQYE 4P53A 5G02A 4O2RA 1WNTA 1DDIA 2I1VB 3MK31 2W6ID 9ABPA 3WBFA 1CDZA 3A7DA 3MMXA 2WQ7A 3BTVA 4GBJA 2VWGA 1NBIA 4YUVA 1P9RA 2C5AA 2FLWA 2RKOA 4PNPA 3WLTA 1GFIA 1Z17A 5BSVA 4WBSA 1TCCA 2FWBA 2J0EA 3I6MA 5FJIA 2HRQA 4OY3A 5TEWA 2H5IA 3M4ZA 1KK2A 1SURA 1TD9A 2I8AA 3G5AA 1ZIPA 3HK2A 4IH9A 1GPAA 2Z1DA 3FBGA 4UOEA 1UXHA 5JS2A 2DY0A 2I2BA 2IUTA 1UWVA 1NTRA 2YZ7A 1H3FA 3F8WA 4X91A 2C3MA 5T3UA 3E9MA 1FA9A 3D3EA 1C3EA 3PDJA 4UPDA 3ZW9A 1DX6A 1FXSA 1BC5A 3M1YA 4NZ9A 4X3PA 1NNSA 2HU2A 1DJLA 1PQPA 4B73A 3EUFA 1KQPA 3OF2A 1XI2A 3UGJA 3GNSA 3L1JA 3VV2A 1FXUA 3RSHA 4EYOA 4IQFA 1XZJA 2WFZA 1UBEA 2IXEA 5JCJA 2PKRA 4D98A 1Z7YA 4NLLA 5LMZA 1JNYA 3KYDA 1IL0A 4EJ6A 3ZDZB 1Z6XA 3H86A 2P3LA 3IP1A 1GPLA 1PX2A 3RC1A 4QZVA 5JHGB 4FS8A 3LYUA 4KKVA 4QBIA 5CMLA 1GPYA 2C7PA 4H31A 4F92B 4NBKA 3EMDA 3N2IA 3WKDA 4AULA 1JNXX 2D3TA 2E4UA 2ZJ8A 1LBTA 2NWQA 3RKSA 1E2QA 2GS9A 4BO5A 1RWWA 3ICCA 2ZYDA 1CUJA 1A27A 1JE0A 1A69A 1AUXA 4R9NA 1SC3A 5FA8A 4RK4A 3A3KA 1ZCJA 3QWFA 1CB7A 2HQOA 4HPJB 3JQPA 3G0BA 3H4VA 1U3WA 2Q27A 1RI1A 3QBEA 4YRSA 1U8EA 1ZKMA 4HGRA 4EUFA 1FL9A 1NVGA 4V2UA 2PA0A 1VPWA 4F3RA 3O3MB 3TB4A 2Z8XA 4UDYX 1FU4A 3E9EA 1VL5A 2EP5A 3WNZA 1KVQA 1NR1A 4A73A 2O57A 5AKHA 4DLTA 5KKCA 5KNBA 1GYPA 1A7JA 2DUWA 2G6BA 4AG5A 4DQUA 4EX6A 4TVSA 4L5AA 4KGZA 4CKZA 2O4UX 4UFOA 2RI0A 3Q7EA 4DJFC 1KJYA 1F6BA 3EW7A 3GZTB 1T6ZA 2ODQA 1L2TA 3AHGA 1HDCA 1G6OA 2OCGA 1LZLA 2FMIA 3GMTA 1ADBA 4Q34A 3URMA 1EGHA 4RD3A 3SVTA 4FZJA 3LYHA 2RHWA 3DE6X 4TMZA 3GP3A 3QPVA 4MUGA 2C42A 5E4FA 2JGRA 4R7TA 3CCCA 1IQPA 1KMHA 3M6WA 4WACA 2NU9B 1G19A 1YRWA 2QL5A 2PWPA 4M7OA 1UJMA 4IZOA 4Q66C 5DHPA 3VPXA 1RYBA 5BSGA 2REXB 4G1CA 3RUHA 1TMOA 4YMSA 3OJXA 2JG3A 2PKYX 2XVZA 4LXXA 1N0WA 2B9VA 1KJQA 1FYWA 1T36B 3H19A 1ULTA 5B55A 5CFNA 3HKEB 2YNMD 3B6IA 3B9QA 5BMOA 1S2OA 5JASA 5FKJA 4PSAA 2CUTA 1P62B 1RTKA 5TF0A 1OYOA 3NHLA 4N8EA 1P0PA 1CRLA 3VKUA 5FV4A 2H54A 4J07A 1YXMA 4AKHA 4TWRA 1JG7A 4RGQA 3QVKA 4JK3A 4XYBA 4B4WA 5HZMA 1FS6A 4RXUA 1OGYA 2EYUA 3RS5A 2IU6A 2HA3A 2XMBA 2RGCA 4WBXC 1Y3AA 4CZ2A 4AN0A 2JFFA 2DE0X 2NZJA 1KSJA 1Z2AA 4WZZA 2GOYA 5BR7A 3K15A 1OFVA 1MJGM 1Y3CE 2WIGA 2Y8EA 4WESB 3D6NB 1OHHA 2ZRCA 2NW6A 2GJ8A 3OTHA 2EBUA 2XLBA 4PV7A 1V1RA 4MVXA 3WYCA 1G2PA 1HZJA 1NFRA 2GEBA 3DAHA 4HZUB 4C14A 1DKNA 2FZGA 3ESCA 3Q3CA 4L8LA 4F3YA 1DRJA 5K6TA 3OJLA 3MN1A 4DEYA 2GBLC 4XIJA 1E6CA 1VFPA 2C2XA 2NIPA 4OM7A 4D9KA 2MYTA 4H1TA 3KB6A 1Y7TA 2QPOA 1JW9B 4ENTA 1ZI6A 4CLHA 4F4HA 1Q7TA 3GLFA 2Z5VA 4Q4JB 4LFBB 4KLZA 5KDLA 3J7AC 4IQ0A 3DOIA 2PX8A 2QENA 3TJZA 2EL9A 3DWGA 1IN1A 1NMQA 3SJ7A 2YJTD 3C5WP 1NF9A 1OZHA 1XR3A 2MYUA 2QN1A 1D4AA 3FOAA 3MOIA 1R37A 3RH0A 3UVEA 2WIBA 3QIAA 4OIFA 5TARA 4BCCA 3JZFA 3WGQA 3P4XA 2AB0A 3PGJA 3EIXA 3GGSA 3IBSA 2HADA 3W3ZB 4NCBA 4DPMA 2JASA 3EHDA 3GPDG 2KHZA 4MDYA 5C53B 4MWOA 4ZYWA 3BXZA 3AF6A 4Q4CA 3JARA 1T1JA 3EQ7A 4BRUA 3RK0A 3P19A 5JFOA 4CQJA 1XJQA 3QEJA 4V1CB 5CA0A 1NJ1A 1LB1B 3FVQA 4Y9TA 4CCWA 3K6KA 2AKAB 3L8MA 3DTVA 1NONA 2ZBQA 1OI7A 1UK7A 2XTMA 3I04A 4EY3A 1I10A 2ZJ3A 3IIEA 1JHMA 5ALOA 4F56A 1RIIA 1UWCA 2OC9A 4KQ6A 2ASEA 4UULA 2L82A 1NLMA 1EFPA 1RJWA 2YN2A 3SAJA 3KYBA 1B42A 3LUAA 3X2SA 2AFIB 3COSA 3PHJA 1I6LA 2XCUA 3ETGA 1CWUA 4HNGA 4G56A 4J0IA 4KVGA 4NG5A 4S2UA 3T6KA 5CHYA 5CITA 2ZUEA 4JGBA 3GQBB 5F1YA 3IALA 4RFSB 3WIEA 1Y7HA 2ZETA 1ZK4A 5BYBA 4MZDA 2PH1A 1X9GA 2OV8A 3PC6A 3R5TA 5TQVA 4RPLA 4XJVA 3R20A 3R7AA 3MJVA 2PPVA 4HUQA 4XTRA 1BDJA 2YWJA 2YIJA 3UUEA 1YFJA 2ORED 1IM8A 1NY6A 2FHPA 4LGCA 1CP3A 4DR3B 1C5KA 4YCDA 3IT2A 1IXSB 3S2YA 1MO4A 3PNQA 3COWA 4BFCA 4K5QA 2BFDB 3I32A 3F47A 2P3QA 1P4GA 2Z9CA 2OFFA 3VHQA 4DVJA 3IOEA 1YZUA 3PX3A 3H7AA 1EFKA 4Q21A 1B0AA 2BW0A 4RABA 2FOLA 5K3AA 3Q85A 5IANA 2XCIA 3I4LA 5I8WA 1NMXA 1ECCA 5CUQA 3B89A 1GPDG 1Y4ZA 5L3SB 4H4CA 3CRNA 5DTJA 1Y63A 4DIUA 1F0PA 2C84A 1KFJB 1C8LA 5EHXA 1RWBA 3TMYA 4E21A 4UUQA 5HZGA 4BU1A 1W19A 1PCXA 1M2VA 1WOMA 2VP4A 4XRRA 3D6HA 3G1WA 2AH5A 4PCVA 1CW2B 3VISA 3ZGVA 3I04M 1J39A 3KM0A 2XTJA 3A6EA 4Z7QB 2O48X 2D1FA 2E9SA 1XHFA 4LC9A 1RAHA 5IUNC 1QRTA 5EZ6B 1TA4A 1TK2A 1Y42X 2ARKA 2JZNA 4U7FA 4UEQA 5DFAA 5M2QA 1A4IA 1YS6A 2Q1TA 3II6X 5D6OA 4BYGA 3UG7A 3LL4A 3JXEA 1H4VB 1N5LA 3T3IA 2V5UA 3M4YA 1YDHA 4W8OA 4KZPA 5IYZA 1Q7CA 4HWOA 4MUYA 1MB2A 5IMSA 1HE1C 4M0UA 1NFFA 3H05A 3BN3A 1IN7A 3ROFA 5AVQA 2JGMA 1K08A 3FA2A 3PC7A 4JJAA 4DADA 3DR3A 4X60A 1GLGA 3UC5A 4YROA 1G60A 1GZ3A 3JVIA 1ADFA 2O2XA 4BO2A 2Q1UA 3FYSA 1GNLA 4KX3A 3WMRA 1UKAA 3NHZA 4AZ0B 1IZ9A 2P62A 4XX0A 5EERA 1HQDA 1VP9A 2C1ZA 3L0PA 5IW8A 2HJRA 2W6ZA 3X1XA 4NE9A 1G20B 2DCUA 3RSQA 2PFSA 1AB5A 4O2AA 4TX1A 3ZLVA 2G1JA 2RHBA 2Z1NA 4L9AA 5IDYA 5LC1A 1UP6A 2Q2WA 1NBMA 3R3VA 4IIBA 2R8YA 2CYAA 5B7GA 3HVJA 2BMFA 4HWRA 1KFKB 3WGHA 4R71A 1IZ0A 5C4MA 1IY1A 1PJ4A 3HNRA 4Q82A 5SY9A 1RZVA 1GPBA 1WMBA 4EYGA 2HMVA 3JATA 4RL4A 1CY1A 4OL9A 4LSZA 1L7RA 4WIAA 4E94A 1E6KA 2CDNA 3PDHA 5E38A 1UKVY 3UQYS 4O4JF 3V8NA 2A9KA 4BC1A 2QM7A 4X85A 5GADl 4JJGA 3MWJA 4ENPA 5KYXB 3MWYW 5FIUA 1UOEA 1H4TA 2QR3A 1N9GA 4JLJA 4YFVA 5B58T 4DSOA 2P7IA 2Q62A 4MGKR 4AJ1A 1PJTA 4XGIA 2D5AA 2OZVA 3DBHB 4RSRA 1M0SA 1JDBC 4HNAA 3AR8A 2R3SA 4GGOA 2DJIA 3NORA 1VE5A 2VBCA 4X24A 3GIWA 3TSWA 4KVAA 2G83A 4MUFA 4H35A 1AQJA 2OILA 2WYIA 3AKZA 2UXBB 3NIDB 1NC1A 5F77A 1XYYA 3ESAA 4FMCB 4HLUC 5DTIA 3VBCA 3L4KA 4A15A 4K9PA 4XASA 3C6MA 4PGMA 1M73E 1KDOA 3R7NA 4IIVA 4DMMA 4W9NA 2QUBA 1FNSA 1R0ZA 2WZDA 3F7TA 3VU3A 2UYYA 2YASA 4IDGA 4RYLA 3TZHA 3ZY4A 3WHIA 2OHIA 3KOWA 3Q8WA 2ORIA 1DZ3A 4MLPA 3ZH9B 2SICE 3AEQA 5IDVA 4AP6A 5BXYA 3DEYX 3GLRA 2AW5A 5FUBA 3AZOA 4OAPA 2QMZA 4ZCIA 1QFJA 1ZW1A 3WXBA 1WCIB 3OA0A 3BWDD 2QL6A 4KK4A 1TKBA 3OZXA 4D4GA 5I7EA 1J42A 4IUCS 3AM5A 1SD5A 2IPNA 4DN6A 2A78A 4UPEA 1O7JA 3LW8A 2GILA 1OFGA 1J7JA 4RVCA 1GR0A 3A9SA 3DOCA 3ST7A 3VR0A 3CONA 5DBOA 5IXJA 1Z38A 2HRBA 1DUIA 1G2QA 1P4HA 3QF7A 2XVYA 3NS7A 1O6BA 4A8JB 1G9XA 1EGMB 5EI5A 5FEMA 3SPXA 1RQNA 3BH6A 2UYQA 1GYRA 1PIWA 1XMXA 2BFCA 1AUVA 4DJDC 3EULA 2JLSA 4IQ4A 2V03A 5D87A 5E8JA 1WS6A 5H3CA 2WUEA 4WMLA 4IINA 4R1NA 4EFDA 3SZMA 4GGMX 1F3OA 1FNDA 3P9ZA 1VBMA 4KAAA 5FOWA 1A8QA 2PZJA 4C0KA 1OYYA 2VTVA 3BHNA 1SUSA 1Q0QA 1CS0A 1TM3E 3Q0IA 5BR1A 4BTEA 1ETHA 4D4JA 1JA0A 3FRIA 3CG0A 1ZGAA 2R6AA 4ER6A 2WMDA 3EVFA 2C4KA 3RG2A 2PY6A 3S1AA 3NXSA 5KUTA 5JU6A 3IQWA 5GV7A 4TQUS 4DUGA 5LZ9A 1P7YA 4ZAVA 2P30A 2VF7A 3IX7A 5IUJC 2XZTA 2AFHB 3CHYA 4C5AA 2WYUA 4LY0A 4FDUA 3G8AA 4L0DA 4P0QB 3I2JA 3QOYA 1X8JA 3TTUA 1U02A 2GCPA 1JAHA 2L69A 3C39A 1EDBA 3JVEA 5AI5A 3WNVA 4OLBA 1CDDA 2YFYA 3PEFA 4MUEA 1P7ZA 1QVAA 1G3MA 4TUYA 4M9QA 3TQCA 4B4DA 4OFWA 3JS5A 1J9GA 2A9OA 3A9CA 4OXQA 3IV7A 4RMIA 4CLDA 4ERXA 2R2GA 5B7PA 3T3GA 1O1YA 2HDWA 3LP5A 2GEKA 3BDIA 4Q48A 1RFLA 1O54A 2ZYSA 4RHUA 3RU7A 4E5NA 2HO5A 2XQFA 2XR1A 3GH1A 4M4SA 5IF3A 2C88A 3BFVA 3AVYA 3OM1A 5FFFA 2ZB2A 1CLEA 4S1VA 4FKBA 2NUPA 3E9CA 3MWDA 4DLUA 3RROA 3PGA1 2VK8A 5D00A 2PT9A 4BP9A 3K8ZA 4HB4A 3OKCA 3P9CA 2Q2OA 3NASA 3TJRA 4P82A 1CJKC 3VZRA 2XQVA 7YASA 1QNLA 3CPHA 3NP7A 3ICWA 4PLGA 2V96A 3EC2A 2BM8A 1U3UA 2YWBA 4NAVA 4V0ME 2Q5JA 4YCJA 2M1ZA 3ZG6A 1HFWA 4JJ4A 1LQTA 1DIHA 1FVFA 1HFKA 1Q83A 2D74A 4FEAA 4ZTBA 3HNOA 4LHZA 3ES9A 4OFXA 4YRIA 3L82B 1DC6A 3T4XA 4AX4A 4ON9A 5I8PA 1IBSA 1DUVG 1NQUA 1P6XA 1ZJ6A 2MSEB 2GHIA 2ZSFA 2X9QA 1JHVA 1T1GA 2PMCA 4YJ2F 4RH3A 1DKQA 4DV6B 3KBBA 2XWSA 4QTYA 3ZDQA 2NYVA 1JH8A 3UBTA 1WMEA 3F9CA 5LWHA 2X3FA 2ORVA 4LWQA 1W4LA 2V7UA 4HTAA 4B7AA 5IF9A 1L3BA 3W1VA 3KSRA 1WM1A 1NN5A 1YS9A 3EBLA 1GSHA 1UK9A 3RSGA 5ADWA 3SWWA 2D5CA 3IAM6 1OV6A 4H7DA 5AUPB 1RAAA 4PLWA 4D56A 4FR0A 4QYWA 4PG8A 1LA2A 3DYBA 3HBLA 2XYQA 3DOFA 3SHWA 4F5ZA 3NAQA 3TOZA 3ZV7A 1LWNA 1U9YA 4JP3A 5JFGA 4K3VA 1Y9AA 4CG2A 3HI4A 1PW7A 4CMEC 4Z99A 3A9RA 1C0EA 1MOPA 1TKCA 2BRUC 2EZUA 4UATA 2H2WA 2BUBA 4BOYA 2Z57A 3NIFB 2P6UA 2RJNA 3AVWA 3ANNA 3EF0A 4FE4A 1R0YA 2CXRA 4YB8A 1PZNA 1Z5UA 4ZWNA 2DUNA 2G1AA 4XVUA 3IAS1 2OKGA 2PDAA 5E9WA 4MITA 1P1RA 1V3TA 1JMYA 5HKOA 4MS1A 4PXYA 4G24A 2XV1A 3P9KA 5IASA 4K87A 4DBZA 4YCCA 1KY4A 3HC7A 3R0VA 3THRA 2DHQA 3BWMA 5F73A 5LYYA 4X62B 3UJ8A 1UF9A 2BZSA 1WB5A 4RKWA 1E1RD 1GGNA 3L0BA 4TV9F 1H4QA 3NCHA 1VE3A 4N5DA 4HS4A 4RK5A 1Y6GA 1G59A 1XSEA 4NENB 5F5LA 3RVDA 3VVBA 3ZLTA 1I2AA 1N6LA 3P1JA 4Q7KA 4XVRA 4ZT4A 1FBTA 1ZOLA 2ZR9A 1NJGA 1SHUX 4FDAA 2VA8A 1KDVA 2VHJA 3AR3A 4DLPA 3VYWA 2HLDD 5I3CA 3S5UA 2P2NA 1IZ7A 3TZQA 1Y9JA 1E2FA 3ENKA 5K3BA 2Q3CA 1FW8A 1FP7A 3PPXA 4UBOA 2WTUA 2VQSA 1A97A 1YI0A 2OP0A 3CMMA 4F6RB 4U7DA 3KD2A 5BOSB 3O0DA 4RULA 4FDLA 5EIOA 1D2MA 2E4YA 1KR2A 1OBHA 2PLFA 3MLAA 4WECA 4AJOA 3AVXA 1NHWA 1V6CA 3VDQA 3P52A 1EP1B 2Q4BA 5HJ2A 3V42A 3GUUA 5J2UA 1Z2EA 1A5ZA 4YCNA 2XA2A 3BC1A 2VNIA 1GPWB 4UMVA 1IBLB 4NULA 1I1QB 4JT2A 5C5CA 1MAHA 1VB3A 5JT1A 4AJPA 3JQ7A 2Z9DA 3R6LA 3OQPA 1TE2A 1WXXA 3H04A 1DARA 2QD3A 3LQRA 1W581 3OX4A 2WK1A 4IDCA 3U4MA 4FCCA 2ID4A 2F9FA 2IJGX 4ZVKA 2GEDA 4KQGA 1F9AA 5B37A 4K6MA 3UFXA 1QFXA 1HYGA 2IY7A 2SKCA 3FYUB 4KPFC 1DC7A 3C3XA 3ZUGA 4GL2A 4IGIA 5F9HA 1TCAA 4QOGA 1ZXXA 2C4NA 2MINA 1C1XA 2CFRA 2D0PB 1NVMB 4F72A 5BW6B 1QVRA 2PRIA 1MN6A 2EFHB 3CNHA 4J4TA 5MHTA 1U8TA 2YV2A 2HK8A 2FRDC 3OFJA 1WTAA 3LUBA 1NIJA 2QXYA 4JJIA 3KYCA 3QPAA 5I9SA 1FEZA 1TGVA 4C6TB 4C78A 1P8JA 4MV5A 2X86A 3C8DA 3RUFA 4Z1MD 5C8YB 3C1OA 4G09A 4XQCA 3BB1A 4BVFA 4B9EA 1JEYB 1W48A 1KPGA 1FYEA 4HXGA 5C52B 3HZRA 4YHBA 5F3RA 3C5EA 4MIOA 3SVZA 2Q0SA 4OX9B 3DSRA 1UAGA 3PR3A 4XX1A 1T4MA 5THKA 2IE8A 2G72A 4L3OA 4US2R 5AVZA 3MAJA 1VCNA 1IMJA 1ITZA 3FE2A 1A2KC 4GP9A 3V4VB 3WK5A 4AN4A 5KYUB 2ZROA 3PYMA 3QBDA 2E4XA 3HADA 3E1SA 2ZSBA 4RQUA 3RRJA 5B36A 2HN9A 5GONA 3ZR4B 2WM2A 4YXWA 5LP1A 2B36A 1H6DA 2P4QA 1GR1A 4TWJA 1OX6A 1ZSVA 2B0CA 4G8BA 5AHXA 2R4TA 1BGXT 3M4NA 2V65A 5EKDA 3JY6A 3TUJC 2Q45A 4XTCS 4ASUA 2PE5A 4DBVO 1WXWA 3N1UA 1AK9A 2QM3A 1POWA 3HB0A 4EGAA 4FDMA 3HJUA 1C9EA 5KJFA 2BM9A 1CZLA 1WP9A 2JAWA 3U7FB 4KQCA 2A1UA 3LLVA 4L9WA 1CXZA 1IVNA 1JJVA 2I7TA 1BFKA 1FMLA 3G0IA 1GNTA 2JFNA 3ILHA 4FYPA 4PAOA 4Q01A 5DEIA 2BGTA 3BGDA 1EP9A 1JG4A 4O5OA 3Q6IA 1CR2A 4I2VA 1E2GA 3V9AA 4DQ0A 2VN8A 2VAXA 2XT6A 1AQYA 3FJOA 1UPBA 4QGHA 3MWGA 3VNQA 5REQA 4U7TB 3WI7A 4WCFA 1GSOA 2J3MA 4HYEA 4AF7A 4LECA 1EDZA 3DAOA 3ZU5A 3IP8A 2FSPA 3C6KA 4QREA 1SBHA 3GPLA 3KZ1E 3VPFA 1D5WA 2O2ZA 1YE8A 3U0VA 5E3HA 4F5DA 5IN4A 1F2UA 4AMZA 1DLJA 4LXQA 2C82A 4N9WA 1JPVA 4BO0A 5IX8A 3FWPA 3H2IA 1C4KA 5FI0B 4S1TA 5K8TA 3QVGA 5JJBA 3OLZA 2NU6B 1ORDA 2Q3BA 2V7GA 1LDEA 1QGUA 1VYUA 2WYVA 2YV3A 3AQIA 3CEMA 2R5WA 3MD0A 1DKLA 3VKGA 1GD1O 1U5BA 3N53A 3AF2A 3B6KA 5FV7A 3ZGXA 3I9NA 3Q7IA 3F2VA 2K2QB 1KQNA 2CFCA 1JFFA 1UQTA 5SYNA 2HMUA 4HN2A 3WLKX 2BM1A 3MBOA 2ECOA 4FIDA 3IKTA 4JI8B 2R84A 4CG0A 1KVTA 3GLHB 2FMKA 3V55A 4ZV7A 5CR9A 3ZK8A 4AB1A 4DSAA 3OQIA 1QR6A 3L9XA 1X8XA 4B75A 3E5MA 4CV0A 3ZDCA 2PZKA 1XP5A 4R1TA 3EUEA 5CW2A 1I6MA 2Y1CA 3EEFA 4D3FA 4E88A 1R10A 3JD4A 1K4MA 2X3UA 3VV3A 1ZJWA 4ZODA 3AV0B 3ZHUA 4BEVA 5FRDA 1NTOA 3RVSA 3IURA 1P1KA 1R9MA 4GX0A 4R9RA 4U0JA 5FORA 2BJVA 1BU5A 1A0OA 1RE1A 3L92A 4HQRA 1UADA 4IOLA 3OT1B 4JUDX 5PGMA 2O2EA 4JOSA 4CF5A 4EWLA 4ZPJA 5DYWA 1U5CA 3TBKA 4PZPA 1VRWA 2FRDA 3LZCA 1USWA 1I1HA 2P9CA 3BCUA 4EF6A 5KNDH 2I87A 4LVNA 4YRZA