4F1KA

Crystal structure of the mg2+ free vwa domain of plasmodium falciparum trap protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
200
structure length
200
Chain Sequence
b'EVCNDEVDLYLLMDCSGSIRRHNWVKHAVPLAMKLIQQLNLNENAIHLYANIFSNNAKEIIRLHSDASKNKEKALIIIKSLLSTNLPYGRTNLSDALLQVRKHLNDRINRENANQLVVILTDGIPDSIQDSLKESRKLNDRGVKIAVFGIGQGINVAFNRFLVGCHPSDGKCNLYADSAWENVKNVIGPFMKAVCVEVEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thrombospondin related anonymous protein
publication title Structure of Plasmodium falciparum TRAP (thrombospondin-related anonymous protein) A domain highlights distinct features in apicomplexan von Willebrand factor A homologues.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Cell adhesion
total genus 82
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4f1kA00
1M2VA 4JDUA 1M1XB 1ZOPA 3M6FA 4C2BA 1QCYA 2VDPB 2VC2B 4IXDA 1N9ZA 1RRKA 1PD0A 3K6SB 2VDLB 2XGGA 3Q3GE 1SHTX 1JV2B 2I91A 1QC5A 1V7PC 4WFQA 3TW0A 3NIDB 1CQPA 3VI4B 3BN3A 3K72B 2WW8A 1FNSA 3HXOA 3NIFB 4NENB 2O7NA 3F74A 5E6UB 1MQAA 1M2VB 4Z7OB 1ATZA 1U0OC 1M10A 3IBSA 3EG9A 5HJ2A 3T3MB 3IJEB 4DMUB 5KYYB 4HQKA 4NEHB 3N2NA 3ZDXB 1CK4A 4FX5A 1LFAA 4CN8A 2B2XA 3HXQA 4O02B 2I6SA 4Z7NB 4WK2B 1BHO1 4C29A 3EGXA 3PPVA 1XUOA 3ZE2B 2NUTB 3ZE0B 4PN7A 4G1EB 2I6QA 4G1MB 5KYWA 1PCXA 5KYUB 1IDN1 2XWBF 2VDMB 4F1KA 5E6RB 4HQOA 1ZOOA 1BHQ1 1JEQB 1NA5A 5E6SB 2ODQA 4CN9A 2IUEA 3F78A 1RD4A 2VDOB 1RTKA 2X5NA 1DGQA 4M76B 3HI6A 4WJKB 1QC5B 3RAGA 4F1JA 3V4PB 5KYXA 3EFOA 4MMXB 1XDDA 1M2OA 1MHPA 3V4VB 1AO3A 3TXAA 1JLMA 2ODPA 2NVOA 1MQ9A 1IJKA 1DZIA 3TCXB 3ZDYB 4C2AA 5HDBB 4IGIA 3EG9B 3TVYA 4UM8B 2QTVA 1PD1A 1SQ0A 3PPWA 3T3PB 3PPYA 5ES4B 3VI3B 4MMZB 1M1UA 3EFOB 2M32A 1AUQA 1U8CB 3ZDZB 1T6BY 4UM9B 1XDGA 3FCSB 2ADFA 1MF7A 3BQNB 4XW2A 4MMYB 1RS0A 1MQ8B 5E6UA 4CNBA 3EGXB 2WINI 3EGDA 4HQNA 3EOAI 4WK4B 3BQMB 1UEXC 5KYYA 1L5GB 3GXBA 4BJ3A 5KYWB 3E2MA 1JEYA 2NUPA 1FE8A 1IDOA 4IHKA 1TYEB 5LN1A 3PPXA 3QA3E 1AOXA 1OAKA 1PT6A 2VDQB 3EOBI 2ICAA 1SHUX 1N3YA 1YVRA 2VDNB 3NIGB 1U0NA 4WK0B 3ZQKA 1ZONA 1T0PA 4Z7QB 3K6SA 3EH2A 3EGDB 4HQLA 1Q0PA 4UM9D 2VDRB 1MJNA 3K71B 1YVPA 4HQFA 2NUTA 4A0QA 3ZE1B 5HGJA 5KYXB 5KYNA 1JEYB 3EH1A 2NUPB 3FCUB 1IJBA 4NENA 5KYUA 2VDKB 2XWJI 5BV8A 5E6RA 5E6SA 1JEQA
chains in the Genus database with same CATH superfamily
1K9SA 2PUWA 1RLTA 2VYQA 2X0RA 2N47A 3WLQA 2MYTA 5JSZA 4I5EA 2EL9A 2CHFA 3MELA 1RJDA 5CA1F 3L40A 3W3ZB 2IU3A 1OXMA 2M6SA 3E8XA 1Y98A 2QZZA 2QX6A 3LH5A 2A84A 2VEOA 3HRIA 4C21A 1L5FA 7REQA 4AJPA 2IV7A 2VRBA 4YJFB 1V6AA 5JDIA 5KYVA 4YV0A 5BURA 2BFBB 1KU0A 3RE1A 1KI9A 1Y8RA 1PK9A 1COZA 1E99A 1RAHA 5DASA 3GEDA 1U5BB 2C7BA 1ZI8A 2B8JA 3RPEA 2IHBA 3IBSA 2XYPA 3R6LA 3ZI0A 1VPDA 2BUBA 1ZHOA 4WN9B 1GGEA 3INTA 4G4GA 4EW1A 4X41A 1ONSA 3QFCA 2ZVDA 4RMGA 4NABA 2HLDD 1VLMA 4M4SA 4G5FA 2IBSA 1DOZA 1ZUD1 2EFHB 1XO1A 2V7QA 3VRHA 2JGFA 5BNZA 4AF6A 1AJEA 1ELOA 3ZWWA 3QTBA 5I7OA 3I9JA 3WRVA 1TTHA 1NPTO 2PKCA 3FCYA 3GFQA 3REGA 2IDMA 3F7OA 1XP8A 2ZJFA 1WUJS 2F4NA 5EL0A 4TVSA 3ANTA 4G1MB 3NG1A 1JQKA 4QRIA 1TU3A 2HZ7A 2JGKA 2UV8A 2JDIA 4LI0A 1T1SA 4WINA 4KBYA 5JWRA 3L0PA 2RJOA 3IPAA 4Z86A 5EKDA 3QLJA 3UK2A 9LDBA 5I5EA 3DLCA 4EFNA 3R3UA 4HXFB 5JMOA 4KPEC 3W34A 3G2MA 4NZPA 2JBWA 4G41A 4MULA 3VVLA 4WIAA 3C5EA 4GLJA 1PR4A 1YA6A 1A27A 3EXHB 4ZC8A 3GRCA 3Q4GA 1JQJC 3FMOB 1NN0A 1JZSA 1PEKE 4X6UA 1G1AA 3D0QA 5JZSA 5FPTA 5DGDA 1KARA 4K6CA 4TKUA 2OD2A 1HE5A 2JA1A 4ETMA 3OEEA 1KY3A 3I73A 4I36A 4WXYB 2WQ7A 1CF2O 2YVUA 4PYKA 5CNJA 3GLRA 1PHRA 2RGNC 4RPCA 2IGTA 2PAFA 2VJPA 1ZVVA 4ME6A 4LKRA 2GOYA 4FS8A 2B36A 4R5HA 4AMBA 5IAGA 1PJLA 2NYUA 5G0TA 3EJ6A 3EIWA 4UQLA 1IVNA 2GJ9A 2HU2A 3CBGA 1N2OA 3WK5A 3ZV6A 3OCZA 3ZJYA 2ODTX 1E2HA 1GSHA 3FKQA 4UXIA 5DSXA 4G09A 2ENWA 4IY1A 4XVHA 1P0IA 2HFJA 3G1UA 1SQGA 3WLFA 1L6RA 4AJ9A 2AH5A 2I1QA 2I1LA 4YMIA 3ZWKA 3UPTA 2GEUA 3Q9NA 4MEBA 2ZYRA 3TCKA 2OXCA 2GUWA 2FB9A 3BCRA 5B30A 1IBLB 5L6LB 2QORA 1AOXA 1N9GA 2ZAMA 4U7FA 2OUKA 4ZAVA 3ZBPA 2F3QA 2MOKA 3E3NA 1DLIA 1RE0A 2BLNA 2ZRPA 3A4IA 4J1TC 2EHJA 3DMFA 3CRZA 5H70A 1RWBA 5HJ5A 3G02A 1ODLA 1MIHA 4M0UA 4J2OA 1LPAB 3X2EA 3C7CB 3DSRA 1C4WA 1R0BA 1SKBA 4NU8X 2FMHA 5EIXA 4IJMA 4LA4A 4R5MA 5KS2A 4HDNA 5EIHA 1T1EA 1EMDA 2D2XA 1ZH4A 3BXHA 4HAVA 1T9AA 1IOZA 1UP4A 1GR0A 2ZYIA 1F2DA 1E3WB 2XQGA 4B3TB 1VE9A 4PO9A 2D3TA 3HKDB 2FSIA 1M1NB 2W2LD 3HO6A 5J63A 4XYGA 4ER7A 4I8XA 3QIAA 1GPLA 2CVQA 2OZLA 3HPQA 1V4NA 3RIHA 4LCEA 1O57A 3CRW1 3WYDA 4L85A 4RTQA 2CV1A 1L7PA 2JCXA 1JG6A 2NO4A 2WF8A 4WDQA 4DLVA 1TD9A 3GL9A 1F8XA 3TRJA 4CT0A 2C3YA 5KDLA 5KHLB 4H0NA 1FVOA 1GPAA 2GDZA 2ZYDA 3C24A 5EERA 4EOGA 3GLGB 4YCAA 2P3SA 3LCCA 3M3HA 2HSZA 4PIMA 4Y7DA 1WHSB 1UQRA 3RJTA 3EQ9A 3EIXA 2H2HA 3WAJA 5CXXA 4LSMA 3LK7A 2BKLA 2VSYA 3ESXA 4HV4A 1C7EA 3PRHA 4C5AA 1G3QA 4LSZA 3VPFA 3NETA 5EPUA 4DVJA 4DDUA 5BWLA 5C1PA 4XRGA 2A94A 5AK0A 5KQGA 4I3FA 4EAQA 1G59A 5FO0A 1J0AA 1RHUA 1J2TA 1BVYF 2AOUA 3GN1A 1FJXA 1P4JA 2F9FA 3C8UA 4G63A 4OVKA 4XPIA 5H59A 4EJSC 4M8KA 1DG9A 4OLBA 3TBKA 1PQPA 2JIBA 3MSCA 3FZGA 1PR1A 3FTFA 2QRZA 4RY8A 4HGOA 4UOQA 1SXQA 1EFHA 3CF2A 3N87A 4G01B 1YIOA 2XHZA 3ABIA 3LQFA 4Y6PA 1PI3A 4D0NA 2DFDA 5IT5A 5LWHA 1Y8QA 3UHPA 3T5CA 2H48A 1S5PA 3L1IA 1UBMS 2R97A 1TIKA 4WJKB 3PGJA 5BVGA 3OZ7A 4RLFA 1PR2A 1PTJA 3K4HA 3GNLA 3TQOA 4MRNA 4Q4AA 1U9CA 3O4GA 3JRWA 4EIWA 1SG9A 1LX7A 1DL5A 2GUGA 1XCJA 3L07A 1KOLA 3M82A 3JQBA 1CDDA 1ZOIA 4G0MA 4GYWA 4JV5B 4OMCA 4BFYA 3M5DA 3OQJA 4B3MB 1W76A 1ZLXA 3FGNA 1U2SA 3ML1A 3OBIA 4IIEA 3CNHA 4GMHA 2NUAB 4B7CA 2IOFA 4CHTA 2H29A 1GL6A 2IE8A 1GNVA 5IXJA 1PUIA 3WRYA 1TA0A 1JBQA 1XDGA 3LT2A 2AYXA 4QQKA 1M34A 2ZYVX 4Q4HB 3I92A 3H2GA 3COWA 5H02A 3SF8B 1SPBS 2OGUA 2XY4A 4F21A 1T26A 3H1AA 4MRMB 1WMEA 2XD9A 2V5AA 3LCJA 1T9GR 5FNVF 2XA1A 3K0FB 4GC5A 4MVXA 2J9YB 5JXJA 2JLYA 3Q3CA 4YMHA 1IEXA 3EZ6A 4GUDA 1G7SA 1I6KA 1K75A 1QG6A 1V8FA 1XZ8A 1CJCA 1BMDA 3B6IA 3FDFA 3NRCA 3R3XA 4I0WB 3PPXA 4JT9A 4OL0A 1Z9BA 1PR9A 4BQOA 3CR3C 3WO1A 4EF5A 3C3JA 4YASA 1V4VA 3H17A 3P8ZA 4LY3A 2QK4A 5AW8A 5A9RA 1GARA 1AZTA 1UM9A 1Y89A 3FDZA 1R18A 1DKQA 4W7SA 6YASA 5ICEA 1OVGA 1U0BB 1PNTA 1ZH0A 4FSXA 4P2BA 3AHIA 5ITZB 1LFDB 3HCBA 3ZY5A 1EUQA 4TWAA 2A30A 5E6RA 4LDZA 5HBGA 2P67A 1R4ZA 1QOPB 4MIKA 4XOIA 4YRDA 1MLDA 2R6CA 1R6XA 2PX4A 4EGFA 3PT9A 2AHRA 2V6MA 1HLDA 4OF4A 4OL9A 2XMCA 3G0DA 4CW7A 4WLFA 1GAEO 1T4CA 1EJ0A 4RV9A 3O8NA 4CM6A 2J67A 5HE8A 3REQB 1SBIA 4M99A 1T35A 2WF7A 5AKJA 3HXOA 1XN4A 4NENB 3UATA 3T0FA 4HTAA 2I0FA 4LBZA 3KSMA 3IALA 2EIHA 2HI0A 3DOJA 1U0OC 4BFXA 5EJIA 2QSYA 2FSVC 3Q9UA 4N4AA 3C6YA 2YW2A 2YUIA 4AKSA 3D2AA 5AHWA 3E3AA 4R8LA 3UJ7A 1JXMA 1ZI6A 4LRTB 2D8AA 1FSSA 1O8CA 1VPEA 2BOVA 4TKVB 1GPKA 5I4KA 5H1YA 4G9GA 3O4RA 5I4IA 2A9KA 4C29A 4LEIA 4UU8A 1H2ZA 2XUAA 1A9QA 3BJIC 1OXUA 4L5IA 3QWFA 3LWBA 3NLLA 4QHYA 3L18A 5FOXA 1CJSA 4B45A 3AVUA 2VQ3A 2JAOA 4YH1A 3W3AA 4V0KA 1JEQB 3L7NA 3OJWA 3L93A 3PD0A 4GRAA 4Z8XA 4EA6A 5JJ5A 2NYAA 4K9LA 4M9SA 1I6LA 3T5DA 2AQHA 1G38A 2ZZNA 2TMGA 4G5GA 2N75A 1QB7A 1QRRA 5BN1A 4GBED 1OX6A 4ZZ0A 2WJJA 1TT7A 3PA8A 1E5LA 4J6EA 1HYBA 1KO1A 1TW2A 1YS7A 4XFJA 2YBDA 5EJAA 3RSFA 5DZSA 4LGVA 3C3DA 5AR1A 3V4VB 1JPUA 1YZKA 2QUZA 1SOVA 1YA4A 3PRKE 2AQ8A 4LV5B 3QKIA 4G5OA 2G9RA 2GNOA 4B74A 5FH9A 2V9CA 3QYJA 3D4IA 2JLVA 3HKBB 1Z08A 1Z35A 2FVXA 3BK7A 5A1JA 3VU3A 4C5BA 5IZCA 1G4HA 1VCNA 3NTUA 4FS3A 2DUMA 1LJUA 1MG0A 4Q5IA 3LWDA 4ZVTA 2YWBA 5CDFA 2ANBA 3L84A 4J0EA 4JWTA 4PBRA 1XMPA 4B2LA 4CTNA 4XX0B 1P4SA 4L3VA 4WKGA 4AMUA 3WL6A 1MG5A 4RGVA 4YP1A 3W9SA 4N3GA 3QJGA 4AF7A 4TV8B 4XM2A 6NULA 3BREA 1HYHA 3GUVA 4ENTA 4MKXA 2O3RA 1G291 4DG5A 1P45A 2GKSA 2H1FA 2J5KA 4MV7A 1Z0KA 5B7NA 4LUCA 2UXBB 3OU6A 4Q7MB 1H3FA 2NW6A 3NC0C 1UEJA 2D5LA 1J6UA 3MHPA 1H1DA 1PU2A 1LBEA 5GZ6A 5B37A 2X6QA 1HDGO 5B3JA 4Q3LA 1KK0A 5HR5A 4TWJA 5EJ4A 1YBHA 2XW6A 3QPVA 4COOA 2WWWA 5HKBA 3CX4A 1NNI1 3PJDA 4NESA 4UFPA 2GCPA 2JI7A 2XADA 1ZJ4A 3HB1A 1GL7A 4QNRA 4EWLA 1ST3A 2C83A 3WP0A 2D1RA 3ZVLA 4JK3A 5F5XA 5IDWA 1ODFA 1HZZA 3A3PA 3CG4A 5KSZA 1XKTA 1EVEA 1X0XA 3AIKA 3E1GA 2ID9A 3AUFA 3RHTA 2R87A 2Q21A 3OX1A 1Z37A 4LBWA 4KAJA 1M2GA 1VGRA 3K2EA 4FE7A 4IL5A 3O8OB 1VE7A 5F2KA 2X2PA 2QX7A 4F12A 4CKCB 4I4CA 2C5LA 1UBHS 2CCGA 4IMIB 3ZV4A 3A9SA 6GPBA 1XI2A 1FQKA 1KXZA 2CDBA 3CGGA 3LT5A 4B3RB 4RW0A 3JZIA 3TH5A 3VSCA 4KSBA 4BUCA 4Q03A 4P5PA 1PBTA 1K8QA 3W5UA 1D2GA 1NHWA 1NNSA 3IHLA 4IZHA 2UXCB 3DZDA 2PNJA 1PNQA 3R0XA 4KI7A 4B1FA 2BGWA 5J2UF 2OBYA 1GG8A 5BUZA 3GZTB 3BXOA 1XKLA 4K2AA 3UJ3X 4RTJA 3RSSA 1QIIA 5HHTA 2PPLA 3TI7A 1TZMA 5DGHA 2BGGA 2QI9C 2YY7A 5CG2A 1LQUA 1X3SA 3IMCA 4U7DA 4BPBA 3BMCB 2XQKA 2ZIGA 4TTIA 1XDWA 2CUNA 1PSZA 2XMQA 3H4TA 2QXTA 2XRMA 3RODA 1RPAA 3OQBA 4DR7B 1GZSA 2KWIA 1J1UA 1V26A 4B6RA 2L2QA 4HEHA 3HM9A 3LRTA 3QVOA 1R0LA 3BCSA 4NMMA 3QKSA 4FMDF 1MX5A 2NVUA 5TE9A 4L73A 1C3VA 1S3SA 1GN8A 1SCJA 4E2YA 5JBNA 1SXJB 3DHEA 1P33A 1U7XA 4P81A 5BXQC 1V48A 2UZIR 1VYTA 2X0DA 4MI3A 1C9JA 3IB6A 1M2NA 3DE0X 4N5DA 1UQTA 1EFAA 1O2DA 4IZIA 1DXHA 3PR2B 4C6HA 4TYYA 3AFHA 1S4QA 1WZNA 4EO9A 1E1LA 2B2NA 3HB0A 1SN7A 3HEAA 5HEKA 1RYZA 5BUQA 1SCAA 1WBJB 5AK6A 2NPOA 5IRCD 4XFDA 2P2DA 1A69A 2QD1A 4M88A 4N82A 1XQWA 1TJPB 4OATA 3IELA 4QBHA 1R5JA 1WO8A 3CLUC 3HNPA 2PMBA 1N8SA 3AR2A 3PSAA 5SZHB 1UMCA 2AR7A 2H3EA 1J2JA 2CVPA 3L8ZA 3M5WA 4D4JA 4JDPA 3DJYA 4GP9A 4LFAB 1GZHB 3K31A 3KUUA 1R9JA 4IIDA 4TQGA 2PUEA 1JLSA 2VG8A 1X15A 4RA9B 2QRMA 3DS8A 3T9AA 3L43A 1USVA 1Z28A 4ZHQB 1NMEA 4B40A 3KVOA 9ATCA 2DTDA 1NF9A 2C1ZA 3OPYB 1L3IA 4WY8A 2VBIA 4BQRA 5HIMA 4ES6A 1MAHA 1KGDA 5K09A 2V58A 1QVWA 2VK2A 4QDXA 1Y6QA 3BHJA 4DR5B 4RD4A 2XMBA 4L0DA 3HHEA 3JY6A 1V4BA 3RUEA 4BQEA 3E48A 3G7UA 5HIAA 3T1NA 1GIAA 1NY5A 4IIGA 1KFBB 2QM7A 1KIAA 1O9HA 2VO1A 1EKXA 1FMLA 3VHRA 4Q4CA 5I9NA 4CL3A 3QY9A 5BYJA 3HABA 4RD3A 1CV2A 3CRMA 1T6NA 2CMGA 3RTBA 5HX7A 1J5XA 3ASVA 2PUAA 1ZWLA 5FADA 1QU2A 3H83A 3I39X 3KHSA 4PX5A 1NVTA 2Y1WA 1BW9A 2DBZA 1A88A 1J23A 2ZCUA 4FXPA 4LMPA 4ZQFA 1ZOPA 2CLCX 2W43A 5GGXA 2X4IA 4QT4A 3NDRA 1EX7A 4Z1OA 3OCXA 5JIBA 2E87A 5K3BA 2UUBB 2ZWPA 3RFCA 1GA6A 1TGYA 3FJOA 4RK7A 3EVZA 2GERA 3MINB 1OYVA 2XIJA 4MUNA 4NYMR 3RYFB 3UUEA 5KNDA 4E13A 3G6KA 1WNFA 3C87A 1RI2A 3KK0A 3PUVA 3W2GA 3EASA 3NOQA 4OM8A 1ZMTA 3EXIB 2MINA 3AV3A 5CH3A 3ISTA 3D31A 3SHOA 1K4MA 3AY0A 3IJEB 4LXQA 3NNSA 1IB6A 3H99A 5JYCA 1QGYA 2ERXA 2PXXA 2PZBA 3FVVA 4C20A 3KHUA 1DU4A 1P8AA 2AC2A 5LYJF 1D0SA 1SQ5A 3RU3A 3UJNA 2BUAA 3WBKA 3PNOA 2CJWA 2CN1A 2KBFA 5D1NA 5C8VA 2P9FA 2V97A 4F2DA 3HZRA 3O4VA 5DT2A 3FIUA 4KX5A 4C3VA 4II3A 2W4MA 1DHTA 3G7SA 3KKNA 2W93A 5J4YA 5CLHA 1CU1A 1G5RA 4EGSA 4NG5A 1X1RA 4CL0A 3JTEA 2OP0A 1IULA 1A2OA 4LJSA 2A35A 1BG6A 1WMSA 4BASA 4LK3A 2J6BA 2YQ5A 1YZUA 3HU3A 3NCTA 1ZOOA 5U4XA 4NH0A 1K1EA 1JVBA 2RGAA 3I2IA 3OLVA 4E70A 2VYND 3IMGA 4YXWD 2FY8A 1L8XA 1UBJS 2BKVA 2R7NA 3DE2X 3OZTA 5LLSA 4FGSA 1NFRA 2PQ0A 4XR4A 3O3CA 5HF5A 1NTRA 2ZAYA 3R77A 5AP9A 2FQYA 4C2UA 2X8WA 4D8TA 4K9PA 4NI5A 4BRZA 3W8FA 1TI7A 1IEWA 3PG5A 4F4CA 1JVNA 3L8EA 2YVLA 2XDQA 3K9GA 5A2GA 3WDMA 3I5XA 3ZDAA 1V6CA 4N3CA 2PKXA 2WK1A 3DLAA 3GCDA 3TKAA 2R8XA 3K70C 1TO1E 2AMYA 4QPDA 5SY9A 3ZU3A 1NN1A 5DYTA 3LLUA 1OLSB 2IU0A 1EBFA 4AECA 1ITZA 2HU8A 3D0KA 5JFGA 1FNBA 4CTKA 2ZPUA 2WD7A 3FUUA 4BMDA 3STWA 1AXRA 3IDQA 2X7XA 3R7WA 8ABPA 5IKEA 4O4LB 3C4QA 4DMFA 1KH2A 1A2QA 2G1JA 2YYYA 4F72A 4IGEA 4JEUA 1QP4A 1UOEA 4DMLA 2YVQA 3NP9A 1IG3A 3FYUB 4R9NA 2REBA 4EPXA 3NDBB 1XEFA 2RMKA 2HCFA 3LBAA 4WNAA 4BZPA 2H31A 1FYXA 4MW5A 3W6OA 5K8LA 1QXSA 3FRIA 3WMGA 3SKYA 4UEOA 2ZYAA 3BE4A 4HRXA 5B64A 4KFUA 7GPBA 3ZE8A 3PNSA 3Q41A 4NKRA 2WVAA 1ZRHA 4J4TA 1U0NA 2I9PA 3D3WA 4L07A 2JVJA 4ZO8A 4UW9A 4Q15A 2FJPA 3H18A 4BO6A 3OIGA 3MGAA 4PXAA 2ET6A 2XEDA 3D4OA 3I64A 2C5SA 5DYWA 3BKWA 4QUAA 1N32B 4YHBA 1YR6A 4L8LA 3BH6A 3N8DA 4WV3A 3OX4A 1B43A 1GJRA 3V8EA 3E22B 2O2HA 3MMZA 2YNMC 4MW9A 4NBRA 4JHLA 2QBYB 1C3JA 3OJXA 1PRYA 1JT9A 3Q5DA 3MB8A 3GA0A 5CCEA 4CWAA 4EK9A 1CNMA 1C0IA 4H15A 1F2UA 3MQ2A 1A8UA 3MF4A 3CTMA 3DE3X 4ARAA 8MHTA 5EUMA 1DXOA 3FVTA 4IXTA 4TTQA 3U3RA 4XWTA 1ORIA 2I8CA 1NJ1A 1QTRA 1RBQA 4D9CA 1QZTA 1X94A 4NCAA 4XSHA 3PDWA 4D9FA 2QLJA 3QYFA 3HXTA 3MRVA 1SZPA 3T1VA 1F60A 1SURA 3TR0A 3VR0A 4A82A 2DFTA 2DG2A 4QNMA 3IDAA 3HUDA 7REQB 3QHPA 4UXHA 3T9DA 4JN6B 4CUJA 3NQ41 3WLRA 4BL5A 3E6AA 3KB2A 4CIAA 4DUGD 2N3ZA 1XB2A 3AB8A 3HSKA 4L8WB 4XWAA 2MSKA 5FR2A 1YQTA 3BE6A 1K6XA 2H1IA 3ZE2B 1BHSA 1Z4PX 1C80A 1IRXA 4WWHA 5M04A 4NQRA 3RS7A 3S81A 1OFVA 3A6JA 3DZFA 4FX2A 4K6FA 4M0DA 4C05A 4IJKA 3NOVA 2J8ZA 3BE8A 3N59A 5F78A 4GRDA 2PT7A 2BC9A 3QLVC 4Y1RA 2PL1A 3K1AA 3WX0A 4EI8A 5C5DA 1NM5A 1PDVA 2HMAA 3OQ1A 3MMSA 3DDZX 1B6TA 3ETJA 4D1YA 4KDFA 4WX2B 2VNSA 1SHKA 2FWNA 5B58T 2AMJA 2IJGX 4A3SA 4BU1A 3NTQA 5KDDA 1EHYA 3T95A 3OA2A 2PFKA 3U3KA 3K8ZA 2CCKA 1PL7A 2EATA 1YJ8A 3PRJA 4JT8A 3ZE9A 2AG5A 2X23A 3KAKA 1E0KA 5CB4A 1QHHA 3LC0A 2ZTSA 4O6VA 4KIUA 5FIUA 4OIFA 1KMNA 3HLYA 2I03A 1OJLA 1YGPA 2WFZA 2Y4NA 1ZYUA 3SLRA 1UJ4A 5DM1A 5JY1A 5C8XA 3JR3A 2G6TA 3H7IA 5DGCA 5AK4A 3TPCA 2IQ5A 1I3OA 1QH8A 3C3EA 4HXEB 3V7YA 3CJTA 1R4AA 1YC5A 3BQNB 3D6UA 3GCZA 1DXQA 1BRMA 4FZRA 2V1XA 3VPGA 3HXKA 3WJ7A 4TMKA 4ASUD 1N1GA 1IHXA 1UJ2A 1HO3A 1BCSA 2BSXA 2Q28A 3P52A 2ORVA 4XB1A 5AW4A 2JLZA 1JU9A 4DHWA 4BO7A 1TJNA 1T5LA 1HLGA 4O8ZA 2Q4RA 1CX9B 3UQYS 4FR2A 4Z9XA 5LQRA 4V0LA 1TM4E 1Y9EA 3VR5D 2IH4A 4CNQA 3T7IA 4UTOA 3OM9A 2FZLA 1MV5A 3KYJB 4WK0B 2FPSA 1QGOA 1C3XA 4UM9D 3PLNA 4JKYA 5MN4A 2YXEA 4MKZA 3P0IA 2V7XA 3WGVA 2CGEA 2VQSA 1NNLA 2WWVD 5LMUB 1UT5A 4HH1A 1BEUB 4G0QA 4EPTA 1RYEA 4OSOA 2QRQA 2VYFA 5EGNA 2GA9A 2Q5FA 5M2QA 4J16A 1BRTA 3GEGA 1JEAA 1NVXQ 1KA9H 1EK2A 2X22A 3W5HA 3WIBA 3QENA 2QVBA 3KLBA 2I8AA 2OD7A 1ZX1A 1O95A 1E3DA 1QFXA 2PKWA 2WTMA 2ZT6A 3QIVA 4U00A 4EFDA 4F5ZA 3R6WA 3E4DA 1MGOA 4GXNA 1DAEA 4UVGA 3EA0A 3LUFA 1PQWA 1SBYA 4RE5A 5TQJA 3RFVA 3L5KA 2A0FA 3JQ7B 4QFBA 2AVNA 4R2XA 1V95A 3D8TA 5ALQA 4KZPA 5KKAA 1ARZA 4AICA 3HY3A 4A0RA 2QE7A 2I2DA 1CHDA 4DLLA 1W36C 3RVQA 3OQPA 4OBEA 1P17A 1F6DA 3RRYA 2XE8A 1ZGGA 2EL7A 4FIDA 4ZU1X 1PVOA 3MCVA 5KJEA 4PFKA 4CEIA 2OZLB 4K9RA 1GFSA 4IIYA 4M8NE 5ECDA 4EUEA 1ABBA 1FLNA 2PANA 1U4NA 3WQQA 5BQ3A 4AX4A 2IYOA 2XUZA 1FDSA 1YHNA 4DADA 4Y2QA 5CXQA 1P39A 3AJAA 4MW6A 2ZG6A 3EK2A 3W7BA 3ZXIA 4Z9FA 3LVFO 4OQMA 3K1JA 3WL8A 3WADA 2P1ZA 3WHPA 4BB9A 2AOXA 1ZH8A 2OL4A 3NJ4A 4IM7A 4K7JA 3NYQA 3BKXA 2OPHA 1KO7A 2ZWAA 1FFSA 3GJQA 5BY2A 3AM5A 9GPBA 1MO4A 2QQ0A 4RABA 4OFXA 2IZOA 3ET5A 4M7WA 1V71A 1H2HA 5CIYA 1VKJA 2WA1A 5C8YB 4KYTA 1QTNA 1E3TA 4QPZA 3NWJA 2ZQYA 1L4GA 3O2NA 5CLQA 2OXTA 3T7CA 3SU8A 3VNBA 4BLRA 4CMEC 4JC0A 1QLWA 3IBFA 5K8IA 1OWLA 4FQ8A 1JB1A 4QWMA 3M83A 4M3NA 1R7RA 2ZSHA 4JROA 1W9MA 1LVHA 2I6UA 2O06A 1OPXA 2WG1A 3OF5A 1O6FA 3OCYA 3LY9A 2PGXA 5GAJA 2AN1A 2ZYSA 4BVAA 1VG8A 1NSYA 3QXGA 1JXQA 2YTZA 2IX3A 3DOUA 4JVOA 5K0JA 2GM5A 5LQKA 1PW7A 1Y8QB 1E66A 4K1XA 3BL6A 2ZUFA 1VG1A 1Y1TA 5C52B 2GPWA 2XCRB 3MJFA 1DB3A 2BVNA 3IAXA 1TNDA 3D3QA 3THSA 4QQRA 4WY5A 8GPBA 2QD2A 2WWIA 4S35A 1J7JA 4WOKA 2NQ2C 4UOZA 1PZFA 3N6XA 1OTYA 4HNUA 5KOJA 2NOAA 3PX3A 4BE4A 5LPNA 2MTBA 3I45A 1WX1A 4I9UA 1DIRA 4F45A 2IUUA 2QZSA 2BGNA 3EPHA 1PWZA 1M7BA 4EHIA 4BFCA 3Q85A 1JIQA 2B21A 4MK4A 2SNIE 3DWEX 4PC1A 3AUYA 2GRAA 1HRKA 3O3MB 4J0QA 4QUBA 1J5EB 2WU4A 1ADYA 3L0DA 1J70A 1L7BA 2GTIA 2KHZA 3OCWA 1QE0A 3SMVA 1M34B 1DIAA 3QUTA 3KJXA 4JBNA 4DCVA 5D3MA 5AKXA 1DQRA 2DLCX 2WA2A 3CWZA 1JVSA 3FSEA 3GFTA 4RY9A 5IC4A 5DI9A 3CNNA 3EH2A 3TTTA 1L9XA 3GA7A 1W49A 5F98A 4KP7A 1N3LA 2EKBA 5KVCA 3U7GA 1EXDA 3I72A 3OJOA 4ZPXA 3X2FA 3WA7A 1HNZB 1FMFA 5K3DA 2JJ1A 3LNCA 4DNXA 5F3WB 4Y9RA 5DSTA 1F2TA 4DDHA 2O1SA 1H2FA 5DWDA 1VXRA 5DN6A 2RE8A 2J0QA 2YIDA 4CDNA 2P6UA 3M6FA 2KS6A 1L4NA 4I9HA 4D96A 3TLAA 3F47A 5FPKA 1N2SA 3Q0TA 1UM9B 1PFVA 1NURA 4N9WA 3EF3A 3DD5A 3U3JA 1M34E 5CEEA 1RHJA 1M74A 2QT1A 3TZHA 4UPEA 3EY4A 3HCDA 1FPMA 1UKVY 5A6SA 5JPCA 1HSOA 1V1JA 1N3BA 3KUKA 2X40A 4Q4JB 4CIDA 2ZE5A 2ZWIA 4L4YA 2X76A 2XZDA 4PGMA 1G0OA 5EJ5A 1E0AA 3T3MB 4DXDA 3K9QO 2DHEA 1YNOA 1AMOA 5K51A 3F9CA 3U5TA 4ZVSA 3DLBA 3DZ8A 1T4CB 1HYGA 2H7CA 1BGVA 2PX6A 3I2KA 5CYOA 2C0PA 2IXDA 2Q3DA 2QU7A 5D51S 2PL3A 3T94A 2UYOA 2FA9A 221PA 3FJ1A 3OPNA 5ALYA 1V2GA 4D3ZA 3GP8A 2HC9A 2JG3A 2NNWB 1N7JA 1RVDA 2VUUA 2ZIAA 4GECA 2UYCA 2V3CC 2XB2A 1A1SA 2NUTB 2ZSJA 3OQIA 5IAJA 2FPKA 3L7KA 3KQNA 2OAEA 3NT5A 3TLBA 4QTYA 4REQA 4F5DA 4EUNA 4ZK2A 4OHMA 4G86A 4X91A 3SHTA 3VH1A 3WBJA 3TRHA 1CVRA 1VQ1A 4P22A 5HE9A 3U9TA 4TMZA 2ZITA 1NXSA 4D6YA 3LHSA 4K9QA 4XYEA 2O7RA 2Q2VA 4MR7A 1AN0A 1M8GA 4EG4A 3OZSA 4AXBA 2RK3A 4GOLD 3U4IA 4M0EA 4D8YA 1Y37A 3RTCA 1TK2A 1O1YA 3B2QA 3D6TB 4RORA 4BJ6A 1EGMB 5FFFA 1GPNA 2GEBA 3K15A 1ZZGA 1T36B 4YWHA 2AZDA 4JKIA 1OIWA 5C7LO 2W5UA 4WZBA 2O48X 2V6BA 3BWMA 3JARA 3GJ0A 5CYFA 5K3SA 2OBMA 3UA4A 2Z2KA 4X65B 4PGAA 3MFYA 2V59A 3OZIA 3WYNA 1D4ZA 3MQFA 3VZRA 2NO7A 3KT8A 1X7XB 1AGPA 1PZHA 1V1RA 2W98A 1HA3A 3EQ6A 1H6BA 3FNQA 1PJ4A 1PSWA 4KE6A 4URHA 3UQZA 4BNYA 5CFRA 4AP6A 1YJAA 4K9SA 4P7KA 1KH3A 3F71A 4RMHA 1L5SA 4QSHA 3W3AH 2MSDB 3FB4A 5FUMA 1AHNA 1E2EA 1YZQA 2QL9A 3I2FA 3MJCA 4ZYZA 3UGQA 2WT8A 4RFSB 4IDNA 5EGSA 1GLNA 1GAXA 2H8GA 3DUFA 4NL4H 5DP2A 2IPNA 4NE9A 1ZC4A 1KRXA 4UREA 3COPA 1D5WA 1EFTA 1QKJA 1TK9A 2IW1A 3DTVB 4WZAA 4C3UA 2ZM5A 1O0SA 3U6BA 3I32A 3RASA 2R8OA 3ILXA 4XSGA 4XVUA 1UFOA 2YV3A 1KK2A 5GM1A 1DC3A 3PC7A 2Q3FA 4DJEC 1B4DA 4AN1A 2H11A 1DTEA 5DLEA 5KC8A 2VRCD 5HQTA 3FKSD 4MV4A 4AIRA 3OOSA 1ZNXA 3BD8A 1E32A 1P73A 3BC1A 2B94A 3NH9A 2AQKA 1FS4A 1QTIA 2CNLA 2FFRA 4NK5A 3U60B 1ZI9A 4HH3C 3ONWA 4QBIA 3TR5A 4AJ4A 4BMNA 4YCMA 3GAFA 3IGFA 4ENVA 8ATCA 3AH8A 1R9NA 3ZW8A 3DOHA 4XCXA 1M6WA 3W2TA 4Z4IA 4RDXA 3L7DA 1OYWA 1HX7A 3AP1A 1L4HA 3A7EA 4XARA 5TMDA 5CAEA 4D9IA 1BMFA 2IYRA 4R7TA 5E9WA 3JPYA 5AKEA 2YN4A 3WDLA 5BQ5A 2QN3A 1X9GA 2WU1A 4WZ6A 3CA8A 4H7FA 3BTVA 1PVVA 5TV2A 1SCBA 1ECBA 3GBSA 3Q10A 3VO1A 4AS2A 4KN8A 5CBKA 1X8KA 1XCBA 5CDHA 3OIVA 2Z5VA 1Z5WA 1OX4B 2NO6A 1M8FA 4HG2A 3LT0A 3M1YA 1ZD8A 1TCBA 2AOVA 2HWWA 4E1VA 1M72A 1N6PA 3FMFA 1UDCA 4QU8A 4KGZA 4C03A 1G5PA 4ZV4A 1RP7A 3AHEA 4NMHA 5FBQB 2PD3A 4OMUA 4HAXA 5DN9A 4EG5A 4MWEA 5MFZA 1FSFA 5EJ2A 4R2MA 5KQRA 3IHKA 3F5QA 5LZ4A 3ZHTA 2J31A 5HJEA 2FW8A 3OFKA 2IZ1A 4OGWA 1ZIYA 4TQUS 4KQWA 1DRKA 3HO1A 4KQXA 1XP5A 4J75A 4BNUA 4YFYA 1V2HE 1XLWA 1D03A 4DLAA 3ZV3A 3PLAE 5D3ZA 2Q3JA 1IG0A 4DC9A 2JIDA 4OFWA 3OSZA 2K7FA 3V46A 1I3MA 1I2AA 1E2NA 2RARA 1CULC 3INNA 1TZKA 4DZRA 1DBSA 3FZQA 1IQUA 5JEEA 3DOIA 4TXLA 3GGDA 1J99A 4MH0R 5DYNA 5ARDA 3VDNB 1V8OA 4CR6A 2J3JA 1MRNA 1XCOA 4KQ6A 3BWEA 1QGUA 1XZQA 3ZCQA 3RAGA 2GZSA 3JZMA 4E14A 2J33A 4F85A 4TL8A 1HNNA 1MHPA 3LMKA 4Y2GA 1CQJB 2OAQ1 2P41A 3A9UA 5LOVA 2GN9A 3SQLA 1SD5A 3GMTA 1MX3A 5DNYB 5GQSA 4B9EA 2OOSA 3GA5A 2GEFA 1SA0A 1WUHS 2OFWA 3BB4A 1P4RA 2N0SA 3LRXA 4P08A 1I33A 4X93A 5JY6A 3E70C 3KUDA 2IY7A 2PWZA 3RVPA 3GT0A 4ARZA 4JZYA 1OC2A 1BDJA 2G1AA 2Y68A 1DCTA 3C14C 1FTQA 2HF7A 3ZGYA 4CMIA 3OY7A 4INJA 3DWFA 4XKJA 4BQPA 4MMYB 1P3Y1 4G4JA 2QZ4A 2B1GA 1QE3A 2HV8A 1Q3TA 4OYYA 3WE7A 4A03A 1KQPA 1U3DA 2W0MA 4X94A 1EHIA 1XCGB 1QV6A 3IFSA 2FSUA 4L9SA 4CV3A 5BR4A 2VTBA 3SSAA 3OP4A 5AO9A 2A2ZA 1RI3A 3HZZA 1TF7A 1WMBA 2YMQA 1RRFA 1G6HA 2WZQA 3ELDA 5ENVA 1WUKS 2AFIB 1L4EA 2G40A 3W8EA 2WJ3A 1BAPA 2Q29A 2VH2A 5BN5A 2HUNA 3VO2A 4B8ZA 3AMVA 1W4AA 3RYTC 5FJJA 2IFTA 5JAMA 5ARBA 1U0LA 3NIGB 3B8EA 1LJ8A 4FTWA 5SZJA 1N4DA 1GLGA 4CKEA 1MJNA 1ESEA 3NXSA 1ID8A 3S0JA 2VSOA 3CNEA 4UJ3A 5EP1A 2Q3HA 4PQGA 2NPFA 1H8HD 1YO6A 4OI2A 1BE0A 1GG2A 1TM7E 2J3HA 4NE7A 4QZVA 3HUFA 3SDBA 1W94A 4GI3A 4I4LA 1U7WA 2O0HA 3IEMA 1F6BA 2C2WA 2H4YA 3ABSB 4O63O 1Z56C 1EP9A 4GICA 5LP6C 2UZ0A 3EZLA 2FPOA 4LDRA 4RPJA 4F6LA 2R8ZA 4C0JA 3KEFA 1CJUC 4TN5A 4UHBA 2FPPA 1FRNA 1XZGA 1KP9A 1FEZA 2NTJA 2ZI5A 4NYIR 5EG5A 4AJEA 4QOGA 3TGWA 1W5EA 3OBBA 3TLXA 3R5XA 1LUAA 5FLXA 1LKZA 5CNKA 4RZHA 5J1TB 3ZOKA 1JKXA 3LI2A 4LZWA 3MWEB 5ERYA 5K20A 2DQKA 3A6FA 2O3SA 3GD5A 4L5JA 3CRQA 5FULA 1M10A 2GCNA 2HMYB 4X95A 4KPGA 5KX5F 4B5LA 4F71A 5IKPA 3O92A 1W52X 2HRDA 1FBNA 1IFXA 2VJYA 3L79A 4O0LA 3SJCA 1UPFA 3BZBA 1N6IA 1Y8AA 5DLYA 1GV0A 5K45A 1II8B 1XRSB 3PCXA 3L1JA 4KQCA 1EINA 4P7JA 4AIIA 3HNOA 3B7WA 1TD1A 2BFCA 1NONA 1RIIA 1YBAA 2VHXA 3OZXA 5F12A 1SXPA 1ISGA 1IZYA 4C1NA 2MINB 1Q21A 4HRYA 4NCNA 2I2AA 4YCBA 4EG6A 4MB2A 4NZMA 3TB4A 2R48A 3GJYA 4F2HA 4W5WA 1JSLA 2B83A 4KQGA 3SOPA 3STTA 1QR2A 2DCUA 5F4ZA 2XWBF 4FHEA 2D6FA 1ZESA 5M7EA 3T4XA 2RAFA 2XTZA 2CJWB 2H2AA 4MGYR 4E7OA 3S2ZA 3OICA 4LMRA 2PRKA 4CTMA 1Y1SA 2J0EA 2ZBGA 2PYZA 2D1FA 4TOIA 3HWWA 1R4MA 4KYUA 3EVNA 3DO6A 3RKSA 2DKOA 5TS2A 3PFCA 4AFNA 3CLUD 3EGIA 1JJIA 1P7YA 1I3KA 5FPQA 2YJTD 2GVNA 3I1YA 3DHVA 4GWKA 4HFRA 4QYIA 4RELA 3FW1A 1QH0A 3CZ4A 2R1TB 4ISCA 2YWEA 4I3GA 1IK6A 4YFVA 4A26A 1PD1A 4FNGA 1Z6QA 2G77B 2I4MA 3LZCA 4JLOA 3WQBA 4OBWA 3G1WA 5GZ1A 1U31A 3UJDA 3VPXA 3BWVA 3BMXA 3AEUA 2IKSA 2Y27A 3EYAA 3JCZA 4RENA 1NZDA 3VR3A 1THMA 1UBOS 3ELYA 2V0GA 1P0PA 4FMCF 4W7IA 3FSRA 5EZ6B 4DE5A 3QXXA 1ZVJA 4JBIA 2HBYA 3EGXB 2PZLA 4KODA 3JPWA 1PTKA 5KYGA 4L08A 2P9CA 2DFLA 2HB6A 3IR7A 2IPAB 3VV3A 1PL6A 3QFTA 8ADHA 3FD8A 1Q19A 1ZXXA 3NR2A 2Q3MA 4XQ9A 1A9PA 1M1YB 2P7IA 3DNMA 3LLCA 4EELA 5GZ3A 1R8JA 3EEFA 2XUHA 4GBJA 1FUUA 5F4BA 3FSGA 4TLCA 4NY1A 1D09A 2E1PA 1EGHA 2E5WA 4MGHA 4BBPA 2JJYA 1PKXA 1T2DA 3TSZA 5A03A 3VUFA 4ZN6A 1ZOSA 2IWRA 1WL8A 2F1OA 2BBOA 4MGKR 4PU0A 2Z8XA 3B7GA 3BJMA 4OAOA 1WTAA 4BXOA 1CW2B 1VCHA 1SRRA 4KBFA 1E3QA 4EMSA 1G8YA 1FRFS 1CKEA 4CPDA 1XNQB 3W6PA 4TVBA 1DAHA 1LPPA 2VC2B 2P6OA 3GMDA 3JAWB 3U3XA 1KRHA 1L7DA 1XVUA 2X9GA 3QVVA 4P53A 4ZEOA 2C8VA 1M1YE 2PLNA 3ORHA 4HRAA 4NFYA 3I4CA 4TMTA 5TVGA 3ABQB 4FLEA 1Q3HA 4PLYA 3U19A 2YFHA 1LJLA 1ISRA 5EFZA 1DUSA 1IZ8A 2HCJB 1FFGA 1A8QA 2WYWA 1ZR4A 5ADHA 3KKEA 3NBUA 1MN6A 4MUYA 1IXRC 4U9HS 4O1MA 4R0MA 1IWBB 4IJVA 1OZFA 4YMWA 5EXPA 1A7JA 2C2KA 4D44A 4UNRA 1ZJ5A 5CB0A 3Q7RA 1KO4A 2VLIA 3IV6A 4LMBA 4UHJA 3DEFA 1O8BA 3VKUA 1CBUA 1F2UB 4OUDA 3CJRA 3IP8A 4DRZA 4GPEA 4LXUA 2WPDA 3G1TA 3V55A 5KVSA 4R8SA 5CFZA 3OMXA 3LE8A 5BN3A 5FTNA 3EVAA 3WNDA 4YQEA 3L41A 1JHRA 3SBOA 2WF5A 4FWBA 3ID6C 2O7VA 3R7FA 2WKWA 4BO8A 5BPHA 3I3SR 1OHHA 3D6FA 2FP4A 3PEUA 1QS0A 1OB5A 4ZO6A 1K27A 2A9PA 4GOKA 2WJGA 4BBZA 3U4QA 1GDHA 3JQAB 2BE9A 4E31A 4KXFB 5JNTA 5CB4F 1E1RD 1UJBA 3UXMA 5MGNA 4JXZA 4JOBA 3GJ4A 2ZUVA 1KC3A 3Q0IA 5ESRA 1QGZA 1QC5B 3AEYA 3GEPA 5IBQA 4AJOA 3AY3A 4Z53A 3MRSA 2OENG 1EBUA 3TKLA 1WIWA 3K70D 3NGMA 1T4DA 3HN6A 1H5NA 4C7JA 5KKNB 3BORA 1GD1O 2J3MA 1B0AA 2OXFA 3LBYA 2BKXA 2QVGA 4OH7A 4M1MA 2FE4A 2Q9CA 3F3MA 5EMNA 2RB5A 3FPJA 2O59A 1Q5PA 1KI2A 1KO5A 1DQNA 1TAGA 4MMZB 4BMYA 2TECE 5EC8A 1L4MA 3GRPA 3WL4A 4WVFA 3KZNA 1Q7RA 4L76A 1LV7A 4MZXA 2XXBA 2BHRA 1TT5A 4HQNA 1R6BX 2HEIA 2WNIA 3RC9A 1MEEA 3VKVA 1GUYA 3CZQA 1TVMA 4BNWA 5AVOA 2RGXA 3PQDA 5T8KA 3U7IA 2PJZA 3WYGA 1V5IA 4ESHA 1L5QA 4E15A 3WGJA 5DBEX 3H0CA 2B69A 1CUWA 3D2BA 3OAAD 4FQ7A 4BKUA 7MHTA 2LNDA 3IPYA 1LC3A 4F4IA 2GEVA 1IZ7A 2A4MA 2GNAA 4FZVA 2QXYA 3WGGA 4RV5A 3JD1A 4ZAXA 1P31A 4CG2A 2QP9X 5KYKA 1A71A 3FROA 1TTTA 1Z6XA 4ACAA 1PR6A 2VJDA 3M6IA 4BJHB 1W1IA 1L1FA 3CZAA 5DULA 3CKLA 3EZFA 3JWIA 3U37A 2XNDA 2Q1SA 3N2KB 2IYYA 3A9CA 3ZIAD 3WRXC 2FW0A 2YNMD 1P18A 1XMVA 1J9GA 1E0JA 3R3ZA 4JSTA 2AW5A 2GTPA 5KWVA 4FLFA 1P2FA 4LNUB 4Z9BA 1ZA2A 1NQXA 3OKAA 1N9ZA 4EF6A 4AZWA 1PGPA 1U5CA 1Z3CA 2HBRA 2CHVA 2P9QA 4H3SA 5SYAA 4GKJB 5DH9A 2G28A 4X84A 5AVRA 4Z4HA 4UDYX 4WCFA 6Q21A 2MT9A 4F5EA 3AZPA 1P6UA 1CEYA 1Q6ZA 3AK4A 2X3UA 2ZE7A 5BOVA 5JH7B 2HTEA 4WKCA 4G56A 3GU3A 4IZ6A 3FCAA 4NJMA 3TIXB 5E2IA 4RKWA 4RCZA 4ZARA 3LVRE 1CB0A 1VL6A 2J07A 2OA0A 1UC4B 1F1BA 2GKGA 3Q40A 5AM3A 2BKUA 4C7VA 2IU6A 4XGKA 3BGWA 4LXYA 3O8RA 1SUDA 4ALJA 1CP3A 1SC3A 3PUXA 4LQDA 2ZJ5A 4OA5A 2XKBA 2R5WA 4IIJB 1V9LA 3FTQA 4F0JA 3EFBA 4HB0A 2H1HA 1CR2A 2DBRA 2QE6A 3VTZA 1QVVA 2PGAA 3K9HA 1U90A 1QFZA 5JOQA 1L4UA 2PMEA 2TYSB 2WTAA 3DTNA 1MTZA 3ET4A 3TRDA 5DYYA 4W1QA 4FHDA 2WT9A 2ID7A 1G20A 4KC0A 1PR3A 2JFGA 5H0IA 3ZHCA 2AXPA 3I52A 1EB8A 1S2MA 2Y0DA 1KFJB 1GPUA 3H1PA 4I14A 3AJDA 4MV8A 2KMLA 5E9JA 4HATA 8OHMA 4N7MA 1NZJA 4HOYA 1VI2A 2BFFB 4RV4A 3ZZ0A 5EJEA 2GYUA 2P8JA 3P4YA 1MD9A 1Q3KA 2VRNA 3L4KA 1X86B 4P84A 5CDYA 2AKYA 1K7CA 4DM7A 4I2VA 5A9SA 1C7ZA 3EXG2 1BQ4A 5ARCA 3ESQA 4LF6B 1TQ4A 4H7DA 4KSYA 2WWYA 2D1YA 3K5PA 1GZUA 4IKOA 3OX3A 4E5PA 2C5GA 4HK4A 1FP2A 3EEBA 3PJEA 5KZMB 5LIRA 4XIFA 4B43A 4BX2A 3T15A 3JS5A 4H6VA 2IYEA 5F33A 1O54A 2X5JO 3RD5A 1R3UA 3DFIA 4A1FA 2IUTA 4INAA 3H9GA 1S2OA 1ABEA 4RMNA 2AZXA 1GNLA 2QJTA 1ZC3A 3GV0A 2V7PA 4QXRA 4E5UA 2FN8A 1K88A 1MAWA 1U6IA 2HD4A 2CKDA 3MYRA 1ZISA 4EUHA 1A2BA 1M6VB 3DO5A 5DNCA 2WG0A 3OVMA 3HBAA 2WSSA 5EFOA 3OEWA 1DJMA 4URYR 1OWMA 3CQ9A 3F4BA 1VL0A 2G17A 2IEBA 3N53A 4P98A 3EDOA 1JJFA 2R6GA 3ISJA 5JCXA 1CLUA 1AQYA 5CPFA 1IC6A 1E2IA 2R4QA 3C5VA 4WOBA 4BMZA 1WR8A 1NKVA 3PGVA 4H0FA 4RTRA 4QDZA 4IJQA 2HDHA 2KLBA 3OT4A 1LD3A 1AKWA 3T7RA 3CKMA 4DCPA 4OHYA 3EOBI 3P96A 4RVCA 1Z2OX 1C3OA 4EZBA 5KOJB 1AX9A 1MOZA 3KYDA 5JAOA 4NQZA 1ECPA 1JQDA 3L8MA 5FWAA 2FETA 4EKGA 1SJ9A 1FS5A 2H2WA 1WWKA 3EPPA 4MP6A 4BO0A 3OJCA 2IIBA 5IVPA 1PK8A 1GSIA 1KXJA 2B1RA 3ZCXA 1BE6A 2R00A 5B4UA 3F73A 1EWTA 5IYZA 3TL2A 1JQBA 1SGWA 3R9XA 1R66A 4IXNA 2CFOA 2P69A 1GRNA 1FFDA 2QW0X 1M6YA 2JLWA 1Z5NA 5A05A 3W2IA 1OC4A 2HK8A 5JSFA 1N77A 3AUKA 2XRYA 3CKYA 1TOAA 1GRCA 5D3MB 3QVXA 5C34B 2X4GA 1X7ZA 1GN9A 4XAQA 1HG1A 4J9UE 5L7WA 1MZVA 1CUCA 1L7XA 2VVTA 3FPHA 3QEJA 3TW6A 5KTTA 3AKZA 3KVNA 1W36D 1U2GC 4HDKA 4N7JA 3T5BA 3OI7A 3W8DA 1EUCB 4GQBA 1HDRA 2ECKA 5ALUA 3OX2A 5C0OE 3MCZA 3VISA 2RHOA 2J4DA 4ZEWA 1X1DA 3D3NA 3LYHA 2PTGA 3U44B 4FHGA 2WZCA 1QRTA 4Q4DA 3ITDA 3O8QA 5CJ2A 5KCMA 5FDFA 1U6JA 4XQEA 2WJ4A 4PG7A 4DIFA 1XE3A 5F52A 3EPKA 3L4SO 4WBNB 5HCIA 5AI8A 2DTXA 4YMSA 3D4LA 2OXRA 3VMFA 1CY6A 4OQYA 5G2OA 3WMFA 1E1QD 1GY8A 4D3YA 4DA6A 1P1BA 3WIVA 2OCDA 2AD1A 2FX3A 5TT0A 2GN2A 2HZBA 4E5YA 3GK3A 4WCDA 2OO3A 3PSHA 4CODB 1FSGA 2ZIVB 5EOVA 2L17A 1YQXA 4JP2A 4N5MA 4OJQA 5HRCA 4Z0NA 3AW8A 1UMKA 1WXXA 2CHUA 1Z6YA 1F17A 2JAPA 4YVFA 5DEOA 3RRZA 3QLEA 4ESEA 4IF6A 1E7MA 5JU6A 4Z49A 5H80A 2CE2X 3RVKA 3DKRA 3KQHA 1N0UA 3L9WA 1RWMA 1ZZEA 3LP6A 4NU0A 3DKIA 3HBMA 4KV9A 4RAOA 2C5HA 4FDAA 1GTZA 5FPPA 1GWNA 1E61A 1TM1E 3CH4B 4D45A 4J0IA 2GCEA 4K6OA 2DECA 1PT7A 1W5AA 2Y99A 1GTL1 2CZGA 3B1KA 4UUBA 2ARKA 3K2IA 5DXFA 1E59A 4Y2SA 1XA4A 2IF2A 3EFHA 1UT8A 3P9RA 4MDYA 2P9GA 3NB0A 3QA9A 3Q8WA 5EJ9A 2H0AA 1JKIA 2ZJAA 5G0WA 1BXRA 4PANA 5AXCA 1C0EA 2IODA 2A58A 3LVBA 3PPYA 5B7QA 3ZDCA 1OBFO 3PHCA 5JZVA 1MOPA 2RH8A 2SKDA 1RDFA 1JS1X 2W00A 2BELA 2FR0A 2XTJA 3EWSA 4MCAA 4FYJA 1U3GA 4NZ9A 2J9GA 3S1AB 3ZI4A 5JXIA 4DRXA 1LDGA 3L02A 3BSWA 5A5VA 3ZDDA 1YOVA 2X14A 4KRGA 1WP4A 2HFKA 3RFTA 4E5SA 4HLNA 4GP6A 1Z4OA 2F2TA 3ILSA 3JARB 1Y4AE 3AFGA 1JEOA 1F0PA 1XRQA 2ACEA 1TQHA 4ENSA 4EEKA 1FC0A 3R0QA 4YRCA 5D3QA 4F6CA 4HWTA 4DR4B 3FTCA 3CX6A 2OC4A 1TYEB 5BNIA 4GEGA 1RWOA 4C0BA 1JXOA 3ADKA 5J9FA 4XIYA 3L6UA 4LYYA 4RZQA 1OXBB 4EB8A 1I4LD 1SZCA 4Q21A 4ILEA 1KQ3A 2C29D 3H84A 1CDZA 1SMKA 1IQ0A 2PS0A 4AT1A 2A5FA 4D8UA 4D5GA 4CKWA 2VWPA 2O8DA 1R6TA 3MK31 5PGMA 4RF5A 2QUHA 3KQYA 2PZGA 5KYXB 2OQIA 1U4SA 2UZ4A 4IO0A 1LPSA 5B1YA 4RH3A 3KFVA 2GFQA 4RVDA 3IKJA 1C9KA 2O2JA 4QYWA 4CGZA 1OH7A 1NZFA 1RKXA 2RAUA 1DPFA 4AY2A 2ZIZA 2Q45A 4M36A 1S9DA 1YDMA 1ZK1A 2KI5A 4GSKA 2ZIXA 3ZHXA 5JWOA 3O3NB 5CEJA 5EZ5A 5BSTA 3UOAB 2B4YA 1UBKS 3EWNA 1FXUA 4L5CA 4KQJA 5ECWA 4NV1A 2B98A 1JMVA 1PJBA 1EEHA 1CQPA 1N0IA 3CEPB 1CQXA 3P9PA 2DH6A 5NLLA 3WK7A 4BGUA 5GJCA 4B73A 3BMQB 3LZDA 2IHVA 4HMOA 1N75A 2Q4OA 3HJNA 1NBHA 2EVWX 1HMPA 2HQSA 3GCGA 1T1GA 3MJVA 4BEBA 3VDQA 5A3QA 1QU3A 4ZQHA 5C8ZA 1WCWA 4GOOD 4WZAE 5EI5A 1XJ0A 3MS7A 5CAEB 4S1PA 1QDEA 4PAOA 4RHCA 1Z4NA 4WDRA 1EUDB 2WD8A 1JFSA 2VF4X 1C30B 1T43A 4CN8A 3CS3A 2VXYA 1XMOB 1YB6A 5AIBA 4CEJA 3DZGA 3OO0A 4WD3A 1WE2A 2ILVA 1AA6A 4KQFA 1Z06A 2XVMA 1P1FA 3E7XA 4L9AA 3PXEA 5K3OA 4R1TA 4WEQA 2P2LA 2RCNA 3GZJA 1H2EA 2AR9A 2VK4A 3FUXA 3OF2A 2HR1A 3KLOA 4OHVA 3KTDA 2A33A 4EG1A 4ZOCA 3X1KA 3HTXA 1I4OA 4D9KA 3C70A 1K0FA 4I19A 2A1IA 3GUHA 3LZ6A 1NAIA 3TLMA 2IYZA 3DLTA 3ELUA 3HUTA 4I1IA 5H68A 4F8JA 1X70A 2C82A 3A1DA 3N2YA 3HE3A 2P11A 2ZRNA 3T5TA 5A5FA 4H7HA 1E3LA 1YR2A 3DMRA 2JJ2D 4UZFA 5LOVF 2LD4A 5FUYA 3QEMB 3JVIA 4TWRA 2QRNA 1QE5A 4NBVA 3H9EO 3LQ1A 1L4BA 5LCXA 1EHCA 5KJCA 2GM9A 3TXAA 1TKCA 3FF1A 5KTYA 1GVNB 1IWPB 1M5RA 4ZDWA 2ISSD 4W8OA 2VP9A 1JNYA 3SNKA 5LJIA 2WY2D 1Y3CE 3JQEA 2FYTA 1U9IA 1QGUB 3KIPA 4DCSA 5EE1A 3IVCA 2CUZA 3BXXA 3HR7A 4XVCA 1S02A 3AETA 4KO8A 2GKOA 4NCHA 5F2OA 4CM4A 2OCYC 1VECA 2HSEA 1AKVA 2F48A 2Y2UA 1ID1A 5G3YA 1ORVA 1XJ5A 2W8BA 3H7AA 1AGYA 4EHDA 1JQAA 2Z5GA 1L4FA 2XI4A 2ZB7A 3A3NA 4KDEA 5ALNA 5TMPA 2NXCA 3R5JA 2RHCA 1FP7A 4JB2A 4UMVA 2GBLA 1UPCA 1KORA 3A37A 3HYRA 4URZR 5AVZA 1EUZA 2YJ5A 1HG0A 1NBIA 3PLRA 3L04A 5DHSA 4CMIB 4Y3UA 4RJTA 1EK6A 4DILA 4C6TA 3L7YA 4MSUA 4H4DA 4ZREA 3L7OA 3QM1A 5AXAA 1XF1A 2ZRIA 2V98A 2V4ZA 2GCOB 3EQZA 3F0TA 3S70A 4HEQA 2H07A 2MMCA 4CFYA 1TQDA 1QQAA 1MFZA 2VZ0A 1OYYA 2Q9BA 4TT8A 1M2WA 1K6IA 3LRPA 1U7UA 1J06A 3IKMB 521PA 5BN5B 4OJNA 1GPWB 3GT3A 2B4KA 2IQIA 2WLSA 2I4NA 4OAQA 5DCUA 1VBKA 3I6YA 3OO1A 4G4SO 4RM2A 3SXPA 2I2BA 2NGRA 5DISB 1K06A 3SZGA 4U6NA 4DPLA 2GVDC 4AQYB 4CL2A 1M6NA 2AJTA 3MCTA 2N46A 3NATA 3R7AA 2I91A 5K9ZA 1KGSA 3PFGA 3BN3A 1AKTA 2H59A 3K6JA 3KCNA 3KUCA 3O8LA 1OXTA 1SU4A 4FCTA 4B31A 1U8YA 2OBFA 3AKEA 3JWPA 5IC5A 1DBPA 3WLJA 2E7ZA 2WUEA 3KSZO 4JLUA 1L5LA 5JXWA 2C7PA 4I9FA 1BTOA 1P5HA 2CW5A 4PHCA 1NMSA 2LZ0A 4FEYA 3EBPA 1KZYC 3GVCA 4KFRA 1N6RA 4J07A 3DBRB 1AHHA 5TMBA 4AG6A 5IM4F 4P86A 2DUWA 2QIOA 2IUFA 3LVQE 4W1RA 2JAXA 4IG9A 4NV3A 1WD7A 3O7WA 3SEQA 2RIPA 1C1HA 3WK4A 4MVJA 5L8VA 1AVTA 3BZUA 3ZK7A 3G79A 1W88A 1PJAA 2BM1A 4QGBA 5CU7A 3W1WA 3N74A 1ZQ1A 1K5HA 4XB6B 4V0RA 1C0PA 2HTFA 2OK8A 2VATA 4NBTA 1Z16A 4JB3A 4BVGA 2EWMA 1K7YA 1VP3A 4MI9A 5KOIA 2IVFA 2PRJA 4PAMA 1RJGA 1ZCAA 2YWJA 4FFVA 3G2LA 2ZUBA 5EJFA 5HRUA 3PITA 5MDHA 3VBCA 1PLLA 2IUEA 4MV3A 3WDSA 1P2BA 4RDCA 3OETA 2PR7A 4II7A 3ZXYA 1IN7A 1JHVA 2RAPA 3GHYA 1TGVA 3HI6A 1EX1A 1NOJA 2XVAA 5AOBA 3TCNA 4XIIA 3OU7A 5HK8A 4EEZA 3ZE6A 1Q0HA 1GZ7A 2A6PA 3DBHA 4TSRA 1I1HA 2CHGA 2RI0A 2VOEA 2Y0EA 2NZUG 3RVMA 4EYOA 3GBPA 3LU1A 5JDIC 1PYOA 2G82A 3E9NA 5IANA 1PWYE 1SC4A 4L22A 2G07A 4FZ5A 4JJZA 1MEOA 1G2PA 3SS8A 5SZKB 3T0IA 2XX3A 4KWIA 1EQ2A 1R4MB 2C07A 3TFWA 4MJLA 4BRSA 4D9BA 5BP7A 4DM4A 4N0QA 1P1RA 4ZGBA 4V2IA 3U1VA 4JUAA 4EPYA 1DVRA 2QTBA 2ADFA 3ZLVA 3F6YA 2VCHA 2W90A 3IDFA 1W46A 2VAVA 3LQYA 3TOSA 1ZGJA 3M6WA 5EIFA 3F6RA 5KKCA 1LSSA 3EDYA 2DQYA 1XRPA 1YHYA 2AD5A 2YCBA 1K4YA 1V5FA 3B78A 3I9OA 5B53A 1NVVQ 1YL5A 4ANFA 4DQDA 5AKHA 3LF2A 1NWCA 1B2LA 3ZWBA 2VDWB 4BFSA 4PCAA 4BMPB 2CXOA 4IYJA 3A26A 4KPYA 3NT4A 1VBNA 2YJGA 1DDGA 4Y6OA 1N2HA 4RBNA 5L51A 2BKEA 2Y0BA 1DDIA 2BMJA 1E6CA 1GZ3A 1C1YA 1I2DA 3C48A 3QOXA 4H35A 4AMZA 2BKAA 4OQDA 3T0GA 1O6CA 3K5WA 3OM0A 5JCOA 1TF2A 3BXPA 1EDZA 2FWJA 5JSYA 4KGXA 3FYSA 3SZLA 4GL4A 2H51A 1P4HA 3C3PA 2GZ1A 4M1OA 3DEAA 3KHTA 4A10A 4ZT3A 2QLFA 2AFHA 3GLHA 4P92A 1C1DB 2WIDA 4BFTA 1K8XB 4BS9A 1N9KA 3CN7A 2FJUA 3MTDA 4PVCA 5A62A 3N0XA 3GT4A 5IP5A 2XGGA 2FX5A 1VKOA 2Q4TA 1RXWA 2VXBA 2PGNA 3QX9A 2J7PA 3T7DA 1RLJA 3HDGA 4IBOA 4KIJA 5J4KA 4QPNA 4OXRA 1NG9A 1I7PA 1SOUA 1ZWKA 2H2DA 2CLLB 1KU6A 2JATA 4KIFA 2HRCA 4HDSA 4L51A 4RIGA 4DT1B 2AFRA 3VUEA 5EJ6A 1RT9A 3MGCA 3W5BA 3HMQA 2ATEA 1F1JA 4I99A 4IVRA 1Z0AA 4LC0A 4F46A 3TGLA 2QSUA 2XHEA 3HFSA 4NDZA 3GJ8A 3V00A 4DKXA 3GJ5A 1NVKA 4MP8A 4US2R 3VJRA 3QTTA 4PLCA 2WJPA 3GPBA 4FYPA 3RUFA 4C7BA 2YASA 3MN1A 4FD3A 2CFRA 2P9HA 2HXSA 4BAZA 3MAAC 1Z7WA 4ND8A 4L8VA 5CPBA 3UWKA 4B44A 3IP6A 4UOEA 4EYKA 2PVPA 3FOBA 4JU9A 4LJRA 4TVKA 2VPZA 3RC2A 3T3OA 1COWA 1NQ5A 3HZHA 1DS6A 1EVKA 3JQ9A 2I3DA 1KI4A 1P75A 1XUOA 2IPLA 1MNQA 3H86A 3RR2A 1D6NA 3KOWA 4MYHA 3T99A 3ZWOA 4Q48A 5I01A 2E5LB 3AUTA 5DLPA 5KYUB 1PFGA 2Q6IA 2RBKA 2WHQA 1UH5A 2VDMB 4HS4A 4OI4A 4RZIA 4TMVA 2X0FA 4U2KA 4I4NA 1DBWA 3QUCA 4N8EA 5ALGA 2WU8A 1CZNA 4BN5A 4ZAFA 1D5CA 4OQPA 1QQBA 2Y3IA 2IEAA 1Q11A 2V45A 3TZ6A 1R50A 1XA3A 4O2AB 5FL3A 2IBTA 3H2KA 2AV6A 1JWAB 1FDTA 1UP7A 1YL7A 5JLAA 1T3TA 4NTZA 1X1QA 2Z3WA 1KJQA 5JNWA 2O8CB 4HQ0A 3T1QA 1YI0A 3MWLA 3PFHA 3FNBA 2F59A 3I6BA 3R6DA 4ID3A 5ERGB 3RKRA 3S4YA 5FA6A 3FCOA 4DA8A 4EUKA 1ZD3A 5JISA 2R68A 4PWYA 3LO5A 2J3LA 6REQA 1WCIA 2V1UA 1RP1A 2EOAA 4L6AA 4KNYA 1DBIA 5CT5A 4O3FA 3ZU5A 1XTZA 3LF1A 3DA8A 2AR0A 4AP5A 5EZQA 3FBWA 4MDHA 3M6XA 1WUIS 4I50B 5AJUA 3AVOA 2X1LA 3TZEA 3VTAA 5LUAA 1M1UA 3MOIA 4JQYA 4ZA2A 4D6PA 3OTIA 5J2TF 3KKKA 1M83A 3SR3A 3CG0A 4JH0A 2PBLA 3TW8A 4A5SA 3NDPA 4OYLA 2ZI7A 4MQMA 2P2CA 3IYLW 2DGDA 3OOYA 5AOVA 3GLSA 4HGRA 3TOZA 1RU3A 1M2HA 4R1UA 5DCLA 2H4HA 1ODSA 1P2TA 2IYWA 1Q1EA 3R0VA 2QL7A 1JDVA 1VMEA 4OBBA 4NU6A 4DQUA 2OZEA 4A7PA 4O2RA 4D2IA 4HB3A 1RJFA 3JZDA 5C51B 2XUJA 1H1LA 1TUGA 3ZY3A 2ZE6A 1IY2A 5DX0A 4YRIA 3HL4A 2HCRA 2W8ZA 3FZNA 3RUAA 1TT5B 3V2UA 1LTKA 2YYAA 1Y1LA 1ODJA 1UUFA 1LSOA 4G0XA 4FYVA 1XG5A 1E2DA 3JYHA 3QBDA 1LBQA 1MABA 3BWCA 4PO3X 1M2OB 1U0FA 4WI1A 5B1HA 1UF9A 1E1KA 1PTJC 4B79A 2AZTA 1HTBA 1Z26A 3N7AA 3TLKA 4UUOA 4EW6A 3L1HA 1Q84A 3HCPA 3TMKA 3FFXA 3JQBC 4N5LA 3RQIA 4D8WA 1U3WA 3FRJA 3H04A 4DY6A 1Z73A 5JZMA 4X92A 3S2FA 2DB3A 3S5JA 2ZTUA 3SIXA 2QDXA 2H1SA 2J0VA 4YRLA 2YMPA 4C30A 2XAUA 1CY8A 3NHAA 4G5YA 1N33B 4ZJYA 1CR0A 4N0EA 1WXHA 2H7VA 1UDAA 5TJHA 3WKBA 3ERCA 1XVIA 4AKGA 4IPTA 2J9RA 3BGSA 1FYFA 1AB6A 4HDCA 5AI9A 4RQTA 3WP1B 5TMEA 1SXHA 5DSZA 5GJVC 5T4BA 3UJPA 4D3XA 2HIHA 4WKNA 4IMPA 3B5IA 3WK6A 1A9TA 4BGIA 5F2EA 4EARA 1U4OA 1PS8A 4UEJA 4WCFB 4EI7A 5JC8A 1LK0A 2IOFK 3KXIA 4MWBA 4RDHA 3GUUA 3KQVA 5K0LA 5BNTA 1GG5A 1XTBA 2LRHA 4FNAA 2ZJ3A 3T4PA 3K5HA 2AF4C 3IQZA 3GH1A 1OSNA 1RWVA 2ZR9A 4NJMB 4X1YA 4A6DA 4WXMA 4PC2A 2HJRA 1CIJA 1FP4A 3UK0A 1CRQA 3QU9A 1A9YA 3EQ8A 4LC1A 2BMDA 4I1UA 4F6RA 2BEVB 2PV0A 3GZNB 1V96A 3HDHA 3NJRA 1OV4A 1U7TA 3LUBA 4L9WA 5G1NA 4BV3A 3IL2A 1JB9A 6PFKA 3LAWA 2DSNA 4H16A 2NO9A 5AK3A 4Z1MA 3CF0A 3IT3A 2XVYA 2HBQA 3W4JA 1MJGM 3P19A 3O4HA 3WWCA 2EKPA 3A2NA 4A0GA 4LDAA 2I7XA 3T38A 3UWSA 1W9HA 2BMAA 4IDQA 3JAKA 3A1UA 1DDOA 5J47A 2RGUA 2QJWA 1DIBA 2FXVA 3BF7A 1BD4A 3EB9A 1NOIA 3C98A 3ISVA 4HAUA 3AHCA 3BG5A 4QOHA 4RQBA 5EPEA 1UFKA 3RSCA 1RXEA 4YJKA 3GY0A 4LRUA 5CFPA 4YRTA 2B82A 1YCGA 1ODKA 2GWHA 2N1MA 1O03A 1GKLA 5DNDA 5TPZA 3EBOA 4R98A 2C2XA 5K0NA 2OG2A 4F3KA 1FBTA 3R09A 5L3SA 1US8B 3HCCA 4LVOA 1OIXA 2XCOA 2V3WA 3Q88A 4HDRA 4ISBA 1T5OA 1U8EA 4UM5A 2HPZA 2PXCA 2GXSA 2D0DA 3FKJA 2C8LA 2WWTA 4ZGGA 5KNBA 4RWZA 4CR7A 2ZUDA 5LDGA 5TGDA 3N6VA 2HA5A 2B3DA 5BRNA 1G20E 1T34A 2GO1A 5EZYA 3FPKA 5TB5A 4RGYA 2PNFA 2EEZA 1E2GA 4JASB 4BEWA 1JEYA 4LJ6A 2NTEA 3TIIA 1M0WA 4J1QA 1RYDA 3M2TA 1U7ZA 2YN0A 3BFJA 3IB3A 3TX6A 3SS7X 4CI9A 3D9QX 1E0DA 3LD9A 4AY3A 4X64B 4OSPA 4TRMA 1FVXA 2AMLA 4IV8A 5B36A 1JQEA 3AI1A 4EY8A 1ZNYA 1IZZA 1EI9A 1SRQA 5J59A 3WBFA 1N36B 1FU4A 3A0RB 4ZAZA 2VXCA 2OCLA 1A98A 5E6SA 4EY6A 2CNDA 4MWDA 4AROA 2HQBA 2X0NA 4GLBA 5DHQA 2VTEA 2WDZA 3UZUA 4D81A 5ALVA 1SVKA 3DM9B 4BO9A 3KOUA 3P2YA 3BK2A 2I7CA 5EAIA 5FPSA 3ST7A 1KBQA 2PFSA 5DU2A 3THWA 3ADBA 3GAMA 4ZZ1A 5JEDA 5IZCC 3PIIA 3QOYA 3V4SA 1FSZA 4ALLA 4OHBA 4WERA 2C4KA 2WJZB 5IYZB 1YHZA 3V8QA 4BNXA 3K9WA 1HT3A 3CO5A 1YQUA 1MQAA 1D07A 1RC1A 2L42A 1SBQA 2G5PA 2Z57A 4YDHB 4N65A 4V0NA 4BLQA 3T5GA 5LNK6 2OKCA 4QE3A 1OFHA 2OCPA 1OT3A 2C84A 4KN5A 4FYYA 4ZOAA 5LBIA 3R9IA 4DMUB 5FWXA 1KI6A 3I37X 2G1PA 1ORTA 5BSRA 3DT6A 5BORA 2I6SA 2DT5A 3EF0A 3BBLA 2ZXFA 2Y9MB 1WAMA 1TYAE 1D0IA 3FPLA 4X1KA 5B3JC 1J07A 3FFWA 4LYJA 3TUJC 3U31A 3K16A 1KMHA 2IEGA 4FEGA 2Z09A 3FZYA 1FYWA 1XXHB 3E82A 4JB8A 5EIOA 2ZBQA 4B83A 5KIAA 3F7NA 1D04A 3KPJA 3AHHA 5JAHA 2XCSB 1J4AA 2TSYB 1OBOA 2CC2A 2DUJA 3C3AA 2B4TO 3FR7A 3KKLA 3O5AA 1KDTA 1OQAA 3I76A 3CUEF 4CKXA 4K6HA 3H4MA 1EFPB 1KAQA 4CQMB 1R3DA 5KNLA 3FB1A 1NQTA 4KFTA 5D86A 2XITA 3KR0A 3LCUA 4KQ9A 1C7FA 2I6GA 3UNXA 4MUBA 1J97A 3H19A 4TTSA 2OP1A 4LHEA 3THXA 2QLBA 3ELWA 3F5DA 1CF9A 1C7RA 3ES9A 1M67A 3OC0A 3M5PA 1LSUA 4BWGA 1L4YA 4MYUA 4ARCA 2C04A 3KQOA 1WD5A 2D8MA 4HUJA 1XEAA 2JBAB 1Y1PA 2BGLA 2D00A 5HA5A 1WCYA 4FOTA 4UUMA 1GO2A 1KEKA 3E27A 1SXIA 3DV2A 4OU4A 3UB2A 4BWFB 3ZJTA 5EKTA 2W6QA 4E46A 2EJTA 2R6R1 1BD3A 2EV9A 4H27A 4IP0A 4YPFA 1TQ6A 5EE0A 1LLUA 4JYCA 3ZI7A 1SUWA 1MQ8B 3VNAA 2X15A 3B85A 4N5NA 4MIEA 3P9YA 4TROA 4LXGA 3TXXA 1N3IA 3JYLA 1Z0ZA 2QS9A 5G41A 1K86A 3IUQA 3EE6A 4PSCA 1T3GA 4RJJA 1LS6A 4KDRA 1ZCZA 3VVCA 4S2UA 2GGSA 3SYLA 1ANKA 2M1ZA 1O94A 4A8JB 5GOZA 2EERA 3JASB 1JHZA 3RG8A 1SBNE 3HC7A 2P2SA 1B0ZA 1SCUA 1S8NA 2R8RA 3O75A 4DRXB 5KSWB 4D4IA 5C81A 1WB5A 5JQWA 2BFDB 3F7MA 4OB8A 2HHCA 3T1OA 4DCOA 3ZQKA 2QYHA 3FVQA 4MVCA 4OK3A 3C6QA 3WQRA 4F4UA 3RFUA 5JUWA 5HNKA 1LNQA 1MB4A 2CLMB 2QTGA 3CZ9A 2JFPA 1I4TD 4NAVA 2EW8A 4Y9DA 5AW5A 1CYEA 4Q7QA 2OLEA 3KWLA 4GM1A 1N57A 4TTRA 1JG2A 4EGJA 1QVZA 2X1VA 4RF2A 4UZEA 5ELXA 3WWYA 4WECA 2V5VA 4AD8A 3DB2A 3FOWA 5FI0B 3JD3A 2HNBA 3AJ9A 5KDOA 4RA6A 2O8DB 5DFAA 1C81A 1EB9A 1Q6YA 4M9QA 4CKWB 5HSGA 1WXDA 2G4CA 3QXSA 3JQCA 5AKGA 5B7GA 3E9DA 3FI9A 1NUAA 3WS7A 1H0HA 1NQUA 1P19A 3H2BA 4E5KA 4F4HA 1K6JA 2O05A 4FDTA 4Y6RA 3FOZA 1N5DA 4LG1A 2R8PA 1EVLA 1USGA 2G72A 2FMFA 3ZUGA 3ICOA 1KEPA 4U2FA 4BFZA 4ZTUB 2F64A 5DHPA 3HY6A 4B6EA 5JCJD 3FPBA 3GF4A 4DKJA 1EZ4A 4PONA 1M8PA 1LFAA 4WOCA 3DDOA 3KV1A 2AGVA 4C7XA 2EKLA 2HU7A 5FTKA 3LIPA 1QIFA 2JRCA 4IHJF 2I62A 1XVLA 1I1QB 2B25A 3DONA 1NAHA 1YA8A 2Z5LA 2ZYHA 4U0JA 1GQRA 2GCIA 3GLIA 4B5KA 1FCJA 1RHQA 2QAIA 2M6RA 2Y8EA 3L0CA 4G1EB 4IGFA 1Y5MA 5H16A 3U1TA 2P9EA 1DCMA 1WS6A 1UZLA 2QYSA 4URUR 4BAGA 5JJKA 2BFPA 4LE0A 2BGTA 2B4AA 1JDBB 2H0RA 2AF3C 2IOYA 1GAWA 4PPNA 3LDUA 3FOEC 2FU5C 4AUMA 2R66A 3H8VA 1YWGO 2JARA 3DL0A 3W6UA 5TRTA 3WVNA 3QVUA 1UK7A 4WACA 4TZ6A 4KK4A 2PX0A 3NPMA 2GMWA 2C59A 5F9FA 4DDWA 4YDQA 4QUIA 2A0XA 3VSEA 1EJ2A 1YIDA 1U3UA 3QSYA 5BV2P 2GSWA 1A1VA 1LC0A 4RZ2A 3GMIA 5FPHA 2QD4A 3K1YA 1ORRA 3EHEA 4XVQA 2XB4A 4YV7A 3H5TA 5CGZA 2GHTA 2RHWA 3HWRA 5H9VA 1CQWA 2D4HA 2A5YB 3RO7A 3PS9A 4DJ5X 3D6NB 5B2FA 4EQ6A 3D4BA 4QARA 1SC1A 1HMYA 1PGJA 4TLLB 1XQ1A 1E9RA 1ZHHA 3WKDA 2JJ8A 2MHCA 4K6GA 1FNMA 4ZO9A 1RQRA 1H2XA 4ZYUA 4YRFA 2J3DA 1KERA 1UC8A 4KCGA 2NZYA 2ZR7A 3RF6A 1XZAA 4MI1A 1K6MA 3LDGA 1ISJA 1EM8A 3GP5A 4PQFA 1KJNA 2HJ9A 2ZAGA 4BNKA 2Z4RA 1QANA 5K1ZA 2NX2A 3P26A 4XD7D 4ECAA 4DANA 1KSGA 2VQ6A 5MGBA 5JS1A 3C39A 4CXMA 3K6RA 4Y18A 5AJWA 1HR0B 2NWQA 3AETB 2ZJ7A 1D8TA 2O5CA 4HN9A 2Z58A 1WKCA 3I83A 3LUCA 1JSZA 1JR4A 4FHFA 3EXAA 2F3RA 1Z4KA 4TV9A 3HR8A 2CNNA 3PE3A 4WLEA 3HH8A 3RIMA 3C97A 2XT9A 5HPYB 4YHHB 3G2KA 4WE3A 5BR1A 2OO5A 2PX8A 3E0XA 1W1WA 3P32A 1SUBA 1R0WA 2OPBA 2DYKA 1C9MA 2F1IA 4FGUA 5ECYA 4Y9UA 3UT5A 3PIRA 1OAAA 4C6TB 5FTJA 3BEDA 2H2FA 3LBHA 3OQ6A 3WKAA 4JP8A 4D4HA 4ZFNA 5LA6A 4F56A 3T1TA 3FUTA 3IXLA 1ZW1A 5AI6A 4BCCA 3L8FA 2PMDA 3LXXA 1Z0FA 1QB8A 1UBLS 2NPIA 1EFKA 4QHSA 3ZWMA 4FR0A 4YACA 5JJLA 3WOHA 1F3LA 2IYAA 2Y1XA 2YZ2A 1DAKA 621PA 5DTIA 1LI7A 2ZYGA 3EEOA 5EHNA 3JALA 3HWSA 1OFUX 2K2QB 4B84A 3OJLA 4QPJC 4R0VA 2FEMA 2HGSA 4ZRDA 4DIEA 4MVJF 4NAHA 2LXNA 5K4HA 1LK7A 3CPJB 4P4TA 4MEJA 1QHXA 2B5VA 1O3YA 1PV1A 4PSDA 3Q87B 5C1BA 2W7TA 3D5EA 1L3CA 4XUEA 4FONA 3EEYA 2LKDA 2QRGA 3H75A 3JZFA 3IPXA 4MS4A 4S0XA 1CUAA 4Q16A 2YDYA 4LYHA 1W73A 1Z13A 4J6FA 1TPYA 1NJSA 4X66B 2Q1TA 1E9CA 4YALA 4F38A 5AUPB 3OE7D 4MW0A 4DNFA 1BHQ1 3WFZA 2XE6A 4EY5A 1BVHA 2O4UX 4OQXA 1JJBA 3KAPA 3UUWA 2BBTA 3F78A 1LW7A 3MJHA 4J2TA 2WV7A 4OMFG 1G7TA 2OFOA 3DEYX 1DGQA 4E2ZA 4YECA 4QWWA 2C2GA 5ICGA 3PHJA 3ICPA 2C1XA 1PLKA 4UE6A 5DF1A 1JJVA 2OCIA 3I8XA 1OD6A 4D5EA 3ZIDA 1I4DD 3OHPA 4K40A 1E1NA 2XNCA 1YVUA 2FQQA 5IKOA 1SB8A 2DFVA 4I9GA 4MVJH 2QUJA 4LE2A 5BSMA 5DP1A 1AN9A 4RK5A 4HI0E 1AK9A 2PMKA 2PRSA 5AW1A 1VHJA 5KWIA 4IWNA 1QAQA 4MVJE 1BWSA 1XD9A 1D1SA 1ZSNA 1VDZA 4TRJA 4U2CA 3UYLA 5BYKA 1HKHA 2J0UA 4PGGA 2CV0A 2C4TA 4CNBA 1PYGA 1CNEA 1D2RA 2F3SA 4X1IA 4FC7A 721PA 1HOTA 1Z7GA 4HLUA 4NU5A 4LZLA 2Y71A 3OLQA 3GRRA 1QHGA 4O29A 2Q7OE 5JVDA 1YIAA 3MXOA 3DULA 1QK3A 2EZ4A 2X0JA 3I09A 1YRHA 1X80B 2I7TA 4J0GA 3UG6A 2ZI4A 4Y2JA 3A6DA 1OAKA 4B82A 5C53B 7AT1A 1E9VA 1BFKA 1QO7A 1U0SY 2XGOA 1NGSA 3F4KA 3M3PA 3ILYA 2B2CA 4CLEA 4MVYA 1I8TA 1X19A 1BFDA 3M9XA 1NM5C 3NHRA 4FFDA 3IQEA 2H3HA 3K20A 3I01M 3C5CA 2F7SA 1PFUA 1QYDA 3R5FA 1W59A 4JIGA 4M9UA 4YCDA 2NZJA 3SYKA 1BKYA 4YT2A 3RS0A 3KETA 2XVXA 1W25A 4BCBA 2G5CA 4HWSA 1NXTA 2W4IA 3AEXA 1WM1A 3AR8A 1JGTA 3NM5A 1UDBA 4M0CA 5LKAA 4WMLA 3DL7A 3MTIA 1BXGA 3B7PA 5G4LA 5JTUA 1C0KA 4GHWA 4UTVA 2AN5A 4M98A 1QQ7A 2UKDA 5EESA 1FYDA 4X8HA 2A9RA 2ZE8A 5HK9A 3ER9A 3TYXA 3TSYA 4CL8A 1NRIA 2FF5A 4TYPA 2FR8A 2VJMA 1V8BA 5JRZA 4JGIA 5DM70 3OT1A 4LW8A 1GKIA 4JLMA 1MO2A 2FW9A 1QSGA 1NE7A 2OHOA 4QJBA 4W82A 3CJQA 4DGQA 2X4LA 3R23A 4PO1A 4U63A 3NGLA 4HTFA 3GLHB 2XOEA 2ZQZA 4KQ1A 2FSPA 2G0NA 4MS3B 1ZMXA 3AL3A 2BEKA 3QMMA 4X7RA 4RVOA 1RJ9A 4E2FA 5FB3A 1BE1A 2GR9A 3E3OA 5FFMA 3C41J 5CTAA 5FO1A 1XZHA 2ZSKA 4PCLA 4YK7A 5IVHA 1KWKA 4TN1A 4BE9A 3DVQX 4HDMA 5TSDA 1QRSA 1F2VA 1T1RA 5GP1A 3UGTA 2LTAA 1UAGA 1XWIA 2IIPA 3R4VA 4P7FA 4BP3A 3VYTB 2RD2A 2IIVA 1Q16A 3HBJA 2G8LA 3A6KA 4G26A 1KZ6A 1FL9A 1V0JA 4J0HA 4PF1A 4PTYA 4X7BA 4CQLA 4E21A 4MV0A 4V1CB 5I9SA 2XNJA 4B09A 2QX9A 3O4IA 4HX9A 3UJHA 1NVMB 4MHTA 4LVNA 3ZDEA 1ZW6A 2AFHE 3GLHE 1Q7BA 2FPRA 3L7MA 1XFDA 1XAGA 4QYSA 1MIOB 1MZPA 4FFBB 1XU9A 3O47A 4Q3EA