3T7KA

Complex structure of rtt107p and phosphorylated histone h2a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
248
structure length
233
Chain Sequence
KAEKILARFNELPNYDLKAVCTGCFHDGFNEVDIEILNQLGIKIFDNIKETDKLNCIFAPKILRTEKFLKSLSFEPLKFALKPEFIIDLLKQIHQININLFDYEINGINESIISKTKLPTKVFERANIRCINLVNDIPGGVDTIGSVLKAHGIEKINVLRSKKCTFEDIIPNDIFKYVLIVTKASQVKKFTKLINDRDKNETILIVEWNWCVESIFHLNVDFTSKKNVLYQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of C-terminal Tandem BRCT Repeats of Rtt107 Protein Reveals Critical Role in Interaction with Phosphorylated Histone H2A during DNA Damage Repair
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Regulator of Ty1 transposition protein 107
total genus 75
structure length 233
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16770 RTT107_BRCT_5 Regulator of Ty1 transposition protein 107 BRCT domain
A PF16771 RTT107_BRCT_6 Regulator of Ty1 transposition protein 107 BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3t7kA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3t7kA01
4IFIA 3FA2A 3T7KA 1JNXX 3II6X 3K15A 4XQ0A 3PC7A 4IGKA 1WF6A 4U4AA 3AL2A 3OLCX 2COEA 3K0KA 3JVEA 2XNHA 4ID3A 2EP8A 2NTEA 1IMOA 1L0BA 3HUFA 3PD7A 2M2IA 2VXCA 3PXCX 3PXDA 1L7BA 3T7JA 1KZYC 3PC8A 1CDZA 1GZHB 2AZMA 1Z56C 3COJA 4Y18A 3QVGA 2INGX 4XPZA 2DUNA 3T1NA 3SHTA 4OFBA 3I0NA 2VXBA 3I0MA 1T2VA 3KTFA 2EBWA 3SZMA 2ETXA 4BU1A 2EBUA 2D8MA 3HUEA 2LE0A 3U3ZA 3UEOA 1N5OX 3SQDA 2COUA 3T7IA 2COKA 3L41A 3L40A 2E2WA 3EF0A 3SHVA 1Y98A 2L42A 3PC8C 1T2UA 2WT8A 1T29A 3L46A 4Y2GA 2ADOA 3UENA 2JW5A 1IN1A 2K6GA 3PXBA 3PC6A 5ECGC 4BMCA 3PA6A 3QVGB 2XNKA 1T15A 3K16A 3PXAA 2HTFA 2R1ZA 3EF1A 4JLUA 3AL3A 4BU0A 1OQAA 4N40A 3K0HA 4BMDA 2K7FA 3K05A 3PXEA
chains in the Genus database with same CATH superfamily
1ZXXA 2QSYA 2R6ZA 3G5TA 1E2NA 1WTCA 3OE4A 4JP5A 2APJA 1EWQA 1Q1NA 3FZEA 4BIMA 3EVEA 4QDUA 1ZH2A 3U3RA 3ZGXA 3PD1A 1EINA 1T1SA 1Y37A 2E5FA 5KJCA 1WB5A 4MGZR 1D7AA 2OK8A 1V1JA 4PC3A 5B1EA 2Q2WA 2XAUA 4PBSA 3T3NA 4G07A 3BDIA 3OT5A 4KFSA 1Z07A 2VDJA 2DY1A 3RTEA 2XLCA 2YMLA 1IHDA 1QS0A 3DHWC 3MTBA 4MJLA 4NZ9A 4DCOA 4FFLA 2QQGA 3ASZA 2W8ZA 3Q8WA 4ZI7B 2CBGA 1UMDA 2YWRA 3O1JC 4Y9SA 3DZJA 4G0PA 3S6JA 2NIPA 4B9AA 2YV3A 4KQCA 1X1CA 2B1QA 1VKNA 1K7EB 5IVIA 2D6FA 3C4VA 4LHYA 1L5LA 3WGZA 4TKMA 3E9NA 3VA7A 2CXSA 4HDSA 2BMEA 3EOZA 4M9RA 4X92A 4ARAA 5EJAA 1YIOA 4NMMA 1LSSA 4Y2XA 3P5SA 4RPJA 1AC5A 3N76A 4X7MA 3NKLA 2GA8A 3FNEA 4HEA1 3RF7A 1S7GA 3K6RA 4RSHA 2J7PD 4X41A 2X8WA 3REQB 4NZOA 3SVZA 3MOSA 3TSWA 3V1LA 2RAPA 3W9SA 3A9UA 4K6MA 5DYNA 2KJQA 5C7YA 4QWMA 2CGEA 3F8SA 3VU9A 3WKCA 1Y1QA 1PLJA 1TT5B 3QEMA 4BDTA 2WJJA 4JK3A 4B7AA 2O7QA 4ZO9A 5IBRA 1L7OA 3LXXA 4KGXA 2C82A 4JL5A 1T5BA 5CVCA 2OHHA 3O3MB 4GPIB 2AK2A 5EIFA 4G5FA 5J40A 3W34A 4XDZA 2O5EA 2XQJA 5IN5A 2F48A 3IKLA 4ZK2A 4MV4A 5ESXA 2IA5A 4TL8A 1IEQA 4OBBA 3ZJVA 3VAAA 2VUSA 4G1CA 1EBFA 2QVCA 3AI3A 5BW5A 1GAWA 1NDQA 4NAHA 4K9NA 3JZMA 4DIDA 2JI7A 2VR1A 3O75A 5A9RA 1SZCA 1KETA 5J2TA 4AP6A 5I7OA 4X00A 5TS3A 5COBA 2P6PA 2XIJA 3HO1A 3DLCA 1P17A 1I30A 4L8WB 3EG9A 4G5QA 2Y1EA 5JSYA 2C4VA 1CZRA 1UMBB 2XWPA 3DXFA 2RGNC 4GWGA 4ZZ2A 4B84A 3NTOA 2IXGA 3FBTA 4RHYA 4UU7A 1NF3A 5CYOA 3BQMB 1WZCA 3BDAA 1BMQA 2ZUVA 5EINA 1H2XA 5HIJA 3HC7A 2DH5A 2AEFA 4DSNA 3GOHA 1C3LA 3JPYA 3RT7A 1EGQA 3HYSA 3O1HB 2Z8YA 5DLEA 1HDRA 2P9QA 1Z8DA 1O7JA 1SEVA 3PB3A 5DYYA 1VMDA 1IAVA 1A1SA 2JKYA 2QVZX 1R4NB 4IIGA 4LGMA 2R8RA 4R8VA 4U6SA 3ONWA 3FZQA 3IO3A 3HCFA 4RIGA 1DBVO 3H13A 3N1UA 3ZE6A 4F3YA 4B6RA 5K01A 5KNDA 2VPTA 2FWRA 3RUCA 4JBWA 4LDZA 5LA6B 3JATB 4GWKA 2ZVQX 3IIKA 4M7RA 4RSMA 1DKOA 4PLCA 5JQGA 3NGLA 2VTBA 1A9PA 4ENUA 3R3WA 4TKVA 3VDMA 1O8BA 2YN2A 2Q21A 4BPRA 5ESRA 1OI4A 1F2VA 5FOVA 5JNVA 2I4OA 5B4UA 4PS0A 4JI4B 3UMRA 5L3SB 7GPBA 3L77A 1DBWA 1UP7A 3LQ1A 3KEQA 3QVJA 4JP3A 1LS6A 1WMAA 3G6WA 4TYQA 1NYQA 2NVUA 4XQ0A 4DQLA 2O5CA 3HN2A 3MUNA 1C8KA 3Q88A 2XBUA 1YDFA 2VHWA 3U61B 2NTJA 4A91A 1EX7A 3DVAB 4EJMA 5EHXA 4IVPA 4AJLA 3RVKA 2P4HX 2PLNA 2RGCA 2XNDD 1E8DA 3KP1A 4HCJA 4REQB 4G56A 4TRNA 3CN9A 1SXJA 2GFQA 4PTLA 4Y6PA 5F51A 3RS2A 1ZOLA 4XWYA 3I04M 2CD7A 1IZZA 4N8EA 1KEUA 3K96A 4OP3A 2WTXA 4KAXA 4Q01A 4TN1A 5EKDA 4AW9A 1AOXA 4U9HS 4ZQIA 2JGJA 4E32A 3DDCA 1SUCA 4QGFA 3GUZA 4J7XA 1QFXA 2BTOA 2Q1UA 4G4GA 1NLMA 5JCZA 4MA0A 1GAJA 1I5OA 1YE3A 5IM4F 4K0KB 1DP4A 3E9YA 4O33A 4L9RA 1DUSA 1O4WA 1Z08A 3QK7A 4BO5A 4IOMA 3OZEA 5IP5A 2P78A 2PUCA 1FTQA 1ZRHA 2YJ4A 4DCSA 1ZGHA 2QNBA 2BRUC 4B87A 1X0XA 5CCEA 4RCZA 1FFEA 3OZ7A 2ZUSA 2VXBA 1NVWQ 2YY6A 3WI7A 1T2VA 3IALA 1OASA 3T1TA 5A4IS 3MMXA 4RK4A 1IDOA 3RVLA 3WIUA 1M6VB 5GIOE 2V6GA 3EZFA 2IEIA 5KTMA 1EFVA 2QDXA 1ARZA 2EX0A 2I3ZA 3UXYA 1GPKA 3EYWA 1MG0A 2B94A 2JVIA 1SKMA 3KXKA 5BRJA 4TUYF 5D3ZA 1UXGA 2FLKA 2BV3A 3CUWA 5JADA 5DCLA 3FUUA 1JSZA 1LRLA 3NM5A 5JAUA 3NQ41 2VWQA 2LR0A 2OB2A 3VV2A 4X1IA 4E08A 4KMOA 1N9KA 3GEPA 3OM0A 5C1DA 2IBMA 2QWXA 4RTRA 2EZTA 3CO0S 1E63A 2CMDA 3OUZA 4CCAA 1T2FA 4KXNA 2FPLA 2QY6A 4JOCA 3T1HB 2RGWA 4DWOA 3WMXA 1H8HA 2C5AA 2ZU0C 4AJ2A 3MJTA 1II8B 1HLPA 2OWEA 2R4TA 2QGZA 5DTRA 1YZTA 4KFRA 3FFBA 1ZKDA 3UENA 1ZGGA 1C0LA 3Q1LA 4IL5A 4NMXB 1ORHA 3C1OA 5EOVA 5JLAA 3V4SA 2HMUA 4LPKA 2X0DA 4KLRA 4WY5A 1LUAA 4I1UA 4ZPJA 3SXUA 4DA0A 3S2UA 2FR8C 2FPPB 1KO8A 4UZEA 4TM7A 4BB9A 4LVNA 2QPAA 2K2WA 4AX8A 5J2UF 1C3OB 1A2OA 1U80A 4PF1A 4GPD1 4ZYWA 2W2QA 1IY0A 1YA4A 3EF1A 2YXEA 1SG9A 3QXCA 5KREA 5LD2C 4E70A 5FD8A 1ZA2A 4Z9AA 3SHOA 3H4IA 2QTCA 4RZQA 4KVGA 1Q3HA 1XZLA 5T4FA 4MWSA 1DIAA 1O08A 4PPQA 2PX8A 4CM4A 1XVVA 3M6MD 1S8OA 2QORA 3EQ2A 2YFQA 4QRHA 1DAEA 5F7ZA 4F2WA 1XA3A 1XLUA 1U3FA 1ZJYA 2I6TA 2GJKA 2A4KA 1TJYA 4KUGA 2OLKA 1USIA 5EJEA 4CT4B 2ZSHA 1MC5A 2HMAA 3ZE1B 2H0RA 4HGNA 4BAGA 1UT5A 3AF6A 5JEEA 5C18A 1HQDA 1TC2A 2PWBA 1KZ4A 1HDZA 3P32A 1LPPA 2JFOA 3PDHA 3FNHA 4RE6A 4F72A 8ATCA 2GJSA 2J6CA 2WRZA 4TLBA 4ZI7A 2WUEA 1Z0DA 1MGOA 3V7WA 5KVVA 3FFWA 2XF2A 1QRAA 7ABPA 5K6RA 2FW7A 4MNTA 4O02B 3SX2A 1D04A 1UF9A 4D3FA 2ZU6A 5I01A 2CMHA 1M83A 1ZU5A 2ZAOA 3FGOA 2DX7A 2UZ1B 4OMDA 1N75A 3LO8A 4OM7A 2VDUE 3BF8A 4OL9A 3CLSC 1COZA 3C15C 3N8NA 2W42A 2A86A 1NBOA 4S0XA 1DXYA 5IBCA 2REQA 3UMCA 2Z56A 2DUNA 2AFRA 1MO5A 3PUJA 1R4MB 5ALIA 3F98A 2R8XA 3FRIA 1Z7GA 4LTNA 2VSXA 1JHOA 5I45A 3H3XA 2CFRA 3FJYA 4O4HA 4Q4AB 4BCDA 1UMCA 2RHCA 3A9VA 3PQ2A 1BG6A 2C03A 4RADA 1XMXA 2QAIA 4KNVA 1EHIA 2FSVA 3Q7IA 4ZC1A 3DKVA 3JQCA 4ML3A 5D6OA 1XKXA 5DN9A 4A8JA 1FFCA 5LLDA 4PGAA 1WQ1R 1XOIA 3IEUA 3TE6A 1ODTC 4WXMA 3PEFA 2ETXA 1QV9A 2PX2A 4G89A 1OXUA 1X14A 1RXCA 3HA7A 2ZS9A 3T54A 3T1YB 2PZFA 1CUAA 1RKXA 4M9SA 1LDNA 5EESA 1TU0A 5B2EA 3O0DA 2WB4A 3G0IA 2MINA 2GB4A 2ISQA 4I2VA 2O8DA 3N58A 1EZ4A 3ZU6A 4H7FA 1IBCA 3LSYA 2QTFA 4ZV4A 1HFKA 4MI6A 3IESA 2GN6A 4MUBA 1GD1O 5G1OA 2RHWA 2X5XA 3VZQA 2GBFA 1MFZA 4GKBA 2OL4A 3QXGA 1EFAA 3GAMA 4JVNA 3WHKA 1W2HA 1Y7PA 2XXBA 4PVCA 4RKQA 4CV2A 4UDNA 4PYQA 3D6UA 4FN4A 4I81A 3RVNA 4GZ5A 3DFKA 4QLBA 1XROA 2FP4B 2WHRA 3AIOA 4U7FA 2QVGA 5AUNB 4BZWA 2O8DB 3O73A 1IN5A 2G72A 4EVIA 3H1FA 3C98A 1W2WB 2ZKIA 5D8DA 2BF4A 2VLIA 3B70A 4XH9B 1YR8A 3FUCA 3ZX5A 2YN0A 4O3FA 3BJIC 1GR1A 4HSEA 1KEEB 4Q0MA 3K16A 2ZS8A 4RHUA 5E8RA 3TX6A 3F7NA 4K9PA 3IE0A 1XIVA 1XRQA 1O9BA 4ZWNA 5CIYA 1UODA 3VO8A 1XT6A 4H60A 3C6XA 2IV2X 4TTPA 3V4VB 2D1FA 4NENA 4C0LA 2PQMA 5BT9A 4R8SA 3K9NA 4MARA 4OMUA 5CPFA 3DW3X 5ALFA 4DDHA 5CEEA 4DF3A 1V0JA 1M6WA 1A69A 2VDVE 4PPFA 2CUKA 3RVSA 5EERA 1KI3A 2BEVA 3OUUA 3T06B 1K5GA 1XU4A 2AN5A 2Q3MA 3DVQX 3HO8A 1RYDA 2YYYA 4MSUA 4KN5A 3SDSA 2V98A 3MMZA 3ZXUB 4JI0B 2WG2A 3FLBA 4XD7D 4B80A 5DIFA 3RFFA 4XRRA 1PZEA 4J76A 4U2GA 2C2GA 2Y6VA 3GUHA 4UE6A 1L7EA 4M0PA 4RKFA 1HLDA 4JCCA 2HQRA 3KD3A 2A7QA 2IHBA 1G8HA 1UK9A 4M1WA 3BMXA 4IDHA 4YDRA 2QAGC 2A35A 1KHHA 2ZYHA 4ZK6A 1WPGA 3K4PA 2BH2A 2CFIA 4BJ3A 4ESHA 1UQRA 1G38A 3EX7C 1QCYA 4IEFB 4RUKA 721PA 3PZBA 2GPBA 3BK2A 4HAUA 3NUQA 4ERXA 1WW3A 1QLHA 4XASA 4YLGA 4OB6A 5I4IA 1LBEA 3P9NA 3HDJA 2I3AA 1MA0A 4X63A 2Q41A 3IPYA 3ZTYA 2A3NA 1Z56C 3D6HA 4RVOA 3COWA 1YFJA 1N6PA 5ER9A 1XU9A 1XTKA 3BB4A 1PVDA 2BM0A 2O7NA 3MJVA 4MRNA 2J9FA 1DLIA 1CS0B 3R40A 3S2YA 5A5DA 3M33A 2HCRA 2H2FA 2NUBA 4KXLA 2HPAA 3KZKA 3F4BA 5PGMA 4ZKDA 1QS0B 1YZHA 2B1JA 2YMPA 3QVKA 1W6RA 5A4KA 4JXXA 1JDUA 3EEYA 1RHMA 3GMIA 3OC6A 3WSWA 1ZN2A 2Y93A 3E9MA 3HVHA 2P0YA 3LY5A 1YJQA 4TPKA 1P31A 1ZP6A 2IHYA 2XB4A 5DNVA 2PPVA 3BCSA 4NDZA 3BCUA 4OP1A 3VNSA 3V4RA 2AZXA 5GONF 1I3NA 3J7AC 1YI1A 1GGFA 4IUDS 3HY3A 2Q62A 5CXQA 5HFNA 1YRAA 3GBSA 3C3XA 4RHCA 1KDPA 1SA0A 2ERYA 4XSHA 3N7AA 1D7OA 4QELA 3SXUB 4NJMA 1GRNA 2CB9A 2E4YA 1I6KA 1QF9A 1WPQA 3COYA 3UEOA 4D9KA 2LRHA 3SM9A 4TWAA 5IXYA 1H4VB 4YHBA 3LPNA 1J2TA 3AOEC 5DT9A 1KK0A 3Q6IA 2F9FA 4TXJA 3AB8A 5CH8A 2VRBA 4URZR 4D9JA 2YYZA 1P8AA 3RSGA 1FW6A 3LGAA 3PUVA 3E27A 4K9LA 1RKQA 3K5WA 2XY4A 1S01A 4OK5A 1F0NA 1TU4A 2NXCA 2CBXA 4HX2A 1YRBA 1NXSA 1YFLA 4RIEA 1GT6A 4V0SA 4Y2HA 3WTCA 5BSGA 4OXIA 4K6FA 4K46A 4LTMA 1SIUA 1VHJA 3HCOA 2PUHA 4A6PA 1OYWA 4EB6B 4WN9A 2QRKA 2XT0A 4V24A 1E99A 3HJAA 5K0BA 1N36B 3IV9A 1N5KA 3C24A 4JOSA 4CM5A 3QI7A 5BV0A 4GYYA 1PFWA 2AG5A 2HUPA 4ND2A 5A5VA 1NFQA 1TLLA 4B7XA 1UBNA 2QM8A 5ALSA 5F1KA 1LQUA 4BE7B 3M70A 5SYNA 2YKGA 3VKGA 2RCYA 2R97A 3EWIA 4BAUA 3NV9A 4QJIA 3B1JA 1X80A 5HK8A 3AVQA 3C6MA 5BYKA 1CYEA 2X0FA 1DHRA 2WIDA 4AWXA 1XTUA 1N5JA 1I2DA 3F1LA 3FCOA 4XDHA 1TKAA 1PEDA 2O2EA 3W2IA 1AK1A 3PE3A 3QE2A 2XYVA 5DX8A 4B2YA 4QXAA 3ZXIA 2PUGA 1LTKA 4J94A 1P6QA 3WAKA 2Z2JA 1TM4E 1JGTA 2ATEA 1DFHA 5H59A 1OX5A 5I3CA 3ESQA 3WIBA 1DV2A 1Z13A 3QW4B 5HOQA 3LFTA 3VUEA 2GEUA 2VH5R 3GRYA 4W99A 3SC6A 3BTSA 4KI7A 2RHOA 5CM9C 1N4DA 3V2IA 2VCYA 1U8EA 4NS1A 5SY4A 1YVUA 2EP8A 3M0EA 3MQ2A 2I1LA 3HDYA 5FKJA 4FYXA 2WHXA 4XJXA 1XWIA 4REQA 4YPOA 3P71T 2GPJA 5COAA 4D92A 3TPFA 2A9RA 1JTVA 3EYAA 5DLDA 2Q5LA 4JEUA 4B2IA 2QPTA 1JKJA 1RM0A 1YJAA 3N0VA 1AK9A 4IBOA 4AUMA 4YHHB 5IG2A 5FBZA 1K8YB 2X0RA 3OFKA 2PGDA 2E82A 2GLUA 1L7VC 1AKNA 2OFXA 2R8OA 3O8QB 4A36A 2EZ8A 2W2LD 4X66B 4TT3A 3MCVA 3RS0A 2Q28A 3W4KA 2FWBA 3YASA 3FKSA 3AINA 1CRLA 3GVXA 3GRFA 4RH3A 2CXHA 5AHXA 1KI8A 2BGRA 5TQ0B 4Z0NA 1KDYA 2QLMA 1Y8ZA 1K6XA 4J1TC 1B23P 4IOJA 3I3OA 3NHAA 3L6BA 3PR3A 1JPUA 1T3ZA 1W4RA 3F3MA 3OJ0A 4MB6A 1RAAA 4BLOA 3LNCA 1QU3A 3X2EA 4G0ZA 1GPUA 1ONNA 2WHPA 3MJFA 1LV7A 4RJIA 2ID9A 3PNQA 3K7EA 4CG0A 4Q1FA 1WETA 2VHQA 4M9UA 4OCZA 4OHMA 4F5ZA 4F2HA 4K28A 1EK1A 2B1IA 3Q40A 4CTMA 3RD5A 4J7CA 5DM1A 3P9XA 3EASA 3QQPA 4J3NA 4YAUA 4O4JB 4Y9UA 2I4IA 4CM6A 2I78A 4ITVA 2XUJA 2PSJA 2QUHA 1QGDA 4XE5A 1C3XA 2H57A 2D74A 1HE3A 1A71A 1T1GA 2WDZA 3I4FA 2JFGA 4WTOA 1ISPA 1PYGA 1QAOA 2W2PA 3KKMA 5JRDS 1HNWB 3BREA 2VNSA 3R3SA 1KJNA 2PX0A 1KVRA 4GPBA 5KMGA 4AS1A 1AV7A 5EWLB 1WDWB 4P3OA 3CINA 5EKXA 3FB1A 3PPIA 1U5BA 5FP0A 3NHWA 1BQ4A 3LH5A 5A6SB 4ZZ1A 2WAXA 1O8CA 1BN6A 2UZ1A 5A4AA 3O4JA 3GGJA 1XZKA 2V4MA 3OO1A 4V39A 4QU5A 2GNPA 5KTYA 3JTEA 1IC6A 5LZ2A 3UAZA 3K8OE 1FVXA 1PJZA 2LDXA 2R7NA 1VCNA 1YS1X 4JZYA 5LM3A 2XYPA 3KXPA 3C39A 2XDQB 2VNHA 4YASA 4LGYA 3P94A 1K6MA 1U8FO 4RPGA 3VYRB 3ZLTA 2C5LA 2V7XA 5CFRA 3KYCB 4B74A 3JU3A 3N2KB 3I6MA 4U2CA 2YVUA 1VGVA 1XRRA 1TQ2A 3PTZA 4AK9A 4QJ3A 2JJMA 4IFEA 2B8WA 5K3SA 2DY0A 2IYXA 5L7TA 1W88B 2A5JA 2BY4A 2LGJA 1NJ2A 3ZK9A 1YRYE 1MAUA 4DLLA 1L4YA 4ZQFA 1REQB 3FCAA 1S3IA 5HKOA 3I9LA 4YY3B 2HAEA 4ZC8A 3GT0A 2XNJA 4JVMA 5KCZA 5E2AA 3EA0A 3H86A 2OHJA 2QV7A 2GI4A 4CMBA 3GLUA 3A6LA 1ZM7A 2BLNA 1OR8A 1DX6A 4QHSA 5EQDA 4KIUA 1HH4A 2PA3A 4FYKA 4G5OA 3WWYA 2WSSA 4AF8A 1LEHA 4FQ7A 1EU1A 221PA 2NXEA 4OAOA 4DZZA 6LDHA 3WIOA 4KLCA 5EQJB 5PNTA 3JASB 1FX0B 1Y34E 3LDFA 5B1YA 2O2JA 1UMDB 4C29A 1AJEA 4NZZA 4UOQA 1KIFA 3IUPA 4OHBA 3TO5A 2ASVA 5B37A 3UWPA 1QVRA 2GEBA 3WAJA 4OHYA 3FWYA 3WGYA 1QAQA 4DA9A 1JHAA 3IV7A 3N6VA 1G9SA 4OF4A 4QGGA 4C5CA 2O0LA 3RH0A 4TMWA 4FEAA 4L08A 1C50A 3B38A 1LVHA 1F14A 3QOWA 3U0BA 4CPDA 4B4WA 2ZYVX 1Q57A 4PVDA 3SIRA 4E94A 3QEJA 1HDEA 2RC6A 5GV8A 3SBXA 1FZTA 4BNVA 4E14A 2DQYA 2WFAA 1QPGA 3JD4A 1AUQA 3ZJTA 4JJEA 4YMTA 1MX5A 2VBCA 1CQWA 2FMUA 3OLQA 1TKCA 2IU0A 4HXGA 3RANA 2OBLA 3RVMA 3FGZA 2X6TA 4A6DA 4B3CA 5AVOA 3R2JA 5TMBA 1PKEA 2GHTA 1RMTA 4RPHA 1R0BA 1XTSA 1G3QA 1CYDA 1QTRA 1ZD5A 2C2MA 1WCXA 2O0KA 2ZYUX 3K94A 4QUBA 1GPLA 3WRYA 4BQFA 5IKXA 1JFFB 1PUXA 4JX8A 3KL4A 1JDVA 1LFDB 4BQNA 2JATA 4QSHA 1OA1A 2WU3A 4BZXA 3HUEA 1ZWLA 3D4OA 1F51E 1QG0A 4GECA 1CDOA 1JXOA 4KACA 3UMMA 4W8OA 4F4JA 3L6UA 3GD5A 5EPUA 4EHBA 4KG7A 3I5YA 4N3AA 3FG9A 3SF8B 4BNUA 2WABA 5CP8A 3ZE0B 4H7IA 3AFMA 1DUVG 2A0UA 1JDJA 1G3RA 5A04A 1GSIA 1T5TA 3Q2OA 2AEMA 2VXOA 4INOA 2QIPA 1OLUA 3EY4A 3EJWA 5A7GA 5IN4A 4BBAA 2BGKA 1GTJ1 2I2BA 2QGFA 3AOEA 1RSZA 3E4DA 1XJWA 2HMTA 3PQFA 4ZAVA 2QTGA 2D59A 3EVZA 1KZ7B 1MJ5A 1SCJA 1XZQA 2QHXA 2QTNA 1L2TA 4YCSA 4IQ4A 1YA8A 4EUNA 3BCRA 1UBTS 3MS7A 4D4IA 1IRXA 2FE4A 3S2FA 2Q2NA 3CCBA 4NH0A 3NM4A 5JH7B 1JJVA 1G20E 2G04A 3K0AB 5B7NA 6NULA 3TGLA 1OYVA 1W9HA 4JI6B 4PIVA 4NABA 3PJRA 3PFBA 3O1LA 1OZGA 1ZN9A 2QQFA 2PD3A 2OA0A 2FX3A 3TUZC 5FAXA 1JDZA 2IOQA 5ALWA 1UBMS 3EMKA 2D2VA 5DV9A 1L3CA 2O3SA 3A2NA 3H1BA 1KP2A 2XZLA 1OIWA 1XZPA 3O92A 1TB4A 4CR7A 2GCPA 2E5WA 3IXLA 5A7HA 5IU6A 1MHPA 1XZBA 1MZVA 3SJBA 1DPFA 1VLJA 1WPRA 2VNJA 2Z4SA 3FPFA 3H2ZA 1RKBA 4HX9A 3T4PA 3WB9A 4FGWA 1D4ZA 3NC0C 4IFIA 2H1HA 4RZSA 5FWDA 1LLQA 1YL5A 4WD3A 5ALKA 5HQ3A 4AJOA 2VDQB 2PT5A 2WA1A 1U3VA 2CWWA 3II6X 1OC4A 2WYVA 4NCXA 3QUQA 2WJ6A 4O2BF 2B8EA 5CG1A 1XK6A 1E3IA 4CMCA 1E9VA 1QIIA 3DT6A 5A9SA 4ERNA 2W48A 3QJYA 1KWKA 1SCUA 2PK3A 1GUFA 1XNGA 4MQFB 4RH1A 1NBHA 2JHGA 3FVTA 3N6RA 4UNIA 3BMOB 1RAGA 4MGHA 1XQYA 2PUAA 1RKUA 2RJOA 3P0FA 2J3MA 1W1IA 2C8LA 3K72B 2JI6A 3LUPA 1RBQA 4FB4A 1GCGA 2BFWA 3DZHA 3GHYA 4D26A 3L7NA 3ENZA 3QBTA 3H5LA 3BSYA 5KO2A 1L4UA 4QEZA 4ER7A 2GASA 1NSFA 4ZO7A 3NAMA 5ECDA 4JI1B 1ZBQA 2GK3A 3IIEA 1HEYA 4W8GA 1Y89A 3CEMA 5DGXA 5JH7F 2A6PA 3TQCA 4BL5A 3ADCA 3W04A 5CA1A 3ME5A 1V5IA 4WLOA 4C0XA 2BYTA 2AF4C 3THYB 2ODNA 3JYQA 4U5QA 3CKKA 1YC5A 2PMKA 1BHJA 1NSYA 3QKRA 5CNIA 4DNPA 1YOVA 1RS0A 1NW8A 2IDZA 4UEWA 2DLDA 4XWTA 4YK7A 2P30A 3EN0A 4RGQA 1FFXA 1FRQA 4AVYA 1QRRA 1C8LA 5FA5A 4OO3A 2JEZA 3W6PA 3ABQB 4KP7A 5E4YA 3TOSA 2XRZA 3BZWA 2XUGA 4M1MA 4B5LA 3CMMA 5H16A 3ZCSA 5JS8A 4LYGA 1VYTA 4KVFA 3L9XA 1KP9A 3I9V6 2A9PA 4E6PA 4ER5A 5KX5A 4WH0A 1DBQA 3HNRA 4OQZA 1A9RA 1I36A 3HEBA 4NYMQ 5I9TA 3L18A 2LTAA 3UWMA 4K9DA 3H6HA 2WYHA 3FBWA 1T8PA 5D6NA 3R9KA 1GZ6A 1ZK0A 1OXSC 3AUFA 2OCDA 1GO2A 2WA2A 4V0RA 5BO5A 5KAMA 2YXPX 3KQQA 4AWBA 5HZGA 3H4TA 1JZTA 4P7GA 2DWCA 1D2NA 1NU8A 2OGWA 3U7HB 2MOKA 1NQTA 1M2FA 2I91A 3BJZA 1DIGA 5F3RA 4AJKA 5CLQA 2EFHB 4EVSA 8AT1A 4UCFA 5JXGA 3OU2A 1DFIA 1GV1A 1Z25A 5BSWA 5LIPA 2VHVA 2I2DA 4MRPA 2FJUA 2R8BA 1G42A 1K97A 1LX6A 2C99A 1Q7GA 3AQ4A 1DG9A 3ORRA 2QXYA 1BA3A 2JW5A 3CX4A 3LT5A 5JYBA 4YUYA 1C1XA 3FUVA 2Q1SA 1G20A 1SVKA 1ISRA 1V16A 1HDCA 5T3UA 3PC3A 2HRRA 1BJKA 2IEZA 2GEJA 2X23A 4A92A 1ECGA 3H9EO 3LIPA 1H1TA 3VZDA 5AKGA 2Y3IA 2PNFA 5KSWB 5F52A 1XLVA 2OZKA 2VBIA 2ZR0A 3JV7A 3ETCA 2A78A 1WB4A 3PFHA 2IY9A 4JJ6A 5THKA 3SXPA 3P9YA 621PA 4V3CA 2A58A 3ICCA 5JVDB 1NPYA 3D6TB 1GG9A 3THOA 3G5LA 5L3ZA 3VR6D 2B9VA 1BVHA 2RHMA 2FCAA 1P81A 1RLMA 4MRSA 1JQKA 5FI3A 1A88A 3O8RA 1XL1A 2ZJ3A 3HZHA 1SOAA 3IIJA 4QYWA 3DVRX 5HF8A 4BP1A 1AO0A 1OCEA 3MCWA 3BKWA 1E1KA 2MR5A 1F6DA 1Q20A 1IQRA 4LG1A 1TK3A 3OAAA 4D5GA 1DRWA 1CX9B 1F48A 1U2DC 3H84A 3IEMA 2OYRA 3M6IA 4INJA 4M49A 3HZRA 1I32A 4NONA 2P8SA 5BORA 1LPSA 3QQ5A 3L5OA 3CRNA 5I7FA 4YJ2A 3DV9A 2OFFA 3T3EA 2SKCA 1LDEA 1L5FA 2FNAA 1DWUA 3TK1A 3AR9A 3F3SA 1UT6A 2QZPA 4YMLA 3E9RA 5BNZA 2VTBB 4LX0A 2WWWA 4BV8A 1IBKB 1MQ9A 1F9EA 4G0XA 1P4HA 2RHBA 3UFXA 4EI2A 3I9OA 3D8RA 5FPKA 1HLFA 1NVUQ 4WLFA 3DL4A 1FL9A 3JWEA 3IKJA 4P3XA 1THMA 1XEWX 2L18A 2XKJE 3NKFA 3MG9A 4FHEA 4CHTA 4MDEA 2X42A 4GBED 5IDWA 1JMYA 3LF2A 1AGRA 4KQEA 4L5JA 1XVUA 1RM3A 2KLHA 2P9EA 3M5PA 3MEQA 1PZNA 3MK31 3SQMA 3TIVA 2ZIAA 1DC4A 3TW6A 5B1IA 1QKJA 2XTNA 3PZRA 4KXMA 5H68A 1QH9A 1SHJA 1ZZGA 4A3SA 2QI9F 4IJQA 4XVHA 1IXZA 5DHTA 5TC4A 1JEAA 1Q21A 2G9NA 5C8VA 2I7XA 2C00A 1ID1A 5CYFA 4HNTA 4FOPA 3UVEA 3DWGA 4P22A 1UWVA 2FLWA 3PPVA 3Q7QA 3R5KA 4D9MA 4RTMA 3HB9A 5FWXA 5LUAA 1Y42X 2AG1A 4D8XA 4YUAA 1QFYA 3EZ9A 2FA9A 3VSDA 5AM2A 5I7RA 3W5BA 1RWQA 4HDAA 2EQ5A 2YWGA 3LU1A 3E05A 3FPGA 4LY9A 4UULA 4HNQA 4IKOA 3WGMA 5EUCA 2H8KA 2YZ7A 4UM5A 4EG3A 2GN0A 4YT4A 1KBZA 1AHNA 1C1DB 2PV0A 2Z95A 3P0IA 1FX0A 4JZKA 5AM1A 4ZVUA 3FVWA 3IOCA 5C1IA 1UZNA 1H6DA 1NXXA 1BEUB 4HDQB 2CSUA 3FOFC 2EIXA 4UXJA 3TSZA 2AFHB 3LHKA 4XFKA 5AQ1A 5AKLA 1OFTA 2R3SA 2C7BA 3FNBA 1KY2A 4KC0A 4OHWA 4ZVNA 1SXPA 2HBQA 1VHTA 1GAEO 1PL7A 1OW3B 1SJ9A 5DX0A 2KHZA 1SRRA 3OWHA 2WM2A 1KKLA 2BFBB 2EKQA 2C4KA 4HBGA 4A6XA 3HEMA 3ZDYB 4Z0PA 4JXZA 1XB2A 5EXDA 1TT5A 1O77A 3N2LA 5F2OA 3L1KA 1KDZA 4BWYA 3CJTA 4WCVA 3B6EA 2QTZA 1JQAA 1DINA 1DLJA 1PQPA 2R4UA 5HGJA 4KRGA 1REQA 5KVQA 5CGQB 5HCUA 3RYIB 3NH6A 1Z06A 4URVR 5LOVF 1SC6A 2QK4A 1LK5A 4L6CA 5K8CA 1U9IA 2HQOA 4R51A 1QH1B 3EXEA 5EJ6A 1I6LA 2HPHA 4NCHA 4OMFG 2OEPA 2I54A 1OH7A 2W22A 3GDGA 4A1FA 2ECKA 4JT2A 1IEWA 4L4SA 1P2SA 2V74B 1Z6XA 2J6IA 1K6JA 2H1SA 4MW1A 3MFQA 1Y5RA 4PO1A 4WECA 4J1TA 2IPXA 3HB7A 2FGJA 3LCVB 1I9CA 2QZ9A 2J3QA 1WOYA 3QG5A 2DUJA 1P1KA 4MUKA 5IJ0B 4ALJA 4QRDA 3K70D 2HT1A 1HT3A 4FYHA 4PTYA 1Y8RB 1C30A 3E5NA 1JJBA 3JY6A 4BY9E 4RGVA 2GBPA 1II9A 2DFLA 4LDRA 4K3VA 2JFBA 1NBMD 1QQ5A 1DEOA 1JI3A 1K63A 4FBMA 3TJZA 3DPIA 3TRFA 3TRIA 2WAYA 1AX9A 3JYNA 2QUJA 2XUOA 1YBMA 4X1OA 1SXJC 1JILA 1PJ2A 4KXQA 1NQOA 5CJ2A 4DXHA 3KDPA 3LS2A 2ZUFA 3A27A 1XL0A 1GGVA 5K0CA 3NBMA 2FPPA 3KOYA 1O4VA 3OEHA 4PEVA 4TQUS 5AJXA 3P0JA 5MDHA 1SD5A 2QE6A 2W43A 3A6GA 3NNNA 4BLTA 5AJVB 2BKLA 4IRMA 4NEGA 3C48A 4Z4QA 1D0SA 3LHDA 3JAKA 4N47A 5LZ4A 2F1JA 5DTQA 3QNWA 1X7ZA 5HEKA 5CCBA 4W1QA 3I04A 1S02A 3BIXA 4BBJA 4Z53A 2OBBA 4S1PA 4BJ5A 3PUWA 3ASYA 4HNUA 4Z7JA 5M34A 4Y18A 5IFKA 1UADA 1T9HA 1XK7A 3WMFA 3UHOA 1J0DA 4W7SA 2R6CA 1HSOA 3WBBA 1JEJA 4X1IB 2YIMA 4S35A 3X1WA 2DG2A 2DTDA 2Q3CA 4L0CA 4ZHQB 2O8FA 1Z6QA 1X8JA 1MOQA 1W35A 1XCPA 2Q6KA 3A4TA 3P4UA 3E1GA 1Z45A 3OE7D 4FYPA 3C6KA 3CRQA 2B83A 3ML1A 1M6YA 3QIAA 3UV3A 3KR2A 4DMKA 2GD6A 2P1RA 3QLVC 3F7OA 4E3ZA 2J4DA 5KQLA 2HGSA 5K3BA 1SBNE 1L5QA 4I50B 4YJDA 4Y2TA 2VQFB 1M2VA 2XGJA 3EGWA 1KSFX 2Q3DA 1E7QA 1H3NA 1YS2X 4RZHA 5TQJA 2QN8A 3RREA 3OG9A 2E4WA 2HWUA 4ZD6A 1CHNA 4N5LA 3L0DA 3H5VA 2VDWA 2C0CA 4P4SA 3S5JA 4DG9A 4QBGB 3AXSA 1TK9A 3HFSA 4D3DA 1E3MA 1C14A 1RQRA 1Z6AA 2QMQA 1J2JA 4JBGA 3ZDZB 3ZWQA 2Z3ZA 3TIIA 3RF6A 3TTWA 2G9UA 2ZQZA 4KYIB 3DEAA 4JC8A 4FYYA 4CEJB 1AUXA 1IJFA 4O2RA 1XE3A 4RGYA 1Y5IA 1UM8A 3U48A 5K0GA 4E13A 4B85A 2VYVA 3ETGA 3A6DA 4UKDA 5JNTA 2AW3A 3TXXA 5CVDA 5DBFA 3GJ6A 4KO2S 2VRCA 3CLVA 3D8UA 1OV6A 1VGQA 4JP2A 3T9BA 2XWJI 3V6LA 3DE4X 3NI2A 1AKTA 2NU6A 4B09A 2AFIA 2VFAA 2PWYA 3BK1A 3RBAA 3V46A 1Z2AA 4A16A 5HXAA 1B8VA 2C2ZA 4RXTA 1J42A 4IIXA 4QDOA 3DVAA 1G21A 1DAGA 2JASA 3MS4A 1XRPA 4F9FA 4A8HA 3R3UA 4CQNA 3ZIAA 1V39A 4M1EA 1G5IA 4BE4A 5C1BA 1TCBA 4PYOA 3GUYA 1CR0A 1QUFA 2PEZA 3VU1A 3G9XA 1XZNA 3IEPA 5JS2A 5I47A 1NW9B 2FMXA 2ZWMA 1HG1A 4Y9TA 3IPRA 3O95A 4NWIA 5HK9A 8ABPA 4TQ9A 3IVGA 1IN8A 2VDOB 3AKYA 4LQCA 4ZAFA 4JENA 3H2YA 2JLVA 1AS0A 4MQMA 2WIAA 3T9EA 2WV9A 3IDZA 1U65A 1L9XA 2C3PA 4YACA 1G5PA 2Z5LA 5BYJA 3SXJA 5KTRA 3IBTA 4TYPA 4NE7A 5KNBA 4PFJA 3HKCA 1KOFA 3L43A 4EJ2A 3DOFA 2IUFA 3RC7A 1ADBA 3JD1A 3IP7A 4DQVA 5TF4A 5C5IA 5TNXA 2GGSA 1J1ZA 3GB9A 4MI3A 4OX9Y 2XCRB 3DF7A 1GVHA 1FY2A 4P6VF 4EY7A 4KQKA 1T4CB 3UATA 3ZS9A 4AMZA 1RZRD 1FUYB 4GC5A 1BS1A 2O23A 4UUPA 3IL2A 3EQ8A 2IYVA 3PDWA 2OP0A 2HRCA 2JJ1D 4RL6A 3QPCA 2PRIA 3E5MA 1KZYC 1ISSA 1J06A 4ZO6A 4YRDA 3SYMA 2W2OA 4EYGA 3E53A 2ZRJA 4MVYA 4RS4A 4MUGA 2NADA 2PUEA 2HR1A 3ZH2A 3RSQA 1G4AE 5FO1A 3NTRA 5CB4A 1CZHA 1JUDA 1QAMA 2E55A 3PCTA 2IYUA 4IJ5A 1FYEA 2XZTA 3IUSA 1ZEJA 2O1XA 4ENTA 3GQVA 5CFPA 1NXVA 4FLFA 2R9VA 2A0KA 3LUJA 3C6BA 5BWCA 1RHUA 1ZWKA 2IHTA 1IN6A 2C7OA 1U6IA 1X7HA 3JYPA 3NHKA 4LXYA 4JA2A 4N6NA 3WRWA 1U2ZA 2D4AA 2OVBA 1N0IA 5CLLA 4ND5A 1CULC 4A26A 4M0DA 5HCIA 4TZ0A 1QH8A 3RAPR 3SPXA 4FNMA 1BWRA 4Q19A 1XUOA 2FSVC 4DLBA 2PY6A 4HEA6 4BX9A 1GNSA 3OEYA 1PUIA 2DFDA 2HMYB 4B44A 3JWJA 3BD6A 4I5FA 1XTPA 2YV2A 4HN9A 5FNVB 2QT9A 5ICGA 3M3PA 3OZIA 1MX1A 3LBIA 4G0NA 1IHYA 2EYUA 3LD9A 3EIUA 4PICA 4X6XA 3SBEA 4BIIA 5AIAA 4NAVA 4D4KA 1S0UA 4LRWA 2J9ZB 3EEFA 4RELA 2E4AA 1Z5OA 3TW8B 2DWOA 2VZ0A 5KPDA 3WQSB 1IY9A 1R0WA 1YCFA 3QXHA 2UZAA 2YWXA 3DO6A 2FPSA 4RWEA 5EMLA 4HDMB 1UPXA 2FUG1 1Z12A 2PZ8A 2FFBA 3U2QA 3A7EA 4DV1B 1OX6A 1XMIA 4R0VA 2QE7A 2VQSA 5I9SA 3TAHA 4B6PA 1DS6A 5JAIA 3WS7A 3PC6A 1K9SA 5AVSA 2QI9C 1RI1A 2E6UX 2EDCA 5FPQA 3KCNA 2GAIA 4D0RA 4IEIA 2HJHA 1E1CA 4BV9A 2GF0A 1RRGA 3V55A 2GVZC 2OV1A 1TI7A 1MPTA 3KHSA 3Q3IA 5CYGA 4Y2RA 1QYIA 3QKIA 2DR3A 4FTWA 1V8BA 3EBOA 2ASEA 4D9HA 3PLAE 3FWPA 3I8XA 3HBMA 4CMJA 1NXTA 3AEQB 3BBLA 1RWPA 2Q8QA 1ZGJA 3DMPA 4FUTA 4IXWA 3AR4A 4NSNA 1O6ZA 3EXHC 3OLXA 3VXKA 3L0CA 1TNDA 3NHJA 4L75A 4LWQA 1ILWA 1FVFA 2PANA 4MV8A 5BN4B 1NN5A 1EFCA 1XD8A 1K08A 2RHTA 3NASA 1UAYA 4D57A 5FJJA 1UWLA 4FFVA 1EP9A 1TMYA 4I3HA 4YV7A 3L7OA 2VNKA 1B1AA 3BE8A 4LYAA 5C53B 1JG3A 1WS6A 2H1RA 1RRKA 3R5FA 4HDRA 2D13A 4OGWA 4PYIA 5B3KA 2M1ZA 3AL2A 1PHPA 1WCYA 3J7TA 1DADA 1UWKA 3FMGA 4PWYA 1HTTA 3W6NA 3F6PA 4KLNA 3WGLA 1S9DA 2H1WA 5IAJA 2D0IA 1KYWA 3N3AC 4CIBA 3V3KA 1QP7A 3CPSA 2MU1A 3EH1A 2YWJA 3V6MA 4ARUA 2DRIA 5JS7A 1I7DA 3OF5A 5AICA 1G0OA 4QIHA 4UFOA 3LYUA 4JI5B 4C6TB 3H5TA 3THWA 1BFDA 1N9ZA 2WIJA 4NDAA 4N5MA 2YNMD 4M7OA 1TAQA 2J9XB 3A9TA 5SICE 4EHNA 1E2HA 1F0YA 3SWWA 4NBRA 1EFKA 1VCMA 3AOGA 5JCOA 1C0KA 1U6KA 1HV8A 3R9WA 3NHSA 1R0ZA 1NBME 1WNTA 2P3QA 3G7UA 1IXSB 1HEUA 2DJIA 3LWNA 3MC1A 4GOLD 5CX1A 3MWEB 3FYUC 5E3IA 2V5UA 3GMTA 2N75A 1GAQA 1TQ8A 2WPNA 1OGJA 4IIHA 4OHKA 1L5HA 3DYIA 4M1TA 2IX3A 1DPGA 5LZ5A 1VL2A 1OYYA 3ZNOA 1WMSA 3FZGA 5AXCA 5IUNC 1X1RA 3IPLA 3PI6A 1CW2B 2DQ4A 5ALYA 1MX9A 1G5TA 3N0XA 2FEOA 2W6NA 3REGA 2ZJ4A 1TZJA 4LRSB 1DDOA 3PPXA 1ZD4A 2BBOA 1GHTA 4UU0A 1IL0A 1Z2EA 1QF7A 3GLIB 4MWBA 1OT3A 2QMHA 3KT0A 3CRZA 4X7BA 2AC4A 4BV2A 1NG9A 1F1BA 3ELUA 1WKVA 3ZNPA 4NYIR 3WR5A 1W8DA 4BN4A 2ZUBA 3RGWS 4U7DA 2H0QA 2P69A 1CNMA 3D0RA 1P61B 3F47A 3ILYA 4GEKA 4MH0R 1DIBA 3EGDB 5D01A 3TQHA 1G2PA 1BHQ1 3OLYA 4P2BA 1HZZA 3W6ZA 2WJYA 1Z9BA 1MAAA 1XAHA 1A9XB 1L5WA 1H2AS 1G18A 2LIVA 3FPBA 4KO1S 4LN1A 3VH4A 5JZMA 2CV2A 2O8CA 2BHTA 2J31A 2PRJA 3D2BA 4I5DA 4WE3A 5FOXA 3SNKA 1XAJA 1MN6A 5C1PA 5LIRA 3CMCO 1ODFA 2BF7A 4V0ME 1W0KD 1ULHA 4WX2B 2I8AA 4Y7DA 4B47A 3HE3A 1X7WB 1G4HA 4ARIA 2QZ4A 1QVWA 5ADUS 4G6ZA 3RIXA 3F5SA 5FEUA 3AERA 1C3OA 3GLFE 4WZBE 5A06A 3VPFA 1U1IA 2E1RA 2XUZA 2CKMA 3AL3A 3LZ6A 2OORA 3ZGZA 1C3JA 2HV9A 4ZAZA 4FWBA 4OJKA 4MYDA 4TV9B 3G82C 2FZEA 3LVBA 2YWFA 3RKUA 1TGVA 2NT4A 4IS2A 2E89A 3PNLA 1IVSA 1W8IA 1UMKA 5C3UA 1JHRA 2ZQYA 1JXQA 3V9PA 3DV0B 2NXJA 3Q6MA 5BQPA 4I8XA 3TXYA 5CB0A 4LMBA 4C14A 2O8BA 1Q74A 3QNMA 4IIYA 1YRHA 4MITA 3UG7A 2G09A 1YZFA 1LF0A 1O97D 3BGVA 1S1CA 4HS9A 1ZS9A 4TVKA 1N0UA 3MS2A 3ETJA 2VYND 1C4OA 4LSMA 2AX3A 1Y1SA 2ZWPA 2HSEA 5DKFA 2OXEA 2QLFA 3A14A 1A96A 4KR2A 5TGDA 3WA7A 3A4IA 1X1EA 3WJ1A 3NPMA 4JQSA 1WXIA 1ZH6A 3QXSA 4NCJA 5DCWA 5ERYA 1LV8A 3CQ9A 5TF0A 2M6LA 1DJMA 1DI0A 1MAWA 2BM8A 3NCTA 1COWA 1QO7A 1ZUD1 2ZI7A 1XLTC 2ZJAA 4MV9A 3SZRA 4BNXA 4I55F 4BVBA 2WSBA 1PJCA 2ZR8A 1JH8A 3NYWA 3QGMA 2DUUA 1VYHA 4DDVA 3I30X 1IB6A 4L9AA 3WKEA 5K05A 4FM9A 4BMXA 2AVDA 3EDCA 4WFIA 5IS2A 1RAEA 1YBHA 4ZOEA 2HDOA 2JS7A 3KU1A 4YR9A 4G09A 1YVPA 4JV5B 4YALA 1ECPA 1U9CA 3LW7A 3L0IB 1J8MF 4J2OA 3UMFA 3O8OA 4CM8B 5BV1A 1Y6FA 3TMKA 1LVGA 3VM6A 5SYMA 4G0UA 3PT5A 3QLUA 1ZM3A 1ZD2P 3MMSA 2QZJA 5KYVA 4AULA 1ZR4A 4DM4A 1PV1A 4DRZA 2ATVA 4FDUA 1LW7A 1GL9B 5ELLA 1DQZA 1YQXA 1Z3IX 1QHHB 2D1QA 3C7TA 3LCCA 5F9MA 1DIOB 2WD8A 5BOSA 5M29A 2I9PA 3B3AA 3T52A 4QLOA 3TQRA 2BC9A 2D7CA 1LDMA 3NBUA 2R48A 2YC4C 4Q3OA 2JLUA 3QNUA 5ENVA 4GLOA 1RZRA 2YN4A 2ZW9A 2EL9A 4Q1CA 1M2GA 1BYIA 2WINI 3K0CC 4GGPA 4Q48A 3KEMA 4TKUB 3SKXA 1DJQA 4RY2A 1BEZA 2JLCA 2CYAA 3DBLB 4XD7A 3ABSB 4D0GA 1UWCA 4PLHA 3A9SA 2ZJFA 2RGXA 4BVGA 1QONA 1IVNA 2VJBA 3EBPA 4IF4A 2VSYA 2XCUA 5JZOA 4JLDA 3E7WA 5F5NA 2BFDA 4LOLA 4A8TA 3PICA 2C9ZA 3OZSA 4QDKA 1JDBB 2YCBA 3HR7A 4Q00A 2IPNA 3DKKA 4ZZ3A 4JFRA 2W90A 1IWBB 4HWGA 2VYQA 1L6RA 4E03A 3R1IA 2XUHA 3UHPA 1KAHA 4HWRA 4YMHA 4JMPA 4YMGA 2AZDA 4RSRA 2UVQA 3JQ9A 4D44A 5CDFE 2EJUA 5AJTA 3BMQA 2DB3A 3TG8A 2BN4A 3HLYA 4GGOA 3BVPA 3L6OO 1VE9A 2R8EA 3C3YA 4YDQA 4HZUA 4BOYA 1Z34A 3RSFA 1UJBA 3AEXA 3KR0A 4N12A 5HF6A 1FFAA 1DCFA 2J6BA 2QP9X 3MQ4A 1JQ5A 2FZVA 2MYTA 4NV1A 3VI4B 4BYMA 3DBRA 4QEKA 4NHOA 3C3EA 4E5PA 1H2EA 5BVGA 2XVAA 3PXEA 2C2HA 1R9GA 2B69A 3B1FA 3CXRA 4RKWA 2ZSIA 1IHUA 3WK8A 1ENOA 4AWAA 5BN4A 2CEKA 1SVUA 1E1MA 2DAPA 3W9YA 1EBBA 1G17A 2FMFA 1K6IA 2QXUA 4I1YA 4S1OA 3T7KA 5JTTA 3AIKA 3PENA 1CERA 4J1QA 5JHHB 2JZCA 1JAHA 4QPJC 4RA6B 1IHXA 3A6JA 1CRQA 4EYKA 1C9KA 1NJ1A 3GFQA 3Q11A 3SIWA 4HT3B 1FBNA 4R2IA 1Y3CE 4HTAA 4CR8A 3OLVA 1GGNA 2QTTA 2EFEB 2WBLC 1WBDA 2VP2A 4BFXA 4RV9A 5KWSA 4RVCA 4YV2A 1DRJA 4EF6A 3QVLA 4EENA 1X7XA 1THGA 4DQUA 4UEOA 2AX4A 4IDDA 3I12A 2P4SA 4LBZA 5KKCA 3UH0A 1Z37A 3DFMA 4POOA 5AKYA 2NSDA 5ENDA 1UJ6A 3OZVA 5JI3E 1ISGA 3D0KA 1LK7A 4F3RA 3BL8A 3WX0A 4ZANA 2AXQA 2HLHA 4X61A 4EEKA 3PI7A 1DL5A 3RC1A 4OQ4A 5AM4A 2EBHX 2KYRA 4HGOA 1F2UA 4LDJA 1X9HA 1OAOC 2QL5A 3ANMA 1TA4A 4JELA 3KD2A 2CT8A 3ZDRA 1U0OC 3DOHA 2QT0A 4XM0A 5LMUB 4Y3UA 4LOJA 2C84A 1G21E 1SQ0A 2Z2XA 3PK0A 3AK4A 4FR5A 4ND6A 3VYTB 5BXQC 4LFBB 3LOQA 3KSRA 2O2ZA 3NEPX 1OOEA 2A0XA 1OJLA 3DBHB 3O03A 4H4CA 3G0DA 3IODA 4MKHA 2AQKA 3ZJUA 2YNMA 1H2WA 2DUMA 3UWDA 4WJZA 5BWLA 3AM5A 5MFPA 1RHRA 1YFZA 5G1PA 1EJBA 3N28A 2JFFA 2NZYA 3AVOA 3SZGA 2CC2A 2DCMA 3LBAA 5ESWA 1VKJA 3DMFA 4BYGA 1I7QB 3SN6A 4DLSA 3DR5A 1EP1B 1LBSA 1UL1X 5GZ6A 3NB0A 4X60A 1SUFA 1BXKA 2P2GA 2FV8A 3KTOA 3KV3O 3P96A 4HUJA 3TLZA 2PZLA 5CJPA 5CAEA 1P2GA 3I5XA 1YXMA 5BN5B 4H7EA 4D82A 3UGQA 3AFIA 4KV9A 5DWDA 3OHSX 5F2NA 1U2EA 2CXQA 2JA2A 3WRXC 2L42A 3JD3A 4EY8A 1FTWA 5AUQA 3EWNA 3USCS 1R5BA 2H5JA 2YBEA 3N75A 5AM0A 2BKAA 3ZOKA 2SNIE 3AF4A 3AONB 3FFTA 3K9BA 3K2EA 4IDBA 4WIAA 3U0VA 3VR5D 2Q5IA 1IZYA 4JU9A 5KMGB 3QRWA 1AIPA 3ETLA 4FW9A 4E1BA 3HVKA 3U3DA 2JCYA 4YAKA 4ZMBA 2D3TA 2FU5C 4JT4A 3OZFA 3TNFA 1V37A 1ZH4A 2HH9A 4GL4A 1TEHA 4TL6A 3RS4A 4DV0B 3SIPA 4PZUA 2PQ2A 2YYSA 4EHIA 4M89A 5BMVA 1MABB 3A2LA 3LK6A 1NM5A 4GX2A 2L0XA 4ICIA 4YMUA 2BCJQ 4IRXA 4QNMA 4AJIA 5DK4A 2BHLA 3DDSA 4C4ZA 3GCGA 4Z4EA 1Z82A 2VT3A 2C5FA 2O6LA 3E18A 5LP1A 1V8PA 1O94D 3I09A 1LZLA 4L8VA 4R5HA 4MTCA 1V8DA 3CS3A 2UKDA 4CMAA 5F76A 1WV1A 2V4ZA 1GUDA 1PHRA 4B8ZA 2BGNA 1M34B 1FYFA 4MPJA 3GVCA 1TYZA 2YMQA 3W8NA 3NJ8A 4BKPA 1RNLA 4UBIA 2WWFA 4NATA 4WOKA 3HJCA 3H7AA 1XLTA 1L4KA 2FRDC 3DE0X 1MJNA 3MGCA 4ZCSA 4D9FA 4EIWA 3D2CA 3K09C 3HXKA 1VPLA 1XXHA 2IYNA 3COPA 4IJKA 4DR1B 3A3NA 3MWDA 3COSA 5DBGA 1OLXB 1JB9A 1QGZA 3LCRA 1AQIA 1VFPA 1GITA 3KJXA 5U9CA 4ESVA 3ECSA 1DT3A 2W6JD 7REQA 1D0IA 4FIDA 1K8ZB 5J43A 3M82A 3BWDD 3ZWKA 1K7XB 3MWGA 5MGNA 4O3MA 4HDNA 4UPDA 3SU8A 1EUCB 1PJRA 2JKVA 4GR4A 1TA9A 2Y1KA 5HFAA 5J2TF 4EPVA 5KKAA 3UAGA 3VNUA 3TRJA 4OEHA 4JLWA 1XELA 3UUWA 2OKGA 2VG8A 3DZBA 5FUWA 1NF9A 3S99A 3X1JA 1KI2A 4JLSA 3RRMA 3ZGNA 1QXSA 1I1QB 3CV3A 3EZ2A 2CXNA 2ZRIA 2PCLA 3CYFA 1JTFA 4LV5B 3FTNA 3TG2A 1N0WA 4FVTA 2W00A 4K5QA 4KJXA 3U3JA 1TT7A 5K8UA 4M8LA 3A4LA 4KDRA 4DQDA 2CLMB 1BCRB 3CUSA 3MJRA 2OY0A 4Y30A 2ZE6A 1BQEA 3UYLA 1E69A 5JD6A 1WZUA 1D2AA 2Q6IA 2OHOA 4NYJQ 4ND7A 3MJEA 1ZI9A 1OBCA 2PM8A 3IT1A 3ZZNA 4UOEA 1PWEA 3Q7RA 1G6HA 1JZQA 1X1BA 3OOSA 1ZX1A 3C5CA 3K20A 3B7WA 4I9FA 2NZ2A 5J5CA 3ZUPA 2LCFA 1LWNA 5JY6A 1RBZA 2WYWA 4CFYA 2O3JA 3ABZA 3CGWA 3KFXA 1M73E 1WG8A 4KZKA 5GM1A 3RU7A 5CDUA 3HY6A 3GLHA 1WZEA 4GI3A 5FBRB 1GKLA 3C87A 3GZNB 3PRHA 3QH4A 1YBVA 4HUQB 4RU1A 1P0CA 4KCGA 3T1OA 5EIHA 3WXMA 4R0MA 5BSEA 1SBIA 4R01A 2OHVA 2BL4A 3NBXX 3VTKA 1CWUA 2P5YA 3ENKA 4F3KA 4QXOA 1X15A 4IQFA 3QSGA 1VYUA 2ZEJA 4K7JA 5A3QA 3P20A 5DEOA 3JAKB 1ZMXA 3QY0A 4NX2A 2DFVA 4ROTA 5CNMA 3UB2A 5J4KA 4WNYA 1EEHA 1VTKA 3SAJA 4KE6A 1ONPA 3ACBA 5K3CA 4NOKA 1D6MA 4XWKA 1IOZA 4BO4A 2CLDX 3M3HA 4C7XA 5KWIA 1IH8A 3DMHA 1MB3A 4EB0A 3V4ZA 1E6LA 1K92A 3IPXA 3PHHA 3HHEA 5DBEX 3R3HA 1VJCA 2DBRA 1Z8HA 3DSRA 2Z6AA 5J4HA 1U2TA 4PHHA 4UTRA 2GN9A 2C77A 3X44A 1M33A 1GFIA 3PPWA 1ZC4A 4Z4HA 5KU1A 4Y2VA 4YB8A 1AKYA 1ZUWA 3VPHA 3ZV5A 2PE5A 1GZVA 1OXVA 1X74A 5EMHA 4L16A 1TVCA 4BQOA 3UK7A 5IHXA 1DRUA 4KKVA 1J8YF 5A4JA 4E5DA 3SR3A 1A4UA 2WLTA 4BN0A 2DM6A 1HLGA 1J49A 2WG0A 2H63A 5BN5A 1GFSA 3EGEA 1JP7A 2ZBDA 3LCMA 4DHEA 1O0CA 3JWIA 2VKQA 5E9QA 3DCIA 5C51B 2DBZA 5BV2P 1CF4A 4GPAA 1EUDB 3I1YA 4X90A 3GDHA 2A5GA 3R6GA 1AS2A 4G97A 4JJIA 2WQ6A 3R7LA 4ZRDA 3A04A 1FRVA 1GGMA 2ZUDA 3GJ5A 3WV4A 2HD4A 4PHTA 3OJLA 1LX7A 3AP3A 2XQVA 3TBHA 1S3FA 1ZMOA 2VWGA 3G68A 3OPVA 3PITA 5CUQA 5SZIA 3CH4B 1QHNA 3GRRA 2AS0A 1MC8A 5AFSA 4CMGA 3ZVKA 3CR7A 3EVDA 3OCVA 4H3VA 4QXQA 3O7MA 4R2JA 2BFPA 2IIPA 2OBFA 4C4PA 1SD1A 4KXUA 3WDMA 4LZLA 1ONSA 2VAXA 1RQXA 4QULA 4UTXA 4EI7A 1J8FA 5KB3A 3GT4A 3ORSA 1JJIA 1NVVQ 3JQAD 4CM3A 1P9LA 4XCQA 1AGPA 4M0FA 5EMMA 1NN0A 1QCDA 1N6RA 1QCCA 4GF5A 4MS1A 4X0EA 1IWOA 1E4EA 1LPMA 3JQAA 2NO5A 1GCUA 1GSAA 3IE1A 4C7VA 5KDOA 5DLQC 4DRXA 5BQXA 5AOVA 3V8NA 1ZK1A 2QTLA 1HKUA 1Z4KA 1ZOOA 3A6FA 4MUAA 1XTJA 5CVJA 5FTLA 1ECFA 2QY9A 3FJOA 1MLDA 4GZ3A 2WJ4A 4NICA 2XR1A 3UT6A 3EPLA 1Z33A 3VPSA 1NU6A 1QIFA 4Q1EA 2O07A 3AQIA 2D8MA 3HJTA 3DMGA 4OH7A 1YR6A 4I1RA 2FJ0A 1LI5A 5FI1B 3LVRE 4FR0A 7MDHA 2R7LA 5BNFA 2CJXA 5LJLA 1AV6A 3I05A 1QX4A 5FBLB 2WWYA 3QLJA 1RMQA 1YZUA 4BB6A 5KKNB 1ULZA 1ZM2A 1C9DB 2H92A 2QRMA 2X7HA 3SQDA 1MMFB 3TCXB 1IEVA 4EAAA 1KOGA 1ZMTA 2WUWE 3OECA 3AUKA 1LXCA 2V03A 3M7IA 3NNDA 3M5CA 1KEPA 3OOJA 4F9TA 2Z6QA 3QEAZ 1K27A 4O1MA 2HHJA 3ODGA 1Z6TA 3QTLA 2CV1A 2UVPB 2WJ3A 4AZSA 4FR2A 4AY4A 4GVLA 4E5VA 3DAYA 2NVOA 4DMHA 3WLFA 1X19A 4ER3A 4G0WA 1DBPA 3LM8A 4OPMA 3UUGA 1EFDN 1CLEA 1G9XA 3HO6A 3IDFA 1EDZA 4FC6A 5L3RA 5A9TA 4OLBA 5JZSA 1JX6A 2BFEB 2QR3A 2GO1A 3AIIA 3CU5A 1UBKS 3DMRA 4FJ0A 4KW7A 4L6IA 3T3HA 1SK9A 4GOND 4AO7A 3O9MA 1W5BA 4PW0A 1FDRA 2QQ5A 4RMNA 5EVJA 3G5AA 3RJZA 3RVPA 3UT5B 4B4VA 1KOJA 2IH5A 4DUZB 1OBFO 4ZVTA 3R74A 1GGEA 2MYNA 2YVLA 1OB5A 2QSUA 3Q87B 1EJ6A 2QN2A 1PJTA 3AEZA 1W19A 3HG7A 4TWRA 2Q5HA 3HABA 4L8LA 4OHVA 3KVOA 3U4AA 3T5AA 1FVHA 1GA4A 2CB0A 1C8BA 1XJ0A 1P1FA 1GDDA 3I6BA 4HAYA 4I66A 2CXTA 4FILA 1PW7A 2BR3A 4UM9D 5FFFA 3H1GA 5KIAA 4XX1A 4MDFA 3BRWD 3NHUA 4D42A 5HYVA 4DNOA 2II6A 3H04A 5LQRA 3PNOA 1YL7A 1M6NA 3GJSA 3LX6A 4HRVA 2CFOA 3KXIA 1HRKA 1WVIA 4L3WA 3O4VA 4LIPD 5AI5A 2B4AA 4II2A 4Y1RA 3CTPA 1EM6A 2RGBA 4NE9A 1FDUA 1U2QA 4DG8A 1Z4PX 3EDRA 5K4HA 2PUDA 4DCMA 3W2TA 1TW2A 1CHDA 2XXJA 3M9LA 3SYNA 2O50A 3G9QA 5DGIA 1ZITA 1E1NA 3H9QA 3S70A 1VSQA 2CK3A 1HPLA 2P0EA 1J00A 3ACDA 2J87A 2W58A 3BJEA 3FIUA 3OZRA 1G7TA 1ULUA 2ZYSA 2XA9A 3AP2A 4HG2A 5ALUA 3CISA 5SYAA 3G2OA 3IMFA 3IR5A 5JC1A 2VQEB 4B7CA 3Q2IA 1T34A 1HFWA 1GN8A 3WK6A 1CUCA 1M2NA 2NVWA 3RODA 2X6RA 4RJLA 3TSCA 5EZ5A 3GIWA 4Q93A 4YCLA 2UZ4A 1E79A 4A9AA 4KTVE 2H18A 1JFVA 4EFMA 4Q66C 3E3LA 1QORA 4CG3A 3NC1C 4GRAA 3W05A 5K45A 1ZK2A 1SY7A 4Q9LA 2FXVA 1JVNA 4L0DA 1W25A 2I29A 1KYZA 5LZ7A 2A1IA 4MWCA 4KQMA 2AG6A 4XVRA 2WE7A 2OUIA 1PX2A 3B6IA 3FRJA 4XUEA 3IDQA 1Z26A 3WLTA 1OZFA 4UXIA 2JF0A 5AYVA 3W5UA 1DQSA 2FF7A 1CK4A 1Z62A 4IIDA 3SK0A 4QNRA 4W63A 2HLNA 3DMTA 3MAJA 4I08A 4WKCA 1V95A 3RVJA 4BQIA 3GU3A 1LNQA 3LMKA 4TV8A 4EX7A 2VK2A 3DXYA 2WMOB 2WYOA 4LRTB 4OIMA 4UTZA 5DASA 4Z0TA 1OGYA 2QNRA 4KWIA 1WSAA 5IMSA 5LQMA 1X2BA 1QV6A 4GP9A 2X2EA 4AZ0A 2IS6A 4PLWA 1ZJWA 1FNCA 2R5FA 3M1YA 4LBVA 5AK0A 4QBIA 1AKRA 4B6QA 1CG6A 5J4VA 3VX4A 2UYGA 5HM6A 4M55A 1YOBA 5IH7A 5JNLA 2FR0A 3U3XA 4DKJA 3CF4A 4HTFA 5K3DA 1I24A 3ABIA 3O82A 5H3HA 1OXBB 4FGJA 1EFLA 4H0NA 3R5HA 3PGVA 2ROQA 3CHYA 2HWYA 1NY6A 3PQEA 2OBYA 4L8GA 3K1TA 3ZJ4A 3IHWA 3HU3A 3LK7A 3HBJA 2IE8A 3K9FC 1T6NA 2JK0A 4QTXA 5AIBA 1C3VA 2I76A 1H2ZA 1FA9A 2JFHA 1C8VB 1DAOA 4G5GA 2B1RA 3BH0A 4YJFA 4PQYA 4M46A 3L4SO 2OAGA 1PJQA 2HXGA 4MIYA 1GTRA 4PC1A 1U0BB 4GT1A 1FDSA 1XCJA 4JQOA 1MIOB 3L8ZA 5G0TA 2I34A 3T3IA 1N6HA 3N5CA 4RL4A 1N2CA 1GUZA 2VHJA 1P0FA 1JT9A 2QLJA 3CFYA 3E9QA 3GLFA 2IGBA 4IH4A 4LJRA 3QFSA 2XT9A 2UZ0A 1UC9A 4Q9KA 3ZLVA 1TADA 1I3MA 2H48A 1J9ZA 2VTEA 1VI6A 4NYIQ 5LC1A 5DN6A 1YB5A 4B6EA 5JR3A 5MHTA 4QQRA 1QGYA 2C4TA 4XDYA 5CVUA 5K6AA 4EVRA 5L4NA 1WHSA 5FBHA 1ORDA 1PT5A 3GROA 4AMVA 1VLZA 2QLLA 4G5SA 4JITA 1Z4IA 4CLRB 3KLPX 3PC7A 5KYXB 5LQDA 3DWEX 3NBFA 3W9BA 2BTEA 1BMFA 4FFPA 4IQGA 2WEKA 3EGVA 4QC2A 1T0JB 1JYSA 4XIFA 1Q0HA 3V1YA 1X77A 4PGMA 3MBIA 4MR7A 4OUDB 4BZZA 4JJ4A 3ICQB 3F5FA 4BATA 1N2IA 3GLKA 2FFAA 2BZ0A 4LV6A 3WLPA 5FLEX 1W49A 1XQVA 3CF0A 2REXB 3AF5A 3DMDA 4RHFA 3L1IA 1XV5A 3NNSA 3CLHA 2WHYA 2JI8A 3L04A 2F4VB 2YFYA 3K5HA 3HVIA 4OQLA 3GH1A 4II3A 4Y98A 3GPCA 2C58A 4J29A 4V3BA 2UDPA 1RC1A 1BJTA 1AT1A 4KXYA 3W5DA 1DKLA 2AUMA 2Q5OA 4UJ5A 1V9CA 3B48A 2JFXA 2VBGA 5TB5A 3S1AB 1DQNA 3HDGA 3DC7A 2HHCA 1YIDA 4J1NA 4B4KA 3R8XA 3IDAA 3OF3A 3AV0B 4JJZA 2R25B 1F0PA 4J4HA 5HKAA 3KETA 3L79A 4MP3A 4QU0A 2W2XA 3VZBA 4URXR 1CDEA 1XNHA 2PTGA 3I9MA 4R9VA 2KX7A 1RPAA 1E60A 2B7LA 1X1QA 3Q5EA 3IOYA 3H42B 3THWB 4Q18A 5KZMB 3NDJA 2HRZA 3UT5A 1JLSA 3SNHA 2HBRA 2GJ4A 1M6EX 3QA9A 5CNJA 5KOHB 1DT5A 4GYWA 3RAJA 3ZTTA 4I8IA 3LO5A 1HUQA 2CNWD 2CLSA 3HDQA 1YKGA 5BRAA 4WZ6A 2H4FA 3QVXA 3K31A 4G2NA 3LC7O 3EC7A 4H27A 4Q21A 5JHGB 1U7WA 4R2WA 5SY6A 1I7PA 4I9HA 3BFPA 2VHZA 3S2SA 5L7YA 3L41A 2IYPA 3W3AH 1YVRA 3HA2A 1JE1A 5G1NA 2XHEA 2OAP1 2RKBA 4H7PA 5E6UA 3Q6NA 3RPEA 3U80A 3SD7A 2P62A 5BQ3A 1GPJA 4O2AB 4YMSA 5BNTA 5L6MB 4KXFB 4P7KA 3QVTA 2NZJA 4J9VA 3ZK7A 2ZZNA 2MSLA 3FRHA 3KBOA 2K5UA 2ZIWB 3MD9A 3AGQA 3WWZA 2IDKA 5KSPA 3Q8LA 1E2QA 2J32A 2CVZA 3ZQKA 1KFKB 1Q7CA 5EIAA 4N5HX 1OY1A 3C6ZA 5I5GA 2HWKA 3R7NA 5FBVB 4LJYA 5DDIP 2PBZA 2H7CA 1K6EA 4DANA 4JFAA 5G0SA 4LPSA 5C34B 4E6EA 5INTA 2WVGA 4YJ3A 4NJOA 4RVFA 2YFKA 2YUIA 2OM2A 1JL3A 3A0RB 3EHEA 4S2EA 3E3AA 5IC6A 2OPHA 1CUEA 1CQJA 2YC2C 2ZIGA 2W6IA 3EOAI 3O84A 5CT5A 1F06A 3KAPA 5E4JA 5TEWA 2WQ7A 3FTFA 2PZAA 2EVWX 3PNYA 1C5KA 3TS1A 4XLZA 1QTIA 1A95A 2HUNA 4MVJP 4PXSA 1SAYA 3DEYX 1JIJA 1KXJA 2YHIA 3T4XA 2AR9A 3VDXA 1ZR2A 2ZJ5A 4KR3A 4OXYA 1YT5A 1PG0A 4DBLE 1E98A 3E9ZA 3FFXA 1BOOA 1XKQA 1NVKA 2XEXA 1EESA 3PIRA 1NJSA 2YHBA 3AFOA 4CETA 1U90A 3AG6A 1NA5A 5CBPB 1M7GA 1H1DA 3JVVA 4AQ7A 3V1MA 1ESMA 3IAS1 4S2UA 5FXMA 5CLGA 1OPXA 4BKUA 1N9GB 2JIZA 5LWHA 4DUGD 4F3NA 2XGGA 2VAMA 2Y9PB 1H5QA 1O2DA 4YX9A 4CL2A 1LRKA 5E6RA 4B5KA 5F5XA 5A2GA 4DDTA 2FWAA 1BXGB 3U44B 4YROA 4HJXA 5BUZA 2RK4A 3K8ZA 1SUEA 3TW0A 2E7ZA 5FQOA 3V7NA 2F3SA 4NCBA 1IULA 1FS5A 2NO6A 1FSGA 1WIWA 4J4TA 2OCYC 3D7KA 2EQAA 3GPDG 3HCCA 3HI4A 4LYEA 4XEUA 4ZDWA 4CF5A 3ZDBA 5IBPA 1MJGM 4IIJA 4BCBA 2BDEA 3HV2A 3PNBA 4B3XA 4BJHB 3CPJB 4MS4A 4XVUA 2M9MA 4IXNA 2CZCA 2V3CC 2XTAA 5I3ZA 2W6JA 1XF1A 1VXRA 2CK3D 2PKQO 4H17A 3G2LA 2G1AA 3VKWA 5L3QA 5C8XA 1E1LA 3KTDA 1Y9JA 1YR3A 2FPGB 3RIEA 1V5GA 2JVKA 2P9BA 1O5IA 2WWXA 3KOZA 4PG5A 5KYYA 5LKAA 4P34A 4UUAA 4IMRA 4M88A 2F43B 4UQPA 5G3ZA 3TOVA 4XEHA 1G59A 5AJYA 4LEIA 3R3YA 2V7WA 1TU3A 3E48A 3A1WA 3JD2A 4D02A 4E5UA 1EVEA 1OAKA 5BQ5A 3H2KA 1PU2A 3NATA 2YJGA 2KW5A 1VKHA 3ZD7A 2FZLA 2QMYA 3WC4A 4KNYA 1U7HA 3AV3A 2G6TA 1NRIA 2QW1A 2V8BA 3E15A 3EXIA 4FHCA 4IZIA 4LBYA 3KBBA 5AJZA 3T7SA 1QU2A 1X39A 3CZ4A 2BJWA 3OTOB 1JMKC 1VB3A 3VYSB 3C8MA 3TEFA 4ZO4A 5TQ0A 2OV8A 2CLOB 3R20A 1E7MA 2VT2A 4OK6A 4F8JA 1J0BA 3WG9A 3BG5A 3TF5A 1UJ4A 5FPYA 2NP6A 5H4GA 2Q9AA 1CUHA 2BR4A 1W59A 2JHFA 1N2JA 3GBPA 3GLQA 4YONB 5CLHA 1WHTA 4IDGA 4QYIB 1QM5A 1XQ6A 3VYVA 5LYJB 4TWJA 2JJ8A 4W8HA 1CUIA 1A76A 2TS1A 1NLYA 3MZ0A 4I19A 4NNOA 1QVVA 1NJ6A 5HG0A 1A7UA 3RBXA 3U7EB 3D6MA 2P4EA 4N9WA 2JD1A 5HE8A 2AEEA 1YS6A 4BVEA 3UGTA 1PCXA 4KPYA 3ZCXA 3OFJA 1FLAA 1DOZA 1NOKA 2JRLA 2P3LA 4PIPA 2H7VA 5AW2A 2GVDC 4MVWA 4AMBA 1M2KA 3KQTA 3LVFO 5FNZA 3KNZA 2LUOA 1DAHA 1KQNA 3SR0A 2O8VA 2XUDA 2C4HA 1VPEA 2G5CA 3H5RA 4MCJA 1GL3A 1H1LB 1JEQA 5K1ZA 1K4KA 1VMAA 4PLGA 5JJKA 2HZBA 4WBSA 2PEYA 1V2HE 4LXGA 3WL7A 3BGWA 4S24A 2EKLA 3L6CA 1M10A 1KL7A 1X42A 2Q3FA 1WUKS 3KPUA 4Q9HA 4P53A 3ZD8A 4ZVPA 4XGIA 4MQ5A 4P5PA 3E9DA 4L2IB 3OT4A 3VKUA 1YDGA 1RCTE 2WF9A 2XRYA 2OORC 3L0PA 1C4WA 2J5XA 1CVIA 3WAGA 1SUWA 3K9CA 3ZVMA 5JBQA 3AHJA 5EUBA 3M6UA 4CV0A 3L7JA 1DJOA 2A1TR 4FKMA 2H9IA 3FX2A 3ZGYA 7AT1A 3NXKA 1B2RA 2B30A 2FDRA 3CSSA 3G79A 3N2GA 3MT8A 4JNCA 4N01A 5EGSA 4DCVA 1RKVA 1W5EA 2YQZA 1ZSVA 4R1UA 4D4JA 1WMBA 3JQRA 2I3GA 3TZKA 5C8YA 3W2HA 1USGA 2GFHA 4UQOA 5FFNA 1L0BA 1A2BA 4I50A 5T6BA 1I3KA 3ZHBA 4MAFA 5IVHA 4GU5A 1QGED 3EIWA 4O4JF 4G1VA 5THQA 4HD8A 1F12A 3MRXA 4YJHB 4M0LA 1ZHHA 1HZZC 2BOVA 2JIMA 3O0TA 2G70A 3T1VA 3ISVA 4DDWA 5BSFA 3CNEA 3UH1A 1R16A 3IHTA 3PPYA 2PGLA 4V1CB 2RH4A 4ES6A 3DL0A 5IKMA 3SSOA 3VJLA 1J09A 4QREA 1Q7EA 1VP9A 3PRYA 3IGFA 2X0EA 4QICA 2JG3A 2JDID 1D2CA 2Y8EA 3CKYA 3LSTA 2BT4A 4MKXA 5JSZB 1IBLB 2UUCB 1HDYA 1KYIA 2Z04A 3ER6A 3L02A 421PA 3H5WA 2PWAA 3ANTA 1PGNA 5CJJA 5T64A 5CXUA 1MRSA 1E5LA 1R6XA 5GV7A 1M0WA 2ZSEA 3HRHA 3U49A 2PAAA 3OKPA 3R0VA 2I4LA 4MS3A 2B36A 1FUKA 2DPXA 3T0GA 2QLNA 2DKFA 1HQYE 1EXVA 4E3WA 2JGDA 5FADA 3LP8A 4RF4A 3G8DA 4K88A 3ZWNA 5KSZA 3PWSA 2P41A 1KJQA 2NPIA 3WFJA 1OLOA 2C3UA 2QX6A 2X1HA 4HMQA 3WWPA 2GZ3A 4MS4B 1PS9A 3KJFA 4BNMA 1KMIY 7MHTA 1A5ZA 2VI5A 3B8EA 4RIIA 1NONA 1JG1A 1H22A 1JJAA 5LA6F 2J9YB 2IW3A 1GPAA 1TVKA 2EP7A 5KVSA 5JC8A 1GPDG 1VKRA 1PS0A 1Z18A 2YZGA 4YJGB 4F0JA 5KTOA 2ZRNA 2QTAA 1Z28A 5H7XA 4OIFA 4Y2GA 1ODIA 1WNFA 2HK7A 2K4MA 4X7RA 3NFRA 2IYSA 4LKOA 1U6JA 5GJWC 5C7LO 1YAHA 2C96A 1CUYA 1IQPA 3K5PA 3AC0A 1HYEA 4BMPB 2QGNA 2AYYA 4KR0A 5EIXA 3Q2KA 3P2MA 4BX2A 1ABFA 4JBNA 5E3JA 3TE7A 1RWNA 1K3TA 2ENUA 4X91A 4XFDA 3TR0A 5B64A 1QCZA 1CJVC 1T5OA 4RC9A 2FH5B 3P2KA 4ALLA 4CG1A 2QA5A 4L7VA 1AE1A 1NI3A 4HMPA 4POAA 4X20B 4TLAA 1F8YA 5G4LA 1NZJA 3PJDA 5HRCA 1QFSA 5LMCA 1QQAA 1RLOA 1YFKA 2WWIA 3NEJA 1N1DA 4ZT4A 3JQFC 3H0KA 5E8JA 2N9UA 5GWXA 4RYDA 4J0QA 3TR6A 2IH4A 1T1JA 1MO6A 3HNPA 5EL0A 4ZARA 1GCAA 1ODSA 3ZGVA 4BTVA 4GR9A 1W7AA 2PFSA 1VECA 2FWMX 3VFDA 4ED9A 3U40A 1EVZA 3C97A 1BW9B 2JJ2D 2B8TA 3GJ7A 1W0CA 4GHWA 1KJJA 4PXYA 1SCQA 3CF2A 3SYRA 1VG8A 3NC4A 5DCUA 5JYEA 1XSEA 1I7LA 3OMLA 1CZNA 1XI2A 2QRUA 3IDSA 4HPJB 4ARVA 1KQOA 1UKEA 2NSYA 4RIHA 3VPXA 5B12A 3VH2A 5DHUA 3H1EA 1N32B 5JQWA 4RAQA 4BVJA 3THXA 4HNRA 2CXRA 1SXHA 5DXJA 2PMEA 1E92A 1GDHA 4BUCA 1PR4A 4TVSA 5CFLA 4DM7A 2IQ5A 4BMNA 1RHJA 4U7WA 2X76A 3U1VA 3LDAA 2Z9CA 4O08A 3JRXA 4JY7A 3VAYA 4PLTA 2A59A 2CDAA 4WNIA 3OIUA 3PXDA 3ST7A 1GPH1 4QNNA 2BHRA 2JKZA 1JBEA 5JARA 1NX9A 3IMGA 1LWOA 4CV3A 4EMBA 5E2IA 3WRXA 1JAZA 3R6LA 4MROA 2XB9A 2YICA 3T3GA 1VA5A 4OAPA 3NBKA 4MQ4A 1MIHA 5HHTA 4G37A 1GY8A 1JDNA 1T9ZA 4PZYA 1RI2A 1UAAA 2G77B 3PIIA 4BNJA 1XMQB 1SBZA 5DFAA 2D7DA 1XQ9A 1P9OA 2IOFK 3R0IA 5AOCA 1KVTA 4C3VA 3DBVO 1T8UA 4EELA 3M3DA 2Z1DA 5CVTA 3GA5A 4JIMA 5F35A 1EK0A 3RFCA 3U7RA 1AKMA 4A4DA 2F17A 3OJEA 4CQLA 4CI9A 4QG3A 1BCSA 3O4GA 3ASVA 5ARBA 4NZMA 2ZR9A 1XR3A 2GF2A 1I2BA 3IS3A 3CLUD 4FBGA 3D5EA 1O6CA 3OQHA 2I6UA 3A06A 4JB2A 2VJMB 2FTKE 3HBLA 4PG8A 5HJ2A 2FHPA 2OO5A 4LNUA 2NN3C 4LI0A 4MUEA 1SBQA 2XX3A 2EBUA 3DAGA 3T3PB 5IZCA 4L5YA 1QYCA 2IBSA 5KC9A 3TL3A 4XDGA 2WM8A 3GDOA 3ODPA 4N0DA 2O14A 3A3PA 4B81A 3D6AA 3R9XA 3MOIA 3RVQA 4LGCA 4Q47A 4ZOLB 3EEIA 3GNQA 4KXXA 3HGQA 4JBLA 3NHMA 3DOCA 3QEKA 3KAQA 5IDXA 1S8NA 1VI2A 1R0KA 3KQYA 3PC8C 2R00C 4KN8A 3S2ZA 2V5VA 5TLSA 5EPEA 1BGXT 1OHHA 1QTQA 2WT8A 2ZULA 3WJAA 4JX9A 3KOWA 4P2GA 4H59A 1GZUA 4GW3A 3V4PB 2GT1A 4J16A 1GSHA 5JVDA 3HXMA 1YJCA 2I67A 3P9CA 1GPWB 4YT8A 3BB1A 5FOSA 3W7BA 2ZRDA 1SXGA 3I9FA 1Z2PX 1T5DX 3RS3A 4G25A 4Z2YA 3WHIA 1DO2A 1BIFA 3B7PA 3NVKI 3KZMA 4KYTA 1JBKA 4AZTA 5HDBB 4DARA 4OSEA 2RGRA 3OTQA 5JISA 4HLUC 1J33A 5FPTA 1GU1A 3SC3A 4JLUA 3UKDA 4ASUD 3A4MA 3ANLA 3QMMA 3ABRB 4EGQA 2I4NA 2RK6A 4MQ6A 4WZBA 1DVRA 3GGCA 4ZTBA 2NNWB 1TZCA 2EF1A 4EITA 2OD2A 3TLYA 3FSEA 3K2QA 4I5GA 4XB1A 3U4HA 3GFPA 4TTTS 3IPAA 3O38A 1YR9A 3V1UA 3KDSE 4CM4B 4MLDA 5DNWA 4ZCMA 3LBYA 2FSIA 5G4KA 3URMA 2A67A 4PLVA 2PD4A 3WKAA 2PSEA 1U28C 5D2CA 2RI1A 1UK8A 4HKTA 3TR5A 3TDMA 3IB6A 1PT8A 1NW5A 1EM8A 1T5LA 1UOEA 1OXTA 1V3VA 2W98A 1IZ7A 1R15A 5H70A 2LP4Y 4RHXA 4BKOA 5K0JA 1CJMA 2V3WA 3KPVA 2BZSA 5HQTA 1R8JA 3M83A 1L3IA 3HJRA 3KJGA 3G13A 3ZBPA 5HW0A 4HSGA 3TWOA 4BE9A 4MDHA 1FDVA 1MU0A 1QNFA 2ATIA 3QUSA 3VVLA 1JLKA 3V2GA 1A1VA 4LJLA 4MUIA 3BXZA 5B3AA 3KK0A 2JAWA 4HQLA 2HLPA 3R0ZA 4WEQA 1Q1QA 5FV7A 3PU6A 4XTCS 3ZCVA 2R2GA 1M0TA 3HCAA 3NDBB 2P3SA 4LV8B 2Q5CA 1MR3F 1J20A 3MILA 1ZXLA 4Q4LA 5ICMA 2NZXA 1BXZA 1HDIA 1GFWA 3ZZTA 1PFYA 2FP3A 3WP1B 4E5KA 5LQNA 3EXFA 1M2HA 5EZYA 4TV9A 3UC9A 4W5JA 1BXRB 4OQXA 2AK3A 3A6KA 4KQXA 1JLMA 1K5PA 2X8LA 2ZYTX 4IDAA 4I8DA 4MINA 5EA2A 3DJYA 5TPWA 4QECA 2BFCA 2G4LA 3ND5A 3PKZA 2GR9A 1YCGA 4PE5B 1FQJA 3FNIA 3N2EA 2QUKA 3G8BA 4PS1A 5C5CA 4TZTA 5IYZF 4QQFA 1JIVA 1EWYA 4ISBA 2HLDA 3M49A 4G5XA 4WK0B 1P4GA 1EQUA 4H4EA 1NNUA 4ECEA 3MRTA 1KEWA 1LSOA 1XZJA 2QAGB 3DDWA 2W70A 1XKLA 1FRFS 2QZZA 2AG8A 2ZTVA 1CEYA 5DO9A 4YUVA 3O2JA 1G7RA 4BASA 4UVIA 1NI5A 2C2XA 2Z3VA 3FKQA 1J9EA 1PQUA 2J3DA 4LWOA 3AJ8A 4BTLA 4BO7A 4WOPA 1P91A 2IOHA 3D3KA 4OV6B 1RWMA 5ALHA 4AQDA 4BFUA 3T7CA 5B6JA 2R751 1IRIA 2IIVA 1P7WA 1CZUA 4R83A 4NARA 4DRYA 3U62A 4MI1A 4DVGA 3M8KA 4YYZA 4UBNA 1N2CE 2YTZA 4RTQA 3V2UA 4DDUA 3L0YA 4UREA 5JD5A 1JWBB 3GLIA 1RHKA 1WXWA 2QMEA 2YUTA 4B3HA 2ZIXA 4Z54A 3MMNA 1H1LA 3NO4A 1MRNA 1SQGA 5BSVA 4G9EA 3AW8A 4PFKA 2D8AA 1XX6A 3BOSA 4TVOA 3URKA 1FLVA 3VSBA 2JFQA 4J2TA 2ON6A 4RLQA 4Z4CA 5LYYA 1OROA 4P82A