3T7KA

Complex structure of rtt107p and phosphorylated histone h2a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
248
structure length
233
Chain Sequence
KAEKILARFNELPNYDLKAVCTGCFHDGFNEVDIEILNQLGIKIFDNIKETDKLNCIFAPKILRTEKFLKSLSFEPLKFALKPEFIIDLLKQIHQININLFDYEINGINESIISKTKLPTKVFERANIRCINLVNDIPGGVDTIGSVLKAHGIEKINVLRSKKCTFEDIIPNDIFKYVLIVTKASQVKKFTKLINDRDKNETILIVEWNWCVESIFHLNVDFTSKKNVLYQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of C-terminal Tandem BRCT Repeats of Rtt107 Protein Reveals Critical Role in Interaction with Phosphorylated Histone H2A during DNA Damage Repair
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Regulator of Ty1 transposition protein 107
total genus 75
structure length 233
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16770 RTT107_BRCT_5 Regulator of Ty1 transposition protein 107 BRCT domain
A PF16771 RTT107_BRCT_6 Regulator of Ty1 transposition protein 107 BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3t7kA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3t7kA01
2COKA 2COUA 1CDZA 3JVEA 1WF6A 2JW5A 3L40A 3T7KA 3HUFA 3K0KA 5ECGC 3PC6A 4XQ0A 3COJA 4OFBA 1GZHB 2VXBA 2XNKA 3K15A 3K0HA 2E2WA 4XPZA 3T1NA 3PXAA 1IN1A 4BU0A 3PXDA 4IFIA 2EBWA 4BU1A 3L41A 3SHVA 1L7BA 3I0NA 3SQDA 2ETXA 1T2UA 3PC8C 4ID3A 4BMDA 4Y2GA 4N40A 3PXEA 2D8MA 2K7FA 1JNXX 2VXCA 3AL2A 2K6GA 2WT8A 2HTFA 3OLCX 4BMCA 3HUEA 2M2IA 1OQAA 1N5OX 3II6X 3PC8A 3T7IA 4U4AA 3U3ZA 3I0MA 2AZMA 3L46A 2ADOA 2R1ZA 3T7JA 3UEOA 1L0BA 2COEA 3FA2A 3SHTA 3AL3A 3PXCX 4IGKA 1T29A 1T2VA 2EP8A 2DUNA 4JLUA 3PA6A 2EBUA 3QVGA 1T15A 3SZMA 2L42A 3KTFA 3EF1A 1Y98A 1Z56C 1IMOA 3QVGB 2NTEA 3PXBA 3K05A 3EF0A 1KZYC 4Y18A 2XNHA 3PD7A 2INGX 3PC7A 3UENA 2LE0A 3K16A
chains in the Genus database with same CATH superfamily
4Y0NA 3RC2A 1Q1QA 3PCTA 4QGSA 3NUQA 2EKDA 1ZAYA 2VPZA 3V8RA 4BGIA 1DQSA 2FRVA 2XX3A 1NONA 3OIYA 4R9SA 3I2JA 1FFBA 2VJAA 4NAHA 5LB2A 3RD5A 4GGOA 3VKHA 4JKYA 4CKCB 1LI4A 1ZVMA 3EXEA 3KD2A 1IYZA 3HXOA 3BK2A 1YJ8A 1NLYA 1Z26A 3EH1A 3HKCA 3NHRA 3PKJA 3PU6A 5JCZA 3ZCRA 4NCHA 3D4NA 3S5UA 5CW1A 2BAGA 4JIMA 3NKVA 1AQLA 2PNFA 3G49A 4MVJP 2AFHE 4MYTA 4OHOA 4W1PA 2Z4SA 2IRWA 1EUZA 3IDFA 3U6KA 3IAFA 2XTJA 4BO4A 4XVUA 3CVVA 2UXDB 1G21B 3T1NA 3IXMA 1B42A 2QG6A 4YA6A 2R8YA 3KU4A 3M9WA 1JG3A 2BELA 4YCDA 1RTKA 2BEJA 1K3UB 2I1WA 1P0CA 4HB3A 4R31A 1ZKMA 4JBIA 3ROFA 5CA1B 2QLTA 1FSSA 1H2BA 3ZE7A 4AF7A 4LF5B 1Z16A 1DFGA 3VOTA 4DA4A 3R3ZA 4RELA 2O2SA 1IQUA 2JH3A 1PWXA 2QVBA 3JPWA 2HXGA 3LCRA 2MWMA 3LUCA 3KTAB 4ARZB 1F12A 3AL2A 4F0JA 1NI3A 3AFMA 3M4NA 4MUGA 5DB4A 4OLAA 2ZJYA 2OFWA 3IQWA 5CNMA 4TXHA 2ZRNA 4FD2A 3L5KA 5BQFA 5FPKA 4KB5A 4AM8A 2HNAA 2GF9A 3IGFA 2C9OA 3C8ZA 3BMXA 1PV1A 1BRMA 3E9CA 3I9MA 4QYSA 3K0CA 4RQUA 4BB6A 3KVNA 3Q0EA 2FUG6 1NKTA 1ZK3A 4CQJA 3V7FA 1CQIA 2YXEA 3Q5GA 4ZQHA 2IYTA 2QXYA 1SQ5A 3A6JA 1KAEA 4HYQA 1XNHA 2VDLB 4ALIA 3LE8A 5IK2D 2RI0A 5F7OA 4A8TA 2WJJA 2GASA 4QSMA 1Q83A 3NTVA 2DUWA 4BCDA 3WOVA 1LV8A 3D7MA 1Z36A 3ESQA 3QELA 3W1WA 5H83A 4P4LA 2GRUA 4URUR 3AHJA 5JSZA 3E03A 4UAJA 3SU8A 5BPHA 2W6QA 3DAFA 1GGFA 1EQ2A 1Y3HA 1S8NA 4BLWA 1WBJB 1SVUA 1YT5A 1O87A 4QJBA 3OLQA 4TLLB 1LQUA 3KXDA 4P7GA 2BI4A 2LDBA 3CM0A 3MMPA 3QUBA 4J0DA 2ZI5A 4XCXA 1VMDA 1GWNA 5LOVF 1SCAA 1E9SA 2DQSA 3H9JA 4U2GA 5KS2A 5KZMB 3R0XA 4HQFA 2WA1A 3DMPA 1BFUA 3DAPA 4TT3D 1QCZA 2FW7A 3EARA 4D97A 3G2OA 4TTRA 2PZJA 2I54A 3KQUA 5FPQA 3UF0A 5JNLA 5KNBA 1KRWA 2BW0A 4IXNA 4YLEA 4CDGA 1XDDA 1GGVA 5TGTA 1OYVA 1X6VA 1SXGA 1EFVA 4YPOA 4ZTUB 4ZHSA 3UENA 2F1HA 1IXZA 3E70C 3OY2A 4FFBB 5DKFA 1OOEA 5E6SA 1ZISA 1VA5A 2PMBA 2HPVA 4HEA1 1JHMA 3AM5A 3UKJA 3QPUA 4UOZA 2IE8A 5DNVA 4RXMA 3HYLA 5IJ0A 4LK3A 3FMOB 4NENB 1LFAA 3TRFA 1JEYB 2QX8A 1G0NA 1N3LA 4Y1RB 1SVNA 3QKUA 4Q4HB 4TV9A 4E03A 4ZXFA 2JFBA 3GFBA 2FMKA 1ODFA 5E6UB 3TKLA 5HVNA 3K4QA 5E4JA 4ZWNA 3JQGA 1OT3A 2K5UA 1UT5A 1EYZA 1EXWA 4UMEA 1ZK0A 4RE5A 1NOIA 1E2QA 4LZLA 4O4IB 4P54A 4C7VA 4O4JB 4AY6A 1KI9A 3QOFA 1ZYUA 2H29A 2CB9A 1BKDR 2NU6B 3KOXA 3NRCA 3NM4A 6REQB 5F3WB 1JFLA 1AS2A 1QDEA 1U2QA 3BIXA 3PNSA 2NVWA 4B4OA 1XMVA 2B36A 3UO8B 1TVMA 3AESB 1QBKC 3RS4A 3ZIDA 1SURA 2G0AA 5CFPA 3ADOA 1V9LA 3CZ5A 2IHUA 2ERYA 3V32A 1TAQA 3G88A 1OXSC 2HOQA 3KEMA 4NBNA 1E1RD 2AN3A 4JI3B 2PU7A 1NJ5A 2PR7A 4RH0A 3L49A 1T6BY 5C1IA 2ZITA 3ONDA 1A5SB 2JD0A 2LUOA 4BC1A 1RZRA 3ANMA 1K2WA 3GLFE 4BC0A 1E3IA 3ODPA 3P8ZA 1SUAA 3HBMA 4RDIA 1T36A 1AJEA 3ILVA 2J41A 1RKVA 1Z8HA 1HDRA 5BXQC 3OEHA 2FU5C 2PRIA 2XGOA 1KPHA 4QRHA 4D99A 2ZIWB 1IHYA 5KTSA 5FQOA 2FP4A 4LNUB 2FUG1 3JPYA 3Q8LA 2G17A 2JJ2A 1U0NA 4KVFA 5JSFA 2EFYA 1NFRA 4AN1A 4JI4B 1OTXA 2W00A 3TSWA 3AEQB 5TRTA 2YVKA 3ONNA 4S35A 4HVTA 5IJAA 5T8KA 4L9WA 2OBYA 4O3FA 5KEIA 4EHKA 2FFRA 3U1BA 2HW8A 3C6KA 3DVAB 3IQZA 3GAMA 3ABSB 3UMRA 4XDYA 2CHQA 5HTOA 1BXRB 5KTNA 2O57A 1Z45A 5TMBA 4CQMB 1AGNA 3EIOA 4ASUD 1ECFA 1N6PA 2AJLI 3AG5A 4I5IA 4MOWA 3F3KA 5KYUB 4DWWA 4FKMA 3IT1A 1OH5A 3JQCA 3L8EA 2RGNC 1AIPA 2XDYA 4YJDA 4EYGA 1K8QA 4UEKA 4TYPA 3GJRA 2ZS9A 4L8FA 5AM1A 2QUIA 2VYVD 4TWRA 1MPTA 4C22A 5FR1A 1QH0A 4RETA 4PC1A 1RKXA 2H7VA 2I22A 1TKRA 4G0OA 3HYRA 3K8OE 4OG2A 4RW0A 4XGQA 4ZP1A 3C8HA 1VECA 4Q9KA 3M6AA 1Q84A 1X1QA 3EZGA 4L08A 1E7MA 4N0PA 3QPVA 4YCAA 4RKQA 1Y7TA 3LUJA 2HO5A 3WOHA 2CF6A 4TVSA 4AUNA 4URZR 2ZUBA 4HNQA 2Z56A 3OQHA 3QU2A 3MT9A 3GGPA 3OLYA 3HCRA 1RJWA 5ALSA 3WLIA 1IIRA 4F45A 1KAMA 3KXLA 4YYZA 4LK2A 4J75A 5FB3A 4G8JA 4UULA 5L3SA 3W1EA 2A59A 1ADJA 5T3UA 3EFBA 3ABIA 3CBGA 3JQ7A 3KD3A 3KT6A 4KZKA 2OHFA 4AQ7A 5L9AA 1M67A 4HOYA 3D4OA 1JJAA 4LJSA 1E0JA 2I03A 4I50F 3UJCA 2O2XA 3I9V1 4J76A 1GTZA 1O5TA 2A9VA 2YYYA 2IJGX 2W11A 3PRHA 3KNZA 2UZ1A 4B83A 1R3DA 2X4GA 3SX0A 4B0OA 4XWGA 3COYA 3M6IA 4UUMA 3NV9A 1FMLA 5A4AA 1KZHA 4J0KA 3VR0A 3RAJA 4C0AC 5JNWA 3GGSA 4AAYA 2J87A 2DTXA 4I1PA 3ZHXA 1Y5MA 4I1IA 4G5SA 4O4HF 4DR2B 3L0OA 2A5YB 5D5QA 4HY3A 1DFHA 5A6SB 1JSXA 1T5LA 3ZHYA 1RMTA 2C0QA 5ILOA 2CXHA 1Q1ZA 2ZWPA 1FYVA 4RL6A 4BP9A 1NBMD 1WMEA 2CL0X 2CJPA 2DTDA 2XTMA 2BM1A 3FWNA 3IVXA 1KDZA 4OB8A 3WWDA 4Z4HA 3RT9A 1WPQA 3STYA 1IWBB 4H16A 1Z37A 2QD3A 1R6XA 3ZW7A 4KR2A 3AQIA 3GNSA 2ZI7A 2JCVA 5K0NA 4AJ1A 5IYZB 3B3AA 1U7HA 1KFJB 1TW2A 1E1YA 4ARCA 4MUMA 5KSWB 2DRIA 2UUOA 5IC4A 1ZH8A 2CLIB 3HO1A 2CE2X 1IN4A 5KVVA 3DE5X 3UG6A 1IBMB 3DGFC 4JQYA 3QHQA 3TLGB 3TCNA 1KXJA 1Y82A 4MEAA 2X58A 2Y66A 1NDUA 5TB5A 5A62A 3LKDA 3BHNA 4MI6A 3RRZA 3PTAA 4HDKA 4FGJA 3NH6A 3FFAA 4ZREA 1D4AA 1F8GA 2NV6A 3DMYA 4BVAA 1T10A 4HB0A 5AVZA 2BMAA 3B60A 1DO2A 3ENQA 4R7GA 3TZ6A 4EMTA 3N2YA 4RADA 2XYRA 2JFZA 1QYWA 2BFPA 2JFHA 3I05A 4MUKA 1IL0A 3HKCB 3B3FA 4NP6A 3HABA 1YVUA 5K3AA 3CVOA 4PYNA 1RZVA 2SKCA 1Z5PA 3A1SA 4XM0A 3A1NA 3GU3A 1TKCA 1QCCA 3VAZA 1HSOA 2WJAA 4GEGA 1R27A 2ZRMA 5T4EA 1JUDA 3CNNA 3D8BA 3NANA 2ZIAA 4XQGA 1KQNA 4H1HA 2WPDD 1RBZA 2PGDA 2L42A 1WM1A 3QLTA 3F90A 1MEEA 2JI9A 3L06A 1R5OA 4Q3BA 3SR3A 3IL2A 1W5TA 1KOLA 4V24A 2NU8B 1JQLB 3RB8A 5HSGA 4B79A 2QBYA 1JG4A 4WESA 1Y8ZA 2ZYVX 1SC1A 3G2NA 2WZBA 2WYHA 1T34A 1IB0A 1MRSA 1NJ6A 3MFYA 3PPIA 3T3PB 1SPXA 1U7WA 3RW9A 1GNLA 3OM8A 4FOTA 4HQRA 1JE0A 4A16A 3TUJC 4CI9A 1TADA 1O6ZA 1WD5A 2QJFA 2W48A 1SHKA 3NTLA 1EUQA 3JZMA 3QM1A 3DBLA 1J8VA 1FFXA 3MB8A 2FN7A 1UMCB 1QAQA 2F62A 2WIGA 2I4RA 4IICA 3TRKA 3LQ2A 3NGXA 2QL5A 5HG0A 3KEFA 3W6ZA 5J4HA 4LI0A 4ED9A 3KFLA 1OBOA 2UZIR 3ZLJA 2AQ8A 3H83A 1LJLA 4WAUA 2LE0A 1TKAA 4XVCA 2G83A 2VDMB 1SG6A 7GPBA 3LU1A 2O8FB 3PUVA 4EGFA 1QP8A 3Q88A 4G9GA 4EZEA 4CV3A 4NBVA 1RAGA 3RLIA 3KFXA 1R6AA 2GEJA 2JW5A 3SS8A 3VZDA 4CG1A 1RSZA 2DCUA 3OCJA 2FUEA 3OFKA 1F8YA 1UM8A 2FPWA 4ND1A 4NS4A 3FYUC 5JPDA 4XTCS 1FJGB 2GJ4A 4OKNA 2HU8A 4PE5B 3PUXA 4PU0A 1KDOA 4RENA 4US1R 3DMTA 3VPSA 5KB3A 3QVMA 3PXUA 3L93A 2Q46A 2BSAA 2DR3A 5I7AA 3LT2A 5L4LA 4DNQA 3OO1A 1E3MA 3LZCA 4DQVA 1UJ5A 4Y67A 1TU4A 4K9KA 2X0RA 4UC0A 2HBRA 2IUEA 1E4EB 2Q07A 2VAMA 3NEJA 2IIVA 2PLFA 3TX2A 2X7XA 3DEYX 2AXNA 2PKQP 2V98A 3K0CC 3KR0A 4RD6A 4X7PA 3RKRA 4IVQA 5JBNA 3LP5A 2BR5A 1KMIY 3JR7A 3AT1A 3IR7A 3O93A 4FFLA 1AHNA 3RRXA 1WOYA 4X6LA 5JH7B 4F6RB 1VMAA 1NR1A 2R8BA 3OOHA 3U4IA 4TM8A 3TCXB 3PFFA 3K6SA 5C0OE 5K0CA 3MJTA 4FMPA 4UHJA 3UHOA 1C41A 1OX4A 5CIQA 4HJRA 5ES4B 1R0ZA 3N2KB 5TXGA 4H3KB 3RBZA 1Y81A 3UAXA 3B9QA 1EE2A 1ES9A 3AI2A 3BSYA 5EQJB 4EBBA 1OR8A 1TMOA 5JR3A 1GZ3A 1UWKA 2CMGA 1I5EA 3DULA 1RABA 1YMUA 3UGJA 1A5BB 5EHNA 5F52A 3WGLA 4D74A 4QBKA 3KT3A 1TYAE 3AUKA 2X2EA 3AEYA 4BNGA 2FG6C 3RVOA 1PR1A 1PD1A 3B6EA 2KE5A 4YJ3B 1DLIA 1ESDA 1ZN7A 3NTRA 5ER6A 5TSDA 3E0QA 1SUCA 1Y0BA 1W5SA 3QE2A 4NZPA 1U7ZA 2QTHA 1Q1GA 3CV3A 1V95A 4XPIB 2QR5A 4NQZA 2FXVA 2LV8A 1X7ZB 1VSVA 1JWAB 3JYPA 4Q19A 2Q49A 1TMYA 3W5IA 1GN9A 2BGUA 1EPUA 2XR1A 3CPEA 4YASA 1JQJC 2D2FA 1R4NA 4PLHA 3M34A 4LVCA 3WQQA 4QM6A 5ALKA 2OGZA 2YICA 4HAXA 3QSYA 1VKNA 1SOMA 2IZ7A 4QIHA 2QTMA 1Q12A 3OP4A 3ELWA 4IDAA 1F6BA 2VBCA 3DSRA 5AK5A 1KVTA 3BRCA 1Z2EA 3EAFA 4BJ5A 4IDHA 4NYMQ 1G5QA 3AV0B 3ZDBA 1NGSA 5TQ2B 4M6WB 3IQHX 3AXSA 5BQOA 2IXBA 1U5CA 3F3SA 2AG6A 1ZG3A 3W4JA 2H17A 1CUGA 1OWLA 2XMCA 4CODB 4CMJA 5KVQA 4A2WA 4YT2A 4TQAA 3DEFA 1GPJA 3B85A 2ONKA 2XD9A 3OE4A 3VQTA 5IS2A 4BFLA 2Q3MA 2ZJAA 2JJQA 4LBYA 4WZAE 2OQVA 3U17A 5L7WA 4RMHA 4S1WA 2OAEA 1E5TA 3UICA 3BICA 4PSCA 3R4VA 3OETA 1J0EA 4F2PA 3RBXA 3RYFB 4ID9A 5JY6A 1SKAA 3ZTWA 4YDSA 3MTAA 4R0VA 3D1JA 4E7OA 2V65A 2Z95A 4E46A 3I37X 3KJHA 2XHZA 3G23A 1RCFA 5E9WA 3WZMA 4QQFA 3ZNNA 4ND8B 1H23A 2ECKA 1ZNYA 2HJWA 4Q39A 4RFSB 2Y1CA 3IALA 5IKOA 4CJXA 1PT6A 1QK5A 3GOHA 1PDOA 3VMMA 2QBYB 1GVHA 4HDCA 4YI5A 3SS9X 1ZP6A 4HR7A 1M2GA 1VJGA 2B0CA 2X3YA 4HRYA 4O2LA 3AI3A 5FFMA 4YWHA 3RF6A 5AUOB 2BKUA 2IU6A 1Z06A 3GJ4A 1Q20A 1QLWA 4ARUA 1YF3A 3TB4A 1XU7A 4XFKA 1HE5A 3ILHA 3K8YA 4E1VA 2Y4NA 1QORA 5BW5A 1ZVVA 3GLSA 1Y63A 2O2IA 3GNQA 4H59A 4PO1A 5G0TA 3TECE 1PFKA 1UKCA 4TL9A 4WZBA 1J2RA 2JGIA 5DGHA 5EXPA 5TIIA 2QL7A 4RA6A 2W71A 2Y1WA 2QUAA 2JK1A 1XTQA 3DEIA 2RD2A 3H18A 2OSBA 1QFJA 2QMHA 2EKZA 1RVV1 4G37A 4N40A 3SJ7A 1NW9B 1Y5NA 1OAOC 3JX9A 5CJJA 3L6RA 2KI5A 3TLCA 2Q5CA 1H94A 3L6EA 4V39A 3VC7A 1DELA 4JASB 1FZQA 3BX1A 3C6QA 3FMIA 1BVYF 4INZA 1KI6A 4RA9A 5DNEA 3ZLTA 1NW4A 5HQTA 5KINB 4CG2A 1EBFA 2D8AA 4LGVA 4M8IA 4V02A 4IY1A 3DLHA 2OCBA 3L4SO 1P2VA 4MRNA 3TLBA 1YACA 4F97A 3C3WA 2A2ZA 3TCKA 1N7HA 3ZV7A 4BQSA 3WL8A 4G8CA 1EEXB 3UMFA 4LJRA 2CDBA 3BFXA 1G6HA 1GPBA 2FQWA 2MTBA 2QY9A 3H3FA 4KR0A 3CRNA 3GW8A 1NQ5A 5JAPA 3TAUA 5KX5B 3M70A 1N1DA 5EPOA 2W2LA 4X60A 1PSDA 4K9NA 3SEZA 2FSFA 1UQUA 2W4QA 1E3LA 4L15A 4RGVA 3I5UA 2BKEA 1YSCA 4TMKA 4OU4A 5MDHA 3MBOA 1RJEA 1ZUIA 1XXHA 5CB8A 3GELA 1RWKA 2FF5A 3GMTA 1U8CB 2W6MA 4HFNA 3HR7A 4KWEA 2NTVA 3AR2A 1WU8A 3T12A 3BJEA 4K3UA 3ZY2A 1L5QA 2VDQB 2XUDA 3W2IA 2J59A 1FSGA 3ZZMA 3KTFA 1GN8A 2IDJA 5DNAA 4KIJA 3WXBA 1M0TA 4XCVA 2Q8NA 3ENZA 2I7TA 2JZCA 2ABWA 1Q0SA 2V55B 5AP9A 3WNVA 2GERA 5D5HA 1GNPA 4DNFA 3G1TA 3QQ5A 4QOGA 1Y3BE 2YRWA 2C61A 2OK7A 1AKQA 2FMXA 2PHZA 4GR9A 1J99A 4MUYA 4XFDA 3OY7A 5AVTA 2ZLBA 1DHRA 1XTTA 1G8YA 4WECA 2PJUA 4PSAA 2O06A 3WKAA 1P1JA 4K1LA 2FJUA 4CHTA 2R48A 2FNAA 1JI3A 5IXYA 2E49A 5LMCA 1NN3A 1N6RA 2ZSAA 3QBVA 1NM5C 1UQRA 3F7NA 3OICA 2FV8A 4NCNA 2A92A 2GUWA 3STTA 1B3BA 3MD9A 1QIHA 3HCFA 4HTFB 4NBRA 4X20A 3TZKA 5FP0A 3B6MA 4UMDA 3S7ZA 2C00A 1VFNA 3ER6A 1GXSB 2R47A 5AUQA 4EVRA 3K0EA 5HQ3B 1FRNA 4NG5A 2JBWA 1WF6A 3OMLA 1ESNA 2BSQA 3DDUA 1NR7A 3CX4A 3USCS 1WXHA 2I71A 2IF0A 2FZGA 2W6OA 4Q6BA 5EWMA 1AGRA 3OM9A 4HT3B 5KHOC 5CFZA 1E92A 1K3FA 1YNSA 3GCDA 3VYSB 3ZZUA 4Z0NA 3RYIA 4GRIA 4UEWA 2NPFA 1AY0A 1Y5IA 4RKYA 1PTJC 2CLCX 1VE7A 1IHDA 1M73E 1W25A 4M1WA 5DBIA 3TNFA 3WV4A 4H3VA 1ODIA 5C5EA 7REQB 2OLEA 2ZE7A 1GTJ1 1TO1E 2BKVA 4WKNA 2ORIA 4YV7A 3ABQB 3IQDB 3AW8A 4MCAA 3O7WA 3EAQA 4KXQA 4MVJG 4C87A 1Q92A 2Z8YA 5BUCA 3BMNB 1DXQA 3PEVA 3VUEA 3OX4A 2JI8A 1BWRA 1FW8A 2VC2B 3A14A 4GXTA 1GFSA 4IGAA 1RJFA 3GFSA 3UJDA 1JJIA 1PQPA 3K1TA 4MLZA 3RS9A 1HT1E 3Q85A 3BPSA 4DLXA 5TEWA 3BB4A 3I01M 4POOA 3MQFA 5KOYA 2JLYA 1Z75A 4J0CA 3BZBA 4V0RA 3BIWA 4XD7A 1MABB 2BGGA 1W4CA 2CNKA 1OKKA 3BWVA 3R5HA 4HH1A 4YRLA 2WP0A 3NQ41 3UQYS 4WBSA 3OOYA 3ZTTA 4DKJA 4C7OB 1UFKA 3ZWKA 4EMBA 4B17A 1QCYA 2P35A 5JZMA 4F56A 1BROA 4F1WA 4OHMA 4GE0A 4YPVA 1WZIA 4AC9A 5FOSA 4BCCA 4NZYA 1WCIB 2ZIFA 3OECA 1SVKA 4JT4A 3OC0A 4QHYA 3RRFA 2NAPA 4LRSB 4MYUA 4QVGA 4F4IA 2FUNB 2OYRA 3KQVA 3JAKB 2XQVA 4JKOA 3PYMA 2JFGA 1Z5GA 4QOFA 5IM4F 4OYYA 2GQ0A 3ABOB 4QOIA 1U8AA 4L3VA 3X1DA 3M83A 5B4TA 5ITZB 2O2EA 2F8MA 1WMDA 3F7MA 4U1RA 5L40A 2JFUA 2GEKA 1ENZA 1K98A 1ORRA 4G89A 2JIOA 2XKJE 4OOEA 5CBPA 2O23A 1KO1A 3ZOKA 2J09A 3FR8A 1JN0A 3DS8A 3N2EA 1DEKA 3HUTA 4MMXB 3F3MA 1Z8DA 4RD2A 5FOQA 3UK7A 2XCRB 4QBFA 3RIGA 1QK4A 3WNDA 3COWA 2CF5A 2XUFA 2IU3A 1F8FA 1MO6A 3AJ9A 3PEEA 3GZNA 4R9NA 5B55A 4YROA 1CJKC 3BRWD 1K06A 2Y0BA 4I4CA 2IYVA 1VSBA 3SZ3A 3TXXA 3N8HA 4EI8A 3K70D 2WHPA 2X86A 4KPUB 4V0ME 3SBDA 4F4FA 5EGNA 1TEHA 6CHYA 4FFRA 1JR6A 1RU3A 4KQIA 4QUJA 3PTLA 3I6ZA 4BFVA 3EF0A 3BL8A 3MTIA 4JYPA 4Q7KA 3F8WA 1RFLA 4BWVA 1LJ8A 4HUQB 1HNWB 4H1UA 3HYTA 4MVJM 1LPBB 3LXRA 2J8ZA 5DHQA 1JZQA 2AG5A 5AW2A 1ZGJA 5EJ2A 2I8CA 3LT5A 3U44B 2AFIB 4UDXX 4V38A 1B2RA 3HHPA 5HP4A 1F7UA 2DU8A 2HJ9A 3K0FA 5FLXA 4YV0A 3NCTA 1QLJA 1UADA 2BSXA 5DTIA 4O0MA 1R0SA 2OCAA 4EG3A 4ZOQI 1W35A 4B6FA 3M7IA 1N1EA 2DT8A 3RUIA 3ZVKA 1HEIA 1E2NA 3N8NA 2M6LA 1RZUA 1YZLA 4CM5A 1EJ0A 1O95D 3H5AA 3IDZA 1XTSA 3MWKA 3VPBA 4OSEA 5F9MA 4TKUA 5AVWA 3QF4A 5E0KB 1RRCA 3CF0A 3TLKA 2XITA 4Q9JA 2QLLA 4OMUA 5LMZA 3B51X 2X9VA 2IKQA 1TGVA 3O8QB 3KKOA 4BU0A 2P68A 5F2KA 3CWQA 1CUIA 4BNKA 1C1YA 4EPRA 3FOBA 5L7TA 5CIWA 4BBJA 3KVOA 2IS1A 2XT6A 3WHPA 3IQXA 1O89A 4HZUB 2ZIXA 1EUDA 4U3JB 2W6ID 2GN0A 1EFDN 4H6WA 5I7OA 3UMBA 2Y0DA 3G5UA 1ZY2A 4MW5A 5LOVA 2AC4A 5IDYA 3CUTA 1LBEA 4KPFC 3W6OA 1SBNE 2EDCA 3KXIA 5IVPA 2GD0A 2Q5JA 3HM2A 3L8MA 1ZWKA 1YAJA 4W5WA 2XRYA 3R3JA 2PWAA 3FPSA 1DP4A 3OTIA 1K0UA 1A0OA 2O5EA 2CFRA 3WG9A 1P62B 3C98A 1IMJA 3PC4A 2H31A 1V3UA 2QPLA 3LLVA 4XIFA 3BJRA 2BEUA 2Y1EA 2WEKA 3B36A 1DXHA 3HL0A 2A84A 2G40A 5LPNA 3DZBA 4DLUA 1E60A 3T95A 1VKRA 3OZSA 2GZ1A 4O8ZA 3HCEA 2FWJA 3M9LA 4MXDA 1HOTA 2OVFA 1GPWB 3EZ7A 2BLLA 1TVKB 1UPCA 3BTUA 4HDNA 3K9FC 2IZ6A 3MK31 4U6QA 4HWSA 1VB3A 2AYYA 5JO9A 1ZVQA 3D3EA 1U7PA 3K5IA 2YVUA 3K1AB 3R3HA 3K1AA 1WDKA 3NO4A 4QGHA 5JI2E 3E1KA 2IELA 4J0QA 5A4MS 2NUAA 1MPXA 2Y67A 4CF4A 1J6UA 1TMGE 2PPLA 4F21A 1NPDA 2D1SA 2QMZA 2XODA 4GMXA 2VYNA 2WWIA 3PDCA 1GU0A 5J2UA 1LSJA 3T94A 4E7PA 1JDZA 1YB4A 1YRQA 4A6XA 2UUPA 5IT5A 5HS6A 3HACA 1YVEI 3E9MA 1R3UA 2OP0A 4QFBA 4UCXA 3FOAA 3GLIE 2AV6A 3VTZA 1O8CA 4HDMA 1G2QA 3OE5A 3E7PA 4LDQA 4R3NA 4TTPA 4N6GA 3VPDA 3VH3A 5L51A 4W7SA 1M8KA 3TG2A 1U9IA 4J4BA 4X61A 5JQGF 5C37A 2IGTA 3A6FA 3M6LA 3GRAA 3Q72A 1XKXA 5K8TA 5BWBA 4BP3A 2OK8A 1DCFA 3BYZA 3LPNA 1FDSA 3HUDA 1WU7A 1EB8A 3B5IA 1Z28A 3BWBA 4EY5A 1PUIA 4G26A 2UYHA 3T1HB 1NA5A 4DEYA 2HIAA 1BXRA 4I5FA 3WBKA 3NVKI 2ZSFA 3WGTA 3NIWA 4YRJA 1L4GA 4JU8A 1SHLA 2J45A 3TDMA 3F4LA 1FDWA 4ARAA 3TL3A 2I2DA 2JFPA 3C4JA 3D8TA 4O0LA 3D5QA 4QA9A 4RK5A 4OI1A 1X8JA 3KE8A 3QV2A 4G4JA 4M46A 2QX9A 1UDAA 3PC3A 1GYRA 4E6PA 4BO8A 4JROA 2ZYTX 5FNVB 1JLLA 1GZHB 3FZNA 3HXLA 5C8YA 3FTPA 3LL4A 1HETA 3CZRA 3PBKA 4YJFB 3KWLA 1OXUA 3UWSA 1KY4A 1BDIA 3DLPX 4RVUA 5KNBH 1OBFO 4FJ1A 1MOZA 5BOSA 4RTPA 3C7DB 5EP1A 3ZDYB 3ZQJA 5CFQA 3ZIAA 4JLOA 5DW0A 3U80A 3IE0A 1RAEA 3TZCA 1XHEA 1M74A 4RJKA 4YRIA 3KUCA 2AD5A 3FKJA 1M7BA 3MUEA 2VSQA 4GW3A 4HNAA 3ON5A 4JJGA 4Q02A 2QQGA 1PZHA 1JKIA 4ZDWA 1R5JA 3N2KA 4QLOA 4E51A 4DXHA 3LSTA 2PTHA 4UVHA 5A5DA 3LBIA 2ZT6A 4O59O 1ODCA 4I3GA 1TZBA 4B6PA 3L43A 1V8BA 3UHAA 1PHPA 3LWBA 1ECLA 1SD1A 2YZMA 3K6SB 3GVCA 2ODTX 2Z2JA 4R71A 2CCKA 2HA6A 2P11A 1EHCA 1ELOA 3FBGA 3RBAA 2G6TA 3V4ZA 3ZWBA 1ZGZA 2V5AA 3CW2A 4Q7MB 4CEJA 4Y1EA 4AZ3B 4LQDA 4Q1CA 1ZK4A 3PGVA 4JLSA 4LTDA 4IOJA 4BV9A 5JSQA 1XP8A 3WGKA 1PZNA 1XMPA 5F2OA 5JFGA 2AT1A 2D4AA 3H2BA 3ZDQA 4BVLA 2HDWA 4D9CA 1ZOPA 1ZI6A 3LCVB 4CF6A 2FX2A 2Q2VA 3AI7A 4KO1S 5E8RA 4AECA 1EXMA 1N6KA 4FXOA 3EBOA 3HU3A 4R51A 2II6A 2IT1A 2R6ZA 5FV7A 4DZRA 2BHNA 2XUJA 4RWEA 1PX2A 1NYQA 1N5IA 3A2LA 1AF7A 1N4AA 1ZM9A 3B8EA 5E7IA 1ECJA 2PRYA 3IPYA 2EBUA 1RQ7A 1IXSB 1W1IA 2GYWA 4X0EA 3W9BA 4F9EA 1NIJA 1U63A 4WRRA 4LJ7A 3M6FA 4O2BF 5LQUA 3A05A 1OXVA 2PZAA 5B1SA 3GWGA 4XEHA 1GTRA 5JS1A 3IEVA 5DXAA 5EP4A 4YUXA 3SCZA 1GUZA 2EFEB 4N49A 2JFOA 3C0KA 4RTMA 1RLTA 3BAZA 1W30A 3C1AA 2RJNA 1IOZA 4LF6B 4C20A 4HADA 1GUAA 3C3BA 3WGNA 4BAGA 5K2OA 1MIHA 2DM6A 2Q2OA 1M34A 2ZSHA 3KKQA 1YS4A 4ON9A 3BHIA 4F3RA 4EPVA 4RF5A 1FIUA 4KK3A 2ODQA 4D4LA 4Q3AA 3GLGE 1XGKA 4HBZA 2C7OA 4P4TA 2HX1A 3HKEB 2P91A 5JJKA 1GKYA 2A7XA 2FPPB 2JHFA 2XVXA 3AR4A 4IZHA 5CU7A 3ITKA 3G2MA 3HCWA 3U3KA 3ZNPA 1NVGA 1V35A 4QRDA 4YRFA 4C4TA 1CZNA 2OZVA 3JQBA 1OSNA 4L28A 1KDRA 1W75A 2AW3A 4KRGA 4M2LA 2C4NA 3FDZB 3DDZX 4HAWA 5TPZA 2OXTA 2CFSA 4B9AA 4MVYA 2G7MC 5J4VA 3FOCA 1N6IA 1TCAA 1BVUA 4QUHA 4PZZA 2NU9B 1QQ6A 2QVGA 2V6JA 4L8LA 1ECCA 1KDVA 4RVCA 4OAPA 5B12A 2PZ8A 5BP7A 1EESA 1QRAA 2REQB 3DB2A 1U2DA 2WY2D 3H5IA 5BRNA 1XCLA 1TC2A 2I33A 2WNIA 2AF4C 1KORA 2YUIA 2HA5A 2HLPA 4N5MA 4ZO7A 2CUNA 3PNLA 1ARZA 4J9VA 5FYQA 4NZOA 5FA5A 1MC8A 2G0TA 3NJ8A 5K3OA 5M34A 3WWZA 3RR2A 2DUJA 3OLXA 4TSKA 5IARA 2EFHB 1MAAA 1LSOA 3P9IA 4LWOA 5TC4A 5AJVB 3MLBA 1OVMA 4Y2GA 2FZ5A 1QQ5A 4MRAA 1ESZA 3UY4A 4ZDJA 1KI6B 2IS2A 1H6DA 1V16B 1VL5A 3GEGA 1MXFA 1OIWA 2PKWA 3MC1A 4TMVA 5D1NA 2AZXA 3DDCA 3U5ZB 2FSPA 2RKOA 5F64A 1VDZA 4J6FA 4L27A 4KGXA 4MLCA 4DANA 3LYUA 4ER7A 3JWPA 1QUEA 2G5PA 2HA2A 4BMCA 4YP1A 3T34A 7MDHA 2ZVQX 3UT0A 4HNTA 2F59A 1LRKA 4CLRB 3P1JA 2I6GA 4OGGA 2OL4A 4DR4B 3KYIB 4KW7A 4EUSA 1ACMA 5IP5A 2CGEA 2PSEA 3AETB 3EQ9A 5FUQA 2VPQA 5E1MA 2E37A 2A9OA 2FPOA 4HMQA 3U1VA 1EX1A 1V8OA 1DQZA 4MA0A 4F7WA 3U5TA 1OYWA 2GA8A 3LCMA 2X1VA 3RKUA 3FLEA 1UXHA 1Z0SA 3OPMA 3RTAA 1ESEA 2DY0A 4OK5A 5J2TF 2HPZA 2GD2A 2FLVA 3IT2A 3OJEA 2IE0A 4V1CI 3TLMA 1OTYA 1RJ9A 4DCMA 3AKZA 2PZFA 1V6SA 5JVDA 2KJQA 1G7SA 2WUGA 4KI0A 3HWX1 3ZHBA 4G86A 3WWPA 1JHRA 2IXEA 1FFCA 1GG2A 3S4YA 2C7BA 3YASA 1XQXA 1JHZA 2FEOA 3VH2A 2BEKA 4DCVA 4YCCA 2HMUA 4EK9A 1VBMA 1FDIA 1LS6A 3LBHA 1GQYA 2JI6A 5DIFA 4H6XA 2GEVA 5AVSA 4U2BA 3U16A 2O5VA 1AK1A 1JW9B 2AJTA 2HNKA 4CTJA 4MDFA 2O1XA 1QIKA 3TM5A 4AMYA 1ISIA 2VG8A 4M7RA 4OP2A 2OMEA 3N0WA 1I0LA 3SZGA 3I53A 5I8ZA 2WILA 3QE9Y 1Z7YA 4H4EA 3D8UA 1J21A 5DGIA 5DVZA 2XWSA 3AUTA 1P72A 2DR2A 1ENOA 1QDUA 3F6BX 4MO2A 3X1YA 3ER8A 3ZGVA 1C3LA 1D6JA 2BP7A 1CZRA 4EFLA 3JARB 4XVQA 3JARA 2BFDA 3OTQA 1G20A 4FINA 4Q1AA 3EIXA 4ROSA 1IZYA 2E4AA 4CTMA 3HM9A 4R2XA 3K31A 5FR2A 4ARVA 2HO4A 2CXOA 4YDRA 4G5HA 4I5GA 3K2BA 4YAJA 5SYAA 4BTVA 1QQAA 3COZA 2H8GA 3S2SA 1P7CA 1ULUA 2YZKA 1U0GA 3GUHA 4Y2YA 1W1UA 3RK1A 2ZUSA 2FPIB 3WSTA 4MUJA 1CSEE 3BSWA 5HQ3A 5KTMA 1L5MA 5HTKA 2QVCA 1F0YA 2IYUA 1ZIYA 3E22B 4XM2A 4UEJA 1RXCA 3TQHA 5U9CA 2Q1UA 4WLEA 2VHXA 1TU0A 1KEVA 2FFAA 2QN3A 3FI9A 3GDWA 2ZGVA 4LNHA 1OX4B 2WYOA 4UDNA 4K87A 5E1BA 1U3UA 4BRSA 3S81A 3OEYA 3RC3A 5HRUA 4EHNA 3EXIB 4W5TA 1TYEB 2J5KA 3BWXA 1M2EA 1MB3A 2GJ9A 1SOUA 1TFRA 1L5HB 2YVQA 2IEZA 3H2ZA 1JL3A 2BIFA 2PXXA 4NCXA 4X54A 3H2YA 1WSWA 5E4TA 3K2EA 4KMSA 5ETJA 3E48A 4C4PA 4IHJF 3VAAA 2YWCA 3T9FA 2WNSA 2P40A 3UAGA 3VSBA 5DHRA 5DO9A 1O0SA 2GILA 2VQFB 1BGXT 3NTOA 2W2MA 3GCZA 2XT9A 2I78A 2Q7DA 1TVKA 4HDNB 5DLEA 2P9CA 2Y2UA 3EDQA 4KH1A 4OHYA 3I92A 1CF4A 4X45A 3NBKA 5CFMA 1Z2DA 1QWSA 3L7AA 5HJ5A 1NQWA 4C2BA 2G0NA 1QXSA 4OYRA 4R9UC 3LTEA 5EJAA 2BD0A 1OVGA 4IYJA 4UM7A 1GZ7A 3TNJA 4C6HA 2DLDA 3G3EA 2CV1A 3LTNC 3KPVA 1JFTA 1CK4A 1EGAA 3D5EA 2CN1A 2PZEA 2FUCA 5DCYA 1M1YA 5K3FA 3P4XA 4Z0PA 1E9DA 1NXQA 3MFQA 3C3JA 3HEMA 3OE1A 3ET5A 5CFOA 3LCUA 3BXXA 4WW0A 1QYCA 3IAEA 2Q1SA 4P3YA 5LP1A 5FBKA 1BO6A 1OZGA 1FX1A 2C54A 1ISRA 3EUAA 2OAGA 2POCA 3MZ0A 4PYKA 1QS0B 5L95A 4CQNA 2HY7A 4HX9A 1Q0UA 1M8FA 4PBSA 4RH1A 1Q7RA 1WSAA 3WB0A 4FE3A 3RJMA 3VU9A 1H8HD 3WWCA 4UOEA 2ZPAA 3PF9A 5ITVA 1UINA 1AN9A 4I66A 2O2DA 3KQKA 1QFZA 2A3NA 5EIBC 1UKEA 5LXTB 1T9KA 2NZ8A 3VNAA 4XIJA 3V2HA 5K0ZA 1VLHA 3AO0B 5IH7A 2XV1A 1ZN2A 2PYZA 1KI2A 3K9CA 4OXIA 5GOTA 1C0IA 4YAFA 3G68A 1XDGA 2HK9A 1RLUA 4FW9A 4IG4A 2VUIB 4YH1A 3GLUA 3OEED 4CZ2A 2AH5A 1YRHA 1NW7A 1IUOA 4UAVA 1R4NB 2VSYA 3CUKA 5DH9A 3P0EA 4PO9A 1ZA2A 1L5WA 1G66A 3HN7A 3Q0TA 4LIPD 4NEHB 3V4PB 3C7AA 2PZLA 1STOA 5DHSA 1ZMOA 1H6BA 4QHTA 4AMBA 3TBKA 1O8BA 3EASA 4O2BB 4MJXA 1NQVA 1Z22A 1XTZA 4UM9D 3V9PA 1JMKC 1YCFA 2R96A 3R0JA 4FSDA 3AR8A 4ZCPA 2QTBA 2QTVA 3DZJA 3D6VA 4OIFA 1IOVA 4YFYA 2QGNA 4REMA 4RHFA 4QNNA 4DBLE 2AR9A 1DBSA 2R8EA 1P45A 2Q9AA 1NV9A 3B1YA 3DWGA 3F98A 2WHRA 3FSGD 1PQYA 2MSNA 3M6MD 1M0WA 5TJHA 3SI7A 1QH1A 5JFTA 3TBHA 2D2XA 2X19A 1XCOA 4HUQA 4FYYA 4IOMA 4LZZA 3QVTA 3EXAA 4B6QA 4RPCA 4MJLA 2Q6TA 1KTVA 2Z4TA 1U3WA 4UAGA 5D8DA 3S1LA 1J2TA 1A97A 1WWKA 1OAOA 2CMKA 1SBHA 4Y9RA 5GJVC 1DS6A 4DLRA 2QTGA 1ZW6A 3NOVA 4ND7A 5CUQA 4QYXA 4D8UA 3GAAA 2V6BA 4FYWA 4XDZA 1CR1A 3O91A 3NX4A 3RRNA 1JJFA 2BRUC 3C3AA 2EKQA 4Q3CA 4YHHB 3ZXXA 2XECA 1OXMA 4DSUA 2PUHA 1WV1A 3VZBA 3BRQA 1KJIA 2AEFA 2XMQA 1P18A 1E94E 3BULA 2YN4A 3OQIA 1OX6A 4YBRA 3UCEA 1RYFA 3IPCA 2HCTA 5AKKA 2HWUA 4ZU3A 1GXSA 2PK3A 1I6LA 4FR2A 1AQYA 1YDEA 2FJPA 3DTVA 3W5SA 4PZPA 1GDHA 1CVRA 4I1YA 3IAS6 4YY3B 1G8GA 1DEOA 1NZJA 3AVXA 2XADA 4UXIA 2C7VA 2VBFA 3DOIA 4KAXA 1AHHA 4N0QA 3WK9A 3TL2A 1X74A 2ZIXB 5DSTA 3UXMA 1E5LA 4BEBA 2WJIA 1OFGA 5TGZA 2C3OA 2DBQA 3GH3A 3G2IA 2F1RA 3HFJA 5AT1A 3PQ7A 1L4EA 2Q5HA 5JEEA 3KOOA 2BJHA 2ISQA 4K9OA 1DI0A 1Y7IA 2PS3A 1Z5WA 4ZU6X 1N2SA 1QOQB 4FI3C 4BS9A 6GPBA 2A0WA 3E27A 4R1OA 3S6JA 5U4QA 4WNCA 5I9BA 2MU1A 4RIHA 2WRZA 1ADBA 3TPFA 5KQGA 3OCZA 3AEUB 4B34A 3OZCA 1EEHA 2AS0A 3Q6IA 2XWQA 3KQLA 1XLWA 4JVOA 3PSHA 2XHEA 3ORRA 4Y6RA 4ETMA 1XV5A 2HR1A 3WFIA 4KGVA 3KJQA 2JFQA 4O1MA 4MHOA 4RS3A 2XDQB 3KJXA 3O8BA 3PFGA 4DBLC 2OT3B 1W96A 2PGLA 2Q62A 1SY7A 2L18A 4BVBA 2OXCA 3KQNA 1I1OA 2EYQA 4MDHA 2HUNA 2P6MA 1J7KA 2Y1GA 2O9JA 3H97A 4DMHA 1E3JA 3TQIA 4KI7A 2L82A 3A28A 1U3DA 4N3GA 4DJFC 5I3CA 4IJUA 3KYDA 1F1JA 3UB4A 2I34A 3B82A 4P3PA 1DZ3A 1DTWA 1OJLA 1T4MA 2MSWA 3U49A 2WJPA 4P93A 2QTWB 2F1IA 2C07A 2QQ0A 1KHHA 4QECA 3U56A 5KSZA 1U8YA 4LHEA 2PO5A 2X1MA 3L05A 5EMJA 3VDNB 3WMXA 3TLZA 2ZJ4A 4RSHA 3M9XA 2VDKB 2IHKA 2JA1A 3GZNB 3HJFA 4M38A 4CE6A 2JA2A 4ZYWA 4J2TA 4OMDA 1J1IA 3RC1A 3WA7A 1S2NA 1BEUB 3CH6A 4DGSA 1WXXA 3QBTA 3CF4G 4H3SA 5B4UA 4XE5A 1Z62A 1ZOIA 3QYAA 4ACBA 4O4LA 1NFFA 1XDBA 4MR8B 5DLDA 4YUWA 2XUQA 1MZVA 5DK6A 1NOJA 4HEA6 2WKQA 4BAZA 3JRNA 3EDRA 3ZS8A 4BX3A 4DIMA 5JTUA 4OUDB 4OBBA 1OU0A 4B3IA 3S27A 3I2FA 4G5YA 2P7IA 4UZEA 2ROQA 4LYYA 3MSXA 4LC1A 5L4SA 1MVNA 1SKBA 4DSOA 3CBQA 3TIXB 4RANA 1KVSA 4KTTE 5JY1A 2R7AA 3QW4B 4QG7A 2QAGC 2GLUA 4L0CA 4N5LA 4ZT5A 2YXPX 4I5EA 1N0IA 1F2VA 2QVYX 4MQMA 3CEJA 4D25A 3D6MA 1K66A 3LYHA 3UT5A 5L3SB 1W49A 2NVUA 5D3MA 4I3HA 4FHEA 5D3MB 3S99A 3FLMA 1BQEA 1P1IA 1ZM3A 4FMCB 2XWPA 2ETXA 1MQAA 4QJ4A 3HY3A 3TVDA 5T64A 3SWWA 3ZDDA 4KKVA 3G85A 3ETEA 1I4TD 1X1DA 4L6CA 5AKGA 4CKWB 4E15A 4FGWA 4DCCA 1UT6A 2L69A 2M98A 1KR5A 4UHDA 3H5WA 4TN5A 3IV7A 5FHRA 1MEOA 3TRIA 1YZKA 1XMOB 3NHWA 2NPOA 3G2LA 3KQQA 4C29A 1K8ZB 1I5RA 1MH9A 2BWJA 5A5GA 3BE6A 1Y8QB 3BMNA 3IKTA 2GUGA 5IKMA 4PFSA 1DGQA 1LDMA 1TM2A 1FL9A 2G07A 2MSCB 3LZ6A 4YHBA 3MT0A 4R6XA 2HCRA 4ILEA 3ZK8A 1YFLA 3GD7A 5KOJB 1JEYA 4ER5A 5KTKA 3HTXA 1DIRA 5HGJA 4GWLA 3HB5X 5FPHA 1JU3A 2EX4A 3IPXA 1IDOA 2FVYA 3B20A 4FMCF 1EA5A 3G8YA 4ZK2A 4K81B 1UDWA 3FDFA 2A1IA 3GRUA 1NOKA 3FYHA 4TXJA 4UFNA 4FNGA 5BO5A 1VCHA 5KQSA 2VPTA 2G7ZA 4RZSA 1C4OA 3HZRA 1W94A 4KLZA 5IJWA 5L4NA 3WHLA 3I1IA 1DL5A 1TMKA 3PGMA 4PX5A 1YRBA 3TLGA 3HZHA 5AW1A 3FOWA 3BGWA 4R8SA 2NT4A 2FEMA 1D04A 1L3BA 3D02A 4R83A 5FUVA 3OF3A 5B30A 1QM5A 2AMYA 3U26A 1C3OB 4V0SA 1EFPB 4LFBB 3L1JA 3W5BA 3PQFA 2HTEA 4EY8A 3LXMA 5HFNA 1M1XB 2HHLA 2TMYA 2XDWA 5CA1F 2FCRA 1WB4A 2CNDA 3T15A 3CF6R 4DM7A 2BFCB 3A31A 1ITZA 2IUYA 3OPYB 5ERGB 3WRYC 3QEMB 2XXJA 1DTEA 1W44A 4PRKA 2XNJA 3W06A 2GZDA 1EWKA 1FK8A 1EM6A 1UDRA 1E3EA 1SIOA 1Z12A 5H3HA 1JFFB 4F4DA 5C7LO 4HLUC 4KR3A 1FSFA 3FWPA 1OBHA 1UBLS 3IBFA 4LOAA 1GDTA 1A9RA 1LLCA 3L0BA 2BI7A 3ZDAA 3B3GA 5JOQA 4IZIA 3V7UA 1BE6A 1NVBA 2GHQA 1P39A 1U2EA 2GWRA 4P53A 4ARBA 2EERA 4Z4FA 2PKXA 2YHBA 3LVBA 1OHHA 3M33A 1JG7A 4Q4JB 1L5HA 3WNQA 4WZAB 4ZYLA 2I66A 5JVDB 3GP8A 3LCCA 3MYYA 3S8MA 1VIDA 1U0EA 4M76B 3P9CA 4JI1B 4L8YA 4WGFA 1E9AA 4EKIA 3AGQA 5K8UA 2G76A 3H1GA 3ZE6A 4C2UA 2CW5A 1XD2B 2EKPA 2J9XB 3SLGA 2PGNA 4NONA 2GK7A 3ST7A 3NHAA 3F8SA 2X3UA 1VYHA 1FYEA 2WWHA 3AEKB 1WUJS 3NT2A 3RTEA 2Z5LA 4RTJA 4ZTBA 2LKDA 2C5GA 4WSOA 5E4FA 1OXXK 3M4YA 3CNHA 1LSSA 1WEKA 3ISTA 3O8LA 3SZOA 2FK7A 2VUHB 3DZDA 4EY3A 5HWSA 3VH1A 4W9RA 3I61A 1NVKA 2ATEA 4HTAA 5GWXA 5TQ0B 3MB5A 1J9ZA 1LLUA 4XRRA 3KK0A 4ZJYA 1P7WA 5BW4A 8ABPA 1AO3A 1PTKA 4DVJA 4MUEA 3TUIC 5CA1A 2YV3A 5I7FA 2B9EA 1XVTA 4A4DA 1PT9A 1VHTA 1AMOA 3L82B 3VU8A 1ADFA 3CZPA 4I8XA 2WMDA 3EG9B 3PDJA 5A5VA 4F5WA 2DECA 4F1KA 2ODBA 2Q5LA 1FTYA 2EARA 4HP8A 4FW8A 4QGAA 1XNQB 1RAIA 4I55F 4MEJA 5IBQA 4A1OA 2O0JA 5AW0A 1EP9A 2XZDA 4JB3A 1CW2B 5SYMA 1TIBA 3KHTA 3REQA 5IAOA 3WWEA 1J70A 1EUDB 1HG1A 3HA2A 5HKOA 2W4IA 1G9XA 2ZFUA 5ILGA 1A4UA 3BMOB 3JWHA 4NY1A 2P2LA 5I4CA 2JCGA 2VQ3A 3II6X 4JSRA 2QAGB 1SELA 2ZR0A 2QGZA 1I8TA 2I8AA 5FH9A 1J5EB 5F98A 4IR7A 3JQPA 5EQFA 3FMGA 1COWA 2PV7A 4ZC8A 4NYIR 1YA8A 4Q37A 4DPMA 2HV8A 3KC2A 3U19A 4RJJA 4C6SA 4E94A 3EEOA 1QP7A 4ZN6A 2XGMA 1IN5A 4BUCA 5KOJA 4KFRA 4DSNA 3F9RA 3Q15C 3BXEA 3DAYA 3NHSA 2ASVA 2JLXA 3W7AA 3ZX5A 5BSKA 1Z4LA 4ZCIA 1ATZA 1LK7A 2GBPA 4DIEA 3I9JA 2WKPA 3TINA 1A5AB 1QZTA 2UZ1B 3H05A 3Q7RA 4G8BA 4WY2A 1AXEA 3BB1A 2AKAB 2NPIA 3VFDA 3WGOA 4C2AA 1XPUA 3DAGA 3PQ4A 3UTDA 3STWA 4HS4A 2YN0A 2J32A 4CCYB 1GAJA 1ZFNA 3J81k 4RTLA 4EM6A 1P7PA 3UFXA 2JLWA 1Q7GA 3CO0S 1KH3A 4K88A 1JVSA 1KJJA 1HC7A 3NIGB 3W2FA 3KEGA 5G02A 4JIGA 1GQ2A 3VPAA 2BJVA 4YMWA 4RHYA 5FTWA 1E2MA 2FGKA 4RBNA 5F4BA 1M75A 3PJFA 3T5BA 4EH1A 4HQKA 4EELA 5EJEA 2AA3A 5B7GA 3VVMA 4BBPA 4ZDKA 1IJBA 2P78A 4D9JA 3LSYA 1HL3A 4IRXA 4DV5B 4IEIA 4ZVVA 4EDHA 5I9LA 2WJHA 5HMLA 1YOVB 1JHUA 1E3SA 1NQTA 4OHKA 5IANA 1M1NA 3VR6A 4DLYA 2G1PA 2V0GA 5HE9A 4CQLB 4G0QA 1V11A 4AJKA 3JSAA 3TJZA 1YUNA 4FN4A 4DUGA 3R77A 3MGCA 2O19A 1B76A 1D6MA 3RJZA 3TMYA 4IIEA 3ZHTA 2AGVA 3NAGA 2H1SA 1CG6A 2REXB 2GVNA 2IXDA 3HE3A 1QG2A 3ZWAA 4NENA 2EIXA 5CXXA 1Q57A 1V1MB 2P1RA 3B89A 3BXZA 2G82A 5KU1A 1I32A 3TTVA 3PC6A 3DBVO 1E66A 2JG3A 3ZWMA 1E62A 5H0IA 3EZ9A 1JEQB 1V5WA 4PCLA 2QN8A 4YJ3F 1EVJA 4A0SA 1MQ9A 1PJ2A 1C7EA 1OIXA 1U04A 3EXFA 3IDOA 4L76A 4C0JA 4FZVA 2J7PD 4G5RA 1QFSA 4B75A 2PN1A 3L8ZA 2JD1A 1GEGA 1UMDB 3Q1LA 5AVXA 1XLVA 2WU8A 1RKUA 1TCVA 2UYYA 1UPBA 3MTGA 2QJWA 3WAGA 2JH8A 3H1FA 1OV6A 3EQ2A 4ZQFA 3MTBA 2FPPA 1D8AA 1WW8A 1G41A 1XXHB 1MABA 1FJ2A 1PFVA 3ANTA 4LSWA 4W6QA 2CLKB 3TH5A 5CG2A 5E7QA 5BPFA 1KL7A 3FR7A 1KKUA 3B6JA 4PFJA 4U8HA 4DUPA 4WESB 1Z34A 4WKGA 2ZE5A 1GSHA 2ZPTX 3ICCA 1N2ZA 3AF1A 2EOAA 4HAVA 4LXYA 2J3EA 2YHIB 2VYFA 3DFKA 2AN9A 5JCOA 2X7JA 3FVTA 5EA2A 1MEJA 3UWMA 2FR1A 1VBKA 3G6KA 1U0FA 3WK4A 4QUIA 4LGYA 1HRKA 3M1YA 3QX9A 2C4KA 4IS3A 721PA 2A5FA 2J0SA 1USIA 3WL5A 1ZUHA 1EE1A 1NW8A 3NS7A 2CUTA 1OW3B 3ZHUA 4B3CA 4DVGA 2QROA 3EH2A 4KWIA 2PX0A 2XKBA 1I13A 2PMKA 2WWWA 3D6HA 3EC7A 1GCGA 3AY3A 4C0QC 1MKYA 2EFDB 3L4BC 4HB2A 3KB1A 4NSNA 2B4YA 3H1EA 5D00A 4L07A 2ENWA 3ITNA 2ANCA 2FKAA 4OUDA 4AZVA 3DBHB 4R4JA 1UBHS 1Y6QA 4QREA 4DPLA 1QYIA 1GKKA 2J9RA 3ZCQA 1K4KA 4HDRA 4QNRA 3AH8A 1FDRA 1ZITA 4OEHA 3SMVA 4EVIA 3IMCA 2DWQA 4Q18A 4YCNA 2YWGA 1QS0A 2NQ8A 4BNVA 1Y9JA 1W87A 5KUTA 3F96A 5H82A 1YGYA 3IS3A 3WLPA 4M0CA 2PMDA 2XA9A 5HCNA 2D5AA 4OP1A 3SEFA 4PYRA 1PV4A 4MYDA 1E7QA 1L4FA 5DYIA 3GG9A 1BDHA 5FPPA 1Y6GA 4BZXA 4EAAA 4HRVA 3Q9SA 1P6QA 3LS2A 4PZAA 2HWKA 1WUKS 3KU1A 1U2GA 3EB9A 2WMYA 1WETA 1I7DA 2D3WA 3RSQA 4YT4A 3FVWA 3COPA 2V6IA 2D5CA 4WA7A 1FQJA 3WMRA 1HA3A 1GPUA 1QR6A 4CKEB 4HRAA 2E4WA 3O3CA 4XWYA 3N7AA 2B2NA 1SGWA 3MJSA 3W9SA 3TTSA 2O6LA 3EZNA 4P7FA 1T5TA 3MAGA 3OA2A 3KUKA 2C20A 4MYRA 3DEAA 3PUHA 3V2GA 5K0GA 2GK6A 3B1FA 3LK6A 1VBFA 4B73A 4FGUA 4K9MA 3TOVA 1HBJA 5B2ZA 2W6NA 5GIPE 2PANA 1U0JA 4DMLA 1L7PA 3FTCA 3O2QB 7AT1A 2BKXA 1VL6A 2WF7A 1L8LA 1MVLA 1CF2O 1CJVC 1QV6A 2DP4E 2WSBA 2ZB2A 4OKSA 4BUZA 3FOZA 3WFJA 1P3Y1 1IVYA 1WCYA 2AFRA 4HX2A 4KR6A 3ZGXA 4JBWA 1C7JA 4Y6PA 3SPXA 3UANA 2ZJ8A 1H4VB 5AK6A 3O38A 1J49A 4EKDA 1A9TA 5CYGA 1YZTA 4KN8A 4JLWA 4LYAA 3VHXA 1E96A 2W0MA 3GEIA 4M1YA 4WJKB 3NHMA 4NG4A 4NMXB 2R1TB 4GPBA 5FEMA 4BKUA 5BN5B 4GU5A 3KEQA 5ICMA 1O6CA 5HF9A 3NBXX 4Q3OA 3ZK9A 4Z54A 3HR8A 1Y1RA 5JMOA 5LBTA 3B13B 4Q3DA 1GGNA 4OREX 5K6RA 1WUIS 3IJPA 4K05A 4P0TA 4TTTS 1G63A 3QEAZ 4HF7A 3K0AB 3GLIA 1MT0A 1RKBA 4D0RA 2KBFA 3U61B 2ZM5A 1E2JA 1W47A 1PWYE 3BK1A 1O58A 3TLYA 3B7WA 3AHFA 4BZZA 2OECA 3OIFA 2CVHA 2NXCA 1PL7A 4AMGA 1JGTA 4RV9A 2H59A 3ACDA 4ALMA 2VDUE 1EVIA 2R4UA 1YZYA 3COVA 3E2MA 4TKVB 4B2IA 4DR6B 2D1RA 2DHQA 3QVKA 4GL4A 5DU2A 4RZQA 3RVNA 1P0IA 3PA8A 2B92A 1GPAA 2QLBA 2C9MA 2VTDA 2ZSIA 3V1TC 1UOQA 1MW8X 4CIVA 5ALZA 1UP4A 1Z9BA 4I9GA 4E4YA 1X1SA 1M34E 5C7IO 2KBEA 3UVEA 1DAHA 4LY6A 4B6GA 5JNRA 2GPSA 4UW9A 3TZQA 4U4AA 2DULA 2YHSA 5A02A 3Q3IA 3EWIA 3V4OA 3KLBA 2ATVA 3ACCA 3AF5A 3A6HA 3E1GA 1M72A 2PQ6A 2E5FA 2G4LA 3PNPA 1A1SA 3AOEC 1FDUA 1S6YA 4LOIA 1PJSA 4L0DA 4NULA 2XCSB 2Z04A 3WADA 1OILA 1YXMA 4JVNA 3R8CA 1F6WA 2CZQA 1YMVA 3UMYA 3PXCX 1A4IA 1ZLXA 1NBEA 4RHUA 4YAWA 4JLBA 4OJTA 1USGA 3P0JA 4HAUA 5LIPA 1DFIA 3ILXA 3DPSA 4UTXA 1MX5A 2GEFA 4S05A 3HNOA 3QEOA 4LGMA 2C03A 1H42A 1M5UA 2H7YA 1GUBA 1PKXA 3DOHA 4HH0A 1DJLA 2WF8A 1TIPA 2YX1A 4D02A 1XQYA 2IH5A 2PUDA 5CGQB 4E1BA 2GPBA 2E82A 3AILA 3I8XA 5IH3A 1EWQA 4PSKA 2GA9A 3WKBA 3L7KA 2IEYA 2CYCA 2XQGA 4KWCA 3R7WB 1WV0A 4C4ZA 1DKNA 1DZIA 2ERXA 3H11A 3KHUA 4WNAB 4Y1RA 5JRDS 1ST3A 4RXUA 2OBFA 3SSOA 3ZDCA 2XEXA 4NATA 4HXEB 1XJ5A 2GETA 1K75A 2WSYB 4KN6A 4FPXA 1D9ZA 4FIZA 4KQKA 1XTUA 1ZCBA 4MV7A 1WB5A 4YC7A 4S0XA 3KPUA 3M6XA 1Z33A 4BKPA 4BECA 2PCLA 2WJGA 1TK9A 4LDJA 3CLRC 1DSSG 4RK0A 4Y2UA 5DP1A 2YXDA 4Q4AB 5K1ZA 4KUEA 1TAHA 3FNHA 3DVAA 2GPYA 4IZOA 4GI3A 1IAQA 3FPGA 5JHHB 3GT3A 3QXCA 2EJVA 1VKHA 4MARA 2BE7A 2VBIA 3FHOA 5F3DA 2DERA 1U1CA 1LPNA 3L0ZA 4GPTA 9ABPA 1P4GA 5JZBA 4MUBA 3TL6A 1RYMA 2EZUA 1N6NA 2QM0A 2WQ6A 2C57A 4IIJA 3GLRA 2P27A 2C4TA 5JXWA 2PLRA 5F7XA 3D4BA 1G8SA 2UDPA 2XNKA 3LLCA 4FOOA 3UH1A 3GCWA 1E0AA 2JIRA 2V3VA 1HDEA 2P5TB 3OLVA 4HXYA 2VKQA 4TXNA 1MU0A 3X43A 4YT8A 1A2OA 1ETHA 3RV3A 1SJ9A 1YA4A 2VTKA 4IV8A 2Q3LA 4R2JA 3SX4A 4UEOA 3TOSA 4D42A 5AW4A 5KREA 3KTOA 1LQ2A 3RU9A 2F3SA 4ZQBA 5ADVA 3GXBA 3R0ZA 4ZA2A 1JB9A 2HD4A 5JBQA 3OFSA 2IIQA 2HIGA 1C29B 4ITVA 5TMDA 3KOWA 2ZUDA 1W73A 2BI8A 4TKZA 1X2EA 3RSOA 3QE3A 4RM3A 4CYMA 2PZBA 3A1VA 3W1VA 7ADHA 5A4JA 4FMDB 4DQXA 1QV7A 3QKSB 2DSNA 2P4EA 4X94A 4CEJB 3NFYA 2B78A 2R5WA 1CUDA 4E5KA 3VGPA 3VPHA 3L6CA 2XJ9A 1NW5A 3QNUA 5EXEA 4UPEA 1VMEA 3ETGA 4YCBA 2WM3A 4EGCB 1TCUA 2JBHA 1I3NA 3QFSA 4EB8A 1IVSA 3H4TA 1UC4B 2R84A 3HB9A 5TPWB 1BX3A 4V1CB 3I6IA 1YZUA 4ZKDA 3DNPA 5EY5B 5A7GA 1G6KA 4FB5A 1CNEA 5I7WA 3PJRA 1RHKA 5AXAA 3LWDA 2V97A 5IYZA 3E53A 4REOA 2PWYA 1CC1S 2ZAMA 1L5GB 2VJCA 3NHZA 3GVIA 1QV9A 4EA8A 3LA6A 2V74B 4L4RA 4QPDA 4TV9B 2PMEA 3RJ5A 2W6CX 1ORVA 1HEYA 2FPLA 2LPMA 4UVEA 5EWMB 3WLHA 4FGSA 3NRJA 4JB8A 4BQPA 3R9IA 4PN3A 1OKKD 3LDFA 5E2IA 4Z2YA 4C7BA 1J22A 1JI0A 4GPEA 2C9DA 4GNKA 4BO6A 4KDEA 3HEBA 3WGIA 4AY2A 3MCUA 1XTIA 1G20B 4J1SA 1EJ6A 1ULAA 1ODJA 2ZRJA 4UTRA 3P5BA 2O8BA 2QDXA 3KTAA 4JP3A 4ARZA 1QAMA 3TSYA 3O6VA 4X7RA 3V3KA 3NOXA 1JVNA 5EIWA 3VR5H 4N0MA 3GT4A 1TX4B 3QU4A 4IP0A 5HNKA 4Z1MA 2MCFA 4ANFA 2DFTA 2QZPA 4CW7A 3GCGA 4PHFA 1ZONA 4N5IX 1U81A 4CM9D 1GRQA 1Y1LA 2I4LA 5JLAA 4WKCA 2CUZA 1PR3A 1TW3A 3LECA 5FTKA 2FFJA 4R0MA 4F9FA 1GT91 2OC9A 2PT6A 1X7HA 1W52X 1BFDA 3SICE 1S9DA 2JRCA 3FIUA 4Q9IA 4WXEA 1XZ8A 2YWRA 2B4AA 2ZSBA 1DTWB 4ZCSA 2NU8A 4EA7A 4P35A 5DPMA 4YRMA 5IZCC 1A9YA 1W6RA 2PL9A 3M49A 4L0MA 5A0FA 3LRTA 4EI9A 1IHOA 3ANNA 3AM4A 1YKSA 3G9TA 4OQZA 3SYTA 3TD9A 3AZOA 4CXMA 1KO4A 1L7AA 1PDWA 1XAJA 1PG0A 2VZ9A 2R25B 5JWOA 4TS3A 4OXXA 4R8VA 1O57A 1U6IA 1S3FA 1QH8B 4KE8A 1IEVA 5DYYA 3INGA 4GKVA 3L7NA 4D9BA 2JLUA 1UP7A 2VHZA 1JSZA 3HPRA 4OFZA 2O20A 3QWIA 3OZDA 4OXRA 4KDRA 5DM1A 2BKLA 2FWMX 5D7NA 4LISA 1YS6A 3PSAA 1DRKA 3C8DA 3H2JA 3ROEA 4I2VA 2FZWA 1CUBA 3G2QA 4OOFA 2HZBA 4F96A 3HO8A 3FUXA 5B7QA 3KQOA 2JFYA 3C5CA 1FOEB 2J5BA 1UEIA 1QYXA 1ULZA 3GJSA 2OCGA 2VHCA 4M7PA 4MCHA 3P96A 4D81A 2OHIA 3DL0A 1WVMA 1P8JA 3DOEA 3SOZA 2QM8A 3TMKA 3WYFA 4A6EA 1T6XA 5CLQA 2VF7A 2W9XA 1JTEA 1VXOA 1NTRA 2BJWA 2X5NA 2BH9A 4F9TA 2R1UA 4ND3A 3PC8C 1GL7A 3MOSA 4M0PA 4JXXA 1UBUS 3IOBA 3OX3A 2DR0A 1YBFA 4CM9A 3A04A 4UZSA 3KKNA 3THRA 4EB3A 2OPHA 1DIBA 5BMOA 2A7QA 3ZPXA 2HUPA 4IDFA 4LZNA 2CCGA 3A26A 3M4XA 3IEXA 3O74A 3QF7A 5FX2A 1H66A 2V9CA 2B37A 3PDIA 2W4MA 5TQJA 2XQJA 3R41A 4PQRA 4BLOA 4W9MC 4X9XA 4P7KA 4LDNA 4MQUA 3U9LA 1LW7A 4LRYA 1XBTA 1HFEL 2W2QA 4RGQA 4B43A 4UTNA 2M2IA 4LZAA 3UAOA 2IS6A 1FMJA 4BLPA 1LY1A 1B8OA 5CXQA 1Z8NA 3HO6A 4GZ6A 3OCWA 5L6LB 4CEHB 2OBMA 4O33A 2Z0MA 2OFFA 1E5VA 4TRNA 3W8FA 5CEEA 4B46A 1EXVA 3IUEA 3WE7A 3IOEA 1HK7A 5H5JA 2Q6LA 3NUZA 3I1FA 4GXQA 4KV7A 2HDNB 4E5SA 2GN4A 2H4HA 4UBMA 4F85A 4YAKA 1ZN9A 1OZHA 3ZEAA 4TVOA 1R0XA 2FWPA 1TI7A 1HFWA 4MRSA 4QGGA 4U7JA 3SGLA 4WACA 1QH1B 3PG5A 1V8ZA 1EGVB 1Q1EA 2I3ZA 1MC4A 1XAIA 4MV0A 2QUHA 4PW0A 4HLNA 3IEKA 2J3LA 1ND5A 1YJXA 1K5PA 1M9NA 3LX6A 1IPHA 3KZ1E 4K9RA 1WPRA 2I7XA 3FPCA 3M1LA 4UU8A 3WS7A 3T1YB 1RXWA 4MK4A 3PYLA 4G81A 5HDBB 1IG3A 3RF7A 4B09A 1FQWA 1D2MA 1Y4UA 1CE8B 4WUTA 4QOJA 3OD1A 4EYQA 3FYCA 5JXGA 5KQRA 2H5IA 3TEFA 4AUMA 3EWAA 1DAFA 1E3WB 3OVMA 2B5OA 4ZRMA 4LN1A 3OQPA 1GA4A 4W99A 3JCZA 3IEMA 2H85A 3B1JA 1T0BA 3HWRA 3C6XA 5CLLA 2QNIA 5B1YA 1V6CA 2QJRA 5ENDA 1O08A 2I3BA 5KWIA 3H87A 3DJFA 4MINA 3GL9A 1B93A 3BHJA 2WIBA 3SNHA 4DDWA 2DAPA 4YR7A 4LF7B 4XDHA 1YULA 1SU8A 2G71A 2H4FA 2IHZA 3OEEA 2C88A 1A1VA 1J2YA 2PVSA 3H1TA 2HHCA 4RK6A 1A88A 5DK4A 3EE6A 1HYGA 2BTOA 5M7EA 3TR0A 1SKYE 3OZXA 5ALFA 4D41A 1U65A 5JD6A 4YN3A 5KTYA 1B7GO 5AHOA 1XDWA 1QOPB 3BEOA 3HZZA 1PW7A 3K15A 3MOGA 4KE7A 4YRQA 2H9IA 4HQNA 3KYCB 1YFZA 2J0EA 3QA3E 4RSGA 4YMSA 3SOPA 4AKSA 4D8VA 5GINE 1USUA 1ZIOA 4A2QA 3NBZC 1SU6A 2EDAA 5CTAA 4Z8YA 3L0YA 2F3QA 5JG7A 4YCLA 2HSEA 1JDJA 1LI7A 4P80A 4XIIA 3FNRA 3R7NA 1LBIA 5EIXA 3JQ9C 2CJYA 3FCOA 1PI3A 1KRXA 2WV7A 3SJCA 4MH0R 2FWAA 4URVR 5DYTA 3FTNA 3FMPB 4YBZA 1CUHA 521PA 3RVBA 3GB9A 2ZXUA 3CN7A 3VDXA 4ZZ0A 4H6PA 4EWLA 4JGBA 4RLSA 3VAYA 4HNHA 4GMFA 2NVOA 3PPXA 1UBJS 3THSA 1EINA 2K7ZA 1RT9A 1U0RA 1VZ2A 1Z82A 2AQHA 3HCOA 1QHHA 2XGJA 2QLNA 1PWZA 1F3OA 4N3CA 1KEKA 4LDZA 1NXOA 3RM3A 4BY9E 1B6RA 3L7IA 3GIWA 5CA0A 3Q8WA 2ID9A 4JNKA 3ZWWA 1ORHA 1BE8A 1F51E 5ESDA 4NDAA 4KAJA 1N2HA 4MI9A 5G1NA 2IKSA 2QTRA 2W6PA 2W93A 1JPVA 1T1EA 2YMQA 2ZIUB 4U7DA 2PVCA 3EDOA 1MO2A 1ZVJA 3AIIA 5FNVA 1BA3A 4FE7A 1ILWA 2GDJA 1Q0QA 1WA5A 3RSFA 4X20B 3TTXA 2XNSA 2CHGA 4DIUA 3FJ1A 1ML3A 3BE8A 3DZCA 5B37A 1JU9A 3WYBA 1C9KA 4A26A 5KI6A 4R2KA 5DE3A 4DUZB 4LV5B 4N41A 3U7GA 4OHPA 1DX4A 2X6QA 3PGJA 3WLQA 4C21A 1X13A 3L1IA 4EQZA 1X1CA 1JU4A 1OHHD 3E7WA 1E2PA 2H1RA 4OLBA 3SKVA 3MUOA 3GOQA 3NVMB 2FMTA 4GYWA 3MINB 1VI6A 1AUXA 1K63A 3D6NB 1JP7A 2V7GA 3HSYA 1LBHA 3DEZA 3HJAA 4PC6A 4RXTA 3SIPA 4C6RA 4YCSA 1OH8A 3QBDA 1P1FA 4P7BA 4HEHA 1Y98A 3PWZA 4ZOAA 3STUA 3V1MA 3ZE9A 3I73A 2C92A 3I9FA 4G6ZA 4MRPA 5KWJA 5KYXB 3H5NA 4TOIA 3ZZNA 3IQGX 2XUPA 4ZOEA 4JX9A 1K6JA 4MQLA 1W1WA 2AW5A 2VUUA 1MOPA 3PENA 5DM2A 1LX6A 1JYFA 3L07A 4OHBA 3SQNA 2VRBA 2IDZA 4G5FA 4EX7A 5C18A 2ZCJA 4Y18A 1NMYA 1UBEA 3JZDA 2RHGB 1JXOA 3GJ6A 4RVOA 2DH5A 4AJIA 3VVBA 2UZ4A 4AO8A 1EWTA 3L8DA 2PA3A 4JGIA 4NH4A 2AKYA 2NSJA 1LBQA 2OV1A 2BDTA 3OPXA 4MWBA 1PZMA 2WF5A 3AR6A 1KH1A 1RMYA 3BA1A 4LMBA 5DSZA 2HA4A 4CKEA 1M6NA 5LM3A 1H5UA 1WBDA 1MG0A 3EWSA 3NBYC 1N3IA 4FQ5A 2Q9UA 2FRDA 1FJHA 1T6YA 1OZFA 1NSYA 3ESZA 1VSUA 4BGVA 2P2YA 2PX6A 3N76A 2HQBA 1PJQA 4RJIA 5KO2A 4R2HA 1R8QA 5I9IA 4K9PA 2ZRBA 1L8OA 4MV5A 4A36A 2VTBB 4JR2A 4RA9B 1E2GA 1RM3A 4BMNA 4D4KA 2HT1A 2ZOSA 3PHJA 3EUEA 1GAWA 2BE9A 2B98A 1RWOA 3WLLA 1RWNA 1OFTA 3VC1A 4G85A 3F1LA 3U7RA 3FTQA 3O92A 4H3HB 4P7JA 1JT2A 2NYUA 3D0QA 1CY1A 2BZGA 2H1CA 1IN6A 3DVSX 4QGFA 4DRXB 5JV5A 3MHPA 4FJ0A 1FMFA 2OWDA 2ZSDA 3HJHA 4MS4B 2MSEB 5CJ2A 4NBSA 5CITA 3WR5A 3OKCA 2XMZA 2XNDD 4MYHA 2A30A 3OH8A 3OKFA 1N9GA 1A2BA 4QBTA 1NF9A 2D0OB 4A6DA 1AZSC 5BWNA 5KX5A 1JIKA 2F8SA 2H18A 4I9HA 4UOQA 3RIHA 3O8NA 4QAJA 3SYNA 5LOVB 4QXAA 3H4IA 4HGNA 3VNBA 4AP6A 2PGAA 2VJMA 2VJMB 4FEGA 1L5RA 1OTHA 1TJYA 4S3MA 2BMDA 5E6UA 3ZV4A 4RHTA 2ZBEA 2IL1A 4P36A 1KIMA 2ZBPA 4IIVA 4KMMA 5E7MA 3WIEA 1TUGA 1ZESA 2OZKA 5EJ6A 3FPEA 5LQDA 2EZ8A 2XNDA 3EQ6A 4P8RA 4CIYA 1CRZA 3ENVA 3L1HA 4B3FX 1UOEA 3W7VA 1QRTA 2IXFA 1RS0A 2R00C 4WLUA 1CFJA 3GFPA 4OB6A 4WZAA 5LNK1 5H8WA 2A1TR 2HGSA 2A4KA 4NDNE 4WKOA 3RODA 4HDSB 4C08A 2VNSA 4M87A 2OUIA 3BD8A 4HYTA 4FFNA 2CLMB 2OD9A 3H3JA 3I0MA 2HF9A 2V9PA 3MJHA 3IR6A 3RT7A 5KJ1A 2IPXA 1KTIA 1WXQA 3QWHA 4JZYA 2TS1A 2ZSKA 4RA6B 1IIBA 2XVYA 4X62B 2ZYIA 3FDZA 4IGKA 3GLTA 3OPYI 2P3SA 2K87A 2J6CA 1QHXA 1RI1A 1ZH4A 2I7VA 2YIVX 4IIDA 4X7MA 4DAOA 4KITB 1Z18A 5IT0A 5LUAA 4UAUA 2FPRA 4FC6A 4Z3OA 3AY6A 4G25A 3K4HA 3WSWA 4PCVA 2P8SA 4IILA 5AW5A 4D3DA 5GV8A 1JHXA 1RBQA 3VVLA 3ETJA 3KKZA 1ORWA 3OQ6A 4ZI7B 4N8EA 4O02B 4BLVA 3AKEA 2CHEA 3K9BA 4XX1A 4BWGA 1SD2A 5DEOA 1FU7A 3O1LA 4XX0A 5HK9A 2ZIVB 2PU5A 2GF2A 3DOCA 3EY4A 3L5OA 5FPSA 3ZCUA 4D5GA 1MAVA 4X91A 4F92B 1E4EA 2HRBA 1OFVA 1CP2A 4UFOA 1WSDA 2J3KA 5IW8A 2WYVA 1UJ2A 3IVCA 3NT5A 4Q4AA 1W0JA 4A6PA 2WT4A 4MRMA 3VHRA 4E12A 1P7ZA 5A3QA 3F2VA 5EPUA 2OBNA 4QFMA 1HT2E 3HZOA 1O4VA 1RXEA 1UUFA 3CRRA 1BS1A 2DX7A 2CEKA 1H22A 3NTQA 1HLFA 4RIEA 2V7VA 2PX3A 3KL4A 3TEMA 3JU3A 3PVSA 2P2NA 3C41J 4D4IA 3QWAA 3O3NB 3VZCA 3DL4A 3FF1A 5JD5A 4DG9A 3WO0A 4M37A 4QQKA 1DAMA 2ZR8A 3GF4A 3GI1A 4OH1A 3DV9A 4PWZA 4QASA 5CGZA 3SXPA 5ALVA 4MVJA 1XQ6A 3LI2A 2OORA 4CMEC 4EBFA 4KN5A 2CDNA 1J07A 3EGIA 1B1AA 1BXKA 1IM8A 1KU6A 1SXIA 2GKGA 2NADA 3OG9A 4P1ZA 5FWAA 3EGXB 2I9PA 4B9EA 4NDZA 3UOAB 2NSLA 3X2EA 5BV7A 4CKWA 1M8GA 4K2AA 2QWXA 3KVYA 1XR3A 5HF6A 1N78A 5EPEA 2HA0A 5LQRA 5E4YA 4GLJA 5AMXA 1AHIA 1QTIA 3EUFA 4RVFA 2HGZA 3LNCA 1AG9A 1L7BA 1DC8A 1Q6YA 2GR9A 4XI9A 1H93A 3UBTA 2CC2A 1NF3A 2G9RA 3AG6A 2VTBA 2GZMA 1X92A 1D2CA 2G67A 2IUTA 3PFWO 1SO8A 3LXXA 3CR8A 5JAQA 3T3OA 2FDXA 1I6KA 1RXYA 3N0VA 1MJGA 3E6AA 1N2JA 4WBNA 1S89A 3IAM6 4OUKX 2QK4A 2C94A 3NYQA 4WMLA 4W5QA 4U39A 2WM9B 3P71T 1SG9A 1ZUNA 3TUZC 3CZ9A 4D3YA 1W0KD 1L7XA 1M2KA 2XF8A 1ZNWA 3FFWA 1EFRA 5LYYA 1AF4A 1YQEA 5HBRA 1AU9A 1D0IA 1GADO 4HX5A 3LOQA 4JT8A 3SQXA 2JJYA 1RAHA 3ENKA 3SJAA 4UQLA 1G5IA 1Q19A 1P2SA 5HM8A 5MFZA 5DX8A 4GZLA 1UWLA 5EAIA 5AUNB 3ELBA 1CUAA 3LQQA 2FWRA 1T8YA 4KEAA 3EBPA 2WC1A 1H85A 1NUHA 3RRYA 5CTJA 1IXKA 1EM8B 3SJZA 1UL1X 4QE3A 1K7FB 2DYKA 1EZ4A 2AX3A 3CKYA 4R2MA 3I58A 1H9BA 1RBYA 4RAQA 3CKMA 4B76A 3IT3A 4GYJA 4CKBB 2QI9C 3K9LA 4F9GA 3TD2A 3LT1A 2XRZA 3FSGA 5JMWA 5GADl 4RFVA 3GJQA 4BNYA 1N32B 4M9UA 4N7JA 4TRMA 1PNRA 3JASA 1FYFA 2B25A 2YL2A 4GMGA 4XJVA 2FLKA 1SXJB 3I34X 3ICPA 4OXNA 1V1MA 5J43A 5DM70 3DR5A 2PH1A 1WBBA 1KK2A 1RLJA 4XSVA 1CQPA 4TV8B 2F9FA 4J43A 2WOOA 2QSZA 1BW9B 5EWLA 3U3MA 3T5CA 1VLVA 1UT8A 4WXMA 3EN0A 2XDQA 2IYQA 1EG7A 3MCTA 3WP0A 4A8PA 2JLQA 5CDUA 2H7CA 1U2ZA 1MP0A 4AXBA 5JDCA 3DP9A 5AVYA 4JHLA 3DD1A 1IUPA 1OF1A 1E8NA 1ZRMA 3HFGA 4MKXA 3JZAA 3Q7PA 4QELA 4RHEA 4ZGGA 3KB8A 1TVCA 2HRDA 4FLFA 1DJMA 1XMXA 3NWPA 4XDGA 2ID7A 1N5DA 4FILA 3F46A 4P4SA 5TR9A 3D59A 4FONA 5KMGA 4LYFA 4NV3A 5CDSA 4ABYA 3FB1A 4EHHA 4GSLA 4DA6A 5C3MA 1P1KA 2ZG6A 4O3MA 4HWTA 5GTDA 2EP7A 5LR6A 2RGXA 3UYLA 1F8UA 2WHXA 2ZJ0A 3VV3A 1NXWA 1V41E 2WK1A 2VO1A 1XB2A 3U48A 3K35A 4BYGA 1J4AA 2D4HA 1X7XB 3ZV5A 4S1VA 1QQTA 4X6UA 2C2BA 2VTEA 3CJQA 1UM9B 4BNTA 2VXBA 1II9A 1N33B 2B1JA 4KE9A 2IYEA 5BW8A 1IZ0A 2X76A 2QTCA 1L5LA 3HDVA 3S2UA 5K6TA 1FNCA 1F20A 1GPH1 2VHEA 3MJCA 2FVXA 4HGZA 4JUAA 4IS2A 4NJEB 5TJ9A 5F21A 4KYVA 3UM9A 3P4UA 4CLRA 1FDTA 3JV7A 2GARA 3K5PA 4M1EA 4MR8A 4O4LB 4YXFA 1IHUA 1UJNA 3V8BA 4YRKA 4MTCA 5DNUA 1HWYA 5IHXA 3HN2A 2O8FA 1H8EA 1ZEMA 4EY7A 2WBLC 4KVAA 2O4UX 1A9PA 4GOJA 1A76A 3R7BA 2DKNA 5AKLA 5LP6F 1RLOA 3H2HA 4OA8A 2RG1A 1N4DA 5KNDD 4NE9A 1C3OA 1GLNA 3A9UA 1IBKB 2O3JA 3F7TA 2CCJA 4KYIB 4DARA 4N8DA 3ICQB 1ZSVA 3KCNA 2D62A 3MJRA 2PKEA 2R4TA 1OPXA 5KQMA 5F1KA 3ZYCA 3A2NA 1B74A 1TK3A 1DJQA 3PV0A 4PZCA 1JXMA 2AN5A 2UV8A 1VJ5A 2XQIA 1VIMA 2P7HA 1W4BA 3GR6A 1L5NA 3TLXA 4AUEA 1SCKA 5GIOE 4E6EA 1Q16A 2AF3C 2B3TA 2B20A 2Z98A 2YJ5A 3GPLA 1CB0A 3DA8A 5FA8A 2ADOA 5EJ5A 4RTKA 3NKLA 4EFDA 1KGDA 3ZLVA 2X22A 3ZTYA 4Q9DA 3O8DA 4GL2A 4GOMD 4UBJA 5M5BA 5EJFA 1YVRA 2VA8A 2LRHA 1C8VB 4G0NA 5FUYA 5KSPA 1VPWA 3A36A 5ITWA 1IXYA 1P61B 2C5EA 2HA7A 4LCEA 5ESRA 1Z0AA 3QHAA 5HIMA 1JXAA 4RM2A 2N42A 1GNVA 2UZAA 3VKFA 4AU1A 2BDUA 5TVGA 3MAJA 1SBCA 4TXLA 1YNOA 3RFCA 5C1PA 4C0XA 3B9PA 1G6Q1 3X1WA 1XRJA 4YO8A 2O5CA 1KF0A 3VR5A 1TO2E 2WVGA 4X44A 1TPZA 3TLJA 2H9AA 5G4LA 1QTRA 4B4UA 1YU9A 1R15A 1GPYA 1SVLA 2Y93A 4FYXA 3FRJA 5HBGA 3GUCA 4PPYA 4XSHA 2VRNA 5EXDA 2KSQA 3K1ZA 5AJWA 2AK2A 3ZYZA 2GNOA 3B2NA 3SSAA 2EEZA 5KTOA 3OLWA 2NV2B 5J5CA 4UHHA 5SY9A 2RJOA 2PKCA 4OBXA 1YS2X 2YOGA 5H7XA 2C97A 1KY3A 1QHNA 4FKBA 1V16A 2R5NA 4Y9UA 4UHBA 3KB6A 3NR2A 2Y99A 1SRQA 1US8A 1YR6A 4ZVLA 4EITA 5MHTA 3EGOA 3N74A 2ZWOA 3MYRA 1RI5A 4PS1A 3LO8A 5MGNA 4FJ2A 1K8YB 2J9FA 3A4LA 4NAUA 4JDPA 1I1HA 1UK6A 5FT9A 1V9SA 2HCFA 2QXTA 2XB8A 3OIDA 2E6KA 1IZ8A 2HEIA 4YJGA 4WKPA 4ZT6A 5JPIA 4FBMA 2C2OA 3EEIA 5GONB 3TR5A 4U7HA 1QKIA 4MVJD 2D5BA 1W8IA 4CLXA 5DN9A 1VHDA 2OOKA 3GHYA 1T8RA 1IFXA 2G4VA 4ECAA