3T7KA

Complex structure of rtt107p and phosphorylated histone h2a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
248
structure length
233
Chain Sequence
b'KAEKILARFNELPNYDLKAVCTGCFHDGFNEVDIEILNQLGIKIFDNIKETDKLNCIFAPKILRTEKFLKSLSFEPLKFALKPEFIIDLLKQIHQININLFDYEINGINESIISKTKLPTKVFERANIRCINLVNDIPGGVDTIGSVLKAHGIEKINVLRSKKCTFEDIIPNDIFKYVLIVTKASQVKKFTKLINDRDKNETILIVEWNWCVESIFHLNVDFTSKKNVLYQKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulator of Ty1 transposition protein 107
publication title Structure of C-terminal Tandem BRCT Repeats of Rtt107 Protein Reveals Critical Role in Interaction with Phosphorylated Histone H2A during DNA Damage Repair
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 75
structure length 233
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16770 RTT107_BRCT_5 Regulator of Ty1 transposition protein 107 BRCT domain
A PF16771 RTT107_BRCT_6 Regulator of Ty1 transposition protein 107 BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3t7kA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3t7kA01
2XNKA 4OFBA 1Y98A 1T2VA 3I0NA 4Y18A 2COEA 4N40A 1T2UA 3K0KA 1T29A 3PC8C 3COJA 2VXCA 3EF0A 3HUEA 2COKA 5ECGC 1IMOA 2M2IA 1KZYC 3KTFA 1L7BA 4BU1A 2JW5A 2K7FA 3K0HA 3U3ZA 2WT8A 3UENA 2AZMA 3T7JA 3QVGB 3L41A 1Z56C 3QVGA 1GZHB 4BU0A 3L40A 4XPZA 2HTFA 3K15A 1N5OX 2ADOA 4IGKA 3UEOA 2INGX 2EBWA 3K16A 1WF6A 1JNXX 3PC6A 1IN1A 3PXDA 4JLUA 3T7IA 3PXBA 1OQAA 3SZMA 3AL2A 3K05A 3JVEA 3PC8A 3FA2A 2VXBA 3PA6A 3EF1A 2E2WA 3SHVA 3II6X 2R1ZA 3T7KA 2DUNA 4XQ0A 4Y2GA 3AL3A 4BMCA 3PC7A 3PD7A 2LE0A 2ETXA 3SQDA 3L46A 1CDZA 4IFIA 4BMDA 2L42A 2EBUA 4ID3A 3PXCX 2EP8A 3I0MA 2NTEA 3HUFA 3PXEA 3OLCX 2XNHA 3T1NA 3PXAA 4U4AA 3SHTA 1L0BA 2K6GA 2D8MA 1T15A 2COUA
chains in the Genus database with same CATH superfamily
1ZH6A 2C9CA 3IIMA 1MB0A 1T43A 2PFSA 1B1AA 2EL9A 1XDBA 2EOAA 3QW2A 4Z0PA 2ZVPX 1SBQA 4URXR 5JMOA 4DR3B 4XOIA 3RV4A 5BSRA 1PS0A 1ZGBA 2VQSA 4G1BA 4QUIA 4D3SA 2PO7A 3E9YA 2FOIA 3PITA 4XH9B 1XP5A 3D6FA 4MINA 1XIVA 1TEHA 2J3IA 3KVRA 5K4HA 4JITA 4DLPA 3K0BA 5HKAA 1VYVA 4I3FA 1SXJC 4IJQA 5E6UB 4UTPA 2HF9A 1U0GA 4YX9A 4U6NA 2E4XA 1ZW6A 4RSGA 1T6BY 3A7EA 1U0JA 3F4LA 4E51A 1T9HA 3HBLA 3OC0A 4UAUA 2IYWA 3EBPA 1IBLB 5E2BA 4AW9A 4DR7B 1ZM2A 2ZZNA 3M6LA 3WG9A 3NBKA 3B9BA 4CMIA 5E1OA 1E98A 2RHJA 2Q9UA 4IGIA 3F5MA 4JLJA 2J0QA 3SI7A 3D6JA 1SZCA 4BDTA 4WMLA 1DEOA 1RHMA 2QE6A 4XE5A 3I09A 3B6JA 3ES9A 3RS2A 4G2TA 1CYDA 4Q1AA 4U0KA 4ZAFA 1WUYA 4HO1X 1HDZA 2PWZA 2WF8A 5CBPA 4CT4B 3PT9A 2GEJA 2BEUA 3OO0A 2ZJYA 3HKEA 5CIYA 1GNLA 1UOQA 3CF2A 4DYDA 1OSNA 5THXA 4B3SB 1T1RA 3AW8A 2IY7A 5LQCA 3S8YA 2XXAA 1RHKA 1EFDN 2FPMA 1UXOA 2ZRGA 2GYVA 4QGBA 2IIQA 2RGAA 3V32A 1HA3A 2A0KA 4EFMA 4MB6A 2HAEA 1C8LA 1WD5A 2OAGA 4HQ0A 4ZALA 1RAHA 1JPNA 4YMUA 4DLWA 4DR2B 4DR5B 2PKCA 2YUTA 2RHGB 4IJWA 2R25B 4MYSA 3T4XA 1RWVA 3EGWA 4OQFA 4Z4EA 3QWFA 3R9IA 1DEXA 3DE6X 3GCWA 4IFTA 2H7XA 1SXIA 3AKZA 2TMDA 4IGAA 4OXRA 3VR4A 7GPBA 1FXWF 1M75A 2CHUA 3K1AA 4PZUA 4WKPA 5J4KA 5JBNA 1FNSA 1I7SB 5EQJB 3SEQA 4PX2A 5JAIA 1ZGHA 4AQYB 2VO1A 5DGHA 1TL7C 2CYBA 2P5TB 4ISCA 2HJWA 1EGQA 1CIPA 4KPUB 4UBOA 2BGWA 2QJFA 3ENKA 4MVJM 3GF4A 4RD6A 1GSOA 4GSLA 5CVTA 5AHOA 5F7ZA 2FP4A 2H4JA 2AJTA 3OOEA 3GOQA 4JY7A 5FPSA 1P3Y1 1J8MF 4FHCA 1NYTA 2PD4A 4XWTA 1PJ2A 2ORYA 5EA2A 1UBEA 4KXVA 3Q7TA 1HYQA 2VHZA 1OV6A 1W1IA 2D2VA 3VU0A 2PAFA 3ZHUA 4HXFB 3RT1A 2O8FB 3QI2A 3PQ8A 1X7GA 2PBLA 3W5CA 2V45A 2F1JA 3CEHA 4IFIA 1YDWA 4MUMA 5EHGA 4OF4A 3OFJA 2HCJB 5LKRA 2P9BA 3N7AA 3EY9A 5IC5A 3K5HA 3FUXA 1NMQA 4BJ5A 1XYGA 3MJTA 5DEOA 4RJ2A 3E9RA 3NIWA 4OPMA 3RUEA 3O0TA 3T34A 2ZIZA 3PUKA 2W48A 2FPIA 3L3BA 1ESMA 3N6VA 1R0BA 3LMKA 1JYEA 1II8B 1FTWA 3TXXA 3EDOA 2GHRA 1E2UA 2JAXA 3O4FA 1G17A 4GYYA 5GV7A 3I9LA 3CZ9A 1FJGB 1HTWA 4UUAA 4DA0A 3OQMA 1SWWA 4H0CA 4M49A 4MPRA 4QATA 4WXMA 1WAMA 1K97A 4URWR 4H4CA 4EFKA 5EHNA 1FDSA 1LSUA 1M8GA 5FO1A 2CV1A 2IHKA 3EVAA 2ONYA 2FP3A 2K2QB 3BRCA 3KV1A 4AZ0B 3KELA 4PYMA 1YJBA 2BELA 1W2HA 3RBXA 2HSJA 3UBMA 2V97A 3BIOA 1NVAA 3KAPA 4JP5A 4G1EB 4XAQA 5IAJA 4YPOA 3EMBA 2NN3C 4RKQA 1ORTA 3G23A 3OP1A 3AGQA 5EP1A 2AF3C 4QODA 2HO4A 1PTJC 4HADA 1K06A 1D2NA 5K5EA 4DTCA 2IZ0A 1HQKA 3F6CA 1M34B 2W37A 3FCEA 3SYLA 2K7FA 4EA8A 2R7KA 3I05A 1R4NB 2QSZA 5G4LA 4IZIA 4TZ6A 5LQAA 2BUCA 1U31A 4ZCIA 1BDJA 3Q72A 4HMPA 5A4AA 1BCSA 2D6FA 3IAS6 3MUOA 1JWLA 1B7GO 1GCUA 1KBOA 4V0MA 4Z4HA 2IOHA 1OLXA 4N1AA 2HK6A 1GGVA 5M5BA 4BOYA 5BQXA 5T8KA 3EPHA 4B4WA 1W0KA 5JDIA 2RCYA 3DMTC 3GRYA 5FKJA 4IVPA 2OE2A 3U3MA 5LP6A 5EP4A 2FK7A 1M0TA 5E3IA 4I2VA 3UAWA 3C3AA 3PNMA 3WQQA 1H9CA 1FW6A 1N6RA 1DT5A 1XUOA 1ZOPA 1J39A 1I32A 5JVDB 2AXQA 4H9GA 1CR0A 3QLUA 3THXB 2Y1CA 1OBOA 5DM60 2O4UX 2WBLC 4D3DA 3OCWA 2DCUA 4US1R 1NMSA 5LB4A 4DWJA 5B6IA 1ZM4A 2AC7A 2XNCA 1LKZA 3K3PA 5FPTA 3EPPA 3ZGNA 1V4BA 2V6GA 3I58A 3ZXUB 2WTUA 4PR3A 1U8XX 4WCDA 2RHTA 1Q0HA 4AUEA 2Y68A 4EF5A 4ER3A 1T2DA 5KHLB 1YJCA 4C0XA 3KSAC 4YA6A 5FFNA 1OIWA 3ZJUA 1CQIB 2CCGA 1VPVA 4FDLA 4N5HX 4RV5A 1S4MA 5L7TA 1TQ2A 4XD7D 3ANTA 2I4NA 3O8RA 5FWYA 1VBKA 3TVDA 5KTSA 3R3XA 3PHHA 2Z6UA 4TV9A 1TTQB 3I45A 3P2EA 1E3SA 1V8PA 5FWXA 1OJLA 3QXJA 2ORVA 1XCMA 3C3YA 4OGWA 4S05A 4GMHA 3F78A 1ML3A 1T3LA 2VL7A 3GFQA 4NFYA 1J9EA 2FWNA 2GF2A 3R24A 3PRKE 3RKSA 1ZK2A 2NZ8A 2QG6A 1YCGA 2QN2A 3DONA 1JAYA 4L0CA 3W6OA 4AJIA 3EPRA 5LJIA 2XKKA 1I36A 3Q5EA 5A6VA 3A6LA 2PUTA 3B2QA 3ANNA 2B99A 4DAOA 4XZ3A 1SC6A 3EDMA 1OY1A 2K2WA 2YRWA 3L93A 1LZLA 3T7TA 1SUDA 1RRGA 1XNQB 2VTVA 1ACLA 3OE1A 4UTNA 1U4OA 1JG1A 2G9RA 2M9MA 2PH5A 5JG7A 2HJ9A 1N2CB 3RODA 1J20A 3MVEA 5DYIA 1SOAA 1CFZA 3DWIA 5DI9A 3VJLA 4OB8A 2EU8A 3D4LA 2PO5A 5GONA 1EIZA 3OZAA 5FP0A 3SQLA 4P0PB 1JKJB 2REBA 1QC5B 3QPAA 1ECPA 2ODAA 1Q20A 2ZYSA 2J9FA 4WX2B 4ZCTA 3FOZA 4OB7A 4QU8A 2BFEB 3HACA 1ZD4A 2ETVA 3IDAA 2A1UB 2EJVA 3NCHA 2BUAA 3FY4A 4FONA 1NN0A 1XTZA 4QUDA 3RASA 5CCBA 4WNAA 1FP4A 1HDOA 2F2TA 2FQ1A 2VUSA 4PZPA 4QUKA 4X1YB 3MRXA 5HE9A 3K0FB 3T0IA 3TJRA 3TO5A 1JFVA 3QELA 1I9CA 2QM7A 5B1IA 2C3YA 1M2OB 3MMZA 4W7IA 2EX4A 3WE7A 4AY6A 3WK9A 2G28A 1V16A 4MPJA 4U5XA 4YRIA 3EPLA 1DG1G 3GNQA 1IVSA 4P35A 1VMIA 3E03A 3L05A 4UPVA 2GRAA 5HMMA 1GVNB 1E9DA 1AKWA 2AJLI 2GYWA 4HWRA 3K2QA 3X1DA 4CIAA 4XIYA 4V39A 1GT91 3ZYZA 2BFWA 2BFOA 3ZCSA 2QLLA 1DQSA 5B1SA 3HNRA 2A9QA 3AXTA 4GDFA 1KNQA 1PFUA 4P9NA 2R7LA 3CB2A 2BSQA 2CVOA 1HTBA 3QPVA 1LX7A 3CKLA 2CNNA 4X62B 3N0VA 1TQHA 2OGTA 4CQMA 1N2CE 3KOXA 4BNHA 2XMBA 3O7MA 1N25A 3AOEA 4Y2TA 1QJCA 3QLVA 2Q5JA 1Z73A 4ENQA 1VPTA 5KQMA 1H65A 5IZCC 4OBBA 1M67A 2PSDA 1YONA 2C54A 3QMPA 2W8BA 4O08A 1T0HB 4ZOAA 4HNRA 1UEIA 2H9AA 4PNHA 2IWRA 3TLGA 1VBMA 2OHOA 5DO9A 3Q5GA 2WU1A 4HWPA 1AT1A 2Q50A 4OY3A 4BY9E 1KRXA 4Z3KA 4L3VA 3IAFA 4I9NA 5KYYA 4OJNA 3RHTA 1IPEA 3PC8A 4GYKA 2O07A 2H18A 2ZS8A 4NMWA 4D4HA 3TMAA 2VPIA 2Y0PA 3E5RA 4YJ3F 4QARA 1DUVG 7REQB 1QZZA 4IDHA 2Q3LA 2Q6TA 3FMPB 3H8VA 3PA8A 3LNCA 3IDFA 4YIKA 5CLJA 3W6PA 2QRZA 3EXIB 4W63A 5TGZA 1ESZA 4IW3B 5ICMA 2F8TA 2OGSA 3IR7A 1UMBA 2WF7A 4HB4A 4BMDA 4LDQA 1SQ5A 3C6BA 3H04A 4BFUA 1XD2A 1H6CA 1SA0A 5EIBD 5C3UA 2WUVA 2BD0A 2ZRQA 1WY7A 1YU6A 4QAJA 3WVNA 4CMJA 3I52A 2QYOA 5FJJA 4HDAA 4TVOA 4IOJA 4BFCA 1EFVB 4L02A 3R0JA 2P7IA 1QQ7A 3E3NA 3MXOA 4KXFB 5EWJB 2NUPA 1SB9A 4IUDS 5MGNA 3TRKA 4OXNA 1MG5A 5HRAA 2GLUA 2YJZA 4L8YA 4K9SA 2J5KA 3L8ZA 2J5BA 1OW3B 1ZMBA 2YS7A 3F6EX 4WRRA 4EEXA 2A3RA 1XRMA 1TD1A 3M4XA 3I61A 2W2XA 3QU9A 2WQ7A 1NJ6A 5F76A 5CVCA 2QW8A 1T2CA 2H07A 4J0DA 1M76A 1GGEA 3MINA 4K05A 1QVZA 4ZEXA 1KQOA 2P4EA 3HFGA 2W2KB 1VKHA 1U7PA 3ZHVA 2Y2UA 4YMIA 5KEIA 5EEGA 3UGTA 5EMMA 3NI2A 2VOJA 2A92A 1CUUA 3UWSA 3DO8A 3IODA 4PIVA 3FJ1A 4R9RA 2RC6A 3HJHA 5K3CA 4ZI7A 4LV8B 5TQJA 3K32A 1QDEA 2FR8C 1FMFA 4PWZA 1DBQA 2OZLA 2DSTA 4M9ZA 1K3FA 3RW9A 1UBHS 5L3ZA 4TKVA 1IJEA 5K0EA 1NNEA 2P2CA 3NT5A 4AFNA 4HEA6 4FZRA 1Z38A 4G85A 3TEFA 3OLQA 4O2AF 3T06B 1BX3A 3LY8A 4RADA 1E32A 1GOTA 2ZE8A 1ITZA 3AVOA 2B4QA 1QBGA 3DWFA 3QFTA 4HPXB 1JAIA 4UPDA 1V1MA 4CM3A 2ZI9A 3OWOA 4PZEA 1G7CA 1TTPB 3DOUA 2W6JD 1TD9A 4ETMA 4XRRA 5YASA 2VP3A 1BVHA 1XR3A 2FN3A 1ZI8A 3BGSA 2AI2A 3HBJA 3V4OA 3VA7A 4KQJA 5EE1A 1Y9AA 2WD7A 1QVAA 4LV6A 2O2SA 4ETWA 4EEZA 4HH4A 3UBTA 1VI6A 3LC1O 8ADHA 3VC7A 1OZHA 1QV6A 3QVKA 2WJYA 2XVAA 1LDNA 1K8YB 4INZA 3SXJA 3HK2A 2UVPB 3ESZA 1A9SA 1T5OA 3J81A 3I01A 1N0VC 3OZBA 3AZQA 4FBLA 2HPZA 5DSZA 5J9FA 2SCUB 5LZ7A 4JJIA 4BVKA 3L4BA 3D8TA 4K26A 1U7OA 1RRKA 4P0TA 1FIUA 3P9PA 4X94A 3USES 1DCFA 3QKRA 4WASA 1EVQA 3JASB 1WIWA 5I9NA 1ZD3A 3EQ2A 4QOHA 1ORWA 3D64A 3FGOA 1XD8A 4NMMA 4G0UA 2WAOA 4QU0A 1XDSA 4EI9A 2Y93A 4C7OB 1ZP6A 5CIQA 2IDZA 2QNIA 5I9BA 1R5OA 2V7WA 4ALIA 2LRHA 4N3AA 3OQHA 4TTIA 5D84A 3A04A 3UMMA 3H6HA 5EJMA 1IHUA 1C8VB 1Q92A 1RLTA 3DXFA 3GH1A 4JWKA 3WYNA 2PD6A 2VN8A 2IU6A 4CTMA 2C0CA 4MWDA 3PICA 5D5HA 2FWJA 3RBZA 1ILEA 1DUIA 2F9LA 1Y7TA 3BS4A 3O8QB 4RCYA 2LE0A 4QASA 5ENZA 3GCZA 3MRSA 1DL5A 1NPTO 3QEJA 4B73A 3BEDA 4CVNA 3U7RA 3NS7A 4R8KA 4ND7A 4E31A 1E62A 1P19A 4TMYA 5E6UA 2DAPA 1SFRA 1AQNA 4XQEA 2QX8A 4QG3A 1AKVA 1AHIA 4FU0A 1DKPA 4UUPA 3TOCA 2XTMA 1ZG3A 2L2QA 1WDWB 3AOGA 2HA5A 3FPEA 4R98A 4OOFA 1PG0A 1L7XA 5KNCH 3ZGXA 5KVCA 4KGXA 3W9SA 3LYAA 1EXVA 1ADJA 3USZA 1MDBA 1X77A 5CNMA 1R64A 2VZLA 3S28A 4JJ7A 3AM4A 4ND5A 2ISQA 5AVJA 3HDVA 5DFAA 5KX5B 1V8DA 3G8YA 1N0IA 3NOXA 3ICEA 2ODPA 5FA8A 3F7OA 1QF7A 3K0KA 4KE7A 4LJ7A 1H4TA 2FRVA 3MQ4A 2FWPA 5HKBA 5KDDA 2FDRA 2JFFA 3B20A 4EB8A 2XCSB 1Q83A 3OFNA 1H0KA 1SULA 4H6VA 4RGVA 4MRRA 4BQQA 1M2WA 1T5SA 3LHSA 2WT4A 4XJTA 1DCKA 5IVIA 3NIBA 1U1CA 1W4LA 2OBLA 2XOKA 1HEUA 2YWFA 3LRTA 4FD3A 1G9SA 3CTMA 3HS3A 4JC5A 4EYOA 5ALVA 3MS4A 1L7DA 1YACA 2OXRA 3LUCA 5D51S 3UJ8A 3WAKA 1VDZA 2YJ5A 3B1XA 3CLSC 4D92A 1GUAA 1KVUA 4F6LA 5KJFA 1QP0A 3OCVA 3I28A 1T8RA 3U7HB 2DPMA 3T6KA 3LFHA 1VRCA 3Q3VA 4YRRA 5FIUA 4B45A 2AE2A 3WDLA 4RY2A 1HLDA 1L3IA 3FHLA 4KJZA 5DCYA 4DNFA 1M10A 1RQLA 4LTMA 1Y7HA 1TZKA 1PDOA 2P30A 3GA5A 1O87A 1ZGJA 2FSSA 1UJBA 4MUXA 3TDNA 2ZYRA 1Y0BA 2PSJA 1OXXK 3B2EA 4BNJA 4NOKA 1CUHA 1EFTA 2HPVA 4FJ2A 3NDIA 4L6CA 3VOTA 3KSRA 2JBHA 1IIRA 2AZDA 1FRQA 2FWAA 4X66B 2PL9A 5KI6A 1KA9H 1DLIA 2WV7A 1QZXA 3G7SA 3U60B 1CZHA 3W2TA 5A9RA 2ZQYA 3QYPA 2F48A 2B0CA 1LNSA 4RDCA 4AP6A 2O8FA 2VR1A 5DGTA 2Z8ZA 3KFXA 1N75A 2ATCA 3QA9A 2QYSA 3RVOA 1VG9B 5E7QA 4DLSA 5BVHB 5CFOA 2PKQP 5KTOA 1VB3A 2HMVA 4KO4S 4ZODA 3M6IA 1BDMA 1BO6A 1XTJA 1SG9A 4MUYA 3WLEA 3P20A 5AKYA 4O4JA 3X0DA 3ELBA 2PUAA 1TVKB 2PUJA 3DDZX 4RPKA 1K2VN 1PRYA 2GR9A 3ZCPA 3LLUA 1II8A 3GRFA 3NG1A 2C5AA 4CUKA 1EFCA 3SZGA 3ELWA 2EWVA 5LL6P 3ABZA 4QXRA 1FFGA 3COPA 1YUNA 2AE1A 5G3ZA 3NWOA 4JYCA 4PN7A 1RWPA 4YUWA 4YRFA 1YVDA 1BROA 1YCDA 1AS2A 4C4SA 2LDXA 4N47A 3PFNA 4AZ0A 4YWJA 2WJ4A 1AF7A 5JS1A 2WWTA 4U9HS 4UTOA 3RGGA 5AVTA 4Q93A 2AJBA 5KDLA 2YMPA 2ZRPA 4MS3B 5AVRA 1Y3IA 1JIUA 3JATB 4NCXA 3UKJA 4EHDA 3QYJA 5K0SA 1OFIA 4BFWA 3L6CA 3ODPA 3PWZA 1YV9A 5D86A 4GM1A 4QYMA 1M34A 2X8AA 1QQ5A 3FIUA 3M1IA 1OYYA 4LHEA 4A2CA 3EAFA 4JHLA 4PRZA 1XFDA 1R4NA 1O58A 2PUGA 2HPHA 1Q0QA 3O84A 4QPDA 5D2CA 2JJMA 3UQYS 3V33A 1F1JA 4BVBA 1BMTA 1O4VA 5CIWA 3QP9A 3T7SA 3CF6R 1A7JA 5AH0A 1V3QE 5HQTA 3OSZA 2GNOA 2WHRA 1IATA 1WCXA 3WNBA 4OM8A 2VWQA 2E5LB 5IS2A 2AMYA 4MRAA 4JT8A 1FXSA 1XGKA 3NTXA 2X8JB 2WIBA 3UPTA 1ZOOA 4M8KA 4EW3A 3HBMA 2YJ4A 3AEZA 3BXPA 3OCJA 4GIBA 1SPBS 5M29A 3E8SA 1AKUA 3RQIA 1GN9A 4BUCA 5JVDA 4UDOA 3WMFA 1DKMA 2GVNA 5JNSA 3THXA 3K70D 1GL7A 4JIMA 1D5WA 2IYXA 1YHNA 4R69A 4RVNA 4RM3A 3U1BA 4BVGA 1TCAA 3L2OB 1HL3A 1PZXA 2VYFA 3ODGA 1PT8A 4DTIA 4P54A 1ZGZA 3QTBA 5IDWA 1JDBB 1FUKA 4GXRA 5B1HA 2BFDB 4OP3A 4QE3A 3TQCA 4WDQA 3VI3B 2B4AA 4DDUA 1NULA 1SB8A 1CQIA 2A88A 1CUGA 3DKVA 4RHUA 3LUBA 1CPYA 3PPYA 2RI1A 3PFKA 3QW4B 3H7IA 1T4MA 4Q9LA 4F9FA 5K3OA 1XSEA 1MKYA 1KKLA 2AJ8A 4DCTA 4HV4A 5LPNA 3LA6A 3STYA 3QPCA 5JFTA 2R8RA 1N6IA 3HWWA 5EKTA 3B13B 4LV5B 1GA6A 1FDUA 1KHHA 4Q7LA 3MJHA 4RELA 3T5PA 1NN1A 3TECE 4FCTA 3IE1A 5HHTA 3WL4A 1ZUNB 1ZKDA 4OP2A 1OGIA 1EDDA 2Z8YA 3IQHX 3KPUA 4IDAA 3AKEA 3PXBA 1J1ZA 2KB0A 3E6AA 3QV1A 3QXSA 1IVYA 4HLUC 4OYHA 5I7WA 3G9TA 3KTOA 3RTCA 4RL4A 5EWMB 1BWPA 1DMSA 1EE9A 1F2TB 1T2NA 2O2GA 1YQ9A 2ZT5A 4LMPA 4D4MA 5DNEA 3SMQA 1H5QA 4BNZA 1EESA 4WKGA 3RM3A 5BN4B 2FE1A 4ETIA 2JFVA 2X86A 4IMRA 3SDZA 1O94D 5CPFA 3F4BA 1DIOB 3D2CA 1NQWA 1CNEA 2BHSA 3H0KA 1ONOA 3LWDA 3ND5A 3UK0A 2PUHA 3EDQA 2V65A 3ZGVA 4FIZA 4L4ZA 4HEQA 1KDYA 1NE2A 2EKPA 4IWNA 3FDJA 1T9AA 2W2VA 3OI7A 2O0JA 3RSLA 4DSZA 3IV7A 1IK6A 3RADC 1X1DA 1G20B 3NP9A 1LFDB 3C7CB 4I19A 2GHQA 3I30X 1OAKA 4W1RA 1JKJA 1JDTA 3GFFA 1QC5A 1NU6A 3AF2A 4QRHA 3HO6A 3HYLA 3VPGA 2E82A 3JQ9C 1IHPA 1GPUA 2BFEA 2YHSA 1HEYA 3PNYA 3UVEA 2A1UA 2Q29A 1ODCA 1ZOSA 4XIJA 1DU4A 2BMVA 4H77A 1XTUA 3L6UA 1CZLA 3ONNA 4INJA 1A1SA 2QX4A 1C41A 3FNFA 4X1YA 3SIXA 4I3GA 5FR1A 1AK9A 3K0FA 3TLJA 1N77A 3DLHA 3ILVA 2XZOA 4DG5A 2YZ2A 5AM1A 3INRA 5KYTA 1M2OA 2AN1A 4O29A 2LWIA 5HUJA 4NDNE 2QQEA 1SJ9A 2V9ZA 2XGGA 5DMHA 3AVVA 3A4MA 2A94A 4JSRA 4OIMA 5BSTA 3WLIA 2HD4A 3WL5A 1DQPA 1CY7A 4LHVA 3EEOA 4ZT6A 3NMUF 2RHOA 4TT3D 1PV1A 2ODEA 2PJRA 3FPAA 2UZ4A 4OA5A 2PL5A 3CISA 2O50A 4DHWA 3KNZA 2OORC 3Q7RA 4FEEA 4G9EA 4Q6BA 3RV3A 4YMVA 4WCVA 5T4FA 1L7OA 3IR5A 5JWOA 3NVMB 5SYNA 3R9XB 1UK8A 4BLUA 5HKKA 3PKJA 1GTRA 4L4XA 1K6IA 1QGUB 1HETA 2WP8J 1QOPB 2J1LA 3ECCA 3ENZA 2AEFA 3GP5A 4FINA 1OZ0A 2PGXA 1NX6A 2VRCD 2X0JA 4YEDA 5DOZA 2V0CA 2DUMA 2Q5FA 1ZCZA 3BD8A 4GOXA 4OQXA 3NV9A 3U80A 3GL9A 4HHEA 4LHXA 2X9GA 3RUHA 2X5KO 4M8SA 2Q1YA 3VOSA 2GPBA 3EG5A 4RV4A 1KYIA 4WESB 4JBHA 2IHUA 3D8HA 5AESA 3WICA 2NU9B 1LWNA 4I36A 1OX5A 1HDYA 2VYVD 4NZOA 5JW6A 3H4VA 4KWHA 1ZSNA 3FWZA 4Q4CA 1PVVA 5FL3A 4ARCA 4ZVLA 5CMLA 1Y6ZA 2DLDA 2P1ZA 2O7SA 2WMYA 2YN2A 3P1JA 3DMDA 1SVSA 3LBHA 4IOMA 2ZTVA 1NZFA 1XBTA 1TAQA 2ADFA 4I5EA 4RL6A 4MMXB 1KJYA 2AOWA 2WIFA 1RZUA 2H1IA 1XCBA 2ZW9A 4MUHA 2IK8A 1XMVA 3EXIA 3PWTA 2YICA 4G36A 3GJ8A 1WM1A 2ZUTA 4CCWA 1NU8A 4ENTA 3SXPA 3MMSA 3QUSA 3LC0A 3TNFA 2RJNA 2ZBUA 3IMCA 4LRSB 1CUSA 1KL7A 4UAVA 4MEJA 5HTKA 5C80A 1YASA 4W5NA 1E7MA 3OHSX 3LFUA 5BNTA 1Z07A 4YMGA 3GUVA 3WK6A 5EC8A 5TNXA 3ZHXA 4WEOA 4AJ4A 2O8DB 2P5YA 3F3KA 3P32A 4B34A 5HXAA 3E5MA 1KZ7B 1EFVA 1E1QA 2PVPA 3AUUA 1Y4ZA 3C98A 4BQPA 3P52A 1KDZA 1J22A 3II6X 3V2UA 2J59A 2O7RA 4U9UA 4F2GA 4NNJA 3DQZA 3UJHA 4TSKA 3GC6A 1O5OA 4FN4A 3CQ9A 1J5XA 1ZJZA 3STVA 2QTRA 1XCPA 3S1AB 3OQVA 4ALKA 3SPXA 2J3DA 2DFPA 4P80A 5KVAA 1SO8A 1W29A 2C29D 1GDHA 2YXNA 1OZAA 3U62A 4BFSA 3CKKA 1NR7A 1T9BA 3EASA 1GZ4A 4Y9TA 1N6OA 4K3UA 5HQJA 1DOZA 2W2KA 5AJVB 2QENA 1S89A 3LPMA 1VFPA 2VP4A 1X1AA 3FBTA 2GF0A 4ZP1A 1HORA 4G8DA 3VDMA 4PC1A 3OHMA 3RKRA 1K9SA 1NNI1 1NZJA 4M76B 4O33A 1P0IA 3W6NA 3ZY2A 5KPDA 2ST1A 1DUSA 3CX6A 4HB3A 5F1OA 2GXAA 3G3EA 2CXRA 3UZUA 1F17A 2PN1A 2X9LA 5CH8A 4BEBA 3BB4A 2YZGA 1G8MA 4YS6A 3S2ZA 2BT4A 2ZSDA 4EKIA 3BXHA 1Z3IX 2XYVA 3IQDB 5SZIA 3OPMA 1UJ6A 4E70A 1P60A 3KEOA 1JQJC 3RSSA 2P2SA 2Z6VA 1G8AA 1Z63A 1GKYA 2R86A 5AQ1A 4OK6A 1AUPA 1L5LA 2M6LA 5JD4A 4N5IX 3N05A 1L5GB 1QMGA 1RAIA 1FVXA 5ALHA 1VHLA 5U4QA 3VHXB 3HZZA 1KSGA 1DC7A 1P4GA 1X0VA 1BXKA 3B6MA 3GEHA 1NMYA 4R5MA 5TMDA 3RIMA 4NULA 3GQBA 5A4DA 3KTFA 3CVXA 1SUCA 3H42B 4NS4A 3KKNA 2GUWA 1ADBA 1R4AA 1E2LA 2C2XA 3LDAA 4G4JA 5J59A 1T0UA 1RYYA 3ZKWB 1ZN8A 1TVEA 2R87A 1SVKA 3BORA 3MRVA 3LCJA 4UHFA 4UM8B 1IJKA 4DDMA 2ZPUA 5I45A 1V5GA 1ZIOA 3CNQS 3N8HA 3OIWA 2UVPA 1PNVA 5F7XA 2HM7A 3HDJA 4X85A 4WL0A 1BVRA 3C5CA 1KFJB 3ROZA 1BJRE 4MXDA 2SCUA 5KNCA 2Q1XA 2C1XA 1F0KA 2RGBA 4ZVVA 2W6ID 1PI3A 2QUKA 2VTKA 4LOIA 1R8JA 3H5WA 4TGLA 5BMVA 3JASA 2Y1GA 2FMTA 3HKBB 3EWAA 3GUHA 3IQIX 3DHVA 3AJRA 2HZ7A 4C7OA 3L40A 4QTYA 3OLYA 2P2DA 3IUBA 3ETDA 5IM5A 1XAIA 1K8XB 3I6YA 2QRMA 3AH8A 1D2MA 4CMHA 2I65A 4YJGA 4W1PA 1Q0LA 2MMGA 1WMFA 2XA2A 3B38A 3G1TA 3M5CA 5WRFA 1CEQA 3LY7A 2PWPA 5FV4A 3UCFA 2ACEA 1CD5A 3IURA 3QMMA 1JYFA 1QDLB 3F1KA 2POCA 1CQPA 1TK9A 1HEIA 3ACBA 2G07A 3AIKA 3BD6A 4BO8A 5DYGA 5ALRA 1Y8RB 2A78A 4F5YA 1VYTA 3UUEA 1KI2A 2YHBA 3Q0TA 3S44A 1SHUX 2BGTA 3WBJA 2CDNA 4X63A 1Y9DA 4RMGA 2QUIA 1B15A 2OCBA 2VSXA 3E1GA 3E8XA 4FYPA 5SYAA 1A8SA 4G8BA 4PZCA 3K05A 2W0MA 3FMVA 1EFAA 1K8ZB 3CRNA 3UJPA 2ONZA 1FTNA 1XCJA 2JFBA 4D81A 3SZOA 2WU3A 2X5XA 1NF9A 4YJ2B 3ILXA 1TW3A 4IH1A 1SQSA 3H0EA 4D3ZA 1DXOA 1UZUA 2R1ZA 1GNQA 5JD6A 1AQYA 2NO5A 3IULA 5ARCA 1EK6A 3IMFA 5CW1A 3I01M 5JNWA 4KFSA 3ZV7A 1A98A 4LYJA 1NSTA 1HTTA 1ULSA 2ZANA 2P6OA 1Q57A 4UKDA 5EXDA 5DNUA 5KQSA 4PVCA 1D8TA 1QLJA 1YI0A 3EVGA 3FCAA 3HPRA 5F5NA 2EYUA 1KTIA 4CMEA 3F5SA 1QAQA 5KX5A 1E8DA 3QLJA 3JCZA 3I32A 4EA6A 4ZOBA 5AMXA 2IDKA 3BWBA 1XCGB 4JI4B 1ENZA 3Q9LA 1WKCA 2EBFX 4BNFA 2VSNA 5IYZF 3O6VA 4OI1A 1ISRA 5DSTA 4MA5A 1A5BB 3OMLA 5UKDA 4FYYA 1S9HA 1XJ0A 4OLBA 2W2LD 1KAHA 1M7GA 2XYRA 4D0SA 5CVJA 2DBRA 2CV2A 3IHTA 3OT1B 3SOZA 2QTGA 3TZKA 1A8PA 3G17A 1N78A 1YZ3A 4CV2A 2Q62A 1XZDA 3MMNA 3WNVA 2IPAB 2P2YA 2PLWA 2ZSKA 2RSLA 3I2YX 3GLHB 4Q7QA 5T67A 3WFZA 3OCCA 4RZHA 2IYSA 3UJ9A 5IFLA 2IP4A 2WICA 1LLQA 2QAJA 3KJHA 4OH7A 1GGFA 2G0NA 5DYWA 3RPEA 2GJ8A 3ESAA 3BRQA 4RZQA 1UAYA 1T29A 4X95A 1DE0A 2OFPA 4XLTA 3LUFA 1F9AA 3BG5A 2AN5A 3PLNA 4CTJA 3VSBA 4LZLA 1W48A 1ZK1A 2Y1KA 3EZGA 4UXJA 5L51A 4H1UA 2ZUDA 3AT1A 2DWUA 3ZDFA 2J3MA 3ONVA 3DCNA 4XARA 3TSOA 2XA9A 3UG7A 3ZV3A 1KJZA 1OAOA 2W2QA 4MKXA 4ZT4A 3THRA 3DE2X 4XDGA 1U2DA 3D6HA 5C0OE 4DG8A 1ATIA 1U1GA 2PJUA 1M8KA 2GBPA 4M1QA 2QNRA 1YRQA 1EAMA 1QO0D 1V37A 2NZWA 2Q4OA 3Q15C 4MMZB 1QIEA 3T7JA 1MO6A 4Q37A 1SELA 5K4GA 2N9UA 1DJMA 5BVHA 2KX7A 3GJXC 3H9JA 4TQAA 1EK0A 1GCOA 1KFBB 1NM5C 3D3NA 4RK7A 5TJ9A 3BILA 1RDFA 4EMUA 1LFAA 5DP2A 5BUQA 1ZH0A 1TVKA 1KWKA 1N5RA 1MP0A 5F52A 3KFVA 3MF4A 3OZXA 5L3VA 3U5TA 1DFGA 1F3OA 3FBGA 1V41E 1PEYA 4Q7KA 3SS8A 3V8BA 4LZAA 5FWAA 3KR1A 4MVWA 2EBWA 2YFKA 4PLVA 2CD7A 1MIOB 3P5SA 4XJXA 4TXMA 3DTNA 4N39A 1ZQ1A 1PS8A 1XALA 4GKBA 3HLTA 4GPIB 2XHZA 3KD3A 1DC6A 1YGYA 5ILGA 5DRTA 3WMGA 5KREA 4FWTA 1QU2A 1IOZA 1Z6YA 1UM9B 3D3EA 4L1KA 1A8IA 5JMWA 1JBEA 1OXUA 1UUFA 2HADA 5EJEA 4KR7A 3D5TA 2H08A 1OTYA 4L6AA 4OXYA 1Y1RA 5FUVA 1XZIA 3LY9A 2EKQA 5IJXA 4EY6A 4YAOA 3ZIAA 3HCRA 1FNMA 3T61A 1ODIA 1KY3A 2HO5A 3NM6B 4XWWA 2KQUA 2FY8A 4AJ1A 2LD4A 2RHWA 2XSZA 3OCZA 3EVZA 1MX9A 3QVXA 4MS3A 4WZBE 5C52B 4IX1A 4N7JA 2AD1A 3AONB 3JATA 4QVIA 1N3IA 1Z5VA 5EZYA 5G40A 5F9FA 2P9TA 3RB8A 1ESEA 1COWD 3QMVA 3HN6A 4F4DA 5L9AA 2DHCA 3Q3EA 2NU8A 4Q12A 3PTLA 3VR2A 1E2DA 1JLSA 3M6AA 3D8BA 2MIIA 3RIEA 3RYFA 2JDIA 1X19A 4A7PA 4L8VA 1I14A 4R2HA 3MJEA 3ZW7A 2VDMB 3KAQA 5JSFA 1S2NA 5HE8A 4BASA 5BNIA 4KBYA 2JCXA 4EG6A 5LQMA 5KOYA 1SHTX 4RVDA 4LX8A 2VP2A 1RJ9B 4Y6LA 3UGJA 3AJEA 1U0FA 3OQIB 3LAWA 5JAZA 3RJZA 1WUHS 4YP9A 5A5GA 1M6WA 1P62B 4NYIR 1BGXT 3DD5A 1DQYA 3WHIA 3ZJVA 2X8JA 3UUWA 3JTMA 3IRUA 5E95A 4D57A 1RNLA 3BGVA 1A7KA 4OGGA 4X3PA 1XTRA 5IT0A 4E30A 3ZBTA 1JA1A 4A5OA 5D01A 4B9EA 4RPCA 3Q9UA 4V3BA 1RKVA 1N2IA 3TOSA 4B44A 2GOYA 2XCLA 3WIVA 3SHOA 3VPSA 4RULA 1KI8A 3L0PA 4AN4A 3FFXA 5EJ5A 4TYYA 1Z13A 1BA2A 4V02A 2AMLA 2C84A 1F9EA 1SUAA 1EVLA 1WPXA 3BCHA 1O0BA 3D7NA 5FH9A 3F7NA 2DE0X 5LZ5A 1F8UA 3ZZNA 3DL2A 2BFDA 1OREA 1QFMA 3EMKA 3RTEA 3THSA 5H9WA 3MNFA 621PA 2I6QA 3V7NA 4CG2A 4HNUA 4Z9BA 4MKZA 1P5RA 1J70A 3RU9A 4ILEA 3DBHB 1FMLA 5CLIA 3VZQA 1EA7A 1GPWB 4C0LA 4DR6B 3DAHA 1RWNA 4UHJA 5FL7A 1EVKA 2AN9A 2GD1O 1EUCB 3H17A 4KQEA 1AX9A 4MYCA 4CF5A 4F21A 4GI7A 3WMXA 2P9FA 1K9VF 1ZNZA 2FETA 3PF9A 4J0KA 3UV6A 4EF4A 2F62A 2NPIA 4XWGA 4E22A 3MWGA 1T5BA 1YS2X 4AXBA 1ZUNA 4J9UE 1O0SA 5JXJA 2XVZA 3B7WA 1OXSC 3OPYB 2B61A 4TKZA 3HXQA 3LPLA 3N2EA 4UJ3A 2XVYA 3FJOA 3DNPA 3M6FA 1WUTA 4G2NA 5DWVA 2ZROA 2R6AA 3DQQA 4UD2A 3D6MA 1VBFA 2H17A 3GN2A 4FDUA 4I4IA 4JLOA 5BN4A 5BUSA 4L16A 2WWGA 1X7YB 3ZWQA 2AMJA 1S2DA 4HN9A 3VPXA 2VDWB 2I1QA 3W3AH 3CN7A 4O2RA 4WA8A 5BN5B 2X2FA 2Q41A 4OI2A 4F93B 2GB4A 1WB9A 3NUGA 3L0SA 1JB9A 1GO2A 2CXQA 1RPAA 1GLVA 3ZTTA 2QU7A 1E3JA 1G20A 4I1YA 2EZ8A 3A6FA 3KBBA 1AXEA 1NVWQ 2A9FA 4KR0A 5H5JA 3U81A 1U0HC 3IL2A 1BWRA 2TRSB 1M0EA 1N7IA 1F14A 2XZTA 4NYIQ 1MABB 2IIBA 2D13A 1D7AA 2R6JA 1T8WA 2I67A 2CNOA 2F9FA 2QWXA 3MSCA 4GL4A 1LLFA 1IZ8A 1X7XB 2IXAA 3DV9A 2YYAA 3HN7A 3HZRA 4ZV9A 2HLDD 3RKUA 3SMVA 4JB0A 4M8IA 5BT9A 1KKMA 4UBKA 3FPJA 1R5NA 3TSYA 3X2FA 4D8XA 4GKVA 2ZAGA 2JCBA 1C9YA 4KPFC 2GJSA 2B7LA 3STHA 1KI3A 3ET5A 4LY3A 1XEAA 2Z95A 1IHDA 2ZUSA 1GRRA 1YB7A 4LKOA 5H3HA 3SXUB 1ZIDA 2I9PA 4JVOA 3VUEA 2ECFA 3NHBA 1M2EA 4RMJA 4PYJA 1EHIA 2ZCUA 1KERA 2IFTA 3P26A 1OAAA 3NX4A 2D7JA 3OEHD 4GI1A 3VYWA 1QQAA 3IAAA 3QE0A 5LQNA 2HY7A 5GV8A 1NOJA 3HRKA 1DGQA 4BE7B 2GN4A 1LPPA 1MAWA 2OCGA 3LSTA 3PXCX 3T4EA 1I10A 3R2JA 1NASA 3FLAA 3L06A 3KKMA 1JNYA 1E79A 3A4YA 1H2YA 3NPAA 3DEIA 1E0JA 3D5EA 4JYMA 3R9XA 1VMAA 1XVIA 5AR1A 2VJDA 3QU5A 3JVUA 1LRKA 1LVHA 2K6GA 1OYWA 3OE7D 5EMJA 1VGRA 1QGUA 3GLGE 3RUAA 1HSOA 2C3PA 1L4NA 3B3FA 3VR1A 4YRKA 1RLJA 2AR7A 3P94A 1BFUA 4S1TA 4GL2A 4E07A 1XEWY 4NBTA 3SHWA 1O1YA 2XQGA 3B82A 3LXUX 4KAXA 3RC2A 5K8CA 2ZR0A 4N4AA 4JQOA 2GEUA 2ZUCA 1CF2O 1MVLA 3BJZA 1MO5A 1OFVA 4QTUB 2ZI4A 4WESA 1J0BA 2HYDA 3A9UA 1K7EB 4O5AA 3FTFA 4Y8VA 1E4EB 2FE4A 2NU9A 1NRIA 3LBIA 4CLOB 5LKAA 4ZCSA 5LP1A 1LBQA 1CEEA 4GRDA 3QEBZ 1UXJA 2NYVA 4Q19A 2DR2A 1QUEA 4GWLA 4B3JA 2XITA 1Y3AA 1SD2A 2M2IA 4J2HA 3A31A 3G13A 1TFUA 1VCIA 1BFDA 1OZFA 4E5SA 5C5EA 1PZFA 1QANA 5G0UA 5AW9A 4EJ0A 1FRVA 4OQNA 3TZCA 1Y5RA 4EPVA 4KFUA 4B5LA 4D6XA 3B8EA 4JJAA 1HO3A 5B55A 3TFWA 4R1MA 5A9TA 4FMBB 2XF8A 4TKUB 2IHTA 2Q4EA 4CL3A 4DMHA 1S8FA 1SRQA 5T64A 5JSYA 3PLRA 1XZHA 1Z5OA 1ZONA 2IUSA 2YV4A 3GCXA 1BN6A 4QYTA 5BWCA 5G0SA 3A3PA 4ZO7A 5LCXA 2ASEA 1GXSB 1WCIB 3CEPB 1NWCA 3QX8A 4BEVA 1V9SA 4NOJA 4F1KA 1A9YA 1AQUA 3LKVA 4L4UA 5C9ZA 1DIAA 4KWIA 1L7AA 1ND6A 3IA7A 4JROA 4MQ4A 5JEDA 2F3PA 4FLMA 2BFMA 1X74A 5AUOB 4ZDJA 5CH5A 4XYLA 3IJEB 1D1TA 2QAGB 2A57A 2PQ6A 3LF2A 1SXGA 3S1AA 1P1CA 4RVCA 3BF8A 1ZCAA 2B4RO 3QF7A 1RMYA 3H5AA 2QGNA 2YOFA 5EP3A 1E3IA 1OTXA 3EAGA 1G8FA 2V6IA 3BJEA 4K28A 4PLZA 1UKYA 2Y1EA 5IMBA 1WQ1R 1CY1A 2P9JA 4XFDA 3JYHA 1FYXA 4HXEB 4CL8A 3LCUA 5MN5A 4KFRA 4YR9A 4HRVA 2ZXFA 3BSYA 3BRWD 4YCAA 3F9IA 5IAKA 3L4SO 2J9ZB 4B3RB 1NSYA 3JZIA 3OY7A 4XM2A 1Z12A 3DOOA 3C6YA 1AG9A 1VJCA 3CYFA 2H4FA 2ECKA 2V6MA 2WNSA 3OE4A 5C5DA 3FVWA 2C3MA 1B6TA 1FE8A 2X7XA 5SY9A 2HWUA 4CHTA 3D8SA 1AE1A 3O9MA 4CRWB 2BM8A 1M2GA 2D59A 3SZRA 1P72A 2IJGX 1Y5IA 4CPDA 2ZU0C 2JJ2D 2A6PA 1KSHA 1SVNA 1Z5NA 3LQFA 5A0TA 3ESYA 2PR2A 3OLCX 5EPUA 3AI1A 1U1EA 2WYWA 4M6WA 2WF5A 2IYAA 4C5CA 4D56A 3WISA 2FI1A 2DKFA 1QQBA 2C4HA 5C8DA 4FYVA 1IB6A 2CVZA 5GMOA 2ZULA 2BGRA 2OC9A 2Q1WA 4AROA 1DIHA 2C94A 3O4VA 1PD0A 3DPSA 3ZKWA 4JJ8A 4X6XA 4KV7A 3ROGA 1GRNA 5HGJA 4Z9YA 3JD4A 3M6UA 4OU4A 2DZDA 3MTBA 2XCIA 3R5JA 3WA7A 2YOGA 2BV3A 2P4SA 3D6VA 1G66A 3AM5A 1DINA 1TIBA 3SX4A 2VDVE 4ZV4A 5KDOA 3HKDB 1RM0A 1EXWA 1UPAA 4E5VA 1IK4A 2XQVA 1TYZA 3HKBA 1CVRA 2I0FA 3I5AA 3EA5A 5CURA 2NSYA 4E14A 1XA0A 2HLHA 4JLSA 1D6SA 3BL8A 4I4CA 1OV4A 5CFLA 3G0BA 2XCRB 4OQQA 4PTYA 3Q3GE 2EFHB 1FTQA 1YO6A 1UPBA 2YRXA 2HQOA 4F06A 4MV0A 5PGMA 1UINA 3GUZA 3WO1A 1GUFA 3K0CC 3PQ2A 4Y6QA 3PFHA 4F9GA 5LU9A 3K9CA 1ADFA 2PRYA 4J7CA 4YCLA 1Y5NA 1U9YA 1E99A 2XUDA 3QUTA 1XAJA 4EY4A 2ZYAA 1CG6A 1UM8A 1Y8RA 2B25A 4YLEA 4MUIA 3C43A 3ETEA 4WOCA 3T3PB 2FA9A 3LC2O 4RH0A 3ZWMA 4EUEA 1QAMA 4LOLA 2IHYA 4JLNA 4Z7OB 2NZXA 2Z3VA 2PKRA 2WFZA 3K1JA 1G5PA 3OECA 2JBWA 4Q5IA 1XFAA 3A3YA 4KO3S 2G0TA 4QUAA 3WJ7A 4MHTA 3TR6A 1U2RA 3RRFA 1O2DA 3FRHA 2XE6A 3I83A 3L7AA 4HX5A 3KSMA 3BBLA 2Z2IA 2BFPA 1CHDA 4JLBA 1JUDA 3G1WA 1Q0UA 4GR9A 4CNBA 4MPPA 1QIHA 2XODA 5LU8A 3MJDA 4IX9A 2C2ZA 5B64A 1DJLA 1MEOA 2VJLA 4QVGA 1BNCA 4BQEA 3BRSA 2DHQA 3ETGA 3G02A 4F97A 2XLBA 1IUNA 2IQIA 4MLPA 1SCNE 3L0CA 3MWKA 4E46A 1ABEA 1EB9A 1U02A 3I2GA 3PQ7A 1YB2A 2I8CA 4U7GA 1H8EA 2RK4A 4DV7B 5ALWA 3NWEA 3JVEA 3CUKA 2XW6A 3TW4A 2WD9A 4MICA 1VIDA 2D74A 1XZAA 3ZG6A 1OLUB 1R10A 2C2GA 2ZSIA 4EB6B 4F3RA 2DR0A 2I5PO 2Q2NA 1EGMB 2FW1A 4X8HA 3WMWA 4TYNA 4OK3A 4UUNA 1T3ZA 1CC1S 1K0FA 4NJEA 2NZJA 1K68A 1EE1A 2OV1A 4A8JB 3OT1A 2YMQA 4URHA 4EARA 2BY4A 5HSGA 5FNZA 3BQ9A 1AHPA 3KXLA 3V1MA 4TL6A 1M0SA 5HZMA 4NCAA 3EZYA 121PA 1B8NA 2D5IA 4R4JA 1EVZA 3D4IA 3O0DA 2O3JA 1JQAA 2YOHA 4KSCA 3GLHA 1P1FA 1PWZA 2HRBA 2GLXA 3KOUA 4FNMA 3ZW8A 4EKEA 4R83A 3RFVA 1KQ3A 3H2ZA 3U13A 1IL0A 3VYTB 2FW8A 1X7DA 4FE3A 3SFVA 3BMQB 3P0JA 4YP5A 1GGMA 5BWBA 5IVKA 1YIAA 3F6BX 3R3ZA 5EIBC 5JJIA 1F4PA 1YC2A 2O2ZA 1V7CA 1RKQA 2PU5A 4G5OA 2CKMA 2NQTA 5IF3A 3C1OA 2W2PA 3GYGA 2AC4A 2BEWB 1RI1A 5FB3A 4OMCA 1X2EA 5GZ3A 2AF4C 1MVOA 1IY2A 2R68A 6PFKA 1NQVA 4UEWA 2WWHA 5CT6A 4E5DA 4LSMA 5ADUS 3IQZA 4XCVA 3F74A 3OQ1A 3OJOA 3PTZA 1W0JD 5EG5A 1PFYA 2ZE6A 3HEBA 2YJGA 1OC2A 4HPJB 3A1WA 4L9AA 5KWVA 3PX3A 1JJ7A 2XEDA 1NBMA 3COJA 1J42A 2VZEA 1Y63A 4IGFA 4PFQA 3DCYA 2QRGA 3I4LA 1SCQA 4L95C 1AB5A 2Y0DA 1XN4A 3WFIA 5HYVA 2NXNA 1DKRA 3BVPA 1FP2A 4G1MB 5LNK1 3NAMA 1GPDG 1MIOA 1PT5A 1W6UA 3UTDA 2DVMA 2EZ4A 4BX9A 3EIHA 1UM9A 4O63O 5GM1A 2O5EA 1W34A 2QAIA 4J91A 3ZV6A 2QXUA 1R9NA 1TYDE 1PW5A 2WPDA 4TL9A 4M0EA 5K2MA 2RGWA 2ZJZA 4H0NA 2Q1TA 1PJSA 5B3JA 1FLNA 3ZE2B 5IZCA 3JAMA 1ULTA 1E1CB 2N42A 1NF3A 3QVGA 4A2WA 4YAGA 3WGVA 1DDOA 2CMKA 5GVSA 5F98A 3ND8A 2NXWA 1MOQA 1OPXA 4DV5B 3QH4A 3VNQA 4UMFA 3WLHA 3FHTA 1EJ0A 1TQ4A 3KCNA 3HCEA 1PR4A 1M1XB 2FLVA 4ND1A 4PRKA 1VSUA 5DNVA 2C8VA 3IQEA 1KVTA 3A2LA 2AXNA 2VXOA 4EBFA 2J3QA 3ESXA 3QA3E 4NBVA 4XSVA 2KMLA 3OTWA 5ESWA 3TR0A 3B5IA 3V5NA 4KLNA 1GLGA 1G21E 3DMGA 3FPKA 1OQAA 4INPA 5JANA 4CKZA 3AJ9A 1A9RA 3OQIA 2QMZA 4DDTA 1YR6A 3GRUA 4GWKA 3TTTA 3ROKA 3HA3A 5FPPA 3R0QA 2I33A 2CXSA 2JGRA 2HNAA 3GEBA 4S3MA 4BX2A 2QRPA 3OJCA 3WGGA 3AB8A 4DLXA 4OJQA 5HQ3B 1GPNA 4M60A 1IJFA 1JECA 3IVXA 4IQ0A 3K1ZA 4UVGA 2XYPA 5GGYA 3TXYA 3U16A 5BPFA 3ILYA 3AGPA 1K7SN 2C4WA 4HVTA 1NUTA 2J6IA 1HDRA 4J3NA 1KZ1A 1XRPA 2W0SA 3OTGA 3JZFA 3W3AA 1YB5A 2GTPA 2OQ2A 4BVAA 3MOGA 1XN1A 3L46A 5JYCA 3TPCA 2WM3A 2PEYA 1AK1A 3QRWA 4N7RA 3RC7A 4DVJA 4MCHA 3H9GA 3H2YA 2FZLA 2L69A 1KAQA 1P1IA 4J3JA 1NBOA 3KQSA 3QF4B 3V8RA 3FNQA 3EQ9A 3QQ5A 4OLHA 2NTYC 2QY6A 5T3UA 3MWFA 3DBHA 4D4LA 5KC9A 1KK0A 5KNBD 2DQYA 4JT4A 4Y3UA 3JQ8A 2XT9A 4BAUA 4URUR 3S68A 1ZJ4A 1MENA 1VCHA 2MDTA 1OVMA 2OV3A 3TD6A 3FGPA 1TEVA 2MCFA 1G3MA 3O9ZA 4O4HB 4OEHA 3DZHA 3PI6A 4D2IA 4CETA 4PW0A 3ONDA 1XZNA 4TTQA 1KI4A 2CDRA 5G4KB 1KAOA 2D0IA 1ICIA 4LF4B 3CT4A 4D25A 4AVYA 4PQGA 3HO1A 3OPYA 3DZDA 4E5KA 1CRPA 2ZR9A 1LBSA 3QYAA 2JARA 3N2IA 4L9SA 4MSUA 1SKBA 4JOCA 4NY1A 1JW9B 2NOAA 1QCCA 1PFVA 2WJPA 2YS6A 2PS3A 1E3QA 2RGNA 3OZVA 3NORA 4AJNA 2UXDB 1WJGA 1X7YA 2HU7A 3R9KA 2EKLA 1A9ZA 1A9TA 3KALA 4JYZA 1UBSB 3PE4A 4Q1CA 3JQDA 3U6KA 3TIXB 1R5BA 3RABA 4E1BA 5CA1F 5BN5A 4BUZA 3URMA 1E0AA 1T0JB 2FSHA 4QDKA 5AHWA 4XVCA 3OLWA 3C4JA 4CKEB 5CNIA 2R8PA 1U2GC 3HB5X 1Z4JA 1RIIA 1UBOS 2HRRA 3A3OA 4O5OA 1LTHR 3LCMA 1LX6A 2EZTA 4KXMA 5T3YA 3VV2A 2OAEA 4BLRA 1VE1A 2QUHA 3OKCA 3VOBA 3ZCQA 2AFRA 3IS3A 5E8JA 4IJUA 1I51A 4QOFA 3VH2A 4ARIA 1YVRA 2BKXA 3WQRA 1JFRA 1AXGA 1SKYE 1CQJB 1JX6A 1I2CA 1X7XA 1D4FA 1GZHB 1QK5A 1QIFA 1UEXC 3LRPA 1FUYB 4FSHA 5F51A 1J99A 4YTEA 2OD2A 1R0LA 2PL3A 3RWOA 1GKIA 5FI0B 4G0PA 2WNHA 4WBXC 4FGKA 2B92A 3R7SA 4GT1A 2NV2B 5ER6A 1B14A 1RWMA 2NO6A 1RMQA 2VWPA 3SXUA 1D0SA 4AIIA 5JYEA 4LK2A 5G0VA 4J49A 4UVDA 4BP3A 1DRVA 2F64A 5TMEA 5I3CA 2YW2A 3CZ5A 1P4JA 1UBKS 4OGFA 3WR5A 2D00A 4GNRA 5LN1A 2XD4A 3NKLA 2A58A 4B0PA 2B0JA 2W71A 4R8VA 1M1YB 1KPHA 1S2IA 1VPDA 4FQ5A 2H31A 3E9EA 3Q3HA 4MUGA 2PY6A 3I9JA 1QH0A 2Z04A 1DAOA 3GVIA 3I9FA 4FP9A 3RNOA 4LUCA 1YGPA 2XUHA 2H57A 1MH1A 4JI0B 1N1GA 3BULA 2I91A 1I4TD 2GKOA 1XL1A 2QN6A 4JMLA 4LRXA 4IKPA 4EP1A 1MRNA 3I1FA 2DU8A 1XVVA 5EIHA 4ZI2A 1XLUA 2EGHA 3F47A 5JBIA 4JC4A 4AMVA 3R23A 2WG2A 2I54A 2MMCA 5JS6A 2BTEA 3FMFA 3QNUA 1QXSA 4JLAA 3FDXA 4LAFA 4G1VA 4DRXB 1OI3A 3SFZA 4CF4A 1YMUA 3DV2A 5F9HA 1IAQA 3WLMA 1HYGA 2JAQA 3OIDA 4UU7A 4HLCA 4MWEA 2MT9A 1WU8A 5EHQA 2VA9A 4BLTA 2H2FA 3OEEA 3GMDA 1EJBA 4HGQA 2X9NA 5KSYA 1IB0A 4YBZA 1NF2A 4XCXA 4NAUA 4FQ8A 3SOPA 2PBZA 3C4VA 4B6FA 4BKOA 5EGSA 4CLOA 1JL3A 2R66A 4V3CA 1P1HA 3HR7A 1ZMTA 4F86A 4CU2A 2N1MA 2OQVA 4D1YA 4NYMR 2XXJA 3GZNB 1U8ZA 2PYDA 3M3PA 2CDCA 3QSYA 4EUNA 4R9SA 2B9EA 1XA4A 3WB2A 4L74A 4EQ6A 3KLNA 5EEHA 2CXUA 4K2AA 4Y9DA 5E7MA 3C45A 2PX5A 1LI7A 2BMWA 4TKUA 5JCPA 3H8WA 3KZCA 1FFHA 3QZUA 3FSGA 1I30A 1V8FA 2HIMA 1Z39A 2V7EA 3DZCA 4ADSG 4ARBA 4DLNA 4OHMA 4A4DA 4EDHA 3S6JA 3WRYC 3AFHA 3HYNA 4B7AA 1KH3A 3PTAA 2FZCA 2L17A 2J9RA 1YJXA 3G6KA 4N54A 5E9AA 1ZRNA 4ZTUB 1GXSA 1I1HA 1WCIA 2PR7A 3QVWA 3OTQA 2J0EA 3BGIA 5F33A 1FQKA 1YUMA 1TPYA 1YE3A 2KJQA 2ORED 4FGZA 1FU8A 2HDOA 3IC5A 3T9FA 2AK2A 2QN3A 4IIHA 1BX1A 1UDWA 5CTAA 4CMCA 2HBYA 3FPHA 3JD1A 1PYGA 1RXYA 2ZXEA 3EUEA 2QLTA 3GEMA 4KAAA 5IKXA 1ZWKA 2XCTB 2Y92A 1E7RA 4YAWA 2QAGA 2DR3A 4YV7A 1NVKA 3TM4A 3K70C 2RG7A 3SIRA 2CBGA 5DZSA 5LLSA 4BCBA 1V1RB 1WD7A 7ADHA 1OFTA 1KNXA 1QONA 1YTLA 1J07A 3FDIA 3NHZA 4KIJA 1JJIA 4L7VA 3REFA 4BE4A 3I9KA 2WFMA 4DA8A 1QIMA 5KJ6A 2CLOB 1IY9A 5EERA 3ROXA 2WVHA 4HFJA 2OFWA 4EK9A 1OH5A 1KDTA 1CP2A 3EGCA 4TTPA 3BMNB 4M36A 1GL6A 1PS9A 3H16A 1ISIA 3OU6A 4C4YA 5LLTA 4CR7A 5LMCA 4OHZA 3SAJA 4FYHA 4GQBA 4U7TB 4V0LA 4WOJA 2VDKB 3V46A 4BKRA 2AHRA 1YCHA 3IERA 3WI7A 2ZOSA 4MWZA 1OXBB 2GNAA 4KQCA 4V0NA 4JASB 1PK9A 3HADA 1E2MA 4F91B 2H5LA 4NE9A 3LYLA 1XB2A 2NT4A 1QB7A 1R0KA 4HPWA 3FCCA 4F2HA 4LYGA 2EF0A 1K27A 1LDBA 2AEJA 4A0RA 4YP0A 1GVHA 1WXEA 1WXWA 2C00A 2NO9A 3H1FA 4OB6A 4A15A 4C2TA 5SZKB 1PGJA 1HMYA 3HRHA 3L9WA 1TNDA 1NI5A 3PVSA 4GPD1 2QG4A 5BNZA 3P2OA 4WKNA 4H15A 2ZBGA 2CJPA 1SBNE 2PG3A 2FEKA 1D7OA 1O94C 3JQAA 3PYMA 1WMBA 4KYTA 1TQDA 4ZANA 4L51A 1LLDA 1O6FA 4PAMA 4QJ5A 2SECE 1R9GA 2ECQA 2G77B 5T4EA 5I6DA 4IKEA 2RJ3A 1W59A 2OKGA 1Z7YA 3Q98A 3PNLA 3MRTA 1S0UA 2A5GA 1DTSA 1GNSA 1CK4A 1CQZA 1TI7A 2QUBA 2Y05A 4OHFA 5A71A 5THKA 3QFCA 4IXDA 4IJKA 5KPJA 2QP4A 4MAFA 1U1IA 1XNGA 2VJPA 3HKDA 3NBYC 4ZVNA 1TKBA 3O2QB 2A0WA 4TLDA 1UXIA 1JWBB 2DUUA 2EP8A 2R6FA 3H3FA 1H9BA 2FZKA 2GWRA 1RQ2A 2PQMA 2QRVB 1CNFA 1HE8B 1E6LA 2P9CA 2ZI6A 1ZK4A 3PD1A 1U0EA 3GVCA 4K86A 5DLQC 4OAQA 3Q1LA 5D1NA 4BIIA 1ZD9A 2HA2A 1QYIA 1ZO8A 1CUCA 4FWBA 4GOJA 3C8ZA 1ZEJA 4I5GA 5E9WA 4ZAWA 2CLCX 4B71A 4MJLA 1A5SB 4XR9A 4CIWA 2O8EB 1Q12A 3AHJA 1GRCA 2CLHB 3IAEA 2H2GA 1VIYA 3QWBA 3W77A 3L77A 3VM6A 3E3MA 4PX3A 4JK3A 4X45A 3Q4GA 2XOXA 4U2DA 3IIJA 4DNXA 5CFNA 3BERA 3BMXA 1YVPA 1Z6QA 1O95D 2WU4A 1BYUA 2Q0XA 1ISGA 2WPNA 2Y2VA 3AXSA 3L7MA 2QJRA 5ALPA 3EHEA 4BB5A 1LTKA 4F96A 2QVLA 4LJRA 1IN8A 4GLFA 1T4CB 1FLDA 2VTDA 4PQYA 3V8EA 2QTHA 3VNRA 3FOAA 3WHPA 2CDBA 4RS3A 1LPAB 4ZHQB 3QNWA 4TPKA 3LWNA 3MJSA 3ED1A 3J81k 3AIMA 2FWBA 4K9MA 1SWVA 4QELA 4IH9A 3ZX4A 4KMOA 3AZOA 1RWKA 4IDNA 4MGZR 3M6WA 2ZXUA 2EFEB 3MBIA 3FWNA 4KH0A 4W7HA 4H6XA 4AYXA 6NULA 1JU4A 4HUTA 1T5IA 1JG7A 4FKBA 3NHUA 4C4OA 3GWGA 3LT4A 5FTKA 2H4XA 3WIUA 3HSYA 2MHCA 4K2HA 2QTLA 2VDNB 1D4AA 2CL0X 3FTPA 4UE3S 4ZO4A 3BREA 4GD3Q 4HQLA 4UMEA 1I3MA 4AT1A 2XIQA 3ZVNA 5A2GA 3E7DA 3VVLA 2B5VA 1KBQA 1Z6XA 1BJTA 1OLUA 1U0RA 1V11B 4ENRA 3L6OO 4V38A 1QG4A 4J1SA 2H1HA 2P7HA 4QOJA 2YIDA 2ZS7A 4ZZ2A 1MGOA 3WRVA 4A8JA 4CMAA 1L4UA 1YCFA 3D0QA 2C7BA 4P4SB 5DTMA 3U7JA 4ZCLA 4JNCA 1JT9A 2IY9A 3ILHA 2ZJ7A 2QTWB 4TQGA 3JD3A 1N2OA 3V4FA 2ZRKA 1V47A 2Q8PA 2WYOA 5EJ8A 2CV0A 1YH3A 3L18A 1KYXA 3TG8A 4FYMA 3NB0A 3PC2A 5JQWA 1WHSB 4UM5A 1K6XA 2WSSA 5I48A 3SZMA 4QBTA 1QYXA 1XTPA 4PSUA 4F6RB 1DJQA 1XE3A 1E1RD 3NTOA 4QPCA 2C2BA 4GF5A 1YJ8A 2KHZA 3IOEA 1ZI9A 4CL2A 4Z1OA 2QM3A 4IR7A 3SE0A 4OI0A 1K8QA 4HSGA 2ZRNA 3HJAA 4N5DA 5B2FA 1FLVA 3DKRA 1ODFA 4IM7A 1X42A 1W93A 5JXHA 3HB4X 1KEUA 1C3VA 1N6PA 2FRXA 1KDRA 3UOGA 5AVYA 1RQ7A 2BEWA 1ZD2P 3BTSA 2HSZA 1RJEA 1W47A 3AFIA 4RA6A 2DPXA 4FBMA 5GJVC 3K5IA 5DM70 3WXBA 3ZD7A 1YR1A 1XRRA 2R97A 3IP6A 3QVVA 4LXYA 1ZJ5A 4CM5A 4DQ0A 1WR8A 3NV7A 4F5DA 4OP1A 3M2TA 4YRQA 3UAZA 3GY0A 4B6RA 1JKXA 3WKBA 1ECFA 1NJFA 1Y7LA 2YN0A 4JEHA 3KEQA 2JGMA 4TLAA 3V3KA 4BNKA 4MDFA 1W0CA 5JUWA 2MU1A 1J2RA 4K9KA 3VFDA 4BNTA 2OBXA 3ITEA 5TS2A 3LDGA 3E8MA 1OT3A 2C9OA 2VYNA 1MA0A 2R6CA 2OHIA 1E3LA 2VJCA 2FXVA 2Q3MA 3DE5X 4PSKA 4WUVA 4ZOLB 3OF5A 4WZ6A 2I7CA 5TLSA 1G3RA 2VYCA 2HRQA 3HMKA 2WTXA 3U39A 3DE4X 1NPYA 4V24A 1LI4A 3CIOA 2ZB2A 2CZCA 1NFQA 1QG2A 5CA0B 2GBLC 5LP6F 3DHWC 1PF7E 2A5FA 1T2VA 3OX2A 3CW9A 5DH9A 1OYOA 4F85A 3AHCA 3BHJA 4MJ7A 5HOEA 1TYAE 3PJDA 3NHMA 1PR9A 1WKBA 5BYBA 4FILA 4GVPA 1E1CA 2PX6A 3T8YA 1ST2A 2GM5A 3CLRC 4JL8A 4NDAA 1HDCA 3TFQA 3WYCA 1AXRA 5EKSA 1LVUA 3OJ0A 4WVFA 1NA5A 2H29A 1FC0A 1O6BA 3KLBA 5HVNA 4JJFA 1QIGA 3K72B 2ABWA 4TWZA 5KNCD 5IRCD 2QQFA 3DC2A 3FZNA 2WKPA 3FHJA 3FJYA 1E9SA 5CNJA 5KSPA 2JJQA 4DUZB 4BU1A 3THWB 3QPWA 2GN1A 2IODA 1QHHA 2J6CA 4Y0VA 2KLHA 2JA2A 5L6LB 1S3GA 4Z54A 5IUKC 1ECCA 4NQRA 4JDPA 2G1PA 1FNNA 2FMXA 2B4TO 1UWVA 4OHWA 3NETA 4TV9F 5E6SB 3V48A 3MGGA 1Z0ZA 2B36A 9GPBA 3KU4A 3QVMA 2ZIEA 3MC1A 4GZ3A 4Y2YA 4PYIA 4CG3A 3N87A 4QTZA 3EIUA 5A3VA 4D0GA 4DM3A 3JAKB 1MJFA 1YJQA 2G36A 4W5JA 1ZVMA 4MUBA 4Y9SA 5DYYA 1ICEA 5HQ3A 4LHZA 4NMLA 3EF3A 4B6EA 3LT5A 3CO0S 3ASUA 3WLSA 1O8CA 1U0LA 1F6BA 4NATA 1E63A 2BJHA 2I34A 5AW8A 3OX3A 4Z0NA 3NNSA 5FI1B 2JKZA 1YZFA 5BSUA 1JXMA 1YFKA 5TF0A 1WCV1 2QI9F 3NBQA 1YQUA 3CW2A 4LE0A 4BV2A 3UWPA 2CMGA 1Q7CA 1CUJA 1IH8A 1PKXA 1VGQA 2HBRA 2NU7B 2UUOA 3HBFA 1RVDA 2FSFA 4M8NE 5AVVA 3KSZO 3PFCA 5AHRA 4JUBA 4B48A 3BT7A 1FSPA 3K1TA 3FR8A 3OZEA 4RXMA 4C1NA 5JXWA 2GPNA 4BBJA 2AI3A 1CX9B 1WEHA 3GD5A 2BFCB 4J90A 2J5XA 5A1TA 3CONA 3PQEA 4GI2A 3IAXA 2ANCA 5GONF 3DL7A 1XA3A 1VRWA 3EEIA 1POXA 3QF4A 1LSOA 4BL5A 1OGJA 2Y1DA 3PE6A 4HH3C 5JI3E 2WIKA 3WGMA 1W73A 1YHYA 3FIJA 3OM1A 4DBVO 2F90A 2AG5A 3HUUA 1JLLB 5FHQA 1Z15A 3LPNA 2DUNA 1K08A 1DEHA 4AMZA 1A8UA 1E60A 5A7FA 2X8BA 4XIIA 4DFDA 4B3GA 4O4HA 2PRKA 3DZGA 4MIOA 4BQRA 5HNKA 4YFYA 1U8UA 1XXHB 2YRFA 3KYDB 1ENOA 3LIPA 5G4KA 2JGEA 4O4LB 3ZHBA 3OICA 3UAYA 5B36A 4BPBA 1TAUA 3SM9A 4LKRA 4PLFA 3IP3A 1BX0A 1WDMA 4Z9XA 3FDZB 1W5SA 3NATA 3QX9A 5I4CA 1VL8A 2C4TA 3H6GA 5BW8A 3PR2B 3F97A 1D2EA 4B8ZA 1TTTA 1YQXA 3GLQA 3G85A 3MOSA 5TB5A 3AO0B 3SC4A 3EFBA 4IDCA 3L7IA 5HF6A 2A5LA 2PTHA 2QZPA 4KYUA 5ERXA 4B7UA 4BLOA 2R8ZA 2WDZA 4H59A 1E92A 4J94A 3GR6A 2WHPA 3CRRA 1YBFA 3IAS1 4E6EA 4YRSA 2AK3A 4Q3NA 4D97A 3GJSA 4QU5A 3GFVA 3EUAA 3CR8A 4HYEA 1CZRA 3A4LA 4HC4A 3JQ7A 3EXAA 4N49A 3KM0A 4DLTA 5LXTF 4E13A 3VR3A 2QVXX 3RE1A 3ST7A 4PGMA 4N40A 1O54A 3CU5A 4ZJUA 1IXKA 2GJ4A 1DS6A 2KM1A 1MX1A 2NVBA 3CVOA 4LISA 5D3QA 1BU5A 2RHMA 1CQJA 4E2FA 5H16A 5BO5A 2WJ6A 5LUBA 4DSAA 4KLAA 4FZVA 5DM2A 5IVDA 2E55A 1DPFA 3JXEA 3TGLA 1P1RA 1YWGO 2GSDA 5ALMA 5E3JA 4BV9A 1EZZA 2QRQA 4MQ6A 4YQZA 1OLOA 2CYCA 2EYQA 1IM2A 4CM9A 4NHOA 3S2SA 4X64B 1X9IA 4WVLA 1QHYA 4YCJA 5B58C 1DC8A 1KF0A 2X2OA 1WBJB 3EDYA 2J9YB 3GFRA 1Q44A 1R5JA 2WE7A 3MWYW 1O9HA 1CS0B 1M1YA 4PN3A 3L5OA 1TEXA 3EOBI 4MP8A 1WP4A 2IZZA 5HK9A 2OEPA 1O03A 3AKYA 3ECSA 4KYVA 5DGCA 5H68A 1I9GA 4EAQA 1BMQA 3FCYA 1JDUA 1OLSA 5BXYA 3Q8LA 4D4KA 3A4IA 4LX0A 4O8ZA 2JAPA 5H3CA 3JQGB 1YJ5A 4GZ6A 2VP0A 5K51A 1A7UA 1FQOA 3B6IA 4FFWA 4YP6A 2ADOA 4ENVA 2FXIA 2C4NA 4Q9DA 2JRLA 3BE5A 4GQAA 4UC0A 3W5VA 4OAOA 3C16C 5A4FS 3WJ1A 3Q0EA 3RSCA 4DRXA 5BWOA 2HJSA 1I0LA 2W5UA 4NJMB 2PGOA 1X38A 2HRCA 3B3QA 1ZPDA 4GO1A 4JA0A 5J2UB 4P7KA 1CJTC 1TU4A 4ZV7A 1NDHA 4ZEVA 5ALLA 4A27A 2PEZA 3Q88A 1CJVC 2H3EA 1GG8A 3K2EA 3LPAA 4C0BA 4PGGA 3KQOA 2GZDA 4LWZA 2XOEA 1Q0RA 3ED5A 5FADA 1RCFA 3NHKA 4GX5A 5DN6A 4RD2A 1EEHA 2OLJA 1D03A 2PZLA 1L6IA 1CULC 1MU0A 1YZNA 2XH8A 1WZUA 3GZNA 1JMVA 4HBZA 2HFJA 4GOOD 4UATA 5BMVF 5EJ9A 4IFBA 4CWAA 4MV6A 2OVBA 3WC4A 3REOA 1Q1NA 3TRIA 1YIDA 2GPJA 3W5UA 1NQ5A 1A2OA 4OKNA 1X15A 3CVUA 1KYYA 1SCUB 2ETXA 4WK0B 1DFIA 3K2IA 4RH3A 4I4TB 1HDXA 3N2GB 2I55A 1SXJD 2E87A 3Q8WA 4OLFA 4RWEA 4WV3A 1SC3A 1Z7EA 4QPNA 5ESXA 1FRFS 5DTRA 1L5VA 3A9RA 4Y2JA 1BFKA 3V4RA 1MUUA 4UUMA 3VKWA 3NIGB 4DR4B 3PXEA 4QLOA 4EJ6A 2ZB3A 3L0YA 3K9WA 3EOAI 1X86B 5HDQA 3VZSA 5ELXA 2O23A 5FORA 3VC3A 4HQRA 1RLIA 1EX6A 4LI3X 5I8WA 5CK5A 4S0ZA 2GAAA 2JFZA 4HNQA 3GB9A 3JQEA 1JV2B 2ZRFA 3P2YA 4U2GA 1NATA 3DAPA 3WK8A 3V4ZA 3H8SA 2A7XA 4AZVA 4AY5A 3QKSB 2FW0A 2FZEA 3HKCB 1V1RA 2ATEA 4KDFA 4WCFB 3UGQA 1F38A 3WYDA 2OKCA 3AYZB 3HDTA 2Z98A 3OJLA 4AF6A 5JRZA 5M7EA 4Q0MA 2QUAA 2H11A 1XYYA 2HMYB 1CR6A 4TSFA 2CEAA 1H05A 1PL0A 3TAUA 4G09A 1HT0A 2O1SA 1NM5A 2HU8A 3IJ5A 5CEFA 1HFJA 1T6XA 2Z5FA 3BMNA 1LDGA 2BKVA 1UKBA 1MB2A 3EJ6A 3O4GA 4FDAA 4MGKR 4ABYA 3IQXA 1GPYA 2ZBEA 2IRWA 1EFKA 1KOLA 3JZMA 5CDSA 4I1RA 2CJYA 2ZE5A 1QM5A 3A6PC 1RAEA 3VMMA 4QXQA 4MWCA 3ITDA 1VJGA 4J03A 5H0IA 1KAGA 5ECWA 3CNBA 4M0PA 2UZ1B 2PUEA 1Q0ZA 2QE7A 5GIPE 3MGCA 4A36A 2B3DA 1I13A 4HMOA 1KEKA 1E5XA 3D1VA 4K7JA 3Q7IA 1P8JA 3CCCA 3AUYA 3HBNA 5ETJA 3HM9A 4BN4A 3RSQA 5IAOA 3A1NA 2OG1A 3ETNA 3HRIA 1EVIA 2WD8A 4PTZA 2ZIGA 3GLVA 5JY1A 4M7OA 1XYVA 2HTFA 2IELA 2ZU6A 5A04A 4NZ9A 1QSGA 4S1OA 4R81A 4Y9UA 1X92A 3VPAA 5LZ9A 2Y1LA 4O3FA 3CWQA 3E9CA 2RMKA 3PJEA 2R00C 3LDHA 2WINI 4FFOA 2CF5A 3COZA 5AIAA 5E4FA 5I7FA 2G4LA 1V7ZA 1HOTA 3HLYA 3QPUA 1PQYA 4O4IB 4KRYA 1ULAA 4P92A 3CRMA 2V96A 3PJFA 4C6TB 1ODTC 2FRDC 1E8NA 2F43B 2R11A 3PCRB 2OYRA 4DSNA 1TMOA 3PIRA 1B16A 4TMTA 4HX9A 5CM9C 1N57A 4DCNA 2WZDA 3R7DA 1A4IA 4NBSA 4BPRA 2QRVA 3VH3A 1VP3A 3CNLA 4F3CA 2KBFA 3OBBA 5EXEA 2VXBA 3PIIA 4GLBA 2YXEA 3RARA 2QD2A 4LC0A 2BGNA 1RZRA 3ZY5A 4BCCA 2GH1A 2YVAA 2BFAA 3IFSA 1A2BA 4OXKA 5SV2A 1HNXB 2ZCJA 1GA4A 1HKHA 2B2XA 3NNNA 3ZJ4A 2AMFA 5FLYA 1J0XO 1CUIA 1BQEA 1ZICA 1D4OA 1HYEA 2LKCA 4AJEA 1RR6A 2EW2A 1VPLA 4Y1RA 1ID8A 1PJTA 1AIPA 2O8EA 1F4VA 1YF3A 4QRDA 4YK7A 1EFHA 1KR5A 1FUEA 1NYRA 3PL5A 3DCIA 4RK6A 2QR3A 4LDZA 4YJHB 1JG6A 2HMTA 4ZGGA 2G63A 2W6CX 3FZYA 3CE9A 4JSYA 2R3SA 3V1YA 3NH6A 3NHWA 4Q3KA 4N7MA 4UARA 1KQNA 1OB2A 3IBYA 1TIPA 8ATCA 4Q9KA 1GD1O 1T4CA 4K1LA 1GZUA 1FVHA 3T9CA 5J1SB 2FG5A 3ADKA 5EJ4A 4Z4GA 4F4FA 4ZHQA 1Q1ZA 3R5FA 1XQ6A 3VZRA 1ZCFA 2G1AA 4AL4A 4BZPA 2UYQA 4B8WA 4XLZA 2DHEA 4LN1A 4ZCMA 2XNKA 4LY9A 3ZVMA 4ALLA 4OGLA 4F4CA 4UHBA 3VKVA 1NHWA 1O57A 3LQRA 2O2CA 3VR4D 3IBTA 5H80A 2A0FA 4LRTB 4FKMA 5CB4B 1RHQA 2NUAB 2FX2A 3SYMA 5LZ2A 4PAOA 1TLLA 1JGTA 2BJWA 4JI7B 4UBNA 5BPHA 2ZTLA 2R2GA 1KI9A 3TJMA 5JCZA 4K9QA 4P86A 3L7OA 4UVHA 4UEQA 5CDUA 4COOA 5LQJA 3I76A 1E9FA 1GTMA 5J4YA 1VCNA 4C08A 5BY2A 1T6ZA 3LGSA 4NL4H 3WQHA 4DIEA 1IWOA 2W6NA 2GVZC 4IJVA 3TBFA 3IVAA 1V11A 3TLEA 4NEQA 1U5BB 4PBRA 1UPXA 1V8ZA 2O3QA 2Z2XA 3DULA 4TMXA 3WXMA 4WXRA 4P4SA 1XNJA 5DGDA 1SIBE 1J23A 3ZZTA 4HAVA 3ZCVA 2XNJA 1CYEA 4EX6A 1FFXB 3D1LA 5IAEA 2F3SA 4ND8B 4D9HA 5AK0A 5AVSA 4PSDA 1IN4A 3FOEC 4Z7QB 4NBRA 1F7UA 4H31A 4PY2A 5DBFA 4P7GA 1X94A 1HZZC 1WHSA 2V98A 2Q2QA 3ER9A 3T1YB 3MB8A 3DQPA 1JH9A 5HIKA 2PIAA 3FGZA 4UNPA 3UFXB 5FX2A 4F6RA 4TLBA 5FFFA 5C7IO 2UKDA 4H16A 4OSOA 5G1OA 5EIWA 1Z36A 3H6KA 3H75A 4B8YA 4BNDA 4DCUA 5FLXA 4H0FA 4JH0A 2PV0A 2OD9A 2CHGA 5CFZA 5FTLA 4J43A 1OKKA 3TNJA 5BXQC 3BFVA 1Q22A 1U8TA 1NBHA 5BMOA 2BJVA 3R3VA 5BV0A 1LLUA 3EZ2A 2BI8A 2PZBA 3LV8A 4KAJA 1DBWA 2AVNA 2BGMA 2O2IA 3PC6A 5DDIP 4MRNA 4G4GA 1JLKA 1EI9A 4YCNA 3RO7A 3QE3A 2RI6A 1V35A 1XWIA 4I0WB 4PE5B 1YL6A 3AF5A 2B4YA 2G6BA 4EYGA 3MD9A 4MI3A 5JHHB 5A7HA 1T1SA 1D5CA 3LUDA 3OZ7A 2BGKA 2X8WA 1M66A 2WOOA 2GN0A 5A9SB 1UMDB 5JFOA 5JS7A 1JIVA 4IXTA 3ZZMA 4OXQA 3ZQUA 5FDFA 2Z9BA 3EF1A 2AG6A 5COBA 2H0RA 1M8JA 1DDGA 2JI6A 3IO5A 4ZYYA 3S55A 5HF9A 2G80A 4X20B 4P34A 3ZD8A 4GHWA 1R0YA 2JJ8A 2VLIA 3IKMB 4WQMA 3QG5A 3E2PA 1UK6A 3AUAA 2HXSA 5JVDF 3N1UA 4HCJA 2ZVDA 2RCNA 3ZNOA 3CY6A 2P11A 4HLQB 1ZD8A 1W0KD 3GJ5A 3A7DA 2WU0A 4XB6B 2R8OA 3H7AA 4YCCA 3R8FA 3ESDA 1C3XA 3IQWA 3JALB 1CY8A 3VZPA 3AUXA 2AFVA 4BBAA 3CR3C 2VK8A 3KWMA 1EPUA 1RXUA 4AWXA 5LD2B 1E18A 3T1TA 5FPYA 4RACA 2GWHA 1EGAA 1V8BA 2P9QA 2WF9A 2Z0MA 5K3FA 4NOMA 2QLMA 1A0OA 1U98A 2ZFUA 1N2XA 3THWA 2Y0EA 4D9NA 1NN5A 4PEVA 2HDNB 5LVAA 3R6DA 2CBXA 3KDAA 1O5TA 2L19A 3EC7A 3EYWA 3SHFA 1H8HA 3ZYCA 1JVBA 1USWA 3FFTA 4WEQA 4RMIA 4Y9RA 5E6SA 4ZEWA 4C03A 4JUFA 1WHTA 3G9QA 4P8RA 1M9NA 4XI9A 4B31A 4LPKA 3JPWA 1ORDA 1J5EB 2EGGA 4L3OA 3DL4A 4N8EA 1OB5A 4OLJA 4MR7A 3JAKA 3F4KA 1U5CA 3Q41A 4KO8A 4U63A 2I6GA 3SP1A 2FDXA 2VDOB 4UQOA 4B1FA 2BMFA 3HUDA 3EQ6A 3EVDA 3RLIA 1HQYE 1VJ0A 2DQSA 4O25A 4LGCA 5ALDA 2RJOA 2FUG1 3EE6A 4XYMA 4NC9A 5FI3A 4YCMA 2JCVA 4Q47A 3W4JA 3ZDYB 4LMBA 3JRXA 1OX4B 3N58A 3RAPR 3R5TA 1CDDA 4GZ5A 2CZGA 2EW1A 1NC1A 2NU7A 2CF6A 1NXWA 2P6MA 4ZXFA 5FTJA 3ADDA 2C2HA 3QG1A 4O2BF 3QXXA 5IDYA 4EVQA 4WLEA 1YOVB 5AO9A 5FV7A 1UIRA 2BFCA 1W75A 4BMOB 4PG6A 4ZVMA 5ARBA 1PT6A 4NPHA 4OMUA 2JHCA 1GG9A 2ATVA 3FPCA 3TOXA 3WIOA 2PA0A 3HNOA 2LCFA 1J2JA 3O75A 4GM4A 4H7JA 1KI7A 1DT3A 2WE8A 4OQ4A 4Q66C 5F5LA 1K75A 1BHQ1 4KQXA 4R1TA 4D74A 1J21A 1JLLA 3INNA 3V7YA 2XUGA 1A50B 3ZZ1A 4K9PA 1JR6A 2GETA 2YUIA 2ID9A 4C6SA 3BGWA 3NVKI 2D5BA 1NURA 1P6QA 1OMOA 1PK8A 4U7FA 3TPFA 3JVVA 4WXEA 3QIAA 3HP7A 2G1UA 1XXHA 2YV5A 3KYDA 2VHEA 3U4AA 4CKBB 4O4LA 3T7IA 4UNRA 5A6SB 4BV3A 4QWMA 2RAFA 3N5KA 1SU4A 4HGRA 2BCGY 4IWYA 2XF2A 3FDZA 5JJ5A 1AGYA 2PNJA 1BXGA 3S8MA 4H3HB 2GZSA 4L07A 4LOAA 4XEUA 1ZWLA 2PMWB 2WKRA 3R3WA 4PZYA 1E6KA 2NVUB 2JANA 4YGXB 3S2EA 5FBLB 1OX6A 3ZWDA 1I7NA 1LI5A 4E7PA 3C3DA 2I6TA 1Y4AE 2AB0A 2OFXA 2YWDA 3JYPA 4FCCA 4Z0TA 3WFJA 3MLAA 1RYMA 3L82B 3OJWA 1UIMA 1Z47A 1L5SA 1ZH2A 2JHPA 4HTAA 4S2EA 2XUJA 3SVTA 3EIFA 5TIIA 4UFNA 1T9CA 1TX4B 3MHTA 1L5WA 1L4BA 3H2BA 4FHDA 4YCDA 5H3LA 3EN0A 1YDEA 3LUKA 4TYMA 1EFRA 5TEWA 1KJ9A 5TQ2B 3TWOA 1K7YA 1YL7A 1C0PA 5FTMA 4D44A 3M9XA 3KTAA 1CJMA 1DJNA 1HF3A 4XFJA 1GNPA 2IYTA 1GUZA 3ZV4A 3NXSA 1SZJG 1TKAA 4J0CA 5IT9A 3Q40A 5FBZA 1P1JA 3LHDA 2QX7A 4KU4A 4M3NA 4CQMD 1P2VA 3GMSA 4BGDA 1TC1A 2P1RA 4C14A 5DT2A 1WPQA 4XCQA 2I4MA 3U4HA 2YX1A 1NMEA 3ANXA 4YAJA 2I87A 4YMLA 1G60A 1DKUA 1IY8A 1CZKA 1JG4A 1W30A 4MUKA 4XB2A 3CH4B 3EULA 3BN3A 4K0KB 4GX0A