The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
75
|
sequence length |
248
|
structure length |
233
|
Chain Sequence |
KAEKILARFNELPNYDLKAVCTGCFHDGFNEVDIEILNQLGIKIFDNIKETDKLNCIFAPKILRTEKFLKSLSFEPLKFALKPEFIIDLLKQIHQININLFDYEINGINESIISKTKLPTKVFERANIRCINLVNDIPGGVDTIGSVLKAHGIEKINVLRSKKCTFEDIIPNDIFKYVLIVTKASQVKKFTKLINDRDKNETILIVEWNWCVESIFHLNVDFTSKKNVLYQKK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of C-terminal Tandem BRCT Repeats of Rtt107 Protein Reveals Critical Role in Interaction with Phosphorylated Histone H2A during DNA Damage Repair
pubmed doi rcsb |
source organism |
Saccharomyces cerevisiae
|
molecule tags |
Protein binding
|
molecule keywords |
Regulator of Ty1 transposition protein 107
|
total genus |
75
|
structure length |
233
|
sequence length |
248
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2011-07-30 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF16770 | RTT107_BRCT_5 | Regulator of Ty1 transposition protein 107 BRCT domain |
A | PF16771 | RTT107_BRCT_6 | Regulator of Ty1 transposition protein 107 BRCT domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | BRCT domain | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | BRCT domain |