3T7KA

Complex structure of rtt107p and phosphorylated histone h2a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
248
structure length
233
Chain Sequence
KAEKILARFNELPNYDLKAVCTGCFHDGFNEVDIEILNQLGIKIFDNIKETDKLNCIFAPKILRTEKFLKSLSFEPLKFALKPEFIIDLLKQIHQININLFDYEINGINESIISKTKLPTKVFERANIRCINLVNDIPGGVDTIGSVLKAHGIEKINVLRSKKCTFEDIIPNDIFKYVLIVTKASQVKKFTKLINDRDKNETILIVEWNWCVESIFHLNVDFTSKKNVLYQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulator of Ty1 transposition protein 107
publication title Structure of C-terminal Tandem BRCT Repeats of Rtt107 Protein Reveals Critical Role in Interaction with Phosphorylated Histone H2A during DNA Damage Repair
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 75
structure length 233
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16770 RTT107_BRCT_5 Regulator of Ty1 transposition protein 107 BRCT domain
A PF16771 RTT107_BRCT_6 Regulator of Ty1 transposition protein 107 BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3t7kA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3t7kA01
2EBUA 3T7JA 3COJA 2JW5A 4ID3A 3EF0A 1L7BA 3PA6A 1T2VA 3K16A 3PC6A 1Z56C 1IMOA 4U4AA 3PXBA 1IN1A 3SHVA 2L42A 2XNKA 3JVEA 3OLCX 3K0KA 4N40A 4XPZA 2K6GA 2COEA 2DUNA 3T1NA 1GZHB 2COUA 4BMDA 3HUFA 1Y98A 1KZYC 3T7IA 3HUEA 3T7KA 3I0MA 3PXEA 1OQAA 3PC8C 5ECGC 2D8MA 3L41A 4Y18A 3PC8A 2VXBA 3K15A 3L46A 4IFIA 1CDZA 2NTEA 2VXCA 3PXAA 3QVGA 4Y2GA 2ADOA 4JLUA 2HTFA 3EF1A 2E2WA 3SZMA 2M2IA 1T15A 2XNHA 2WT8A 3II6X 2EBWA 3PD7A 3SQDA 3U3ZA 3PXDA 2LE0A 4BU0A 3QVGB 3L40A 1L0BA 1T2UA 4OFBA 3FA2A 3PC7A 2R1ZA 3I0NA 3SHTA 2K7FA 3UENA 3AL3A 4BU1A 1N5OX 3K05A 4XQ0A 4BMCA 1WF6A 3AL2A 1JNXX 2COKA 4IGKA 3K0HA 2ETXA 3PXCX 2AZMA 3KTFA 2INGX 2EP8A 1T29A 3UEOA
chains in the Genus database with same CATH superfamily
3ZDXB 3PEWA 3U1BA 3RKSA 4GSLA 3MJCA 1RQGA 2IYEA 5HE8A 1K8YB 2E6KA 2V0CA 2XH8A 2IWRA 3UFXA 2FKAA 1DELA 2QW8A 2WILA 4LGVA 1MB4A 2GCIA 2QYTA 4PW0A 1GA1A 2TS1A 1Z56C 4TM8A 3REGA 1EU1A 4MI6A 3Q10A 1K7XB 2H2HA 2JFYA 2ZANA 1ADCA 2NV6A 4JLWA 1GZDA 3OM1A 2C2OA 1TF2A 4I3GA 1B2LA 3HEMA 1Y89A 2C9MA 5ALTA 1Y42X 2VS1A 5HFNA 3VR5H 2QUKA 2P79A 2JEZA 4R8KA 2UUPA 4MQUA 4NWIA 3H4VA 1U2PA 4IMRA 4GBJA 3VH2A 4AJ1A 1CV2A 2IDJA 2XVYA 1BHQ1 1IXZA 1NJ5A 4LEIA 4ECEA 2HDOA 2XNKA 4PZCA 1SAYA 5H81A 1R6VA 2CVFA 3K5IA 4GOMD 5C32A 1PWZA 4AXBA 3DD1A 3NEYA 1BNCA 4ZVNA 2OC4A 4UVDA 5DSZA 4RTRA 4AN1A 3PDUA 1ZN2A 1YFJA 5C5EA 1I7PA 2GTHA 1EXMA 1NRIA 2PQMA 3KAJA 3OZCA 3OZSA 4UAJA 5A4JA 4IOLA 5IXYA 2VHUA 4OU4A 2HLNA 1RU3A 4CG3A 3I2JA 3HCDA 1M1NA 3L0YA 4WVFA 1CRPA 1I0ZA 4M53A 3HU1A 1CJBA 2PYZA 4KWCA 2JRLA 2B83A 2HCTA 2W0MA 2JLBA 2YJ5A 4MWBA 4QOJA 2IXEA 5FNVA 2BF7A 2I9PA 3KEOA 4QDKA 2YFQA 2C9ZA 3KTDA 2CVOA 3C45A 1E79D 1GTVA 2G5TA 4X7MA 2FLWA 4MUGA 5IJAA 5EFZA 1QHEA 4AKEA 2B8EA 1L8QA 3EMDA 2C59A 1N1EA 1TYZA 2ZREA 2Q27A 2QDKA 3CNNA 1HH4A 1G3MA 5LOVA 1W0JD 3G8BA 3NPMA 4PZ9A 5DIFA 3UJ8A 1KRXA 3LM8A 2VF2A 3LHSA 2CJWB 3P9PA 1EVIA 1C14A 2VXCA 3WYBA 2AW5A 1EA7A 1WNFA 2C57A 2I62A 2ZAIA 3OE1A 1REQA 1D4AA 2Q49A 1DI0A 2IVFA 4LRQA 4Z7QB 3PV0A 2LXNA 1N7GA 4NYJR 3CYFA 3ETGA 3RRMA 4DDTA 3OEWA 4RADA 1V6AA 3MC1A 2H59A 4TSRA 1TCCA 2QZJA 4J0HA 1U2EA 1CZUA 5GINE 4K40A 1P7YA 4JNCA 2QM7A 2G9QA 2GILA 2RBKA 3I5MA 3KWMA 4JJ6A 1IY1A 4BV3A 1Q0SA 1IH8A 4KGDA 1XYGA 4PO9A 5JWRA 3ROEA 3A6FA 3HKBA 2HCJB 3MT7A 1Q1ZA 2BBTA 1JPUA 1A5AB 3G2LA 3O4JA 4JN6B 4N47A 1UOOA 2D5BA 2ZE7A 2LZ0A 1DRUA 3EIQA 3GRKA 3WOVA 4OFWA 2VTBB 3DBIA 3F3MA 1E61A 4PNEA 1QVWA 1JA0A 2ZR9A 3VVLA 4L72A 1TPYA 2JIBA 2MSLA 4XQ0A 1VECA 2VXOA 2A5DA 3NBAA 2VF4X 4QXPA 3EVBA 3HJGA 1M74A 2WYHA 5LZ5A 4BL5A 1JG3A 2WPDD 2XZPA 5EIAA 3X1KA 1X19A 3EC1A 1GCAA 1GCIA 3N7UA 3OECA 1T5LA 4UDNA 1HNWB 3JAWB 2O2HA 2BPOA 4KQ6A 3OURA 5HCIA 4H60A 2A33A 3MVEA 1Q50A 1EFCA 1YU6A 1FUEA 2EBFX 2WF7A 4YCJA 1EM8B 2GA9A 4J0IA 3T35A 5L4SA 3GJ6A 1ZHOA 2GZAA 4L4XA 4PSDA 1C3VA 3PHLA 4B4OA 3IAS1 1TTTA 1FB5A 2ORVA 3NEJA 4JMLA 2PKQO 3O9ZA 4RPHA 5DGIA 4J4BA 4CKWA 4IIDA 4MHOA 2XQJA 1L5SA 3SHFA 3O8QB 3LFTA 4KQIA 3UAGA 3LO5A 2FQYA 3EDQA 4Y7CA 5AI0A 3ZJUA 3FOFC 4UHDA 4BIIA 1IMOA 3O8CA 1WOMA 4NCNA 1ZD2P 1X1CA 3GNLA 1AKNA 4OBXA 4P7JA 4Q1FA 3HP4A 2HRCA 3PSHA 4BO9A 5KX5B 4BO4A 5ES4B 4B3SB 2HSGA 2IE8A 4HJXA 4MVJD 1TM5E 3EAFA 2SKDA 3CZMA 4NV1A 5FOSA 2R00C 1P1FA 2JFPA 3NWBA 3CNOA 4R2WA 1KQPA 4BZPA 4KE6A 5BN4A 4DQKA 3V9PA 1IOWA 2K6GA 4P82A 3TNFA 1GDTA 3L02A 2RKBA 2OMEA 1XTRA 1C4XA 2H1HA 1DJNA 1VE3A 1P0MA 1EUDA 1QK4A 1E5QA 1CX9B 1U8CB 2PO7A 3AU9A 1I5OA 4LJ8A 1E3MA 2Q4DA 2IYSA 4PLTA 3QBDA 2OV3A 1KDRA 1RLMA 2SHKA 1JBEA 2Z4SA 4X20A 3VDQA 1AK9A 4AU1A 2G82A 1P9RA 4MVJF 2GHIA 1JNYA 3LT5A 5BW4A 4FYKA 2XAUA 3G9XA 1OQAA 4J76A 5C8ZA 2XMZA 3SEAA 3V42A 1WZ2A 1L4LA 3AUTA 3EBLA 1GZ3A 4HB0A 2IYNA 3E9QA 4R16A 1F4VA 2XR1A 3R2JA 4KVGA 4H6WA 3FNEA 4PAOA 1ZR2A 1M2WA 2FEMA 1DC6A 1OY1A 2I6QA 5DLDA 4CV2A 4DYHA 2QP3A 4JJ7A 4BFTA 1A9TA 1B43A 2Y8EA 4NCBA 3ECSA 2W70A 1TO2E 4TV9B 5BQPA 4UOQA 4Q4HA 4CL8A 1RJWA 2P41A 2EERA 2EF1A 4E5DA 4UFPA 4ZT5A 5E38A 1CYDA 2ALJA 1YE5A 1KO7A 1WZUA 3USCS 2R97A 1F4PA 2FP4A 1CJSA 1SKAA 4ZVVA 2D6FA 5B58T 1SQFA 2BKVA 4C87A 1CWUA 1T10A 2BGIA 1I01A 3EGVA 3U81A 3KQNA 4EDFA 1P0IA 1JWLA 2HK9A 1J00A 5D6NA 3HMQA 3L1VA 2PM8A 3SEFA 1I7QB 3RTAA 3ZOZA 1DB3A 1S9DA 2F1OA 2AK2A 2IP4A 2W7TA 2R4QA 2CFCA 1YJQA 4K9QA 4XOUA 3AZPA 3H1TA 3WGGA 2JHPA 4KLAA 3CY6A 2OTCA 4F3NA 2PRJA 1EINA 3HN6A 5CNMA 3MTIA 1QLWA 5E95A 1KARA 3UJ9A 4ZZ3A 1RWOA 3BE8A 1OTHA 4MDFA 4YMTA 1HM5A 3BT7A 4JCOA 2AE2A 1DKPA 3UGJA 4Z3OA 3SBOA 5IASA 4TUYB 2WKWA 821PA 2CLCX 4DYDA 3JPWA 1JHPA 3CLHA 1H8HD 1E8MA 5AKIA 3P7MA 5JASA 1C9MA 3N0WA 2PH7A 1ORWA 4MRMA 1RHKA 5L6LB 5B12A 3U7RA 1FNSA 2YWEA 3OCCA 4UMEA 2E37A 2BAGA 1IY0A 2HMYB 2FF7A 2GZSA 1U6KA 1T9HA 2REBA 2Q5OA 2V54A 3M6XA 4WZAA 3C3AA 1MORA 3EIFA 2GAJA 1VJTA 4RV9A 4ZEOA 5IJXA 2ZJBA 3QPBA 2E9SA 3V3KA 1U7ZA 1R4MB 3BRWA 2J9FA 3NTXA 3BMQB 3U2QA 2IUEA 3KD3A 3IQHX 5EZ6B 2XE6A 1NPYA 3IEUA 4F5EA 4TKUA 3NIDB 3O8OB 1KERA 3RUAA 3V32A 2FFBA 5FPTA 4BTEA 4QUAA 4REQB 3PT5A 3BSFA 2YHAA 1B73A 2DHRA 2GYVA 2RGEA 2WTEA 5C1BA 4BXOA 3FWZA 3ZJTA 3GDGA 4XWGA 2JCXA 4R9VA 5E7QA 4UCWA 1WBBA 3OF3A 3T9FA 3NW9A 2D0IA 5J3JA 1EE9A 1WUTA 2B4QA 8ADHA 3OA0A 5ED4A 1LSUA 3AKZA 1KVSA 1M34A 4TL6A 1AS0A 5JS8A 1KJZA 1QKIA 2DKNA 4GVXA 1N4DA 2YZMA 2HIMA 4W8OA 2BFNA 2WYIA 3QQ5A 3BTSA 2IITA 3DWIA 4G09A 5ECWA 3KTAB 4B82A 1WV0A 2NYVA 4E3WA 5I6DA 2A86A 3AIMA 3ZWPA 3W5BA 3PGJA 1TCBA 4KE8A 4LY6A 4UE6A 5EQFA 1WCV1 4X3OA 4D0GA 3AVVA 1JPJA 3LMKA 3PWSA 5F3WB 3IMKA 3GF4A 4HNUA 3WGZA 5BR1A 4NONA 2I2DA 4W5QA 1RW4A 1P62B 1Z74A 2WYOA 4F04A 1RD4A 3K5WA 4RTSA 3WLIA 4QTXA 5TV2A 2GN8A 2AWOA 1IN7A 1YDHA 1A8QA 4QU5A 5DLYA 1JEDA 4KFRA 4KO3S 4QJIA 2VJQA 1Z07A 3AJ9A 4DSUA 2P90A 2DHQA 3VRHA 2AB0A 2JA2A 4LWPA 3EASA 1AHHA 1P9NA 3C1AA 3GMIA 4Q12A 3VO8A 4C6RA 1HT2E 3FYUA 1ZCBA 3T3HA 1ZOSA 3O1JC 3N2EA 5KYKA 2G1AA 3NO4A 3FH0A 4YJGB 3CPSA 1SPXA 2FW8A 1VG9B 3MW8A 2FW1A 1QO0A 2HTFA 1P2TA 1X7XA 3H1PA 2OENG 5GJBA 2MR6A 1G5IA 4JA0A 5IVIA 4Y98A 4CI0B 2MINB 2B5OA 2XHEA 1ZD8A 2DLCX 4CLDA 4MUMA 5SICE 3GLTA 2FX3A 4BB9A 4AWAA 4Q7JB 4AYXA 4KFCA 5DYIA 1SKBA 2OP0A 1GQ2A 3K71B 4ZZ1A 1V8BA 1KYTA 4RMNA 3OWOA 3NAGA 1V2HE 3BGVA 1E18A 2XIJA 3W4IA 1F5SA 1IAQA 2YX1A 2I8AA 2IP1A 4TYQA 1L1QA 4R68A 3AF6A 1XWIA 4DCVA 1Q0TA 1OWMA 3EVAA 3OPYI 5E7MA 3P94A 2ACKA 2Y3IA 3EGXA 3PC7A 3NAMA 4H3HB 4Y6QA 3SHTA 4IVRA 5BSTA 5LIPA 3GLHE 1JDJA 3ZNQA 1KYVA 1BX1A 2TMDA 2O1EA 1IJBA 3AF5A 4TTRA 1NN0A 1BKSB 4FBGA 5DJ5A 1LWNA 3O4VA 2SKCA 5FTWA 4CUZA 4DJTA 5D5HA 2B21A 4IYJA 1IUKA 1JAXA 3KT6A 4ZANA 2QAIA 1EEHA 5ALQA 5SY4A 4DIDA 5JNSA 3KAQA 1M1YB 1NF9A 3PU6A 4QUHA 1J0XO 4F4DA 1CTQA 1BGWA 1OCEA 5BO5A 2JBAA 2ZRNA 3C5HA 3QU7A 3AR3A 1V37A 1QZ3A 3JYNA 4JU8A 3C14C 4TLBA 1LUAA 3B2NA 2W83A 5AKYA 4A10A 1MC5A 1MO3A 3WYFA 2YUIA 4A0RA 4YRGA 2Q6KA 3A1VA 1T4CB 1JDVA 2VDWA 2L2QA 4AKGA 2UZ1A 3ZWAA 4EA7A 4CU2A 4H6XA 4DJAA 1XJWA 4QHSA 3N2YA 4RETA 3ZLUA 1CUXA 1AV6A 1Q17A 1W5AA 2Y1WA 3IHLA 2AYXA 4YUZA 3CIOA 2RHLA 3U9SA 1MIOA 3R6WA 4HP8A 4PHTA 1COWA 1QQ6A 1TJNA 2BI8A 2XEXA 1JZTA 4NJEB 5K6RA 4X90A 4XH9B 1HGXA 3SFZA 1EK1A 4QUGA 4ROSA 2J59A 5K01A 1U8EA 4KBYA 1OD6A 1GQRA 1PJ2A 1YJXA 1MABB 2D13A 5FWYB 3WR5A 4ESEA 2QAJA 2GO7A 3HFJA 5CDFE 3FDZB 3KQLA 3KL4A 1JAYA 4D9FA 1UBEA 4CFSA 5B55A 1TXGA 3OE5A 2FCRA 4RZXA 3GGSA 4XPZA 2CMDA 1I24A 2C9YA 2XE7A 3TIFA 5LZ4A 2RGAA 4UJ5A 3E3NA 3RU7A 2O1WA 5LYJA 2C2BA 3HU2A 3D02A 4WADA 4FKBA 3VC7A 5IYZA 3SF0A 4IUDS 8GPBA 3FCAA 5K0ZA 1MC1A 3OF5A 3PUKA 2H9YA 4BJ3A 4KN9S 1FQKA 3OPYB 3E7DA 2HN9A 1T8SA 4LJKA 3T7KA 3A6EA 2B99A 3NOXA 3PCRB 1JSXA 1TF7A 3KYCB 4NU5A 3GNSA 1QB8A 2I67A 1Q6YA 5JAQA 1ZXXA 2FMHA 3R09A 2VIIA 3LAWA 4PTLA 2QRGA 3VPHA 4LZAA 4MV0A 1I1QB 3X1YA 1E6LA 4WFJA 4DJDC 5IUNC 3EZNA 4NVRA 1U2DA 3NHSA 2FZ4A 5JCOC 2HLDA 1WMSA 3B2QA 1L5HA 4C2UA 1UFOA 1YQQA 3FBWA 3ZVNA 3MD0A 2A5FA 2GK6A 4JAVC 4UEKA 3AT1A 3LF2A 3ENVA 4RA9A 3HUDA 2HK6A 1YRAA 5FOVA 3ZGLA 4EHLA 2H5IA 1YOVA 3WLKX 3L8YA 4LZPA 1KC1A 4TL9A 3QMPA 4IGFA 2Z2KA 2YZ2A 3RU2A 1FQWA 1JB9A 1M2HA 2HNBA 4IDQA 4DCMA 1QQ5A 4KPUB 1AUXA 1Q11A 2LRHA 1U65A 1W5BA 1J8DA 2OO5A 3ZWQA 3H6KA 2PH1A 4F12A 4EQZA 4G0NA 3L3BA 4P5PA 1TM3E 2QUAA 4TV8A 1X42A 3IXQA 5FUWA 1JH9A 3VDMA 4NOMA 1G64A 4UHBA 2YHIB 2IIPA 2GYYA 1ENPA 2J48A 5KQGA 4MW5A 4KSBA 3F1LA 3ZS9A 3P0FA 4KIWA 4LIPD 3W79A 4BLSA 2E4ZA 4NATA 4QYXA 2B5WA 4J4TA 4MYUA 4TT3D 4C0AC 1Z3IX 4Q7QA 2XZDA 3PNLA 3IULA 5K3SA 1A0OA 4D3DA 1PX0A 2ODQA 4ZGWA 2IS2A 3AJ8A 1S8NA 3KWLA 4ARZA 3GAZA 3HO6A 5DM60 3T5GA 4HSGA 5DE3A 3QHAA 5AM0A 4ZT6A 1GCOA 4X9XA 1K88A 3RR2A 3RUDA 2ZSJA 4YV0A 3D0QA 4JLBA 5ALDA 2KI5A 2G25A 4IHQA 4G2NA 3L8HA 1EWTA 1HK7A 1YBFA 4BQEA 3BXOA 4DUZB 3RIEA 2OSBA 2XBUA 3B70A 4N82A 1GG5A 2ZBVA 5J2TF 1VLQA 2LUOA 1X9GA 1HE3A 4OGKA 3RHFA 3UUGA 3UK1A 1ZJ4A 3H65A 3G8CA 3K1ZA 4BDSA 5HKKD 1QTRA 3CIFA 3G0IA 3H1AA 3SYLA 1XZMA 1CBUA 5G1OA 4OHZA 3N8DA 3ONFA 3I32A 3D2LA 2MSEB 4MHSA 4PHGA 3W3AA 1PZEA 4GMXA 1ULZA 4M0UA 5DK6A 4Y2JA 4BGDA 4HDRB 3OFSA 1DO8A 2OYSA 1L4MA 1GILA 1KS2A 5KHLB 1QF7A 2JZOA 4QPPA 5CFZA 4JKYA 2PT6A 2A1TR 3O9MA 7REQA 1XKQA 3MAAC 2FXIA 5CVJA 1VGRA 1VMDA 3SGLA 1SBYA 3HADA 2BBOA 5K6TA 4DIOA 2ZYGA 5CP8A 2OCGA 4PWYA 1OAAA 1P0CA 1U0GA 3QZUA 4ZT3A 4DCCA 1QRSA 4POAA 2HF7A 3TZHA 2H00A 3MJEA 4GQBA 2Q0QA 4KQWA 4O1MA 4BNTA 1PUJA 3HJCA 4BWGA 1X8XA 2A67A 3FJ1A 1LPOA 3JSXA 2H2FA 4G65A 4ZVMA 3T7IA 1SFRA 3ZTTA 1WUHS 2WUVA 3QF7A 1Q3KA 1BDJA 3UCXA 1GNLA 4FHFA 3EFEA 4RD2A 3VHQA 2QN7A 4G8JA 2PH5A 2ZWVA 2HJ9A 3HR7A 2Q07A 1K27A 2CFTA 1IEWA 4YJHB 2W6JD 3VR6A 4BMSA 1ZM9A 1HT3A 2X8JA 5B4VA 4NABA 1GNQA 3I9JA 2Z2JA 4ESVA 4EARA 3PDIA 4RJLA 1ZXBA 3WL3A 1BCSA 2GCGA 2OESA 1L7OA 3OT4A 2WDPA 1EQAA 4O4JF 5AM3A 2HRRA 4CLRA 5LMNB 1D8AA 2P1ZA 4MW6A 2WY2D 4AY6A 2LIPA 1PKEA 1VI5A 1N2ZA 4G01B 4UW9A 1ZXLA 3M49A 5A06A 2XNJA 4K0RA 4OAOA 1A5ZA 1N77A 3IOMA 2OL4A 4E12A 4CQMA 4D3FA 4PSCA 3IDOA 3R3SA 2NQTA 3PUZA 1WXIA 3R6TA 1JDUA 4NH0A 2AFHB 5C8YF 3PPXA 2FX5A 3WWOA 1PS9A 2ZSIA 4JI6B 3DAPA 2Q62A 3VR5A 1XG5A 1RI2A 3EXG1 1Q22A 1H8EA 1ZOOA 3ET5A 4MIOA 1NWCA 3V8EA 3WFJA 4A2CA 1XD2B 3MTJA 2O8VA 5EWMA 3ISVA 4I3HA 1CJMA 2F1IA 3GJ0A 3IUPA 2JLYA 4U3JB 1E58A 3MQFA 2QAGC 3VR3A 2BDUA 2YJ6A 3EHEA 1YC5A 1RKBA 3E03A 5CFLA 1JLLB 3SZRA 4XUDA 1I80A 1RHRA 5FA5A 4FN4A 5HF9A 4QQ8A 3L84A 5ALKA 4NCXA 2FSVA 1NA5A 4R81A 1Y6RA 1A9QA 1CUSA 1QO7A 2OZPA 3W5UA 4D4IA 2D54A 2CJXA 2REQB 3HZRA 4P53A 2WDZA 2VTEA 2INGX 3VVCA 2DR0A 2XHZA 4ZHQB 2WD7B 5BPHA 5D3KA 5CT5A 1E9RA 3QVOA 4H3VA 2AYYA 2I1LA 3ENKA 1TEVA 4JK3A 4B9AA 4DT1B 4ID3A 4WKPA 1PD1A 2QP4A 2VDOB 2CWDA 4D9KA 2ZIGA 1J8YF 3KVVA 3NT2A 1RCUA 4MCAA 4GP7A 2OCAA 3RO7A 1CB7A 4YUVA 1T5TA 3L4KA 1V1MB 3AF2A 4KQMA 3VX3A 2X58A 3O3CA 4E14A 2ZUWA 1WJGA 2AF4C 1Y5RA 1PTKA 1ML3A 2NLOA 4Q24A 2XDQA 4JL6A 4QNMA 2C7RA 4TWBA 1BH2A 3WNBA 5TJ9A 2A9RA 5T41A 2XA1A 1JDTA 1N57A 2QZSA 1G5PA 1W44A 3AKEA 3GEHA 3KJXA 3H05A 1ULTA 4HDMB 4B43A 2WI8A 3N7TA 2XB6A 3H17A 4OLFA 2JIZA 3WV5A 4BO3A 4H15A 2UVQA 3CNBA 3IYLW 1P1JA 2P2ZA 1DTSA 2XUZA 3TVYA 5B1HA 5CA0F 4PXAA 3UMYA 2H2GA 2B78A 2JA1A 3A05A 4ACAA 3KSBC 2P9FA 1AY0A 3OJOA 3U61B 1NFQA 5KPDA 4EENA 4HZGA 3O9VA 9ATCA 2PKWA 4Y6GB 5PNTA 2EJVA 4ED9A 1KIFA 1V8ZA 5H83A 1L6RA 1PUIA 3DL7A 3R4CA 3BMNB 4IVQA 2IYRA 4LE2A 4W1QA 3ZD9A 1O9BA 3H3XA 3NBUA 1E66A 3COZA 1TLTA 3OTHA 4DLTA 1P1KA 3B3FA 1RCTE 1VZ2A 2FPPA 1AHPA 1KKUA 5D5PA 1KAHA 2EF0A 5C8DA 3A1NA 3EEQA 1NLZA 2BTOA 1FMCA 2FUEA 3FRIA 3NBKA 4NOKA 3RSZA 4YQFA 3AVXA 1FZTA 2QE7A 4ZAZA 1QH1A 3K15A 1Q57A 5CLLA 3UQYS 4ITRC 3LLMA 2VRWA 4DCUA 2C29D 1NRJB 2QT1A 1SUPA 3N6VA 1RRPA 4GPBA 5SY9A 3RBVA 3V00A 5F4ZA 4F9FA 4S0XA 2FMTA 1XU4A 4RK1A 4RZUA 4YV1A 1E2FA 1Y6JA 2HDHA 5BT8A 4AQYB 4MVXA 2VWHA 4BBAA 2I2XB 4WDRA 4KOEC 1PSWA 3BK2A 1JQEA 3A2NA 1U2QA 1VJ1A 2F3PA 2ZYTX 3OC6A 3H3FA 5AJWA 3VDXA 1DKMA 2YNMC 3CBGA 5FFMA 1T35A 4YLGA 2HWUA 1S2DA 3KWFA 3AEUA 1SB9A 4Q5IA 4YAEA 5EKDA 3ADCA 3CVYA 3AV0B 5K2OA 2C03A 5ARCA 5LA6A 3E8MA 1ISFA 3KL2A 4E15A 3C3KA 1Z7BA 1P8JA 3N59A 1XEWY 2P6MA 3THYA 2A3RA 3S3TA 4CHGA 1SBNE 1V47A 4QYSA 1PEYA 4WXMA 4DMGA 2IZ7A 5A7FA 4YO7A 3U09A 1C7ZA 1WB9A 4NDAA 4OHMA 2R5NA 2J07A 2D0PB 1GGVA 2JIQA 3RJMA 5L8VA 1G59A 1JU3A 4KV7A 4BEVA 1K3FA 4N18A 4JC4A 2O9JA 4Y6LA 2CNLA 1P5RA 1Y4ZA 3G0HA 3U4QB 2JPDA 1PV2A 3NHWA 4XAQA 3ZWCA 5K0EA 4KWIA 1CLEA 2P2LA 1PU2A 4HS9A 4MGZR 3PDJA 5L7WA 3AZQA 3VR6D 2JDID 2NZVG 4CM9A 3GFTA 1JQ5A 1FTWA 3T1TA 3TSCA 2AQHA 4C0QC 3NHFA 1XTUA 4R7GA 5FHQA 4DR6B 3R0XA 4MV9A 2JAPA 4R1OA 2Y77A 2FN8A 1CNMA 4WFIA 1GXSB 4M4SA 4REOA 1SCNE 1VL8A 4R7TA 1C1DB 2QRJA 4U00A 3SR0A 5JY1A 1Q6ZA 2CLEB 1B8VA 1RR6A 1DAMA 3CSDA 1PJZA 2PJUA 3M9XA 4IQ4A 4RTJA 2BRUC 1W4RA 3BD8A 5D01A 4ETNA 2AEFA 1I94B 1HZZC 1ZMBA 3P4UA 1JG1A 1K68A 3VBEA 2HCFA 4HAUA 3ZHBA 1ZSNA 4RIGA 1XI2A 2XKAA 5AK3A 1OR8A 1VMKA 1VYHA 2L18A 1YVRA 2PCLA 3AR2A 2NV2B 3PQ7A 4GLFA 4GX0A 2XUHA 3GEPA 1JAHA 1LGYA 3TRJA 4WIAA 3LDUA 3FOZA 1ONNA 2A0FA 2DQZA 3LC0A 4QGAA 1KJJA 2QW1A 4LYHA 4QU9A 4RF3A 4Q9HA 3RTEA 5B7GA 1I2DA 1O94A 4JV5B 3GEIA 3ZI7A 4OX9Y 1PGOA 4CIDA 4ZQGA 1VKHA 3VYTB 4BLQA 1HLPA 2DT8A 5K05A 2V5AA 4K3UA 4TYWA 3LY7A 3UKDA 2ESRA 5BQOA 2ZAOA 4BVLA 2QTVA 2ZG6A 2B8TA 1R3DA 4G86A 4JI5B 3T9CA 4HRYA 2DR3A 2NUTB 3IO5A 4BLRA 2H3HA 2H08A 3WRXA 4TVBA 5JQGF 1AMOA 1J90A 2QIPA 4A8PA 1GZ6A 2XTJA 5EPUA 3M83A 1QX3A 3LKZA 1DL5A 2OD7A 2PRZA 2FW9A 1GCUA 2BFEA 5ALLA 3DPSA 4ZVLA 3SBDA 3V1KA 5KDOA 1L4NA 2JKVA 3AFMA 4YQYA 1AKYA 1GPMA 4JI3B 1P4GA 1QP8A 1U0LA 4IOJA 2BZ1A 2HBQA 1NUSA 2NTEA 2POQX 4Q4AA 5K0NA 2XCUA 3VZSA 2G9NA 5SZIA 5FKJA 1UBKS 1ZD5A 3D7SA 2FG7C 5L3SA 3NOQA 2YIVX 4IIJA 4UCQA 4YRNA 2JLVA 4BKUA 3C7DB 1TCUA 2W8ZA 5HIIA 5I9LA 3L0CA 3RSGA 2YC2C 2YNMD 4WHMA 2P0YA 4C1NA 4NBVA 1QYDA 4ENVA 4DRXA 2C7PA 1UDXA 4O2BF 3VKGA 2C3MA 3KJZA 3N2KA 4EGSA 1WW8A 3JY6A 3SC2B 3ECAA 4TRNA 1TJ4A 2WKPA 3OM0A 5EWLA 4CM8B 4U6SA 1PFYA 5CLIA 2UYCA 1FYWA 3IBTA 3TPFA 4HUQA 2HHHB 2IYFA 1EM6A 1OFHA 2UYQA 5B36A 2PUGA 3A4IA 1LEHA 1GG8A 4B8YA 3HB5X 3U3JA 1V8DA 1JB1A 2GFQA 3LUAA 2CF5A 2C20A 1N2CE 1UBFA 2GEKA 1W36C 5MN5A 2A58A 2BE9A 2ZZMA 4JP8A 3N9IA 2NU9A 2C31A 4E31A 1KFKB 4MZDA 5FI5A 2ONYA 3B9QA 2O19A 4MLDA 2OXEA 2I8LA 5FA6A 2AVNA 3EDCA 3AO0B 2SECE 1O89A 4L5CA 5L4NA 5J2UF 5J2TB 4CLEA 4CR8A 2YVUA 3WK5A 4R83A 1KK1A 5F1OA 5JNRA 2H4FA 2YY7A 3ICEA 1E7YA 1QDUA 5LMUB 2GZDA 2AZMA 1HYGA 4R8RA 1W5SA 4TWRA 1Y3HA 2VDKB 5SV2A 3ZHUA 1QPZA 3GHYA 3VAAA 1MUUA 2FMUA 4UZEA 1SC9A 1IDN1 5IC4A 2B1IA 1NYTA 4FYPA 3ZY3A 1U3DA 3A3OA 1EYZA 4NCAA 3VYWA 1B00A 1IZ9A 1W4LA 3OKPA 3PFGA 3PFKA 3LFHA 3I3SR 1AKWA 4KOAA 1H0RA 3EFHA 4LHYA 4CM4B 1RTTA 1QOPB 4OKSA 4AKIA 5DYNA 3IERA 4Q4JA 5J5AA 4P0PB 2PFGA 2GEDA 2ZIWB 5JG7A 3EX7C 1KKLA 2N75A 2I3GA 4JYZA 5FLYA 1L2TA 2F4VB 1UANA 3AP2A 4AULA 4QGSA 4MP6A 1NI5A 2VSQA 1E96A 1DT5A 1Q0HA 1GU7A 1Y3DE 3KKOA 4Q7EA 3OFJA 4HDQB 1I33A 5AKLA 5HIKA 1LDMA 3EQ7A 1W5TA 2FSFA 5IZCA 4BKQA 1TK2A 4WGFA 3ELYA 5J63A 1AQNA 3GT7A 3TEMA 3K0KA 5GIPE 1NW4A 2J6HA 2FJPA 4GP6A 4MKZA 5EUQB 3LV8A 2E5LB 2W6ZA 4OM7A 5TF4A 1FE8A 3R1IA 4QNNA 4FQ5A 3KQHA 2P9GA 1TUBB 2VHJA 3JASA 4GKAA 3MBIA 2REXB 4II3A 4NZOA 2ZWMA 4MYTA 5LZ8A 2PFSA 2MSKA 3Q0IA 3V7WA 2VNSA 4TL8A 1RLOA 3AERA 1RRVA 3I01A 1HE4A 3NS7A 4AJPA 3MA0A 4XR9A 3F6CA 3EQ9A 4EYSA 3BMOA 4O4JB 4W1SA 3WQQA 1EJ0A 1SD5A 3A04A 3PXXA 3LY9A 4M3NA 4NJMB 1T6XA 3KOXA 3T6KA 3WB9A 2ZRAA 5BVGB 3DVAA 1QYCA 3ZKAA 3AVUA 4WVLA 1N7IA 2X2PA 2FPWA 1U3TA 3M4XA 3OCYA 1AHIA 3DL2A 1IN4A 3KQTA 3LL4A 4RY0A 3THWB 1U3GA 3M6AA 3OUTA 5E2BA 4FXOA 3V9AA 5C5DA 4G5YA 1VI2A 2EJCA 3U16A 2WQ6A 1VKOA 1RABA 2IOFK 2F43B 1YCFA 2ADOA 1PFKA 1CJCA 1RWKA 1SBCA 1XZHA 1M0WA 5F5XA 4CMCA 4DVGA 3FWHA 1GQSA 3SZMA 5C8YB 1EMDA 1PR9A 1S8FA 1Z4PX 2WYWA 4IVNA 5L7TA 2HRQA 1KAOA 3AHFA 1QFMA 4LPKA 4EWLA 5IAOA 4AP6A 2CNWA 3EVDA 3K9BA 4OH1A 2ES4A 5DTJA 2F3TA 2PT5A 1FDIA 4H7KA 5BMOA 2FETA 3PJFA 1G21E 3IEMA 1IIRA 1NVDA 2XXBA 4JJKA 5HK8A 1SXHA 2C2MA 1KDVA 4D3ZA 4F3RA 1W36D 3BQ9A 4UQLA 4A0HA 3GYBA 1RAHA 2CHGA 1ZWLA 3VR4H 3IAXA 2O8CA 4XUEA 3BOSA 3I0NA 4K6MA 1NR7A 1PJTA 4YK7A 2OHVA 2H5LA 3O82A 4V03A 4XFJA 4XWTA 1L7VC 1F0KA 4YCDA 4D9GA 1T36A 3CZCA 3KTOA 3SXUB 4BO0A 5ICEA 4URZR 3N3BC 2B30A 1BMTA 1J8FA 1JR4A 3KVNA 4CNQA 1L1FA 1OBHA 4DWWA 2NO7A 3TUJC 3H1FA 2AJ8A 5AW9A 1IWOA 1IUOA 1IZYA 2V9CA 5ETJA 2JGRA 1FF9A 3ETJA 2RIRA 2RD2A 1CUEA 1D7AA 1EXNA 3AM4A 4Y1RA 4QTYA 4KKXB 2ZIVB 3TD6A 4J1QA 5K8VA 4YRRA 5KYUB 3K73O 5E9WA 2JEOA 2PUJA 3L46A 4ALLA 4EOGA 1EFVA 5IW8A 4DLAA 1WEHA 3FY4A 5KHOC 2QG6A 2HX1A 2WUWE 1M7GA 2ZYWX 3HHPA 4WASA 4HEA6 4CG2A 5AUPB 2PCJA 2FPSA 3LK6A 1PTJA 3OZFA 2ZQZA 2WT4A 4P3YA 1J0BA 2WU1A 3I8XA 5P21A 2NAFA 3R4VA 3CRMA 1ESDA 3HVRA 2FGJA 3SYRA 2H54A 2NTJA 2O8NA 1Z2CA 1Z4NA 2HCBA 2WYUA 2YYAA 2ZKLA 3CEMA 4I1IA 1NP7A 2O05A 2IVZA 4PFJA 3ILYA 5CA0B 4HD8A 5AJXA 3LHDA 3PNBA 4M9ZA 1R0LA 2GHQA 1Q3TA 2H4XA 1QXSA 1JFVA 1ZI9A 4GEKA 4M1SA 2DY0A 2IKSA 4DSTA 6GPBA 1OH5A 1BDHA 1W29A 4KR3A 3ZK9A 5EMKA 1NSFA 4C29A 1OXXK 1IU9A 1EEXB 2FFHA 4UQPA 3GH3A 4OP3A 5JWOA 2VUSA 3TTXA 1W73A 4RZ2A 2VUHB 3HA5A 2PX3A 5DTIA 3UAXA 1TAUA 3CW2A 5JIBA 1ODTC 4N5IX 1QCZA 3K4PA 2D0OB 2ZUCA 3EC7A 3F6YA 5GAJA 1YZYA 1N25A 2I34A 4OK5A 3VKHA 1FRVA 2YASA 4KX5A 1YV9A 4NBUA 1KYQA 3GGDA 1HKHA 1TO6A 2Z30A 2WOOA 4NAUA 2GK7A 4ZYYA 1BXGA 1BMDA 2RHBA 1Z4LA 5ADUS 3OSUA 4PZDA 5HCUA 3RSHA 3HJHA 3KYJB 4HZUB 5EKTA 2AHOA 5ECGC 2G1PA 4DVJA 2PTHA 3L41A 4XDYA 5JZVA 3GLFA 1PNOA 1K8QA 1JHYA 1Y9ZA 1H3NA 2BFBB 2PSEA 1GUYA 1EFAA 2P3SA 5AW5A 2C7VA 4HNTA 5KVSA 1EESA 2H0RA 2GLTA 2Z95A 5ECYA 1R7RA 2QVXX 1KQ3A 4EZBA 3X2FA 1U7HA 2WAYA 4BY9E 4E5UA 3KXIA 1XKLA 3Q2KA 3FB1A 2NVWA 5I4BA 3GRZA 3D7LA 1PZGA 2DWUA 5FUVA 1UPUA 2Y1CA 3EXHB 5GMOA 1G19A 1JW9B 2V6IA 3THXA 4IEFB 3SIWA 3OFND 4D3YA 1V9CA 1USKA 2P9JA 3QV1A 2FMFA 4FOTA 1IULA 4G5QA 1HDXA 4URHA 4DC0A 1A9XA 3AVYA 5ERGB 5FNVF 3WNDA 3E3OA 4G0OA 1FTNA 4ARBA 2IZ5A 2ZXFA 2OBMA 4WBSA 1JQDA 3AHCA 3LWDA 3GLSA 5GZ3A 2DZDA 3QUBA 2OFWA 3DFZA 4R3NA 4I5FA 4XPIB 3E9ZA 3ILSA 3M6FA 3QWBA 3TNJA 4X1OA 4LF9B 3PHCA 1BFDA 1NMSA 4MUXA 4CT0A 1RAEA 1KJYA 1ZUNA 5AI5A 5IAEA 4ZO9A 2F64A 2UUCB 1S2NA 4N6OA 4BWYA 4ZDWA 3FOEC 4YUYA 4Y0AA 1NQAO 3PC2A 4LNUB 4BMYA 1OIXA 1UWLA 3UJ7A 1CPYA 2C94A 4I81A 5L40A 1CJTC 1V4BA 2BD0A 1SBTA 2J09A 3MWYW 2QENA 5F78A 4E4YA 3QQPA 2ZUUA 8MHTA 2NXEA 3KQMA 2ZVDA 1G18A 3BH7A 4G0XA 4PYRA 1N8NA 2F3UA 2HF9A 4P9NA 4ZYVA 3EPLA 3ORHA 3SICE 1M0EA 1GGFA 3PZBA 3RAJA 1RZ3A 3O1IC 4DABA 5BYAA 1ZESA 2FJUA 2Z5FA 1JDBC 1E77A 4D9HA 3HEBA 4KAJA 4JVOA 3BMCB 3HO1A 4IPTA 1RWPA 2DBVO 3HL4A 5KYWA 4AT1A 2FPIB 3WGMA 3OOYA 2GO1A 3L6UA 4BUZA 1DJPA 3H5AA 1NMZA 3MQ2A 1DQPA 3I6BA 1LBQA 1ZRNA 4PRYA 4WMLA 3SYKA 1F14A 3ZJYA 4A6EA 3SIRA 3GRAA 2C0PA 3IRUA 3TXAA 4FE7A 3VUEA 121PA 2ACVA 1I3KA 3L6OO 1NJ2A 3HDVA 2DWPA 3BE6A 3PPIA 3ZNOA 2WSBA 4KG7A 5H8WA 2GF2A 1IQPA 2RHHA 3OX3A 4MV8A 4S1TA 1D8TA 3SQNA 3WSTA 5JQGB 2X77A 2AN4A 3MLBA 2WUGA 1JWAB 1OA1A 3TFQA 1E1KA 1DWOA 1GEGA 3OQIB 4IV0A 2EP5A 1DVRA 1M67A 2QLFA 4MUYA 5AI8A 5AVOA 1FFEA 1QAQA 4US2R 1S4MA 1L9KA 3QXJA 3BPSA 3IBYA 2KBFA 3KWJA 2CJPA 3R5XA 1XDBA 4B45A 5HQ3A 2Y0EA 3NBQA 4IIEA 5KNBH 1WNTA 3TE6A 4XTRA 4LV5B 4JVMA 1R50A 3O1HB 3QOXA 3F47A 3DDNA 3OCZA 1Z68A 4LJ5A 3ZNNA 1KE1A 1FSSA 4EPWA 4DB2A 5EJFA 4EYEA 3VOSA 2D2FA 5FBQB 4ZJUA 3FOBA 3IPXA 2H52A 4OHXA 3EOBI 1CR1A 4DBLE 1T2FA 3DOJA 1Y8QB 1M8KA 1FS4A 1SUSA 4O2BB 2Q5JA 2RB5A 3WXBA 3ZVLA 4R8SA 3PT9A 1RAFA 2FSUA 2I1WA 2C8JA 1QH8B 1UM8A 1D5CA 1WY5A 1YUNA 1Z0AA 1U8ZA 2W2LD 3CF6R 4MCIA 1KZHA 4DMLA 5A0TA 4M0LA 3T9AA 4MICA 4UU7A 2GCNA 4TYNA 3B52X 3PI7A 3NIFB 5G0VA 5EUCA 2ZJ6A 4FYHA 3Q1KA 2ODBA 2E49A 2EDAA 3DFFA 1XTJA 2PY6A 4Q7MB 3CN9A 2JFZA 3JQGB 1RC1A 2EW2A 4YJFB 5DXJA 5TQVA 4C01A 6Q21A 2JFQA 1XDUA 1L5QA 2Q2VA 1ZNQO 3QEKA 4JROA 2PMEA 3SQDA 2ENUA 3PIIA 4QT0A 1H1LB 5ED0A 3NFYA 5HF6A 3PNMA 1M2OB 3H99A 1DKOA 1IEXA 4V0NA 1LJLA 3K30A 3WOHA 5EJ4A 2WFZA 2OAP1 3OOSA 4WWHA 4AB1A 5JXGA 4ZIRA 1Y80A 2XXJA 4OOFA 4RH0A 1SU4A 2BC9A 4KITB 1ADBA 5F2EA 4V0KA 3VVBA 1KHTA 1LPPA 2QUIA 3CSSA 5JAOA 1G8KA 3DHNA 1FJHA 3ER8A 1O95A 1Z0IA 1AT1A 2I2FA 4GZ5A 3WB1A 4EHKA 3WKCA 3TZEA 1IPHA 3AIIA 1PYOA 1Z17A 1NFRA 3KXLA 4XKJA 1TT5B 4CIAA 3ETCA 3P1JA 1Z6YA 2CE2X 4EO7A 3IVRA 1VIMA 1YR1A 2BKEA 1LY1A 4TZTA 4CETA 1S3GA 2QRPA 1EUCA 1CQPA 3N5KA 2ECKA 4B71A 1FRZA 3FHCB 1M2FA 5JISA 1J0DA 3C3MA 1N6LA 2TYSB 4LHWA 3I9LA 1XDGA 4UUQA 3E8SA 1J23A 2IY7A 2OV6A 3HXPA 4YYEA 3ZE6A 4B6RA 5I9NA 3UMSA 4B6FA 3TRDA 2WSMA 4D6XA 2D00A 1DWUA 4W5NA 1X7GA 3LCMA 1AXEA 4L3OA 2CUNA 1MBZA 1T25A 5FPPA 2JS7A 4QOGA 2Y6VA 2CXXA 3IHKA 5TGDA 2I9KA 2P7IA 1OOEA 1QHFA 5E2AA 4B47A 4OA8A 3Q1LA 1MR3F 3PNQA 5I9TA 3MHTA 1ZI8A 3ZUGA 5DU2A 5AUOB 3RIMA 1R66A 1BZYA 4EGCB 721PA 4RDHA 4YT8A 4AF6A 3QX3A 4BQQA 4RMHA 1KO5A 3CG4A 2J8ZA 3NIBA 1QH9A 1N2OA 1QX4A 4X94A 5HTOA 4XGRA 1C8BA 5LP6F 3MGBA 1IZZA 5C81A 5E3JA 5EQJB 3A4TA 4GMHA 3SS7X 5TS3A 2YUTA 2IEDA 4OQMA 3PJGA 4M0DA 2QTBA 1ZH4A 4EHFA 1P17A 1CC1S 1GGHA 1SUFA 2CVZA 2XI4A 4DLKA 4F7DA 4HLUA 5F1KA 2W6OA 2PXAA 1Q16A 5JY6A 1K6XA 3A28A 3HUFA 2ODTX 3IP3A 4RBNA 1QS0A 2ZVJA 3AM5A 4OJQA 4ZU3A 1ZM4A 3AW9A 1Y8RA 3S1LA 3TOZA 2IBTA 4CMJA 4FD3A 1I8TA 1SKUA 2CW5A 1UBJS 5B2FA 3LD9A 1CUWA 5A05A 2I8CA 2B3TA 2O7RA 5AK4A 4QWMA 3O91A 4UBOA 1F17A 2OB1A 4Q3CA 4KI7A 5DYTA 4ZMSA 2VHEA 3F7TA 2JFNA 1PJ3A 1E8NA 1KR2A 1T3ZA 5CVVA 2WTMA 4MQ4A 3A1FA 1NG9A 5DMHA 1FBNA 1HZJA 3DZBA 1FYXA 1TUGA 2DAPA 2VDLB 3HKDB 4O0LA 3I1YA 4JLUA 3ZVRA 4YC7A 4X91A 5B3JC 2ZBGA 1A04A 1XXHA 3HV2A 3CR7A 3W7BA 4EATA 2VNKA 1GYRA 1LTHR 1Q1AA 2W2OA 3NQ41 4LJ9A 3VOTA 4L08A 4F38A 10MHA 3I37X 2GJ4A 3UXEA 3O73A 3ANYB 4KUGA 4Y0NA 5B6PA 3H2SA 1DC5A 1LFDB 2X15A 3PRHA 1DC8A 1NVBA 5TRTA 3NLLA 4BWVA 2QUBA 2QOEA 2NO1A 3CEJA 3L01A 3PHGA 4TQGA 2VEDA 3LXUX 4C4RA 5KVQA 1U2DC 3RIGA 1QO0D 3JARA 1W36B 1T6BY 1UFVA 2ACWA 2E4YA 4M55A 4QC2A 4BX0A 1DWPA 1M6HA 1RLIA 3DB1A 3KPVA 2BSXA 5DTRA 3UHAA 3G17A 3U44B 4ZCLA 2RGDA 2BGLA 3IAFA 1K4YA 4Q3OA 2OXTA 1XMVA 3H8WA 2Z2IA 1JR3E 3D1JA 1HKUA 1OROA 1X1BA 2OC9A 3EG9B 4A5OA 3DEZA 4GI5A 3C85A 4B3XA 2QF7A 4K88A 3EA5A 2ZUBA 4G67A 1Z63A 2X9GA 1J8QA 1YZUA 4ZICA 4IQFA 3AUFA 3DZ8A 1P5ZB 4JLJA 3G2KA 4DV5B 2HMVA 5AK0A 4KCGA 1P3DA 4P58A 2ZT6A 3C4JA 4LDNA 3SHVA 1T9KA 3PXCX 1U6JA 5AJUA 1FFCA 2WFAA 1KZ4A 1EJ2A 1SEPA 5ILGA 3L7NA 3EDMA 1DEXA 3E0XA 5DN9A 4A8HA 4EVIA 3EUAA 4BAUA 2C7OA 1P33A 2WT9A 4L3WA 1MC4A 3P2MA 4B4DA 4F2HA 1NRXA 2PD3A 5DGHA 2AXQA 2Q2OA 3KSMA 5IAJA 4D02A 1FS5A 1R6DA 3EDOA 3NHPA 4UNPA 4B5KA 2UU9B 3VZBA 4ZQFA 3TW8A 1PNRA 1N5KA 4J94A 1CQJB 2RONA 3UJCA 1RMTA 1U28C 1WDTA 1RYBA 1PT7A 3CH5A 3LUDA 4DG9A 3THSA 4FCWA 3TN7A 1OILA 4X92A 4PAMA 4AZWA 3G79A 4EGFA 4JOBA 2XUKA 2ECQA 1QDLB 3DMPA 5T57A 3OQ6A 5TGZA 221PA 2EL9A 5EPEA 3UFXB 3HLYA 3TQTA 1BTOA 2L42A 2VSNA 3IUEA 3T99A 1T1JA 4B9EA 3ZUPA 1Y63A 5KINB 1E3DA 3DD5A 5AJHA 1RZVA 3F7OA 2N3ZA 1MA3A 1COWD 3W04A 2H9IA 5A62A 3T5PA 3CINA 3HXKA 3JWPA 2FWNA 2J7KA 4QATA 1E3SA 1EVEA 1FFAA 2PMKA 4X00A 3E4DA 2FJ0A 4PFSA 3ZQ4A 2YW9A 1QBGA 4EYQA 4Q05A 3OLZA 4BEWA 1CETA 5E9JA 4L16A 2DSTA 1GHTA 2GZMA 4WD3A 4AUKA 1GRVA 1NI4A 1QMPA 5IJ9B 3PFBA 1E2EA 3HCPA 1YQEA 3SD7A 3UC5A 2BMAA 1R0WA 2JGKA 2YINC 4CMIB 1SN7A 4IGAA 2MHCA 1MQSA 4YLYA 4WKCA 1PVOA 5JANA 5I9SA 3BIFA 4DSOA 1KDZA 4YJ3A 3T5TA 4H16A 1M2VA 3K2IA 2EGUA 2HA7A 2GDZA 2Y2VA 4II7A 1OB5A 3O6VA 5H16A 1QO9A 5KUTA 1HA3A 4AW9A 5FNVB 1NW3A 2J4DA 3VC2A 1XJ5A 3UUWA 1NASA 5LD2B 3V8NA 4F11A 2AJDA 1E9FA 1FTYA 1I4WA 1W5EA 3OE4A 1GL7A 4JUBA 4B7AA 4LDZA 3RC2A 4BMNA 1HSOA 3Q3JB 3BL6A 1RKXA 2CMHA 2R96A 4BQSA 4EF6A 1HMPA 4D25A 3QXHA 1E1CB 4C7KA 4R41A 5IYZF 4C6TA 1QRTA 1XUOA 1NV8A 2ZDQA 5JFTA 1G20B 2HLDD 1NC3A 4D3XA 1P8AA 5D3MA 1Q7EA 3TTVA 1UK8A 4CEHA 1REQB 2PKXA 2Q5CA 3BULA 4FHGA 3C4QA 3TIVA 2FH5B 1QRAA 2ZAMA 3BBLA 4NBRA 1TC1A 2EEZA 3UK7A 4BLPA 2UDPA 1ZH2A 4IEEA 1Z25A 4CDGA 1IXRC 1HE2A 3DMHA 2LDXA 1JYSA 1Y7PA 4O4HF 4DKJA 2K87A 4PLPA 2EX4A 3H83A 4D9IA 1OZGA 3IIJA 3MBKA 4RE6A 3ESBA 1O4WA 1U3UA 1WTAA 2GS9A 2FPOA 1QVZA 3GUYA 3CMCO 3HKBB 3QENA 3ETEA 5IDYA 2DUJA 5HRUA 5HKOA 4RTPA 2PGDA 4L57A 1Q0PA 2X0KA 3RHTA 3RYHB 5JZBA 3VJRA 3OZDA 5HA5A 1QHSA 3IODA 3DLPX 3HKEA 1BGXT 4IWNA 1GDDA 2BFOA 2NWQA 2YW2A 1Z5WA 4Y67A 1S8OA 3OZAA 3T3MB 2Y66A 2EFCB 2FI1A 2PRYA 3HB0A 2WUDA 3AILA 3NATA 1Y5LA 2GD1O 3IEVA 1DQZA 4KSCA 2G36A 5LXTA 1TE2A 1ZBQA 5CXSA 2OK7A 3HZZA 4TV8F 3BQNB 2FSVC 1YT5A 1NKTA 3SMVA 4EUSA 3MWJA 5CH3A 3PQEA 1AKRA 4Y3UA 4FB5A 1AKMA 2XMGA 4BRUA 1S96A 2XSZD 2BP7B 3BVPA 3EF3A 4I1OA 1PT6A 2VF7A 1TTHA 3IO3A 3VHXA 3KR2A 2VA8A 4NAHA 1HNZB 1E2QA 2ZQ5A 4KNVA 1G60A 2QR3A 2A1IA 2BVNA 3VKWA 4MS1A 2GD0A 2GESA 4JI1B 1L8AA 4I46A 2FSPA 3IKMB 4CFZA 1SWWA 3WLTA 4B0OA 3NRCA 1IHXA 3DCNA 3W3AD 1OFTA 2NPOA 2RAUA 2WBLC 3LDGA 4AKSA 2QMEA 3K0CA 4QE3A 1Z0FA 2WTAA 3EXEA 6ADHA 2G0AA 2PRSA 1RC8A 3TDMA 4GMGA 1TFUA 1NQ5A 4JLOA 1AF7A 1IEQA 1H0KA 2ANCA 2AW3A 4KWTA 1L4EA 4KP7A 4QYTA 4O4IA 1MJNA 2X8WA 3I9FA 5BN4B 5BW8A 4L28A 1OIWA 3O31A 1DOAA 4RH3A 3LCUA 5AVRA 3FUUA 4AJEA 1DJQA 3DGEC 3EJWA 3BRQA 3QW2A 5FBRB 1EUDB 3A70A 5K8TA 2J6IA 1ZM7A 1HYHA 2FHPA 1MAWA 1NM5C 1EP1B 4GLLA 3R9IA 3WYEA 4Q3BA 3VU0A 4K46A 3RVLA 4TKVB 4ENWA 1TW3A 2WWWA 7MHTA 3Q12A 2DP4E 3RWOA 1I13A 5JRJA 3BFJA 3FZQA 1N2BA 5DWQA 3VNVA 4KMRA 3X1DA 2IYLD 1GLVA 2VOJA 1V1JA 1HL7A 3DE7X 4FR5A 4B8WA 3KQUA 2ZIUB 5HILA 2R65A 5BSMA 2BBSA 3TB6A 4D41A 1LTKA 2BFDB 2NXJA 3ED1A 5FTMA 1DAIA 3WDSA 1NW9B 1ZINA 3VI4B 2QQ0A 4JASB 4C0BA 1DZ3A 1EVKA 4Q4HB 5AXAA 1IRXA 3A27A 4UHCA 4TQAA 1JJ7A 2AMJA 5FRDA 4J90A 2JANA 3U4MA 1DE0A 3IJPA 1SB8A 5KTOA 1T1EA 1KBOA 2QJRA 1U7WA 2FP4B 3OKAA 4YPVA 5B37A 5IJWA 2FUCA 1XMJA 2R7NA 5HJEA 1XTBA 4WUVA 3H7AA 4GKVA 2JAUA 1NW6A 3D3EA 3U7HB 2FPXA 4Q3EA 1NSYA 1TM4E 2IS6A 2R6CA 3IURA 1U63A 5JSQA 1IE3A 1GCGA 3DMTC 1R3UA 1XNGA 4PX2A 4XEHA 3ZYZA 3H9GA 3M5PA 4RE5A 1Y6GA 1KJNA 1ZFNA 1PJQA 3VV2A 5HGJA 2B92A 1KKMA 2XWBF 1YFKA 3PDHA 4P98A 5DCUA 2P4SA 4BNJA 3VR5D 3GEDA 3MINA 4MW7A 4F71A 1T6YA 2ETXA 5IEJA 4RY8A 2ZRMA 5F12A 4J3JA 1AZWA 2GSDA 3DHVA 3VKVA 4BO8A 4CCAA 5BW6B 1JDBB 4JB0A 5TQ0B 3N70A 5JZSA 4URXR 4TTSA 5H3CA 1DIHA 4O59O 2WU4A 5FI1B 2LR0A 4DA8A 3T61A 1JG4A 3TVTA 1DBSA 1T2VA 4LZOA 4D3SA 4I3FA 1E20A 4Q9NA 3DUWA 5ISMA 1DG1G 1JSCA 3WRWA 5A9RA 4JYMA 1EAYA 1S7GA 4XYMA 5ARBA 2I78A 2FQQA 4PN7A 3Q8WA 4X1IA 3E7WA 3OWXA 1MHPA 3KEMA 1HT0A 4J7XA 4X41A 4L9WA 1O0SA 2MWMA 4PLWA 4X7PA 2QPTA 4RYDA 2ORWA 3W6UA 4UPDA 3WISA 4GBED 1BX3A 1HORA 2J9FB 1WABA 1GSIA 2AHRA 2OQRA 3D6UA 1A7KA 3W8RA 2OGSA 2AL7A 1R5OA 4FIDA 4YTEA 4OSEA 4CR7A 4TKUB 5I3ZA 3L4BC 1X1DA 2JFUA 2OV8A 5HKLA 1EX7A 2PMBA 5CW2A 3COWA 4BXOB 4KDRA 2JD1A 4BBJA 1D2EA 1JBQA 4AN0A 3SJZA 5A3RA 2GEVA 5KWVA 1ZJZA 2VWGA 1A97A 2R6ZA 4N7RA 5CNJA 1M34B 1R88A 3GGPA 3IH5A 5ALHA 5GJWC 4AS1A 1QF6A 2A9FA 3L06A 2NT3A 1KMMA 3R7SA 3C4VA 1OGIA 3WIOA 1I9CA 3HA3A 2GBGA 3L6RA 1VRWA 4ZODA 1P1RA 1AC5A 1H6CA 1C3LA 2QU7A 1J0CA 4M6WA 4L22A 1GL9B 4Y18A 2ZUDA 2E7ZA 1QHIA 1J1UA 1L7AA 1I3LA 2G9RA 3OPMA 4TVKA 5JXJA 1QQBA 2ZGVA 5J5CA 1UIMA 1WPQA 2DPYA 2HT1A 4GICA 1K5GA 1Q0RA 2JGDA 4KQXA 4RSGA 4L0MA 5AVVA 3JD0A 1J5EB 1CY4A 3DZJA 4JU9A 4QDUA 2ZU0C 1GNPA 4F1KA 4G8CA 2QE6A 2BGKA 1TYEB 2B4YA 2QE7D 3JQCA 3PD7A 2VDVE 1OXKB 4NL4H 1Z83A 3TPCA 2AFVA 3NPAA 3SQLA 2IWHA 3FYUB 5AW1A 2XB2A 1TZCA 2DPMA 4OJKA 4WN3A 3WLHA 1A2BA 4EW2A 5IU6A 1Z6PA 3K1JA 4L8LA 1X7XB 3C8MA 3ZE8A 1BA3A 3DDCA 4M1TA 5F98A 1IOVA 1VL5A 2ANBA 2P1DA 4KTTE 4XXHA 2DB3A 1VJ5A 1RRFA 4OQLA 2KBEA 2R9VA 4I5EA 2VXYA 3GXBA 2K5UA 3GMTA 4B84A 1GAEO 4FR0A 4QM7A 2JD2A 5CDGA 1A1VA 1FFWA 2NV0A 2IYQA 1OHHD 3NUQA 4NBSA 2XUPA 4QPJC 4POOA 3W6ZA 4BE9A 3MBOA 1KOGA 2IJGX 1QONA 2XYVA 3R9XA 4NU0A 3IQXA 3WGNA 4DR7B 3RSFA 3D6JA 2C9BA 4INJA 1XD8A 4MV3A 2HIGA 3EGXB 4MJ3A 5ALSA 5FWXB 1Z5GA 1QP7A 2HRZA 2OHGA 2BONA 2DVMA 1JIXA 2FHSA 2QYSA 2ZJZA 3ORQA 4MR8A 1XPJA 3ZU5A 2HFJA 4NU8X 3ZWDA 4GMDA 4RVFA 3RF6A 4IP0A 1YZLA 5KNBA 3U17A 1RQRA 4JX9A 4OV6B 2QL7A 2X7JA 3AR6A 4I14A 3LG2A 3GRYA 2IF2A 3UK6A 4BQNA 1RIFA 3R75A 4ZN6A 1VBFA 4JFAA 4B76A 2YVKA 2JBAB 3F4KA 1DC7A 4JGBA 2ENWA 1A27A 3ANLA 3IA7A 5LA6F 2RK4A 3ZR4B 3Q8MA 1I3CA 5LDDC 1L4FA 3K5HA 1YJBA 2FQWA 1WCXA 2B34A 2JFWA 5L3ZA 1NMXA 2LW7A 2BDEA 3B51X 4DYVA 1NVMB 1VMAA 4M8LA 5F7ZA 3UV6A 4CCSA 3AHGA 5I9MA 4RULA 3L18A 3NAZA 4QGBA 2UZ1B 4D45A 4JWTA 1N3BA 1J8MF 2JIPA 1FVXA 3LKDA 4KQFA 2O4CA 4L9SA 3ZZTA 1ZD9A 2NZJA 2XMDA 4I55A 1OAKA 3GLGE 3FNBA 1J5XA 1RYMA 1L8OA 1AS2A 1XTVA 3IVCA 3N8GA 1FFDA 1U31A 3VAYA 2I2BA 4EDHA 4FT2A 3WMFA 5EJ8A 2G8LA 2VDMB 3E5NA 2Q3MA 3OKCA 4CKEA 2WSSA 3L0BA 2NTYC 4JB2A 3RTCA 4EZEA 2AZDA 3FROA 1DARA 5FORA 1AUOA 4AJ9A 2PS1A 2QI9C 2BLNA 5ICGA 2V7EA 3EZ6A 2RGRA 1E2IA 2QLNA 1MIHA 2A88A 4CI9A 1R1DA 1HBJA 3TR6A 4EYKA 4P4LA 1Z3CA 3KUDA 1RHUA 5I7RA 5IZCC 3KG2A 5K0BA 5D86A 5K2MA 5LCXA 3OM8A 4P34A 3GBPA 3PC8C 3ZGXA 4DMUB 2Q21A 1G17A 1W87A 3C98A 1E6KA 3UA3A 1MJHA 5BNWA 2B9EA 5ALPA 4OQPA 4PN3A 1DRJA 1GP2A 2ADMA 3B82A 5AHRA 1VPLA 3DOUA 1RYZA 3HYTA 2QLJA 4TLCA 1CZRA 2ONJA 4GBGA 4QA9A 4WLEA 4Y2SA 1NTRA 5JDIA 2V7VA 3TKYA 4HYYA 4EY5A 3OIWA 2ZSKA 3FXAA 1JE1A 2W71A 1BMQA 1Z2AA 5AXDA 3HTXA 1IPEA 1B16A 1GRRA 3NKFA 5I8PA 1W6RA 1Q0LA 2JFGA 1DQNA 4P31A 5J2TA 2P77A 1R2QA 1KI3A 3FZGA 2YYZA 1N0VC 2YN2A 2WICA 2W2XA 3EGDB 1QIKA 3NHYA 3PUIA 4BVEA 3SZ3A 3CLTC 3LY8A 1DRWA 4O4HB 2IPAB 1NJ1A 2BM0A 3E2MA 2CGEA 4B3TB 3DKVA 2O0MA 1CRQA 1SUAA 2YJ3A 4XQCA 5CM9C 1OA0A 3CUUA 4EY8A 4I1UA 1TJ5A 3I9KA 4PG4A 1SIOA 3AG5A 5EMLA 3T7DA 5GVRA 3UAZA 4B7UA 5KKCA 4URYR 2YXBA 2AG8A 4E0BA 5LP6A 3HCCA 2H06A 4RA9B 4J3FA 2H7CA 3A9UA 1YOVB 3OIYA 1TVKB 4QOIA 4IW3B 3RBZA 3GLKA 1USUA 4PPQA 4CM3A 3T4UA 3KHKA 5JSFA 3P9CA 5DT9A 4HLCA 3AUJB 3K53A 3K09A 2CBGA 3M6WA 3QBTA 3JTEA 3IVXA 4BCDA 1JQBA 4R31A 2M6SA 4HN9A 1WPGA 1O5OA 3BF7A 4Z5XA 1AE1A 1UXOA 3TR0A 3DLHA 1CVRA 1ZL2A 4XQ9A 1GNTA 4TTQA 4XLLA 4MRVA 5C4GB 5AIBA 5BUCA 1M2GA 3GJXC 3JTMA 2YCBA 1LH0A 2H8KA 2UZ3A 3QEMA 4D4GA 4ENQA 1B3BA 2NUPB 1ULHA 5HKAA 3TSYA 4RD6A 4IDNA 1N2XA 3MUNA 4ENSA 3ADKA 3K1AB 3WIUA 1DTEA 2GN6A 1DFGA 2ODWA 2QNBA 2VTKA 2VVTA 4HH1A 4KVAA 5FTNA 3TZBA 1LPAB 4Q1BA 1PR0A 3KCNA 4ZXPA 2PVSA 1JIQA 2OZLA 1Z5OA 3NEPX 3QVLA 3BA1A 3KOYA 1MAUA 1CE8B 2DU8A 2IW1A 4PX5A 3HR4A 3SFTA 4QHYA 4ZDJA 1Y4DE 5LU9A 4ZVKA 2EZ9A 1RRMA 3LKVA 1N2CA 4J7UA 1PRYA 1L5NA 2D3WA 2QVYX 3I6MA 5EL0A 2NZYA 1OKKD 2DBQA 1P80A 3MMPA 1EIZA 3N07A 3B78A 3HDGA 2CUZA 3GZNA 5KNCH 4J0FA 4PSAA 5DBEX 3VUFA 3GNTA 2TMKA 2YN4A 4AECA 2CWWA 3FCUB 3DEYX 4M7RA 5CW1A 3OLCX 4TZ6A 2PRIA 3H6HA 3R5KA 1ULBA 1Q2UA 3N5CA 3NXKA 1CUYA 1LJUA 2OGTA 3LFUA 2C4HA 3PEVA 2ZSDA 3QH4A 4XWOA 3IQGX 1YD7A 1R8SA 2R47A 4JC8A 4WLUA 4S1PA 4ZVSA 1J22A 1AGRA 2PWBA 1R15A 3RCBA 3K9WA 1E1MA 1HEYA 2B25A 2DMRA 3KUCA 3G8YA 4K9RA 4B0PA 4BNNA 4ZQIA 2C77A 3KKQA 3F97A 4PS0A 4QYIA 1YZKA 2EU8A 1JKXA 3SPXA 3ZQUA 3UOAB 2WWHA 3SYMA 4WTOA 1T5SA 3K6RA 3GJ8A 3A1CA 4L5BA 5ALRA 3SX0A 3WGTA 2EAUA 2XKJE 3AOEA 3AYXB 3ESXA 5AVQA 2V7QA 4G85A 5DASA 3HM2A 4HOYA 1ZCAA 4EW3A 1H3EA 3FNRA 4GBMA 4PTZA 3L7JA 2QR5A 4NE2A 1T9CA 4ZEMA 1SHLA 2JGFA 4DCGA 1CDZA 1VJDA 4BN0A 4WZBE 2V4UA 5A3VA 3RIXA 1UBTS 1C8VB 4PLZA 1WDLA 4PAWA 5B57C 5JCZA 5DV9A 4ND5A 3DFUA 3CLTD 4K1LA 5AHKA 3L7KA 1QIHA 1XRMA 5CMLA 4WN9A 2GCPA 3AY0A 2NSDA 5AI9A 3FRHA 3FVWA 3KLBA 4PU0A 1WXHA 4NBWA 4URUR 4D79A 1VHTA 2VZEA 4FYYA 3FD8A 1VLLA 2X8JB 4HWOA 4TMVA 4Z1MA 4AQDA 4F60A 2B1RA 2ZI4A 3MIZA 5DNDA 4FU0A 4P7BA 2MU1A 3VPGA 3QFFA 2WZQA 4B4UA 4HQFA 4LK3A 1BCSB 4ZMRA 2XYHA 3CX8A 3ISJA 4HGQA 4JLKA 2J0SA 1YUBA 4E11A 5LQUA 4CLRB 3DQPA 5BSUA 2JGLA 2VYVA 4L9RA 5EC8A 3CX6A 2W2VA 5BVGA 2CNWD 3IUSA 1Y1PA 4IHJA 1F2VA 2PLAA 3HBJA 3P5BA 1HG0A 4IJVA 3BGDA 1QGYA 1JQKA 3ZV4A 5HOEA 2VSXA 2LCFA 4LN1A 1NP6A 5AI6A 2HXGA 1YR2A 4FJ1A 4DNQA 5A02A 4B3RB 2C3UA 1CEYA 2FQ1A 3CNQS 3OOHA 3A9CA 3AB8A 2P8JA 2WVGA 3R77A 2J30A 1IHYA 1DINA 3F5MA 1UK9A 1HDCA 3WL4A 1JMKC 4OH7A 5G40A 5K3DA 3K0FB 1T8WA 1VP9A 2RDMA 2HPHA 4KXNA 2JHCA 1SHKA 3I1JA 3HL0A 1UBRS 1L5FA 4E5VA 1KYIA 5F3DA 2XKKA 4LVCA 3C3WA 1C9EA 1TNDA 4Y6RA 4Z8XA 1T3HA 4I4NA 2JGIA 2ODEA 4F96A 2CXHA 4H08A 4H17A 4IDEA 1YOBA 3CGWA 2P1RA 4ESOA 2BGRA 1J99A 4JR2A 4Z4CA 3G85A 3FETA 3WV4A 3ABRB 3L7IA 4IFBA 5L3VA 1POWA 1R6BX 2AQ8A 3EIWA 2IYUA 1ISPA 4B33A 2D0DA 4CDMA 1UWKA 2BTEA 1R8XA 3OQOA 3KJEA 5TB5A 3NT5A 1V16A 1PFGA 2UZ0A 3R6DA 4JT8A 1U90A 1EE1A 2OM2A 4M1EA 3IHWA 2CCGA 1BC5A 2GK3A 2J7PD 4JHXA 2HMTA 3N87A 4P7KA 1O8BA 1A72A 5AOVA 3H3JA 4QRIA 4ZI5A 3G2NA 2VP2A 2J9RA 3DBLA 3ZEIA 3KE9A 3TLEA 2O6HA 5LDGA 1ZK1A 5K3AA 3UBMA 5TVKA 5DI9A 4NX2A 2V0GA 4MKFA 4OLAA 1TPZA 3PEEA 1NQVA 3RVNA 4A0SA 1YRWA 4K8OA 1NVTA 2CL7X 3JQ9A 4A6DA 2JJQA 1ISGA 3DJYA 1NLYA 1JDZA 2WE8A 3S44A 3ZPXA 3CZ4A 4BHTA 5AW2A 3MSCA 2NP6A 3BL8A 4IGIA 4BEJA 3HXOA 1NXXA 1RM3A 4HRXA 2VJMA 2ERCA 3BORA 5I7WA 4ZCRA 2G8NA 4TTPA 2H57A 3HK2A 1T0PA 3MGCA 4BVJA 2J4FA 5BYKA 1R6TA 4F93B 4ZV7A 3SYTA 5E0KB 4E6EA 1EGHA 1RMQA 1XU9A 3K2EA 1YJ5A 4KO1S 5EZ5A 2BHNA 1JR6A 1L7XA 3FTEA 5JAUA 4YP7A 1MB2A 5AVZA 4TXLA 3ZWWA 5M3BA 1ABEA 1G5TA 3AFNA 3GP5A 3HG7A 1MJGM 4G5GA 2XNCA 2XMCA 4IDAA 2EQAA 2VHYA 4NFSA 4RVHA 4BLVA 4JBLA 1Z2OX 3R6LA 1EPUA 3BXEA 5EXTA 2BYTA 4UAGA 4S12A 4TTVA 3WB0A 1YXMA 3QLUA 3TI9A 1JXOA 2BGMA 3FDFA 4MR7B 5LR6A 4ZK6A 1LSOA 2A0UA 1LW6E 4EJSA 4K0KB 4XUCA 1XE3A 1G21B 1XRLA 2DM6A 5FH9A 2H1OA 3U3RA 1KI7A 4HBGA 4JVNA 4AY5A 1YDFA 2DJIA 1ENZA 3M5DA 3NM5A 3Q3VA 4G4GA 1QP0A 1Q7TA 3AJRA 3I53A 1XP5A 2VHZA 3TIIA 1A9PA 4KIUA 3ACDA 4NYMQ 5U4QA 1ZGBA 5C80A 1QDEA 2PJZA 4B83A 4DLRA 2K7FA 1T6ZA 4IIXA 4F4JA 4G1VA 3M6MD 1H4TA 1W5FA 3I73A 1K5DA 3SEQA 2IE0A 1QGUA 1QWOA 5I45A 3R3JA 4G26A 4Y9RA 4A6XA 4BFXA 5ELLA 4M8KA 4B46A 1UPCA 4E03A 5MDHA 3DYVA 2NACA 3AEUB 3UFBA 4D8WA 2UYHA 4U6QA 1I7SB 4MV4A 5JNUA 4EX6A 2V7WA 5LA6B 7GPBA 2NTVA 1CFJA 1SHZA 1ZK4A 1K3UB 2UUOA 3THYB 3JYOA 4C4ZA 4EPXA 2OAQ1 4ON9A 3S8EA 4L2IB 3VMFA 3HDHA 3FTPA 1RYNA 5E7JA 4JQOA 5JPDA 3QPCA 4U2BA 4I5IA 1GU1A 1AKVA 4OHUA 2GGSA 3EOZA 3P9SA 5AVXA 5G0SA 4JENA 5FFFA 1Y1LA 2VA9A 2D06A 3NYQA 4GWKA 5CB8A 2O2ZA 2FK8A 1TZBA 4ZYWA 3PA8A 2ZITA 2FFAA 2EXXA 3BB4A 4XA8A 3WJ2A 4DDKA 2W2NA 4J8PA 4E7PA 5DK4A 4WK0B 4LJRA 3N8HA 5CDUA 5E8JA 1IVSA 4IDGA 5FUYA 1E2MA 4EB8A 1ZOPA 4KK4A 1EDEA 4JI2B 3DW1X 1TD1A 1PDOA 4L4UA 2CV0A 2OZEA 1W88B 3AFOA 1ID8A 4Z0NA 4GNRA 4YRKA 1U02A 4YASA 1G8HA 1B3RA 4PHCA 1XCMA 5FOUA 2FSSA 5FOWA 4B4VA 1UMKA 2R6FA 3EQ8A 3WSWA 3SC3A 5F2NA 3KJHA 1YMUA 3H2JA 3TCXB 1JSRA 2AN9A 4KAAA 5KKAA 5TPZA 2QX8A 2WHYA 1XCPA 2NXNA 4KXVA 3X1WA 3DDSA 1E1DA 1SCUA 3QV2A 2FV8A 4DS3A 2V6JA 4KBGA 3G02A 5JHGB 1PL8A 1ADGA 2PEZA 2P5SA 1G8YA 1ZW6A 2QZ9A 4ZU6X 5FT9A 5IANA 3R20A 3L6DA 4FGKA 4QVGA 1IXSB 1NUQA 1ZGJA 1MQAA 2BR4A 3JVIA 3L6BA 4WKOA 1E63A 3TM4A 2O0JA 3I5XA 4PAGA 2Z43A 5E6SA 1WOYA 3VU9A 3PE6A 3KX2A 2FVXA 2VXBA 3KKPA 2O3JA 4F06A 1HX7A 4WJLA 2IXGA 4G4SO 4NC9A 1N8SA 3PLAE 3Q98A 3MM4A 5ALZA 1JALA 3SLKA 1MQ9A 2ZR7A 3BGIA 3F2VA 4BFYA 4BUJA 2FDCA 1TGVA 4IFTA 4N5LA 4A0GA 4KQHA 3TGLA 2JASA 2VSFA 4GYKA 5B58C 3AU8A 3DF9A 2XTNA 3KD2A 3CH6A 2NU7A 1YS1X 5IH7A 3JXEA 3JYPA 3LSYA 2C2YA 4MGYR 3DLCA 3FVQA 4LVUA 4Q4AB 1R64A 1RLJA 2GXUA 1UMBA 1V45E 1SKYB 2C5LA 2GCOA 2PL9A 3PGVA 5F21A 1V39A 2AD1A 2ZJ1A 5KJ6A 4YAKA 3LXXA 3RUEA 2JNWA 2VJKA 3TFWA 5KTNA 2EL7A 3ND8A 3NWOA 3AR9A 1FLDA 4CGZA 4F9EA 6NULA 4DRXB 3QE3A 4RS4A 3N2KB 1AD2A 5ALGA 4F1JA 1C4WA 1XDSA 3CCBA 4OFZA 3TGPA 5EWLB 1X1SA 1VFPA 4XIFA 1TQ4A 1LNSA 1P2GA 1TAHA 8OHMA 3DOEA 4HUQB 1PG2A 2CHFA 2CDCA 1T1GA 3GJ5A 1U4OA 3MPOA 3PSAA 3R3VA 4FGSA 4JEUA 2ABWA 4LDAA 3UANA 4BNIA 4GYJA 4DNFA 3IP9A 3M3HA 4JJ8A 4P3KA 4PBTA 5D6OA 1V26A 1FXUA 3LP8A 5TQ2A 2PSDA 2VNAA 2X3UA 1O95D 1FU8A 1NBIA 1OXBB 1RHJA 3ESDA 4HH0A 4N3NA 1MDBA 4PPNA 5BNFA 2HBZA 4EAAA 4P0QB 5D7NA 3ZCRA 3VMMA 1ZH6A 5IDQA 1RRCA 4DHEA 2J3HA 5EXXA 2RGUA 3UB2A 3FYCA 3WTBA 2BM8A 2VK4A 2W6NA 3Q87B 4HGOA 1RKQA 2VT6A 2ZRLA 2JH9A 5A0FA 2V3CC 5F51A 4X84A 4JODA 1X80A 1CUIA 1U0TA 4MWCA 1U2RA 3MNFA 4BE7B 3GJYA 2GCEA 2EWVA 2IX9A 4CDRA 3WRVA 1H2XA 2P7HA 5HXAA 4OXNA 3ZY6A 1CCWA 1LDGA 3H2KA 3FKSA 4JWKA 2W2KA 1M6VA 1E3IA 3S2YA 1J7KA 2VP4A 5IWAB 1SOMA 4O29A 1YAJA 3P71T 3QGMA 3HY6A 5EI5A 1SY7A 4INZA 4YR9A 3OT5A 4PGHA 4ARUA 3MAGA 1LX6A 2VLBA 5FBHA 2AKEA 2DUNA 2V1XA 1HRKA 4C30A 1QANA 4PZLA 4EJ6A 3S81A 1QIDA 4D56A 1DQSA 1LSJA 4K9OA 1GZSA 4OLBA 2CJYA 5EWJA 3TIGA 2HMAA 5G41A 2GBLA 4I2NA 4TSFA 1WKCA 4WW0A 1KP2A 1YDGA 1XNRB 2REOA 16PKA 3IP7A 1WM1A 2JHGA 4E5YA 1VG8A 1SBQA 3RVJA 4FDTA 3EZGA 5AKXA 1JU4A 9GPBA 3WWPA 1N5MA 2OECA 1JE0A 4CODB 1AIPA 3B5JA 4AKHA 3JASB 2VJYA 3A06A 1C4OA 2QRHA 4TWAA 3OZRA 3J7AC 3OLQA 4EB0A 3ZD7A 2AE1A 3UPUA 4MKHA 4EVQA 3AF3A 3AERB 4ZEXA 1SD2A 1I6KA 1ORRA 3WGYA 2OD9A 2V3WA 3TBHA 1A9RA 3W77A 4Z2AA 1XPOA 3A3PA 3FB4A 1D3AA 2C95A 2YOHA 4YT5A 1OB2A 1U8UA 4MMXB 1ZVMA 1Q2XA 4Y0VA 4IF4A 5AR1A 2ARKA 2BKLA 3LDHA 3O2SB 2GVDC 1RE1A 4MQMA 4Q1EA 4ZTUB 4CEIA 2HNAA 2Z5GA 3VC3A 5ER9A 3WWDA 3C39A 3PPVA 2XCOA 3BWXA 5FNZA 4ER7A 1KYZA 4KRFA 3ZY5A 4FW8A 1GLGA 3AIKA 4LQDA 4R84A 5E1BA 3JX9A 5DULA 3TR5A 4BU0A 1LD3A 3G13A 3K72B 3LQ4A 3QVJA 4CXMA 3GIWA 5EKSA 5C34B 3VBCA 2GD6A 5HF8A 1NF3A 5GWXA 2PS3A 3D3KA 1TM7E 1Z2EA 4FZVA 4OMUA 3P2YA 1N0UA 4DNPA 4DPKA 2I3AA 3FNQA 3R8CA 2IPNA 4WBNA 2IH5A 4YJKA 3W4JA 3H04A 3LYHA 4JGIA 5JEDA 3QOFA 1KAEA 2X9NA 3STTA 1KIMA 1NNLA 3E9EA 2GRUA 2VPPA 4AN4A 1C29B 2FN7A 5DX1A 1RYYA 4FJ2A 5BYBA 4GM0A 5KU7A 5LNK1 2O8CB 4YRDA 4L15A 1H85A 2Q45A 3GJTA 3ZTWA 1RI4A 4GR5A 2Q7DA 2QZ4A 5EG5A 5I48A 3UV3A 2ID7A 3FNIA 2ZJYA 4DV0B 4MGHA 3FNFA 3KT0A 1KEEA 3WAJA 3QUTA 3RFFA 5A1JA 3LLSA 3EF0A 2E21A 4HMPA 4LS3A 5FWAA 4IWXA 5I8ZA 3S27A 5BRAA 1MV8A 2QMUA 1UZLA 5T6BA 2J87A 4DREA 3QTLA 5EXEA 4EL0A 3C3XA 3DHWC 3OOWA 1V6CA 4Y1RB 3IFSA 3G82C 1XELA 4OYHA 3TLGB 3OP1A 3P9ZA 1J09A 5CDYA 3WG9A 1QC5B 3MOGA 4V1CA 1EFVB 2OV2A 2P75A 2HSEA 2WG2A 2VP6A 1OBVA 3GB9A 3EWAA 4IH9A 2VT7A 3P20A 3T3OA 1XVUA 4FFBA 5CM8B 2CLMB 4B6GA 3ZJ4A 4U9UA 4G97A 3QELB 5JSZA 2OORC 2A1UB 5T5QA 2GH1A 3G5LA 4L8VA 4CT5A 5K0GA 2EGGA 3FWKA 4QX6A 2YWDA 3LW8A 3E15A 3OZTA 4PCLA 1JR3A 2A9JA 2QGFA 4WA8A 4WCFA 5KCMA 5TSDA 2VYND 3IE2A 3VKUA 2P9EA 4CMKA 4DCNA 2FSIA 1F60A 3LQ2A 2R1VA 1ECJA 4IIVA 1VBNA 5DKFA 3ZQ6A 3KETA 1I30A 2LWIA 2Y67A 4QARA 4B3HA 2VPWA 2CK3D 2WOJA 2HQOA 2PD6A 2GKGA 2V7XA 1OFUA 2A2ZA 3EWNA 2DWCA 3AXTA 4JUDX 3DYIA 4PG8A 3K4QA 1V3VA 3PGXA 1XFAA 3DL4A 3NDPA 1CUHA 3M9LA 2AR9A 3QVVA 2AFIA 4NZZA 4I6EA 5DTQA 3KDSE 1Y7HA 1V95A 3FIUA 3UHFA 1YFLA 1XPRA 2X4DA 4DDMA 3N0XA 4TZ0A 2GASA 3BERA 1U9IA 4PS1A 4QBFA 1M5RA 2YMPA 2D8MA 1GPWB 1FJXA 3ZZ1A 5JH7F 1XZGA 3IJEB 2B4KA 1Y8AA 2CN1A 5AKKA 2PIDA 1FVFA 3FVTA 3AJEA 3BIOA 3L43A 2IEAA 3FAKA 4PEVA 5IVPA 3W6OA 5BW5A 3RVDA 3O84A 1AH2A 3K0CC 5K4GA 2H1CA 2JH8A 5BV0A 4GR9A 1ZL0A 1BXGB 4DUPA 5LFAA 1SRQA 3O83A 5TGTA 4DSZA 2VCYA 1HEUA 3ISTA 4AZ3B 2HU7A 3TQOA 2GXSA 1ZMTA 2J3JA 3GVCA 2G09A 2HUPA 2D4AA 3Q9LA 4QUDA 2G5CA 4UQOA 1XO1A 1L9XA 2FZWA 3BUSA 3DS8A 4QRDA 2ZPUA 1E7RA 5F64A 3GLFB 4CZ2A 3EVFA 4DA9A 4YX9A 1E5XA 1XQYA 1E89A 3GN2A 1BYIA 3OU2A 3SE7A 2XLCA 2XAAA 3FX2A 4FYXA 1JPNA 1WCWA 4TKMA 5JRZA 2RC6A 2QUJA 4RABA 3RVRA 2H8GA 3EVEA 4WK6A 4E1VA 1UJ5A 1H6BA 5DEOA 1HR0B 1C30B 1VQ1A 1F12A 3SHWA 3JAMA 4GOKA 1ORVA 4X8OA 521PA 3S2GA 4G0QA 1ZC3A 4CKXA 1N3YA 4JP5A 3C5EA 3W2IA 4Q48A 3LT0A 1O8CA 1UT8A 4HAYA 3RYTC 2QN3A 1WZIA 1NR5A 4LECA 1U1CA 4V02A 3GMSA 4EKIA 3T54A 4IM7A 5L53A 3THXB 4YJ3F 3WY9A 4BX2A 2IUUA 3VJKA 1BVRA 1LPNA 3BH6A 4IZ6A 1A9XB 3FCXA 1E9DA 1EKXA 4FE3A 3D0KA 1UKBA 2PU5A 5GM2A 3LTNC 4XTCS 3OIGA 2EFJA 1QPGA 1DKRA 3MQ4A 3OLWA 3RE1A 2EYUA 5HP4A 5JR3A 5EGNA 2C3YA 4JT2A 3I2HA 1L7EA 4NPAA 4UVHA 5DN6A 4BX9A 3WNZA 1I32A 1ZUNB 3GW8A 1FFXB 4YDQA 2NN3C 1YIAA 2YIMA 3E5MA 2ROQA 4MRRA 4OGWA 4N5MA 2VSYA 3HKCA 1YS4A 1Y33E 4YHBA 3WP0A 2V96A 2YJ4A 4G4SP 3E7XA 4URWR 5CBKA 1XZKA 3M3PA 4TSKA 3E7FA 3JQQA 4OVKA 5L3QB 1PT9A 2A59A 4IIGA 2NO9A 3CKKA 2YS6A 2MYTA 3OZGA 3PLRA 2MIIA 4HH3C 1CIVA 4BTLA 3FHLA 3WYNA 4YP1A 5EPOA 5KI6A 1IYZA 3ZCTA 1QYRA 3TSWA 2QMOA 2MYPA 3H87A 2J3LA 4GI2A 3T3IA 4AS3A 1YF3A 3R9KA 3SVLA 1KU0A 4W5TA 4DB4A 5KYWB 3NMUF 1IB6A 1E69A 3GRVA 3CHYA 3X1MA 1JXQA 1K6IA 4L8FA 3AEXA 2G4CA 2PIAA 1YZTA 2ZIZA 3V97A 3PQ4A 3C48A 1K5HA 5DSTA 3KP1A 4BGEA 3CUYA 3LC7O 2IUSA 2W4MA 2H29A 4K9PA 2QLMA 5BQ3A 1PSDA 3S2EA 1C81A 1E1LA 1U1FA 4DANA 1W8IA 2DTXA 1P29A 1Z6XA 3K6SB 4N76A 4GOND 3ELBA 2B94A 5MN6A 2IYVA 2PAAA 3CO0S 2JLUA 3COVA 3RUPA 2CDNA 3CFYA 3QF4B 1OH6A 3I0MA 1XTSA 1GL6A 2C4NA 2Q5EA 4D0NA 5LXTF 4LY0A 4DL9A 1ULUA 5KQPA 1W4CA 3WIVA 3DMNA 1OX4A 1TZJA 3ODGA 4I9GA 4YXWA 4YP0A 1W25A 2HA4A 3KZNA 1I5EA 2C99A 4GPAA 3WE7A 4L73A 4IFIA 1OFIA 8ABPA 5AW6A 4P5DA 2MMGA 4MWGA 1AA6A 1SZJG 3VR4D 4RH1A 1ZNYA 2HPVA 2YN0A 2XUGA 3AF0A 1FFGA 1ZMOA 1E64A 2OE2A 3DTTA 1GUAA 2ZTUA 3K9GA 2N46A 2Q1WA 4RO0A 1AM4D 2VI5A 4WCVA 4B3MB 3QNWA 2UZ4A 3REQA 4PNHA 4MROA 1M1YE 1JLSA 2Q8PA 3UV7A 2B7BA 3EC2A 2Z9DA 3S29A 4L1KA 5FCDA 2FFQA 2QVBA 4IXDA 3EXIA 4I4TA