1M1UA

An isoleucine-based allosteric switch controls affinity and shape shifting in integrin cd11b a-domain
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
184
structure length
184
Chain Sequence
DSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Integrin alpha-M
publication title An isoleucine-based allosteric switch controls affinity and shape shifting in integrin CD11b A-domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2002-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1m1uA00
1ZOPA 3F78A 5KYXA 1XDDA 1YVPA 4PN7A 1T0PA 4WK2B 3EGDA 5KYWB 1QC5A 4C29A 3GXBA 2X5NA 3EH2A 2VDRB 1SHTX 4IGIA 3ZE0B 1MJNA 1FNSA 2XWBF 2NUPA 2VDOB 5HJ2A 2NVOA 1MQAA 2VDKB 5HDBB 2NUTB 1CK4A 3T3MB 3EG9A 3PPYA 3V4VB 1M10A 5KYXB 3EFOA 1BHO1 3EGDB 3Q3GE 1QC5B 1ZONA 3EGXA 3TW0A 1U0NA 4XW2A 1MHPA 4WJKB 2NUPB 1M1UA 4G1MB 1PCXA 2XGGA 3ZDXB 3ZE1B 4IHKA 1AOXA 3K6SA 2VDQB 3EG9B 5KYYA 1LFAA 3PPWA 4F1KA 1AUQA 3EFOB 1AO3A 2WINI 5KYNA 2ODPA 2B2XA 1SQ0A 1XUOA 1IDOA 3EGXB 5KYUA 2VDMB 3ZDYB 1IJKA 4F1JA 3NIGB 4HQFA 3VI3B 2ICAA 2O7NA 2WW8A 1IDN1 1XDGA 3ZDZB 1PD0A 2ADFA 5E6RA 4C2BA 1PD1A 1U8CB 4CNBA 3K6SB 3ZQKA 2I6SA 5KYYB 1N9ZA 1OAKA 4MMZB 1JV2B 4WFQA 4CN8A 4CN9A 1BHQ1 5HGJA 1JEYA 1YVRA 5LN1A 4NENA 4MMXB 3K71B 4NEHB 5BV8A 5KYUB 5E6SA 1DZIA 1M2VA 4BJ3A 3QA3E 4IXDA 4WK4B 1M1XB 1MQ8B 2VDNB 3RAGA 1DGQA 3FCSB 5E6RB 1NA5A 1PT6A 1SHUX 1ZOOA 3PPVA 2I6QA 3EH1A 3HXQA 2XWJI 2VDLB 3PPXA 2VC2B 2ODQA 3HXOA 4JDUA 3TXAA 3HI6A 3EOAI 1TYEB 3BN3A 4Z7QB 1JEYB 1L5GB 1M2OA 3EOBI 4NENB 5E6UA 3VI4B 1Q0PA 3NIDB 5E6SB 1M2VB 4WK0B 3M6FA 1RTKA 1RD4A 3IJEB 1JEQA 4UM8B 1FE8A 4UM9D 3TVYA 3IBSA 4Z7OB 2M32A 1U0OC 3BQMB 1MQ9A 4Z7NB 2VDPB 1ATZA 4M76B 4MMYB 1RRKA 4HQNA 1MF7A 4O02B 4HQKA 5ES4B 2I91A 1IJBA 1T6BY 1QCYA 4UM9B 5KYWA 1UEXC 3F74A 3FCUB 3ZE2B 3T3PB 4A0QA 3BQNB 4C2AA 1CQPA 3N2NA 5E6UB 2IUEA 4HQLA 1JLMA 3TCXB 3E2MA 1V7PC 3V4PB 3K72B 1JEQB 4FX5A 1N3YA 1RS0A 2NUTA 4DMUB 4HQOA 3NIFB 4G1EB 2QTVA
chains in the Genus database with same CATH superfamily
4MUKA 8ABPA 3I1JA 4NJEB 3SFZA 3V32A 4XFKA 1P7CA 1HMPA 1M7HA 4C7KA 2UUCB 2XF2A 2EJWA 1ONSA 2XB4A 1IH8A 1K3FA 1X1EA 1NBOA 4MKIA 2XB9A 2GWRA 3A36A 4KGXA 4OFXA 4YAJA 4BEWA 5FB3A 2V0GA 1BJRE 2C2ZA 3LZCA 3O1JC 2FNAA 2NO5A 1OH5A 1ZO8A 1FNSA 4CT5A 1JE0A 1E2UA 4GD3Q 2EZ8A 5FBHA 1ZN7A 5FBQB 1NI3A 1OJLA 3PNQA 1FJGB 2LUOA 1P0IA 2G6BA 2IHYA 3PHHA 2QAJA 3QVXA 4TSRA 5I7AA 3BF8A 1E2IA 3G2LA 2XCRB 3KSBC 1FMLA 5TE9A 4YUXA 1QZXA 1CLEA 3SC6A 2BTQB 1BAPA 1LTQA 1VCIA 4NECA 2BM0A 4WI1A 1NONA 1BS2A 2HRBA 5DO9A 4A1OA 5HZHA 3O6VA 4L27A 5GVRA 4ENSA 2XZPA 4JT9A 1EFVA 1PVVA 1KFKB 3IO5A 3O74A 4HQRA 4RSHA 4YH1A 3AESB 1WG8A 3FLBA 1X2BA 1XKQA 4F04A 4FE3A 2PH5A 4BU0A 1ZS9A 4CKBA 4DC1A 1BGXT 1IZ7A 1XLVA 1SA0A 4F1KA 2K7FA 4X71A 4UPDA 2E1RA 4IQ0A 4K9SA 3WLSA 3BULA 1GZ6A 2VSXA 1YHNA 4JA2A 3X2EA 1V8PA 4F72A 3DPIA 3MEQA 3PBKA 3VNQA 2PHZA 3GG9A 4OQZA 2Y0DA 4PAOA 2OZKA 2W6MA 4DLWA 3HE3A 4EGFA 2QM8A 4C7OB 3FPCA 4B35A 4I1YA 2HSJA 2FFRA 2QTRA 2ID9A 2YHIA 3MJDA 4I55A 1T8WA 2CDCA 2QJOA 2WJAA 3VSCA 4YP5A 1NW6A 2ZWIA 3GLFE 2WM8A 4EG3A 2XPCA 3CLSD 4YRCA 4PBSA 4DV3B 2YNMC 3OIDA 1JQ5A 4YJHB 4AJ4A 2XE4A 3K5WA 5F2OA 5ECDA 5EG5A 1TVEA 1J1IA 4RL4A 2YRXA 3CX6A 3GGGA 3UYLA 2XYRA 3WLNA 4A27A 3M70A 1Y0BA 2B35A 1SOAA 4BVEA 1C9YA 1S8FA 2ZIWB 3CCCA 3EXEB 3I0MA 3KHUA 1VLQA 1K0UA 1RBYA 4BY9E 2CXPA 3CUVA 5BYBA 5JS8A 4XLLA 1TEHA 3FYCA 2OORA 3HEBA 1XNJA 4QC2A 3TKLA 1I5RA 1P2SA 3BE6A 4IDQA 3LUAA 4WEOA 4G5FA 4CM8A 1YCGA 1CB7A 2PSSA 2IS2A 4ALNA 3I6QA 3JU3A 2C20A 2PXAA 4BNZA 4F7DA 4D1YA 2HZ7A 3FTQA 5CVDA 5D51S 1YF3A 2VVTA 4KN9S 5I7SA 5KNCA 1OIVA 2J5RA 4Z9XA 1OLSB 3P0JA 4FLEA 4UE6A 1EDEA 2OV8A 3NBQA 1EFPB 4FDMA 2O3QA 1CZLA 1QH8A 4RADA 4E1VA 4B9EA 1X7XA 5EC8A 3T0FA 4AD8A 2YWFA 4FOTA 5JQGB 2WB2A 1J22A 3QBEA 3W9SA 2AOVA 3EFEA 1RKVA 5HWSA 3GJ7A 1RMYA 4NXNB 5JFTA 3ZLBA 3F3KA 3IEKA 4JI6B 4M83A 4FNOA 4BAGA 1Z45A 2WZDA 1YOVB 2OAEA 3MJVA 4G89A 5HZGA 1EQAA 1UBHS 1MX3A 1Y6JA 2V7PA 3KM0A 3PQ6A 1D2HA 2X5NA 4UUNA 3HCFA 2HLDA 1DSSG 4IGIA 1QHSA 2JAHA 3MILA 1R4ZA 5JEDA 3TG8A 4JN6B 5LLSA 4BL5A 5ERYA 2I2FA 4BMNA 2X9NA 5CFOA 2CMKA 4QXPA 2RHRA 3ENWA 4EYEA 4UAGA 1BCRB 1RPAA 1MH1A 4HOYA 3ZY3A 3C16C 1N77A 2G7ZA 4ID3A 1REQB 1NDUA 4Q05A 4R9VA 2CLKB 1UJ2A 4P3YA 4X41A 5BSGA 2JEZA 5JAMA 1T29A 4CNQA 3AY6A 2BHNA 2PSHA 2D1TA 1J0DA 1OC2A 3HP4A 3X44A 4BWVA 2BOVA 2V5AA 4I2VA 3P8ZA 1BCSB 5G0SA 3USES 2XTMA 2CUZA 2WUEA 4EWLA 3M7IA 1KEVA 3HJNA 1K98A 1RYHA 2O2JA 3T52A 5EPEA 2I2AA 4ZVUA 3PL5A 2ZSUA 2RC5A 2QMOA 5M04A 1E66A 1TTHA 3IV7A 3RS3A 3VYRB 3M3DA 2W8ZA 4Y1EA 4MVJP 1ENOA 2NM0A 1M1ZA 3KQYA 1PL0A 3L5OA 2FSSA 3N3AC 2WU3A 4RZSA 4AO7A 1KEUA 3T4XA 5JDCC 4TLEA 2HJRA 3AH8A 2WUFA 4MEBA 1JG3A 1QH0A 1XMPA 3TR0A 3ROXA 4F2PA 1E63A 4Y9RA 4AWBA 3IDFA 3EAGA 2JCYA 4E3ZA 5K09A 4P31A 1ZIPA 2OC9A 4B73A 2CNOA 5ALFA 5EXXA 5IJ0B 1QH1A 4NJMA 1QR2A 5A2GA 4ZI7F 5EKDA 3U13A 5JTTA 3HN7A 4FHGA 3SE7A 5T4EA 3ZW9A 2A3NA 3MSXA 3PRYA 1UM9B 4LSMA 3PNSA 3VHQA 5I9IA 3IEVA 4QQ8A 2PKRA 1GO2A 2JCVA 3IHWA 3ZLUA 2PPLA 1XTTA 2GS9A 3W2IA 3TBKA 1D7AA 2KE5A 3COPA 1OCEA 3AJEA 1V2GA 3ROFA 3S0JA 3LX5A 5BURA 5JEEA 5DF1A 1DRVA 3FE2A 3OEWA 2V9CA 2G28A 3EPRA 4KGVA 3NWPA 2ZYAA 4TVSA 4FR2A 1DHTA 1Z4IA 3DAYA 4IPTA 5JCPA 4CCWA 2PE5A 5JNLA 1XLTA 4NCIA 3RGGA 2FETA 3U3XA 3BB3A 3E3NA 4UFOA 4C22A 2CNKA 4UHCA 1V8DA 4BWYA 1KI3A 3OJ0A 1NTRA 3VR6H 1NJGA 3Q7EA 5IFLA 4M60A 3SE0A 4RY0A 4TX1A 1QIKA 1DFIA 1L4KA 1R9JA 5DM0A 4KH1A 3L7BA 1XJCA 1F4LA 4YACA 3HB7A 3FMIA 3OAAA 2Q1SA 5TPWB 3W2EA 3QXSA 3ME5A 3KZOA 3NP9A 4LI0A 4V0LA 5DGXA 2P6MA 4ACAA 5LQCA 2FWMX 5JPCA 4FHDA 4D5GA 1P5FA 1WABA 2VHQA 4Q39A 2QAGC 4OMDA 4XPZA 3OCJA 1BXGA 1HM5A 1G8YA 3H3JA 1ECFA 2Z6UA 2RARA 3EGEA 1NBHA 2FJUA 1J8DA 1U7WA 2P69A 2VKQA 3DGFC 4B43A 2NNLD 3LX8A 5H02A 2CY0A 1EAMA 1Y5NA 2WF9A 3L0YA 3DDZX 2P4HX 5KTRA 4MR7B 4RD2A 4V1CA 2HGSA 3K0EA 1C9MA 4BVGA 1KQGA 4Y8VA 1T9GS 1T0PA 2RHDA 2Q3CA 4O4HA 5LZ7A 4KQKA 3RM3A 2A92A 1SHTX 5K3OA 2BMWA 3C41J 3V9AA 4D44A 5FI5A 1BQEA 2ZFUA 5GQSA 4AZWA 2GBGA 3L04A 3E5HA 4UMDA 1VE6A 1F8FA 2XIJA 4WPGA 1OIWA 2YL2A 1RADA 1GZSA 4ZQBA 2G5GX 3BH7A 4EHNA 1LVUA 2IEYA 2YFQA 3L05A 3QUBA 4JITA 5COAA 2YY6A 4DLTA 3DZCA 3IVAA 5DHTA 5ILGA 3V8RA 4B74A 1XCJA 5A4MS 1MP0A 4Q4AB 5AJUA 3D5TA 2ETVA 1H69A 3AHIA 2QZ9A 1CUBA 2JA1A 2D3WA 2RG1A 4N8EA 4TWBA 4DJJA 2LW7A 4MVJF 3RADC 1Y42X 2VBFA 5CNMA 3H8VA 2JASA 5IK2A 1L5YA 2PL1A 1GU7A 1LBEA 4YRJA 1M8KA 3BVPA 1ML4A 4UHDA 4J0EA 1J0XO 3M4XA 4OQFA 2OCKA 1Y48E 3MAGA 4RH0A 5AI6A 5KWJA 2P62A 5B1EA 4BE9A 1FSGA 4HT3B 1WQ3A 3G17A 2FUCA 3DMNA 1RCTE 2ZLBA 3KIPA 2LCFA 2XNDD 2YDYA 1B00A 2OQRA 2ZT5A 1P7PA 5EYPB 5FNVF 5K9ZA 2FPLA 2YW9A 2WW8A 3E7PA 4ZQCB 4JOBA 4UD6A 2YZGA 2HR1A 2IYNA 4CNBA 3BILA 3IUPA 1A9TA 4RJLA 1OB5A 1N9ZA 2P41A 1RJ9A 3FPAA 2R66A 3GJTA 5C31A 1BVHA 3O2SB 4MMXB 5DN6A 1VZ3A 1I4OA 4DPMA 3GLIA 4HL6A 1C3LA 4YQYA 5L4SA 2XZTA 2XQFA 4WD3A 1PQYA 4GI5A 5DVZA 1P29A 4U7HA 4GICA 4QYMA 5HGXA 1EUQA 5CXQA 3I45A 3L84A 5AQEA 3WL7A 3L01A 1PKEA 2DT8A 4PCUA 4Q9HA 1Y9ZA 2XUPA 1FYVA 2BM8A 3K9BA 4QBIA 1UJMA 3P9YA 2W0SA 3FLEA 1KI7A 2CN1A 2OUIA 3N70A 2QN3A 2RGNC 3MLAA 5I8PA 3AR7A 2WAYA 2RC6A 4RXTA 4R8VA 5L3RA 2XUZA 4JBYA 4LCJA 2AXPA 5AW4A 5CGZA 3TQCA 3RBVA 5ENZA 1P72A 4W7HA 3TG2A 3GLGE 2H92A 1SCNE 2X3UA 3H04A 3PNOA 1K97A 4Z2YA 2Z2JA 4XFJA 2HU8A 4X7RA 4OQPA 2A1IA 1E0SA 3AKCA 3UQZA 1TAGA 3G8BA 4V1CI 2WYIA 3FCYA 5FAKA 2P9QA 4CMIA 4LXXA 2J9GA 5C1BA 3WLKX 5DYYA 3TLKA 3F2IA 4OOEA 1UJ4A 3K0SA 1BGWA 2Z04A 5CXSA 3ZU3A 2XMDA 4M55A 1YDGA 2EL9A 3FPFA 1G5HA 1B3BA 4YAOA 4NYMQ 2Q8NA 5E0KB 1AHNA 1Z2NX 3DDWA 5TARA 1IB6A 1XRJA 1Z7EA 3CUYA 4F0JA 5C8YB 3M6XA 1MABB 2FSPA 3PC8A 3PHBE 4KO2S 5JNWA 5JZ9A 1EWQA 3WZLA 1FNDA 1NQVA 1RPTA 1ZUHA 4HH4A 3LK6A 3IO3A 1UJ5A 4MDHA 2Q9CA 4HTFB 2GF9A 1RYEA 4N5HX 2D5IA 3L8YA 2XA1A 2ZDHA 5EFOA 5LZ2A 4FE7A 2E4AA 5H8WA 1FJXA 1S8OA 4UTRA 3H3FA 2A8YA 4MVCA 3VJLA 2H4FA 4AG6A 4QAQA 2G09A 3LC7O 1HUQA 1SC9A 2YC2C 4JBHA 5JSFA 1DIOB 3C5CA 1R7RA 3OH8A 4DVJA 4AMBA 1IN4A 1YVUA 2OV3A 3BSSA 4UQPA 2IIQA 1EIWA 2AKEA 1X9HA 3N8KA 4W1SA 3F7TA 3I2GA 4EQ6B 5AVVA 4LY6A 2R8YA 2GXUA 3OU2A 1D1SA 1VGRA 3CURA 2XUQA 3AK4A 3CUUA 2P9GA 3FRJA 4Z4GA 2ES4A 1KEWA 4MR8A 4EA9A 3OE1A 1VI2A 3G88A 1ESCA 4BTVA 1MRZA 2QOEA 1YS2X 3DEHA 4QUJA 1U8XX 3DM5A 1SPBS 4AF7A 4F84A 1ZHOA 2XHEA 1U1GA 5F9MA 5A3SA 1XUOA 1YI8A 2L2QA 4HH3C 5FBZA 3O93A 3O5AA 4KRYA 2FW8A 3TGPA 2QTAA 1WB4A 4GH5A 1M1YA 3SVTA 1WZNA 1TCVA 5D5QA 3KZNA 5AI5A 3ODPA 4Z9AA 3FLAA 1D4ZA 2ONYA 2YW2A 1Y98A 4CV0A 4EA6A 5CA0B 1IPFA 3TM5A 2BEJA 4GE3A 4B48A 3KELA 1EU1A 1P3DA 2VHEA 1BMFA 1Q84A 4Z9BA 5F12A 1M8PA 3BTOA 3BIFA 1E3MA 4MUJA 2YIVX 3MINA 1ZAKA 2BV3A 1IM8A 3PUJA 4C3ZA 1UFVA 1CRQA 2EWVA 2ZSIA 1Y1PA 1G3MA 4LJKA 3L3BA 4U8HA 3KAPA 3R7LA 2JH9A 2R7AA 1W5EA 2AEEA 2YV5A 1KZYC 3FF4A 3ZK7A 1IQPA 1UKCA 4HC4A 3D7NA 4P3OA 4DZTA 5JCZA 5AHWA 4Q4HA 5ELMA 3BGWA 2FN8A 4MWOA 3U7RA 1YZKA 3F5SA 1PJSA 3JYLA 1I80A 3N2GB 4M22A 1ZZGA 3R8CA 4BO7A 4D0LB 5E4YA 1IC6A 1VBFA 4FFMA 1SBZA 5LOVA 3GRFA 4JYAB 1C8KA 2HU5A 4V0OA 4PU0A 2V8BA 3QQ5A 3KB2A 1ESNA 1ZW1A 1SNYA 3AHGA 5DHFA 5GMOA 3QW4B 4CKWB 1NNSA 3C3AA 1U2DA 4Y6GB 2CJPA 1F6WA 1E1QA 3CGWA 3D3JA 3A1EA 3WB1A 2PRJA 2FSGA 3ZXXA 1DCKA 1BDJA 1Q6YA 2LP4Y 3KKEA 2D59A 1TGVA 4KAAA 2H4JA 1R6XA 4B8YA 4Y30A 4PLPA 3WVNA 1CY4A 3RVDA 3I04A 4ZDKA 5IAOA 3BJEA 2IK8A 3LL7A 3HLYA 3FAZA 3CWQA 1PDOA 4JLAA 4DJDC 2BKVA 3LIIA 3PJRA 4ND5A 5EJ9A 2O4CA 3FWNA 3D6FA 4L6CA 4M0CA 2VDWA 1KC1A 3V7NA 2P79A 4QL3A 1G5QA 1RWBA 2R6CA 1U1FA 4LNAA 4US1R 1XZFA 1PZGA 4G1EB 1KMNA 3QLUC 4CM9A 3TDNA 4C05A 1H6CA 1TE2A 3FZYA 2BGTA 2BFCA 1DI0A 1EUDA 1U81A 1HLGA 1SG0A 2O57A 2ZRLA 3IOCA 4IVPA 1J8YF 3ILSA 1X7WA 5DM2A 3VNAA 5TNXA 221PA 1P9RA 1UP4A 7REQB 4LDZA 1PRYA 2G5TA 1Y81A 5DXJA 2WFLA 4MVJG 1P75A 4CU5A 3KK0A 1N0VC 1DAKA 1PU2A 1TX4B 1XNHA 2ESRA 2YQZA 2YWDA 3FH0A 3P2YA 4DJEC 3I4FA 3DP7A 5FPTA 2QRGA 2XGOA 3G8CA 4XTCS 1GPNA 2OR3A 2ZRJA 3R7FA 4P80A 1OHHA 5J23A 4PLTA 3PSAA 2ANCA 2NTNA 1IE3A 1JU3A 1M2WA 4XTRA 5IHXA 1UMDB 3JQ8B 3AIIA 2ZI6A 4GLBA 4KLAA 2X5KO 3BWBA 3OT4A 1I7NA 3INNA 4RJJA 2YJNA 1YRQA 1EDOA 2WVHA 3JARB 4G1MB 1LCIA 1JXOA 1YBVA 1YS4A 4CR6A 4ENWA 5BMVA 4LF7B 2V7WA 2VDQB 2OBFA 1ST2A 1CP3A 3GLFB 4UEKA 1JVNA 4RVFA 1JMVA 2WE8A 2WSYB 4OMUA 4HEHA 1K66A 3OEHD 4HQ0A 4P08A 2WAMA 2V7XA 3EJ6A 3HY3A 3LQ1A 1E9CA 5FYDA 1ZA1A 3RIYA 1W35A 3TK1A 5BVGA 3GF4A 1EZ1A 2ERCA 3SX2A 4V38A 1JYFA 1B6RA 1BC5A 4DUYB 1KAEA 3DFUA 1F0NA 4LMAA 3R7SA 2W58A 1J49A 5K99A 1M6VA 4RMJA 1ZNYA 3DV9A 4F4IA 2WUWE 4Q1CA 5AJVB 1D2RA 2F4NA 3LPDA 4JVLA 2DH5A 2VF5X 4UHJA 2GVNA 4YCMA 4Q3LA 5C8XA 1GTVA 2EFJA 1LRKA 2QUKA 4GHWA 2IT1A 4FFWA 5KU1A 3EEFA 1CJTC 4O4JA 2JAOA 5JH7B 3JQGB 4L76A 1ZZEA 1SO8A 4NZ9A 1B42A 2C1ZA 3HCEA 3LXRA 5K6AA 1U4SA 1PFYA 2IF0A 2PT7A 3H9UA 4YAKA 5EUQB 4MPJA 4OFBA 4II3A 3G85A 4LFAB 1K2VN 1MTOA 1Q7BA 2QR5A 2IIVA 3W5JA 2BMJA 4NMMA 4Y2VA 1PAUA 2D8MA 1IHXA 2EJUA 3NQ41 1T8SA 2HRCA 1QNFA 3DF9A 3UPTA 1CEYA 1QYXA 2W2KA 5EIEA 5ANRB 1BXZA 3AR2A 3VVBA 5JJIA 4BX0A 5C52B 2P1ZA 1QAQA 1WXWA 2BMDA 2REBA 2VF8A 5ALDA 3RODA 4LOIA 2JA2A 4I50B 1RTKA 1G4AE 3PQ3A 4XVRA 4C6HA 3QP9A 1Z35A 2ZJBA 2BJVA 2C7BA 4HG2A 3SJZA 3QTTA 3W6NA 1ZL0A 2C04A 2XXAA 4OGFA 5I7UA 3RBAA 3ZD9A 4D9FA 3F6BX 1OAOA 1PG0A 1WEKA 2P9YA 4RGYA 5KKAA 4YP6A 2J3MA 1QYCA 2IS4A 4EB3A 4YMHA 4PCAA 1ENYA 1U8TA 1P1KA 3P7MA 1RNLA 5CA1A 1K27A 4H17A 2QIOA 4JC5A 1U5BB 1T4MA 1ZGHA 1AVTA 1I7SB 5K8IA 4HAIA 1LLDA 1Y82A 5GZ3A 1PJ8A 1IY2A 2ZBPA 3RSLA 1BXRB 1WTAA 4L28A 1BN7A 4O2BB 1PJAA 4PHHA 3ICQB 4UUPA 3OTQA 2BSQA 1SIBE 1DIHA 2P27A 5DI3A 1O87A 1PE0A 1JAZA 4MW6A 3P9QA 4YBRA 1PWYE 4DBZA 2C7QA 1K3TA 2BZSA 1MB2A 1ZJ6A 3L7OA 1KC3A 1VIMA 3FGOA 4YI5A 3RHTA 1OH6A 2BZGA 3GEGA 2AG1A 1F17A 2VRCA 3HHEA 3M4ZA 1N4AA 1OX4A 2Y6VA 5A5VA 5JSZA 3K31A 1T9DA 4CPDA 4ETWA 1WMSA 4G26A 2QRUA 3JQ7B 3JQAD 5CXUA 3NONA 3IDSA 3OI7A 1DJOA 1EGHA 1UZNA 3TNYA 3O4GA 2IPNA 3O2NA 5LQAA 3LGSA 1KWKA 3A25A 3LTEA 3JASA 3MS4A 4QULA 4ZI5A 5K6RA 4C7BA 3LCCA 4GMKA 3KL2A 1KP3A 2D5CA 3ANLA 5JISA 1YFZA 2VQEB 2ZS7A 2ZSBA 1SVWA 2OAQ1 4YMUA 1UXHA 1NG1A 2BFBA 4G81A 4Q7JB 3TVDA 4YRIA 1VI6A 1O7JA 4W8OA 3V2HA 3GEBA 4XCQA 5BSEA 5KVCA 1Q7EA 4KNVA 1I3OA 3K4PA 5HTOA 5FA6A 1SQ0A 3S2UA 4DMGA 1ESDA 2B94A 2FCAA 2XNKA 3EXHC 3K05A 4REQA 1BE1A 4B3TB 2PKQO 3WY9A 4BLWA 3PFHA 3OETA 1C0IA 1NAIA 2TS1A 5BN5B 1IDN1 2Z4TA 3WFZA 1U7PA 3OQMA 3VU9B 2PRKA 2QTGA 3AX6A 2E82A 2ZJFA 3J7TA 3ZQKA 3D2BA 4QJ5A 2XKBA 2H8KA 1D2CA 2DJ5A 3DULA 3SIRA 1T2FA 1ZVJA 1DMSA 1NZJA 1ZD1A 3M5DA 1QRRA 4HBZA 4Q01A 3T61A 4J9VA 3UGQA 1SHJA 4M4SA 3G6KA 2Z6AA 4WXRA 3V4OA 4UMEA 1UDCA 3DZJA 3QX8A 3NC0C 4X8LA 2AN4A 4MWEA 1JILA 1FDOA 3THXB 3K0AB 5K05A 1KU6A 4JI1B 2J3QA 2FTKE 3EH1A 3DD1A 3C5VA 1JUDA 4RA9A 1DLJA 2OBYA 1W1UA 2BGUA 5DK6A 5I51A 4NWIA 3ZBUA 1NR1A 2PO7A 5EEHA 2F55A 3PFFA 4MKFA 4DV5B 1CY6A 2CC2A 3OSZA 1CU1A 3PGJA 4RPGA 3OQVA 3NOXA 3I9JA 3U60B 3BFPA 2PX2A 1KFCB 3SC3A 4LTNA 2A94A 1L7VC 1FE8A 4G5OA 2XTJA 4TLCA 3W79A 3WL5A 1XZNA 3DL2A 5BOVA 5BR8B 5JWRA 3ITNA 4MAFA 2AQKA 5BT8A 1S2OA 3BDIA 1Z62A 3DZBA 3IPRA 4MIYA 4F9EA 3DZFA 3H75A 3D3QA 3NTOA 2GBLA 1FP4B 1TZKA 5EHIA 3H97A 4KXXA 3IOEA 2W98A 4MAMA 2OK7A 2AFHE 1Z39A 4XE5A 5DW3A 3RVRA 4F8JA 4PZYA 2Q1TA 4IP0A 3RAEC 4QQNA 3QELA 5EJAA 3HDQA 4F6LA 3WRWA 4DMUB 3Q7RA 1KJIA 1GWNA 3T5TA 1U0JA 1KR2A 3VTAA 1ZRSA 2ECQA 3DL7A 3BWVA 1Z5VA 1ZIDA 2F3UA 2O8CA 3LWNA 5REQB 5GM2A 1VPWA 4X63A 1U0HC 3EGDA 4F56A 3KSMA 4LYEA 4L16A 4O4HF 2B4KA 4WNAA 3H5WA 4GMGA 3HRKA 1Z8FA 4PPQA 2YXDA 2GAAA 2VHTA 4RE6A 2XOKA 3BE5A 3FAKA 3QX3A 3LLSA 1USVA 2J1LA 4G0QA 2PU7A 1K63A 4ESHA 4RPLA 4XYLA 1M7BA 1BU8A 2B20A 3GLSA 3HXKA 4YASA 1LUAA 4CF3A 4ZV4A 3B9QA 3CVUA 4RACA 5ALMA 1IOLA 3E2PA 3KEQA 1RJGA 2CBGA 1UINA 2FUKA 2HXSA 3R5KA 4RW0A 3CNHA 2B25A 2A14A 2VJLA 3DHYA 5IT5A 4WJKB 3U7GA 3GARA 3OQJA 3W3AA 1OPRA 4PYRA 3HYLA 1W36D 2GXQA 2BR4A 2OSBA 3CNQS 1JLLA 2HEGA 1Q7TA 2QLFA 1CEEA 2MR5A 1N5IA 4CMAA 1C1DA 1WF3A 2VCHA 3WTCA 1VE9A 2VTVA 2XE8A 4UOEA 3IHTA 1I5OA 5EMNA 4ZI7B 4MVYA 1J39A 1C5KA 3I9OA 4MCJA 5BW4A 2ZUCA 2XVMA 4BYMA 3AUYA 5BRNA 3ZDAA 1MV5A 1GQQA 4IZIA 1KJJA 2CSUA 4M88A 4CMEA 4C0XA 2OVFA 2GDJA 1NW4A 3KZVA 5TX7A 2P90A 1A2QA 1Q16A 2OFFA 2IYFA 1R37A 2Z4SA 3UBTA 2C3PA 3D8TA 4JQYA 1OKKD 1KMHA 1EAYA 4KDCA 4LZLA 1IN1A 1E7QA 3JD1A 5GWXA 2AEJA 2W6ZA 5ALIA 1MOQA 1SY7A 3LWDA 4ME6A 1CWUA 4WLEA 4YI3A 4C7VA 4QAJA 2A0YA 3NT5A 1H1LB 4LJAA 1CJCA 4NIMA 4IMPA 4OLFA 3SZLA 3WJ1A 3T5AA 4GKKB 3CUEF 3E1KA 2R96A 3HPRA 4FQ7A 2WJWA 5CYPA 3OT1B 2NIPA 3GLGB 1J9GA 1XLWA 2BKXA 2GLUA 4O5AA 4ZVSA 4Q16A 2EL7A 2GASA 1E3JA 3PHCA 2EP7A 3N5KA 4GSKA 1XWIA 3CVJA 4HB0A 4PV7A 4B6RA 1CZKA 1P2GA 4FZ5A 1XTZA 3V3KA 3LD9A 3HDVA 4J75A 2GN4A 5DISB 3IE0A 1U04A 4PO9A 4GOXA 3TLJA 2W2VA 1V16B 1POXA 2PL9A 2VXCA 1TM3E 3V33A 5LQNA 3V34A 3TJZA 2VH1A 1PV2A 4UXIA 4DLNA 1VHWA 2ZB2A 1F2DA 4IXMA 3SHOA 5LD2C 3KWFA 1NP3A 1ZCFA 4O02B 4WDRA 1VG0B 5EWLA 4F7WA 5BWCA 1OXKB 3GJZA 1SAYA 4AL4A 4AZSA 1M2OB 3M1YA 5FXMA 4AC9A 3WWOA 2RGWA 3PEFA 1D2NA 2NT4A 5FOSA 1F8XA 3WNBA 4CKEB 2XW6A 4LCBA 1JDBC 3BIOA 3H4IA 3T1VA 4BRWA 1WJGA 1I4EB 1LWOA 1VDMA 3VUFA 4CETA 1UDWA 3WIUA 5HW0A 1Q0LA 2CFSA 1L7MA 2WEKA 3DFMA 1A1VA 2ZB3A 1FRVA 4QXRA 1ZJ4A 1SR8A 1YCHA 3PR2B 4F91B 1NHWA 3R74A 4LDAA 1WD7A 3RRZA 2HXYA 5CLLA 5ALLA 4BNDB 1IPEA 1Z36A 2QTMA 1ONPA 1OLUB 4OBXA 5CH5A 1HZZC 2OENG 3JAKB 4Z9FA 1R0KA 4DJAA 3UOGA 1QYRA 1SCIA 3AGQA 1EWRA 3I73A 1ZEMA 2IWRA 3W3ZB 4KPUB 1V3VA 4JUBA 1EXDA 1RWNA 4XIFA 5DHUA 2QM7A 2QU7A 2IW1A 2PXXA 3ZKWA 4AK9A 4XSVA 2B36A 4L0DA 1WVMA 1AGNA 1EFLA 1N9GA 3AFHA 3COZA 4MQEA 1GVHA 3KJHA 4CQJA 3BFKA 5H59A 4POOA 1AIPA 1NASA 2PV0A 3AHDA 4IXWA 3RVLA 4AULA 2JKVA 2P0EA 4EATA 5FNVB 3WS7A 4WOCA 3HB9A 4GT1A 4Y2HA 3C4JA 4ZAWA 4EECA 2JGDB 2FGJA 10MHA 4BCBA 4WUVA 3DEFA 1S9DA 3CV3A 3OEEA 1CT9A 2AJTA 3H7AA 1RZUA 3U3MA 1R74A 1CD5A 5CT4A 3AR3A 4BQRA 1C80A 5CM2Z 3OF2A 1ZIOA 2MSDB 2XMRA 2O23A 3DMGA 1T4CB 4QBHA 5T8KC 1JS1X 4RLSA 2VUIB 1NJ6A 2EQAA 5EVCA 4UDOA 5BW8A 1G7TA 2A35A 5HHTA 4HAUA 5BSMA 3UT5A 2HO5A 3ZGVA 4R1NA 1AS2A 4BO6A 3EIWA 2II6A 3D0RA 4WCFC 3QVMA 1YI0A 3NTRA 1EVZA 2WWXA 3AW9A 3DMDA 2QLMA 3GMSA 3VC7A 3LZDA 3WKEA 5ADVA 3OQNA 1EJBA 3PQFA 1KIAA 1NFRA 1ZYUA 3OESA 4JJ4A 5EZ6B 3LCVB 2A4MA 2O20A 1M2VA 3C15C 2PRIA 2AZXA 4YXWD 1TEZA 3R7WA 2JJ2D 4MRSA 2GJ4A 5IBQA 4EHBA 2KQUA 1V5EA 5AW9A 3MAAC 4FDTA 4O4IA 3BH6A 3GP3A 3TZCA 1PX0A 4B3CA 5MN5A 4K26A 2FFQA 2ONCA 2ZRPA 2YNMA 2JBAB 1F2UB 1HL3A 5JZMA 2XGMA 6REQA 4KPYA 2QSYA 4PHTA 2NSDA 121PA 3Q6MA 4PZ0A 4D98A 1X7GA 1QIGA 3VAAA 3W2HA 3IVCA 3KQMA 2DCUA 2C2MA 2EGHA 2V9ZA 5K03A 2FPGB 5LOVF 4HWGA 3ELDA 3G0OA 4MPRA 5DNCA 1LW6E 5JZVA 2GGSA 2QMQA 5HIAA 4L8FA 3OKPA 3EIQA 5BSTA 5LBUA 2I4OA 3WGHA 4C0HA 2VUSA 2JJ1A 2PZLA 1SM4A 1QG6A 4DQDA 4YUYA 5FO0A 1PQ4A 2Z5FA 1NQOA 3DMTC 2Y0BA 5FLXA 2UVDA 4RNDB 1U2GC 3IAAA 3AF1A 4ENQA 1PJ4A 1X19A 4YCSA 3TW8B 2IHBA 3NFRA 4R3WA 1YR9A 4MB6A 1E6MA 4TTJA 2I1QA 2GD0A 4X20B 3WO1A 3DLCA 4GYYA 2EKBA 4ARZB 1GR1A 4PF1A 2R5NA 4HDOB 4FMCF 4C4SA 4ZGBA 3QE2A 1I14A 4ZO9A 5SYAA 2NQ2C 4IIXA 1BXKA 1DO2A 2WSSD 1XA3A 1P5ZB 2F3QA 4RZ3A 2JHFA 4I3HA 2Q8QA 3YASA 3VNUA 2NYUA 1UBGA 1J06A 1K8QA 2H9IA 3E7WA 3FFAA 3WDMA 3QF4A 1FS6A 1KAHA 1R50A 4QOFA 1MJNA 2JHGA 3WZMA 4LYYA 3FJ1A 1IG0A 2ODWA 5CFRA 4EW6A 3ZXUB 1Y4UA 4Z1OA 2JVIA 3GUUA 4RK6A 4Q9NA 2DPGA 3T35A 1BA3A 1NQUA 1T9BA 2XODA 4P4GA 4MWDA 3OPVA 3L1IA 2NN3C 3DC2A 3GJ4A 3KWJA 4ZEXA 1MIHA 4M0LA 3L82B 4HLCA 4HB2A 1FZTA 3PDIA 1DAEA 3U7QB 2OAGA 3TGLA 4F5YA 2WR8A 2EIHA 3QJ5A 4DCVA 3F3SA 1GQRA 2P75A 3CLSC 3ZDXB 3ESDA 3S40A 3UK1A 2D13A 1ZM7A 5A62A 3T0IA 4XWTA 3OCXA 3T9FA 5BMVF 3QXXA 2IZ5A 1TD1A 4RKRA 1HT3A 5CIWA 1D03A 3AOEC 1K92A 2G9VA 4QLOA 3GGPA 2F3PA 3IT3A 3CC8A 1SBCA 1KMMA 3D1JA 2CSXA 2SCUB 1EXVA 1QHFA 2PMKA 3R9XA 3NIBA 3MQ4A 3KDAA 2GRUA 4OU4A 3QE4A 2ADFA 4JLJA 3BDVA 2X77A 2P8JA 1XZPA 4OKIA 1CYDA 3E48A 4ZAXA 3WNZA 1SELA 3NV7A 7ABPA 1HA3A 4JSRA 1V4VA 1H0KA 3KV1A 4G1VA 3OU7A 3LC1O 1OYOA 1XE3A 3FMOB 3DE5X 3SJCA 4KX5A 5B6IA 4KRFA 3CIOA 1P1RA 3PA8A 5JDCA 4U8GA 3QNMA 2R8BA 2PQMA 4K1XA 5A7GA 1EZZA 3M2TA 3R75A 2I7CA 1XNQB 4WLOA 4EB6B 2G80A 3MXTA 4H9GA 4O4JF 3TVTA 2FSUA 2O0JA 5J2TA 3EIFA 1ZM2A 2AJCA 4KUEA 4RKFA 2WP0A 2GM9A 3TQSA 2AOUA 2OZLB 3ONDA 5CK5A 3NDBB 3KOYA 1SHUX 1WDLA 4BMPB 1KZ9A 1PFQA 3CX3A 3GFRA 5GY7A 5AJYA 2Q6KA 3BEOA 2BI4A 2VC2B 2FXIA 4YJ3A 2XR1A 1BMQA 3GBSA 3STVA 4A3SA 4OREX 1J2YA 5C2JB 4M3NA 4UXHA 3CIFA 4L15A 4Y9DA 3UAVA 4F71A 3IXMA 2IXTA 3R2JA 1EA7A 2XTNA 2ZBGA 3GIWA 3LF1A 4NE9A 1RVDA 4Q3EA 3W8EA 2JLAA 3DL4A 1J0AA 5JVDA 1GCIA 4Z6KA 2NZWA 2WAOA 4IDDA 3LA6A 4AJNA 2PGOA 4O4LA 1DTSA 2GDZA 2IYAA 2W2LD 2C8KA 5L6LB 5F51A 5LBTA 4EARA 4HQKA 4XCVA 4BNKA 3ETJA 4JDPA 3DKIA 2FE1A 3BGDA 1DEAA 2J0UA 1HTBA 3HACA 3MB8A 4NV3A 4OH1A 2BGMA 4R7GA 5D7NA 4BGIA 4DDVA 3K5IA 4ZZIA 5CA1F 3LPCA 4Y2GA 3QXCA 1V7PC 2DPYA 4H3HB 4NDZA 5A0FA 3E15A 2G3YA 2A1TS 3PG5A 2P6NA 1OZHA 1UPTA 3LUFA 4QT0A 1IM5A 4OHOA 1UQRA 1ZJWA 4D26A 3OKCA 4P4TA 3KT0A 3Q0EA 2HDNB 2WT9A 1Z3IX 4HBGA 4YP7A 1P39A 1RMTA 2QAGA 3FMPB 2ZE7A 4XCXA 1W73A 2W43A 1M0TA 3HB5X 3HFGA 1P80A 4CJXA 3CJTA 1THTA 5FBRB 1IQRA 1HFKA 3IAM6 1EBUA 4PC6A 4CQMA 1W96A 2XQIA 3RW9A 3ANXA 4YECA 1EHYA 3HXLA 3KSZO 3VTKA 1AQ6A 4I46A 3EVEA 3ACDA 2R8OA 1IB0A 4LJ6A 1GUDA 1VG8A 3ETCA 3FFXA 4GRAA 4L02A 1B0AA 3A26A 4Y67A 4UUOA 1JQDA 3ZBPA 1XYYA 1SU6A 4DG9A 3UBMA 2B21A 2ZBUA 3TB6A 1KI9A 3QH4A 4LZPA 3VOTA 4EUSA 5F1YA 3L92A 3MWDB 5MGBA 4JOCA 3QKSA 4YAUA 1NXTA 1Y34E 2CFIA 3ELYA 1QTRA 3JSAA 1SVNA 2WT4A 3AKDA 5ALNA 1YQWA 1T43A 5M29A 4N1AA 3HA7A 1N2JA 1XSEA 4HDQB 5CT9A 1YJAA 5H82A 1RAIA 4LGMA 4GOMD 2KLBA 4INZA 4Q7LA 2GYWA 3FWZA 3KOXA 3P1JA 1R9GA 4E5MA 4KXUA 1NBEA 2WJVA 2H1VA 3QHPA 4FGZA 3L77A 3WLRA 4BXOA 3SXUA 5KVVA 1C0LA 5C80A 2IYSA 1L7DA 4BMXA 1ZNXA 2ZRIA 1R16A 2BFDB 3MJTA 5D3MB 3T3GA 5HZMA 1E3QA 3ET5A 1UQTA 1Y8QA 3EY4A 4PQYA 4ZVRA 1VRCA 2ANBA 2R6FA 3EIUA 1RQNA 3CONA 3PGXA 1U0FA 4FFOA 1MDBA 4FQ8A 4Y0NA 1XKLA 3V3TA 4AAYA 5E4TA 3GLKA 4FOLA 1XXHE 1FZQA 4OMCA 3QVWA 2LKDA 4QREA 4RF3A 4YIKA 4DT1B 1JB9A 4OJYA 2GEVA 3EQ2A 2ZYVX 3DDSA 4DBLE 3EY9A 1PZHA 3EVCA 2NYVA 4AP6A 2O8BA 4DIEA 1SHKA 3DONA 4PX2A 3COSA 2C4VA 3RS9A 4BLOA 2Z6QA 1NKSA 1US8B 3VKVA 1NW3A 2N42A 1P1JA 3E9YA 3JQDA 3OTHA 5AW3A 4H4EA 2I6QA 4C2TA 1RIFA 5A3RA 4EMBA 3H84A 1OY1A 1ESMA 1CCWA 3NRJA 5IH3A 3B1JA 3LHSA 3JALA 4IOLA 3J81k 3DDOA 1V7CA 2GPWA 4TS9A 1O08A 1ZPDA 4D6XA 4NENB 1CDZA 1B73A 4WVLA 4KODA 4CM3A 3D1LA 3EUEA 1AY0A 4G67A 3URKA 1RD4A 4FPXA 3UC5A 3M4JA 1TAHA 2Z9CA 1R0SA 1PT7A 3D6VA 4Y1FA 2H0QA 1NVKA 3AF2A 2A5LA 2G82A 2GUGA 4Y18A 2YMLA 1I4TD 4RANA 4PLZA 1A9YA 3W05A 5LDGA 2HUNA 2YH2A 5D5PA 1W88B 1DEXA 2WQ6A 1YRAA 2O3SA 4NOMA 3T3PB 3F5FA 2RGNA 5BYKA 3S81A 2OTCA 5MN6A 3ZV4A 2HSZA 2I2WA 3GRKA 2I3BA 4FI3C 1J23A 1IAQA 4V3CA 1S0UA 3PICA 4G2NA 1EM8A 2NTEA 1V6CA 3K72B 4J9UE 4L8LA 3QPBA 4P4SA 2GEKA 1QHHB 1GAJA 1U0EA 3A11A 4MV3A 5SV2A 2K2QB 4WH0A 1E3LA 1OPXA 3SC2A 3A6LA 1R3UA 4GI1A 4BVBA 5CDGA 1SQSA 4HEJA 4EY7A 1DQYA 2WA1A 1MV8A 2BLNA 4XGQA 1ZITA 1CNEA 1VE5A 5LB2A 4BBJA 4KW7A 1U8AA 2BKAA 3NLLA 3MJHA 4MVJD 4RLHA 5BUCA 2XNHA 3TXXA 1DJQA 1Q7GA 2IXAA 3RS4A 3T38A 3T95A 4ZVTA 3X43A 4N65A 3AERB 1QYIA 1N5OX 1T8RA 3IDAA 1QS0A 2OGZA 1E6EA 3GQVA 1LJLA 1CJBA 3VSBA 2RE8A 4WJLA 1KYWA 4QJIA 1MX5A 4DQ0A 1P5RA 2FKNA 3IC5A 4WXYB 3KOWA 3UZUA 1QP4A 4IVQA 4KXQA 3FNGA 4HVTA 3OLVA 2XRMA 1UFRA 2VR1A 2FZEA 1C0PA 4LHSA 4QEKA 2A86A 1M66A 1JHAA 1Q6ZA 4NNOA 3WOHA 4BGUA 5ESRA 3V6MA 3M4NA 1VJ0A 2H1CA 4M7PA 1NW7A 4B2LA 5E1BA 2ZXUA 4CW7A 3EOZA 3RAPR 3BOSA 3EG5A 3OX2A 4WOBA 1P7ZA 1TA9A 2PZMA 5IZCA 2IP1A 1ENZA 4G1CA 5BYJA 5DNAA 1IXKA 3B2QA 1Z9BA 3IESA 2O3UA 3B3FA 1TYAE 2BC9A 2EKLA 4GX1A 2GJ9A 4GX5A 1QO0D 4JEIA 4K6MA 5EIWA 3TAXA 4ONEA 2AG5A 4BOYA 4OI2A 1EP1B 1G5IA 2YV3A 2BFWA 2ZT7A 2V0CA 5LYJA 1YBFA 1UJCA 1TO6A 2OZEA 3HN2A 3Q4GA 4G84A 4HGNA 4RH3A 3ZCXA 1SPXA 4KAXA 2VJYA 3CSDA 3QVOA 2JKZA 4WE3A 3BQ9A 1VJDA 1ZU4A 2EW1A 4JJ7A 1WZ2A 4FDUA 4KH0A 4QOHA 5B1YA 2QE7A 4YYZA 4RVHA 3ILXA 5K3DA 1PUIA 2JEYA 2Y99A 2D2EA 3IIKA 3LBIA 2GWHA 1RAEA 3Q8XB 4RMHA 4S1VA 3ZHVA 4DPLA 5FBWB 2DBZA 3FJYA 1Y7PA 3PX2A 3NTUA 2GBCA 2FW1A 2GVZC 1VHLA 2LGJA 1T1GA 1EESA 1LZKA 1U28C 5DIZA 1XFAA 4F5EA 4R8RA 4D8TA 4IGEA 4AMVA 2JRLA 3I9LA 3PPIA 5C4IA 4OO3A 4NBKA 3HM9A 2ZE5A 3T7KA 3O26A 2BGLA 3IPXA 1JEYB 1F12A 2LV8A 3KKMA 2P4UA 4N0PA 2QX8A 4U6QA 4JGBA 3IURA 5IBPA 1IY0A 3CVVA 1CUGA 2YFHA 2C0PA 2Q1XA 4Y6PA 2HBRA 3LUKA 5DM1A 1NBMD 1XZBA 2GJSA 1CUVA 1RAHA 1GPKA 4NQZA 5LQSA 1JR4A 3UAZA 5KNBA 4OA8A 1M2NA 3TMKA 1LRLA 5KTNA 1C7EA 2ACKA 1MF7A 2PNFA 3E8SA 3HSSA 3MRVA 4JLDA 2PGIA 4ZXPA 3DBHA 4MA4A 1EGVB 3DZIA 5DW0A 4YR9A 2D2XA 3OZAA 4ZJUA 1Z0SA 2VT3A 4TWRA 1PQPA 1H4VB 1NMEA 2VP0A 3N6XA 3W5BA 3VHXA 1FF9A 4D5EA 1DAIA 2VP3A 2NU8B 4R8MA 1EJ2A 3LRXA 3GX1A 2V58A 1ZH6A 1TRHA 4KX3A 1M5RA 1KGDA 3MNFA 1PGPA 2BI7A 4DCGA 3WLAA 3B7WA 2WYWA 1EPUA 3FUWA 4NX2A 5EJ8A 2G5PA 4GVLA 1JNXX 3I5MA 1J20A 1YASA 2ZRNA 1X7ZB 4WK2B 2AMYA 1HNWB 2BLLA 1C7JA 4S3MA 2YKGA 2VZEA 2ZE6A 3MT9A 2OZVA 1Z5PA 4ZYVA 4M9CA 1M6EX 4C4OA 2AJDA 3TN7A 5F9FA 3T3HA 5HJ2A 2H18A 5B3AA 2AEFA 2A0WA 4KE6A 3BT7A 1DKPA 1F4PA 3NWOA 2VH2A 3QLUA 2VHUA 5ALTA 4HYEA 1KR5A 2JCBA 3CKLA 1QHGA 1NLUA 3B1KA 5FWXA 5HRUA 2ZYWX 3QYJA 4N41A 3W1WA 3UMCA 3HKBB 4LQCA 5T67A 1XZCA 3VKWA 4ZI3A 2BM9A 4LGVA 4Z4EA 5ITVA 1W4RA 5EL0A 4U6SA 4RKEA 4DG5A 3E35A 1SKUA 3HNRA 2RH9B 3QY9A 4ZVKA 4C0JA 5C1OA 1W48A 2I6FA 3EXFA 5J5AA 1P7VA 3LPLA 2ZT6A 5FP0A 1YQTA 1T9HA 3SQLA 1QANA 2FPRA 5ALSA 4OK6A 2Z2KA 4Q82A 3MOSA 2BD0A 2JIPA 3LA8A 1DKUA 2CHQA 1PFVA 1OFHA 5JIBA 4IEFB 1KOLA 1WMEA 4OPMA 5DBFA 4AWAA 4HYYA 4QKQA 5EE0A 4ZDIA 3IA7A 3MJFA 4LRYA 1KMIY 4FFVA 1ZD2P 4DR3B 1K89A 5ITZA 3AC0A 5T6BA 4CI0B 5JR3A 3BZUA 2JCSA 3ZHTA 2RI6A 2RGBA 4PSAA 3VZQA 2PQ0A 2JFZA 1SURA 2XDQA 3PVCA 4JLMA 4YALA 4BWGA 3FKQA 1FPMA 1V5FA 1Y9JA 1IXYA 3GA7A 4R54A 4G6ZA 1RWWA 3LKDA 2ADOA 2WBLC 3ZWNA 2Z8XA 4RX1A 4WACA 5CX1A 3PGKA 3GP5A 3PCXA 2OLEA 4FFDA 2ZT8A 3HY6A 1ZOOA 2UYQA 3TLZA 1Q7CA 1H2YA 3KUKA 4O4IF 3T1QA 2C5LA 1N2SA 3VZDA 3ZY6A 5BORA 4GKJB 1KARA 2P0YA 1HEIA 4FNAA 3TEFA 1OSNA 1HOXA 1NVMB 4PAQA 2ZTSA 5JSUA 4V0QA 2WTMA 5FBVB 1O9GA 5KNDD 3ND8A 4JKYA 1YUNA 5G40A 1PLKA 2IOQA 3TTWA 5E6UA 3HCAA 3NIDB 4MK4A 4HV4A 4AJIA 5KJCA 3DE0X 3PXAA 1JG4A 1G7SA 1GTL1 1H4SA 1MC5A 2YYYA 3RUDA 1QO9A 1AU9A 3MGGA 3HDJA 3PGLA 4B1FA 5BO5A 4E3WA 5J2UA 1I9CA 4G0UA 2P4EA 4DMKA 2VAPA 2PUHA 4KYTA 5JMTA 1XR3A 1Z22A 3PLRA 4MW4A 3RQSA 5JARA 1YK0A 5KYWA 3WICA 1NUQA 2E3JA 1L5HB 3OIUA 1XTKA 4U39A 4FYYA 3D6MA 4YRKA 1U8YA 4P4LA 2C0QA 2G67A 4RCYA 3REOA 5L51A 3KBBA 3LO8A 3QY0A 4TV9A 4YP9A 1IHDA 4JY7A 3TE6A 4AMUA 3EGIA 1G63A 3CXRA 4MCHA 4C6TB 4A10A 4MO9A 2IHNA 2HY7A 1YZTA 3SM9A 2HJVA 3MOIA 3ZCSA 2H51A 3U44B 4QUAA 3OU6A 5FUYA 5A1JA 5KJ6A 4UARA 1IUPA 4GF5A 4H1UA 4Z9YA 5A5GA 1QC5A 1OH8A 4RFSB 4EDHA 2Q3EA 3Q7IA 3QKTA 4MJLA 1GGVA 2W00A 4FHFA 1VCHA 5IH7A 2WMYA 2C97A 3BRCA 1JDTA 4KXLA 5AUPB 4YROA 1MQAA 3PJGA 4W1QA 4KP7A 4KEAA 1PFWA 1QO7A 1AD2A 5JJBA 3KJEA 4L7VA 4LJ5A 4OXKA 2WPDD 4DJTA 4CCSA 4GLLA 3H2YA 1P2VA 3TQIA 2VZLA 2H1RA 1WDTA 1U2EA 2O2SA 3H19A 1T0UA 5KSPA 2IHTA 4K9NA 1SZCA 4TZTA 5AJZA 5J4VA 2AXNA 1GRVA 2HHAA 2X6QA 3ENKA 3LFUA 4YMVA 2E5LB 3PIIA 4NEGA 3RYCA 3WZ2A 1K5DA 1KEEB 2I67A 2TMDA 1WQ1R 3QITA 2I4IA 3CG0A 1P2FA 3CRNA 4IJ6A 2XCUA 4YWHA 3EVNA 1RAAA 1YE8A 3CB4A 3IAS1 1OV6A 4RENA 4WOPA 1Y37A 2QQEA 3QBJA 5G0WA 2YHUA 3RR2A 4BGDA 4HPXB 4E21A 5GV7A 4EEKA 4BJ5A 2UYCA 2FY8A 1JSLA 1G291 1ULUA 2CDBA 2G6TA 2RSLA 3L8FA 3JQCA 2FR0A 3O8QB 4KHZA 4QHTA 2BH9A 3UFXB 5PGMA 4F60A 3K6JA 2FPIB 3SJBA 4A0RA 1P2UA 4GWKA 3EW9A 3IT0A 4UHFA 4NAUA 4YRDA 5IN5A 4Z51A 3V8EA 5G41A 2VPXA 2H4WA 2KM1A 4Q66C 4WCVA 1R8JA 3VDXA 3M34A 4GXTA 1U3GA 4EX6A 1F8YA 2FWJA 2W4MA 5F98A 1U8ZA 5C46F 1SU4A 4ZA2A 1PQUA 1G8HA 1JDPA 2VOEA 4OSEA 3EXHA 5H83A 2PSFA 3D02A 3SAJA 5LZ4A 1RQRA 1QX3A 2AK3A 3LY9A 5J2TF 1FFXA 1VMIA 1IMOA 5ENVA 4BNHA 4FDVA 2B98A 3UOWA 3SJAA 2NZ8A 1EMDA 4RK0A 2IYEA 5KAPA 3UWSA 5F1PA 1JKFA 3F4KA 5G1PA 3VX4A 4W5HA 4D57A 2I2DA 3E8MA 4C4PA 1LI5A 1TM5E 2F48A 2OD9A 3FJOA 3Q98A 4WV3A 5CNKA 4YJ3F 4D9EA 4TV8F 5ICMA 2PYDA 4Z7QB 5TT1A 1A71A 1CRPA 1J00A 4KG7A 1EFHA 4KBYA 1H5NA 1IM2A 3E22B 3OX3A 2FQQA 3WGQA 1SUEA 3AEZA 2P65A 3AG5A 1TZCA 4RK1A 3NHPA 1BX0A 2NV0A 3KKQA 3R5XA 1PW7A 3ILVA 4DCMA 3K8OE 3LQYA 4BTEA 1Z8HA 2P30A 2P9BA 1Z4LA 4MNTA 2V7TA 3TZEA 5CJJA 3DYBA 4HDNB 4J43A 4BFCA 4Q1DA 5BVHA 1RRMA 2C2HA 1VSUA 1C0KA 1MT0A 2PZKA 3EIXA 3HYCA 4FMCB 4P38A 4R7ZA 4FSXA 5BQPA 1PO7A 4U63A 4LFBB 2ZRHA 3DE7X 4JYPA 2HLDD 3FHLA 3AY7A 3OZIA 4OQEA 1DDOA 3E23A 4RV5A 2F67A 3UANA 4A8HA 4E6EA 5GGYA 1SUCA 1OVGA 1T8YA 3LDUA 1GRQA 3F5QA 1NU6A 3U7EB 3K5PA 2NO7A 4I19A 2VEDA 3JW8A 3PDJA 5U4XA 4RJTA 2G8NA 1WPQA 2GM4A 3VJRA 3LWZA 1THZA 2ZSFA 2ZIFA 2YXNA 4AZ3B 3WQQA 1GHTA 4OKSA 1ZA2A 3IQWA 2ODNA 3IV9A 1QGZA 3W6ZA 4INAA 1BWPA 3T9BA 4X62B 2EW2A 2GAFA 3TIXB 4GP7A 1XJ0A 4AECA 1KEKA 2ZZMA 4RHYA 1EK2A 4XGNA 3JPYA 1QK4A 2REOA 3H17A 2FW6A 4QSMA 3T3DA 1OOEA 4JBLA 2QTFA 2WAAA 1FXUA 3TWOA 1N3LA 4GDFA 1P8JA 2FOIA 3EC2A 1QIMA 4HXYA 4EELA 1CS0B 3UO8B 2AJBA 4HWOA 3UUGA 3WMWA 3BH0A 3ZE6A 3A9VA 1ZONA 1T36B 3DNMA 3EPPA 3UMFA 1ES9A 3LO5A 1N7GA 1DJPA 5SZHB 3H05A 4PONA 1YZFA 4NKRA 3I6YA 5CLQA 3NB0A 3QE0A 3TQFA 3ZD8A 3IBYA 1ECPA 1HKUA 2E4ZA 4HD8A 3EZLA 2YZMA 3DEAA 3G9XA 3H5RA 4G07A 2PXCA 1XXHB 4IGFA 4QM7A 3IP6A 1P44A 2PUWA 4G0WA 4JB0A 1PJRA 2UVQA 2GESA 3CJQA 1RYNA 3OJOA 3R7BA 3FYUB 4NBVA 4D41A 3O47A 1E4YA 5IXJA 3AL3A 1P73A 3EGXB 1F38A 3LQ4A 3Q3JB 5K0FA 2JLQA 1MPTA 5FHRA 3RVBA 4EUEA 1YE5A 2BCJQ 4EB0A 4HFMA 3B1XA 4X3PA 2HFJA 3UJAA 3AVOA 3ZWXA 1Y3HA 3ENQA 1D0IA 3TEMA 1QBGA 1NN3A 1YMQA 4UPVA 3N7TA 1QPGA 4W8GA 5CYGA 2WSBA 4KQ9A 3RRYA 1X7DA 1RC0A 1A8IA 1F3OA 2BBOA 1QX4A 4ZAVA 1X0XA 1V3TA 5KOJA 1P1FA 4JI7B 3EZFA 3VU3A 5JXJA 2PT9A 4NR0A 1OZFA 5CP8A 1GTJ1 1QVVA 1NA5A 4X8MA 3OAAD 2FR8C 4II2A 3VYWA 3NW9A 2BAGA 2J4CA 3MIIA 2IE0A 1DQZA 3PVSA 3UJ7A 5CPFA 3OZXA 1AH2A 4GI3A 1PGOA 2RGGA 3DKVA 3EIEA 5E7MA 2C2GA 2NZUG 3IAEA 3PUIA 4IS3A 4ZMRA 4H31A 4GVXA 2EEZA 4HO1X 3UW3A 3AM1A 1T3GA 4J0QA 4A8PA 2NWQA 3OQ1A 4YGYA 4YAWA 4ZREA 3GVCA 1GFIA 2W6OA 3Q41A 4CXMA 2JFNA 5TMDA 1OBHA 5C1DA 1G21A 1OGIA 1L4UA 3BMOA 3Q88A 4GGMX 1ADGA 1Y1SA 3P9KA 4JZKA 4BBPA 4ZZ0A 2Q29A 1XMQB 2BT4A 1H2EA 4QOEA 5HJ7A 2OWEA 4MV8A 4UHKA 3K32A 4YVFA 4LXHA 2AS0A 2UZ1B 2YZ7A 5HQTA 5K0ZA 1K06A 1NJ5A 1PR9A 3L0DA 1XU7A 5D85A 2NXCA 5LZ8A 1UAGA 4O6VA 2M9MA 3DOIA 3U4QB 5KMGA 1VYHA 3G0BA 2EX0A 4ZK6A 2ZUDA 3WSWA 4MGKR 4IXTA 3LWBA 3IPCA 4MYRA 5EIHA 2X2PA 4UNNA 1XHEA 2XCLA 4A8JA 3JQPA 3TIGA 3DE2X 4XDYA 1NW8A 1FXWA 1IBKB 1W36C 3WXMA 1DWUA 1V71A 1VHJA 2WJYA 3DLPX 1B0ZA 4NESA 2VYNA 3WGYA 3ZHZA 4DUGA 2HA0A 4D43A 4ZO8A 4IIYA 3RTBA 1IZ9A 1JEOA 3HB1A 1XL0A 1H23A 2W2TA 3ND9A 3K96A 1E3IA 4FU0A 2AI3A 3IVMA 1LLUA 1BEZA 1Q1ZA 3GFPA 3D3KA 4GBJA 4OHYA 2IC5A 3O03A 4KR2A 2OZPA 3KU1A 1XXLA 4LRUA 4TTTS 3B7PA 2XVAA 2ZJ4A 3CRW1 1PWEA 4HNHA 4J7CA 4L08A 1TYDE 3CF4A 3KYIB 2Q4TA 4LV8B 3C2QA 1IVYA 4R9NA 4C4ZA 2Q5CA 3TE7A 4WTOA 4I6EA 3E0XA 4HDAA 2GZSA 5K8UA 1HZZA 2FWNA 3BXEA 4YREA 3L8EA 2FSFA 1Q1GA 3IXLA 3U31A 2CL7X 3AM4A 1V11B 4ZTUB 4L8VA 3I8OA 2H2DA 1Z7GA 3O4JA 3OQHA 3RNLA 2P2LA 4OXIA 3ZN2A 3GGCA 1T2VA 5DN6D 1AMUA 4B45A 1YKFA 5FOQA 1G8AA 3ES9A 1FP1D 3RCBA 4OYYA 3HQ4O 4Y6LA 3ESCA 3TFWA 2G76A 5CDFA 4JCOA 4YUWA 4G5QA 1GNQA 2AR9A 4OLHA 2D00A 5L3SA 2RH8A 4DREA 5LYJF 1UCFA 3DE4X 3N8DA 4ZAFA 4ZU1X 3U16A 1M5UA 3FTEA 4KR3A 2J6HA 3H9QA 2B0CA 1C50A 2EBHX 3KQWA 3FMGA 5LL6P 2GYYA 5KSZA 3IBTA 4YJ2B 4KYVA 3C87A 3O8RA 1U6KA 1CHNA 1Z5WA 1MT3A 3HCBA 4WXPA 3VR5H 5T8KA 4JV5B 2ZR9A 2IYZA 2F1KA 4S2UA 1Z4OA 4ISCA 4FBMA 3TYXA 1UKZA 4DR2B 3H0KA 1JE1A 1M1XB 4O2AF 2I87A 1V8ZA 3R3WA 3NVMB 4Y6OA 1AM4D 5ILOA 4D4KA 3STXA 4EP1A 4I1PA 1O4VA 1B6TA 4N8SA 3B7GA 4V0RA 4D9IA 1Q3KA 3GR6A 1W7AA 3M9WA 4D82A 3QF7A 2ZVDA 1FUYB 1W4ZA 2W2MA 4PN3A 3TRIA 3UW1A 4YX9A 1SOWA 4ZPJA 1ZK2A 4E07A 4QATA 1RZ3A 2I22A 2R5WA 3KBOA 4R1OA 4Y1RB 4A0FA 4G5GA 1Y3FE 2X9QA 2XD9A 1E89A 2QUHA 1H66A 3KT6A 4J94A 4HWSA 5EZYA 3RYFA 4KGDA 4D4JA 5B3JC 1GKYA 1MENA 2GCPA 4EF4A 2WHPA 3HLKA 5BNFA 1NUTA 3TQRA 3GDOA 3IR5A 1G66A 1BE0A 4C06A 3W5DA 2VF2A 3DBLA 4EPVA 3JQ9C 1Y6FA 4XUCA 5DHPA 4DXAA 1ZU5A 2HH9A 2PSDA 4RXMA 4BDSA 2DTEA 2J07A 5E95A 5I5EA 3PQ2A 3H1FA 2XCSB 2AFIE 1RXVA 3RFVA 2H0RA 2KWIA 4O59O 4URZR 2PMEA 4DL9A 1SXJE 2WJIA 2M2IA 1PNQA 2IDJA 2LNDA 1XEWY 2QMEA 3S68A 3WLMA 3ZTYA 1IY9A 2UXBB 2Y67A 3LBNA 2WQ7A 4Q37A 1I6MA 1NRXA 3M3HA 1GCAA 2ZBQA 4GOJA 4II7A 1U2GA 4QIHA 5HE9A 1JFFB 3JAWB 4BKQA 5EJMA 2J3HA 1IQUA 2OY0A 1W9HA 3HZZA 3EWSA 1EHIA 3ROMA 2ZSHA 4US0R 4RWZA 5FA5A 4DCNA 1DV1A 2WLSA 4FCVA 1LV7A 1BS1A 1UADA 3ERCA 5EN4A 1UPXA 3EGVA 4H60A 1I33A 1ISSA 1C41A 1PBTA 2QTLA 3DAGA 5I7FA 1N8TA 2ZJ8A 3SYLA 1V39A 1SC6A 2HRZA 2J3LA 3LW7A 1LBTA 4A0SA 1FRQA 1Y9AA 2CCGA 4UEWA 1GFZA 4I4TA 1HYBA 3CZ9A 5BWNA 4KYUA 4J91A 4UHHA 5K0JA 1LPMA 2AW3A 1E7SA 1YZHA 2CLHB 4LWPA 3A1SA 4FILA 4LYAA 2UYOA 4FT2A 1KZGB 1JAHA 4MA5A 5TEVA 4MHTA 2PO5A 4UBOA 1UPUA 4R8KA 4ZQFA 1AMOA 5ILQA 1XL1A 1YRYE 4KQCA 3JQRA 4QGGA 5KJEA 1DIRA 2AA3A 4UZEA 1DAGA 3SZ3A 3WB2A 4CG2A 4DJFC 3DWIA 3LGXA 3ZGXA 5DTEA 1KQNA 1S02A 4HNAB 4PLCA 1NJSA 1PJLA 4AY4A 5FUBA 1RLOA 2H08A 3O8OA 1H2WA 2VSOA 4R01A 3RWOA 5E6RA 3RLIA 3NBAA 3V48A 1V4NA 5JD5A 4TYQA 5A1TA 1N57A 1N6PA 4H27A 2G9RA 1JHVA 3AOEA 3M89A 4PLHA 5F21A 2FUG6 4BP1A 5I4CA 4DB2A 2TMYA 1SZPA 4FCTA 1L5ZA 4JEHA 4DA7A 5A4DA 1SXIA 4F2WA 3WOVA 1E2EA 2GCNA 3QKUA 4YUVA 2IODA 2H6EA 4IHJF 4E70A 5JNSA 2IY8A 3GUHA 1KDRA 1CERA 4QNRA 4C0AC 2GXAA 2HF8A 1DDIA 4IUYA 2PKQP 1E1QD 1YRBA 2PFGA 3JRXA 2A1UB 4MRMB 1D2EA 4D97A 3PC6A 2VHVA 4MJ3A 3C7DB 4P35A 4WZBE 4KU4A 2W93A 4P7BA 4XXHA 4MDFA 3IQIX 3LL4A 1YQ9A 3CNNA 4TQGA 4DRXB 2FFBA 1T1EA 4G86A 1CUEA 3DVRX 3QEOA 2EX4A 1JVBA 1N7JA 1ZJYA 2PLAA 4HDCA 4S1NA 3WGNA 2ZU0C 4BBAA 1G7CA 1ZKDA 4AN4A 5BYAA 1NQAO 4GNRA 2ZIVB 3E6AA 4A6XA 4CM9D 1FTYA 3KYDB 2AMLA 1J24A 1YR8A 3C6YA 4G8BA 1C9JA 1QCYA 1U5CA 1XP8A 4HDSA 2QAIA 1A77A 1QDLB 3LW8A 621PA 4BLVA 1MHTA 1QTQA 1ORRA 4XR4A 3I34X 4LVOA 1K5GA 1T2CA 4QELA 1PS9A 2ZQ5A 3KFVA 4J29A 5DWDA 5EMJA 3WSVA 4XM0A 4QFMA 2L42A 5GIOE 3C3JA 1HDGO 1LSJA 4M87A 4ZODA 4ZARA 1AF4A 2JGLA 1JA1A 2B82A 2OQVA 1OHHD 4HGQA 2VN8A 2XB6A 1DADA 2WSLA 4OMFG 5E9AA 3WDSA 2ATXA 1Z0DA 1E3EA 5CNJA 4GBMA 5CCDA 2V03A 3EH2A 1HE4A 5CH8A 3WGVA 2X0IA 3A9TA 1QR6A 1JPUA 2DUJA 3AHEA 2JF0A 2L17A 3M1IA 3NHBA 4RA6B 3ZZNA 4D4GA 4N40A 1UDAA 1Q14A 4HAZA 1OYVA 1S89A 1E6UA 4KLNA 2BDEA 2Q5LA 1N5MA 4C4XA 1KJ9A 1YR3A 4JH0A 3ZS9A 5LR6A 1UZAA 5ABPA 2BL4A 1TIPA 5CB6A 2ISQA 2AH5A 5J3JA 1MR3F 3AEKA 3ZWYA 1V1JA 3RRFA 4PZEA 2NP6A 1KK2A 1GUFA 1NFFA 1H22A 4C87A 1U2TA 3H1BA 2X9LA 5BW6B 3RRMA 1XF1A 1NL3A 3UICA 4DMCA 3UMSA 4ZVQA 3ORHA 3IERA 3LXMA 1USGA 4JMLA 4YLEA 4D4HA 4RTSA 4IHKA 1NXWA 2ZIXB 3NBKA 3ZHCA 3DBRB 2OOKA 3Q8LA 2VUUA 4U3JA 4CLRA 1NM5C 1VI5A 3OKFA 3QKRA 1F0KA 2F43A 5DYNA 4EI7A 2ZJOA 5C8ZA 3U80A 1QWSA 1VMAA 1HORA 1QHEA 3TD6A 3WHIA 3I0ZA 1AV7A 1QONA 5EQJB 2VTBB 2O8NA 3RKRA 4ON9A 3INTA 3WGUA 5IWCA 2O14A 2OBXA 2WTNA 1VC2A 3FOCA 4MGHA 1HFEL 2MJLA 4KL8S 4ZOLB 1M2FA 1U2RA 2ZI5A 4RV9A 3F98A 3T4PA 3Q9NA 4EUFA 1QE0A 5IC4A 3KVOA 4G9EA 3RDPA 1KVTA 1XTBA 3H9EO 1YRLA 1B3RA 5F4BA 3VOSA 4BC0A 1IOWA 4EIWA 3F96A 3NAMA 4HGRA 3ZQJA 4YN3A 1XO1A 1DQNA 3SC4A 4D9HA 1YVRA 4DHEA 4JLKA 3WWEA 1KZ6A 1A8PA 1S01A 1SOVA 4OH7A 4DC0A 2IZOA 4U9HS 5B1IA 1OZGA 5CVVA 3JQFC 3L7NA 2Z98A 4MCAA 1SRRA 5B37A 3WYFA 4AF6A 3FXAA 3CKYA 2HD4A 4QJ3A 5AW0A 4PNHA 1SHLA 1LF0A 5CUQA 5T41A 2JZOA 1UZLA 5AVYA 4AB1A 2NU7B 4MQ4A 4OBWA 3W0LB 3ZIAA 4A9AA 2GZDA 4B44A 4HNGA 3RVKA 3JATB 2O8FB 1PVDA 1XZQA 4NE7A 1FTNA 4TUYB 3TEJA 4YR7A 3OP4A 1AJEA 5FJIA 2A5YB 1IN5A 3OQ6A 2VI5A 3OY2A 4W9RA 3LYLA 5LP1A 1JEQA 2Q7OE 1ZH2A 2OEPA 3ML1A 1N2IA 5I4KA 2ORVA 3IGFA 1H8HD 3TTYA 3VC1A 5FLKA 3RE1A 1GG5A 1NDQA 821PA 1S7CA 2WWYA 1PG5A 1MC4A 1W87A 2C9CA 1LW7A 3A58B 3HN6A 5ALPA 1Z0KA 4IDPA 1HGXA 3VPGA 5AVTA 1JX6A 2Q5FA 1FEZA 1X6VA 5J40A 4AY6A 4RF2A 2OCIA 4OA5A 4YXFA 1NVEA 2AT1A 3EQ9A 4P1ZA 1KBQA 1E9AA 1GKIA 3N07A 4BBZA 4E0BA 2BFAA 2J6CA 1EDZA 2X15A 4HDKB 4Q4JA 4QBGB 3PFCA 4MH0R 2QT0A 4MINA 1UWKA 4U4AA 1A7UA 3QM1A 4Y0VA 3TJRA 1L3IA 4OGKA 1WUHS 4DBVO 1CB0A 2PMDA 1C2TA 1FNBA 1ID1A 1PX2A 1Z6TA 3HUFA 3IDOA 2JGNA 1AZWA 4LNHA 4W1RA 3ONNA 2ETXA 3GZTB 3FYDA 3U56A 1XAGA 3X1DA 1PP4A 1B8NA 3AUJB 1E5QA 4BNWA 2RGCA 2HX1A 3B6EA 3BK2A 1PK7A 3GQBA 3MJEA 4MV9A 5CPBA 3MS7A 3LOQA 4MQ5A 1AKVA 4ZRDA 4ZDWA 1EFDN 5JAQA 4HXGA 1F5SA 1N6NA 3TTTA 3WDKA 4EGAA 4FP9A 1CZRA 1UOQA 3AU9A 1KJZA 1Y1RA 5EJIA 1ZD9A 2B83A 5ER9A 4PQEA 3TFQA 2QM0A 4U2BA 1A9QA 1UMCB 3UK0A 3WK4A 3R0JA 1IL0A 4Q4LA 4BLRA 4YUAA 1FYDA 4U7PB 1R5NA 4RJ2A 4B75A 2XNDA 1HT2E 3KEFA 3OIGA 2A78A 3FWYA 1JJ7A 5DT9A 4D81A 1RM3A 4O1MA 4TWZA 1WEHA 1E3TA 2DHDA 3FGPA 2WHXA 1P33A 3QVGA 1XEWX 4CDGA 2B1GA 1ZMBA 2VP6A 4KQIA 4ES6A 4PO3X 3I1FA 4TKVA 2VXBA 3Q9LA 2ZREA 4OX9Y 1XZJA 3RK4A 1AKMA 1DRKA 2FEKA 1QVAA 1J9ZA 3L8ZA 2J5QA 4AJKA 4CUJA 4EBFA 3ULKA 1OXMA 5JJCA 4LJ4A 4XX1A 1WXGA 1TJ4A 2GPJA 1V9SA 3WKAA 3Q1KA 3JQQA 4D9NA 4IW3B 1HOTA 3EVGA 5DHSA 2YBEA 2PDAA 2MINA 4ICIA 3B82A 3K71B 1TGYA 4ND2A 3T7JA 5F3WB 2PMCA 1SKBA 2IYWA 3DH0A 3BA1A 2O2CA 3JRNA 2A9RA 2JIDA 2ZQZA 4TV8B 2GZ1A 2TMGA 2QMYA 3I12A 5CT5A 4D2IA 2PH7A 3LVFO 4OQQA 4FYHA 3ZH2A 4GGPA 1WZEA 3DVAA 1YTUA 3LCUA 4RIIA 4QPPA 3FRIA 1ZN8A 1JHQA 2CEAA 3T9CA 1BH6A 4PICA 1T6YA 4K2AA 3OZ7A 3LCRA 4RH1A 5F5XA 2AN3A 3DOEA 2RGXA 3HC7A 3W5SA 2ZIAA 3VPHA 5CFNA 1QMPA 4U0KA 4XSHA 1NSTA 4P2GA 4DDWA 3UN1A 3S2FA 3GZJA 1U28A 4K88A 2ZDQA 2GPNA 4IZ6A 3DE6X 1P6UA 4BMYA 4JYZA 1H2BA 4RKYA 4E1AA 1N6HA 2V7QA 1DKLA 3T94A 4J0KA 2ZUSA 3H2JA 1FU7A 1Y7IA 1HETA 1ND6A 1Q2UA 1QGDA 4NJEA 4PFJA 3TM4A 1UBOS 4NZZA 1N1MA 5E7JA 4LXUA 3I9V1 3IYLW 4CEJB 2W6QA 4H1VA 3L7DA 2Z3VA 4D8VA 1JHXA 3KVVA 1EEHA 1CDEA 1CR6A 3P2MA 2REXB 2V7BA 2P2ZA 1FJHA 3HWRA 3Q85A 4LTMA 4R84A 3FSJX 1FK8A 4AMGA 1DT3A 2W71A 1MG0A 3CZCA 5DBEX 5JU6A 3FSRA 2YWRA 5HUHA 2F1OA 5EQDA 4QLAA 4DLLA 4RORA 4BE7B 2Z57A 2DFDA 5LMNB 2IH4A 1TVCA 4K7JA 5TR9A 1YUMA 2Q0QA 3R44A 3KPUA 2C4MA 3KOZA 5IARA 1Z47A 1UK8A 3NHSA 3UKOA 1YVPA 4AY2A 3GUCA 1TW2A 1ODIA 1ZCJA 3BL8A 5H5JA 2WF6A 2BTQA 5FUVA 3SYTA 4NG5A 3AT1A 1LNSA 1SXHA 1PYGA 1PKXA 2YZ2A 1SFRA 4DVGA 2A9VA 4OHCA 1WXQA 2QP3A 3MGAA 4A8TA 3AESA 2AMFA 3FVTA 1U8UA 4FKMA 4R9UC 2HFKA 2AUTA 2QL9A 4A23A 6AT1A 4AP9A 4JJKA 1B8UA 1G64A 4R68A 2IU0A 4CV3A 3NGMA 3RHFA 1IWBB 3RNOA 2GB4A 4D0NA 2OYCA 1U0LA 4DNOA 2IH2A 1FLDA 1GNRA 4IFEA 4M0DA 3GRAA 3TSOA 4BNMA 5HRCA 4C7OA 2GCIA 3SMQA 4BN4A 1S2LA 5AUNB 4R9SA 4FDAA 3BFJA 4JJ6A 2R4TA 2AMVA 2IVZA 2PKYX 2I7XA 4MITA 1GYQA 2A0UA 4PXSA 3EZXA 3IP7A 2Q3LA 2GA8A 1G8MA 3O4VA 1ONOA 3L1UA 4YJHA 4BO5A 3KP1A 3KQHA 4GMFA 1IK6A 3VRHA 4DDHA 1KJQA 2WAXA 1XZHA 4B3FX 4GLJA 3BJZA 4MW7A 3U81A 2HRQA 3UCEA 4C0QC 4BTLA 4EMTA 1PNTA 2A5FA 5BQFA 5FFNA 5KVAA 1J7JA 1OGJA 3EXEA 4MI1A 3WYNA 1JTEA 3HU3A 2PLFA 3A6ZA 1ZXLA 3VDMA 3ICWA 4MMZB 3CTMA 1GEGA 3AXSA 2QRHA 4JP2A 1LK0A 1I3MA 1JEDA 4UATA 2ZJZA 5LKAA 2WY2D 2EFYA 1J8QA 1U5AA 3M33A 2V6GA 3UTCA 5T4FA 2D1YA 3E82A 3CKMA 1BDHA 1QZ3A 3TTXA 5ARDA 5I9LA 4EW2A 2XBMA 4FOPA 3UWOA 1BS9A 5BY2A 4PRKA 2PY6A 3HNPA 1OLSA 1Z2EA 4JP3A 4WKBA 1S8AA 1ZBDA 2AQIA 2C4HA 2QUIA 3QFCA 1EFPA 1Z15A 2FKAA 1W0JD 2Y9PB 3EOAI 3PX3A 4JDUA 1R0LA 5EKSA 1QQ7A 1KPHA 2QM3A 5ELXA 3U9SA 2FW9A 1Z4NA 3W8DA 2IS1A 2GRAA 4MVJM 1CUUA 4CT0A 5JQGA 3H9CA 3KTOA 5L7TA 1TU4A 3GC6A 3WTBA 2AFIB 3FI9A 3JX9A 3PB3A 3R6WA 4R0VA 4WW0A 3OE7D 4GL2A 1Q22A 1SXJB 3IH5A 3KKOA 3C3MA 3M81A 4DWJA 2WKPA 4UCFA 5KSOA 5EZYF 1Q0SA 2IEAA 1MDFA 5K0LA 1LPSA 3R4CA 4CTMA 4KIFA 4M86A 1U1DA 2JLXA 1WD5A 5J4KA 1H5UA 2V3WA 1Z6PA 4WT7A 1YOVA 1Y3CE 3D7LA 1FIUA 4RY9A 4NI5A 2PWBA 4PAGA 3BD9A 4YRBA 3ITKA 3BQNB 2JAPA 1CF9A 4YIHA 4AJPA 2IFTA 1OC4A 4IJWA 4LJRA 3ITDA 4FWIB 1ZG3A 3MHPA 3FPHA 3PFBA 2VPWA 3AF4A 4RESA 1BCRA 1ZRNA 4MV4A 5EE5B 2HQRA 1REQA 1QM5A 4ZJZA 3ROEA 2H16A 5EUBA 1SN7A 3KLPX 3O84A 4YHBA 4DV0B 1QJCA 2W4IA 1X8KA 4EW3A 1BCSA 3Q40A 1NVVQ 1M1YE 1TRKA 2FSVA 4H3SA 5CBKA 1A9PA 1YOBA 4X6UA 3HDYA 1XQ9A 1FPQA 1YMUA 3PFIA 3RFXA 4B6EA 2R7KA 4OGGA 1ZH8A 4R6XA 2RHWA 3E3AA 4B3XA 1DUSA 3G13A 2A67A 4LBVA 2FDXA 2Z0MA 1M6YA 4OYHA 1SQFA 3GT0A 4E5PA 4JLVA 4XQ9A 4KLCA 5HDBB 3OTWA 4W5NA 2HMWA 1OFIA 2XX3A 4Y1GA 3TLMA 1G9XA 1PYDA 2M6LA 4B17A 3EZNA 4K05A 3KQUA 4UUQA 2HEIA 3UJ9A 2LRHA 3D8RA 3SKYA 1CF2O 4GU5A 3WADA 4EHJA 4JEUA 3AM5A 1LC0A 4CQNA 4E2XA 3DD5A 3D64A 3KLOA 2QBYB 1ZQ1A 1NMQA 2CLIB 3MTAA 3GJ8A 4ZCTA 2AW5A 3CO0S 3GVXA 4CEHB 5IJ0A 4S1PA 2H59A 1KMCA 1T1JA 1Q92A 2C42A 4N5MA 1E59A 1WHTB 4IDBA 5J43A 4O25A 4ZCPA 1FTWA 1AUQA 1UM9A 4INPA 4LRXA 1D6NA 5HF6A 1LSUA 1SUAA 1YT5A 1RP7A 2O2IA 1GV1A 2J87A 4LE0A 4KDRA 4BQQA 3MCUA 4MP8A 1U8EA 3A6KA 4YAGA 5AW7A 5KINB 3QFFA 2GPSA 2OV4A 3N75A 3SHWA 3L7YA 4TT3A 3QMPA 1S9HA 1G5RA 2GK4A 3PQ4A 4LDQA 1M76A 2V0NA 4QQRA 5C8VA 3GD5A 1MLDA 4G0OA 2O8EB 1SGWA 3F4LA 4BX9A 1FOEB 1Z6YA 4O2AB 3UIEA 3AF3A 4DLRA 4L6AA 4WZBB 1ZMTA 3MTIA 3CN9A 3LPMA 1HLPA 3EDOA 4GUDA 3D31A 5FOWA 3L7LA 3GJYA 4TN1A 4K5QA 5BV2P 1OV4A 4KBFA 1SVLA 2HMTA 4UU0A 2H5IA 2NUAB 1LPAB 1P4HA 5TPWA 2BE7A 2XD4A 3VZRA 1AHPA 1TTQB 2E55A 2FQWA 3FOAA 4FFBB 2YDXA 4RVDA 2I8CA 3THRA 2F00A 1DTEA 3UK7A 5JAOA 4XIGS 4QDUA 4TQ9A 1RXIA 3AEUB 1CUCA 2ZITA 1MEJA 5DFAA 2PS9A 4AN1A 5AVSA 1WXXA 2BM1A 3DO8A 3ORQA 3OE5A 3FSEA 3AV3A 4UUAA 2G1AA 5AM5A 3OJWA 1G38A 3D8UA 2X42A 1FRFS 3CZAA 3GFFA 4CM6A 2QGFA 4X3CA 2HPHA 1MJ5A 1QCZA 2QNIA 4EKYA 1WB6A 3ECSA 5DCUA 2Q9BA 1NJ1A 1KJNA 2H2GA 4MR7A 1MXHA 4UEQA 4MKXA 1N36B 5JAPA 1SULA 1E1LA 5KHAA 3BRQA 5ULLA 1E0DA 1IJBA 2X4GA 3FCUB 3DBOB 1LD3A 2VJOA 4UKDA 4YHHB 2FEWB 2VDUE 3FWPA 1ELOA 4GM0A 4RZIA 3LIPA 3V8PA 3ZCVA 1X15A 4EA8A 1CP2A 1ZGCA 2WOJA 1MOPA 2M6RA 1AV6A 1FJ2A 5JI3E 1WU8A 3SQDA 1Z2AA 3GCDA 4BO8A 4H3VA 3R0QA 4YRAA 1Z12A 2M1XA 3D4IA 2SKCA 1NVDA 3BCUA 1G8JA 3B48A 2QUAA 4MS4B 3P71T 4Q4AA 3OM1A 4BIIA 1C30B 5E4JA 3GAMA 1B41A 4XEHA 3GBPA 1EFKA 3WBBA 1C9DB 1IIBA 4ISBA 5AVJA 2XMSA 1ZHFA 2AWNA 2KB0A 1RRGA 2QX7A 2XOXA 3CF4G 3ZE0B 5TF0A 3D8NA 1NBWB 5I7EA 5CIYA 3VMFA 1CEXA 4PO1A 1YONA 2ZRDA 1W581 3FUTA 4F5ZA 1N5RA 1U9YA 1DC8A 3GMIA 4IJKA 3SU8A 3INYA 3GGOA 3EFHA 1RW4A 2C2WA 3K7EA 1YHYA 2N0SA 2QTVB 4URYR 5T4BA 5ALKA 2BZ1A 3EB9A 1AHIA 1JZSA 1HDYA 3DDHA 3VV2A 3ZH9B 3TFOA 4EMSA 1U9CA 2FLWA 3AL2A 2C2BA 3QG5A 1ULSA 2PKXA 4JIMA 2PKCA 3R40A 5EYPA 3BIXA 2EARA 3NHLA 2YS6A 4ANFA 2IOFK 2ZETA 3A3NA 2IEGA 1AQYA 1XTJA 1HRDA 2VZ8A 3MJRA 3SQMA 4TXLA 2P77A 4IRUB 2G25A 4B2PA 1TW3A 5ALHA 3P52A 3EG9B 3EYWA 4ARCA 3CEMA 4GLFA 2WICA 1UBJS 2XAAA 4NCBA 1QQ6A 3CUTA 3K6KA 4JBXA 5BPHA 1FW6A 3BHIA 4UMFA 4Z53A 1I2BA 2WVGA 1XMXA 3DCIA 5SY9A 4PVDA 3IP9A 2OXCA 3K1AB 3OQBA 4X7BA 1QWOA 1XZIA 2G88A 4JXZA 4DDKA 2WNIA 3LY7A 3PT9A 4P3KA 3D6NB 4A2CA 2FG5A 1QG0A 2CHVA 3SR3A 2JLRA 3LKVA 5AXBA 5COQA 5CW2A 3QEJA 3REGA 4IHJB 1E7YA 3RC1A 3WHKA 4CFZA 4U7JA 3HGTA 1RQ2A 1E98A 3NHAA 3RSFA 2UXDB 1TQHA 1NOKA 4HSEA 1P1HA 1EWYA 1JQKA 2IWHA 4RCVA 5LN1A 5AP9A 5HPYB 2AMJA 1Y6GA 4W9NC 3BXHA 5B55A 1NVGA 4C2UA 1WQ4A 3CBGA 2FFJA 1C0EA 2O1WA 2QRVB 2D0OB 4PPGA 3WL4A 4KAFA 3UOAB 2QT1A 5INTA 4ITRC 4ZGWA 3K4HA 2H7YA 5FI1B 3HR7A 1G9TA 4YUZA 1YQXA 1GUAA 2C9MA 2OBMA