1M1UA

An isoleucine-based allosteric switch controls affinity and shape shifting in integrin cd11b a-domain
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
184
structure length
184
Chain Sequence
DSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An isoleucine-based allosteric switch controls affinity and shape shifting in integrin CD11b A-domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-M
total genus 70
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2002-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1m1uA00
3EH1A 5KYWB 3TW0A 5KYNA 3TCXB 1IDN1 5E6UA 5KYXB 3GXBA 4WK4B 1BHO1 3ZE0B 5E6SB 2QTVA 3EOAI 4C2AA 4IXDA 1L5GB 2I6QA 1JEYB 1MQ8B 1N9ZA 1PD1A 2M32A 2NVOA 5HGJA 1RTKA 2NUTA 1YVPA 1ZOOA 3EOBI 2X5NA 4O02B 3FCUB 1CK4A 3EGXB 1TYEB 1M1XB 2VDLB 1MF7A 4UM9B 1T0PA 2VDNB 2VDKB 1QCYA 3EG9A 3EGXA 4G1MB 1SHTX 4HQKA 3ZDZB 4C29A 4MMYB 1MQ9A 3PPYA 3NIGB 1SQ0A 5E6RA 4M76B 4CNBA 3VI4B 1LFAA 3K71B 5BV8A 3IBSA 3HXOA 1DZIA 3EGDB 5KYWA 4PN7A 2NUTB 2XGGA 3ZE2B 1ATZA 1M2VA 1XUOA 4Z7QB 4NENA 2VDQB 5E6SA 5ES4B 2O7NA 4WJKB 4WK2B 2XWBF 4UM9D 3T3PB 3EGDA 1U8CB 4DMUB 3IJEB 3Q3GE 3V4VB 2WINI 1U0OC 3HXQA 2IUEA 1FNSA 3PPXA 2ODQA 3F74A 2B2XA 1JEYA 2VDMB 3QA3E 1MJNA 3NIFB 1IJKA 3N2NA 1IJBA 4NENB 5KYUA 3ZDXB 5E6UB 5KYXA 3K6SA 2VDOB 1QC5A 3EFOB 2VDRB 3VI3B 1U0NA 3BQMB 4NEHB 1FE8A 2WW8A 3FCSB 4HQLA 3T3MB 1RRKA 4WFQA 2I91A 4CN9A 3NIDB 2ADFA 4A0QA 3EFOA 4F1JA 3M6FA 3TVYA 4HQFA 5E6RB 1RD4A 4F1KA 4Z7OB 3V4PB 5LN1A 1OAKA 4XW2A 4JDUA 1MQAA 1AO3A 1AOXA 2VC2B 3RAGA 4Z7NB 2VDPB 5KYUB 3HI6A 1ZOPA 2ODPA 1QC5B 1XDDA 1BHQ1 1PCXA 1JEQB 3BQNB 4MMXB 4IHKA 5KYYB 4MMZB 1JEQA 3E2MA 4FX5A 4BJ3A 2NUPB 1JLMA 1CQPA 4CN8A 1PD0A 1N3YA 2ICAA 4C2BA 3F78A 1AUQA 3TXAA 5HJ2A 4UM8B 1IDOA 3ZE1B 1Q0PA 1V7PC 3EG9B 3PPVA 1MHPA 2NUPA 2I6SA 1XDGA 4IGIA 3ZQKA 5HDBB 4WK0B 3PPWA 4G1EB 1PT6A 3K72B 1NA5A 1RS0A 1M2VB 1JV2B 1M2OA 3ZDYB 1M10A 1T6BY 2XWJI 1SHUX 4HQNA 4HQOA 3EH2A 3K6SB 3BN3A 1M1UA 1DGQA 1UEXC 5KYYA 1ZONA 1YVRA
chains in the Genus database with same CATH superfamily
4FMDF 4DREA 4YMLA 2P3SA 3DXXA 3UJAA 3Q9LA 4JI7B 5DI9A 3KBBA 4O2BB 3V7UA 2O3JA 4AN0A 3PA8A 1NG9A 4D25A 3MTGA 4OHMA 1PGOA 2DUUA 2QTBA 4CQJA 4RK6A 3Q9UA 3GEBA 4G4IA 3I6BA 1TZ2A 2X5NA 3GRPA 1T5OA 1ZM4A 1X2EA 3RVDA 2DJ5A 4G5XA 4DV4B 3GHYA 1AGPA 1JS1X 1IBSA 3EDQA 4IJKA 1NP7A 3HYLA 1IYZA 3GYBA 4AXXA 2FPLA 2XLCA 4MR9B 3SXJA 1KEZA 1PUIA 4PHHA 4CGZA 2AZ4A 2WRZA 3RHFA 3P52A 2MOKA 2WJ3A 4TUYF 5JCJD 1YIOA 4R9NA 5B1EA 4PE5B 3ZDEA 4NZZA 1O87A 1G8SA 1XUOA 2CXTA 3DEIA 3WL4A 4BJ5A 4GEKA 2GFHA 2RJOA 2Z6UA 1GT6A 1RHJA 5JZMA 2CXRA 4AQ7A 1VMDA 2Z04A 4NZYA 3NNSA 2DP4E 5DYNA 2CV0A 2RGNA 4XIIA 2V7UA 2XE7A 2B7CA 5K2OA 3N0TA 2P5YA 1DOZA 1H2HA 3NBYC 3IEMA 1PFWA 1CLUA 4IIHA 2EDCA 4H1TA 5JH7A 4AI6A 2XSZA 4R3NA 3EIWA 4ZFNA 1O6BA 3AJ8A 3ZDXB 4BV2A 3M9WA 2ETXA 2P30A 1N2XA 1JT9A 1X1RA 1CUUA 2XGJA 2HFKA 2FPMA 1H2BA 4R2IA 1ZEJA 2I3AA 1RWXA 3AWDA 5F7OA 1L1QA 1Z56C 1CB0A 1AT1A 5AHKA 1PT9A 4MCJA 5LD2C 1FFSA 4Z1MA 4AL4A 3ZVNA 3G9QA 3KWLA 1E2DA 2WV7A 4O2RA 1J7JA 3TQOA 4U63A 1WUJS 2J4FA 1VG9B 3E23A 2C9ZA 3HWX1 1DC7A 3ZKAA 1LZLA 2X14A 1A9YA 1RW4A 1FP7A 1P3Y1 2GAFA 2XCLA 4I1YA 4K6OA 5U4QA 5ITVA 2A6PA 5JNUA 3L4JA 4HZGA 4PSAA 4WESA 3RWBA 3D4IA 5KSYA 1XTIA 5M34A 2OBBA 4QUBA 2IQ5A 4NYIR 3TTSA 1KI2A 1Z2OX 4NBNA 3ZG6A 3JD1A 4PRLA 4BP8A 3ZCXA 3EQ7A 1U2GA 4PGGA 5EJFA 5E4YA 2RAFA 1DTEA 4QGAA 3NHBA 5CM9C 1IMOA 5ETJA 2XTMA 1OMOA 1U7WA 2G5CA 3PXAA 3WWEA 4BJ3A 3FOBA 1CJBA 1CQPA 2GO1A 5HJ7A 1JAZA 3PGVA 1RC1A 4GMKA 4RK0A 3SZGA 2BR4A 1T5SA 2BF7A 4NFHA 3CUEF 4DHWA 1ADBA 1QLJA 4V39A 3SOPA 3KQKA 1EXNA 1N92A 1S2MA 2H57A 1J2RA 2PKCA 2VSYA 3PWSA 3QVKA 4KBFA 4XWTA 3TEMA 4BL5A 5HKOA 1YUMA 2ZJFA 3OQBA 1UXJA 3MJSA 1DC4A 1ETHA 2MDTA 3ZHQA 4OQDA 3BF8A 2P6NA 4XX1A 1V8FA 3DFKA 1E7QA 1TYCA 4UCXA 1IK6A 4ARAA 2QSYA 3GL9A 2PQ2A 1AGXA 4S1PA 1GVNB 3K3PA 4BMSA 5G0UA 4DRYA 4O33A 3CISA 4OKSA 3I42A 2DT5A 1B8UA 1Q22A 2H8GA 5IC5A 2PM8A 3EUAA 2O14A 1TPZA 1Y7LA 3GLFA 4E6PA 1T3GA 2FMTA 3S2GA 4D9BA 2FP4B 2IWRA 3RO7A 5JXWA 2Q5HA 4QL3A 4B73A 4Z6KA 3R77A 2A7XA 3RIHA 1U1GA 4EY6A 4V0NA 2WPNA 2XTNA 3GVCA 4GKAA 1EPUA 4ENPA 1YVPA 3RUFA 3HG7A 1I7NA 2ZBEA 3LCJA 4NAVA 1KPIA 1YBVA 3WMWA 1M8GA 3TKYA 2F64A 1D04A 1KGSA 1H9CA 4BO8A 1VPVA 4KVFA 5LA6F 4JFRA 4N3CA 1N6RA 2YZGA 3ZLBA 4W5OA 1HI9A 1GAQA 2WJ4A 3NBZC 1AVTA 4JD5A 2AOTB 3VR5A 1LFAA 2MHCA 5M5BA 5BWMA 1NW4A 3AHIA 2IRWA 4WX2B 1F4PA 2RMKA 4Q03A 5E8RA 4AECA 4EABA 2DVMA 3SYKA 2N9UA 3BB1A 1IY1A 3BXPA 3NAMA 4KU4A 2O8FA 3M34A 2IYEA 1HDEA 5L4NA 3Q8KA 1P6UA 3MJEA 2XJ9A 2G5GX 5JNVA 4NV0A 1GZVA 3AUXA 2P2DA 3BBLA 4RETA 3AJ9A 4ZVLA 2MSDB 4HATA 1R8YA 4EJ2A 2F3UA 2W2PA 4KMOA 1NR7A 2AOVA 4D79A 1HX7A 5TX7A 1GQ2A 4OMCA 5CVDA 1ZH6A 1I9GA 2ENUA 1VG8A 1W4AA 3H86A 3KJZA 2QM0A 5EE0A 2X15A 3QKWA 4TTIA 3RC9A 4G8BA 2QYTA 4QPPA 3QUCA 3CBQA 2EFCB 1GPH1 4R16A 5ED4A 2I4NA 5KYUA 1IRIA 1WDKA 4KWIA 3O92A 3DDOA 4D46A 2V5UA 2JVIA 3RBAA 2FPXA 2QIPA 4IJWA 1U5BB 4ZO8A 3HI4A 3AC0A 1LX6A 1A04A 1X0XA 4FYYA 4OKIA 1D1TA 3P9SA 1X1TA 3AOEA 4RF4A 1XCOA 2J4DA 1H2YA 3LRTA 3N53A 4AY4A 4EY7A 5BYBA 4CKCB 3WGMA 2LIPA 1UFKA 2J3JA 3PT5A 5DNEA 5F33A 5SICE 1O94C 2XYRA 4YPFA 5HF9A 5T8KC 3T0IA 1TAQA 4E3WA 4KK4A 5C32A 5IJ9A 4HGOA 4JODA 1SVUA 3MT0A 3HUEA 3AI3A 3JQBC 3L7LA 3PX3A 1VE6A 3PUVA 4LGCA 5EWLA 4JXZA 2EDAA 2BEUB 2NO4A 1ONBA 1A4UA 1CY4A 2J0UB 2XUIA 3AGQA 3TBKA 3BXXA 2ZUFA 3SVZA 3LD9A 4ZCTA 1FJXA 1RMTA 4EFLA 5CB4A 2WIFA 1X7XB 4O25A 1KRWA 1H05A 2DYKA 3PI7A 3PQ5A 4CQLB 2F90A 2CBZA 3AWIA 2YVAA 2CJPA 3TAHA 1QP8A 1DB3A 3QJGA 2DJIA 3KTFA 3DZJA 1AZTA 1FYXA 4JNKA 2P9BA 3S44A 2GXAA 1KO1A 1KKUA 1SKUA 3IVCA 3KUXA 4N48A 4JVOA 3VOAA 1DXHA 1OFTA 1IZ9A 1WL8A 2YVLA 3LKZA 3TLMA 2V7PA 1I3LA 1XRQA 2ZB2A 3GJ4A 1EP2B 3FPFA 2OECA 3OJFA 2NXWA 1XWWA 3GAZA 2OLJA 4F8JA 1HR0B 1LPSA 2AOUB 3EQ6A 2QMUA 4EKNB 4INJA 1N4AA 1NNSA 4Y6RA 3D6VA 1KFCB 1UMDB 3IKJA 4QECA 1UT6A 3ORYA 4A2QA 4QHYA 1FRQA 1C29B 1KY5A 1H66A 2UUAB 1TQ4A 1OFGA 1YZNA 2CVHA 2WR8A 4PRYA 5LOVB 3DTYA 1V3TA 2WUDA 3IVMA 2ZTLA 3GZNA 3SYTA 5IABA 3C3AA 1GNSA 3CR8A 4ETMA 4AUNA 3ZE0B 4KRFA 2CY0A 3QVTA 3T5AA 2X19A 1BW9B 1PU2A 4MDEA 1FZQA 2O5VA 4M89A 2A9FA 1P6QA 3LPMA 3OCZA 4J7CA 1MV5A 4HDKB 4QDUA 5ESWA 3U09A 3EIHA 3FTNA 1DX9A 3KVYA 3DW1X 1K7CA 1EVZA 4M3NA 5CMLA 4U02A 4M21A 1R0SA 1P1FA 2ODTX 3JQGA 4K87A 2FEOA 4U8GA 3PQ8A 3QEMA 4ALJA 5CIWA 5B6PA 3PPYA 1LLCA 1SRQA 5AW7A 2DLNA 2HAEA 2E4WA 4JUBA 1QO7A 4OIFA 1O96A 2CNNA 2H48A 3FVQA 3KRTA 4HCJA 1S3FA 1JG2A 2JIZD 1W6RA 3GF4A 4O08A 1JXQA 5HF8A 4DABA 2FAXA 1YRQA 2BSXA 3X2FA 2IE8A 4DMFA 1MJ5A 1JWAB 2A92A 4CKEA 1WV1A 5AI0A 4GYYA 1OX4A 3RU2A 2QQFA 4HNQA 1B14A 1NBIA 3PNVA 1JIVA 4TLBA 3Q87B 3IQXA 3UENA 1EAYA 1PQUA 1WQ1R 1R88A 2R1ZA 3G0GA 1T1GA 2UZ1B 5U9CA 3R0XA 1OB5A 1BROA 1DUIA 1ISJA 4BDSA 1ZG3A 1TD1A 4K05A 1DQRA 3ZX4A 3T5BA 3HBNA 4CDGA 3G68A 3TZHA 1YKFA 3FHLA 3BDVA 2X9QA 4UHBA 1J9EA 4E22A 2HDOA 1WDWB 2Q5OA 3K2EA 1FS6A 1BEZA 3T5CA 4E21A 1QE0A 3I2FA 3CN9A 1ZD8A 3VR6A 1WG8A 4ID9A 3AEKA 3M89A 4JUDX 3T8YA 1TVEA 1G8KA 1QE5A 4HV4A 1SD5A 2YJNA 4XD7D 3FUTA 4PWZA 4CKYA 3PI6A 1H3FA 3T3MB 4GUDA 1TZKA 3IBYA 2WHRA 4KVZA 1UAGA 4C43A 1P61B 2G7ZA 1V45E 3CRVA 2WB4A 3Q5EA 4UVEA 2WWXA 1MORA 1V3UA 4G01B 2CJWB 3SQXA 4CWAA 1AKUA 5DHAA 3Q9SA 3W05A 3B3AA 3HABA 4EW3A 3HR7A 1U1EA 1OYVA 3RUEA 3W5DA 2OT3B 4BZZA 1IQRA 2Q1WA 4R5HA 2E4UA 4QIHA 5KX5F 2JFUA 1B6RA 3WHPA 2N47A 1PR3A 4BFSA 3QE9Y 2ANCA 4R0VA 4PS0A 4GPEA 1JHZA 1IEVA 1N3YA 4PXYA 5DI3B 3H6HA 1K6EA 4ZXFA 2V8OA 3CVUA 2QV0A 1FPMA 3FH0A 4R83A 4IIJB 4M0EA 5EP2A 5IUKC 5BPHA 5AVTA 5LWQA 4FMPA 2ISQA 1VI6A 2P4HX 2PQ0A 2PA3A 4YQYA 3BEDA 4EAQA 4E4YA 4ZZ2A 2AE1A 4C5CA 3N70A 3W0LB 2VNIA 3O8NA 3ONNA 1E1DA 3OMLA 3BIJA 2DHQA 3DOIA 3G5AA 3GRVA 4U1RA 4GI1A 3NG1A 4L6IA 5CXSA 5CAEB 5EUCA 2W58A 4AS1A 1RYFA 3LDAA 2BLLA 3ABQB 4W5HA 1E2MA 2VA8A 2X40A 3EYWA 4V3CA 2IHVA 4YJ2F 2VPWA 4YMSA 1LQTA 4CJXA 2YKGA 3TWOA 1KI9A 4PC7A 4P3YA 1UDWA 4D3ZA 4RMNA 3CB2A 3Q11A 4PGHA 2CFSA 3NRCA 3N0XA 3OHPA 4BNIA 1YHNA 2J4CA 4ND1A 4U0KA 1Y6JA 4YAJA 5F7XA 2WFZA 2H4JA 4IDQA 2ZKLA 3FUCA 4XEUA 4E2XA 1C0IA 5KYXB 5FNVF 4QELA 4MLDA 1G291 3IKMB 1O0SA 1R0CA 4V0KA 5K6AA 4UEQA 1KGDA 1KJ9A 3EOBI 5A5EA 5JHHB 2Y6UA 4A03A 3KR0A 3EZNA 5KREA 5F73A 1H4VB 1JHRA 2UZ4A 1HLPA 1SC3A 4DIBA 4MJ7A 2J3MA 1P4RA 1SUDA 4DV7B 4GGMX 2IBSA 3S28A 2AE2A 3DO6A 3WK5A 3KT3A 4DPMA 3K31A 4X66B 2EATA 3AEUB 4BP3A 3RHTA 1E1CB 1MVOA 2GVNA 2DKOA 2VQFB 3EB9A 1UIMA 5IKEA 4Z4GA 1QOQB 3C8ZA 2QBYB 3H83A 3D7MA 1U2TA 1YB1A 1CUAA 1FTSA 1VA5A 3H4IA 3D6NB 3PUYA 1Y8RA 5FLKA 3U7FB 4O2AF 1N7GA 4C9BA 3QJYA 2AJDA 2BFBB 3GT7A 4MHOA 5BN4B 1DSSG 3MWJA 3U39A 2JW5A 5JVDF 3BMQA 5I7AA 3P1JA 5DHTA 4JN6B 3UAVA 5C18A 4LBZA 4BFVA 4FS8A 4DN6A 2DB3A 1R0XA 2PYDA 3F6PA 3A06A 3MGKA 3N2NA 3RC2A 1E1RD 3NTUA 1MJGA 5EN4A 1DT5A 3TFWA 4DV0B 5BNZA 4WSOA 3K35A 1YBFA 1T26A 3P4UA 3R3VA 1IXKA 1U9JA 3MWYW 5LA6B 1AF7A 1N9KA 2QTMA 3ASZA 3V1NA 1EBUA 2IP1A 4KSBA 4YRKA 1MX3A 1Z2CA 1P8AA 1NW6A 5DOZA 2CXXA 3VNQA 3M5CA 2C4WA 1D0VA 1DLIA 2DBYA 5EWMA 1NNEA 2BKEA 1PR6A 2PVSA 2AJ8A 2QN1A 4I8IA 2VWHA 4W8OA 3SICE 2ERXA 2IPLA 3U4QB 1X19A 3HNOA 4H08A 4ARUA 1LPNA 4RQAA 2I6FA 4UM5A 2OLEA 3ZWMA 1CUDA 4HUTA 4IW3B 3WO1A 1Y6FA 1CBUA 5T3UA 2HSDA 1KXZA 2OBLA 3AL2A 3S8YA 3LUGA 1DI0A 1QF7A 1SXIA 5PNTA 1VPDA 2BH2A 3QHPA 3ROGA 2KB0A 3LK7A 2E5FA 4OLBA 4K9QA 4E03A 5A5DA 3SDSA 3VU9B 4FOTA 4ER5A 3V1YA 2PL9A 1Q77A 3EG5A 1DG3A 3U40A 5KJEA 3URKA 3RWMB 2G9QA 4TV9B 5K0BA 3OJLA 1V9SA 2QRPA 2LV8A 3D4PA 4JZYA 2XDQB 5U1PA 1GVHA 2FUG6 3WB0A 4E2WA 4LYGA 4GMHA 1MHPA 2CVQA 1EDZA 3CRZA 4JQYA 2G83A 3ZWVA 3JQFC 1WO8A 2HMAA 2I22A 2QPAA 4IDFA 3K9FC 3OKFA 3FG9A 3QFFA 1CUFA 5CHYA 1ZI9A 3S99A 1H9BA 1TMYA 2GD0A 4XXHA 1M2JA 2ZRDA 3OM9A 2D4AA 4HVAA 3STHA 4YUZA 4XQ0A 1ZKDA 2C59A 1MUUA 1YI8A 2WAXA 3EVCA 1W49A 3U44A 1H8EA 5H82A 4BQOA 4BMPB 2QTVB 4DYVA 3HO8A 2OFFA 2CHUA 2LWIA 3TLGB 1LC3A 1LA2A 1P2DA 1GAEO 4MVWA 1U3UA 1WE2A 2I33A 1VGVA 4WEQA 2QRLA 3G89A 5DP1A 2W0MA 2QWXA 3I12A 2XBUA 3CGGA 4KKXB 3R0VA 1JN0A 1KMNA 2E2WA 4MJ3A 1BH6A 1DCKA 1MV8A 5KKCA 4AIIA 4LYHA 1OYYA 3KKKA 3BMOB 1PJ2A 2HJVA 2OGWA 3JAKB 2H5LA 4G2NA 5KTPA 3CC8A 1YDGA 4FEYA 4BCCA 3CR3C 3OF5A 1GQQA 4LQCA 3AEKB 1P0IA 1YE8A 1PT5A 3EDOA 4HHEA 2RFLA 1RKUA 3LQFA 4NV3A 4EHJA 2EU8A 3UV7A 4NZPA 3FYDA 3P0FA 3SWWA 3VGJA 5I48A 1SC4A 3ZHXA 1F14A 2W70A 1OIVA 1W5TA 1XEAA 1Z68A 2KLBA 3GD5A 4UCWA 5BN3B 1NURA 3CTPA 1PR9A 1N0VC 3DYVA 1YE5A 5FT9A 3TW8B 1M0TA 2Q4EA 3EGDA 3IAUA 4FGJA 3I5AA 1SD2A 4MKIA 4NSNA 3MW8A 4R68A 4H4CA 3KV1A 4Y7CA 2HCTA 3IT1A 4BWVA 2NTEA 1BN7A 2QORA 5LXTF 3LU1A 2QF7A 3EVGA 5DI3A 2E87A 3BAZA 3WKCA 2WE8A 1BVRA 1GEGA 4I8XA 3KFXA 4EG5A 4WZZA 1N2EA 1T3SA 1X9GA 3ASUA 3H9EO 2X2PA 4G1UC 1SIWA 1RRCA 1OQAA 3VI3B 1FLNA 3L43A 4MZDA 3ZTWA 1TK2A 2XGSA 3EVTA 4H60A 5C8YA 1GZSA 3N2KB 4JDPA 2FZ4A 4GSKA 1TCBA 2GBGA 2V9PA 2ACVA 3JALA 4EQZA 1IULA 3V33A 3FGOA 1A2QA 1FVFA 1HDCA 1GRVA 2VQDA 5JNTA 2Z4TA 2WJZB 4U7JA 3NOQA 1X2BA 4W5QA 4MHTA 2CMFA 2DFPA 1IEWA 4P3KA 1Q16A 5IG2A 3VA7A 1QHHB 4M8IA 2X2FA 2ZQ5A 4DCSA 2HA5A 4CDRA 3HP1A 4DCGA 2WYWA 3U4CA 4ECEA 3GLFE 1PT7A 3JCZA 4UHJA 3H8SA 4MV5A 3KYDB 3TB6A 2R11A 4LRXA 3T6KA 2EZ4A 2VK2A 1PL7A 1Y6QA 3R7FA 4PSUA 3I5YA 1U63A 3U7QB 1PD0A 1Q2UA 3TL6A 3V32A 4AY6A 1F0KA 2W6MA 3FM9A 1T8UA 4L6AA 3SEZA 4QXMA 3ZIDA 1WSBA 5KSWB 1A8UA 3VBEA 5BWNA 2Z5VA 3HV0A 1SHJA 1OI2A 3H18A 4YHBA 4JLAA 4KW7A 4ZCMA 5HJEA 1SVIA 3JQ7A 3MAJA 1JFVA 3DDNA 1XZQA 3H1GA 1H1DA 1CR1A 1TD9A 1TK3A 2JJ2D 3DR5A 4F9GA 1GLNA 3EARA 2DWOA 1KP3A 3GELA 3UTCA 4U9UA 3WV5A 2PZLA 1ZK4A 2XPCA 3PHJA 1GKKA 1P1BA 1HKHA 5C7LO 3A1TA 4ZVTA 4TROA 4A1OA 1ZNQO 2PLNA 4FXPA 4MAMA 1USWA 3JS5A 1ZM2A 1H65A 3RSGA 5C7IO 3IFSA 1DCTA 5ELXA 4PR0A 4KUHA 2XV1A 1V7CA 3IDZA 3N3BC 3VO9A 5JAZA 4I1SA 2HO5A 1XLTA 4M1EA 3THRA 3NVKI 1X1QA 2P75A 3B3FA 1PQ4A 2HIGA 3ROKA 4WZAB 5D01A 4C2AA 3OICA 4UASA 2CV2A 2W0SA 2BDUA 3ONEA 2XKJE 4RVHA 5ILOA 3ZI0A 4FK8A 4BNDA 4E6EA 1GPMA 3UUFA 3TR5A 2QPTA 2QUJA 1KAQA 1NJ2A 2V7GA 3KHKA 4LRYA 5E9AA 1JQLB 5C52B 2WT9A 3TD2A 4JOBA 1Q1BA 3U7EB 4GD3Q 4EBFA 5LWHA 3WGNA 3HHPA 3ILSA 1Q0QA 3F4LA 1THGA 4WCDA 2OHGA 3IXQA 5FB3A 1A1VA 4JR2A 4TRNA 3CU5A 3TFQA 1P1HA 1T10A 5FTJA 2JIQA 1T2UA 1RKQA 2MSWA 4IHQA 4RZQA 1JALA 3DJYA 3MELA 2ZJYA 4M4SA 1SMKA 1QYIA 3DV0B 4HSEA 2BZ0A 5BWOA 2LE0A 1ZUNB 2H2HA 4QX6A 5ES3A 4N3BA 4ZHQA 3TTWA 4JT2A 1VMKA 1D5CA 1OZ0A 2YMMA 4PWYA 3RM3A 4C6SA 2PLRA 3CSUA 3F49S 4L3VA 4ZGBA 5EUBA 4F12A 3NNDA 1NGSA 2YS6A 3HXQA 5AJUA 4XIJA 4HTFB 3H17A 1UC5B 3KJGA 1E9SA 1KOFA 1NJFA 1J2JA 1LY1A 2R8YA 3HXKA 3VZBA 3KQNA 1NULA 4MWBA 3S2ZA 2WTEA 2WEKA 2B20A 4DQVA 4F06A 5COAA 4CR8A 1KTVA 2W6IA 5EWJB 1T6YA 3NM4A 3D3KA 4NHOA 2XI4A 4PX3A 2WWHA 3KO8A 1Y5IA 3OF3A 1PBNA 1FRFS 2ID9A 4GIBA 3FWNA 1SVOA 3TM5A 4B7CA 2VUSA 4RUKA 3H97A 2WSBA 2JLSA 4HXYA 1RAHA 1Z4LA 3COSA 3IOBA 4FGUA 4Z0HO 4HQFA 1HEUA 1ZCJA 3AHGA 2P7HA 3LBHA 5CLQA 4C4YA 4CMCA 5KYGA 2QUBA 3UK0A 4CEHB 1AQUA 1V8OA 1VA4A 4OO3A 1NW5A 1EUCB 1GU7A 2OFXA 4REQA 4URWR 5GONA 2F4NA 3WGIA 2P2NA 1KEEB 1SM4A 2OR3A 1V8BA 3C2QA 3RSLA 2Q3HA 4PZ0A 3OY2A 2BHLA 3SX0A 3NDBB 3S0JA 4Q3NA 3CLSC 4NU0A 2EJTA 1V1MA 5AVVA 3NR2A 1IZ8A 1OIXA 3ZE7A 2BUCA 4R8VA 5T8KA 1YK0A 3QKSB 2CZQA 3GGSA 5GWXA 2NZVG 4LYAA 1EX9A 3E3MA 3EZ2A 1VCNA 3HFGA 4IFBA 4R2KA 1PF7E 4DUGA 3B3JA 4NMLA 3RK4A 4Q7KA 4MSUA 2J5BA 2ZG6A 4C4SA 1TOAA 1OOEA 3FETA 1JFFA 1F12A 2C9MA 1U7HA 4S1WA 4J7UA 5FBLB 5ADHA 4DR3B 1NXQA 3Q12A 1XAHA 3IBCA 3JQEA 3K72B 4HVTA 4B2LA 1Z38A 3DV2A 1DKUA 3EMDA 3OJXA 4NNJA 4DPLA 3N05A 5KTNA 4ZYLA 3F5QA 3HDHA 3V80A 1WCXA 3ZJUA 2M6KA 1S4MA 1QS0B 4W5TA 1ZOIA 3C15C 4YRLA 3TF5A 1GDHA 5TT1A 2FN7A 4NNPA 2RBGA 1ZL2A 3IEPA 5ALKA 3TW0A 2WLTA 2CMDA 1RCTE 2XTZA 4P53A 5J43A 1A97A 3GFBA 3HADA 2A1UB 4MYHA 3E18A 3JQ6A 5C1BA 4I50F 2PKXA 1PJRA 1SHLA 2QVGA 2AIRA 2ZSIA 2DR3A 3EFEA 4YJHB 5FNVA 3ZZTA 1PW7A 4EDHA 3PEYA 4GPD1 4XGIA 4B3DA 1GCUA 1DCFA 1W0JD 5CM2Z 4JJ7A 4C20A 4NBVA 5AW3A 5A4KA 2OCYC 3ORHA 3T3HA 4F4UA 4AU1A 1O6GA 5CYPA 1Y5RA 5IMBA 3OCVA 5F23A 4FR5A 4WZAE 4U00A 4XGRA 4XCVA 3K71B 2UVQA 1J21A 2Z8ZA 3ABSB 4PICA 5LQRA 4P54A 2DR2A 1Y3CE 1UPXA 2C31A 2QYSA 3TOXA 4A0HA 4HFMA 4EYQA 2C8JA 3ZXXA 5ER9A 2XEDA 3SR0A 1FP6A 2HA3A 4UPVA 8OHMA 1HM5A 1WM1A 3FYHA 3GBPA 4Z86A 3AIOA 4DDVA 5T6BA 1KKMA 4X1KA 4TVSA 3OETA 5JSKA 3EJ6A 1M72A 4EWLA 5MN6A 3OE1A 1OH8A 1R5BA 1YQEA 5F77A 3C3EA 3LPDA 4ZOLF 4MIKA 4QUAA 2ODQA 1AY0A 1V9CA 3U7JA 1KQGA 1XD2A 2WKWA 4I4CA 3TSYA 2MYUA 1AQ6A 3OCYA 3D6FA 2E5WA 4BY9E 3GCWA 3NGXA 4ZOEA 3NGLA 3WYGA 4EG7A 1W88B 4RSHA 5A4DA 1E9AA 4MUAA 3OZXA 5L7WA 1F2VA 5AKZA 4CCWA 5JBQA 2Y1DA 2J9FA 2JZNA 2VIIA 1C1HA 5T3YA 3VO1A 4X5OA 4KACA 1SAYA 1JDTA 4RPKA 2II6A 4QYMA 2KWIA 5FUWA 1AKEA 2YRWA 2CFRA 2ATCA 1JR6A 3KOMA 4F4FA 2R7AA 4PSCA 2BBSA 4Q66C 1XIVA 3C8UA 4OBBA 4F5WA 1K9VF 2Q3DA 4ARZA 5HQ3A 3G49A 4H6PA 1QCCA 1AV7A 4JDUA 3OZAA 5IKXA 3T9BA 1UFVA 3AJAA 4Z4IA 2GRAA 3FTFA 4ER0A 4K9LA 4BWGA 2VF8A 3KJFA 2OCAA 1E3WB 1EJ2A 1XNGA 3BTVA 4JU9A 5B37A 1NNLA 3KT0A 3VPDA 4MQ4A 4NZ9A 4IS2A 4DWOA 4WBNF 3O2SB 2Q1YA 3OJCA 3VYUB 4YMHA 4PAGA 3MCUA 1M7GA 1S1MA 1V4BA 3AZQA 3B85A 4RNDB 3ZWDA 3MLAA 4C2BA 2PANA 4KV9A 2WU8A 5KKAA 3EEQA 3H11B 1K3TA 1K7XB 3KTOA 3QNMA 1GZ5A 1UQTA 3AG5A 4LG1A 1OGIA 2AL7A 3ZWKA 1QO9A 4D4LA 5MGNA 3IAXA 3CX6A 1TAHA 1SURA 1RYDA 4GX1A 5IARA 1KHTA 2GPTA 5LMCA 4US1R 4J91A 4PVDA 3DT9A 2VS1A 2IEIA 2UYCA 4I08A 1J99A 3O8QB 3W06A 2WWFA 2PZ8A 4KQKA 2RGCA 1N3IA 1KNQA 3GO4A 3K0KA 4FD3A 1KYQA 4BB6A 3VR4H 1CU1A 4TN5A 1KU0A 3INNA 4DJ5X 3KK0A 2Y4NA 4MS1A 3GVIA 3RUDA 5H83A 5I9LA 3ESZA 1WF6A 3MRSA 3Q85A 4C0XA 3V2GA 5E3IA 4PW0A 3E48A 2PD3A 1IIBA 3E70C 2HEGA 1F2DA 3LRPA 3DLBA 1UZMA 4JBYA 3TINA 1K8YB 5EKDA 2A4MA 1PJBA 5FPTA 5LJIA 2W6ZA 4QICA 1F38A 1AKMA 3RVRA 1ISHA 1QK3A 2J7PA 2WMNB 3HJRA 1V16B 2NZWA 2Z1NA 2DWPA 4W6QA 5EHNA 2C2HA 1GOTA 5JTUA 1JT2A 3ZDZB 4D80A 4BMXA 4U3JB 1YZQA 2HRBA 3EPKA 5DH9A 4WQMA 2WNSA 3G2KA 4PG8A 2ZYAA 5CH8A 1DQSA 2ZKIA 2CE7A 1A9TA 3ZCTA 4BNLA 5L8VA 1QHSA 2CMKA 1F5SA 1DAFA 2GWHA 3SKXA 3HXOA 3EAGA 2YMLA 4N0PA 1YRBA 4FFWA 1M6VB 3GGGA 3P4YA 2W6QA 2NV6A 4BVLA 1II0A 1PT8A 1XTQA 1FW8A 4EB3A 2ZYRA 5BSMA 5KHLB 1Q7CA 3U81A 3U9SA 4CG0A 4BHTA 1HE4A 1O4VA 4Q1AA 4PYOA 4YMTA 3JASA 2ISCA 5I4KA 1U8CB 1V2GA 5DF1A 4JUIA 2G09A 2JIRA 3GEGA 4WY2A 4Q9JA 4EK9A 4YPOA 4JENA 3IR5A 2DHDA 3RANA 3P26A 3UMGA 2YNMD 1PR0A 2COUA 5AO9A 1QGUA 2H1LA 4R54A 3FD8A 4GAEA 1B43A 1Q57A 4G85A 1D0SA 1JU3A 3FTDA 2FSUA 1TT5B 4FKBA 5HW0A 3M1LA 1UAYA 4M87A 4G0OA 121PA 3E9MA 3HHEA 3BFPA 3EFOB 3IUEA 4L4UA 4XR4A 4EIWA 4C7OA 3VJRA 4KBYA 1OPXA 3QKTA 1JG3A 1RYMA 3G0OA 4KNWA 3LFUA 1GYQA 1FDIA 2BWJA 1XF9A 4LRTB 4WXHA 4D4GA 2B4AA 1N32B 4F6LA 1KMHA 4WFQA 3TPCA 5LDGA 1ISMA 1YRYE 2GK3A 4JB8A 3NBXX 2VF7A 5DSZA 3CZMA 4PHCA 5FKJA 2AG0A 4MS4B 2QVZX 3Q41A 1FNCA 4K26A 4XFDA 2XKKA 1EFDN 5DXFA 6Q21A 4IQGA 1H2ZA 2YFYA 5FFFA 3TIGA 4QLBA 4DV1B 2NTVA 4B17A 2ZWPA 3BRQA 5DPMA 3SX2A 1X7WB 3DE5X 4LZPA 3B6ZA 1CTQA 3OC0A 4ND2A 2B9VA 2NNLD 3VHLB 3DCYA 4BP1A 1BHQ1 1PO7A 2HXGA 2XOEA 1UJMA 3CHYA 4C0BA 5J4KA 1IWPB 3HJBA 2UUCB 1TT5A 3WICA 2B4YA 2E9SA 2HMTA 2D0IA 1C7RA 1XQ1A 1YQGA 2IHZA 3EASA 3QEOA 2OD7A 2VCEA 4KV7A 1RPZA 4X1YA 4PQFA 3IE2A 1OFIA 4GM4A 2FOLA 3OCCA 2ZI4A 3EAQA 1GGJA 2GTPA 2V1XA 4GXRA 5JH7F 3FPSA 1QAOA 3QH4A 5AHRA 1QX3A 3IA2A 2NUPA 2MSNA 3MBOA 4PPQA 2AMJA 1WZ2A 1AHHA 5T57A 2C1ZA 2HPZA 2C2XA 1VIYA 1NVXQ 3OA2A 3KX2A 4QDOA 2R6GA 2RGDA 3PNMA 1YU6A 3PUWA 2JGFA 4U4AA 2JH9A 3GZNB 3I01A 4FYJA 3UWOA 1T6BY 3ZW9A 2AZXA 3QVSA 3C1TA 3FNGA 4YUWA 4HMOA 1N2GA 1H8ED 1CUVA 3K1TA 4D82A 1E9DA 4K88A 2J3QA 2EEPA 2B2CA 5EESA 2JIZA 4JMLA 4BNZA 3FIJA 3S81A 4J75A 3H9BA 4H0CA 3CIOA 4OB8A 1E5QA 3HXLA 5E6SB 2IHBA 2QG6A 2Z3WA 5J2TA 1AM4D 1JEYB 3G9XA 4PLCA 4GRIA 3ZY6A 2EGHA 4JUCA 4MAFA 1XVIA 4RKQA 3V5NA 5IRCD 2NO9A 4CUZA 1JHXA 3EUFA 4OAPA 1PBTA 1DIHA 3FHOA 5K6TA 1D7AA 3O26A 3LRXA 1FLDA 2BTQA 4QYTA 4YA6A 4DNQA 4G81A 4TV8A 5HZGA 1TJ5A 3HB7A 4BUZA 2AFHA 1X77A 4MMYB 1ITZA 1L6RA 4YQFA 3HB9A 1J56A 2BZGA 1ABBA 4MIEA 4JK3A 4FDLA 1T3LA 1P44A 1T24A 3VX4A 1P2VA 4MVJM 1BWQA 3CVJA 2LVBA 2GNAA 3EXHC 2C07A 3I8SA 2CLOB 2QA5A 1L1RA 1HFKA 1WA5A 2Q21A 3B9QA 1DC5A 4PZEA 2Y2VA 1WULS 2ENWA 5FUBA 3WNDA 3NMUF 1QIJA 2UV8A 4R8MA 2CB9A 3GZJA 3UFXA 5K0EA 2BJWA 2G1KA 4JL8A 1XLVA 4PG5A 2OV4A 2FEKA 3PPXA 2JI9A 3TQQA 2FJUA 3ORQA 3TW6A 3VKVA 1CZHA 1N8NA 3QUAA 4FKMA 4C7BA 1ZHOA 3TNJA 1G18A 3OJEA 3PRJA 4LQDA 4UVGA 1CQXA 5B4TA 4WLOA 3K0CA 2Q5LA 2BGRA 2YBDA 3ZV5A 1K97A 1N5KA 4B8YA 1BSVA 1I4WA 4I9GA 1GL9B 4ZTBA 3X1XA 4LDRA 1C1YA 4ZHSA 1P91A 1QIFA 4D6YA 4L8VA 1WXIA 2QI9C 2RGXA 2C2MA 2UVPA 1MABB 2J7KA 4ZJPA 1CEQA 1I4OA 2C8VA 2IOQA 3BMOA 2BGMA 4WL0A 1IMJA 1FMTA 3RJMA 4G4GA 4B2IA 5K0TA 2UYHA 5EJ9A 1UDCA 3PNYA 2ATVA 4LK3A 4Y0AA 5CUQA 5JE8A 3AB7A 2HMVA 5AVOA 2Z2YA 3KETA 3OQHA 4JYBA 1J33A 3DWEX 1TKBA 4J16A 5JPCA 3NGMA 1KTIA 2FJPA 3ZDAA 1D4OA 4MVJD 3FFWA 3UC9A 2PSFA 2EBWA 2C57A 4H6XA 3RS5A 4Q4JB 5D5QA 4B6JA 4CM1A 3U44B 1FDSA 2X5XA 4OB6A 4BRZA 1XTPA 3QXCA 1AHIA 1RM3A 3M6IA 2VH2A 3P45A 4K2HA 4KE6A 5HIAA 3QUTA 3ZR4B 4KGXA 4RPJA 1NUHA 2IZ6A 2MYTA 4LJLA 3GJ3A 2HTEA 1COWA 2NUBA 3QKIA 4MEJA 3DO8A 4CCYB 5BSWA 3W4IA 3O83A 1ZH8A 3D3WA 4GH5A 2WI8A 2J9YB 1ZD5A 5CNJA 4FSXA 3FY4A 1WW2A 1V5EA 2JBAB 4DCCA 2HXYA 2IGTA 1W8DA 3IAHA 4ESOA 2FW9A 2IJGX 1Z63A 1JDUA 5BNFA 1NF8A 3LBYA 1ZNXA 3D31A 3RIEA 4IEFB 4U5XA 4XOIA 3NU1A 3T3NA 4BMDA 5HUJA 1FDRA 2H00A 2CL5A 3P32A 2B5VA 4Y9DA 1CD5A 1JA9A 2FZVA 4B3HA 3V8PA 4H4EA 2YJTD 9MHTA 2HJGA 1WXWA 4RO0A 3V3KA 3W5CA 1XQ9A 4J1NA 3B13B 2P6OA 4OHKA 3PC4A 4AJ2A 1E3JA 2VUTA 3QLUA 3MJTA 1KQNA 3A4NA 3U7IA 1WXDA 1RSZA 1AQIA 3IDOA 5E9WA 4A6XA 4AK9A 2FWBA 2C8KA 2RHDA 2D5CA 3A8TA 3E5MA 4Y2TA 4UJ3A 3KXPA 1QFZA 4EG4A 4RPGA 2NXEA 3MAGA 2PNJA 3SXUA 4B84A 3RARA 5C80A 4AJOA 1J5XA 1QH1B 2PD4A 3LG2A 2QGZA 2PO5A 4HUQA 4L8YA 2P77A 2ZAGA 4O1HA 4PONA 9ABPA 5CJ2A 5IKOA 3SNHA 3JVVA 1JJAA 4NWIA 3B6MA 3Q72A 2QT0A 2C2KA 2YWGA 1E66A 3NKFA 2RCNA 4IDCA 5AKHA 5DHUA 4L3WA 1OKKA 4JBLA 2Y0BA 3GPIA 3QU4A 3COPA 5LP6B 3GMIA 5FO0A 2EF1A 3EDRA 4DWJA 3K70D 2W90A 1E7SA 1I0LA 1NASA 1URPA 1HURA 3KSUA 1I0ZA 3PQEA 2XUOA 4FW9A 1DAKA 1RE0A 3GGCA 3NHPA 4RIIA 3WKBA 4BS9A 5JROA 3OZTA 1RR6A 1OHHA 1SBNE 1BE8A 2YYSA 3GQVA 1EFVA 1RHMA 1YZVA 6GPBA 5DBHX 1S3IA 1N5OX 2EZ8A 1HWYA 4PN3A 3K5PA 5B5SA 5FBHA 5A3RA 3URMA 3U4QA 1N6PA 2BFWA 2REBA 4FPXA 3IPYA 1UBFA 5LBTA 3EXG2 4NFLA 2JCVA 4MW4A 4EKDA 3WIUA 3NUZA 1QO0A 3LYAA 1EHYA 1TLFA 4JROA 4FOOA 3QE4A 4IINA 3AVVA 3EZ6A 1IY8A 3GPBA 4UFNA 4QA9A 4CN9A 3EISA 3IAEA 2QUAA 2Y0DA 3Q7QA 1NV8A 5ADWA 3QFSA 3OZSA 5FA6A 3UFBA 1E2QA 1Q21A 4CRWB 1WVMA 2H0AA 3AV0B 2ID4A 1L2TA 2Z95A 5IT5A 1RXUA 5DNWA 2Y0PA 5FPKA 4K6GA 4NCNA 2ZJ6A 1ZISA 1H1TA 4MGYR 5HGXA 1XNRB 1SXQA 4OU4A 1PP4A 4OQNA 3E9ZA 1EWRA 1UKVY 5AKLA 5K3CA 3E1KA 1E3EA 1EZ4A 3IQFA 4B74A 4BTLA 4X0EA 3HVKA 3MTQA 5HYVA 1C9MA 1CC1S 1EZZA 1XV5A 3ETHA 4QU5A 3AR8A 4P5PA 2G1JA 4N6OA 3OOWA 1DG9A 2AV6A 1X7DA 4XH9B 1M76A 5EMNA 1TAGA 3WP0A 5LLTA 3FCEA 1RCUA 2BTQB 2H7CA 4H7EA 1GAXA 1U0FA 2CLSA 3DVQX 3KEOA 4FI3C 1T2DA 4RIEA 3WYEA 4B80A 1DQPA 4JP5A 3A05A 1VLJA 5BRNA 5KTYA 5L3SB 5LOVF 1NQOA 2PL3A 4LJYA 2I54A 3LT0A 5CX1A 3SD7A 2IL1A 1N2CB 1GD1O 3QOFA 1G20A 2GM3A 2I7XA 2QQGA 1ZR2A 3W5BA 1I94B 3BGIA 2TYSB 2QX6A 4MVJI 2AD1A 3FZEA 1IJFA 4HNGA 3MMNA 5IJAA 4CIAA 4YP1A 4ZVKA 4EFKA 1U4NA 2WKPA 2ZT7A 3NHFA 1A8SA 2JD0A 4WRRA 2AC2A 3E4CA 3WYCA 3H9GA 1FRNA 3NDRA 5HK9A 2OTCA 3E03A 3ML1A 3DCIA 4PRZA 5LXTA 4GUAA 4CF6A 4Q7LA 4ZT2A 3BFKA 1XXHA 3MINB 1N7IA 4FVTA 1FOEB 4MR7B 1DKNA 1LXCA 2FI1A 3ZHCA 3WB2A 3WYDA 1OHHD 2C9BA 3DTVB 3OTWA 2PJDA 2X0IA 4RF2A 3RT1A 3DMRA 2VDLB 2X1MA 3OMXA 1G7TA 4RIFA 3QTLA 1XWFA 1ZGJA 1P9RA 4EDFA 5EHQA 5EI5A 3EC2A 1NNUA 3NRJA 1XHEA 2IIQA 5E1DA 1VYHA 1RRMA 2OV8A 1E1QA 4ILEA 3ROFA 3V6MA 3CNQS 3R7SA 1U02A 4GNRA 3LHDA 1HORA 1SEVA 3IBSA 3TSWA 3LW7A 4Z4FA 3HB5X 1BMFA 1GDDA 1RM4A 1TLLA 1JJIA 2VXBA 2VRNA 1FFAA 2JD1A 4E70A 2GETA 4F9TA 1WY7A 3X43A 3I32A 3H3XA 4Z3OA 3VKHA 1FRVA 2B9EA 2YIJA 1YKGA 4OXXA 5A5FA 5MN5A 1G3IA 1S01A 1RYNA 1NVMB 1KK2A 3IUPA 4QBFA 1T4GA 4RFSB 3JYPA 3VNBA 1CDOA 5AKKA 3DBRB 1H9AA 3LCVB 1YZHA 1FXSA 3W6OA 4NPCA 1K5DA 4F56A 4LJ8A 1E92A 1ZMRA 4KR2A 5FTLA 3FTCA 1X0VA 3B9BA 4LJ9A 1XRSB 2LIVA 1K4KA 2W00A 4LV8B 3DZGA 4QNRA 4DCPA 4EAAA 2CFIA 1NMXA 5D5HA 4YLYA 5DLPA 3NCHA 3PX7A 3DLIA 5LP6C 5MDHA 1IQ0A 1L0BA 3MC1A 2OYSA 4KGZA 1H6BA 5E3JA 1SB9A 4AJKA 3DDSA 4OTZA 1QFSA 5TGDA 3C39A 1NT4A 1PWZA 1W4CA 4YCDA 4PHGA 4CKWB 1HF3A 1QHHA 2QL5A 3KPUA 3Q40A 3NIDB 3FFXA 1E20A 3I34X 1Y1RA 2VFAA 1Q1ZA 4JFAA 4WXEA 1XK6A 2AJCA 3OTIA 4LE1A 2Q3MA 2J87A 2JCYA 2P79A 4DQXA 4Q18A 3RREA 1G6HA 2MINB 1JG6A 2Z98A 5B4VA 2GESA 1KJZA 2JGDB 1YQWA 1VYUA 4W5JA 5J1TB 3SF8A 3IDFA 4A8HA 5FEUA 3CNHA 3WRWA 4KPEC 4DR6B 3WDLA 2QSZA 3N86A 4JI8B 1NNI1 3K1JA 2H9IA 5FXMA 2H31A 2Z56A 1AH2A 1IG3A 2CB0A 1RPJA 4FX5A 4LXGA 3PCXA 2ICAA 3QP9A 3EC7A 2IPMA 2M6RA 3FPHA 4LX8A 4WZ6A 5DGXA 1A96A 3TMKA 2ZI7A 4D45A 3N6VA 4GQIA 3FHJA 4OA8A 3B53X 1GL3A 2JEYA 5ELMA 3U7HB 4J3JA 4LNUB 3OHSX 2X8BA 2GYWA 1TW3A 1FL9A 3BTOA 3DTNA 4Q39A 2EBFX 4AN1A 1XQYA 2GHIA 1ZM3A 3PPIA 4RGYA 4LOJA 1U2PA 3ZV6A 4YVFA 2WOJA 3K0CC 3MAAC 3JWJA 1JKXA 2ZS8A 4EG8A 1ZITA 5AVXA 5IP5A 4I99A 3FPKA 2I34A 3S2YA 1TM3E 3F8WA 3HU1A 1H0HA 4BGDA 4R9SA 2FN4A 5HQ3B 5B6IA 3CLSD 3GJ5A 1E3TA 2QRNA 1JQ3A 1YR7A 3MCWA 4E4TA 1EXVA 1ENOA 4EFMA 2RAPA 4LC9A 3O5AA 3AUKA 1DEAA 2H8KA 3AMVA 3DXYA 4JEMA 3KJIA 1RADA 2WF7A 3BRCA 2VP6A 5EE9A 2J33A 5CNIA 3W1VA 2GQ0A 2GZRA 3FPCA 5KU7A 2IZOA 1JDPA 4FZJA 4OL9A 2E21A 4AJLA 1A4XA 1HEYA 1OWOA 1SUSA 3KJXA 5EE5B 4DA9A 5JNSA 5EYPA 5IWAB 5HGJA 4TKVB 4KUEA 2C7PA 1FUEA 2BFDA 2G82A 2C5AA 4HWOA 4QUIA 2FXIA 4B76A 5L3QB 3V55A 4A36A 3BWEA 3QYPA 1FP1D 1NBAA 2VDNB 4QJIA 2NZJA 4G1MB 2HZ7A 3ZY4A 1B16A 4RM2A 4BKPA 1ZIYA 4C3OB 1ORHA 1U8YA 1DRKA 1ODIA 4O2LA 2OG2A 4R9VA 4C22A 1KPGA 4EO7A 4QZVA 2O8EA 1TA4A 3F6RA 4D0RA 4EYGA 5HCNA 1YK1A 1T6XA 1J8VA 2D7DA 3IAFA 2YHSA 1RDFA 4I2NA 3T52A 4UBNA 3HKBB 4EGSA 5K8JB 3DFIA 3PDCA 4M60A 1UJCA 1YBAA 4QASA 1D7OA 3BS4A 1FTWA 4BEVA 4RMHA 4DRXA 3H9UA 1O6FA 3EEBA 3LY5A 3T1OA 3EY4A 4CKXA 3G5MA 5JZVA 2BFFB 2BDEA 4QOEA 2C92A 1U0EA 1VJGA 1GG2A 3VYSB 3B3QA 3IP9A 1A69A 3PGJA 5KVVA 4NG4A 4GBMA 4JBIA 3BZUA 4HAYA 2VF2A 3NKLA 4Q7QA 3QQPA 3RK0A 2VEDA 1J8MF 3OEWA 3GWZA 4RKRA 4BC1A 2C9DA 8LDHA 1EGQA 2C0PA 1B0ZA 1F4LA 2I4TA 3T41A 4B3CA 5JALA 3IV6A 4LF8B 2IHKA 4BEWA 4LY0A 4M9CA 5CG2A 3MS2A 4UOEA 4NONA 4IVRA 5LVAA 5KQLA 2AOXA 1MNQA 1NUSA 2V7VA 5FNZA 4CMGA 4H7IA 1JFLA 1U0NA 3QKUA 3KOUA 1C1XA 1DKMA 3H5NA 4LE2A 5DP2A 2Q2VA 4Y1EA 2XT0A 4L9RA 3RYFA 3TTXA 5AVQA 3UF0A 4GKKB 3KTAB 4RTQA 5AW2A 4KFCA 3O1IC 4NAHA 1PV4A 4K28A 4YXWD 4C6RA 2FEPA 1RP1A 2PRIA 1MENA 4F2WA 1PW5A 4D9HA 3T35A 1G9XA 1FVOA 2HA7A 4XLTA 3VNUA 1XCJA 4L16A 3VZRA 1YB4A 2NZUG 1PYOA 2YHUA 1IUNA 2GS9A 1RVDA 2QAGA 3RYIB 1XDBA 3VPCA 2XXAA 1RWWA 3SS7X 5JNLA 1K8QA 5BURA 3OZDA 1Y4SA 4JY7A 2JKVA 1E2KA 1NJSA 3E7DA 3D0OA 5IAEA 2QAGB 1CJTC 2XZPA 1P0CA 3K9BA 3R74A 2Q4OA 3QW2A 3JD0A 1CP2A 4N3NA 2HREA 3KC2A 4HRXA 4UE2A 1OILA 4Z0NA 4F7DA 1U2ZA 1Z62A 3FAZA 1E1LA 4FJ1A 3CH7A 1KARA 1EGAA 2FPPB 3N5CA 3RJ5A 1HFEL 1ZGCA 1SOUA 2UZIR 5IASA 4PIVA 1Z2NX 4IVPA 1GN9A 4ZJYA 4NNOA 1EHCA 2PXCA 4DIUA 1GGVA 3R5TA 1L4FA 3CO0S 5GONB 1XCPA 3IXLA 4BCDA 4YRIA 5JV5A 2Z2JA 1TM2A 2JFBA 2QW0X 2W8ZA 3C3YA 1E79A 3ESXA 3L0CA 1P0PA 3LUCA 3P9NA 5B58T 3FVTA 4DSAA 2H18A 4EJSA 4PYQA 4RIGA 3U56A 4XIFA 3IRUA 2QTTA 4Q21A 4UOQA 1OFUX 4X8OA 4YDSA 2GF9A 3UMJA 1IHPA 3QG1A 1J9GA 3C6MA 5T4EA 2HU7A 4NARA 3E58A 2H1IA 1MN6A 3G7SA 3ROMA 1EDEA 1S6YA 2E4ZA 1Z8DA 2CUZA 3FUXA 4JJ4A 2V45A 2Q6IA 1EIZA 4KXXA 4WERA 5BR1A 6NULA 1CDDA 2EKPA 1IXYA 4LYYA 2RK3A 2N1BA 1LPBB 2AK3A 4B44A 4OI0A 2ZBGA 3FX2A 3RRNA 3WB1A 2ZITA 4FFOA 3SIPA 3T3IA 2PGJA 5G0SA 4RESA 4LJ7A 1GA6A 1VLLA 1C0PA 1JR3A 1LJUA 3PNBA 4N5LA 4PM4A 5DHPA 3RTGA 5KDDA 1ZJYA 3G59A 1GITA 1P62B 3NKVA 2PMBA 3DF7A 4LZNA 3PJDA 4R1PA 4AAYA 5JJKA 1N8TA 1F3OA 3AEUA 4EUFA 5A3QA 4ARIA 4XLZA 3SIRA 3RADC 3G8DA 4PZAA 1T35A 4J0QA 1SG9A 5TLSA 2ZCVA 3KPJA 3KZCA 1YZYA 4YJGB 4IXNA 2PUTA 3ZXUB 3MS4A 1KDOA 4BVEA 4LZAA 4BLSA 4NX2A 1NMYA 2BFDB 2I9PA 4OJNA 4O0MA 1E2UA 2BOVA 5BN1A 1QP7A 3HK2A 2ZE7A 1L5WA 1V5GA 2XDYA 2ZPAA 1NUQA 2AFIE 4O5AA 4QQ8A 4ZCQA 5HIJA 1JH9A 1P5RA 2ZYHA 4DZRA 1T2AA 3BK2A 5TEWA 4DTCA 3NIFB 2BM1A 1YTUA 1C50A 2HU5A 4KIFA 3IOCA 1ENYA 2PCJA 4WD3A 4DA4A 4G26A 1B1CA 3WLQA 3LFTA 5BV1A 4JI3B 1Y48E 4AKHA 4OXRA 1G5FA 1C9DB 4YMIA 4PSVA 4HQLA 4DAOA 5HKKD 2REOA 3GH3A 1BC5A 2B21A 1W96A 4KQ2A 4TV8B 1XU9A 1K98A 1H22A 3LMKA 5MN4A 3IHKA 2Z2IA 1K7SN 1A8IA 5J2TB 2R62A 2WFLB 3MJCA 3DLAA 3AIMA 3CIFA 3T3OA 3OFNA 1JP7A 2BFNA 1IB0A 3QJ5A 1AO3A 4FYIA 4EA7A 2VH5R 2RH8A 2J7PD 3BJIC 4G0WA 4IJUA 5BW6B 1C7JA 3AVXA 3EIQA 3R8CA 4QPZA 2IFTA 1ZOPA 2YZ2A 3N76A 3PIIA 4FHGA 3BERA 4I5IA 3IMKA 1ETUA 4CGYA 4DSTA 2J6BA 4WXPA 1JLLB 3VYTB 1OTYA 3WLOA 1W5SA 1SUPA 1XPOA 4HDSA 5T7BA 1U9IC 1QV7A 3GNTA 3H2BA 3EX7C 1PK8A 1FFXB 3WGKA 1XP8A 3TCNA 5EAIA 3UY4A 1FUUA 1SULA 2VHEA 4BFCA 1IZYA 5K9ZA 4LJRA 3PE6A 1UKAA 4RACA 2R6ZA 1NOJA 2X8LA 1G6KA 5CDSA 3KYCB 4EI2A 2OFOA 1SG6A 4WLVA 5KYKA 1E7MA 1JW9B 1ODCA 1W581 2IYPA 2YV2A 5TS3A 3J7AC 3ESBA 2QM8A 3D6JA 4Y1FA 4C0SA 3G2PA 1U7TA 5IS2A 3DUFA 3FDZB 4LDQA 1DDOA 4H7KA 4CFZA 1AUXA 2HHCA 2NYRA 3CX7A 1JYFA 3BD6A 4NICA 3KSRA 2FSVA 1J06A 1YDHA 4M0LA 1ADGA 3RRFA 3UA3A 2ERYA 1S2NA 2W2LA 4UZFA 5JZSA 1GTSA 1JXAA 4CT4B 4XJTA 4CTKA 1SCQA 2QRUA 3L7MA 1QK4A 2WYHA 2VT3A 4IQ0A 1J90A 3UAGA 4MGIR 4ZI7A 2QTAA 2BCJQ 2NADA 4LK2A 1TCCA 3G2NA 4IZHA 3W8RA 3RBXA 1TYBE 5BSRA 1O95A 3VH1A 2FRVA 4HQKA 2JZOA 4QVGA 1J4AA 2J6IA 3GA5A 2P78A 3RGGA 2IV3A 2ZRNA 1QVAA 1XQ6A 3IUBA 5BO5A 5GGXA 2P9TA 1L5MA 1VCOA 2YTZA 4CNBA 4GPIB 4LFBB 3AESA 2REQB 4Y2XA 1L7BA 5IHPA 2DBZA 2V4MA 3OWHA 1FYWA 4KAXA 3SFTA 2PL5A 2O7SA 4V0RA 1PZMA 1QGUB 2GLUA 5ICGA 3HJFA 3IP1A 1VLHA 4BLVA 4BGIA 1Y7IA 3HCCA 1I6WA 3HUUA 5DTJA 4BLPA 1O9BA 5ECYA 3F5DA 3ZKWA 4J3NA 821PA 1RWOA 5A7HA 1JE1A 4AMGA 5CK5A 1R74A 5ALRA 2BFEA 2R6HA 3UXEA 1Z47A 1S02A 3E81A 4DYHA 1QMGA 4J4BA 1E3SA 4NABA 2QQ5A 4MV6A 4R05A 2CCGA 2I7DA 1D07A 2FJ0A 5DM0A 2DQ4A 3M82A 4HL6A 3VDXA 4UD6A 1I51A 2H4YA 2XE8A 3E9YA 4ED9A 2I2XB 3T1YB 2JLXA 3HKCB 2VLIA 1N5DA 2OHFA 5K0JA 2OV3A 4M53A 2XZLA 4DA6A 3GAFA 1FFBA 1PV1A 4HX9A 4UPEA 5JAUA 2IDKA 2BHSA 4FJ2A 5FAKA 1L9XA 3IR7A 3F3SA 3B8HA 4RJLA 3GEEA 4QUDA 2FSIA 4TN1A 2WP0A 4ZQHA 3G2QA 5JQWA 4GLJA 1G9SA 2PBZA 4EB6A 1RPTA 3FPJA 3N8KA 1HO3A 2NU6B 3DHYA 3ND6A 1GTZA 5ALZA 3WZ2A 1DXOA 2H6EA 1FDOA 3HL0A 3ACDA 2PX8A 3C3DA 4TX1A 4MHSA 2ZXEA 3S7TA 2P41A 3LJKA 2ZUCA 2XRMA 1TB4A 2FX3A 3QEMB 1OYWA 2QE7D 1YB7A 3L05A 4KMRA 1MPTA 1T4BA 4TMTA 1FTNA 3UJ9A 1IATA 4HWSA 2AUNA 1GO2A 4G1FA 3VUFA 4O8ZA 4LF9B 4CETA 3SQWA 3KB1A 1LLUA 2D5AA 1YQTA 2QG4A 3I6IA 4I19A 1U5CA 4S2EA 4TRJA 4UFOA 2O07A 4C7KA 4X7RA 1KMCA 4MW7A 3VR3A 3V2HA 1OW3B 3TZLA 1F9EA 1PFVA 4UMFA 3SVTA 4PEVA 1MD9A 3PL5A 1KDPA 2HQ1A 3EXEA 1K2VN 3VMMA 3WGLA 4CKZA 3TECE 5A3SA 1TIBA 5CDUA 1O2DA 3ANNA 2GK6A 2PBRA 4FDTA 2I87A 3SYMA 5B1YA 3ZDRA 1QUFA 3H2SA 5ALYA 2YV4A 4NCAA 3CE6A 5JDCC 4Q9HA 1OVGA 5HZKA 2VPZA 3FZNA 3PKIA 1R16A 5AD1A 1PTJA 1CP3A 5ALQA 3TTUA 4IWYA 3Q3HA 3VKUA 2FWNA 3GK3A 5JADA 1Y7TA 2H2DA 1VECA 2GI4A 4I1VA 4L9AA 1E4EB 3D1VA 4M8NE 5CP8A 4KH0A 4OBWA 5KSOA 1RACA 1MVNA 2TRSB 5DGTA 1PWEA 3ES9A 3E7PA 2GN9A 3AYXB 3TFOA 5LNK6 4F5YA 2CKDA 1HMYA 2W4IA 2E18A 1TA9A 2HOQA 5JLJA 3QZUA 5K51A 3EVAA 4AY5A 3IIMA 3P9RA 3HZOA 2H1VA 3I28A 2BC9A 1O77A 3VPAA 1T0JB 3O93A 4J6EA 1KQPA 2GNOA 1M1XB 5IC6A 4OGKA 3FMGA 2WD7B 3UV6A 4UNPA 4ZKDA 3KQSA 3B3GA 2Q2QA 6REQB 1NT2A 1TXGA 1UP6A 1VRVA 2Y2UA 5TE9A 3V9PA 4DW8A 3JQRA 2UAGA 4KSCA 1SH7A 3BL5A 4QYXA 2AI3A 2KX7A 2JGJA 3PXBA 3GJTA 4PQGA 4HWGA 3R7AA 4YS6A 4EUNA 3UPTA 1GUDA 1UJ5A 2JGAA 3FMPB 1ZIOA 2CLIB 5ERGB 3PR1A 3UGQA 1AMOA 4TXJA 5L7YA 1TK9A 2GWRA 2QKYA 4NP6A 4U6QA 2A3RA 3RS9A 5JZOA 4AG3A 5KWJA 3CZ4A 4WV3A 4KTVE 3S68A 2O59A 2C00A 3DEFA 4XARA 4Q9NA 1TI7A 4A3SA 2R1UA 2FW6A 2PFKA 3DBLA 3QHQA 4RK5A 2XUHA 2XTJA 2YOHA 3N6RA 1VP3A 1X15A 4I9NA 1HTWA 2XNHA 1Q2XA 4QOSA 3R3ZA 1V39A 2F43A 5F1OA 2O5CA 1ZMXA 2NT3A 2BMAA 4U7HA 4DCVA 2P4EA 5EIOA 2OBNA 4HDSB 3EPRA 1QBKC 4DSNA 1DXQA 4MI3A 2WD8A 4EARA 5ALHA 3FN4A 3RHZA 1GYRA 4FQ8A 1Z2EA 2QNRA 4P86A 2NUAB 1Q1AA 1NIPA 3QVLA 4D96A 5BP7A 3H2GA 3HNPA 1OA0A 3ZKWB 1MQSA 3MPUA 2WWGA 3FFAA 3V4LA 3H84A 3JYHA 4CLRB 2R6R1 4J2TA 5FLXA 4RKFA 4YAWA 1X39A 1HT3A 2IH5A 4MR7A 5C8YB 4FILA 3M70A 1I2CA 2Q9BA 4U9HS 5C53B 2GM5A 3JALB 1WUKS 3O31A 1FTGA 2RIPA 5AICA 5EPOA 1I9CA 1JB1A 2R00C 3V8BA 4P5DA 5FFNA 2AFRA 4CCYA 2DH6A 1Z13A 4DADA 1OJ7A 2ZVDA 4P35A 4RFSA 2F8MA 3B9RA 2WM2A 4G4SP 5D3ZA 1SKYE 1ST3A 4ANFA 3HLTA 3KVRA 1Z18A 3VR4D 1D5WA 4E5KA 1CR2A 5JH7B 5B64A 1MC4A 2YJ3A 4PHTA 4B33A 4ZJUA 2OV1A 3MMSA 1WCYA 5H4GA 5BNTA 2YXDA 2E37A 1A9RA 1UPFA 3OKAA 5GV7A 4CM8B 1QG4A 1X3SA 3PWZA 2BHRA 3DXFA 3GLTA 5BUCA 4DXAA 2O2IA 3AOGA 4PG6A 4RMGA 3A26A 3KZKA 4G4JA 3I0ZA 5BNWA 1L5ZA 4MO9A 2VWGA 3H42B 4XPIA 2NTJA 3H9JA 3ZQ6A 4NV1A 1ZEMA 3P2EA 1AC5A 5D8DA 2F00A 1ZOSA 2ALJA 3JYNA 2QN7A 1YS1X 4EW6A 1PGQA 3SX4A 3WNVA 4YNBA 3TM4A 5J58A 3GX1A 3G0IA 3P8ZA 3JQ9C 4NQRA 5EWMB 4ZHQB 5BSVA 3OQ6A 4WK4B 1X7ZA 3BWDD 3E7XA 4LY6A 3NUGA 3EVDA 3ITEA 2XF8A 3A3OA 3CCFA 3M3PA 3KB8A 3O94A 4EYOA 2WA2A 2IVZA 2A9KA 2IZ0A 4XWAA 1BDHA 4KJXA 4IJ5A 1OR8A 1R7RA 4L95C 5FIUA 3TQIA 3OEED 1ZX1A 2BYTA 2FRDA 3UKDA 2Q4DA 1M34E 1VC2A 1I6MA 2NAPA 4WCFA 1CUEA 1TRHA 1S9HA 1XWIA 1P0FA 5EWJA 1CYEA 2DPMA 3MQ4A 1W52X 1NPYA 2CZGA 3H04A 1QB8A 2GTIA 1I30A 2CFOA 4M9SA 1JZSA 2NZYA 4P6VF 1Z37A 4ZP1A 4DIFA 4ZMRA 1DRVA 3SQMA 3HY6A 1WD7A 3ECAA 2N42A 3DVAA 2OHHA 1VLVA 3H6GA 4C4AA 5JUWA 4P8RA 4DFDA 4NC9A 3BGDA 2G5PA 1HYGA 2P35A 4WBSA 3T3PB 2VHXA 3MXTA 2E55A 3X1JA 1PFUA 3LBAA 3AV3A 4B09A 1XVTA 1N5IA 2WHPA 4A15A 4IL5A 4C01A 1HDIA 2R1VB 4JWTA 4JXXA 1QDLB 4HLQB 2W6OA 2F1HA 3FLMA 3KXLA 1R4ZA 1FS4A 5LQUA 2DLDA 4LHXA 4M1MA 1L5VA 4KGVA 3JQPA 4MGEA 1RT9A 3TLCA 1ZGGA 1F2UB 3KL2A 1QGZA 2VDWA 3L8ZA 4FCVA 1UQUA 2R5NA 2VHZA 3TG8A 1PZHA 1RAFA 2QXTA 4BO5A 2A4KA 4Q6BA 3L0YA 5F9MA 5EYPB 1RHQA 3O03A 1P72A 4HZIA 4A8TA 1M2OB 2PUBA 1GA4A 1ZW6A 1DTWA 4G0MA 4UTXA 1U8UA 2DQSA 4UU0A 2P5TB 3KOXA 3N2ZB 2C4NA 2JAQA 2GVZC 2J45A 2OO3A 4NJMA 1JQAA 1Z5UA 2HCBA 4K6FA 4ZQIA 4FHDA 4OJMX 3CRNA 4M7RA 4H6WA 5ALOA 4KXUA 3UWMA 4REOA 1N2BA 4AKTA 3U7GA 4HGZA 3SM9A 3AU8A 1LPPA 4OXYA 4QWMA 4BV8A 4DUGD 1CUSA 1WHTB 1OJLA 1CFZA 1R0ZA 2B1QA 2VC2B 3I73A 1Z4OA 1R6BX 3JQAB 2AF4C 2GXUA 2W5UA 4Q19A 2V8BA 1NF3A 1LRKA 2D2XA 3WK6A 3CGWA 4BNTA 5THQA 1TQDA 2FFHA 4XAQA 4Y6PA 3OT1A 1FP4B 1L7QA 3O82A 3TQCA 2QRHA 4Y1GA 1E9EA 5EKUA 3HFSA 4FKZA 3T3EA 3TG2A 3CM0A 5JARA 3PC8A 2ZYGA 3GLUA 4Y6QA 3OUZA 3CUKA 1RWNA 3HXTA 2ZIFA 4JOQA 5EEGA 1DUVG 1R4MA 3ETGA 4TL7A 1ZSYA 1D2HA 1VHDA 1QMPA 1ZRHA 3FAKA 1TZMA 1UC9A 4WOBA 1W36D 3ZDDA 4NYMR 5BSKA 1SVNA 4TT8A 2J0UA 1NA5A 2IYTA 2WFAA 3IUJA 3STTA 2C88A 1TU3A 3JAWB 3OOEA 3G1TA 2HA0A 2KS6A 3ANLA 1W44A 1Q0SA 3PR2B 4OPMA 2VBFA 3AM1A 4BB0A 1B8VA 1P75A 5JJIA 4X94A 2C96A 1ACMA 4I1PA 4B3TB 1LVGA 3CJRA 1J8DA 1M1UA 1O94D 4P08A 4CTJA 2ZLBA 3SOZA 4YCLA 5FH9A 3WWOA 1FZTA 1XEWY 3JYQA 1NBHA 2RC5A 4F2DA 4YP5A 2LGJA 4BNKA 3UNXA 2GBCA 5EVCA 3D3EA 2A0KA 1C1DB 2BONA 2GN2A 3OP4A 4UDXX 1J7KA 2GKOA 3DOFA 2PJRA 1MU0A 2C5BA 2PFGA 1RTKA 3DVSX 3GFTA 4Z3DA 3UK2A 1ZOOA 2OCBA 3JPYA 1E58A 1N6IA 4H0NA 4CFYA 3KS9A 4S24A 3DMTC 5E8JA 3WRVA 3NEPX 1HMPA 5EINA 2K4MA 3S2SA 5A6SB 4TS9A 2QZPA 4LVCA 3WMXA 3ZOKA 3A28A 3DWIA 4ZOLA 3WOVA 2PUFA 3JWHA 3KSDO 2VHVA 4QFDA 3WL5A 3ZNNA 3VVLA 2WPDD 4TL6A 1Q7GA 1EGHA 1Z36A 1IFXA 1IAQA 3EGWA 1AKYA 3SIWA 2EG5A 2YINC 3FWHA 3NHMA 2C3YA 2IOYA 3QWIA 3OQIA 3ROPA 5EZ6B 1GG8A 1BTOA 1NI5A 2ZTSA 4MAAA 4MVJH 3H5LA 1WUIS 1HT1E 2ZI9A 1M7BA 5CYOA 1H5UA 5I45A 3WLEA 3ZD7A 3UHOA 4PO8A 1DJPA 3PVCA 4H4DA 3AL0C 5JSQA 4FLEA 1XZIA 3V4SA 2CVOA 1JHPA 4EP1A 3U9LA 2OZEA 2ACKA 1NMZA 3VSAA 1ADCA 2OO5A 1CZLA 4NYJR 3WGVA 3BDAA 4IH1A 5KOHA 3EN0A 4BGUA 1E0AA 1U8EA 5HKKA 4XRRA 3LK6A 4N5HX 1CHDA 1LDMA 4GX2A 1YNOA 4PGAA 5J4LA 1JR3D 4XM1A 5CLIA 1JZTA 4HAZA 1KIMA 4CPDA 3AF3A 1TIPA 5LZ9A 2XLBA 3KCQA 3ED1A 5BV0A 1ADJA 3IVGA 2GR9A 1MO3A 4I9UA 4CMEA 5LOVA 1XFAA 3O4RA 3BG5A 3ZBUA 2Q0SA 4C21A 3TUZC 3EW9A 1J23A 3IDSA 1MPXA 3A1SA 4G0VA 1NN3A 2Z9DA 4GZ5A 3WYAA 3KQHA 4AKIA 6ABPA 3GI1A 4AO8A 2X7JA 3N8NA 2AOUA 1EXDA 3PENA 1Z7EA 2FW8A 5L95A 2VZ9A 2OHOA 2Q2OA 4EJMA 2RGRA 1Z0FA 3O9MA 5EZYF 3GFVA 2IEBA 1RFGE 2JFYA 3CO5A 4GRAA 4EJSB 2VYFA 1TTPB 3ENZA 3L8MA 4UW9A 4FT4A 4S2UA 3DZFA 4ZAGA 2PUGA 1J70A 3THXB 5IF9A 2Q8PA 2V7EA 1IDOA 4UTOA 5H3LA 1SNYA 2FW0A 2ZAYA 1QB7A 1Z8NA 1Z4MA 3MCVA 2XRZA 5D85A 4A6EA 4DQUA 1OXTA 3GOQA 2QTGA 2VNHA 5DEIA 5HILA 1FTQA 1VZ2A 3L01A 4WK0B 4RHYA 4F5ZA 4Y2GA 2O50A 1N3BA 3WZLA 1GY8A 2B5WA 1Z7BA 1TC1A 2FUNB 3HA5A 3TO5A 2VZ8A 3AK4A 1P4AA 1RPAA 5H0IA 3TLKA 2XUPA 4AY3A 4B4WA 1V48A 2P6UA 2WMYA 4GT1A 2MCFA 2C8LA 2JAHA 2K87A 4E1BA 1TJ3A 1PS0A 2O0KA 4O4JA 2HRDA 2QU8A 5CNKA 3REFA 3TKLA 1M83A 3JWPA 1TFUA 4H2DA 4HGNA 3F8SA 5K8IA 4JBGA 4B3GA 4DSZA 3WS7A 1BGVA 3TCXB 1SKAA 5CW1A 4UNNA 1R15A 3T1VA 1BJKA 2I2AA 1E9FA 3NV9A 4F4JA 3O91A 3WYNA 2XRFA 2KYRA 2BBTA 4WPGA 3G0HA 2HJ9A 4GMXA 4J0FA 4UU8A 1JMKC 4HFJA 1BIFA 2RHOA 3OOJA 6PFKA 3JYOA 3VZPA 2DY0A 2WWRA 4H16A 1QVZA 1NKTA 3H2ZA 3SZMA 1EX7A 4AUEA 5BVHB 1XN4A 2JAWA 1FX1A 2PAAA 4I55A 2QLNA 1ZCBA 5AHOA 3WOHA 1NQXA 1IBMB 1RAGA 5JO0A 1T9CA 4OHWA 4XIYA 4TKZA 2OBFA 3KZVA 1ZJ5A 5IDXA 4RYLA 4R3UC 4CQMD 1OCEA 5H9WA 1NJ5A 5DZSA 1OGJA 2GEDA 1EJ0A 3C8HA 4P22A 5CCBA 4L7VA 3N0RA 3PGLA 4JVLA 5B3LA 1TUBA 2BTEA 5AMXA 1NXWA 1X1DA 3Q3GE 4OHOA 3HN7A 4WKGA 3V4VB 2D1FA 3THWA 4JUAA 2MR6A 5LZ7A 5FULA 1KBQA 2ZRFA 4TXNA 2J5RA 2QTLA 2F9LA 3BICA 3D2LA 5CURA 3OOSA 4CT0A 3QNUA 3WRYA 2QX9A 4PGFA 4B3FX 1P8JA 3M1YA 1QS0A 3SE0A 4CVNA 2YMQA 1T5IA 1ABFA 2I4IA 4FNAA 1EINA 2RI0A 4R71A 1PQYA 1DX4A 1SC6A 1XZCA 2DPHA 2R6JA 3GGOA 2C5LA 1P5FA 4UEKA 3BIFA 1QQAA 3H5IA 3L18A 3V1MA 3VHXA 1M33A 1V16A 3PGMA 5FR1A 4FYPA 3NBQA 2CD7A 2NVWA 3EFOA 1PX2A 3R41A 2GD2A 2YWXA 4J4TA 3W3AH 1K5HA 5L45A 2DY1A 3M6WA 1A8PA 2BFAA 5GQSA 4BQNA 1E77A 4IF6A 3O4FA 2VYVA 3DOEA 1ZCZA 3HDVA 4JP1A 2XDAA 4HRVA 1RXIA 2ZR7A 2D7CA 2ZSJA 1ICEA 2BJHA 1EE9A 4V1CB 2YH2A 4OMDA 4MS3A 1XLUA 2VR1A 2PX0A 4JLMA 1V3VA 2QL6A 3OPYB 4RIHA 1TZBA 1ZAYA 3N2YA 3HJNA 3ZCPA 3E9EA 1MA3A 3SCZA 3E8XA 2R4UA 2QVBA 1JEQA 1W46A 3CWZA 2OFPA 4KUGA 3O4JA 2XADA 5FOQA 2QD1A 2X8JB 4L75A 1W5BA 2P2GA 4J0JA 1ECFA 3L7JA 2QLFA 2QT1A 4CDNA 1Q0PA 3INGA 1C3LA 2ORVA 3K0FA 4O1IA 4NFSA 4LQLA 3A6LA 5A1JA 1EVKA 3DNPA 4F2GA 4NJEA 2CLKB 4NH0A 3Q0EA 4G9BA 5IXYA 4XD7A 5ICSA 3AVYA 1LWOA 2XCUA 1MCZA 3LC0A 5DM4A 1X92A 5A2QA 1T2EA 2CL0X 4OLJA 4D3XA 5B3KA 1NE2A 5D3QA 2WE7A 4Z4QA 3T99A 5A9TA 3X1MA 4QT4A 3OUUA 2NQ2C 3ZZMA 3W5JA 3R1IA 3EUWA 1YNSA 4OQMA 1L4GA 4H1WA 3GZ4A 1BXGA 4YWHA 2P5UA 1WJGA 4YV7A 5KYYA 3NNNA 5CX4A 2DTDA 5ARBA 3VM6A 3EYAA 1ULBA 3AIKA 3KJQA 3VR3D 4K3UA 4DQDA 3WQHA 5K8CA 4RTNA 1S0UA 1O5OA 5LZ4A 1G2PA 2PT7A 2FR0A 2BFOA 1QYXA 2DF8A 1JHDA 3OHMA 5KOIA 1E2HA 3TPFA 4GL2A 2ANBA 1E6WA 5DXAA 5IFLA 4X1IA 3OPQA 5EZYB 4N7JA 5D86A 4A4DA 3PJFA 2ODAA 5IT9A 5EZ5A 1RQNA 1U81A 4Q7EA 3IT3A 2MJLA 4G0ZA 4UVDA 4ZU3A 2VL7A 4WA8A 4HOYA 2FQYA 2RHTA 4MDYA 3RRXA 2IUFA 4DILA 4OY3A 2BP7B 3ZHBA 3A11A 1XTZA 3I01M 1GQRA 3KVNA 1PR4A 2WY2D 4AM8A 1O6CA 4KIJA 1TO2E 3CF6R 4G97A 2O57A 5T4BA 3WA6A 5IN4A 3TD9A 5AUQA 3H11A 4Y6SA 2JGRA 1V5FA 2IU0A 1YQDA 2YXLA 5CA0A 4UNIA 4GKBA 1SCKA 3S40A 2XIQA 1XGKA 2BKAA 3PJGA 1FDVA 5CVVA 3PNQA 3BWYA 2OV2A 3T7CA 4TUYB 3DMTA 5UKDA 4YRJA 1N0UA 3B2NA 4QFCA 5HMLA 4C14A 1DBSA 4GMFA 5LFAA 4LMAA 2HK8A 1QYWA 4A2WA 1ZMTA 4QO8A 1IN8A 3ZVLA 1M0WA 1I32A 3GJRA 3PDHA 3BM5A 3A3YA 3OPXA 3QNWA 3SI7A 1K2WA 1ZAKA 4CKEB 4IGKA 3ITKA 4LHWA 5KO2A 4D98A 2AXEA 3DZCA 5K3AA 4DLNA 2APJA 4JLWA 1JQBA 3WA7A 1YOVA 1EB9A 5FPSA 1JWLA 2HU8A 5L3SA 1WIWA 2C29D 3E53A 3L9XA 5G4LA 4CV3A 1MT3A 1UXKA 4R1LA 3X2EA 3ZWPA 4GI3A 2PPLA 2BKXA 4FMDB 2I91A 3MYYA 1YACA 1ZGBA 2BVNA 1LJLA 2R1TA 4KO1S 4ZOCA 5D51S 1XAGA 2CUKA 4R8RA 3B48A 4EGJA 1I8TA 2Z1MA 5ENVA 3C3WA 2V65A 1W59A 2P6MA 4OIMA 3DNFA 4ES6A 5EE1A 3NJ8A 4EB0A 5K1ZA 3PG5A 4IZOA 2PL1A 2DPGA 5F51A 1S8FA 3ZZNA 2X9VA 3HY4A 1RHRA 1C41A 4MPRA 4NMHA 1DEOA 4IAOA 1KIFA 4AB1A 1FMCA 4G5HA 4ZQGA 2IYWA 5K2MA 5KKNB 4WGGA 4YJ3F 2HIHA 4NPHA 4D2IA 3A14A 4EJ0A 4WK6A 3BXOA 4RA9B 1CUCA 1NOIA 2CYCA 4HJXA 4D5GA 1R0RE 1PRYA 1UP4A 3EG9B 1JZQA 1WW3A 4P4SB 4GICA 3AF2A 4O4IB 2AZTA 4V2IA 1E2NA 1TT7A 3BB4A 5KOJB 3N6XA 2C97A 2JH8A 3V8RA 1T3TA 4RC9A 3VYWA 3M8KA 3CZAA 2QX7A 3ILHA 4JL6A 1LTQA 1WVIA 3HO6A 3RAJA 3RT9A 4AO7A 2JFNA 3KLBA 3R9IA 4GKJB 3PFKA 1TF5A 2X3FA 3WBFA 1P81A 2Q46A 4R9UC 3FE2A 2MIIA 4N9WA 1M10A 4D8TA 1DV1A 4HN9A 1VKJA 2E4YA 1X7YA 4TXLA 2BLNA 2YJGA 4WIAA 1MOZA 1LDNA 2EZUA 1CSEE 1BAPA 3T0FA 3U37A 4JCOA 4TWIA 4EGFA 4EMBA 2G0NA 3KZXA 5BQFA 4QUGA 3ADDA 5ICMA 3ER9A 3CUVA 1DWUA 1UINA 3AUFA 2DPLA 2LR0A 3STUA 3SU8A 4GPZA 3FPLA 1I5EA 1K08A 3GJZA 1T5LA 3L82B 4NBTA 3UEOA 4AZWA 4JYZA 2ORIA 1Y4DE 3ABRB 3O3MB 5KOJA 3BSFA 2OUKA 1SB8A 4LFCB 1C3XA 1Q0ZA 2I66A 5E0KB 2UZ3A 4HS4A 3L9WA 4DE5A 4QDJA 4WAUA 5CEEA 3F1KA 1MJGM 1OWNA 1QYDA 1XTVA 3NIGB 4XDGA 3OIFA 2OM6A 1YDFA 3VVMA 2QAGC 4EATA 3ZVRA 2GJ8A 3S5UA 3TR6A 4K9KA 4OQXA 2NWQA 2W7TA 4QNNA 3SF8B 1TE2A 5KNCH 5IVHA 3CKLA 1QG2A 4K5QA 3DVLA 4RJTA 2W42A 3EIXA 1MO5A 3OWXA 3W5VA 3C4VA 3H19A 1R50A 3PQ2A 4RXMA 5F2EA 1EEHA 4M9QA 4BX0A 2FRDC 4EG0A 1HL7A 2R6FA 3OEHA 1EWKA 1LLDA 1WB4A 3B6IA 3TE6A 2HYIC 1IUKA 2PDAA 3IC5A 1A5BB 3EBLA 1I1NA 1NYQA 1D2MA 2PJZA 2PMKA 1WLYA 5H1YA 3ACCA 1K4YA 5L53A 3IE1A 5ALGA 3V42A 3K7EA 1HT2E 1VM6A 3OG9A 5BR7A 4P4UA 1X8KA 2X41A 2V7WA 1T1JA 1YQQA 4F91B 4K6HA 3BXFA 4UEJA 2R84A 3PHCA 5LP6A 5K8LA 3GP5A 4WVLA 2VJKA 4FGWA 5G1OA 1ZGZA 2R6CA 5JD6A 1DJOA 5HRUA 1BS1A 1ZS9A 3MWDB 1CLEA 2CT8A 1F51E 4M55A 3C6ZA 2HZBA 3G3EA 3OE5A 5IAGA 1A50B 3E82A 4BJ1A 4JP8A 2G1AA 4PBSA 4O63O 3M6FA 3TVYA 4YAFA 2ZSHA 1MT0A 2DT8A 5L3VA 5BORA 4QTXA 4A0FA 2O7QA 4IUDS 1Z6QA 4F21A 1QOZA 4ZO6A 4R1OA 2O8NA 1NDQA 4PFKA 5B6JA 4J0HA 3VYRB 4KQ9A 1JSXA 3TUJC 2V9ZA 3HJHA 3ZU6A 4DKJA 3K6RA 3U3JA 2ID7A 4BE4A 3L7YA 1SZPA 1D09A 1ZNWA 1IG0A 2J3DA 3QOXA 3RVLA 2ATXA 2YX1A 3M6UA 3Q6MA 4PLHA 3G0CA 4OQQA 4Y9RA 2O52A 3KT6A 4HADA 1LW7A 2O20A 4BVBA 4HRYA 4KXNA 5KIAA 3VR6H 3LLMA 5EIBC 1Z0JA 4OGGA 1G21B 4IRMA 2F43B 1YB6A 2CD9A 2EP5A 3NTQA 4TKMA 4DHEA 4BFUA 4FHFA 3GBSA 1VGRA 4F3NA 4RLSA 1JXOA 3FDXA 3MD9A 3UV3A 3LGSA 5BWLA 1PLLA 1JQKA 1JHOA 3MD0A 4RENA 5AKEA 4KO2S 4PG4A 4YRQA 1OYOA 2HK7A 1A0OA 3RU3A 3U0VA 1M2OA 5KNLA 1RI5A 1JEJA 2B2NA 3D2BA 1T36B 3WB9A 2ZR9A 1CVRA 1UDBA 2Y66A 2Z3VA 4WJZA 1T1EA 5EFOA 2OQ2A 2P4UA 4R4JA 1KK1A 1T1IA 2AVDA 1E2LA 2W2TA 1G20B 2QZSA 5F12A 1FC0A 4X93A 3T7IA 4GOJA 4BECA 4LFAB 1KYYA 4ZEOA 2F3QA 5E3HA 4ASUA 3NTOA 3O21A 3B89A 3QX9A 4RD6A 1MEOA 2AMLA 2YY5A 1OLOA 2JLQA 3B36A 1TKRA 3BUSA 2B1JA 1FP4A 1MAAA 3DEYX 3UJCA 4B7UA 1LI7A 1K68A 3B52X 4D4HA 4OVKA 3VZSA 2IW1A 5AKGA 5AI5A 1X1AA 2W6NA 3G2HA 5BMVB 3HCWA 4C4PA 2J0VA 1NPDA 2YYAA 3OEHD 5TQ2B 5JY6A 4ZO9A 5F5NA 5IU6A 2WJAA 3HEMA 4J1SA 3UB2A 4HB3A 2IHYA 4INPA 2YXEA 1KSFX 1JHVA 1T0UA 3GRFA 4CLOA 2A86A 4OOEA 3H4TA 2M9MA 3ESRA 4QDZA 1HY3A 2WC1A 3MCTA 3BXGA 3HP7A 4J1QA 3EEOA 4Z7QB