2X2FA

Dynamin 1 gtpase dimer, short axis form
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
347
structure length
336
Chain Sequence
EFSMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYSRVDEMLRMYHALKEALSIIGNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title G Domain Dimerization Controls Dynamin'S Assembly-Stimulated Gtpase Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DYNAMIN-1
total genus 105
structure length 336
sequence length 347
chains with identical sequence D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2x2fA00
1VG1A 1U81A 3C5HA 2V1XA 1XDBA 4Q00A 3FKSA 4OQMA 1D5CA 2WZQA 4TTRA 4KLZA 1RZ3A 4C30A 4HLQB 5H8WA 1II8A 2XNDA 3B2EA 2ZI9A 1ZNWA 1SXJA 3N2IA 4Q4LA 4DB2A 2MMGA 1YRAA 4MRVA 3NBYC 5GJCA 5KNCA 5UKDA 5JHHB 1W36C 2NO0A 2XOKA 1VYUA 1QHHA 2QAJA 2F3TA 1MRNA 2A30A 3NWJA 2XSZD 3LO5A 4JLNA 4A2QA 2ZPTX 4XD7D 721PA 4BPBA 4MKIA 3SJBA 2XB2A 2FGJA 3D6TB 2NQ2C 2ZXUA 5LD2B 3R8FA 2ZRNA 3REFA 4Q9HA 1KDPA 4M1WA 3P4XA 4C2UA 4CZ2A 4QHTA 4HB3A 5AUPB 5C2JB 2HJVA 4EFNA 4PX9A 1XEWY 3A37A 1KMQA 4DVGA 1D6JA 1J7KA 3BORA 1YZTA 4PZZA 3IEVA 3KJGA 2DFKB 1JPNA 3SS8A 2R65A 3E1SA 3HJNA 3SZRA 4EPRA 1T9HA 3RS0A 1UBFA 1A1VA 2JA1A 1TQ2A 2BM1A 1P2SA 4LHVA 1G17A 2HCBA 4LHZA 1SXJB 1UM8A 2G3YA 4UNSA 1LTQA 1Z5ZA 4QC2A 5IK2D 4Q4HA 2ZROA 4OJQA 1M7GA 1MO6A 3MGCA 4EUNA 4LDJA 3EIEA 2O8EB 1SKYE 2OFXA 1Q12A 1QHHB 5JRZA 2WOJA 2WAYA 2ZYTX 4IVPA 3NG1A 1X8JA 3MFYA 1CJTC 2Q9BA 1EFCA 2WV9A 4R9UC 2ZRGA 4M1SA 2PMKA 4M4SA 3K70C 2Z4RA 3CRMA 5KDOA 1O87A 4DIEA 3GLIA 3A8TA 3OESA 5KPDA 3RC8A 1E4VA 2DPXA 4J0QA 4FI3C 4B33A 2ZSBA 5FR2A 1EX7A 3C15C 4QRHA 1EFHA 2RGCA 1QHXA 3PUZA 2QTFA 1EFRA 1IN4A 1E2GA 3FTQA 4JKIA 2XOKD 4BWYA 1KTVA 2Z83A 3Q72A 1OH5A 2J41A 2YYZA 3AKDA 4B76A 5HKKD 3A6PC 1GFIA 4DCVA 3CNOA 3QPUA 2P0EA 1ETUA 1Z6YA 1M74A 5CK5A 3ZH9B 3K9NA 4TLBA 2V54A 4TL6A 2QSYA 4JVNA 5LDDC 1U9IC 4HAVA 4BRUA 2ZRJA 4JVMA 3Q9LA 1ZM2A 1YZUA 3G82C 4IDQA 4KI0A 4D82A 5EE9A 1R10A 3RANA 1XJCA 4NYIQ 3THXA 4FMDB 2GNOA 5DIFA 3LRPA 1JNYA 1TUEA 3OIWA 2FV8A 3W6NA 1NKTA 1DG1G 4DRZA 2ZE8A 4QOSA 3RLFA 2X77A 1UEJA 1W0JA 1YZNA 4KFRA 4FINA 3PUXA 1Z08A 2OCAA 5D3QA 4PHTA 5FBWB 1PJRA 3TAHA 2VSFA 4UKDA 4L9SA 2G88A 3DOFA 1JAHA 1P60A 2ZSDA 1S4QA 3JVUA 1XF9A 1WE2A 5DHAA 1KMHA 1A82A 2IYLD 3CRVA 2ZRLA 3T12A 4JL5A 4TLDA 2GESA 1X3SA 2NPFA 1KK1A 3A1UA 3PUVA 1KDRA 5B64A 2XXAB 3HP1A 3U44B 2FEOA 5G41A 1MR3F 1DO2A 2JJ8A 1N6PA 4HZIA 2OESA 5DSZA 4ASUD 1G3MA 1N6OA 4Q9IA 5C4GB 2PLRA 1FMJA 2IXEA 3THXB 3HPRA 1KY3A 3CPEA 3A58B 1CR2A 1ZNYA 2PZEA 1J70A 4FCVA 1GOTA 4V0MA 4KCGA 4PHHA 3N5CA 2FZ4A 1WDTA 1KI2A 3GJ3A 4IOKA 3T5DA 1US8B 2ZR0A 1SVOA 3EZ9A 4FMDF 5HCIA 3KQLA 4X8OA 2FNAA 5AJZA 4LJ7A 3RRYA 1ZP6A 2W6ID 2OBLA 1GSIA 1XCGB 3ZQJA 5EXXA 4PO1A 3KUDA 2N1BA 2NO6A 3VMFA 4PSVA 4LJ6A 4A2PA 2GF0A 4HAZA 2RB4A 4POAA 2F3RA 1S9DA 4L4UA 1PLJA 3UIEA 1TQ6A 2R6FA 4ARZB 3ECCA 2DCUA 3TK1A 4JSTA 1GNRA 4Q03A 2MSDB 4BRWA 2VP9A 4JL8A 1U2RA 5C1BA 2C77A 3OEHD 3LX8A 3KB2A 4BLPA 2JATA 3CIOA 3OEED 1JR6A 4RVCA 4H1VA 1NBME 4F92B 5HZKA 2C8VA 2W0MA 1E0KA 4JJZA 1KI4A 2W0SA 4LV6A 1E0JA 2PLFA 1IY0A 2FF7A 5LB2A 3SJAA 1MKYA 1IJEA 3Q7PA 2JLUA 4Q7JB 5CIQA 4LWZA 5HR5A 1E2IA 4Y0VA 1N5KA 3B8HA 4O3MA 2UZIR 4XD7A 2BOVA 2AL7A 4Q02A 1UAAA 2W2VA 2WKPA 4OKSA 3K0AB 5IF9A 2Q21A 2GEUA 4ZKDA 1RRGA 3RS4A 4AI6A 4ARZA 3KJEA 3DDCA 3EIHA 2I4IA 4Q7KA 3TNFA 3GLHA 3NIBA 4OHWA 2WWIA 1L4YA 4NCIA 3CRQA 1QRAA 4YXWA 2VSOA 4M1OA 2FPMA 2FMXA 4RZXA 2ZJ8A 3BIFA 1II9A 2GK7A 3NH6A 4Q19A 4XWAA 5EP3A 3TW4A 4D81A 5J4VA 3U7EB 1QHNA 2BV3A 4YMWA 2G6BA 4KO8A 2F6RA 4KLNA 2F43B 1CF4A 3WHLA 1SVWA 4L5BA 4IKEA 4M0LA 4CT5A 1F2UB 2B7BA 1C1YA 3QI2A 1XRJA 3AF1A 2CL6X 3RNLA 2ZETA 4RD4A 1S8FA 4LJ9A 4HB0A 1NSFA 4JZKA 1CBUA 1X6VA 3IKJA 3B1XA 2AKYA 2A5FA 3P26A 3ZQ6A 4Q1BA 5L8VA 2I3BA 1PVOA 2OG2A 1U94A 1DS6A 1E2MA 2GJAA 1OXUA 3T1OA 1Q21A 3MMPA 2HF9A 1N6IA 3GLHB 3VX4A 5J4LA 4HAUA 2KWIA 4M9XA 3VKHA 1DE0A 1T8UA 5K8TA 2BHRA 3VR3A 2QG6A 4CEJA 8OHMA 1O3YA 1VG8A 1UBGA 1N0VC 2WJIA 4NYJQ 2WWXA 1W4RA 4HDOB 3A1VA 2JLSA 2F43A 1UKVY 2BBOA 3EIQA 4US1R 5FFMA 6Q21A 2FX3A 2GVZC 1T0JB 4TSFD 1VHLA 3LVRE 5H68A 1E2FA 1ZUHA 5JBQA 4M53A 5KOYA 3AVVA 2VRWA 2O0HA 2CE7A 2J3EA 3C5CA 3GJ0A 2YV5A 5J4YA 2XZLA 3EA5A 3FGNA 4EKDA 4D4JA 3WBKA 2ZE6A 4S35A 1FTNA 3WNDA 3R7WB 2YOHA 4BECA 3C16C 2FFBA 1SXJD 4PAOA 4BZQA 1G64A 4GSYA 1RC8A 1IAQA 2WSMA 3TKLA 4OI2A 3IBYA 1T3LA 2WWWA 1U8YA 2IS1A 2ZTSA 1PLLA 3X2SA 2OV2A 4CVNA 4QKQA 2V4ZA 1GDDA 5HTKA 1W44A 2XNSA 2JDIA 2C2HA 5FI1B 3K70D 1TU3A 4CDGA 2B6HA 1DAFA 2IL1A 4WOPA 4KBGA 4URUR 4DWJA 4C4PA 5JMTA 2QPAA 2XAUA 4OHYA 2QM7A 3QG5A 4DLVA 3DKPA 1E9DA 1L4UA 2EW1A 3SJCA 4ERNA 3H86A 1PV4A 4HAYA 2AR7A 2DFTA 3CF0A 1ZC3A 4X8LA 4Z1MA 3Q5EA 1DARA 2CNWD 1JEEA 3KKPA 3AVOA 4ZDIA 3ZD6A 1OFUX 1IXSB 1W4CA 2QMHA 3R8CA 3UG6A 2NG1A 3B5JA 1QHIA 1SVIA 4EPWA 3SYNA 5KPJA 4A9AA 2BEKA 2I1QA 3U4QA 5DO9A 5FOUA 3GQBA 121PA 2KBEA 5C46F 3SJZA 2ORVA 4C0HA 1W0JD 3H84A 3K0FA 2IYQA 2GXUA 3WYFA 1S1CA 2OCBA 1OH8A 2FSGA 2B8TA 1NI3A 2YWEA 2NTYC 2Y8EA 4D0NA 2XNDD 4UNPA 1OHHD 1SQ5A 4MGZR 3E2IA 3IILA 5DHFA 2IS2A 5J5CA 3NHAA 2OCPA 1Q1ZA 5LPNA 1SGWA 5JHGB 3AB3A 1F5NA 3TRFA 3OF5A 2FZLA 2J5XA 1XX6A 5E3HA 5JCZA 1NLYA 1JBKA 2IS4A 4CEIA 3GLFA 2OBMA 4B44A 1CR0A 2YVUA 1TQDA 2I1VB 3U60B 3VU9B 4OL0A 1OIWA 2QENA 4GDFA 1KY2A 1T5IA 1K5DA 4WZBE 3THWB 3M4YA 1S3SA 4KSCA 3AF4A 1KI8A 5AWFC 3RABA 2OEPA 4GOXA 3I4LA 2P2LA 2R6GA 2WTUA 1COWD 2LKDA 1QZXA 1IXZA 1GZSA 3FVQA 5A4JA 3NBFA 2ECKA 3FFAA 3VR1A 5IHPA 2MSEB 1M8PA 2EFHB 5IK2A 1KI1A 3BC1A 4GMDA 3IHWA 2YWGA 2Q9AA 2WOOA 3MWLA 4W9MC 1RW4A 2J7PA 2ZI6A 3ZJYA 4Q9LA 3OHMA 4MGIR 4L9WA 4F4CA 3EZ2A 3TIFA 4IOLA 1JB1A 2P5SA 3NVAA 4G5QA 4BUJA 1CULC 3UANA 4P3YA 5JJLA 5M04A 2GDJA 4GRAA 1SULA 5J40A 5IDVA 2V9PA 2IWRA 3H0KA 4IRUB 1E9CA 2JASA 3N2EA 4CF7A 2G77B 1EFRD 4HDQB 1YZKA 1E4YA 2QE7D 3L82B 4ZKEA 1H8ED 2AK2A 4ZDKA 3KJIA 1MT0A 2C98A 2ZAOA 2GXAA 2HLDA 3SC3A 1TNDA 5JEEA 2RGNC 2CVFA 4M1YA 821PA 3A1TA 1TUIA 2X1VA 2CCKA 3B13B 4WBSA 1Z47A 1DELA 2QSZA 3LQRA 4TLAA 1ZVQA 2IEYA 2FFHA 4PR0A 2CEAA 3ZVRA 4EPVA 4ZDJA 3R9XA 3SR0A 2QBYA 1COWA 3CH4B 4TN1A 3TE6A 4QJ4A 3QXSA 3BB3A 1DPFA 2H8KA 2GAOA 2ZUCA 1D2MA 3LA6A 1NKSA 4OI4A 2E1RA 4G01B 2ZJYA 4EPXA 2GAAA 4RZ2A 4P32A 4EIWA 2JGNA 2NO9A 5EQTA 3U61B 2CBZA 3AQ4A 3IIJA 1IM2A 4IOMA 4TZ0A 1L2TA 1NY6A 4US2R 4NCNA 4E09A 1G21E 3BERA 1Y63A 1CLUA 3HYTA 3VR5A 4DT1B 2QORA 1NVVQ 3SU8A 2HXYA 1IHUA 1HT1E 2GVDC 3TAUA 2IUUA 2BKUA 2YWHA 1MABB 2L0XA 4I1VA 2ATVA 1G8FA 3O47A 3UATA 4DCSA 1E2JA 4DLWA 3SQWA 3AUYA 1WRBA 4XIGS 5JWHA 5TB5A 1OT3A 2YNMA 2GEVA 2QGZA 4PFSA 3D3QA 4R7ZA 4YXWD 4A15A 5C18A 4E5UA 4RZ3A 5TDHA 1TADA 3AKYA 4PSKA 2PEYA 3EW9A 2OBNA 3GJ4A 4B47A 2IYYA 3H1TA 4MKFA 2WPDD 1G7CA 3DHWC 4OJKA 1E2DA 1S1MA 1OH6A 1G7TA 4Q4HB 2PX0A 1ZCAA 3AM1A 3VHLB 3LXRA 2BEJA 4M9ZA 4DCNA 2OM2A 3UMSA 4NYJR 5E7IA 2IWHA 1RVDA 1U9IA 1H65A 3JZMA 4Q1CA 1NMYA 2FU5C 5LB4A 3W8RA 1NN0A 3BB4A 1DAKA 4DLRA 3CX6A 5BYKA 4DDUA 3VNVA 2VEDA 1GTVA 4KHZA 5JI2E 2YKGA 1BKDR 4TQAA 1MABA 2OXRA 4UNQA 1A2BA 3QBVA 2VF7A 1NG1A 4KBFA 3U3OA 1N5IA 3DZ8A 3WNCA 221PA 1F48A 3C14C 4BLSA 1AQYA 4TLCA 2C9YA 4S2EA 2AWOA 2C9CA 1XBTA 2BCJQ 2WJGA 5J4HA 4M8NE 3TSOA 4KAXA 3LBNA 4D2IA 1M2OB 5HZHA 3LH5A 4B3GA 2D74A 1LW7A 3A1SA 2JAQA 2CCJA 1IY1A 1G7RA 3I8XA 1CTQA 1FNMA 3IQXA 3MWJA 4Q9JA 1FFHA 2P6UA 3GFOA 3QXJA 4QBHA 1RE0A 2ZS9A 2OAP1 2HF8A 3TQFA 3E70C 1XPOA 4CW7A 2ZYVX 3B82A 1PUIA 1KO1A 1JECA 2A7QA 3HDTA 4NYMR 3DEFA 4Y0AA 1HTWA 4YLGA 2QEQA 3KB1A 3DOEA 4CEHB 4XWKA 2DWPA 3FKQA 3NC0C 4XOIA 5GVRA 1NLZA 1VMAA 4IEEA 1XPRA 1WCV1 1OIVA 5DYGA 3CWQA 3NKVA 4A6XA 4Z1MD 3CPHA 4E03A 4A0RA 2ODBA 4Q1DA 1GIAA 1KIMA 2ZJ5A 4O25A 1FX0B 5IT5A 2CK3A 2EQBA 4U5XA 4EFLA 2GCNA 4HUQA 2CLCX 3LD9A 4ZCLA 2QNRA 2Z5FA 1QHGA 1FL9A 1YJ5A 2YOFA 5TARA 3CZPA 1HYQA 4UQOA 4Q4AB 1X1SA 1ZU4A 3OE7A 4QGFA 4Q7LA 2H57A 2RGAA 1HT2E 3LLMA 1E9FA 1BH2A 1BO6A 2GTPA 2QY9A 4G5OA 5EE3A 1ESMA 1KK0A 1QG2A 1R7RA 1VCMA 4URYR 1XD8A 3NEJA 5L3SA 2VSXA 2XJ4A 1XJ0A 2PCJA 2VF8A 1G291 2FA9A 2VHTA 3N70A 2ZVQX 3NH9A 5EJEA 1EWQA 3I5YA 4Q47A 4QGGA 4NE2A 1P2VA 3JVVA 1LFDB 1XXHB 5H1YA 4NP6A 2J0VA 4TYQA 3LFUA 3EXAA 2GCOB 2W2TA 3T1VA 3EAQA 3M1IA 3I32A 4Q66C 1WA5A 3DM9B 2KJQA 2G1JA 1HQYE 1WB9A 3ICEA 4L8GA 1N6HA 1AZTA 4Z8XA 5GJWC 3CRW1 4RD3A 3W34A 3DM5A 2EWWA 2W83A 4QBGB 4DZZA 5JS7A 3SDZA 1AGRA 1Z0DA 1E1RD 4OK3A 2QAGC 4O2LA 1X1RA 4JMPA 4C9BA 4Q1AA 3K70B 1CJVC 1DAHA 2QPOA 4PC3A 2O0JA 1T3HA 2IYZA 5L3SB 2EYUA 4GZLA 1G19A 4IDOA 2ZM5A 2B7CA 3Q5DA 2ZUBA 4D0GA 2QP4A 3I3SR 3W6OA 1K5GA 2J0SA 2OAQ1 3GJ8A 5A5GA 1A2KC 1XXHA 3L0OA 1CRPA 1XEXA 3A36A 5AJWA 1NNEA 4C7OB 4RJLA 2BVNA 4JJKA 3OIUA 3QG1A 3QOFA 1GL7A 5FOVA 1LVGA 3RRMA 5K8UA 1NVWQ 2D7CA 5FBLB 2SHKA 5JI3E 1TF5A 1AS0A 3NC1C 4OHXA 2JDID 4LHWA 3ND9A 3TQCA 1DAMA 2A9KA 1TQ4A 3A1WA 3LLUA 4PSAA 4BLOA 4Z54A 3CH5A 2ZI5A 3HR7A 3K1JA 4IDHA 4PANA 3TMKA 5LBIA 3SQXA 1G3QA 1G6HA 1KI6B 3PUYA 4QBIA 4A8JB 1E3MA 4D4MA 3RHFA 4N3NA 3J81k 1HH4A 3WNBA 2AN9A 4IW3B 4AWXA 2ZRHA 4GP7A 3HWSA 3QPWA 3L0IB 2CK3D 3KKQA 5D3MB 2H5EA 1PUJA 2RHMA 2ZU0C 4GI7A 4AKIA 4MYTA 4DSUA 3OFNA 1Z22A 3CF2A 3I5XA 1D9ZA 5JWRA 1Z2CA 3AVTA 3GLGE 4Q9KA 4DEYA 3AUXA 1W7AA 5JEDA 3MG9A 4M9QA 4RFSB 4AKGA 4GL2A 5DGXA 4LHYA 2GJ8A 2WVJA 3HYRA 2W58A 1FQKA 1YR8A 3CNNA 3EZ7A 4LPKA 3UMRA 3OEEA 1SZPA 4FCWA 2ZE7A 1GL9B 2ZREA 1G8GA 3MWKA 3EPJA 2H1LA 4A0HA 4KYUA 5KSPA 1OHHA 2OE2A 4GP6A 1H8EA 1N5LA 1OXXK 1SHKA 4V0KA 3R9WA 1LF0A 4BFSA 3VNUA 2F7SA 3OAAA 1KMHB 1Y3AA 2HLDD 3GJXC 4KSBA 1MRSA 1G4UR 5EZ5A 3NHBA 1BMFD 4IOJA 1DEKA 1E2LA 5JZVA 1R0ZA 4KFUA 2FPLA 3PEWA 3WXMA 3UPUA 1E94E 4OQFA 1E1QA 4OI1A 1AZSC 4NONA 2AD5A 2QAGB 4JLJA 4CRWB 1W5TA 1XEWX 2G83A 2J7KA 1H8HA 2QM8A 1N25A 4BE7B 2ZRDA 2P3SA 2WPDA 4X8MA 2K5UA 4AYTA 2PZFA 3OZXA 4JBWA 1IQPA 4V0OA 3KFXA 5BW8A 2G0TA 1ZIOA 3S1AA 1VYTA 4QHYA 4UJ3A 5AUOB 2REOA 4YMUA 3ZVNA 1W36B 1YQTA 4QGHA 1G9XA 5JS8A 5F9FA 1US8A 5AR1A 4BZPA 2V7QA 1WMSA 1NRJB 3PG5A 2UKDA 2J7PD 3T5GA 3K09A 4JLDA 2HXSA 3CB4A 3EZFA 1Z6XA 2PEZA 1R8QA 1QG4A 3LAWA 1GRQA 4FW9A 2A3RA 1SVMA 3I1FA 4DB4A 1NN5A 4W5HA 3DZDA 5SZHB 3PEUA 5FBRB 2G0NA 1LB1B 2C03A 1JAIA 2W6JD 5AK0A 3QENA 2BBWA 1G3UA 4JT2A 3ZIAA 4Q18A 1V5WA 4RD2A 4EFMA 1G41A 3KX2A 4XVUA 2QE7A 1MO4A 3AKCA 5TXGA 1OYYA 4I81A 3FMPB 2F9MA 4DLYA 1YR9A 3OIVA 5CYOA 4L16A 1MOZA 4I4LA 1OB5A 2R2AA 4YONB 3VR4A 2QZ4A 1G5PA 1KO7A 4HAWA 2WWYA 1UEIA 2NGRA 3OFND 4KV9A 1J8YF 2IT1A 1KO5A 5KSOA 1TF7A 3B85A 1HE1C 1YZGA 3O8CA 1E1QD 2ZRAA 4KYIB 3U7GA 1NF3A 1OIXA 3RS3A 3QKRB 4U02A 1E9BA 4URVR 3O8RA 3X1YA 2G1KA 1KK3A 2IXGA 3K0AA 4MRRA 3KTAA 2CJWB 5E7MA 2IUSA 3A4LA 1G6OA 3GJ6A 3CR8A 2P5TB 4EDHA 2ZSFA 2IYTA 3U3KA 5FUWA 1VDZA 2NIPA 5DNYB 3KXKA 1VPLA 3HU2A 5E7JA 1D2EA 1E9AA 1Q1BA 2RGDA 3LDAA 2V6IA 1XFAA 5GJBA 3IGFA 2O8FA 4A1FA 1E99A 1ODFA 2XTNA 2A2ZA 4RKFA 3H2YA 3V4RA 2VHQA 1N2CE 2OXCA 3IPYA 4TMXA 5CJPA 5JFGA 3QE0A 1F2UA 3VR2A 3FMIA 2QMUA 1JXOA 2EFEB 3IIMA 1IJFA 3M0EA 2FPKA 1NJGA 2CL7X 4I1UA 3CNLA 4QBFA 4RSGA 5P21A 1ZYUA 2FE4A 4PZYA 3RSLA 4DCTA 1XTQA 2CJWA 1R5OA 2GZAA 2AFHE 3BFKA 4RD0A 3RWOA 3SBDA 2ZRFA 3G5UA 3IPXA 4YQFA 5B30A 3EWSA 1U0JA 1Q22A 2PH1A 4UNNA 2OCYC 1M7BA 3UWOA 3MAAC 4AK9A 3QIAA 2JLYA 1IN5A 4EPTA 5TV2A 4CEJB 3ZZTA 2V7QD 4NHOA 5H70A 2VIIA 1FW6A 3SYKA 2P65A 1E1RA 3CW2A 3RS5A 2REBA 4RD1A 3PV0A 2GZHA 2O8BB 4TYPA 2O8FB 1G5RA 1OFIA 4B48A 2ZSEA 2ZITA 5KTYA 4LGMA 4A4DA 3UG7A 4B3XA 2O8EA 4PHGA 4TMWA 4DLXA 2J0QA 5DE3A 1RYFA 1KO8A 4V0ME 1EFUA 4PHFA 2RGEA 4O0MA 1F60A 5FUXA 2IC5A 4PC2A 5EP2A 4IEIA 2X2FA 1XMIA 5FBVB 3UMFA 4TT3A 1K6MA 3EG5A 3MWYW 1Z29A 3WMEA 521PA 1CJUC 1IXRC 3SFZA 2ONJA 4LBZA 2ONKA 4FWIB 1ZM3A 3R9IA 4I1OA 4LRWA 2J45A 3X1WA 1OSNA 3WYGA 3CR7A 4R71A 5IRCD 1R8SA 4F4JA 2OO7A 4AY2A 2GA8A 4UXJA 3LY5A 3QNUA 1XD9A 4XH9B 2WSSD 2IUTA 1II0A 5DN6A 1Q57A 4D6PA 4P0TA 1AA9A 1HE8B 3MJRA 1KYIA 4BEBA 5JWOA 1P9RA 2A5GA 1H8HD 1VG9B 4JT4A 4NCJA 1GNQA 3LVQE 2FSIA 1N6NA 2ZRIA 5CYPA 3B78A 4IVRA 1HY3A 1W49A 4WZ6A 3BH6A 4QGAA 2VA8A 3QXHA 3VTKA 1P2TA 1Q3TA 1MO5A 3ZLJA 3FHTA 3BFVA 4YMTA 1HV8A 1YKSA 2F9LA 3PENA 1XZQA 5CM8B 5BN3A 1E9RA 3QXCA 1E9SA 4PTLA 2CLDX 3VKGA 3BJIC 3L43A 4NMMA 1JI0A 3U6KA 5LD2C 1E2PA 2FOLA 2FG5A 4LC1A 4AG6A 3AGPA 3FFBA 1TTTA 3GFTA 4NYIR 2XB4A 4TMVA 4URWR 3ADCA 2BBTA 4A8JC 4EPYA 3ZGXA 1NLFA 1JQLB 1T5LA 1E98A 1P9NA 2O5VA 2GXSA 1XD2B 3BD9A 2Q0HA 2ODWA 1RRCA 3THYB 2IYVA 4LJAA 4TLEA 4B2PA 1E0AA 1BMFA 4DSTA 2PL3A 1X8LA 3WP0A 2WJVA 3ETLA 2ORWA 1ZMXA 2UZ3A 5EXPA 4CYMA 2NZ8A 2BCGY 3B6EA 2F1JA 2ZR9A 1S96A 1W1WA 1Z63A 2RMKA 1OF1A 4HB2A 3T35A 4LJYA 3DMDA 3LW8A 5CIWA 1KK2A 2J46A 2QI9C 1UADA 3K0CC 2A5DA 2QGNA 2G9NA 4Z51A 3ND8A 1KSJA 3B1YA 4F7WA 4EAQA 1TX4B 3EC1A 3IIKA 3EPHA 4MH0R 2Z0MA 2DBYA 3U3RA 1XTIA 3B1VA 4FMBB 1ZU5A 3IHLA 2VPPA 5J47A 2F55A 5JSZA 4G3XA 4ZCIA 2FDCA 4IFEA 1J90A 4XTCS 3KQUA 4NBSA 3BH7A 1CXZA 2BDTA 3THYA 2CLSA 4PAMA 1W5SA 4BFYA 3K9HA 1NMXA 5C4MA 3PUWA 4HB4A 3ZDQA 1EX6A 1P61B 3AVQA 4B3FX 4MRNA 2BMJA 4UXIA 1XTSA 1Q20A 2YZ2A 3DL0A 4HAXA 2XGJA 1KOFA 3A4MA 4K8OA 1G18A 1DBSA 1FP6A 2C9OA 4CEHA 1OJLA 4FMCF 3GPLA 2HT1A 2GKSA 4ZI2A 3AVPA 4P4UA 4EQ6A 2AFIE 2ZRCA 4NCKA 2KB0A 4D80A 1JJ7A 1YU9A 2PMDA 2ZI4A 4DDTA 4FWTA 1OKKA 1OFTA 3ZYCA 2FSFA 2CDNA 1ZAKA 4B3BA 1I4DD 3ASZA 3CF6R 4V0LA 2WWGA 1NN3A 1E79A 1PZNA 1EXMA 5FBQB 3T61A 2GBLA 3KJHA 2LKCA 3W5JA 4RCYA 3K8YA 1KNQA 2QN6A 1EGAA 4BZXA 1DAEA 3CX7A 3IO5A 5DYIA 5CDFA 1XWIA 2ZANA 3QY0A 5F2EA 4JBYA 4MITA 4TWZA 4QJ3A 1W46A 1KDTA 3QKUA 1KJWA 3HU3A 5B2ZA 3GEHA 3LX5A 1RRPA 2KBFA 1YR6A 5EE0A 4H1UA 4HDCA 1EK0A 2VBCA 3ZIAD 1N0WA 4WIAA 1KJZA 3D8BA 2VQSA 2GJSA 1XPUA 2JJ1D 4NCHA 1KKMA 1NVUQ 3MCAA 3TH5A 3SHWA 3R20A 2BMFA 1DAGA 2H7VA 1D8TA 4TQ9A 2B21A 4LZZA 1E2QA 2IYSA 3SI7A 4FD2A 1E2KA 3RC3A 4B2LA 1P5ZB 4M1MA 2REXB 1DADA 1IN8A 1RIFA 2Z4SA 3GLGB 4I1SA 5FUVA 3BRWD 3QVVA 2HCJB 1ZD1A 2HT6A 4HZUA 4PC6A 4DT1A 2FFQA 4HLUC 2O52A 4RD6A 3CWZA 3TGPA 4IFBA 2Q6TA 4PPGA 2BBSA 3LXXA 3GLIB 4HSEA 3QVUA 2ZE5A 3VKWA 4AKEA 4G5RA 3ICQB 2O8DA 1Z3IX 1C9KA 4ZIRA 2FFAA 1BS1A 2HDNB 2ZJAA 5AJXA 2D62A 4CIDA 4D25A 2ANCA 3ZD7A 1RRFA 3Q3JB 4TL9A 3DVLA 1P9WA 5CB6A 1XCMA 1KZGB 4N0DA 1UDXA 4XVQA 5FR1A 3EPLA 4PXAA 1S2MA 1U98A 4A92A 1Z83A 2FSHA 3OE7D 4OK6A 4GOJA 4PQFA 2IYWA 2ZS8A 2ZRMA 1GAJA 1S9HA 5AJYA 2YJTD 4QHSA 2OFWA 1XTJA 4IJMA 3VHXA 3W3AA 3DMNA 2AKAB 3AEZA 5EXSA 4FCTA 4LBYA 1BOFA 1D2NA 2FN4A 3AV0B 2H16A 3F8TA 5K8IA 2XZPA 2GCPA 4LJ5A 4HZUB 3K9LA 4TL8A 4GOKA 1CP2A 5BQ5A 4KU4A 5AUNB 2HYDA 4RFVA 2JLXA 5JJIA 2O8DB 1UBCA 2IBMA 2YWFA 4B34A 4ZIRB 4PPFA 2RGBA 3KXLA 4JS0A 5D3MA 2QQEA 1GILA 1UKEA 4PO8A 3PCRB 3AVXA 2JLQA 3AP2A 1TL7C 3L8YA 3O8DA 4ITRC 3ASYA 1E96A 4G0NA 3WRXC 4JLPA 1E9EA 1OXVA 4NKRA 2W00A 1KZ7B 5HE8A 2YOGA 4C2TA 1Z0JA 3U44A 4RFSA 1CR4A 4P4TA 1DTSA 3IO3A 1S3GA 1TAGA 2IEZA 2WIAA 2JLRA 3KFVA 2ZI3A 5FTNA 4B6EA 4US0R 3U4QB 3FMOB 4YMSA 5HCNA 1U8ZA 1P73A 1U90A 3K0FB 4AIIA 621PA 3I61A 3T1TA 5G3YA 1Z28A 2Q3MA 4BLTA 4K81B 3T34A 3EC2A 4D0LB 2O8CB 3Q8XB 3CZQA 4LC0A 1XXHE 3EARA 3OIYA 4M2LA 4MYUA 4PQRA 5L3QB 4F4IA 2AK3A 3NDPA 4OHVA 1OXSC 2X2EA 4MUAA 1LF5A 2QTVB 5G3ZA 4A82A 4Q4AA 3QF7A 1ANKA 5GJVC 3B1WA 3VR6A 4WA7A 1G3RA 1Z07A 2DFLA 1NVXQ 5DN6D 2P6RA 2NPIA 4AG5A 3FPAA 2LWIA 5G40A 1LY1A 1FNNA 3GCGA 4HLCA 3AGQA 3RS2A 1HA3A 5L3RA 3THWA 3FOZA 3ADBA 4NH0A 2GHIA 4M21A 4OQLA 4ON9A 4P4SB 3QUSA 2DHRA 3P1JA 1VKJA 1QDEA 1ONBA 2J9RA 1AGPA 2JEOA 4D4KA 5FL7A 3QEJA 1EWRA 2VP4A 4H9GA 3KDSE 2GCOA 1FQJA 4BFZA 1WXQA 4LI0A 2DY1A 3WBJA 2O8CA 4DCUA 1E79D 2UVQA 2VHJA 4DC9A 3AH8A 1NSTA 4PPQA 5CITA 5E4FA 2IXFA 2EFCB 4M9SA 4JYBA 4KFSA 1U0LA 4TMZA 3VAAA 1IN7A 2FH5B 3FE2A 4X8HA 3PQCA 3PR1A 3BXZA 2PZGA 3VFDA 2V1UA 3CONA 4NZYA 4EJSC 2V6JA 1FZQA 1KI9A 3IDQA 1G4AE 2CL0X 5KYKA 3QKSB 4ZO4A 1I4LD 2AHOA 2D4HA 5FUYA 1PLKA 4JKYA 1SXJC 1SKQA 2WMOB 3ZS9A 1CRQA 2MMCA 1OXTA 2AD1A 3SNHA 1AS2A 3TUJC 4C7OA 4JLKA 2WKQA 4B2IA 1G8HA 4GT1A 4BFWA 1I2DA 1K8RA 3ADKA 4WAUA 1ZUIA 3K53A 3IQWA 1JALA 2QU8A 2VO1A 1CR1A 3QKRA 4OQNA 4B73A 3PVSA 4ZPXA 1KNXA 2E9SA 2OFOA 5K8LA 4GZMA 3WRYC 2GZDA 4MQBA 4HLUA 2C96A 3KKNA 2XTZA 3L8ZA 3T15A 4LX0A 2JJ2D 2MSCB 2FGKA 4LSGA 1Z6GA 1Q1EA 4JIMA 4RZUA 1E2NA 5FI0B 4LCBA 5JECA 1KI7A 2QBYB 2CHGA 1SKYB 4A8JA 3BE4A 3WMGA 2FEMA 4DLUA 1N3BA 1RJ9B 2KI5A 3FHCB 4LV5B 5FL7D 2RH5A 2VP2A 4ASUA 4UJ5A 5ANRB 4TTQA 2CXXA 2VP5A 4YDHB 1VIAA 2X8AA 4PQYA 1KI3A 4OHZA 2Q3HA 4M1TA 3F5FA 2QQ0A 2E87A 2HEIA 3QKSA 1CS4C 4A0FA 1ZD9A 5KSZA 1OLOA 4RY2A 3NTUA 3C8UA 1F2TA 1ZJ6A 3WYAA 4MKHA 4A6PA 1TPZA 4BGDA 5J4KA 2ZI7A 1ZM9A 1Q1QA 1KJYA 2F1HA 4DXAA 2CHVA 4ZDWA 3RRNA 2VL7A 3HPQA 2W6IA 2ZR7A 2DB3A 1NJFA 1FP7A 4MYHA 3PFIA 2ZEJA 2BJVA 1KAOA 5L3VA 3LV8A 4ZCMA 5HE9A 3Q85A 3ZS8A 1G16A 2A78A 1E6CA 1JEDA 2ZRKA 5F9HA 4NDZA 4IDPA 1W36D 4M22A 3U6BA 1M6NA 3KQKA 1I4TD 2TMKA 3EZ6A 3BOSA 4LBWA 4JVLA 3UXMA 4DIDA 4XWOA 4Z8YA 1A5TA 3PEYA 2OLJA 5TY0A 1T8TA 5KUTA 5JJKA 3CLVA 1ZRHA 2KSQA 3SYLA 1EESA 1KAGA 2BMDA 2IW3A 1M1YE 2GJKA 5EE5B 4DEXA 1ELOA 4JBXA 4L15A 2EYQA 1GUAA 5TMPA 3L0PA 1JJVA 2B8WA 3TUZC 4A0GA 1VYVA 1OPXA 5EUMA 2BIFA 1XCPA 1G20E 2J0UB 2Q9CA 4HI0E 1N6LA 3FB4A 5B58C 5KDLA 4Q4JB 4XSGA 3SEAA 1L7VC 2OUKA 1SVKA 2OILA 4IXNA 1Q0UA 3S1AB 1KHTA 1N5JA 2BM0A 2HYIC 1G8PA 5BN5A 1T0HB 1SHZA 1VG0B 1VIYA 3FMFA 1AK2A 2VLIA 3BH0A 4NYMQ 4AC9A 2JLVA 4U00A 4LUCA 2XEXA 3L2OB 2GBLC 1G8YA 5DI3B 4Q1FA 4V03A 4XVRA 1GP2A 2WM9B 4BLQA 2JLWA 4P31A 4Q5IA 1NP6A 3QSYA 3TR0A 4R2HA 4BFUA 5GVSA 2FWRA 4B71A 1JR3A 1X8KA 1Z2AA 1U99A 2C5LA 5EXTA 4B74A 4AKHA 1D9XA 2ZQ5A 2WKRA 2OT3B 2J0UA 1OKKD 4LJ8A 5ELXA 3W8NA 1ZCBA 4DLZA 4B6FA 4Q4JA 3LWNA 1EFTA 3EA0A 1YHNA 4OYHA 4XTRA 1B23P 1XMJA 2PX3A 2A5JA 3IBGA 4HUQB 3GLFB 2BWJA 3A4NA 2WICA 3PXGA 3D7MA 4Q7MB 4QNRA 3K0SA 1NG9A 4TYWA 3VU9A 1KGDA 5GADl 1G7SA 3GJ7A 3P27A 1VTKA 2NO7A 1KSGA 1GWNA 1TMKA 2A5YB 4B75A 1QHSA 3W3ZB 1W47A 2ZS7A 1ZNZA 5DI3A 3GLIE 5FPHA 2IK8A 1DVRA 2WMNB 1XTRA 1DO0A 4HYYA 2XX3A 4HATA 3OAAD 2PT5A 3TSWA 5BYJA 3LNCA 2VHUA 1ZINA 1ZIPA 1Z8FA 2ZAMA 4DHEA 3TVTA 1W0KA 1TU4A 1S0UA 3QXXA 5FTKA 4PO9A 1AS3A 2J87A 4R2IA 4V02A 4CT4B 2VHCA 4HLDA 4KITB 3MD0A 2IF2A 4GMXA 1SXJE 4MDEA 4MA4A 1YRBA 3CPJB 5JLJA 5CDFE 2CVHA 1XJQA 3U3MA 1GL6A 4MRPA 1EG7A 2D3WA 2HV8A 4PPNA 2R44A 2HUPA 2QMEA 4UXHA 4QJ5A 2IA5A 2VYFA 2GEDA 4C0LA 5KNDA 3NBZC 2JIZD 5EE1A 1AJEA 4BFXA 2JJ2A 3X1DA 4B3CA 4BFVA 1CU1A 2QROA 4FN5A 2AWNA 2J59A 5AJVB 4QXAA 1WBDA 1P72A 2GXQA 4ZI3A 3C7KA 4DDWA 5CJ2A 2H18A 1M7HA 2D06A 4QG7A 5DLQC 4C3ZA 3TR5A 2YHSA 2ZU6A 3UKDA 1W4BA 2QP9X 2YC4C 4IHQA 2RAPA 3T06B 1ZC4A 2YC2C 1A4RA 1R4AA 4ESVA 1XEXB 5F3WB 2PBRA 1F6BA 2QRNA 1C4OA 3WP1B 1W2GA 3KUCA 1W48A 4TYYA 2W6JA 3ZVLA 4D4LA 2RCNA 3SN6A 4RKEA 3BAFA 1U0HC 3EWAA 3U2QA 4F91B 5EZ6B 2DYKA 2F1IA 2C78A 4C0AC 1KSFX 1MO3A 1T4GA 3WMFA 2XJ9A 3AP1A 5DH9A 3L0SA 4EQ6B 2WWHA 2EWVA 1JR3D 1OE0A 4LJ4A 1IONA 1G5TA 1VHTA 1QVAA 1JXMA 1R5BA 4OQXA 4QFMA 1GKYA 3HU1A 5AUQA 5SZKB 5CLQA 3TUIC 1B0UA 4QM7A 1UPTA 1N0UA 1ZBDA 2RKOA 2C95A 1V43A 5G53C 1NIJA 1CKEA 2ZSAA 3CUEF 4DLTA 1FTSA 3B60A 1NVVR 1J2JA 1IBRA 4IXMA 5FTMA 4JLBA 1MH1A 3GJ5A 1ZM7A 2ODEA 4Q48A 3SFVA 3X1ZA 2XXAA 3W5IA 3I62A 2VP0A 3RS7A 3KXIA 1U8AA 2ZYUX 3IEUA 3UWKA 2H92A 3GEEA 2OHFA 2QRZA 4ACAA 3HR8A 3BFXA 3BK7A 2ZVPX 1DG3A 4MUBA 5KSYA 1TF2A 1OYWA 1JR3E 2GRJA 2GJ9A 1UF9A 4TZ6A 1ZNXA 1XB2A 2XZOA 5FOSA 5SZJA 4M1KA 4DLSA 1G3IA 5CM9C 1WF3A 4TMKA 4LYHA 1UDWA 1W0KD 3F3YA 5SZIA 2DWQA 2NO1A 2VP6A 5FL3A 1F3OA 3QJYA 4JLOA 4QNMA 4AYWA 3CRRA 1T3SA 1RYHA 1P75A 1VCIA 4OI0A 2CHQA 5BN4A 2ERXA 2IYXA 3MUFA 1R2QA 4Q1EA 3I73A 1RFLA 1CJKC 5EP1A 3M6AA 3KQHA 4PC1A 3SE0A 4HUTA 1TEXA 1CIPA 2IYUA 3V4FA 3K9GA 4NL4H 2EFDB 3I72A 1GNPA 2QT0A 4DBLC 1GRNA 2QAGA 3ZZ0A 3X1XA 1IN6A 1LS1A 2ZJOA 4W5JA 4UNRA 4MGKR 3U7HB 3AVUA 3AF0A 2XITA 2GWHA 1JQJC 1XD2A 2BC9A 3P32A 4Q21A 2RGGA 4LYJA 3QPVA 2Q3FA 4NTZA 4C0BA 5FPSA 3CO5A 4WZAE 4LV8B 1NMZA 3C41J 2C04A 4C0KA 3TVDA 4DJTA 4MYCA 5HKKA 2D7DA 1E69A 4A36A 5FOWA 3BWDD 2QA5A 1E0SA 1XZPA 2AXNA 2O0KA 1W4AA 3QBTA 3PJRA 3UK6A 5DI9A 1AQUA 3AP3A 4IVQA 4MGYR 4TYNA 1HUQA 3GEIA 3TSZA 5BWMA 1AN0A 4TT3D 4JYCA 2JCSA 1GM5A 3BB1A 4LHXA 2WAXA 1SVLA 2QT1A 1LNZA 1Z0IA 2JJ1A 4DUGA 1WP9A 1OFHA 3RAPR 3FHOA 4XJXA 4BASA 3NBXX 1P3JA 1FX0A 1YZLA 2CE2X 4TTPA 3GMTA 2AXPA 1XU4A 2V55B 1L8QA 1NL3A 1XNJA 1N6RA 3CBQA 5JSZB 1Z0AA 1GKUB 2DR3A 3THOA 1Z0FA 2OSBA 2CCGA 4NPHA 2ZYWX 3V00A 2BJWA 2IHBA 1ESNA 1FUUA 2ORIA 2X19A 4JSYA 1FMLA 1I2MA 1YZQA 3DKVA 4BEJA 4CEIB 2R9VA 2WSSA 3I92A 1P2UA 4B32A 2LCFA 3CX8A 3E5HA 2R62A 3C4JA 3KKOA 2D2EA 2ODNA 3CKLA 5DISB 1NY5A 3ZVMA 4TQUS 1KSHA 3EASA 4I99A 4DDVA 3FDIA 2GK6A 4ZV4A 3BBPA 4DKXA 2XSZA 3MRSA 4DSOA 1AKYA 5HPYB 3W90A 3MLEA 1SVSA 2V8OA 1R0YA 2JIZA 2IHYA 4AURA 1ZW6A 3LBHA 1WQ1R 4HEJA 4ACBA 1E2EA 4LOAA 2NZJA 1RPZA 2QMOA 2R8RA 1IY2A 4RCZA 1TEVA 4XSHA 4LPSA 4FXPA 5L3QA 4QL3A 3TW8B 3BGWA 3I8SA 3NEYA 5A0FA 5CLLA 2N46A 4URXR 4R98A 3B1ZA 3F0TA 3RYTC 4ILEA 3V9PA 2ZRPA 3NXSA 5FPKA 5KHOC 4JL6A 4LYAA 3P20A 1OW3B 2QL6A 4KXFB 5FTLA 4U7DA 3FWYA 4C0QC 4FMCB 1GVNB 3QF4A 4G5SA 3QEOA 2PJZA 3CM0A 1N6KA 1Q3HA 3IUYA 1WBBA 3WHKA 3H4MA 1R0WA 4LYFA 4TL7A 2J1LA 3FKSD 4JLMA 1T91A 1P62B 3LBIA 4WXPA 4LK2A 1ZD8A 2ATXA 1J8MF 1R6BX 4YMVA 1UJ2A 1P6XA 3R7WA 4F38A 3QQ5A 3REGA 3RSOA 4MKGA 3U7FB 1QHYA 2BKEA 3U3JA 4LBVA 3GLHE 3RRZA 5KO2A 1Q44A 2GETA 3GFPA 3VX3A 5FOTA 3KL4A 2GF9A 5FOXA 2IF0A 5KDDA 3GLGA 2HJGA 2O8BA 3K09C 4PC7A 3RDPA 2DFNA 4CGZA 2RGNA 2VH5R 5FTJA 4TMTA 1KDOA 1KI6A 3KKMA 5BXQC 2N42A 3RWMB 2ZIAA 4AYXA 4EJSB 1XMSA 3QF4B 4DUGD 2RHDA 1YVDA 2P6NA 3KQNA 5KNBA 3WY9A 5JCPA 1LV7A 4GNKA 1Z06A 4OBEA 4V0NA 421PA 4WXRA 1VCOA 2QTHA 5F98A 1KKLA 2F1RA 1LS6A 2QPTA 4QM6A 1AM4D 1FUKA 2EVWX 1HURA 4GBMA 3NDBB 4KODA 5KU1A 2ANBA 4WW0A 3U5ZB 2AX4A 1QVRA 1J99A 2H17A 1X86B 4KVAA 2OZEA 4IDNA 4LY6A 2PJRA 3K0CA 4AD8A 1VCNA 2WHXA 4JVSB 3ONWA 3T1QA 2DWOA 3ZZUA 3AVWA 2W2XA 4P33A 3SBEA 5FPTA 1QF9A 3FYHA 3B9PA 3ADDA 4OK5A 4D26A 4YC7A 1R0XA 2R6CA 2ASEA 2YINC 2FJUA 2PT7A 1XMVA 4F93B 1RJ9A 2B92A 4EJSA 4II7A 2EU8A 4ABYA 1JPJA 3Q7QA 4G5GA 1Z6TA 1OB2A 3AKEA 3JZAA 2WBLC 1AIPA 1XTKA 4JLAA 5CB8A 4BFTA 2PCLA 3TLXA 1P7CA 4B3DA 2QUZA 2IX3A 1DOAA 4FIDA 1E32A 2WJHA 4B43A 1T6NA 2P67A 3SHFA 5FH9A 4G1UC 1BIFA 1F2TB 2V3CC 1BYUA 1HEIA 2QP3A 2IYRA 1AKEA 3LQQA 1XP8A 1QBKC 4URZR 5B57C 2NOAA 2ZJZA 3O8BA 4N1AA 4DSNA 1R5NA 2CMKA 2XTMA 4TSFA 3RVBA 2ZJ2A 1HQCA 4JLVA 3W9YA 2OLKA 1YE8A 4KVGA 3PIRA 2KE5A 3GP8A 1GKIA 2Z43A 4BLRA 4K46A 1NBMD 1DAIA 1M34E 4KFTA 1CEEA 1GG2A 2R6AA 2ZRBA 1UKYA 2RGXA 4MRSA 1UFQA 1CJMA 3MSXA 4PAQA 4C0SA 4C0JA 3TBKA 3KZ1E 1OV4A 2IS6A 2WWFA 3OEHA 1GITA 2D2FA 2EFGA 3AVYA 3PEVA 3DPUA 1NIPA 1Z0KA 4A2WA 4YDSA 2WIBA 3D31A 3EPKA 5CK4A 3W6PA 3BS4A 1BYIA 4E07A 1ZM4A 4W5WA 3AF2A 5E95A 3P4YA 2VTKA 4BQSA 2GILA 3QKTA 1FOEB 4Q01A 4E22A 1OH7A 3GD7A 1P4SA 5EUQB 4GPTA 1GRRA 5FPYA 3G0HA 4W7SA 3LW7A 5JRJA 1II8B 1Z6AA 3MJHA 3TJZA 1UKZA 2WJYA 4P4SA 1W2HA 4MDFA 2BMEA 3PITA 2Z6VA 2C99A 5TVKA 1ZUNB 4O2RA 2ZUDA 3B9QA 4GFDA 1NN1A 1YR7A 4ESHA 4WVFA 3SOPA 1XEFA 2CNWA 5EP4A 3K0EA 2NMVA 1KO4A 1MV5A 4PZLA 1FPMA 1G1MA 2ERYA 4NU0A 3VQTA 1A7JA 2ZJBA 3DO6A 3EX7C 2R6DA 3AF3A 1RKBA 1IOZA 3GLFE 1VECA 1E2HA 1UBEA 4KJZA 3B7GA 3KTAB 4N0EA 4B35A 2WJJA 1NBMA 2JLZA
chains in the Genus database with same CATH superfamily
2LRHA 4ZQCB 1TAHA 4YEDA 1TKBA 1Z18A 2DSTA 3ZCRA 1N2OA 2MU1A 1WNFA 3R0JA 4OL9A 3E2PA 4C6RA 2PUHA 2GRAA 4Q00A 3R6LA 1JHPA 1X7YA 2WZQA 3BSFA 4CLHA 3OQIB 3GLVA 1DIRA 2EQAA 5IAJA 3UHPA 6Q21A 4ZCSA 4GW3A 3GLRA 4HLQB 4B2YA 1II8A 1F6WA 1QHFA 5K05A 5FBHA 3RVDA 3C43A 1SXJA 4BYGA 2VRCA 4F1JA 3EUAA 3EGXA 3R7SA 3KOUA 5KNCA 5JHHB 1TCBA 2GK4A 3I3OA 2YICA 1VYUA 4GEGA 2B69A 2QAJA 3EBOA 3V1NA 3WLQA 1MRNA 4GOOD 3PYLA 2X5NA 3U4MA 1XVVA 3ZW7A 4FK8A 2BTQA 2OORC 3CLRC 3HJBA 4G9EA 1TZKA 1AE1A 2QTNA 4ILKA 4RXTA 4BKUA 2JLBA 3SJBA 2VDMB 721PA 2VPWA 4OQ4A 5BPHA 2ZRNA 4MB2A 1Z2DA 4C2UA 3R3YA 5K3FA 2P7IA 4QHTA 3BJZA 2QD3A 4P2BA 5IABA 3UNXA 1BN7A 3CEJA 4X9XA 3WV5A 1G20B 1XEWY 3A37A 5KAPA 1U8CB 3RK4A 1BS2A 3WWZA 5AOAA 5KC9A 1GTSA 4CGYA 5AJUA 3D6FA 4NBLA 3SS8A 1ZFNA 1ZCZA 2X7XA 3E1SA 1J06A 1Z0UA 2AG6A 3PI7A 2AE2A 1A1VA 3WZLA 3NOQA 1DXHA 1DPGA 2W2QA 5EN4A 3WDLA 5K0NA 4EX6A 7REQB 1H0KA 1MQAA 2EARA 5DNDA 2G3YA 2M6KA 4D0RA 4CQMA 4Q4HA 2ZROA 3DJYA 1KR5A 1M7GA 3MGCA 4OJQA 4FFRA 4E4TA 4ZYZA 1K86A 2TRSB 4R1NA 5T4FA 1PT5A 2OFXA 5JRZA 1YL7A 3USES 4KMOA 2E1PA 2WAYA 3LTEA 1N2XA 3IODA 5GPBA 4EWLA 4OOEA 1X8JA 2WV9A 3G5AA 2E85A 1HE4A 4UU8A 2C1XA 4M1SA 5CDSA 3CCBA 2J67A 1OZFA 2Z4RA 3CRMA 4DIEA 3GLIA 1G8KA 3COYA 3O8QA 2MDTA 3Q0EA 2DPXA 3B9RA 4FI3C 3W5UA 2ZXEA 3EYWA 5FR2A 1J20A 3T94A 5A1TA 5K5EA 1H9BA 4UBIA 1EFHA 4FZ3A 3GGJA 1EUYA 2QTFA 3H5RA 4WWHA 3COSA 1EFRA 4ZXPA 2G71A 4BZWA 2YX1A 4XQ9A 4DADA 4FYKA 2PSFA 1QH8A 1YT5A 4PGAA 1MP0A 3W7VA 2JGIA 4LE0A 5BNZA 3ILSA 2Z83A 3Q72A 4XUDA 3A6PC 5H7XA 3TI9A 4ZTBA 2FMKA 4MVYA 4M8IA 3QFCA 4O8CA 2P0EA 1M74A 3NWEA 2HIAA 2R60A 3ZNOA 4BJ5A 3FRHA 1U7WA 3L06A 2QHXA 4UARA 4V38A 5I48A 1ZR4A 4BRUA 5HRAA 1V35A 2ZRJA 1ILEA 3Q9LA 2YFYA 3SE7A 4KN5A 1PQUA 3NV9A 5KNBD 2Q5FA 1NBWB 1TGYA 1CQJB 4NYIQ 1L4EA 2C97A 1C1XB 4X95A 3TRHA 2OD9A 1USUA 3LRPA 3Q0TA 3OIWA 1N8NA 2FN7A 3Q11A 1F8UA 1FQOA 5BMVF 5BV8A 1M2VB 4QDXA 3RLFA 2X77A 1NBEA 4YCBA 3EXEB 1C7EA 1W0JA 5JDCC 3FCUB 1YZNA 2XVZA 5D3QA 3SXPA 4LYEA 4CM5A 1N8TA 4JT9A 3I1JA 1WJGA 1KZ6A 2VSFA 1H4TA 2G88A 2ZSDA 3BM5A 1FMFA 1S4QA 1WE2A 2DECA 1KMHA 1A82A 4EGSA 2PUVA 1BEEA 3NASA 1G2IA 2L42A 4RM2A 4TLDA 4YAFA 1YFJA 1H05A 1X1DA 1X3SA 1Z35A 1KK1A 3R7NA 3DEAA 3QUCA 2EHDA 3G3EA 4HN4B 1VSTA 5B64A 1T0IA 2RHBA 3S2UA 4ZCRA 5EIXA 1BXZA 1UBKS 3HSKA 1H94A 3GLTA 2OL4A 1E1CA 4COOA 1M3SA 3OA0A 3BGIA 4C4TA 4AVYA 1DG9A 5DNVA 3TBFA 2JJ8A 2X5XA 4YFYA 1AOXA 1N6PA 4Q6BA 5ER6A 3V8QA 3WFIA 1N6OA 3FOEC 4Q9IA 1GPNA 1ETHA 2XMBA 5C4GB 5AVRA 1N1GA 5AVZA 2GS9A 1U9JA 3ZDBA 1NPYA 1T13A 4HS4A 3HZOA 1WQ3A 2Q41A 3BTVA 3FRJA 1QGOA 1A9SA 1CR2A 1QB7A 2ZTMA 4HPXB 1QGED 2FP3A 4FCVA 4JA2A 4OHFA 4QBKA 3RO7A 3OC6A 1UP4A 2XAAA 3N9IA 4IOKA 1UMDB 2QYSA 3T5DA 1N7IA 1WABA 2W48A 4YECA 4D44A 1L7BA 4W9NA 3HCPA 2OZLA 5HCIA 4MQ4A 4X8OA 2AV6A 2FRVA 2QG9A 5BURA 2NPOA 1BWSA 1XCGB 1SU4A 3A9TA 3RAFC 1K3TA 3QU7A 1FP4B 3KUDA 3PB3A 2N1BA 3VMFA 3HDHA 4MTLA 2VZ0A 1HMYA 2GF0A 4HAZA 3BL6A 2VNIA 4QJIA 3SKVA 1VHJA 4DMCA 3Q7RA 4ARZB 2BDUA 5D8DA 2DCUA 4UBOA 3KYJB 5EINA 1PVVA 4JL8A 5DBIA 2FR8A 5C1BA 2BTEA 3OEHD 2LTAA 2Y1EA 3CIOA 2FRDC 4RVCA 2OKCA 4CKXA 2PMCA 4H1VA 5K09A 1VP9A 3GFSA 3SYRA 4JXZA 3DAFA 4F2GA 2WRZA 1W94A 1WZEA 2DWUA 3IQZA 2W0MA 2MINA 2J9YB 1QV6A 3M49A 4CKCA 1LZLA 4ECEA 4DR2B 1MB0A 3SJAA 1UMDA 2J3JA 4RK4A 3SVZA 1UMCB 5LLTA 2HTEA 1JUDA 4ZALA 1XLWA 1YJCA 2ONCA 4WESB 4LWZA 2WUEA 2R4QA 1E2IA 4EF6A 4I9HA 1L4FA 1U2PA 4ZVMA 1L5KA 1N5KA 4BJ6A 4GI3A 2A67A 1MGOA 4ZJUA 1A77A 4YYEA 3B8HA 2UZIR 3FETA 4JXJA 5SY4A 4F60A 4J16A 4RTOA 1IQRA 4TGLA 1RU3A 3BCUA 1R3DA 2W2KB 2Q21A 4EQZA 2GEUA 5EWMA 3ER9A 1HFKA 1D6NA 1RPTA 1D4ZA 1C8LA 3LDUA 1RJDA 1IVYA 3KVYA 3A25A 4O0LA 3KJEA 4ARZA 1O4VA 1SUEA 1TC2A 1WXXA 4FGSA 2OCKA 4CL0A 4WDRA 3NIBA 2F3SA 1YGPA 3U17A 3RU3A 1QANA 1RFGE 2WWIA 4FYVA 4XYEA 3ZCQA 5I7RA 1GPAA 2OXFA 4Q16A 2FMXA 2PKEA 1GZVA 1PWHA 2IPAB 3NH6A 2QN8A 4Y2PA 5EP3A 3GO4A 4DNXA 2PFSA 1T4MA 4X92A 1GA6A 4Z99A 2BV3A 4NENB 5LA6F 4YMHA 1O77A 1B2RA 3ROEA 4UEKA 1JAXA 4RQUA 3E9NA 4JENA 5E8JA 1SVWA 3HG7A 3QMVA 3WHLA 4YMGA 1ZOIA 4KLCA 1O96A 4FS8A 1C1YA 1PGPA 1Z5OA 4PYJA 2R84A 4BNMA 2CL6X 1TRKA 4C4XA 5JO0A 4N6NA 1FDTA 2JZNA 4JI0B 2QXTA 2I22A 1CBUA 1XDWA 1X6VA 1WPGA 1SM4A 2A5FA 5L8VA 1V3VA 1PVOA 5A3RA 3TDMA 1U94A 5ARCA 2GJAA 3QNWA 1Q21A 1AXGA 2AFHB 4TXHA 5DCUA 3W8FA 5JR3A 1UQUA 4MKXA 5B2FA 1YTUA 5A3QA 1WXHA 2A58A 1OLUA 1N6IA 2TMYA 5J4LA 2NV2B 3V1MA 1T8UA 1UM9A 1ZGGA 2FWMX 4BNJA 1JBEA 2QG6A 2HI0A 4FDAA 3UF0A 3IAHA 1NQXA 2WJIA 4Y2XA 3TZBA 5C8YF 3BRCA 2P90A 5EKXA 4HDOB 1LI7A 4WZZA 4HEA1 3ROFA 4LISA 1P3DA 4IINA 2ZATA 3O4HA 3FBGA 5CTAA 4I6EA 3C70A 2BBOA 4MWTA 5CMLA 5FFMA 5EJFA 4S2UA 1RHRA 1O6ZA 2JH9A 2Z5VA 5EZSA 3CLSC 1T34A 4N39A 3LVRE 3L6RA 1E2FA 1ZUHA 4MUXA 5GIPE 2B4AA 1F9AA 3MM4A 1MJGM 3HBJA 5KOJA 5GM1A 2PS3A 1HMPA 4M60A 4YRLA 3KYCA 5JU6A 3TG2A 2YV5A 3AHJA 3EA5A 3FGNA 2GN9A 3ANLA 5TT1A 2DSNA 4S35A 1P44A 4JP2A 3WNDA 3R7WB 3CV3A 2DZDA 3RVMA 4FC6A 1SXJD 4BZQA 3W1EA 3DBRA 1RS0A 1R9NA 1G64A 4GSYA 6GPBA 2R11A 1YQEA 4QFBA 2BMWA 1HOTA 2WSMA 3JATB 1KEKA 1YB7A 4AZTA 1Y7TA 1X14A 4RTMA 2G70A 4XDZA 3EBLA 2WWWA 3NOOA 2NVUB 3CW9A 3V7UA 4ZHQF 4HUJA 5CUQA 1UPUA 4BUZA 1VOTA 4GNRA 3PL1A 4W1RA 4HDMA 1SC1A 4Z4HA 4BBAA 2COEA 3I39X 1X1TA 1NJ8A 2G25A 1LRLA 2JDIA 2C2HA 2XNSA 4Y2YA 1TU3A 1I9CA 4GPZA 6ADHA 3HBFA 1DAFA 4PGGA 1TVMA 3QITA 4ZVPA 1X19A 4KBGA 2VZLA 1ZW1A 2XWQA 4OG2A 3UGKA 5GMOA 1EXNA 4EUFA 3KJXA 5KWIA 2SICE 1D2GA 2J6HA 1CUFA 3IVGA 1L4UA 5HFAA 3VR3D 3TWOA 2GDZA 1P18A 2OZVA 5D7NA 3UWSA 4N41A 2DFTA 4ZWNA 4Z3KA 2XUJA 2Q6LA 3MB5A 1ZC3A 4DV2B 5BT8A 4Z1MA 1EGQA 4ODIA 4PYIA 4F86A 1X2BA 2FSPA 3GJQA 4IXDA 1PFUA 2GK3A 3DC2A 1KJQA 3Q98A 2E21A 2EJUA 3CGWA 3WL8A 1OFUX 1R8YA 2YY7A 1RDFA 4BLUA 4D0SA 3ZD6A 3SLKA 2NG1A 1Z4KA 2F17A 1E7YA 2WU1A 2X42A 1PWXA 3B5JA 3CUWA 3LCVB 4HHEA 3A3YA 5F7ZA 5DO9A 2OHGA 3R7LA 5B3KA 3DOHA 2R6R1 2WVAA 3MQ4A 3H42B 1A69A 1R74A 2PUWA 4O2AA 5IASA 3SHOA 1VZ2A 1U8EA 2HQSA 3KBOA 3IR6A 5JAUA 1GQOA 5KTRA 1S1CA 1KZ9A 1J23A 4JZYA 2D4AA 1NXVA 5LP6A 3DUFA 3EMVA 3QW2A 1NI3A 3NDIA 2HPAA 4UPVA 3GBPA 4MGZR 6YASA 3MBIA 2O2DA 5A5DA 5J5CA 3NHAA 4BMSA 1ORDA 3PDIA 4BAGA 4C4SA 1F5NA 3GGCA 1A4UA 1Y1RA 1Y5MA 2FZLA 5IJXA 3ROZA 1VJCA 2X4DA 4B8YA 4WBNA 3SYMA 5E3HA 3MHTA 1T6BY 2J3MA 4J7AA 5LNK6 3VC7A 2OBMA 3O21A 4JROA 4WSOA 4WXYB 1WKBA 5FAXA 4YWHA 3K8QA 5K3CA 3WLFA 3JAWA 5IUKC 4YRNA 3ZW8A 4A26A 2Z2XA 3VU9B 3ZUPA 5AOBA 1OIWA 2QENA 2UYQA 4Y1FA 1MORA 3QE4A 3EDQA 2GO1A 4WZBE 4J1SA 3M4YA 4B46A 5FYDA 4F56A 1S3SA 3C3YA 4HNQA 3TR6A 3IJEB 5DHSA 5AWFC 4DZRA 1KR2A 2VXCA 3PNVA 4G84A 5AI6A 1FK8A 1Q2UA 1YJ8A 1WEHA 2FSSA 3RKRA 1QZXA 1GZSA 4U2BA 1WW8A 1BDBA 2QTZA 3CNHA 5DWVA 3FVQA 2G5GX 2LE0A 3ESCA 1VM6A 3JQ8A 3SXJA 3CVUA 3OJOA 3GGSA 3N28A 4G4IA 5JS6A 2VJCA 5FADA 5IK2A 1GA4A 4YV1A 3DTTA 3IHWA 3PDIB 4O2AF 3UAXA 3F74A 3MWLA 5E2BA 3I2HA 2P9YA 4MWOA 3D6UA 2J7PA 4HAOA 4M87A 1JH9A 2ZI6A 3FPHA 5H82A 5FWAA 2VDUE 3C8ZA 4QQKA 4Q9LA 3X1JA 4EVIA 5JANA 1G1AA 2AFIA 3EBPA 2IEDA 1AHPA 1JB1A 4DA7A 4YH1A 3CEMA 3ABRB 1I0IA 2VHYA 4MS4A 4G5QA 1V7QA 5DM2A 3QVGB 2WYWA 1CULC 1NF2A 3ANXA 4R41A 4P3YA 1KAEA 1YNSA 3P9IA 5NLLA 5IUNC 5M04A 1V16A 4C7MA 5IDVA 2V9PA 1T5HX 3FUXA 3H0KA 2UUBB 1QUFA 2JASA 4K6GA 4ZOBA 3MOSA 3MAGA 3ODPA 2QE7D 3M6XA 3L82B 4FUTA 4G2NA 1TLFA 1YQUA 2PN1A 3MBOA 4N65A 4ZKEA 2ZWPA 5AD1A 1SCAA 2I0FA 4BP9A 3FVWA 3AEQB 3VMMA 1EXDA 3ANYB 3AG5A 4TXLA 3DWIA 5AHWA 2D59A 5JE8A 4UBLA 3UMCA 3BD7A 3ORSA 1IUNA 1XZJA 3E58A 1KFEB 4FGWA 2FHPA 2RGNC 4M1YA 821PA 4FM9A 4JBGA 1VLQA 1W59A 3A1TA 4KWCA 2QVLA 4RKWA 4DGSA 4FHZA 1Z47A 1OTYA 3NDJA 4HWSA 4HXYA 4BV2A 2CY0A 3NP7A 2AFIB 3DLTA 4ZDJA 3SR0A 1PJ4A 2DLDA 2NU7B 2UUPA 3CH4B 4IZ6A 4RQTA 1RXYA 1MGPA 2ZDHA 4QJ4A 2QBYA 3BB3A 4UVGA 4WCFB 1HDXA 1S2GA 4K6FA 3LA6A 5BRNA 2WY2D 1S2OA 3AYZB 5GIOE 1QPGA 4QOIA 4UOEA 4EPXA 2BE9A 1EJ2A 1CV2A 2GAAA 3HA2A 5CEJA 4P32A 5BPFA 1ORIA 1FFXA 2C3UA 3DKKA 3ST7A 1ZK3A 4ZOAA 2ZYDA 1GZ5A 1QIDA 4P36A 2XA2A 4RZSA 1Q7EA 5ESWA 5AICA 1NY6A 3EGEA 2Q6KA 2Q5IA 3WL5A 5BXYA 3ZHYA 1QKKA 1PNRA 1JB9A 3BXGA 5DMXA 3VR5A 3ZD8A 1PJCA 3RFVA 2NTNA 1BS9A 1T0PA 2GVDC 4OGFA 2IYAA 1QMGA 1IUPA 2J4DA 3LDGA 5DNEA 2IUUA 3RYIA 4R7GA 2BKUA 1TJ5A 1SWWA 2BFFB 2HRQA 2L0XA 2NQTA 1JLHA 3AETA 3D4OA 1E2JA 3O47A 1T4CB 3WZ2A 3SQWA 1ECPA 1R0CA 5JWHA 3DW1X 3CEHA 2YN2A 3U80A 1OV6A 5JJBA 2YQ4A 1SQFA 4R7ZA 4AMUA 1Z62A 4LZJA 4YXWD 5LJLA 4Y2VA 4YMLA 4A15A 5TDHA 2PXAA 2W93A 3H8JA 3P7MA 4L75A 1CC1S 4TWBA 4U9UA 1M1YA 4W4TA 5CYFA 3BUSA 4YCDA 2IYYA 1G7CA 2UVPA 3D0RA 1Q91A 3R0IA 1XIVA 1OH6A 2PX0A 3VHLB 3HUDA 1X77A 1MFZA 2WILA 3IOCA 1ADGA 5JNUA 1RVDA 1VBNA 3ZBTA 4K9DA 2XUIA 1A9ZA 3LXUX 4AN4A 3IP9A 2NAPA 3BB4A 2PZ8A 1NW8A 1NVAA 3CX6A 1GZUA 4G85A 4H7DA 4RE5A 4DDUA 3ZLTA 2G7MC 1BKDR 1ZOSA 4TQAA 4UW9A 1KGSA 2DHQA 4NJMB 4B3SB 4R68A 1QOPB 1A98A 2VF7A 1NG1A 4KBFA 3W9BA 3LPDA 3DXFA 3F7OA 4HFRA 3WLIA 1PD1A 3FI0A 3HXPA 3VU0A 4AJIA 1CZKA 1PQ4A 3JQ9A 2C9CA 1VE1A 1U9YA 2JIMA 4M8NE 1CVLA 1L7MA 1M2OB 3FM9A 4O02B 3GYBA 3RARA 3O03A 4D2IA 1Y4UA 3A7DA 4MVJM 2CCJA 2ZB3A 3FR7A 4MVJI 5FBZA 1FNMA 3MWJA 1Y7HA 4L73A 3GFOA 1CUYA 4J07A 4B4UA 1GDHA 1RYZA 1Y9JA 2NAFA 2QRVB 5IW8A 2G6TA 2H08A 4JYAB 1X7XB 3ZWWA 3B82A 1H9CA 1KO1A 4HY3A 2BKXA 4CF4A 3O92A 4EHDA 3LZCA 4IJ6A 5KX5A 1CR6A 2QEQA 1S2IA 3KB1A 5IFLA 3FDXA 3VPDA 3HA5A 3HCRA 4XOIA 1GPBA 4R16A 3RTBA 4HN2A 4U4AA 1ZICA 2Z8XA 3DHEA 4A6XA 4Z1MD 2IPLA 3CLTD 4OB6A 2XWPA 5IT5A 4G09A 4TV8B 4H7HA 3PR2B 3ICCA 5DM1A 2GCNA 1V1JA 4HUQA 3RRFA 1BGVA 3ZTWA 2WIDA 1LC0A 2OOSA 3B5EA 1QHGA 3EGDA 1YJ5A 1NAIA 3GNSA 5TARA 5CPFA 4UQOA 3EZNA 3E9ZA 1R6DA 1F9EA 3FYUC 2A0UA 3IIEA 4QGFA 2H57A 4MYSA 3S40A 1H4SA 4YPFA 1NI4A 3A11A 2EQ5A 2UZ4A 4X1OA 5F1OA 2B61A 3IP1A 1I3OA 2DH5A 2QY9A 4EW1A 3DA8A 1ESMA 2B5VA 1QG2A 1R7RA 2Q1WA 3EDCA 4B87A 1DJMA 4URYR 5T4EA 3NEJA 1SOVA 1UCFA 4R9NA 1BVRA 1BHO1 2H07A 1VZ3A 2PCJA 3N7UA 1G291 4UE3S 3I5YA 4Q47A 1YOVA 4TRMA 4DPKA 1ZO8A 3AIOA 1P2VA 2P1DA 4MIKA 3EGOA 1IHYA 2FSUA 1Q6ZA 4BYMA 1FFSA 2WAOA 3CXUA 1XJ5A 1CIVA 3IIIA 4BJ1A 3TLGA 2P2GA 3WIDA 4EELA 3LUKA 3UXYA 3I32A 2VQFB 2DXIA 1V1MA 1HFJA 3NC4A 4NE9A 4Q66C 4X7PA 2GYVA 1XQWA 2KJQA 4GPAA 1HQYE 1WB9A 2O5CA 3G2QA 4Z8XA 4NMXB 3CRW1 1J9GA 1GT91 2FB9A 4RD3A 3LSTA 2PXCA 3GUUA 5DTIA 4WLOA 2W83A 5JS7A 1EZ1A 1QRRA 3GJSA 4AJ9A 1UQRA 2X41A 1AGRA 1GUYA 4KQWA 2O2CA 1BVUA 4MV3A 4TTSA 3T9DA 4ZHQA 2TECE 4UBNA 2FW8A 3VM6A 3FMGA 4Q1AA 1ZKDA 3RAJA 1Q6YA 2O0JA 1T3HA 2XCLA 2EYUA 4GZLA 1G19A 3HB0A 4IDOA 1GADO 2ZM5A 1NW3A 2B7CA 3PQ5A 2PUAA 4GM0A 3CH7A 3JQ7B 4D0GA 2FMTA 3W6OA 1DEOA 3GJ8A 2BZSA 5A5GA 1CRPA 1XXHA 5L7WA 3WLLA 1BRTA 2QD1A 3MJSA 1Y7PA 4UDNA 1IZ7A 3DWGA 3A0RB 1LK5A 1A4XA 4HQOA 4JJKA 1OWNA 5J23A 1N2EA 1V1MB 1JHUA 3C8HA 1BXRB 1KXJA 3ENQA 3SG0A 5K8UA 3NHMA 4CN8A 3KEMA 1GXSA 1I1QB 1XCOA 3NHFA 1Y8RB 3NHLA 3NC1C 1JG3A 2ADOA 2FPGB 4G1FA 2XHZA 3ND9A 1N9ZA 1TKRA 4XYGA 2A9RA 4Z54A 3CH5A 3A4YA 4HVTA 4XB6B 3TKYA 2BR4A 1QRDA 1QH1B 3D7LA 5ALSA 3PUYA 4X6LA 1ISGA 1V3QE 3SMVA 1QLHA 3WFZA 1S2DA 2OD7A 5HF6A 3T9CA 4N3NA 2UYGA 5DLDA 4ENPA 5K01A 3WGOA 3WNBA 1FLDA 1C81A 4N7JA 4QO8A 1Q15A 5HS4A 3FLEA 3PICA 2BZ1A 3HS3A 1BD3A 1VKHA 4WK6A 2HCTA 4QOEA 1KEWA 1X80A 4KXXA 3NHYA 4HQ0A 3RWOA 1E89A 1FXWA 3LHDA 2FWAA 4GI7A 5D01A 1V5FA 3AILA 2P9QA 2JLAA 3OFNA 4MA0A 1OWMA 4MYTA 3CF2A 3RG8A 3PXAA 2PVSA 4LVUA 4MB6A 5H16A 4AIRA 3E9EA 1BXGB 3FPSA 4IKPA 2H1RA 4Q9KA 4IH1A 1W581 3T3EA 5JEDA 1W7AA 3ZDRA 3TYXA 2CDAA 4RFSB 3J80A 1EVZA 2XD9A 3N07A 1FDSA 2GJ8A 3ZHUA 4YGYA 1T5TA 1FQKA 1XTBA 2JCXA 3R24A 3R6WA 4DFDA 5A4IS 4GUDA 4UU0A 4CG2A 3FJYA 3TQRA 5ALGA 3ROKA 3GZTB 3TEJA 4EI2A 2XCTB 1QU3A 2H1LA 1L4HA 1D0SA 1Z7EA 2X2OA 3S2YA 4A0HA 1L8LA 3GGGA 4GP6A 1H8EA 2CZQA 1IOLA 2FSVA 4HJXA 4V0KA 4WTOA 2MOKA 4XJTA 3RBAA 1LF0A 2FJPA 4HGRA 5JMOA 3TZKA 5JYCA 1NNLA 1VKZA 2EGUA 3NALA 1GN9A 4KRXA 1ECLA 1Y6QA 3VHQA 4P82A 1VBMA 3IVMA 3R7DA 3UB3A 1UXOA 4JX9A 5JADA 5AW1A 3BX1A 4UHCA 4JEIA 4L8LA 2A9FA 3DVQX 1L1FA 3QEBZ 1R0ZA 1W5FA 1IDOA 4KNYA 1HLDA 3OTHA 2Q6IA 4KFUA 4IL5A 4DOMA 2R00C 5MGNA 3UPUA 3SJUA 4W99A 3GJYA 4OI1A 5ADUS 1G9TA 4NONA 1EGVB 1Y8AA 4JLJA 5AW9A 4CRWB 3WLTA 2G83A 4BWGA 1F17A 2J7KA 2QVZX 4WMLA 1ISFA 1T1SA 4X8MA 2JH3A 2IZ5A 3OZXA 2G9QA 3KCNA 2MTBA 3R5TA 5LN1A 4IMJB 3S1AA 1CEQA 3OEWA 4TVSA 3QLTA 3F5DA 5AUOB 2RHLA 3ZVNA 1W36B 1YQTA 3AESB 1EBFA 2JGEA 2C58A 2GKGA 5F9FA 3NOVA 4BZPA 1EG2A 1ZJZA 2J3KA 1WMSA 1NRJB 2TYSB 3KQMA 5GM2A 3RTGA 1M76A 2FKNA 2VNHA 1UPFA 3DQZA 3NYRA 3K09A 1EB8A 4JLDA 2HXSA 4ZVTA 1TGVA 3FSJX 1W4ZA 1R8QA 2QLTA 1FP4A 1V7CA 3N2NA 4HF7A 4FW9A 5AMXA 4C7JA 4CNQA 1JR2A 1XROA 1U65A 1MX5A 2Q3EA 4HWTA 5ENDA 2G76A 4TXNA 1W19A 5SZHB 3LWDA 2C03A 1JAIA 2ID9A 2W6JD 3LF2A 4XSVA 2PX6A 3ICVA 4Y6LA 1ZJJA 4CMBA 4NOMA 3RROA 1V5WA 3BK1A 2AZDA 1BA2A 3GDHA 3P9XA 3RG2A 3KX2A 4XVUA 2ZVJA 2UZAA 5HK9A 3O38A 1MTZA 1ORTA 2H4HA 2RGUA 2Y1WA 4I4TF 1RQLA 2IY7A 1HYGA 4RJ2A 4RMGA 3RSGA 1U5AA 3FMPB 2QRPA 3NR2A 4UUQA 3G9XA 1EX1A 3IP6A 3JQPA 4L16A 4I4LA 3ONVA 2QZ4A 2EP7A 1QVZA 3M89A 3Q2OA 2FFRA 2NGRA 3D8HA 1KDZA 3TD9A 4KV9A 5A5VA 3AJEA 2A7XA 3VTFA 1FS5A 2NV0A 1HE1C 4E88A 3O8CA 1E1QD 4HDSA 3TNYA 4F4HA 3R76A 4G37A 2WM3A 2JFHA 3OHPA 1QIJA 2ES4A 1E9BA 2PS9A 3CVJA 1PUXA 5JNSA 3T3OA 2IXGA 4UPDA 2O2HA 5JCJD 2H63A 3B6ZA 2BFCA 2YFHA 3HJUA 3OTIA 4MRRA 3WGHA 1Y81A 2JHFA 1G6OA 3BJMA 2P5TB 4EDHA 4N5IX 4C21A 2IXAA 2C5BA 1NYTA 2YYAA 3ILXA 2IYTA 3PGLA 3PIDA 3MWFA 5FUWA 3ELUA 5LOVA 1UWKA 1F4PA 3HU2A 5E7JA 1E7WA 5A3SA 1D2EA 1Q1BA 1D1QA 1OI4A 2DE0X 1RWXA 4NZMA 1MTOA 2O8FA 4RDHA 4A1FA 1XU7A 2QUHA 1FDWA 2XF8A 3OLQA 4NK5A 1NUPA 2IQIA 5BR7A 3TTXA 3O74A 3VVLA 1LPNA 1X1AA 2PRYA 5CJPA 1HOXA 4N9WA 3DLBA 3QE0A 1F2UA 3VR2A 1FE8A 3EF0A 3FRIA 5ADHA 2FETA 3OE4A 3U13A 2FQ1A 1SBZA 1W5AA 1WQ4A 3D2BA 1CG6A 3FUTA 2CL7X 3GRVA 3TECE 4RLQA 4ES6A 4QBFA 5L51A 1NXQA 2C0PA 4RSGA 3RSLA 1ZYUA 4Y9TA 1FF9A 3VJLA 1XTQA 3GRYA 3C7DB 3LPAA 4YJGA 5LBUA 3DZKA 1KE2A 4FOSA 1DEAA 1T25A 2HTFA 3IPXA 3NIGB 4YQFA 1ZR2A 1JH8A 1Q22A 2PH1A 2PKRA 3JQDA 3UWOA 2Z8YA 1TOAA 4HO1X 1CX9B 3QIAA 2DHEA 1PHPA 4E51A 5HQTA 1P7ZA 1AKMA 6PFKA 3ZZTA 1EFPB 4PSUA 5IAKA 3KQWA 4CEJB 1XV5A 3IQGX 3SYKA 5ALQA 5E3JA 1BHSA 1YDFA 3N2KA 4RD1A 1XZMA 3RS5A 4BY9E 1G5RA 1ZL0A 1DWUA 4H08A 5KTYA 4LGMA 1TJNA 3FGOA 3HDGA 4B3XA 3DBHB 1Z2NX 3KQOA 1J2RA 1KO8A 3UJHA 1XTUA 2ENWA 3VZCA 1ACMA 3ER6A 1X1BA 2R1VB 1F60A 3ENWA 2ZKIA 5EHIA 3D4LA 3SPXA 2I7XA 3E5RA 4JXKA 2P77A 1NONA 2DPMA 1C8VB 4II2A 1FYXA 1ODSA 2WABA 2Z58A 3JPWA 1U11A 1T8PA 1AVTA 3ESZA 4WJKB 4LJKA 3SFZA 3DE2X 5I3ZA 5CFZA 2ONKA 1PL8A 2NZUG 4OQYA 3KLMX 1QGYA 5EJ5A 2CNNA 2HKIA 1I6LA 3PWZA 5C3MA 1HO3A 1RJGA 3R9IA 1Q0TA 1QH8B 1JP7A 2I62A 1QV9A 2J45A 3PC4A 1H5UA 3X1WA 4C5BA 4WASA 2IY9A 1H93A 5KCMA 2PX2A 4X61A 1EVYA 2IDJA 1PR5A 4A8HA 2G04A 1N4DA 5HXAA 4F4JA 2V6GA 4PZAA 3GZNA 4Q6WA 4HNTA 1P2GA 2GA8A 3O6VA 1XD9A 2JAPA 1Q57A 3C1OA 4P0TA 2P3OA 3MJRA 5D1NA 1XWFA 3FH0A 2R1VA 3MCWA 3OE1A 1P9RA 1ULSA 2I7VA 2A5GA 5EVJA 3V8NA 3BVPA 4CHTA 2Y71A 2J5KA 1A9PA 1ONOA 3HZHA 3KKEA 1MG0A 2I7CA 3R23A 4ID3A 2FSIA 2X2PA 3NFRA 4KXYA 2X0JA 1BMQA 4QGAA 1KEPA 4ZAFA 4QPPA 4ZT3A 2HV9A 3VTKA 3O1LA 4F1WA 5I5EA 1G2OA 3WOVA 1CUUA 5JD4A 4MRMB 1NZJA 3L0YA 3E8MA 2FCAA 2W43A 3PENA 1EDOA 4QLBA 2DBVO 2QT9A 3INRA 5CVDA 5H4HA 3INTA 2IIQA 4LZOA 4AZWA 1DJOA 4ROSA 4YWJA 2CLDX 2FMUA 4ZEXA 3VKGA 1Q50A 3R6DA 4YNBA 3U6KA 4PSCA 3UOGA 1M0TA 5LQSA 5JCOA 5REQB 1NI5A 4LC1A 2IRWA 2ONZA 4XQGA 1J0AA 1VRWA 4KE7A 2XWBF 3UUFA 1BWRA 1WUJS 1KYYA 2NO5A 4O4IB 2BBTA 4X7BA 3RIGA 3VA7A 4DWOA 4DPLA 1N33B 3MWEA 1GU0A 3OPYB 5EVCA 5B1DA 1E98A 1BQ4A 3HL4A 1TC1A 4I50F 2GBIA 2HD4A 2GXSA 3BD9A 1IBCA 3ZEIA 3A9UA 2BN4A 3THYB 2WTBA 1M73E 3BN3A 4B2PA 3T9BA 4CKEB 2AC2A 3V5NA 4EI8A 1VGQA 2WJVA 3ETLA 5GONA 5P8WA 2ORWA 3V42A 1WCIB 2UZ3A 3JVDA 2QU7A 3A27A 2RSLA 1JKJB 1QK5A 1S3FA 4IZIA 4MRMA 3UEOA 1WUKS 2F1JA 2QV7A 2HR1A 2JKZA 4LF5B 3M34A 1Z3CA 2RMKA 3P9SA 4A10A 1WG8A 3ZKAA 4PZDA 2AJBA 5CIWA 1KK2A 2J46A 3IDZA 4EMTA 3N6XA 5EJ2A 1S7CA 2QGNA 5JZSA 2HMUA 3GXOA 3VZPA 2WT8A 4TMFA 1TIBA 1RWPA 4MVJG 4Q7EA 3B1YA 3K1AA 4MUMA 4F7WA 1XZGA 3EC1A 3SQOA 4MH0R 2NU9B 2R87A 1WUHS 3CINA 1VI6A 1XTIA 1I3NA 3CZMA 3I1IA 4DIFA 5JH7B 5LA6B 3OWOA 4QT4A 2R97A 4DF3A 1P1IA 2FDCA 1E4EB 3ZHSA 4YAUA 4IFEA 5BY2A 3TXXA 3LYUA 3N75A 4BVFA 3LLSA 1JA0A 2CLSA 2HJWA 1W5SA 2P4QA 3C6QA 3F6SA 4BFYA 3THYA 5C4MA 1HR0B 4HB4A 1CJBA 4N8EA 3TMAA 4CMEC 3UKOA 2BMJA 4JC5A 3SX0A 2X9NA 1Q1GA 4R31A 2XGJA 3IR7A 1YRLA 1LU9A 4OAOA 3MMSA 4YIKA 4FFBA 1F1JA 1MJNA 3RVSA 5L6MB 1D8AA 3D0QA 1NLUA 2PANA 3MW8A 4AY3A 2CXQA 2QRGA 4BRSA 5KTOA 2C20A 4QULA 1C9NA 1SXGA 2I3AA 4YRDA 4ZA2A 3PVCA 2HT1A 3WLSA 3MPOA 1RQ2A 3PQ4A 2XMGA 3UHOA 3IUQA 1TZ2A 4QODA 4L3OA 1NZFA 3BXXA 3VYUB 2BT4A 1YU9A 2OUIA 1OFVA 2G5TA 4PTZA 1QQAA 2PMDA 4HBZA 2ZI4A 3LP5A 4XEHA 4DDTA 3JRXA 4QVIA 1YI1A 1LBHA 1OFTA 5FWYA 3OA2A 4FWTA 3ASZA 5BUQA 4E2YA 1E4EA 2J0EA 4V0LA 5F4BA 4JGBA 2FQWA 3H2JA 1VPDA 1UP6A 1W9MA 2GBLA 3RFFA 5T6MA 2Z1NA 3QLVC 3O4RA 4KO3S 1XQ9A 2J4CA 4DUZB 1I32A 1KNQA 1PSZA 2QN6A 2C84A 1D1TA 2V96A 3CSUA 3IO5A 2HXGA 5CDFA 4EM6A 4BGVA 4R1UA 3QY0A 4A73A 4JBYA 1DDGA 1F12A 1LBSA 2F3UA 2WFLA 4KIJA 4OUDB 5C81A 4C6TA 4LKOA 1DT5A 1N2BA 3LX5A 4MMYB 3Q7TA 3MTIA 2Y0BA 2A8YA 1GTJ1 1CUDA 4HDCA 2ZTHA 1N0WA 1NWCA 1EMDA 1KJZA 1S8OA 1XZNA 4Z9XA 3RJTA 3TB4A 3WK7A 2VQSA 2GJSA 4BJHB 1XPUA 1G6Q1 1YACA 4YX9A 1DKQA 3K9FC 3ZGVA 1GR0A 4PHCA 4PX2A 2ZYHA 3MCVA 4R54A 1N8SA 4LTDA 5JH7F 5FI5A 1SURA 2VT7A 1E2QA 2HU5A 5KTNA 1CZHA 2JS7A 2H1WA 3PBKA 2YCLA 5HZGA 4FD2A 3L49A 1BSVA 1KZYC 1LNQA 2ACKA 3F6YA 3JQAD 2C5HA 3UO8B 5KYWB 4M1MA 3G5MA 5CVEA 1THGA 1IN8A 1W34A 3A6HA 5FXMA 2C2ZA 1JG4A 1YGYA 4QU8A 4IDAA 1BU8A 4IWYA 5DULA 4DT1A 1YR1A 2YFKA 3E53A 3NJ8A 3CG0A 3O4VA 1P7YA 3TLKA 2O52A 2XDYA 4OBXA 2XBUA 4R2MA 4C29A 1VGVA 3GLIB 3LXXA 1S5PA 1EAYA 4V3CA 4DR5B 5JRDS 3QVUA 3VKWA 4YP5A 1WV0A 4G5RA 3G85A 3OOHA 1I0LA 4GKAA 4INZA 3G2NA 5TE9A 3C8MA 4F7DA 3BGVA 4D25A 3OWXA 2ANCA 3ZD7A 2NN3C 4OJMX 1VGRA 1DIBA 2UXCB 1MOSA 5K0TA 2FPWA 3K5WA 3DYIA 3UY4A