2X2FA

Dynamin 1 gtpase dimer, short axis form
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
347
structure length
336
Chain Sequence
b'EFSMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYSRVDEMLRMYHALKEALSIIGNIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DYNAMIN-1
publication title G Domain Dimerization Controls Dynamin'S Assembly-Stimulated Gtpase Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 105
structure length 336
sequence length 347
chains with identical sequence D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2x2fA00
5CIQA 4ACAA 3KTAB 4IDQA 2IXEA 3VTKA 3GLFB 2IS4A 1T5IA 4D0GA 4TLAA 2IS2A 4DLRA 1OB5A 1NMZA 1AKYA 3QIAA 2HYDA 1G4AE 2V1UA 2QAJA 1XTSA 3NVAA 2MSCB 4IVRA 2O8FA 4RFSA 2G0TA 3AEZA 1IM2A 4DIDA 3RYTC 2O8BB 2D7CA 4C0LA 1J2JA 4OJQA 2GXAA 4ZKEA 1JPNA 2GTPA 3UG7A 4G5OA 2JLXA 3ZZUA 2YHSA 5G40A 3H1TA 3L0SA 2G83A 4F7WA 1AS2A 3RSLA 2FE4A 4IOMA 1ZP6A 5FOVA 4KLZA 1TU3A 5FTKA 1KSHA 4F91B 2BIFA 2P6RA 3SE0A 3SS8A 5L3QB 3CBQA 5CK4A 2XAUA 4TLCA 4BFYA 1G8PA 2N46A 4NMMA 2QP9X 2JDID 3LAWA 1DG1G 1W4CA 3UMRA 5AJXA 1VG8A 2YNMA 5LD2C 1QF9A 2R2AA 3HU1A 1VG1A 1GRRA 1PVOA 4TYYA 3KQNA 4JBWA 2CVHA 3VQTA 1XRJA 2C98A 5FH9A 5KNDA 4TT3A 2ZJ8A 2XB4A 1KJWA 1IY2A 2PLFA 3OE7A 1CXZA 3WMGA 2FG5A 3TBKA 5JFGA 2F3RA 3RC8A 2CJWB 1A7JA 1M34E 3CX7A 3NBZC 2JLVA 3K9NA 1W4RA 2Q3FA 4HLUA 3EWAA 2HF8A 1KI9A 1P6XA 3SDZA 4FMBB 5FUYA 3BE4A 2RGXA 1G8YA 3NDBB 5AJVB 1KO7A 2YWHA 2O5VA 3W34A 3TSZA 1B0UA 1GAJA 1QVAA 2GHIA 1G64A 4DLVA 2IW3A 3ONWA 1ZD8A 1OXSC 2F1RA 1W4AA 4CIDA 5C1BA 5IF9A 2LKDA 4CT5A 3A58B 5CM9C 3AKYA 4LPKA 5CYPA 2YWFA 3D6TB 2IC5A 2IWHA 2MMCA 1P7CA 4B3DA 4TLDA 1QHIA 4HAWA 4P3YA 2QQEA 3MRSA 1G6OA 3NC1C 1YU9A 4JLPA 4HEJA 4LHWA 3M6AA 4BEBA 3EPJA 4AKGA 1S0UA 1QVRA 2CXXA 4JLVA 1FNMA 2ZRAA 4OHYA 1XX6A 1LF5A 3G5UA 3NHBA 2REBA 1II8A 4PC6A 1P3JA 3WHKA 5K8TA 1FNNA 5EXSA 3K09C 4OKSA 4JJZA 4RKEA 2GK7A 5TDHA 1L4UA 1EFRA 2A5JA 3QJYA 1FQJA 3T1OA 2GJSA 3P20A 3ADCA 3MCAA 4GI7A 2FSGA 5FUXA 4AI6A 3ETLA 3EX7C 2DY1A 2YWEA 3EAQA 1KK3A 3X1WA 3B13B 1Q1QA 2GZDA 2ZANA 3B60A 3TR5A 4PSKA 3CRW1 2QENA 1CEEA 2OAQ1 3ZVNA 2JCSA 4JKYA 3KKQA 5SZHB 1LFDB 4Z51A 2XSZA 3ADDA 1ZINA 3LWNA 5H8WA 4YONB 5FUWA 1CLUA 4HLQB 4D25A 2PZGA 2JLUA 2XXAB 5FI1B 5DGXA 621PA 2H17A 2J87A 3U4QA 2CLSA 3AV0B 5H68A 4A0GA 2QGNA 3X1DA 3K0FA 3A6PC 3OE7D 5FUVA 3TJZA 2J5XA 2MSEB 1XFAA 2RGAA 4PXAA 2VH5R 3WRYC 4JLJA 4ESVA 2ZVPX 1M74A 3HU2A 1MR3F 2ASEA 4MRNA 1Z3IX 3ND9A 1MKYA 2IYWA 4LYJA 221PA 2BJWA 4FINA 4EJSB 4ABYA 1DELA 2CEAA 4DDWA 2XZLA 2VO1A 3DKPA 1OE0A 1KK0A 2BJVA 4OHWA 1Z0AA 3FGNA 4Z1MA 3RWMB 2LCFA 5TV2A 2GWHA 1LY1A 2IK8A 1IXRC 1KSJA 1TADA 1IN4A 1G5PA 1T3LA 5M04A 2VRWA 5JECA 4A6XA 3Q3JB 4TSFD 3T12A 421PA 1VPLA 2CNWA 1RRFA 5LBIA 1X1SA 4E5UA 3BB1A 4DLWA 1FOEB 3CKLA 2J7PA 2ZRCA 4B75A 1PUIA 1TF5A 3P4XA 4KFSA 1FZQA 4JT2A 3KJEA 1Z07A 4EPXA 1E9CA 4LX0A 1YZGA 2H92A 1XD8A 1M1YE 2ZYWX 5D3MB 4HZUB 1IN7A 4B6FA 2A3RA 3M1IA 4H9GA 4NYJR 2EFDB 4TL9A 2RGNA 4XJXA 4C0QC 2W2VA 4RKFA 3T61A 3BERA 1ELOA 2ZSBA 4L16A 3VR1A 1NVXQ 2QAGA 3FMPB 3GEEA 3KXIA 1XB2A 4QJ4A 1E69A 4Q4AB 3T5DA 4BRUA 1ZUIA 4LGMA 2RGBA 5CJ2A 3SN6A 4A4DA 2DFKB 4YDHB 1TQ4A 1E2FA 1EFRD 3BBPA 4JIMA 3ZLJA 4JS0A 1MH1A 2C04A 4KU4A 1XU4A 1UKEA 5E7JA 2W0MA 4C7OB 4IDPA 4KYUA 1E2JA 4HDQB 1Q57A 4QBGB 5HTKA 5KUTA 1C1YA 3CB4A 2CL7X 4WXPA 2VTKA 1W0KA 1R0YA 2IS6A 1G16A 3GLHA 4GT1A 3VNVA 1ZW6A 1PLKA 2P2LA 2ODWA 1E98A 3OZXA 5JS7A 5EJEA 5DN6A 3KUDA 4JVMA 1DS6A 3AGPA 1IY1A 1Q0UA 2O8EA 2QSYA 3RS3A 4MRRA 1W5TA 2XSZD 1E4VA 3CX8A 2NO9A 3HU3A 4ARZB 1MO3A 4YDSA 3M0EA 4JLAA 5KTYA 5L3VA 1N6RA 1ZU5A 2CLCX 2OE2A 1W36B 2UVQA 4TTQA 4BFZA 3QXHA 1XMVA 5AWFC 4CEIA 1VCMA 2QNRA 3U3RA 1E9FA 1I4TD 4ZO4A 1GZSA 4BEJA 5KHOC 2R44A 4EKDA 3C8UA 2QTVB 3GJ5A 3TAUA 4CW7A 5JI2E 4E09A 1DEKA 1YRAA 3O8BA 1NSTA 3PJRA 3B5JA 1PLJA 3D7MA 3GEHA 3UXMA 4LJ6A 4C0HA 4D4MA 1I4LD 4Z1MD 5A4JA 2ZVQX 3C14C 1N5IA 5DE3A 3K0CC 4LHYA 4D2IA 1TQ6A 3BFXA 2WKRA 1BYIA 2CNWD 4LYHA 4BLSA 1TPZA 2I1VB 1ZU4A 2G6BA 4AG5A 2J7PD 3K9GA 4IJMA 4OI0A 1Z6GA 4FD2A 4NONA 2G77B 3L82B 3QPWA 5F9FA 4US1R 1E4YA 4U02A 1KI8A 4M8NE 2BBOA 5HKKD 2P65A 5HPYB 2J7KA 1EXMA 4B3FX 4L15A 3QPVA 4C9BA 1DAIA 4B3BA 3BH7A 4TMXA 2OLJA 3IEUA 2NMVA 4A92A 4AC9A 5B64A 6Q21A 1GRQA 3SYKA 5IDVA 3UMFA 1OSNA 4RFVA 3GLFE 3I4LA 3GLHE 4ZI2A 4NCIA 3ZQ6A 4OYHA 2W6JA 4BLQA 1W0KD 2VQSA 3ZJYA 1Z0JA 3AVQA 5EE0A 4A0RA 3VHLB 1O87A 4EPRA 5DN6D 1YE8A 4NCHA 2WMOB 2FPMA 3SQXA 3U44B 2FFAA 4HYYA 5BW8A 1N6OA 1QG4A 5EXXA 3KFXA 2H1LA 4Z8XA 1DO2A 3IILA 4G3XA 1OFIA 3RNLA 4MUAA 3VHXA 5J4LA 3Q9LA 4LHVA 2OEPA 3PEUA 5DH9A 1L2TA 2G0NA 3E2IA 4ZDIA 3IUYA 3A36A 1R8QA 3PITA 4ITRC 1OV4A 2GESA 2QPTA 5JZVA 3WBJA 1CBUA 1GDDA 3RS2A 1P9NA 1G1MA 3E5HA 3QNUA 2JJ2A 1X8KA 2OBLA 3BS4A 3K53A 1W2HA 3GFTA 1Q3HA 3LLUA 4OQMA 5UKDA 1OHHA 1NN1A 3HYRA 1X8JA 3B7GA 2GF0A 4GOXA 4W7SA 1E2IA 5JHHB 4C2UA 2D2FA 1DG3A 1N2CE 4L8GA 2F6RA 3B9PA 2YV5A 1XEXB 3SEAA 4EQ6A 2VSFA 4TMKA 4CZ2A 4JT4A 4JVNA 2PCLA 2AL7A 3B1XA 1XF9A 1T5LA 3EA5A 1BS1A 4XOIA 1M6NA 3TR0A 5AUOB 1T8TA 1U90A 1D2MA 2GZAA 1UBEA 2C5LA 3DKVA 3QF7A 3VKGA 4HUQB 4M1SA 5FFMA 1GNRA 1OFUX 5J47A 1JB1A 3KJHA 3SOPA 2B7CA 1LW7A 2WKQA 2ZIAA 3AKCA 4BECA 5LPNA 1N6NA 4BASA 2NO1A 3KQUA 1XWIA 2PCJA 5HZHA 3VKWA 2QE7A 1FP7A 3AF2A 1PUJA 1TUIA 1G5TA 2NOAA 3EC2A 1F5NA 1SVSA 3AF4A 2D7DA 4B3GA 2WTUA 3AF3A 3I5XA 4RZ3A 2FX3A 4C30A 4JYBA 3EIQA 3QF4A 1UDXA 3QVUA 1ANKA 4LWZA 4ZDKA 1UDWA 1AQUA 1H8ED 1KZ7B 3R7WB 3DM9B 1KAOA 1E0KA 2BCGY 3NBFA 1HY3A 3K8YA 3U3OA 4Q1CA 2I1QA 2ZREA 1FMJA 2QRZA 3EZ9A 4Q1EA 1RRPA 2FSIA 4W5JA 1AZSC 4PHHA 2QN6A 2WOJA 2CE2X 4URWR 2IYYA 1SHZA 1ZVQA 3BFKA 5KPJA 4WZBE 4LZZA 4TYQA 1VIYA 5AUQA 2GCNA 2J45A 5FBWB 2GEVA 5CIWA 3K70D 1GVNB 2ZJOA 4WVFA 2G1JA 3KKMA 4BRWA 5IHPA 4FCVA 1R4AA 1SXJB 3P1JA 1OXVA 4MDFA 3BGWA 3GJ7A 1YZTA 4QG7A 3FWYA 1SVIA 1E79A 2ONKA 1P61B 3U60B 4UNQA 5EP2A 3KQKA 2ZRNA 2QA5A 1D2NA 1KK2A 1PJRA 2JJ2D 3TRFA 4YQFA 1DBSA 2FH5B 1G6HA 3RAPR 3VR3A 2QT0A 4FMDB 2GEUA 1OHHD 1T91A 4A8JB 3RS4A 1G3MA 1ZM7A 2I3BA 2IBMA 1WDTA 4LOAA 2RGEA 4RVCA 5D3QA 3T1VA 4AYWA 2H8KA 4EFLA 5JLJA 5KNBA 2PJRA 1HUQA 3C5HA 1GL7A 4RZUA 4DB2A 1K5DA 2N1BA 3CPHA 2YKGA 1U0HC 2ZS7A 1VG9B 1VHTA 3CWZA 4Q7JB 4XTRA 1AJEA 5GJWC 1CKEA 1ZNWA 4PSVA 3GLGA 2J46A 2PZFA 2WJHA 4EJSC 1P60A 1E1RA 2FJUA 3SBDA 2MSDB 4M1MA 3W3ZB 1QHGA 2OV2A 4MKHA 2GILA 4BWYA 4NCJA 4NYMQ 5JWOA 1NSFA 4QRHA 4JLBA 1WCV1 2QE7D 4KFTA 3W6OA 1US8B 4EIWA 1FX0A 1CRPA 3K0AA 2GCPA 1F3OA 3QQ5A 2DFNA 3B2EA 1GKUB 4AIIA 4X8HA 3HP1A 3OESA 4W9MC 1KOFA 4IFBA 1OT3A 2ZYTX 1NF3A 3L2OB 1E2NA 1ZJ6A 3N5CA 1K8RA 2AN9A 1Z47A 4C0SA 1T8UA 4N0EA 4AKEA 4MA4A 1I4DD 1Z83A 4H1UA 2Q3HA 4POAA 4TL8A 3SI7A 4Q4JA 5HCIA 4OI1A 3WRXC 1GILA 3H0KA 3REFA 1M7GA 1G7CA 1N6HA 2NPIA 2REXB 3ASZA 4PZZA 4TTPA 2VHQA 1Z06A 3Q7QA 4JJKA 1I2DA 3UANA 1IBRA 5F2EA 4AKHA 3QY0A 4GDFA 1E9BA 1ZNXA 3RANA 4N1AA 4A9AA 4BQSA 3THWB 2JLWA 2OFXA 3MSXA 1DOAA 1E1QA 2D2EA 2OCPA 2DPXA 1E79D 4FXPA 1QHYA 4G5RA 4ZI3A 4ZPXA 3I72A 3HDTA 2FPKA 3WYGA 4ERNA 4A15A 4HZIA 4QBHA 4D82A 2QRNA 1WF3A 3GJ3A 3FTQA 1ODFA 1HURA 3EPHA 4Q9KA 2ODEA 5DI9A 2KWIA 4HI0E 4WAUA 5JWRA 4I1OA 1OW3B 2GBLC 2KI5A 3EASA 1GTVA 1XJCA 5AUPB 1W36C 4E03A 3GLGE 3O47A 4Q1BA 1HTWA 3U4QB 2WMNB 2ZI9A 1MO4A 5TARA 4D4LA 1ZNZA 2GJAA 4LBYA 2FEMA 4KV9A 1IQPA 5C46F 3BWDD 2GAAA 3AP1A 1N5JA 4NP6A 2TMKA 3F5FA 1XCMA 1E1RD 1Z2CA 2NO6A 1Z08A 2Q21A 4U7DA 3CNNA 3H4MA 1R7RA 5KDOA 2O8CB 3IIKA 4IVPA 4JL8A 3I1FA 4PHFA 3PEWA 2G3YA 2PLRA 1PV4A 1QHXA 1VKJA 2IYSA 4FMDF 4BZPA 1CULC 3QBTA 4I4LA 1U98A 5EE9A 1KNQA 1KHTA 1ZAKA 1NY5A 4TZ6A 3TVDA 1E2PA 1E2QA 4DWJA 1L7VC 4NZYA 3WNDA 3OEEA 4CRWB 4K81B 5BWMA 5BXQC 1RFLA 4EPYA 1MT0A 4AG6A 2WWWA 4AWXA 4FWIB 4DT1A 1E2MA 4M1OA 4V0LA 1KI6B 2BBSA 3IO3A 4G5GA 4DIEA 3MUFA 3OIVA 2JLZA 2JJ8A 2NO7A 4GSYA 2VPPA 2D62A 4EUNA 3CR7A 3L8YA 4ZIRA 2WVJA 3VR6A 3PUXA 2D06A 1R2QA 3GQBA 3CPEA 4S2EA 2FNAA 2KSQA 1X8LA 1I2MA 1TEVA 2P6NA 3KL4A 4M9XA 3TNFA 3CZQA 5E4FA 2ORWA 3BH6A 2JATA 2OAP1 2CK3A 2X8AA 3BRWD 2YC2C 1Z6TA 3K09A 4LSGA 1Q3TA 2QGZA 2ZE5A 3JZMA 4HAZA 4PC1A 4O3MA 4B35A 1JI0A 2J1LA 1EX7A 2DFLA 4IDOA 3RS0A 3QKUA 4FIDA 5J4HA 2GKSA 3GJXC 4PQRA 3LBNA 4IXNA 3U7HB 2EFGA 3KFVA 2F1IA 1KMHB 2EFCB 5DYGA 3OIUA 2ZE6A 4LJ9A 4JVSB 4IOKA 1U9IC 4JBXA 1NN3A 2QZ4A 4X8OA 1PLLA 4C2TA 2FOLA 2ZI4A 1TF2A 1YZNA 3X1XA 5BQ5A 3B1ZA 1A2KC 3GFOA 2ZSEA 3EPLA 2IF2A 3HPRA 2KBEA 4BPBA 1RYHA 4CEJA 3IQXA 3FKSA 3U5ZB 4P4SB 5KSZA 1HQCA 1TQ2A 5JSZA 1M7HA 3TIFA 5G53C 4MYHA 1TMKA 5FPYA 3EG5A 1OH5A 4PPNA 1A2BA 2YVUA 4CYMA 3QEJA 2B6HA 4DLSA 1NIPA 3NIBA 1T3SA 3UIEA 4CEHA 3T1QA 1BOFA 2ZM5A 5DI3A 4URVR 2F7SA 3LA6A 3EIHA 3FYHA 4BFTA 1BKDR 4TYPA 2YOGA 3LLMA 1ZIOA 2AFHE 3NHAA 4YXWD 3A1UA 4UNPA 2QMOA 4LHXA 4XWAA 3U2QA 2OUKA 4RD6A 3UATA 4PHGA 4RD1A 3QKSA 3MGCA 1GKYA 2RGGA 3OEED 3ZGXA 4NH0A 2Z4RA 4TQ9A 3HPQA 2IHBA 3EPKA 3LNCA 1UM8A 1X3SA 2OZEA 2PT5A 4D81A 5IT5A 4GRAA 1MABA 3B1YA 4KAXA 4NHOA 4B3CA 4LJ5A 1CU1A 5EP1A 4OQLA 4A6PA 2BV3A 5JJIA 4DXAA 4XTCS 3KXKA 5FTLA 1Y3AA 1FTNA 2HJGA 1N5LA 4OK6A 3I73A 3IIJA 4BFXA 3KKPA 2DWPA 4F4JA 4XIGS 4ZDWA 2IA5A 1G3IA 2VSXA 3BFVA 4KHZA 3FVQA 4MH0R 3OF5A 1DPFA 1JNYA 3X1YA 1HE8B 3I61A 2C9YA 2VP6A 3DZ8A 2CK3D 1VIAA 2RH5A 2XB2A 1XPOA 3SQWA 3P4YA 2G9NA 5JEEA 1U0JA 2J59A 1NLYA 4UKDA 3VR5A 1SXJC 3X1ZA 1VYTA 2XTZA 2B21A 3CR8A 2X2EA 1R6BX 5CK5A 1SKQA 5FTNA 1SXJE 2VA8A 4EAQA 4PAMA 4NYIQ 4ASUA 1YZKA 2JLQA 3NC0C 1KY3A 4Q18A 2A78A 3LQQA 3GMTA 4GFDA 4O0MA 4MGKR 1GFIA 1E9SA 4TLEA 5DSZA 1TUEA 4A8JC 3QXSA 5ELXA 2KJQA 4I1UA 1R0WA 4TT3D 3BH0A 4PR0A 1Q1ZA 3IKJA 4BUJA 3PUVA 4HAYA 1S4QA 1RKBA 4JLDA 3TMKA 3PENA 4TQUS 3N70A 4ZCIA 3L8ZA 721PA 3GP8A 2VF7A 3SBEA 5EZ6B 4A2WA 1W2GA 2O0JA 3ICQB 2HJVA 4AYXA 3W5IA 3IHWA 5DLQC 1JAIA 2ZSAA 1WB9A 2IEZA 1S8FA 2J9RA 4GOJA 3JVVA 1OH6A 4R98A 1N5KA 3RLFA 3BC1A 2O8DB 1F2TA 4RD4A 3QG5A 4PC7A 5EXTA 2ZETA 1OPXA 1SGWA 1XTRA 2J0UA 5JHGB 2FGJA 4UXHA 1FQKA 1QZXA 4DSNA 4LV5B 3GLIB 3THXA 4P4UA 4C0JA 3JZAA 2GEDA 1CRQA 3MWJA 3K0CA 1YR6A 3N2EA 5CB6A 1CP2A 4P4TA 3CZPA 2HLDA 4WBSA 2AK3A 1SKYB 1ZRHA 3DDCA 2GAOA 2FGKA 1GL6A 4Q48A 3Q8XB 1XPUA 3VU9A 4B6EA 2ODNA 1WXQA 4YLGA 3FHCB 4TYNA 2VP5A 3IPYA 1GRNA 2BEJA 1DADA 4M2LA 3U7EB 3ZVLA 1J7KA 3EZ2A 5FL7A 4Q4HA 4QBFA 1XXHB 5FPSA 4PC3A 4U5XA 2RMKA 2WV9A 1VYUA 1DAEA 2BMFA 2Q9AA 1KDOA 3GLFA 3EC1A 5BYJA 2DR3A 4LY6A 4MKIA 1VDZA 1LF0A 2ZAMA 3R9WA 5KSYA 1S9DA 3AF0A 1GP2A 2JIZA 2OXCA 4DLYA 1IN8A 4ASUD 3K0SA 4X8MA 1EFUA 1HYQA 3UG6A 2G88A 3VR4A 3AVWA 2O0HA 1OKKA 2R9VA 2D3WA 4O2LA 4JL6A 4HUTA 1HEIA 1GIAA 4KJZA 1J90A 4X8LA 2O8BA 3OIWA 3LBHA 1KSGA 1KO1A 3L0OA 4A36A 1CJTC 5TXGA 4M9QA 3I92A 1OJLA 3EWSA 4R2HA 4RD0A 3CNOA 2QP3A 2QUZA 2NGRA 4HLCA 1U99A 4OI2A 2BKEA 3AUYA 3REGA 2LWIA 4IXMA 1JECA 5EXPA 1KKLA 4F93B 1A5TA 4PFSA 4TL6A 1Z0KA 4PAOA 5C4GB 1WRBA 1SVKA 2FSHA 2XJ9A 1IAQA 2Q9CA 2VL7A 4Q1FA 4A2QA 3Q5DA 1HA3A 1OIWA 1RRGA 1JR3A 1TF7A 1NVUQ 2W58A 4JLKA 5FPKA 4NYJQ 4QHYA 4OK5A 4HB2A 5DHFA 2HXSA 4Y0VA 1OXXK 1IY0A 4MRVA 4Q9HA 4DCVA 4YMVA 4KYIB 5IRCD 1W4BA 1YR8A 1RIFA 4M1TA 3U3JA 5CB8A 3LY5A 3QOFA 1G4UR 3WMFA 4DDTA 4MYUA 4JLMA 1RJ9B 2V1XA 5JWHA 2REOA 2BBTA 2R8RA 3CPJB 3LQRA 4WW0A 2ATVA 2BWJA 4UNRA 1SHKA 1TAGA 2CJWA 1NL3A 3TE6A 4G1UC 3THYB 1ONBA 2AD5A 3LD9A 4GMXA 1OIXA 3PXGA 5CJPA 1FTSA 2J41A 2RGDA 4V02A 1XEWX 2HLDD 1JXOA 3QVVA 3A4NA 1X1RA 2OM2A 3HJNA 3SU8A 2IYZA 4D0NA 3EIEA 1N3BA 1VCIA 4B34A 5JJLA 2BMDA 2HUPA 2R65A 2AWNA 2QT1A 1LV7A 2Z4SA 4NL4H 3CLVA 4K46A 4QHSA 4Q4JB 3S1AB 4D26A 2ZEJA 4MITA 5FL7D 3IHLA 1QHSA 1CR2A 1P9WA 2V8OA 5KSOA 1VHLA 4D4JA 2YZ2A 4LK2A 3U61B 1KIMA 3CX6A 3LVQE 4B32A 1AS0A 1UKZA 1ZMXA 2WSMA 3K9LA 2KB0A 3PFIA 2R6AA 4KBFA 4NKRA 3T06B 2C03A 4AKIA 2JIZD 3NH6A 3B78A 3PVSA 3K9HA 3MG9A 2YWGA 4O25A 1JALA 2VP9A 4Q19A 1OKKD 2FZLA 2IUUA 1DE0A 2V54A 4XSGA 1L4YA 5AUNB 4N0DA 1Z0FA 2BCJQ 3GFPA 4JSTA 1VCOA 4URYR 4DCNA 3GJ8A 4XWOA 4Q4LA 2OILA 4GOKA 1XTQA 3AGQA 4PC2A 3VX4A 2JJ1A 2FMXA 3WNCA 1W1WA 1E0JA 1NLZA 2N42A 2GNOA 1DARA 1E2GA 2EYUA 3QXXA 4QFMA 2Q0HA 3DOFA 1JR3E 4DVGA 2ODBA 3M4YA 2BMJA 2QPAA 4V0MA 5AJWA 5EE1A 3IPXA 4L9SA 3AP3A 4DSUA 3CO5A 1HV8A 2F9LA 2ZXUA 4I1VA 4BLRA 4NE2A 2QY9A 3R9IA 2AXNA 5E95A 1FFHA 1WMSA 1D2EA 1KI4A 1NKTA 2JA1A 3AH8A 4M9SA 5JRZA 4AD8A 1T4GA 4KITB 2O0KA 1QHHB 4I99A 2XXAA 1V5WA 1ZM4A 5LD2B 2QBYA 2NQ2C 2ZJAA 2AR7A 2H57A 2J0QA 1UKVY 2F43A 3FB4A 4ZDJA 2ERXA 1FPMA 2JLSA 2VBCA 2OG2A 1JEEA 1ZD9A 1NNEA 1Z28A 4JVLA 2ERYA 4TMZA 3AVTA 1ZUHA 3NDPA 1Z29A 1T3HA 1UEIA 4UJ3A 1WA5A 2EFHB 4EJSA 4O2RA 1OXUA 2C99A 3A1TA 1G7RA 2QP4A 4F4CA 3DHWC 1GG2A 1AA9A 4XH9B 1KDRA 2V9PA 5JCPA 2RB4A 4M1WA 1W0JA 2C78A 1NIJA 2VHJA 2ZS8A 3KJIA 5J4KA 2P67A 1KAGA 5KYKA 4M1YA 4GNKA 4F4IA 4G5SA 5BN4A 3SJCA 1YR9A 3TQCA 1H65A 4LJAA 4DJTA 4FW9A 4KI0A 5G3ZA 1SVWA 1LNZA 3UMSA 3KB2A 4MGIR 4K8OA 5HR5A 3VX3A 1R0ZA 2ZRJA 4WZ6A 3O8CA 1NI3A 1GOTA 2W6JD 4ZIRB 3KZ1E 2QL6A 3DPUA 5EE5B 4LYFA 3FHOA 4HZUA 3IIMA 2FA9A 2JGNA 3ZYCA 4Q9IA 3ZIAA 2Z6VA 1IN5A 2O8FB 4RFSB 4R2IA 3FOZA 1B23P 1Q20A 5HCNA 4IEEA 3OEHA 5L3RA 4EFNA 3U6BA 4N3NA 1K5GA 1KSFX 1DTSA 2UKDA 4NYMR 2I4IA 5H1YA 4KSCA 2BDTA 2BKUA 4CT4B 3GEIA 3NEJA 4PSAA 4A82A 4DDUA 2JJ1D 4JYCA 2WWIA 3TVTA 2IEYA 1N25A 1RYFA 1U2RA 2V6IA 3MLEA 4V0ME 2ZU0C 3AVVA 1GKIA 4Q03A 5FOWA 1E94E 3B82A 2XOKA 4UQOA 2PL3A 2ZROA 3EZFA 1G7SA 1OXTA 5C4MA 5FI0B 3V00A 4D4KA 3LXXA 4J0QA 4M9ZA 3TUIC 2GF9A 4PPGA 2Z0MA 4TMTA 1GNPA 4XVRA 1XTKA 3ZZ0A 4DKXA 4HB4A 3SC3A 2ZSDA 4ARZA 4XSHA 2ZRPA 1MOZA 1NVVQ 5B57C 3ADKA 5DISB 3CRVA 3AB3A 1W47A 2GBLA 4DCTA 3A8TA 3LH5A 4BZXA 3MJHA 3G0HA 5JMTA 1UJ2A 3EZ6A 1WBDA 2AXPA 1RRCA 2RGCA 1YR7A 2IXGA 2YYZA 5DI3B 3RRMA 4L4UA 2IUSA 4QHTA 3SR0A 4LBVA 2DB3A 4TWZA 1K6MA 2RHMA 3RVBA 2P5TB 121PA 1ZIPA 1W0JD 1NMXA 1E6CA 3B6EA 3VAAA 1C9KA 1AS3A 2OO7A 2ZRKA 2UZIR 3T35A 1DO0A 5K8IA 3BK7A 2YOFA 1QRAA 5DIFA 4MDEA 2QTHA 2GXUA 2J3EA 2WJGA 3QBVA 1KK1A 4PAQA 4KSBA 4BLTA 4DC9A 3QE0A 1C4OA 3AQ4A 3D31A 4LI0A 4LJ4A 4RY2A 2QEQA 1ZCAA 2HEIA 2ZJBA 3KDSE 3WBKA 2DBYA 3SJBA 1S96A 2ANCA 4BFVA 5JCZA 3ADBA 2QG6A 1Q44A 1BO6A 4Q9JA 4ACBA 2GJ9A 4IEIA 4QOSA 3DZDA 4US0R 3E70C 2OFOA 3KB1A 3WMEA 1II8B 1CTQA 1KI2A 1NLFA 3QENA 3NKVA 4C0AC 821PA 1J70A 2WWGA 1U8ZA 4D0LB 1ZM2A 1UEJA 3FMIA 3ZIAD 2IT1A 4LC0A 2PJZA 2FSFA 1V43A 4KFRA 5A0FA 4JSYA 2AHOA 1IONA 1EWRA 1TU4A 2Y8EA 3OEHD 3WYFA 2ZPTX 1Z8FA 4B73A 2X2FA 3IQWA 1G8FA 4Z54A 4B48A 4Y0AA 4NCKA 2ZSFA 5EE3A 1OFTA 3GJ0A 3I8SA 1ZBDA 3DO6A 3I32A 1KO8A 1UPTA 2XX3A 1DAGA 4LC1A 3AVOA 4WIAA 4DDVA 2A5YB 1KTVA 2FFBA 2PEZA 4TMWA 4OHZA 2F3TA 1M2OB 4B2PA 2V4ZA 2XOKD 3CONA 3SFVA 4TN1A 3DVLA 2R62A 2ZI5A 1VECA 2AWOA 3U44A 2GXSA 4KCGA 2CBZA 3U7GA 3ZS9A 4JZKA 3TGPA 1ZM9A 4V0OA 1JXMA 1D9ZA 4RCZA 3UKDA 2CCGA 1S2MA 5KU1A 4E22A 4BFUA 5KOYA 5EUMA 2DWOA 1XD2A 1IXSB 3QKRA 3NWJA 1XZPA 5DO9A 3K0FB 1U9IA 2W0SA 1E2KA 4M4SA 3FKQA 1XCGB 2WJIA 2NO0A 2ZITA 3A4MA 3SFZA 5C18A 3O8RA 4JLOA 2VHTA 4KO8A 2ZE8A 2HCJB 4DSOA 1E3MA 2ZI3A 4CDGA 5GJBA 5FPHA 4RD3A 1BIFA 3BB4A 2C9OA 1G19A 1OFHA 1HH4A 2PBRA 4M21A 2JASA 1KI7A 1XEXA 1NBME 4CGZA 1EESA 3QPUA 4BGDA 1NKSA 4JKIA 1R10A 2ZRMA 2GXQA 2QMHA 3ZVRA 1XJQA 1ZYUA 5GADl 4R9UC 2DYKA 4WOPA 3ECCA 3THXB 2MMGA 2NTYC 3RRYA 1WE2A 4DLZA 2B8WA 3QEOA 2WWFA 4HUQA 4GL2A 3TH5A 3EA0A 3LBIA 1EK0A 4QGGA 1FUKA 4LBZA 2CDNA 2C8VA 4P32A 2FWRA 1UAAA 5G3YA 4LV6A 1KKMA 3CH4B 1XMJA 1DAHA 4ILEA 1CJUC 1Z6AA 1HQYE 2P3SA 4NU0A 4V0KA 1G5RA 3A1WA 4MUBA 1AM4D 4MKGA 5KDLA 1GM5A 2NG1A 4AY2A 2XGJA 2AKAB 2QAGB 5L8VA 1COWA 5B58C 3ZS8A 1G20E 1MV5A 3GJ4A 4EPWA 1S3SA 3C5CA 1E1QD 4KVGA 1AQYA 3W8NA 4KBGA 2ZS9A 1NN0A 4IOJA 2WWXA 1XMIA 2C77A 5K8UA 1CR4A 1J8MF 3VKHA 1T0HB 4HAVA 3D8BA 2EW1A 3GLHB 1IJFA 1P72A 2H7VA 2ONJA 1F2UA 1N6PA 4HLDA 4QGHA 2CVFA 2A5GA 1E96A 4JMPA 1O3YA 2V6JA 4JBYA 3BJIC 4TL7A 5DNYB 4XD7A 2IWRA 2BM1A 3LV8A 3BXZA 3DM5A 4LYAA 2O8EB 2HYIC 3U6KA 1DAKA 1ZM3A 2ZRIA 1XPRA 1VYVA 1SXJA 2NIPA 1F6BA 3QSYA 1JAHA 1LB1B 4P33A 4Q66C 4EDHA 5J4VA 3LX5A 4B2LA 5CLQA 1AGRA 2JLYA 2BC9A 3KXLA 1SULA 1YZUA 3QXCA 3Q5EA 5JEDA 2VHCA 2G1KA 4D6PA 1XJ0A 4CEIB 1E0AA 4FI3C 2IYRA 4XWKA 2FU5C 3ZD7A 5GVRA 4XVUA 2IYTA 3C41J 2QMUA 2XITA 3IGFA 4IVQA 3BB3A 4B33A 4BZQA 4DRZA 4A8JA 5BN3A 3MWLA 1ETUA 4R7ZA 4I1SA 5EZ5A 1XEWY 4A0FA 3KQHA 2RAPA 2HXYA 1XBTA 2WWHA 4HAXA 1P9RA 2ANBA 4PPFA 4B76A 5F98A 2ZI6A 1YVDA 3NEYA 3AVXA 5AR1A 4AK9A 1G3QA 4IRUB 1N0WA 1FL9A 2AX4A 5CDFE 1WQ1R 1EFCA 2IL1A 1YKSA 4OQXA 1P75A 3TSWA 5TMPA 3VNUA 4GPTA 1WP9A 2DWQA 5DYIA 4QKQA 4ZKDA 4L5BA 3O8DA 3MJRA 1GL9B 3C4JA 2EU8A 4M0LA 3SNHA 4A1FA 5KO2A 4EPTA 4NYIR 5BN5A 521PA 3OFNA 3W5JA 1AGPA 1Z2AA 4MKFA 3PG5A 1GITA 1US8A 2LKCA 2ZYVX 3SYNA 3P27A 2AD1A 1FP6A 2IYLD 1UBFA 3DMDA 3FFBA 4GZMA 4PHTA 1MRNA 2AK2A 4LJ7A 4TSFA 3CIOA 5A5GA 1COWD 2C2HA 4OL0A 4RZ2A 4ZCLA 2CL6X 3V9PA 1Z5ZA 5E3HA 3LVRE 2IF0A 4QBIA 2VHUA 4IDNA 1CR1A 3R8FA 4HAUA 4TTRA 1PZNA 1S3GA 4BLOA 3IDQA 3TW8B 3TW4A 1CF4A 4B71A 3B1WA 4QJ3A 5CLLA 1Q22A 5JS8A 1LS1A 1OH7A 3PUWA 4GMDA 4TMVA 5E7MA 1IXZA 1TQDA 2GCOA 3OAAA 5LDDC 2WPDA 2C9CA 2BM0A 4MRSA 3W90A 3K70B 2EWVA 1KI3A 1R5OA 4XD7D 4BFSA 4AYTA 3PEYA 1G9XA 2EVWX 2NZJA 4B47A 2AKYA 5HE8A 1OIVA 1CIPA 3CUEF 4OHXA 3X2SA 5FPTA 1SXJD 1IJEA 1AK2A 1FMLA 1JPJA 3THWA 1UADA 3CH5A 1BMFA 1Y63A 2EFEB 3CM0A 3HYTA 5TY0A 3C7KA 2IS1A 2VP2A 1T6NA 3TKLA 1NJFA 2ZRBA 2ZUCA 2OXRA 4W5WA 4MGYR 3FKSD 1XP8A 2JLRA 1N0UA 2CHQA 2ZAOA 2ZU6A 1NY6A 3NBYC 4C0KA 1Q1EA 4Q7LA 4LPSA 1YQTA 4YMSA 4YMUA 1CR0A 2X77A 4JL5A 2GVZC 5JJKA 1Z6XA 5TB5A 2WJYA 1KMQA 4Q5IA 3MMPA 3NG1A 3F3YA 1NP6A 2BBWA 4LRWA 3K1JA 4G5QA 5CM8B 3N2IA 3W6NA 2OCBA 3CWQA 1KJYA 4LUCA 4FCWA 4EQ6B 3I5YA 4DLXA 2VYFA 3AVUA 3AVYA 2F55A 3C16C 5FTMA 4Q21A 2FF7A 3HR7A 2O52A 3QI2A 4KFUA 2QBYB 1LVGA 1D8TA 1VMAA 2R6GA 2FDCA 4HLUC 2F43B 2X1VA 4G01B 4URZR 2HDNB 3K0EA 2RHDA 2A9KA 4A2PA 4IW3B 1U0LA 2PT7A 1ZNYA 2C95A 1JBKA 2WAXA 3FDIA 4NCNA 3IEVA 3F8TA 2O8CA 3HWSA 3T15A 4NDZA 4QM6A 4IFEA 2JEOA 2OHFA 3B9QA 3OFND 1W48A 1W46A 3PCRB 3C15C 4MYTA 1RW4A 2HV8A 3QF4B 2P0EA 3CF0A 3LXRA 1RZ3A 2FFQA 2GETA 4B74A 3CRMA 2IYXA 4IHQA 1TX4B 3RHFA 1XDBA 2CE7A 3EZ7A 5L3SA 5B30A 3KKOA 3LW7A 4Q01A 4KXFB 2FEOA 4DBLC 3FFAA 4MYCA 5FOSA 2L0XA 4URXR 2ZJ2A 3QKTA 1SVMA 1OH8A 3TK1A 3VMFA 1HT2E 1KY2A 2Q9BA 2CL0X 2VIIA 1KI6A 2J0VA 3AUXA 3KTAA 3OAAD 2WPDD 2WKPA 5DHAA 3WHLA 4BLPA 3LW8A 5HKKA 3ZVMA 5EP3A 1Z63A 2GVDC 1M7BA 1R8SA 1SVLA 3FE2A 1SQ5A 2R6FA 1GSIA 2VF8A 2NZ8A 5F9HA 1U81A 4A0HA 3UPUA 4S35A 3U3KA 5GJVC 4M22A 5GVSA 4R71A 1YJ5A 1G17A 4E07A 2NPFA 1RE0A 2VP4A 3W6PA 2CCKA 2CLDX 1BMFD 3V4FA 1D9XA 3ND8A 2BMEA 1GWNA 1R5NA 2RKOA 2DFTA 4OJKA 3LO5A 1Q1BA 3CRRA 5JRJA 3FPAA 2YJTD 4NPHA 5K8LA 1M8PA 1Q12A 2H5EA 2OBMA 1G3UA 4GBMA 3AP2A 3FMFA 4W5HA 1OF1A 2Q3MA 1E9AA 1EGAA 1KMHA 2A2ZA 3L0PA 1P62B 5L3QA 3I62A 3VR2A 4PANA 4I81A 3ZD6A 3Q7PA 1JQLB 2CHGA 5TVKA 5J5CA 4LV8B 2GK6A 3SJAA 3ZH9B 1UF9A 1RC8A 2IXFA 3TUZC 3ASYA 3FMOB 1N6LA 5AJZA 4DCSA 1GNQA 4GZLA 3UWKA 3GLGB 4FN5A 3MD0A 2WIAA 5FR2A 2V3CC 3T5GA 1NRJB 3DL0A 3U7FB 4LBWA 2DCUA 4C3ZA 5FL3A 2K5UA 4QGAA 5FOTA 5CYOA 1QBKC 4P4SA 5IK2A 2FZ4A 4TZ0A 3GD7A 2ZYUX 4CVNA 5JBQA 5GJCA 1KYIA 1DAFA 4L9WA 1RPZA 4DLTA 1FX0B 1H8HA 3LX8A 3PV0A 3K0AB 4IDHA 3UK6A 4II7A 2OT3B 5KSPA 1R0XA 4HB0A 4F92B 5JI3E 1ZD1A 1KO5A 2W00A 1JQJC 3W8RA 2F1JA 2PMKA 1LS6A 2VLIA 2W83A 2PEYA 3MWKA 4DEYA 2QSZA 1II0A 1XNJA 3LRPA 1HT1E 3SHFA 3PR1A 1HE1C 2GDJA 2RGNC 3B85A 4M1KA 3W3AA 3KKNA 2QAGC 4PTLA 2XNSA 4QNRA 2ZJYA 4HDCA 1FUUA 4KODA 1G291 3OIYA 1UBGA 3JVUA 4MGZR 1D6JA 1KNXA 4FWTA 2WOOA 3A1VA 1TTTA 1G8HA 4YMWA 1W5SA 2QU8A 2GA8A 3NXSA 1H8EA 1VG0B 2V55B 2J0SA 2BVNA 5G41A 3WYAA 4PX9A 1AZTA 1EFTA 4IKEA 4KLNA 4UXIA 4GP7A 2KE5A 2DHRA 4UNSA 3TAHA 3MAAC 1XMSA 3GPLA 3E1SA 2ZRDA 4QXAA 4C0BA 3EXAA 4ON9A 3P32A 2HF9A 4YC7A 3RDPA 2E87A 1CJVC 2PZEA 4YMTA 2XZOA 3I3SR 5EP4A 3L0IB 3F0TA 3THOA 1ZC4A 4Q02A 2R6DA 4Q47A 5FR1A 1W7AA 4OBEA 1G18A 2WAYA 1KI1A 4OQNA 1UBCA 3SZRA 2ZJ5A 4TYWA 2WICA 3KJGA 4PO9A 1NG1A 1VCNA 2OCAA 2ORIA 1GUAA 1J8YF 1G7TA 1JR3D 1P2UA 3BAFA 3T34A 2IYQA 3NTUA 1BH2A 1U94A 1ESMA 3QG1A 3OHMA 2FPLA 3LDAA 1XD2B 2ZUBA 3QKRB 1U8YA 2HT6A 4LCBA 4RCYA 2GJKA 2OESA 2C96A 2VP0A 2D74A 1P2VA 4PPQA 3ICEA 1NMYA 3BOSA 4NTZA 4OI4A 8OHMA 2GJ8A 2RCNA 4DLUA 1XZQA 1W44A 5IK2D 4Q1AA 1OLOA 3EW9A 1EFHA 2ZRLA 1KGDA 3PQCA 4M53A 3TSOA 1QG2A 1BYUA 3KQLA 1H8HD 1Z22A 2XEXA 3H2YA 4UNNA 3D3QA 1E2DA 3RC3A 4NBSA 2XJ4A 1Z0IA 1X86B 5J4YA 3ZQJA 2O8DA 2H18A 1P5ZB 2IHYA 2SHKA 3L43A 1E0SA 2ZE7A 3BIFA 2B92A 4ESHA 2WIBA 2W2XA 3NH9A 4Z8YA 2OLKA 3ZZTA 1MRSA 4QL3A 5KDDA 1EX6A 2KBFA 1YHNA 5AK0A 3GLIA 4PO8A 2F1HA 2UZ3A 4DT1B 4LDJA 2B7BA 1E32A 1S9HA 2FV8A 1OYWA 5FOUA 4B44A 4BFWA 1UFQA 2PMDA 3Q85A 4UJ5A 4HB3A 2A30A 4P0TA 2A7QA 2YOHA 1NVWQ 3TUJC 4UXJA 1WBBA 3H86A 2GRJA 1P4SA 3AKDA 4OHVA 1MO6A 3A37A 5D3MA 3WY9A 3A1SA 1MO5A 1IN6A 1NVVR 5SZKB 3IBYA 1DVRA 3VFDA 5E7IA 4DHEA 1G21E 1NN5A 4DB4A 3NBXX 5LB2A 4U00A 3CW2A 5J40A 4Q4AA 3WP0A 3G82C 1S1CA 1T9HA 4D80A 3WP1B 4B43A 2ZRGA 2E1RA 4LJ8A 4OK3A 3J81k 3K70C 5B2ZA 1CJKC 4URUR 2WWYA 1XXHA 1F2UB 4FMCB 2WHXA 1II9A 3IBGA 3T1TA 3I8XA 4C7OA 3H84A 1XEFA 4KVAA 4PQYA 1RVDA 5FBLB 3W9YA 2QROA 2R6CA 3QXJA 5CITA 2ZR9A 2OFWA 1IHUA 3GCGA 2XTNA 1Q21A 1TNDA 4HSEA 1L8QA 2H16A 3B8HA 1X6VA 2V7QA 3DEFA 2YINC 2WSSA 2ORVA 2WJJA 3SYLA 1JR6A 3RWOA 2IUTA 4QGFA 1OYYA 2BEKA 2QM7A 2ZTSA 5HE9A 4QC2A 3R8CA 4DEXA 4B2IA 4DSTA 4LJYA 5SZIA 4CEJB 1YRBA 3WNBA 3CRQA 4RD2A 5C2JB 3BORA 4RSGA 1A1VA 3RS7A 3TQFA 2Q6TA 1KDPA 3PIRA 5JSZB 4V0NA 1P2SA 2ZQ5A 1CJMA 2XNDA 2BOVA 2A5FA 2IYUA 4PO1A 2HT1A 5EQTA 3P26A 2EYQA 4CEHB 2VSOA 4DCUA 5AJYA 1XCPA 1N6IA 2QPOA 3SJZA 2X19A 1IOZA 1G3RA 2P5SA 2VEDA 1E2HA 5KNCA 1EWQA 4G0NA 3R20A 4H1VA 1F60A 1VTKA 4DZZA 1NBMA 4AURA 4RJLA 5FBVB 1OB2A 3GLIE 2PX0A 2BHRA 3QKSB 2FN4A 2CMKA 2HCBA 3RRZA 2ZR7A 2EQBA 3B1VA 1RJ9A 4PZLA 1D5CA 1XTJA 4MQBA 1JJVA 3AKEA 1UKYA 1JJ7A 1KDTA 1TEXA 3RABA 1A4RA 3U3MA 3THYA 1MABB 1SKYE 3AF1A 2IYVA 3LFUA 4PQFA 4Q9LA 1FW6A 3FHTA 3UWOA 3HR8A 1YZLA 4ZCMA 1N0VC 1ZC3A 2QMEA 2WM9B 4F38A 4JLNA 4DUGA 3AVPA 2ZI7A 2FFHA 3A4LA 3ZDQA 3WXMA 1P73A 2W6IA 5EUQB 3PUYA 5KPDA 2JAQA 3S1AA 1XXHE 2ZRFA 1G8GA 5FOXA 1EG7A 3PUZA 1N6KA 4Q00A 2CHVA 2QORA 1YZQA 1XTIA 2GCOB 2ZR0A 4Q7KA 4QM7A 3V4RA 1A82A 1NG9A 4XVQA 4TQAA 3BD9A 3IO5A 4Q7MB 4BE7B 2ECKA 3MFYA 1SVOA 1JEDA 1CS4C 4FCTA 2XTMA 2F9MA 2V7QD 2WSSD 2QTFA 1E9EA 2IX3A 1KZGB 2Z5FA 4IOLA 3DOEA 4EFMA 4WA7A 5HZKA 2OBNA 2GZHA 3KX2A 5F3WB 2B8TA 2P6UA 5FTJA 5LB4A 4US2R 2ZJZA 3GJ6A 1P2TA 4CF7A 5BYKA 4QNMA 1W49A 3Q72A 4HATA 1KO4A 2PH1A 3CF2A 2D4HA 1U8AA 2E9SA 3CNLA 4OQFA 4WZAE 1Z0DA 2OSBA 1W36D 1E2LA 5H70A 4FMCF 3PEVA 2AFIE 3AM1A 2XNDD 2W2TA 4TLBA 4C4PA 1G41A 2WZQA 1NJGA 2QM8A 3MWYW 4MRPA 2JDIA 1S1MA 2WBLC 1F48A 3RSOA 1Z6YA 3CF6R 1R5BA 4LHZA 4HDOB 5SZJA 2ZUDA 1F2TB 1XD9A 1ZUNB 3RS5A 1DAMA 2Z83A 2CCJA 4V03A 3DMNA 4GP6A 1QHNA 2ATXA 2J0UB 1NBMD 4RZXA 1QHHA 1KJZA 1AKEA 1ZCBA 2EWWA 2ZRHA 5CDFA 4EPVA 2WJVA 4WXRA 3R9XA 3KUCA 1AN0A 4QJ5A 1E9RA 1E99A 2XZPA 1QDEA 5ANRB 2OCYC 2QQ0A 4B3XA 4ZV4A 4PZYA 3TLXA 1E9DA 1ESNA 3QUSA 3VU9B 1SZPA 1E2EA 2Z43A 2PX3A 1AIPA 4DUGD 3RRNA 1TL7C 4YXWA 5L3SB 1LTQA 5FBQB 3SHWA 3EARA 2QI9C 4P31A 3R7WA 2W6ID 1J99A 5FBRB 2A5DA 2YC4C 4Q4HB 1T0JB 5P21A 4Q1DA
chains in the Genus database with same CATH superfamily
4NOMA 2R7KA 3KSRA 4H0CA 2TECE 4ACAA 1NYRA 4D0GA 1EX9A 4I9FA 3JQRA 4NICA 2IS2A 2HPZA 4KZPA 2CUKA 3LDGA 2V1UA 1FYWA 5IM5A 1ID1A 3ZEAA 3NTOA 4IMPA 4RY9A 4G81A 1LFAA 1FP4B 2R00C 3AUAA 2K87A 2X13A 3NVAA 1DKOA 5PNTA 4P84A 1SXIA 1V5EA 4P80A 4IVRA 4X71A 1FVOA 4BO1A 5JCJD 2O8FA 4RFSA 1AT1A 1EEXB 2Y3IA 3T7JA 4U3JA 1JQAA 3NUGA 2D7CA 4C0LA 5HM6A 2WV7A 1YQDA 3JQ7B 4K2HA 4OJQA 5TGDA 2GXAA 1JZSA 2J9ZB 1JPNA 4G5OA 2Q6IA 2JLXA 2QXUA 3ZV5A 3ZZUA 4CMKA 2XKKA 5G40A 4F7WA 1GTJ1 3NB0A 1D5WA 2FE4A 2QF7A 4ODIA 3I9OA 2IH5A 2BFBB 3P9CA 5FOVA 1A9RA 1BEZA 2NV0A 1TU3A 2VT2A 3DFFA 1IWOA 3E4CA 4OXNA 2CXHA 2BIFA 3A3OA 3HGTA 4I50F 2DMRA 4I9GA 5L3QB 3FRIA 4N47A 3URMA 4P1ZA 4GMHA 3INGA 3KRTA 4GICA 2F17A 2C8LA 5BVHB 1EAYA 1BFDA 1JHXA 1KR2A 2QP9X 1DG1G 1PGJA 3WKBA 3VU1A 3EFOB 4CM4B 5BSKA 2XADA 1A8UA 4N12A 3O3MB 4EO4A 5LD2C 1XRMA 3H1PA 1IBKB 1KU0A 1VFNA 3GL9A 3ZWXA 2V0GA 1GXSB 3OPYA 4TYYA 5LP6F 4QELA 2G8NA 5CXUA 3OMWA 4JBWA 2ZFUA 2C98A 4TX1A 2WFLA 1L5MA 4Q3CA 3OX3A 4TS1A 4N03A 2CXPA 2A0WA 3OSZA 5B1IA 4BVHA 5ALNA 1H0SA 3WMGA 5AOAA 1X13A 1EP2B 2FG5A 2GD2A 2VAWA 5TGZA 2CLFB 3TBKA 2N75A 3VRHA 3F7NA 5DVZA 4KQJA 3LQKA 4EAAA 2WU0A 4PLYA 5C7OO 1KI9A 1PFYA 3GLUA 1K92A 5FUYA 3LYLA 1IE3A 1X9GA 3EGXB 1G4HA 1ZS9A 2RGXA 3HQ4O 3R5SA 2EARA 1MQSA 2J6CA 3LMKA 5EIFA 5ICCA 5CA0A 1A8IA 1LKZA 3OO1A 4DILA 3NDBB 4FJ1A 1B0UA 4UU0A 4R16A 4J91A 4INOA 4DLVA 1QYVA 2IW3A 1XMXA 3ZE2B 1ZD8A 1OXSC 5ULLA 1B1AA 3HH8A 5DMHA 1DB3A 3L7MA 3CYFA 4HMPA 4NV1A 4O1IA 5LMCA 3TNYA 4E5YA 2LKDA 1MX5A 1OU4A 3H2BA 3GZNB 3WIVA 2XBUA 3BD7A 1HSOA 2VWHA 3DXYA 5TS3A 1ND6A 4L50A 4R8LA 4B3DA 4CLEA 4NZMA 5CFPA 2PDAA 3HUEA 4HAWA 4P3YA 5IARA 1CRLA 1L5RA 4H35A 1G6OA 1U3FA 1U5BA 1YASA 1YU9A 3ITNA 4JQOA 4C7MA 3N0TA 2FR0A 2YXBA 5EHNA 2NZUG 4D9MA 4HEJA 5JSQA 2NTVA 1ZOIA 3GA7A 5EL0A 1I6WA 4MARA 1NAIA 4BEBA 4PVDA 4AKGA 5IMBA 3FLBA 1E5DA 3BULA 5K3OA 1M2KA 3U26A 3G5UA 2WJ4A 3NHBA 2FHSA 1II8A 2XKJE 3K5WA 2ORYA 4H1HA 4F06A 2IBSA 3ME5A 2RHWA 3MQ2A 3WFZA 1SBHA 4BEWA 3JAKB 3BGVA 2I3GA 4Q0MA 2FEXA 1JVSA 1T5OA 4KGVA 1KVSA 2ES4A 4IG4A 1L4UA 1Z12A 1Z62A 1BHSA 1C3LA 2ZTLA 3PPIA 3QJYA 4JUAA 1ZHHA 1MQ9A 3P20A 1J21A 3QP9A 3T1OA 5I4BA 3ADCA 2FSGA 4U0JA 3V7UA 4AF6A 2PUCA 3GC6A 4ND8A 3WTCA 5IVIA 3PFKA 3I6ZA 3RTBA 1DIAA 5JSKA 2JFPA 2V58A 3B13B 2RHLA 1RMTA 3BZBA 1PGPA 4AFNA 3Q1KA 1E3QA 3HB5X 3M9LA 4YBRA 4M0FA 3TR5A 4AIRA 4YEDA 1H9AA 2Y0BA 4HLNA 3W5CA 2QENA 5KTMA 2OAQ1 4FEYA 3NIFB 1Q0QA 1XAIA 4I8XA 1R5JA 4J0IA 4JROA 4DWVA 5LIPA 4IJUA 3C5WP 1ENPA 4WK2B 3GK3A 4O2AB 4Z51A 1KQOA 4AULA 2O2SA 2YNMD 2D7JA 2UUOA 1JU4A 3ADDA 4NJEB 5H8WA 3WTBA 1L1QA 3F98A 1PGOA 2H2GA 5FUWA 3MVEA 3TJMA 4BXOB 4D25A 1F17A 2JLUA 5JU6A 2JAHA 2I2BA 5K2OA 1O0CA 4C05A 4FK8A 2J87A 3H2IA 3DYVA 2BKLA 4RK1A 5H68A 2YH2A 4A0GA 1BE0A 1VJ5A 2AJLI 2EHJA 3K0FA 4R0VA 4TS4A 3SZMA 4JU9A 2JBAA 4B1FA 3OE7D 4FFOA 1ZVVA 3TJZA 4OIMA 3MMZA 2RGAA 3K0BA 1BH6A 3BRSA 2VH5R 4NK4A 4JLJA 4U6SA 2WJZB 5DNWA 3UPDA 3KZKA 3X2EA 5TEVA 2VXBA 3JALA 4ZT7A 2FX5A 5TLSA 5BQPA 1RQLA 4BJ5A 2VHEA 2CEAA 3PC7A 4AN0A 5GIPE 3DKPA 1OE0A 3RWMB 1Z0AA 2IHKA 3OM1A 3RYHA 1UINA 1QYXA 2Q3LA 1ADCA 5EIXA 2A84A 3EEYA 1J8DA 1PF7E 1TADA 4NATA 2WVHA 4JUCA 5M04A 2VNHA 4ES6A 1GSHA 2VRWA 5JECA 1G0OA 5LZ2A 1K2VN 3ENVA 3ETDA 4CV3A 1FP2A 2IYEA 5BN4B 421PA 1VPLA 4WDQA 4HSGA 1XZ8A 2G8LA 4G41A 4H59A 3PPXA 3CKLA 3STXA 4B83A 4MNTA 1ZESA 3A05A 1S5PA 4B75A 1TF5A 1I10A 3HB7A 2E3JA 4S24A 5KHAA 4JT2A 2ZYAA 2JGKA 4YJ3F 2P6MA 3VH4A 3C7DB 4LX0A 2H92A 2XY4A 2RSLA 3AJAA 3IA2A 4K87A 3A1DA 3GX1A 5SYMA 3JCZA 2YFYA 1E7WA 1XPJA 2ZW9A 1T2FA 2JI7A 2W2NA 4ZVTA 5D6NA 2BZ0A 3HZZA 4IF6A 4NVRA 3VTZA 4EB6B 4MUIA 4RKRA 4L16A 1TGVA 3KXIA 4QJ4A 4BRUA 4Q4AB 3VJRA 1GTG1 4NE9A 1X39A 4NG5A 3IEXA 3D3EA 3AWIA 3SN6A 1KOGA 2DFKB 4J1TC 3WWOA 2G70A 3TKAA 1TQ4A 2VJQA 1EFRD 2J9YB 2FR1A 2BEWB 2C04A 2A1TR 1DLJA 1NW3A 5E7JA 2OZVA 2HNAA 3NBQA 4KYUA 4ZCRA 1YONA 1DCFA 2HMYB 2I6FA 4HOYA 4J0EA 3TOSA 5A3RA 5LXTB 2JKZA 1KYXA 3MQ4A 2DTEA 3NTVA 3NHPA 1R0YA 1G16A 5ALWA 5JDCA 1TVMA 1H2AS 1ZGZA 2CNLA 2JHGA 4RZIA 3ENQA 4QPZA 2JD0A 3W9UA 5EJEA 3BSWA 5DN6A 2QIOA 3TVYA 4TGLA 1X42A 2PQ0A 1FB5A 1E18A 1E1DA 3NT5A 3WLMA 3FMGA 4YCNA 1Q0UA 3L77A 4CFYA 5LYJF 1IUNA 2OHGA 1HE3A 2FN8A 2QSYA 5H82A 4P83A 4IXWA 3RS3A 3GCDA 3MSCA 5IKMA 1DWUA 1P4JA 1W5TA 2XSZD 3CX8A 1N3YA 1H6BA 1S89A 2C42A 1P2GA 3DNMA 5ALSA 5ALPA 3V1UA 3IMGA 1U9YA 4YDSA 3SOZA 3M0EA 3CBGA 1O08A 4OGGA 5BUZA 3ZIUA 4K6FA 1U3WA 3AHHA 1UMDB 4PSDA 1KVTA 1ZU5A 1E1LA 4JDPA 3NAGA 2Z4TA 3FAKA 4U2KA 2W6PA 4OUDA 4YIKA 5AWFC 3F90A 3GLRA 4CEIA 5LOVF 1MIOB 3U3RA 5KB3A 4QPDA 4MUKA 4OLBA 3ICVA 2VZ0A 4MSUA 4H0NA 3VPHA 4B8YA 3KKZA 4M8LA 5AXAA 3C8UA 5TMDA 1HGXA 2C2BA 4X93A 5ICFA 4ALNA 4OH1A 2P1ZA 4CW7A 5JI2E 5JDIA 1NM5A 3O8BA 4OPMA 3WKDA 2IYNA 2ONCA 3C24A 3D7MA 1F2DA 2WTMA 4EG8A 5GMOA 1EUQA 1TOAA 5KWSA 3PWZA 1UFKA 4DAEA 3G8DA 1GT6A 1O94D 2CVOA 2ZUWA 3IRVA 4JK3A 5DE3A 4ENQA 5JVDA 4D2IA 4QUGA 1YO6A 3OQNA 2FZWA 4HDSB 2FQ1A 2HA7A 2DJ5A 1K6EA 4UM8B 1UBTS 4EI7A 4R1OA 1QE3A 1AURA 3KM0A 1NXOA 4O4IA 5DTQA 2C82A 5EZYF 2IKSA 1SCBA 1WVMA 5DSTA 2EJWA 1YVEI 3UH0A 3FVTA 4QPNA 5DP2A 3PKIA 5ESXA 5TC4A 2XD4A 2G77B 5F9FA 3CZRA 2DP4E 1HDYA 4US1R 4U02A 1RWXA 3GT7A 2ICAA 1BFKA 1ES9A 2GN8A 2B8JA 4K9MA 4DCOA 5IYZA 1ORIA 5HKKD 4BBJA 2J7KA 2H8GA 1T4BA 1EXMA 4B3FX 5E9JA 1C9EA 4IDGA 4L15A 3PXDA 1Y5MA 5DTMA 4U2GA 2VSNA 4C9BA 5BUQA 3OE1A 5AW2A 1DAIA 2O2IA 4B3BA 4TMXA 2X1MA 4M8KA 3SZUA 3FCAA 4A5SA 4L4SA 3VYTB 2OPHA 1JT2A 4HH4A 2YRFA 1G20B 4AC9A 2ZIXA 3M6XA 3K32A 4GHWA 1PZGA 3ETCA 3V1MA 3AERA 4QUKA 3W8FA 1U7PA 4RFVA 2OXIA 4PNZA 4F9TA 2P4QA 1WMDA 4RMHA 3MN1A 4YJGA 1EKXA 3IH5A 3E0QA 4ZCQA 4C7BA 2VQ3A 4D45A 1DWQA 3HCCA 2VQSA 1VPEA 4UTVA 1I1NA 3E7PA 4EA9A 3B2QA 5AKLA 1Z0JA 5CEEA 4FHFA 2X3YA 4BZZA 5DM70 4DCGA 4G89A 1SC3A 1Q17A 5EXXA 3U3ZA 2OO3A 1F9EA 4PW0A 4G0ZA 4Z8XA 1N78A 4ZPJA 4LDZA 3IILA 4G3XA 5DTJA 2XYPA 2KX7A 2X9NA 4D96A 4NR0A 3VHXA 3U56A 3EJWA 3PA6A 4J16C 1Z17A 4S1TA 1SD1A 3OC0A 3T0FA 1RLUA 4UOQA 1B3RA 1EFKA 2I2AA 1FA9A 4ITRC 4A27A 4WE3A 2GESA 1ZWKA 3JZIA 1R1DA 2V7BA 2X0IA 4GMFA 4JNKA 4XB6B 4ZRMA 5JZVA 3PSAA 4IQGA 1G1MA 2V7GA 1E20A 2NXEA 3GRCA 1F0PA 3BS4A 3IT2A 4B3MB 3T9CA 1D03A 1EWYA 1IEWA 1TUGA 4OQMA 4ALIA 4YJ2A 1OHHA 1M54A 4NIMA 4HRAA 1E77A 3GUZA 3MPOA 1X80B 5JQGF 2GF0A 1KS9A 3IAAA 3JD4A 4WZZA 1DJOA 4DV5B 4BNUA 2J3JA 2RHHA 1N2CE 4IUDS 4M0DA 4C2UA 1XQYA 1A98A 4GKAA 4P7JA 2QRVB 3B9PA 2YV5A 1QZTA 5E3IA 1JR4A 1VHJA 4GLJA 4CZ2A 5FOQA 3PGVA 1DOHA 5L7TA 4K0RA 3F97A 3B1XA 2C9DA 4OV6B 4UULA 1M6NA 1CK4A 4IHAA 1THMA 1T8TA 1UBEA 3HKDB 3NT2A 4V39A 3V3KA 4JUBA 3SBOA 2WYVA 5H9WA 4GI3A 1PJAA 2GRAA 1FMFA 2NP7A 5FFMA 2Z1MA 2OFPA 4IWXA 5J47A 2ZDQA 3KJHA 3A7EA 4EG7A 1NJ2A 2WYUA 3L40A 1U0RA 2B7CA 4I4IA 4OAPA 5FLKA 5JMOA 1X1BA 4BECA 4J9VA 4RMNA 4I3HA 1XWIA 4J0GA 4DC0A 3WGIA 1PUJA 3JQFA 3KQSA 1N8SA 3JD3A 2Q4EA 2D7DA 2WTUA 3QVGB 2FX3A 2BFDA 4X1YA 1UDXA 2QXTA 4LWZA 3Q0EA 1ZA1A 3OE5A 2COKA 3QWBA 4ZZIA 4DPKA 1CUSA 1KAOA 3DM9B 3MS4A 1E0KA 1VQ1A 2BCGY 2HZBA 4GI5A 3UFXA 5CYFA 3U3OA 4TKUA 1HQKA 3TOXA 3ZBUA 2BGLA 3EZ9A 4MGEA 2PMWB 1RRPA 2COEA 2ZT8A 2NUAA 1FEZA 1OZ0A 1RQ7A 1KFJB 2PK3A 2I87A 2XWSA 2XUQA 4TUYA 4YK7A 3S70A 4MWCA 4URWR 5JPCA 5DTIA 3IULA 3MWDB 1ZVQA 3UA4A 1XNQB 4WZBE 2QJTA 1QMPA 1BGXT 2ZWVA 3AZQA 4JBNA 4RPGA 3V1YA 3ZWDA 3MINB 2WR8A 2JI4A 2BFNA 3OWXA 5TX7A 4NMXB 2VLBA 1YBMA 1C0KA 4RY0A 1O9BA 4RVSA 4PLHA 3ZLBA 4YS6A 4DDMA 1XNGA 1OXVA 4FGLA 3BGWA 2G80A 3GJ7A 1O6GA 2JIDA 3NDIA 1GPMA 2WUFA 3Q9NA 4BNWA 3DPIA 3FWYA 1CWUA 4QG7A 2HSGA 1DDOA 5C5IA 1UZAA 3GMDA 3OBIA 4WXEA 1G2IA 1V11A 3N2NA 4V38A 4BL5A 1F06A 1ADJA 4TKMA 4OKNA 3P9RA 1Y5LA 4BO6A 4YQFA 1DBSA 4MS3B 3U39A 3Q40A 3KZVA 1G6HA 1QK4A 1B76A 2QT0A 1MB9A 4HNGA 2GEUA 4KIWA 3VR3A 1T91A 5AVZA 3TRKA 3BJRA 5BN3B 1PQUA 3K31A 4I4CA 2IBMA 3TX6A 2FMFA 4FOOA 3VSAA 1Q3KA 1WDTA 4CLRB 3E9YA 4HRXA 2H8KA 1YMVA 2PV7A 4ZAZA 1VOTA 4BMCA 2AFIA 2I8CA 4G5XA 4PAWA 3O1JC 4G8JA 4Y18A 3K35A 5F76A 4ER5A 2EXXA 2PJRA 1VL8A 1YRQA 3K5IA 1HUQA 3C5HA 4NZZA 3KSUA 4UE2A 2Q5QA 5LA6A 4I1YA 5HMMA 4EVIA 1XRQA 1CDZA 4JOCA 1R0BA 1LX6A 3QW4B 2Y99A 4IGIA 2IHZA 3ZV4A 1SG0A 4FGZA 4Y7DA 1D1SA 3EMDA 4XTRA 2EFJA 1AU9A 5JXWA 1AJEA 1CKEA 4PSVA 1V4VA 1CG6A 2J46A 2E4XA 1PQ4A 2I65A 5EWJB 4IIFA 4EZEA 5AM3A 1F3LA 4NCJA 1MJFA 3DMPA 1FFXA 4EHAA 4NYMQ 3U7IA 3EXFA 3CKYA 4V1CI 4JLBA 1XZIA 3G5AA 1UBMS 4GZ6A 4FSDA 2C5FA 1BHJA 2QE7D 4HEHA 4KFTA 4QDJA 5D8DA 3C1UA 1VDMA 1C0LA 4IXDA 4IYJA 4WOBA 4HBZA 3K0AA 4D9KA 4ZZ3A 2I29A 4NFHA 2HL6A 1RP1A 3QQ5A 1C9MA 1EDDA 1GKUB 1YFKA 4K2AA 3OESA 4CMIB 2XQFA 4IFBA 4NS1A 4Y6OA 1NF3A 3L2OB 1L4FA 3SIWA 2P7HA 2B1JA 4HQFA 5C51B 4AVYA 3UBTA 3WYBA 4C0SA 1T8UA 3ZWOA 3FSGD 4IH4A 3EGOA 2QVXX 3ZDFA 1XVIA 4H1UA 4O29A 5HCIA 3BUSA 4OI1A 1M7GA 1NZFA 1B4DA 3KLNA 4XASA 3FB1A 4QD3A 1SUSA 4Z3OA 4C4ZA 5FWYA 1Z06A 1I2DA 1JFSA 2CLEB 4XARA 2JHAA 1CD5A 4AKHA 4LY3A 4XUGB 2G17A 3L7OA 4RPIA 1JYSA 3GV0A 3LX6A 3B51X 4DHWA 4TWBA 1FQWA 2O8VA 3ORFA 1NVDA 1AF4A 1Y7IA 2BL4A 1M2HA 5CVDA 1GPKA 2NSYA 4EI9A 5CT5A 1E62A 2AXQA 4UUQA 1ZG3A 2NZWA 3AW8A 3MSXA 3THWB 1DOAA 1E1QA 1KEWA 2Z58A 1N7IA 4BMSA 4CNQA 5AQEA 2R00A 2A0UA 2YXNA 4G5RA 4OQZA 3W2FA 4KQIA 1KZ1A 1QGUB 1TLLA 2CFOA 2DPYA 2E0IA 1RABA 2HFKA 2P3LA 4ITUA 3ZV3A 1JSCA 3WYGA 4C88A 4A15A 3QJGA 2AT1A 3GJ3A 1OLUB 4QPPA 2WQ6A 1PYOA 2C3PA 3GGPA 4X95A 3IT3A 4ZCTA 1ATIA 3D1VA 1ZIYA 3U9SA 2VBIA 2ODEA 4Q9KA 1N9GA 3ZOZA 5HWSA 5AM2A 4HDAA 1BMTA 4MI1A 4WAUA 5EKXA 5JWRA 5LZ9A 4I1OA 3WGGA 4F96A 3FOFC 3ASVA 3E8XA 3RKRA 1UEXC 2VTBA 2W4MA 4H7IA 3TZKA 5KNBD 2IY7A 3KT6A 1DKMA 3H5LA 1PYDA 5JY1A 3E7XA 1U8XX 2QV0A 3O47A 2EEPA 2WMNB 3O38A 1CUAA 4QOGA 4RYDA 3SPXA 1SCJA 4D4LA 3KO8A 3ZJVA 1QDLB 2FEMA 3FNGA 5K05A 1PFWA 1OMOA 5C46F 4G07A 3ORYA 3C3YA 2NO6A 2Q21A 1JDZA 4FFRA 2HBYA 4U7DA 4PNHA 4QASA 1R7RA 1S7GA 1ZEJA 3OZBA 3R7FA 5KDOA 2ERCA 1N1MA 2ZPUA 2YV3A 2CZCA 3I1FA 4PHFA 4F3NA 4QFBA 2PLRA 1PV4A 2UUCB 2I91A 3IDAA 1QHXA 1VKJA 2IYSA 4FMDF 3I5UA 4H6PA 5DXJA 3WV4A 1W76A 3ASUA 2AOTB 1I51A 3EVBA 1O97C 2UZ0A 3QBTA 4I4LA 4JAVC 1U98A 4GWLA 1KNQA 4H6WA 4QEKA 5EE9A 1NFRA 3RRFA 5K20A 1PCXA 1NY5A 1WCYA 3KYCB 3TLJA 1GKLA 2QJFA 4TWRA 1E2PA 3RJTA 1DTWB 1E2QA 4ZVVA 4KUHA 1UC4B 1LA2A 1QFZA 2K7ZA 1U3VA 3FZEA 3HJUA 4X3OA 2NVBA 1SQFA 4CMHA 3HO8A 4BNZA 1WAMA 1SD2A 2HU5A 1PJLA 2W2LA 3GNTA 2IZ0A 2FMIA 4CRWB 4PN7A 5BWMA 1RFLA 5BXQC 2HA6A 3MBKA 1QRUA 1MT0A 2OBXA 1PL8A 4FWIB 4N6NA 4GMKA 1K7EB 4LZNA 4RTJA 1DKRA 1QAQA 1NQOA 2BBSA 4DIEA 3EY4A 5FV4A 1ZCJA 1ZJYA 2JGDB 4PG5A 2IE8A 3ACDA 4D0RA 1NWHA 2HUNA 5J9FA 2HPAA 3PUXA 2QSUA 1J20A 3JAMA 5EFOA 3GQBA 3CPEA 4S2EA 2HM7A 2H5IA 2ZAIA 1TYEB 1DAPA 1N32B 2PZBA 1X8LA 2H2IA 4L8LA 4OHOA 3Q3CA 2P6NA 4PX5A 2G0AA 5E4FA 3OZTA 5A7GA 1YVUA 3OUTA 3BH6A 1O57A 4HXGA 5IJWA 4IDFA 3GJYA 3KZCA 2HX1A 5C5EA 3AOEC 3ZCPA 3LUJA 3PNSA 5SICE 4YLYA 2AG0A 2QGZA 4C6TB 4O3MA 2WLSA 1HZZC 4DARA 1N7GA 3EQ7A 5DYYA 1EXVA 3I37X 1N5RA 2W8BA 1M2NA 4HS9A 4LJRA 4UARA 1NI4B 3U7HB 1E58A 2P9ZA 2WB4A 1KMHB 3GUCA 4UE6A 3CZCA 3VR0A 3V97A 4RDCA 3WGVA 2ZQZA 1VXOA 3RT1A 4FDUA 4IIGA 2ZE6A 3PFBA 3H6HA 3L0BA 3TR6A 4JVSB 4IOKA 1U9IC 4JBXA 4KO2S 5FPQA 1NN3A 3V8BA 2GBCA 3NDRA 2MR6A 3S27A 2PZ8A 3KLOA 4PLTA 2FOLA 2ZI4A 1VJTA 1TF2A 3BA1A 1YZNA 2NZYA 1TDJA 1WNFA 1A2KC 2G5CA 2WVAA 4KAAA 5JD3A 3HPRA 2C59A 3R09A 1DBVO 2XVAA 2AA3A 4BOYA 5HCNA 4G85A 1EB8A 6REQA 3FKSA 3U5ZB 3VNSA 4CIAA 3LCJA 2P69A 3ML1A 5KSZA 2EKLA 3L01A 3COPA 1PZXA 3DE0X 2BMVA 1TMKA 4BJ6A 1O4VA 4N0MA 5L3RA 5U4XA 4D8VA 2YVUA 2R85A 4NBLA 5KQPA 3ESXA 3RAJA 1HF3A 4WERA 3A6JA 5DM60 2B20A 4YAGA 3JTMA 2PX6A 3EIHA 4PEVA 1IY9A 1GGVA 1ECJA 4MW0A 4LCEA 2V03A 2IV7A 2PGJA 3F5QA 1ZX1A 3ZBQA 4P93A 2OP1A 3B3JA 4MQEB 3NHAA 4IAOA 4YXWD 1JQBA 3A1UA 3GELA 3DS8A 1VCHA 2OUKA 4RD6A 2F3PA 3ISVA 3RUPA 4PX2A 4HG2A 4XLTA 4ZANA 2IKQA 2ZT6A 4INAA 1UZUA 1ZH8A 1LSUA 1NUPA 2H1FA 3L7DA 5JROA 2FZGA 4TQ9A 5AD1A 2IHBA 2BELA 4OYLA 3B9BA 3OJXA 3TBFA 4D81A 5JH7F 2HJHA 4GRAA 1MABA 4O4LF 4LJ5A 1GTMA 4L3OA 5E2BA 3VR6D 5JJIA 1URPA 4KFCA 1M73E 2XMRA 2WHQA 4WKCA 1Y3AA 2PH3A 4OK6A 1N5LA 4XB1A 3TQQA 3TRJA 2OO5C 3KKPA 2DWPA 5K8VA 2XGGA 3H05A 5JNTA 1O6FA 2O2GA 1B0AA 4AP5A 2FPPB 2YHIA 2ZDHA 4KHZA 3WK6A 4ZYTA 4MH0R 5ED4A 1JNYA 1HE8B 1R9JA 2C9YA 2X9GA 1RM3A 3BHIA 4CMJA 3BDAA 1RLTA 1P5JA 4KK3A 4M0PA 1JEAA 2P4SA 3P4YA 1YQGA 5AHKA 5FWDA 5AXCA 1KBQA 2EZUA 2J59A 3N2YA 4UKDA 3ZXYA 3A6ZA 1Z5UA 3K05A 1N8NA 4J1TA 3RK4A 1HE5A 1R0CA 2HSZA 3BQNB 5FHRA 1MAWA 4RESA 5G1PA 3QEAZ 1C4KA 5KAPA 2X0EA 5CK5A 2W11A 3EF1A 1SXJE 3EZYA 1K0UA 1H2BA 4JLWA 2VA8A 2AZ4A 1R3UA 1GKKA 4TV9F 5F7JA 4ASUA 5ITZA 2JLQA 3NC0C 3CLRC 1KY3A 3COZA 2H11A 3I34X 1BDMA 1VPVA 1DT3A 2DHCA 2MYPA 4O4HB 2JGMA 3ZWMA 4R2JA 2ZUTA 2A78A 4TXHA 1QCCA 4YH1A 1GFIA 4YRNA 2POCA 1QF6A 4R2LA 3QXSA 2P9TA 5ELXA 2YN4A 1RAIA 2BGTA 1L7AA 5KNBH 1MCZA 4ARZB 1L4KA 3EEBA 1MB0A 5TMBA 3TLGA 3U31A 4D8TA 3BWXA 3AR8A 1GZVA 2O3TA 1UPXA 3IKJA 5HQJA 3HCWA 1Z4PX 4RQBA 4JLDA 5NLLA 2OPBA 4IKPA 1E61A 4WXMA 5BMVF 1P80A 2OHVA 3BQMB 2VF7A 4A2WA 1ICIA 1S01A 3HEBA 3IQHX 4F11A 2O0JA 3NEAA 3TGWA 3EGVA 3IHWA 3EB9A 2CV2A 2I7DA 3D6VA 3E3MA 4OXQA 1I1OA 2Q4OA 3QLJA 4TVSA 2VK1A 3D81A 1ZUNA 1U9JA 4N7MA 2O8DB 3UMCA 3AJ8A 3QG5A 3ZZMA 5EXTA 2ZETA 1XHLA 2GD6A 5AOCA 1OPXA 2VT6A 3A9UA 1UPBA 4IO1A 1A7UA 3RO7A 4KEAA 4P3PA 1XTRA 1W4ZA 1MRZA 3VPBA 3ZY6A 1QBGA 5IBPA 5JHGB 1M2FA 1CZNA 1JHPA 1QZXA 1YMQA 2ZBEA 2FOIA 4KLAA 4LV5B 1DRKA 4L27A 5GGYA 4PRYA 4P82A 3T7EA 1W9HA 4KZKA 2GEDA 1CRQA 4R8MA 3EN0A 5I4CA 1YR6A 2GZSA 5FBZA 4QYMA 5D3ZA 3UVEA 4S05A 4R9RA 1YNSA 3QUTA 2FWMX 2JIOA 3PNPA 4J07A 3LUPA 1J25A 1ULTA 3CZPA 2VPYA 1TC2A 2HLDA 2O2JA 4LQLA 1SKYB 2PSDA 4BFLA 2PL5A 3GVCA 3ZU5A 1MXHA 1PD1A 2J3HA 1VHDA 2REQA 2YZMA 2ZBQA 3A6GA 4KH0A 3COSA 2C5EA 2DSNA 3PQ6A 4UFOA 3U4AA 1H5NA 2IIQA 3WLPA 3WLKX 1RJFA 1WXQA 2Q4DA 3FHCB 4TYNA 2PYIA 2D0PB 1ESEA 1HK7A 2VP5A 3DP7A 4GYYA 3R44A 2HFJA 3P2YA 4GVLA 3QWIA 5GM1A 4RVNA 2X4DA 4M2LA 2Q1XA 4NF2A 4ZXPA 3GAFA 3WLEA 3AIIA 3TF5A 1KJJA 4OHBA 1XTBA 1XXHB 2RHBA 3KIPA 3F8WA 3OM9A 2O1SA 5FPSA 3VBCA 4HUJA 3WWDA 5AKEA 4BO4A 1DAEA 4KDCA 4YWJA 5BYJA 2YMPA 1X7XA 2DR3A 4LY6A 3UCFA 1VDZA 4CQMD 3TM4A 4LOHA 2G9VA 4HAIA 5IFKA 1M72A 4GRDA 5CPBA 5B37A 3KQYA 1GP2A 3JD1A 2YBDA 2WD8A 2QRQA 3LG2A 1FFCA 5DNDA 1FP4A 1P4GA 2C4NA 1DX4A 4ZOLF 4X8MA 3QW2A 4FB5A 3K0SA 1HYQA 3UG6A 4QULA 6ABPA 4GLFA 2PJUA 4O2LA 5TPWA 3HB9A 4JL6A 1BX3A 4TYMA 1ZGCA 3SLRA 3ZLUA 4X8LA 4ZN6A 1HBJA 1NT2A 3JQ7A 2BSAA 3OIWA 3PA8A 4A36A 2VOEA 3DYIA 4M9QA 2AR0A 3I92A 3EWSA 3ND7A 4R2HA 2VYVD 4RD0A 3OM0A 2NGRA 1LVUA 1O95D 1Q0ZA 1U99A 2G25A 3MOGA 3AUYA 4HLCA 3UJBA 3PDUA 1DIOB 3QFFA 5BV0A 2UUBB 2BFBA 5CFOA 5CYGA 1A5TA 4I6JA 2CLHB 4J16A 4TL6A 5AYVA 1Y89A 2WF8A 4EB0A 5REQB 5BWOA 2XUKA 4FEEA 4MVYA 3IUPA 4Q1FA 3GBSA 5AI8A 1KEPA 4DM3A 4XEUA 1KA9H 1ORVA 1RRGA 2Z1NA 4OVKA 3KB8A 2GB4A 3FX2A 3GUHA 4GR9A 5KC8A 3MS7A 4CM4A 5FPKA 4ME6A 1QH0A 2Q8NA 1O8BA 1K6JA 3EFOA 2A92A 2QTGA 3Q41A 4HB2A 4J7UA 3LWBA 5DNVA 4Y0VA 5CT4A 3IMKA 1FYEA 3SE7A 4DCVA 4YMVA 4FE3A 1GXSA 1W4BA 1YR8A 2PA3A 2IQIA 3KSAC 3AEYA 5CLJA 1EIWA 4MQFB 4BU0A 1IMOA 1NXXA 2VJCA 1FVHA 2REOA 3H9EO 5IJXA 5ITWA 4DLLA 2AQKA 3CPJB 1DNPA 1O94C 2O3QA 3LQRA 3LVFO 2X4LA 2BWJA 4Y8VA 5DEIA 4F72A 1NL3A 4OHPA 2XYHA 3OPYI 4GX2A 3WLAA 4C4SA 1OWPA 1S2OA 2GFHA 3IUJA 4UQPA 4C2BA 3HKBB 4ZQIA 1FTSA 4V02A 4JUIA 4D9JA 1TC1A 1DFGA 1XJWA 4GL4A 1V8ZA 1A71A 5CDHA 4EEXA 2R96A 2RHJA 4L22A 3VNQA 3F7MA 1HT0A 3FGPA 3HJNA 3QVSA 5JXJA 1YCDA 4EOGA 3A4IA 3CN9A 1GSOA 3A1NA 1V25A 1LJLA 1N3BA 3LHKA 5IKEA 5A6SB 3I4FA 5EY5B 5JJLA 1BHQ1 2BMDA 1EDBA 3VR6H 3SDBA 2R65A 2YQZA 2AWNA 4NL4H 1LV7A 3GPDG 4Q4JB 4K46A 3WWEA 3GZNA 3QLUC 4JUFA 2ZEJA 1C3VA 4MITA 4RXMA 5FL7D 4FDVA 2IH4A 4L5CA 5F35A 3G2IA 4GU5A 3DZFA 3QZUA 4YO8A 5TS2A 3A3NA 3WFJA 4F46A 1XI2A 1JLSA 1SRQA 1PZHA 2YZ2A 4LK2A 5D7BA 3CX6A 4B32A 5DHUA 3QMMA 2WSMA 1UKZA 3PFIA 4DA7A 1W73A 4YHHB 3I42A 3WLLA 1YAHA 4KBFA 1IXKA 3DFZA 4ZMRA 4B8WA 1JW9B 3OM8A 4CL0A 4AKIA 2HQRA 3S2UA 4NK5A 3C6MA 3JAKA 1L6IA 4DR3B 2BI4A 1FDUA 4RPJA 3DMHA 5CP8A 4Q37A 4EHJA 4KWTA 4OY3A 1Z4NA 1R6UA 3HHPA 1DE0A 3NXKA 4XSGA 1L4YA 2FXVA 1YTUA 1Z36A 3C3PA 1Z4LA 4JSTA 5E4YA 3DLPX 4WLEA 4HH1A 4XWOA 4DN6A 4Q4LA 1LPNA 1XTQA 2C3MA 3AGQA 1QZZA 4JLUA 2JJ1A 5FADA 1SHLA 3GCWA 1NLZA 4F8EA 3AY0A 3U9TA 1E2GA 4DMRA 4QFMA 2Q0HA 3WX0A 4BB9A 3LF1A 5JAQA 1OLSA 1Z2PX 1P4AA 1Z73A 1PRYA 3CU5A 3KHTA 1QFJA 3D3WB 1ZWLA 2G7ZA 1WDKA 1M83A 4IDCA 1YS1X 3L4KA 2O48X 4ALMA 1L7MA 2PLNA 3SM3A 2Q1SA 2F9LA 4O2AA 4I1VA 2WU4A 1RXSA 2QY9A 4ZI7B 1Z6ZA 2AXNA 1WMSA 4F97A 1D2EA 1KI4A 4NJEA 2HRDA 2JA1A 2KMLA 2VSQA 3H11B 2SICE 2W6NA 2QGFA 2OV4A 4S2UA 3SHVA 2QD4A 4QU0A 3W7BA 4NS4A 1QHHB 4I99A 1KMMA 1V5WA 4G23A 1TA9A 2PS0A 5IBCA 1H4QA 2Q3JA 2L18A 2H57A 1D1PA 3FB4A 2ZIGA 3IMEA 4ZDJA 3K94A 1LNQA 3G2PA 3N39C 1FPMA 2W70A 3U7RA 4HX2A 2VBCA 3AWDA 4DXDA 4EY8A 5A4FS 1B00A 4O08A 3ZC3A 4FGKA 1VBFA 1NNEA 4R3NA 4CL8A 2Q29A 2ERYA 2J32A 3SVTA 2HU8A 1ZUHA 1NW9B 2B2NA 2P2DA 1Z29A 1J1IA 1T3HA 4UJ3A 4Z6KA 3RVMA 1Q1GA 1J5XA 4D74A 5HZGA 1C9NA 1UK6A 1X92A 4I1PA 1QK3A 4F4CA 5K8CA 1GG2A 1KDRA 1HX7A 4DZRA 4M1WA 4P5PA 1W0JA 1MENA 1NIJA 2PO7A 1U1FA 3A1CA 3F9IA 3KJIA 5J2TF 4BATA 3F2IA 4ED9A 1JAXA 3E58A 2I6QA 5BVGB 4NNJA 3MK31 5EEGA 5IVDA 4PZAA 5BN4A 1NV9A 1YR9A 1RQGA 1PFVA 4YN3A 1XCBA 4LJAA 5BQ3A 2YY7A 3ZJTA 2H9AA 4FR0A 3OLWA 1WM1A 2FZEA 1LNZA 2JFOA 1MDFA 2LE0A 2PUVA 2A9RA 2XUOA 1O77A 4L51A 3I6MA 5JBNA 3JZDA 3OCWA 5CVCA 2XXBA 1BDBA 1NI3A 4TTVA 5FORA 4ZIRB 3O8CA 3F78A 4BX9A 4EF5A 5EE5B 4F71A 3OJLA 4WDRA 3HM9A 1QR6A 4L7VA 4CF4A 4DMMA 1EDOA 3ZYCA 4BBZA 4J6EA 5DLEA 1Y9AA 1ODLA 4KPUB 4R2IA 3RRJA 2C7VA 2Q5OA 4D9GA 5HUHA 2BEUA 2OV1A 3LT2A 4MUHA 4NEGA 4ID3A 3CEHA 2HOQA 4N3NA 4MHOA 1TYZA 5EEHA 1K5GA 1KSFX 2XBMA 1OASA 4X6LA 2UKDA 4NYMR 2BEWA 3IDSA 3LUKA 3WB2A 3OETA 4KSCA 2J3DA 2R6ZA 1NVAA 3V1NA 4A82A 3W5HA 5LXTA 4Y2QA 1N25A 4EHDA 3MLEA 1I3NA 2V6IA 4ZC8A 3T7TA 1LI5A 4Q03A 4CM1A 4GYJA 4ENPA 2C31A 4UQOA 3MILA 5H59A 1CRZA 1DRVA 4DQ0A 3W4IA 3RVJA 5JCOC<