2X2FA

Dynamin 1 gtpase dimer, short axis form
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
347
structure length
336
Chain Sequence
EFSMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYSRVDEMLRMYHALKEALSIIGNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DYNAMIN-1
publication title G Domain Dimerization Controls Dynamin'S Assembly-Stimulated Gtpase Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 105
structure length 336
sequence length 347
chains with identical sequence D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2x2fA00
1UKYA 3VMFA 2IA5A 1NY6A 5HCNA 1CJMA 4PXAA 3CR7A 4MGYR 2ZS7A 4CRWB 1HURA 2ZE6A 4TL6A 1SQ5A 1G3MA 2BMFA 1BOFA 4OQMA 4FMCF 2AD1A 4QBFA 4NCHA 2Q3MA 1SVMA 1XEFA 1FNNA 2HJGA 1ZNZA 4AYTA 1XX6A 4ASUD 5DNYB 1ETUA 4C2TA 3K9LA 2C2HA 3FMFA 2IYQA 2WPDD 3SZRA 3LLMA 421PA 1RPZA 3KB1A 3U6BA 2EWWA 2J46A 3LDAA 5GJCA 2AD5A 3HYRA 3DZ8A 2QE7D 4D81A 3T5GA 2V55B 4DLVA 2OFOA 3CWZA 5EXPA 3I32A 3K9GA 4JIMA 1M7BA 1R6BX 4WW0A 2PLFA 1II8A 4BFSA 4DKXA 4A82A 3IO5A 1E9AA 2P6NA 4D80A 5GJVC 5LBIA 1E2HA 5DO9A 4D2IA 3DKVA 3RRZA 4BEJA 4I1OA 4LCBA 5E3HA 2IBMA 4I99A 3SE0A 2X8AA 3SQXA 1BYUA 3QXXA 4B2IA 1G19A 2NPFA 4F93B 3ADCA 3T06B 1SHZA 1W4CA 4UXHA 1HYQA 3OEHA 4GOXA 2JATA 3X1WA 3ADBA 2V1UA 2F43A 2C5LA 1KO5A 4M4SA 4HDCA 1GVNB 4I81A 2BV3A 5A5GA 4DB4A 4Q9KA 4NU0A 2GCOB 1ZNXA 2WIAA 1YHNA 1ZW6A 5JI2E 1GNQA 3S1AB 5JLJA 1HY3A 4O25A 2L0XA 2ZJAA 3FOZA 4QGGA 4AG5A 1HEIA 4LI0A 1XTSA 1R5OA 3Q8XB 3LO5A 4ZV4A 1JPJA 1FW6A 3H86A 1MV5A 1NF3A 2ZAMA 4Z1MA 3VX3A 1A2KC 1J99A 1G6HA 3OFND 4M1WA 1AN0A 2C77A 2PCJA 5BYKA 2PT5A 5J40A 1P61B 2WAXA 3ASYA 3JZAA 1G64A 3NVAA 2DBYA 5TVKA 2MMGA 1MABA 3CWQA 1IQPA 4MYCA 5KTYA 1WBBA 3LWNA 3SYKA 2FFBA 4Q47A 1DO0A 2ZSBA 1FP7A 4LGMA 2EWVA 3TBKA 3QE0A 2H17A 3ZGXA 4TLEA 3CF0A 1E98A 4YMTA 2YHSA 4DB2A 1ZCAA 3SFZA 3EPHA 1LB1B 4OHYA 3K09A 5BN4A 1BMFD 4DCUA 2ZRJA 1T8UA 2IHYA 4DUGA 4DLTA 3CBQA 4PZYA 2DY1A 2IX3A 1Q22A 2VP0A 1UBEA 1ZD9A 3ZDQA 1GNRA 2GJAA 2EU8A 1S3GA 1JEEA 4B74A 2R2AA 5JS8A 3L82B 2GEDA 2LWIA 5LDDC 2QP9X 2A5GA 2IYRA 1DBSA 3IILA 5KHOC 1IY2A 1XMSA 4LYFA 3T1TA 1ZBDA 1US8B 1XPOA 3NBXX 4MH0R 2PZFA 2ZITA 4MRPA 2ZUBA 4HDQB 3MFYA 3UANA 5IF9A 3L0IB 1P3JA 2FSHA 3NTUA 3T15A 1G41A 3EIHA 3E70C 4B75A 1XD2A 4QRHA 3WP1B 4ACBA 4A6XA 2YYZA 1II8B 2JLQA 1XF9A 4A2PA 2AR7A 3BFXA 1UDWA 2RMKA 1GUAA 4FWTA 2PJZA 2ZE8A 4HLDA 4OI2A 1E0AA 1S3SA 2W2TA 4HB0A 3GJ7A 4Q1CA 3CONA 1SULA 2EFEB 1FP6A 2QY9A 4LHZA 3IHLA 2RHMA 1E2EA 2OESA 1E0KA 1JBKA 4PFSA 2VH5R 5JWHA 4NPHA 2XNSA 4L9SA 4RD6A 2F9MA 5TV2A 4FINA 4B2LA 2QT1A 4A0FA 5EP4A 3U4QA 1TL7C 1E2GA 1TMKA 3QKTA 3WYGA 1XCPA 1NBMA 2IW3A 2REOA 4PX9A 3LY5A 2VHTA 3CIOA 1OF1A 4NYIR 4KYIB 2F9LA 1N6KA 1XU4A 2XSZD 4QL3A 2VF8A 3N70A 4QOSA 1AZSC 2RGBA 3P4XA 1ZUHA 4Q7JB 4HAXA 1J8YF 2YOFA 3K70D 1P9WA 4FMBB 1E1QD 5FI1B 3HU1A 4FW9A 1S2MA 2LKCA 5EE9A 1DPFA 1MABB 1G8PA 3AVOA 1LS1A 1TUEA 1YE8A 3SHWA 4NYJQ 2FGKA 5C1BA 1GDDA 2IWHA 2IWRA 3NBYC 2D62A 2ZJ2A 1OHHD 3FYHA 2WZQA 3H4MA 2D4HA 3GLHE 2NO7A 1RRPA 5HR5A 5F9FA 2A5JA 4C0AC 1OKKD 1AKYA 2IYSA 4EDHA 3U7HB 3QVVA 3MSXA 1JR3D 4Z54A 5DYGA 3T35A 1MO6A 3PJRA 5DI3A 4YONB 2WOOA 1OXVA 3GJ5A 4DCSA 3LX8A 1SKYE 1E9CA 2QMUA 2CNWA 3NEJA 2HF8A 4POAA 1Z0IA 2P2LA 1PLJA 4M1YA 3I8XA 4Q48A 1VG9B 2WHXA 3P26A 1YR7A 4OBEA 4RCZA 2G9NA 4Z51A 4OL0A 2WV9A 2A5YB 1IN4A 1H8EA 3FE2A 5DHFA 5GJWC 2GA8A 4Q4AA 2WSSD 3NBZC 2C99A 4C3ZA 1T5IA 5HPYB 5TB5A 2JLWA 3AKCA 3VR5A 2B8WA 3X1ZA 5IRCD 1E2QA 2X2EA 3PR1A 4M53A 4UNQA 4IOJA 4LBYA 2MSCB 5P21A 4QC2A 3MWKA 1RZ3A 2GKSA 3MJHA 2QU8A 2BMEA 4M0LA 1N6IA 3EW9A 4B3DA 1LF5A 2AHOA 5EE0A 2ONJA 5B58C 3CZQA 2OG2A 5L3SB 5TXGA 4Q9IA 1KK2A 2JLZA 3W6OA 2JA1A 2QNRA 3A1TA 4LUCA 4F92B 1NN3A 3ADKA 1N5JA 1AK2A 3QF4A 4DJTA 5E95A 1KSGA 2ZTSA 3AH8A 3V4RA 4DSTA 1ZVQA 4TWZA 2OE2A 4ZIRA 2CK3A 2GWHA 1XD9A 2W6JA 3CRQA 3M4YA 1W36D 2Q9BA 2QQEA 2WJIA 4M1OA 1GL9B 2KE5A 1XBTA 3V9PA 5FBVB 1AS2A 3VKHA 2P67A 2NOAA 2ZI4A 1CRPA 1NJGA 4WAUA 2BBWA 2VSFA 4W5JA 4QGHA 1E9RA 5SZKB 1XXHA 1Z0KA 3I5XA 4KFTA 1R8QA 4CW7A 1U94A 3WHLA 4G3XA 4IXNA 5BWMA 2BIFA 3H0KA 4ZPXA 2JCSA 4PPFA 1JR6A 1TX4B 5C4GB 3DVLA 4U5XA 1D5CA 2GCPA 4B76A 5C18A 4BLRA 5H68A 1IN8A 3P4YA 4TLAA 2Z4RA 1Q1ZA 3WYAA 5JZVA 1KI6A 2NPIA 3G0HA 5DI3B 3W90A 4M9SA 3TK1A 1KDPA 2OXRA 3GFOA 4A8JC 2KJQA 2QM8A 4HUQA 1ZNYA 2OO7A 4G5QA 3OZXA 2W6IA 2P65A 1KI2A 3LH5A 1ZINA 4KV9A 4JSYA 2ZE5A 1GNPA 5JI3E 4QM7A 4GZMA 5FUXA 3IUYA 4PZLA 1UPTA 3JZMA 1W49A 4LWZA 1IOZA 1H65A 2Z5FA 1GKUB 5CB6A 1U90A 4GSYA 5B30A 1E2MA 4GMDA 4NYMQ 3PUYA 2GZDA 4DDTA 1CJUC 4BFTA 1AS0A 4DC9A 1DAGA 1M7GA 2V6JA 1FTSA 2FV8A 3NH6A 4DCTA 1JB1A 4ITRC 4M9ZA 4GPTA 3RSOA 5DH9A 2YOHA 2J5XA 2ZRNA 2B6HA 2RGXA 4NH0A 2XXAB 4Q02A 2XZLA 1EX6A 4HAVA 4PQFA 3T34A 1WXQA 4A0GA 1VYVA 1W0KA 4QGFA 1Z0AA 5FOUA 621PA 3AP1A 5BW8A 4ZCMA 1KNQA 3L0PA 4B3FX 3K0SA 4G5OA 3RRYA 4HB2A 4O2LA 3SBDA 1LV7A 2D2FA 1AJEA 3QI2A 4TT3A 4YDHB 2I1VB 3L8ZA 1AKEA 3GLGA 4Q9LA 2ZRCA 1ZD1A 1E9FA 1G8HA 4RKFA 3K8YA 2NTYC 3A4LA 3LLUA 2KBEA 1NN1A 3FHOA 4W9MC 2NO6A 3OEHD 3CPEA 1AQYA 3P27A 4BFZA 1QHSA 2GXQA 1VCMA 1XPUA 2PCLA 3VR4A 1N5LA 1GRQA 1ZNWA 5FBRB 4GRAA 1E2DA 4PO1A 3THOA 3FMPB 2PEYA 1SVIA 2GXAA 3QVUA 4JBYA 1W4RA 2ZR7A 4C9BA 4A92A 5KO2A 3KX2A 4YXWA 3SJZA 4J0QA 3C14C 4JSTA 2XOKA 5L3QA 1YZUA 2HT1A 1KO7A 4IOKA 1KAGA 4WZAE 4EJSA 5CJ2A 2O0KA 4MRNA 4B32A 5HE8A 5FTJA 1U0JA 2ZYUX 5CLQA 1NMXA 4PSAA 1CIPA 3QKSB 5CIQA 3QOFA 5K8LA 1NJFA 1GG2A 2WWYA 1JR3E 3B1XA 3QBTA 3BB4A 3R7WA 1ZU5A 5JRJA 2CL6X 2FSFA 2ZJBA 3FKSA 3KQUA 1FFHA 4ZDIA 3GLFA 5JJKA 1G18A 4TMKA 3NDPA 2J0VA 4ON9A 4MDFA 1KJYA 2IUTA 1RRCA 3FGNA 2PT7A 1XDBA 4B3XA 2UKDA 1ZM4A 4DUGD 5G41A 3RWMB 3O8BA 3QG1A 3X1DA 4FI3C 1Z0FA 3RLFA 4ZDKA 1N2CE 1XB2A 2JDID 2DHRA 3IDQA 2GBLC 4CEHB 5AUQA 3A4MA 2QPTA 2G1KA 4D0NA 5IT5A 1Z28A 2IYTA 2HV8A 1J8MF 1IY1A 4KODA 2QRZA 4C0HA 3OIWA 4M1MA 1TQ4A 4QJ5A 2BJWA 3LAWA 1A82A 3SHFA 1E9EA 1UBCA 3ADDA 4TZ0A 3HWSA 1DS6A 1W46A 4PC3A 1KI1A 2HLDA 4UXJA 1XTKA 3IO3A 4A0HA 3H2YA 4PAOA 4ACAA 3A37A 2W2VA 2ZJ8A 1KHTA 2JIZD 3O8CA 121PA 3C16C 1MRNA 4M9QA 2ZRMA 1WMSA 2KWIA 2PX0A 1PLLA 3AVQA 4EFNA 2XJ9A 2H7VA 4GFDA 4IEEA 4OQNA 1U2RA 3DEFA 3SDZA 5TMPA 2YC4C 3GLGB 2AFIE 2OCBA 4JYCA 1AIPA 5HZHA 3MG9A 2HYDA 2ATVA 3A4NA 5JBQA 1F6BA 2A78A 1KO1A 1N6OA 1VHLA 4Z8YA 3NHAA 2ZANA 5FR2A 2ZPTX 1VHTA 4YMVA 1OIXA 4OK5A 3R9IA 2WKRA 4P32A 2P6RA 1Z63A 3GMTA 5DSZA 4W5HA 2ZM5A 1OFIA 2BKUA 3QJYA 1A2BA 1JAHA 3EA5A 3ZD6A 4EPYA 1Z07A 4OHZA 4D0GA 4B6EA 5CK5A 4US0R 5EJEA 5L3QB 3W5IA 4CEHA 4E07A 2VLIA 4EJSB 1XTJA 2V1XA 4PTLA 1X8JA 1G21E 4PPGA 3KKMA 4RZ3A 4A8JA 4MKHA 1B0UA 5C46F 3X1YA 2MMCA 3FTQA 3E5HA 4ERNA 3IBYA 3G82C 4GI7A 4DEXA 4MUBA 2I3BA 1CR1A 4LJ7A 3ZYCA 3GLFB 4LBZA 4G5SA 4HAWA 2VSOA 4WZBE 2GAOA 2VIIA 3MWJA 4OHXA 3SBEA 1W48A 4DLSA 4HDOB 4U00A 1I4LD 1KYIA 4RD1A 4C0BA 4MKFA 1KIMA 4XVUA 4CEIA 5EP1A 2YV5A 1MH1A 1M74A 1IXZA 1G8FA 2ZQ5A 1EFHA 1G8GA 1BYIA 1KO8A 2N46A 4E22A 1XTQA 1D9XA 5D3QA 1G20E 1DADA 1IXRC 3KQLA 2XNDA 3L8YA 3EPJA 3NDBB 1HE8B 2C9CA 3KQNA 1GOTA 2BCGY 1YKSA 2XEXA 2Z4SA 3AF1A 4LJ9A 4F7WA 2GK6A 4JVNA 5HKKA 5KPJA 4R7ZA 3AEZA 4FCTA 5JS7A 2CHGA 2AKYA 1FMJA 1W1WA 1H8ED 2D74A 2FH5B 3GFTA 2E9SA 3A1VA 1MO5A 3LA6A 1N6RA 1IONA 3BIFA 1AA9A 2CE2X 1NKSA 3ZH9B 4KFSA 1I2DA 1GAJA 1XMJA 2HF9A 4PHFA 4HEJA 2DWQA 1XEWY 1J2JA 4WXPA 4KBFA 4QM6A 4Q4JB 4A1FA 2F1RA 2WKQA 1YR9A 1S9HA 5AUNB 1KI3A 1EFRA 2W2XA 1PUIA 1KI7A 2BC9A 2VEDA 2WIBA 5G3ZA 2OLJA 4LJYA 3CM0A 3DOEA 3LV8A 3MWLA 1LTQA 4TMWA 3S1AA 4UJ5A 3AV0B 1E2JA 4FWIB 5FPTA 4C7OB 5CDFA 3N5CA 1W4AA 4LJ5A 3U3MA 1FPMA 2AK2A 2VF7A 3IPXA 1MO3A 1P60A 1TU4A 3OE7A 1Z47A 1NSFA 2ZRHA 3WYFA 5FTMA 4IHQA 4ZO4A 2JJ1A 3KXKA 2QAGB 5JJLA 4GMXA 2CMKA 5FBLB 2ZRBA 4B3BA 1K8RA 3H84A 1HUQA 4TL7A 1QDEA 1N5IA 4M1SA 2J41A 5KNBA 4ABYA 3IEVA 1XTRA 2V7QA 3EZ7A 2ODNA 4O2RA 4YC7A 4ZCLA 3BH6A 1ELOA 1VDZA 5HZKA 4JKYA 1OFUX 2FSGA 5G53C 4OK6A 4CZ2A 3QXSA 3UIEA 3F3YA 2UZIR 1QRAA 4Y0VA 4TN1A 2OCPA 4DRZA 2XJ4A 2RAPA 1ZC4A 3LVQE 3WMEA 1I4DD 2DWOA 2R44A 1P72A 3LBNA 4R71A 4F4IA 1ZP6A 1TNDA 4PQYA 2ZR0A 4N0DA 3THXB 3PUXA 3MJRA 4OHVA 4V0MA 3QXCA 4CEIB 1M34E 5BN5A 2YKGA 4MA4A 3OIUA 4TYPA 2VPPA 4IDHA 3ZVRA 3SJAA 4RFVA 3CNOA 2GJ9A 1E32A 3GJXC 4MGKR 1FUUA 4BLOA 5JJIA 2GBLA 2FE4A 4GDFA 2ORVA 4ESVA 3EPLA 2YVUA 2C9OA 4BFWA 3ICQB 1US8A 1XEWX 2FOLA 3RRNA 1LY1A 1XMVA 2X1VA 4NYIQ 2C03A 3GLIB 2GETA 4BRWA 3ZZUA 3OEED 2F3TA 1OPXA 2NZ8A 2WKPA 1E79A 2J7KA 3W3AA 3JVUA 2XX3A 2EFDB 1RVDA 1E2FA 2ODWA 1JAIA 4Q03A 4P4SA 2QMEA 5JRZA 3DM9B 1NIJA 4TSFA 4XD7D 1P9RA 2BBSA 3WNDA 3AF4A 1W0JA 4JL5A 5M04A 4BGDA 3TUJC 1WBDA 4HYYA 1QZXA 3CZPA 1NMZA 4IOLA 3PUVA 2XGJA 2DFTA 2IC5A 5SZIA 2H1LA 4B47A 4IJMA 2KSQA 4D4LA 1VTKA 5KYKA 3F0TA 5JEEA 4R2IA 3AKDA 1TQ2A 2C98A 4V0LA 2QP3A 1ODFA 2IYXA 3BB3A 2REBA 1W5SA 3MLEA 4QGAA 4PAMA 2FNAA 3GEIA 3RVBA 3TSWA 4B33A 4ZCIA 4H9GA 2R6GA 3L2OB 2RHDA 1PV4A 1H8HD 821PA 4JJKA 1XD8A 4NCNA 1P2TA 4IVQA 1TEVA 4FN5A 4TLBA 2J45A 5EXTA 1R10A 1SXJB 4QHYA 1NP6A 1NBME 3EZ9A 3FB4A 1HT1E 2O8DA 1T3SA 3K0FB 3MCAA 721PA 2JJ2D 2O8CB 4A6PA 4CDGA 4CEJB 5GJBA 5EZ5A 2QROA 3J81k 5IK2D 2QEQA 4LV5B 3Q7QA 1OH5A 2NO1A 2ORIA 4PHGA 1D2EA 2JEOA 5EP2A 1XNJA 3RAPR 5KNCA 1FX0B 1L4YA 1F60A 3QXJA 3U7FB 2KB0A 4QFMA 3B60A 1RYHA 2QMOA 3LBHA 4NZYA 3BD9A 4LJ8A 3G5UA 2XOKD 2OV2A 3KJGA 1HH4A 1R0YA 2AWNA 1L7VC 1R8SA 2AN9A 4X8OA 4KITB 1KKLA 1OIVA 1S0UA 2NO0A 4US1R 2ANBA 3QEJA 1N25A 3IQWA 3C4JA 2CE7A 1W5TA 3ZVNA 2D06A 1XEXA 1RIFA 2NGRA 2B8TA 4HI0E 2CEAA 1GM5A 2QRNA 1NMYA 2J7PA 4G0NA 3SI7A 2V54A 1Z29A 1N5KA 1ESMA 4LV8B 1MRSA 4NTZA 5EUQB 1YZLA 4P4SB 2F1IA 4B71A 1DEKA 4C0SA 2IT1A 3ZVMA 2PBRA 2BWJA 2AWOA 3KKPA 3KXIA 2XTZA 3Q3JB 2J87A 1C1YA 1TF2A 5FUYA 4QHSA 1E99A 2A2ZA 2WJGA 4MRRA 4JVMA 3IBGA 1ZRHA 3Q9LA 1A7JA 3QBVA 5KDDA 5L3SA 4UQOA 2VA8A 4AKEA 4C0JA 5JECA 4EPXA 1WCV1 2PMKA 4LJ4A 1GKYA 1Q21A 2VP9A 4JVSB 4B73A 1SZPA 5D3MB 4A4DA 2ZRPA 1CR4A 2J59A 2VO1A 3QY0A 3B1WA 3AVTA 1E9BA 2FG5A 2QPOA 4P0TA 4Q9JA 4M2LA 1I2MA 4DIDA 3FMOB 4JLAA 3VQTA 4TYWA 2CHQA 2G77B 2CVHA 5FOSA 1Y63A 2WJVA 3PVSA 1VCOA 4OI1A 2IS2A 5TY0A 1FZQA 2O8DB 3BE4A 1E9SA 4DXAA 3Q72A 5DI9A 2IF2A 6Q21A 5GADl 1KNXA 3O47A 4URVR 4Q19A 3B1VA 5FPYA 1Q1QA 2GDJA 1PLKA 1HV8A 1N6HA 2EYQA 3IIMA 1YZNA 1T6NA 1S8FA 1V43A 3REGA 4XVRA 5KDOA 1OE0A 2PLRA 1ZM7A 1U9IA 2AXNA 3SU8A 2ZYVX 2D7CA 2GVDC 1VIAA 3CR8A 3K0AB 3UXMA 1CULC 4GBMA 4WVFA 4KVGA 4B2PA 1Q1EA 1OH8A 4PZZA 4FXPA 1E2LA 3OAAD 3QUSA 4EJSC 3I8SA 3U3JA 3DHWC 1XXHE 2IYVA 3EZ2A 4OKSA 3T1QA 2OCAA 2CVFA 1DG3A 1NIPA 3OIVA 4RZXA 4DLRA 3THYB 4TLDA 4L9WA 1F2UB 2OAQ1 5AUOB 3KB2A 4KBGA 5EQTA 1JECA 3LFUA 4BQSA 1T9HA 2FSIA 4QJ3A 4PSVA 1SVLA 4IDOA 5J4LA 3EZFA 2ERXA 1OFTA 4IFBA 4KSBA 3UMSA 1LNZA 1XEXB 3QKRA 2GVZC 4PO8A 5BYJA 3ZJYA 2A5FA 2GF0A 1P9NA 3NC0C 1Z6AA 2OBLA 4AWXA 1UEIA 3CF2A 4PC6A 4WOPA 5J4KA 1T3HA 1OIWA 2YWFA 3X2SA 2GHIA 2GF9A 5FBWB 5AUPB 5EUMA 3P32A 1B23P 3W8RA 1DVRA 1OH6A 2RB4A 1VMAA 3KFVA 1XCGB 5KSYA 4OYHA 4FCVA 1IY0A 3CRVA 1GRRA 2XXAA 1SHKA 1ZIPA 1D2MA 2VP6A 4P31A 3ASZA 4EPRA 1QHHA 3NHBA 3R9XA 1G5PA 4TZ6A 3HPQA 4MKGA 1R0XA 3TNFA 2W83A 2ZU6A 4D0LB 5FPKA 2Z0MA 1Q44A 4JZKA 5G3YA 3VHLB 1Q3HA 1K6MA 1OB5A 4LJAA 2BHRA 1BS1A 5AWFC 2ZIAA 1AGRA 1Z08A 2BEKA 4Q1DA 4AY2A 4LJ6A 1U99A 2J3EA 1LW7A 2ZI3A 3FPAA 1E4VA 3LRPA 4RKEA 1QHGA 4MYTA 2IXFA 4TMVA 1G8YA 4OQLA 1YR6A 3NIBA 4FCWA 3DZDA 4TL8A 3BAFA 3EIEA 5FBQB 4D4JA 4EPWA 5DN6D 2GK7A 3AGQA 4PC2A 3T5DA 4URWR 1XPRA 3W6NA 4F38A 4ZI2A 1EFRD 2OFXA 5E7IA 2IS6A 3CX8A 4URUR 2XB4A 4MQBA 3GLGE 3IEUA 1W47A 1ZMXA 2DFLA 3D7MA 1RYFA 5AJWA 5KOYA 2LCFA 2ZSFA 2QAGC 5BQ5A 3RS3A 4C30A 3WNCA 1OH7A 2JJ1D 1KI4A 4IDQA 1KTVA 4Q21A 1GL7A 1U98A 3ZS9A 1E0JA 2FX3A 3AF0A 3U3OA 3TW4A 1IJEA 1EXMA 1OYWA 4UNPA 3AQ4A 5JHGB 2CCJA 3QKSA 2K5UA 1RE0A 3MD0A 4M8NE 5CITA 3MGCA 4JBXA 3ZIAA 4D25A 2ZS9A 3U7GA 1VG1A 2B21A 5GVSA 4Q5IA 1K5GA 1S96A 2LKDA 3QKRB 4DVGA 1Z6TA 4PR0A 2CLCX 1WA5A 1KJZA 4DLXA 3LVRE 2OAP1 2CJWB 1NVVR 4M9XA 4QJ4A 2D7DA 2W0MA 3X1XA 4O3MA 2Q3FA 4HLQB 4ASUA 2O8FB 3BOSA 4K81B 4UNNA 4NCJA 3GEHA 4AD8A 3UWOA 2VP2A 1FQKA 4GL2A 5J4VA 2WPDA 3IHWA 4JMPA 2W00A 4JLJA 1XJ0A 2FA9A 2QMHA 3AP3A 3D8BA 2RKOA 3RWOA 2CL0X 2QE7A 1PZNA 2R6CA 2FEMA 1Z2AA 2UZ3A 3HPRA 4LYHA 5AR1A 5FOTA 1KI8A 1G5TA 1EFUA 1WRBA 3NG1A 4NYJR 2GEVA 1JI0A 1QHHB 5JWOA 4FIDA 5KSPA 3MWYW 4W5WA 4ZDWA 3SC3A 1VPLA 1XJQA 2OM2A 3RS7A 1V5WA 1II9A 2BCJQ 2ZJZA 1C9KA 3CW2A 1E96A 5ANRB 4CIDA 3A8TA 2VP4A 3KUDA 1P62B 3SQWA 1TTTA 1G17A 1E2KA 4BRUA 4WBSA 1CR0A 1ZUIA 4HLUC 1XTIA 2JAQA 4XIGS 4BLQA 4LBWA 4Q4HA 1KSHA 1CF4A 2FMXA 3ZLJA 2QTVB 2MSDB 4GOJA 1G3QA 1RW4A 5EXSA 3I92A 1UAAA 1VCNA 2QG6A 2ZYTX 2BEJA 2AKAB 4OQFA 1OW3B 2ODEA 3EZ6A 1N6NA 4KJZA 1ZM9A 3AVPA 3CRW1 3M6AA 4XWKA 4QHTA 1I4TD 3KTAB 4RSGA 4URYR 1KMQA 1CLUA 3R9WA 2WJJA 3WMFA 3EA0A 2D3WA 3C41J 5DE3A 3RC3A 2ZYWX 4UJ3A 4BPBA 1T91A 4Q7LA 3OFNA 1CBUA 5KU1A 1Z8FA 4I1UA 5H1YA 2O5VA 2A3RA 3SS8A 3B7GA 2JASA 1YRAA 2FZ4A 2QSZA 4DSNA 3U2QA 2I4IA 4DT1B 2WSMA 3GLHB 4Z1MD 1SXJC 2FEOA 2QL6A 3TVDA 1HQCA 2BMJA 2QZ4A 1HTWA 3M1IA 1UKZA 4HLCA 3RS2A 1X1RA 4L8GA 4D4KA 2ORWA 2BBOA 3GJ8A 2BM1A 2IXEA 3LNCA 1DOAA 3JVVA 2R6DA 3RYTC 1Z6YA 2ZE7A 1SKYB 3T61A 4HZUB 5JCZA 3T12A 4XWAA 1N6LA 1GFIA 1Z6GA 4CYMA 1TF5A 4C0KA 3I1FA 3MMPA 4KXFB 3U61B 1JXMA 1KMHB 1EGAA 1NRJB 2ZSDA 5SZHB 2AFHE 1JQLB 5JFGA 4RD4A 3IIJA 3N2IA 4RD0A 3ZD7A 4GP6A 1N6PA 4EPTA 5H70A 2ASEA 3BRWD 2WOJA 4BFUA 3DPUA 4E03A 4V02A 1NG9A 3WP0A 2O8BA 2HDNB 4L5BA 1G4UR 3N2EA 2HCBA 4I4LA 4LHYA 2FFHA 1Z0JA 4TMZA 2ZI9A 4G01B 4OHWA 3CPHA 1L2TA 3KKNA 2FZLA 4TTRA 4ARZA 2ZEJA 3EARA 1XJCA 3QNUA 3EC2A 3EIQA 5FI0B 1NN0A 1Z22A 4X8MA 1Q0UA 4LX0A 1F2TB 2C96A 2ONKA 3BBPA 2ZUDA 1OLOA 1IJFA 2R8RA 1OXXK 1ZD8A 5AJZA 2VBCA 1ZU4A 3A36A 3E1SA 4KHZA 1DAFA 4XTCS 1MOZA 1ZUNB 4Q4HB 1WQ1R 1MKYA 5FUVA 5JEDA 1Z83A 4Q4JA 3CF6R 2G0TA 2OHFA 3A1WA 4BLPA 4MUAA 3HU3A 3KQKA 2HXSA 3TAHA 2XTMA 2IF0A 1Q12A 2AL7A 5SZJA 1EX7A 3FKQA 4TTPA 4MITA 2ZRKA 2QBYB 1FQJA 1E94E 1YRBA 3MUFA 2XSZA 2FGJA 4B34A 3BWDD 3R20A 4D4MA 4XOIA 2ZS8A 1E9DA 3CNLA 4DHEA 4C7OA 1NBMD 1ZM3A 3FFAA 4BUJA 3B9PA 1CEEA 4GP7A 2HEIA 1G3UA 1WF3A 3E2IA 2QPAA 4IW3B 4H1VA 1E1QA 1L8QA 2QAGA 4NYMR 4NP6A 3TGPA 1WB9A 2RGGA 4TYNA 2IL1A 2QSYA 3TQCA 4RZUA 1LFDB 2YZ2A 5CDFE 3TJZA 2R9VA 2Q9CA 1OHHA 1Z06A 4XVQA 1OXUA 5FL7A 4IVRA 1NLFA 4JLKA 4P4UA 1AZTA 3KL4A 3KZ1E 4RD3A 1WDTA 2GJSA 4YLGA 1OKKA 1TEXA 2OEPA 2WWHA 1JR3A 4JLDA 1ZC3A 3QF7A 3B5JA 3BERA 4RFSB 4IXMA 4DEYA 3THXA 3KJEA 2E1RA 1W4BA 4UXIA 5DIFA 1G291 1YVDA 2EFGA 2GZAA 4F4CA 1T4GA 3I3SR 2FPLA 4B43A 4GOKA 3TR0A 2CCGA 4TQAA 4MDEA 3TE6A 4NBSA 2O8BB 4LC0A 1KKMA 1KOFA 4DDUA 3UMRA 1EFCA 4KCGA 2QGZA 5J47A 4MGIR 2RGDA 4G5GA 5LB4A 4BASA 1O3YA 4DCVA 221PA 2WMNB 4ARZB 3PEWA 4OQXA 2CNWD 1R7RA 1D8TA 2H57A 1DG1G 4KU4A 1P5ZB 4Q18A 1E1RA 2WSSA 3EG5A 4V0ME 4C0QC 3UPUA 4NCIA 3TSZA 3AF3A 2GEUA 1IN6A 2BM0A 3GLIA 4R9UC 3WHKA 4A15A 1JJVA 2ZU0C 4DSOA 2FFQA 3L0OA 4LHVA 4N1AA 1N3BA 2NO9A 2VRWA 3NEYA 1X1SA 1CR2A 3C8UA 3UG6A 1Z3IX 2JLXA 1WP9A 1X8LA 3AVUA 1Z5ZA 3K0EA 3BGWA 2PZEA 4Q1FA 4HLUA 3RANA 4A9AA 5J4YA 2H92A 4LY6A 1Q57A 1PUJA 4M21A 3PCRB 1MT0A 4URZR 1KSJA 3VFDA 3CPJB 2VQSA 4M22A 4DLUA 2HT6A 1EG7A 2IYZA 2ZRDA 4HB4A 4JLNA 4EUNA 4ZKDA 3GCGA 2P0EA 1R5BA 3HR8A 3BB1A 3C5CA 4BE7B 2VL7A 2Z83A 3WRXC 1TADA 1FL9A 5LD2B 5A0FA 1TF7A 2ZREA 2GJ8A 3K70B 2TMKA 4RCYA 1OXSC 1C4OA 4EIWA 3RS4A 4Q1BA 5KUTA 3EAQA 1UBFA 2CK3D 1SXJA 2W6JD 1GITA 1UFQA 2IHBA 5EE1A 4W7SA 3SYLA 4DDWA 3C7KA 4HUTA 1NNEA 1COWA 4YQFA 3K0FA 4BWYA 2YNMA 2YWEA 5DLQC 2O8CA 4KI0A 4NHOA 4QNMA 2PMDA 3V4FA 3TAUA 4CEJA 1NLZA 4YMSA 4AIIA 2JLRA 1UF9A 4S2EA 4AYXA 3GJ3A 2KI5A 2EQBA 3A58B 3HYTA 2J9RA 4ZDJA 1VG8A 2WTUA 5DGXA 3D3QA 3TUIC 1IM2A 1U9IC 1FX0A 1U0HC 2C9YA 1E0SA 1ONBA 2P3SA 3BFKA 1G9XA 5FR1A 3PXGA 2V9PA 1NL3A 2BVNA 2JLSA 4NE2A 4CT5A 2PX3A 4AKGA 1KAOA 1X86B 5FPSA 4NCKA 2RGNA 1TQDA 4Q01A 1VKJA 3K0CA 1T0JB 3DDCA 2DWPA 5F98A 1EESA 3GJ6A 2ZUCA 2F6RA 3HDTA 3AUXA 2AXPA 4HZIA 1T5LA 2W6ID 3ZIAD 3OIYA 1EFTA 3NC1C 2GXUA 1QVRA 2YWHA 2G3YA 2IYWA 3AB3A 3EPKA 1J70A 1E4YA 3KKQA 1KDOA 3L43A 4LSGA 2BBTA 3OESA 1U0LA 3QEOA 4AYWA 3MRSA 3CO5A 1K5DA 1GWNA 2ZETA 3R8CA 1RJ9A 2ZI5A 3KFXA 4RY2A 2Y8EA 4B3CA 4KVAA 5E7JA 2CL7X 4R2HA 1E2NA 4YMUA 4OI4A 4C4PA 4NMMA 3CX7A 1M6NA 2OBMA 4TMTA 3B1ZA 2F55A 1XRJA 2EFCB 5EE5B 4FMDF 1RFLA 1G16A 2V4ZA 3AVXA 5FTNA 2J0QA 5CYPA 3PQCA 3CUEF 3Q7PA 1X8KA 1KSFX 3TW8B 1W0KD 1TQ6A 2QI9C 1S1MA 2ZAOA 5D3MA 2RH5A 1E2IA 4URXR 4JYBA 3SYNA 1W36B 3CH5A 2ZRLA 2A7QA 4PO9A 5FOWA 1VIYA 5LB2A 4JLOA 5AJXA 1G7CA 4TT3D 2C95A 3FHCB 4MYUA 2XZPA 3CB4A 2ZJ5A 5UKDA 2VHUA 1IBRA 2PZGA 1O87A 2F1JA 4GZLA 1ZJ6A 3DM5A 2O8EB 2Q0HA 2W58A 3FWYA 2QM7A 1OT3A 4EFMA 4IVPA 4JVLA 4M1KA 3VTKA 2PH1A 3TR5A 1KJWA 1NG1A 1QVAA 1YZGA 1PJRA 5IHPA 2DCUA 3IKJA 3EXAA 3WRYC 1P75A 2WMOB 3ZQJA 4IDNA 3THWA 1QHIA 3TSOA 3K0AA 3QPVA 1TU3A 3F8TA 3NWJA 4U7DA 4TLCA 3O8RA 1G3RA 1VCIA 2X19A 4YXWD 1D2NA 5JWRA 2IYYA 4ESHA 2SHKA 2Z43A 3U60B 2VP5A 4Q00A 4WIAA 1P6XA 2ZI6A 1JNYA 3THYA 1J7KA 1HE1C 3AM1A 3DO6A 4LHXA 3BC1A 1F2UA 1X6VA 4KAXA 4CT4B 1ANKA 4R98A 3KDSE 1OB2A 4BECA 1UADA 4TTQA 4DLZA 1YU9A 2OFWA 4BLTA 1CJVC 2EW1A 1TAGA 4Q9HA 3GEEA 4HATA 1N0UA 3KUCA 2YC2C 3FKSD 1CU1A 1G6OA 2JLUA 1OSNA 1R0ZA 4L15A 2F7SA 1FNMA 3ZQ6A 1UBGA 2JDIA 3AVYA 3B13B 3BXZA 3RABA 4I1SA 5FTKA 4PC1A 4AKIA 1RJ9B 4A2WA 3FHTA 1U8AA 1KY3A 4WXRA 1W7AA 3PV0A 2DPXA 2HYIC 4O0MA 1NVXQ 2CHVA 3C15C 4JLBA 2ZRIA 3K1JA 1CS4C 2NIPA 1OXTA 2YOGA 3V00A 5FPHA 4AC9A 4TQ9A 3QG5A 3Q5EA 4DZZA 3FDIA 4RJLA 2JIZA 5EZ6B 1DTSA 2R65A 4PPQA 1T3LA 4XSGA 1KZ7B 1J90A 1G7RA 5JSZA 2HLDD 3RRMA 2GXSA 3HR7A 2XZOA 4A36A 2ANCA 2G6BA 2J1LA 4LYJA 1CJTC 1GIAA 3PEUA 1GL6A 2ZJYA 3IPYA 1GZSA 1M8PA 1KDRA 4P4TA 4LV6A 5FL3A 5AJYA 2F43B 3TQFA 3R8FA 1XZQA 4RD2A 1P2UA 3RHFA 1IHUA 4DLWA 4Q66C 3RS0A 2ERYA 3GJ0A 2J0UA 1HA3A 1IN7A 1UDXA 2CLDX 4IOMA 4AURA 4WA7A 4AK9A 1NY5A 1NVVQ 4NONA 4S35A 2WBLC 1M1YE 5E4FA 4G5RA 3BH7A 1TUIA 4F4JA 4LPSA 1SVWA 3VR3A 2QGNA 1YQTA 2VHQA 4N0EA 2CCKA 4UNSA 3EWAA 3UWKA 3THWB 3I5YA 4A2QA 3W9YA 3VNVA 2OUKA 1X3SA 3W8NA 5FH9A 2ZXUA 5L3RA 3RC8A 2C8VA 2GJKA 4V0KA 3K9NA 1GTVA 2ZSAA 4PHHA 2QP4A 5IDVA 2H18A 4JL8A 3RDPA 5LPNA 4MYHA 4BZPA 2FN4A 1IAQA 1YZTA 2REXB 4EKDA 3LQQA 5FL7D 3SEAA 4HAYA 3UATA 2G1JA 2JGNA 2VHCA 1UM8A 2H8KA 2HCJB 5E7MA 3ONWA 3ZZTA 1E3MA 2ATXA 2CJWA 3GP8A 1GSIA 4EQ6A 2O8FA 1SVSA 4EPVA 3ZS8A 2H16A 3WBJA 5L8VA 1LF0A 5K8UA 4X8LA 3WNBA 5B64A 1ESNA 1NVWQ 3U7EB 1F3OA 1KO4A 2JLYA 1VYTA 1UKEA 1XFAA 2OZEA 2QTHA 4N3NA 2ZVPX 3Q5DA 3QKUA 3TH5A 5FTLA 2Z6VA 2CBZA 3A6PC 3HP1A 1AM4D 2FWRA 2YWGA 3AKEA 1JPNA 3IQXA 1W2GA 2XNDD 3SJBA 1NVUQ 2OCYC 3I4LA 1LVGA 4Q7MB 4G1UC 1XD2B 3ND8A 4OJKA 1E1RD 4DDVA 4DCNA 3KJIA 1TPZA 5HKKD 1VG0B 5JSZB 3PENA 4B3GA 3KJHA 3M0EA 1UKVY 4V0NA 3K9HA 3NKVA 3RSLA 2GNOA 1ZYUA 3AUYA 2X77A 2IK8A 1HQYE 3DMNA 3ECCA 2BDTA 4PPNA 4DLYA 2V8OA 1NI3A 3BFVA 2WJYA 1FOEB 2WAYA 5EXXA 1ZCBA 2PEZA 1KK0A 2O0HA 4XWOA 2PJRA 3ND9A 2A5DA 2QT0A 4IKEA 2N42A 2HUPA 4BLSA 3AVWA 4A0RA 2ODBA 2KBFA 2N1BA 1P7CA 2RCNA 2J0UB 4OK3A 3U4QB 1JXOA 1W44A 2ECKA 3KTAA 4I1VA 4TYQA 5KPDA 3OF5A 2Q6TA 4JLPA 3GQBA 1Z2CA 4OI0A 1DAMA 1D9ZA 2IS4A 2NQ2C 3LXRA 5B57C 3UG7A 4B6FA 5JHHB 1OJLA 4FD2A 5LD2C 1ZM2A 5DISB 5BXQC 2FPMA 2IUUA 2GESA 3FMIA 2FPKA 3K70C 2DFNA 2EYUA 2G83A 4MRVA 4C2UA 4PQRA 1S4QA 3OE7D 3QPUA 4Z8XA 4DT1A 3GLHA 4IFEA 3CRMA 4QNRA 2X2FA 2FJUA 3LBIA 3B9QA 3P1JA 3NH9A 1SVKA 1SXJD 2IYUA 4LC1A 5HTKA 3SR0A 1COWD 2BMDA 4JLVA 2IYLD 2V7QD 1QF9A 1XWIA 2GAAA 3TMKA 1MO4A 1E69A 1P2SA 3UKDA 4HZUA 1KY2A 3W3ZB 2WM9B 2NZJA 3VU9A 3LX5A 2CLSA 2DR3A 4DBLC 2ZI7A 2OSBA 1OFHA 3BH0A 3W6PA 1KMHA 2XAUA 2B7BA 3VKWA 1UJ2A 4EQ6B 4YMWA 1R4AA 1SKQA 4FMCB 1DAKA 1II0A 4B44A 2O0JA 1CRQA 5AK0A 1KZGB 2OBNA 3FFBA 2P6UA 3H1TA 4XJXA 4E09A 2Q3HA 2F3RA 4ZI3A 2ZRFA 2VTKA 4WZ6A 3GLFE 1BH2A 4JL6A 2IUSA 2IS1A 3I62A 2GCNA 4L4UA 3OEEA 4XSHA 8OHMA 1E6CA 5KSZA 1Q1BA 3SOPA 4K8OA 4Q4AB 5CJPA 3TUZC 1F2TA 2C04A 1EK0A 3W5JA 5KNDA 2GILA 1VYUA 3BS4A 4FMDB 5GVRA 3B78A 2R6FA 3KKOA 4XD7A 1Y3AA 4TMXA 1T8TA 1E79D 4UNRA 1ZAKA 2YJTD 3B2EA 1CKEA 2CDNA 3B8HA 3HJNA 4QBGB 1RRFA 2GTPA 2IEZA 5HE9A 4D82A 4P33A 2B7CA 5F2EA 4CGZA 4AG6A 4B48A 1QHYA 4UKDA 5CK4A 4TSFD 3RNLA 4DSUA 3IGFA 1W2HA 1NLYA 1W0JD 4IRUB 3GD7A 4BFVA 1CP2A 3T1VA 1SVOA 4OJQA 1CTQA 4JJZA 3QSYA 4DWJA 3QF4B 2QBYA 2V6IA 4JS0A 2QUZA 1F5NA 1XP8A 3ETLA 4JT4A 5G40A 1H8HA 3LXXA 1A4RA 3VNUA 2H5EA 5B2ZA 2ZROA 4ZIRB 3EWSA 4MKIA 2RGCA 1W36C 1S9DA 1G1MA 2P5SA 4JLMA 1YZKA 3U3RA 5ELXA 4LPKA 3IIKA 2EFHB 2QTFA 3KXLA 4Q1EA 2JJ2A 3QIAA 1G7SA 4IEIA 4PHTA 1U8ZA 1UEJA 2GZHA 2WWFA 1Z6XA 5FFMA 5IK2A 3ZVLA 1EWRA 5CYOA 5C4MA 1XXHB 2OXCA 5EE3A 1M2OB 1OV4A 1Q3TA 4JBWA 5AJVB 1OYYA 1BMFA 4V03A 4ILEA 2XB2A 1ZIOA 4YDSA 3VU9B 4BZXA 4TQUS 3WBKA 3FVQA 2C78A 3VAAA 4PC7A 4V0OA 5CIWA 4RFSA 1XMIA 1PVOA 5FOVA 4Q4LA 4EAQA 4GT1A 5K8IA 2EVWX 3WMGA 4QBIA 1KI6B 4CF7A 3KQHA 2RGNC 3NXSA 2YINC 4LYAA 4AI6A 2GRJA 2OT3B 4HUQB 3AVVA 3CKLA 3K0CC 5H8WA 1D6JA 2G88A 1FTNA 3D6TB 4PSKA 3TIFA 1HT2E 1P2VA 2VYFA 4GNKA 1KGDA 4U02A 3LQRA 3TRFA 3BK7A 521PA 2IEYA 5F3WB 2FF7A 2QORA 2RGEA 1VECA 5DHAA 3PG5A 4P3YA 1QHNA 1CXZA 3F5FA 4QBHA 2UVQA 1Q20A 4D26A 2J7PD 3U44A 2ZJOA 1JALA 3U3KA 4QKQA 2J0SA 2AX4A 3PIRA 4PAQA 1NSTA 4X8HA 1T0HB 3NBFA 3LW8A 3EASA 1YR8A 5A4JA 2IXGA 2FFAA 4US2R 3D31A 4RVCA 3GLIE 2FU5C 1DELA 1A1VA 1RRGA 1DO2A 2A30A 2ZR9A 1QG2A 3DOFA 4JKIA 4KO8A 2R6AA 3UMFA 2WWWA 4XH9B 1KI9A 4F91B 3B6EA 4HAZA 1G4AE 2QN6A 1FUKA 1NKTA 4KFRA 4LBVA 4M1TA 3B85A 2RGAA 4HB3A 4LOAA 1QHXA 4LDJA 4KLZA 4LK2A 4PANA 3ZZ0A 2E87A 2OLKA 1DAIA 3PUWA 5J4HA 3A1SA 3CLVA 1A5TA 5FOXA 4TYYA 4K46A 3CRRA 3QQ5A 2XITA 5K8TA 3W34A 2WVJA 3K53A 3I72A 5L3VA 2PL3A 1RC8A 1M7HA 2HJVA 1DE0A 3GPLA 2G0NA 2I1QA 3QXHA 4KSCA 4LRWA 3L0SA 3U5ZB 2HXYA 4KYUA 4Q1AA 3SJCA 2DB3A 1G3IA 1GP2A 1SXJE 3UK6A 3CH4B 3OAAA 3VR6A 2QENA 5J5CA 5C2JB 1GRNA 3SFVA 3VR2A 4HAUA 1YJ5A 2FDCA 3AGPA 4IDPA 3TLXA 3AF2A 5CB8A 5DYIA 4ZKEA 3I73A 3VX4A 4BEBA 5KSOA 2AK3A 4NDZA 3GJ4A 4TL9A 1R0WA 1EWQA 5FUWA 3P20A 3DKPA 1XCMA 2W0SA 3R7WB 3K09C 3RS5A 2JJ8A 1Z0DA 1XZPA 3PEVA 2WWIA 2NMVA 4BFXA 4II7A 2BKEA 3VR1A 3TVTA 3Q85A 5JCPA 3B82A 3DL0A 2NG1A 4MRSA 3OHMA 2WWGA 1YZQA 3EC1A 2V3CC 1IXSB 3ICEA 1U81A 3U44B 1DAHA 1N0VC 2WWXA 2F1HA 3I61A 5JMTA 1G7TA 1E2PA 3WXMA 2QQ0A 4H1UA 4QG7A 3PFIA 3LD9A 3LW7A 3PEYA 4QXAA 2QA5A 2OILA 4KLNA 3U6KA 3MAAC 3SNHA 3VKGA 3REFA 1L4UA 4BFYA 2ZSEA 1RKBA 2VHJA 4CVNA 2WICA 3CNNA 2ZRGA 3T1OA 1G5RA 1KDTA 1AQUA 4BZQA 3HU2A 2ZRAA 1P4SA 1S1CA 1WE2A 1U8YA 3PITA 1F48A 3CX6A 5CM8B 4B35A 2CXXA 3QENA 3BJIC 4L16A 4DIEA 1DAEA 3A1UA 3WY9A 1SGWA 2BOVA 4MGZR 1JEDA 2R62A 2D2EA 2Q9AA 2Q21A 2MSEB 2DFKB 1NN5A 4Y0AA 5DN6A 3VHXA 3AP2A 2WJHA 4AKHA 4LHWA 2VSXA 1QG4A 2O8EA 1BO6A 4JT2A 2QAJA 2XTNA 2GCOA 3B1YA 4LZZA 5F9HA 5KDLA 5TARA 1AS3A 1QBKC 4E5UA 4NL4H 1AGPA 1BKDR 4KFUA 2ZVQX 1BIFA 1CJKC 2DYKA 4NKRA 2O52A 3GFPA 4HSEA 5CLLA 1DARA 3EX7C 1IN5A 3O8DA 5CM9C 1P73A 1N0WA 3PUZA 4D6PA 4Q7KA 1JJ7A 2B92A 1LS6A 2A9KA 1GILA 3BORA 1FMLA 4XTRA 1GKIA 3DMDA 2P5TB 3SN6A 2JLVA 4RZ2A 2BJVA 4C0LA 1KK1A 5TDHA 3QPWA 5HCIA 3AKYA 4A8JB 1R5NA 1R2QA 1KK3A 3C5HA 1MR3F 5EP3A 5BN3A 4EFLA 3TKLA 1JQJC
chains in the Genus database with same CATH superfamily
2Y4OA 3AHGA 3PUKA 1Q74A 4AM8A 5LNK6 1CJMA 3IUMA 3CR7A 2V45A 1QCYA 4I8IA 3HMQA 2W2LD 1SXQA 2Y2VA 2ZE6A 4G9GA 1O03A 1SQ5A 1G3MA 2BMFA 4FSXA 4GVXA 4YB8A 5D5HA 1OXBB 2AD1A 4BNXA 3JQQA 1FLAA 4QBFA 1XROA 3LUJA 3L8EA 4PINA 1FNNA 3H1FA 4IGIA 4X6LA 4Q82A 3ZLTA 4MV1A 3QVOA 5KTKA 4BP1A 3NPAA 4IJ6A 5THQA 4C2TA 5EINA 3LLVA 1WEHA 5DK6A 3SZRA 4J0CA 2WQ7A 1M8JA 1PJQA 2VTBA 2VZ8A 3U6BA 1E18A 1RWMA 2J46A 2IU6A 3IAAA 4G1MB 5GJCA 2AD5A 8MHTA 4KB5A 4D81A 4OXNA 4A3SA 4ZGGA 3PNPA 5BYAA 2X58A 4JIMA 1R6BX 5JNSA 2I99A 3UCXA 4DKXA 3IO5A 2YJ6A 1YNSA 3K71B 3RPEA 1WVIA 2DTDA 4O4HA 2GN2A 4JELA 1TE2A 4W82A 3RRZA 2H1VA 5EJAA 4D2IA 1E7SA 1NZFA 5ADUS 2AHRA 3NONA 4DNQA 2ZT8A 3H97A 4TKMA 1GGVA 3FOFC 3GMIA 2X8AA 3KRTA 1G19A 4MR9A 2NPFA 3WDMA 4F93B 1W4CA 3ZBUA 4WX2B 4TUYB 4RLHA 3TLBA 1FTWA 3X1WA 5CVCA 2JATA 3WFZA 4B9EA 3ADBA 2V1UA 1KO5A 5A5GA 1GVNB 1RADA 2BV3A 3AU9A 3DE2X 4Q9KA 4NU0A 3BTUA 1BXGB 2GCOB 4J0EA 4RXMA 2OHVA 1ZW6A 4UTOA 4CL3A 4YRTA 4KYVA 1FS6A 3S1AB 1YQDA 3TZQA 5CEJA 4ZVVA 5H9WA 4QDXA 3N0VA 3QUQA 4O25A 1E6WA 2PLWA 1LZKA 3G2MA 3LS2A 1AVTA 5KQLA 3VC3A 4LI0A 4YJ2A 1XTSA 1FW6A 3H86A 3ZGZA 3L49A 4Z1MA 5HS6A 1A2KC 3DXZA 5CX1A 4BO6A 2XYPA 2QN3A 1UBNA 4HYEA 3U9LA 4DMUB 3G0IA 3STUA 3IBTA 4JGGA 4M1WA 1JEQB 1NNUA 1EX9A 3O2NA 1TVEA 2WAXA 4Z0NA 1O94A 1G64A 1NUAA 1USIA 2Z30A 2MMGA 5TVKA 1LBHA 3JQ8B 1IQPA 3FCUB 3MMSA 5NULA 5KTYA 1QH9A 1WBBA 3LNTA 5A4AA 3V8PA 2EWVA 2H17A 3ZGXA 4TLEA 1K3TA 3CF0A 4K9PA 4Y2UA 4YMTA 3PRKE 2PZJA 4KGDA 3WLFA 1LB1B 5CFRA 1KDYA 3K09A 3RRFA 4ZVOA 3OX2A 4P58A 1ZN7A 1BMFD 2X8BA 4MW2A 4ROSA 3IRVA 4B7ZA 5KTMA 1QQBA 3RR2A 2ZRJA 3ZHZA 5CURA 4MQFB 4D46A 3CBQA 4PZYA 4QDOA 4DAOA 2WUGA 4AUNA 4DLTA 1Q22A 2VP0A 3ZDQA 3GJQA 4H4DA 3W1EA 3ILSA 3TLMA 1R0SA 2H85A 3W2IA 5M2QA 5A05A 2ONCA 2HZBA 3Q7TA 4B74A 3NYQA 2BRUC 2I6GA 2BGKA 2QP9X 1TYDE 2A5GA 2VHVA 3HKDA 2WSIA 4AJ4A 1QGDA 5AOVA 3FDJA 1J6UA 2YRWA 4LYFA 3O2QB 4GXTA 4D02A 2M1ZA 3NT2A 4P34A 3IMGA 2OTCA 1ULZA 2ZITA 2IX9A 4HDQB 3WV4A 1RBYA 2JCYA 1WZCA 3IP7A 2I6XA 3KD3A 2XBUA 3NANA 4JHLA 4RFLA 2XQGA 3E70C 1DCMA 3PWZA 4CTOA 3CW9A 4YUXA 4ZK6A 2VHWA 5INTA 3R5XA 4A6XA 6PFKA 4TV9B 2ZCVA 1ZOOA 1P9LA 1UDWA 2RMKA 2H29A 1CV2A 1LQTA 2XRFA 3N87A 4K9QA 4H27A 4S0ZA 2WJ3A 1AMNA 2ZE8A 1P17A 1Y9JA 1J2RA 4HB0A 2P5YA 1E0AA 4Q1CA 5JDIC 3STVA 3CONA 4X1IB 1XJ5A 4Y2SA 1QTNA 2O5EA 4WKPA 1NWCA 3QX9A 4LHZA 3ZK9A 4U6SA 3NJRA 3F74A 4ZJYA 1JBKA 1CQIB 3TCNA 2VH5R 5JWHA 3CU5A 4GC9A 3VGJA 4A16A 3IX7A 4RD6A 2GFQA 3INYA 4AKSA 1JDBC 1OI7A 1EJ2A 3U4CA 4A0FA 2WILA 1TL7C 5IDXA 2M2IA 5JH7F 1XCPA 5FBKA 3LCCA 3MGKA 3RVQA 3CIOA 3EF0A 1FFEA 1M2GA 5EL0A 1HG1A 4AJEA 3WWDA 4NYIR 5CW2A 4NECA 3V48A 5FDFA 2F9LA 2JBWA 1EM8A 2PKWA 2RAUA 4OJTA 4WBXC 2XSZD 5AK3A 4F7DA 2VF8A 3BCRA 4KLCA 1XVTA 1GA1A 3F71A 3V4LA 5CP8A 3O21A 5CMLA 2E49A 1FFXA 2YOFA 5EZYF 3QMPA 2B4QA 3RIXA 1B1AA 3VR0A 2BGRA 3MMXA 5K0LA 3UKOA 1P9WA 1YGPA 4D9KA 2Y0DA 3D4NA 1EVEA 3AC0A 4DUPA 4CUZA 3WGHA 4CIAA 3MJ4A 3OOEA 1DPFA 1MABB 1JV2B 3R41A 3R9KA 3ESCA 3RH0A 1I4EB 1YE8A 3G7SA 1L5RA 2FGKA 3HHEA 1AOXA 2ID8A 3ZWQA 1GDDA 3DJYA 2IWHA 2R8XA 4G36A 1D03A 2IWRA 3QM1A 1XTBA 2GO1A 2ONZA 3SR3A 2W5UA 2UZ1B 1XDUA 1ENPA 2W7TA 3JYQA 4HQNA 1RJFA 1T2EA 1QJ4A 1XVLA 2WZQA 3T0IA 2NO7A 2OYSA 4MZXA 2XUGA 5HR5A 2VWQA 3GRFA 2ZCUA 3PICA 5F7ZA 5F9FA 3X1JA 1J39A 4ZVTA 4FBLA 4YCDA 3ZWVA 2HR1A 3D4IA 1WUKS 1JR3D 2VWHA 3MN1A 5K9ZA 1QH8A 4LZJA 1THZA 3R0IA 4AZ0A 1M1UA 3AFNA 1O6CA 3QVGA 4O4LB 2QYTA 3PJRA 1X1EA 4YONB 5DNUA 5K03A 4R5MA 1FNDA 3OU2A 1GUZA 2QMUA 1RQNA 2QV7A 3QYAA 4U1RA 2HF8A 2I1WA 3DOIA 4POAA 3P0JA 2H00A 1J9GA 2P2LA 3KT3A 1K63A 3DPIA 4E5VA 4NBLA 5CNIA 2G9NA 1XQ1A 1AUVA 3NHRA 4H3KB 1IN4A 2I8AA 1WHTB 1O6FA 3EVBA 4GLBA 2CT8A 1QVZA 1T5IA 2JLWA 4PAWA 1RHMA 2B8WA 2PZAA 2UZ0A 3L5OA 3PR1A 5DRYA 5AVJA 3BG5A 3VDMA 3IJRA 3OM0A 2ZWAA 3O4IA 1AURA 2VBFA 5DZSA 3ZWPA 4DLPA 2RHBA 4OLFA 5KJEA 4ZJUA 4Y2JA 1YL6A 3KV1A 4M89A 5KC9A 1JS1X 2BLNA 3EW9A 5CFOA 4DILA 4WLOA 1OC4A 4RH1A 3QA3E 4RW0A 5LXTA 3D0KA 1ODLA 5CH5A 4ZVMA 1DIBA 2JZNA 3ESYA 2JLZA 3W6OA 4OYRA 4LUCA 1WHSA 2L82A 2J6HA 3NFYA 3SHTA 1UR5A 4KWEA 1PV1A 3OZTA 3EUEA 3FUWA 5JARA 5E95A 1CIJA 1A9SA 1RWVA 1V7CA 2D0IA 4Y30A 1D7AA 5LQDA 1Q1AA 3R23A 1V1RB 4YI3A 1QE0A 3T8YA 1IWBB 2QXTA 4DSTA 2JZOA 4TWZA 2PN1A 5HM6A 2B9VA 4WT7A 1RHQA 1XD9A 1QONA 2W6JA 3O93A 1LSUA 3URKA 3RQSA 1NVGA 2HPZA 1GL9B 1K4KA 1XBTA 3V9PA 4MW9A 2RK3A 4IIDA 4O5AA 5AKLA 1NC3A 4DMKA 1H5UA 2P67A 2ZI4A 5CH3A 1CRPA 2O3SA 1KEKA 3COYA 2OGUA 4WAUA 3ZKAA 1C1XB 3DZJA 3LTEA 4QGHA 1MIOB 1QPGA 3ISJA 2C8JA 1VGRA 2JRCA 4QYIA 4HVLA 3WKBA 4KFTA 1R8QA 2GRAA 2VSNA 4HBGA 4NBVA 1KVTA 1HLDA 4CHTA 3WHLA 4G3XA 1EZ4A 4WXMA 3EPRA 2QYOA 4IINA 5F1YA 2C9MA 2XYRA 1JNXX 3AJ9A 4ZPXA 5M29A 4PPFA 1GGFA 1DJMA 4I6EA 5HMMA 5BWLA 4NULA 3TI7A 3KJFA 1P3DA 1LDYA 4BLRA 1ILEA 3EVFA 1MC1A 2BFCB 2VT6A 5H68A 4F3NA 4TLAA 4YGXB 4I1PA 2YFYA 1M0WA 4V3BA 3S44A 2R6HA 4NXMB 1PQ4A 2R97A 3KP1A 5DI3B 3KETA 3S2GA 3TK1A 4BIIA 2KJQA 4HUQA 3A4TA 2BRUA 5SICE 4EA6A 4K03A 3MCZA 3T6KA 4S1WA 1KI2A 3LH5A 2YXEA 2AKEA 2XUJA 4KV9A 4EY7A 4EKYA 4LFBB 4QM7A 2VZ0A 4K28A 3IUYA 4IF4A 3ZCQA 4LWZA 5FUQA 1FFCA 3A05A 3DCYA 4MVJD 1QSGA 2ZKLA 4FDAA 1GKUB 1UMKA 4Q3DA 2Q3BA 1NQOA 4GSYA 3AX6A 4MCAA 3E15A 4O08A 5TNXA 2X0DA 1K2WA 4HVTA 3F4KA 4NYMQ 2GZDA 2AJDA 4J07A 3T38A 1CJUC 3H2IA 3Q15C 1AS0A 2HQBA 2JRLA 3I52A 4NAVA 4DC9A 1A50B 4EEKA 1R0RE 5JDIA 2VRBA 4CTMA 3UMYA 4EA8A 4M9ZA 4FE7A 1T9GR 2AA3A 4GPTA 4KUGA 4UEJA 3RSOA 1YR2A 4NH0A 1L0BA 5AKYA 1AQ6A 1VLZA 3QPAA 1R18A 3S2FA 4L4YA 4P0QB 1EX6A 4HAVA 2E82A 2G72A 2BZSA 4A0GA 2G5PA 3KR1A 3HYNA 2NZVG 3ZLBA 1Z0AA 3NAQA 5FOUA 1SBHA 2K6GA 2ORED 4QJBA 3RIYA 4C01A 621PA 4ZI5A 3L0PA 4B3FX 1CQJB 4G5OA 2JA2A 3BJRA 3U17A 1YTUA 2OECA 5ALYA 2AOTA 1Y4DE 4EEZA 4TKVA 4A5OA 1LV7A 5BNTA 5JH7A 2D2FA 5J4LA 2ZQZA 2QJRA 1CJSA 4QASA 4DQXA 2M6RA 3C3DA 3GLGA 1N2EA 4YFVA 3UMJA 3L4JA 2O2ZA 3SZMA 3O3NB 9GPBA 1SB9A 1ZD1A 2BR5A 3G0BA 1XR3A 3K8YA 2QYSA 3OJCA 4JJAA 5BSTA 4D41A 1RYMA 2P2ZA 4YV7A 3E03A 1CUAA 4DYDA 1MMFB 2NO6A 1W93A 3FBTA 4I8DA 1AQYA 4WNYA 3LGAA 2EKQA 3SBXA 2GXQA 4QODA 3TTWA 4M6WA 3LSYA 4K9NA 1GQYA 4C08A 1N5LA 4G67A 1G8AA 4PO1A 1E2DA 2OCXA 1TM4E 3B6JA 1QV6A 3EXIB 4L73A 1TQ8A 2EX0A 3WL3A 3OTOB 3THOA 3FMPB 2PEYA 4CMGA 1UFVA 3QVUA 3PGA1 4GWKA 5L6MB 4G0YA 3T3NA 1DOZA 5ED4A 1W4RA 3KYDB 2WI8A 3A32A 4YRQA 1ZOPA 3SJZA 4J0QA 4JSTA 3SF0A 3M4XA 3UAGA 2W11A 4B3JA 5AW3A 5B6PA 2O0KA 4FZVA 3ZCTA 2HXGA 3DZKA 3OLQA 3OX3A 1UXKA 5FTJA 2H4XA 3PA6A 5HE8A 3CNBA 1D1SA 3QOFA 1XRRA 1I9GA 1NR5A 5A4DA 3QBEA 2W8ZA 3N7TA 3SC2B 1JR3E 3BB4A 1DIOB 4WOKA 4F6CA 4WFKA 2FSFA 5DBOA 3KQUA 4JYPA 3VH4A 1FFHA 2JARA 4FFMA 1J22A 1ZN8A 3EBOA 4YR9A 2J0VA 1JEYB 4GXQA 2HSGA 3QU5A 1CG6A 1KJYA 4E2FA 4RHTA 1UBKS 1K88A 1YVRA 1UWCA 2FYTA 1DC3A 1T4DA 1ZGZA 3KQOA 3FPSA 5ALKA 3W04A 4B3XA 1V25A 2WIKA 1ZM4A 3WQHA 1X2EA 2DH5A 1IK4A 3O8BA 4O5OA 3N3BC 4AUKA 4BO1A 1ATZA 4QUEA 1AB5A 1P1FA 4MVJF 2P9ZA 5JAQA 2QPTA 4YJKA 3TN7A 4P8RA 4B0PA 1FRVA 2IYTA 1J8MF 3OQ1A 4KODA 4CKEB 2QRZA 3PXDA 3PLAE 4C20A 1TQ4A 3KLBA 2HNKA 1VLHA 2BJWA 3JARB 3SHFA 3TQIA 1E9EA 1NYLA 2H7CA 1WD7A 1W46A 1SU4A 5AIBA 1KI1A 4UXJA 4K9KA 3PQ2A 4KQ1A 3IO3A 1D04A 1B8VA 4M0PA 5F5LA 4B6RA 3HXOA 2TYSB 4C7XA 3O31A 1ZGCA 2HK6A 2JIZD 2GN0A 3BHJA 3O8CA 4D3SA 4GR9A 1L7BA 5L4SA 4HYTA 3AVQA 4EFNA 2H7VA 4IEEA 1N92A 3B7PA 3GJRA 5TMPA 2FSPA 4XA8A 1T36A 1M2EA 2OCBA 2XT0A 3DBHA 4MRMB 3C6YA 3KB8A 2GH1A 3SKYA 1GDHA 5BRNA 1KO1A 1N6OA 1VHLA 3GEGA 1F7UA 1URPA 1UKAA 4DLAA 1OI2A 1P0FA 2JGFA 1O96B 4Z8YA 2VDVE 3WLEA 2CNOA 2ZPTX 4MQMA 1J5PA 1EEHA 1MJFA 2M6SA 5HJEA 4OM8A 3TL6A 3G9UA 4RS4A 4FTWA 4LE2A 4O4JF 2M6KA 4D9MA 3CVWA 2O14A 4ZVQA 3DZBA 2PGLA 3EXEB 3GMTA 3UXHA 1OFIA 2QQFA 2Q4OA 3ZNPA 3VSEA 1Z07A 4B6EA 2XKBA 3VNBA 1RHRA 2XUDA 1CEXA 1PK7A 1BCRA 4LI3X 3WX0A 5EJEA 3V8EA 1ONSA 2H63A 2XT6A 3HCOA 2C5GA 3ONFA 5EVJA 1WDKA 1Y5NA 4BFLA 5C5DA 4CEHA 1X7XB 4TWJA 4E07A 1WG8A 2VLIA 1WWKA 2O3TA 2YZNA 4KQ6A 5IC4A 2GD2A 3MELA 2VZLA 2AFHA 4D9GA 2VHYA 4QX6A 2GTIA 3WLRA 5JNVA 4HXGA 5EMHA 3KKMA 2OQVA 1U3WA 2BD0A 4DQDA 4R1LA 4GW3A 2R86A 1OTHA 2BSAA 3CG4A 4FILA 4C5CA 1Q2UA 3PHBE 4V0RA 2C5BA 4DEXA 2C4UA 2VG8A 3RT1A 1FDVA 3R3XA 4LXIA 1CRZA 1NHGA 1ZZEA 1CR1A 4UZFA 5K09A 3T95A 3ZQ4A 4G5SA 1ND5A 3GGDA 1L7EA 3KTDA 4HAWA 4CR7A 1UXGA 2FR1A 3AUKA 2Y1LA 3EIWA 1VA5A 4O6VA 4OHXA 4QUHA 1ORVA 4U00A 4X95A 5CLIA 1RZVA 2XGGA 3G0GA 1YKGA 1W25A 3IDSA 3L8CA 4CDRA 4OAPA 1VPTA 4E5NA 9ATCA 3JASA 1O77A 5DYNA 1Z4KA 2N46A 2CXOA 3V34A 1D9XA 3MTEA 3OX4A 4MW4A 5EHQA 5LUAA 1RLIA 5EUCA 3NV9A 4QPJC 7MDHA 3UJHA 4NR0A 5BSFA 4F5DA 4RABA 3T3HA 1JAZA 3EAFA 5HJ7A 3EVDA 3B6MA 3MT7A 3KQNA 2AG6A 4X9XA 4XWYA 2Q1YA 4E11A 3PA8A 4ND4A 2IY8A 3AF1A 1ATIA 1EI9A 1RJGA 1QGZA 1X7YA 2OUIA 2Q5EA 3H9GA 3AEZA 3VVBA 2ZJ4A 4Q3LA 1YS2X 4FCTA 1NRIA 2CHGA 3DQQA 4FNGA 2IJGX 4RNDB 1JDPA 3CLSD 1PR5A 3A0RB 3PKIA 5EAIA 2CGEA 2D74A 3W7AA 4YRDA 4ZVRA 1Y7LA 1O6ZA 2D5AA 1WW2A 1AA9A 1K6JA 3C85A 4R8LA 4CF6A 4IRMA 4RTKA 1AO3A 5BPHA 2HWUA 1P4RA 3LPLA 4KFSA 1I2DA 1GAJA 1XMJA 4ND2A 4O02B 5CT4A 1RPJA 2DWQA 1XEWY 4DBVO 3VJMA 2XE8A 4HPWA 1KQFA 3KTOA 1POWA 2N0SA 3P5SA 5CT5A 4C0WA 4CCYA 2W2NA 1YR9A 2XUZA 3A1CA 3UWDA 2V5AA 2ATEA 2H5IA 4CFZA 1ULHA 5BY2A 1KI7A 2IKQA 2BC9A 2WNHA 2Y66A 1C7JA 5G3ZA 3PFCA 1N2SA 3DOEA 1L5HA 1QDLB 1VLVA 3LV8A 3GRZA 1M2JA 3AV0B 4FWIB 1JLRA 5ICGA 2Y1WA 4C7OB 1KKUA 3KYIB 4YBZA 3UCFA 2H54A 3ILVA 2H1HA 3AEUB 1A9ZA 2BFFA 1M6VA 1NBHA 2ZRHA 1RYZA 3WWZA 5FTMA 1JKXA 2IY7A 2AN1A 3KXKA 4OYYA 3FOCA 3GPCA 4GMXA 2FK7A 1JKIA 2CMKA 2VATA 2DAPA 4WY5A 3UT5A 4EYQA 5K0FA 1V2HE 5B1HA 3ZDRA 5FWXB 5IDWA 4O29A 5HCUA 4TL7A 1V2GA 4ARAA 5KNBA 1G55A 1V8PA 1LLQA 4BB5A 5AM4A 1WXHA 3EZ7A 3B3GA 2ENUA 1JYSA 4NZPA 1R0CA 1I01A 2FSGA 4D0RA 3T3GA 1Z4QA 1YB2A 3LPDA 1FYXA 4GWLA 4OK6A 4B6PA 2J3DA 2P3LA 5DTRA 2VKQA 1Y9AA 1GZDA 2CFSA 3CW8X 2EP7A 3IDFA 3K4PA 1YFJA 3FNIA 2RAPA 2WFLB 1ADBA 1Z4JA 4C3VA 3ST7A 3OQHA 5CFQA 3JQ6A 3KZXA 1TIKA 5HSGA 2CNLA 3QXCA 1RXWA 1I1NA 3S7ZA 3CKKA 4CEIB 2OA0A 4II2A 1RFGE 5G0TA 2YKGA 4MA4A 2GHRA 3FLBA 2FZCA 2EBUA 3A2MA 1L5VA 3JAKB 3SJAA 4UCQA 4RFVA 3CNOA 2GJ9A 4BLOA 5C8DA 3NVKI 5JJIA 5KYYB 4L5CA 1GRCA 2ESRA 2BGNA 3TEFA 3QUTA 2FN3A 3AFMA 2YUTA 3NTVA 4R4JA 4GDFA 2ORVA 1YRWA 4BWVA 1NFRA 1GAEO 3JYHA 4R6XA 3TNJA 4AURA 4GI5A 1JA1A 3D5EA 3I04A 4IKPA 5CA1F 4XDYA 3RRNA 1KE2A 3OLYA 1QPBA 3IBCA 2C03A 1HSOA 2PQ0A 2GETA 3GRRA 3KAJA 1ZH0A 1J97A 1GSHA 3D7NA 2F3TA 3I4CA 3KOUA 3KZVA 1RI4A 2NZ8A 2WKPA 4G86A 1CE8B 1E79A 3W3AA 2I3AA 3VBCA 1CEQA 5H3HA 4I1YA 1K4YA 1GU0A 2DQSA 3EQ6A 4U63A 4IHJB 1F0NA 1JAIA 1Y34E 4EW6A 1PL0A 1U8FO 2QMEA 2Z5VA 4CI0B 3HFSA 3DLHA 3OF2A 4AJKA 4OMDA 1DEXA 2BBSA 3HLYA 3WNDA 4QOEA 3COPA 3L7MA 4JL5A 4RTPA 1I6KA 5BQPA 3TUJC 3OM1A 1QZXA 3CZPA 1NMZA 1NMSA 4CWAA 2KW5A 1PO7A 2XGJA 2I2BA 2EDCA 4JMLA 4KWHA 3GGCA 5FWNA 5IVKA 4D4LA 5CAEA 3F0TA 4UM9B 1RS0A 1B6GA 3QV2A 4EENA 1AA6A 3STXA 3OU6A 3ZI7A 3QV1A 4UARA 4S12A 3ASVA 1EDZA 1X7ZA 2O6LA 4OU5A 1ODFA 3BB3A 2IU3A 4MARA 4RJIA 1R3UA 4QGAA 2V97A 5HRAA 4RQAA 3W5AA 1AGXA 4ALIA 3GO4A 2NUPB 4FYIA 4LNHA 2Y6VA 3ILXA 4O4JA 4Y9SA 5AVOA 2XNJA 5KOHA 1NOKA 3F47A 4B17A 4H18A 3ODGA 3Q5GA 1N5DA 1BRTA 2C3UA 1P2TA 2Q4RA 5EXTA 4FN5A 4OPMA 1GLGA 4YV1A 5CFLA 2CYBA 3CVOA 1ZJ5A 1SXJB 4TXLA 3OTWA 4ZQIA 3WYNA 1E1YA 4F46A 3I9V1 3EZ9A 3FB4A 1HT1E 4HAOA 5ADHA 2O8DA 5DJ5A 3SYRA 1L8LA 1NU8A 3NTRA 4NCBA 3TTXA 2O8CB 5H59A 2GCGA 3LDGA 2DP4E 2AI3A 4CDGA 4CEJB 2IQIA 4E13A 4Y2HA 4QQKA 1LRKA 2PRKA 4GSLA 5C31A 1YVPA 4JCCA 2QROA 3CIFA 3BT7A 3Q7QA 2PGIA 4HDSA 2QLFA 4IPTA 5EJIA 5C51B 2JEOA 3N39C 4RIIA 5EP2A 1Y3HA 5KNCA 4ZU1X 3HRHA 2J5RA 1CY8A 2XMGA 3IUNA 4G5YA 4WNIA 2KB0A 2CZCA 3M5PA 1XQYA 4X20A 3SOZA 1O0BA 1D0IA 1Z2NX 4LJ8A 4PCAA 3D4BA 5BN5B 4P35A 4PQEA 1Z0SA 1P4HA 1YI8A 2XOKD 4IIVA 3KJGA 4JENA 4M8SA 4HVAA 1HH4A 1R0YA 4IZ6A 4BNJA 3H5VA 1L7VC 4NEGA 3EEFA 1RXEA 4X8OA 3HDGA 1KKLA 1OIVA 1CYEA 1ZEJA 4XUDA 5DIZA 3KBOA 1W94A 2CE7A 4J49A 1M8KA 4ZJZA 2F3SA 4NC9A 2V3WA 4C2BA 4EX6A 2F8MA 1XEXA 1LDGA 3RAJA 4BKMA 1GM5A 1C1DA 2CEAA 2QRNA 4CQLA 1T2AA 2HRZA 2P4HX 2V54A 4MVJH 3LGXA 2BZGA 1TKAA 1N5KA 1SA0B 1ESMA 1U4OA 4LV8B 2ZUFA 3TLGA 3U5TA 4UM8B 1YZLA 3HUUA 4Q3OA 5E8JA 2JW5A 5JO9A 4RTLA 2EF0A 1VMKA 3DEYX 3ZVMA 4MQ5A 4QDZA 2F8SA 3MPOA 2HLHA 1NI4A 3SF8A 2A8YA 4F84A 4YACA 2RBGA 4FHEA 1C1YA 5LMCA 4M9UA 1GZ4A 5FUYA 3SG0A 1NW4A 3K9BA 3KV3O 4QHSA 5TS3A 3WC4A 1E99A 1U2TA 2NVOA 3HDVA 5JS8A 4JVMA 4Q39A 3WADA 2B4KA 2VDOB 4S24A 2E4AA 1A7JA 1I2CA 2ZTMA 3JALB 2OP1A 3M9LA 5DCWA 3SYTA 4JV5B 1P18A 1KERA 3PDJA 4R1TA 3CLRD 1A8HA 1O08A 4Z2AA 3CFYA 1Q21A 3VV3A 4BQIA 1TKCA 5JNTA 5D3MB 1DC8A 2O4UX 1O95C 1WDMA 2ZRPA 3GP5A 2JAHA 1E9BA 1JSXA 2CXUA 1RBZA 1RWOA 1Y3DE 1YVUA 1ZUD1 2QPOA 2QRLA 3FMOB 1M6YA 3H2BA 4M2LA 5C0OE 4BX8A 3WL8A 1EAYA 3K15A 2O3QA 4BC0A 1JTVA 1M1NA 5FOSA 3RU7A 5DP1A 3PVSA 3ADOA 4OHFA 2OWDA 4Z7OB 2JKZA 5IJ0B 1UK6A 3SIRA 3U39A 2OD7A 3ZWAA 1RXSA 1W88A 1HQDA 2OBXA 4R1PA 3SXJA 5IEBA 4GP9A 1WXGA 1MORA 3EUFA 1MEEA 1E61A 1NQXA 1H4TA 1KNXA 2A1UB 1PQYA 3DD1A 4A7PA 4URVR 3OIDA 5JJCA 1Q1QA 2GDJA 3KTFA 5LNK1 2ONYA 4Y6RA 3HFRA 4H7KA 5E1MA 5EGSA 4JU9A 3GA5A 4QJIA 1P1CA 3EGWA 3ENWA 4F2DA 2D0OB 3AFGA 4PXYA 5DNEA 4CF5A 2Z6QA 2PYZA 2PLRA 3KEGA 3G7NA 3F2IA 4MPJA 2X0KA 4YCAA 5KNCH 1VIAA 3CR8A 4GBMA 4RZQA 1Q0QA 4UPDA 4ZT3A 1Q1EA 2CLOB 3VR6D 5HQJA 1DC5A 3I8SA 3U3JA 4EJSC 2HT1A 4TZ6A 4LDAA 3T1QA 1R88A 3W1VA 4U2EA 5EIXA 1F8XA 1R0KA 3PFFA 4B3MB 3ZY3A 1DX9A 1QP7A 1NAIA 2R84A 4JBIA 3VKUA 4L9WA 5GV7A 1F2UB 3IQEA 4M88A 4PLTA 1NAHA 5E4JA 4J03A 4L4RA 1Y1QA 4I66A 3N5KA 1IMOA 2J6BA 4BQSA 3DKIA 2O3JA 3QW4B 5KB3A 1IEVA 1RC1A 4QJ3A 1FNBA 4TKLA 2R8YA 3UHFA 5JXWA 3W2GA 4BIMA 1Q83A 1I2ZA 4PWZA 5DVZA 3JQ7A 1U7OA 1K8XB 3P71T 2FG6C 5EWJB 4CIYA 4MTLA 1UBUS 1L5GB 4KUHA 2GF0A 5DXAA 3KCQA 5TPZA 1GPKA 3UYLA 1P9NA 1UEIA 5FLXA 2VQ6A 3BRSA 5U4QA 1RKVA 2FZEA 1JN0A 5EUMA 1X70A 4EGAA 1YC5A 5EKDA 3HC7A 3CG0A 4OP3A 1FQOA 2ZIEA 1I3NA 1Q2XA 4EY6A 3PHCA 3U4HA 2GPTA 3EULA 4OYHA 4EZBA 1BSVA 4MIEA 1SHKA 1U7DA 1D2MA 2VP6A 2UVDA 4GUAA 2A14A 4FOPA 2YN4A 1MHPA 2WF5A 3F97A 4URHA 4D3DA 3GLRA 4CCSA 4M49A 1DUVG 4H16A 1USKA 2YIDA 4MKGA 2DFDA 5IP5A 2DPLA 2M1XA 1RE1A 1K3FA 3RS9A 5FPKA 5HQTA 1UK9A 4AIRA 5I9TA 4JZKA 1N2IA 1K6MA 1Q3HA 1SKAA 2B4YA 1NYQA 3PNOA 5CPBA 2PWBA 2ZIAA 1AGRA 3L7BA 3QE2A 4EUEA 1L5YA 1V1MA 2ZOSA 1DO8A 2RJ3A 1U99A 1Z7EA 3ELDA 1M1YA 2CZGA 4DTCA 5ALFA 5HQ3B 1E4VA 5ITZA 3HSYA 4MYTA 2M6LA 2LW7A 4OQLA 2DEUA 4NJMB 1E3WB 1U3DA 2HU2A 3ANLA 3BAFA 1GCOA 2Q3DA 2C9DA 3WZLA 1NJ1A 5AM3A 2GX6A 3O3OB 4MWDA 3I2JA 4OXKA 4D4JA 4EPWA 1R16A 5A9RA 1L4EA 1QXSA 4F38A 1EFRD 3K30A 2OCIA 3TF5A 3WGKA 1KEUA 3V33A 1RQ2A 4MQBA 1U0TA 1O2DA 1T8SA 1YMUA 3IEUA 4Y0NA 3ZHQA 1JSCA 2DFLA 1H4SA 3HMKA 1Y5RA 3OPXA 3SXPA 1HE4A 2Q3JA 3P9IA 5AJWA 1JBEA 3HTXA 1BXKA 3ZW8A 1GZ3A 1P1BA 2QAGC 1A4IA 1OX4B 3RS3A 4I50A 3C6ZA 1EWTA 3H75A 2QTLA 5EWMB 3WNCA 5CYGA 2J6IA 3EUWA 2VPIA 3PYMA 1QZ3A 1IJBA 4HDMA 1HL7A 2FWPA 5JVDF 2Z2XA 2AVDA 3BILA 3TW4A 1IJEA 4BFCA 4UNPA 4B81A 3ZJUA 1PUXA 4KHPB 3RKSA 4BNUA 3RK0A 5JHGB 4LJKA 4X62B 3QKSA 2K5UA 1NQ5A 3MD0A 4HFNA 2PPVA 1VG1A 2H1OA 4E15A 1A71A 3H5RA 1O9GA 1Y1TA 2CNBA 5JY1A 1NQVA 4Q5IA 4DVGA 1JIIA 1MG0A 4AP9A 4E0BA 5JY6A 1C4XA 4EYOA 3DUFA 2ZIZA 3E3MA 1NVVR 4KGZA 4O3MA 1QR6A 3AFHA 3X1XA 5K3AA 3A6JA 4YS6A 3ZNNA 1CZNA 3BOSA 4UNNA 1LLCA 2C5FA 1BE1A 5KNLA 3GEHA 4BAGA 5C4IA 3UWOA 1Y33E 1FQKA 2Z8ZA 4MWEA 2QN8A 4MUMA 2X42A 2Y67A 4JMPA 3ZXXA 2FUCA 4TTTS 3QVXA 3PIIA 5LLDA 1C4WA 2FA9A 4JLJA 4Q3NA 3SVLA 1JHYA 2RKOA 4XJTA 5FA5A 4K2HA 5K6TA 2BTEA 4LGCA 3TEJA 4WK6A 1PZGA 5K3DA 3JYPA 3LG2A 3P9ZA 2QE7A 4BWGA 2WTEA 3KR9A 1S2NA 3HPRA 1Y8ZA 2D5IA 2GFIA 3DEJA 1EFUA 3GFFA 3NG1A 4EVRA 2GEVA 3FDFA 3PVCA 2HA2A 2X4DA 5ARCA 4IUYA 1QQ6A 2Z2JA 2CUZA 4ZDWA 4IIYA 1NLMA 1VPLA 2OMKA 2NACA 5EXDA 3RS7A 1EUCA 1U7HA 2FWBA 3CW2A 3F90A 5LP6B 4CDNA 4K05A 3TNDA 3ZHUA 1O95A 4UPEA 4LMPA 4UCWA 2JIQA 2ZSHA 4IQFA 2FSSA 5K6RA 4HVCA 4HS4A 3SQWA 4L2IA 2YRFA 3F6YA 4BRUA 5JCOC 4BLQA 4XIGS 1X14A 1KSHA 2OL4A 4ISBA 4YAEA 5JJ5A 2QTVB 4YMHA 1SXIA 1L7XA 1RW4A 3C6XA 1GUYA 1UAAA 2QG6A 4OQFA 5EWLB 3EZ6A 3CKYA 2A5LA 2BJHA 1O58A 4IHAA 2IYNA 1RM4A 3M6AA 4XWKA 1TRHA 2HWYA 1QC5A 1EVJA 2CDRA 1I4TD 2GVNA 2HMYB 3HNPA 3K35A 3KELA 4MV6A 3TRKA 3HBJA 4QBTA 5AVTA 1X13A 1NPYA 5U1PA 3WKCA 1TEZA 2XKJE 3D02A 3OC6A 2PUAA 3RC3A 4MP6A 1L4HA 1ZMTA 2ZYWX 3BIXA 4UJ3A 5SYMA 4C87A 1A0OA 2FUKA 2LR0A 4JBLA 4I1UA 2O5VA 1J2YA 1RHUA 2A3RA 3K0HA 3SS8A 2J4DA 2AC7A 5AW4A 2EZTA 3OVMA 4DSNA 3U2QA 2C2ZA 2I4IA 4DT1B 4MIYA 4QU5A 1RZRD 2FEOA 2BFBB 4UREA 4OYLA 2BEVB 5LXTF 3P7MA 2X8JB 3M1IA 4WCFC 3SX2A 1OYOA 2XUHA 3O9ZA 1FY2A 4LOKA 3RS2A 1X1RA 4L8GA 1WZEA 3KOXA 4Y9RA 2BBOA 3GJ8A 4QNNA 3C43A 2WD8A 3VM6A 2IXEA 1TYAE 2QVBA 3WWYA 3JVVA 1APBA 5GIPE 3QOYA 1B6TA 3WBBA 2B82A 1SKYB 1ZK3A 3T61A 2JI7A 1M76A 4XWAA 2DHDA 1N6LA 3DHVA 5DYYA 3SLGA 3OWHA 1IC6A 3DMRA 4KXFB 3RRBA 3OZEA 3O1JC 4U7JA 1KMHB 2XA9A 1EGAA 1L5KA 3A3PA 3EIOA 1N8KA 1JQLB 4WFIA 5DWVA 4BVGA 5JFGA 3ZD7A 3IIJA 1C30B 1SCBA 3L01A 4RD0A 1N6PA 5ARBA 1FSFA 2PKQO 5EIBC 1Z88A 3ZDYB 4MVJG 2X76A 4K6CA 4M83A 4PU0A 4E03A 4V02A 2O8BA 1ENZA 4EA9A 1PR6A 2HCBA 4I4LA 4ZYUA 4LHYA 2F3QA 4TMZA 5I4CA 3WMWA 1L3BA 1B42A 3NTXA 4RDXA 3OOJA 2PKEA 5B7PA 4HTAA 3TZ6A 3EIQA 2IPAB 2PL9A 1S7GA 3C1OA 1Z22A 1WW3A 2HWKA 2C31A 3E3LA 3INGA 3Q7IA 1A4XA 1VLJA 4WCDA 4EG5A 3BBPA 4C4TA 2ZUDA 5EHGA 3K96A 4YP7A 3CUSA 5AJZA 2ODPA 1E60A 2WT4A 16PKA 4LZNA 3KQQA 4CM3A 4BJ6A 3TXXA 1GLVA 2QTRA 3G1WA 2BELA 1QNFA 4KHZA 4BNHA 2DQ4A 5LQRA 4HQFA 4ZV7A 4E32A 4DM3A 3PQ3A 5JEDA 1MKYA 4TS9A 2F4VB 2YMLA 4ME6A 2WFAA 4YJFA 4MGHA 5BUQA 3WQBA 4LYYA 1BN7A 4BLPA 4MUAA 3VTZA 5KBYA 3TAXA 1HT0A 3W5HA 4CODB 1KYWA 2NVWA 4IDFA 4M7OA 1T2FA 1ZCZA 3IUPA 1O7JA 4HH3C 3V2GA 2DBRA 2AG1A 4LWPA 4MAAA 4ATNA 2CBGA 4MITA 4GKJB 1Q91A 1E94E 1N4AA 3SMQA 1CY6A 4YAGA 3BDIA 1THTA 3JQ9C 3MJEA 1IQUA 4GBGA 4U6NA 1W4LA 3OKFA 2C2KA 3B9PA 3CEJA 5BQFA 1VPEA 4GP7A 2AG8A 4HY3A 2HSEA 1WF3A 3P9PA 5D8DA 2C1XA 1E1QA 1EX1A 1G4HA