2X2FA

Dynamin 1 gtpase dimer, short axis form
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
347
structure length
336
Chain Sequence
EFSMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYSRVDEMLRMYHALKEALSIIGNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords DYNAMIN-1
publication title G Domain Dimerization Controls Dynamin'S Assembly-Stimulated Gtpase Activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 336
sequence length 347
chains with identical sequence D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2x2fA00
5JFGA 2F3TA 2WMOB 1E4VA 2BDTA 2RGNA 1JAHA 1JR6A 4B3DA 3RWOA 1YZQA 2RCNA 4E03A 4EPXA 5FI0B 3AVVA 2Y8EA 1F48A 1E79D 3ND9A 4KLNA 5H1YA 1QDEA 1Z22A 2ORVA 2X19A 5KSPA 4YMVA 2RGDA 4XWOA 2WMNB 1KJWA 4N0EA 2J59A 3K9GA 1OF1A 3OIVA 5HE8A 3THOA 1BS1A 3CH5A 3ZDQA 2XB2A 5GJVC 4OHZA 4B73A 2ZJZA 5JI2E 3QQ5A 1TL7C 2I4IA 2OBNA 1R8SA 4YONB 4II7A 3IIKA 5B57C 5E7JA 4Q1EA 4Q1AA 3OFNA 1LS1A 2YC2C 5DNYB 1Q44A 1DS6A 5K8TA 1MV5A 3KXKA 3D8BA 2RMKA 1YKSA 3VX4A 4NDZA 3BH7A 1Q1BA 1WA5A 4IRUB 3UANA 1W7AA 2OFXA 2ZM5A 1U0JA 4ITRC 2QG6A 1OXUA 1QZXA 3MLEA 421PA 3NHBA 1P5ZB 3T1TA 4Y0AA 2QP4A 1F2UA 4WOPA 4NONA 3PUZA 3VR5A 1FP6A 2BCGY 2ZI6A 5EP2A 3MWLA 2FFAA 3ZVLA 4G5RA 2ZSEA 4ZO4A 4B35A 1IN4A 4MDFA 4B74A 4LC0A 4DEXA 1NI3A 1GITA 3GMTA 3UPUA 6Q21A 2AXNA 1L4YA 1SVIA 2PZFA 5G41A 1EFHA 3CM0A 4IDQA 3SN6A 1VDZA 3RS4A 4Z51A 1Z2AA 3ZGXA 2G0TA 3ZZTA 4MYCA 1KMHA 1J90A 1M2OB 3AGQA 3X1YA 2CLCX 3C8UA 2CJWB 2IL1A 4UJ3A 5JEDA 1UBEA 2F43B 3TBKA 4URYR 1KK3A 1OLOA 2NZ8A 4QGFA 3WHLA 8OHMA 5G3YA 3RS5A 3AF1A 3GLHE 1HUQA 3CRMA 4XIGS 3SR0A 1IJFA 1A7JA 4KBFA 1F5NA 4HLQB 1SVKA 2PBRA 1E9FA 1Z6XA 4V03A 5DYIA 3IBGA 2VF7A 3AKDA 1TQDA 5EE0A 1L4UA 1Z3IX 3ZIAA 4RZUA 3F8TA 3LLUA 4ZV4A 1UBFA 2IW3A 4A1FA 1JR3A 2QQ0A 2BV3A 2G77B 2O8FA 3LFUA 3QKTA 1W0JA 2QL6A 3L2OB 4JVSB 2HYIC 1E0AA 2PT7A 2GXAA 1RRGA 2KSQA 2VO1A 1Q1ZA 4Q4JA 4UNRA 4OBEA 1ONBA 4Q66C 1KMQA 2HV8A 2DY1A 2A9KA 4LYFA 3L0IB 1E2LA 5J4VA 3RSLA 2O52A 3EASA 5EP3A 3QXJA 1ZYUA 2D2FA 4PFSA 2WICA 1T6NA 2BM1A 2E1RA 2P3SA 5FR2A 1FNNA 1OB5A 4PPFA 3P4XA 5DI3B 4TL6A 3VR4A 4WXPA 1U8AA 1MR3F 3ZLJA 4GI7A 4X8OA 3QENA 1GFIA 3GLFA 1G8HA 1XTSA 3S1AA 4ACAA 4BWYA 3RSOA 3FDIA 1EESA 4LHYA 1XPUA 3U61B 2X1VA 3T61A 3Q7PA 1RRPA 1G8YA 4EFMA 2VHQA 4W9MC 1VTKA 1TAGA 2ZRMA 3EIQA 2FSIA 3GQBA 3U2QA 4DZZA 2N1BA 3LY5A 4IHQA 3VAAA 1VG8A 1XJQA 2A7QA 1G9XA 4A2PA 4A15A 4TZ6A 1U99A 5LD2C 2ONKA 1R0ZA 3SJAA 1N0WA 4DSUA 1NLYA 1Z6GA 4M9ZA 1BO6A 1X1RA 1F3OA 3EZ6A 2IXFA 3PR1A 3TE6A 2ZYUX 3HU2A 4JLVA 1CXZA 4CIDA 1FMLA 2ODBA 3KQUA 1DG1G 4G3XA 4BRWA 5JS7A 1II8B 2QBYB 1KK1A 2GK6A 2NO0A 5IF9A 1N5IA 1G3MA 1LF0A 3U4QA 4G01B 3CNLA 5FI1B 1PUJA 4DCVA 1P62B 1OV4A 4BLQA 1R7RA 2IA5A 3FFAA 3ZIAD 2F1HA 2JLSA 2H18A 2J1LA 4JSTA 5AJXA 1E9CA 1ZC4A 3ZQJA 2G1KA 1TQ6A 2ATVA 4AKHA 5FUVA 5AUQA 3SU8A 1SHKA 3X2SA 4BFWA 1W4CA 4BLPA 5G3ZA 1HURA 3NTUA 3FE2A 4B44A 4IXMA 1T9HA 1IXSB 2ZJ2A 1W48A 4QKQA 2C99A 1KDRA 4ILEA 4XTRA 5FBLB 3IO3A 3C7KA 4TQAA 5GJWC 1UM8A 1J70A 4PR0A 2R2AA 4GOKA 4TT3D 2A78A 5CM9C 1CLUA 4ERNA 2UVQA 3GJ3A 3BORA 1VCNA 5FFMA 5KSZA 1ZD1A 1LS6A 2AFIE 2O8DA 4DIEA 3GJ7A 1OXXK 2FE4A 4FMCF 4Q1CA 1QG2A 1ZNYA 5AJVB 3T1QA 4M1KA 4QHYA 1KI9A 3REGA 4C4PA 1JQLB 1CJTC 1P9WA 3O47A 2XTZA 1X86B 1ZUHA 2GCNA 3KKOA 5LDDC 1NVUQ 1SKYE 3LBNA 1N2CE 2IYZA 3C5HA 1L7VC 1KAOA 3RRNA 3AVWA 1P9RA 3ZJYA 4BFUA 1S9DA 2FDCA 1UADA 2WSSA 5TXGA 3AF3A 3KB2A 2ORWA 3BRWD 4C7OA 4MGKR 1OSNA 3TAUA 1JQJC 4FMCB 1ZM2A 3MWJA 4A36A 1A2KC 2G88A 2N46A 3Q8XB 4NKRA 2BEKA 2IS6A 1UFQA 1G19A 1YZUA 2CNWA 1Z8FA 2HCJB 2VHJA 4JT4A 1E2HA 1P2SA 4L5BA 4E5UA 4ZCIA 4GNKA 4GP6A 4PSVA 4DLUA 2V8OA 4C30A 2ZS7A 1E69A 2VBCA 2Q9AA 3EA0A 2PX0A 1Z63A 5LD2B 2D3WA 5BN3A 1KI6A 4ABYA 5DO9A 1FFHA 4XWKA 1HT2E 1JAIA 4D4KA 2IS2A 1XPRA 4ZDIA 4RFSB 2BM0A 1Q12A 1D6JA 2WAYA 3UWKA 4QNMA 2O8BB 1E6CA 2WJHA 2B8WA 4PQYA 4JL5A 4OHYA 4DB4A 3EZ9A 4O2LA 5H70A 2IBMA 3IEVA 3K9LA 2OESA 1P2TA 4V02A 3T1VA 2GJ8A 2YNMA 1HV8A 4Q9IA 2FZ4A 4LGMA 3A37A 4RKFA 1OXTA 5KSOA 1E3MA 1T5IA 1IN7A 4HAZA 3GLHA 2O5VA 5JZVA 3QKSB 3QJYA 1EX6A 1Z6TA 2AX4A 1QHXA 1XB2A 3ZVMA 1XF9A 3NC1C 4Z1MD 4FCTA 2OUKA 4PZYA 1XMVA 2IF0A 4R9UC 3A1WA 3GCGA 4KXFB 1CEEA 3JVVA 1G1MA 1SVMA 2YWFA 3EPJA 2WTUA 1EWRA 5SZKB 2BEJA 1NN0A 1F2TB 5FPHA 4AYWA 1DTSA 1BYUA 3CRW1 2BVNA 2DFLA 1MRSA 2WSSD 3GJ5A 1SVLA 1BMFA 2CBZA 3B1ZA 3U3MA 2RH5A 3AEZA 5HCNA 2EFEB 2VSFA 2DHRA 4IDPA 1G7TA 5J5CA 4BEJA 4LJ6A 4KBGA 2BOVA 2C9OA 5P21A 1Z06A 2CNWD 2H5EA 1BH2A 3MMPA 1KI4A 2Z5FA 2MMGA 3DOFA 3W90A 3U6KA 2YWGA 4JLOA 1HQYE 4ZI2A 4MUAA 2PMDA 2DFKB 1W46A 2RGEA 1T3LA 1MO4A 3BAFA 3KFXA 3IHWA 1C4OA 3SFZA 1ZD8A 4CEJB 4FIDA 3KUCA 4UXHA 4C9BA 4FCVA 1YRAA 4A0GA 5FL3A 5AUNB 5FTJA 2CVFA 3VQTA 2EFCB 4JIMA 1FQKA 2A30A 4A0RA 1DEKA 5JHHB 2JGNA 2O8CB 1KKLA 2P0EA 1Z07A 4NYMR 4TLCA 2EYUA 4WVFA 4N1AA 3WRYC 3A1SA 1OH6A 1IONA 1LNZA 2GVZC 2VEDA 2QI9C 5UKDA 3JZMA 3CBQA 4UQOA 2WV9A 2ZJ8A 1RRFA 3K70C 3I1FA 2RGBA 1SULA 4P4SB 4KITB 3OIWA 4GPTA 1G6OA 4HZUB 2FV8A 3IQWA 2D62A 3DL0A 1M6NA 4JKIA 4ZKDA 4LBYA 5AWFC 3F5FA 3NHAA 3WY9A 4RSGA 3NEJA 2J9RA 1XD2B 5L3QB 3FWYA 1ELOA 5J4HA 3VFDA 1NIPA 1NSTA 3T5GA 4F93B 4OQXA 2ZUDA 1XTQA 5A0FA 3MJRA 1CP2A 4H9GA 4URZR 4A92A 1AS2A 2BKUA 1FUKA 1CU1A 3QVUA 5IDVA 5C2JB 4AY2A 3SJZA 1G3QA 4JLMA 5FH9A 3DKVA 2VRWA 3GFPA 1L8QA 4OQNA 5FOSA 3BD9A 2R62A 2Q21A 2OXCA 3I3SR 2OXRA 2GA8A 3I8XA 4M9QA 4C2UA 2IYUA 1KSGA 1G4UR 1XMIA 3B2EA 3SHFA 1BMFD 1T3SA 5CLLA 4LUCA 4KFRA 1UKEA 1HE8B 3R8CA 1E9AA 1QVRA 3EC1A 3OE7A 4IOMA 4OJQA 4Z8XA 1KDOA 2QT0A 2ZPTX 3QBTA 2VLIA 2RB4A 3SBDA 4D0NA 2GXUA 4E22A 4DDUA 1XTIA 3W9YA 1A2BA 4EPVA 4BZXA 2B6HA 4LHWA 2BIFA 1W4RA 1SGWA 1G6HA 4MKHA 1RRCA 1Q20A 1OKKA 2PEYA 3R7WA 4YMSA 1S9HA 3FTQA 5DSZA 4OI1A 4M1TA 4TSFA 2BCJQ 1NKSA 2V6JA 1EFTA 1OPXA 1T0JB 3H4MA 4Q4AB 4IFBA 1P3JA 2JA1A 2QROA 1VG9B 3FGNA 3U7HB 2O8EA 4Q01A 3B9QA 5J4LA 3THWB 3MCAA 2R6DA 4M1YA 2PT5A 4M8NE 1IXRC 3HU3A 1VIYA 4B6FA 2QAGC 1YR6A 1GP2A 4IDOA 2DPXA 2QTVB 3TQFA 2Q3MA 3W3AA 3CONA 2ZQ5A 1D5CA 4PO9A 1XCPA 5K8LA 3EPKA 2IYRA 4TQUS 1NVXQ 1G64A 1J2JA 1H8EA 5IK2A 2GDJA 2WKRA 3U7FB 1N5JA 3RDPA 4AKEA 4Q4LA 1CBUA 4LZZA 4N3NA 1Q57A 2IF2A 1XFAA 1JI0A 1T0HB 2ZR0A 221PA 1S4QA 1GRRA 4XD7A 1G3IA 3IQXA 4JJKA 4B2LA 1WBBA 1N0VC 3AVYA 2ECKA 2C8VA 3RC3A 2ZTSA 3QVVA 2SHKA 1WP9A 1SKYB 2ONJA 4IXNA 1X8JA 3NBFA 3TVDA 1OXVA 3VTKA 2XITA 1GL9B 1ZMXA 4YMWA 3IDQA 2XGJA 1G7SA 1E94E 3IHLA 2AFHE 4OL0A 5JWHA 3VU9A 4HUQA 3C15C 1HEIA 4LJ9A 3T06B 3FHTA 2VQSA 1QRAA 1ZC3A 3E2IA 3KTAA 3CWQA 4NH0A 3DOEA 4ACBA 1CJMA 2FEMA 2C98A 3BB4A 2ZJAA 1SXJE 4Q21A 3MJHA 2GTPA 4LY6A 3KFVA 3OE7D 1QHHA 1OIWA 1TMKA 4LSGA 2NQ2C 1W0KA 1KO8A 4BECA 3KDSE 5C1BA 1Y63A 4JT2A 4C0QC 4YQFA 1KSJA 1CR1A 1OKKD 2Z43A 1U94A 4TSFD 3U3KA 3CUEF 3CRVA 4IOKA 3CX7A 1W4AA 2A5YB 2OEPA 2QQEA 1YR9A 2W6IA 2ZRKA 2WPDA 3UG7A 3A4MA 3QG5A 2J0QA 5KPDA 2I1QA 3IEUA 3CLVA 2IK8A 2QAGA 3T12A 3LQQA 2QRZA 1AZTA 1AIPA 2FN4A 2V55B 1ZP6A 1DPFA 3K70D 3SZRA 4AG5A 4EUNA 3B1YA 3CPEA 5EQTA 4ZI3A 4TZ0A 1NF3A 1YHNA 4ZPXA 4BLTA 3GLIA 1H8ED 5IK2D 2VP6A 5GJCA 3VR2A 2ZRNA 1FUUA 1S0UA 3T35A 4OI2A 3QKRA 1RFLA 5JWRA 2ZRIA 1NMXA 3FMFA 4TMKA 1TADA 1Z29A 4V0NA 4CDGA 4LJ4A 1M7GA 1XTKA 2OT3B 4QRHA 1CRQA 4XD7D 3ADCA 2ZI4A 3FFBA 2ZE7A 1OXSC 5BQ5A 1R5BA 3HYRA 3WNBA 1OIVA 4TLAA 5JWOA 1KDTA 5D3MB 2OCPA 2OV2A 3U7EB 4RVCA 2IYSA 4C0HA 1C1YA 4LHXA 1ZD9A 5F9FA 3SYKA 3WMGA 1WBDA 3C16C 2VHTA 2JLXA 1O3YA 4R2HA 3GEEA 4RZXA 3TNFA 1EX7A 2MMCA 4GDFA 3P1JA 3ASZA 1T4GA 2J0UA 4WW0A 4WZAE 1VG1A 3BXZA 1QHSA 4XVQA 4TYYA 1CR2A 3BFVA 4Q7MB 4DBLC 3JZAA 1W0KD 1IY1A 3NBYC 1N0UA 3AVOA 2LWIA 1E99A 5KO2A 2L0XA 3NVAA 3AUXA 2NO7A 5TARA 3W6PA 2DR3A 2FFBA 2KE5A 1YRBA 3QPVA 4HDCA 2FWRA 5TB5A 2Z4RA 3OZXA 5KDLA 1YE8A 3GJ6A 4JZKA 1Z47A 2W6ID 2WPDD 3V4FA 1RKBA 2OBMA 4M9XA 2D4HA 2REBA 3ADKA 3I92A 4GOXA 3RWMB 1X3SA 4RD2A 3I62A 1UBGA 4U5XA 5DISB 5BYKA 5JJIA 1OFTA 2J7KA 3QNUA 1TU4A 4DJTA 2RKOA 5HTKA 1XP8A 3PITA 1GKIA 2EU8A 4XSHA 4DCNA 1NL3A 3RNLA 4C0SA 3U60B 1CS4C 3EX7C 2ERYA 5FBRB 2UZIR 1JALA 4FWIB 2VH5R 4CVNA 3OEEA 5JRJA 4PO1A 3WNCA 4ON9A 3KKMA 2W2TA 1B0UA 1SVWA 2BHRA 2IT1A 1ZM3A 4PSKA 3AQ4A 5BW8A 3EARA 3BFKA 3VX3A 1DAGA 3EW9A 2GZDA 2PCJA 1TF7A 2FSGA 4EIWA 1RZ3A 4DLXA 1R10A 4MRSA 4A0FA 1QG4A 1S3SA 3WYGA 1ZIPA 4R71A 3IPYA 4QBHA 1NBMA 3EIEA 4MGYR 1IQPA 2VPPA 1YJ5A 1TUEA 1XTJA 4Q9LA 4JKYA 4JBWA 1S2MA 1E1RA 3PG5A 4QOSA 5CITA 2X2FA 3DZ8A 3QOFA 3NDBB 1E2KA 2CJWA 1EWQA 2F43A 4KSBA 1N5LA 4K46A 3K0AB 3L8YA 1OIXA 2QUZA 4N0DA 1W5TA 4G5QA 2KWIA 4BGDA 1QBKC 2WJYA 2ZUCA 2ZRBA 5EXPA 5F9HA 5AUOB 2MSDB 4Q9HA 4Q18A 1E96A 1AQUA 4V0OA 2IYLD 3LLMA 4LPKA 4TTQA 1TQ4A 4RFVA 4MYHA 2F6RA 3O8CA 3PEYA 4WIAA 3TKLA 3B5JA 3AVUA 4E09A 1GUAA 5ELXA 2ZRGA 4TYQA 4FMBB 1PJRA 4XH9B 2GJKA 3G82C 1DAHA 1O87A 4PPQA 1NY6A 2ZYVX 3V9PA 5KHOC 4ZDKA 3J81k 1FOEB 4BFXA 3QI2A 2GWHA 3DPUA 3RAPR 4TYWA 2AKYA 3OEED 3X1WA 3VNVA 1JB1A 5KNBA 4FWTA 2D7DA 3AKYA 1NNEA 2RGGA 3CRRA 4B3BA 3MWYW 5DI3A 2ZRDA 4EQ6B 4DDVA 1CULC 5HKKA 2B7BA 2KI5A 1G8FA 4PC6A 3I5YA 3LBIA 2GESA 1EGAA 2NTYC 4X8LA 3THYB 1Z0IA 3BWDD 5C46F 4HLDA 2WWHA 5JECA 3U44B 2IEYA 3LH5A 1SXJB 2NPFA 1XX6A 4NYIQ 3OIUA 1M1YE 4G5GA 4DKXA 4PC3A 1NBMD 2C04A 2VP5A 2GEVA 4DLZA 1UEJA 1R0YA 2IC5A 4O2RA 5SZJA 5LB2A 4Q5IA 1N5KA 2G1JA 4NCHA 1E1RD 3PQCA 4TT3A 1G5RA 1DAKA 2JDIA 1E2QA 4V0MA 2ZAOA 2F3RA 3O8DA 5M04A 2FSFA 4BFYA 4GSYA 4DVGA 2QTFA 1PLJA 2NPIA 2WJGA 2DWOA 4D25A 1FZQA 2P6UA 4JJZA 1II8A 2QBYA 4TN1A 1Z08A 2PJZA 2ZJOA 4A4DA 4EJSC 1Z6YA 2UZ3A 2VHCA 4HAXA 4XOIA 2XJ9A 1GIAA 4NU0A 3W6NA 1Z83A 1ZRHA 3KKQA 1DE0A 3BIFA 3NBZC 2ZANA 5SZHB 2CL6X 2W0SA 2ZU0C 3AF4A 4CGZA 3N2IA 1SVSA 4DT1A 4GZMA 3W3ZB 4EPRA 1J7KA 1KSHA 4LYAA 4B2IA 2KBEA 1XTRA 2ZRLA 4LI0A 1NLFA 4CEHB 1M7BA 3EXAA 4PC1A 3GJ0A 2F9LA 4TYPA 2QY9A 4OK5A 3PCRB 2FGJA 1KO7A 1W4BA 1YZKA 4CZ2A 3BE4A 4CEIB 2CVHA 2IS4A 5HKKD 2H17A 3BOSA 1JECA 2AK2A 2R6CA 1IAQA 4DT1B 4QHSA 1AS3A 1C9KA 5L3RA 4EFNA 4FMDF 4DSTA 2REXB 2ZSFA 4HYYA 4MRPA 3REFA 3P4YA 1QVAA 3LNCA 4B3GA 4JS0A 5AUPB 1NMYA 1E2PA 4HI0E 4A0HA 5KDOA 4G1UC 4XVRA 1U0LA 1WQ1R 3B9PA 4PHTA 4MH0R 2CDNA 4JLJA 5FPTA 2JDID 1TF2A 5IT5A 3EIHA 3LVRE 1NSFA 4FMDB 2V7QA 3RS2A 4DC9A 1R4AA 2FPLA 4M53A 4X8HA 2NO9A 2H92A 5TY0A 4AI6A 2P6NA 5DH9A 3KL4A 3I5XA 1KZ7B 4Z1MA 1VCOA 3NBXX 1RC8A 4WXRA 3AUYA 4M1SA 2QNRA 5KTYA 3PJRA 3SS8A 621PA 4QC2A 2FOLA 2X2EA 1XBTA 4G0NA 2QMHA 2W2VA 1G5TA 2BMEA 4W7SA 1VHTA 2CHGA 3AV0B 2G9NA 2HT1A 1RPZA 2XAUA 4NPHA 2WOOA 1Z0AA 4TMZA 1NN5A 1I4TD 4Q48A 1TEVA 1X8LA 4RFSA 3H1TA 2O8BA 4Q1BA 2G3YA 4I4LA 4KSCA 4D4JA 1X6VA 4M21A 4PANA 3QF4B 4KFUA 4JLNA 2H57A 3ADBA 1GDDA 2HJVA 2HLDA 4EJSB 1IM2A 2FMXA 1YU9A 1JPNA 1NVVQ 2NO6A 2ZAMA 4F38A 2QM7A 3MSXA 1FP7A 2QE7A 3QG1A 3CO5A 1E2GA 4U00A 3MGCA 3A4NA 4DSNA 3VKWA 1SQ5A 3K0FB 1E2MA 4YLGA 4DEYA 3KJGA 4F4JA 3VKHA 2WOJA 2YHSA 4PZZA 4ZCMA 1XCMA 1CTQA 1SZPA 3QKSA 4TLEA 1T8UA 3HR7A 1W2GA 4MQBA 3KXIA 1XEWX 2XEXA 1KI1A 2CHVA 2VP9A 4D82A 4DIDA 4DWJA 2ZSAA 4OJKA 1RVDA 2YYZA 5LPNA 4QNRA 2FSHA 2Z83A 3CB4A 1NN3A 2Q3FA 1OE0A 3I72A 1G3UA 3A58B 1EFCA 2ZRHA 4JLBA 2ZSDA 1VYTA 2P5TB 5DYGA 4HLCA 3ND8A 4PXAA 4UNPA 3R9XA 2FU5C 3ZVRA 1OH8A 3C4JA 3PVSA 2ANBA 2OFOA 1F2TA 1OJLA 4CYMA 3WHKA 2HUPA 4KFTA 3TSOA 4LPSA 5EE5B 2EFHB 1FTSA 3K1JA 5CB8A 4Q4HB 2V7QD 4HAUA 1VG0B 5JLJA 2HF9A 3EG5A 3WP1B 5EZ6B 1D8TA 1R8QA 2W58A 5L3SB 5G40A 4GOJA 5C18A 1MOZA 1W2HA 4K81B 3AM1A 2F7SA 5JMTA 3GLGE 1NIJA 1IOZA 3CR7A 3WP0A 1OB2A 3E70C 4JLKA 4JVNA 4PC2A 5FUXA 4CEJA 4OQMA 1GM5A 2PZEA 3K9NA 5J4YA 2QGZA 2P5SA 3SDZA 1SVOA 3K53A 2WAXA 4F92B 2O8CA 4GMXA 3CKLA 3CPJB 4PPGA 3Q5EA 5C4GB 2V54A 5JEEA 1UDWA 2HLDD 2Q3HA 3UWOA 2IEZA 1XEWY 3CF0A 3K0EA 4B32A 1VCIA 4M22A 2ERXA 3SEAA 1N3BA 2ZROA 1XJ0A 3RC8A 2QE7D 2H1LA 4P4SA 1Z0DA 1AM4D 4NE2A 5F98A 4HZUA 1X8KA 1Z6AA 4QBGB 4B33A 3IBYA 1II0A 3IILA 2W00A 1GKYA 4JVLA 4MYTA 3TW8B 4YMUA 5FTLA 4QM7A 3PUVA 3K0CC 1UF9A 1NP6A 1GILA 2R65A 3Q9LA 4RD1A 5B58C 4NTZA 3GP8A 1XD2A 1P9NA 2HJGA 4O25A 4QBIA 3H84A 5L3QA 4IOJA 3EA5A 4TWZA 4BLSA 3RRZA 5K8IA 1WF3A 1JNYA 1XD9A 3SNHA 3FHOA 2QP3A 3GJ4A 1AA9A 3LAWA 2HT6A 5DE3A 1BYIA 3PEWA 1W36B 1YQTA 3TRFA 1J8MF 4OKSA 2JATA 4BLRA 2JLUA 1N6KA 2IYTA 3UK6A 3DM5A 5DHFA 1NRJB 1GOTA 4TTPA 2P65A 1P61B 5JJLA 4MITA 4Q1DA 5KNCA 3PUYA 4L15A 2BBOA 1ODFA 1AQYA 3AVQA 2Z0MA 4HAVA 4JVMA 5BN4A 3EAQA 4ZDWA 2HEIA 3SJCA 2NGRA 2OM2A 3KJHA 1NMZA 1KY3A 2OLKA 2D74A 1HA3A 3CIOA 3D7MA 4LRWA 1K6MA 2ZXUA 1XEXB 4LHVA 4TL8A 3KX2A 4EPWA 5F3WB 1Q1EA 3FYHA 3JVUA 1E9SA 1G7RA 4L9WA 4P32A 4Q4AA 2A5JA 2JJ1A 5EUQB 4DLTA 2CK3A 2G0NA 2FEOA 2IHBA 3VR6A 1GRNA 2CMKA 1E2FA 2IX3A 3WMEA 2IYWA 1QHNA 2WM9B 2ZRPA 3TUIC 721PA 2QT1A 3WBJA 3THWA 3BK7A 3TUJC 3SQWA 2AWOA 1U90A 2WIAA 4IVPA 4H1VA 4HUTA 4ASUA 5AJZA 2RHDA 4PQRA 3TR5A 4JLAA 4IFEA 4CW7A 1D9ZA 2OAP1 4I1SA 1QF9A 3O8RA 2RAPA 4XSGA 4MDEA 3BC1A 5GVRA 3K0CA 2WWFA 1PLKA 2ASEA 2J7PA 3FMIA 3ETLA 1IN8A 4ESHA 1DAIA 2J41A 1E9RA 2QAJA 2JASA 3I61A 2BBWA 3AVPA 4BFVA 3RABA 5KDDA 3CF6R 4DRZA 2GHIA 1I4LD 4LBZA 4GFDA 4B75A 3WYFA 2ATXA 2C96A 3A8TA 5GADl 1G3RA 3A1UA 4YC7A 5F2EA 1FTNA 3W6OA 2NIPA 1LFDB 2JLQA 4RD6A 2B21A 4ESVA 1N6PA 4LYHA 1KNQA 4C2TA 4IDNA 2CLSA 1ZJ6A 3UATA 3CRQA 4MA4A 5LB4A 1YZGA 2WHXA 3FOZA 2X8AA 4B3CA 4PPNA 3ZVNA 2W83A 4WBSA 1XEFA 4AURA 2PH1A 3Q3JB 2ZI9A 1UKZA 2XTNA 3Q7QA 4DLVA 1E32A 3ZH9B 1UEIA 2AD1A 3H86A 2WKPA 4OK6A 2A5GA 2YV5A 1CR4A 5FPSA 2VP2A 4OI0A 2HYDA 3FKQA 4XJXA 2X77A 4NCJA 1DAMA 2FX3A 3DMNA 2BJVA 2WBLC 1W5SA 2ZJBA 2GETA 4TLBA 2BKEA 1ZUNB 3K09C 3LV8A 3U3OA 1XXHB 3IO5A 4R98A 1KI2A 2JJ1D 2CK3D 2HXSA 4PAOA 1E9EA 1JJ7A 1NVWQ 1COWA 2IYXA 4LDJA 5FUYA 4C0JA 5J40A 2YKGA 1OFUX 3NH9A 3DKPA 1G5PA 1X1SA 2ODEA 1KO4A 4FI3C 4BFSA 5GJBA 3L0SA 5B30A 1GSIA 4ASUD 1PUIA 2IYQA 2XSZA 4C0KA 4OK3A 4RD0A 4MGZR 4Q02A 4D81A 2VF8A 5JBQA 3A36A 4D2IA 3HPRA 3DO6A 3P27A 2GJAA 3K9HA 1TPZA 2YJTD 2QRNA 4HSEA 1EK0A 2J7PD 1U8YA 3AP3A 3KZ1E 4LJAA 5TV2A 3ZS9A 3AB3A 4URUR 5TMPA 1KI7A 1BKDR 2W0MA 4NYJQ 1KK2A 2ZE6A 5AR1A 1MRNA 1ZUIA 2WWXA 3AGPA 4IW3B 2FPKA 2ZVQX 4L8GA 4A2QA 4KHZA 3RANA 3HP1A 3UKDA 4ARZB 1DVRA 1M8PA 2QTHA 1P2UA 3LA6A 5EE1A 4D4LA 2F1JA 2Q9BA 5D3MA 1XZQA 1Q21A 4DLWA 3LD9A 3RS3A 5FBQB 1P75A 4RJLA 2QU8A 5KOYA 4R2IA 1R6BX 2R6GA 3LBHA 3V00A 1EFUA 1JR3E 4HZIA 3LXXA 3V4RA 2CCGA 4EKDA 2GCPA 4WZ6A 2EFDB 1LTQA 3PIRA 5CIWA 1OH7A 4D6PA 4O0MA 2ZI3A 4A6PA 3AKCA 2QP9X 1WMSA 2OCBA 4GP7A 3GLGB 5KSYA 3EZ7A 3PFIA 1YZTA 2VP4A 2JLWA 2ZITA 3PEVA 3KJIA 5HZKA 1KKMA 1OT3A 2ZYWX 4F91B 4A8JB 4DCUA 4P31A 2GJ9A 3K8YA 4B34A 2C03A 2J87A 3K09A 1DOAA 1E0SA 1T5LA 2GF0A 5FOVA 3SBEA 5CK4A 3E1SA 3IIMA 1Y3AA 2HDNB 1Z5ZA 2ZJ5A 3NG1A 3GLFE 2A5DA 5JHGB 2QGNA 1COWD 3ZD7A 3IUYA 1XWIA 5JI3E 4GZLA 2PZGA 3QF7A 4AG6A 1G18A 2CL7X 1AZSC 1G21E 1ZNZA 2XOKA 2QPOA 1XDBA 4JBYA 1U0HC 1ZW6A 1AGPA 3EC2A 3CZQA 4PTLA 2GKSA 5KYKA 3QSYA 1VIAA 3HU1A 2XSZD 3WXMA 3FKSA 4MRRA 4Y0VA 2XXAA 1OYWA 4KFSA 3TW4A 2CHQA 5EZ5A 3D6TB 5FL7A 3THXB 1R0WA 3B1VA 3W34A 4Q19A 1MABB 2GAAA 5CIQA 3NKVA 2FH5B 4XTCS 2HF8A 3WBKA 3Q85A 1CF4A 3B13B 2V1XA 1D2MA 2E87A 1FW6A 2LCFA 2MSEB 1IY2A 2GCOB 2RGXA 2IYVA 4EDHA 1XD8A 4P4TA 5C4MA 2QM8A 3LQRA 3DDCA 1RYHA 4IDHA 4LJYA 4YMTA 1UBCA 2XXAB 3QPWA 5HR5A 2R6FA 3HR8A 4W5JA 2J46A 3EWAA 4DDTA 1RJ9B 1EFRA 4QGHA 3MWKA 1NJGA 4NP6A 4MKFA 1ESNA 1FX0B 1CJUC 1N6NA 4A9AA 3LWNA 1SXJC 3LO5A 2BC9A 3QIAA 5HZHA 4KLZA 1SKQA 5KU1A 1PLLA 3BFXA 1CJVC 3NEYA 1GNRA 4DUGA 3QXHA 5DHAA 3BBPA 4PZLA 2O0HA 4DCTA 1KO1A 1GAJA 5E7MA 4F4IA 3SQXA 1QHIA 3Q72A 4QG7A 1WCV1 2ZE5A 3NC0C 3K0AA 3TLXA 2ZRFA 4Q7LA 4HDQB 1JJVA 2R9VA 3TVTA 2WWWA 1AK2A 3I32A 4GBMA 3KKPA 4ZIRB 1RYFA 2CE7A 2XX3A 3ICEA 4CT4B 3TGPA 4Q9KA 4BZPA 1NG9A 1HY3A 1XNJA 3UIEA 1M7HA 2JCSA 1FQJA 1P73A 4NCIA 3MAAC 5CYPA 5JSZB 2XOKD 3EPHA 1Q0UA 1Q22A 3B7GA 1G8PA 5FTMA 5H68A 1KI3A 2ZRCA 2JJ2A 5H8WA 2F55A 1IBRA 2W6JA 1A4RA 3FKSD 4IKEA 5EE9A 4TMTA 4FCWA 3SI7A 3SC3A 4TMWA 5FL7D 3CF2A 1E2IA 1XCGB 3ECCA 2D06A 1JEDA 2ANCA 3MFYA 3QY0A 2XJ4A 4KVGA 4POAA 4GMDA 3MUFA 4B2PA 3GPLA 3K0SA 1LF5A 4XVUA 1D9XA 2C9YA 4HB3A 5CB6A 1L2TA 1VYUA 2CCKA 4KO8A 3LDAA 3ASYA 3CWZA 3KJEA 3UXMA 4F4CA 4M1MA 1E2NA 3EWSA 5FOWA 4EQ6A 2REOA 2I1VB 4US1R 3F0TA 1ZVQA 3THYA 2BWJA 4H1UA 1P2VA 2H16A 2O0JA 4BEBA 5A5GA 2B92A 4DXAA 2JLRA 3U44A 1NN1A 1ZBDA 4C0AC 1EFRD 2OILA 3U3JA 1VPLA 1SXJA 2ORIA 1K5GA 3M0EA 2ZU6A 2LKDA 5DLQC 3B82A 4RCYA 3VHLB 4NYIR 1FNMA 1M74A 2NG1A 4PQFA 3PXGA 5EXSA 5CJPA 5HCIA 3FB4A 3BS4A 3SOPA 1WRBA 2WWIA 4FINA 4P33A 3TSZA 2ZR9A 4DUGD 1VCMA 3ZS8A 1M34E 2J3EA 4FN5A 1AJEA 4CF7A 1CR0A 3B1WA 1OYYA 1F2UB 4LV5B 4KCGA 2WZQA 2AL7A 1YZNA 2BJWA 2NZJA 3SJBA 4E07A 1G16A 4Q00A 1HYQA 3EZFA 1Q3TA 3KKNA 3FMPB 2AN9A 1DAFA 1MH1A 2Z6VA 2FFQA 1II9A 2XB4A 2KBFA 4D0GA 2JLYA 4OHVA 3HPQA 4QGAA 2YWHA 2AD5A 2QN6A 3IKJA 1JXMA 2KJQA 4HAYA 521PA 3CX6A 1KMHB 4Q7JB 3FMOB 3U3RA 2GK7A 1HE1C 4PC7A 2QENA 1W1WA 3OHMA 3PUXA 2JJ2D 5FTKA 1UKYA 2W6JD 4MUBA 2C77A 1F6BA 4DCSA 1E0JA 4LBVA 5FPKA 3H0KA 5DIFA 2CCJA 4ZKEA 1DADA 4B43A 3OFND 4RD4A 4LK2A 4ZDJA 2IUSA 2XNDA 3ZZ0A 4AD8A 4CEHA 4K8OA 5CDFE 4LC1A 4AIIA 1Z28A 2VSXA 1G291 2FFHA 5TDHA 1GWNA 2V4ZA 4C0LA 2ZE8A 2QEQA 3I73A 4CEIA 3FVQA 2VTKA 4I1VA 5FR1A 1VHLA 3LW7A 2O8FB 4URXR 1W49A 1JPJA 1VKJA 2AHOA 2OFWA 4Q4JB 1ETUA 3KQNA 2DB3A 1GNQA 2LKCA 1SXJD 1ESMA 121PA 2DFNA 1G4AE 2UKDA 3HYTA 2DWQA 3B1XA 2A3RA 4Q47A 4FXPA 5J4KA 2ZREA 4FW9A 4JL8A 2V6IA 821PA 5A4JA 2J45A 3L43A 1U81A 2QMEA 4IEEA 4KI0A 5IHPA 3EZ2A 4URVR 1GG2A 4D0LB 2VHUA 3RS7A 1N6HA 3CH4B 3U7GA 3DVLA 5GVSA 4KAXA 2PL3A 3VR1A 2PLFA 1ANKA 1WDTA 1GL6A 1VECA 2XTMA 3R20A 3GLFB 3S1AB 1ZNWA 4RY2A 4B71A 1GVNB 5KPJA 1KJZA 2VSOA 3KQLA 4TYNA 2FZLA 2OAQ1 3FHCB 2WVJA 2XZPA 4JSYA 2PCLA 3KQHA 4KJZA 1QHGA 4OQFA 1HH4A 3UMFA 4WAUA 3W8RA 1FL9A 2QPTA 1I4DD 1KI8A 3N5CA 1KO5A 2JLZA 3P20A 1NG1A 3D3QA 4GRAA 3A4LA 5KNDA 4J0QA 3X1ZA 1G20E 1JR3D 3PV0A 1S1MA 4GT1A 1E1QA 4EPTA 1P4SA 1W0JD 2YOFA 3QEOA 4W5WA 3C41J 5BN5A 3KB1A 3QF4A 2XNDD 4I1OA 3NXSA 4EJSA 1E9BA 2YOHA 1G7CA 4C3ZA 1N6RA 1NVVR 3O8BA 3U4QB 2GJSA 1U98A 4QJ3A 3ZD6A 1DG3A 3E5HA 2P2LA 4DSOA 1P6XA 4UXIA 5EUMA 4MYUA 4AYXA 1MO6A 2OO7A 3K0FA 4QFMA 1KYIA 3QBVA 4IEIA 3EPLA 1XJCA 3HWSA 4UKDA 1OHHA 3OEHA 2QA5A 4DLRA 1XXHE 4US2R 2IHYA 1KHTA 2OHFA 1GL7A 4B6EA 5J47A 2C2HA 1GRQA 1LVGA 1ZU5A 3F3YA 4XWAA 4CRWB 4BE7B 1AGRA 5L8VA 1R5NA 2OZEA 4RCZA 3VMFA 5K8UA 2J5XA 4PHFA 5CM8B 3L8ZA 1OFIA 5BXQC 1MT0A 1IJEA 1W44A 2D7CA 2VA8A 2YZ2A 4V0KA 2EQBA 1KDPA 1ZM4A 4HB0A 4URWR 4B76A 1W36C 2DFTA 2ZJYA 3GEHA 1KGDA 1DBSA 3WYAA 4M2LA 1JEEA 2O8DB 4I99A 2EVWX 4Q4HA 4UNNA 4HB2A 4QJ4A 3RRMA 2ODNA 4W5HA 5L3SA 2EW1A 1KAGA 1G41A 1N25A 4KODA 3TSWA 3UMSA 5AK0A 1E9DA 4M1OA 2FGKA 2QMOA 3IGFA 4IJMA 4G5SA 5TVKA 3L0PA 5KUTA 5LBIA 4EAQA 1KNXA 1YR8A 2OCAA 2ZS8A 5CYOA 2C78A 4D4MA 1D2EA 4NHOA 1VYVA 1KSFX 4QHTA 1S3GA 3OESA 4TMXA 3SFVA 5B64A 5EXXA 5EXTA 4LYJA 3N70A 5FBVB 4BZQA 1WB9A 2F1IA 3ICQB 2V3CC 2QZ4A 1E2EA 4QXAA 5AJYA 2GZHA 2VYFA 4C7OB 1E1QD 1XPOA 2QSYA 3I4LA 2ZI5A 3ZQ6A 4TL7A 4HDOB 2GXQA 4TTRA 3B6EA 2E9SA 4RZ3A 2OBLA 4EFLA 1YR7A 2CE2X 4YXWA 2Q0HA 1P60A 3OAAA 2QSZA 3AVTA 4KV9A 1IHUA 1K8RA 2J0VA 1UPTA 4PAMA 1KK0A 4S35A 1CIPA 4KYIB 1N6IA 2XNSA 2ZR7A 4HB4A 4HLUC 2GF9A 3CW2A 1KI6B 2Q6TA 4PO8A 5CK5A 1G17A 4JYBA 5FUWA 5BYJA 4I1UA 1IXZA 1V43A 3TAHA 3A6PC 1E98A 1OHHD 4US0R 3OEHD 4JLDA 3MD0A 3R8FA 1A82A 1TQ2A 4HAWA 2YVUA 4NBSA 2NMVA 1CKEA 4Q03A 3PEUA 1R2QA 1ZCBA 2Z4SA 3BERA 4BFZA 1YVDA 2RGAA 4NL4H 3UMRA 3U5ZB 2IWHA 1TTTA 3B78A 1AKYA 2VIIA 4X8MA 3R9WA 4GL2A 2F1RA 4M9SA 4YDHB 3GFTA 2GAOA 4QBFA 3RS0A 4LX0A 2WWYA 3ADDA 2ODWA 4LV6A 4QL3A 1HQCA 4RD3A 1DARA 3GLHB 4HATA 2PJRA 1R0XA 1OFHA 3GLIE 3DZDA 5JCPA 4PHGA 1XMSA 1OH5A 5CDFA 1LV7A 1W47A 1XMJA 1HT1E 4AWXA 1GZSA 2EWVA 4P0TA 4O3MA 1MO3A 2YINC 1EG7A 3P26A 1ZM9A 1ZM7A 4KVAA 4LHZA 4MKGA 5E3HA 1AN0A 4HEJA 2CXXA 1XEXA 2MSCB 2ZSBA 1A5TA 1R5OA 3TQCA 4B3FX 2ZIAA 4OQLA 2AKAB 2BMFA 3QEJA 5G53C 5JCZA 4BASA 1QHYA 2GVDC 4U02A 2OLJA 1IY0A 2O0KA 3QXXA 1VMAA 5EP1A 2G6BA 3GD7A 4YXWD 2IYYA 2WKQA 1DO2A 1TNDA 3OAAD 4MGIR 1SHZA 1U2RA 2XZOA 2JIZA 4HLUA 4RKEA 3QXCA 1UJ2A 5IRCD 2FG5A 5E7IA 1ZINA 3X1XA 1IN5A 3ZZUA 2IXEA 1H65A 2AXPA 2C5LA 4IOLA 5DN6A 3TJZA 1KIMA 3R9IA 3X1DA 2XZLA 4IVRA 5EP4A 2WJIA 4UJ5A 1XZPA 4PAQA 1DAEA 4U7DA 4UNSA 2ZUBA 1WE2A 2GEUA 2GILA 4L4UA 3C14C 2PMKA 4UXJA 1FMJA 2BBSA 4LCBA 4NYMQ 2IS1A 1BIFA 3W5JA 5BWMA 1TF5A 2WWGA 1E2JA 4G5OA 1CJKC 2YOGA 4TMVA 1IN6A 1LB1B 2W2XA 2OE2A 3U6BA 4PX9A 3GJ8A 4JL6A 2OCYC 4D26A 2WIBA 3CZPA 1W36D 2DWPA 4L16A 1ZIOA 2V1UA 3T15A 3AP2A 2ZI7A 1G8GA 4WZBE 4QJ5A 1EXMA 3QXSA 1P7CA 5AJWA 3ZYCA 4BUJA 2K5UA 4JLPA 1YZLA 2AR7A 2ZETA 2AK3A 4Z8YA 2NOAA 4Q9JA 3CR8A 1RE0A 1MKYA 4MRVA 3IPXA 1ZAKA 1UKVY 2QPAA 1GKUB 2RHMA 1NJFA 2C95A 3H2YA 5FOTA 3CNNA 3TK1A 4AKIA 2EFGA 1RIFA 3NDPA 4AK9A 5JJKA 4A8JC 4MRNA 4NCNA 4P3YA 2JAQA 3HDTA 3LX8A 1XXHA 4KYUA 4KU4A 3HJNA 3A1TA 4IVQA 3OIYA 4JBXA 3FPAA 1KZGB 2CL0X 3LRPA 4R7ZA 4LJ7A 1PVOA 3AF0A 1AKEA 3AP1A 3CNOA 2FJUA 4WA7A 5FPYA 1NBME 1TUIA 1XRJA 3L82B 4P4UA 4Z54A 2I3BA 1B23P 1V5WA 2EWWA 1J8YF 4V0LA 3KQKA 1JXOA 2HXYA 1H8HA 2VP0A 3GEIA 1DELA 2JIZD 4DB2A 4QM6A 3GJXC 4LBWA 1E2DA 4B48A 4CT5A 2WSMA 4NCKA 4OHWA 3R7WB 5ANRB 3RLFA 3G5UA 3T5DA 5JRZA 2B8TA 5DN6D 4LOAA 3PUWA 2EYQA 2PX3A 4LV8B 4C0BA 2IUUA 1Z0KA 3OF5A 4UNQA 1KTVA 4B3XA 4TLDA 2O8EB 4NYJR 2IWRA 3TR0A 3NH6A 1CRPA 2A5FA 3BH0A 3PENA 1F60A 1I2MA 1N6OA 3N2EA 5D3QA 2DYKA 1T3HA 2IUTA 2BMDA 4ARZA 3K70B 4LJ8A 2R8RA 5DI9A 1TX4B 4A6XA 3VKGA 3IIJA 3BJIC 3TH5A 1FPMA 3MRSA 3QE0A 3TUZC 1AS0A 3DMDA 5FBWB 3W8NA 4PSAA 2DBYA 5EE3A 2WJJA 3M1IA 1XU4A 1GTVA 3UG6A 4OHXA 3G0HA 2ZVPX 3M6AA 3BB1A 1ZNXA 3RVBA 1T91A 1Z0FA 2TMKA 4ZCLA 4DHEA 3GLGA 2GRJA 2KB0A 3B60A 4TL9A 4BRUA 3BH6A 1D2NA 1UDXA 1US8A 4TQ9A 1NLZA 2CLDX 5FOXA 4A8JA 5EJEA 5JS8A 2FA9A 2GZAA 3GFOA 2B7CA 2ZS9A 3VU9B 4DLSA 4HUQB 2QORA 3DEFA 3L0OA 2JJ8A 3VR3A 2FF7A 3DHWC 1DO0A 3KTAB 3M4YA 3B8HA 3QKUA 1RW4A 4RZ2A 1I2DA 1NKTA 3LVQE 2ZYTX 4AC9A 1S8FA 2RGCA 5CLQA 2JLVA 4LJ5A 3RYTC 3AKEA 5L3VA 1ZU4A 3MG9A 1E0KA 2GBLC 4LWZA 1QHHB 1U9IC 5FOUA 1NY5A 3C5CA 2P6RA 1P72A 4AYTA 2OG2A 1US8B 3TMKA 4NZYA 4OYHA 1H8HD 1GNPA 2PLRA 4Q1FA 4JMPA 2NO1A 5FTNA 4M0LA 2WJVA 1S96A 2Q9CA 4V0ME 4L9SA 4D80A 3NWJA 2RGNC 3B85A 3THXA 3LW8A 5SZIA 1HTWA 2CEAA 3AVXA 3WRXC 1E79A 1MABA 2H7VA 1PV4A 3DM9B 4A2WA 2PEZA 5E95A 1KY2A 1Z2CA 1UAAA 2BMJA 2QAGB 1TEXA 4M1WA 4MKIA 1TU3A 2A2ZA 3NIBA 4OI4A 2FPMA 2N42A 1LY1A 4QGGA 5CJ2A 1MO5A 4DDWA 2GCOA 3LX5A 4BFTA 1BOFA 4BLOA 3KXLA 2YC4C 3ONWA 3T1OA 3LXRA 3VNUA 1K5DA 4Q7KA 4EPYA 2BBTA 4M4SA 3WNDA 1ZCAA 3CX8A 3QPUA 2ZEJA 2ZRJA 3D31A 3QUSA 5B2ZA 3WMFA 3KUDA 3GLIB 2GXSA 3AF2A 1RJ9A 4B47A 1Z0JA 4DLYA 2ZRAA 2VL7A 1JBKA 1E4YA 1FX0A 2DCUA 1U8ZA 3QKRB 4F7WA 2R44A 3P32A 3BGWA 4PHHA 1WXQA 2GEDA 3RHFA 2D2EA 1S1CA 4BPBA 5DGXA 1T8TA 4FD2A 5HE9A 1J99A 2V9PA 3A1VA 3TIFA 4AKGA 2AWNA 2H8KA 3I8SA 4YDSA 3SYLA 2R6AA 3SE0A 3T34A 3VHXA 2OSBA 3BB3A 1KOFA 1KJYA 2P67A 2JEOA 1Q3HA 3RRYA 4NMMA 3W5IA 4S2EA 3SHWA 5HPYB 2C9CA 1OW3B 2YWEA 2G83A 1PZNA 4ZIRA 2IXGA 3SYNA 4BQSA 2GBLA 1A1VA 1N6LA 1U9IA 4I81A 4A82A 3Q5DA 2GNOA 4JYCA 5E4FA 2J0SA 1Q1QA 1LW7A 2QMUA 5JSZA 2J0UB 3AH8A 2F9MA 2HCBA 3CPHA 2FNAA
chains in the Genus database with same CATH superfamily
4RM2A 1YKGA 4DQLA 5JFGA 4IXDA 1JLSA 2CV2A 3WJ1A 4WZBA 4RIHA 3SFTA 2RGNA 4E5YA 3WGIA 4URFA 4IV5A 1JR6A 3R4VA 1ID8A 1O5TA 3GC6A 1YZQA 3OZVA 4LQCA 1P29A 4AS1A 2VDPB 3UJ9A 1WABA 1HRDA 1CFJA 5KSPA 2ORVA 1JT2A 1ZS9A 2CUTA 2HBQA 2X19A 3PKZA 2XWJI 4LMPA 4N82A 5EKSA 3K1AB 4N0EA 4JP1A 1RZRD 2XB2A 3GRUA 2NU6A 4RHUA 2D1SA 3Q6IA 4EMUA 2RG7A 2XNCA 3E03A 3IKVA 4QUKA 2I76A 4RJJA 2HL6A 5ADHA 3PDIA 3R2JA 5KS2A 3NT5A 5D00A 5KQPA 5KWJA 2A0XA 3G0DA 1UZLA 4RU1A 1WCIB 3ICCA 4Q3OA 2A59A 3OG9A 2KYRA 3DDNA 4MINA 4II7A 4BB0A 1ZZGA 2JJMA 2WYWA 4ZRNA 3PC8A 2J30A 3VDNB 1XMPA 3I0MA 1Q1AA 2FVXA 2NXCA 3O7MA 4Q1EA 2YWDA 5JS2A 3MHTA 1PJAA 3TG8A 5EN4A 5ADUS 1DS6A 5K8TA 3KXKA 5AW1A 1QGAA 3IQDB 3ETHA 4CCYB 4O29A 1MIOB 2ZAIA 4G1CA 1J42A 3BH7A 4BP1A 1JMKC 1WA5A 2DPHA 2OC4A 3I2GA 4F71A 2VTBA 3GOQA 1SBCA 1BFDA 5EEHA 1W7AA 1SUFA 1B2LA 1OXUA 3MLEA 421PA 4I50A 3RUCA 2YWXA 1CVRA 1P5ZB 2QJTA 3WBFA 5CIYA 4H7EA 4WOPA 4BNIA 2BZGA 3TJMA 1E20A 4JX9A 4J7CA 2O05A 5IJ9A 1N1MA 3DV9A 4EHBA 3MWLA 1UBTS 2AUTA 1TUBB 4S1PA 4ZO4A 1JE1A 5C1IA 1RAIA 2PKRA 1RHUA 4B74A 4LC0A 5LYJB 4MDFA 3PQ7A 4XUGB 1X87A 4GGOA 3DYBA 2AXNA 1B43A 1KFJB 1L4YA 1PWYE 1SVIA 3FMVA 4DQDA 5M7EA 3QUTA 1YFJA 1GGHA 1N8TA 5H59A 2CFRA 1I51A 2OTCA 2M6LA 1Z2AA 1N9KA 1YTLA 5FAXA 2C7OA 3AY6A 3GG2A 3SR3A 3VSDA 2WYVA 4HPWA 3DO8A 2NSHA 5L3VA 2PU7A 1UBEA 1VPWA 4URYR 1Q11A 2NZ8A 3EDYA 1TA9A 3MXTA 3GLHE 1HUQA 5HHTA 3SR0A 3A3NA 2O50A 3MSCA 1PDOA 4EABA 3NUQA 1BX0A 4PONA 1WEKA 2GZSA 4U3JA 3JYOA 3IBGA 1T5SA 2CBXA 3O03A 3UCFA 1W19A 5EE0A 3VZQA 2QL5A 2IUYA 2OMEA 3Q7TA 4OQYA 1E7SA 3HDJA 4Y9TA 1N9GB 1W52X 2D5CA 2QNIA 1VDMA 1DQRA 2V3VA 2GYWA 1L7OA 1OT5A 3BMNA 3BHNA 3F5QA 3OC0A 4QEKA 5HGJA 1MC4A 4EGSA 2FXVA 2QQ0A 1PX2A 2G77B 3QKTA 2I6QA 3LX4A 5KIAA 2HYIC 3QUBA 2FSSA 3WIBA 2EX4A 4OUDB 2VO1A 3NBUA 4O8CA 2HO5A 2NN3C 4Q4JA 2VLBA 2BFNA 4UHBA 1JH9A 2VJYA 1Y1RA 2AOUB 1PWHA 2GUGA 3D8TA 1A7UA 1DT3A 1KMQA 1ONBA 2HV8A 3CTPA 4Q66C 4UUAA 4QXMA 4LYFA 1G42A 2PH3A 4JAVC 5EL0A 5FT9A 1U6JA 1LEHA 1B0PA 1EX1A 1LBHA 1RP1A 1F12A 2D2FA 3C6XA 4PFSA 5AW0A 4HDMA 5LBTA 2BI4A 4F72A 1FQOA 1OB5A 1SIWA 1DZ3A 2BN4A 2G36A 5AKLA 1SQ6A 1OOEA 4EF6A 4MVJP 4P7KA 1U8AA 4C01A 4GI5A 1NQAO 1QPGA 4RHCA 1M1UA 1T1GA 3OKAA 3K3PA 4MW6A 3FNHA 4C7XA 3GLFA 1G8HA 1XTSA 3S1AA 4B7CA 1CUCA 4ACAA 1RQXA 2HH9A 3ILYA 3P0IA 2OENG 4BWYA 2AMLA 2YBEA 3TZKA 2WM8A 4OLHA 1ULTA 2AEEA 5JR3A 5L95A 1XZGA 3OOSA 2C2XA 4YBZA 2PRIA 1SUSA 4UMVA 3CBGA 4EFMA 1A9XB 4R9NA 1VC2A 1OTHA 3CR3C 4W9MC 4F96A 2ZJ3A 3FVTA 4Y9DA 2QRGA 3FUCA 4L9AA 3GQBA 1O54A 4JJ7A 4IHQA 3BL6A 4QECA 5JMWA 1FBNA 3ZGYA 1VG8A 4L75A 1C7EA 1G9XA 1W4LA 4CFSA 4KB5A 3OHPA 4A15A 4L28A 3N75A 1QGUA 3O4VA 5K3CA 5LD2C 1A9OA 3SJAA 3C3AA 3GFFA 4DSUA 1NLYA 5J23A 1BO6A 3DC2A 4W6ZA 5IMSA 4BL5A 3PQFA 3C8MA 1KH2A 1RS0A 4XWWA 4BB6A 1DGQA 3HU2A 4HN9A 2WLSA 4EELA 4QEDA 1CXZA 1FMLA 4JI8B 2ODBA 1JWLA 4G3XA 3O8QB 4TS4A 1SC3A 2QBYB 2W98A 4N9QA 1KOLA 2BAGA 3WGTA 2ZJ1A 4BLVA 1LF0A 3DT6A 4RHEA 2X8LA 3RUHA 3BTUA 5IKPA 2ZTHA 2VJQA 1U4NA 3F90A 1R7RA 2IA5A 3P9KA 3ZIAD 2F1HA 5CD1A 3NONA 3HEAA 2ZWAA 5F9MA 3DOHA 4MWDA 1YI1A 2RBGA 4RGVA 2IIPA 3O83A 2J1LA 4WNYA 3RYIA 2EF0A 2SECE 2OECA 1A9YA 4IDGA 2VEOA 1LK7A 5AJXA 1E9CA 1ZC4A 3HGQA 5DBHX 5E2IA 4KMRA 2RB5A 5FUVA 3SU8A 1EVYA 4DQKA 3UKJA 4H1TA 4BFWA 4EKGA 3LL4A 4UU7A 3FE2A 5IFKA 4FFWA 2ZJ2A 1RT9A 1KOJA 1MB4A 3W5VA 1QX3A 4XQ0A 4DV1B 2E4YA 1R66A 4ILEA 4IWXA 4PFKA 1FQWA 1MP0A 4XTRA 2HMVA 2QTWB 4YAEA 1FSSA 4LYGA 4TQAA 3T3OA 1S2IA 1J70A 2PL9A 1YOVA 2EV9A 1BHO1 3ICWA 4TT3D 3HU5A 5CM9C 1CLUA 3HLKA 4OF4A 2B4KA 5T5QA 5HJ5A 5EHGA 1FXWF 5KSZA 1KP2A 3LHDA 4MKZA 1NU8A 3M6WA 1EAYA 1ACLA 5F4BA 3Q10A 1ZIXA 4OFZA 4Y6LA 1BA2A 1QG2A 5E9AA 1IDOA 1FVFA 2SICE 2VK8A 5GZ1A 5ILGA 2FPGB 4MR8B 4B8WA 2C42A 4DTCA 4NF2A 1P7WA 1Z5UA 1K3TA 7REQA 2ZUVA 3I0ZA 3O47A 2CKMA 4X66B 3DBRA 2GCNA 4OGKA 1CP3A 1NVUQ 1SKYE 3P9NA 1QS0A 1N2CE 3TKYA 2DOKA 2EJCA 3JQFA 2IPXA 3RRNA 4HX5A 5JBIA 2X5JO 1KARA 1FFYA 4ZOAA 4EMTA 2O07A 2WSSA 3QFSA 2ZDQA 3WGZA 1V11B 5JQGF 2CB9A 3BRWD 4C7OA 1OSNA 4FR2A 2IU0A 2FPRA 3F6PA 4ALNA 4EZEA 4J8PA 4WY5A 5CYGA 4A36A 2BHSA 2FX2A 2G8LA 2H2IA 3NYWA 1AKUA 2N46A 4Z0HO 4DV7B 1UQUA 1UFQA 1G19A 3IAXA 2VHJA 1RI2A 4GW3A 4FFSA 2SBTA 1U2EA 4G24A 4K6MA 3SS7X 2Q5CA 4E5UA 5ABPA 1UK8A 3FW1A 3P2MA 3EQ7A 4TWAA 2MT9A 3JYLA 4PG6A 5BUSA 2PX0A 2I87A 2A6PA 5LD2B 3G2NA 3BMOA 2D3WA 3HBAA 1X80B 4ABYA 1E8NA 1PJ4A 4JQOA 5DO9A 1J97A 4XWKA 1HT2E 2WILA 4FE3A 3UAGA 7MHTA 1BVHA 4LRTB 4H6VA 3ROFA 5JQGB 4ZCSA 1G8MA 5I4CA 4MVJD 2VWGA 1D6JA 4KQ2A 1E6CA 2WJHA 3T5AA 2B8WA 4PQYA 2WDZA 4JL5A 4DB4A 4WKPA 2YFQA 3EZ9A 1EXDA 3SQNA 1QF6A 4KL8S 3IEVA 3IXQA 4H59A 4V02A 1PR6A 2GJ8A 2YNMA 2PE5A 5EJGA 3MS4A 4FT2A 1B74A 3D1VA 1WXWA 3QKWA 4J03A 4QU0A 5DM60 3CMMA 3F6RA 3R3HA 5IJZA 1P9OA 1ORDA 3IOYA 1T5IA 2I65A 2RG1A 3L1HA 4G86A 1K7YA 1GG9A 4HAZA 3QIVA 5IXYA 4C20A 2EW2A 2O5VA 4B8YA 5JFTA 3QKSB 5D2CA 2C1EA 1EFVA 1EX6A 2XMBA 1Z6TA 3NT2A 4R1MA 1V3QE 5GY7A 4F9TA 2NT4A 3DMPA 1QHXA 3UQZA 1O8BA 1XB2A 5SV2A 1TZBA 4JI4B 3V3KA 1XF9A 3F8WA 3NC1C 4FCTA 2OUKA 1FSFA 4N6GA 1SQGA 4DMCA 3UJPA 2C2BA 5DJ5A 5LQUA 2PUGA 1XMVA 5AW7A 1EYZA 1PS9A 2BTOA 2IF0A 3OX2A 4I46A 4R9UC 3R74A 1O96A 5BYBA 1Z4QA 4OP1A 3OF2A 5KEIA 4QDJA 1SXQA 1G1MA 1KYWA 1SVMA 4DCJA 1TIPA 1UT8A 4B6GA 4F1JA 5SZKB 4F9EA 5KTMA 5EVJA 5IAEA 1F2TB 5FPHA 4YQZA 4AYWA 1V1MA 1BYUA 4XYGA 1Y4AE 1ZKDA 2BVNA 1PR0A 1KETA 1PT6A 2QG4A 2V7WA 3GJ5A 2JAUA 4DA9A 4BO3A 2CBZA 1HF3A 1SHUX 4E11A 5DKFA 2ZIEA 1JIQA 4EJ2A 3H0CA 4LJ6A 3BWXA 4PGGA 1C1XA 2BOVA 4KBGA 4X94A 1AUVA 4E15A 4EB6A 2Q2OA 1BDMA 2RC6A 2H5EA 1MENA 4RZSA 1NUUA 3HCDA 1KI4A 1TVEA 1BGWA 3DOFA 1HRKA 3D3KA 2Y4OA 4GMGA 2UYCA 1HQYE 4MUAA 4H6PA 3SKYA 1QO9A 4JODA 1G0NA 3TTYA 2UDPA 1C1HA 1MO4A 3NOQA 4RA6A 1OGJA 2FYTA 2CEKA 5LLTA 1NASA 1C4OA 2WT8A 1ZD8A 1WCXA 4FIDA 3KUCA 4FCVA 4M1QA 4A0GA 3UF0A 5FTJA 4GI2A 3A6LA 4JIMA 1CYDA 1DXYA 4C4YA 2O8CB 3M49A 2BGWA 5IXSA 1WJGA 3O2SB 3C48A 4B9EA 4TLCA 1WZIA 4U7PB 2J9FA 3O2NA 1JU9A 4PEVA 2BFPA 4PX5A 2WABA 1OH6A 1IONA 3RT9A 1FDRA 4FEYA 4FYHA 3U40A 2WSBA 1AUQA 3K70C 3RTEA 1WB6A 2RGBA 2Y2VA 3DYVA 4EG5A 1YKFA 4N47A 5BNZA 3OIWA 4GPTA 4PBRA 3TOCA 4UTXA 2FV8A 3OMXA 4X84A 3SQDA 1E3LA 4JKIA 4JQCA 5AWFC 3DNPA 1J2YA 3EWNA 3EY9A 3F5FA 3NHAA 5AYVA 2G5CA 5L53A 1U3DA 3N0WA 2NP6A 1UFOA 1ZZEA 2J9RA 2QW8A 3NEJA 4UEOA 5B58T 4EK9A 3AOEC 3VZBA 5MHTA 1FFEA 2O4UX 1MTZA 5J4HA 3F67A 4AUMA 3U37A 1NIPA 1NSTA 4ZQCB 3IURA 4OQXA 4Q3BA 4A1OA 4RZHA 1H2RS 1ZSNA 1JA0A 1NULA 2B1RA 5E4YA 3TXXA 3OBBA 4KK4A 1V96A 2WZBA 5IDVA 1FU7A 2V45A 4LZJA 3WFIA 4AY2A 1IHYA 4OGGA 3KQYA 3NEAA 5E4JA 1YS2X 5FH9A 2VRWA 3GFPA 3OFKA 3TOZA 5ADWA 4JYZA 1L8QA 2P35A 3BD9A 4QVGA 1Y3BE 2OXCA 2Q21A 2FFJA 2VPIA 4M9QA 1ZEJA 5CFRA 2VDWB 4P4GA 1KSGA 1G4UR 3TNJA 5K0BA 1XMIA 3HY4A 3L93A 1HE4A 1FDOA 5CLLA 1KEZA 2Q4DA 2F3QA 1X9HA 4QT0A 5CAEA 1C30B 4LUCA 3W2GA 1UKEA 1HE8B 3EDOA 5EKUA 1E9AA 3EC1A 3NHRA 3OE7A 4IOMA 4NDNE 4W8HA 1KDOA 2QT0A 4YJDA 10MHA 4E21A 4KQIA 2WYHA 1JH8A 2G40A 1BKSB 4PN7A 4MWBA 4BIMA 4BZXA 3HEMA 3DUFA 2WIGA 4RESA 3E9EA 3QLEA 4O3FA 4YIKA 1Q20A 2IVFA 1OKKA 5LZ5A 1JG7A 3WOHA 1Y5IA 4JCOA 1S9HA 4N0PA 2AFIA 1Z6QA 5CM2Z 5DSZA 9LDBA 4UD2A 4Q4AB 2V6JA 1EFTA 3H4MA 4IO1A 4IRMA 1FFCA 4WLFA 2CF6A 1HNZB 1N0HA 2GPBA 4WXMA 3IIEA 4CV0A 3VNSA 2OC9A 1VG9B 2YQ4A 3FGNA 4G5FA 4Q01A 1YULA 2OZKA 5DX0A 4EFDA 3THWB 1UZAA 2R6DA 3WRYA 2PT5A 2ROQA 1IXRC 3HU3A 1VIYA 4FNMA 4YRPA 5DIZA 1YR6A 2B2CA 1NSYA 1WW8A 3C3PA 2BDUA 5IEBA 5B2EA 4JGGA 3TQFA 4RL4A 2J4FA 4UDXX 1QO7A 3HL0A 3LA8A 3E22A 3Q0EA 1NVXQ 3E4DA 4FBGA 4IJ5A 2J0EA 3A10A 4RVGA 1U7TA 2GDJA 3UFXB 3ZHVA 4F8YA 2VTVA 2ZQZA 2RHGB 5E8JA 2FKAA 3I30X 3T3MB 2PTHA 5C80A 3FTEA 4RK5A 4YY3B 2IF2A 4L4RA 3AI3A 1JI0A 1T0HB 1G9TA 2CLKB 2DECA 3L41A 4UHHA 221PA 4X7PA 3RUEA 4EYKA 4BMYA 2XE4A 1E62A 1T9CA 3HB4X 4WUTA 3WC4A 1G3IA 4BC0A 3IQXA 1DWOA 4MAAA 4F8JA 5KTPA 4IUBS 5IVHA 2ECKA 4P53A 3GBVA 3GJZA 3T4EA 4F46A 2KLBA 1WP9A 1U3UA 2VWQA 1GZ3A 4G0ZA 1PV2A 2JGLA 3TVDA 5U9CA 3VTKA 4DUZB 1XI2A 1GL9B 5ALZA 2CSXA 2FR1A 4IDDA 1LK5A 4L5JA 3IHLA 2AFHE 5B1HA 1YBAA 3CT6A 5H80A 4LJ9A 1CFZA 3WK9A 4LFBB 3HBNA 4NH0A 3CWQA 3C8ZA 1CHNA 2XGGA 3DOEA 5F7JA 1OI3A 3AINA 4JK3A 2QZZA 1Z39A 1Q77A 4Q93A 4RE5A 2GTPA 1H1DA 3OLYA 4MKXA 1OIWA 4LDPA 2NQ2C 1FS6A 1GQSA 1U9YA 5DXJA 3FY4A 3VAZA 2AOTB 2XUQA 1W0KA 1WG8A 1KO8A 2CDBA 1XRSB 2RIPA 3KDSE 3ZCSA 1J6UA 2VPWA 1Y63A 3PXAA 2AJTA 4C0QC 1UT5A 2HQOA 5TLSA 1ZGZA 3TF5A 1B6SA 4PBTA 1CR1A 3SDBA 3TLMA 4PVDA 4CLOA 3U3KA 3ITEA 1JF8A 3CUEF 5CP8A 4IMIB 3ID6C 1XTTA 1KE1A 1XDWA 3KQQA 2H1VA 4K26A 1J5EB 3OQ1A 4RQAA 2CVZA 3BQ9A 3KC2A 3A4MA 3DA8A 3QG5A 3MQ2A 4YP7A 5KPDA 3IEUA 3CLVA 4OBBA 3QFCA 3L6UA 2H1HA 3U31A 5HBGA 3V1YA 3NP7A 1AIPA 4R1UA 3L7KA 3PRYA 1RBYA 2Q8QA 4BQQA 4CDRA 4N7JA 1MXHA 3PEFA 3WGVA 1QPBA 4AG5A 3CPEA 5EQTA 4QLBA 4PRYA 4ZI3A 1Q7BA 1A5SB 4WLVA 4R8MA 2ZTVA 2AMJA 3WLQA 4O4HA 4DPMA 1C0KA 1TT5A 3BM5A 4H4DA 2WVGA 4C4AA 5IK2D 5L40A 1KJNA 4GBJA 4DLLA 1FUUA 1S0UA 3GROA 2FZVA 4OI2A 1OBFO 4K9QA 4JI1B 2ZRIA 3PR2B 2A0KA 3FMFA 4LWQA 1Z29A 4BJ5A 3CLTD 3FFTA 1L7BA 1XTKA 3IQFA 4EH1A 1QP4A 1S89A 2HSZA 1P77A 1F4PA 3MMZA 5FEMA 1GV0A 1IHDA 2DPLA 3RVOA 3Q3GE 1OXSC 3PZRA 3CZAA 3LYUA 3I1JA 3LFHA 1FYXA 1QK4A 1R5BA 3HYRA 5LZ9A 3OQVA 5BO5A 5T4HA 3N8IA 1FDVA 5GQSA 3VBCA 1LDEA 2Q1SA 3U7EB 1N1GA 3FNQA 4RVCA 5KHLB 2XCTB 2GEJA 1BCRA 1KZ6A 4C0HA 2QDXA 3QMMA 1O95C 4B3RB 1H2XA 1C1YA 3EGOA 1DC4A 2NYUA 4CQMB 4LHXA 3CTMA 4LTNA 3SYKA 3WMGA 4RFLA 2JGJA 3MGBA 2XQIA 3U49A 2OKGA 3C97A 2JBHA 3F71A 3PCTA 4MR7A 4ZXPA 4HVTA 1DJPA 2C29D 1GCUA 1C8KA 1S3FA 2J0UA 2P9EA 3JQ8B 1JN0A 4WW0A 4FI3F 2PN1A 2VCHA 3BXZA 2HM7A 4YT4A 4B3SB 1CR2A 3BEOA 3D5TA 5ALEA 1MC1A 3RVQA 3M5WA 5JCOC 3N59A 4NNOA 2EEZA 1S02A 3ZBTA 4HNTA 3AVOA 3VAYA 2LWIA 4UM9D 4ZPJA 1JHQA 3FPEA 1PNQA 2L0XA 4ZMSA 3AUXA 2NO7A 3ADOA 4ZEXA 1UJ6A 1P80A 1XYYA 1YV9A 4X97A 3W6PA 2VJLA 5DBFA 4PV7A 2DHCA 3UV6A 1KR5A 2J5KA 4PRLA 3WDLA 1XQ1A 4BTVA 1C4WA 2HQBA 2ATIA 2Y0DA 1Y3IA 5JV5A 1BEZA 2WPDD 3TD2A 2BYTA 3AUFA 3I9V1 4WRRA 3K1AA 3OY7A 1GR1A 1XA4A 5AICA 1USGA 4D98A 2YV3A 5KYNA 2D4HA 2REBA 4GOXA 1Z2NX 1UBGA 3NBAA 5BVGB 1YQGA 1BEEA 4C0XA 1WL8A 4TS3A 3KQTA 1HQKA 2WNIA 1WCIA 4IFTA 4TTVA 4ZVUA 3S2FA 4E3WA 5L4NA 2FK8A 3L6RA 4J43A 3FGZA 4B6JA 1BJTA 2HRZA 4XSHA 1KJ8A 3GRAA 1JLMA 3TQSA 1NL3A 1O5IA 3U60B 3KL2A 3VR2D 3EX7C 3SZGA 4BEWA 3CUSA 4PX2A 5FBRB 3NORA 3OZRA 1NVGA 1QOZA 1KKUA 1Z37A 3F9IA 1K27A 1V4VA 3T0FA 3TRKA 4CT0A 2PGNA 4CCYA 1MIOA 2IITA 3OEEA 5AVZA 4FHZA 2D0DA 4MV8A 1XMOB 1K63A 2GTIA 3DFUA 3KKMA 3PNKA 4NQZA 2R7MA 3K30A 4DADA 4DLAA 4X5OA 1UP6A 2ID4A 2JRCA 3ORFA 2E4VA 3UC5A 4PSKA 5JBQA 4NOKA 5BW8A 1P1HA 4MQEB 2YJ6A 4NBTA 3I0NA 3A11A 4YRIA 1DAGA 4UBJA 2C5AA 1NQXA 1WAMA 3DLBA 3M5DA 1Q5PA 1XELA 4R2MA 5A04A 1TF7A 3INTA 1AQ6A 1NXPA 1T1EA 1UDRA 2C3PA 1TUBA 2QJOA 4QWWA 4A0FA 4DLXA 5LYJA 3WA6A 2ACVA 1LLUA 2WEKA 2QLFA 3IPYA 3QMPA 1DUIA 2XXBA 4MGYR 4YCJA 2DAPA 4B6PA 4IJUA 1L4BA 2VC2B 4F4HA 5CPBA 5I8PA 2Q3LA 4QOJA 4Q9LA 4JKYA 2VDMB 3LQFA 1QIFA 2OQRA 1YS7A 1QB7A 3AI2A 2X2FA 3DFZA 4UHJA 1E7YA 3QOFA 4EG4A 3HA7A 3HGTA 2UYQA 4AN0A 2CLFB 4KGXA 5KKCA 3GUCA 1ATZA 1EWQA 2E6KA 1T13A 3AHFA 4P84A 1C2TA 4CG2A 7ABPA 3E7XA 4GXQA 3U4CA 3V8RA 2Y76A 2I2AA 2ODQA 2QUZA 1ECPA 3NTOA 1JR4A 1NLUA 1W5TA 3A7DA 4K6KA 2KWIA 4KQEA 1QBKC 2VXOA 1AZWA 1YR1A 4D9JA 2ZUCA 2OGSA 2PFGA 1TT7A 2FZCA 5EXPA 5D87A 1AQJA 3OM0A 5LQSA 1P1CA 2O7QA 2BEWB 4ZVRA 2HZ7A 2WUFA 3GFVA 3JWEA 4Q18A 3DSRA 4Q9HA 5FLYA 3ZV6A 1N9GA 4DLKA 3ECSA 2DR0A 1N2JA 2QPLA 4LPKA 1XEAA 5IAGA 1TQ4A 1K89A 2B34A 4J07A 2R1TB 1OASA 1P4HA 1V5IA 5TQJA 3VYRB 4YRQA 2OXFA 3AR4A 3JQ9C 1VHWA 3RIHA 3T7DA 4TYQA 4M7WA 3SE7A 1MOQA 4Y30A 3C45A 3FPCA 3G82C 4OUDA 4LKOA 4XH9B 4EI2A 1YCFA 4O2BF 1UJMA 1FOEB 2R1ZA 3AR6A 3M5PA 2IZZA 3O4GA 4YRFA 2I66A 3H9CA 4BFXA 3KZXA 5ICMA 2R66A 2OGWA 2YCLA 3X1WA 4PYMA 5KNBA 3SBXA 4COKA 3AKYA 2DHQA 3ISJA 4MMYB 4NSNA 1A8QA 3CRRA 4FC6A 5ELLA 4B3BA 3MWYW 4PLVA 4AN1A 2R85A 4EQ6B 5HKKA 1XGKA 2H00A 2VAXA 1DJNA 4GMHA 4GNRA 4LYDA 5IT0A 2NTYC 4MJ3A 3THYB 2OORA 4P5DA 5C46F 2W11A 5JECA 4LG1A 4UTVA 2IEYA 4RHYA 1SXJB 3U9LA 3AF5A 4DJEC 1QIKA 4FYIA 1M1YE 4A03A 1KORA 3KSUA 1A9XA 2GEVA 4LS3A 2IC5A 1AGXA 4GU5A 3FDXA 4IL5A 4Q5IA 5A05A 4NCHA 4BVEA 1E1RD 1QMGA 3K73O 1KQ3A 3DFIA 3PQCA 4X91A 4CMEA 5K0TA 3AZPA 2CFCA 1XAJA 4IZOA 5LXTF 2SKDA 5HZGA 4MUFA 3OTOB 4WKOA 3OT4A 2DBRA 4I6EA 4BFYA 3E3NA 5WRFA 2AI2A 2NPIA 5FP0A 4ENUA 4R9VA 4EY7A 3IUBA 4KN6A 1QO0D 1CUJA 1FZQA 1X7GA 4X45A 3GP5A 4JI2B 3EXG1 3O8QA 2H4ZA 4JB2A 2QBYA 5AESA 2J5RA 3PVCA 2PJZA 9ATCA 4MWEA 1TYAE 1RHJA 2JW5A 4ZGBA 4ZCRA 4R1OA 1MDFA 2AN5A 1NPTO 1D04A 4BRWA 4BQPA 1FDUA 1Z83A 4K9OA 1DE0A 3BIFA 3BD6A 3NBZC 4N6OA 4NFSA 2ZU0C 3ZKWB 4EM6A 3QEBZ 3QVJA 4C07A 1D6NA 1VE6A 2PS9A 5LXTB 1V35A 2C9DA 4YUXA 2B2NA 3W3ZB 4DSAA 3ESYA 1J7KA 3FI9A 4QJIA 3QJGA 4LYAA 1LI4A 3R1IA 3F4BA 3MERA 4B2IA 4OAPA 1GA4A 5EGSA 4DXDA 4ER5A 1M7BA 4PICA 5ER9A 4CEHB 1A96A 2AZMA 4Q39A 2F9LA 3JZIA 3N7TA 2QY9A 1K7CA 2LE0A 3IKMB 4G67A 3ZEIA 2YV4A 3B7PA 2Q5JA 1O94C 4OKIA 4CR8A 1KO7A 2HPAA 4DYDA 2YIDA 3ICPA 4WACA 2HF2A 3ZXUB 4CZ2A 1N3YA 1XZBA 4FOLA 1KEEB 4CEIB 2IS4A 1QQ5A 3BOSA 2JGFA 2JI7A 1IAQA 2R6CA 4DT1B 5IAAA 2R0QC 3MTQA 3CX4A 3INRA 3F6CA 3GJRA 1M2EA 4HNVA 2EKQA 1TB4A 4R81A 4UVIA 3T3NA 4B3GA 2FPGA 4MR8A 3KEQA 4JS0A 4REOA 2QTGA 1W93A 4CMKA 4F2PA 3H0EA 5BXYA 3FPHA 4ZT2A 5JTTA 4HI0E 5DCUA 4A0HA 2XE8A 3R0ZA 4G1UC 2BHNA 1WQ1R 1W5FA 2PG3A 1V5EA 4DQVA 1V26A 3T52A 4GZ3A 3ORYA 4BOYA 3DD5A 4BQFA 1QWSA 1CUVA 4XIFA 1VL8A 4YHHB 1UMBB 1FXWA 2YWJA 1TF2A 3EULA 3G1WA 3HNOA 5DTQA 1P0PA 4J4TA 4YXFA 2Y71A 5BQXA 1H2AS 3IDOA 3LVRE 4EG7A 1V11A 2DE0X 4A91A 3TSYA 1OY1A 3ENVA 4DC9A 3AFOA 3RC2A 1AHIA 3TW6A 3WQSB 3O3MB 4B1FA 2R96A 1KZ7B 1VCOA 2HU2A 2I71A 3NBXX 3T7SA 3WGLA 4RENA 2XDAA 2CDRA 4I9FA 4INPA 1QRUA 4OGFA 2QNRA 4WKNA 1QAMA 5ES4B 1R27A 2BTQB 1AB6A 2QVGA 3ZE8A 2FOLA 3ZWMA 3L9WA 1XBTA 2QL7A 5TVGA 1PZEA 1L1RA 1JHZA 1JKJB 1LWNA 2W2VA 3FSGD 1PFQA 3NFYA 1VRWA 2A94A 4HQLA 5A4MS 1X80A 1MQAA 1DL5A 4RIEA 2IU6A 3H75A 1RPZA 4NPHA 3RTBA 5D8DA 2WOOA 1WNTA 5JQGA 1I4TD 3WQQA 9ABPA 1SCAA 3R0JA 3EK2A 3A05A 3DD1A 3KYCB 1F38A 4L85A 2IFTA 4M21A 3T0IA 2VUIB 3FMGA 4ZGWA 5KOIA 4E1AA 1N33B 1SPXA 3ADBA 4BQIA 2WMDA 1IM2A 1RAEA 2FMHA 3FDFA 3LQ2A 4QEZA 1D1PA 2A58A 4F38A 3ZXSA 1FP7A 2KM1A 1IQRA 2E5FA 2QE7A 3EJ6A 1XLVA 2CBGA 3MGCA 3QG1A 4U00A 5LDGA 4AZWA 4B4UA 5J1TB 1ZICA 1HMYA 3KE9A 1TIKA 1K08A 5JAMA 3GVXA 1DU4A 2F1KA 3NHWA 3VKHA 2ISCA 1D03A 2WOJA 4PZZA 5BQOA 2XUJA 1XCMA 2GHTA 3QKSA 1XTVA 1EK6A 4JIGA 4TLEA 3HR7A 1LTKA 1KI1A 4DIDA 4D82A 3VGJA 2VNHA 3UVEA 2C3MA 1QUEA 4CJXA 3SLGA 4CI0B 3R6WA 2GVNA 1GZUA 2Q3FA 2ZUUA 2BF4A 3I72A 4JKOA 4YP6A 1WNFA 4WN9B 3PPVA 5SICE 2A0WA 3OU7A 2A0FA 3ND8A 3FNEA 4UNPA 4F12A 1LKZA 3PVSA 5EUBA 3IT0A 4HXYA 4F6CA 2QT9A 1F2TA 3IPLA 4RLSA 4PR3A 3O8LA 4CYMA 4ZJUA 1ECBA 3QEAZ 3AFHA 4H60A 4LPSA 2CGEA 4QXPA 4GE3A 4K87A 4XCVA 1RKXA 1RR6A 1WVGA 2HBZA 1VG0B 3IC5A 3VPXA 3KALA 5K05A 5D01A 3O6VA 5BW6B 4QFDA 4X93A 3IIIA 4DWWA 3NHFA 3PQ2A 1R8QA 1UXKA 1MT3A 5ECDA 3E8XA 5DNCA 3C7CB 4FFLA 3I37X 5CX1B 2O20A 3FZEA 4TTJA 3RREA 4UC0A 4HTFB 1DKOA 3GLGE 2F00A 5CG2A 1VMDA 4ZEWA 3WP0A 1LVUA 3COSA 4A0SA 1U28C 1CUSA 4OV6B 4U2DA 3QX3A 2BLNA 2WHEA 3ANSA 3D6NB 3OUUA 3JV7A 5K0CA 3PGMA 3PJEA 3L4KA 4KR6A 5FOQA 1WETA 4X54A 3H1PA 2CSUA 2QGZA 3G2HA 4PNZA 1SVOA 3K1TA 3PQ8A 3RQSA 3VNAA 2O8CA 3CGGA 1YBVA 4PXSA 2X22A 1BS2A 4RVSA 4W6QA 3CPJB 5FBZA 1HE5A 2V54A 1EX9A 2QD5A 1NBWB 1PTKA 1Y33E 1A1SA 4M8KA 1IUKA 4H15A 1VCIA 4GYJA 4B32A 4M22A 5CB0A 2MOKA 1XLUA 1N3BA 3GYGA 1VKHA 1XJ0A 3I5AA 2HA6A 4HWOA 2C4VA 2OV8A 4ZCPA 4WN3A 2XB8A 2NYAA 4NE2A 4GXTA 4JWKA 3RG8A 2Z57A 5A4IS 4B33A 5KQRA 4IUYA 1ZRNA 2IYNA 2IXBA 2PS1A 1DNPA 3KLOA 2IXTA 2QVLA 1NP6A 2IQ5A 5AK5A 5B58C 3WL3A 2BM8A 3H84A 1YGPA 3DV0B 4IOJA 3EA5A 4TWZA 2I3DA 2EKDA 3RIYA 4B8ZA 3CV3A 1PTJC 4D3DA 1TYBE 1JNYA 3VVMA 5HBRA 4RQBA 1HR0B 4F5WA 4LXQA 1XMXA 2PMWB 1COZA 3G3EA 1ODKA 1YQTA 1YA8A 2J9YB 3LHFA 2JATA 3EFBA 1PFUA 3N3AC 3FPGA 4GX2A 3CEAA 3UK6A 5FWYB 1HOTA 1ZW1A 4MV3A 2VDWA 2ALJA 5IM4F 7GPBA 5FF9A 3DAGA 4CXMA 3ZDYB 3CURA 4XCQA 3VKUA 3P5BA 3S68A 3KJNA 5KNCA 3LWDA 1C30A 3OMWA 1I5OA 2BBOA 1AQYA 4H3VA 2Z0MA 2R8PA 4HAVA 4JVMA 1PSDA 3DHYA 2YUIA 1CUUA 2BL4A 1X74A 3DEJA 5COQA 5KBYA 3AHHA 1O58A 1PGJA 2OM2A 3AUTA 3KJHA 4XXHA 1ODTC 2YBDA 2VJOA 1R0KA 3AFGA 3CIOA 4HMPA 4LRWA 3FPKA 4D9CA 2UZ1B 1XEXB 4LHVA 5H9WA 5JARA 5A2QA 3LX6A 1B7GO 2BFDB 3IELA 1PIWA 3QYFA 4JJGA 2OQ2A 1E9SA 5TF0A 2L19A 3E58A 3IDSA 4Q4AA 3V6LA 2JJ1A 4DLTA 1GYQA 1I7PA 2OA0A 3AONB 4MIOA 3CT4A 3P52A 2HWWA 4C4XA 1LDYA 1QHNA 2ZRPA 4LW8A 3TUIC 721PA 3THWA 2MYUA 5DTIA 1TTQB 5D1NA 4CBVA 4E4YA 3BK7A 5I9NA 3TUJC 3WZLA 4IHAA 1PFVA 1CY0A 4P38A 2YY6A 2Q62A 3FI0A 1CQXA 4H1VA 4M76B 4PYIA 1EXVA 1XQXA 1KZYC 2JFZA 2RHOA 2D1YA 1VSQA 1VZ2A 2RHDA 3PQEA 2GFIA 2W90A 1IZ0A 3DE5X 4PQRA 3TR5A 4E5MA 2GM5A 2NZUG 3SYMA 3G49A 2PIDA 3N1UA 2EG5A 1N0IA 1VHQA 5GVRA 3RRJA 5IZCC 4N6NA 4H0FA 1L5RA 1PLKA 2ASEA 2B4YA 1MEEA 2J7PA 3C3XA 3ETLA 3G9QA 3IQGX 3WYCA 1RAHA 3NC4A 1JP7A 2HLNA 3MGGA 1N2HA 1PR5A 2QAJA 3I61A 3AVPA 1SZCA 2AVDA 3DZGA 2P9GA 3FM9A 4C1BA 4EB3A 4KPFC 5LMNB 3WKCA 4GOLD 3UWDA 3WLIA 1DKLA 1P4GA 2ATXA 3A8TA 3WYFA 2GPTA 3G89A 1ZXLA 4KE8A 3KZNA 2OQVA 3S2SA 3EVEA 4XWTA 5DULA 3HWRA 4PWYA 2NNWB 1TJ5A 3N8NA 4ESVA 3IT2A 4PSCA 1CF9A 1EVIA 4KG7A 4LYHA 4Q3KA 5KAMA 3H6HA 3W9BA 3UUEA 1T8WA 3G6WA 1O0CA 4BO0A 4O1MA 5LB4A 1GV1A 1PNTA 1KOGA 2X8AA 1NWHA 4R51A 4PPNA 1AH2A 3H8WA 2W83A 3JQGB 4HGRA 4WBSA 4UOEA 1BDHA 2VJMB 3ES9A 1UKZA 1USIA 3Q7QA 4DLVA 1P5FA 5JYBA 4OHKA 5A6SB 4M46A 3CVOA 3VO8A 3ZDFA 4G89A 1CR4A 5SYAA 4OQEA 4OI0A 3FKQA 4S12A 4XJXA 4RVUA 4M8LA 4RXMA 1TYZA 3PEEA 1IOWA 2FX3A 1Q0SA 4W7HA 2BJVA 4YV0A 5L7WA 1ES9A 1LPAB 4IJWA 1FPQA 3HWWA 3MJFA 5AVSA 5EY5B 1JDTA 2X0RA 3A32A 4MB6A 4B4WA 1KI2A 1VE5A 2PD3A 3E53A 4RYDA 3HA3A 3P9ZA 3ETJA 4JDUA 5EVCA 4AJ2A 4Z7JA 2FPPB 3OM9A 4X7RA 1ZJYA 1T9GR 1R4NB 1JJ7A 1NVWQ 2AV6A</