2X2FA

Dynamin 1 gtpase dimer, short axis form
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
347
structure length
336
Chain Sequence
EFSMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYSRVDEMLRMYHALKEALSIIGNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DYNAMIN-1
publication title G Domain Dimerization Controls Dynamin'S Assembly-Stimulated Gtpase Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 105
structure length 336
sequence length 347
chains with identical sequence D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2x2fA00
1CXZA 3MG9A 1YR6A 5CDFE 3THXA 2JEOA 1E69A 1VG0B 2AKYA 1VTKA 2NO9A 3VTKA 5DI9A 2HDNB 1Q44A 1NVVR 2XJ4A 3TSOA 3R9IA 4GZLA 2WOOA 1RIFA 2CNWA 4XJXA 4LX0A 2C2HA 4IW3B 2WWFA 721PA 5DI3B 1K6MA 3DM9B 4A2PA 2PJZA 2R9VA 2FPLA 3THWA 1LFDB 4BFXA 4BLQA 1F48A 5JJLA 1QHSA 2QMEA 2AK3A 4CDGA 2ZI3A 3K70B 2BJWA 1SULA 2BM1A 3U60B 3RDPA 3TVDA 4EAQA 1TPZA 1XJQA 1F2UA 2O8BA 1N6PA 1NKSA 5K8UA 3L2OB 4M9SA 5B30A 2H57A 1ZP6A 2PEZA 1P60A 4L9WA 3VNVA 2VHQA 4P3YA 1UPTA 4XSHA 1GNPA 1GSIA 4IFEA 1US8B 3RLFA 4DDUA 3J81k 2AX4A 1P62B 2WAXA 3EA5A 2D7DA 1Z07A 2UZIR 1SKYE 3IEUA 3K09A 1LY1A 2JLXA 4G0NA 3P27A 3SN6A 2GWHA 4KAXA 1IONA 2O8EB 1YVDA 2AK2A 4A0RA 3VX3A 2KE5A 2CLCX 3RRZA 1NBMD 1Z0IA 2OXCA 5EXSA 2OBMA 4ASUD 4HEJA 3A6PC 2O0KA 5AJWA 3RWOA 4CVNA 3SC3A 3VNUA 5TMPA 2C9YA 3K0AB 1J70A 1E1RD 3OE7A 4HUTA 2ZJ5A 1AQYA 4URUR 1AGRA 4IJMA 3TQFA 5TB5A 1AS2A 4DLUA 4V0OA 2F55A 3QF4B 5AJYA 3AF1A 1RFLA 1JAIA 1II8B 1N5KA 1WMSA 2E9SA 2VP4A 1W46A 3T15A 4IOLA 4MYCA 2EFEB 1SHZA 3VHXA 3WNBA 2GHIA 3PUYA 3REGA 2WSSD 4V02A 4P4UA 2ODEA 3KXIA 1D9ZA 4NE2A 4OYHA 2LWIA 1N6OA 5BXQC 1D9XA 5FI0B 1CJTC 4X8MA 2QY9A 1TEVA 1Z2AA 1CJKC 1R10A 2PJRA 3QIAA 3U7FB 4EPVA 2HJGA 2GK7A 2B21A 5EP1A 3CF6R 1XD8A 4C3ZA 1FOEB 3K0SA 2ZE7A 2ZI9A 1PLJA 4PO8A 1Z47A 4EJSB 4TLEA 5AUOB 1F2TB 1RJ9B 1ZM9A 2GEDA 3G5UA 3VHLB 2FF7A 2V7QD 1Q1EA 4F92B 1IBRA 1WA5A 2JJ2D 4TTQA 1U81A 1U0JA 4MKFA 2H8KA 3HU3A 3GD7A 4HDQB 4RZXA 3HYTA 2C8VA 3BIFA 3U3OA 1KI7A 3B1VA 4QXAA 3TW8B 3UKDA 1QHHB 2HLDD 3MMPA 4M9ZA 3B9QA 1KOFA 3K0FA 3KB1A 4QC2A 1QRAA 3W6PA 4BLOA 1ODFA 3DVLA 1W4BA 2ZRFA 4URZR 3IBYA 1AJEA 5DYIA 1OXUA 5GVRA 3F3YA 5FL7A 3QBTA 3ZD7A 4UXHA 4O25A 4C2TA 4KFUA 2QROA 1ZIPA 1VCOA 4LYAA 3RRMA 2HT6A 1XEXA 4L5BA 821PA 4HAWA 1P61B 1XZPA 2ZAOA 3PUWA 1RKBA 1QHNA 3U3KA 2REXB 1S96A 2QTFA 5KNBA 1E2EA 3EIQA 4PC7A 4QNMA 3TAHA 1OSNA 5DHFA 4POAA 2F3TA 2W6JD 2GZDA 3TR5A 8OHMA 1E98A 2A5JA 2DWQA 2OCYC 2GILA 2GXSA 1FL9A 1GWNA 4DSNA 1Q1QA 1XMSA 3P20A 3UMRA 2RGBA 1E32A 4FMCB 1ZNZA 3JZMA 1R6BX 1SXJC 5E95A 1TF5A 1E96A 3W5IA 1HE8B 1NJGA 3M1IA 2WJVA 4XVQA 5EE9A 3GLHA 4LJ5A 1ETUA 1HEIA 4TLBA 3OHMA 4M9XA 1XJ0A 5C4GB 1LS6A 1E9CA 3P1JA 2A30A 1G3RA 3T12A 1XJCA 2ZRNA 1O87A 4NMMA 4JMPA 2QTVB 3DMNA 1J7KA 4XSGA 2XNDA 3BE4A 3NEJA 4RD6A 4Q7KA 3ONWA 4AURA 2CNWD 4URVR 3GFOA 3PEYA 1M7GA 2V6IA 3MWYW 2X8AA 1RW4A 1HYQA 4EUNA 4X8HA 4BWYA 2Z83A 1P2TA 1NNEA 3VR2A 1ZD8A 3G82C 2EVWX 4QJ5A 4A82A 5F3WB 3DOEA 1E9AA 2Z0MA 1M1YE 2GNOA 4MA4A 3ADBA 4BZXA 4PSAA 3FGNA 4GFDA 3U61B 3FTQA 5UKDA 1E9SA 4HZUB 4J0QA 2YVUA 2QRZA 2FH5B 1SKQA 1E2PA 3AGPA 4DDWA 5TDHA 5KPDA 1CJVC 2V4ZA 4AKEA 3NBFA 2W0SA 1BIFA 1KO5A 2OT3B 1IOZA 3ZGXA 1P7CA 3U6KA 4PC1A 1DAIA 3JVUA 1FNNA 2R2AA 4E03A 3FKSA 2ZPTX 3VKGA 4MYTA 3CPJB 1OIVA 2AHOA 1SXJA 5M04A 1N0UA 4JJKA 2L0XA 2WSMA 3QEJA 1J90A 5L3SA 4NP6A 1AA9A 1QG2A 4N1AA 3FHTA 4PAQA 1KJZA 2QE7A 3B7GA 4AYTA 4X8LA 4DBLC 3K70C 1L4UA 4NONA 2FE4A 3GLIA 2VTKA 5TARA 4QGAA 3Q85A 3CR7A 5JSZA 5FUWA 4PANA 3NXSA 3ZIAA 3KB2A 5J47A 1NVUQ 4BECA 2IX3A 2IF0A 4OI0A 3AVUA 2C04A 3VAAA 1XXHE 2V9PA 3AEZA 3T35A 2DBYA 2C98A 3IILA 3WHKA 1QVRA 3OE7D 2BCJQ 2OLKA 2GJSA 4JLVA 4B71A 3QKSA 1RPZA 2CHVA 4QKQA 5CLQA 1UFQA 2YWFA 3BH6A 2C96A 2IYSA 4HUQA 1L8QA 4EQ6B 4FW9A 1IXZA 2JLSA 2CEAA 3RS5A 4A2WA 4D2IA 1P3JA 3U44A 1T8UA 4HDCA 3ZQ6A 1JR6A 4R71A 1QHXA 3RAPR 1ANKA 2P6RA 2ZRLA 1YJ5A 3RNLA 4Q1BA 4PQYA 4JSTA 5FBLB 3Q3JB 4N3NA 1AIPA 4TT3A 2IYLD 1L7VC 2IYRA 1DG3A 2Y8EA 4P31A 2XXAB 4MUAA 5FOSA 1M7HA 5G3ZA 3QPUA 1IJFA 4X8OA 4C0KA 2ZAMA 4ESHA 4QGHA 1T3HA 2MSDB 5KNDA 2D74A 2WWGA 5EE1A 3C4JA 2CVFA 4PTLA 4CEJB 2WJHA 3O8BA 1KHTA 2WOJA 4WZBE 3UWOA 4GT1A 3X1XA 1XCPA 3VKHA 1G6HA 1YHNA 2KI5A 1R8SA 3DM5A 4B3XA 3ADDA 4JLBA 2NIPA 5DI3A 5BN3A 4LJ6A 121PA 4A4DA 3EAQA 3QE0A 3W9YA 1XD2B 3WYFA 1E2JA 3CBQA 1G8FA 3HDTA 4KBGA 4US1R 2FEMA 4M21A 1N5LA 1X86B 1S4QA 1Z0KA 2VP9A 3B6EA 3BRWD 3ND8A 1M7BA 4PHGA 4S35A 4B33A 4FMCF 1EESA 1E2FA 3CPHA 4Z54A 2LCFA 1DOAA 1NY6A 1IXRC 2YWGA 1IM2A 3WHLA 3KFXA 5GJWC 2ZYUX 4NTZA 4F4IA 2QMHA 4ZV4A 1SHKA 4PO9A 3QG5A 2V3CC 2IEYA 2J7PA 3EG5A 1YE8A 1NN1A 2OM2A 1XTJA 1US8A 4NYJR 2PT7A 3GCGA 4EJSC 2DYKA 1P72A 1KI1A 1WF3A 2Q9BA 3IPXA 1ZC4A 4MGYR 4NYMQ 3GJ6A 2FZ4A 3W3ZB 5FL7D 4FINA 5FL3A 4ERNA 1VIYA 4AY2A 4RZ2A 3NC0C 4D0LB 1ZCAA 3SFVA 1YZTA 3IHWA 4JKIA 2ZSBA 1S3GA 1CKEA 3AF0A 2J0QA 1E9BA 4IHQA 2O8EA 4B73A 4JVLA 3E2IA 4OK6A 2ZVQX 4A92A 3CF0A 1GP2A 3LXRA 2ZANA 4B2LA 1VIAA 1W4AA 2FSHA 2P6NA 3QBVA 4JVMA 4DSOA 1V43A 4ZI3A 1OPXA 3SEAA 3K0AA 5HTKA 2GJ9A 4HAYA 1VHTA 2IUUA 1R0XA 4ZPXA 2IK8A 4C9BA 3G0HA 4B75A 2H17A 4JT4A 4O0MA 4FXPA 4B48A 2R8RA 1NIPA 3EZ6A 3RS4A 2V1UA 2FGKA 1GILA 2BJVA 3QF4A 1OV4A 1E2QA 1SZPA 4DUGA 1OXSC 1FUUA 1II8A 4QBFA 2ODBA 3EASA 4AG6A 4JBXA 4MGZR 1OHHA 5DSZA 4UNSA 1BMFA 2JGNA 2VL7A 2BMFA 1G5RA 4H1VA 2GTPA 3C41J 3K9NA 2OZEA 4Q00A 2QNRA 1AS0A 5A4JA 1E2NA 2H1LA 4DC9A 3GLFE 2JLRA 5KPJA 4HZIA 2R6FA 2OXRA 4OQNA 1AKYA 1S3SA 2XNDD 5EE5B 3PEUA 3W8RA 3ZS9A 2ZQ5A 3SOPA 4EJSA 1F2TA 1RJ9A 3C7KA 4Q9JA 4C7OB 2ZS9A 3PUXA 2UVQA 2ERXA 1E0JA 5TV2A 1MRNA 3AVYA 3K0CC 1G8GA 1JPNA 3LRPA 4YMSA 5FOXA 1AQUA 1T0HB 3MRSA 3NDPA 4UNQA 1RC8A 1JNYA 5C1BA 5AUNB 1G1MA 1OYYA 2CLSA 2FEOA 2ZJOA 2YOGA 3CZPA 4Q9IA 3TR0A 5HKKA 3AVXA 3H1TA 1D2MA 3CONA 4RCYA 3UXMA 3AH8A 1XWIA 2WPDA 3GP8A 1Z63A 4XTRA 3NHAA 3P4XA 5DNYB 4B32A 5L3QB 3N2IA 4A2QA 1QHHA 1G41A 1R5NA 4BRWA 4CEIB 1P9RA 4G5SA 1GKYA 2UZ3A 4Q1EA 4LJ4A 1JEEA 4R9UC 5JRZA 2PZGA 3FKSD 1XTIA 5BN5A 1EWQA 4OJKA 4TLDA 2BEKA 2JLZA 1YZNA 1XRJA 2NO7A 1SXJD 4NYIR 4LBWA 2MSEB 2KBEA 2OV2A 4M9QA 4KBFA 4QM6A 3EPHA 1E9RA 1A5TA 2RAPA 2GCOB 2QE7D 3OAAA 1LV7A 1W2HA 4KCGA 3WP0A 3B1ZA 3IGFA 3BC1A 5DYGA 2FPMA 4JL8A 3QF7A 5AJXA 3T1TA 5JJIA 3KXLA 1AKEA 5H1YA 2ZRCA 1E0AA 2GJ8A 3PUZA 5AJZA 4TMXA 2OILA 1SQ5A 3I1FA 4JLDA 4E07A 2O8DB 4N0EA 3WRYC 1TAGA 3WXMA 2A5FA 1FUKA 1UEIA 2BOVA 2XEXA 2DCUA 2PCJA 1JXMA 4V0NA 4TLCA 5E3HA 4PSVA 1HT1E 2GA8A 1KI8A 1PJRA 2OUKA 2E87A 3L8ZA 5KNCA 3K0CA 5EZ5A 2BC9A 2FFBA 1N0WA 3ASYA 1TX4B 2D2FA 1TMKA 2ZROA 4YDHB 1LS1A 4Q47A 5D3QA 5JECA 1W0KA 2GRJA 3TAUA 2GJAA 1ZNWA 3P32A 2Q0HA 3FHOA 4TT3D 1MH1A 4JS0A 4CYMA 3PCRB 2XZOA 4W5JA 2VRWA 4ZO4A 3NH6A 3DKVA 4NKRA 5KHOC 2BBOA 5P21A 2XZPA 2RMKA 3B5JA 4L9SA 1KO8A 1NRJB 2HF9A 4KLZA 3UMSA 5EXXA 1Q57A 4Q01A 4W5WA 4D26A 4M0LA 1KKLA 1KYIA 5KOYA 3L0IB 1G8HA 4GNKA 3QG1A 5EQTA 4CT4B 2D62A 1EWRA 4ZIRA 1EFCA 2ZRIA 4WA7A 2P6UA 1OT3A 1OJLA 3IUYA 3SR0A 2GXQA 3K70D 5FH9A 1RRFA 3AVOA 2ZI4A 2VF8A 1VCMA 4TZ0A 2G83A 1KJWA 2FJUA 4HZUA 2P5TB 4IXMA 5TY0A 3HPQA 1KO4A 3QXCA 4P4SB 3GEHA 3PENA 1UADA 2O0JA 1W36B 1BYIA 2J7PD 4HI0E 5FPSA 1SKYB 3NH9A 2OAQ1 5B58C 5J4HA 1P6XA 4PHFA 4I1UA 3Q8XB 4KXFB 5EXTA 4Q1CA 1DO0A 4HB3A 1OF1A 4KSCA 4B6FA 4U7DA 3MWJA 1W2GA 2FWRA 2KWIA 2XX3A 5J4YA 3O47A 3FE2A 1NG1A 3GEEA 4KSBA 2AL7A 4QFMA 1GKIA 5AR1A 4DHEA 1FPMA 2W83A 3EIHA 4NCHA 1W47A 4R98A 5JS7A 1JECA 3THYA 1XPOA 1ZUNB 3B82A 5F98A 1UJ2A 3AKCA 3WY9A 3QQ5A 2CCKA 4Q4AB 5CIQA 1N5JA 3K0EA 2R44A 3IDQA 2B7BA 3AF4A 3HJNA 3IQXA 1R5BA 2ZRDA 2QAGB 3QUSA 3U7HB 4US2R 5EXPA 3C8UA 2FFQA 1DAGA 2C9OA 1N25A 2QRNA 2WWIA 5C46F 1JR3E 1GTVA 1ZM3A 1P73A 2GZAA 4WXRA 1G3IA 4E09A 2WAYA 1TF2A 4L8GA 2HEIA 2ZVPX 3RWMB 3VR1A 5FTMA 2QQ0A 4EQ6A 1PV4A 4DUGD 1U8ZA 3DL0A 2PMKA 1E2DA 2W6IA 2EYUA 2ZRAA 2VA8A 3KQNA 5JWOA 2QMUA 4KODA 3GJ0A 5IRCD 4ARZB 4BFUA 2PZFA 1COWA 1OHHD 2GESA 2EWVA 1QHGA 1XMIA 2OBLA 4I1VA 1BMFD 1YRAA 2CMKA 1YRBA 3W8NA 4II7A 3VX4A 5ANRB 2H7VA 3AM1A 1Q20A 4EKDA 2ZSDA 3FDIA 2XXAA 1SVWA 2VPPA 1WBDA 2IC5A 3B8HA 4B2IA 3W90A 4QHSA 2IUTA 2NQ2C 2VIIA 4IDOA 4D82A 4EFLA 5BYKA 3ICQB 5F9FA 4Z8XA 4Q4JB 5JEEA 4CEJA 2CE2X 3Q7PA 2RGCA 4ZI2A 4WBSA 1UKZA 4RJLA 3LQRA 3MWKA 3GLGE 2A3RA 2CLDX 4F93B 3R9WA 2ERYA 1E0SA 3BB1A 1G7SA 3KJGA 1DAEA 4TYYA 2QM7A 5DO9A 3RYTC 1OH7A 1KSGA 1UDWA 1XD2A 2ZJ2A 5TVKA 1KAOA 3N5CA 5HKKD 5FUVA 5E7MA 2VSXA 4V03A 2WPDD 4TSFA 2A9KA 4FWTA 2BV3A 3U7GA 4TWZA 1XNJA 3FMOB 2ASEA 2FG5A 2PCLA 4KFSA 4O2LA 1KJYA 3BXZA 4MKIA 1GL7A 5LBIA 1F5NA 3IQWA 1XPUA 1YR9A 4TYWA 5JI3E 4PPFA 2IHYA 3VR6A 1JI0A 1Q1ZA 5FTNA 1KSFX 1BS1A 3TIFA 2D2EA 5FOVA 3MSXA 3FKQA 4TL8A 4D0NA 5KDOA 2R6DA 2WMNB 1EFTA 4JL6A 2C99A 1I2DA 3I3SR 3OAAD 1D2EA 2QSYA 2QT0A 2ZRKA 4LI0A 3PEVA 1OE0A 3CNOA 5JJKA 5JCZA 2BDTA 2QP3A 1WDTA 3CRMA 4LBYA 1OB5A 2BHRA 2WHXA 2QN6A 3LV8A 1X3SA 3TW4A 4PZZA 1EG7A 2WJIA 3KJEA 1YKSA 3UG7A 3GJ4A 1VCNA 3BK7A 1WXQA 5G3YA 4YDSA 3WP1B 1NIJA 2C77A 2P67A 3CNLA 3U6BA 2RCNA 1FQKA 4YMTA 2WTUA 4ON9A 4AKIA 4IEEA 4K46A 3O8DA 4BFTA 4D6PA 1XCGB 2QG6A 5EE3A 4ZKEA 1F6BA 1M2OB 3HP1A 3D6TB 3V9PA 1GM5A 2G6BA 2QMOA 1F60A 4JLJA 4XWOA 1GDDA 1NKTA 1CR0A 3V4RA 4Q4HB 4FWIB 3TNFA 3EC2A 3TBKA 4ZCMA 1Q3TA 1CU1A 2XTZA 4LV8B 1KMQA 2IS6A 2OG2A 1OXTA 1W0KD 5BWMA 2FFHA 2GETA 4V0LA 3EZ9A 1ZAKA 2XOKA 3SFZA 4G1UC 1TF7A 1R0WA 4OHYA 4LHZA 2ZREA 1Y3AA 2NZ8A 4M53A 5GJCA 3DKPA 2OBNA 1D6JA 2ZRJA 1FTSA 3ND9A 3ZZTA 1VMAA 1E2MA 3NC1C 4PHTA 1DTSA 3PXGA 1DO2A 3K53A 5LD2C 1EK0A 5IF9A 3BD9A 4LZZA 4QGGA 1X8JA 1A2BA 2J46A 1OFUX 3Q72A 4LRWA 1M8PA 4C7OA 2F6RA 3GJ5A 4PZYA 5J5CA 4C0AC 3ZLJA 2XGJA 2G1KA 1RE0A 2GAOA 4F38A 4BLSA 2VSOA 4DZZA 1JB1A 4ZCLA 3K1JA 4D81A 2Q3MA 3QKUA 4JT2A 3I5XA 4JYCA 5FTJA 4TLAA 1Z08A 2SHKA 4PO1A 5CITA 2NG1A 3U3MA 1Q21A 2ORWA 5G40A 1ZM4A 2HF8A 2ZU0C 2JASA 2RH5A 4DWJA 1GRQA 4TYQA 1G5PA 5SZJA 2YJTD 1ZYUA 5J4LA 4IDQA 1E1QA 3NEYA 3T5DA 2R6GA 4AD8A 5JS8A 3X2SA 3TRFA 2CDNA 1T3LA 4NCKA 1JQLB 4FN5A 1HUQA 3HPRA 4OI2A 2FA9A 5DH9A 3NVAA 1E2IA 1KI9A 1HT2E 2F3RA 2MSCB 1G17A 1D5CA 5LDDC 3CB4A 3AVQA 2QGZA 2GCOA 1XXHB 2R62A 4Q7JB 3EA0A 4H9GA 4NDZA 3WBJA 5J40A 4MH0R 3WNDA 1NF3A 3AQ4A 4XVUA 4RD3A 1Z6TA 3QVUA 1W0JA 3NHBA 2O8FB 1W36C 4NCJA 2X19A 4GMXA 4IDHA 2IEZA 3CH4B 5JBQA 4YMUA 4MYUA 1OXVA 3ZVLA 2JJ1A 3PQCA 1NLFA 1IN4A 2FU5C 2J59A 5HZHA 5L3RA 3FVQA 1G4UR 1E4VA 2BBSA 2IYTA 3CNNA 2VQSA 2CXXA 2P65A 421PA 2BBWA 4CEHB 2W6ID 5HCIA 5CDFA 5CK4A 5FFMA 4B34A 4FMDF 1YQTA 1G4AE 5DN6A 1F3OA 2ECKA 2QP9X 1COWD 2ODNA 3DDCA 1FQJA 2AFIE 3RSOA 3U4QB 2Q9CA 5C4MA 4LJAA 1Z3IX 3H0KA 2CL6X 4BASA 2ATVA 4B6EA 4JYBA 3CR8A 4CZ2A 1GIAA 2QAGC 4GSYA 3TQCA 1J99A 2VP2A 1U0HC 4P32A 1T4GA 2CHGA 4MUBA 1FNMA 2OFOA 3QI2A 4C0BA 3TKLA 1YZLA 2O8CB 3QVVA 4UQOA 2R6CA 1ZBDA 1P9WA 2Z5FA 4IEIA 3SYLA 1T91A 3X1YA 1CULC 4OHVA 3UK6A 5IT5A 1A1VA 2ANBA 2F1IA 4FMBB 1XMVA 3C16C 2OCBA 2JLWA 4S2EA 2GF9A 1T5IA 1FX0B 2HXYA 1BO6A 2B92A 2QT1A 2VP5A 3QXXA 4MQBA 1MKYA 4TMKA 1KMHB 3LX5A 5SZKB 3DZDA 4B3FX 2WM9B 2YWEA 1DS6A 2PEYA 4TSFD 1VECA 3QSYA 3MGCA 2G88A 3A4MA 4P4SA 4GOJA 4B47A 5JRJA 2J0VA 2QI9C 2BM0A 2ZSEA 3QPVA 4KYUA 4UNRA 1R5OA 5LB2A 1GNRA 3GJ7A 3L8YA 3D7MA 4FI3C 4NYMR 1VPLA 2VP0A 2HXSA 4OQXA 1A4RA 3AF2A 1FP7A 5J4KA 2ANCA 2NPFA 2OFWA 3M0EA 1OLOA 2DWPA 5FPTA 2V8OA 5FR2A 1E9EA 1VG8A 5SZIA 2VHUA 4BQSA 3SYKA 3C5HA 3KZ1E 4Q4AA 4QL3A 3CLVA 2ZU6A 2CL0X 2HV8A 4G3XA 2K5UA 4Q4LA 4DEYA 3EZ2A 5FPHA 1KZ7B 3BB4A 4BFWA 3K9HA 3DZ8A 2QAGA 3PR1A 3SHWA 3UIEA 3Q9LA 1UEJA 4B3BA 3AV0B 4AWXA 1EGAA 3X1ZA 2B6HA 3H4MA 4HAXA 4AIIA 3LNCA 3KQHA 1RRCA 5FBQB 3CIOA 1HQCA 2R65A 1NBME 1ZD1A 2CK3A 4KJZA 3UANA 3BS4A 2C5LA 4BZQA 5HPYB 4A8JB 2ZITA 5JI2E 1T8TA 2UKDA 5DISB 3RS7A 5A5GA 3AUXA 2JAQA 4JSYA 1NMXA 2CHQA 4Z8YA 3BFKA 3QOFA 4WVFA 1NL3A 1XDBA 2EWWA 3PIRA 1XD9A 5EUQB 1HTWA 3RRYA 4I1SA 1N6RA 4ARZA 2YNMA 3E5HA 5K8LA 3I4LA 3GLFB 2XOKD 4DCUA 1GVNB 4P33A 4WZAE 2D4HA 3EC1A 1X1SA 2C78A 2QZ4A 3A1WA 4LJ7A 4URWR 5DE3A 2ONJA 3CWQA 3ZH9B 4D0GA 1Q22A 1TTTA 1U90A 2AWOA 3NBYC 3LQQA 3RHFA 4BGDA 1NSFA 3FWYA 4PPGA 1QHYA 2ZRGA 4OHZA 3TGPA 1G7TA 1NSTA 2Z6VA 3GFTA 2BEJA 5FUYA 3OFNA 3LH5A 2QGNA 4Q4JA 1E2LA 4HB4A 1XEWY 1OIWA 1KI3A 3DO6A 1DADA 4PSKA 1EFHA 1CJMA 3ZJYA 3CRVA 2IS4A 2GVZC 4RVCA 1L4YA 1KSJA 4XOIA 5BYJA 3EWSA 2JLUA 1G19A 1IN7A 2MMGA 2VSFA 4MYHA 5EUMA 1TU4A 5KU1A 5TXGA 3THWB 2YWHA 2CCGA 2EYQA 3D31A 3LAWA 3LD9A 4LPKA 1Z22A 3EARA 3PG5A 4BFSA 2A5GA 5EP2A 4PPQA 2J41A 1W4RA 5KSYA 1MRSA 1W48A 2I4IA 2V55B 4D4LA 1IY1A 1Z29A 1OFTA 1UKYA 2DFKB 4YONB 4MRNA 2IWHA 4HLDA 2J1LA 2RHDA 4D4KA 3QEOA 2WWXA 1IJEA 3K8YA 2LKDA 4XD7A 4EPXA 1YR8A 3RS0A 3GJXC 1CRQA 1GZSA 1J2JA 2ZJZA 3RSLA 2WWHA 3X1WA 1DEKA 2A78A 1XBTA 4L4UA 2NZJA 2DHRA 4LYJA 3P26A 4UXIA 2CJWB 4DLZA 4ZKDA 3U7EB 1W0JD 5C2JB 5CLLA 4ILEA 2HCBA 2OE2A 3SBDA 4M2LA 1PUJA 5GJBA 5C18A 2JJ1D 1JEDA 2NMVA 3OEEA 1JALA 1DE0A 2OHFA 4IDNA 1S1MA 2JDIA 4CRWB 3KQUA 2QA5A 3ZD6A 2PH1A 4JLMA 3M6AA 1JPJA 3AF3A 3OIUA 2FGJA 2G0TA 3BFVA 4OK3A 4PAOA 3VU9B 3FMFA 3AP3A 4Q4HA 3NKVA 1N6LA 5FR1A 5DN6D 5HE9A 2KSQA 5HE8A 5IHPA 1WCV1 2JLYA 2AFHE 4HDOB 1MR3F 3E70C 4KITB 2FZLA 4KHZA 3CRW1 1G6OA 1HY3A 5CYPA 4DIEA 1C9KA 3GQBA 4JLAA 3A58B 1N0VC 1GRRA 2GXUA 1W7AA 2QPOA 4TQ9A 1ZM2A 3EW9A 2ONKA 5EP3A 2G0NA 3NWJA 4C0HA 3SBEA 3FYHA 3QXHA 1KY3A 2QAJA 3AVPA 5KSOA 1T3SA 1D8TA 3LWNA 4Q48A 1RRGA 3ZZUA 4CW7A 3L0SA 1YZQA 1WBBA 1II0A 3A36A 2BVNA 2VP6A 1TUIA 2XTMA 3AP1A 5G41A 3SHFA 1QDEA 2ZIAA 4I99A 4KV9A 4DRZA 4LHVA 4KO8A 5KSPA 4UNPA 4Q9HA 4WXPA 3A1SA 1Z0FA 1ZJ6A 4IKEA 5JCPA 3WYGA 1OKKA 3H86A 3WMFA 1S2MA 1W36D 3W34A 4PPNA 3U3RA 2VHCA 2X2EA 1KO1A 4U00A 4XIGS 1LNZA 4HLQB 4IVPA 3WMGA 1VCIA 3T1OA 2PX3A 4QNRA 3EIEA 1E99A 2IYQA 2WBLC 3A4LA 3EPJA 2ZUCA 2AR7A 1GAJA 4XH9B 4A15A 2O5VA 2ZRPA 4O3MA 2IT1A 5JLJA 4QGFA 1EX7A 2I1VB 3P4YA 4DKXA 3PVSA 4FCVA 1AGPA 4JL5A 5KO2A 3UG6A 1AM4D 1P4SA 2B7CA 3ZVNA 4BEBA 1E94E 4MITA 3ZIAD 1XEFA 4MRSA 1XXHA 4K81B 5DHAA 2ZR7A 4G01B 1XZQA 4RKEA 4U5XA 3ZVRA 4GL2A 4W5HA 1RVDA 5AJVB 1OH5A 1FFHA 3OF5A 4BLTA 1KK0A 1BH2A 2CVHA 3ZYCA 2I1QA 4QHTA 3K9GA 4ZCIA 2H18A 1D2NA 4NL4H 4A0FA 1WRBA 2E1RA 2J5XA 3REFA 5FPYA 2CK3D 2GDJA 3WNCA 4W9MC 4IOKA 1JJVA 1C1YA 1YZUA 5FTKA 4A36A 1BYUA 1KNQA 4IDPA 1UBEA 4TQAA 4CEHA 1CBUA 1EFUA 2HT1A 4DB2A 2IA5A 4M1OA 2OEPA 2ZE5A 3T06B 4DEXA 1K8RA 1S8FA 4GI7A 4DLWA 1HURA 1ESMA 4GRAA 3ZDQA 2FFAA 3H2YA 3U4QA 1EXMA 1I2MA 2IWRA 5GVSA 621PA 4BPBA 2J0UB 4KFTA 4QOSA 5L3VA 1KZGB 3KTAB 2ZI6A 1UKEA 1XPRA 3GLGB 2ZE8A 3MWLA 1IY0A 3EPLA 1IQPA 4ZDWA 4DSUA 2ZM5A 1QVAA 3OFND 4OKSA 5B57C 1G5TA 5FOUA 2YOHA 3PEWA 2O8CA 1FP6A 1UDXA 1MO5A 4A8JC 4M8NE 4M1SA 2H5EA 1JJ7A 2W2TA 2WICA 4NCIA 4QBGB 2EQBA 4LBZA 3AVTA 1G3MA 1IHUA 4RFSB 5HCNA 2VBCA 3ETLA 4CF7A 3VR5A 2HYIC 1BKDR 1VHLA 1FX0A 2GF0A 4I81A 4QJ4A 4TN1A 1LF0A 2IXEA 4WOPA 1ZCBA 1KMHA 1TNDA 2WJJA 3CX6A 4A6PA 3LLUA 2Z43A 1NI3A 2BMDA 2W58A 1UAAA 4JJZA 4TL7A 4DT1B 2QORA 5ELXA 3I92A 4EFNA 4PC2A 4AKHA 1QF9A 1JAHA 1KI2A 4ITRC 1KK1A 5H70A 2F9LA 4RFVA 3WRXC 3IIMA 4CIDA 2FV8A 3WMEA 4ESVA 1OFIA 2IYVA 3D3QA 3C15C 2GKSA 4IXNA 2F1HA 3FHCB 2EFDB 5GADl 4F91B 1BOFA 4GP6A 1T6NA 4IRUB 1HH4A 4AG5A 1G64A 1E4YA 2PT5A 3OZXA 4LOAA 3QENA 5LPNA 2WZQA 3MD0A 2RHMA 1XB2A 4Q7MB 3IO5A 5F9HA 1N3BA 3CKLA 2F43B 2DFNA 2N42A 4I4LA 2W2XA 3OEED 3A37A 1Z6GA 1NY5A 2JDID 5EJEA 5E7IA 3W5JA 4K8OA 4A8JA 1VYTA 2OSBA 1SVKA 2ZE6A 3LX8A 2ZJAA 2XJ9A 3WBKA 4Q66C 4YXWA 2JA1A 4IFBA 2IUSA 2NO1A 1Z06A 4NCNA 4PX9A 1U8YA 4B76A 3GFPA 3GLFA 1DAKA 3KKMA 2ZJBA 5E7JA 5BN4A 4TMWA 1GL6A 3V4FA 1TEXA 5KSZA 2WVJA 1OH8A 1P5ZB 1AK2A 2FSIA 3QNUA 5JHGB 1R8QA 3B85A 1DBSA 1IN6A 3GLHE 4U02A 2VH5R 4Q21A 2A5YB 3NBXX 4DVGA 3IKJA 1YR7A 3B2EA 1TADA 1IN8A 2KBFA 3KJIA 2GJKA 1JBKA 2IYXA 3LLMA 4LWZA 1MOZA 3BWDD 1W44A 5FTLA 2GK6A 1Z2CA 3SQXA 3W3AA 1U99A 3CX7A 5JMTA 2F9MA 2H92A 2ZI7A 1TQ6A 3L43A 2QBYB 1TUEA 2BKEA 2ZYWX 2RGGA 2CCJA 5E4FA 1J8MF 3E1SA 4FD2A 1DAMA 4URXR 1B0UA 3RS3A 4E22A 4FMDB 4AKGA 2ZS8A 1OKKD 3SYNA 1XTQA 1Q12A 4Y0VA 5FBRB 2A2ZA 2Q9AA 4HAVA 5JWRA 3IPYA 4RD4A 2G77B 2W0MA 3THOA 1OFHA 2XB2A 1KAGA 3EZFA 2ZSFA 3I5YA 4C0JA 3B78A 5HR5A 2QU8A 3PV0A 1LTQA 4PC3A 2RGEA 2RB4A 3Q7QA 4OBEA 1MO4A 1JXOA 2FPKA 5AUQA 2C95A 5K8TA 3EPKA 1MO6A 3CX8A 3HU1A 2F7SA 3SJZA 2F1JA 4B3CA 2ODWA 5FOWA 3DOFA 1T0JB 2CJWA 2REOA 4GOXA 5KDDA 4RY2A 5JZVA 3OIWA 1Z83A 3B1YA 4HATA 3LW8A 1Z0DA 1SXJE 1GL9B 3RRNA 3SJAA 5CJPA 5KDLA 5AK0A 4ACBA 1OB2A 3KUDA 1RZ3A 3D8BA 1ESNA 2JIZA 2GBLC 2QEQA 4C2UA 3SI7A 3JZAA 3ASZA 1CR1A 1W5SA 5DLQC 3NTUA 5EZ6B 3GLIE 1DELA 1G7RA 4BFVA 4RD0A 2PX0A 3N70A 1FMLA 1XX6A 1Z5ZA 4HAZA 4HYYA 3S1AB 3T34A 3VU9A 2P3SA 2X2FA 5FUXA 1VYVA 2TMKA 5CJ2A 1S9DA 3DEFA 1XTRA 2P5SA 1VKJA 3RVBA 5AWFC 1GITA 1XEWX 3IHLA 1Q0UA 5KUTA 2YYZA 4BLPA 2ORIA 1Z28A 1KDPA 1N2CE 1GG2A 2QENA 5KYKA 1N6KA 1G21E 3CW2A 4G5RA 2GZHA 4Q1FA 3TSZA 3BJIC 1LW7A 2Z4RA 2OFXA 4HSEA 4V0ME 2Q3HA 2DPXA 1CTQA 1H8HA 1P75A 4A0HA 1E2GA 1TU3A 1U0LA 4TYNA 2NTYC 4WW0A 1NMYA 1W5TA 2HYDA 2RGAA 4Q03A 2G9NA 3R8FA 1GUAA 4LUCA 3KKQA 1FW6A 4JZKA 1P9NA 1WP9A 1M6NA 1GFIA 1NVVQ 1U2RA 4A1FA 2OAP1 4M4SA 3LBIA 1ZC3A 4JBWA 1XMJA 3BOSA 3MLEA 2AN9A 3ZS8A 1E9DA 2PBRA 1NLYA 4N0DA 3BORA 4D4MA 2GCNA 2J3EA 2FNAA 1DAFA 1II9A 2NGRA 1ZD9A 1YZGA 5L3QA 4GDFA 2BMJA 4CEIA 3PUVA 1AZTA 4TQUS 5KTYA 4C0LA 2ZSAA 1NN5A 4B43A 2Q21A 1G18A 2BIFA 3IEVA 4MKHA 4EPTA 2IYUA 3CRQA 1U94A 2GBLA 2MMCA 2YZ2A 4G5QA 2VHJA 4Q1AA 4XWKA 2AXNA 4PC6A 4DLRA 2JLVA 1Z6XA 2C03A 1KTVA 3I61A 2QPAA 3KDSE 4UKDA 4LJ8A 2HCJB 2ZJYA 4UJ3A 1AS3A 2AD5A 2ZETA 4D4JA 1ZINA 5FPKA 1KO7A 2ZXUA 1JR3A 5K8IA 1FZQA 3KKOA 4A9AA 1QG4A 3LDAA 2O8DA 6Q21A 2V6JA 1ZRHA 2G1JA 3UPUA 4TL9A 2FMXA 4PQRA 1PLLA 2C9CA 2KB0A 3FPAA 3KKPA 1UBFA 3VMFA 2RGDA 1ZVQA 1G291 4B74A 3LFUA 2EFCB 4GP7A 5H8WA 3ZZ0A 2KJQA 5JEDA 3L0PA 2IYYA 4YQFA 2GVDC 3PFIA 4TL6A 3FFBA 4C0QC 3KQKA 3F0TA 2OO7A 4DCTA 2JJ8A 2AD1A 2ZR9A 3I8XA 4LY6A 4YXWD 4RD1A 1UBCA 3QKRB 3GPLA 4RZUA 1MABB 3K9LA 4BLRA 4DDTA 2QPTA 2J0UA 5CIWA 3ICEA 5BW8A 3KTAA 4C0SA 1ZW6A 3I8SA 3WYAA 3GLGA 3AP2A 3AVVA 4BUJA 3B9PA 4DLTA 5FI1B 4ZDJA 3LVQE 4M1KA 1R4AA 2F1RA 3SE0A 4F7WA 5JHHB 2YOFA 3MFYA 1DAHA 4MRVA 4DLYA 4KYIB 2ZR0A 3MJRA 2XTNA 1MV5A 1M74A 1T5LA 2J9RA 2ZYTX 4JLPA 4M1TA 3C14C 5CB6A 1RYHA 2EW1A 4Q9LA 1Q3HA 2OESA 4B2PA 4RFSA 2XB4A 3N2EA 4QM7A 3W6NA 1E79A 4AI6A 2J45A 1GNQA 1XF9A 4PR0A 1TQ4A 2VF7A 4ZIRB 5GJVC 2Z4SA 3BGWA 4UXJA 3O8CA 4V0KA 2JATA 2WJGA 3QY0A 5CM9C 3A1TA 3ZQJA 4DT1A 4FCWA 1TQ2A 4YC7A 3EWAA 2PZEA 1P2UA 4KI0A 4R2IA 3RABA 1Y63A 1VG1A 2IS1A 1XTKA 1XTSA 3IIKA 1I4DD 221PA 3FB4A 4TTPA 5SZHB 1U8AA 4DCSA 2CE7A 1G20E 2FSGA 2XSZA 4Y0AA 1CJUC 3T1VA 2AKAB 4PQFA 4M22A 1EX6A 4QBHA 4LDJA 4YMVA 4Z51A 3UMFA 2IL1A 4EDHA 1CEEA 4LV6A 4AYXA 2QUZA 1QHIA 1SVIA 2G3YA 4DXAA 3ZVMA 3THYB 2V1XA 4Q1DA 3DPUA 1LVGA 2IW3A 3B1WA 2O52A 3HR7A 3LBNA 3VKWA 5D3MB 3R9XA 3EXAA 2F43A 2JIZD 5B2ZA 4JLOA 5CK5A 4DB4A 1PLKA 2I3BA 2VYFA 2VO1A 2EU8A 2ZUBA 2WWYA 1Z0JA 2YC2C 1CP2A 4JBYA 3SJCA 1H65A 1NVXQ 3U2QA 2HJVA 4L15A 3A8TA 3H84A 4JLNA 3TUIC 5CB8A 1G9XA 2H16A 4NPHA 2NPIA 1SVSA 1KKMA 1U98A 1KDRA 3R20A 3RC3A 3T1QA 3NBZC 4A6XA 2ZRHA 1KI6B 1N6IA 3R7WB 3KJHA 5IDVA 2NOAA 4Q02A 3IIJA 2CBZA 4BEJA 2DB3A 2PLRA 1Z6YA 4PFSA 3W6OA 4DCNA 4NHOA 5JWHA 3QXJA 2D06A 1RYFA 2YV5A 3OESA 4OI4A 4DJTA 3TUZC 2DFTA 4OJQA 4C30A 4MDEA 4LHWA 3X1DA 1NMZA 4GBMA 4JVNA 3THXB 4V0MA 5CYOA 1VYUA 3PITA 3KXKA 3AGQA 1H8HD 4OQFA 1S1CA 3O8RA 4WZ6A 4G5GA 4XVRA 3LXXA 1L2TA 4DLXA 5B64A 4P0TA 1J8YF 1WQ1R 1EFRA 2P2LA 1PVOA 1GOTA 1U9IC 1E6CA 3SQWA 4DDVA 4DIDA 3SZRA 2IXFA 3QJYA 1HA3A 4ZDIA 2QBYA 2O0HA 3IBGA 4OQMA 5BQ5A 4PAMA 3BFXA 4OK5A 2QP4A 1H8EA 1DVRA 4KVGA 4AC9A 2IS2A 1F2UB 4R2HA 4P4TA 5L8VA 1E1QD 2O8BB 3F8TA 4YLGA 1IXSB 4DLVA 4B35A 1CS4C 3Q5EA 3F5FA 4I1OA 3U5ZB 4LHYA 2D7CA 3T61A 4R7ZA 1NVWQ 2WMOB 2VEDA 1CIPA 1ZUHA 4HLUC 4KVAA 1Z8FA 2J87A 3VR4A 1X1RA 4BFZA 3A1VA 4BE7B 4EPRA 1I4TD 1M34E 1A2KC 2IHBA 5IK2A 1NLZA 3I62A 3OIVA 3UWKA 4HB0A 4DCVA 2PMDA 3CRRA 2AWNA 4OL0A 1K5GA 2JLQA 4BZPA 2BKUA 5G53C 3BH0A 1JR3D 4GZMA 3TLXA 4TZ6A 2YINC 1UM8A 4Q18A 1AN0A 1OW3B 1W49A 4QHYA 5CM8B 3V00A 4C4PA 2ORVA 3TVTA 1NN0A 4US0R 2ZUDA 3GEIA 4KFRA 2IBMA 2ZJ8A 1N5IA 4E5UA 4BFYA 2PL3A 2XAUA 2B8TA 2FSFA 1E0KA 4LSGA 1XU4A 2X77A 1UKVY 4PXAA 4BRUA 2BWJA 4F4CA 2PLFA 1A7JA 2W00A 2YHSA 4PZLA 1U9IA 2CL7X 5FOTA 3TSWA 3S1AA 2IYZA 3OIYA 3OEHA 2N46A 1UF9A 3PJRA 3RS2A 4MGKR 4DSTA 4Z1MA 4TMTA 3FMIA 1B23P 3CWZA 2WJYA 3AVWA 4ZDKA 1PUIA 1CF4A 2IF2A 2FDCA 2VLIA 2WKPA 1LF5A 1XFAA 5FBVB 4RSGA 4TMZA 2QQEA 3FMPB 3NDBB 2DWOA 2FX3A 1NG9A 3KFVA 2ZYVX 5EP4A 1R2QA 3TE6A 4PHHA 1WB9A 3TK1A 2GEUA 2DFLA 1ZMXA 1TQDA 2Q3FA 4WAUA 3KQLA 4TYPA 4QJ3A 2ATXA 5EE0A 2IXGA 2RGXA 3DMDA 4L16A 521PA 5J4VA 4FCTA 1CR2A 4HLUA 3BERA 1HV8A 1K5DA 4FIDA 4D80A 3HU2A 3MAAC 2DR3A 4KU4A 2QSZA 2RKOA 1S9HA 4CGZA 3TH5A 4ABYA 1E79D 3ADCA 4UNNA 3MJHA 2R6AA 4NU0A 4CT5A 3EX7C 1CR4A 3DHWC 4OQLA 3FOZA 1ZU5A 3RC8A 5A0FA 1E2HA 1ZUIA 1Q1BA 1QBKC 2XITA 1R7RA 3QXSA 1NP6A 3BH7A 1W4CA 1ZIOA 1E2KA 3K0FB 1KK3A 2WWWA 1C4OA 2W2VA 2XSZD 4GOKA 1NN3A 4GMDA 3AKEA 4B3GA 1WE2A 4IOMA 3LO5A 2YKGA 4LYHA 1X8KA 4MDFA 3C5CA 2GCPA 4WIAA 4EPWA 2FOLA 2A7QA 3HYRA 1N6HA 1OYWA 2P0EA 4NYJQ 4OHXA 3UATA 2J7KA 3Q5DA 4Q9KA 1CLUA 4QRHA 5LB4A 1CRPA 5HZKA 2O8FA 3CH5A 4EFMA 1S0UA 1Z0AA 4LCBA 1XEXB 1YZKA 3AKYA 1O3YA 3B60A 4JKYA 1NBMA 1OIXA 1YU9A 3FFAA 1R0ZA 3CPEA 4EIWA 4ASUA 4B3DA 1N6NA 3AB3A 2GAAA 1XCMA 3KKNA 1V5WA 1ELOA 1ONBA 1ZM7A 3AUYA 3I73A 3L0OA 4Q19A 1KY2A 4H1UA 1JQJC 2N1BA 3LW7A 4RKFA 1E1RA 2GEVA 3U3JA 1IY2A 1KDTA 3M4YA 4MRPA 3RANA 1UBGA 4OHWA 1MO3A 1P2SA 2EFHB 3BB3A 3B13B 1SVLA 3SS8A 1Z6AA 5LD2B 2JCSA 1ZU4A 2GXAA 4M1YA 2WKRA 4LJ9A 3SNHA 3QKRA 4M1MA 4XWAA 1VG9B 4TMVA 3GLHB 1LB1B 1MABA 2ZRMA 3ADKA 3B1XA 4W7SA 1G8YA 2WSSA 3KUCA 1PZNA 3SDZA 1I4LD 5H68A 3IO3A 3LY5A 1IN5A 1DG1G 1SVMA 4IVRA 2WIAA 1DARA 4NBSA 1GKUB 4JVSB 3GMTA 1T9HA 1X8LA 3MUFA 4Q7LA 3TMKA 4HLCA 4LPSA 3VQTA 4LHXA 1E9FA 3L82B 2WV9A 4LV5B 3GJ3A 2D3WA 1EFRD 2V54A 4LGMA 2BBTA 4F4JA 2A5DA 2RGNC 1VDZA 4LC1A 4UJ5A 4OI1A 4DLSA 3HR8A 5FBWB 2FN4A 4KLNA 5DIFA 4HAUA 2BMEA 2V7QA 2HUPA 1HE1C 1A82A 3NIBA 1KK2A 1R0YA 3JVVA 1W1WA 4GPTA 2OLJA 5F2EA 3SU8A 2QM8A 2VHTA 2JJ2A 2WKQA 4JLKA 3BAFA 1H8ED 4YMWA 1ZNYA 3ECCA 3TJZA 1X6VA 4NH0A 3A4NA 1P2VA 3CO5A 2BCGY 2NO6A 3GJ8A 4TTRA 4MRRA 2ZTSA 5AUPB 3I32A 3KL4A 4QBIA 1AZSC 2HLDA 4O2RA 4XD7D 3KX2A 2OCAA 1GRNA 1KGDA 1OH6A 2X1VA 4RD2A 4XTCS 1SVOA 1FMJA 4NZYA 2OCPA 4M1WA 4B44A 1G3UA 2WIBA 2LKCA 3EZ7A 3LVRE 1HQYE 4QG7A 4IOJA 5IK2D 2DY1A 1SXJB 2YC4C 4A0GA 4AYWA 4G5OA 5L3SB 3VFDA 2Q6TA 4AK9A 2EFGA 4LK2A 2REBA 4LC0A 4NYIQ 4LBVA 1G16A 2ZEJA 1DPFA 3CM0A 3QKTA 3CUEF 4HB2A 1KDOA 1E3MA 1RRPA 3GLIB 1QZXA 3HWSA 4RCZA 5JSZB 2J0SA 3NG1A 5DGXA 1G8PA 4D25A 3AKDA 5D3MA 4LYFA 4MGIR 1G3QA 1SGWA 1OXXK 1KIMA 3CF2A 3QPWA 2ZRBA 3CZQA 4URYR 1KSHA 2W6JA 4RZ3A 2XZLA 3I72A 2QL6A 1KI4A 3R8CA 1KNXA 3QKSB 2RGNA 1FTNA 3SJBA 1G7CA 3MCAA 4MKGA 1MT0A 4Q5IA 4HUQB 1IAQA 1TL7C 3LA6A 3OEHD 4JIMA 2B8WA 3TUJC 1KI6A 3U44B 3R7WA 1NJFA 2IYWA 4Z1MD 2ZI5A 3K09C 2ZS7A 1ZNXA 3VR3A 2NO0A 3A1UA 3T5GA 5JFGA 1XP8A 4LJYA 4ACAA 3LBHA 4IVQA 2QTHA 4EPYA 2XNSA 3BBPA 2AXPA
chains in the Genus database with same CATH superfamily
4NMXB 3EEQA 1RLUA 1RZUA 2XA9A 4I9UA 1E69A 4QECA 4YMIA 1GPMA 1C7IA 4KIFA 4NMHA 4KQ1A 2PGLA 3KAKA 4N9WA 5I8WA 5KYYB 1B1CA 1H85A 3VTKA 1I24A 4G6ZA 3R24A 3VM6A 4CMHA 2C5BA 1T9ZA 3DE3X 3A6DA 3NZEA 1FRVA 2V6FA 4JD5A 4YGXB 1DFIA 3RF7A 1S2GA 2GB4A 4L3VA 1PQYA 2NTEA 1STOA 3QVTA 3VU8A 5K0LA 5DI3B 3MTBA 3Q1LA 1JFFB 2NU7B 1I7PA 1LFDB 2Q2WA 4QRIA 4M0PA 1P4GA 4BFXA 1NC3A 4ZVPA 2VVTA 5FOQA 5KNCH 1NUUA 1U9YA 4CDGA 3NTRA 1SBIA 2QD4A 3DAOA 1SBNE 4UHDA 3IA2A 3RDPA 5NLLA 1N36B 3K0BA 2XGGA 4KQHA 2EJVA 3V3KA 4LF5B 3WLRA 2YN4A 4OP3A 4CHGA 4DPLA 3HM9A 1HORA 2B9VA 1NKSA 3UAVA 3L2OB 5LJLA 2H57A 2IEDA 1XRRA 2ORED 3ANSA 3BZWA 3JVEA 3PYXA 1W5BA 3GGPA 3HKDB 4L9WA 1HYHA 3ZNQA 1ZJ4A 2HPZA 2MYTA 4HQOA 2O3SA 2I1LA 2JD0A 3C8MA 3FNIA 5AKIA 5BO5A 4BE9A 1QSGA 2WAXA 4AFNA 4E2YA 2DOKA 1AO3A 2XUAA 4INZA 2LR0A 2X9QA 2GK4A 3AI7A 4FWBA 4NH4A 3MXTA 4YGYA 4CLRA 1SJ9A 3IAEA 1PR3A 2UZIR 4KAFA 3D8HA 4AZ0A 3IEUA 4FQ5A 4Z9AA 1Y98A 3PNLA 5MFPA 3JD4A 4FZVA 5CNJA 2RJNA 3F78A 2X5NA 2Z3WA 1LY1A 4JOBA 4K1XA 4JZYA 5AT1A 4A27A 4B4WA 4DG5A 2JLXA 1VMIA 1YVDA 1P0MA 3OLWA 4G67A 4IJKA 3NPMA 4OLAA 1YB2A 1ZX1A 2AJCA 3HBNA 1Z0IA 2R48A 2OBMA 5TVGA 3O03A 3ZHUA 1A2OA 1RP7A 2GZMA 5ES4B 4QOJA 2O0KA 5AJWA 5H83A 3ZLUA 4CVNA 1WB6A 4K2HA 1MPTA 2GRAA 3VNUA 4FLFA 4PO9A 3A0UA 5CLJA 2UZ0A 4QPZA 3ZXXA 1E1RD 4YALA 2QS9A 3IP6A 1AQYA 5FBZA 3JQGA 1I7NA 4RY0A 1H2FA 3FWKA 1JHRA 3WAKA 1VI5A 3F6BX 1KJJA 1ORIA 1QP0A 3GA5A 1JXQA 4BQFA 3ED1A 3QEMA 4KC0A 2QRMA 4KK3A 3JQAA 1JAIA 4HJXA 1WMSA 4GW3A 2C0QA 4GMHA 1W46A 3T15A 4IOLA 4L57A 2Z2YA 3RIHA 3K3PA 4FILA 1Y8RA 4YHBA 2QVLA 2AOTB 3MTIA 3OU7A 3PUYA 1FB5A 4IDEA 3EAGA 4I8XA 3QUCA 4V02A 1MTOA 2XWSA 3ETCA 4QLOA 3RTCA 4NE2A 5IDXA 2FEAA 3PX2A 5IHXA 1KWGA 1E6WA 3DLCA 5CFPA 3O8RA 3E3OA 2B9EA 5ILQA 5JQWA 5LWQA 1JG2A 5IVKA 2FF5A 1CJTC 2TYSB 4R0MA 3DEHA 2BE7A 1TEVA 2BEUB 3BAZA 1N8SA 1Z2AA 1CJKC 4P8RA 1JT2A 2AEJA 3C3WA 4DSAA 3M2PA 2HPAA 4UREA 2ZE7A 2ZI9A 3CZRA 4EJSB 4LVOA 1QS0A 3T1YB 4WBNF 4KVFA 1F2TB 4ED9A 5GGXA 3WX0A 4J3FA 1RLTA 3MBKA 1EUYA 1MF7A 4F92B 4BVBA 2H48A 3LX6A 3HKBA 5BWBA 1C80A 2ASVA 4FN4A 3S81A 4XIFA 1QM5A 3PR2B 3TLCA 4DLPA 2M1ZA 1U5BA 1L4GA 3A9UA 4OGFA 4MMYB 5DNCA 1XCBA 2M1XA 4OGGA 1IDOA 3GBPA 1U0JA 4FC7A 4MKFA 1REQB 1SB9A 2H8KA 2VQDA 3HU3A 4HNRA 3BRWA 4II2A 5AK6A 2VYVD 4BMSA 4HDQB 1MIOB 3DP9A 4RZXA 5EKUA 3HYTA 3BPSA 1TK9A 3U3OA 3ITDA 3L9XA 1E3SA 4E88A 5KYXB 4UC0A 3W6PA 1JA1A 4BLOA 1ODFA 2X5KO 2NU8B 2YMQA 1WHTB 5CCEA 5AVZA 4B0PA 3NT4A 2ZRFA 1TK3A 3JZDA 2BGIA 3WGMA 3IBYA 3OP1A 3QJGA 4FJ2A 4NABA 4YLEA 1GPDG 3I2YX 3GZTB 5D5HA 4N3GA 2Z1DA 3O31A 5C37A 3LIIA 4IIJB 4UE3S 5GIPE 3ZD7A 1ZN2A 2AS0A 3AEXA 1YL6A 4NOJA 4CKEA 4KFUA 1EWVA 1LX7A 1ZIPA 3QYFA 1VCOA 1N8TA 5DW0A 3VJKA 1WXGA 4LYAA 4UOEA 1DKNA 1XEXA 4MS4A 3HCPA 1NBIA 4JT9A 5MN5A 1CERA 1XZPA 3PUWA 1QGOA 4ZXPA 4D8YA 1QK4A 4FI3F 4I9FA 3U3KA 4GICA 1JBQA 3E8XA 3LPLA 4I8IA 4KRXA 2YR0A 5KNBA 2HGZA 3EIQA 4PC7A 4QNMA 3EXEA 4PEVA 1OSNA 2Y6VA 3DAYA 3G8AA 1XA4A 4POAA 1AX9A 2W6JD 1M66A 3KOZA 4KN9S 2O1WA 2HEGA 3TR5A 4EG3A 1TW3A 3RASA 3LGSA 5C35A 2C4MA 2A5JA 7REQA 4JWTA 2GXSA 3RUHA 4DSNA 3REQA 1XMSA 3R5KA 4IMPA 4JBNA 4KTVE 3U37A 3IQEA 5B2FA 3AR8A 2PK3A 3S2YA 1H23A 3LFTA 1SXJC 4RE5A 1X0XA 2X7HA 3GDOA 4JODA 2JBWA 1P6UA 1TF5A 2NNWB 2QN3A 4MR7B 5LA6A 3ZEIA 4AJLA 1G5QA 3RUPA 3DQZA 3VR3D 2HBRA 2J31A 5EE9A 1GGMA 3GLHA 3SSMA 5KOIA 3DYVA 3MIIA 3A3OA 2ISSD 4GKAA 3WGGA 1BEUB 2AN3A 2OBXA 3OHMA 5DKFA 5KBYA 1NFQA 3CT4A 1E9CA 5L3ZA 1EUDB 1TIKA 1G3RA 1JH8A 3T12A 1DEHA 4AJ2A 4ER3A 1C7QA 1O87A 5BRJA 4NMMA 1KYQA 2QXUA 5K7SA 1VZ2A 2QTVB 4FNAA 2LW7A 4F7DA 3L7NA 4IBOA 2CVOA 1C4KA 2CMGA 3NIDB 3ER8A 2GAIA 4RD6A 5KHAA 4AUNA 2D6FA 3ONWA 3I04A 3UTCA 4URVR 1AH2A 5K3BA 3TZ6A 3MWYW 1XJ5A 1SCKA 2J30A 4Q3KA 5C7OO 3X1YA 5H82A 1O77A 5BQ3A 3T7JA 4HS9A 1TZJA 4YJHA 2F4VB 2Z83A 3WJAA 5B12A 1P2TA 2P9FA 1SIBE 2WT9A 2OXIA 3VR2A 4ARBA 3T7RA 3ZUGA 4CCSA 4CFYA 2XI4A 4O5OA 3KQTA 1C5KA 1M1YE 1Q0LA 2FLVA 3C43A 1YI8A 3E0QA 4CKBA 4E4RA 1EWYA 3FGNA 2QZPA 4GFDA 4PSAA 2QJRA 4WJKB 5ALZA 1V16A 5UKDA 4CODB 1SKQA 1E2PA 1DCMA 3DYIA 3KDAA 2ZCVA 2V8BA 4FEAA 4MWZA 4XFKA 2R7KA 4PF1A 2UZ1A 1KO5A 4TRMA 5J2TF 2QJWA 1AMUA 3HXOA 2IIVA 3IXLA 5DM1A 4PC1A 2NU9B 4DIUA 3JVUA 4AS3A 1R12A 3CEHA 2Z5VA 2ZPTX 4NQRA 1N34B 1FFAA 2QIPA 3CPJB 4OHRA 2AHOA 1NXOA 2AI3A 5EJ8A 1QVWA 1SXJA 2XUIA 3RJ5A 4C3OB 1N0UA 2L0XA 4CM1A 4MDHA 3INRA 1BA3A 2NYUA 4MVJD 4R2XA 4N1AA 3LUJA 4KIWA 1ESCA 2GH1A 4F3YA 2QUAA 3B7GA 3RJ9A 2BSQA 1FDRA 2FE4A 1BHO1 2GFIA 2DLCX 3TLEA 3Q85A 5F5XA 2OZPA 1NULA 4JCCA 5LSAA 1NVMB 4B2YA 4EG0A 3KR0A 1NVUQ 3WKCA 5AKXA 1RZRD 1QQAA 2C04A 3GVXA 3MRTA 5B1HA 5IMBA 2QMZA 3WHKA 3IMFA 3RV3A 1YAHA 2QLMA 2Z9BA 3O84A 4OF4A 2OXFA 1LVUA 3A4IA 3M1LA 1PJZA 5CYGA 3HVKA 1RPZA 2A9QA 2I80A 3UGQA 4BRSA 4EHFA 2QUKA 5CLQA 5C80A 2C96A 4KN6A 1XRNA 4FW9A 5TQ0B 1P3JA 1NNLA 1R64A 2B82A 4HDCA 4DUPA 4KLRA 4ZGGA 3NHJA 3HADA 1IHYA 4J94A 3RAPR 4Z4CA 2ZRLA 4DILA 4OQQA 4W5TA 1VDMA 2VDOB 3PE6A 5I7VA 4JSTA 4UAJA 2I7XA 2H1FA 1FTYA 3N2KB 2IYLD 4NBWA 4R2WA 4ZRNA 3Q7IA 2WHRA 2H7YA 5LOVA 1DG3A 2DPHA 3KVNA 4PINA 1Q7RA 3SAJA 3CYFA 5G3ZA 2QTZA 4TXLA 4R7GA 1IJFA 1G2PA 3DZHA 4TKVA 5EHZA 2XCRB 1HMPA 4QGHA 5KNDA 3EVFA 4ZCQA 2D74A 2WWGA 3CVVA 1I7DA 1MIHA 4JELA 4GXRA 5EE1A 4PYKA 1KIAA 4FR0A 3G0OA 2FP4B 2YZKA 2WOJA 5JD5A 3WXBA 4EI2A 4WZBE 2PYIA 3I1JA 1J49A 1IEVA 3V9AA 4F6RA 2DT8A 3VKHA 3IH5A 1G6HA 1R8SA 4NE7A 4B3XA 3PFFA 1RYMA 3STVA 4DYDA 1UL1X 4A4DA 1K6XA 3EAQA 2B1JA 1X2EA 4OHFA 2HN9A 5D3KA 2W2NA 4YN3A 1E2JA 5KJEA 1G8FA 3HDTA 4P83A 3WYFA 5AI5A 5EGSA 5IKOA 2X7XA 4LZLA 1X86B 1Z0KA 1X80A 3AG5A 2NWQA 2H1RA 1KKUA 1M7BA 2FUEA 1VA4A 3B6EA 4FMCF 4N5DA 5EQDA 3SF8A 2R6R1 4AT1A 4QOGA 1DOAA 3WTBA 1IM2A 4C7MA 2WINI 3H9QA 3MWDA 2B5OA 4FIZA 3IAXA 1KEZA 1KYZA 4UHHA 5BP7A 1R16A 3LDHA 2NUTB 4DIBA 4WH0A 1A98A 1KEEB 2PLNA 2BR5A 2OM2A 2BFOA 4MS3B 4BNUA 4JA0A 4M0DA 4ZYZA 3B6ZA 2BY4A 4IIVA 4YUZA 4AXBA 4EJMA 1U63A 2Q9BA 1ZC4A 4NYMQ 4Z2AA 3SDBA 4NCBA 4G89A 3ACBA 2I4NA 5FL7D 3VH1A 5FL3A 1UH5A 4FYKA 4QQNA 1HXHA 3BA1A 1YZTA 4G0MA 4HS4A 2ODAA 3IUBA 4RKQA 4B9AA 1S3GA 2R79A 1OCEA 2VUSA 1K4MA 4DBVO 4IHQA 2BI7A 6ADHA 1IHXA 2MYPA 1Q0PA 3E2IA 4POOA 3W7BA 4ZO9A 3UJ9A 3W1EA 4A92A 4RABA 4DZTA 5AM4A 3ILHA 3F98A 4W5OA 3LXRA 1RJWA 1VI2A 1D2AA 1UBRS 3I34X 1JT9A 1V43A 2Q5QA 1KFKB 4XXHA 2QF7A 3K0AA 4YUYA 5FUMA 1V4BA 4FLMA 5DCWA 3R76A 4ZPXA 4YJDA 2ZUEA 1V7PC 2G06A 2IK8A 4UQPA 4W6ZA 1HFEL 1MW8X 2QRQA 1KEPA 1ZSVA 3FF4A 2OD2A 4FXPA 4B48A 2R8RA 1NIPA 1PG0A 1OI2A 2V1UA 2VXYA 1FFYA 3H6KA 4Q16A 3QF4A 1X8XA 2X22A 2HMSA 4XCVA 5KWSA 2W42A 4OX9B 1QV6A 3X1MA 1OXSC 2UZAA 3AFHA 4ZWNA 1II8A 4YQEA 4DUGA 4ZAWA 2BP7B 1UK8A 3B38A 3EASA 1NDQA 4WASA 4WRRA 1KH1A 2AJTA 4M0CA 1BWRA 4Y7CA 3TB6A 1HETA 2XNKA 5DSZA 2E4YA 1P45A 2OFFA 1CZKA 1E59A 3ANMA 3OY7A 5WRFA 4DWOA 2ZBEA 2OZEA 2YHIB 4Q00A 2UUOA 1AS0A 4HWTA 4YMLA 2BGGA 1JWAB 3L8MA 3BEOA 1VLMA 4FFSA 4CG0A 4G0YA 1E2NA 2DQKA 2VSNA 4YJGA 1OX4B 5TMBA 3UOAB 2JLRA 5KPJA 2R6FA 1JSRA 4B40A 2OXRA 4OQNA 9LDBA 2F8SA 2XNDD 4Y0NA 3IBCA 1UBHS 4DNPA 3MPOA 4WNYA 3RLIA 1SKUA 2JFNA 3P2KA 3RE1A 3RO7A 2G17A 1YB6A 4FSXA 1JNXX 4C7OB 6AT1A 3F49S 1H94A 1E0JA 2ERXA 3K20A 1TGVA 1SU6A 3RFFA 4YMSA 1JPNA 3LRPA 5FOXA 3WWPA 1H6BA 1TI7A 2EBFX 1RC8A 1JNYA 2CC2A 5C1BA 1MAWA 3PXCX 1T2CA 4DR1B 3DEZA 2FEOA 3R09A 2HD4A 3G9ZA 5HKKA 3AVXA 3TR0A 2ZYAA 1D2MA 1T24A 1XYGA 2VH1A 1SUSA 2V58A 3CONA 3LPCA 4RIEA 3UXMA 5HUQA 5LN1A 1H3EA 1RRMA 1XWIA 4GWKA 3HCAA 3GQVA 3JALA 3M4ZA 1Z63A 4IV0A 5A3JA 5K3FA 3P4XA 3TNJA 3RVLA 3W2HA 3LXMA 3N2IA 4A2QA 3CVJA 1XZKA 1Y6RA 4MUNA 5EERA 4KR2A 3QOWA 4PYRA 5B4TA 3TKYA 4WKGA 1DCTA 3PLNA 4O4IF 4Q1EA 4CF5A 1XPJA 4YT4A 5IF3A 1XMXA 4R9UC 4YLYA 2HJSA 1MGOA 2JVKA 2OO5C 4OJKA 2BEKA 2PPVA 2GJ4A 2BFNA 2OV2A 4JP5A 4KBFA 3VXKA 2G8NA 2IY9A 3EUEA 2QVCA 3CUUA 5D85A 1W2HA 3FNBA 4KCGA 2GQ0A 1TO1E 4FDTA 2P9GA 4MTCA 5DYGA 3GAFA 3O2NA 4P86A 1DMSA 3DQPA 3GUVA 1EJ6A 5EJ7A 3QF7A 3C4VA 2QXYA 3OJCA 5H1YA 1UWKA 4FHCA 3KPUA 4XB2A 1E0AA 3HDVA 4O63O 4QPJC 5D00A 3FSJX 5I8PA 2OILA 4HWPA 1SQ5A 3I1FA 5EJFA 3DGEC 3L9WA 4E07A 2GEBA 2W8BA 3IUNA 1SCUA 3MCVA 1TAGA 4AS2A 2JIDA 3FNEA 2A5FA 1VL0A 2P9QA 4NFYA 1QNLA 2ZW9A 2DCUA 4I4TB 4CCAA 3FLAA 1PQWA 4V0NA 1XZNA 1YNSA 3O9MA 3GBVA 3KZXA 3KV3O 1KI8A 1PJRA 2OUKA 5EIHA 3IQFA 1J20A 3IP8A 3ORFA 3ZE2B 3A3PA 4K9SA 2D2FA 5KVCA 1TMKA 5DXAA 2XKAA 1BVRA 1SD5A 5JECA 5DP2A 4U2BA 1ZNWA 3HVUA 4EX6A 3OKPA 3U4MA 5EWMA 3P32A 2Q0HA 4HLNA 5BRNA 1F7UA 5JD3A 3SQNA 4RKWA 2AVDA 2I54A 4JS0A 1Z88A 3PCRB 5HCUA 3N7AA 3P0HA 4IZIA 3KZKA 4C1BA 4W5JA 5REQB 4D57A 4BLVA 1C9MA 3DKVA 3QPAA 4GI5A 2XZPA 1QYWA 1K3FA 2RMKA 3B5JA 1NRJB 3LPNA 3KQWA 1C9NA 4YCAA 1XKLA 1HBJA 1IBCA 5J3JA 4GOLD 2J07A 2Z5GA 1EHCA 1YZHA 3HE3A 2O5CA 4LS3A 4ZI5A 4INPA 1RBZA 3DZKA 3D43A 1NVBA 2GUWA 3IURA 2OO5A 4PBTA 1TUBB 3DZBA 7MHTA 2D62A 4DXHA 1EM8B 1EWRA 5FI5A 1EFCA 1MLDA 1IOVA 2VJYA 2VWHA 2I2DA 2YHBA 2ZRIA 4HGQA 4M0MA 4DANA 3VPGA 3O95A 3ZNOA 5JAMA 1NQTA 1C3XA 1QAOA 1OJLA 4BKRA 2VOJA 1VQ1A 3IUYA 4BE4A 3N2NA 4FYPA 2Q99A 2VPZA 4EDFA 5FH9A 3WAGA 3RR2A 4HNHA 1L7MA 4R5HA 4FHFA 2G83A 1KJWA 2FJUA 4CTKA 2P7HA 1I5OA 2P5TB 3BMNA 1DX9A 3T38A 5TY0A 1KO4A 3QXCA 3JAWB 1SAYA 3GEHA 1W36B 3TLAA 1BYIA 1DC3A 2OOSA 2WSBA 5BXYA 3QU9A 4DJFC 1SCQA 2BR4A 1BRMA 1RIIA 4IHJF 3DMFA 1KQ3A 5B58C 2FW8A 4NXMB 3Q8XB 2WJ3A 5EXTA 1XELA 4Q1CA 1DEOA 2Q1SA 4HB3A 1NYQA 2NSJA 5FUQA 3STWA 4UVDA 4U7DA 3ZU5A 2P3OA 1NV8A 1TVKB 2ODPA 1E1CB 4L50A 2XX3A 2J09A 2W6ZA 1BW9A 3O47A 3FE2A 3C39A 1NG1A 3GEEA 4KSBA 4QFMA 2I4MA 4E11A 3LC1O 2ZUSA 5D8DA 4BB6A 5I01A 4NCHA 3EIHA 1OYVA 4LXHA 1W47A 3OE5A 4R98A 5GZ6A 3SIWA 5JS7A 4BYGA 3B82A 1LA2A 3PQFA 3K35A 2I9KA 2VZLA 2X0KA 3ZIUA 2PQ2A 3ZU6A 5G1PA 5CIQA 2C9DA 3FSGD 3PVZA 2R44A 4EKYA 2B7BA 5TQ2A 4OQYA 1WVIA 1BH6A 2HY7A 3ES9A 1NONA 3A1FA 1JKJA 1XZEA 2C2BA 4O4HA 4FZJA 1KDVA 4GOND 4DYVA 3K9QO 1R5BA 2ZRDA 3TGWA 3NHPA 4HYTA 5TNXA 3ZD8A 1CQIA 1P2DA 1V7QA 2GCIA 2Q1XA 2RC5A 3JTMA 3R3WA 3R4VA 4K9NA 1AKRA 3ANXA 4BY9E 1JR3E 3G2HA 2N47A 4RYLA 1F17A 3D4NA 2CBXA 4L8GA 3KAPA 2HEIA 3S7TA 2ZVPX 3VR1A 1NUHA 3HGMA 4FDAA 4NEHB 5FTMA 4KYVA 1KIFA 4P7JA 5CCDA 4A1OA 5JARA 2XYPA 2ZRAA 3TYXA 3Q2IA 4OTZA 2YL2A 3EZGA 2VA8A 3HACA 4RLSA 5ALUA 5IKMA 3DOOA 4EATA 1EFLA 2VH2A 4DREA 4I1VA 2IJGX 4H6WA 4MR9B 1ZJWA 4ROSA 4MQMA 4JFRA 3PFNA 3W8NA 4Q12A 4DXDA 4GBED 1E2UA 1CY4A 5JISA 3CRNA 5F52A 2IBTA 4CLXA 4EKDA 2QX7A 4L8WB 4DQVA 1LI4A 1IMJA 4ZMRA 2VPPA 3N76A 4K9MA 4IX9A 1A9QA 1XO1A 1DBVO 4W8GA 4RNCA 5E9JA 4B2IA 5A6SA 1FVOA 5DV9A 3VKVA 5F9FA 4GOMD 5CH8A 3AERB 3RRJA 4ER7A 2MHCA 2EZUA 4PG5A 1QQTA 1BROA 1VL5A 4RJLA 1Z34A 3LQRA 3MWKA 4PGAA 2IGTA 1FSSA 3GUHA 1DAEA 3DW1X 3IQGX 1NQ5A 1DJPA 5DO9A 4TROA 2IPLA 2A8YA 1SHUX 3JQBC 4OGWA 4MPDA 2Z8YM 1A9PA 1WHSB 5FUVA 1MOSA 4EY7A 3KQVA 2ZYRA 4RDCA 5FV4A 5ITZA 4JXXA 2C8LA 3D5TA 1XQ1A 1XSEA 1KARA 1MENA 4KFCA 4KIUA 4V03A 3HV2A 1ULTA 1F20A 4PRKA 2FG5A 4Z86A 3ELBA 3IDSA 4ND2A 3WLMA 3R41A 2O7RA 4MCIA 4DC1A 1P81A 1Q6YA 3IQWA 5TSDA 2AN5A 2BGTA 1DWUA 2HR1A 2JH3A 4GQIA 1VM6A 1B6RA 3AEUB 4BV9A 4O4JA 2OVBA 4IWNA 4Y2HA 2NTVA 1UP4A 1VYHA 1JI0A 1T2VA 4J0JA 5FTNA 1YNOA 5H9VA 2RCYA 1KSFX 1UFVA 5DHPA 1WTAA 3IELA 5TT1A 2R11A 1BS1A 1WW2A 4HL6A 2WUDA 1T2UA 1MX3A 3A10A 2WA2A 4P3NA 5FOVA 4D0NA 3N75A 3JPWA 1L5OA 5C8YF 3JQ8B 2X6TA 3UYLA 4DA7A 3Q8KA 1AKMA 1AHPA 1O5OA 1FLVA 1I2DA 1R8XA 5JYDA 3D7KA 2HDWA 4LI0A 2WB2A 1Y9DA 3PEVA 4FDMA 1OE0A 5CB4F 4XX0B 5DM2A 2I4LA 4LBYA 4XR9A 5CU7A 3ZBPA 5DXJA 2GPJA 1D6SA 1V11B 2W6NA 4LMBA 4PZZA 3TW4A 3VR5H 4E13A 5DYNA 3MFQA 4GE3A 1JG4A 2CFCA 1UP7A 3UG7A 4ZOQI 3PFHA 2C83A 5LVAA 3KEOA 5K1ZA 1ST3A 1SUPA 3PD0A 3K1AB 4YMTA 2WTUA 2FJ0A 1JIVA 4EHNA 2Y1FA 3COSA 4IEEA 1YVRA 4K46A 4ZRDA 4D6PA 2ZK7A 4A8TA 1Y8ZA 4HMOA 4EB6B 1WXWA 2XDWA 4WESB 2R87A 5DGIA 4ZKEA 4HVCA 3D6TB 2ZUTA 3F96A 4L8VA 4IP0A 2FN9A 2G6BA 1AUOA 1YRLA 3B7PA 5E6RB 3VO1A 5A4AA 2WKWA 3IR7A 1P39A 4JJ6A 4RGBA 2NLOA 5HOQA 1MOPA 2ZULA 3KD3A 4MEAA 3TBKA 3W5DA 2QTTA 2FPWA 4ZCMA 4I3GA 5KVQA 4IJ5A 3ZU4A 3FUXA 3EMVA 3FYUC 3JQBA 2JF0A 1IN1A 1T25A 2FFHA 4JP8A 4HWRA 4TUYA 5GV7A 1ZAKA 3SFZA 3V7WA 1E3EA 3DGFC 3M4NA 1R0WA 1WXEA 3HYSA 4R3UC 1APBA 4N6OA 3AY6A 4BMOB 4OHYA 3KSMA 3GOQA 4NZZA 3DH0A 1ORHA 3O9VA 4MVWA 4Y2QA 3ZZTA 1P80A 1ORVA 4GPD1 5ECWA 5H02A 1X2BA 3PXGA 3SF0A 1LBHA 1WAMA 1PK8A 4YCDA 3A4VA 3IJPA 2JIOA 3CCFA 2ZDHA 1A2BA 3HCDA 3Q72A 3ZX5A 2O2DA 1Z25A 4M0FA 1FX1A 3ZPXA 4BP9A 4LDQA 2C2KA 2F6RA 3GJ5A 1JQ5A 4QDUA 4BEVA 4S05A 4J49A 5I7WA 3IJ5A 3HSSA 3KZNA 2XVAA 2R96A 1QHEA 3IOMA 4BQQA 2JB9A 1JB1A 4LZNA 3ZWOA 1EVLA 2PQ0A 2Q3MA 3QKUA 3I5XA 1X7ZA 1BN7A 2ECFA 4LZWA 3LE8A 2SHKA 4KACA 3HBFA 3JQCA 4PO1A 5CITA 3DHEA 5HMMA 1Q21A 3LHIA 1ZM4A 2UUPA 4EVQA 2FPGA 3HKEA 3KYIB 1CVRA 4MS1A 1UWVA 2LBPA 1GRQA 1RKVA 3W04A 1ZYUA 4ZQEA 3H17A 4HRYA 4I1PA 2VJAA 2IPNA 2HO4A 2R6GA 2RK3A 5JS8A 2ZM6B 4BO3A 3X2SA 1OYOA 4ZOLB 4DA0A 3IP7A 1VPTA 2CDNA 1TEZA 1HUQA 1DRKA 3NVAA 1E2IA 4HQ6A 5A7HA 2JIMA 5DB4A 5CBPA 2QI9F 1OGIA 2MSCB 1YQUA 3R7NA 1D5CA 1O8CA 5LDDC 4KEAA 5C52B 2HU5A 1JHQA 3LNTA 4MAMA 4YJKA 2CHEA 3FYUA 2GCOA 3IVGA 4EG5A 5A9SB 3BEDA 4Q7JB 1VE7A 4NDZA 3ILVA 2YWDA 5J40A 3WBJA 3EIXA 4P53A 4BMNA 1KGSA 1MJNA 3QE2A 4LNUA 3EE6A 4HV4A 2DCMA 2AIRA 4RD3A 2VDKB 3QVUA 1W0JA 2O8FB 3N39C 4GVXA 2X6QA 4ZFNA 4GMXA 4IDHA 1A8UA 2IEZA 1RC1A 4X95A 3ZWAA 5JBQA 1ADCA 3RHSA 2JJ1A 2FU5C 4A6EA 3F6EX 1T1RA 3GWZA 4Y18A 1MA3A 2V0CA 1UMBB 5C8DA 2JG3A 3CNNA 2P65A 4WY2A 4R5MA 2XCSB 1PVVA 3H1GA 2H4HA 2OP1A 3AHIA 3H2GA 3BMQA 4O4LF 1ZGAA 5HCIA 1NVGA 1KWKA 5CURA 1C30A 1XYYA 2HGSA 1P0CA 4OD0A 1GAQA 5TF4A 4B34A 3N5KA 1YQTA 5DN6A 2ECKA 1JVSA 2DH5A 2QP9X 1DRJA 4KRGA 3FCAA 1GV0A 2Q9CA 3AEKA 5T8KC 2Y2UA 5C4MA 3AIIA 2AC2A 4LJAA 4AX8A 2CL6X 4BASA 3OZWA 4DIOA 5C5EA 3D0RA 4HGZA 4G65A 4X1OA 2QAGC 3MPUA 4WZBB 2YUTA 5ITWA 4OJYA 2YJZA 3TQCA 3WLJA 1J99A 5JFTA 3TZEA 1Z56C 3CISA 3N8GA 3G13A 4P32A 2CHGA 2HPVA 1CZRA 2OFOA 3GUUA 4JUCA 4C0BA 1YZLA 2O8CB 1VLZA 3HYCA 4UQOA 2R6CA 5H5JA 2Z5FA 1MX9A 2KMLA 1LDNA 4F1JA 3UK6A 3Q0TA 4ZJUA 2LIVA 4XAQA 1U11A 3G59A 5HS4A 3QMWA 2ANBA 4GEKA 1NBHA 2VRCD 1KAEA 1AU9A 1PVDA 3I39X 4CUZA 2VPIA 5FWXB 2UUCB 2JLWA 1S2LA 4HXFB 4S2EA 4RY9A 4EMTA 2GF9A 2WUVA 3EQ9A 2HXYA 3RFCA 4AF7A 5ARDA 1ODTC 3NOQA 1CB0A 1MKYA 2H11A 5TLSA 3DZDA 3PEEA 2WM9B 2YWEA 4I08A 1LLFA 2JVIA 1O5TA 3MGCA 2X8JA 1IZ7A 4YB8A 4GOJA 5AVOA 2V5UA 8GPBA 4UNRA 2ZSEA 3QPVA 2RJOA 5IKPA 4CM6A 2AF4C 2PT6A 1R5OA 2W8ZA 1CB7A 3UGTA 3KS9A 5CXUA 4NYMR 2Y4NA 2H85A 5GM2A 1VPLA 1NT4A 3K6SA 3PR3A 1YDMA 3KHTA 2VP0A 4TWBA 4YRBA 1I30A 3OQJA 3RRXA 2VJNA 3RKUA 2M6RA 1JS1X 3FVVA 3I01M 4R1PA 3EEBA 2XH8A 4R68A 3A9VA 4MUIA 3ENWA 3TRHA 3ZGVA 2GSWA 5SZIA 1Z7YA 3DYBA 4IQ4A 1YBMA 4RYDA 3BWCA 4HHEA 4C4SA 3SYKA 2DQYA 3C5HA 3MWFA 4IYJA 4MR8B 3UCXA 5JMWA 3BBLA 2AYXA 1OUMA 2PKRA 1IQRA 2TMYA 3CMMA 3N05A 4O2AF 3OT1A 4QL3A 5T8KA 6PFKA 1S89A 4WT7A 4YRAA 4GC9A 3VISA 2LE0A 2FW0A 1E63A 4MRAA 4EG8A 1KZ7B 2KS6A 1UMKA 3EGIA 1D6NA 3HN7A 4EHHA 2QAGA 3UIEA 3AV3A 3P0RA 1YE3A 5ULLA 4AWXA 4BKPA 4ALJA 2YMMA 2HA5A 1EGAA 1WQ4A 2XIJA 1MVNA 3RSFA 1ZSNA 3OQHA 4AECA 5FBQB 2AUMA 4MLDA 2DRIA 1HQCA 1EXDA 4FDVA 8ADHA 4I50F 5AJTA 1QZUA 1GPLA 3UANA 3ZDDA 1OWLA 1ZFNA 1Z6PA 4BZQA 2PUWA 5HPYB 3O26A 1A4XA 3EVAA 2UKDA 2BZ1A 4M37A 4TTAA 4JSYA 2QSUA 3WDMA 2CHQA 3L4JA 3N7TA 4GGPA 3OOHA 3LQ1A 4F84A 3FTPA 3Q8MA 1ADGA 4BQRA 1UZAA 3WV5A 2QD5A 3PIRA 2QV7A 2DFPA 5EUQB 5IN4A 1LJ8A 3RRYA 1PZMA 1ZDMA 2ZUUA 3TCNA 2C7GA 2GYUA 5K8LA 2Q46A 3I4LA 3W77A 4XIYA 4WXHA 1VA5A 2Y27A 1CYEA 3UH1A 1ZSYA 2D4HA 4LJ7A 1OX6A 1YZVA 4JQZA 4Q37A 1T36B 4MUKA 4NJEA 5BR4A 2QDXA 4N41A 4R3NA 2AWOA 3DJFA 3NBYC 3GUYA 1NSFA 3FWYA 3HN6A 5GQSA 3G7UA 3L92A 3HVHA 4KB5A 1AKWA 1NSTA 2ZIXB 1T1IA 3CLUD 4MROA 5FUYA 5T67A 4NBTA 3ZHOA 5EMJA 1Z5UA 2AMYA 3LH5A 3OQ6A 4IF4A 1YJCA 3EAFA 5U1PA 1QP4A 2DPMA 3LHSA 2OXTA 1NDHA 3FIJA 3VR3A 4LK3A 1NI4A 1KI3A 3EMKA 3K8ZA 2GLUA 3ANTA 2EIHA 4PSKA 2ZBDA 3TN7A 1L5QA 1EFHA 5AI4A 3S5UA 1N8NA 3Q3EA 1B6SA 2DH6A 1KH2A 1KSJA 4XOIA 4R16A 3WLQA 5ILOA 4UAVA 3MTDA 2A9JA 1G19A 3OFVA 1IN7A 1WX1A 3LLVA 4P54A 3NVMB 3GUCA 5KU1A 5TXGA 2CKMA 1CV2A 2FCAA 1N7IA 1OREA 2FN7A 2A5GA 3DFIA 3L05A 3LKVA 3GEPA 1W4RA 2D4AA 2JAXA 1KOGA 1W48A 2H1IA 2ZPUA 3PUIA 4YK7A 3FGPA 3QX8A 1Z29A 4NV0A 3KXDA 1N57A 1OFTA 3E18A 2IV2X 5K0CA 1Z26A 4D4KA 3I76A 5BW4A 2FXIA 3QEOA 4ZHQA 1JIKA 1IJEA 1KOLA 1ZD4A 2I6TA 1N2EA 3K8YA 1Z16A 4DIKA 2ZJZA 4FFBB 5ALRA 2EWMA 4O6VA 3X1WA 1AQ6A 2NTNA 1JYFA 2A78A 4KMSA 4ER5A 1JDPA 4ZEMA 3QLUC 3ZDAA 4E2FA 3ODGA 5FLYA 5KOJB 3L0CA 2CJWB 3TTVA 1RWXA 3G2KA 1HDYA 4ARAA 4RWZA 3U7EB 3GW8A 2W11A 3R6TA 4QUBA 3GFSA 5C2JB 1AHHA 1JEQB 3Q9NA 1EVQA 2HCBA 1IEQA 3ZE9A 5GJBA 4WDRA 3U7QB 3L5OA 3ZHZA 1JEDA 5C18A 2IDZA 2NMVA 4CR8A 2V98A 4BTVA 1TAHA 1XNQB 1P2BA 4CRWB 2FKAA 3KQUA 4UU8A 4B3IA 1QYDA 1U9ZA 4JLMA 3AF3A 1XAJA 4CTJA 1Z75A 1BXRB 4JDPA 1DUVG 3VU9B 3FMFA 2V6MA 2XDQB 4S1VA 5A6VA 3M83A 2IY8A 2VQ6A 3RUEA 5K51A 4NAHA 2QLLA 1WCV1 3O7WA 5JPIA 3CG0A 2HPHA 1L5HB 1O94C 5DTQA 3P5SA 2ZTVA 4NATA 3EHEA 5FA5A 1D7OA 4B3MB 3TM4A 3FPFA 3WIOA 4NR0A 1PP4A 3O3NB 4R40A 4OYRA 1TD9A 5FWYB 5HEKA 5AIBA 4DIEA 2EGHA 3A58B 3EF0A 2ID7A 5K0BA 1DEXA 2DTEA 1U8UA 1V8FA 4FKMA 5G0SA 3EW9A 2OWEA 4D9MA 3PPWA 2GZSA 3MJDA 1YAJA 4IL5A 1J0AA 3FYHA 4FEEA 4E4TA 1QE3A 2H1CA 2IPMA 1SHLA 2RHGB 4I36A 1T3SA 1D8TA 1IFXA 4L6IA 1TZKA 5B1DA 3ZZUA 2BGMA 5A4IS 4RULA 3QVKA 1S01A 4IJUA 1PEYA 1ZGCA 2IITA 2VRBA 3A36A 3QV2A 4M76B 4PQEA 3N87A 1GFWA 1GTL1 4Z7JA 5DTIA 3C7AA 3SHFA 3QLUA 1UC4B 1NSYA 3NHRA 3PDHA 1ZOOA 4FFNA 4YJ3B 1SMKA 1E3DA 4KO8A 1TYDE 3BXFA 3L77A 2H2DA 3H11B 3QE3A 1U0EA 1Z0FA 1ZJ6A 1TECE 2JZCA 3ZDYB 2YY6A 1MAUA 3CKKA 1A7UA 1ZBQA 2Q27A 2XA2A 3HI6A 4IKEA 1SEPA 4ZV9A 3UY4A 3DHVA 3W34A 4B3HA 1I6LA 1SOMA 2VHCA 3Q12A 4XIGS 3KYJB 3UN1A 3O4JA 3TVYA 1VPDA 2EEPA 4M6WA 2PX3A 4R8SA 3EIEA 2A3NA 3SXJA 2AUNA 4I5DA 1UOPA 3SIPA 3PTAA 3EPJA 3ZZMA 1XZ8A 2ZRPA 4U7TB 1GCIA 1QGAA 4EY3A 3U1BA 4CL0A 2I1VB 4FJ0A 3WA7A 3I30X 4P34A 4AZTA 3PI7A 1DIBA 2DSTA 2A6PA 1TCUA 2B7CA 3ZVNA