2X2FA

Dynamin 1 gtpase dimer, short axis form
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
347
structure length
336
Chain Sequence
EFSMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYSRVDEMLRMYHALKEALSIIGNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title G Domain Dimerization Controls Dynamin'S Assembly-Stimulated Gtpase Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DYNAMIN-1
total genus 105
structure length 336
sequence length 347
chains with identical sequence D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2x2fA00
1ZINA 2H16A 2YVUA 1H8EA 5DHAA 1E0SA 5K8UA 5KU1A 1GP2A 2FF7A 3LW7A 5FR2A 4QNMA 3QE0A 2XITA 4LYHA 4JLOA 3R20A 2OCBA 3B1XA 2QL6A 2ZUBA 3K0CC 2GA8A 2ZRHA 2OESA 2AXPA 3AH8A 3RNLA 421PA 2MSEB 4A4DA 4I1UA 2OM2A 5HZHA 1N6LA 3GP8A 3N2IA 3V4RA 1Q1QA 4ZDWA 1NN0A 3LV8A 4JKIA 1BMFA 3EIQA 3K0FA 2YHSA 1P62B 2JJ2A 4M1MA 4WIAA 5JSZA 3SQWA 4Q03A 3HR8A 4LOAA 4UQOA 2Z43A 4DDTA 1DO2A 1AQUA 3A4LA 3U3MA 4DHEA 4BWYA 1GKIA 3DKVA 2ZRKA 1E79D 1EFHA 3K9HA 2FA9A 2J1LA 1UBGA 1P7CA 1W4AA 2CCKA 2QNRA 1BOFA 3BB1A 4UKDA 2PCLA 4JLKA 4A82A 3Q5DA 3SNHA 1IJEA 1FL9A 4A92A 1K5GA 4BEJA 2FNAA 4ABYA 3V9PA 1HT2E 4Q1EA 4NMMA 3AUXA 2X2FA 1PJRA 5DI3A 1AGPA 1JBKA 1WDTA 3KJEA 4JL8A 1UKVY 2IYSA 5EQTA 2WVJA 4GZLA 2FSIA 1E2LA 4GNKA 3TJZA 2BBWA 2QI9C 4OQFA 2QSYA 4IOMA 1E2NA 4HUQA 2BMJA 2CJWB 4ARZA 3V4FA 1XWIA 1GL6A 1T3SA 4TQAA 1DAFA 1T5IA 4KYIB 5JJIA 3D7MA 1HTWA 4E5UA 4EUNA 4W5JA 3ZJYA 3MD0A 5HE8A 4PZLA 1Z07A 2GCNA 3CLVA 2AHOA 1FQJA 1Z83A 1ZAKA 1R0WA 1G21E 1VG0B 5HR5A 1SVOA 2G77B 2CLSA 2PX0A 3S1AA 3TNFA 3B2EA 2NO7A 1V5WA 2XXAA 4JKYA 3NHAA 2W00A 1E94E 1VTKA 2HJVA 2QAGB 4FW9A 4HB2A 4Q9JA 3FKSD 4G5SA 3T06B 3ZVRA 1CULC 3A37A 3GLFA 3GLFB 1T3HA 3U6KA 2Z0MA 4XTCS 2XOKA 1KSHA 1VHLA 1ZU5A 2F1IA 3QVUA 4D4KA 4MYHA 1Z6GA 1GRNA 1YRAA 1DAKA 2B92A 1U9IC 4QBIA 1AK2A 5AJYA 1E98A 2IS1A 3OIUA 4V0OA 1TF5A 2D7CA 2CK3A 2H57A 4KLNA 1AN0A 1NY6A 1W44A 3ADBA 4GRAA 3SN6A 4B3BA 1ZM3A 2JIZD 1FP7A 1TF2A 3THXA 4M1KA 3LLUA 3TAHA 5TV2A 4OQMA 2W6ID 5HZKA 1E9FA 4B3XA 1X8LA 3IQXA 3B85A 1M7HA 3CF0A 5E7MA 2HV8A 1PUJA 3HPQA 3ND9A 1GOTA 3CB4A 4RD0A 4G5GA 3CX6A 4K81B 5FUVA 4F38A 3A4NA 4AC9A 1QHIA 2PX3A 3LFUA 4C0BA 4F4JA 4US1R 3WXMA 3QXSA 4V02A 1S1MA 5ELXA 3RRMA 1ESMA 2ZUCA 3I8SA 2FFHA 5FI0B 1IONA 1R8QA 2PEYA 2P3SA 3KB1A 1JB1A 2J0VA 2YWGA 1IOZA 4HLUC 2OG2A 1ZVQA 1VCOA 3PUWA 2BHRA 5KPDA 4V03A 2LWIA 3KUCA 2XSZD 1TQ4A 3NDBB 3OZXA 1R5NA 2EW1A 3CZPA 1A1VA 1U8ZA 1NSFA 1WE2A 4NTZA 4HUTA 4Q19A 2VTKA 1N6IA 1AS0A 4RD2A 4TQUS 2R6AA 4UNSA 1SQ5A 1IXRC 3DDCA 1S3GA 5GVSA 2YOGA 3NDPA 5K8TA 3U7GA 2IL1A 3LRPA 1N6KA 3ZD7A 1J8YF 3RANA 3S1AB 4XWAA 4TMTA 3MJHA 2WTUA 4KI0A 2OSBA 1JQLB 2J45A 2XTNA 2JLUA 1W0KA 4OBEA 5IK2A 4QKQA 5EXTA 4R98A 4MITA 1G7RA 4B35A 5FBRB 5AUNB 2YC2C 3GFPA 3TSOA 4GOJA 3FMOB 3QF7A 4BLRA 1AQYA 2WAYA 2XX3A 3ZQ6A 2WWHA 3QKRB 1FNMA 2OFWA 2IWRA 3TSWA 2G88A 3GFOA 1CF4A 4D25A 1P9WA 1LFDB 2GEVA 1WB9A 3QI2A 1FUUA 4PPFA 2JLYA 1GITA 2B21A 1XDBA 2D74A 2YKGA 1XXHA 1XNJA 3PEYA 3K8YA 5G41A 4TT3D 4LI0A 2DY1A 3U3OA 3ZZ0A 1T8UA 3EIHA 4EKDA 3IPYA 2VHTA 2J87A 2V4ZA 1ZJ6A 1IHUA 2IW3A 4EFMA 3WBKA 2WJJA 3A36A 1M6NA 3HJNA 3QQ5A 5AUPB 3R7WA 2IYWA 2WWIA 2WWYA 3UMSA 3WYFA 3I61A 1OIVA 5AK0A 1KI3A 2JLRA 1XPRA 1LB1B 2ERXA 4DEXA 3H0KA 1C9KA 3HYRA 4S2EA 1T91A 1LS1A 2OE2A 1NRJB 2WZQA 1E1RA 4OQLA 1MO6A 4WAUA 4B6EA 4EPXA 4Q4JB 2GEDA 3TR0A 3LBHA 4DBLC 3W8RA 2VLIA 1KNQA 4L4UA 1KO4A 3VNVA 1NSTA 4NYIQ 2QROA 3EA0A 1NJGA 1SKYB 1G4AE 2X2EA 3T12A 1WBBA 3BXZA 4DVGA 4PAMA 5L3QA 1OJLA 3BFKA 1BMFD 4U5XA 1E2MA 3KL4A 1XB2A 3K0AB 5H68A 4A9AA 4LJ9A 3TW8B 3MSXA 1G4UR 2CL0X 3N5CA 2XTMA 1EFRD 4RVCA 1Z6AA 1YJ5A 1U99A 4XVQA 2G1KA 4LBVA 5FBLB 4EDHA 4A6PA 2FFAA 4XIGS 1R2QA 2AWOA 1N2CE 2ZJ5A 3IO3A 4LWZA 2GXQA 4IDHA 3VHXA 5BQ5A 4ZO4A 3Q8XB 3Q7QA 1IN8A 4DLTA 3NTUA 4MYCA 1QHHA 3G5UA 3KKOA 1KIMA 1VG1A 2FOLA 4P33A 2YOHA 3LNCA 5FTJA 4JJKA 5DE3A 4A6XA 4RKFA 1F2TA 1JEEA 5CDFA 3PVSA 4Q1FA 1GTVA 2ZJ2A 3FDIA 2R6CA 4PPNA 1KNXA 3GLFE 1JXOA 4JLMA 1OFHA 2ZETA 5DN6D 1CEEA 4FCTA 3P4YA 3RVBA 5HCNA 2HT6A 3VTKA 3WP0A 4RKEA 4LY6A 3TBKA 4OHYA 2NPFA 4TMXA 4KFTA 1OHHA 3BE4A 2ZI6A 4UJ3A 2AR7A 3E5HA 2BKUA 1ZYUA 1E4YA 2WSSA 3LWNA 1KKMA 4OI2A 1VCNA 5FPSA 1II9A 1Q22A 4QC2A 1M34E 4GZMA 1XCMA 4IOJA 3RC8A 1Z0DA 5FPTA 2XZOA 1CXZA 2ZR7A 2IT1A 4QHYA 4WOPA 3K09A 3L0IB 2QP9X 3RYTC 4B44A 3BAFA 3FKQA 1P72A 2BKEA 2FPKA 2ZEJA 3NH9A 3BWDD 3PUXA 2HUPA 1U8AA 4II7A 4W7SA 4AKIA 1XJCA 2VYFA 3P1JA 2XOKD 1CR4A 3DEFA 2EYQA 1R10A 3NBZC 2C78A 1TF7A 1VCMA 1NN5A 3C16C 3CRRA 3A1SA 2WPDD 4DLRA 1OYWA 3ZS9A 2DB3A 1YVDA 1ZM2A 2ZYTX 4HLCA 3CWZA 3QF4A 5KSYA 3TGPA 4QJ4A 4OL0A 3RRYA 3SHWA 2D3WA 4MRVA 1NVVQ 3U7HB 2WWFA 3AF4A 1BIFA 3BRWD 3WMGA 2W2VA 4LRWA 4X8HA 2RH5A 1CP2A 2J41A 3U7FB 1H8HD 4RD3A 1G8HA 1U8YA 1XU4A 4PHFA 3QXCA 3VAAA 3CR7A 1EFTA 3KJIA 4MUBA 5BN3A 1E9EA 1PLLA 4LHXA 2FWRA 4GMDA 1CJKC 4GOXA 3X2SA 4DDWA 1G3MA 1CBUA 3NBFA 4QXAA 2ATVA 5FR1A 5FTLA 2XTZA 2OCYC 2GF9A 1JJVA 1MR3F 4Z51A 4PHTA 4TYQA 3QOFA 4ERNA 2BMFA 4HAYA 4KV9A 3I62A 3JVVA 3KJGA 5J4HA 5JCPA 1VYUA 2IHYA 1YR7A 4FMDB 1XF9A 1KK2A 4QGGA 2JATA 5LD2C 3W90A 5UKDA 4A2PA 2FSFA 3CNLA 1Y63A 5AWFC 2PEZA 3B78A 2JGNA 4JMPA 4QBGB 1C1YA 4D80A 2GWHA 4CEJA 2NQ2C 4HEJA 3O8RA 3EPLA 5JECA 1KO7A 2O8BB 1COWA 1SGWA 4GBMA 1CS4C 4TMZA 4C0KA 4X8MA 2XGJA 3AKYA 3P4XA 3EAQA 3ZVNA 2IYUA 5D3MB 2IBMA 2EFCB 1NIPA 2PT5A 3AVXA 4R2HA 2WKRA 2R65A 2WKPA 1W0KD 2QTFA 3CRQA 3K0FB 5J4YA 1OB5A 1TL7C 2QAGC 2IYTA 1ZM7A 4WXPA 2P6UA 4AI6A 1BO6A 1Q0UA 2Q9BA 3MWJA 4M4SA 3ZS8A 1RE0A 2CL7X 1UKEA 3GJ6A 4TLCA 3OF5A 1XXHB 1G5PA 4TQ9A 3FVQA 1Q1BA 4RCZA 1YZNA 3U3JA 1CJUC 2PT7A 4CYMA 4XVRA 4Q4LA 4D2IA 1HURA 2QGNA 3P32A 2GBLA 4JLVA 4G5OA 4EJSB 3TLXA 2OFXA 1X6VA 1ZD1A 1NLFA 1TAGA 4TT3A 2KJQA 5G3ZA 4NE2A 1OH7A 1M1YE 4HATA 4S35A 2HF8A 2EFEB 1E32A 4LUCA 2IXFA 3VR4A 4TYNA 1XMIA 5AUQA 2GBLC 4EPTA 4RFSA 1T6NA 3AVQA 1G18A 1BYIA 1Q57A 2NO6A 4BE7B 1CJTC 1S2MA 5DYIA 1E2KA 2BJVA 1CU1A 1RRFA 2OAP1 3SOPA 1U0HC 1ZUNB 5G53C 1G3QA 5G40A 3KDSE 5FOTA 5IRCD 3AF2A 3IO5A 4D81A 1GNQA 3F5FA 2CDNA 4RZUA 5KDOA 5H70A 2BC9A 2VP9A 3SFVA 2IYQA 5BYKA 1QVAA 2G6BA 2GAOA 2HLDA 5BN4A 5F9HA 5SZIA 1CJMA 2F7SA 3E70C 3L0SA 4EPWA 1NMZA 3NVAA 4DB2A 4BRWA 1ZNXA 2V3CC 4TLEA 4URYR 3X1YA 4K46A 2XAUA 1HY3A 2YWHA 3TUJC 3ZZTA 1E2GA 2F3TA 2R9VA 5K8LA 4CT4B 1QHSA 3B8HA 5FTNA 4TTRA 4DLVA 3THYA 2IUSA 3AM1A 5CK4A 4CVNA 2ZSBA 1G1MA 2ZROA 4BFVA 2J7PD 1OFIA 4O2LA 1PLKA 5JWOA 5JI2E 1SXJC 4DXAA 1QRAA 4JL5A 3TVTA 3T5GA 3GJ3A 4C7OA 2WKQA 5KUTA 1VG8A 4DC9A 5IT5A 5EXXA 2QRZA 4US2R 1TMKA 3ASZA 4C0QC 1G3RA 4OHWA 5KYKA 4PC7A 3VQTA 1E0AA 4LJ8A 4A8JA 3U60B 2ODEA 3ADDA 2WMOB 4GI7A 1JQJC 4M0LA 1LTQA 4CEIA 1OHHD 4Q66C 2C9YA 3A1UA 4NH0A 4HI0E 2QP3A 1OLOA 3KKMA 2NPIA 1OW3B 1T8TA 4OJKA 4MGZR 1WCV1 5L3SB 2GESA 3HWSA 3K0EA 3RSLA 2MSDB 4C0LA 1PZNA 4DRZA 3DM9B 4XD7A 1WQ1R 4N0EA 5E3HA 2ZVQX 4QFMA 4A0RA 4TN1A 1UAAA 1W48A 2OZEA 1B23P 2EU8A 2GJKA 2CNWA 3K53A 5JS7A 4DCSA 2H7VA 4UNQA 4V0NA 4JBXA 4CEHA 2WPDA 2HF9A 1JAIA 3B1VA 3ZLJA 3LY5A 3RS3A 4A0GA 1MKYA 3L0PA 3TAUA 4YMTA 4BFWA 4PZZA 2BM1A 4M1SA 3U4QA 4CT5A 2C04A 3VKGA 1MRNA 1FFHA 1U0JA 2PL3A 3EC2A 4JIMA 2VP6A 1HA3A 3AVVA 1ETUA 1P75A 3BBPA 4B48A 2EWWA 1LF5A 2YC4C 1G6HA 1S9DA 2DWPA 4K8OA 1O87A 2QE7D 3K9LA 3VHLB 3BD9A 1E9CA 3FPAA 4OHZA 3RAPR 1ZIOA 4U7DA 2OEPA 3B1YA 3LVRE 1NJFA 1F3OA 1XPOA 4IHQA 2GNOA 4OJQA 1FP6A 3UKDA 4F4CA 3K09C 1GKUB 1VYTA 4KFRA 4D82A 1G3UA 2C03A 2CCJA 3PUVA 4C4PA 4EPVA 1EK0A 2VA8A 2ATXA 1XEWX 1IQPA 2A5FA 2NGRA 4QBFA 2GXSA 1WRBA 4UXIA 3SU8A 3UMRA 2WWWA 1F2UB 3IKJA 2AWNA 1II8B 5CDFE 2F55A 1II0A 1RW4A 2O8FA 1COWD 1D2EA 1JPJA 1S8FA 1KMHA 4IDQA 1VIAA 3MWKA 2C5LA 4LZZA 5EE5B 3TKLA 3LX8A 2P5TB 5B30A 2DYKA 1U94A 2JCSA 4XWOA 2WIBA 1YR9A 4B47A 5DI3B 4DLSA 4PZYA 2JLZA 1G5RA 1Z8FA 3A8TA 3RS5A 3B9QA 4NCJA 1VYVA 4FMCB 2O0HA 3VX4A 4DT1A 1CIPA 4E22A 3SFZA 2F9LA 5C1BA 1YR6A 3IHLA 3MUFA 5CJ2A 1RIFA 4BUJA 1N0WA 3WMFA 3SQXA 1M74A 4EJSC 1D9XA 2PCJA 1YE8A 4DIEA 1WXQA 4HAWA 2F9MA 1WA5A 4W5HA 1MOZA 2ZI3A 2A7QA 5GVRA 4IFEA 4P4TA 1W36C 2IF0A 2YNMA 2ZSAA 5EP1A 1DEKA 2JJ1D 4ESVA 2UZIR 3QXJA 2XXAB 4B2IA 2D7DA 2F43B 2FGKA 2C9OA 1P73A 3WP1B 3M0EA 2ZSEA 4Q9IA 3M6AA 1WMSA 4HLQB 3J81k 1YZTA 5KNCA 2ZR0A 1TPZA 2R62A 4DSTA 3DVLA 2Q9AA 1SVLA 3OE7A 4MGIR 2WV9A 1P9NA 4DUGD 2JLXA 1OF1A 2CLDX 3NWJA 2CMKA 4FN5A 4NKRA 5E95A 2ZJAA 4HLUA 1AGRA 4GP6A 4QNRA 3BERA 4NP6A 4WZBE 4XH9B 1CTQA 4P3YA 4HAVA 2P6RA 2ODNA 3QEJA 5G3YA 2OXCA 1IY1A 1XD2A 1FUKA 1PUIA 3SI7A 2ZYVX 1N6NA 2TMKA 4IJMA 1XTQA 2G0TA 4BLOA 4TYWA 3VX3A 1K6MA 2X77A 3W34A 5JHGB 1A7JA 5EXPA 2HJGA 5B64A 1R0YA 2CE2X 3LVQE 5FUWA 1SHZA 5AJXA 5HE9A 2VQSA 2GK7A 4FCVA 2IYXA 2GF0A 3AUYA 1KZGB 1RJ9A 2NG1A 4A36A 3AF0A 3AF1A 4G3XA 1Z0IA 3RS4A 2D4HA 4W9MC 5JRJA 5FOXA 3BGWA 1XJQA 1T4GA 1ZM9A 3JZAA 2X1VA 3M1IA 4TSFD 3R8FA 1ZD8A 3X1ZA 2DFTA 4KFUA 3H2YA 4L8GA 1QG4A 4KFSA 1HH4A 2EFGA 1KO1A 2JLQA 4WXRA 1KZ7B 4MYTA 3CNNA 1N5JA 2ONKA 3FHCB 3GLHB 3TW4A 3UXMA 3U4QB 4IFBA 3IQWA 2DWQA 1NKTA 1GSIA 3BH6A 1TEXA 4RFSB 3ZH9B 2GDJA 3BOSA 3P26A 2VO1A 1HV8A 1KK0A 4LDJA 3UATA 4B73A 4A2WA 3U2QA 4DSOA 1SVIA 3KQKA 1E1QA 4MRNA 2BV3A 3AKEA 1EESA 1E2EA 4AYWA 2B8TA 2P67A 5CLQA 4LYAA 4X8OA 2FJUA 1FX0B 1VPLA 2E1RA 1UEJA 4IDPA 1XCPA 3ECCA 3ASYA 2OILA 3CO5A 3GJ7A 3MJRA 3QBTA 3WYGA 3QPWA 1DS6A 1D8TA 2RGCA 1OXUA 1NNEA 1E96A 1N0UA 4GOKA 1P4SA 4CF7A 2ZRAA 1L4YA 3FFBA 4M9QA 1JI0A 1UFQA 2VSXA 1IAQA 4LPKA 3RS2A 2CCGA 2CBZA 3R9WA 1IN6A 1G64A 4M1TA 4BFXA 1E99A 1ZCAA 3U3KA 4ZI2A 1C4OA 4M1WA 4Q18A 3SZRA 1RRPA 3AQ4A 1JNYA 2IUTA 1HEIA 3HPRA 4XD7D 5JWHA 2WMNB 3UG7A 4TTQA 5DH9A 5F98A 3V00A 1BKDR 3BFVA 4P4UA 1A2BA 5CYOA 3PENA 3RC3A 4WA7A 5DYGA 4QG7A 2ZE5A 5FH9A 4TMWA 1KJYA 2V9PA 4I1VA 2AXNA 3W5IA 4PSAA 2KE5A 3EX7C 2XB2A 1W5SA 4Q4AA 2GZHA 3U7EB 2ZS8A 1SVWA 3IIJA 1FQKA 1W4BA 4ACAA 1E2FA 2QPOA 5HKKD 4HDCA 5FPHA 1EXMA 3OFNA 2WJHA 4MDEA 2QT0A 1N0VC 4BZXA 4PO8A 2NIPA 2BBOA 3NC0C 2D06A 3M4YA 3DMDA 2W0SA 3IBGA 3MG9A 4Q4HB 2J46A 2Z5FA 4PPGA 1EWRA 1OH5A 2GVDC 2FU5C 4L5BA 2GHIA 4V0LA 1QF9A 4AD8A 4MA4A 3F3YA 3MWLA 1Z28A 5EXSA 1U81A 4Q4HA 2QP4A 3I5YA 2XB4A 2W58A 3EG5A 2AKYA 3B60A 5KTYA 2GETA 2ERYA 4YXWD 1R0ZA 2YOFA 4MDFA 1NBMD 3TUIC 1UKZA 1HYQA 2ZI9A 4E03A 5ANRB 4JS0A 3A1WA 3AVOA 1MABA 5BN5A 1VMAA 4RD1A 3W5JA 3CPHA 1NG9A 2J0SA 1XTKA 5L3QB 1L8QA 5EP4A 1OFUX 3QPUA 2RGEA 1E69A 2H92A 4KU4A 1S4QA 3GLGB 2ZYUX 4LJ4A 3NC1C 4HZUA 1T5LA 2O8DA 4JT4A 4B33A 1NVVR 3C15C 2FFBA 2IYZA 1DAEA 3K0SA 2RMKA 3L82B 3LAWA 5GJWC 3IEVA 2A5JA 3X1XA 3QXHA 4ON9A 5P21A 1Q1ZA 1V43A 6Q21A 1NI3A 2KBEA 1W2HA 2WJVA 2IX3A 3GLIB 3ADKA 4PC2A 5FOUA 3MCAA 5TXGA 2QAJA 4PHGA 2CVHA 1GUAA 1JALA 5TDHA 3RLFA 3FB4A 1S1CA 1Y3AA 2EFHB 1SXJB 1BS1A 3PUZA 4FI3C 4QJ5A 3SHFA 3DZ8A 2OCPA 3AB3A 2H1LA 2PMKA 2HYIC 1JXMA 5DISB 1E4VA 1ONBA 2CXXA 2JJ1A 2LCFA 1JR3E 1Q1EA 1IXSB 2WJIA 1GZSA 2RGAA 1U98A 5L3RA 3MFYA 621PA 3AGQA 4P4SA 3WYAA 4ZIRA 3KKNA 1IBRA 3QIAA 1YQTA 4NCKA 1NY5A 1T0HB 2CL6X 3T1OA 2PBRA 1SXJD 4IKEA 4TLDA 2JDIA 1MT0A 5J5CA 2GXUA 3CW2A 3REGA 4BRUA 3Q7PA 4XVUA 2N42A 2ODWA 3KFVA 1JEDA 1OT3A 2REOA 3D6TB 2J59A 3QSYA 2O8EA 5CYPA 1W36B 3WNDA 4Q1DA 4KO8A 1P3JA 1AM4D 2YWFA 4KSBA 1KO8A 4OHVA 1IN5A 4D4LA 3P27A 1G7CA 4NCHA 1UEIA 2F3RA 3SDZA 2ORVA 2O5VA 1KI4A 1MRSA 1I2MA 4DIDA 2QA5A 2IYLD 4RFVA 1VIYA 1G7SA 5L3SA 4M9SA 4AYTA 5JHHB 1ZRHA 121PA 3LQQA 4Q9KA 5EZ5A 4OKSA 2IYYA 4IDOA 2CE7A 1UPTA 3UIEA 1P5ZB 2GILA 1TADA 2FSGA 3EW9A 2RHDA 2ZYWX 2P0EA 3PITA 5BWMA 3FMIA 3HDTA 2ZE7A 1D6JA 4A0HA 2FMXA 4TZ0A 2W6JD 4GDFA 5B57C 4B6FA 1E9AA 5KNBA 3GCGA 4Z8XA 4UXJA 1GVNB 1RYFA 3NHBA 4OI1A 1AJEA 3G82C 3KX2A 5KSOA 1CJVC 4C7OB 3A58B 3NEJA 2IHBA 2MMGA 3FGNA 4C0SA 4C2UA 1NVUQ 3VKHA 3C7KA 3GPLA 2FEMA 3K0CA 1YZQA 2F1HA 4JVMA 2PLFA 3IGFA 1OKKA 2ZRFA 4GT1A 5CM9C 1H8ED 1KTVA 3VFDA 4Q47A 3C14C 2YV5A 4QOSA 2A5YB 4LGMA 3OIYA 1G8FA 1LY1A 1GRQA 5FBWB 1QVRA 1KJZA 3KXLA 4DB4A 4FD2A 3EPJA 1CRQA 4AKGA 2IXEA 3I5XA 5C2JB 5DSZA 2BJWA 3K9GA 4DZZA 4MQBA 4WZ6A 4CW7A 3I72A 4LV8B 3VR5A 4Q1AA 3QPVA 3SBDA 4LHVA 1GL7A 1LV7A 1W5TA 2QAGA 3WNBA 4YMUA 5FL7A 2WWGA 2HYDA 4KHZA 2QQ0A 2FE4A 4IW3B 1G19A 2Z6VA 1GNRA 4JLJA 4QRHA 2ZRBA 1F6BA 1EFCA 3X1WA 5FPKA 1N6HA 1KDPA 3QXXA 5GADl 1J70A 3THXB 4LYJA 4F7WA 4XJXA 1DO0A 2BOVA 2ZREA 4YLGA 1MO4A 1NG1A 2V54A 4HLDA 1KMHB 1QBKC 4LHZA 2LKCA 5LDDC 3W6NA 3GLHA 4DKXA 1KK3A 3F8TA 3E1SA 1TX4B 2G83A 2ECKA 1XMJA 3DL0A 4F92B 1XX6A 4M1YA 2ZRCA 4Q1CA 4EJSA 3GJ8A 4NDZA 4BLQA 3LO5A 1XP8A 1W46A 1N5IA 3KTAB 2JAQA 4X8LA 2HCJB 1JR6A 4NPHA 3Q3JB 2QY9A 2H5EA 2IS2A 2XJ4A 4LCBA 521PA 2G3YA 1PV4A 2SHKA 1VKJA 3OFND 1RZ3A 4JJZA 3TMKA 5CIQA 3BS4A 4DWJA 4HB0A 5BW8A 4U00A 2GJSA 3ZIAD 1Z0AA 1SULA 3PEVA 3GEHA 3I92A 2REBA 3FKSA 5CLLA 4PO1A 2FX3A 1OXVA 1A4RA 1Q3TA 1X8JA 2ODBA 4AY2A 3TH5A 3LA6A 5FTMA 3KFXA 2ZANA 2DPXA 2QGZA 4BLPA 5JSZB 1KI6B 2Q6TA 3BFXA 3RDPA 3B6EA 4YONB 4A8JC 4PC3A 1Z2CA 3AP3A 3QKTA 4YXWA 1XFAA 2WHXA 3PR1A 1SKYE 1W4CA 1X3SA 1KOFA 4UNPA 2ZU6A 2QMHA 1UDXA 4AYXA 1OFTA 1KI6A 1RFLA 4O2RA 4JT2A 4B74A 2FG5A 4Q5IA 4R71A 4O0MA 2CHQA 2X19A 1G16A 3ADCA 2ZRLA 3A4MA 3ZVMA 4OHXA 1Z6TA 1OSNA 2ZSFA 4QM7A 1R8SA 4M21A 4M53A 1Z0JA 2Z83A 1BYUA 3A1VA 3GJ0A 1NVWQ 3WRXC 1G3IA 3BH0A 5DLQC 1ODFA 1QHHB 3O47A 4HYYA 3EPKA 5IHPA 2GRJA 4XSHA 2ANBA 3PG5A 4ZCLA 3T1VA 3JVUA 2JIZA 4JVLA 4PTLA 3EASA 1Z08A 2YJTD 3UG6A 2FPLA 1W0JD 3I8XA 2QMOA 1N6PA 2Q3HA 2W2TA 4LJ7A 3LLMA 3I1FA 3QKSB 4JYCA 1MH1A 1Z0KA 4IOKA 5CB8A 5JCZA 4CEIB 4LHYA 4ACBA 4QM6A 3LBIA 3TIFA 1N5KA 4V0KA 1DAGA 2GJ8A 3NEYA 4U02A 5HCIA 3BIFA 2RGXA 4EAQA 1VDZA 1KDOA 5J40A 4MRRA 3IBYA 4L9WA 5AJVB 3H4MA 3IIMA 2R8RA 4PQFA 2ZIAA 4C0JA 4DDVA 1XCGB 3K70B 1I4DD 3GJXC 1RKBA 4PANA 1DVRA 3CIOA 2FH5B 5IK2D 1TU3A 3IDQA 5F9FA 2V6IA 3WRYC 5BXQC 4RSGA 2RCNA 1PVOA 1T3LA 3SYLA 3KXKA 5DNYB 1UF9A 5EE1A 3I3SR 1TQ2A 4PR0A 3RS7A 5D3QA 3U44A 2ZRPA 1IN7A 3R8CA 1HE1C 2P5SA 1QDEA 1T0JB 2Z4RA 2ZRGA 3RWMB 2ZM5A 4B2PA 2QRNA 2GCPA 4KBFA 5SZHB 1DG3A 2QU8A 2Z4SA 4LPSA 1JJ7A 2PLRA 1E6CA 4AKEA 4NL4H 2ZQ5A 4P31A 4NCIA 5TARA 3QKRA 2WAXA 3HR7A 5C4MA 4KBGA 2GVZC 1E9BA 3BB3A 5E7JA 1US8A 3FFAA 1GM5A 2NMVA 2PZFA 1Z6XA 5CK5A 3IPXA 5KDLA 1JAHA 4B34A 1OXTA 3H86A 4LJ5A 1Q20A 3MLEA 1NVXQ 3B13B 4DEYA 3VU9A 2PJZA 1ZMXA 1KSJA 1E3MA 1E0JA 4DLWA 1IJFA 2WICA 4FXPA 3RHFA 3AP2A 5LB2A 4M22A 1UBFA 4Q4JA 5LD2B 1YHNA 2HT1A 1MO3A 3AVPA 4PHHA 1NP6A 2K5UA 3KQUA 4C0HA 3HU3A 3QNUA 2V1UA 2Y8EA 3AEZA 4Z1MD 2BMDA 3MRSA 2GXAA 2ZAMA 1DELA 3C41J 1OKKD 3KXIA 2I1QA 1W2GA 3AGPA 4EPYA 4BLTA 1U9IA 3FOZA 3KQNA 3EWAA 1AZSC 4WW0A 4B76A 2C96A 2CLCX 4POAA 1E1RD 4FWTA 4EQ6B 4PSVA 1KDRA 2HXYA 3LXRA 1AZTA 1Z6YA 2ZJYA 3ZVLA 3PIRA 3TQCA 2JA1A 2MMCA 1IXZA 3MAAC 2FZLA 4GMXA 2X8AA 5FL7D 4XWKA 3BC1A 2GAAA 1BH2A 5FPYA 1P6XA 3PCRB 2E9SA 3EXAA 1E2PA 3EC1A 3LXXA 4I1OA 4UJ5A 3VR3A 3VR6A 1GL9B 2P65A 3GLGE 1HUQA 3CWQA 3HU1A 4RD4A 2QENA 1YZLA 4EPRA 4FCWA 4JVSB 4TYPA 3U61B 2GZDA 3DO6A 2CEAA 5DIFA 1EFRA 3L2OB 1W36D 2DWOA 1GNPA 2NO0A 1J99A 1KSGA 1RRGA 3NG1A 4URZR 2ZJZA 3OEHD 3EZFA 1D2NA 3ZYCA 1XXHE 4IXMA 2QQEA 4CEHB 4WBSA 4BQSA 2OV2A 2ZJBA 4KCGA 4EFLA 2Q9CA 3QUSA 4Q02A 1WBDA 1GAJA 2NZ8A 5FL3A 2W2XA 1YZKA 5SZJA 5JEEA 3DKPA 3SS8A 5GJVC 4HZIA 2RGGA 2RKOA 3HYTA 1RPZA 2QMUA 5DI9A 2Q0HA 4QHSA 5AR1A 1QHGA 3OIVA 1E0KA 1F2TB 4GSYA 4YDSA 1VECA 1S0UA 4A15A 3CF6R 3C5HA 5FOVA 1CR0A 5FBVB 1NN1A 3B7GA 5DN6A 3ZIAA 4F93B 4GP7A 1IM2A 4PSKA 2VIIA 2AK2A 4CZ2A 4TMVA 4D0GA 5JWRA 1VG9B 1R4AA 4O25A 2QPAA 1XEWY 8OHMA 3PJRA 2AN9A 4MKGA 2WSSD 4MH0R 4B32A 3QEOA 2IS6A 3TQFA 1P2TA 4PAOA 3NXSA 4E09A 2YYZA 1KJWA 4ZCIA 1RRCA 1YKSA 3L0OA 3OIWA 3HP1A 2R2AA 1F5NA 4ASUA 2A2ZA 2V7QA 1AS2A 3LDAA 3WY9A 2FEOA 3JZMA 1NF3A 3O8DA 1GFIA 4KYUA 2RHMA 1XTRA 3ND8A 1XEXB 1Z2AA 2LKDA 3GJ5A 3PEUA 2NTYC 1LF0A 1P2SA 1XMVA 4L9SA 1ZIPA 2WJYA 4ZV4A 3GFTA 2EFDB 2H8KA 3CR8A 3OESA 3QG5A 2OUKA 5KSPA 1DG1G 4TLBA 4R9UC 1A82A 4TLAA 1X1SA 4PFSA 4JLNA 4FIDA 3A6PC 3GQBA 1FNNA 3OHMA 1TUEA 2ZRMA 4JSYA 3ICQB 5KNDA 2A30A 3CPJB 4TMKA 3WHLA 2NOAA 5DHFA 3VNUA 1Z5ZA 5C46F 4HAZA 4DLZA 1I4TD 4MKIA 2QM8A 3THWB 2XNDA 1H8HA 2Q21A 4QJ3A 5KOYA 4TL7A 4OK3A 1W0JA 1U0LA 4PXAA 2OFOA 2ZI7A 3KTAA 1ZP6A 2IUUA 4V0ME 3EA5A 1NMXA 1Z47A 2BWJA 5CIWA 1FTNA 1SKQA 3CH4B 2D2FA 3THWA 4V0MA 1OH8A 1ELOA 1HT1E 3QKUA 3R7WB 2V55B 5HTKA 2VHUA 3OAAD 4LBWA 3ETLA 5GJBA 3CM0A 1OYYA 3EWSA 2FN4A 3U5ZB 1TTTA 3CBQA 4OI0A 1NIJA 1OV4A 3DM5A 4Q00A 4B3FX 4ZDIA 3CX8A 5IF9A 1FX0A 1TU4A 2ZI5A 2ZPTX 2GJ9A 2PZGA 2VSFA 3CH5A 5M04A 3SR0A 4BPBA 2UKDA 1TQDA 1E2JA 3BK7A 3KJHA 5IDVA 1J2JA 4LBZA 5JMTA 2HEIA 4H9GA 3PV0A 1JR3D 4KSCA 1TNDA 2O0KA 3AF3A 1GILA 3F0TA 4C9BA 1OXSC 4PO9A 4LJYA 2ONJA 5EUMA 3TK1A 3CPEA 3W9YA 1XEXA 2A78A 4ZDJA 3Q85A 2QUZA 3C8UA 2CHVA 3NH6A 1DADA 4HAXA 3SYKA 1XPUA 1NBME 1NKSA 1W4RA 4TWZA 5FUXA 3T61A 1Z0FA 3DOFA 2C77A 1KGDA 4DSNA 721PA 3I4LA 3VKWA 3AKCA 2I4IA 4D0LB 1YR8A 1W7AA 2QEQA 1CKEA 2FSHA 3NBYC 4DSUA 1TUIA 2IEZA 2VHJA 3N70A 3ZDQA 5EJEA 4MYUA 4PX9A 1G291 5B58C 4ZPXA 2C9CA 1AKEA 1S9HA 2BMEA 2JEOA 4G1UC 4TZ6A 2OAQ1 4RD6A 4D4MA 4A2QA 1VHTA 2ZJOA 2O52A 3UWKA 3OEED 4XSGA 4C0AC 1N6RA 3NBXX 4JLPA 5EZ6B 1XD8A 1OH6A 3CX7A 1FMJA 4OK5A 1J8MF 2ASEA 1P2VA 4NYMR 4KVAA 3W6PA 3GMTA 4DLUA 3EZ7A 2AKAB 1XTJA 2ZJ8A 2XZLA 4NYJQ 3R9XA 4PAQA 1ZCBA 2OLJA 2ZXUA 2J0UB 3KKQA 5K8IA 4O3MA 1KAGA 1KI7A 4LJ6A 4DLXA 5AUOB 3CKLA 2AFIE 1KI1A 4Z1MA 1R7RA 2GCOA 4IVRA 1AS3A 4PQRA 4AG6A 1R5BA 1SVSA 1X8KA 5H1YA 2IEYA 4JSTA 1E9SA 1OIXA 1FPMA 2WM9B 5EE0A 1G8PA 1ZC4A 1P60A 1DTSA 4XTRA 4B43A 2XNSA 5KPJA 4FMCF 2AX4A 2H18A 1G7TA 5TVKA 5EP3A 5CJPA 3LD9A 4Q7JB 2ZR9A 4YMSA 2HLDD 3SJBA 2KBFA 2AFHE 3FMPB 1WF3A 2J7PA 4XOIA 1G5TA 1UJ2A 1S3SA 3AV0B 3R9IA 3WNCA 3CRVA 2VP0A 3FHTA 2D2EA 3EZ9A 1ZNZA 2VP4A 3Q72A 3ZQJA 2J0QA 3L8YA 3OEHA 4G0NA 2NZJA 1GDDA 1NN3A 5L3VA 3UPUA 1W49A 4ESHA 2PZEA 3O8BA 4PC6A 3FHOA 2FFQA 4LJAA 1QG2A 2QPTA 3O8CA 4MGKR 1D9ZA 1AKYA 1GKYA 1SVKA 1N6OA 2IWHA 2ZAOA 2C99A 3ZZUA 2OBNA 1K8RA 2AL7A 2RB4A 2ZITA 4RJLA 1P2UA 2O8EB 2BIFA 2FGJA 3Q5EA 2HXSA 4US0R 1QHYA 1UDWA 3T34A 3UMFA 1YRBA 5EP2A 1U2RA 1DBSA 4ITRC 3GEIA 3PQCA 5E7IA 2QTVB 4D6PA 5JBQA 2GCOB 4FMBB 2O8CA 3CONA 4D0NA 1U90A 5F3WB 1EX7A 4NYIR 3DMNA 4B71A 2REXB 1EWQA 2O8DB 4OQXA 3FMFA 3LX5A 3TUZC 5JRZA 1MO5A 3QBVA 4NBSA 4JVNA 3IILA 2G1JA 1KI2A 2GK6A 3PFIA 2VBCA 1MV5A 1XTSA 4BFUA 1MABB 1ZU4A 4KAXA 4M8NE 3U3RA 2V1XA 5GJCA 2DCUA 1KY3A 2V7QD 4ASUD 3MWYW 4ZKDA 5TB5A 3EPHA 4OK6A 2FV8A 5KO2A 5LBIA 3C4JA 5J4LA 2DFNA 4JL6A 1AIPA 2J5XA 1P61B 1RYHA 2QORA 1W1WA 2CNWD 3C5CA 5JFGA 4TL6A 3ZGXA 4NU0A 5FFMA 4RY2A 2C2HA 5L8VA 2QM7A 1G20E 4KODA 4DT1B 1GIAA 3GLIE 5JJLA 1XZPA 1TEVA 4QL3A 4H1UA 2PJRA 2O0JA 1ZD9A 5TY0A 3GLHE 3SJCA 2D62A 2OT3B 4CIDA 4C2TA 3FTQA 1FTSA 2QZ4A 4IRUB 1IN4A 4A8JB 1UADA 2JLWA 2C98A 1XMSA 2WIAA 2XZPA 4CEJB 2XNDD 4CDGA 2DHRA 4KJZA 1H65A 3VR1A 4BFYA 3MMPA 3UK6A 4B3CA 4QGAA 5LB4A 2VF8A 1P9RA 2QE7A 1G9XA 4TTPA 1XJ0A 1QHXA 2W83A 4Q1BA 4YMWA 2BCJQ 3K9NA 1ZBDA 4P4SB 1DPFA 2Q3FA 2JJ8A 4BECA 1KAOA 2ZE8A 4C3ZA 2QN6A 4PC1A 3DOEA 3OAAA 3QENA 1DARA 4NONA 1E9DA 2WOOA 4H1VA 1OB2A 4LC1A 1DAHA 4P32A 4UNRA 4TL8A 3CRMA 1KDTA 3TE6A 5BYJA 2B7BA 3KQHA 4EQ6A 2DR3A 4KXFB 1CLUA 2XJ9A 2ZE6A 3KZ1E 2RAPA 1XRJA 2OBMA 5SZKB 3LBNA 5A5GA 1XBTA 4MGYR 2JLSA 2VL7A 4JBWA 5B2ZA 5CITA 3IEUA 3B82A 2VPPA 3KKPA 1JR3A 2QTHA 5EE9A 4EIWA 4M9ZA 5J47A 3GD7A 4WZAE 1SVMA 3GLGA 3KQLA 2J3EA 3IHWA 1GG2A 1EX6A 3WBJA 4P0TA 3DZDA 5AJWA 3CZQA 1Q21A 2GEUA 2EVWX 1LS6A 4Q01A 2ZRJA 5A4JA 4OI4A 1HQCA 4AWXA 3THYB 4W5WA 4N1AA 2OCAA 2C8VA 2J7KA 3BORA 4HB3A 3AVWA 3ONWA 2RGNC 2ANCA 4N3NA 1LW7A 1N5LA 4I99A 4YC7A 5FOSA 2R6GA 5J4VA 1ZUIA 4ZCMA 3BH7A 5KHOC 4JLBA 2W0MA 1JPNA 1UKYA 4D4JA 4DUGA 3OEEA 4Q48A 1G8GA 2F1RA 1DAMA 3D3QA 1EG7A 3THOA 5KSZA 3CUEF 5J4KA 3WHKA 5C4GB 4B3GA 4G5RA 2I3BA 4M1OA 2G0NA 2UVQA 2HDNB 1OIWA 1SZPA 3CF2A 3OE7D 4IXNA 1WP9A 2BDTA 4TYYA 4Y0AA 4J0QA 1QHNA 4LBYA 3RS0A 5H8WA 3D8BA 4HDOB 4DCTA 2KI5A 1I2DA 1XD9A 4Y0VA 1R5OA 4Q21A 1E2HA 1RJ9B 1OXXK 2ORWA 2FDCA 2VF7A 1CR1A 4I4LA 4RZXA 1FMLA 2NO9A 1F2UA 3WMEA 1UBCA 4M2LA 3G0HA 1PLJA 3NIBA 2DFLA 2MSCB 3RSOA 1KYIA 1ZM4A 1DE0A 2OO7A 1M8PA 2ZRDA 3CNOA 4AG5A 3GLIA 2QBYB 2IS4A 4BEBA 3QF4B 4IEIA 3LW8A 2ZUDA 1US8B 4IDNA 1EGAA 2ZS9A 1GWNA 1IY0A 4URVR 4LSGA 3SE0A 1UBEA 3UANA 3BB4A 1R6BX 2L0XA 3DPUA 4E07A 2OBLA 4L16A 2IYRA 4KLZA 3N2EA 4TSFA 2F43A 2KSQA 4UXHA 3PEWA 1SXJE 5JI3E 5CM8B 2KB0A 4NCNA 2DFKB 1M7BA 2G9NA 2N1BA 1QZXA 3B9PA 5F2EA 1O3YA 4LHWA 4L15A 3QY0A 2VSOA 4GL2A 2YWEA 4DJTA 3SJAA 2O8CB 2BM0A 1YZGA 4LYFA 1GRRA 4JZKA 1IY2A 4G5QA 4NYMQ 1ZUHA 4I1SA 4MRSA 3TSZA 1CR2A 2OLKA 1E1QD 2GZAA 2C95A 2A9KA 2V8OA 4NHOA 4NYJR 4PPQA 3K70D 3B1WA 2OXRA 1Z63A 1HE8B 1J90A 2JJ2D 4PQYA 2RGDA 2BBSA 1HQYE 4QGHA 5TMPA 4LC0A 1A2KC 5FI1B 2O8BA 5CB6A 4ZKEA 2R6FA 3D31A 4R2IA 1E79A 4BLSA 2FZ4A 2F6RA 4WVFA 5C18A 1K5DA 3L43A 4G01B 3IIKA 4UNNA 4JYBA 4FINA 4GFDA 3REFA 4A1FA 4BFTA 4HAUA 2O8FB 4RZ2A 1M2OB 1E9RA 3P20A 2WBLC 3TR5A 2IF2A 4HDQB 2B6HA 2ZS7A 2F1JA 5HPYB 4LV6A 5AJZA 1KI9A 2VEDA 1OE0A 1B0UA 5EE3A 5HKKA 1ANKA 1G8YA 1X1RA 3VU9B 1KO5A 4Z54A 3EIEA 4F91B 4YQFA 3TVDA 1KHTA 3T15A 5JZVA 3K1JA 3W3AA 4C30A 2ZI4A 3TRFA 1Z3IX 2GJAA 2RGNA 2ZTSA 4JLAA 5EUQB 4AK9A 2B7CA 2DBYA 2BCGY 1I4LD 4IVPA 4B2LA 1KMQA 2ZRNA 3H84A 4Q4AB 1LVGA 1N25A 3VR2A 1J7KA 4DDUA 2YZ2A 821PA 4KVGA 1M7GA 4JBYA 4FMDF 4ARZB 3RWOA 3AP1A 3SJZA 4DCNA 2QG6A 1G41A 1SHKA 1X86B 3W3ZB 3DHWC 4BFZA 3T5DA 3U6BA 3MGCA 3X1DA 4LV5B 2AD5A 1ZC3A 4LK2A 4MUAA 2A3RA 2KWIA 3FWYA 2YINC 3CRW1 4BASA 3EZ2A 2IK8A 1UM8A 3T1QA 4URXR 3Q9LA 2VH5R 4FWIB 4Q9LA 3I73A 1DOAA 2FPMA 4CRWB 4R7ZA 2EYUA 4IEEA 4LX0A 5DGXA 4ZDKA 5JJKA 1NBMA 2CHGA 3B5JA 1ZNYA 3VMFA 3T1TA 2CK3D 1FZQA 1RVDA 1YU9A 3FE2A 5A0FA 2PH1A 4QHTA 1TQ6A 3LQRA 3PXGA 4BZQA 2IA5A 4DCUA 5FUYA 2AK3A 1OPXA 1D2MA 2W6IA 3K0AA 4NZYA 1KI8A 5E4FA 2A5DA 4QGFA 3RRNA 2Q3MA 3IUYA 3QJYA 1KK1A 5JEDA 5JS8A 2ZRIA 2VHQA 2ZU0C 5DO9A 1YZUA 3EZ6A 4YDHB 1XTIA 2ZVPX 3RABA 1CRPA 3B1ZA 4CGZA 2E87A 4I81A 3UWOA 4MKHA 4A0FA 1E2DA 2GKSA 4Q7MB 4M9XA 1G17A 2A5GA 2BVNA 2P2LA 3PUYA 4BGDA 1Q3HA 1KSFX 1L2TA 1ZNWA 1R0XA 3AVYA 1S96A 2GTPA 1RC8A 3BJIC 2CJWA 1ZW6A 3NKVA 4OQNA 4BFSA 1NL3A 1F48A 4N0DA 3W8NA 3ZD6A 1FW6A 4IVQA 1E2IA 4GPTA 3L8ZA 2XSZA 2R6DA 4ZIRB 1JECA 3A1TA 1AA9A 1L7VC 3LH5A 221PA 1F60A 3SBEA 4ILEA 2EQBA 1SXJA 4B3DA 1L4UA 1Z22A 2VHCA 2I1VB 1KY2A 2JLVA 2ORIA 1FOEB 4RZ3A 2WWXA 3FYHA 5JLJA 3T35A 1EFUA 1Q44A 3EARA 1LNZA 1D5CA 2VP2A 3SC3A 4KITB 2J0UA 4Q7LA 1NLYA 2QSZA 4MRPA 4URWR 3AVUA 4DCVA 2AD1A 4AIIA 1XD2B 4BZPA 3GJ4A 4ZI3A 4TL9A 4HB4A 1II8A 5FOWA 4B75A 4URUR 5KDDA 3GEEA 1N3BA 2J9RA 2JDID 5D3MA 2B8WA 2PMDA 1DAIA 3H1TA 2QT1A 1NMYA 5LPNA 4MKFA 4Q9HA 4IOLA 3HU2A 3KB2A 3I32A 2OHFA 2BEKA 1T9HA 4OYHA 4Z8YA 1G6OA 4RCYA 2QBYA 3K70C 4QBHA 2N46A 2ZSDA 3SEAA 2H17A 2UZ3A 3AVTA 2VP5A 2WOJA 1KKLA 2R44A 1W47A 2VRWA 1XZQA 4HSEA 1ESNA 2XEXA 1A5TA 3SYNA 2P6NA 2IXGA 2IYVA 5FTKA 2WJGA 3KUDA 4AKHA 2QMEA 3RRZA 2CVFA 2NO1A 4HZUB 4Q7KA 1VCIA 2W6JA 2IC5A 3U44B 2BEJA 4EFNA 4D26A 4AURA 1NLZA 3QG1A 5FBQB 3QVVA 4YMVA 3AKDA 1XEFA 2EWVA 2RGBA 2WSMA 1Z06A 3QKSA 4HUQB 3ICEA 1Q12A 4DLYA 1E2QA 3E2IA 2HCBA 4F4IA 2BBTA 1Z29A 2JASA 4JLDA 2V6JA 3W6OA
chains in the Genus database with same CATH superfamily
2YVUA 3HB7A 3OPMA 5DHAA 1A5ZA 5KQLA 5K8UA 5FR2A 1DINA 3OCXA 3QE0A 4QNMA 1SQ6A 2QZ9A 4LNUB 1M0EA 1NW7A 2QHXA 2V97A 4L6CA 5IM4A 3F49S 4X94A 2X42A 3GEMA 5HQJA 3WZLA 4IXWA 3K0CC 3DAYA 2AXPA 3I76A 5IVKA 1LV8A 421PA 4A4DA 4I1UA 2Y1OA 3DVAA 5CHYA 1N6LA 2Q1YA 3GP8A 1NUHA 1HMPA 3V4RA 2RHWA 2RG7A 4OPMA 3PIDA 5H3CA 3LV8A 3BT7A 2M2IA 3EIQA 3OM9A 4OP2A 2W2MA 4DYHA 4M1MA 2IYPA 4FJ0A 3SQWA 4Q03A 3KJNA 3OFSA 4DDTA 1HO3A 5BNTA 2R4UA 3O8LA 2PG3A 3B1JA 3TRHA 2PVSA 3LF2A 2EERA 2VUIB 1E79D 4FDVA 2AN1A 1EFHA 2D1TA 4O4IB 4IX1A 3L0YA 5C53B 4IIGA 1ES9A 2CCKA 4HRXA 1Q2XA 4GXRA 4JLKA 5E1OA 1FP1D 5TQJA 4K88A 7REQA 3Q5DA 5DP2A 3IUNA 5A9SB 3FUWA 3AEKA 1VE1A 1AB6A 2XMZA 3IQGX 4OHCA 4QXRA 1LTKA 1YJQA 3C3EA 4G4SO 4TVOA 5HIMA 5KREA 5BO5A 2IV3A 4BS9A 5G1OA 5IUJC 1C7IA 4NMMA 3GFRA 1VE5A 1V47A 1R4MA 1ID1A 5FLEX 4J8PA 2CJFA 5DI3A 1WDTA 2W98A 8GPBA 4UCXA 4HMOA 5LDHA 3MZ0A 5TS2A 2I03A 1PSZA 3FRIA 2FSIA 3QV1A 1A96A 4GNKA 3TJZA 1SG9A 2XLBA 2ZCVA 2QSYA 4IOMA 1E2NA 2BD0A 1MFPA 1LDGA 2BGLA 3DMHA 4HUQA 1Y4SA 3LZCA 2CJWB 3D4LA 4IHJF 2ZFUA 2WF6A 1JVNA 1VGRA 5JJIA 4EMBA 4E5UA 4W5JA 4UHFA 4QWWA 2AJCA 1CW2B 1F1JA 3CLVA 4PZLA 4QX6A 1XQVA 2HCTA 3CX4A 5AM4A 3WYCA 4WKPA 1UAYA 1QCYA 4YREA 3MXOA 1ISMA 4EKNB 2G77B 1Q7EA 2NXWA 2XE6A 5HR5A 4UU0A 3B2EA 5FQOA 2NO7A 3UGQA 4AP6A 1PD0A 3Q6MA 1H2ZA 1VGQA 3EJ6A 3K72B 4ZVMA 4EZIA 1OAAA 1CE8A 1VHDA 5ALZA 1Q19A 5TGDA 2JVIA 4G5SA 4HH0A 4JA0A 3D59A 3IX7A 4PFQA 1PJZA 1W6RA 3R4VA 4WNAB 3GLFA 1BWQA 1Y1PA 1QIIA 3GLFB 3L77A 1NF8A 2Z0MA 3KEMA 1GGVA 1N4DA 1VHLA 2CHFA 1KJNA 4D4KA 2VAMA 1PGJA 2QF7A 2UYQA 3A4TA 1U2TA 4CV3A 5LQDA 1Z6GA 4IGFA 4RUKA 2QRQA 2AZTA 1INLA 1C7FA 1YRAA 3WL7A 3VAZA 3X0DA 4QULA 2WMDA 2G1PA 2GKOA 5CT5A 1AK2A 2WUWE 1W29A 2IFTA 1SH7A 3RC2A 3RG2A 4P7JA 4DQVA 4G4GA 1QWOA 3WWDA 2H57A 2WJAA 1W44A 2OVFA 2W2LD 1NUPA 1KEKA 2X76A 4V0QA 3MYYA 3EGWA 4PZAA 4X62B 2JIZD 4NJEB 1JL3A 4UMEA 2OBYA 3OP1A 1JSZA 2BDEA 4YP6A 3E9EA 3GNLA 1N5RA 2W6ID 5HZKA 2ZWMA 4PCVA 4CMEA 4BMCA 3IQXA 3CF0A 3DPIA 1QGDA 2IU3A 1ISGA 3DBHB 3IBCA 1PUJA 3P5SA 1ZD3A 3P9PA 1O95A 2BM9A 3ND9A 2QLJA 4RMHA 5EZSA 2P6OA 4YUAA 2AMYA 1RNLA 2H4YA 3E9RA 1QHIA 4BNXA 2JFVA 3TQOA 2NV0A 3LLVA 4EGQA 1J1IA 1QFMA 3L7MA 1KH1A 4Y1GA 4E5NA 4JD5A 3PHBE 5CVCA 1IONA 1R8QA 3Q2KA 5BR7A 1OI4A 2ILTA 3ITDA 1LXCA 2WTAA 5EPOA 4HLUC 1IOZA 2NZWA 2ZZMA 1GV1A 3DGFC 1PG5A 2IHJA 2OG2A 4BHTA 2ETVA 2NXCA 3PUWA 3NS7A 2BTQA 4N9QA 5KPDA 1UDAA 2XSZD 3IAS6 3WQHA 1GZUA 3OZXA 1R5NA 4A6EA 5BSWA 4DM7A 2FRVA 4CMKA 2D1QA 2XNHA 3ZOZA 4E15A 2O1XA 2B2XA 4REMA 2A57A 2G6TA 4G0YA 4NTZA 4Z3DA 2ACEA 2C94A 2QQFA 1FP4A 1V9CA 4ITUA 2HU2A 2BR5A 4MUEA 4KXQA 3GR6A 4B7ZA 1AS0A 4Q37A 5TEWA 1JHQA 4QA9A 4KQ9A 5YASA 1IXRC 1C1DA 1S3GA 1M5TA 1Y9DA 2V03A 4P3OA 1WPXA 4ESOA 4KPFC 1K4KA 3PGJA 1AMUA 1BQ4A 3RANA 1PSWA 2R8XA 3MJHA 3AUAA 3FVVA 1BXKA 4KI0A 5H16A 1BW9B 2ZW9A 3L1VA 4I4CA 4L4ZA 2XTNA 2JLUA 2ZUFA 1W0KA 1U1GA 4OBEA 2Y1CA 4D98A 4QKQA 5EXTA 4R98A 3JVEA 4LOIA 3ZCRA 5FBRB 2I7TA 4B35A 1KZYC 1TIKA 3DBIA 4MQ6A 4GOJA 3TSOA 3FMOB 1U1CA 1EUCA 1JQDA 2IOHA 4XI9A 2WAYA 2EARA 4LY3A 4R2JA 2WWHA 2PPVA 1P7ZA 3URKA 4KG7A 5IT9A 1QX3A 3P5BA 1CF4A 1L1QA 5AI0A 4TRJA 1WB9A 4ND6A 1CSEE 1OBFO 2WJ6A 4BYMA 5JJBA 2E82A 2WJ4A 1M33A 3DH0A 3EAGA 1SCUB 4PLWA 3VR4H 4F5ZA 2YKGA 4DY4A 2W2PA 2BEVB 2YWCA 1XNJA 4JFRA 3OPXA 4DNQA 2DU8A 3C6YA 3VTZA 4E7PA 4KR6A 1ILEA 4YAJA 4TT3D 3U3OA 2X0EA 5GWXA 3ZZ0A 2AEEA 3E48A 4R8KA 4FLEA 2V4ZA 2YXDA 3SHTA 1J23A 1PRYA 1H4VB 4G67A 5CTAA 2QM0A 2O2SA 3HJNA 3KR0A 3IHKA 1F51E 5AUPB 3DLTA 4GXQA 4AZWA 3UMSA 4QJIA 2OO5A 2V0CA 3KOXA 5CH5A 4ECEA 1W35A 5L6LB 4N54A 5AK0A 3T7SA 1XO1A 2HQ1A 2JLRA 3BMQB 3ORYA 4PW0A 3GEGA 5E8JA 2GK4A 3H0KA 1YS2X 3KAQA 1K92A 4BNTA 2P2GA 1LS1A 2OE2A 2VDPB 2PS9A 1FBTA 4MLZA 4DBLC 1UCFA 3GAZA 5EVCA 3SR3A 3T9EA 4LXUA 3A2LA 4IUDS 4Q3NA 4PGGA 2A86A 3TD9A 2QTNA 4LYGA 1YFZA 4CDMA 1KMCA 3EA0A 3R0XA 5D84A 3U4CA 1E6MA 2QUAA 3UCEA 3UCXA 5ALVA 3DUFB 3M5DA 3QUAA 4MVJF 4F4UA 4ED9A 1Y6JA 5JFTA 3K94A 5J2TA 5HRAA 2V6BA 4A9AA 4LJ9A 3SNHA 3MSXA 4RM2A 4W7HA 2WAAA 4C01A 1U0RA 2VHXA 1U99A 2G1KA 4LBVA 4WGGA 4EDHA 2P9YA 4ZYZA 2QQGA 1PSDA 2GEKA 2C7OA 3KEQA 5CDSA 1QGUA 4L8LA 3BILA 2ZJ5A 3IO3A 3D2CA 3PDWA 5AXDA 3VUFA 1T3GA 4IDHA 3VHXA 1PZEA 4LI3X 5BN4B 3P96A 2GZ2A 3ZK9A 1L7QA 2XNKA 4UBJA 2VDJA 3Q8XB 1G21A 4MWCA 5JZ9A 1XZFA 3FGZA 4MYCA 1XHFA 1ZAYA 5KMGA 4AWAA 2YOHA 2X0NA 3ML1A 3C8HA 2JLAA 3MFQA 4ZANA 1F2TA 4YIKA 4Q1FA 1VOTA 3BTVA 3FDIA 2ZJ2A 3N8DA 4YHBA 3I2YX 3FBTA 4LRUA 2WDPA 3GLFE 5DM2A 3QJGA 2ZETA 1IZ7A 2FUEA 2CFOA 1Y6QA 3HLYA 3RVBA 5HCNA 4RHTA 4ODIA 3WP0A 5JJCA 4OHYA 3ZEAA 2NPFA 3WWEA 3VJKA 3NGXA 1TJPB 2QZPA 2ZI6A 4Z99A 2ZIWB 1D2HA 2C29D 1ZYUA 2EAUA 2VJYA 2WSSA 1BX0A 4QVGA 2CXQA 1KKMA 1DRKA 4C29A 3BKWA 4DQUA 2FR8C 1Q22A 4AFNA 1M34E 3AJRA 3IBSA 2QXTA 1Z0DA 1EFPB 2W22A 3QTBA 4ZRMA 1RT9A 4PGHA 1HTTA 1L4GA 3IT1A 4QHYA 1Z15A 1QH1A 3OX4A 4WOPA 3K09A 2IZ5A 2H54A 3A2NA 2QP9X 3RYTC 5KSWB 2X5XA 3BAFA 5JCOA 2FPKA 2H4JA 2YUTA 4PBSA 2A1UA 2JGFA 1U8AA 4II7A 1H0RA 2JD1A 3EEIA 1XJCA 1RXYA 4LKRA 4JY7A 3PP8A 5EUCA 5FF9A 4C7XA 4EGSA 5LQCA 1UBOS 5IC4A 2EYQA 4GI1A 3DE0X 3NBZC 2C78A 4MJ7A 5J1TB 2PE5A 3V46A 2QJFA 1VJCA 3A1SA 5JY1A 2GK3A 1OYWA 2P4EA 1ZM2A 2FRDA 2ZYTX 3QITA 5HS6A 1M0SA 2ZJ0A 1E1LA 4HLCA 4LWQA 1PWZA 1RD4A 4GKVA 4N0QA 4PO3X 3MQFA 1TIPA 5DZSA 5EWMB 2YVLA 3WJAA 3G0OA 4JU8A 4QJ4A 5ALJA 4DCPA 5IKMA 2D3WA 4MRVA 3U7HB 5AKJA 4QGBA 1V1MA 3PA8A 3JZFA 4PQGA 2ZOSA 4OAOA 2KS6A 4CIAA 1BIFA 1NONA 3RJZA 4F3CA 2HIGA 3WMGA 2VR1A 2X5JO 3ZGOA 3LZ6A 3CR3C 2FN3A 4NBWA 3TVYA 3V7UA 5CBPB 1Z16A 3ESCA 5E6SB 3U7FB 3ANTA 2O3RA 3A6EA 4BDTA 3KJIA 1DXHA 1E9EA 4OJMX 4GMDA 1CJKC 3GFSA 1O95D 1U2ZA 5LU8A 2I2DA 5FR1A 3E4CA 4QXAA 2XHZA 4I5DA 4JP2A 5JO9A 2QRJA 4A23A 5FTLA 2OCYC 1SCQA 3E8SA 2AQ8A 3GIDA 3I04M 2RI1A 2VXCA 3F78A 3KYIB 4L08A 4NSNA 1XZ8A 4TYQA 3GLVA 3KT0A 5K51A 2W43A 5BPHA 2I9KA 4KV9A 4CI0B 1ESZA 3I62A 4WERA 4WFJA 1GT91 1Z4KA 1VSVA 4MPJA 4CMEC 3F6EX 5JCPA 1U6IA 2FEKA 1ABEA 1L4FA 2IHYA 4W9RA 1GU7A 2X8BA 1SA0B 5BOSB 4TS9A 1E3TA 2GVNA 4WESB 3GEPA 1G5IA 4YWHA 3W1VA 2XMBA 5UKDA 1G20A 1Y63A 1QUFA 1S2LA 1ZITA 3ZWAA 5AM2A 3UJDA 5DX8A 2BFCA 4C3OB 2W8BA 4AM8A 4D80A 1RC1A 4HEA1 4FHFA 2H29A 4KN9S 5G4LA 1SGWA 4I1RA 2C3YA 3NDRA 1TCVA 3LRXA 4C0KA 4X8MA 3WWPA 2R1TB 1GA4A 5GV8A 3AOEA 3P4XA 5KTTA 3KLNA 2P62A 4ZWNA 3EAQA 4J0KA 3C8MA 5DHTA 2PR2A 5AI4A 4MX8A 3V1YA 5D3MB 3TG2A 1NIPA 1WCYA 2ZBQA 1G0OA 1PYDA 1PO7A 2PT5A 3A06A 2DBQA 3I6BA 1DIOB 2WKRA 3RVMA 2WKPA 3OTQA 4UCWA 1W0KD 3IAFA 4UOEA 1V39A 1VJ1A 3DBHA 1TL7C 5J4YA 1TYZA 2BMAA 3N8HA 5B2FA 1V95A 2A1UB 3JALA 2X0RA 4QO7A 2COKA 5DNCA 4AI6A 4C06A 1BO6A 1VB5A 2ZXEA 3KZCA 2Q9BA 1HFKA 1MA3A 1CHNA 1RE0A 2O2ZA 4DMMA 2ZYGA 1CYEA 4C1BA 3GJ6A 2JJYA 3L41A 3EZGA 1UJ5A 2EX0A 1P1FA 4GLLA 4Y2RA 1XXHB 5K3DA 3HY3A 1VMKA 1Q6YA 1GTL1 1C3EA 1LWNA 1XLTC 3F71A 1WDMA 4RCZA 2YS6A 4EYSA 1HR0B 1G5HA 2P27A 3F6BX 4E5DA 4W1QA 3P0IA 1MD9A 4EOGA 3BAZA 3ZDAA 4XVRA 4Q4LA 1CJSA 3R9KA 1HURA 2QGNA 3G2NA 3T35A 4AIRA 2K2WA 4RJTA 3TCKA 1NJ2A 4G5OA 4KR2A 1ZN7A 1TAGA 4TT3A 3FSGA 4G1EB 3WKBA 1M1YE 1REQB 4NV0A 5IJWA 1E32A 3ZBQA 3VR4A 2GHQA 4ZGBA 1XMIA 1Y5NA 3K9WA 3SLKA 1X1AA 1SNYA 4EPTA 2YQZA 3T3HA 1A0OA 1C9MA 4ZAGA 2BGKA 1PV2A 1Q57A 4C14A 4F8EA 3IUQA 5C1DA 3IMFA 5TF4A 5DRTA 1VBKA 2QW8A 1BJKA 5DYIA 1E2KA 2BJVA 3WFJA 5A7FA 2HRQA 2OAP1 1RRFA 5JS1A 2HO5A 5B6JA 4CKBB 5EHZA 1YDHA 1ZUNB 4MV9A 4BKUA 1GRCA 1H1DA 5BMVF 4G36A 3DDWA 3QMWA 4YFVA 5TQ2A 1XMOB 1YS6A 3IO5A 2VUSA 2CDNA 3NHMA 3T1YB 2M1XA 5H70A 4DV7B 4AZ3A 3IP9A 1JN0A 5HJEA 2FPXA 4JEUA 3KD3A 4HQFA 3OE5A 1YZYA 2XYQA 4I2NA 4MP3A 3U37A 1XCBA 4AKSA 5AVKA 1MC5A 2B1GA 1QVAA 2FMHA 2G6BA 3L4SO 3WL6A 3G0IA 5SZIA 1J9EA 1L4LA 3CN7A 3R3VA 4HD8A 4KIUA 3RU2A 1JDUA 5FWXB 2OHVA 4GQAA 3NVAA 4FZRA 3SEFA 3MQ4A 4EK9A 1N7JA 1ZNXA 2NSJA 2I99A 2QNIA 1XHEA 1TK9A 1TLLA 2YWHA 1HY3A 4INAA 4K46A 4NZPA 3RYCB 2I3AA 3ZZTA 4WV3A 1E2GA 1N2XA 2VBIA 3DHYA 4WZAB 1DEAA 4EL5A 1CX9B 3V1MA 3GYBA 2WFZA 2YYAA 3HRIA 4IIJA 3AJ9A 4E32A 3KV1A 4TTRA 4DLVA 3S2FA 2ID8A 3BXOA 1U8UA 3EXG1 3PFGA 3M6WA 2NSYA 2WVHA 5CK4A 2PRIA 4KRYA 2H1RA 3BWXA 3JALB 3BGSA 3RYHB 3SM9A 5IARA 2YJ5A 2NSLA 4O2LA 2GM4A 3A27A 1XLVA 1SXJC 2ADMA 3MCZA 4DXAA 5K05A 2D5BA 3BE6A 4JI5B 3T5GA 6REQA 4G23A 4C7OA 5JARA 4BTVA 5LA6F 1SBZA 5IT5A 3OJEA 1W87A 4GLJA 5GIPE 3PHHA 3AU8A 2ZUSA 3P2JA 1KIAA 4OREX 4C0QC 5B1YA 1G8MA 1X2BA 1G3RA 4HDMB 3O38A 1R37A 3FPSA 3DMYA 3LRTA 4KBYA 4OHWA 4DA8A 2OOKA 1EVJA 2BFAA 3ZE6A 3F47A 1EHCA 4XEHA 3DE4X 4GI7A 4BNWA 2V7VA 1DBIA 1QIKA 2BAGA 1O96B 4Q66C 1OOEA 1R6VA 3K20A 2PS0A 3CXUA 4NH0A 3I9KA 2VNIA 4O4LF 5AK5A 2Y0PA 1RR6A 1MHPA 4JXJA 4A1OA 5IN4A 5FHQA 1W2WB 4I55A 5IYZB 3RAEC 3V7WA 4OJKA 2MSWA 4MGZR 4R8SA 5AKZA 1WCV1 1A5AB 1I14A 4CLDA 3ZIDA 3E3NA 3RHSA 1KYTA 4DFDA 4DV4B 1T9ZA 3EQZA 2ZQYA 4FYJA 1UFOA 3QYAA 3L7OA 4N0EA 4P2GA 2BKXA 1EAMA 5DHRA 8ATCA 2QTBA 4BGUA 4EG7A 2CUTA 3DOHA 2EU8A 1T35A 4N5HX 3DZFA 4KQ1A 5JS7A 4P34A 5L7WA 2XQIA 3BGDA 4KPYA 5DLYA 2PFKA 3U31A 3LM8A 1XALA 4CEHA 4PRYA 1M6EX 1Y6ZA 5IMBA 3QBDA 2VDQB 1L9KA 1UKBA 4JB3A 1BG6A 4BO3A 3L0PA 2Z09A 2WY2D 3VM6A 4Y2UA 1ZGBA 1VIMA 1P17A 2EDCA 2UV8A 2FFJA 3U4QA 1RACA 2C04A 1MRNA 1SZCA 2NZ2A 5K6AC 1Y3BE 3B2NA 5G0WA 4JIMA 2IDMA 4LE2A 4GVLA 1L4EA 3R76A 3ABQB 3LKZA 1RM3A 1W88A 5DW3A 4Y0NA 1LF5A 2YC4C 3AY0A 2GN4A 1C3VA 1WUTA 2Q2OA 6PFKA 1NXVA 3FUTA 2V7BA 1E9CA 4KRXA 1ZIOA 1OBCA 2DPMA 1NJFA 3BVPA 2AOUB 1K6JA 2I9PA 1NZJA 2VN8A 1JEQA 3ZU6A 1X15A 2GNOA 1EE1A 2I76A 5FV7A 5BT8A 4R8MA 5F77A 3CBGA 3WGNA 3K09C 1XNGA 3PUIA 3OSZA 3WA7A 1Q50A 1G3UA 4RHCA 2VDUE 3IL2A 2BE7A 4D79A 3ZHYA 4M0CA 2CCJA 3RM3A 3PUVA 4C4PA 4G6ZA 1EK0A 2VA8A 3G88A 3RVQA 3H1AA 3LQYA 2NGRA 1IQPA 2A5FA 1GPKA 1DIRA 3AM5A 3OLWA 3IC5A 4XPIA 4PNEA 4YRKA 1K66A 3CY6A 3WR5A 1J0EA 1II8B 3S44A 3ZX5A 2P0AA 1A76A 3NX4A 5T4BA 4YO7A 5KQMA 1GQOA 3A9TA 1JG2A 3MWKA 5C8YA 2C5LA 2EZ4A 4TTVA 3LPMA 3TKLA 3LP6A 3LX8A 4IWNA 2P5TB 5AESA 1R15A 2X0JA 2BHTA 2ISCA 4MW5A 3X44A 1HOTA 3GUYA 4G1MB 4LF6B 4J0JA 4NZNA 4KK4A 3JQAB 3FPCA 1WULS 4PZYA 1W5BA 1Z8FA 1CUZA 1KDVA 4H2DA 2XD9A 3TTTA 4M8LA 4L5IA 4DT1A 1SOVA 1CIPA 4QBTA 4E22A 1E7QA 2F9LA 4L5AA 1MOPA 1YR6A 3IHLA 3DQQA 1N7IA 4IIBA 1GPNA 2PX4A 1H66A 4EQZA 4F6RA 1DBVO 1SB8A 3C3MA 3JX9A 2A9JA 3HDJA 4XCQA 2OKGA 2PCJA 1YE8A 2R00C 1WXQA 4HAWA 1C2TA 3HADA 1WA5A 3K35A 3QWAA 4O6VA 2VJQA 3DVRX 1MOZA 1B0ZA 2ZI3A 4MIEA 5IM5A 5D6NA 2D4AA 3FR7A 2HF7A 1X7WA 2Y66A 2IF0A 4RVSA 4XW2A 1JQKA 1Q6ZA 5K0NA 1MVOA 2JJ1D 2SKEA 3W5DA 1G9TA 1ICEA 3LIIA 3TRIA 2XXAB 3EDYA 2D7DA 4I1PA 2WJZB 4PHCA 4PLGA 3VSAA 4TSKA 5BUQA 2WTBA 3UKJA 2J9FB 4D9EA 5IT4A 4NXMB 3J81k 1UP6A 1YZTA 3WOHA 5KNCA 4A2CA 2IZ7A 4WHMA 4B7UA 4OXRA 3VR4D 2QL5A 1P9NA 4BU0A 4DOMA 3GRKA 1OF1A 3A3NA 2OZKA 3AOGA 4NKRA 2N47A 3RU3A 3DT6A 5BMVA 1QYRA 4GP6A 2Z6AA 3TTXA 1SUFA 1CTQA 4U4AA 2UXDB 4MS3A 4MS3B 3MOSA 3PHIA 2V5AA 3ZXIA 2ODNA 2Z2JA 5HKAA 3QLVC 3M5CA 1QYIA 3R7SA 2ZIEA 2AQIA 4XDHA 4N5LA 3SI7A 3QWBA 1P18A 2JZCA 1DCFA 2CLIB 2G0TA 2XUKA 1V6AA 5JQGB 3VX3A 3VYSB 1R9GA 1SPBS 2DQZA 1A7JA 1M2NA 2HJGA 5B64A 1ZGAA 2CE2X 5I4BA 3BBLA 4DJEC 3EEQA 4FILA 1SHZA 1YACA 5HE9A 2OGWA 5LVAA 1DDOA 2GHRA 2IYXA 4XGRA 3HCFA 4F60A 4X20B 4C4ZA 1OILA 3A6HA 3A1EA 1PR2A 1QKJA 2XA1A 1KVUA 1RJ9A 2LR0A 4R3UC 5IDQA 3FYUC 3O0DA 3RS4A 3U49A 5ADUS 3AFNA 1ORTA 1LRKA 4OG2A 3LSTA 1T4GA 2B83A 5KYNA 1RCFA 3OD5A 1P91A 1K8ZB 3ZHRA 4DA9A 4TROA 3H2YA 4EB0A 1HH4A 4BBJA 2R7AA 3KHKA 5CLGA 1ISIA 1JFFA 3MYRA 2JLQA 2XUGA 1WUYA 1KZ7B 2ZUWA 2D0OB 1U0GA 1ZDMA 3GLHB 4MYTA 1EQ2A 4ER0A 1DIGA 1Y7PA 3JD4A 3QVXA 4YJ3A 2WR8A 1NKTA 1UWCA 1GSIA 3ZY5A 1TEXA 4CG3A 2PUGA 5M3BA 1BA2A 3ZW7A 1LDBA 4I4IA 3L9WA 2CXTA 5CJJA 5L3ZA 2V6GA 4G9BA 1R00A 4B73A 4A2WA 4DSOA 3PSHA 1GQ2A 2XLCA 3MMNA 3AKEA 3SX0A 3FLAA 3AJAA 4DLKA 4F3NA 4WK0B 5KAPA 3S70A 3AL3A 1FX0B 1VPLA 1Z26A 1JG3A 3GELA 3UHPA 2GD2A 1FU7A 1XA3A 1H2WA 1R18A 2OILA 3CO5A 1ZUWA 3MJRA 3MT9A 3QPWA 3RVJA 1OXUA 1NNEA 5B2EA 2FP4A 1Y3FE 3B6KA 1PNTA 4KDRA 2NYAA 2ZRAA 4CF7A 2UVPB 3GUCA 4DRYA 2CNDA 1B3RA 1JI0A 1UIRA 1BE1A 1EM8A 1J39A 3KHTA 1YT5A 1Q92A 1OZFA 3TZHA 5JSUA 4GMKA 1IN6A 5JMPA 3ZCXA 1ISSA 3NUZA 2IYEA 2MYPA 1G64A 2IPMA 2YN2A 1E99A 3L0DA 4KDCA 5JCOC 5EINA 3U3KA 4IKPA 2GLTA 4JA2A 2Q5FA 1L5VA 2RARA 4Q18A 3AQ4A 2GAIA 4NG4A 5DOVA 2NUAB 2G7ZA 2IUTA 2K4MA 4FKBA 2QR3A 5HUHA 2CLFB 3NYWA 3Q9UA 2X14A 4DLWA 4IINA 3OM0A 3UG7A 4IICA 2H5JA 3SC2A 5KTSA 2RD2A 1QKKA 4P4UA 3EVBA 1A2BA 1RBYA 3B12A 4I08A 3PENA 3V3TA 2H2IA 3CJRA 3ZHBA 4GBED 1KQPA 5AI6A 5FH9A 2PX8A 4TMWA 4IDFA 1BDMA 4QE3A 4RDXA 4HN4B 1G42A 2H2HA 3L6OO 2JKZA 1PP4A 4MV1A 4MMYB 1QVZA 1GO2A 3AR8A 3NYRA 3WAGA 1LQUA 1GG9A 5EJMA 5TIIA 4GZ3A 5KHAA 3HB1A 3CLKA 3OMWA 4J9VA 2Y27A 4MDEA 4E5PA 2QT0A 1N0VC 1DQRA 1EJ0A 4EEXA 1JJIA 1K08A 4GXNA 4TXLA 2YV3A 3T38A 2FWNA 3RHTA 3I58A 3MG9A 3WGZA 4BNMA 3VH4A 4D8YA 2GN6A 5CEFA 4HQNA 2FUG6 1OH5A 4O59O 5BW4A 1FE8A 1BWPA 1XTZA 4Y7CA 4Q4CA 2WMYA 4L5BA 2XRYA 4L4SA 3EBOA 1UK9A 8ADHA 4NG5A 3MWLA 4E1AA 1U81A 3WJ1A 1M1NA 4AJNA 3NXKA 2XCSB 5GY7A 1GCUA 2W58A 2W5UA 1WABA 5JANA 3U1VA 2EGGA 4QQFA 5K6TA 3PNMA 4E12A 4FOLA 1R0ZA 3D6VA 1IPHA 1AU9A 2C2KA 2P7HA 2P9QA 1UKZA 1HYQA 3G6KA 4TKMA 1LUAA 4PZEA 3K4QA 2PL1A 3EGXB 3MGAA 3WK9A 2IY9A 1G55A 1NW4A 1P9LA 1SKBA 3ZY4A 4NJMB 4BAGA 2HZ7A 3W5JA 1CQZA 4NJMA 4U7HA 1XTKA 3KU4A 4Y6LA 5L3QB 1HTBA 1E59A 1L8QA 3K2IA 1CETA 3JASA 4R51A 2WI8A 5MN4A 1PFQA 4UMFA 5HNKA 3NC1C 3NOXA 1Q3KA 2DHEA 2HPHA 3AUJB 3GRAA 4JN6B 4D02A 2Z2YA 4REQA 4JT4A 1D8AA 1V3QE 4B33A 3C15C 4OXIA 2GFIA 2IYZA 1GKLA 2JZOA 3LAWA 4YT5A 3IEVA 2A5JA 4D9IA 3KR2A 1V8PA 5GZ6A 5TF0A 6Q21A 1GPH1 3HCEA 4L74A 5JDIC 4DWVA 1Y7TA 4OGLA 1ZH8A 4WN9A 5JD4A 3W05A 1YS7A 2XQKA 2O7QA 3B3QA 1L9XA 2A58A 4N5MA 4YAWA 4YMHA 1ZVJA 3EXHC 2WQ6A 4XFDA 1Y5RA 3G02A 1LK7A 1U8FO 3L8EA 3RLFA 4PBRA 3S2IA 2O5RA 2RKBA 2WP0A 5DWVA 1Y3AA 1M2HA 3EAFA 3QE2A 2EFHB 2CF5A 3RQSA 4BEVA 3FOEC 2HHHB 2VHYA 1A9XB 5HF5A 3G2JA 1XZHA 1JXMA 3BCHA 5DISB 3WRYA 3BULA 1TEZA 4P35A 2HYIC 1XQ6A 2D2XA 2CXXA 2JJ1A 3I2FA 3IOCA 2B8EA 3P7MA 3R41A 5T8KA 2WJIA 1U1EA 4DMRA 4YBZA 5L3RA 4RTJA 1D5WA 2H06A 3BMQA 1RKQA 3LWBA 3V4ZA 3QPDA 1JPVA 2RB5A 3KKNA 3QIAA 5H4HA 1YQTA 1NY5A 1T0HB 2CL6X 1PGOA 1WG8A 5JZBA 1RWKA 4DIOA 1EGVB 1SXJD 4IKEA 1LC3A 4MZXA 4BO1A 3FJYA 5CGQB 2AUTA 5J5CA 1HBJA 1KA9H 3WK7A 1UEXC 2GXUA 4ZA2A 3REOA 4D9KA 4BC0A 1YA6A 4DUYB 4O4HA 2FW1A 1VC2A 2REOA 3V48A 2DXIA 4I7EA 4YRZA 4CFZA 4Z4QA 1QYXA 4OFXA 4MMXB 1P3JA 5LA6A 1EWYA 5IX8A 4GMGA 4YASA 1IN5A 1J1ZA 3EDOA 1N34B 1G7CA 3ANNA 3OU6A 1UEIA 1X87A 4KVZA 3SDZA 3BK1A 1MRSA 1I2MA 3GZJA 1EWKA 2IYLD 5I9MA 1VIYA 1KQFA 4EYKA 3ORQA 1F38A 1G7SA 1PX2A 1ENZA 1DX6A 3LSYA 3OQBA 3P71T 3OUUA 4TN5A 5C52B 1TI7A 4I0WB 4DRXB 5CR9A 2O2JA 5IFKA 5JHHB 4D41A 1P1RA 5I5GA 5EZ5A 1EZ4A 5IBPA 4HX5A 1NQWA 2IYYA 1BE0A 5ABPA 2QQ5A 4Q4DA 1Y8QA 4X44A 3EK2A 3TE7A 2JANA 3ZDRA 1CZLA 1IDOA 1VYHA 2P0EA 1I7SB 3ISJA 4O4HF 3TIIA 3NRBA 5BWMA 3FMIA 2ZE7A 1ZPDA 3OETA 1D6JA 1A8QA 5ED4A 4H3KB 3PLNA 5EWJA 3T3GA 4EELA 1G5QA 5DN9A 4FEGA 3RSGA 2W7TA 4GDFA 1RAEA 3GVPA 3E3MA 3SZLA 2H1VA 2GZMA 3FLBA 1H2YA 1XUOA 1RYFA 4DIBA 3UTCA 3IJRA 3MT0A 3G82C 3HDGA 3KX2A 2ZYDA 4OJYA 4QIHA 5TSDA 3WBFA 5KSOA 1KFKB 1TFUA 5AOCA 2IHBA 1Y6GA 3FGNA 3JQ9A 1O9GA 1NVUQ 1H4SA 1HZZC 4G0ZA 1A8UA 2SNIE 2FEMA 3E7WA 1H9CA 1FFXA 1Y3DE 2Z98A 4JVMA 2PGDA 1MIOA 1OKKA 2W6NA 2O7RA 1H05A 2GT1A 5CM9C 5THXA 3INYA 3VFDA 4NAVA 1EQUA 3C14C 5LJIA 2DR2A 1Z36A 3AFIA 3OKCA 1J97A 4R81A 5JVDA 1X7YA 1GRQA 4G56A 1KJZA 2P4QA 3PC8C 3RD5A 3WADA 4JI0B 1L5KA 1KOGA 2B4TO 4AKGA 5ENZA 4IRMA 4HDRA 5DSZA 4BFCA 3K9GA 2NSHA 1A97A 2X7XA 1MVLA 4L85A 3O9MA 4HGPA 3AZOA 4UVDA 4XM2A 4CW7A 3DEIA 1WM1A 5CA0A 2HA5A 3DFMA 3WNBA 1W5TA 1BE6A 3RRJA 4KHZA 1W581 1TZBA 3IE0A 4RM3A 5J5AA 3OFKA 2WT8A 4LVCA 1U4OA 1VB3A 1GNRA 3KCQA 2JGKA 3PQ2A 4D44A 2F8TA 3P52A 1U0OC 4FCCA 1EFCA 1LDMA 1M1YB 1Q1NA 3OCWA 4JI8B 4HVAA 2EDAA 1U1FA 5FPKA 5M2QA 2A7XA 2WD9A 1FS6A 2OMEA 3QXXA 4UATA 3ZNQA 1B41A 4IGAA 4XJXA 3ZNNA 2BOVA 2ZREA 4P6VF 2FPSA 5ALWA 5BRAA 2YXLA 4GPD1 1SPXA 3Q7SA 3GLHA 2X4GA 2GYWA 3E1SA 3IJPA 1SXHA 4ZFNA 2C4HA 2HDHA 4CQLB 4MZDA 2CB0A 2ECKA 5EIXA 1QS0B 2ZP1A 4ZVRA 4A26A 2XADA 2H9AA 4HWOA 5HBGA 3CYFA 2LP4Y 1J8FA 1GQQA 1N5IA 1V1JA 1XVVA 3KTAB 3QHQA 4MW2A 4OHOA 1LI7A 4RF2A 3U56A 1S7CA 2QRMA 4IHJA 4BWVA 4KQJA 4PG4A 2GD6A 2H5EA 521PA 2PM8A 2G3YA 1MX5A 5IS2A 4BMYA 1VKJA 1V11B 1RZ3A 2HWWA 1Q11A 3CNEA 3EDMA 3QM1A 2VUUA 4M9UA 4YGYA 3BS4A 1IZYA 4R1QA 2FZCA 3P9SA 3ZIAD 1SULA 3GEHA 3I92A 3JYOA 3HJBA 4UEKA 2HGZA 2FX3A 2JS7A 3HV2A 2B4AA 4ZU1X 2LD4A 3EYWA 5DYWA 4WESA 4AY2A 2JCYA 2POCA 2W48A 2DPXA 2P91A 2QGZA 3K0HA 3N5KA 4ZJYA 1KI6B 1SD2A 1T2NA 2G1AA 2JJQA 3BFXA 3DS8A 3GGDA 4JP1A 4OMFG 5KYYA 3AP3A 2J9YB 4KYVA 2NW6A 4FZVA 3O75A 1O57A 4NCAA 3UMVA 2WHXA 2BF4A 1FXUA 3U26A 4QOEA 1VSTA 3RUPA 2WYOA 4AYXA 4B74A 4QT4A 4KOAA 1URPA 4JT2A 2FG5A 4PRLA 4Q5IA 4E4YA 4J0CA 1IK6A 2Q5EA 1YNOA 2EG9A 1N77A 1NJ5A 1JFSA 3JQAD 3A4MA 3K2QA 2N9UA 3ZVMA 2B34A 2IEIA 2ZSFA 3YASA 4UEQA 3MLAA 1THTA 4GYKA 1YI0A 1D2CA 3GBSA 1CP3A 3ZZ1A 4FYYA 4WY5A 4HDAA 4ER7A 3T7TA 4TRNA 1OLSA 4J2TA 1L5MA 3O47A 4HYYA 4N39A 1C4KA 2E4UA 3PDIA 4OH7A 3EIOA 4L8VA 2VDVE 3BL6A 3ZOKA 5AVWA 3A9SA 3I6ZA 3SXUB 3PG5A 3HDVA 1A9OA 4NECA 3L4KA 4RQAA 1D6NA 3EASA 1DKQA 2ZBUA 3FPJA 2JFYA 4RIIA 2JL1A 3KJQA 3UG6A 4FFOA 5B7QA 2FPLA 1I10A 1XFDA 3A28A 3I8XA 1W76A 5A03A 2FPPA 2Q3HA 1N3YA 2W2TA 3D8NA 3EXIA 2VLBA 2PKQO 3MK31 3I1FA 3QKSB 4MW9A 5BSTA 4PVCA 5JCZA 1SUAA 3C3PA 2ESRA 3WGUA 5HJ5A 3HHEA 4LHYA 3ASVA 2PYIA 1VLJA 3OT1A 4G2NA 5E2AA 3V8PA 1N5KA 4V0KA 4LMBA 3RVKA 1P1CA 1GXSB 2NADA 3G7NA 1UQUA 4E7OA 4YA6A 3BIFA 2Z95A 4JIGA 1AHPA 3WIBA 2PSHA 1JTFA 1NR7A 1VDZA 1OWPA 2JCVA 3KWFA 3S2GA 1ZL0A 2EJVA 2R8RA 3IIMA 3U4DA 4PQFA 5K5EA 2ZIAA 1J9GA 1NJSA 2O06A 3BA1A 1XCGB 2QYSA 2QTVA 4JYPA 1RBQA 5BNZA 1RKBA 1DVRA 6REQB 3TOCA 2WYWA 1JKFA 4BUZA 1DCTA 1PWXA 5F9FA 3JSAA 2V6IA 2E5WA 2ZBDA 3I83A 2RCNA 3GEBA 1EFKA 3LTEA 2AJ8A 5CYGA 4PLHA 3RUCA 1FB5A 4WT7A 1AKWA 1TQ2A