4DW8A

Crystal structure of a haloacid dehalogenase-like hydrolase (target efi-900331) from bacteroides thetaiotaomicron with bound na crystal form i
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
266
structure length
266
Chain Sequence
KYKLIVLDLDGTLTNSKKEISSRNRETLIRIQEQGIRLVLASGRPTYGIVPLANELRMNEFGGFILSYNGGEIINWESKEMMYENVLPNEVVPVLYECARTNHLSILTYDGAEIVTENSLDPYVQKEAFLNKMAIRETNDFLTDITLPVAKCLIVGDAGKLIPVESELCIRLQGKINVFRSEPYFLELVPQGIDKALSLSVLLENIGMTREEVIAIGDGYNDLSMIKFAGMGVAMGNAQEPVKKAADYITLTNDEDGVAEAIERIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloacid dehalogenase-like hydrolase
publication title Crystal structure of a haloacid dehalogenase-like hydrolase (Target EFI-900331) from Bacteroides thetaiotaomicron with bound Na crystal form I
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 101
structure length 266
sequence length 266
ec nomenclature ec 3.8.1.-:
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 4dw8A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4dw8A01
5AW0A 5AVYA 2FPUA 2HEGA 4UMEA 2CFSA 4CE6A 2B8JA 5AVZA 3FGOA 3QXGA 1NRWA 3CNHA 4DFDA 1T5SA 5AIAA 2IOFA 3J7TA 2HDOA 1TA0A 1SWWA 3WKDA 2WF7A 5AM2A 3QUBA 4GXTA 3B8EA 1VFPA 4Y2YA 5ALNA 3R4CA 3NRJA 5ALHA 3U7FB 4PNHA 2BY4A 5ALUA 3EWIA 4UM5A 2MU1A 1T5TA 4BNDA 4EELA 3QU9A 1T9ZA 4Y2TA 1FEZA 2HF7A 5IT4A 3OCUA 4Y2JA 2HHLA 5ALGA 1F5SA 4KX5A 3EPRA 4L6AA 2I55A 1N8NA 5AVVA 2WM8A 2ZOSA 3KOOA 3WK8A 1RKQA 3EF0A 1Q92A 1RMTA 2BDUA 1Z4QA 3S6JA 4MUMA 1XPJA 3FZQA 2GMWA 3ZTYA 2NO5A 4C4RA 2I7DA 4CF5A 3IB6A 3L0YA 5AKKA 5AVQA 5FP0A 2YJ5A 2C8LA 1NF2A 3NANA 4AP9A 2W4MA 3AR4A 3WGUA 3RF6A 4B6JA 5ALSA 1WR8A 2DQSA 1ZD2P 5AKGA 1VJRA 5ALRA 1Z5UA 4G9BA 3ZWDA 3U13A 5AVRA 2EARA 5AVWA 5ALMA 1S2OA 1RLOA 3KZXA 4OD0A 2R8XA 4EEKA 5AVSA 5AW9A 3ZTWA 5AK6A 3WKBA 3ZI4A 4IFTA 5ALFA 5AIBA 1U7OA 4H1WA 5ALZA 3WGVA 2RB5A 3OCYA 3ZX4A 2B82A 4HGQA 2HSZA 1QQ6A 4I9GA 5ALJA 4IG4A 5AICA 5AK5A 2I33A 2G80A 1L7OA 1U02A 2D2VA 4XOUA 3IJ5A 3N5KA 2YY6A 5JJBA 3A1CA 5AKYA 3MPOA 3WK7A 3ZUPA 4BYGA 2FUCA 2OBBA 1LTQA 1CQZA 3L0BA 4RESA 2WFAA 4YCNA 1L6RA 5IT0A 2YMMA 3L8FA 1VJ5A 4UMVA 3FM9A 4CF4A 3U19A 3QUCA 3A1DA 5ALLA 3SF0A 1XVIA 1RC8A 2C88A 4BKMA 3MC1A 2YMPA 3ZVLA 5E0OA 4YIKA 1Q91A 3AR5A 2YN4A 2P69A 3W5DA 3FPBA 3E81A 4UARA 4Y2UA 1RMYA 4CNQA 3AR7A 2FPSA 1U2TA 1Z5GA 2C8KA 2GFHA 1KYTA 3N28A 3SKXA 4RETA 3VAYA 1YDFA 3QUQA 1L8OA 3I1YA 5AM5A 3AR8A 2B1QA 5AW1A 2G0AA 2RAVA 5ALKA 2IOHA 3ESQA 5AI4A 4C4SA 4MWOA 3A3YA 2X4DA 5AK4A 5AESA 4NABA 3WK6A 4FFDA 2P11A 2OA0A 2C4NA 3UMGA 1Z88A 5A3RA 3UM9A 1RMQA 4HGNA 1O08A 2B1RA 4BX0A 4L6CA 4UMFA 4Y3UA 1L7MA 5AI5A 5A3SA 2IA5A 5A3QA 3RFUA 1L7NA 2HOQA 3R09A 3ET5A 5ALEA 1Z4KA 5AKZA 4QJBA 1ZD5A 2FPRA 5ALOA 5ALWA 5AI9A 3PCTA 3E58A 4UU0A 5AI6A 1Z4IA 2R8EA 3B9RA 1ZD3A 2WF6A 3QU5A 5ALTA 2YMLA 4UASA 4UU1A 3ZW7A 4GIBA 2AMYA 3FPSA 2FI1A 3U7EB 2JAOA 4YIHA 3DAOA 3I6BA 1RQNA 3M9LA 2W11A 3KBBA 2B8EA 3ZVMA 2P9JA 2YJ4A 3M1YA 3OPXA 1IWOA 1Y8AA 1N9KA 4XPZA 5AK3A 1MH9A 3IRUA 3OCXA 1TJ5A 4DW8A 4KNWA 4J03A 3N07A 1ZD4A 2C9MA 5AM3A 3MMZA 1O03A 3ZWKA 4ZEXA 1X42A 3WKEA 3QU2A 5ALQA 5AKHA 1S8OA 5AW5A 4C4TA 4BEVA 2FPWA 2YBDA 4BX2A 3MN1A 4Y2RA 3R9KA 4ZEVA 1NNLA 2NO4A 2B0CA 2CN1A 3ONNA 3L7YA 4Y2SA 2QLTA 4Y2VA 1ZRMA 2JAWA 3EF1A 5AKJA 3BA6A 3SLRA 2G1AA 3ED5A 4FYPA 1WZCA 1ZS9A 3AR6A 1J8DA 3L8EA 3A1EA 1TE2A 3P96A 3W5BA 1EK2A 2NYVA 2I6XA 4CF3A 2EAUA 2GO7A 1Z4MA 2IYEA 4UAVA 3NUQA 3WKCA 2G07A 2O9JA 4J2TA 3SMVA 1Z4LA 5AKIA 4KX3A 3AR2A 2PR7A 3DV9A 2RARA 3WK5A 3L0CA 3ZU6A 2YJ3A 2HX1A 2G06A 2ZBFA 3ESRA 4OCZA 2WHEA 1L7PA 1RPZA 3SKYA 4HAIA 4JDPA 5AVXA 4EX6A 4Y2XA 2GHTA 4HGOA 3QYPA 4YCLA 1YNSA 1YS9A 3QU7A 2YFYA 3I28A 2Q4TA 4UM7A 3KC2A 2B30A 3ZX5A 2R8ZA 3NALA 3L8GA 3KD3A 3GYGA 5AW3A 2RBKA 1YJ5A 2JAUA 1RDFA 4XQ0A 3KDPA 5AKXA 1XP5A 3L1VA 2G08A 5AVTA 3PDWA 2ZG6A 2JGAA 3B9BA 4G63A 3ET4A 4UAUA 4QQFA 4UMDA 1Z4PX 5AM1A 2PQ0A 4DWOA 2ZBGA 4BNDB 5AW4A 3HLTA 1QQ5A 2ODAA 4O8CA 1QH9A 3UMCA 1WPGA 3U7HB 1EK1A 3PGVA 3SHQA 1RRCA 5ALIA 3NASA 3L5KA 5AW8A 1L8LA 5AW2A 3NIWA 1CR6A 1U7PA 1Z4OA 2PKEA 1RQLA 3OTQA 2R8YA 3QNMA 4YGYA 4Y2PA 5ALYA 4NWIA 3ZVNA 1QYIA 2HI0A 4L57A 3U7GA 5AHXA 3DDHA 4BEWA 2OYCA 4DCCA 4EX7A 3PGLA 2GHQA 3SD7A 5AVUA 4EZEA 5AKLA 5AI0A 4OFZA 2WF9A 2IOFK 1YMQA 2I34A 4NAVA 3TLMA 2G09A 2FDRA 1AQ6A 2ZBEA 4FE3A 3DNPA 1U2SA 2JARA 1PW5A 3I76A 1ZJJA 2BDEA 3QUTA 2FEAA 4XE5A 1SU4A 2HF2A 3OCZA 2MSNA 3K1ZA 3UMBA 4NV0A 2HCFA 4BBJA 2FUEA 5ALXA 3FVVA 4F71A 3QU4A 3L1UA 1RKUA 1YV9A 4HGRA 3WK9A 2AUTA 2W43A 3L8HA 2HO4A 2YMQA 3CZ4A 1Z4NA 1JUDA 4ZEWA 1ZRNA 4EENA 1LVHA 4NFLA 3N1UA 1J97A 5AM0A 5ALVA 3W5CA 1RLTA 1QQ7A 2YJ6A 5T41A 3E8MA 4KNVA 2AH5A 4HYTA 2FPXA 2O2XA 2Q4RA 4Y2QA 2AGVA 4KN8A 2EATA 5AM4A 4AS3A 1WVIA 4I9FA 5AW7A 3QLEA 3F9RA 4KYTA 2Q5EA 3D6JA 2CFRA 3NAMA 1RLMA 4F72A 3AR9A 3N8GA 3WK4A 4YCMA 3HYCA 2WF5A 3OCWA 5AI8A 4YH1A 3W5AA 5AW6A 2ZXEA 1K1EA 2OM6A 3U26A 2P27A 4AS2A 1ZOLA 1SWVA 1TJ3A 2WF8A 1Z4JA 5ALDA 4HGPA 4UW9A 3E84A 1RKVA 4E88A 2ZBDA 3OCVA 3QGMA 3QX7A 1TJ4A 5AKEA 2QYHA 3BWVA 4UATA 5IS2A 2VKQA 4OHFA 4JB3A 5ALPA 2CFTA 2I54A 3AR3A 3WKAA 4BX3A
chains in the Genus database with same CATH superfamily
1ISPA 1AQUA 2ABWA 2RGBA 3IIKA 4L27A 3A05A 1NP3A 3FKSD 2MWMA 4F8EA 4CE6A 1H94A 3R77A 3N8NA 2Z30A 3P5BA 2CLKB 4QGHA 2HT6A 3QXGA 2PU5A 3W77A 3WDMA 2O23A 4EKGA 5JBQA 3ZV7A 3H99A 2QTVB 3FSGA 4G0QA 3LGXA 2GAAA 3EXG1 2NU6B 4EY4A 2VYQA 3DXYA 3J7TA 4J7UA 4B3TB 3VV3A 2ZKIA 2VTBB 3KQMA 2G25A 1PR4A 4TQAA 4NCBA 4G09A 3QW2A 1NR7A 3M6VA 5GONF 2P9EA 4ZU3A 3K0CA 1X7HA 4DG9A 4C88A 3LOQA 5E2IA 1FC0A 3PDJA 4MK4A 2ZTVA 4YRRA 3ZCUA 3A6GA 1MAUA 2FN7A 1B7GO 3D2BA 2BEKA 1U3FA 1FXSA 3ORFA 4MRMA 2XCQA 4XX1A 5HFAA 2AWNA 3N2NA 2ZIVB 4MVJG 3KOZA 1P45A 2BGJA 2C04A 2OKGA 4NFYA 3L7BA 2GEDA 4RZ3A 2I55A 1FFAA 4FWTA 2J9FB 2CKMA 3G7UA 3TGWA 2I6TA 1T6ZA 2YS7A 5THKA 3GVIA 1Y3DE 2YHBA 4PU0A 1OZGA 2DBRA 3ZZUA 3PC8A 4BX9A 5IJZA 3EIEA 5KYYB 2ZPUA 2YL2A 3H86A 4Z0NA 4M7OA 5B7NA 1JR6A 2WILA 1GG2A 5CFZA 5K3DA 3ETEA 5ANRB 2XNKA 4B2YA 1JI0A 4QPJC 1RI1A 4QDZA 4RHUA 2LIPA 1XF9A 1KJJA 1NQXA 4Q02A 2ECFA 4XVHA 4HZGA 2OCAA 3AJDA 4B6JA 1EU1A 2EBFX 4I5GA 1MEOA 2GM9A 3N9IA 4E1BA 4UEQA 4HRXA 3K05A 5HS4A 1V5FA 5LU8A 2ERCA 3OQPA 2GKOA 2HJ9A 2VXBA 4D0NA 3EX7C 3ZN2A 2PUEA 3RV3A 1IMJA 5CNJA 4QU0A 4EUHA 4LQCA 2RJOA 5AVRA 3UMMA 4JK3A 1LB1B 1KO8A 1S2OA 5B5SA 3KXKA 3QI7A 5FOSA 2HV9A 4HNUA 2WJ6A 4JMPA 4Q34A 4EW6A 3ZYZA 1STOA 5G0VA 4BFSA 2P9BA 1WV1A 1J5PA 3QBVA 3T61A 4BWGA 1RPNA 1DOAA 4UZFA 2WSSD 3ADDA 2Q3EA 1XAHA 3CRVA 3DOCA 4IOLA 1EVQA 1MH1A 1Q0UA 2JH8A 4OUDA 4QEDA 5HKOA 2EDCA 3ZH2A 3KSZO 1TUBA 1WSDA 3ROXA 2I99A 2B82A 2JAXA 4A3SA 3I53A 4XW2A 2QQEA 1EJ0A 1ECGA 4Z4IA 4RL4A 1FYVA 1TMGE 3MNFA 3KAPA 4XIIA 3B3FA 3BCHA 4KPUA 3LDUA 3GHYA 3GNTA 4N01A 1RRPA 3FOWA 3ZNNA 4G1MB 2CJWA 4EA6A 4UOEA 4IHJF 2D2VA 1SZDA 1NN1A 1USUA 2MMGA 4M0MA 3C5WP 3PDHA 4KYIB 5A1JA 2DUJA 4QRIA 2OLJA 4GF5A 1LQ2A 1IN5A 1N25A 3DL4A 3MUFA 4GBJA 4UHHA 2ZYGA 4UEJA 3SX4A 4BNLA 1JKFA 5K6TA 3HLKA 1D8TA 2B6NA 2OZKA 3NR2A 3CWCA 4ZXFA 2UZ4A 2YQ4A 2ZTUA 4FYMA 1GQQA 1ZK1A 5AVKA 3MMNA 3MMXA 3Q72A 3EY4A 5IDYA 2IZOA 4OLBA 5DVZA 3UANA 2ONZA 4CM7A 4YCNA 3RBAA 2C4WA 2VR1A 2I2AA 3FHOA 2A35A 4CCYB 3TLYA 1EBFA 1LDBA 3LA8A 1GAQA 1KI6A 3OIUA 4E4TA 3OEED 1D0SA 3OSZA 1Q16A 2IYYA 1AV7A 4D74A 4WK6A 3C41J 2PS0A 2ZS9A 3HRKA 5JEDA 3B70A 2FEXA 1UBJS 4IDPA 4CMJA 1MA0A 2ZTHA 1IAVA 5ALLA 3D5EA 3QUSA 4OP2A 1BX0A 3M1LA 3STWA 3GCWA 2NXNA 1W8DA 2IYRA 1V4VA 4O08A 2VJKA 4X24A 4KR3A 2YMPA 4XJTA 1I7DA 2IU0A 3ERCA 4O4JB 3FKJA 4FNAA 5BYJA 4RK1A 1KAMA 4F3KA 1XRJA 3GNQA 2D74A 1DADA 3B89A 3I39X 1XLTA 4II3A 5A4MS 1XYGA 4YCJA 2C0PA 4KQGA 3JYPA 3A27A 1I3CA 3VNVA 2E49A 3AR7A 4Y18A 2VRCD 1X7WA 1FP2A 1XNJA 4HI0E 4PNPA 2XD4A 1QFXA 5JS6A 1AUQA 1UT5A 2B34A 1G0OA 4FBLA 4BWYA 1SG6A 2BGKA 2GXSA 1M34A 2GM5A 4RCVA 3IAM1 4N12A 4YB8A 1OLUA 4MI6A 1Y42X 1XEFA 5AHRA 4IIVA 4UVDA 3B6IA 1D1TA 1X7XB 2GK4A 1G42A 3L0SA 4YRLA 1C3EA 3F4KA 3QFFA 2VQSA 4J4TA 2E48A 1JDSA 1DC4A 3NGXA 3TLEA 1L7AA 2IHYA 2X0RA 1XTVA 1FDVA 4H59A 4JMLA 4QDOA 5GMOA 5JSHA 3NWJA 2K2WA 5FULA 1WABA 2WG1A 1OBFO 1VJCA 3MJHA 4YQZA 4EB6B 4WERA 5E1OA 1K5PA 3LSTA 4UQPA 1O08A 5AR1A 3CUKA 1AHIA 1B74A 1F8YA 1KJYA 5ARCA 1JDPA 3O4HA 4BMXA 1PQ4A 1WKBA 1E1YA 1K0FA 1K7XB 3G9QA 1J8FA 4R41A 4YA6A 4AL4A 4QSHA 1WXQA 2JBWA 1F4VA 4KR6A 3SQXA 2JJ1A 3G13A 2Q2NA 3BMCA 4F2GA 4A0QA 5DJ5A 4CKBA 4WNAA 3VKVA 4MCAA 3DAFA 3OZAA 2W37A 3KYBA 1KGDA 3AL3A 2BKUA 1C5KA 1EWVA 3ECSA 2J4FA 4IEEA 1YOVB 1CRQA 1Z4IA 2R8EA 2OXFA 3MBKA 3H3FA 1T5LA 3QEMB 4BBZA 1IOLA 4ZVSA 1Z62A 2JLBA 9LDBA 1MDFA 3EYWA 3HVRA 1ZGCA 3ELWA 3LP6A 4G0UA 2J32A 3NLLA 1XRQA 4GIBA 5K03A 1TI7A 1SELA 4PYKA 1TYDE 2H6EA 5DCWA 1X1RA 4MHTA 4WUTA 3H75A 4I3HA 3ITNA 3IUYA 2E6KA 3BWYA 3CH6A 5MGNA 3F7NA 3CZQA 3JVIA 1KARA 3RF7A 1HOTA 1ENOA 4LE2A 4MCIA 4TLCA 4L8VA 3SFVA 1T2AA 4M8SA 4QPCA 4ZK2A 5A1TA 1IG3A 1OHHA 2AMVA 4NBTA 4P4SA 1OYYA 4RVDA 3E3MA 4F8JA 1E6CA 1ZN9A 3G79A 1NURA 2A0KA 2YNMA 1OUMA 3NHLA 4KQJA 4NH0A 5IXSA 3BIWA 3AK4A 3NPMA 4FFMA 4CG1A 2F1KA 2R6ZA 1ZD4A 4A73A 1HYHA 4Q3AA 4HSEA 2X1MA 2BMEA 5I47A 4CGYA 3GAAA 3D5TA 3NOVA 2G8LA 3C3BA 1EGMB 1WDTA 5CVVA 2Z6QA 5JAIA 4Q9AA 4JGGA 4UTRA 1I10A 4Z4CA 3DMNA 3R9KA 1DKMA 3OLYA 1QQAA 4O5AA 4O4HB 3SS8A 1HLFA 1R8QA 2HXSA 4X7RA 4Q3KA 3C3EA 4N0EA 3H7AA 4TWBA 3LPNA 2FPMA 1ZXLA 3GRUA 1SH7A 4BQPA 3HCFA 3X1MA 1VG1A 3ZDRA 3PWZA 4D4MA 3QVGA 2Q1WA 5BRJA 3PR2B 1KMIY 4RQTA 1RXIA 3AWIA 3AY6A 3VPAA 2R1TA 4ISBA 4IH1A 4Z9YA 5DGDA 4FFBA 1OB5A 3FF4A 4A5SA 4BGIA 4GR9A 1V16A 3PSAA 4DUZB 2XGJA 2V7PA 3PXEA 1NUAA 4S04A 5HKLA 4R05A 3KNZA 2X8WA 1HLDA 1PP4A 3FMOB 1OC4A 5D6NA 4R2WA 3T5DA 3WLSA 4FBMA 3E2PA 4CVNA 4PAWA 1M8FA 3O4JA 5KNDH 1G3IA 4AZ0A 4MS3A 2IEIA 4GLFA 4WD3A 5BV7A 1A8IA 3QVTA 4DCMA 1PJRA 421PA 4EKNB 4F56A 1EG7A 1UJ2A 4B8WA 4XWYA 2Q8PA 1K5GA 4UDNA 3FDZA 1VSQA 1YL6A 4G5FA 2BBTA 2P2ZA 4J0EA 2IPMA 3F2IA 4UD2A 5HIKA 3N75A 3JWHA 4NFSA 4CG3A 4OGLA 3RJTA 3F0TA 3PUKA 5EHGA 4YCLA 5REQB 3GHHA 2VHWA 3L0PA 1RRGA 3DFKA 4EHNA 1IJBA 5LP1A 4Y6OA 3KOMA 3LXRA 2ACKA 4BB6A 1H66A 3A6LA 5ADHA 5L3SB 1NKSA 3A4VA 3T3GA 1U8YA 1E3LA 3DEZA 3H8VA 3HH8A 3A7DA 5D3QA 2C5GA 3KDPA 1ZBDA 3NTQA 1XLTC 1XP5A 1M66A 2PRZA 2HZ7A 3ZWPA 1QV9A 3EY9A 3PDWA 5CBPB 1OGIA 3AO0B 4UAUA 4YLGA 5EJ8A 1T8RA 4RBNA 3ZZNA 2IHZA 4U63A 3U40A 4KKXB 4YRGA 4PG8A 5FDFA 1QQ5A 1QG2A 2NO7A 2NYUA 2VDJA 4QFBA 2AFIE 1M6VA 4ZCLA 2CJXA 2RHTA 3EB9A 3PDIB 2ZXUA 1IEXA 2IELA 4QGGA 4X71A 3SHQA 1B15A 2OY0A 2QL6A 1S3IA 4BV9A 2XF2A 3EW9A 2H4XA 1Z7GA 4IGFA 5EJ6A 3UKJA 1X9HA 2HXYA 4RH0A 3RIXA 3BGVA 4MWDA 3O7MA 1GUAA 3IMFA 1KK1A 4ESVA 4Z99A 1NVVR 1NVEA 5CHYA 2PKEA 3I2JA 1JQJC 2CF6A 3OIYA 3PI7A 2WYWA 4FR2A 4Y2PA 4ZWNA 5CAEB 1Z75A 2XKKA 3ZVNA 1OXXK 4R7TA 4CIDA 3F6CA 4Q4DA 3S44A 4M54A 2OYCA 1U7HA 4WH0A 3Q8MA 2R1UA 1PG0A 3GJYA 2IY7A 2AJCA 4P3OA 4YAOA 2DHEA 1Y1QA 1A5ZA 4IUDS 2WSYB 1TCUA 1FP6A 2PEZA 1QUEA 3G0CA 4H77A 4EZEA 5EWLA 2IUUA 1XDGA 3FRHA 4I1UA 2ORYA 5F1YA 5T3YA 3VM6A 1AUXA 5CXXA 4DMFA 2XTMA 4C5CA 1FTWA 1JJFA 4L22A 3WWPA 3BWDD 4HUJA 3Q1LA 1AQ6A 4GDFA 4LF5B 1T1JA 1ZU4A 5I48A 4IIGA 1J06A 3NS7A 3DTYA 4P83A 5FI1B 1G59A 3H4MA 1XDWA 3IESA 3IYLW 1RWOA 2OESA 1YL5A 2YJGA 3GFTA 2RMKA 4FGKA 2PUBA 3SAJA 4ZHSA 1T2FA 4ITUA 4LOLA 1D2GA 1T8WA 5DRTA 1J2UA 3K1ZA 4UBLA 2OV2A 4KQ6A 4W82A 1XMPA 1UCFA 4G5SA 2IPOA 4BP8A 3L7DA 1GL3A 1T6YA 4JOQA 1IM8A 3PGA1 2YWCA 2QLNA 1KC3A 2HFKA 2N1BA 5JZ9A 4NYIR 5HQJA 3Q88A 4A27A 1WCYA 4BFCA 4JUIA 4DZTA 1QMGA 2AI3A 1XTIA 3KZMA 3VV2A 1B8NA 2WA1A 3UCFA 1V1MA 2ZIUB 3L40A 3FW1A 1Q95A 2BTQA 1KEKA 3TAHA 4RSMA 5A03A 4OA5A 3NATA 1R16A 1SCQA 3TLKA 5JTTA 2ARKA 2BMAA 4RULA 1P1BA 1UBMS 4ZDJA 3OETA 1V7CA 3O90A 1GTMA 1ZIXA 3MWDB 1OBOA 3HB9A 4PF1A 5EI5A 2WUDA 5KAPA 2PUFA 2JJYA 2P3SA 4M88A 1QP8A 1EFVA 1BGVA 2JI6A 3JQFA 4B17A 1YCFA 2BI7A 2H08A 4R84A 5SY9A 3AOEC 3A0RB 3R40A 5L8VA 1CT9A 1JLMA 1W0KA 3PNSA 4ZOBA 1Q1NA 4CNBA 1OIVA 2X23A 3QXXA 4PX2A 4V1CB 3OLCX 1Q0RA 2DPYA 5K5EA 3IX7A 1ZUIA 3K9BA 2DFNA 2FW6A 3E7WA 3I8SA 4RCYA 3TDNA 3BCRA 2XWJI 3VC3A 3NAMA 1W46A 4J9UE 5EZSA 3R8XA 3NQ41 5JVDA 5KOJB 1D04A 2WVAA 1T5OA 3HKEA 3IUMA 1WHSA 2ISQA 3HM2A 5HQTA 5L4LA 5DTMA 5FUYA 5ECYA 1M6NA 3ER6A 2QVXX 1LK0A 1R4NA 2PG3A 3T9AA 4TZKA 5CLQA 5L6MB 4Y7CA 2JA1A 4R83A 2ZANA 1XZBA 1XTTA 4MI3A 4A2WA 3KXDA 4DADA 3EHDA 4J16C 2ETXA 3G5AA 1XL0A 4G5RA 4KP7A 3NTOA 4NBNA 3DEJA 1G5FA 3RUAA 3ZGYA 4C1BA 1RD4A 1E5XA 2QX9A 5LB2A 1USVA 1R8JA 2Q0SA 2Q1YA 1UP6A 3NT4A 2FCAA 2FY8A 2VHEA 3NP9A 3U3OA 2GJ8A 4WBNB 4D57A 1NF8A 1G3UA 1M76A 121PA 4OHFA 3D4BA 1BCSB 1ML4A 4X93A 5FBHA 3LQYA 2CZGA 1DRUA 1K98A 4JQSA 5L3ZA 5C2JB 2I9KA 1U04A 1U0JA 4FI3F 4YFYA 4NV1A 1Y4ZA 4BKPA 4NZMA 2RONA 4RTKA 4MI9A 3GLGB 4YRAA 3E82A 3D7MA 3H1PA 1XOIA 1X8LA 1BKYA 2XYQA 1Z7WA 2C5FA 1NRWA 3ZJUA 3CNHA 3PQ2A 3H5NA 2WJWA 3JZMA 1EK5A 2WKRA 2EZTA 3A9WA 4JYBA 3DO5A 1XAIA 1II9A 1P4JA 3C8DA 2XTJA 1L4GA 1G8AA 1QX3A 2CNOA 5COQA 3HDGA 2ZZNA 4LNHA 4NYJQ 3K6SB 1XZNA 1CRLA 2DERA 1JNXX 5DHAA 2VNJA 1NNI1 3MT0A 4AF8A 2R00A 1S5PA 1RWKA 3ABSB 4OQLA 5AQEA 4C4ZA 1CUDA 2GAJA 2NU6A 1MC5A 3WL6A 1BX3A 2VTDA 1ZW6A 3HN7A 1NM5A 5EJGA 4AK9A 4EGJA 2QSZA 2VTBA 5CCXA 2PKRA 4BVGA 3W6ZA 1E20A 2I67A 1F2TA 3JAMA 1QJCA 3ZDZB 1N2OA 5BWBA 2QPOA 3IQWA 4PZCA 4Q3LA 3EXAA 3OEHA 4JI2B 5BR1A 4CHGA 2HJWA 3NBMA 2AJDA 1X39A 3MT7A 3GY0A 1P19A 3QG5A 1Y7HA 2A4MA 3DVAB 4OHXA 2AJTA 3RC2A 3FZQA 5F76A 4IYRA 4CF7A 2JK0A 1L2TA 3IB6A 4PCAA 2EFCB 2WYOA 1T9HA 2HV8A 2FR8A 1TMOA 4PVCA 4RKQA 4ER5A 3BQ9A 4QFCA 3H3XA 5K0EA 2I4OA 1GFIA 2Z3WA 2J9FA 4CEHA 3EGOA 2XKJE 3LS2A 5JJ5A 2W4QA 3MTIA 3Q8XB 1L4MA 3QF4A 4C01A 1F8UA 5A2QA 5ALSA 4FX2A 4PXYA 1PVDA 1WR8A 2PWZA 2XA9A 2YYAA 2Z2ZA 3ZHXA 4CETA 1O89A 3ZTTA 3HACA 1VJRA 4RDXA 4LY0A 5EJ5A 2O8EB 3P19A 1K6JA 1NMYA 2A67A 4KPYA 5LQAA 1Q0HA 2GHRA 1A9ZA 3K5HA 2BCJQ 1HDXA 5HJ5A 1RLOA 1CR0A 1NRJB 1H6CA 1Q20A 2H1CA 3TZEA 3EEYA 1DJNA 4RGVA 4QJ3A 2F9FA 7ADHA 2JJ8A 4GSYA 4N4AA 3GGPA 3W9BA 1L1RA 1RHMA 5L7TA 2EWMA 3O5AA 1JTFA 4J0DA 2XYPA 1DBWA 2YZKA 2WZBA 4U7DA 1OMOA 1RJDA 2F3RA 4F91B 1AQNA 6ADHA 4KITB 2ZRFA 2Q6KA 4TL8A 4R98A 5HUHA 5DNEA 1TB4A 3MUNA 3WYDA 3AVVA 2HA2A 4RD0A 4B2LA 5EJFA 4Z0HO 1C9EA 1WZNA 2P40A 3R1IA 5BMVA 1Q22A 1YJQA 4GNKA 4ZZ1A 3B9QA 3MT9A 5EPEA 1NW6A 2Q5CA 1QYDA 1VIDA 5KNBA 2Q49A 3F71A 2KPOA 3DZBA 3LRPA 2AV6A 1M1YA 2AKYA 3R3HA 1GQFA 3BL5A 4RMNA 5TVGA 3O92A 3N5KA 4FILA 4CF6A 3I5YA 4K6MA 3G5TA 3NGLA 1ZWLA 3KTFA 1YZGA 2JK1A 3OBIA 3Q8KA 1PT8A 2A1TR 2MMCA 2B83A 1D4OA 2QJTA 3DZHA 3PFKA 3ADCA 1QV6A 3D0KA 4DVGA 1KAOA 2BAGA 4I9UA 3USES 2R751 3LUGA 2QZJA 1J33A 3OESA 4JQZA 3LUKA 3VH1A 1NQOA 1Z0ZA 1JAIA 4H6VA 3OAAA 1ZMOA 2X1HA 4REQB 3QM1A 1RTTA 2VDKB 3PT9A 5BSVA 4WDQA 2R4QA 3JD1A 3UAVA 2AD5A 1XRRA 4I36A 4UMVA 4FEAA 4LV8B 3B1XA 3FM9A 4PICA 1KVSA 2OPBA 1G5PA 3F5FA 1IY9A 1Z8FA 3PD1A 2HRRA 4FYVA 3GLUA 4CBVA 5IWCA 2ZYTX 2P8JA 2A94A 2EKBA 2JLYA 4B80A 1MRZA 2JAPA 5CK5A 1B41A 2FWRA 3ZBTA 1BVRA 5G40A 3DJFA 1IYZA 5KDLA 2CCGA 4OSEA 5A4KA 1YL7A 3MC1A 3T1QA 3U7IA 3LMKA 2I2BA 1VP3A 2TS1A 4IGAA 1PSWA 2P41A 2G04A 1RKXA 4YIKA 4V3CA 2FQXA 5E0OA 4CCYA 4D8YA 4RYDA 1BD3A 1XA4A 4G41A 2BFEB 1NLMA 3DL2A 3E8SA 3E81A 4EF6A 3T5AA 3M6WA 4K0KB 2AW3A 4FZ3A 4GLOA 1M74A 2DRIA 3FVWA 3JQ9C 3KLBA 1UJNA 5KNLA 2JZCA 2BTOA 1R0XA 3IKLA 4HNRA 5C31A 1DZIA 3DA8A 3L8DA 3R0IA 1TFUA 4K6GA 4OHUA 1XTUA 2IHJA 3M0EA 1IN4A 2OV4A 2R4UA 4LZNA 2BH2A 4FLEA 5FQOA 3TOCA 1D2MA 4YROA 4B34A 2HZBA 4ZT6A 4ZGBA 1N8TA 3MF4A 2EP7A 4ZVUA 1QFZA 4R2IA 2G0AA 5BV1A 3KB1A 4P3XA 3LAWA 1D7AA 3LGAA 4MWOA 3NVAA 1GTL1 3B2QA 1KYIA 2Y1KA 3RUDA 1EB8A 2G88A 1QX4A 4EYSA 5LL6P 3RSHA 1E0SA 3ME5A 4GWGA 5H0IA 3C2QA 4PZDA 1TUIA 4QL3A 4C43A 3AYXB 2A0XA 5EUMA 1ZSYA 2GCIA 3DG9A 4Q3BA 1I4OA 4HY3A 5H16A 3R24A 2OGUA 2VJLA 5A3QA 4HWOA 3REOA 1UINA 2PZGA 1OH7A 1NYQA 3EISA 4QYWA 4BU0A 2ZUEA 3EGWA 1JSZA 5TXGA 3W6OA 3RE1A 2F3UA 2GFIA 3E58A 1M1NB 2WQ6A 3I9JA 5ESDA 3HDHA 4MDYA 4ZJYA 1IG0A 3CUWA 3IMEA 5ECGC 5FOUA 3L7KA 3SC4A 4X61A 4UTPA 1NE7A 4JR0A 2YMLA 5E1MA 5CDFE 3JQ7B 4ENTA 1ZICA 1NN5A 4DSUA 1HL3A 2JB9A 1IULA 2FR8C 3EZXA 3P45A 2AN5A 1M8PA 3F5QA 3I8OA 1H2EA 3OM9A 1RYZA 4JL6A 1N0WA 4P93A 4Q19A 3T54A 4V24A 1ZJ5A 4EDFA 2P4EA 2Q3MA 5IH3A 3OY2A 3LJKA 1I32A 1Y3FE 3DYIA 4OP1A 2Y1FA 4CU5A 2JDIA 2QTAA 3DDCA 3EQ7A 1FLAA 2V5VA 3AZQA 4EY8A 3HE3A 4FJ0A 2HWUA 3ROPA 1Y8AA 1MOPA 3GF4A 3KKLA 4QBHA 1CXZA 1USKA 1HPLA 4PVDA 4CCSA 1EB9A 2C2GA 4DDKA 3S5JA 3NKFA 3H5TA 2FPPA 3RVKA 1I7SB 2WG0A 1KWGA 4WK0B 2QYOA 3TTXA 4IKOA 1UBFA 1V2HE 1W0JA 1FNCA 2W2OA 3Q3VA 4FE7A 5AJUA 3TQFA 2XCIA 1J9EA 1F4PA 4RVCA 1RI4A 3V7YA 2Z5LA 5MGBA 4PV7A 4X92A 4ARAA 1EUYA 1ZOIA 3H1TA 4ARSA 4N82A 4ETNA 5AKHA 1S8OA 5LLTA 3BE8A 4XWKA 2FP3A 1MTZA 1WS6A 2QM3A 2VS1A 1ZGHA 2O3JA 2R48A 4L1KA 3ZQ6A 5DU2A 1JJBA 4HN2A 4NBRA 4JN6B 1DIOB 5EMJA 3AFIA 3K09A 4G1UC 4Y2SA 5IF3A 3EF1A 4JUAA 1XTRA 3BA6A 1XCOA 3CMCO 2HMSA 4BNJA 4DC0A 2QWXA 1GZ7A 2ZSFA 2WHQA 1B3RA 3T1NA 1L0BA 1XD2B 1XJ5A 3UENA 2GAOA 3B1KA 4HD8A 2QRNA 1GGMA 1GPAA 3L8EA 4JBNA 5F2KA 2ISSD 3E0XA 4C2AA 4LHSA 4U2EA 4C5AA 5KNCH 1OYWA 1TE2A 4KR7A 5KHAA 3GFRA 2A7QA 4O4HA 1TK2A 3EVNA 2GLUA 1QZ3A 1PZHA 1CDOA 2O14A 2PFGA 2XGOA 3RYCB 1QYCA 3GFFA 3QSYA 5EGSA 4IIXA 5LYYA 2O8CB 4MAFA 1R18A 1EM8B 1YE3A 1YONA 3GH3A 2FEPA 8MHTA 4W5NA 5G02A 3DTNA 3U7RA 1A98A 5HQ3B 1XDBA 4OCZA 2CB9A 5IAKA 4OHMA 2IHKA 5DTJA 3KLNA 3JATB 4PX3A 1U0FA 1IIRA 4I4IA 5J5VA 3VHRA 4BGUA 1I9GA 1CR1A 2EFHB 1ODLA 4HL6A 3WLTA 4DIUA 4ZICA 2J30A 4ED9A 4ES6A 1QGOA 1WSAA 3R4VA 3QYPA 3HCDA 4FQ8A 1ADYA 2VNSA 1M8KA 3K3PA 3NHMA 5SY4A 2AFVA 4DG5A 1VKOA 1P1HA 4GSKA 2UYGA 4ZARA 3PEYA 3U3DA 2ZIWB 5HF6A 2JGIA 2J45A 3KD3A 1ZXBA 1ADBA 3V46A 3VKWA 2C5BA 2CNNA 5AXDA 2X22A 1NQTA 4ESEA 1GG9A 1AN0A 3S2EA 1BVYF 4ZDWA 1QRSA 1FMTA 5MFZA 3L1VA 1JEAA 2GYVA 1CNEA 5EUCA 3KZKA 1W52X 4DAEA 1UBRS 3WR5A 5G1OA 2IIQA 3P2OA 4BNDB 1CS0A 4AQDA 2IOYA 5AW4A 3BXGA 5KQGA 4UE6A 1NXXA 1RFGE 1ZM4A 5COBA 3SR0A 4FFOA 4C0BA 3HPQA 1U6KA 5LB4A 4G4JA 3N05A 4CEJB 3SF8B 2XWSA 3ZHOA 3EARA 3LUBA 5LBUA 3BSYA 1UUFA 2JZOA 4OHBA 4D99A 4EQ6A 5KOHA 2KWIA 4OJKA 5CBPA 1RJFA 4WPGA 4W5TA 3RSLA 1QYXA 2GCNA 2XVZA 5KU1A 2NSJA 3BTUA 4I55B 4EG5A 4E4YA 2OBMA 4DEXA 2I6QA 4HPXB 2NIPA 4MOWA 1I13A 4JITA 4ALKA 2QW8A 2PYZA 4YDRA 1KXZA 2B94A 2FSFA 2PO5A 3BIXA 4NBKA 3KUXA 2X40A 4GECA 4PQEA 3BGSA 3SC2B 5ICGA 5JMWA 3LXUX 4YAWA 3WQHA 3ZUGA 4G4GA 1OYOA 4Z9FA 5HDQA 4DJEC 1NV8A 1R0KA 3LXMA 1UC8A 3MELA 5DX0A 4HR7A 3OQBA 1R0LA 3DKRA 1A96A 2XVXA 5AKLA 1RAFA 4NMMA 4O1IA 2NWQA 5EVJA 4ZMSA 4AS1A 4IMIB 4IDQA 3UWOA 3IFSA 4BZXA 4OQ4A 1KI3A 1T13A 1C9YA 1UAGA 2G09A 2I3ZA 3GLGE 4RA9A 1FTGA 1ZVKA 4HB0A 5LNK1 2GBFA 1EK0A 2B69A 3LBYA 3MIIA 3P52A 3HSKA 4LHZA 3TLBA 2GF2A 1T0PA 2VSNA 1V96A 3BTSA 3QPDA 1XMIA 2ZJAA 5T4BA 3LBFA 3B1YA 4EI7A 2MSNA 1GN9A 1DMRA 2ZWMA 5FTLA 2H1WA 3MIZA 1UAYA 3DYVA 3OZIA 4FDLA 4OHVA 1NMEA 3WGTA 3IURA 3QNUA 4PIMA 3ENVA 5P8WA 4AG5A 4IS3A 5BYBA 1HZZC 1YJ8A 4IDCA 2PBLA 2GX6A 2KS6A 1JE1A 2Y2UA 3PC3A 4WXEA 2ACEA 3DAGA 2GCEA 3E9EA 1E2LA 3GZJA 4TTAA 3TZQA 3WB9A 2ZJ4A 2AF3C 2X2OA 3PFGA 1CDDA 4IJQA 3UJNA 2QQFA 4BAGA 4NOJA 1OV4A 1XU4A 4Y6RA 1I2AA 2XA2A 2D3TA 1NXVA 3TJRA 2FSVA 4ACAA 3ICQB 2WWWA 1E3EA 4GMXA 4DF3A 3ITDA 3TAXA 2M9MA 3HUFA 5KI6A 4IOMA 3E05A 2RAFA 2YVQA 5IDWA 4JDUA 3O7WA 2JGMA 4J0FA 4G67A 2ONKA 1H8HA 1X1TA 1X2EA 2IBSA 1CY1A 3R9IA 1GZ5A 2PX4A 3C3AA 1O6FA 1MEJA 1P1JA 2FPXA 3BORA 5TX7A 2AOWA 3SY8A 5LDDC 2F7SA 4UULA 4ECAA 2R25B 2YQZA 1QG0A 4REOA 4AUKA 1H0RA 2BSAA 2EZ9A 3ETJA 3PXAA 4AURA 2C2KA 3MWDA 4I8IA 4OI2A 3BF7A 3P9QA 3O0DA 1UH5A 2DF8A 4DBLE 1T8UA 3GFGA 1FSPA 2QW0X 1OA1A 1H23A 2NZWA 1A95A 3DAPA 4GNRA 5FEMA 5AD1A 1ZVJA 5TIIA 2EGGA 2ST1A 1U9ZA 3U3ZA 2YRXA 2WBLC 2QS9A 4CIVA 3R5FA 1C0LA 1UL1X 2V3CC 2VYND 1HI9A 5C7IO 1Z7YA 3FKQA 1IK6A 1SOMA 3R0ZA 5CM8B 3CVUA 5ALDA 3UYLA 1ORIA 2NM0A 4JI6B 3ADOA 3FSEA 1SFRA 3AY0A 4XUEA 3WLIA 2YH2A 1XPRA 4E88A 3M6AA 1Q83A 2GZDA 2X7XA 1RHKA 3KK0A 1FB5A 5C8VA 1P7WA 1I6KA 2VKQA 3PPYA 4JOBA 1CJTC 1AV6A 4NQZA 3IIMA 2UAGA 2JLRA 1ZM9A 4JJAA 1UXOA 2P0YA 1IRXA 4DG8A 3EFHA 4KR2A 3VR5D 1XNRB 1KH1A 3GFSA 2PRSA 3L18A 2AR7A 2C83A 1CZKA 1BW9B 5DYYA 5BOVA 2J5XA 2VSFA 2BEUA 2EFDB 3HS3A 4RM3A 1CERA 4BV3A 3RYTC 2W90A 2C3OA 4JSTA 4RJJA 2C31A 4MYHA 1BCSA 4US2R 2R8OA 3EGCA 2J48A 1CF4A 2WC1A 5F9MA 2ODBA 1LVUA 2FB9A 5FOWA 5IXYA 1O96B 3IQIX 3CQ9A 1U5BA 1SQ5A 3OPYI 4YK7A 4AROA 1YU6A 3PC6A 4HEQA 3T3DA 4TKUB 3GLGA 5KYWB 3U7FB 3F6SA 1XCLA 1TMYA 1RYHA 4WLOA 3TF5A 1YZLA 3FMVA 5BSKA 2JRLA 3TNDA 2PLFA 3BXFA 2O0JA 1WUKS 4RUKA 1SIBE 2BM0A 3CEHA 1SBHA 1T3SA 4TMZA 2EQAA 3W2EA 1DOHA 1NKVA 3GVPA 1SHTX 1EQAA 2C9ZA 3ABRB 3LIIA 4L6AA 3CZ9A 1GSIA 2VNAA 2Y1LA 3OT1B 9ABPA 1C8KA 1PWXA 4PZYA 1YZ3A 1G291 3OHMA 4NI5A 4TT8A 3WB0A 3WK8A 4B76A 3NOOA 4DY6A 2R85A 5E7IA 4C0AC 1V3TA 3H1BA 4ZTZB 4BFZA 3HR7A 4MUMA 4PSCA 1R6UA 4CL8A 4M7PA 1JHDA 3DLCA 2X8AA 4ZGWA 3A2MA 4E2WA 5BXYA 2W4MA 3LPMA 2A84A 1MN6A 1U2QA 2VO1A 3O8QB 2VNKA 4EPXA 1JHUA 1LWOA 3EDQA 3G2IA 3K7EA 4MMYB 4Q9HA 3RS0A 2HPVA 3W3AA 3QLVC 5MN5A 5IKXA 4KDRA 3WJ2A 1HE1C 1OAKA 2O8BA 2XQJA 5CDYA 2RGNA 1OXSC 2FUG6 2L82A 2X1LA 2ZSHA 1ZD2P 1B2LA 4H3SA 5LZ4A 3DMDA 4CQMD 2OUIA 3FCCA 2OWEA 3CWQA 4RK5A 4FOTA 4U02A 3U13A 2ZI6A 3ZHBA 1EHIA 5EXPA 2YZ7A 3FPEA 3JQ8A 3MWFA 3TQIA 4CTOA 4KLZA 3B6JA 1T9GR 2WJ4A 4K7JA 4XIYA 2VZ8A 4BO0A 1JQ5A 5BWCA 2IW3A 2WU8A 5K99A 1W75A 2YBEA 2XB9A 4GBMA 5J43A 2A7XA 4DZZA 2Q9CA 2AZXA 1JHQA 2QX8A 3OPYB 3IEUA 2RG1A 1Y7PA 4NHEA 4U7TB 1CIPA 1C7EA 4QHSA 4TM8A 4WASA 1PDWA 1DBPA 3JY6A 4INZA 1G4HA 4XDYA 2W6MA 1FNNA 2R44A 4DCGA 1KI1A 5BSHA 3R2JA 4ZYTA 4CGZA 1TVMA 3KYDB 5ADUS 5G4KB 1ZUNB 2CXNA 4UHKA 5JVDF 4H1VA 1Y0BA 1GRCA 4G4SP 2WB2A 1NMSA 2FEOA 4PM4A 1N7JA 1Z39A 5KMGB 5LPNA 1K9SA 1XMXA 1LRLA 2XW6A 2NMVA 4BNMA 2J5QA 4MW7A 4G25A 1J8QA 3QMWA 1RWVA 3E7PA 1K7YA 3FUCA 3D6AA 3L0ZA 4W8GA 1CVRA 4L9SA 2PLRA 2J67A 3A14A 1IOZA 4YJ3B 3CO5A 4LZJA 2XIQA 4E11A 5U9CA 2ZRCA 1P0MA 2Q4BA 3UWKA 3CF4G 3LRXA 1DHTA 1VYVA 3BD8A 3ZU2A 2ALJA 2OB1A 2PM8A 1VKHA 4PAMA 2HGZA 2XMDA 2VXYA 3H3JA 5CH3A 5FPYA 3ACCA 2QN3A 1HWYA 3ISTA 2OTCA 2OBBA 3N53A 4XJXA 4CUZA 2VRNA 4QJ5A 1E89A 4KK3A 4HXYA 3R7NA 1YS2X 2BELA 5KJFA 3WJ1A 3LBHA 1JU9A 5BUQA 1T1EA 1NASA 4E07A 3G7SA 1GTZA 2XBLA 3V33A 2IY9A 3RIEA 3RYFB 5GTDA 1HFJA 2VPIA 3H2BA 1GFZA 4RTOA 1XZHA 3B1WA 3CLTD 4RLQA 1CDEA 5J2TA 1XMQB 3JZIA 5KJEA 1DRKA 2A0YA 2F1OA 1F20A 4W7IA 3RAJA 1JWLA 3GT0A 5JAOA 1T9CA 3AEUB 1IHYA 2TYSB 3NETA 3OZEA 2QVYX 5LQMA 3BDVA 3K8YA 5HMLA 4DLBA 4JH0A 2AYYA 2CUZA 2FSUA 2VK2A 4REQA 2ONJA 5B2FA 5IK2D 1Y3IA 3E5RA 1XRSB 3IXQA 4BVKA 1G2IA 1BHO1 3VSCA 4BWFB 1PEDA 2JGDA 4ZZ2A 3FNFA 4LJ7A 2QRPA 2EYQA 4ZYYA 1W6RA 4K9NA 2AKEA 1V45E 3RYIA 1KNXA 1KEWA 1U2TA 2DWOA 1Y7TA 2FPSA 2JEZA 2QGFA 3BFPA 4DQDA 5KVCA 1CY6A 2Q3BA 3ANSA 3MILA 4LNUA 3VVBA 3ZV5A 2BFWA 2PQ2A 4V03A 1F1BA 3UGQA 3HVJA 3DVLA 4M38A 2RKBA 2BFEA 2YTZA 2B1QA 5K2MA 3SQMA 3MCAA 1VGVA 2IGTA 3PL1A 1DDGA 4MUYA 4P32A 2I7XA 5WRFA 1ZCAA 3IKVA 1UFKA 4C21A 1LPSA 1JEYA 3V8MA 4ABTA 4JBGA 1A7JA 5AESA 5LZ7A 2OA0A 1TQ6A 2PX6A 1PVVA 5U4XA 2XQVA 4FSDA 3BYZA 1Z13A 1Z88A 3P9NA 1PL6A 2Q7XA 2YDYA 3K5PA 1Z0SA 4UBMA 5EXXA 4ZYWA 3GX1A 2HBZA 5DM4A 1EUDB 4KYUA 3NOQA 2NN3C 1CULC 1PZGA 2OKCA 4JLDA 4JX9A 1DEHA 2P9ZA 2V1XA 4R2JA 4UM8B 3T94A 4N39A 4DNXA 4P35A 4EA9A 4M0LA 2CJPA 3ND8A 2BFOA 2P75A 5F9HA 1JI3A 1Q2UA 3F1LA 3K2BA 5HTKA 1KOGA 4MUAA 3E8XA 1ZD5A 5ALOA 1AURA 5ALWA 2QPTA 3IP3A 2R6R1 3Q9NA 2FMIA 1DXHA 3F8WA 1SZPA 4TN1A 1FY2A 1R8SA 4LOHA 4M9CA 3GCZA 5IUJC 2DFVA 3SFZA 3ZIDA 4QXOA 3UY4A 3U37A 1ISGA 4ZREA 1E2BA 2Q6TA 3PT5A 2YKGA 3T5TA 4GOJA 3RVRA 4D80A 4HX9A 3S1AB 4EUKA 2XNCA 5CW1A 1YULA 3S2YA 2XI4A 3BGOS 4QDJA 4RPKA 4QXAA 1NOKA 2Y0PA 1RNLA 4L5AA 4B8ZA 2P67A 4YIHA 1XVAA 2EDAA 5EWJA 3DYBA 5ECWA 4KOEC 1W25A 2W48A 1L5SA 4UU7A 4B44A 4D6XA 4DV1B 3UATA 3ESAA 3OT4A 4DA9A 5BMVF 3FIJA 4U6NA 2QRVB 3BD9A 2LRHA 3LUAA 2TMYA 5FIUA 3AESB 1TAQA 3C5VA 1I36A 1MQ8B 4H7DA 3HQ4O 3IXLA 1CEQA 4WCFB 4KI0A 4B6PA 1Z5OA 2FX3A 4C29A 2OAGA 2CGEA 1H3EA 4MQ6A 1S2NA 5ITZB 1QTQA 4TZTA 2PH5A 1PJLA 3OURA 4TMXA 3GG2A 3WGHA 4CTKA 5KEIA 1V1JA 1T0BA 1J24A 4YRIA 1HEYA 3EIWA 2P5SA 4JXKA 1T4BA 1TZMA 2GTPA 5YASA 1Q3HA 2ETVA 5SYAA 4QT4A 3RQIA 1LNQA 3TQRA 4F7WA 3TOSA 4DBLC 1N8SA 1YQEA 4QGFA 1A97A 1QE0A 1RI2A 4NEGA 4MKIA 2IQIA 1VE5A 3DOHA 4KAAA 4M6WB 3PLAE 3ANTA 1PYDA 1P62B 2WMOB 2KBFA 3FETA 3MN1A 1Q6YA 2JLSA 1JKIA 3OX3A 4AICA 1E3JA 3FKSA 4N18A 4F97A 2IX3A 4UU8A 3VO1A 4AKSA 2DR2A 1LPAB 3FYTA 2ZS7A 1T36A 2AXNA 4H08A 4Y2VA 4AS3A 2IP2A 4ARVA 4WBXC 3E03A 2OFFA 2PIDA 3QPUA 1NW5A 4B9EA 1UPAA 4KKVA 1E2MA 2BUCA 1XJWA 1KP3A 1BOFA 4AWAA 3LT5A 4TYYA 5JCXA 4CKCA 2WWFA 4MHOA 5A06A 1Q0TA 3GJQA 4RKFA 1YVRA 4R1OA 2HF9A 1LBHA 1EAMA 2IEDA 1X80A 2QG9A 3Q98A 2YWXA 1QH1B 1HL7A 2NAPA 2F1IA 2P90A 3M5CA 1MX1A 4EVRA 3W4KA 4Z5XA 1OFUA 1CQXA 2GO7A 2GARA 3F90A 4QNNA 3KPVA 3P9CA 4TUYA 5EXTA 1L5HB 1P91A 1TZKA 3ZLJA 1DC6A 1NC3A 1PK9A 1V39A 1GA4A 1TF7A 5D7BA 3TNLA 2UYOA 2WE7A 3E2IA 4KIUA 5A9SA 1GGEA 4F2PA 2MR5A 2CD9A 4PX9A 5AJTA 3RT1A 1H0HA 1EFTA 1YFKA 4ZXPA 3UXYA 5J59A 1CNMA 1RQ2A 2YUTA 1P7YA 5CURA 2AOUB 1NFFA 1THMA 4R31A 1KDYA 2PRJA 5C4GB 5TVKA 4FXPA 4B40A 4H6WA 5CDTA 2GR9A 2DG2A 4GI2A 5TGDA 3SPXA 1NLFA 3EOBI 4YV7A 2GHTA 3A3PA 3W1VA 2O8CA 5K45A 2ID8A 1L7VC 4D9IA 4CI9A 3MQ2A 3V80A 2OFWA 3KC2A 2B30A 3DTVA 3IOEA 3U39A 5KUTA 2EQBA 1AUOA 1DXOA 3L8GA 4PZAA 3ZEAA 5HQ3A 1DP4A 2O54A 4MJ3A 4Q03A 1LFDB 3TKLA 4EG0A 3B7GA 5I01A 1BDMA 4PCVA 4H7PA 2GDJA 1FUYB 4IKEA 2G17A 2IEAA 3WMRA 1B43A 1FP4A 4F21A 4UBIA 1GNLA 2ZBRA 3CLUC 3H65A 3OG9A 4ER7A 3KKOA 8ATCA 4KFRA 2ZBGA 4DA8A 2W6PA 3QFHA 3VYWA 1SBTA 4JEUA 4HGYA 3VR4A 3WADA 1GLNA 1U0HC 1INLA 1IY0A 2PD4A 5GADl 1K2VN 2BSQA 3PGVA 2QMHA 1N2IA 2LGJA 4FEEA 4HTAA 2WJ3A 4YQEA 1B76A 2NPOA 1O95D 2VT2A 4QYSA 2XZOA 1C7QA 5EP1A 5KTSA 4D25A 1KPHA 3HKBB 1BXGB 4HG2A 3ECCA 3O4VA 3DXXA 3IVGA 3S2SA 3HA2A 5FPSA 4DA7A 1WWKA 4EARA 2I66A 5CLIA 5EXEA 5B2EA 1Q12A 2OZLB 3DUFB 4ZKDA 3OFJA 4GSLA 1CB0A 1QH0A 3DBHA 3M89A 2Z58A 2WKSA 3EGXB 4JAVC 3SLKA 3VO2A 1PHPA 2A9OA 4NWIA 1KU0A 3FSJX 3OTIA 3BX1A 2XTNA 1KYZA 4CEJA 3G68A 3D1VA 4KRGA 4IXDA 3WTCA 1ETHA 1QWOA 1WUTA 3FLMA 2GHQA 4WZBB 5L7YA 4ZYLA 3CT4A 4IEIA 5IBCA 2IBMA 1RXEA 1B14A 2W0MA 3E2MA 3N8DA 4HJRA 3UJ7A 4ZZ0A 5AUPB 5KVQA 5KWEA 4AYTA 3R3XA 4X6XA 4O3MA 4B4KA 5AI0A 4CQJA 3K0BA 1MB2A 1P0QA 2NXEA 3CTPA 1YACA 1JQDA 3B51X 4KSCA 4MIOA 1BROA 2P9FA 2CVFA 4FE3A 5A02A 1IHDA 4RF3A 4JEHA 4BU1A 2QZZA 2BMJA 4LMRA 1FRZA 2W6ID 4ALJA 1DEKA 1WG8A 4P80A 2WIFA 3D2LA 1XU7A 3F6BX 2FEAA 4L78A 3I9KA 1XX6A 4XE5A 3V8EA 1PFQA 2P9GA 3GRYA 2P2NA 4DBVO 5A5DA 2X0DA 4YAGA 1N5JA 1RBZA 3LVRE 1A9TA 2FNAA 3ILVA 3Q5EA 1UKZA 2APJA 2H9YA 3ONDA 4ZAGA 3FPGA 4ZMBA 1ZX1A 2PMKA 1B93A 1H9AA 3HN6A 3O74A 4MDFA 1IEWA 1QSGA 3V4RA 2XE6A 2G5GX 3OEEA 4HK4A 5CB6A 5GM2A 1HE4A 2RH4A 1V7QA 2IYQA 4KUEA 4N6GA 3GWZA 4W9NC 4EG8A 4M1EA 3SEQA 4O33A 4C14A 1X7ZB 2E55A 4KXLA 1ZCJA 4CPDA 3OIFA 4XA8A 3EAGA 3M5WA 3TN7A 5C7OO 3UMFA 1WNTA 4IXWA 3OF2A 4X1OA 1WMAA 3FLAA 2VPPA 1U8EA 2I1LA 4KWCA 1A1SA 1ONBA 1IXSB 2A5DA 3HCOA 1V8PA 2OQIA 4HQNA 4ZV9A 1ZJ6A 3E7XA 3M49A 3P4XA 4OQPA 5EIHA 4O4HF 1UC5B 5B37A 3RS3A 4MVYA 2H2FA 2VQFB 1R6TA 1ACLA 4UCXA 4RZHA 2UU9B 4YY3B 3LI2A 1VCOA 1EXNA 2W2VA 2OMEA 3QMPA 5JYDA 4B6SA 4D9MA 3U56A 2VRCA 2IC5A 3PPIA 1NR5A 1T4DA 2YV1A 3QLUC 1K6IA 1AIPA 4DXHA 1B0UA 3HPRA 4YRKA 2M6SA 4KN8A 4L95C 5KBYA 1B42A 4TMVA 5AM4A 2HRBA 3B3GA 3QLEA 2CHEA 3JQAD 4UXIA 2HA7A 5H81A 1DRWA 3SE0A 2ZWIA 3PC4A 4KBYA 5ENZA 1ECPA 3AHGA 3D6JA 2PZ8A 1L5YA 4JVNA 2QRHA 3WK4A 4L0MA 2B5WA 3FCSB 4PO9A 1RWPA 3P2JA 1IMOA 3O3OB 2OV1A 1PNOA 1OPXA 2O7RA 5CLLA 1I0IA 1Q57A 3S2UA 4RVHA 1U7UA 5CIQA 4YH1A 1Z6XA 3E3LA 1Q1QA 1JB1A 2F6RA 2X41A 3BG5A 3OP4A 4OHRA 1ZHOA 1UWVA 4DIOA 1MQSA 4UBKA 2IYSA 5F3RA 5DBFA 4QX6A 4HQLA 5ESWA 4GPIB 4GWLA 5AFSA 2UVPA 4JJ8A 5FNVA 1P17A 1TJ3A 5E38A 1HNWB 2I0FA 2P91A 4QT0A 1OPRA 2VCYA 3CUTA 5C1DA 5HKAA 1FNBA 3O84A 4AYWA 4KO2S 4UCQA 1TJ4A 1L1QA 4I8XA 3NDIA 1AH2A 1BMFD 2QYHA 3IEIA 4F06A 2H1FA 3BWVA 3MWJA 3THOA 4N41A 2OAEA 3COZA 4ALLA 1ADFA 5K1ZA 3BPSA 4BDSA 4MA0A 4JB3A 4JJIA 3AR3A 3ST7A 2D0IA 5JH7A 4J0GA 5IHPA 4XRGA 2HA5A 2ES4A 3LVBA 1G9TA 4TS3A 1CNFA 4CLEA 5AVYA 1CU1A 1U1GA 5DHUA 1F51E 2NUAB 4E2ZA 1TRKA 2LE0A 2LPMA 1E2HA 4Q6WA 2BZ1A 1U11A 2C3PA 2PGXA 4FVTA 5KSPA 2B5OA 3FGOA 1N5LA 3Q12A 1EHYA 2C9DA 2J7PA 3IOMA 3M81A 3PQEA 3ANMA 2WSMA 5H70A 4CHTA 4DMUB 1I7NA 1DBSA 1ESEA 3IQHX 4TQ9A 1E0DA 2Y0DA 1NY5A 2FAXA 1EWKA 3CX6A 4U9UA 3OPVA 5ENDA 4ZVNA 3C74A 1IBSA 1P5JA 1QO9A 3M6UA 4Y1EA 2FZVA 1V1RB 3T7CA 4OLHA 1QFMA 2IYAA 2PGIA 1I7QB 1Q6ZA 1TVCA 1PZFA 3VR3D 4DR3B 3GLHB 2VC2B 2GZSA 2DFLA 3UFXB 3WBBA 4N9QA 2HJSA 3DBVO 3SDSA 1PHRA 2BSXA 3N58A 3H05A 1L5WA 5JRZA 1Z2CA 1KMMA 3FRJA 3LU1A 1FU4A 3ZW8A 4D3XA 4OX9B 4M36A 2W6NA 2QTRA 1WBBA 1NHWA 3I0MA 4RPIA 1O96A 2RG7A 2ZWOA 3DO8A 4EL0A 2PD6A 1EP3B 1E6MA 5KYWA 4UNPA 1IQ0A 3A2LA 1FFWA 4CLRB 4JYPA 3A11A 1J7KA 1O5IA 1T9AA 4BLUA 2C54A 3D43A 1DUSA 7MDHA 2RHMA 1Z4QA 5FNZA 5F7JA 4QOJA 1XPJA 1RPZA 1TAHA 4MV6A 2WKQA 1PNQA 3LQKA 2WWIA 4FHFA 2QUZA 1W4AA 1W36D 3FFAA 3FJYA 4RK6A 4JODA 5DGHA 2WLSA 3IS3A 1GR0A 3U62A 3OT1A 2WDPA 1YB4A 1SUFA 3A9RA 4EVQA 1NW9B 1PZEA 4KFCA 4P4GA 5EVCA 1U8UA 2DQSA 2XY4A 3UJPA 5IAOA 3KG2A 2C2XA 2OXCA 2FW7A 4Z0PA 3MS2A 4B7XA 2H0QA 1COZA 2Y1XA 4E2FA 4Z53A 3K53A 2BI4A 3EK2A 4PTYA 2MINA 4CIWA 1KQPA 1JWBB 3Q0EA 4GEKA 2BKXA 3NORA 1XRMA 5T57A 3VR2A 1UPCA 3MJEA 4JBXA 3QF7A 3THYB 2FFAA 2QQ0A 2UUPA 2HR1A 2X19A 5KTTA 3WRVA 4XGRA 4OO3A 3T41A 1CX9B 1L8AA 3I6IA 2CMGA 5HIIA 1DE0A 4BFVA 1GRVA 3IVXA 2HJVA 3DD5A 5ICMA 3TL3A 5JD5A 1MENA 2VRWA 3IR7A 1JU3A 3KQKA 3RQSA 3SIPA 3PV0A 4PZEA 4PAQA 2BGRA 3SIRA 1QKIA 1KZ4A 4G36A 3NOXA 3DGFC 4QUHA 5IRCD 3CCBA 4L74A 1WTAA 1GPBA 1J0DA 4JWKA 2B3TA 5HX7A 3OPYA 4KQMA 4N48A 4FIDA 5I7WA 3GD5A 5J58A 2ZI9A 3NAQA 4QAQA 2ILVA 3KUUA 3ZKWA 3AFNA 3BJIC 3PXXA 3T7RA 4BB5A 1JEEA 2O0KA 5CXUA 4GZ3A 2HU5A 1TM1E 2DWCA 3IJ5A 3U0BA 1J25A 4J76A 3SQLA 1ZUNA 3A6HA 1CZNA 1PEAA 4L8WB 3A1CA 4A10A 3S8EA 2XYGA 4MZXA 4K1LA 4KQWA 2PKXA 2UUCB 2Z5VA 1LK7A 4EG4A 2UYYA 2C5AA 4GUAA 4YHHB 1NVAA 1ND6A 4KQKA 4GQAA 4HNTA 3BSWA 4YRSA 2JATA 3S55A 4RESA 4CTJA 5IJWA 4YBRA 5H80A 1VPEA 1NU6A 2I2CA 5DK6A 4E13A 4YJ3A 4EM6A 3EC1A 2IP4A 4N1AA 1MORA 1VHWA 1JIVA 4ICIA 2IYUA 4KLAA 4WZAA 5CPFA 2XXAB 2O2GA 2X3YA 4Z9BA 2H2WA 3WNBA 4ZCRA 5M2QA 2ANCA 3RIGA 1QR2A 3AFOA 1HFKA 2FGJA 4Y9SA 5LLSA 4BE4A 4I08A 4RFLA 4UNRA 1EVLA 3LQ1A 1KYXA 1FJXA 2IT1A 2BJHA 4X44A 5EHIA 2IZ1A 4YGXB 5ERYA 2O5CA 4B85A 4C7VA 3VZPA 3LX4A 1YRLA 1Y1PA 4MP8A 4BKMA 3FGPA 1YBMA 3EBOA 5CFNA 1ZG3A 4PG7A 3ZI7A 1KDPA 1UC4B 2X6RA 3OTGA 5I7AA 1ZESA 2L18A 2F55A 1GUBA 4R54A 1OLSB 2WP8J 4KVFA 5CB0A 4Q12A 4MA4A 4NTZA 3JQEA 4F4HA 3FCOA 3IDFA 2ZI3A 4P31A 3ZV6A 4WLFA 2NZJA 5HZKA 2YN2A 1KTIA 1YFZA 2BE7A 2X42A 2ZCUA 4FEYA 4UC0A 3TOZA 1PBNA 2NZXA 3ZGLA 4HH1A 3AEUA 2AOTB 4G37A 4IHQA 2YOHA 4ENWA 1NYTA 4EA7A 1RWWA 2WTUA 5I7SA 4JLJA 5FV4A 4N0QA 2FF7A 1U3CA 3IXMA 3ODPA 4PY2A 3WO0A 4QOHA 4WLNA 3HR4A 5AT1A 2H31A 3KCQA 4QXMA 3W6NA 1M5UA 3FOFC 2YJTD 5AW1A 4NMWA 1D2RA 2C0QA 4PC7A 2R84A 1IHXA 4NZNA 7REQB 4M1WA 2W58A 3LZDA 3NYWA 4KGXA 1BCRB 4PPGA 2LZ0A 3O75A 5GV8A 4Z6KA 2JIQA 3N8KA 4JT2A 4HHEA 1J42A 3WK6A 3LT4A 4HC4A 4HSGA 5A4DA 5JXGA 5DX8A 2H3HA 3GLFB 4NULA 1MO3A 2GCOB 4GOLD 3EODA 3OX2A 3EC7A 4URWR 4FD3A 1QBKC 3S81A 1QC5B 4XR4A 1FE8A 3GELA 4DLNA 1P9RA 5B53A 3L6CA 4FHZA 4FN4A 1NOIA 4B43A 4F3YA 3DE7X 1VI2A 2JFYA 2WT9A 3HYTA 3RRXA 2ZR9A 1G4AE 3CXRA 4BWVA 3T1VA 4DQXA 1N2HA 3ZYCA 1OXVA 4MR9B 3U61B 1H4QA 4I6EA 4OMUA 3BIJA 5EE3A 8GPBA 4IUYA 1W44A 5JOQA 3LY9A 2GN2A 4ENPA 1EUDA 1RIIA 2Q5HA 2A30A 2O48X 3T5GA 4MUGA 3H9BA 2EBUA 3L05A 2ONCA 5I9BA 4FT2A 4RAQA 5CFOA 2ZIGA 4PLPA 5BURA 5C1BA 4JB8A 2AMYA 1UM8A 5TQJA 1G55A 1X8XA 3C6XA 1DZ3A 2PKQO 3DFIA 1RQPA 3EDRA 5EC8A 3GUHA 1GQYA 1XHLA 2PL3A 4ROSA 1X7GA 3DMGA 4QJIA 1Z5WA 2UZAA 3OE4A 1KE1A 4JP2A 2PV7A 1ZNXA 2J3KA 1VGQA 1WEKA 2P9JA 3M1YA 3KAJA 3IUJA 4TYQA 5LBIA 3QW4B 5CA1B 1AKNA 1UMCB 1J0XO 3H04A 3EVAA 3MFYA 2H1HA 2O8FB 1SG9A 3MVEA 3PYLA 2C9CA 3EQ6A 4Q4LA 1E1RA 4XPZA 4AKTA 4EITA 2BFBB 2D3WA 3EVTA 3BWMA 5JTUA 3O2NA 2FXIA 2HREA 3NGMA 4UHJA 1DVRA 5I5EA 4E14A 2MR6A 1ZEMA 3BH7A 1AK1A 3DPIA 4U7WA 4NDAA 5CX1A 2R6JA 5CGQB 1SA0B 3TO5A 4ON9A 2BJWA 2FHSA 4WCFA 3I9FA 5K8CA 2QN6A 3VZRA 4ND3A 4GO1A 2Y05A 2PSSA 2Z2YA 3TZHA 1CUZA 1HFWA 3DCIA 4PWZA 2NO4A 3ABIA 3I6MA 3M6LA 1QVAA 2CN1A 3AERB 4QTXA 4WZBE 2GBLA 3FB1A 1D9XA 1XLVA 4RNDB 1TF5A 3AP3A 3QJYA 3FTCA 2H92A 1H2BA 1RI3A 5J2TF 4PN3A 3N2ZB 3IBSA 3B3QA 4RTQA 2QE7D 4EVSA 4RVNA 4M6WA 2AQHA 5ES3A 5FUVA 3U3XA 4MVJD 1VKJA 4PBTA 4YLEA 3U60B 1QK4A 3LK7A 1PO7A 4GWKA 3RRJA 3BTOA 1YHYA 4Q5IA 4MGIR 2IHTA 5E9AA 4CM6A 2ZQYA 4YMIA 4E5KA 4ND8A 2NADA 1N32B 1P2VA 1I2CA 2FLKA 3HCNA 4Y6LA 1CS4C 3KWMA 4LFAB 4OQEA 4LJ9A 2PGDA 3PEEA 1UM9B 1LD3A 4FMBB 2AIRA 2B78A 1WCIB 4YCDA 3HABA 4CLXA 2H2GA 4GOKA 3FNIA 4DIMA 2F8TA 5JWHA 1CR4A 4Q4CA 1QH1A 5JCOC 1GPH1 4QUJA 2D7CA 3RYHB 3ZJ5A 5KYXB 5B1SA 3V8NA 2ODTX 1EEXB 4IFBA 1VFNA 4FFRA 4Y9DA 5K0BA 1P4SA 2Y4OA 3C7TA 4E5NA 2F8LA 3S27A 1Q44A 2WIKA 2YX1A 4CQMB 5DWDA 2CMDA 2C4UA 1NZFA 5CNKA 3DC2A 3QXSA 1KYWA 2Y9PB 1EDEA 1MPXA 4FB4A 1NT2A 5BRNA 4ZZ3A 3PXDA 5KVSA 2AOUA 4TSRA 4DQLA 4JI0B 1Z38A 2XCLA 2WOJA 4O2BA 2RSLA 2RHOA 4ZGGA 4S1WA 2X4GA 4MGHA 3LKVA 1NW7A 3OHPA 4FOOA 1R66A 3BFJA 3GJRA 3L9XA 1YTLA 2UKDA 3LX5A 4M7WA 2B1GA 1YZNA 5LD2B 3N0RA 3UB2A 4UMDA 3HUDA 1ZL0A 2A1TS 4D2IA 1VE9A 5LMNB 1PK7A 1ICEA 4UPDA 1X3SA 3KALA 2R62A 4O8CA 1K66A 3JQPA 4Q24A 1GTVA 3VSAA 4FQ7A 3OOHA 1JEOA 1LBIA 2H8GA 2G71A 2YC2C 1KZGB 2R66A 3STVA 3SIWA 3TEFA 3RG8A 2FFBA 5BXQC 4N5DA 3P5SA 2JIZD 1WA5A 2OGWA 1VG0B 3CCFA 5KSYA 2WHYA 2RE8A 3KTDA 4ZQBA 3MWGA 3AKEA 3ONWA 1JG6A 1PDOA 2VP2A 3HJGA 3MCZA 2AMFA 4D3SA 3GGSA 3NHKA 4HFJA 4L50A 3DDHA 5DM2A 4E31A 4BEWA 4EGAA 2J0SA 3HHEA 4YBZA 3TJMA 2Y6UA 3OZGA 2DEUA 3KKQA 2W6JA 4CLOA 4JIMA 1HE8B 1WY5A 4MS1B 5DDIP 2D1SA 1EFCA 1T9DA 4URFA 1U2RA 4LKOA 5F5NA 5TJ9A 4HNAB 2FG5A 2ZT5A 3QKRA 4K9DA 2FZCA 3OQ1A 1HRKA 1L5OA 3QXJA 2WF9A 2IOFK 2WUGA 3EGXA 3QLTA 1HTTA 2I34A 2Q46A 1XWWA 3BS4A 3BUSA 3ESXA 5AXAA 3WQSB 5AK0A 1AKEA 2C2MA 3U16A 1KP2A 2XQGA 3M34A 3CIFA 3PQ4A 1JV2B 1PW5A 1HDRA 4WZBA 1BZYA 1ZJJA 2NGRA 4FKMA 5DN6A 4EKEA 1LSSA 2VWGA 1DLIA 4FFVA 3V4LA 1GL9B 1DB3A 3PD7A 4BMDA 4B9AA 1FRQA 2CC2A 2K4MA 2OXRA 2WWRA 4WY5A 3SIXA 1FUIA 2O5VA 1R5NA 5FFFA 1IJEA 3FVRA 4Q9LA 3GLIB 4AQ7A 3KTAA 2VPXA 3FTPA 3OCCA 4JLPA 4HDSB 5JLAA 5EHQA 3RKUA 4EZIA 4JGBA 1GKYA 1Q1GA 2OXEA 1TVKB 3PQDA 4EAQA 3DE4X 4O1MA 3GLHE 3JWPA 4X7MA 3VYUB 2HSDA 4RWZA 2VI5A 3OVMA 4CM8B 2N46A 3PJFA 3UXHA 1XXHE 1CQIB 2PVPA 4YAIA 3FHJA 3HLYA 1UFVA 3OF5A 3QIVA 2XUAA 3RDPA 2C3MA 1JUDA 2BGTA 1YJBA 4ZRNA 2WWXA 4JLMA 1SC9A 2H85A 3D54D 4HNGA 3JWJA 2XLCA 4H15A 4QQKA 4QQ8A 4TUYF 3ZI0A 2QTFA 2MOKA 1RYNA 4EKYA 1YKFA 1GSOA 2QD4A 3N7TA 4MIEA 3E8MA 1GV0A 4KV7A 3TSWA 2X8JB 4M8LA 2B0JA 2WWGA 3TW4A 1TT5A 5J4YA 2AH5A 3ADBA 4GL2A 4IPTA 4WCFC 4OBWA 1RSZA 3CBGA 4BQEA 1UKEA 3GUCA 5IAEA 3H2IA 5FAXA 5D85A 1XWFA 1FU8A 1BGWA 3GRRA 4H31A 4I66A 4KQ9A 5DK4A 1JT9A 4WQMA 4NX2A 3QUAA 1GNSA 2HHAA 2HU7A 4G97A 1JQ3A 2GBLC 3L41A 4XRRA 1PJAA 1Z2DA 2V4UA 4ZK6A 2XB4A 1KZ1A 2JW5A 2ZAGA 3JQBA 1QYWA 4ZO4A 5A4JA 1FLDA 2Q9AA 1WCXA 2CXTA 1CZUA 3TLJA 2H1SA 2OLEA 4ZDIA 1NW3A 2PX5A 3CZ5A 2ZUWA 1YH3A 4R8SA 4C0WA 5I6DA 4ND2A 3UJHA 1PZNA 4MB6A 2H8KA 3NFRA 1C8BA 1DAGA 1TO1E 1YASA 1W4ZA 4YAEA 2WY2D 2JAQA 4R71A 1XMJA 3E84A 4R01A 2AMJA 4EY7A 4J0JA 3WMGA 5H8WA 1MW8X 2HQBA 2PLNA 2XQKA 4GYKA 4MQLA 1RADA 3QE2A 1RYMA 5B1HA 4F7DA 1Z5PA 1D6MA 3TE7A 5L4NA 2PGAA 2Y1CA 1FMLA 1IXZA 1Z6ZA 2XUOA 3FI9A 4UATA 3KAKA 2I22A 1JH9A 4OFWA 4RAOA 3MMPA 4ALNA 5BN3A 2PJUA 2X5KO 5C3UA 4AX4A 4BX3A 5KSOA 1QCYA 3C4QA 2G28A 1N5OX 5B3KA 2C5LA 2G7ZA 3BILA 3ZDQA 4C89A 1P7ZA 1B73A 2CFSA 2KBEA 2O2CA 4LI3X 5FB3A 5F73A 1U63A 1JYSA 3KSMA 2VDUE 3P9XA 5KYNA 1OY1A 3HU3A 4DFDA 7GPBA 4ZTBA 4TTVA 3WHIA 1OXMA 1KIAA 3B2NA 1SD1A 2B4AA 1YIOA 1ZL2A 2VP5A 5CEEA 3T15A 4EZBA 2G1JA 2CNWD 1P9LA 2IXAA 1JMVA 1XTQA 2VTEA 4FGWA 1OROA 3FVTA 1HSOA 4OTZA 4TYWA 1BDJA 1JALA 4DWVA 1EXMA 1I4LD 5AJWA 2UVQA 2ZB8A 3CN9A 1ACMA 2B1IA 2GILA 1Q17A 2V0NA 3QP9A 4LF9B 3GFPA 1IDN1 2QDXA 4KDEA 1UZNA 4KLNA 4I1PA 4TTJA 5T3UA 1U8FO 2ZUBA 3NEPX 4B1FA 2FK8A 3C6YA 2Q5FA 1QVWA 4L8FA 5F7ZA 5CDSA 3H84A 1UKVY 3AZPA 4UVEA 3UB3A 4ZT4A 3ZDBA 3EFBA 2V5AA 2XBUA 4CUKA 4Q9DA 2IW1A 2VDLB 3O2JA 3EF0A 3E3OA 4OQXA 1P5ZB 4UHEA 2CK3A 1H3NA 3ETLA 1MB9A 2GZHA 1U9YA 3B7PA 3BRWA 3HB4X 4LC9A 5IBQA 1U7WA 1WTCA 4B7CA 3EZ9A 1CY4A 1SO8A 1CUGA 2JH3A 4BMCA 4BMVA 1W1UA 4U2GA 1IZYA 3MG9A 3WIUA 3ZV4A 1Q77A 2VPZA 1T0IA 5E2AA 5TPZD 1LBSA 1OXTA 3RPEA 2QXTA 1HK7A 4OB6A 4NEHB 4CT0A 1G2PA 4K6HA 3HYNA 4CLRA 2KX7A 4AULA 1VQ1A 2QTZA 3O9VA 3V8BA 1JS1X 2VP0A 2OFPA 1EHCA 2PRIA 3WJ7A 4GP7A 4YXWD 3SDBA 4E08A 4XGNA 1J20A 1V35A 4KBGA 2CVZA 5J4HA 1B6RA 1N2CB 5D3MB 1CE8B 3FCAA 3FSGD 3GQBB 4YS6A 1RTKA 4LECA 4F2DA 2R8XA 4ZI3A 4D4HA 6PFKA 4AZTA 2JFOA 4KOAA 1NQAO 1YR1A 4MPJA 2GPTA 4M89A 2FJUA 2VAMA 5DWVA 3RVNA 1OU0A 2PANA 4GQBA 4KUGA 2FKNA 1YKSA 2O0HA 3QOXA 4EMSA 5JZBA 4D6PA 5I51A 3F9IA 1N2JA 5K4HA 3KSDO 2GM3A 3RK4A 3L6UA 1AGNA 5LYJA 1Y5NA 4DXDA 2YRFA 5FX2A 4IOJA 3L4SO 2OPHA 3AF1A 3GLFE 5I5GA 3K31A 1QP4A 1UIRA 3MRXA 4M0KA 1R6DA 2Y92A 3BFVA 2J46A 4IIJB 1TZ2A 2QAJA 3THYA 2QUHA 3RS5A 4BOYA 2GB4A 4HMQA 1F9EA 1ZK0A 3KWJA 4TLBA 3KXIA 1F6DA 3O93A 4MKRA 3PNMA 2ADMA 2PGJA 3JZAA 4V39A 1CLUA 2PBRA 3H5LA 3LPDA 4TKLA 1L7QA 2HK7A 2FE4A 1KJWA 4JT4A 5FNVF 1N0VC 3NNNA 4CIBA 3KDAA 3PXCX 1W2HA 3BEOA 1UFOA 1WQ3A 4MSUA 2BD0A 1E2FA 2V65A 4PQGA 4YUAA 4NP6A 1JNYA 4BMNA 2W00A 2JI7A 4B87A 5B4UA 5K0FA 4I7EA 2IPNA 2FKAA 2NO9A 4AMUA 2ZAYA 1UKBA 3L1JA 2OLKA 1CY8A 1PWZA 4QYIB 2H54A 4LRWA 2ATIA 2NNLD 2P4HX 1KDVA 3NBKA 4C22A 3QYFA 4DJ5X 3W2TA 2FRDA 4IL5A 2JIMA 5JH7F 3GGJA 2CBXA 1L6RA 5CM9C 4WOKA 3VRHA 1IUOA 2RC6A 1SB9A 1W19A 4Q1AA 4WTOA 5EEHA 4ERXA 1RJ9A 1SZJG 3JQBC 1FQOA 4RHCA 4FDVA 1G6KA 5FUQA 3KJXA 1E4YA 5AWFC 4LY9A 3CO0S 2H4ZA 2I78A 2LKDA 5TB5A 5EIAA 4M86A 1AU9A 1NTRA 1JDNA 4IIDA 4N0MA 1M2VB 3ZE9A 5HJEA 5DOZA 4TXHA 3LECA 1X74A 4G2TA 5IAAA 1G7CA 2FMXA 3BJZA 4JNKA 1E9FA 3IVCA 4FK8A 4K9PA 1DNPA 2FU5C 2BF4A 1QFYA 2YN4A 1VJ0A 3DPSA 3EA5A 4GX2A 4D5EA 1ZHFA 3Q11A 3UV6A 2IXDA 1OFVA 2J07A 1YZTA 2J9YB 3OQ6A 4I99A 5HIJA 3DPUA 2J31A 2ZUCA 3EJ6A 1ZP6A 2HY7A 4P8RA 1DIBA 4MR8B 2NTNA 2Y4NA 3TZLA 3M9XA 3AVOA 5C8DA 2DTDA 3DB1A 1ABFA 3KVYA 3CUSA 3SZGA 3ICEA 5JASA 2PKCA 3C6BA 2JANA 4KXNA 4JLAA 5IULC 1XEXB 2HMAA 1L5ZA 3QUQA 1DU4A 4HAZA 4OB7A 1HORA 1OLSA 3ENQA 3GEEA 4UNNA 3SZLA 3RANA 1TZJA 4HDNA 4A8TA 2J09A 1YI8A 1MHTA 2V96A 3LDHA 1P2GA 4N0DA 2PBZA 2X4DA 2F1RA 4ZVMA 2R6FA 2AOTA 5B3JA 2XRYA 1WF6A 1Y3HA 4K1XA 3SR3A 1K2WA 1T1SA 3UT0A 1RXCA 3G82C 2P77A 1EZ4A 3IAHA 4FUQA 1GCAA 2LIVA 4UXHA 4TL9A 3NRCA 4MYDA 2NXWA 4WUVA 5GONB 1MGPA 2VJDA 1SKUA 3N87A 2I7TA 2Q2VA 3GT3A 1P6UA 1LI7A 4HB2A 4PYJA 4UTZA 4DSAA 4XFJA 5DNVA 2EW2A 7REQA 3I1IA 2NSDA 3JQAB 1BCRA 2LBPA 3E6AA 4LMBA 1H85A 2AZTA 3RWMB 2VOEA 2W8BA 1KR2A 3KB6A 5ALEA 2GAFA 3SYMA 3W6PA 4TM7A 4OHYA 5G0TA 3NHFA 4L16A 1E59A 4DYVA 3EZNA 3VZSA 2RI0A 3VBEA 5JAMA 3PCTA 2NPIA 3M1IA 3WIEA 4DUYB 5J4VA 1SHUX 2XUKA 5BUCA 3SEZA 3ONEA 1EX6A 3KKKA 3ASUA 3U4CA 1K7EB 2QG6A 1CUHA 2WD8A 1NX6A 1F60A 2RH5A 1EXDA 3M9WA 2FMUA 2FPGB 4JP3A 3K71B 2WAYA 2XDAA 5CVDA 1ZSNA 1DCTA 4LJ4A 1CZHA 3I61A 4G8CA 2OCKA 4G0VA 4MR9A 3L4EA 2HMUA 4RMHA 1S9HA 1RQNA 4NC9A 4JI7B 3AYZB 1Q0SA 3AUUA 1UZUA 4NJMB 2YWGA 2WJZB 3MJSA 2AXEA 3QOYA 4TXJA 4ZVPA 3UMSA 3WYFA 3NW9A 2O3UA 4WN3A 3NFYA 4DILA 4XYEA 1XQYA 1XQVA 3OICA 1CYDA 1MQ9A 3ILSA 5FR2A 3REGA 4P3KA 3SHWA 5JAHA 4UUMA 3RB8A 2HLDA 3R5SA 2J6HA 1CQPA 1KYYA 2QTMA 3R41A 2J3JA 1E3QA 2O50A 3ADKA 3EYAA 2DKOA 3H9QA 3C3YA 3PZRA 4LIPD 3BVPA 3PQ6A 3MMZA 1U0LA 1RXWA 1KIFA 1VYTA 2YVUA 1A8UA 2VIIA 4WKOA 4B4WA 1R10A 2PSJA 2YWHA 1MF7A 4MKHA 2DB3A 2IS2A 2FG6C 3CNLA 1C8LA 2H11A 1UMCA 3JQQA 4LXIA 3NYQA 4K86A 4KAXA 3QVVA 4B4DA 4XX0B 1LQTA 3L02A 3T7AA 4AZ3B 1EDOA 1LGYA 3PRJA 2BFBA 4MRNA 4H7IA 3QENA 4YJ3F 3AHIA 4LFBB 3MJTA 4CMBA 4BUZA 1E6EA 3ONNA 3L7YA 4P86A 4G24A 3KWFA 3SLRA 2G1AA 1SA0A 4YAFA 1AZWA 2QZ9A 2HCBA 4M8KA 1EUCA 5BSFA 2ZE7A 2F2TA 3LC1O 4S0XA 4RIIA 1J8DA 2ZIZA 4KIWA 1VIAA 1NJ5A 3DL0A 2Y71A 4LQLA 3TFQA 1APBA 2Q4EA 2HLPA 2XD9A 3KJFA 4RDIA 3TCNA 3DKKA 1OCEA 1L9XA 2OORC 1JA0A 1U31A 2GBIA 2XXBA 2FYTA 3D6MA 4RIFA 1ZK4A 2GEJA 1T9GS 1U2GC 4RA6B 4EW2A 4YYEA 1LI5A 1SUIA 4I6JA 3QOFA 3K1TA 4I1OA 3OEYA 4MROA 4EH1A 2PZFA 1W36B 4IOKA 5HHTA 1JFFA 3KKEA 2FPIA 1WQ4A 3EUAA 4B6OA 1JA1A 3JQCA 4HRAA 4FHGA 1OFHA 5TQ2B 3EBPA 4BNNA 1ZUD1 4J1QA 1GGFA 1KSHA 4JS0A 1BRMA 4PSAA 4ZI5A 1OHHD 3D8SA 3AUJB 3WLMA 4ZYZA 1SUPA 3M8KA 3QE9Y 3COJA 5FO0A 4QASA 4ZMRA 5TS2A 4X3OA 1R7RA 1SVNA 1FX0A 2YNMD 4G0XA 3Q5GA 2H18A 4L3OA 4CL3A 3V1MA 3M4YA 1TO2E 4Z0TA 4DR6B 3QHQA 4R5MA 4F1JA 1UEXC 4K9QA 2AZDA 2O2HA 1HQDA 1K63A 3DV0B 1XWIA 4G8JA 3U4AA 2PIAA 3H11B 3HDTA 1YVPA 3PUIA 3HADA 2PAFA 1RI5A 3A28A 4OMFG 4PCUA 3HFRA 4J0CA 5D51S 3WL5A 4F9FA 3DEYX 2WT8A 3RYHA 1JHYA 3GEIA 5KYXA 4I5DA 1PR5A 3UBMA 3HCRA 4R2XA 4EGQA 1UADA 4TV8A 1WDLA 4K40A 2G08A 2WUEA 3HWSA 4OJYA 5AVTA 1PLKA 3VHXB 1FVXA 3T7TA 1J07A 1AKQA 4QU5A 1MR3F 3H9EO 1XA0A 1GM5A 3FVQA 5AM1A 1KZYC 1HNNA 2PQ0A 4AECA 4DWOA 2C7OA 2IRWA 2V3WA 1C0KA 4QSMA 1C3LA 4GS5A 1A76A 4QO8A 1UJMA 1W88A 3AHFA 5I7VA 4Q05A 1QRRA 2HMVA 3EASA 1MAVA 1TEXA 3OOJA 3G6KA 4M1OA 5BVHB 3MBIA 2IZ5A 4ZODA 1E96A 1PGPA 3AEYA 3V6MA 3AM4A 2DZDA 1PEKE 2B98A 3KKMA 1ABBA 1JX6A 2QBYA 2OK7A 4RDCA 1U8AA 1H6DA 1CR6A 2FPLA 2GBPA 3HGQA 4H7HA 4C9BA 5A6VA 3H0KA 1VLHA 2DBQA 2FXVA 5B3JC 3K4PA 4HWPA 3QFTA 2YHUA 1L5QA 2UZ1B 1SBZA 2JLAA 3CURA 4HYEA 2QIOA 3IAM6