4DW8A

Crystal structure of a haloacid dehalogenase-like hydrolase (target efi-900331) from bacteroides thetaiotaomicron with bound na crystal form i
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
266
structure length
266
Chain Sequence
KYKLIVLDLDGTLTNSKKEISSRNRETLIRIQEQGIRLVLASGRPTYGIVPLANELRMNEFGGFILSYNGGEIINWESKEMMYENVLPNEVVPVLYECARTNHLSILTYDGAEIVTENSLDPYVQKEAFLNKMAIRETNDFLTDITLPVAKCLIVGDAGKLIPVESELCIRLQGKINVFRSEPYFLELVPQGIDKALSLSVLLENIGMTREEVIAIGDGYNDLSMIKFAGMGVAMGNAQEPVKKAADYITLTNDEDGVAEAIERIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloacid dehalogenase-like hydrolase
publication title Crystal structure of a haloacid dehalogenase-like hydrolase (Target EFI-900331) from Bacteroides thetaiotaomicron with bound Na crystal form I
rcsb
source organism Bacteroides thetaiotaomicron
total genus 101
structure length 266
sequence length 266
ec nomenclature ec 3.8.1.-:
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 4dw8A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4dw8A01
1Z4MA 2G07A 3EF1A 5ALIA 1LVHA 4Y2VA 2G80A 4KNWA 5E0OA 4UU1A 5AW6A 1SU4A 5AW2A 3A1EA 3DAOA 4J03A 4YH1A 5AI6A 2MU1A 2YFYA 1TE2A 5AKYA 2OYCA 4OHFA 3SLRA 1QQ5A 2YMMA 4XQ0A 5FP0A 1RRCA 1WR8A 3QUQA 2P11A 1VJ5A 3B8EA 5AVTA 3ZTYA 5AKHA 3QUCA 2P69A 1ZOLA 2ZBEA 3HYCA 5AKLA 4ZEVA 2AGVA 1IWOA 4CF3A 3AR7A 2WF9A 3E81A 4L6CA 4QJBA 3QLEA 4HGPA 3ZTWA 2Q4RA 3ZX5A 3U7GA 2FPUA 1O08A 2FDRA 2IA5A 1YJ5A 2W43A 3OCXA 3NIWA 3E84A 3QYPA 4Y2QA 2QYHA 2FUEA 3P96A 1YV9A 2C4NA 2Q5EA 2YJ5A 2OA0A 3S6JA 2I6XA 3AR3A 5AW5A 2O2XA 1Z5GA 5AW9A 2WFAA 2FPSA 3SKYA 4AP9A 2YJ6A 3WKEA 2I34A 4FFDA 3WGVA 2O9JA 4UMVA 4C4RA 1Z4LA 5IT4A 5A3SA 4G9BA 3MPOA 3D6JA 5AKGA 4C4SA 2W4MA 3NAMA 3WGUA 4EX6A 1MH9A 1N8NA 1RC8A 4UARA 3M9LA 5AM1A 3F9RA 2HOQA 3IRUA 3U7EB 5AKJA 5ALYA 3E8MA 5ALWA 4RETA 1K1EA 2AH5A 2HI0A 3QNMA 2AMYA 2GFHA 2R8EA 3AR9A 3NALA 3OTQA 4F71A 2W11A 2AUTA 3U13A 1S2OA 2VKQA 1NNLA 3N07A 3QXGA 4KYTA 2BDUA 3NUQA 4H1WA 2PR7A 4BX3A 1ZRNA 1XVIA 1YS9A 2GHQA 4YCLA 4BYGA 4KNVA 3UMCA 3WK8A 3BWVA 3WK6A 4UM7A 3A3YA 3I28A 1Z4QA 3EPRA 2I33A 4QQFA 3L0BA 4CNQA 1TJ4A 3OCYA 1RMTA 1TJ5A 2C88A 4Y2XA 1U7OA 5AIBA 2QLTA 4YCMA 3MN1A 3OCVA 2OBBA 3DNPA 4KN8A 1XPJA 1NF2A 2CFTA 2IOFK 3R09A 4C4TA 5ALGA 4PNHA 2ZBDA 3KBBA 4E88A 3L1VA 5AVUA 1Z4KA 4NWIA 2CFSA 1ZD4A 3FM9A 5ALMA 3AR8A 5AIAA 5AKKA 2B8JA 5JJBA 4NABA 4EZEA 4Y2TA 4BEWA 3UM9A 2FPWA 1SWWA 3IJ5A 1L7NA 1Q92A 5ALPA 3ZU6A 5AI4A 3OCWA 3IB6A 4Y2RA 2MSNA 3R4CA 3ZW7A 2JAOA 2YJ4A 3UMGA 2HF2A 3OCUA 3BA6A 4CE6A 4AS2A 1F5SA 5A3RA 2WF7A 4HGNA 2WHEA 4IG4A 1ZD2P 3NANA 1L7PA 1AQ6A 3KDPA 4UU0A 2ODAA 3L7YA 4HGQA 3J7TA 2FUCA 2PQ0A 2NO5A 3CZ4A 3WK7A 5AW3A 4UMEA 1U02A 1JUDA 5AM0A 2YBDA 2C9MA 1YDFA 2G09A 4ZEWA 4GIBA 5AHXA 5ALTA 1XP5A 4NFLA 3SF0A 2NYVA 4UASA 4DW8A 3FGOA 4HAIA 2GHTA 4FYPA 4OFZA 1J97A 2BDEA 2G08A 4DCCA 2I7DA 5AVRA 3AR6A 5AW8A 2HHLA 1RDFA 2YMLA 2I54A 2WF8A 1Z88A 4YCNA 3L8FA 2EARA 4Y2JA 1YMQA 4EELA 3NASA 4FE3A 4JDPA 3FVVA 3QU7A 1L8LA 2CFRA 2YN4A 2YJ3A 1NRWA 3DDHA 3ZVNA 3KD3A 3W5BA 5AM3A 4KX3A 4XE5A 3W5DA 2C8KA 3R9KA 4L6AA 3SD7A 4EENA 2ZBGA 5AI8A 5ALEA 2IOFA 3B9BA 4YIHA 3E58A 1T5SA 3N28A 2X4DA 4UAUA 4UMFA 5ALLA 4OCZA 2B82A 2HF7A 1QYIA 5AI9A 3KC2A 3L8HA 1WVIA 1Y8AA 3U26A 3ZVLA 3ZX4A 2BY4A 3FPSA 5ALSA 1ZD3A 1Z4JA 4MUMA 2YMQA 3ONNA 2GO7A 5ALKA 1TJ3A 2HEGA 2B1RA 5ALOA 2NO4A 1RKQA 1KYTA 1RKUA 3VAYA 2C8LA 3EWIA 4GXTA 5AVVA 1RMQA 1RLOA 2EATA 2ZG6A 3ZUPA 2R8ZA 4NAVA 3PGVA 4O8CA 1X42A 5T41A 1WZCA 3KOOA 4IFTA 3QGMA 1PW5A 1U2TA 3FPBA 4JB3A 4HGRA 4F72A 5A3QA 1L6RA 1CR6A 3QU2A 5ALZA 1T9ZA 3W5AA 5AK4A 5AM4A 1Z4OA 3QU9A 4Y2PA 4BNDB 2HO4A 3N1UA 2RAVA 2OM6A 1LTQA 2B1QA 3MMZA 4L57A 2JARA 2EAUA 2IOHA 3ZWDA 1N9KA 3U19A 5AM2A 5AK3A 3U7FB 5AW0A 5ALJA 1S8OA 3ET5A 1FEZA 2YMPA 3QX7A 3AR2A 4Y2YA 3CNHA 5AM5A 5ALVA 1CQZA 3PDWA 4CF4A 3I1YA 2WM8A 2GMWA 4BKMA 4BNDA 4XOUA 5AW4A 3L8GA 4J2TA 5AI0A 5AVQA 1RKVA 3U7HB 2RB5A 2B30A 1RQLA 3QU5A 4BX0A 5AVZA 1RQNA 1ZS9A 4DWOA 3UMBA 3OPXA 3WKDA 2ZOSA 2DQSA 4HGOA 5ALXA 3L0CA 3PCTA 1Z4PX 2HCFA 1J8DA 5AW7A 4BEVA 1ZD5A 3WKBA 4B6JA 4HYTA 1ZJJA 4KX5A 4Y2UA 5AW1A 2I55A 3RFUA 2G06A 1U2SA 3A1DA 4UW9A 3RF6A 1QQ6A 3QUBA 1RLTA 1Z5UA 3QUTA 5AVXA 4CF5A 3L8EA 3PGLA 5ALQA 4UMDA 1VJRA 5IS2A 3WK9A 1ZRMA 4RESA 3MC1A 4EEKA 5ALNA 3ZI4A 4BBJA 2CN1A 3K1ZA 4XPZA 5AKZA 1VFPA 2RBKA 2PKEA 5ALHA 4Y3UA 1U7PA 4I9FA 5AKEA 3DV9A 5AESA 3ESQA 3L1UA 3KZXA 2JAWA 2R8XA 4ZEXA 1Q91A 3AR5A 3WKCA 1L7OA 1L8OA 3N8GA 2IYEA 3SKXA 2WF6A 4Y2SA 1SWVA 5AKIA 3WKAA 2HSZA 5AK6A 1WPGA 3ESRA 2RARA 2B0CA 1RPZA 2FPXA 3TLMA 3QU4A 1Z4NA 3L5KA 4UATA 1L7MA 4G63A 3NRJA 1EK2A 5ALDA 3WK5A 3ZWKA 2R8YA 3A1CA 2FPRA 2B8EA 3SHQA 3SMVA 3ZVMA 3FZQA 5AVSA 3ED5A 3OCZA 4DFDA 2FEAA 1YNSA 5AK5A 3N5KA 2WF5A 3HLTA 4OD0A 3GYGA 3M1YA 2P9JA 1QH9A 3B9RA 5AICA 2ZXEA 1QQ7A 5ALRA 4YGYA 3L0YA 1Z4IA 2YY6A 4MWOA 2HX1A 1TA0A 5AKXA 2G1AA 2P27A 2G0AA 4UAVA 2FI1A 2Q4TA 4BX2A 3I6BA 4AS3A 1T5TA 1EK1A 5ALFA 3W5CA 5AI5A 2JGAA 3WK4A 2D2VA 4NV0A 2HDOA 5IT0A 3AR4A 2ZBFA 2JAUA 4I9GA 4EX7A 1RLMA 3ET4A 1O03A 4YIKA 5ALUA 1RMYA 3I76A 5AVYA 4UM5A 3EF0A 5AVWA
chains in the Genus database with same CATH superfamily
3AINA 1EFKA 1Z4MA 2WJVA 4HFMA 4B0PA 2CWWA 1SKBA 3DL4A 2G1KA 3F78A 1AH2A 1H2XA 1FZQA 4KQEA 4PZ9A 5EPUA 4AMYA 5TGZA 3WWYA 2VNKA 4LZLA 2D0PB 5FLEX 5GV7A 3PDUA 3RAJA 3A06A 4ZZ1A 4GGMX 4OGLA 2WIBA 5LZ9A 4ZREA 3NBXX 3RSOA 1ENPA 3M5DA 3SY8A 1KK2A 1CJUC 3UK6A 1A8UA 5LMZA 1I1HA 3IO5A 3ADKA 1UKVY 2CNNA 3KKQA 3U6BA 1N92A 3EOBI 4GPD1 3MWDB 4LDJA 1ILEA 2DWPA 2VPYA 3LPMA 3O8OA 5IKXA 2YC4C 3EEOA 3WHPA 2LP4Y 2Q29A 2NU7B 3U80A 1OFVA 3WGGA 3AK4A 4KXYA 3EVTA 1SPXA 2QR3A 4I0WB 5AKHA 3RUDA 3T99A 5K0JA 1OIWA 1WW8A 4ADSG 3OMWA 5IM4F 2W00A 3AFNA 3Q1LA 4QBFA 3DKRA 1MAVA 1NE7A 3PI7A 1GQRA 3IKTA 1U7HA 2AN9A 2C54A 1IOLA 2F3RA 2O52A 4HEQA 2Q5JA 4Q15A 4RCYA 2Q3FA 2ZSJA 4TT8A 1O96B 2ADFA 2ZIGA 1QE0A 1TI7A 1G6OA 1E63A 1FFBA 2F59A 2R7LA 1A5BB 1OXXK 2J46A 4PBSA 2OP0A 1KARA 3F3SA 1WD5A 1ZOIA 4P54A 5A04A 1H4SA 4L16A 4BHTA 1N7IA 5INTA 5LYJF 4EYOA 1XRSB 4L27A 3I58A 4NOKA 1QFXA 2YXDA 1W9HA 1Z82A 2KBEA 3DMRA 5B30A 1FMJA 3QELA 2GEJA 3NIWA 4P83A 1RZVA 1E4OA 2GAIA 4ZV9A 2RHOA 3BQ9A 1O5IA 3HYRA 3PUZA 4XIYA 4YRIA 3FDJA 2F8SA 3EGWA 2GEDA 3M6MD 2KLHA 2YWGA 4WN3A 3N0XA 1PZMA 3MB5A 2J0QA 2W6JA 3OJLA 3D64A 1T2EA 4V1CI 3QVSA 1LJUA 2X2OA 5A3SA 4GOOD 4F8JA 3EZNA 2ZJOA 5KKAA 5CNJA 2XUJA 3BMXA 3IT0A 3QXJA 5SYAA 1EU1A 4NCNA 2AWOA 3LC7O 3K5WA 1KDVA 2IEZA 3IUBA 4ZEMA 2VNAA 3EY4A 3L1HA 3VNAA 2AMVA 2ZDQA 1DO2A 1YA4A 3DOFA 2W6QA 3GJ4A 5E1MA 3C3XA 4AG5A 1BFDA 2H1OA 5AKJA 1YK1A 3ENVA 4RETA 4XSHA 4AO7A 1BGVA 4YT4A 2NSDA 2AMYA 1XA4A 4Q1VA 3SXPA 3TBKA 4RFSA 1EFPA 4JJ7A 1XRNA 2ZSDA 4CBVA 3AYZB 1AD2A 3TZCA 1MEEA 1X1AA 5FL3A 4BQPA 2FETA 1CT9A 4TV9F 2OZEA 1RAFA 4AZVA 3E9MA 2WD9A 3LCJA 4D8UA 3NALA 1P8AA 3N8HA 3DVQX 4QSHA 5FUWA 1W46A 2Q4EA 2VT2A 3JQRA 2VRBA 1P2BA 1ADYA 1CJMA 4ZTUB 2W8BB 5I7AA 5SZIA 4MR8A 3JZIA 4HDMA 3U3ZA 2G4VA 5AHKA 4XJVA 3G0IA 4DM7A 3MD0A 4DWVA 2Y2UA 4Q1CA 4BEBA 4LC9A 3U4DA 1CRWG 1LDEA 3QUAA 1XVIA 2XECA 4TMXA 4D0NA 2RJNA 1ZIPA 3IPAA 3FGZA 3SC6A 2YVKA 4RF3A 4RKFA 2CUZA 2ZJ8A 5EMJA 5IAEA 2GXAA 4E2WA 3WG9A 4KXUA 4ZYVA 5IRCD 1ZGHA 2R85A 2CK3A 4TN1A 4TL8A 4Z0HO 5J47A 1F8FA 2BTOA 2PZKA 3OCYA 4NYIQ 4D9IA 4X65B 1Y4DE 3H1BA 2V5VA 3PD7A 1MB4A 4I4CA 1T9HA 1KU0A 3OOWA 4BN5A 3VU9B 2PX6A 4ZMSA 1P0FA 2JFYA 1OR8A 2G9RA 2OCAA 2VHZA 2PGXA 3MJVA 5HFNA 5GVSA 4J9UE 3KQTA 2WW8A 3QFSA 2OBNA 2GA9A 4ANFA 5I3ZA 4MQLA 3LX6A 2BBWA 3Q6IA 1I3MA 1EVEA 2ONYA 3UQZA 4KXNA 2REOA 3RV4A 1WCV1 3P2JA 3MGBA 1HT0A 2I6GA 3KJZA 1N1DA 4EUNA 2FFHA 1AXRA 1RP7A 3RHTA 3WMFA 4QJIA 1WAMA 4MYRA 4P3YA 4QPDA 2Y66A 2HJHA 1ISHA 4L95C 1BWQA 3IC5A 4DQ0A 1N3LA 1I8TA 4RGQA 4WFQA 4B31A 5IBCA 1TVKB 4C20A 1NL3A 2XJ9A 4GI1A 1AUQA 4E2ZA 2B2NA 5JJBA 3K15A 5KYWA 4B79A 4NABA 2HIHA 2CW5A 2FQ1A 4JL6A 4L85A 5KVAA 1KMIY 5IUKC 3EZFA 3ILSA 1C1HA 4B35A 1K4YA 2UYQA 3NGLA 1KFBB 1Q92A 4DGQA 4N9WA 1E1CB 4EYKA 2BGIA 2ZUSA 3QQ5A 1YCGA 4U00A 2VWHA 3CNBA 5EC8A 3CS3A 2FMTA 2IYUA 4BE4A 5FFNA 3V97A 1Z0SA 5HIIA 2FDXA 3RVOA 2J7PD 4MHOA 3PGJA 4K28A 4QYTA 3QBTA 3CT4A 5I9NA 1T3LA 2XCQA 3T0GA 3QWHA 4FP9A 3PWSA 5HKAA 2K2WA 4I7EA 3AJ8A 2FPIA 4FMDF 2O3SA 1GEEA 2BFCA 4XX0A 5AVKA 4QM7A 2QP3A 5EIHA 1UZLA 4N5LA 4TVKA 3HWSA 2RH5A 5BPHA 1ZVJA 3G8DA 1SNYA 3IPLA 1FQWA 1KPHA 4CLDA 3ZXSA 3ETNA 2OAGA 3AY6A 4JELA 5E1DA 1N5IA 3HXTA 621PA 3I6YA 1QG4A 2TSYB 3OI7A 2ET6A 3LWDA 5F78A 3L79A 3MCUA 2P65A 4ABTA 3BMNA 3JQGA 1M7HA 1X8JA 1ZMTA 3F6PA 3PQ3A 4N82A 3EWAA 4PW0A 5CTAA 1L8AA 1U1IA 2I8CA 4KQWA 3TFOA 4G4SP 4Y1RB 3KRTA 3ZDAA 2YINC 2J5RA 4NP6A 1WHSB 1U7TA 3GZNB 3I4FA 4S1OA 2CDBA 4FYPA 5J43A 4ZHQB 2R2AA 4JHXA 3RYFB 3H2JA 4DJDC 3E4DA 3WRVA 1MC1A 4YRGA 1RDFA 4A36A 2Q5CA 1X7XB 2XB6A 1TUEA 1AQYA 4K26A 3WV4A 1YS2X 1F2DA 3CZAA 1RRMA 2NPOA 4EB8A 2HLDD 4ZVPA 2VRNA 2EKQA 1U2DA 3NDPA 5DYNA 2HQSA 4US2R 1VKOA 3DDNA 4MQEB 1A2OA 3QVOA 1SBNE 4P5EA 4FE3A 4Z2AA 1MJGA 3IURA 3NCTA 4QJ4A 6LDHA 4FHGA 1R6VA 3BJEA 1U2RA 3NQ41 3DFMA 2AE2A 2WA2A 4YJ3F 3CW2A 2QMHA 4LWPA 1UFKA 5DVZA 4P3NA 5T4HA 2C07A 1N2BA 3ROTA 4B3MB 2PUBA 1HLFA 1W4RA 4UVGA 3WL6A 2G36A 1ZK0A 3I6QA 3DEIA 4LDZA 2BONA 3CQ9A 4FSXA 2ZYIA 5K4AA 5U1PA 4WMLA 1B43A 1MQAA 2R62A 3G7NA 3QP9A 2EJTA 5HE8A 1D2EA 1FXSA 1WD7A 3L49A 3LPLA 4F1WA 4G5QA 1UWKA 3IKVA 3CXRA 2JGNA 4I81A 3VZQA 4I6GA 2F43B 3JWGA 2NU8A 2A0KA 2B99A 2BY4A 2XMBA 2BTQA 3RFCA 4AF8A 3I5XA 3O8NA 2ABWA 2R5FA 4FFBA 4LWZA 4OAPA 4BQRA 1GILA 1SB9A 2EYUA 1D5WA 1VCNA 2XOXA 3IQDB 5SYMA 3QX8A 1P44A 4Y9DA 4US0R 2VQ3A 5HKOA 1XJQA 2GO7A 3GLHE 3ZE0B 3G8YA 1OTXA 3TFWA 1L7EA 3MAGA 3BPSA 2NO7A 3W8FA 3SEZA 3Q3IA 2Q62A 1P4AA 3X1DA 2H1RA 2BM9A 3EWIA 3EEFA 2PUHA 3KUKA 3WGTA 4UQLA 2E6UX 2GCIA 3IPXA 1XPOA 1V8OA 1I2BA 1I2MA 2QRUA 4CLOB 2ON6A 2BIFA 1PRYA 2MSWA 2YDXA 1F06A 1NXWA 2EATA 1UP6A 1DU4A 4ZOEA 3ST7A 3ZQKA 4BJ1A 4DEVA 1UXGA 2IPLA 3FMOB 3I83A 3MBIA 3P0HA 3EW9A 4PG5A 1WZCA 3NFRA 1DAPA 1BHSA 5KYKA 4QRHA 5H9VA 4ERNA 2A35A 5DBIA 3SHVA 2E5WA 4JMPA 3DE6X 4GP7A 1CR6A 4EB6B 2P6MA 4CKWA 2VSFA 3H0EA 3BF7A 3L0PA 4O59O 2XB4A 4RZ2A 5TMPA 5C34B 2ANBA 5DH9A 2GN6A 3VV2A 4K9LA 1A9OA 1U5BB 1W94A 2P5UA 3F3YA 3MWLA 2XMDA 1E6WA 1CZKA 4HQNA 4BKOA 2E85A 4CL3A 3FAKA 3HM2A 4ARCA 2GERA 1B2LA 3FX2A 2DEUA 3PSHA 4JJKA 1T8YA 2HCJB 1VLZA 3P52A 3RYTC 2XYVA 4JH0A 4EHBA 4BFYA 3AW9A 4NULA 2IS6A 1S8OA 3AB3A 1CRPA 4Q9HA 4JR0A 3WL7A 3AR2A 2CJFA 5BT9A 4BNJA 1NPTO 2WSSD 1OLXB 1QIHA 1PHRA 2HMUA 2JI6A 2VEOA 2QJOA 3IILA 4PRYA 4CF4A 3I1YA 4XOIA 4UHJA 2Y1DA 1NXQA 3ROPA 5BOSB 4N18A 1ID1A 1P6UA 1R0ZA 2LXNA 1R74A 2J32A 2W4IA 3BEOA 4GWLA 4CMBA 1KVTA 1W0CA 3OM1A 4YXWA 3UJAA 1RQLA 1DHTA 2IU6A 3U5TA 1WS6A 2BTEA 1RXSA 1JG7A 2GD6A 2QQ5A 2KJQA 3WQBA 1IM5A 3IDAA 2EBHX 1KNXA 1T0HB 2QM7A 3JARA 3N8IA 3OJWA 3PLRA 4ZARA 5C8YA 5JC1A 1ZOSA 1JI3A 1GPBA 1XZPA 1U8EA 2VAPA 4BV2A 1NQUA 2VSNA 3RU2A 1M0EA 1J8DA 2I3AA 4BXOB 2QBYB 1XAJA 1PCXA 3RHZA 5A9SB 2J6BA 4LNAA 1V35A 2FFBA 1VE1A 2SKDA 3PHGA 3ESAA 4KX5A 4RA6B 4AS1A 1Z6XA 3PPWA 1K0FA 3WJ1A 4QFCA 5ENDA 2DBVO 3CKLA 1EP9A 4DIMA 2BFBB 5G4KB 4F38A 1NVXQ 4CETA 3CRW1 3OJEA 3TEMA 1HZJA 4Z4CA 4PX5A 3GN2A 4WV3A 1FDSA 4M1TA 1P33A 2OORA 2CV1A 4CM7A 1GTG1 1KC1A 3C3KA 5IW8A 3P45A 3H04A 1YUMA 2C9CA 1LVGA 2VBFA 3R3VA 4UXIA 3ISVA 2XTMA 4E4YA 2HGSA 1OVMA 4EO7A 5L53A 3PBKA 2OXEA 4L8LA 3MOIA 4HEA1 5DDIP 2OKGA 4C03A 5BW8A 3AM3A 5JT1A 1O5OA 1E5DA 4YUZA 1I7QB 1MO2A 1XKTA 2WUWE 2V6JA 3WGQA 3VM6A 3ZHYA 1R0KA 2CLKB 1YZHA 3I9KA 3WY9A 3ONFA 5BNWA 2B92A 1PL8A 4CCWA 4FCTA 2WF6A 1P7PA 4ZCQA 3W04A 1MJFA 2ZEJA 1IQRA 1JSCA 2Q6KA 3IMCA 1S2LA 3RK0A 4N49A 3FLAA 4WK0B 4DSOA 2P1ZA 5B4TA 1IH8A 3E48A 4IHQA 4LC0A 4INZA 2HK9A 4C7BA 3EQ6A 1VHDA 3V1NA 2WEKA 2GNPA 1VKNA 2AI2A 4FGZA 1MV5A 2NUAB 3TNLA 2Q2WA 4AKTA 3L5KA 3N9IA 3R0IA 1FW6A 521PA 4BNWA 1E3EA 4B6RA 3JSXA 4MDFA 1GPAA 2HF9A 3E3AA 3MS4A 3ZDEA 3SQNA 4J0KA 2IJGX 3CZRA 3ICWA 4Z3KA 3MZ0A 5JQGA 1VG1A 2NU9A 2ZIXB 3W9UA 5HDQA 3QSGA 5CA1B 2KHZA 4KE7A 4C6TA 3AVOA 3KAJA 1FJGB 1ONOA 1S01A 3B36A 5I48A 4A9AA 1FVFA 5THKA 1DAOA 4M2LA 3MUEA 3N6XA 3KDAA 4K9DA 2IU0A 1OFHA 1DDIA 1DPFA 5AXBA 3X1JA 3QEBZ 5FOQA 3GA5A 3SEAA 3HCEA 5A2QA 1R9NA 2WF5A 3CRNA 3F7TA 4QWMA 3SM9A 5I5EA 1WE2A 1XMVA 3DP7A 3FYUB 3F7NA 4CDRA 4B75A 2VP6A 4N3AA 3AFIA 1KOJA 3OZCA 2DPYA 2Y6VA 4IUBS 4P8RA 2GI4A 1EHIA 3JY6A 1NW5A 4YRSA 5GIPE 3U3RA 4DIUA 1R6AA 4EB0A 1YONA 2I2XB 3NYRA 3QX3A 3DFUA 1JPVA 2MIIA 4A1OA 1ORDA 1E2PA 2PTHA 4I6EA 3PHLA 4G24A 4BLOA 4UAVA 3G8BA 3SDSA 1XPRA 2D5LA 3PXCX 2F4NA 3LT2A 4QUIA 1UBKS 2JGMA 1XCPA 1H93A 1QTQA 2OTCA 1LBSA 4PX2A 1YZUA 5JNVA 4LRWA 5I7HA 1SQFA 3A1UA 5EINA 2JGAA 4XUGB 4P9NA 1A50B 2OMKA 4QJ5A 1Y5RA 3AQIA 3FNQA 1LZKA 1PJ4A 3N2LA 1SVWA 2AX3A 4IRMA 3OQBA 4MKXA 4QOSA 4ISCA 4RY0A 1J22A 2JAUA 3IQGX 3PWTA 3CF6R 3J80A 4GXNA 2Q2VA 3FCUB 4PYOA 5LNK1 2IYSA 1RTKA 3WLEA 1XVVA 3B6MA 3PICA 5HZGA 4D97A 5KC8A 3MELA 2RCNA 3SYRA 1ISSA 4HWOA 5I8PA 4J0JA 2XNCA 3TAXA 3BA1A 3TLEA 3C1OA 4EA6A 1RXCA 1WY7A 4CQMA 2IXEA 2IH4A 1C0EA 9LDTA 1KJJA 1QAOA 1BU5A 4NI5A 2CSXA 3O4IA 1Y6ZA 2JPDA 1QK5A 3JCZA 3L2OB 5GGYA 4DAEA 3AKCA 1QOQB 3G1UA 1FLVA 2Z2ZA 2DFDA 2IUEA 4XFDA 2IYWA 3TIVA 3CYFA 3KJEA 2F6RA 4FNGA 1E6CA 3IUMA 1S8AA 3F6BX 4GP6A 2VDWB 1AHPA 2JFWA 1RRCA 4NCJA 3T1VA 3OQIB 4OJTA 3CMCO 4TRJA 1RRGA 4EG1A 4KDEA 3AY0A 2FWNA 3KHTA 4UOEA 3VJKA 3WQHA 1PJ8A 4MQ6A 5DP1A 4L8YA 1Y8RA 3CF4A 1JYFA 5TSDA 1X38A 4U9HS 5JBIA 2CJYA 1E4EA 2P78A 3HKEB 1PO7A 2XGOA 5ILQA 2YCLA 4C4YA 2QG4A 4QOFA 2IZ5A 2REBA 3EXIB 1KERA 3DB2A 1Z2AA 2A2ZA 1ORIA 2ROQA 1ACMA 2AN1A 3JQEA 4QQRA 4RFLA 2FMXA 3NAZA 3OO0A 5KTSA 2R6FA 1DEXA 1QTRA 3DTVB 4AZ0A 2E4ZA 2BMAA 1PEDA 2EOAA 2G0NA 1UK6A 1NAHA 2V45A 3IT1A 1X94A 1X1SA 4M1ZA 3RVNA 1AO0A 3UMYA 2ZE6A 3UJCA 1IM2A 1N5RA 1N1EA 1NVAA 3KKMA 4Y9UA 1UMCA 3FTQA 3N0WA 3U4GA 2UXCB 1UBHS 3BWDD 2HW8A 1FNBA 3HUFA 2CL5A 1JJIA 3QLUA 3RK1A 3PCRB 2XR1A 1XGKA 4E6EA 4IKPA 4RZIA 4I3HA 4RABA 4RY8A 4DKXA 2M1XA 5HYVA 4AP9A 4BNZA 4RIFA 2O9JA 2XQIA 3NP9A 1U3GA 1PSDA 2CVHA 3C7AA 3GPDG 3HHEA 2OZKA 3MPOA 3HVJA 4D3XA 5LQRA 3GZJA 3OT1A 5AKGA 1ETUA 1QGYA 5AJHA 2ECKA 1TEVA 8ATCA 1Z2CA 2I2WA 3I04A 2IS2A 1I7LA 1MD9A 3BFKA 3SJBA 5JFTA 4K6KA 1GG5A 2PS0A 4D9KA 5C7LO 4UD6A 2BM8A 1G5IA 2OHIA 3E8MA 3RGGA 2GYWA 2WQZA 5FNVA 4FDMA 4DMRA 3NXSA 4RLHA 3GP3A 4TM8A 5B3JA 2X14A 1UWCA 2QZSA 3S7TA 2XBLA 1USVA 2E3JA 4GR4A 4IS2A 4Q03A 5EWJA 4AMBA 3TD9A 3BBLA 1TMOA 3CSUA 3UG7A 3ASVA 2PGDA 4HBZA 1ODKA 1D0IA 3EHEA 4HLUA 4Q47A 4RZQA 1EP3B 3ZIDA 3PR3A 1TIKA 4DS3A 2K7ZA 1NRXA 1QYCA 4BDSA 3O3OB 1ZITA 4KUEA 1JFLA 1L5SA 2G9UA 2V74B 3AB7A 3GA0A 1GLVA 1A96A 1GSAA 3ZR4B 5IJWA 4NE9A 4DRZA 1CUIA 4Z7QB 4MVWA 5B6PA 2WKSA 1YK0A 1R4ZA 3COYA 1L9XA 4IL5A 1QK3A 3M1IA 5AJZA 5BNFA 1XMQB 1CC1S 1GPYA 2JVIA 2IE8A 4BYGA 4B7AA 4HZUB 5A4FS 5BW5A 2HIMA 4FN4A 3O1HB 5FWXB 2XSZA 3Q40A 1QTIA 2SECE 4JJIA 4PGFA 1NRIA 1TKRA 1RBMA 3S44A 3WA6A 5CLQA 3L0BA 3MG9A 1NMEA 2LW7A 4CNQA 2C7GA 1NLFA 1PL7A 2J9XB 4N03A 4URYR 3IVAA 2E49A 1YVPA 1VLQA 2PLNA 4CN8A 3D3QA 5EOVA 3LK6A 3AHIA 1TJ5A 4JSTA 5EFZA 2C20A 2I8AA 4RHCA 1NMXA 1QH1A 5IYZB 1GZ3A 3R5FA 4GL4A 4X8HA 5IC6A 2ZE8A 5I3CA 4YAFA 3QH4A 1HNNA 4RDIA 2CFTA 3SZOA 1JPUA 1M5TA 2H1HA 4J6FA 4XYGA 3RC1A 1HG1A 4YMLA 3MT7A 3SIWA 3WBJA 1PNOA 1XNQB 1D4OA 1KI6B 1R9JA 4POAA 1DZIA 2CBZA 3D3WA 3IDFA 5KSYA 3G49A 3H1AA 2SKCA 3NJRA 4IOKA 4QPCA 5TPWA 3U81A 1A7KA 1F3LA 1ZD4A 2B5WA 5TRTA 5I5GA 2AOWA 1GTJ1 1AN0A 1BU8A 5BORA 4JVMA 2VAVA 3VGJA 5CB4F 4INPA 3OZEA 3WGYA 4H3VA 3GJSA 4ZVMA 4R7TA 2EDAA 1Q7CA 3EQZA 1SY7A 1Y98A 1A95A 2XAAA 1L7NA 4PLFA 4QFMA 2BEVB 2GPTA 2QTGA 1V45E 4FLMA 3T3NA 4KXQA 2H29A 4UPVA 5E4FA 3WNVA 1NQOA 1QVZA 4QDZA 4BS9A 2FUG1 2OK7A 2P3OA 1EYZA 1WSDA 1ZX1A 2FEPA 2JIOA 3M70A 2IYZA 5GONF 2AJBA 5BRAA 3TRDA 3LOUA 2ATCA 2GASA 1FYEA 3UW3A 4S3MA 3GP8A 1SPBS 4OHXA 1HORA 2J6CA 5REQB 5TF4A 4GX1A 2HF8A 3BA6A 3PUWA 3AF2A 3AU9A 4F9FA 3JAKA 1WU7A 1C7ZA 3PC8A 4P4NA 3S29A 3WGIA 3RSLA 4IGAA 1EFVA 3BTUA 5JZBA 5K4HA 2PG3A 5KOYA 5E7MA 5CT8A 1VBMA 4W5JA 3IXMA 2I2AA 4J7AA 4RADA 4IBOA 1Z6PA 2YWFA 4OI2A 1RRFA 4FR5A 4HWRA 2IV7A 3TQFA 4WL0A 2G5CA 3HNRA 1XRJA 5BSVA 1PFVA 4QBKA 4TUYF 1XNHA 4YMUA 1S2GA 4KV9A 3AEUB 3I32A 1QCDA 4DBVO 5B3KA 3U0BA 4GMXA 2IOYA 4DA7A 1NSTA 4TZ0A 1OGJA 1QV7A 3A2LA 4EPYA 2FW8A 3N0VA 4NV3A 1YDFA 1YQEA 2GARA 2PX5A 3JQ9A 2QTMA 1Z16A 1WDLA 4G2TA 2G9QA 4HEA6 4NFLA 4P38A 3EGDA 1EVKA 4ZU1X 3E3NA 2BOVA 4KE6A 2VIIA 3IOYA 1BYUA 4DLRA 1NURA 4DJFC 4W99A 5G3YA 2WWRA 1US8B 2G08A 1YXMA 4IXMA 5TVKA 1OIXA 1XXHB 2LPMA 4RENA 4HQ6A 5IVKA 3DUWA 1PT9A 4G86A 4E21A 5ESWA 3L6RA 5JNSA 1QC5A 5B1HA 1CSEE 4EMUA 4RVNA 2VWPA 5F12A 1SURA 2XRZA 4IEIA 4L8VA 4H4EA 1NYLA 3CA8A 3WP0A 5J4KA 3T3HA 4AK9A 3T7KA 5IVIA 1E18A 4V1CB 3VR6A 3A9VA 5FJIA 4HX5A 1EWTA 2O54A 5BT8A 1M6HA 1A9RA 1ONSA 1V5IA 3PC4A 5DHRA 5JPCA 2WIGA 4KX3A 1Z45A 4PPYA 4MLDA 1KPGA 2O8VA 3E03A 2N3ZA 1D1SA 1LWNA 1BAPA 3DE4X 3DLIA 4JS0A 4L4YA 1HYGA 4J3FA 5FKJA 4D2IA 3QE3A 1ZCJA 4LRXA 3I62A 2IOFA 1LD3A 1FU7A 4AURA 4G56A 4HAVA 1R5OA 2ZB4A 3WIEA 3P0FA 4YIHA 3EASA 1U0GA 1O0CA 1G3MA 3FMPB 3HWX1 4KRGA 3SE7A 1H8EA 4L5JA 5I7UA 1EAYA 3D6VA 1SUSA 3KB1A 5FWYA 4EZIA 1UQTA 2DWOA 4Z49A 4BBAA 5ICEA 2X58A 1BDBA 4M8KA 4YPFA 2UVPA 2C4TA 2ZYAA 3HFSA 3QFTA 5DF1A 3FVQA 2EERA 3ZX4A 3DLCA 4IUYA 2C9DA 3QE4A 3QKRA 2ZM5A 4Z53A 2TYSB 3MCWA 1AKEA 4KMSA 4U2GA 3U4HA 4AKHA 1UWLA 2X9LA 3KETA 1XTPA 2YX1A 3WWZA 4IF4A 4O4IB 2WQ6A 2PVCA 4BFZA 1FC0A 3OU7A 4ZCSA 5FLXA 3D3JA 5BSEA 1X77A 3HKBB 2JLSA 3UJ9A 5BSMA 4XI9A 2B1RA 4CMJA 3NG1A 3QW4B 4EEXA 1SEVA 4QICA 3PFGA 4ZIRA 1PR6A 2NXCA 4KPFC 1JLLB 3RVDA 1DJNA 4QGBA 3WLMA 1Y4ZA 1TUIA 4IOLA 2PV7A 4MW9A 2RIRA 3PDJA 2OGTA 1LBQA 1RMQA 2PS9A 2WWFA 1T6ZA 1HTBA 4YQZA 1SZJG 2Q07A 4CTJA 1BFUA 1MB0A 3JQ7A 5LR6A 3PJRA 1RM3A 3HR7A 3SHOA 1D5CA 2YBEA 5J59A 1VIYA 2QM0A 1V16A 1XF9A 4LQLA 4NAVA 4S0XA 1PD0A 5LNK6 4I1IA 4JJ8A 1YDEA 2CL7X 4L5CA 4TTSA 3K7EA 2I1QA 4M1SA 3W6OA 3BFJA 2WU4A 3BICA 3SOZA 2EGGA 4JBGA 2Q27A 2ZUWA 3D4LA 1X3LA 1AZSC 1U2DC 2GF0A 2Z2JA 3MRSA 4LZPA 1NPDA 3QU2A 4P1ZA 2KLBA 1WNTA 4O2BB 4F5WA 3MJ4A 4RPHA 4NJEB 1KE2A 3UN1A 3V7NA 3MUNA 1EE9A 1L5OA 3KKPA 1COWA 3AWDA 3E82A 1VYTA 1ISPA 3T61A 5ANRB 1SXJB 3ADDA 2R7KA 3O4HA 4PWYA 1B3RA 3IP9A 4QOJA 2O20A 3MWEB 4EOGA 3F5DA 4EI7A 5M04A 1C3JA 2ZT5A 3EA0A 3NYWA 1GNVA 4DMKA 2QP4A 4QHSA 3I39X 4H7EA 3KVVA 1U28A 3OLQA 4RH0A 4B0OA 2YRFA 2OEPA 2V7VA 3GGPA 5LUAA 1G2OA 1G21A 3VO8A 4DC0A 4EAAA 3ROMA 3RUFA 1Y5MA 4AMUA 4BX9A 4HNTA 3RTGA 1Y1LA 4CDGA 2DOKA 4AX4A 1U2EA 4AF6A 4B5LA 1QRAA 3PE4A 3ZD7A 1NYRA 1FRNA 2XXAA 4AN0A 3V7FA 2WM8A 1HLDA 4L3VA 4X6UA 3I64A 1X39A 1IZ0A 1EZZA 3M34A 1KI3A 1O8CA 3OFKA 3DLHA 2J59A 5GPBA 4IR7A 2ZUUA 1RYYA 3DHEA 3E27A 4IXDA 5DLEA 1DT5A 4IIJA 4KVGA 1F6WA 4RV9A 5BV2P 4CFYA 3OFSA 1PD1A 2IIBA 2Q41A 3ABRB 2JI9A 2KMLA 1XZCA 1ZRSA 2MCFA 4C0HA 5BMVB 2F1HA 3QVUA 5BQXA 2AFIB 1ZMRA 2XUQA 4HJXA 3TRJA 4GKAA 3JD3A 5A6VA 3CUSA 2VUSA 4KO4S 4J75A 5TE9A 1G8SA 1II0A 2LUOA 4MO2A 3X44A 1DRWA 3OQNA 3WICA 4G8CA 1XZ8A 2AEJA 5DI3A 5FADA 4BJHB 4BVFA 2BZ1A 1TD1A 3JASA 1R16A 4WBNB 1LJ8A 1KP9A 2C1XA 3KUDA 4L9RA 3HL0A 3F7OA 2GVDC 1RCTE 1SN7A 2RMKA 1HYBA 1ND5A 2ZW9A 1XAGA 4WHMA 3V2UA 3L40A 4R1SA 5CLIA 1KTVA 1E5XA 4PYRA 1TCCA 1WQ4A 2CD9A 3TE6A 3MWDA 5EKSA 3UFXB 3PVZA 5ALQA 2H7XA 1SKMA 3ICEA 1C9EA 3RKUA 1Q50A 2BUBA 2BKEA 3X1WA 4P4SB 5BUZA 3P94A 4ZQIA 2CMGA 3BWYA 2H0RA 3GXOA 3NM4A 3DD5A 3P0JA 2V96A 1CUGA 1M2FA 4Y3UA 1Y1QA 3O91A 5AKEA 4ZRDA 2TS1A 1QK4A 5K8IA 4TYMA 1F7UA 4YJ2F 1W4LA 2WYUA 3KZXA 2DYKA 1PG0A 1DJLA 3HA7A 2I6UA 3GD7A 3HEMA 4KQJA 4B3SB 1MFPA 2BEUB 2J08A 1OVGA 1OTYA 1YH3A 4C08A 2VP4A 3DL0A 4Q4LA 1JX6A 4I1RA 2G7MC 4JI0B 2VF5X 4I9NA 5GJVC 4ZI3A 2PUAA 4E0BA 3LBFA 1E1RD 4EKEA 5T7BA 4LWQA 4X63A 2QGNA 1TQ2A 1RXYA 4B6OA 3QYJA 2O0HA 1W5BA 3F47A 5EMKA 4G0XA 3ZWVA 1H1DA 2DPMA 2PMFA 3W6UA 5HS4A 3AP2A 4JJAA 3SS7X 3T9EA 3H0KA 1HDOA 4RPCA 5PNTA 1W5FA 2J0SA 1BRMA 3WL8A 4X1YB 4KODA 4OK6A 4K6GA 3KYDB 1XMJA 3EK2A 3OHSX 3FR7A 2VAWA 4IICA 2UUAB 4C43A 4BNNA 5IXSA 1QGUA 4G5RA 1LF5A 5J63A 1DLIA 1L6IA 1NT2A 2HUPA 1VRCA 2VH1A 2ZSAA 2O8DB 1DCFA 1H1LB 3L7AA 3E05A 5JSYA 1D07A 1TYAE 3GLTA 1HBJA 1UT5A 3UTCA 4G1CA 4DTCA 2Q6TA 4KFCA 3SEFA 1F2TB 1PZXA 1GZ4A 3EBLA 2ZKIA 3KSRA 4ILEA 4KWIA 4NONA 5IJXA 1XHLA 3M1YA 3LY5A 4V0MA 2IHNA 1XOIA 1IUKA 3A1VA 1QH9A 4D9EA 2FTKE 2H08A 5LDGA 4IQ4A 1MA3A 1TLLA 3SC4A 2OCBA 3CWCA 3VOBA 3L0OA 1NBEA 2B4YA 5GZ6A 1SU7A 1U0JA 1E1LA 2L17A 4JLBA 3IV6A 3WWEA 2C2ZA 3UAOA 1AKVA 4JI6B 1U3VA 3T3GA 2XPCA 3A9WA 1QX4A 2JCYA 2OORC 3NHUA 4Z86A 4OKIA 4AZ3A 1Q2UA 4FHCA 1LSOA 3P2YA 3IE2A 4H1VA 1BD4A 1VLHA 2QRNA 4FHDA 5DX0A 2O07A 3ILYA 4L50A 4RGYA 4MB2A 4XLLA 2V7EA 1K8RA 3QY9A 1ESCA 3IH5A 1NIPA 1XA0A 4WECA 2W8BA 1RHKA 3DJYA 4NCAA 3EFOB 4KYUA 5KTTA 4GD3Q 3WK4A 2AYZA 1PWEA 3QXSA 5SZJA 4XR4A 4R1MA 3O38A 5JPDA 4Y7CA 2P6OA 3UFBA 4E22A 2ZBFA 1IM8A 3K1AA 2QDKA 2FUG6 1AKQA 2ZIVB 3SSAA 1UBNA 5D00A 1GZVA 1F0YA 3ESCA 3OJXA 4UDXX 3KQWA 3FDZB 1HY3A 4Z4GA 3I76A 3U49A 1DL5A 3TOZA 4DWJA 2F3PA 5T67A 2GKGA 2BMEA 4CTOA 3VYSB 4KSYA 4ZA2A 1CJCA 1BXGB 1E62A 5E0OA 4D8WA 4OGFA 5K20A 3I2HA 1S6YA 2O5VA 2ECQA 3I9OA 1XD9A 4TSRA 3N5CA 1HDXA 3HB5X 2R6JA 3BDAA 1EUZA 1ZFNA 2QYTA 4EI2A 3ZXYA 4LZAA 1EJ2A 4KQMA 3ODGA 1ZI6A 5CG2A 1WMAA 2WVJA 4K05A 5TB5A 3NM5A 2RHMA 2ZS7A 5BP7A 3NHLA 2LV8A 2YW9A 2ZREA 4A5SA 5JMTA 3U6KA 2QL6A 3V34A 1SO8A 3O7MA 4IM7A 3TM5A 2A58A 4MP6A 3CEHA 2W93A 4Y6LA 5K8LA 5D6OA 3G0OA 4RD6A 5JAUA 4ZAFA 1XZBA 1ZGGA 5CCEA 2RHBA 1IWOA 5K0TA 5AD1A 4Y1FA 5DZSA 4LPSA 3V4RA 3AM1A 1RBQA 2EJUA 4IZIA 4R1LA 2ZRGA 4EGAA 5CGQB 1UJCA 3KQKA 2IY7A 4QUEA 4K87A 4Y2GA 1F8XA 1V5FA 2RGBA 3RR2A 2AD1A 3ROKA 1XDUA 3TRHA 1N5JA 1L7XA 2VH5R 1O08A 3VR4A 4RJ2A 1W2GA 5THQA 4TSFA 2H9IA 2UYGA 4EUEA 5KEIA 1T15A 2QTFA 3TL6A 2PLAA 2J67A 3RJTA 4DILA 5GGXA 2JS7A 3MINA 1QHXA 5FPQA 4JWKA 3JVVA 1E3LA 3AF4A 3D1LA 4MI1A 4ND3A 4DF3A 2RKOA 3CTPA 5LXTB 3NGMA 1M6VB 4ZXPA 2O1SA 5HGJA 3KALA 4EFMA 3I30X 4OGWA 4X6LA 3PC6A 4GYKA 3R3HA 4B81A 2YJ6A 1Z28A 3P2OA 2PS1A 1IY9A 4WW0A 5EMLA 2GXQA 2MDTA 3S2FA 3TKAA 4G9BA 1H2FA 3M9WA 4KGXA 5CCBA 5J4VA 1YQ9A 4WAUA 1FY2A 1MH9A 1N8NA 1T2NA 2FSHA 1RC8A 5L9AA 1J8VA 3U7QB 2XBUA 1CULC 2X2FA 4NARA 1IWPB 3U7EB 3WXMA 4BN4A 1NNSA 1PL6A 1Y6GA 5FV4A 1KRXA 4Y1RA 1E3QA 1MO6A 2PZEA 2X19A 3LL4A 4CU5A 4NBSA 1JHYA 3WQQA 3EA5A 1H9AA 1C9DB 2QPOA 1O0SA 2LNDA 3NMUF 2HV8A 4CG0A 3RYFA 2WFZA 2ZB3A 1L5GB 1NVDA 2V8OA 4I4TF 1Q3KA 1G6Q1 3V8NA 4LCBA 4YJKA 4M8NE 4P7BA 5F9MA 4I5IA 1XUOA 4ASUD 4JQSA 1GZUA 1GLNA 2EW1A 4Q4HB 2CBGA 4YHBA 1SQ0A 2A0XA 1EX9A 3FKJA 3OF3A 3T6KA 4FIZA 4CM5A 2OAQ1 3BHMA 3GEEA 3MTBA 3SDBA 3AERB 3GGGA 5JAOA 1GT91 1OT5A 1TYZA 1B8PA 1UXJA 2HMAA 2NV6A 1HOTA 3G2NA 3Q5DA 4LHVA 3VR4H 5KVVA 3QPUA 4HAXA 4PHTA 2CJWA 2A8YA 5A0VA 3DEYX 1FCJA 4FX5A 3UMCA 3K8QA 1USIA 3WK6A 4R54A 3VHLB 4QDJA 3CX4A 4HCJA 3YASA 1VDMA 1VYVA 2A0UA 3G0GA 1ISGA 3I28A 4IHJF 2IUSA 4Q9DA 1Z7WA 3PFWO 3KLBA 9ATCA 2HRDA 4D9GA 2X8BA 4F85A 4YY3B 2XZOA 1W0KA 1F8GA 2A3NA 4Y2XA 1UBJS 1U7OA 3UICA 5AIBA 2FJ0A 1YE3A 1PGOA 3OZDA 1LLFA 4MGEA 3QLUC 5DM0A 4WZ6A 3FNEA 1KY3A 4UE6A 2C4WA 5F21A 4OAOA 2CLCX 1T5LA 4JYMA 2EQBA 2F43A 3QBDA 4M1EA 2C3OA 3W8NA 1SCNE 1PBNA 1DNPA 4ITVA 1WG8A 2QN3A 3LECA 3OZFA 4R1OA 2BUCA 4YP0A 1M75A 3JPWA 2C2YA 1LDNA 3BK2A 4NWIA 3TLGA 1E1QD 4V0OA 4Q9KA 2CFSA 3CUEF 1I33A 2ZBVA 2D1YA 3COSA 3H2BA 3IIEA 3IMGA 2VO1A 4W7HA 4NC9A 4KKXB 2YV4A 2CXHA 3ZDBA 2QW1A 2AZMA 1N9ZA 2CMHA 4NOMA 5EJMA 3WGKA 3VO9A 5ECGC 3E1SA 4BMSA 4Y6OA 1C3OB 1EFUA 1E79D 3MTGA 2FPWA 1SWWA 2KE5A 9ABPA 1VCMA 3CIOA 1XNJA 3PP8A 4HYYA 5AI4A 4MUIA 1NJ5A 1XV5A 3OCWA 2Y27A 4GMFA 5I8ZA 4AWBA 5B3JC 3BERA 1QWSA 3R7FA 3H9EO 4E14A 3R4CA 5JQWA 1UC4B 3H5RA 3QLTA 3OH8A 1MB9A 3KLMX 3TSWA 2ZIWB 2NQTA 4TXJA 3OKAA 4HLUC 4OQXA 3RUPA 1GTVA 5CIYA 3JWJA 4G09A 4X97A 3VTFA 5JAQA 5CVTA 3D43A 1A3CA 1OE0A 2RHDA 4HD8A 4JL8A 3X1KA 1OYOA 1GT6A 3GUVA 3DZ8A 1WETA 2JCSA 4X20A 1VL2A 2JFZA 1KYIA 3L7MA 3ROGA 4HG2A 4AECA 4XWTA 2AMFA 4BLUA 1ILWA 1AZLA 4HWTA 4HRAA 5K5EA 3LX8A 5D85A 3UZUA 5CYFA 2A67A 1J56A 3WK7A 1IK4A 1UFQA 5E9AA 5B2ZA 3C85A 2GPYA 2H54A 1LX6A 1WXWA 1ELOA 3AL3A 4OHPA 4Q1FA 5FUXA 5DBGA 1EWVA 5CJJA 4DR5B 1TKBA 4L5AA 3C2QA 4F7DA 5HZKA 3Q85A 2FWJA 4XPIB 3RNOA 4YB8A 3HWRA 3PTZA 2H3HA 3LE8A 2C4VA 1NU8A 2D3WA 4DW8A 3R5SA 3ZD8A 1A77A 2WM9B 2ZSKA 1Y9EA 3AI3A 3MFQA 5KX5B 4GZ6A 5EE3A 4D9HA 1OY1A 2ZSBA 3K1YA 5I7WA 1UZNA 1Z35A 2CV0A 2JBWA 2F3SA 4W9MC 3AEXA 1AGNA 1XTZA 1HDGO 1SBCA 2ZRNA 3JWHA 1VDZA 3QPCA 4Q9NA 2FCRA 2OLJA 4TQGA 4E3WA 5F9FA 4CM8A 5KJ1A 1BX3A 2ETXA 1I4WA 4TV9B 2WNSA 1XQ9A 4YACA 1VJDA 2UYHA 1PWHA 2X2EA 1R5BA 4LYYA 1G0NA 5L6MB 1SBIA 1TX4B 5A9SA 5KOJA 1NRWA 1W6RA 1P4HA 1MBZA 2HSJA 2R6AA 5IWAB 1JWLA 4KP7A 3GFGA 2YH2A 4ZOLF 3BWCA 3L8MA 4RA6A 4O2LA 3VHXA 4H3KB 1EXVA 2ZBGA 3KEGA 3RYIB 1GGMA 4LDRA 1IL0A 1E9AA 2BFBA 4GM0A 5G4KA 3GO4A 4RYLA 2ZTSA 1SRQA 2J9YB 1PR5A 2Z1MA 4M1OA 4MW4A 4R2HA 4TLAA 4Y7DA 3N28A 1Y33E 2WUGA 4LW8A 4K0RA 1HGXA 1C4XA 2B82A 4MVJP 3C3MA 3N7UA 3KIPA 3PC8C 2XHZA 1D6SA 4IQ0A 1GL3A 4QTUB 1G8GA 1WMDA 5JMWA 1E1KA 3GPIA 1OYVA 3O03A 1SHZA 3FPSA 3P9PA 3PX2A 1TD9A 1BH6A 3C41J 4KXMA 1COWD 3RHSA 3KKEA 1A9ZA 3WIUA 2OHGA 1UBCA 2D7JA 4O25A 4Z1MD 1CG6A 1EM6A 1XJ0A 3ZDCA 4R8LA 1K7XB 3G82C 3V1UA 1NYTA 3X1ZA 1KMHA 1XDSA 3VKUA 1YR1A 4UZEA 1WV1A 3FSGD 4I99A 3GT0A 1U1GA 2JFHA 4LXHA 1DTSA 2DUWA 1PE0A 2WWHA 4RW0A 1RKUA 3SQDA 4YRBA 5IJZA 2DHCA 1PTKA 1G9SA 2RG1A 3JQ9C 4BMYA 4TTPA 1BMFD 1T9KA 4O3FA 1V7ZA 3UOGA 4JX8A 3UAXA 2ZITA 4GW3A 3DLTA 1JTEA 2ZG6A 2PEZA 5ITWA 1Y6JA 1V4VA 5JO0A 3OP1A 3R23A 3R40A 3RBXA 4JT4A 2XWBF 2YXNA 2C2OA 3V1KA 4Q1BA 1H6CA 3OFJA 1VHWA 2DR0A 3B5JA 1OWLA 3W1WA 4YPOA 1ETHA 1RQPA 3SF8B 1H69A 5H8WA 4K9NA 1YAHA 2PGAA 3V4SA 1DO8A 3E2PA 2F8LA 4WLNA 4ESHA 4BWVA 2HM7A 5HJ2A 4NMHA 3NJ4A 3U3JA 1Q1AA 3GH1A 2I0FA 3UPDA 2WR8A 1ZJ4A 3A6ZA 4W7IA 2PUTA 4X3PA 2P8SA 3LUDA 3UK0A 4BU0A 4Q21A 1JA9A 1GCOA 5EHGA 1FX0B 4IQ8A 1GVHA 2AQ8A 3OMLA 1Y1RA 2BKXA 3R7DA 1EXNA 3NLLA 4GOLD 1Z68A 2CVFA 3PNLA 3SI7A 3VNRA 5LLDA 3RVKA 4RTOA 3GLGB 4V38A 4GYWA 3MD9A 3BCSA 4LISA 1MRZA 5JS2A 5AW0A 5I01A 2X0NA 4PONA 3OSZA 5C5DA 3C14C 3R5TA 3T3IA 1LEHA 4Z7NB 3OIGA 3OT4A 4WX2B 1NXPA 3B7WA 1EVJA 3C1UA 4REMA 3JQ8B 1G3QA 3Q5GA 2V9ZA 4YMIA 2L2QA 1C1YA 1TL7C 3USZA 5B53A 2VQ6A 4EJ0A 1DMRA 3GDHA 1L5WA 1PLJA 2GWRA 2RB5A 4HLDA 3SU8A 2UU9B 4QVKA 1FFEA 1GNLA 2JGLA 4NNOA 4ENVA 4PN3A 3KAPA 3JALB 3BL5A 4AU1A 5JHHB 3K9GA 3GEBA 1T2AA 1LNQA 2FCAA 1VGVA 2I3GA 3BJZA 4EI9A 1FX1A 5JJ5A 4S1VA 4YYZA 3GRPA 2FQQA 1NT4A 2GD1O 2PJUA 1D04A 4PZEA 1Z4PX 4OJYA 3G88A 4KWHA 3E9DA 1JDTA 3HVHA 2AUNA 3KT3A 3R2JA 3WKBA 5J5VA 4ZT4A 3W1EA 5B3LA 4YR9A 5CLHA 1YB7A 1YGYA 2CNLA 1DQRA 2GRAA 1J5XA 3OLVA 3ONWA 4JIMA 2P3SA 3DHWC 1U2SA 1I4EB 3FCAA 2A5GA 3Q8XB 5BSUA 2E0IA 4YJ3B 2NQ8A 3STUA 4HO1X 4J29A 5LIRA 3AFOA 3BMOB 3LKZA 3LX5A 4UAJA 5AVXA 4ZQCB 3ZDXB 5JYEA 4L1KA 2FG6C 4NBVA 3WK9A 2VDWA 3LQ2A 3FJYA 4Z9FA 3OQIA 3P0EA 2NO9A 4BBJA 4FS8A 1KAOA 4KEAA 3I1IA 10MHA 2HBYA 1XCGB 2C7BA 1QIMA 1P2FA 3DCJA 1TUBB 4HAUA 5B1DA 4AJPA 1J23A 2GZSA 5K0ZA 3EH2A 1XLVA 5BNTA 4FDTA 4NR0A 2WV9A 4YDSA 1U28C 4OQ4A 2HRZA 2I4MA 1U2ZA 1A98A 4H6PA 1THGA 3QKIA 1DQZA 1L7OA 2XKJE 3FSRA 3DV0A 1BG6A 1G8JA 3I52A 3KOWA 3DTVA 1H2WA 3ENWA 2C78A 4I8XA 1F9AA 4R83A 3UMRA 5FPTA 3VR2A 3X2SA 4C0QC 2YFHA 2A9OA 3H4IA 2QE7D 2FPXA 4BRSA 1XZGA 4MKHA 1AV6A 3S5UA 2LD4A 3TZBA 4NBLA 4K9MA 2ZYUX 2Z6QA 1K89A 3B9QA 1JN0A 4FSHA 2HXSA 1Q1BA 3FRJA 2J1LA 4PO1A 3UHFA 3BDIA 4IFBA 5DMHA 4PC2A 1ULHA 3I6IA 3GZ4A 4I66A 1NV9A 3IRVA 3KM0A 1IZ8A 5JZ9A 4E15A 3IE1A 4YJFA 3SMVA 2RCYA 3CRMA 1ZN8A 1ZQ9A 3CSDA 4JQZA 3TW0A 2ISQA 3OIWA 1KAMA 2XT0A 5E9JA 1PR1A 3CPJB 1KL7A 2FEAA 3H5TA 3HN7A 3S68A 4QDKA 4GS5A 2KM1A 1P0IA 3GVCA 2V9CA 3O9MA 4JKIA 1DKPA 1E8DA 1XZFA 3DFIA 4KUGA 3B9RA 4QPNA 3VSCA 4DJAA 4IVRA 4LE1A 4FMBB 5ELMA 4ENUA 7ADHA 5I9BA 4BGUA 1N57A 1OXBB 1Z4IA 1BH2A 3GUYA 4WWHA 3AHCA 1T2DA 4KQ9A 3BTSA 2XH8A 1L7QA 3AEQB 2IFTA 3N2IA 3LLUA 5FOUA 4DLLA 3NH6A 4J0FA 3KQLA 1JP7A 2GESA 1QF6A 2OFXA 3GLHB 3WR5A 4D4JA 2WG0A 4BX2A 3K09A 1EINA 3CUTA 2J5QA 1I24A 1EK1A 2FPGB 3CJTA 5K8TA 4KQGA 4UHHA 4N1AA 3SK0A 4M53A 4BO0A 1UPCA 1HSZA 1XEXB 2C29D 2WUEA 4EPTA 1O4VA 3HUTA 5LLSA 3S81A 4HF7A 4NHOA 4WUVA 1DXHA 4W1SA 1IOVA 5IJAA 4A26A 4G0YA 4EW6A 5DTQA 4ER3A 4HZUA 3NT4A 5ALUA 4UM5A 4B4UA 4BQNA 2DH5A 3QJ5A 4R2IA 3HKDB 2WABA 4E08A 3VPXA 2ZT8A 4ZDIA 1J00A 4EHFA 1E32A 3IIIA 4JOCA 1GZ6A 4WFKA 1Y5NA 4UU1A 3WGJA 1U9IA 4FS3A 4EA9A 5C8ZA 1VCHA 2ERXA 3C5EA 3Q9NA 5K0BA 4G5OA 4PANA 2WIDA 2YASA 3U3DA 5LQCA 1PGQA 2JI8A 4JLVA 2WHXA 1DFHA 1LK5A 3K16A 4CMIB 3NYIA 1LRJA 3I09A 4FZRA 4NV1A 3ZIUA 2C7QA 5FI3A 5KVCA 2WOOA 2VYND 3PRHA 4PBTA 1IHPA 4EG8A 2O2JA 4MUXA 3DMGA 3H18A 2D8AA 1FOEB 1G3UA 2AOUB 1KI6A 1DKNA 1GU0A 1YRQA 1UZUA 2OZLB 2YN2A 2Z2IA 4MMYB 3ND6A 5LUBA 2IGBA 4EPRA 1ZUIA 4FZ3A 4B84A 5IU6A 2N75A 2TMDA 2BKAA 5HMLA 2N46A 4KLRA 4C0WA 4KR6A 2I9KA 1KEPA 2HWYA 1E2QA 1NHGA 3OPNA 1W85B 4JU8A 2ZB2A 3C5HA 4U2BA 4J07A 1YCHA 2J0UB 3D8SA 3JYHA 3OIVA 5ARDA 2PL5A 3DPSA 1JILA 1RCFA 4JJ6A 4JBNA 5EVCA 2UAGA 2D06A 4I1PA 1QGZA 1HL3A 3KU1A 2IP1A 4M9ZA 4EY8A 4YJGA 3SDZA 1B42A 3OCCA 1GGHA 4QBGB 4AKIA 4L51A 4ZYWA 2VDOB 2BF4A 5EA2A 3OCJA 3EGXA 3AT1A 5BN3A 2ACEA 3FD8A 2J45A 3L9XA 3MTQA 1QP0A 5FR2A 2G6BA 2WAAA 3ZHQA 3AVVA 3E84A 2X8WA 1Q1NA 4KQXA 3PCXA 3ICPA 2CFIA 2FUEA 2CXOA 1P7CA 3E6AA 3INRA 4KRFA 2H4ZA 2HA3A 4RL6A 1QVWA 1NXSA 3RASA 3SIRA 2B21A 1W87A 2JIPA 3BAZA 4GKVA 4LZNA 1L5NA 3R75A 4BQOA 4MUYA 2GZMA 1RYNA 1O2DA 2G3YA 3WO1A 1CYEA 4UNNA 1VPEA 5IC4A 3PUIA 3UTDA 4X95A 3ZCQA 3L0DA 5LQMA 1RWNA 4FQ7A 4NK4A 5JSZB 1XWFA 3CVWA 3KR0A 3MLAA 3UF0A 3AKZA 1J07A 2DSNA 3EEYA 4MTCA 1REQB 1P2GA 1IUNA 1QTNA 2FW6A 3CH7A 3QVVA 1FDWA 4LTDA 4PQFA 1B8VA 2CXUA 4G85A 1ECCA 2X7JA 4DZRA 4KFUA 5A5EA 1VPDA 4MITA 3SR3A 2AH5A 1GYQA 4BNYA 2X0RA 1BTOA 1MOPA 2CXSA 2QDXA 1L4EA 2VHCA 2GAOA 3CX6A 2AR7A 3NH9A 1IXSB 1XXHA 2PYDA 3VR3A 4BFVA 5AM2A 3MMSA 3TL2A 4KAJA 3OTQA 3U13A 5LP6B 3TF5A 1C4OA 2WJHA 4RTPA 4WZZA 4R51A 4F04A 1QOPB 3N07A 4O63O 4S04A 2UZAA 2XA9A 4TN5A 5TJ9A 3H5WA 4M86A 5DE3A 1F48A 2NADA 2Q1TA 3NUQA 3JAWB 1YVRA 4Y6SA 5E9QA 3MEQA 4GM1A 3ZWNA 3RQIA 3AJ9A 1RRKA 2P9BA 2ZYGA 3HGTA 2O6LA 4MRMA 4PF1A 2QXYA 2GZ2A 3LYLA 4KAAA 2MOKA 3DE3X 3R24A 2HRCA 1GFSA 2ARKA 4UM7A 3GCDA 2W70A 4A2CA 1S9DA 1YS1X 2ZT7A 3VSAA 5BSFA 4LF8B 1BJKA 4U7PB 1DS6A 4GKKB 1Z62A 2O2EA 1XF1A 3PSAA 1U1FA 4JT9A 4UHFA 4QLBA 1GRVA 5BUSA 2P6UA 1T5DX 1YI0A 4ESOA 1M1XB 1QVAA 3DAYA 2B1IA 4E1VA 5CH8A 4YUVA 2NXJA 2YYZA 4KDRA 5C1IA 3HYSA 1NC3A 4N3BA 1W29A 2AMJA 2C2WA 2FU5C 2OCYC 3ABIA 1A69A 1N4AA 1U4NA 4FQ5A 4ESEA 4F21A 4YMVA 4MR9B 3UCEA 2DVMA 3KB6A 2BEWB 3BB1A 2FDCA 3RBZA 1JH8A 2QVYX 2JIZA 2YYYA 2R7MA 2H06A 3H9CA 1JHXA 3ELWA 5DW0A 1OWOA 3HKBA 5K3AA 4TM7A 2R751 4E12A 1CEEA 2H63A 3W78A 3FM9A 3H2IA 1B41A 4EVSA 3HKCB 1RAAA 3BDVA 5BVGB 5HTOA 1IIRA 3CLUD 1LX7A 4D8TA 1TAGA 1VPLA 3AGQA 3LHDA 4HEJA 1E8MA 1J4AA 3RAGA 5KJEA 4CMHA 1BROA 1UM9B 3DBIA 1RI4A 4EKDA 3RTBA 4BNHA 3ZNNA 2ACWA 3ZLBA 3DVAB 3IT2A 5HQ3A 1TF7A 1SAYA 3GJTA 1QLJA 3HBMA 4YAOA 2MSNA 2QT0A 1QAMA 4UM9D 3THRA 4LNUB 4OL0A 2E55A 4KRYA 4LPKA 4AJ9A 4OLBA 4IOMA 2DAPA 4JJ4A 1JA0A 2HF2A 2GM9A 4S1WA 4AFNA 2YIVX 2DPLA 3PEFA 1X7HA 4LF5B 3LLMA 3RB8A 3ZCSA 1UF9A 5EESA 2XQJA 2Q6OA 2WPDD 1JJFA 5FTMA 1WCIB 1ZD2P 3V4LA 1VI5A 3O8QA 1JKFA 2CHUA 1CQIB 2GZHA 3DE5X 3GQVA 3M83A 5C8YF 1KKMA 4YAIA 5JZSA 4LK2A 3ZE1B 1UEJA 4IJKA 1NQ5A 1CEXA 1E4VA 2PLRA 2QVCA 1MX5A 3UUWA 1I14A 1TDJA 2OE2A 2WICA 3GMSA 5JSHA 2G28A 3D7MA 1OWNA 3CCFA 4GAEA 1DEAA 3PT5A 1N2CE 2CLHB 5E2BA 3RE1A 1WA5A 1Y0BA 1Y1SA 3DWIA 3N53A 5AM0A 2CC2A 5I9SA 1WHTB 2ZVDA 2ONJA 4DV6B 4Q1EA 2OK8A 3O6VA 3OFVA 1D2NA 3S2ZA 1BXRB 5ALTA 1CJVC 1U04A 4PWZA 1IYZA 4JGGA 2QD4A 3D3KA 3FGOA 3MB8A 3B13B 1OJLA 4IWYA 1IXKA 5IKMA 2WQ7A 2JLBA 4JV5B 4UZSA 1MJHA 1EQAA 4RVDA 3PTAA 5A62A 4BB6A 4YRPA 2PN1A 4V24A 3LXXA 5H4GA 1F6BA 2C7VA 3LRTA 3MGCA 3HMKA 3O8CA 4ETWA 2YMLA 1CHNA 1ZK1A 1F17A 2Q9AA 2HZ7A 2IZ7A 2P0AA 1N6NA 3W0LB 1EDBA 1NP3A 2WF8A 2XRMA 3KELA 3PE3A 1KHHA 4Z2YA 3TNYA 3FKSA 3VC3A 5BMVA 4FIDA 1JQBA 2AFIA 3GF4A 4II7A 4N5DA 1K2VN 1V71A 3K6JA 4HR7A 4WN9B 5JAHA 4YUXA 3FSEA 4H77A 4INOA 5EIFA 3I34X 4LCJA 2C4HA 4QOGA 1P9OA 1PZFA 3UW1A 4ZMRA 3AFHA 2QUHA 1DBWA 3DDHA 2XYRA 3H6HA 2CL0X 4WCFB 5AM3A 1KWGA 2ZWAA 4WBNA 5TQJA 3RD5A 1Q84A 1T2UA 2DSTA 4HWGA 2PUDA 4PSUA 2VZEA 2P90A 1X74A 1GL6A 1JEOA 1RI3A 1F0NA 2ILTA 2XIQA 1XYGA 4OHRA 4UBNA 5KJFA 1EIZA 1SG9A 3GAMA 5FBZA 2B3TA 4FC6A 1VMDA 4MYSA 1FLNA 1V9SA 4XVRA 4QVIA 3UFXA 3E2MA 1CV2A 3HZOA 3TQHA 1JSZA 3U1VA 3A6LA 3GDFA 1U1DA 1XTUA 2VR1A 3KC2A 3L5OA 1JRLA 4P4SA 4MAFA 1VJGA 2NT3A 4HNRA 1GRCA 4YMTA 4CEJB 5JQGF 4PSVA 3JWIA 5EUCA 1MOQA 1HMPA 5DN6D 2OYRA 2NGRA 3TL3A 3HACA 5L3VA 1XDGA 3DHYA 4JLWA 5U4XA 1GAWA 4WKGA 2XNDA 4U7TB 3CXUA 3R5XA 1TECE 2GBPA 3NOOA 2H11A 2AKAB 2J33A 3LGXA 2EEZA 2RGNA 1HDIA 4FJ0A 1YFLA 1SJ9A 1M34A 1GTZA 3S8MA 2VLIA 4QU9A 5JARA 3P9XA 1SZDA 1UKYA 2X8AA 4RQUA 3RT7A 4P32A 5T8KA 1ZMXA 4FKMA 4CEHA 1YQWA 1ZD1A 2PBRA 2I4OA 4TMFA 2HKIA 5EKXA 1Q0PA 5HF9A 1IQPA 3TECE 3HK2A 1FS6A 3K0KA 2Y1WA 3Q8MA 1UXIA 3LBIA 4G0OA 3ZUPA 3O94A 5EHQA 2YXLA 4RVUA 5EWMB 3TMYA 1GDHA 2ONCA 2AN4A 4CG2A 3OLYA 4R1TA 2AE1A 3L7DA 3KZVA 4X1YA 2SICE 3KYDA 3OD5A 4YRTA 7REQB 1DC8A 2IIPA 2QPAA 3LGAA 4DPMA 4E7PA 3SSMA 3P32A 1V39A 1IVNA 4KXXA 1OLOA 1S7CA 2P7HA 2PAFA 2C5BA 2POCA 4BNDB 2H0AA 2H1IA 1VMKA 2E9SA 4FEAA 4OUDB 4RYDA 1WMEA 1ZIOA 2FZVA 1F2TA 2OFPA 2PMEA 1BVYF 4DCGA 3VKVA 2V0GA 1LTQA 1JU4A 1K6MA 3HCWA 3PA6A 4TWZA 3AKYA 3BIWA 4NHEA 3WQRA 4BNGA 1M6YA 2IOHA 4DT1B 5C7OO 2H2HA 3OU6A 2RGGA 1WKBA 1Q1QA 5IN5A 1PFQA 1IG0A 3OZXA 2P3QA 4TWRA 3VPHA 1K4MA 1KQOA 3QBEA 3U7FB 2QU7A 1XI2A 1ABFA 2AYXA 3INGA 3Q8KA 3WYCA 1GFWA 4KHZA 3WL4A 3L0ZA 3ADBA 5DGXA 4TUYB 5EJEA 1O94A 3DF7A 1NHWA 1YFKA 1N2ZA 4YI3A 4LYGA 4MDEA 3DTTA 4ARUA 3WSWA 3LUCA 4K6HA 3EFOA 1G3RA 4IIGA 4N54A 5K2MA 4AN1A 2CNOA 1EKXA 4MP3A 4C2TA 3FUUA 5C51B 1E9VA 3GGOA 2GJ8A 2ZRPA 1B8NA 1RPJA 1YB5A 2H5IA 3VNSA 1ZVQA 4A73A 1ADFA 2JBHA 2VN8A 4UDYX 1PJRA 1Z2EA 1LCIA 3L77A 5DWDA 4BEVA 1YMUA 3UO8B 2QD3A 1YDGA 2OVBA 3ZNPA 4X66B 1QH8A 1BXGA 4CDMA 1QP8A 5I4IA 3Q7RA 4WKOA 5EN4A 5F3DA 1P4RA 4OQEA 1DADA 4FHEA 2GT1A 1N8SA 3F0TA 1NFRA 1NFFA 1FE8A 1TYDE 3BIJA 3SJZA 3KR1A 4JDUA 1E6KA 4MGKR 4RBNA 4Z99A 4TS9A 3IHWA 1O4WA 3WMRA 3KZNA 2CDRA 2PRKA 4MS4A 4RVOA 5DRYA 2PSEA 2WI8A 3E9RA 3NTRA 3M3DA 4LXGA 5ARCA 5HJEA 3AVXA 2QMYA 2HWXA 2QRPA 3FTDA 1BQ3A 4ISBA 3ZI4A 3L6UA 2CLMB 5JYDA 3DZJA 3D7KA 4HWKA 3DFKA 2DTDA 2X41A 4KN9S 5ALHA 5HW0A 4C7XA 5E8RA 5JFOA 3GIWA 5U9CA 3EXHA 3JQCA 1ZXXA 2F1JA 4ZICA 2NVOA 2DM6A 1AMNA 4PLTA 1B0UA 1BOFA 3PVCA 1I2DA 1UM8A 2AG5A 3AR5A 4QPPA 3WKCA 3WLHA 3UANA 4RL4A 4IH4A 1LQTA 2TMKA 3NONA 4B45A 1XALA 4BGIA 4HI0E 4BKPA 4K9RA 2XKKA 1AMOA 1PBTA 2EG5A 5FJJA 3VV3A 1AKMA 1Z0IA 1DRKA 1QGDA 4QTYA 1BEUB 2OPBA 2WZQA 2VTEA 1ZEMA 3QX9A 4P2BA 3LFTA 2IYTA 2O3QA 5FNVF 3MAJA 1EAMA 2ZTUA 5BN4B 3WLFA 4E07A 5CX4A 5LD2C 3KB2A 4L2IB 1ENZA 2D1QA 2JCVA 1U11A 1XCLA 3FJOA 3IDOA 3L6BA 4MS3A 3HJFA 4EUSA 1X19A 4MJLA 3RC8A 1XZMA 5G0WA 4BVGA 1M6VA 3FTPA 1LTKA 3RVSA 3W4KA 3A28A 5ALDA 3W3AD 2EKZA 5PGMA 3HN2A 3I0MA 2ODWA 1SVOA 1U6KA 3A1CA 3KOZA 2NN3C 4MIYA 3H87A 5CT4A 4D9MA 3PKIA 1U63A 2J3EA 4NYJR 1KQFA 4BOYA 2AHOA 4EG7A 2VZ9A 4NJOA 1M8KA 4RKQA 4XDGA 2Y8EA 3I12A 4E5NA 1KJZA 2FSFA 3EH1A 3KDSE 4FNAA 3TGPA 2XCUA 3U7QA 1BCRB 1RXEA 3C87A 3HZZA 3EUFA 1FVXA 1XRQA 4L3OA 2K2QB 1K0UA 5FBHA 2IIQA 2J9GA 5DV9A 4LHYA 5EKUA 5FQNA 1TA0A 1BWSA 2VTBB 1JHQA 3OZWA 1EVLA 2FK7A 4GQBA 4OQPA 1AU9A 4MW6A 4PGHA 2QE6A 1Q22A 4PSCA 4TGLA 5HKKD 1P2DA 4ZMBA 1DAKA 4Q4HA 2GCOA 3I3SR 4Y8VA 3EMDA 1XQWA 3AW8A 1YZVA 4JYBA 4BP1A 2AEFA 1K9VF 4F3NA 4IMRA 3AERA 1JAYA 1QBGA 5C18A 1HV8A 1N36B 1P5RA 3MAAC 4ZO9A 4GE3A 1BHO1 4QSMA 1NOIA 2HJSA 5FT9A 1DUSA 1L1QA 1QLHA 4XRGA 4PC1A 3TLKA 2X40A 2F00A 1KETA 1X7WA 1WUJS 3GYBA 3C39A 1RMYA 4FILA 4J4HA 4QKQA 4Y0AA 4DJJA 5BWCA 3HY6A 4HN4B 1ZISA 4BATA 4IJVA 5H68A 2UKDA 1RJFA 2N1MA 5TQ0B 4B48A 4DNFA 3NHBA 5EJ8A 1LLUA 1YZLA 3DYBA 4R9NA 4UTZA 2Z1NA 3PGXA 1FS5A 2QL7A 5JBQA 5B1EA 6YASA 3T52A 3TMKA 5KNDA 2J3QA 5HIJA 1SC9A 3OEED 3TXYA 2MU1A 4HRVA 5EIEA 4U02A 4L5BA 1JAIA 3F8TA 5DPMA 1CDOA 3QF7A 1G66A 3T54A 4ER0A 1W7AA 2DLCX 3I5UA 6PFKA 1LFDB 3RWBA 1GA6A 1WLSA 5AHOA 4MVJA 5ILOA 2OWDA 4U63A 1J49A 2QU8A 1Z2NX 4DNXA 3NVDA 1E3SA 2Z09A 3N2KB 4MWZA 4GQIA 2XYQA 4ARSA 4GR9A 4TYNA 4NKRA 1G2IA 2WSLA 2JH8A 2XB8A 1A8PA 2NAPA 3PUVA 3SXUB 4B6QA 2BE9A 2CSUA 2JGDB 2KSQA 2XCRB 3L6OO 3PXDA 2YTZA 1JU9A 4N5IX 1C3OA 2ZCUA 4N47A 4EY5A 5JNUA 2A6PA 1U7XA 5DYYA 4S0ZA 4RM3A 4QUJA 3ZV3A 3VPFA 1K7EB 4PLWA 1CPYA 1KO4A 2C58A 3MS2A 3GT4A 3QYAA 3FG9A 1RRPA 4M1MA 3B48A 1NIJA 3K09C 3JQAD 2LWIA 2SCUA 2Z3VA 2B8TA 2ZJAA 3HXKA 2C61A 4RX1A 5F2OA 1C50A 7MDHA 3ETCA 1BEEA 2CHGA 2VRWA 1DRVA 3R3JA 3OLWA 2A1UB 3U62A 3DXYA 1YV9A 3AZPA 4EK9A 3LWBA 2J5BA 4HQOA 1I4LD 2VHTA 2VT7A 4IKEA 5B36A 2YHSA 3G59A 2V7QD 1CJTC 2FWPA 3F5MA 1K7YA 1XHFA 2WHRA 3PHCA 5SV2A 3ZU4A 4A16A 4FBGA 5BURA 3P2MA 4JITA 5KNDH 4CV0A 3LJKA 4DLSA 4ZK6A 1NONA 3ZV7A 4G84A 4JLKA 3KEQA 3ANLA 4QXPA 4F5ZA 4QUAA 1K7FB 3V9PA 4ARZB 3FOFC 4GI3A 3JWEA 1FP4B 4MYUA 1U9IC 1K97A 1DINA 4P7JA 2YC2C 5IH3A 2JLVA 1YRWA 4AB1A 4BZXA 5AM1A 1LLQA 4IH1A 1QFMA 3G2LA 3LHKA 2B4QA 1OAOA 1G5HA 1VZ2A 4MQMA 5ALYA 5FPSA 4K3VA 1NVFA 4G0QA 1K1EA 2IP2A 1PNRA 2PUEA 1E0KA 4ZCTA 4FM9A 1FF9A 2OR3A 3NAQA 1HETA 3WWCA 2B83A 5MN5A 4L8GA 4Q7JB 4ZALA 1CRQA 1HH4A 1CU1A 1I3KA 3RAEC 2FEKA 4G5YA 1OUMA 4UEWA 3TQSA 5HK9A 1BJTA 1GGFA 3E61A 4FVTA 1DI0A 2XXBA 2HDWA 3OE7D 2R6R1 2QUIA 2NSYA 4A23A 1Z34A 2JLZA 4DQDA 1BZYA 3TGLA 4JYCA 4ALJA 3KQQA 4FFNA 4L4UA 2EVWX 3ZQUA 1WV0A 4FYJA 4GRAA 4ZVKA 1G21E 2PA3A 1WW2A 3PQEA 3S2UA 1X1RA 5EXSA 4FGLA 4NG4A 3R6LA 4PG6A 1D9ZA 4E1AA 5KTRA 2E87A 3TJMA 3A3YA 1JR4A 1DXYA 1TK3A 2V03A 3PGA1 3PYLA 1U3CA 3AP1A 1EFRA 2W6OA 1MAAA 2AQHA 3MA0A 4LYDA 5FD8A 3T0FA 2VNJA 3GAZA 2MWMA 4GOMD 1JHZA 2D5AA 2FUNB 2LCFA 2QMUA 3C8DA 2VDPB 4RAQA 3RRZA 4LGVA 2NZYA 4CU2A 5CDGA 3PK0A 3KBOA 4NY1A 4P4LA 1Z6TA 1HE2A 3MN1A 3QWFA 4ROSA 3ZH2A 4AJHA 5JJKA 3DNPA 4JZKA 2HZBA 2CLSA 1FSZA 4R3WA 3ZXIA 4RF2A 4CM3A 4ZU3A 3BXFA 1VLVA 1EM8B 3QBVA 3CEPB 5LL6P 2VS1A 4M7RA 5JD3A 4IDQA 5JAPA 4OVKA 3E23A 4DM4A 3DE7X 3L1VA 1UXKA 2XDQB 2REQB 1B14A 2LIVA 5A03A 3TQRA 1P45A 5KPJA 3ORYA 4AM8A 1SBTA 2E6KA 4RVHA 3ORSA 5ISMA 3PPXA 4LVOA 2GBIA 4TTJA 4M8SA 2MYTA 3EAQA 3NXKA 4DLTA 2VRCA 3R4VA 1P1KA 2YV3A 4AO8A 2ZUVA 1EFCA 5IH7A 1Q7EA 1VPTA 2I5PO 4AJLA 4P58A 3AY3A 5KNCA 3SVTA 4TRMA 4BO6A 5GOZA 3WFZA 2W2LD 5IWCA 1Y3HA 2Y71A 3R5KA 1WWKA 4U5QA 1F0PA 4FFPA 3QKSB 5MDHA 1C8KA 3MERA 4ALKA 2VSYA 1TCAA 4C7OB 1L5MA 2GLXA 3EG9A 4ZT2A 3PG5A 4DMFA 4DLVA 2PA0A 3ZWMA 3ZE7A 1JL3A 1DAEA 3SS8A 3F1LA 2QUKA 4YAUA 4H1TA 2H9YA 1MMFB 2C0QA 4AQ7A 3SYTA 4PG4A 3BOSA 4KTTE 2I3DA 3OD1A 4IIJF 4MKIA 2D00A 4E3ZA 4JU9A 1J7JA 4G8JA 4UCWA 1MA0A 4EW2A 5KSOA 5LOVA 4HAYA 1L7PA 3EXAA 5M34A 3W2TA 3O2NA 1TMYA 2IHJA 3EYAA 1BN6A 3UV3A 1XC7A 2RH9B 1KEWA 4W1RA 2MHCA 4ECAA 1F4LA 2PRZA 1G0OA 3QJYA 4YQFA 3GLGA 1YCDA 1TO1E 2Y0EA 1OFTA 4MINA 3T7SA 3WL5A 5B12A 4M22A 1T6BY 4N9QA 1JG3A 1UC8A 2EIXA 3MRXA 4B32A 1JLRA 5BR1A 5C35A 5LQAA 2FX2A 4R41A 2C9MA 4LCEA 4MV9A 3KS9A 4BVLA 3D7LA 2AB0A 2ECFA 2ZDGA 3NHWA 4OXNA 4E4RA 1CUBA 2DFPA 4HXYA 4MKRA 5KPDA 1UIRA 3JQ8A 4OUKX 4Z9XA 2ISSD 4X41A 2J9FA 2GZ3A 1BD3A 1OZFA 4G65A 3K70C 1J97A 3ZK8A 3TKLA 2OT3B 7MHTA 3ZS8A 1AV7A 1JVSA 3HV2A 3BXGA 2IPAB 3DEJA 4M8IA 1K7SN 4BNKA 1J0AA 3ZWCA 1Y7HA 3FYCA 1M1NA 1SCIA 1Q12A 2JI4A 3JALA 4IDDA 4PNZA 4PRLA 3O82A 3QTLA 3A6KA 3L7JA 3QSYA 2LGJA 3BREA 4KVZA 4I4TB 5K3FA 2IS4A 4V0ME 1HYEA 5BYAA 5J2UB 1J8QA 1ZCFA 3KTOA 2VHJA 4YT5A 3FVVA 4FEGA 4KIWA 1I3CA 4RMHA 3OAAA 1M6WA 4I46A 5CFNA 3FWPA 4M0DA 2H16A 2JLYA 1Y7TA 1CEQA 1G2PA 2ZJBA 1KORA 4GMHA 4ZYZA 1GCAA 2XVMA 3CJRA 2VNSA 4A82A 3ZWYA 4X85A 2G8LA 1CR2A 2RG7A 1EUDB 2WWIA 3UENA 5L45A 1T8PA 4HMOA 1NW9B 4D4GA 1CRZA 2WKWA 3BMOA 4N12A 3E58A 1T5SA 3KL4A 3VI3B 5L4NA 3HGQA 4FWIB 2W6NA 4MWSA 1KYXA 2WA1A 3B3QA 1IVYA 1LBTA 3DC2A 1QHYA 4RCZA 3P2EA 1EG7A 5AK0A 4CG3A 1SU6A 4ZCMA 2FPPB 3OVMA 2EHJA 2VZ0A 4IIUA 1NVMB 1SXJC 4KAFA 4XWGA 3LU1A 1JEYB 3ZK7A 3KJIA 5EUBA 3LUKA 3BUSA 1JHVA 3LX4A 1Q14A 3GRZA 4RHTA 3R8CA 3W7BA 1U8XX 3I8OA 2GJKA 2Q8PA 4W9NA 4D9NA 4YCCA 1B1AA 2H00A 5BRJA 1XTIA 2BGMA 2DX7A 4ZAVA 2DR3A 4NJMB 1DTWB 4FGKA 3GRCA 4XVCA 2XGMA 4P0TA 3VAYA 3ZY2A 1ZNXA 4PO8A 5ER6A 4S05A 1MIOB 3IXLA 2BFEB 4AUNA 1KWKA 3CV3A 4J90A 2H48A 3K2QA 1JQKA 3DWFA 1RZ3A 4YRNA 1J2YA 3WIDA 4KZKA 2NP6A 4KH1A 2GDZA 2GN1A 2J31A 3EHDA 4FZVA 1FYXA 1T4DA 3DR3A 3VUEA 1VB3A 3WL3A 1EDDA 3G2HA 3FPBA 4JB3A 3U37A 1J39A 4HGRA 3LTNC 3UAGA 1A5SB 1PK7A 4V2IA 3W2HA 2NXWA 1Y8QB 2EV9A 1V6SA 1WP9A 2ICAA 4QEKA 1XK7A 2AZDA 3B6ZA 1KXZA 3H2KA 1KEZA 3VPSA 2DCUA 2R65A 3EEBA 4UU7A 1BW9A 4P93A 1XKXA 3IKJA 4PXSA 5A4KA 4PGAA 4O33A 1E96A 4XLTA 1LW6E 3HDYA 3RC3A 4YRKA 5M29A 1IVSA 4D6YA 4EVRA 1MQ8B 1USWA 1WOYA 3WB2A 3GRYA 4YP9A 4DOMA 3G0BA 4P53A 5AH0A 1Y8ZA 2LDXA 1L1FA 1IB0A 3H75A 1L5ZA 1ZRHA 3EY9A 3C7TA 2E4XA 4N65A 3GGSA 4PR0A 4QWWA 4R2LA 13PKA 4QYSA 3WLAA 1ZU5A 3WOVA 1RABA 2VF7A 1QG2A 1QZ3A 3DPIA 3ENNA 1XTSA 3AEQA 3CVXA 1PAUA 1OMOA 1U99A 4OB8A 1GAXA 2NUTB 1O89A 3LQ4A 4ID9A 4W5QA 1L5LA 1KO8A 2GVNA 1UP7A 4M1YA 1XQVA 2IUYA 2RB4A 2WJ6A 1U0BB 1JR3D 5C4GB 1QYDA 1VSQA 4JQCA 4DWOA 3R77A 5JXHA 1S02A 3KSDO 2RGNC 3ICVA 2XKBA 3LCMA 1QYWA 1G8PA 2PD6A 4ACBA 3B70A 1TEXA 4PYJA 2Q99A 5T8KC 2ZATA 1XFAA 1PYGA 2IW1A 2XWQA 1JFRA 3B5IA 1I5OA 2VYVA 3FHOA 3HKDA 3IPCA 3JYOA 4C01A 1ACLA 1E6MA 2WKPA 4X61A 2H51A 4A6EA 5LLTA 1YVEI 4ODIA 3IIJA 1KKUA 4PZDA 5F7ZA 3OEHD 5IPFA 4MW1A 3BHJA 2QTZA 4I14A 2V7BA 2W2KB 1PFGA