2FWPA

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59n from the acidophilic bacterium acetobacter aceti, bound to isocair
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
159
structure length
159
Chain Sequence
SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSANRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Biochemical and Structural Studies of N(5)-Carboxyaminoimidazole Ribonucleotide Mutase from the Acidophilic Bacterium Acetobacter aceti.
pubmed doi rcsb
source organism Acetobacter aceti
total genus 50
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2fwpA00
2FW6A 5BORA 5BOSB 3ORSA 4ZJYA 2FWPA 2FWJA 1XMPA 4YCDA 3OOWA 5C5DA 4B4KA 2NSJA 2FWBA 5CTJA 3RG8A 5CVTA 2FWAA 2H31A 2FWIA 3LP6A 4YCCA 2ATEA 1O4VA 1QCZA 5BOSA 2YWXA 4YCBA 5CLFA 1D7AA 2FW1A 2NSLA 2NSHA 3RGGA 3KUUA 2FW8A 4AY3A 4AY4A 1U11A 3TRHA 4JA0A 5CLIA 2FW9A 4ZC8A 5CLJA 4Z7JA 4ZK2A 5CLGA 4ZMBA 4GRDA 3OPQA 4YCJA 2FW7A 5CLHA
chains in the Genus database with same CATH superfamily
3N2GA 3UZUA 5C81A 2XUIA 3KZCA 2C9CA 3HB5X 2F9FA 3IESA 3QLTA 5F64A 3V8BA 1DOZA 4JJIA 4D74A 4N1AA 3TCNA 4DREA 1NBAA 1I10A 1WVGA 4OOFA 5JXHA 2CT8A 1YVEI 3QFHA 3WO0A 2B4KA 2F17A 1NZJA 4R2LA 2HA6A 3B3QA 2PV7A 4Z8XA 5D7NA 5E4TA 1SKMA 1C7JA 1Y7TA 1IEXA 4RD4A 1WY5A 4W1SA 1CUBA 1U81A 4BNWA 3KHKA 2JW5A 1EPUA 1C1HA 2ZFUA 3MOGA 2AOUB 4HQNA 5I9MA 2YUTA 3TXYA 2ETVA 3E9CA 3MINB 1JV2B 3MGBA 3WV4A 1J21A 2JI6A 3QY0A 3NGLA 4A9AA 3WKDA 2Z8YM 2IVZA 4BFLA 3S81A 1T2DA 4MA0A 3TJRA 1XU9A 3R3SA 1J7KA 1LRLA 3KKMA 2V96A 5M04A 4FEYA 4UHEA 4A26A 1OH5A 4TKVB 2CNKA 3EZYA 5FLYA 4CW7A 4HDSB 5JSFA 3K7EA 3MHTA 4TV8B 3DE4X 5BSEA 1YR1A 1UMBB 2F00A 3VKWA 4BB6A 4EG6A 3AM3A 1QDUA 1XD9A 2BM1A 2X23A 2YBDA 1LBEA 2O1EA 3HYLA 3EHDA 3DAYA 4K9QA 4OXIA 2NTEA 2RHMA 4PCAA 3B1JA 2P9QA 4IWYA 1IHDA 2QR5A 1PUXA 3H05A 3NTXA 5KSZA 1NUTA 3N86A 1QRAA 5KOJB 1AXGA 3MJEA 1KU0A 3DP9A 4RMHA 2XRYA 3LPMA 4JBHA 3EJWA 1GRNA 4L3OA 3VTKA 2ONZA 5F12A 1BXKA 5EVCA 3WI7A 1HTWA 1AIPA 2VHUA 2B82A 1V5IA 3LX4A 1SVOA 2VJMA 1RC8A 1N5OX 2B8NA 2VP2A 3LT4A 4RZ3A 2IL1A 2BKVA 4BCBA 3AM5A 4KREA 3LGSA 1L7DA 4GX1A 3FB1A 1W25A 2YWCA 4YALA 3GRAA 5LOVA 1R88A 2NUAA 2E2WA 4BNDB 3A3YA 4P4GA 4QBIA 1KPIA 1KOLA 1RCTE 3FRIA 4AKHA 1VIAA 3I72A 1UH5A 3EIOA 1U0FA 2DBVO 3GEIA 1Z34A 1ZSNA 5K3SA 3WIDA 4RAOA 3V34A 4KE7A 2VF4X 3A6ZA 5BSHA 1V9LA 1XI2A 4M7PA 1HG1A 5EWLA 3INYA 1BFDA 4IDBA 4NENA 1KJIA 1NV8A 3VA7A 1U8XX 4O8CA 3RSGA 5DZSA 1XXHB 3ZWDA 3GLIE 5JQGB 3C3YA 4US2R 2VYNA 2POQX 2AZDA 3O4IA 3V4SA 5EJ4A 2BTQA 3QEAZ 2CVZA 1PJRA 2ODQA 4HUTA 4YP1A 1F6WA 4IV8A 3FLMA 4HHEA 1EB8A 2UZ0A 1Z0IA 3FUVA 3KYDA 1RWNA 5CT8A 2VQDA 4L9RA 3TECE 5M5BA 1DCKA 1WMBA 4A27A 1Y0BA 4X95A 1EGHA 2OGUA 2XQJA 3RT7A 2ZAIA 1P9LA 3DZHA 2V9PA 4I8IA 4UREA 5D86A 2C57A 1Q14A 4YRDA 6LDHA 5B3JC 2JIMA 2I54A 3WLOA 4OL0A 3FYUA 4YIHA 4R1LA 2C4TA 5KYXA 4GRAA 2MWMA 3WIBA 1EUZA 2CMFA 5LP1A 1CIVA 3GLGE 1CRZA 1DARA 1TO6A 4O1MA 3RQIA 3VOAA 3SF0A 4ZODA 2XAUA 4ZOLA 4M0LA 3PNQA 4FEEA 3GUVA 1LX7A 4OPMA 4EFKA 4BGDA 4OUDA 4MWBA 2ZPTX 2RI0A 3TQCA 4TTIA 1G8SA 2WIBA 1UT6A 1XMIA 4FFOA 3TIGA 3PGA1 3L46A 3BGWA 1DFIA 1BVRA 3A37A 1Y8ZA 2BLNA 1PFQA 1C9YA 2JLVA 3EPHA 1NPDA 3G5MA 2R1VB 3W05A 4RLFA 4UM8B 3RKUA 3QX7A 1YJBA 3HCOA 2QD3A 4P0QB 2ZBPA 1M1NB 2XMQA 1UK7A 4DQVA 2VWQA 4D3ZA 5I7UA 5KQGA 4RY0A 1ES9A 4BJ3A 1MJGM 1JHAA 1ULUA 2GCOB 2E49A 4J1TC 3PXGA 4PV7A 1T4BA 4MJLA 4S12A 1R18A 3JYHA 3VPSA 1Z25A 3AHEA 4B33A 4J90A 1X2BA 2VCYA 1G38A 2PO5A 3CB2A 2GTIA 5F9MA 4PZYA 3QVGA 3C7TA 1BEEA 4DADA 5FULA 1U5BB 3BIWA 1U8ZA 2ZB8A 3CX7A 1KYQA 4LXUA 3L0OA 4OQYA 1GSHA 2WYVA 3D7SA 3ZCXA 1CNMA 3OD1A 4KUGA 1X7DA 2XUAA 3I6BA 1RI5A 3F47A 3F5DA 4DB4A 1XDUA 4LA4A 3TRHA 5JWHA 3BMQB 4HDNB 5HQJA 1QE0A 1KAQA 2BEWB 3HMKA 3QJYA 1KO8A 2AFIA 1NDUA 1U2EA 1SR8A 2HBQA 4OLHA 3VFDA 3ZXUB 3DXZA 4JHXA 2CXXA 5EI5A 1AF4A 3FKSD 1IM8A 4OK5A 1OXMA 5CXUA 4H4DA 3ET4A 4M0CA 4BKRA 5C1OA 4JYPA 1HT0A 7YASA 1QZZA 1EH5A 3G49A 3NJ8A 3GUHA 4UXJA 2D1SA 3GF4A 3GP5A 3KJIA 2IYYA 5FOUA 4B7CA 3MLEA 1DUSA 2I4NA 3A70A 4WXHA 3CVVA 4B6RA 4HJRA 1AGRA 4Q9AA 3FTFA 1SHUX 3CZ4A 3ZJ5A 4S1VA 3KQPA 2VNJA 1LLDA 1P9RA 2CUNA 3H7IA 3GCDA 5E1MA 3BWDD 1GNRA 3JZFA 3VDRA 4C1NA 5FQNA 3GL9A 4UE6A 3TIIA 3A27A 3O95A 2WHRA 4EKNB 3N2GB 2H29A 2X5KO 4AZ0B 2IS2A 3V2IA 3V7WA 4QYWA 5CR9A 4D8YA 1OYWA 1VL5A 1HE4A 2VYVD 3SQMA 3W6OA 3W3ZB 3ORRA 4LDZA 1OWLA 3EC2A 5FPKA 3UOWA 5KSPA 4DMHA 3IP5A 1P7PA 4IKPA 1WHSA 2IELA 3QZUA 4MUHA 4ESOA 1JI0A 3ZQUA 3DVSX 1B6GA 3TEMA 1LV7A 1NVMB 5KJCA 2VJQA 3A36A 3RFVA 5K8UA 5FD8A 4HG2A 4Y8VA 5MGNA 1G20A 2B0JA 1H0SA 3VDQA 3ZPXA 5JDIC 3FWHA 3JAWA 3SVLA 1QFJA 2K4MA 3BUSA 3OY7A 1DWPA 4ESHA 4OMCA 5LA6A 1KRHA 1T5HX 4L0CA 1V8OA 4CKEA 1P3DA 3UJ8A 4HI0E 5EMLA 3CW9A 2N9UA 1GGNA 2QIOA 1P8AA 2HIMA 4KR2A 1H2XA 2P3QA 4PG7A 5JDCA 3BBLA 2BI7A 4L07A 2Q5OA 1QAMA 4QUGA 2GM5A 1IM2A 1WZEA 2WMYA 2YOFA 2WRZA 2DLCX 2LKDA 4P7JA 4MITA 5K0EA 5KIAA 3CRZA 2ZJFA 5FPYA 3QG5A 1L5NA 4K2HA 4LZWA 2FGKA 1FJXA 3T5AA 4NCIA 4B80A 3A1CA 4MWSA 4MRVA 1B15A 1J1IA 3FYHA 1TCVA 4WCFB 1IVSA 3GQVA 3KXIA 2XJ4A 3ZD9A 5AQ1A 1XDBA 5IVKA 4QEKA 3LY8A 2PSFA 4DCTA 3GXOA 1NM5C 5EZSA 4G5YA 2PL3A 2M2IA 4AJ1A 4BQNA 2XI4A 2C95A 1KA9H 4KXWA 1QP4A 3MCTA 1X80A 3A14A 1SQ6A 3LUDA 4LYEA 1FNCA 1DX4A 1D5CA 3UAXA 4UKDA 3NC4A 4RY8A 1P1RA 1N2ZA 2B7BA 2CHUA 2RHJA 3EC7A 4EW1A 3SY8A 4ZK2A 2HCFA 1ARZA 2CFSA 4RENA 1OKKA 2VJMB 3W79A 1GKKA 1CUHA 4CFYA 4G1EB 1HURA 4PPYA 3W06A 2JGEA 1FTNA 2RHBA 2V6JA 2H3EA 4MQ5A 2CWWA 4Z7QB 4EZBA 4HEJA 1G5TA 4XA8A 3DTTA 1IUOA 1JG3A 3GEHA 3G2NA 3PPVA 1T8PA 3KB1A 2PIAA 1KJQA 4OM7A 2OAQ1 4GBMA 1EBFA 1CY4A 1SA0B 3E3MA 3G2OA 1MB9A 2PH3A 3FPKA 4HGOA 5BSGA 1QTQA 4BMNA 2JFUA 4JLVA 1JYSA 3S28A 3RC7A 3G9QA 2P4HX 4RACA 1CJBA 4NENB 3WMXA 2ECFA 2ZBQA 1XTTA 2CE7A 3ZE0B 2WWVD 1Y5MA 2IUYA 3GLHE 1W9HA 1TUGA 3L1UA 3H5OA 4KE6A 1QWSA 2WFAA 4QOSA 9MHTA 1U8UA 2ZTHA 1L4KA 2IYUA 4D6YA 4EG8A 4ZZ1A 1JQDA 2BTQB 1GA1A 4WNAB 1Z7EA 1W1UA 4OMFG 5K0JA 2J5KA 5FUQA 3O4FA 4RK7A 2GD2A 2R2GA 1YKGA 1NF3A 3KYDB 1B6RA 4RTOA 2JGMA 5EWJB 2CLFB 3VX4A 1WOMA 4K9PA 1W0KA 4CDNA 3ON5A 1AUQA 4PHTA 3OQHA 3UB4A 3R9WA 2VCHA 1RLIA 3GUUA 3VR1A 4OGFA 5DNVA 1PFWA 3N7UA 1VL0A 1Z83A 4TTQA 1QHEA 1AXEA 5ECWA 5HFNA 2XMSA 4D6PA 4AURA 2R3SA 5KYXB 1Z3IX 2VTBA 5KQLA 4LJ9A 3TDNA 4LJAA 1UC4B 1CR1A 3EG9A 3AETB 3E5HA 3D59A 1T3SA 2HNKA 1LD3A 4N82A 3CJTA 4ZOLB 5A4KA 3M49A 1XTVA 1E0DA 3DLHA 4DA6A 3AJDA 3VPXA 1WU7A 1PGQA 1V5EA 4Q24A 2RIRA 4KIUA 4BNGA 1IJFA 1ACJA 5EQJB 4DAEA 3O8RA 5EC8A 3A9RA 3QELA 1QIEA 2O1SA 4RVOA 1FYWA 1RAIA 2PUVA 1JAHA 3Q7RA 4HX9A 3C6KA 2QN1A 1ENPA 4YI5A 3WFIA 3QEBZ 1QPZA 3VJKA 2CNLA 4DUZB 2PCLA 5HIIA 1CB0A 1TTPB 1P4GA 1GWNA 1FFEA 1TFUA 3AJ8A 2X6QA 3PGJA 3MSXA 1ZYUA 2W6QA 4MO2A 5K8JB 5JALA 1U2PA 1OBVA 4QGAA 1HQCA 3DBHA 4ZCSA 8ADHA 3FX2A 3JVEA 5AJHA 3L07A 5B1IA 3RTAA 1AKRA 4IMJB 2V4ZA 1AKQA 5IXJA 4ZAXA 2MIIA 3DQPA 4FKMA 1KZGB 121PA 3DDCA 3GPCA 3UATA 5JQGF 5GM2A 3H0EA 4IGIA 4KO4S 1NVFA 4UTZA 3ACDA 1HKHA 2WB4A 5HE9A 4C20A 5JADA 2E1PA 4IYRA 3G2MA 3UUGA 1B2LA 4DDKA 4E88A 5GY7A 1PK7A 4X1YB 1RP1A 3D43A 5CXQA 3TQOA 5EEGA 4BV8A 4KUEA 3QVKA 3IP6A 4J9VA 1SCJA 4MP6A 3ZWCA 1GTVA 4D42A 1EKXA 2WTMA 3BAFA 4IH4A 4IS3A 3TD9A 1W88B 2VDVE 5FXMA 4G9BA 1TI7A 2PMCA 2H0QA 1D1QA 2QAIA 3MFQA 4OXYA 3T38A 3HI4A 5ITWA 2FMTA 3GNQA 1GTSA 2R47A 2GEUA 4UJ5A 3HL0A 2FQQA 3AEQB 4LC9A 3ZV5A 5L3ZA 3IP3A 4FB5A 2WU8A 2UUPA 5BWLA 5BORA 4M0UA 1TGVA 1VFPA 1YU6A 2QJTA 3IQIX 5BSTA 5JY1A 1AHNA 4X8LA 4PZDA 3GRCA 5CX4A 4NYJR 1U99A 1I6LA 4N6NA 2QQFA 3G5TA 4QOEA 5A1TA 1EUDA 1P1KA 1C7ZA 2IHYA 3STXA 3WB1A 1KTIA 3EQ2A 2BEJA 5I7OA 4GBJA 4INZA 5T8KC 3QOXA 1VRWA 2GXUA 1GPH1 2CLCX 4X8OA 2PS1A 5CJPA 5H02A 5T6MA 4YAGA 1J2TA 3RUPA 1CE8A 1EM6A 2FR8A 1Z13A 3DYIA 4MVJG 3UHFA 3N07A 1I30A 4EI7A 3U5TA 3VNBA 1XZQA 1WHSB 5E9AA 4EG5A 3DE2X 3L8MA 3PDUA 1T35A 3MIZA 1G0NA 5HKLA 3C5CA 3N9IA 3HI6A 5ICSA 1G20B 3F7OA 5D5QA 4G67A 4OHVA 1UQRA 1FYEA 4RHCA 2O8BA 3P97A 3JAWB 2HMWA 4YCCA 5LD2B 4IQ4A 2JGAA 1PVOA 3JAMA 4BRZA 2OHJA 3GDOA 4LDRA 4XPZA 4Y2SA 1EJBA 4OV6B 4C6TB 1KBOA 4QUDA 4JI6B 4D02A 1JFVA 1C29B 5IF3A 3QPBA 1TEXA 2PRYA 5TSDA 1F0YA 2DY0A 1MT0A 3COYA 5LKRA 2X8AA 4ECAA 3V3KA 2C96A 2Q5HA 3DEFA 3X1JA 5L7WA 3DHNA 4NU0A 1LDYA 1UKEA 3ELBA 2QTNA 3F5FA 2F3SA 3IBTA 3SZ3A 1A3CA 1QR6A 1RE0A 4M9RA 1VCNA 4MR9A 4PQEA 5FWDA 5JYDA 3VV3A 1YB6A 4I7EA 3L6CA 4BKQA 4LE0A 4N9WA 1TYZA 1FYFA 1CJTC 5DNAA 5IJ9B 3V8NA 2VHZA 1C7IA 1NXSA 2C5FA 2H4FA 1XLTA 2PNFA 3LLCA 4RDXA 4BBAA 1ZU4A 4M1ZA 3IUQA 2O07A 1FB5A 4O29A 4RH3A 3UFBA 5KVAA 2EIHA 1M67A 4UDOA 4DQKA 1VGRA 4CCAA 3K35A 3M6FA 4XIGS 4CIAA 4D0RA 1ZD8A 2H7VA 3CYFA 3KL2A 4H6WA 1DBVO 1AGYA 1HDEA 1VJ1A 5AUQA 4OP2A 3TTUA 4L5CA 3AHFA 4NHEA 1CR6A 3ZDEA 4B2YA 1L7NA 5CITA 1E3MA 3I37X 4W9MC 4MI1A 2B5OA 2HWXA 4FLMA 3O2QB 1E6CA 1YDFA 2C2HA 5LZ4A 3WHLA 1U7XA 4NYMR 4F0JA 3H4IA 2RARA 1J06A 1P3Y1 2V7EA 4H17A 1ADJA 1IOWA 4BV2A 5FWNA 5ILQA 1D2EA 2BF4A 1YS9A 2IX9A 1CVIA 1WE2A 3U09A 2C61A 3SJBA 3JQFC 1Y3HA 4QASA 3K1YA 3RTDA 2PWZA 4IKEA 2PKEA 4H7PA 1I80A 4D79A 4C4TA 3RFUA 3A4NA 4FFVA 4P34A 3EW7A 4HRAA 4EHKA 4NY1A 2JGJA 4XQ9A 5JZSA 2BFAA 1FVOA 2ZJ0A 4CLOA 3K4QA 1DQSA 1XFAA 2C5GA 3STVA 3EXFA 4F4DA 6GPBA 2N0SA 4R6WA 2J6HA 5AD1A 2H48A 3V2HA 3EPLA 3U2QA 5L6MB 3OUTA 1T6YA 2AXPA 4WLEA 1P2TA 1UZNA 2OV8A 3NLLA 4QJ3A 1W35A 1JQBA 4H6XA 1TTTA 2QI9F 2R1TB 3FPLA 3O3OB 3SI7A 1KKUA 3UAOA 2Y77A 2VTBB 4BO7A 1WEKA 5AM0A 3C7KA 1TA4A 4GP6A 3UMMA 1QVAA 5JROA 1QRTA 3B82A 2XNKA 3HR4A 4GSYA 1N5MA 2FV8A 2J9FB 2DBQA 5E2BA 2JANA 2PIDA 1T1GA 2QZ4A 4BNKA 3SC6A 5KVQA 2FYTA 3RHTA 1PNOA 2Q1SA 4BDSA 4TYWA 3AJRA 1TCBA 2CMDA 4G0MA 2JH9A 1UPBA 3FUWA 1E7RA 3DWGA 1JHUA 3QELB 4NE2A 1DS6A 1TKRA 1Z2DA 4MQEA 2ZQ5A 1UPUA 4HFJA 4Z9BA 1SD2A 3CNOA 1FRNA 3K9HA 4PXYA 1V41E 2FDRA 3TLZA 5ITZA 5LOVF 4C05A 5BV8A 4RO0A 1JG1A 2FWAA 2XZPA 3DZBA 5JNLA 3K5WA 3E4DA 4W99A 1TRHA 2VUIB 4Z4FA 2OYSA 3MJDA 3HP7A 1UC9A 1CIPA 1JQJC 2GHRA 1I3NA 3SR3A 4E5MA 1YVPA 1NYQA 3KQUA 3ABZA 5CNMA 3GGOA 3LY5A 3DZ8A 5D00A 4N0QA 1JWLA 2HA3A 2OFWA 5CIWA 2AE1A 4H0NA 3DEYX 4YRSA 4CE6A 2O8FA 4F9GA 5EJAA 1XMVA 3AG5A 2YFYA 4JH0A 2HSJA 3FJOA 4JZYA 3IUSA 3QBEA 4KLNA 4P32A 1Y5RA 2OUKA 3WK5A 3OJFA 4B3BA 3M33A 5IYZA 1B0PA 821PA 1C1DA 1N2CA 2O7RA 1V47A 2GPAA 2WJ6A 3PFHA 3VNRA 2BGWA 2FUG6 1HYHA 4HDKA 4I0WB 1FTGA 3OQPA 2COEA 2CVOA 4U7DA 1D9XA 1Z4MA 2EG5A 4XWWA 4LDJA 4KXQA 2O7NA 2LRHA 1Y4UA 3R5JA 4A10A 5BOSA 2D2IA 1R2QA 4B81A 4REQA 2XITA 1Q7TA 4K5QA 1FFAA 2Q27A 3WL4A 2EKZA 1UJCA 4QNMA 1G42A 3ANMA 2FUCA 4IAOA 4ANFA 4D3DA 1QWOA 1ODCA 2ZZMA 3OPVA 2ZRMA 1RHKA 2QPLA 1KQPA 5B2ZA 5T4BA 4XGQA 4QUJA 5T6BA 5JMWA 4ZOLF 5KPDA 3IHKA 3OCYA 1HG0A 2W6MA 2VJYA 4U1RA 4DMUB 2O4UX 2QMZA 4WTOA 2XWQA 1U9JA 2HL6A 4KYVA 3VKVA 3EIXA 1EUDB 1VGQA 2CNOA 3UPUA 1RYDA 2HCRA 3DD5A 1W4LA 3COSA 4RABA 5IT5A 4RTPA 2Y0CA 3CF4G 3CSDA 2VHJA 3EXAA 4EJ0A 4GDFA 3O03A 3WTBA 3EARA 4XWTA 4CN9A 2FRDC 5I6DA 2GN2A 5IBQA 1GPYA 4QXPA 1CE8B 1G8MA 5TVGA 3RROA 3C15C 4BRUA 1XPRA 1BHSA 1VHDA 1NJSA 1XTPA 3OY2A 2Q4BA 3NOXA 4PZ9A 1QG2A 2BM0A 4FFWA 1RXUA 1ZESA 3FOWA 2YYAA 2W2NA 4RDCA 2FN3A 2XKAA 3E7DA 3GUZA 3N2NA 4FFNA 3QX3A 2X1HA 3IDSA 1GG8A 1VG1A 3E22A 4MUYA 3BWYA 3PLAE 3CX3A 1IBMB 3TBFA 3OT4A 4XGNA 3UK0A 3E58A 1X9GA 2NO0A 3AHHA 1NI4A 2ZATA 1KWGA 2MTBA 4BB5A 4DV3B 3DLPX 4TWBA 2GAFA 3HO1A 1WUHS 3RRBA 2CL0X 4CMIA 4DWOA 2QTWB 5D5HA 4TMKA 1UWKA 1QU3A 3DKVA 3EEIA 4R16A 4YTEA 2NSLA 3C4JA 1VIVA 4OF4A 4ACAA 1WA5A 2PSDA 2YUIA 4P3XA 4TMFA 4L8VA 3GQBB 3KUUA 1OXBB 3RTEA 1V8DA 4Q12A 5IZ4A 1A50B 3ELUA 4QU8A 2YQ5A 3JQBA 3K0CC 3DOOA 4L57A 4PPGA 1OC2A 1GV1A 2F1HA 2O5VA 2WSSD 4IFBA 3HKEA 3KUXA 2DUJA 4MR9B 4Y9DA 5JBNA 1UKCA 2ZYAA 3HWX1 1EGVB 5I8WA 3FTEA 4DAOA 4TTRA 3WL5A 3NETA 4B4WA 2P9GA 4GPD1 1KGSA 2YC4C 2QMOA 5EE0A 3K1JA 2P65A 1VE5A 2W6NA 4GMHA 1UMDA 1N4DA 3KYJB 4GMFA 4L15A 1H2YA 3EIQA 1ZMBA 4D1YA 5LQKA 1MEOA 2YH2A 3PNMA 2OB1A 1WZ2A 4BEWA 3LVBA 1R3DA 2IHKA 3HU3A 4RJIA 3FOBA 2Q9AA 1QR2A 3C1UA 4C07A 3Q87B 4JL6A 2IH4A 1QF6A 4NE9A 3QVMA 3KV3O 3PTZA 3RGGA 3C6QA 4L5JA 4YIKA 5LM3A 2J5BA 3GFVA 4OFBA 3NEAA 2JGDB 4IHKA 4WERA 3TI7A 1XRLA 1LJUA 1SPBS 2HCBA 2Z83A 4ZK6A 4D57A 4G07A 1W87A 1M76A 2WIJA 4DDWA 4F04A 5H16A 3WG9A 3T35A 3N7TA 1K7CA 4NBRA 1N9GA 1L5KA 2ZR7A 3OZFA 4LQCA 4RPCA 3SBDA 2JAHA 3QEJA 4ZT5A 5G0VA 3CCFA 4O2LA 4ARBA 3UMGA 5LA6F 2FZEA 3K4HA 3OIVA 3FOZA 1M2JA 3HDQA 1A9SA 3OOSA 1NMYA 1BDMA 4TT8A 1E0KA 2VSOA 3RSHA 4AMUA 3D02A 3KSRA 3F73A 2HXSA 3VHLB 4BVKA 3WNBA 1Q19A 3QLVC 5AVQA 2Q2VA 2C4WA 1ZM7A 5GONA 1K4KA 4Q3OA 4YN3A 1FS4A 2W6ID 2VHQA 3TRKA 4LC1A 2OCDA 3ZD6A 2OG2A 4S3MA 5IU6A 4QM6A 3OE1A 1RRCA 5EN4A 1J56A 2DC1A 2WT4A 3CVOA 4Z9XA 1KO7A 3HADA 3OJEA 4HDCA 5J5CA 2XMZA 3ITEA 2E0IA 2C5EA 1YAHA 1TUIA 1A9OA 3PU6A 3TW4A 4O5OA 3B6ZA 3Q3HA 4NCAA 3OAAD 1YE8A 3GRKA 3ZHSA 3ZGOA 4EZIA 2G77B 5DE3A 2A1UB 3LCRA 1N1MA 1Z4JA 2ZSBA 1GCOA 3M1LA 1W47A 4ZPJA 2FRVA 1BKDR 3DO5A 5JH7B 3OZCA 4L6IA 3TJMA 1AK2A 4BWVA 3A9WA 4YK7A 2J9XB 2C2BA 4C0JA 4P58A 1YI0A 4YONB 3TQIA 1AH2A 4U7HA 5U1PA 3ENNA 3HC7A 3W2IA 4F9TA 4MQEB 2WSYB 4RD6A 2ZLBA 1UEXC 4A0QA 4HQKA 3M6MD 4ZARA 1ACLA 3HY3A 1UPFA 3SEFA 2QQ0A 3BL6A 4TTJA 1K8XB 3V97A 3B7PA 4BE7B 4RKQA 1Q22A 4BMVA 3HZOA 3BXGA 2BMWA 1G1MA 1M75A 3FCEA 3L06A 1CUWA 3AG6A 2G7MC 2J31A 3L0SA 4JC0A 5IC5A 4PANA 3W3AA 3T9FA 1JIVA 1VE3A 4CG2A 3ZIAD 5J2TA 1G64A 3T6KA 3QFRA 3ZJVA 3WXBA 1KI3A 2O8FB 1I36A 2GAJA 1Y8CA 1JALA 5EL0A 2HSEA 4KJXA 4D9BA 4AKTA 1GXSB 1NSYA 1TLFA 1KOFA 3R0XA 1M1YB 5YASA 3VGPA 3W8EA 5JTUA 3HBJA 5DTQA 3SYRA 1C1DB 1N2CB 1VHLA 2Y2VA 4CM3A 5EKTA 1ZXLA 3AR9A 1LW7A 2ZWIA 1CIJA 2HUPA 4KXXA 4Z4HA 1XRJA 1CK4A 1ZO8A 2F62A 1BMFD 1MR3F 4JVMA 4O0LA 4BNYA 1KI1A 1G55A 4LVCA 2EZ8A 3DEAA 3U4DA 4BN4A 5EPEA 1XDDA 1AQ6A 1Y1QA 4EB8A 5BOSB 1BRTA 1OAOA 2I8LA 4PRLA 1SC9A 4PLFA 4MGIR 2IP2A 2R4QA 4UDXX 5G4KA 3ABRB 4G0VA 1GN9A 3IVRA 5ADHA 1IZ9A 1RM0A 1IIRA 1QFSA 2PY6A 3AFNA 3BD6A 3ETGA 5ANRB 3RS8A 4CT5A 2RONA 3DR5A 1RE1A 1YRAA 2H57A 4PX3A 1PQWA 5LZ8A 5AHXA 1M34A 4ZYXA 2JLZA 3QEKA 1AHIA 4KODA 1Y7LA 5LUBA 3C3BA 4CQNA 2GBLC 1M0SA 3UEOA 4XSHA 5H4GA 3T5MA 1GFSA 4EMBA 3TTVA 3G59A 4WK4B 1BWSA 2EYQA 3BMOA 5DYIA 1LLUA 5IFLA 4D3SA 3HB4X 3VZBA 1WVIA 1PDVA 2QRGA 3U4GA 3QLJA 4TZ6A 3HDGA 5LMZA 3FFBA 2E37A 3WWYA 1SUCA 4LISA 2WTAA 1HR0B 4U7TB 1JDZA 4J3FA 4KFUA 3T7JA 3H04A 4LXIA 4WNCA 1IPHA 5INTA 2G1AA 3U60B 2P9BA 1X77A 4K40A 4ARUA 3SC2A 3KAQA 5ETJA 2KYRA 4DPMA 4MVCA 3PX7A 1B7GO 1K6EA 4GI7A 1ODKA 1T9GS 1CWUA 4CIWA 3GAMA 4EG7A 3H9BA 3E22B 4MS4A 1Q3KA 1Z56C 1QB7A 4TN1A 1Z7BA 2PDAA 3WTCA 1ECGA 1SB9A 3VO9A 5DRTA 1Y9JA 2FPPB 3SCZA 4EAQA 3AYXB 1KRXA 4P4SB 1N8TA 3SZLA 1CQZA 4GWGA 4CMIB 3GT4A 3FMIA 1NUHA 4U7WA 1THMA 4Y9SA 3L4KA 5DTJA 5JFGA 3PC3A 4N7RA 2AN9A 2VBFA 1SKQA 4M0KA 4KR6A 2LW7A 1VI5A 3RYFA 2FSFA 4WGGA 2IY8A 3P0HA 4FDVA 2QNBA 3ZWQA 3AONB 3G5LA 4MUFA 3H9GA 3OX3A 1X3LA 7ADHA 1KEEB 4AS2A 4MYSA 1J7JA 1M2HA 1ZFNA 4L75A 4QTUB 5DI9A 4KV7A 3BFKA 3EQ6A 3IPAA 3CT6A 3RRNA 4D80A 4QHYA 2ZCVA 4WCFC 1ADGA 4JEUA 1TAGA 3WSVA 2QI9C 4MQ6A 4CF5A 1H8HD 1FJGB 3R6TA 4JBLA 4TYMA 1TYCA 3PCRB 5DIZA 5JE8A 1SEPA 5BV7A 3HO8A 3KQKA 1OX4B 1N8KA 3RBVA 1W5BA 3JASA 4M6WA 2FR0A 3H97A 3O8QA 2HK6A 5I01A 1AHPA 3BHNA 4FHEA 2YWEA 5FBWB 1JT9A 4MVWA 1NLFA 3ZKAA 3REFA 4GU5A 1GGJA 4HADA 3CGGA 3M6LA 3PXEA 2WDPA 3HVUA 3KUCA 1FDTA 1EHYA 3BGIA 2AR9A 2ESRA 1FSZA 2WMNB 4BGUA 4AMYA 2FOLA 4H3VA 2IF0A 3DUWA 4PSUA 3GI1A 4E1AA 4HNTA 4F2HA 3JCZA 5IN4A 2H0AA 4WGFA 4WY5A 3CSUA 4DWWA 2NZ2A 3Q7IA 3EBLA 5BOVA 3ZC3A 4LYJA 1PL6A 1GZ4A 4W5HA 2JIQA 2OBBA 2RK3A 4TV9A 4FNGA 1GAJA 5HRCA 2PL5A 1YJ8A 3GD7A 3CT4A 2F43B 3BE5A 4MGHA 1U3CA 5CH5A 3T7EA 1DBSA 3GGSA 2HQOA 1RYMA 5A62A 2CD7A 5IKMA 3AGQA 3MJCA 2PBLA 1UFOA 2XUJA 3QVVA 4LJLA 4UTPA 4F1JA 1AVTA 4GPAA 4GZ5A 3SQLA 3GBPA 2R7MA 4NOJA 2BT4A 2A7XA 4QQFA 1R9GA 5DGCA 4BWGA 3GRPA 1G16A 4QG3A 2B2XA 2LIVA 3LYUA 3OFND 1WP9A 1NP3A 3KJEA 1OUMA 3MMXA 3SZOA 4O6VA 1P5ZB 2G83A 3UM9A 4B34A 4F2WA 1R9NA 7MDHA 4KLCA 2JFWA 1E9RA 5SZHB 5TPZA 4OX9B 2BV3A 2CHQA 1AE1A 2PMKA 5CJJA 3U3DA 5C9ZA 3AF6A 3QJ5A 3JQ9C 3RT9A 4TOIA 1V6CA 3OHMA 5JSHA 4BN0A 2ZI6A 5LIPA 3LFHA 4CV2A 2OBMA 1Q15A 1SU6A 2I4MA 3MFYA 4ZIRA 3OQVA 4Z4EA 1HMYA 1AGPA 4TSRA 1KDRA 3HB7A 5D85A 5IN5A 2DQZA 3F7MA 1ORHA 5FI5A 4GOND 4JX9A 4DLZA 3LVFO 3U7GA 1T5BA 1E1RD 4ROSA 3VAAA 2DEUA 4B3RB 2A0FA 3RVPA 1GFZA 2WU3A 1HA3A 1W4BA 4NR0A 1GSOA 3A6LA 4GL4A 2RB5A 1Y4ZA 3UXYA 2FA9A 4PX9A 2XUFA 5BPFA 3U0VA 2XNDA 4GZLA 1QZUA 5F1KA 2FSHA 2JEZA 3GA5A 1JHZA 4RH0A 4PYOA 4B74A 4DVJA 4OLJA 3MWEB 1QFMA 2GAOA 3MOIA 4RA6B 5DTMA 3TQHA 4BP9A 2OZLB 2JHPA 1SUBA 4XYMA 3GOHA 4QJ5A 1WBDA 2F8SA 5CH8A 2FSGA 4ALNA 4AO8A 3LFUA 1WSDA 1MHTA 4ND8A 1CP3A 2QW8A 2AF4C 4D9FA 2I1LA 2AOTA 1ZK2A 1QV7A 4TTVA 2Q62A 5K0LA 5K3FB 4DA7A 3R76A 1M6YA 5HJEA 5JXJA 4JYCA 3A1TA 5B2FA 3KOXA 3FHOA 4EW2A 4YRAA 3HB9A 2QMEA 4W82A 3V4FA 5FLEX 1Z28A 1NVXQ 4F06A 4L1KA 2GCGA 1UBTS 2PRSA 4LNUB 3ZU4A 1DNPA 1I24A 1M34B 4OTZA 4XWYA 3L4BC 2P90A 4TLAA 5EXTA 3ZU3A 1DJLA 1IUKA 4ZT6A 3C5WP 3AZOA 6NULA 1YHYA 5IDYA 3VQTA 5B4UA 1X74A 1HZZC 2WT8A 2NUPA 1XNJA 4XX0A 4YASA 3BWEA 4LPKA 1WNTA 2VTDA 3S3TA 5KNDD 3N0RA 3MTJA 4Q02A 5LZ5A 3SSAA 4A5OA 4PNZA 2X1LA 1QNFA 2WKRA 2YV2A 2PZMA 3P2IA 3WBBA 1ZOLA 1PLKA 3SZMA 4P7BA 1YIOA 4OSEA 1CS4C 3P32A 2X2OA 1P75A 4KSYA 3L7IA 3HJBA 2GBPA 3ZVMA 3D0QA 2R8PA 4ZZIA 3MAAC 1OJ7A 3PHCA 3L8DA 3BSFA 3C39A 2HUNA 3FUTA 4MS4B 4BP1A 1E1LA 1WDTA 2YXLA 4B79A 3O8DA 5B7GA 5IYZF 1SOUA 2Q6IA 4JQCA 4W5QA 1OB2A 4UBJA 1NXWA 3OZXA 1XEFA 1M2OA 1ZD9A 4QJBA 4GIBA 1EUQA 3CZQA 4KAXA 1HUQA 5C8DA 2BMEA 4Z0TA 2Y1GA 3AI3A 4HWKA 4M7OA 1K89A 2AYXA 2GJ4A 3BXXA 5LUAA 1DU4A 1ODTC 4ZOCA 3TINA 3KJHA 2QHXA 1NW5A 4RJTA 2LUOA 2I8AA 2FE1A 3N3AC 3NFYA 3V4PB 3KLOA 1C7FA 1AS2A 2NQ8A 4GF5A 5F33A 4CIBA 5AVUA 5JYCA 4RHFA 3HGQA 1UC8A 3U19A 2WWIA 2HBZA 2ZYUX 2R96A 3IO5A 3IRUA 2WA1A 4W8GA 1M2NA 1T8RA 2UVDA 4HWTA 3EODA 1E8DA 4B0OA 2R25B 4X7BA 1LRJA 3VO8A 1XK6A 1YUBA 2J41A 3DE1X 3DGFC 5DWQA 5ITVA 5L7TA 2OKGA 3HCAA 4EUSA 4M6WB 1OFVA 1J0DA 1J49A 3H9EO 2VHCA 1P1CA 4YUYA 3H17A 4QICA 1KSJA 3B5IA 3PFIA 1X8LA 4JB3A 2Z5VA 4L02A 1V48A 3KT8A 2ZSFA 4JGIA 2DUWA 4XUCA 5HK8A 1TQ2A 3A26A 4PSVA 3C16C 5FNZA 2Q3BA 2IWRA 1UJNA 2BP7A 2XBLA 3GJ7A 4AZTA 5CDFE 4BO1A 3K2BA 1RQ2A 3MWDB 3E0XA 2WUWE 4UAUA 5DHSA 1ORDA 4EW6A 3CIOA 1UBJS 1JDUA 2QSUA 4RJJA 3UKOA 3EMDA 1KH1A 1H94A 3KYCB 4CM1A 4CDRA 4DXAA 5FEUA 1CUGA 2ERYA 1EHCA 3EVDA 1OLUA 1PT9A 3KPJA 4Y98A 5LMCA 5JU6A 1K75A 3I01A 2IQIA 5AXAA 1C4WA 3FPJA 3O1LA 1NVEA 2EYUA 2AYYA 5AVRA 3JY6A 1U0BB 4E30A 1I1QB 3L84A 3B51X 2D0PB 4D0NA 4MRPA 1FDUA 1RAAA 4JP3A 5AMXA 4EUNA 3UCXA 4F6RB 2Z2JA 2ECKA 4JBIA 4TV9B 1C3XA 2FZCA 5JCZA 2W22A 5LKAA 2OYRA 2X9NA 2IPLA 1VPDA 5LWQA 5DP1A 2QX6A 1YS4A 1TVMA 1KC1A 3EA4A 3EMKA 3TNFA 3W77A 1Y6ZA 2OP0A 4KMOA 2IPMA 3SMQA 2WKWA 4O4IA 2ZI4A 3LQYA 4B8ZA 1WTAA 4PIPA 4ASUA 3PR1A 5K01A 2C1ZA 5DCLA 1LUAA 4QDUA 2VHTA 4KFCA 1A8UA 5ER9A 1QGZA 1X39A 3H9QA 4RIFA 4DCOA 3U49A 3I61A 4KQ2A 2XB8A 3WKAA 2YV3A 4OXXA 2QLTA 5EIOA 1K68A 3HYTA 4D3YA 4ASUD 4YLEA 4B3MB 3K70B 4QRDA 1NUAA 5FUMA 5F1PA 2H00A 2QRKA 2ZPUA 3BWVA 3C1AA 4JEIA 2J3MA 4X1IB 3FWZA 4Z1MA 1JTEA 1MT3A 2P91A 5KINB 1FRZA 1O87A 1C2TA 1X2EA 3THWA 3OX4A 2IEYA 4PE5B 4JR1A 3FKJA 5GV7A 4HV4A 3OOYA 2RGUA 1QP7A 2IUTA 1HRDA 5DDIP 3I5AA 3TD2A 5FI0B 2IDJA 4ILKA 4G0UA 1EM8A 1JBQA 2ZI7A 2ES4A 3M81A 1YQTA 4XD2A 2LD4A 1Z0AA 1UXGA 3TLMA 3R9XA 1QV9A 4YYZA 4KR3A 2ZRIA 4U63A 4D45A 1O8CA 1GZSA 1PV2A 1R6UA 2D74A 2IHTA 3U16A 2HJVA 1T4CB 2QMHA 3D6MA 1WB6A 2Z58A 4M36A 3W1WA 3UGJA 4RIHA 3E5MA 4R4JA 5GIPE 1ISGA 3NBUA 3UHJA 5ECYA 2PNJA 4HAWA 4HWPA 4Z4GA 3EEQA 1E89A 4Q34A 3LDUA 2YS6A 2O3TA 5DXFA 1R9MA 6REQB 5JZVA 1IL0A 1X70A 3GAFA 5AW6A 4LCJA 3F9RA 3IODA 4IHJA 3JU3A 4YRKA 2IITA 2WYUA 3PQ6A 3Q9UA 3HCNA 3KVNA 1I51A 1LSJA 5GONF 4I66A 1T5TA 4ND8B 1WCIA 5D51S 4E94A 5AVWA 1S6YA 2AOTB 3HWSA 1FP2A 2NTNA 3KQYA 4FHGA 2IBTA 1VKNA 2NZUG 4JROA 4DZTA 1QG4A 3QXCA 3NPMA 4L3VA 4FHDA 1DUIA 1NL3A 4O2AF 2J46A 4NMLA 4RXUA 5JS2A 5KQSA 4YFVA 2JFBA 4FUTA 4R3UC 5IEJA 1JG6A 3P2YA 2OCKA 1C5KA 4N18A 2CVFA 4KDEA 3CF0A 1Q57A 5EZ5A 4D4JA 1E1QA 1P5JA 4F4UA 5BN4B 3LPNA 7REQA 5IPFA 2ZTVA 1BVUA 5IW8A 2X7JA 3KCNA 4XUGB 4NV3A 4YDSA 3ROGA 4YJGB 1DXHA 4AIIA 3JTMA 4N5MA 1K5DA 4JLDA 2WIDA 4E5PA 1T91A 3FB4A 3UT6A 4PZAA 5MDHA 1KMHB 5AKZA 2C99A 1GNPA 1JJVA 1QHYA 2AC2A 2P2NA 4DR2B 1IHXA 3JYPA 1L8QA 5AHOA 4XX0B 3F6RA 4WZZA 3VR2A 3WWZA 5H9WA 3VPFA 4N3GA 1V16A 2PUEA 3U3MA 5CH3A 5DNUA 4M21A 3OTHA 4CGZA 4PYRA 3UMFA 2YHBA 1XVUA 3E15A 3KFXA 1Q7EA 4RZUA 3PHLA 2BOVA 2HJRA 2CLSA 1ZN7A 2JFZA 2OD9A 1CJKC 2PKWA 1WCWA 3EF3A 5EWMB 3HEAA 3FYCA 1J99A 4N7JA 3RUFA 3WNDA 5TLSA 4YRGA 2FR8C 3RRFA 3TZHA 1V6SA 3CKLA 5J2TF 1Q12A 1DAIA 3ENKA 2V6BA 2WR8A 4DUYB 3VR4A 2DT8A 3HGMA 1OHHD 3GH3A 1Y34E 2YHIA 2X0JA 1BHO1 3CWQA 4NG4A 3GCGA 4YCMA 4E32A 3IBCA 1NP7A 4K6KA 4NV1A 4RTJA 3DMNA 1IVYA 4UFPA 2XX3A 1KVQA 3KE8A 5K1ZA 3HDTA 1TMGE 1Z4IA 2QN9A 2DWQA 3NKFA 3C3PA 1M2OB 1FJ2A 2ZUCA 3LQ2A 4HL6A 4UUPA 2B9EA 2JKYA 4A6EA 1RJ9A 5SYAA 3K96A 4OJMX 1ZINA 3A32A 1YR3A 5F5LA 3SX2A 4Z51A 5DNCA 5LMUB 3CNEA 3V00A 3B2QA 1A4IA 1PGOA 3H4TA 2JIPA 4ZANA 5K3EA 3F6CA 3TW8A 4QBFA 1PJTA 1MVNA 4WA8A 1XTBA 4KZPA 1SVWA 3EPJA 1I2MA 1VMAA 3EGEA 3ZBPA 3SIWA 2YVLA 5KHLB 1CQJA 1G5PA 1U5AA 1Y63A 2PD3A 1JEYA 3BDVA 1EK6A 2BR5A 1PQPA 2IIQA 4W4TA 5MFPA 3UK2A 3QU5A 1MVLA 3ZGZA 1L1RA 3U9LA 3QXGA 1PVDA 1FX0B 3DLCA 1KI8A 3QIAA 2HJSA 1GIAA 1MXHA 2BZ1A 4MI9A 4X61A 5HHTA 1HM5A 1P4RA 4LY0A 4XIIA 4IMRA 4GOXA 3OHSX 3D8SA 2WTEA 5IULC 4M4SA 1AQUA 2JASA 2ZB2A 3PQDA 4ZU6X 4JWKA 4NRDA 5KZMB 1SXHA 5FTWA 2AJTA 4JZKA 5KVCA 1ATZA 2ZJ1A 1LFAA 4GLLA 2FVYA 2PLWA 3UXEA 3O7MA 2A8YA 4W5TA 1EK5A 1E94E 1L4MA 2X7HA 1XZFA 1SY7A 2ODEA 2R8EA 2J1LA 1C81A 3F6YA 1M73E 5KYUA 5B1HA 3L5KA 5J5AA 3ABOB 1CUIA 4KC0A 2ZBFA 4RSHA 4PPNA 1OLUB 3NGXA 1KC3A 2Q46A 5K3DA 3F78A 3GMDA 3U1VA 2PSSA 4Y1GA 3OZTA 4NBTA 3KKKA 1PFYA 3QNWA 3WYBA 4LZAA 5JAZA 2HJHA 4L78A 4WXMA 1X1RA 5BQXA 4F5EA 5IRCD 2ZR9A 3RTCA 2EZ4A 5CA0B 1JAZA 4L2IA 2OFXA 1TGYA 3A3KA 1TEZA 4B7XA 5AK3A 1L5GB 2IHUA 2XA9A 3ACBA 3HBLA 4UNPA 3IALA 3Q6NA 5ALTA 3MGAA 3K9CA 3EFOA 1BEZA 4EFMA 1G6OA 4BNTA 2VCEA 4B47A 2IPNA 2GRAA 3SHQA 4I5FA 1XELA 3WNQA 4IDFA 2JIBA 3NNDA 2BBSA 1G8YA 3AWDA 3ED1A 4JENA 4BC1A 4BYGA 3U61B 4L0MA 1JS1X 3UHOA 2FMHA 4G8JA 3AVPA 4F96A 1AUXA 1BHJA 5TJ9A 2D7JA 4UHKA 4I3HA 4FZVA 3KNZA 4D5GA 2WE7A 2WLSA 5COBA 1F0KA 3LGAA 8OHMA 2F48A 1GQSA 1OROA 3BHIA 5D87A 3THOA 1PZXA 4FGUA 4QODA 1YRQA 4BFYA 1JB1A 4QFBA 4Y0AA 5AJUA 4NBNA 3D1LA 2I03A 2BM9A 4II2A 1VOTA 3I9V1 1L5RA 3CN9A 5A6VA 5DYTA 5E3HA 3N75A 1KMNA 1Z8DA 4EO9A 1JPNA 4YMTA 1JT2A 4EDHA 1ZD5A 1KFBB 3GFGA 4JYBA 1JVBA 3WMFA 4DIEA 1N1DA 1J5XA 4MV0A 4UU0A 5HJ5A 1EM8B 1HMPA 2JAUA 3P52A 4XRRA 3SG0A 4PBTA 1I14A 4X8MA 1A4RA 1ZMRA 5H4HA 1W48A 5DBGA 1C0EA 3G68A 4I50B 4MKFA 4B35A 1YR9A 1ZD4A 4P83A 4AM8A 4C2BA 1CQWA 1VLQA 4RTMA 3VPBA 3LAWA 1B8VA 2AFIE 5JI3E 2ZWPA 3OJLA 4L4SA 1CEYA 4ENTA 4P4TA 3S70A 4EFLA 4ZEXA 3O74A 1BKSB 1TZ2A 4Z53A 4EHIA 5JASA 2J32A 5C46F 3AOEC 5AK5A 1DLJA 1THZA 2AMVA 3TAXA 5HNKA 5GQSA 4GL2A 4ZT3A 4PN3A 5JECA 3I5YA 1GUFA 3E53A 1N0WA 3STWA 3J7TA 3TW0A 3TSYA 3U4CA 1UBFA 2XNSA 3FCYA 2NVBA 1Z22A 4ND5A 4C0WA 5K4GA 1OGIA 4KQ9A 4FMPA 1B16A 1DKNA 4O2BB 4HFMA 3L8YA 5IUKC 3RU2A 1HX7A 1DC6A 1TCUA 1SVSA 3PDJA 5F7JA 3W8DA 2P8JA 1II9A 3GVXA 5A0VA 1MNQA 2B4YA 3BGVA 4F8YA 2VSXA 4XWKA 3AB3A 4YAEA 1IYZA 1JILA 2ZU0C 3C8DA 4RD2A 4TROA 4UZEA 3DZDA 4EAAA 3PJEA 5C37A 1JZQA 3DAGA 3RNOA 4PFSA 2E9SA 1OXKB 4QYSA 5B1DA 2FE4A 3COVA 4PLPA 1PNQA 1NVBA 5LZ2A 5HW0A 3FMFA 4MGZR 2UUBB 5FA8A 4DEYA 3WRXA 2BFCB 4U2DA 4Q4CA 4QLAA 1ZK1A 3H2IA 3N8IA 4MJ7A 3Q11A 3FRJA 4LWQA 1IBKB 2WAOA 1R50A 2JIRA 3G8AA 3QE9Y 2YJ3A 4LSMA 1V16B 2PSJA 1GU1A 1GNTA 3HXPA 4BTVA 2EXXA 2HT6A 4N3CA 4PAQA 4B3JA 2NSHA 1CUVA 1UINA 2AE2A 3M6WA 4GM1A 4DBLC 3DGEC 4ZRMA 4LZLA 4R5HA 4YDRA 3A4YA 2FOXA 3WKBA 3MM4A 1V1MA 3FF4A 3ST7A 3F97A 1ISMA 3KLPX 4FR5A 3UVEA 1E8MA 2E89A 2QYSA 2G8LA 1B26A 1YDEA 1F8YA 1U2RA 2XEDA 4NU5A 5G0WA 2C7RA 5DPMA 3WKCA 3LDAA 4MQFB 1QKJA 3LECA 4PCVA 4KE8A 2NXEA 4B3XA 1LI7A 2VNSA 1EA5A 1RBMA 2QRVA 3ZE7A 1GAXA 3EZXA 4PO3X 1QLHA 3A28A 1O4WA 2KI5A 1PKXA 2ZVPX 1RJ9B 5JS6A 1ZIYA 3WOVA 3BK1A 2XCQA 5FO1A 2YZ7A 3WLLA 4DHWA 1JWBB 1Y37A 2HDOA 1N6RA 1VRCA 1OI2A 2BGMA 1CYDA 1E2KA 1T9BA 2JJ8A 3L92A 3NATA 2O8EB 3PF8A 2G6BA 1A69A 2E18A 3VPHA 4QPZA 1X8KA 3TW8B 2BFBA 4HH3C 4FGKA 1IK6A 1REQA 1ZWLA 1YA4A 4RHXA 3AVTA 2RMKA 1DPGA 1WWKA 3DXXA 3HWWA 1CQJB 1PJ2A 3GA7A 2ZI5A 4IDEA 1YCDA 5BRNA 4UUNA 1X1DA 1JEYB 1PNRA 2P2CA 3QU4A 3IHWA 3UJ6A 2D2FA 1BFKA 3NKLA 1MP0A 1LSOA 3LDFA 2H51A 4TT3D 1F5SA 3IT3A 2BONA 4KXNA 2QD4A 3I76A 4B6FA 4KB5A 1E2UA 2OQRA 4JLJA 5CCXA 5IDWA 5KI6A 1LDBA 4DYHA 2FF7A 3PRKE 1PT6A 4N5HX 1C8KA 1LNQA 4D46A 2DETA 5CVJA 3GBVA 2IYOA 1JKIA 1DELA 1VYUA 1P0CA 1NU6A 2QT0A 2Y1EA 4G2NA 1W2WB 4N0DA 1G4UR 1F2TA 4RH1A 4MUEA 5ULLA 3O8CA 2QTVA 3LKVA 1W34A 2C59A 1SEVA 3KOWA 4FHCA 5CEEA 1QC5A 2O20A 2PKQP 3L7AA 3QU2A 2DH6A 5A9SB 3DDSA 1HL7A 2ZYTX 3H87A 5IVPA 4R1MA 4ZYVA 4L5YA 2BEKA 4ZCIA 1UZUA 1G21A 2AWNA 4LHSA 2IOQA 4BU0A 1QE3A 3MERA 4L2IB 2X0NA 1DV2A 3E2PA 5B3KA 2CYAA 2AEJA 1MAHA 1EB9A 3RC1A 4PGHA 3TEFA 3B70A 3LHDA 1IWOA 5E4JA 3EMBA 2WIFA 1P73A 4AS1A 4TLLB 3WL3A 3PUWA 3BQNB 3WWCA 2PZLA 5AXDA 4IVRA 2LCFA 3FUCA 4Y1FA 5DW0A 4BKOA 2EWWA 5LXTA 1X7ZB 2FUKA 4KRXA 4Q6WA 1I8TA 5EGNA 4ESEA 4BLRA 2OMKA 4R2MA 1WXEA 2ATIA 3X3HA 1H2BA 1NQ5A 3M9LA 3QMVA 3AU8A 5BV2P 1FA9A 4FFBB 2QE7A 2CV2A 1TKBA 5GVSA 5LP6A 1IQUA 1MQ9A 1ZOSA 3AL0C 1RQLA 5DT2A 1ORIA 3ESZA 5AHKA 1U8FO 2YXPX 1UC5B 3HB0A 4GLFA 4HB2A 2NO6A 4FC6A 1O94D 1L5WA 4BE4A 4US0R 5F9FA 3EEBA 2Q3DA 1KP9A 2B8WA 2DHQA 3PENA 1AB5A 1NJ6A 4QZVA 5AW7A 2RHHA 1H23A 1YR6A 4INAA 2DJIA 3T9BA 4BPRA 3AHCA 1C0IA 3LXUX 4GZ3A 3CSSA 3IIJA 4KN8A 1M7HA 3P20A 2J7PA 4M8SA 3I5UA 4B2LA 5EIFA 4I19A 4ZI7B 1E6MA 4IIGA 3OM1A 5FDFA 3RVKA 1YQGA 3QMWA 1YQ9A 5JIBA 3OZ7A 1TIPA 1WUTA 5F3WB 4P31A 5KSOA 4C3ZA 2QVYX 2JGNA 5MF6A 1XVTA 3P2MA 5REQA 1NDQA 2CK3D 1NC3A 5G1OA 1G6HA 3QWFA 5FWXA 4TMVA 2XTNA 4IINA 3RFCA 4YRMA 2HWYA 3S2GA 5A02A 4AYTA 2ASEA 4I14A 4IVPA 1WDLA 1AV7A 2YZMA 3M4XA 5K2MA 1EDEA 3DR3A 3LX6A 2O9JA 4ZXPA 5KTRA 4QXMA 5ED0A 5JPIA 3WBFA 3FG9A 5FV7A 1NMZA 2VSNA 2Z1MA 4WW0A 1EVZA 1FVXA 3CRNA 1ILEA 3TQRA 1KI9A 4W7IA 4YXWA 4EP1A 2P67A 5EIWA 1YRLA 3NBKA 4G09A 5EJ7A 4O4IF 1P1BA 1ONNA 2WEKA 1OGYA 3MWLA 4PPFA 4AZ3A 1AK1A 5DLQC 2FLWA 4M9UA 1T9DA 1QANA 1Z2OX 1HK7A 2CHEA 3CF2A 3MOSA 2O8DB 2EGHA 3CMMA 3OCZA 4I1UA 1YAJA 3PE4A 3HVKA 2V5UA 3KOZA 4BUJA 2GEVA 5J1SB 1A5ZA 4LZPA 3WZMA 1K2VN 1GOTA 4IG9A 4LQDA 1YGYA 4UMFA 4ARZA 10MHA 3WGQA 1YZFA 2N47A 3DL2A 3U7JA 2R9VA 4PZUA 2DWPA 2WQ7A 1XPOA 4IP0A 4YJDA 4OHKA 4DZZA 5BMOA 3RUCA 1DAFA 4YCNA 1W0JA 2IEBA 3GT7A 4XH9B 3VR4D 2P4QA 4I1IA 3GPDG 3PUXA 1ISJA 2H52A 4YV0A 4EHHA 5KQRA 1CY8A 1K97A 1Q92A 4P80A 1JX6A 3OECA 3W7BA 4CQJA 3DA8A 4E4TA 1MB4A 4L27A 1HE3A 2IBMA 1AMUA 1IB6A 1XHFA 4JWTA 3W2FA 2IIPA 2O2SA 1S4MA 3BB1A 1DSSG 2FMXA 2PZAA 1R0SA 1KXJA 3QXHA 2A30A 3O21A 4H3HB 3OJOA 4AN1A 1Z5UA 3IT0A 3O31A 5KYTA 3C5VA 1JJAA 4Q9HA 3W2EA 5ITSA 3I5MA 1JDBB 3D6FA 2WVAA 4G8DA 1PN3A 2EKPA 3B6EA 4XKJA 4BQRA 4FD3A 4CG3A 4F21A 1GR0A 2YN0A 3PD1A 1GCIA 2EEZA 2Z2YA 3G2QA 4M76B 2VK8A 2X9VA 3X1DA 1TUBA 2PPLA 1RU3A 2JNWA 4PAGA 1X7XA 4C21A 3NP7A 2XQKA 3G0IA 2QG4A 5L3RA 4A7PA 2OXCA 2C5SA 2P9HA 1AJEA 2LCIA 4PYMA 4DJAA 2ORIA 5KJ6A 4FT2A 5K0FA 2VJBA 3A1UA 1RXIA 1YRWA 1QTNA 4L4ZA 5IJAA 4LRYA 2PD4A 1A72A 4AKEA 2FY8A 2R11A 3B9QA 5CFPA 3G89A 5KJ1A 4IHJF 3PWKA 2QRVB 5IT4A 2IYQA 1MB0A 3VYWA 2FEKA 2PVSA 2RK6A 5HP4A 2BW0A 2H4XA 1MX5A 2CFCA 4N5DA 4GZ6A 1P33A 1U3WA 1XGKA 1CS0B 2CB9A 1IE3A 2JFPA 4ML3A 4NDNE 2NVUB 5HZHA 5BSKA 4NEHB 2BD0A 1V3QE 1WL8A 4CM9A 5ELMA 2WQ6A 4X3OA 5HFAA 4EQ6B 4R6XA 2EJWA 2O4CA 5EP2A 2VH2A 2BFBB 1B2RA 5F52A 5BSUA 3RU7A 3MMSA 1OA1A 1E9FA 3L02A 3UA3A 4IOLA 3V7FA 1KOGA 2Q6TA 1YQDA 5DTRA 1S5PA 1C8BA 5K45A 3ZDDA 1I2CA 1G5FA 1ZISA 3REQA 1TA9A 3IUEA 3U0BA 2YHAA 4Z7JA 4MVJH 4PX2A 3C6MA 1C1YA 2W6ZA 2OLJA 1Q50A 1CETA 4I9FA 3FDJA 4GKVA 2OORA 4QYTA 3L8HA 4NESA 4DLWA 3Q8MA 3KZKA 1PL7A 4P82A 2FWBA 2HV8A 4BE9A 3MJVA 1GSIA 2WTUA 4W8HA 3DO8A 4DQXA 3PUYA 4RGBA 2CXTA 5FADA 2GF0A 1SCNE 4PBSA 4D8WA 2QTVB 1UUFA 3RAEC 4XX1A 1JH9A 1CRWG 2CFOA 1N0IA 2RKBA 3IURA 3VM6A 1V95A 5A6SA 4IDAA 1O95A 2UYQA 5DOVA 2NYUA 3R3ZA 1QAQA 4KITB 1N77A 5DBEX 5ENVA 3SWWA 2OYCA 1Y1PA 4NBLA 1PJCA 4ENQA 1RZRD 2GPBA 3KQQA 3DH0A 1L7VC 4I55A 2C31A 4NABA 1OJLA 4QA9A 1PW7A 1W8DA 3L6EA 5C8YA 4KHPB 3NH6A 1J1UA 4K6MA 3E8MA 4GDMA 4H3SA 4D99A 3B1WA 2A0KA 3UG6A 1ZK4A 3QIVA 2RGAA 4OBBA 4WAUA 2SICE 5LXTB 4A6DA 3ADDA 1U8TA 4EX6A 3IERA 3PI7A 2P0EA 3VZDA 3T7RA 2G76A 2ZIXB 3QE3A 5LN1A 5BYAA 1OT5A 1RAGA 1YJQA 2GO7A 3DMYA 5H7XA 4RZIA 1F6DA 2D5BA 4BP8A 4RK5A 1AKWA 4X45A 4IILA 4WOPA 2BCGY 2GEFA 2FGJA 1AZTA 3ND8A 4LGCA 4TLBA 3RRJA 3CU5A 1YMUA 2XEXA 3JQAA 4MB0A 3K70C 2GESA 1G5RA 1DC5A 3GA0A 1OZGA 3KVRA 4GLOA 1T6BY 1NVKA 2OO7A 1NZDA 1ZH4A 5ECGC 2QKYA 1R6DA 4OQZA 4ZCLA 2E4VA 3A2LA 2H08A 4FI3F 3RS9A 4CF6A 3NDJA 3URMA 4MP8A 4K1LA 4YAWA 4QGFA 3GNTA 4E1VA 2XMCA 3TBKA 2R5WA 4I9UA 1MABA 2WNIA 1C7RA 3EVFA 3HUTA 2VP9A 4DCGA 2HHAA 4H18A 2FLVA 5F35A 3VPDA 4NMHA 5FWXB 3BA1A 1QMGA 2QN6A 3WWDA 3VAZA 2I91A 1PT7A 2W00A 3RF7A 3MYRA 4DC1A 3GZ4A 1WO8A 1L6IA 4HB0A 1OSNA 2Z1DA 4L28A 3CUKA 3EGVA 1U9CA 1B43A 3B1KA 3GD5A 2CJWA 5FOTA 2IH5A 2XWBF 3IIMA 1K6XA 2AHRA 3G0CA 2VUUA 4F56A 4B7UA 1A9RA 3WOHA 3VSAA 1YFKA 3DBIA 1NRJB 5TQ0A 1Z08A 1ISSA 3WV5A 3RVSA 1DG9A 3DVRX 1YUMA 4ND7A 3CO5A 2PLFA 4K9KA 1QHFA 3AFHA 4AZ3B 3BIOA 5HKOA 5JSUA 4OLFA 4D4LA 1QGYA 2O2CA 1D8AA 3B6KA 1WXQA 1KH3A 2CNWA 2PX4A 3G8YA 3KS9A 1IIBA 4H1VA 3RHZA 4UBLA 1RPZA 2ILVA 2FWNA 3F5SA 3O4GA 4FS3A 4J0IA 2RGNC 5KDDA 2UAGA 4UE3S 4ARZB 4NC9A 3RUDA 3EASA 2GAAA 5KOHA 4I5IA 3ZE9A 4TKVA 5CLHA 2IYFA 3M82A 3QU7A 3W0LB 4GC5A 1WVMA 1OXXK 5KYYA 2I9KA 2FMKA 4PU0A 5E3JA 4UCQA 2WC1A 2VAWA 4B09A 3L4EA 1FFXA 1U0RA 4ZVSA 2QVBA 3K9BA 1QMPA 4YAIA 5GINE 1QO0D 3W6UA 4EVRA 2FPLA 3AV0B 1A8SA 2R6ZA 4OP1A 1MF7A 1PNTA 1RJDA 4CL2A 4N03A 1KAOA 4FX5A 1CC1S 1S3GA 4MS1A 4ARSA 5EIXA 4UU8A 3AVXA 1AOXA 3N2YA 2P6MA 3OT1A 4GEGA 4JBWA 2OOSA 4OEHA 4ESVA 3ASZA 2V9CA 3MMZA 4IR7A 4DRYA 1UBKS 4F97A 3M70A 2GJSA 3IP1A 3JQGA 5CA1B 1U04A 4R3WA 3F6SA 3ZHBA 1E18A 2FMUA 2Z09A 3QMPA 5JLJA 2JH3A 3RYIA 2R00A 1WM1A 2QX4A 3T9DA 1GTJ1 5EHGA 4JI1B 4Q93A 1X7XB 5DBOA 1CR2A 1W85A 1KEPA 1JRLA 1QZXA 3C4VA 3RO7A 2MU1A 3UO8B 1WPRA 3QKUA 4M0DA 1KQGA 2UYYA 5EQDA 3NWBA 4MO9A 4AJ4A 5JZMA 5FP0A 3SS9X 1AN9A 1GQ2A 3RVNA 4PFQA 4HAYA 2FI1A 1GGKA 4TVBA 2NO4A 4DNPA 2ZIUB 2DKOA 2PPVA 3D4BA 3I9OA 3LCUA 4UVHA 1EFDN 3OA0A 1Y1LA 3HXKA 4EYGA 5IVDA 5I3ZA 4ZHQB 3AB7A 3ZHZA 1N32B 1MDBA 2Q3CA 5A3VA 4NOLA 1SCQA 3H8WA 4KQWA 2RB4A 3HP4A 1GRQA 3HU1A 2EJUA 3ETNA 4UD6A 4CEHB 2VHVA 1N7JA 3CVJA 2VSYA 1T9HA 1IRXA 3C4QA 3L0BA 3BDIA 4MAFA 4OSOA 5DHPA 4YJKA 2RGXA 1JR6A 1HFKA 4YR7A 1L7EA 2I4OA 1SU8A 2XYHA 3GEDA 3VH3A 3PLNA 3WIOA 2WHQA 3SC3A 3ZV7A 1XLUA 5GMOA 1RHJA 1K7FB 1J5EB 4AJNA 1A7KA 2C9MA 2W11A 4LZOA 5H5JA 1GRCA 1SIBE 4PC7A 3GV0A 4QIHA 2WPDA 5D6NA 1GNVA 4GNRA 4KNVA 4MRAA 4B4VA 2M6SA 2JC3A 4G85A 5AIAA 3EZ7A 3CRW1 1Z6XA 3E9ZA 4X90A 1PEAA 2WUEA 3BD9A 5IAOA 5KEIA 1DT3A 5HVNA 4YDHB 3CVXA 1XROA 2C5HA 1RBQA 2NSJA 3MJTA 4G56A 4CG0A 2OWDA 3HFJA 2OM2A 1I7PA 3GLTA 1PS9A 2HLDD 4PSKA 1ZMOA 4NK5A 3K0FB 2EU8A 4ARCA 3DOEA 1Z26A 1QHNA 1NPTO 4RV4A 5DHTA 1AF7A 2XRMA 2ZCUA 4EPXA 2EL9A 2IS1A 1VG8A 2YNMA 2EC5A 2F1OA 3LV8A 2V1UA 2BE9A 1WULS 4RGVA 1BJKA 4JN6B 3OBBA 2Y1WA 3TIXB 4IGFA 1KKMA 1AKNA 3I2FA 5BY2A 5E0KB 4DLXA 1EZZA 5KCMA 3NI2A 2GJKA 4AUEA 4Q82A 4MA5A 2BJHA 4F3RA 5JEEA 2EL7A 1KZHA 1A5BB 3Q40A 4JAVC 2O8EA 1W30A 2JFQA 4C87A 2J7PD 2QNIA 2DB3A 4GE3A 5D8DA 1ZR2A 2GEDA 1Z62A 3F46A 5F4ZA 4B8YA 1ZG3A 2DF8A 3SNHA 2FZGA 3TL3A 3UF0A 2AX3A 3JQ7A 4H1WA 5CFMA 4JKIA 1C7QA 2IKSA 1N36B 4MDHA 1E63A 4Q7EA 4NOKA 1V7PC 1YB4A 1HH4A 4RGYA 4Z99A 4DY6A 4QJIA 4UHCA 4DG9A 3F3KA 1VA4A 4LI0A 4E5NA 2GR9A 5EHQA 3MUNA 2MYNA 3QKWA 4G0PA 4YAFA 3VBEA 1KAMA 4BJHB 4NJOA 2PX6A 3NFRA 1DEXA 3S2ZA 4JNCA 3Q15C 2J3QA 1E79D 4H6PA 4AG5A 1ZKMA 3I53A 4PONA 3Q7PA 4AD8A 1A27A 4GG1A 3QHPA 3DB1A 1O3YA 1OU4A 1MNAA 1T5DX 2RGWA 3FGOA 2AL7A 3HYSA 3QVUA 5HF6A 1GL3A 2CUKA 4M0EA 1ZVQA 2QRNA 4K87A 1JTFA 1FDOA 1I6KA 1MABB 1C3LA 3M5PA 4C4SA 1T4MA 4NDZA 2WICA 3X2EA 3R8FA 3BTVA 1B74A 2AD5A 3ZK9A 1NLUA 5KYKA 4X24A 3T9CA 1FCJA 2WILA 3LUKA 4FOOA 3IPLA 3CN7A 2BBTA 2IS6A 1JNXX 1RWOA 4ZT4A 5CAEB 4BUCA 2P79A 1QGAA 3UT0A 1Z7YA 3BMXA 1S1MA 3DZGA 2O8VA 1H6AA 1L7PA 3M5DA 1UAYA 2RFLA 5CLGA 5KYUB 5JBIA 1LBIA 2RI6A 3QKTA 3HJAA 2GPYA 4U00A 2ZS9A 4Q9DA 4Y0NA 2OVFA 5TQ0B 2X86A 1E59A 3D6HA 2NPFA 1L3IA 3PJFA 4EUHA 1FU7A 2WOJA 2BR4A 2YIMA 4D6XA 3M9XA 2HLPA 1FOEB 3FM9A 2VWGA 2JDIA 2IZ5A 4NBWA 3EISA 4UHBA 1E3TA 1P7YA 3BA6A 4KYTA 5LXTF 2QZJA 3KRTA 1B6TA 4MJ3A 5ENDA 1E2IA 3PWTA 1UP4A 1K8QA 4X7RA 3OUUA 4MW4A 1BWPA 1ZCBA 2HRRA 3N28A 5KOHB 1GLNA 5DLPA 4DILA 3E61A 1RWXA 5LP6F 5H81A 3IAXA 3H0CA 3W5SA 5KYYB 3JZMA 1S0UA 2XR1A 1GGHA 2ACVA 5DCUA 3G8CA 1DRVA 1RXCA 1YK1A 1FFXB 3N6VA 3K8QA 4GFDA 4JS0A 3V9AA 2C58A 5JJBA 1XWIA 1T3TA 2QYOA 4O4JA 3CH6A 2ZJ4A 4TS4A 3WADA 4BFVA 4XD7A 1G2OA 1R4NB 2HA7A 4FQ5A 1VSVA 5I45A 1TLLA 4RFSA 3OEHD 2FPSA 3ND7A 1MQ8B 3GP3A 1T25A 2WUVA 1EG2A 2DWUA 2OHHA 3I04M 2F64A 4PWYA 1ZGJA 2HA5A 3B89A 1ESNA 1KDZA 2OM6A 2H4HA 2GD0A 3DPSA 5MFZA 2PH1A 3PV0A 4MDFA 5FBZA 1ULBA 4DMCA 3IVAA 1RI4A 4ZCRA 5KJEA 2CMHA 2J45A 4O1HA 3KSBC 1LCIA 1T8TA 2DUMA 4DQUA 1G7RA 3L7NA 2AS0A 1Z4OA 2JIDA 2W2OA 2ZRPA 3JAKA 5H3HA 3SLGA 3QVLA 4DMRA 1G8FA 1FUKA 5HR5A 2YN4A 5TV2A 3ZWMA 1RYNA 1MCZA 1AXRA 3D6UA 2I76A 4J7CA 4BO9A 2Q2NA 3RRXA 1PR6A 2CMGA 2SBTA 3QHAA 3ORFA 3A6PC 3M7IA 1ZM9A 3OHPA 5GJVC 2QD2A 4QULA 4EI2A 4EJ2A 4E7PA 4DT1A 3CX4A 5KNCH 1CDOA 4U0KA 5IAAA 1ESMA 4L7VA 1VPWA 4NMXB 3TLKA 1PWXA 2CHVA 4Z0PA 2R65A 2ZUVA 1UEJA 2CV0A 3G8BA 4WXPA 5J47A 1R6XA 1W5FA 3GJRA 3CE9A 3IAHA 4S1NA 2PMFA 1CJVC 3SHWA 2QR3A 2FJPA 4IBOA 4NDAA 5BMVB 4DR3B 4CEIA 1W2GA 1QCCA 4PYNA 1YC2A 2PX8A 2GZDA 1W4RA 5EINA 3ZQJA 4MJXA 2OPBA 4ZMRA 2XSZA 3MGGA 2RGEA 5AHRA 4FXOA 2IK8A 2B2NA 2HF7A 5EVJA 2VRWA 1Z38A 3BRQA 4K0KB 2DPXA 2O19A 3GX1A 3ZNNA 1NPYA 5FUXA 1W75A 2GBGA 4B84A 3W78A 3UMCA 3KYIB 1EK2A 4MIYA 4DZRA 3PQEA 1VJGA 5CLJA 1SK8A 3PP8A 2WU1A 4RIIA 2Q9CA 1PYOA 1W5AA 3LLVA 4C0BA 5K6RA 1IEVA 1IQRA 2ZROA 4P86A 3WIEA 1J2RA 3ESDA 3UWDA 2CY0A 3BSSA 1P1JA 5JVDA 1E0JA 3I5XA 1JU9A 2RGCA 2XVZA 3W34A 2GGSA 2Z0MA 2B5WA 1D09A 3UWMA 2G36A 3RC8A 1LSSA 1FY2A 2D0OB 2R8ZA 3HA2A 4JJAA 4AI6A 4OQEA 1EGMB 4X44A 3UW1A 2CDBA 3E82A 1N3IA 1IY1A 1T10A 2QL6A 4OMUA 4R8RA 4BQFA 5AUPB 3OPNA 3GLIA 4DG8A 1Q0LA 1V5WA 2GYUA 4AXBA 4RELA 3LWZA 2HQ1A 3TR0A 4X20B 1EBBA 1JEJA 4U9UA 4F2DA 1ECBA 3L5OA 1WXHA 4YT8A 3T5PA 2PTGA 1ZL2A 2DUUA 2ID8A 1IHYA 3QUAA 1Z6AA 1ZUNA 4WBXC 5KMGB 4FGWA 3PB3A 1BHQ1 1HQYE 3LZDA 1KZ7B 3OMLA 4N8DA 3FTDA 2R5NA 5ALSA 5CEJA 1PR2A 1AX9A 3AESB 3JQ7B 3N0TA 5LBTA 3RFTA 2JARA 4WT7A 1HSOA 1M2VB 2Z9DA 3JWJA 2UUAB 5HE8A 4NJMA 3GJZA 3N53A 4AF6A 3G0HA 3FWKA 3L7BA 3NYIA 1CFJA 1RIFA 2D06A 1BH2A 3FZGA 3GLGA 5AIBA 1IM5A 4EATA 3LLMA 1O57A 2NMVA 1HRKA 5T4EA 3UW3A 2DM6A 2NU6A 4FXPA 3EPKA 2FW8A 1I4TD 2QN2A 2XD4A 1RSZA 3BMNB 1UBNA 3KTOA 5FPPA 2PRZA 4JU8A 1KQ3A 3K2QA 4NZZA 5G40A 3V1NA 5ESRA 1AMNA 2HZBA 5B1EA 1Y7IA 1DT5A 1FDSA 1MVOA 4J0HA 3IEKA 4II3A 1G63A 3WBJA 1UK6A 1SUPA 1T1SA 2FPRA 3HBMA 3OLYA 4FHZA 2V8BA 4C22A 5A2GA 4JV5B 3OA2A 5EEHA 4E4YA 2CJPA 1ZM3A 1D6NA 2DPYA 4ZVMA 3UWOA 4BFZA 3IC5A 1BGVA 3OIDA 3AIIA 5KOYA 2RJ3A 3L8CA 3H2KA 1SB8A 3JQ8A 4R1UA 4JYAB 3ILYA 1O4VA 4GM4A 1E4YA 1NW6A 2V0CA 2WMDA 4DV5B 3LOQA 1VLVA 1U2DC 3CPHA 3SIPA 2BVNA 2BRUC 3UJ9A 1NSFA 3V4ZA 4XYLA 2Z6QA 2JLAA 4JSRA 1PT8A 2GASA 3INGA 3OO0A 2HDHA 4MYHA 3ZNQA 4CM7A 1B93A 1RJWA 3UBTA 3D6TB 1R4MA 4Q16A 4M0FA 4ZZ0A 1HT2E 3EVAA 4UCWA 1N2JA 3BXOA 3M1AA 5C7IO 4DLUA 4I55F 1GEEA 1W49A 2Z04A 1XJWA 2I9PA 1Q0HA 4ZVUA 3ZY5A 1A4UA 4D9NA 5C8YF 1W93A 2ZZKA 3DYVA 3DBRB 1NLMA 4D0SA 4OYRA 1QQ5A 1GM5A 2CCKA 4HEA1 5TGDA 1IY0A 4OOEA 2FSUA 1V8BA 1ZK0A 2PFGA 5CX1A 5IBRA 2RHTA 4ARAA 4BYMA 1CUCA 3W7AA 5J2UB 4FOPA 1PQ4A 4G5HA 3NRBA 4G1FA 2JL1A 5AOBA 4DNFA 4AFNA 5L45A 5ALKA 1IHPA 1FNDA 2Y1XA 4BV9A 1V5GA 4YV1A 2C9YA 2YZKA 4YHHB 4L9SA 5EKSA 4LHXA 4OBWA 2Y9PB 1TIBA 2HBRA 3ME5A 1N34B 1XNQB 5JAQA 2KW5A 4BNMA 5TDHA 3I9V6 2HWWA 1OXTA 1QUEA 1KNXA 4YQYA 2P3OA 3VR5H 3BXHA 1HQKA 3MSCA 4RSGA 4F45A 5ERXA 1EIWA 4NXNB 1NU8A 2DAPA 3ZUPA 5ALZA 1Z6PA 3WRXC 4C2AA 3VXKA 3D3NA 4M98A 4KJZA 1H3EA 1C0KA 4RHEA 5CLLA 1K98A 2W2KB 1X13A 1I7QB 1T3ZA 2LV8A 3SAJA 3AR3A 3LIPA 1E2MA 1JXAA 1SUEA 4G2TA 4GI3A 4UCXA 1ABEA 2FN7A 2VLIA 2Y1CA 1PG5A 3FVQA 3UJPA 3NHUA 1EWQA 3S2IA 1UBSB 2VQFB 4QKQA 1JKXA 3OIGA 4DS3A 1JDBC 2OFOA 3ANNA 3EPPA 5KC9A 5CVVA 4DDTA 3OO1A 1Z06A 4MW0A 4BQEA 5B7NA 4DTCA 2ZBVA 4XM0A 3LT5A 2NU9B 1KAHA 2VA9A 3BTOA 1U0GA 4Z5XA 5EUCA 2H6EA 1F38A 4HAOA 3HNOA 4FWBA 2X1MA 3WHKA 1WY7A 2XUDA 3ZZ1A 5FLXA 3L8GA 1VCMA 4OGKA 4JEMA 2AN4A 3KHTA 3NBYC 4FGJA 1XQ6A 2WJVA 1ZUWA 2ZJZA 3IB6A 3LO8A 3PUKA 2YS7A 3QFTA 4M37A 4Q5IA 1FSGA 2WSBA 3EBPA 1PT5A 4K7JA 5FPTA 3NHBA 1RM4A 4MYCA 1EEXB 4DT1B 5I7SA 3K71B 1NNEA 3I3SR 1YMVA 3HHEA 4Z86A 1AZWA 5AICA 5HIJA 3VBCA 2ZCJA 2BFFA 3L79A 3PQ3A 1USVA 1E2FA 4KGDA 1U7WA 3BFPA 4YRTA 4EA7A 3PRYA 1AA6A 3W2TA 1W36B 1Y9EA 3VKUA 3NTUA 3TN7A 1XJQA 4JR2A 2XJ9A 1JR3D 3WAGA 1QGDA 2RH4A 3ZGXA 3IKTA 1FZTA 3R7WB 4EEKA 1E92A 2JGKA 2JAPA 1A77A 3F9IA 2R0QC 2XZTA 5B57C 5LSAA 3T0FA 1JSZA 3VGJA 3SBOA 2VSFA 2HEIA 3ONFA 1FU4A 5LQCA 3HM9A 2YFQA 1HDRA 2JA2A 1FXUA 3F8WA 4KVZA 4KRGA 3OMXA 3MA0A 1U1IA 1Q21A 2HMVA 5HJ2A 2PWAA 1B0UA 1QGUB 1PZHA 4ZJZA 2IODA 4ZFNA 1TIKA 3NVAA 4MW7A 1UR5A 1N7GA 3KDPA 4MPRA 1XZBA 2JHFA 4KQEA 2HU5A 5LPNA 4OHPA 2ZTUA 3TX6A 1YJCA 1ZD1A 1KF0A 1KRWA 1EVQA 3OU7A 4M7WA 3KB6A 3CM0A 3L05A 4FCCA 3HJTA 4LYFA 3AL3A 4NJEA 3IQDB 1A82A 5JVDB 1UJBA 3N2IA 3OPYI 4LEIA 2CDCA 3FJYA 3OPXA 3NAZA 2A5LA 3DVAA 3L0DA 4B6JA 5KDLA 4A8JB 1MZVA 3GLUA 4C6HA 3L01A 3BSYA 8ABPA 4HNAA 2G09A 2OHXA 3HKDB 3GLHA 4WCDA 1T36B 3GLIB 1JHXA 2FVXA 2R6AA 2QD1A 1IY8A 2O1XA 5TT0A 1PJ8A 3BWMA 2PH5A 2QTLA 3OQBA 3O6VA 4IUYA 4ONEA 2DQ4A 2GKSA 4ZQHA 3ETLA 3VC3A 3FPFA 5L3QA 3U3KA 1E60A 1SZDA 1ZC3A 3UK6A 4V2IA 3GG9A 4V2UA 5F7XA 5JCPA 3OQJA 2X4LA 2WOOA 4HEHA 1NBEA 3HKCA 1WR8A 4FW9A 4JUDX 4NJMB 2BKEA 3KFLA 1I3OA 3O75A 4WESB 3QKRA 3FR8A 1RCUA 4HXEB 3K8ZA 4I9HA 1A96A 5JYEA 2NU6B 2HPZA 3KAKA 1MW8X 4CV3A 1N4AA 3ZY2A 2RCYA 2Q7XA 5J40A 3Q8LA 3LL4A 4B7ZA 4TTAA 2DPMA 4Y2VA 3OWOA 2MSNA 2X22A 3WRYC 5I47A 5KC8A 3T4PA 3PNSA 1E6UA 4UASA 2H8GA 3JVUA 3SF8A 3T54A 3TLGA 4H7EA 1U1EA 2J09A 2R6CA 1YVUA 2AXEA 4HDMA 3DLIA 1EDOA 5T4HA 1YVRA 2HJGA 4PQRA 3C1TA 5IM4A 1JEOA 4ZYWA 3LCMA 1YZYA 4ND1A 4WE3A 3QP9A 1YA6A 4NCNA 4IQFA 1XN4A 3QITA 4CR6A 5DIFA 3PGXA 1DKPA 2IYLD 3AR4A 1EMDA 2QU7A 3EZ9A 3T99A 3TL2A 1P72A 3I0NA 2P2DA 1NI3A 2VPWA 1T0IA 4A1OA 4ETWA 5AP9A 4Z8YA 1Y7PA 1E7YA 1M8KA 5CU7A 4UARA 4BC0A 1XZ8A 3T15A 5FL7A 5A06A 2C2YA 4ER6A 1E2JA 1KDTA 4TL9A 1MZPA 3TH5A 3KT0A 4EGSA 4IZOA 1DOAA 1T1RA 2BZSA 4ABYA 5BW4A 1TXGA 1WB5A 2V6FA 5DEOA 1EUCA 4LHEA 1HEIA 1KXZA 4JNKA 3W90A 1K7XB 3IAAA 4JLPA 5CX1B 2RJNA 3A7EA 1HETA 4L08A 4RPKA 3W8FA 2FDXA 1K8RA 5THQA 4PLCA 2VDRB 1RWPA 5B58T 1IJEA 1NA5A 3O1HB 4KK4A 1RHQA 3FNQA 1MB2A 2HXYA 4EGCB 3AHIA 5DLDA 1Q3TA 1SQGA 2Q41A 3O2NA 3SYMA 1IMJA 1N6NA 2QD5A 1TLTA 1VSUA 4YWJA 4DMMA 3NWJA 1B42A 1RZUA 1BC5A 1UDRA 3OKPA 1DBPA 2HFJA 2JLYA 2H2DA 1J42A 5BW5A 3FNBA 2H8KA 2ZG6A 3HK2A 4WY8A 3R74A 1R12A 4GP7A 1SO8A 3L49A 4JOBA 2C3OA 4PAOA 1DXYA 3R23A 2VDLB 4HGRA 3HR7A 3IP8A 2GK3A 2I3BA 5TPWA 3A05A 4RZXA 1SMKA 1T26A 2EFHB 3BFJA 3OOJA 4UVGA 1Z5NA 1RKUA 1O54A 5CCEA 2V97A 2PJDA 3LUGA 1YDGA 3JPWA 4S05A 2P9YA 1V35A 1L4EA 3I2GA 1FRVA 3IV7A 4M0PA 4AJPA 2Y3IA 1SCUB 1DDGA 5L3SA 1VTKA 1V43A 3PKZA 2GHQA 4EDFA 1HLPA 3WMGA 4DDMA 1MAAA 2ZSDA 4R3NA 2WJGA 4WXEA 2BFNA 1OFHA 1W581 1U90A 3G2KA 2YW9A 3NDRA 3CRQA 5AW0A 3EEOA 3JRWA 1YHZA 1Z4KA 1TF5A 3HWRA 3DF9A 1SXJA 2P6PA 4K28A 4P22A 1GGEA 4X5OA 5K9ZA 1XTKA 2DPGA 5I8PA 5EHZA 3VR6A 4EYKA 4TM8A 3CNHA 4CL8A 4XQEA 3Q2IA 4GAEA 4MV7A 1PEKE 3SSOA 3HO6A 4ENUA 4FFMA 3SP1A 5CK4A 3QBVA 5T64A 1SXPA 3KXDA 1TK9A 1GZ5A 4M60A 4AMZA 2EVWX 3BXPA 1J20A 1MW9X 1QIMA 3GWZA 2H18A 5TRTA 4EY8A 4Z6KA 5A5DA 3INNA 1XAJA 4TTSA 2A67A 5B53A 3ILSA 1GVHA 1M2GA 4KH1A 5CYPA 3T7SA 5IJ0B 1G7TA 2PS3A 2DTEA 4EPRA 4P7KA 3JD0A 3AY3A 4ZO7A 4URXR 4J4TA 4C6SA 2ACKA 4AO7A 4OGWA 4Z2AA 1LDEA 5K4HA 3JD3A 1A97A 4AUNA 5C5IA 1U0TA 1Z2PX 1KO1A 4LBYA 1TPZA 5DASA 1IJKA 2NTJA 2PS9A 3ROXA 3ZGLA 4O4JF 3ZV6A 3KKNA 2ZE8A 1JEDA 1MIHA 3RS3A 2ZOSA 2FPWA 2FPGB 3LYHA 1AUVA 4U2BA 5HS6A 2F8LA 1R0WA 2HKIA 4DPKA 2V4MA 4GKKB 1YZNA 3AUJB 5U4QA 4ZCQA 3ICVA 3AU9A 1N7HA 3MBKA 4EY5A 1RZ3A 2FAXA 3H8SA 1MJ5A 1TVKB 2C94A 2HCJB 3G7SA 2IHBA 2G40A 1SM4A 2C3YA 1G6KA 2P5UA 1ULSA 3GJTA 3UANA 1E62A 2JFFA 4P08A 5AHWA 1E1KA 2CLHB 2JBWA 4Q7JB 2ZRQA 4LFCB 1FNSA 1HYEA 2PTHA 3ZJTA 1CF4A 1SC6A 1UP7A 2J3KA 3IVMA 4NJEB 2PANA 2RI1A 4BGEA 5BWMA 2VZEA 2BCJQ 4XDGA 4W5NA 1B1AA 5D5PA 1YV9A 4ZTZB 3CPJB 3U6BA 1IQ0A 3BCSA 3V80A 3R44A 1FMLA 4PY2A 2WM9B 3MS2A 4MP3A 1O95C 4F2PA 2YDYA 3RSLA 3UH1A 4JP5A 1HLFA 2BEVB 1SUFA 3RRMA 2LP4Y 4DUGD 2HMYB 5EPOA 4DC9A