2FWPA

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59n from the acidophilic bacterium acetobacter aceti, bound to isocair
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
159
structure length
159
Chain Sequence
SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSANRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Biochemical and Structural Studies of N(5)-Carboxyaminoimidazole Ribonucleotide Mutase from the Acidophilic Bacterium Acetobacter aceti.
pubmed doi rcsb
source organism Acetobacter aceti
molecule tags Lyase
total genus 50
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2fwpA00
5BOSA 4YCJA 3RGGA 2FWAA 4YCDA 4B4KA 1O4VA 5BOSB 3OPQA 4YCCA 5CLIA 4YCBA 5CLFA 2FWIA 1U11A 3ORSA 2NSJA 3LP6A 5CVTA 2FW7A 4ZMBA 3KUUA 2FW1A 3TRHA 3RG8A 5CLGA 2FWBA 4Z7JA 4ZC8A 2FWJA 4GRDA 5CLHA 4AY3A 2FW8A 4AY4A 2FW9A 5CTJA 2NSLA 4ZK2A 2ATEA 2FW6A 4ZJYA 5CLJA 4JA0A 5BORA 2FWPA 2NSHA 3OOWA 1XMPA 2YWXA 2H31A 1QCZA 1D7AA 5C5DA
chains in the Genus database with same CATH superfamily
5D7BA 3PD1A 2P0YA 3AIIA 4I9HA 1ADFA 1WDTA 2DH5A 3K4QA 3GFFA 4M1MA 4R8RA 3HDTA 1MB3A 3O92A 3JXEA 4MQEB 3CUYA 1UXGA 2WLSA 4P2BA 1YI0A 2VSNA 1XRRA 3H1AA 1AQ6A 3QPCA 2G8LA 4JLNA 4Q4JB 5DMHA 3R9XA 1C4KA 1DB3A 4W8OA 1KH1A 5A62A 3TLGA 4NH4A 1SBYA 4NK5A 2X8BA 3IKTA 3KUCA 2QL5A 1FXUA 1RWWA 4R2MA 4TWBA 1NVKA 2A7QA 1MP0A 4I81A 4U2EA 4R7TA 4PZUA 1JHZA 1MH9A 4B33A 2N42A 5ECGC 1SQGA 2CL5A 3O95A 5F35A 4NENB 3KWLA 3QY0A 4MVJH 1UBOS 3NWBA 5FOTA 3ZLJA 2X0JA 3E2IA 1R50A 4EG6A 3ROQA 4HYQA 4RZUA 3ZDYB 5BN4A 3VC1A 3U40A 2PA0A 2ZBFA 2O8VA 2I62A 1ULBA 2HK9A 3U9LA 2YR0A 3EYWA 4I2NA 4AJEA 1QDEA 1YCGA 3QLUA 3U3KA 5HFAA 1ZGHA 7ABPA 1V1RA 3EIQA 3MELA 4AP6A 1MORA 2Q50A 1SXJD 2XB6A 1EP9A 4M49A 2PLFA 1WV0A 3L0OA 1WMAA 2PN1A 3O4VA 4QBFA 3HACA 5CG1A 4PWYA 4ZYZA 2HBRA 3R5JA 4N0MA 3PHHA 2OLKA 4TSFA 4CXMA 2KW5A 2A58A 2HCJB 5BNFA 2FOIA 1NR1A 1ULSA 3QFSA 5DMXA 2ADOA 1G21B 2VDWB 4QDTA 4OX9B 4RADA 2P6NA 2GN1A 3EFOA 2DJ5A 2GAFA 3IPYA 4TWIA 4B3IA 4BRSA 2J5XA 4DV2B 3BQMB 1PJLA 2VWHA 3HZZA 2NMVA 2PUEA 4ON9A 1PDVA 1RR6A 4R0VA 3KJIA 5AI4A 3TLBA 2IPNA 1MO4A 2JIZA 4JJEA 4P38A 4ZAVA 3AEXA 1DWQA 3UT6A 2WWIA 1G8JA 1U0FA 2ACKA 2FEPA 3BFVA 4Q24A 2DUUA 1A5BB 5HJ2A 5IN5A 3WYCA 4B6SA 3THXB 2UYOA 3RC3A 5KKNB 2ZAMA 4L5CA 4DGQA 1R5JA 3ABZA 3HLKA 2XYRA 3R6DA 2CHFA 1VHDA 1T0IA 1PX0A 1EEHA 1GIAA 6LDHA 3MVEA 1E1QD 1SHJA 2OP1A 2OTCA 3BSFA 3DDUA 5EXDA 5EQTA 1ZC4A 4ZWNA 1O6BA 3MRSA 3WIDA 4UULA 3OMLA 4M0FA 3L9XA 2I6SA 5JSZB 4EPTA 3A4NA 3BWVA 1XP8A 3Q7QA 4ZICA 4RO0A 3STTA 1QZZA 4HDKA 4JXZA 1X7XB 2HFJA 1JQEA 1MQ9A 1H0SA 1Q95A 1RHRA 1UP6A 2EFJA 3OMWA 1UJ6A 4NCKA 4WNCA 3VV2A 4E5VA 4BC0A 1PU2A 3AVVA 3P97A 4WZBB 2ONZA 1WE2A 1VPDA 2IIPA 3IIIA 4LTNA 4NJEA 2AMFA 1IN1A 4HAYA 4U7FA 1M6EX 2X0EA 3G79A 1G5RA 3T5PA 4FSHA 4A1FA 3X2SA 2O7QA 4CE6A 1VJ0A 5AIBA 2F1KA 2FN3A 4TTPA 1WUYA 2HSWA 3G0DA 3DCJA 3WO1A 5IBCA 1YR8A 5C7OO 2H0RA 1JS1X 3LRPA 3PFKA 2DJIA 1QFJA 1P1IA 1RKXA 3PDHA 4EL0A 4JYZA 1S2OA 3EVTA 1T3ZA 3QI7A 3VPDA 2C4KA 2ID4A 4O2AF 1AKUA 2Y27A 2N9UA 4Z4EA 3DBVO 1MD9A 3ZUGA 3ETEA 5CT9A 3TL2A 4QUEA 3HB5X 1XTKA 2D3WA 4G85A 2HPZA 3GDHA 1U7TA 1YBAA 3KR2A 4FCVA 4H7JA 1OAAA 1FP6A 1ZYUA 2D1TA 1IY0A 1AKEA 3WLOA 3RD5A 1TLFA 4PU0A 4BO1A 4YV2A 5IZCC 1R00A 4JI2B 4L4ZA 1DRJA 1VCNA 5EPEA 1WBDA 3KQYA 1J0BA 3KAJA 4G5GA 1DKQA 3EOZA 2SHKA 4KXQA 3S7TA 1VFPA 3CEMA 5FI1B 3KK0A 3DKPA 4W99A 5FOVA 2V59A 4G0NA 3GT4A 4TS3A 1JLLB 5FEUA 1MH1A 3JQQA 4EB3A 1DIGA 2XQIA 2KBFA 3PBKA 3BICA 4NEGA 5H7XA 3RIHA 3E6AA 2AOTA 5JFGA 5G0VA 4RYDA 5L7TA 2J0VA 2X5OA 3RLFA 2IHUA 4LZNA 3W04A 1CQJA 1NVTA 6CHYA 4EIWA 2VWQA 3DONA 4WEOA 1VJRA 2ALJA 2XTMA 3TIIA 1G9XA 4L07A 3WYNA 1Y4ZA 3DXFA 3D6UA 1Z3IX 3LU1A 1NX6A 2YQ4A 2HM7A 3D3WA 1LRLA 3H99A 4XTRA 1DPGA 1O5IA 4GICA 1K8XB 1QFYA 5L3QB 4QRDA 4GGPA 3CGWA 1G2QA 2VYQA 4EGJA 3I2FA 4A6EA 5DN9A 1ZCAA 4LJ9A 3ML1A 4MKZA 4M0CA 4EFLA 1PS9A 1J8VA 3EDMA 2N1BA 3V55A 2POQX 4QFDA 4G4JA 3AYXB 2I3DA 4C0WA 2GXSA 1WHSA 4L9SA 3DVRX 4TXJA 4IRXA 2C0PA 1EB9A 2H1SA 2XKAA 5IT5A 1PZHA 2A0XA 2GM5A 1B43A 5IJ0A 1BC5A 3ERCA 2XEDA 4KYTA 1YDWA 1KXJA 3MCUA 1GG8A 5MHTA 3IP5A 3L5KA 2FXVA 1N7JA 1R4AA 3BZBA 4NE7A 4OQ4A 5H5JA 1XCGB 4C30A 4A6DA 4F97A 3NQ41 4L57A 1RE1A 3IAEA 3NGMA 3UKOA 4DBZA 2XD4A 3QITA 4JJFA 4NBKA 4FWBA 2WJVA 5IRCD 4ZT6A 3PD7A 3RRJA 5I4CA 1KYQA 4IDQA 4HBGA 2M6KA 2FSIA 3W8RA 5EJ6A 1PV4A 8ABPA 4Y1RB 1FDIA 4B84A 1JHAA 2EX1A 3M6LA 2VHUA 5LKRA 3DOHA 1PK7A 3USCS 2IKSA 5JECA 1PG5A 1UIRA 2H31A 4DA7A 3F96A 1LUAA 3H5TA 4QBHA 4EJFA 3GJ5A 1IZ0A 3DMRA 4KSCA 3TDMA 2YZKA 5JS7A 3HEAA 5F5NA 1KMHA 2JLBA 2XWQA 5EVCA 4BAZA 1OLXA 5AW7A 4UM8B 5BR7A 3Q8LA 3ZIAD 1JFVA 2JHFA 4H3VA 1TEHA 2IDZA 2GD0A 3HCNA 3C16C 4KFRA 3GGJA 4P3PA 2PT6A 3EC2A 1A7AA 1SZJG 4CRWB 2Z8YA 4GR9A 1DUSA 4ZXPA 2C88A 2WFLA 2RI6A 1YJ5A 5BOVA 3PI7A 5EAIA 2XAAA 3BL6A 3S3TA 3MRTA 2WTAA 3HXPA 5D8DA 4YRMA 4EBFA 4FFOA 2X5JO 4LBWA 3W8EA 2R6FA 5JJIA 5KDLA 1ZRSA 2IKQA 3QVSA 3W4JA 3GJQA 2ZAOA 4J03A 4OGFA 3DLIA 1RQ7A 2CFSA 3EHEA 4R2LA 3R7AA 4Y0AA 3SS8A 3HKBB 2XITA 3O21A 4NWIA 4W9NC 2WWRA 5JAZA 5BOSB 3HLTA 5CX1A 5FBZA 4EM6A 3WQQA 2E4AA 1P2GA 1ZL2A 4LY9A 4UU7A 1IBCA 3DFZA 4QKQA 2R11A 2VF7A 4UTVA 2PS0A 1PFQA 3MPOA 1U02A 4ETNA 4HDNB 3UG6A 5KQSA 2YUIA 1WPGA 3REFA 2OHFA 1VDZA 1C1DB 1PNRA 1QQAA 2A0UA 1GTSA 3MLEA 4NNOA 4RSGA 4WOPA 3RRXA 3B6IA 1QP8A 1X0VA 1XROA 4B79A 1EVQA 5H82A 4WADA 1VL6A 2DT5A 4PX9A 5BUCA 1PFGA 3HO8A 3KSZO 3ZOKA 4RKRA 5CFLA 1NRJB 2HXSA 1Q0LA 3KD2A 4EFKA 4JYMA 1R74A 3C1AA 4HN2A 1TZ2A 3GT3A 3AKDA 4ACAA 2AIRA 3OIYA 4MUYA 2Z2KA 3JQBA 5EXEA 2F1RA 2BDEA 3T7IA 1F7UA 2IS4A 3C15C 2UDPA 2NXEA 4CQMD 1NL3A 1T35A 4OGLA 4R1TA 3CLRD 4DY6A 3CF6R 1GA4A 3KQKA 4PYNA 1A5ZA 1Z6GA 2GCEA 3KJQA 3KKZA 5GVRA 2F59A 1HFWA 1LSJA 3RVMA 3L9WA 1ULZA 3STYA 3PQ8A 2GN4A 4BCCA 2E9SA 3ZR4B 2L19A 2UZ1B 1RKBA 4J76A 1OPRA 2PVPA 3GD7A 1MC8A 3UAWA 4QPJC 5CM9C 3KB8A 3LYHA 2HHJA 3WWOA 1ZH6A 3CINA 3IAS1 4ZOQI 4C0KA 2VUSA 1N7GA 3G2OA 3L1VA 2Y76A 2B30A 4ZOAA 5DBGA 1JEQB 4KMMA 3VYWA 3BZUA 5CA1A 2R6GA 4OI0A 3P0IA 3OJCA 3EBLA 2RC5A 1EJ6A 4MZDA 5KVSA 3RRBA 2H00A 5ECYA 4RVNA 4D9GA 4A6XA 1RXSA 1QE0A 1JG3A 1GGKA 2BM1A 2ILVA 3N6VA 1A0OA 3NALA 5ENDA 5LMNB 3NXSA 3ETNA 3O8BA 4GZ6A 4I55A 2CVZA 2YW2A 4XGRA 1R9GA 4A2CA 5H70A 4LWOA 4PRLA 3ZDDA 3V3KA 3D4PA 1KTVA 3I0ZA 3GLHB 3AUFA 2JCXA 3C6KA 5ESDA 5C0OE 1CUXA 1A72A 3QI2A 1K7FB 2EZ4A 2EZ8A 2XMGA 1C1YA 1ATZA 3E22B 3V1UA 5AJYA 4CCYB 1YRQA 2R8OA 4QPZA 4DPMA 4R01A 1A7JA 3GQBB 3VU1A 1JHXA 2PPLA 4PC3A 5G1OA 1P1BA 5TRTA 3ZGNA 4BB5A 5PNTA 3EPLA 1W0JD 5KHAA 3HFGA 5LOVA 4ZMRA 1QK4A 2PQMA 4BTLA 3MJDA 3OZ7A 4X66B 1FYVA 4N7JA 4IVPA 3HBJA 1ZUWA 5SZHB 4DE5A 1YZLA 1XCBA 3H8WA 1ND5A 2JFXA 1T1EA 3K5PA 3MOIA 1EWQA 5JOQA 2HIMA 1UBTS 4ND3A 2VAPA 3EZ2A 3VOBA 3C4JA 3JQ8A 4HRVA 3OLVA 4Y6QA 1NBHA 1UFVA 1RRMA 1W6RA 3L4SO 3ITNA 3MB8A 2F2TA 4CKZA 1I9GA 3R0JA 4X62B 4OLHA 3L7MA 4RH1A 3MT7A 5FNVB 2BSAA 5A3RA 2ZBPA 1RP7A 1IWPB 4GXNA 1ZK1A 1XKQA 2IYOA 1K3TA 2V0GA 1E2DA 1RABA 1W88B 1UBGA 1AKVA 5M34A 3AJAA 2R8XA 4WKPA 1P73A 5K8UA 1V4NA 4EKDA 2COEA 4O4LA 1M0TA 3NWOA 3OUTA 1GEEA 1CUUA 2YHIB 3G1UA 3UOAB 4BIMA 1U3VA 4H1TA 4H1VA 5G1PA 3WIOA 1E7QA 1YZHA 4MPJA 4P7JA 1WUIS 1R4ZA 2R6DA 4U7TB 1AGYA 4ZC8A 5T41A 5AW6A 1DCMA 3CW8X 1IBSA 1G0NA 1U2DC 3AL3A 5TS3A 1AA9A 3E3MA 2Y1CA 2QRMA 3BORA 5EG5A 4BTEA 2IEGA 3QFFA 4GX1A 2C3MA 2CXSA 2ZYGA 1PWXA 4DDKA 2XODA 1PKEA 2X0IA 3OOHA 4I1SA 1M2EA 4TM8A 5AHRA 5A1JA 3NVKI 4C7OB 2EBUA 4ZOEA 5AVOA 3A9WA 3EAFA 4D1YA 4QUAA 4FJ1A 1UCFA 4RAOA 1ORIA 4IO0A 3W3ZB 5BN4B 2OMKA 2XYHA 3IAM6 5A0FA 3PF8A 3WDKA 3S8MA 2IGTA 3WFJA 5K3DA 3TTWA 4OUDA 4RCVA 3L4KA 3PFNA 3G5UA 1V1RB 3U4HA 4M38A 4MQMA 3WHIA 3KOYA 2HDHA 1K6EA 1L6RA 2J3HA 5CCDA 1CZUA 1FFBA 1V35A 4ZQBA 4WL0A 5JS6A 1WXHA 1YRLA 3PFCA 4OQEA 5DN6D 3D6FA 4Q47A 4WGGA 2HJ9A 5E7QA 1NYLA 4HK4A 3ZQJA 4EMSA 3QWIA 3EFOB 4O5OA 1OV6A 1LTKA 1QP0A 4ZDWA 2W37A 2JD2A 3CMMA 1TKRA 5CVCA 1GKIA 3TQOA 1L7NA 1GZ4A 1SXJE 4JJZA 1T8RA 5K0BA 5KTSA 3H2KA 4EG4A 3A36A 3DGFC 1KEWA 3T1NA 1CCWA 1OYWA 1E4OA 3F67A 3QYJA 3NHFA 3O3MB 4ZP1A 1QHIA 1ZGGA 2IPLA 3AHHA 2R48A 2YBDA 3C7TA 4QELA 5K51A 3NNNA 4JI6B 2ECPA 3TLAA 5JYCA 5C5CA 4A6PA 1FEZA 4TXMA 1HBJA 4MAFA 3IUBA 1CWUA 2GPSA 3H16A 4JUAA 4MX8A 3RK1A 3H0EA 4CUZA 1WXFA 1IMOA 1WX1A 1CY2A 1P9OA 4II7A 4D8YA 4R6WA 3GP8A 2VZ0A 3EZYA 5J23A 5KU7A 1TF2A 5ALYA 4REOA 2O3JA 2WF8A 3JD3A 2GJ4A 1XCPA 1VSTA 2CLEB 4JWTA 3IR5A 5CLLA 4HDKB 4BNMA 2W90A 4YACA 1PJ4A 1IVNA 1X7ZA 2PTGA 1LK5A 2ZWMA 1MW8X 3B8HA 3HC7A 3Q0EA 4BKPA 3BSYA 3KLNA 4O4JF 1SB8A 3VI4B 2B21A 2I1LA 4L51A 2PUCA 4EUEA 5J2TA 4WEQA 5ES4B 3PNLA 2J0QA 1RXVA 3SX0A 5KC9A 4XIYA 5LBIA 3W5SA 1MO5A 2O07A 4RL4A 1YZQA 3U09A 2OV1A 2HPHA 4BU0A 1B15A 2F1JA 2XMRA 3DCYA 1L5HA 5FFFA 4MJXA 4YPOA 1XTVA 3CX4A 4LDAA 3ETGA 4Z9FA 4KDCA 1NRXA 5KTKA 2AV6A 5B3JC 1G20E 1XKXA 3OHSX 4CU5A 4NONA 2FPSA 5GV7A 2Q5JA 3IUYA 2ODNA 1ADYA 1BFUA 3EG9A 5LQMA 4N41A 1K4YA 3ANYB 4EUHA 4QYXA 2CXRA 1TL7C 2WUWE 4BVFA 4QNMA 1W96A 3MGCA 4OEHA 4RPIA 4EKIA 1N8TA 1T9BA 4R8KA 1GZDA 2NYAA 1XAHA 5CLHA 3B5IA 3DNPA 2Y4NA 1FDTA 1K9SA 3EDOA 1D6NA 3UCFA 2PWAA 3ACBA 3HNPA 4G8DA 1M8PA 1F17A 1WBJB 2B36A 3CUTA 4YC7A 3O4RA 1AF4A 1VFNA 3W5DA 1U8FO 1RYHA 1C7FA 1KKLA 2IUSA 2WU8A 3O2SB 3VH1A 3EVEA 4YI3A 1H0KA 4GP6A 5JQGA 4S1WA 4C89A 5DNVA 2O7RA 2GHRA 1QVAA 4EAQA 3X43A 4WXYB 4I1IA 3L6BA 4Y2PA 4QT4A 1TU3A 1HT0A 1ESCA 2FR8A 2AOTB 2C9OA 1E9FA 5D6NA 2JRLA 1CQJB 3PWKA 5IAKA 2JFGA 2O06A 3L8MA 3K94A 5SYNA 4EMTA 1E6LA 2RHMA 4ID3A 3FVTA 2OCGA 2PUHA 4LSWA 3D3WB 2H29A 4KVGA 4BX8A 3F8TA 1E3LA 4HFMA 4TWZA 3WMWA 2BTQA 3SICE 4XWKA 5HDBB 1LS6A 5JS2A 4F1JA 2NNWB 3PYXA 4IR7A 4GYWA 3K2QA 3DOEA 1IN7A 3EGVA 4M1KA 5CXXA 3OA2A 2OZKA 3TLEA 1LC0A 1LKZA 3ZX4A 5JBQA 3GPLA 2FK8A 3TDKA 4K40A 3QXGA 1JJFA 4QWMA 4BFZA 1QVVA 4KDEA 4C0AC 1K86A 1VQ1A 3FWNA 3IJRA 3FUUA 3FOEC 1WF3A 1BHSA 4YBRA 4F1WA 3REGA 2P1DA 2ECKA 3DZJA 1R1DA 1VMDA 1KOJA 2PBFA 5K3EA 3DR5A 4PYIA 4C0QC 4Y9RA 2DBYA 1H5UA 4EB6A 1QB7A 3RNLA 1F20A 3G2JA 1GLVA 5EEGA 1ZSVA 2HJWA 3KXPA 5BQ3A 4CM3A 2GZDA 2AW3A 4QLBA 1Z8HA 1KVSA 2IZ1A 1JLMA 3OEHD 4JT9A 2CL6X 1Z7YA 1LDMA 2PL5A 4QX6A 1GRQA 2Q2VA 3KPUA 1W0KA 4JR2A 4KPYA 3OIGA 3CKMA 3QVXA 4OH7A 4BFVA 2A57A 3NU1A 4XUGB 1X1QA 1Z4MA 1O57A 3OZVA 4GBJA 2E87A 1VLVA 1L5MA 3MLAA 2I4TA 4IQ4A 1X2BA 2QGFA 2BBSA 1QIFA 1ZFNA 3OTOB 4D57A 1U90A 1DWUA 1V48A 3DWIA 4RMGA 1WXQA 2AG0A 2H1CA 2P2SA 3T4PA 4ZMBA 4BB0A 2P9YA 5LQKA 1OVMA 3ZY5A 5F1KA 2AQHA 2CLKB 4RFLA 2JK0A 5F7OA 1JMYA 3Q85A 2IHJA 1L9XA 3JQGA 2O20A 4OREX 1DPFA 1DXQA 1GARA 2XR1A 1K9VF 3HYCA 1F2UB 3A7DA 3RR2A 2XECA 3I5MA 4XB2A 4GLLA 2C8VA 2NO1A 4B9AA 1O6CA 1XMVA 3GBSA 3NWJA 1TIKA 4GL4A 4H6XA 3DM5A 4DGSA 4E5SA 5BNWA 3X1MA 2CXHA 4QRIA 2AXPA 4HNRA 4PYKA 4G63A 2W6NA 4ZT2A 2VH2A 2D8MA 3G5LA 2O7VA 3BK1A 4QTTB 2WWVD 3RC7A 3SC2A 2BFEA 1I6WA 3WK7A 3GEGA 5EJFA 1DBIA 3GUZA 1K27A 1LPPA 1OUMA 2D4HA 2FWIA 2JGKA 2WKPA 1TUGA 4J7UA 5SYMA 4EOGA 4XR4A 3O1LA 4O0MA 2QG4A 5JTUA 3HA7A 2O19A 1G63A 4QEDA 5I9SA 3CRRA 5CX1B 3ZZ0A 2ILTA 1DFGA 1XZNA 2HLDA 3EDQA 3KZ1E 1JAIA 1RLTA 2PSFA 2VWPA 1TYDE 3N2EA 3KKOA 3OOSA 3CNOA 3WLSA 3THWA 3UG7A 1YDHA 1H2XA 3NBQA 2E48A 3LQKA 3MSCA 4BJ5A 4ED9A 4DLBA 3V1LA 4TV9F 4PQRA 3T0FA 1NU6A 3EXEA 3MEQA 1QLWA 2GBFA 4GUDA 1WEKA 1PVDA 4JBYA 3QQ5A 5TMEA 3SF8A 3ECSA 2EX0A 2G7MC 2Q4RA 2W83A 1YRBA 3FDZA 2WU1A 4MS3B 1DIOB 4OOEA 1R6XA 1CNEA 3FWZA 2MSNA 1D1SA 1YVDA 2J67A 2GHQA 4DBLC 3HKDA 4LVNA 3E9MA 3H6HA 4OBWA 3I5YA 1H69A 1BCSB 4LC0A 2WQZA 3NIGB 1LBIA 1C1XB 3WZ2A 1CV2A 3PUZA 3PNOA 4R54A 2OBFA 1EK1A 2XWBF 3JSXA 3PIDA 3F7TA 4PSVA 3ND7A 2QN9A 5I9MA 1V4BA 4HFNA 1UKVY 4LN1A 3TUJC 4F72A 4UREA 3U2QA 2HR1A 1E2JA 4Q21A 5B1DA 3A2MA 3W2TA 5KYWA 1KI7A 2DQSA 3WGKA 2XXAA 2KLBA 3GT7A 1XPJA 2IX9A 2ZE5A 1T6YA 3QQPA 1ZBQA 2PCLA 4NR0A 2DXIA 1F2DA 1W4CA 3R23A 3LZCA 3S6JA 3M6VA 5DIZA 4A2WA 2NAFA 3U7JA 1O6GA 4GM4A 4QDXA 4R8MA 4FMCB 5CCXA 1T1JA 3A6ZA 1Z5VA 3UM9A 4M8IA 4M89A 1XFAA 3M33A 1II9A 1K4KA 3V7NA 1TFRA 5EKDA 5EPUA 4PG8A 3UT5A 2R7AA 4AP9A 2GZAA 2H9IA 2M6RA 1U9IC 1XX6A 4QLOA 3B5JA 1F14A 4EI9A 5LLTA 4AXXA 4UOQA 1PWZA 3A0RB 2IYQA 3EZ7A 5JRJA 1L7BA 4MS1A 3UK0A 4DJDC 3WIVA 2VPXA 5DYYA 3ZLTA 3O9MA 2QVYX 4BAUA 3FDXA 5B1YA 2QBYA 4WT7A 2Y1EA 4I55B 2H1RA 2UUPA 4I1PA 1ODIA 2YFYA 4JR0A 2B98A 5FB3A 4IS3A 3SR3A 4Q9LA 1TQ6A 2QRUA 1XEXB 1LI5A 1EDZA 1WR8A 2XZOA 3NHZA 4IZ6A 1FXWF 1QVZA 1JR3A 1JJIA 1M7HA 1QAOA 2HF8A 3R0ZA 4R3NA 1NAIA 3LYAA 3UHJA 3KVVA 3V6MA 3VQTA 3UB3A 3I4FA 3UWKA 3NATA 4Y6LA 3VUFA 2YWDA 1XMXA 2YY5A 5AKXA 4YMLA 1E79A 3QVGA 4RPKA 3E1SA 2Q4EA 4URZR 2XT6A 5LOVB 3JWJA 4GECA 4HSGA 2ZUUA 1YBMA 2QLTA 2QJWA 1V8DA 1FDVA 1Y4DE 1Y34E 3O8DA 3E9DA 3WGZA 1BD4A 2HQOA 4F3RA 4OMDA 2AF3C 4MI3A 1CUBA 3ZN2A 5K05A 1KJ9A 2XE6A 1TQ2A 2A78A 2P68A 3JQ8B 5AO9A 4DCOA 5JISA 3NEPX 9MHTA 1T5HX 1XNJA 5M29A 4PZ9A 1XWIA 5FJJA 3W3AH 3JY6A 1JXOA 4UUQA 2VN8A 5CT8A 3D81A 3KRTA 2X19A 3V1TC 5C46F 2J5BA 1DJMA 5JD4A 1WETA 5I7VA 4JA2A 3U9SA 1GPAA 1JSCA 1T5TA 1SQSA 3RJTA 1H6DA 9GPBA 2QG6A 5FPSA 2V3WA 1A2KC 2G0NA 4LY6A 2AF4C 4UNPA 3ZHBA 3A9RA 1KH2A 1Z06A 1H5NA 3DM9B 3KSAC 2MMGA 3NTUA 1CR0A 1O6ZA 5B7NA 1UBMS 1QYIA 3A6KA 1M67A 5I4KA 2BZ0A 3U3XA 2C95A 1X39A 3LQFA 4ZJYA 2Q21A 4O33A 1F9AA 2KQUA 2P6PA 3KT8A 3OOWA 4IHKA 2NPFA 4B3JA 1CEXA 4EHNA 1BFKA 1XVAA 4W9RA 3JQ9C 2O3RA 3IE2A 1VJ1A 1FX0A 3VU9A 1KI2A 1NSTA 3SI7A 4ENTA 1AGNA 4HNGA 2H4ZA 2K7FA 4EPWA 4KB5A 2BBWA 2GEJA 4E09A 4BNYA 3VHRA 1TKBA 2CXQA 4LJAA 1CY0A 3UTCA 3TD9A 4TX1A 5CYGA 2TMDA 2J7PA 3ICWA 3UANA 2OYSA 2C04A 3A1WA 3VX3A 4C7KA 5GGYA 1C8BA 1CBUA 3BHIA 4CR7A 1HLFA 1ENZA 1VJCA 4PG4A 5L45A 1QQ7A 2WOJA 3ANSA 4JUCA 1XZDA 1OT5A 1V47A 4FVTA 3TYXA 1PD0A 4JXKA 3KHUA 2OLJA 2HRBA 4IF4A 2FEOA 1W49A 3EVGA 2WV9A 4RTMA 1OW3B 5TMBA 2X9VA 1GPBA 3D5EA 2OO5C 3AM1A 2PGIA 4ENRA 2PCJA 5JCJA 3HYLA 3RT1A 4GXQA 1PAUA 2HIHA 2RI0A 3DDNA 5TQJA 4WNAA 4DCVA 2Q6VA 4D41A 4HXEB 4ZEMA 3WYAA 4XYLA 2XA2A 4QM6A 2GNOA 4M22A 4E31A 1OR8A 4DJTA 4IL5A 3H3JA 1ESMA 3Q6MA 3A10A 4TT8A 1JFSA 3ROMA 1KTIA 1EGVB 4NFYA 5HM8A 2H6EA 2Z57A 2CK3A 1ISJA 2EBFX 3RE1A 2HU8A 3CUEF 5LXTA 5ED4A 1ZY2A 1QQTA 3ZGOA 2PU7A 5DSXA 3ZI0A 5JVDA 2WAMA 3FMVA 4Q4HA 3ZY2A 1P7YA 3G17A 4PPFA 3RHSA 4OGGA 2ZYHA 3D54D 1UPAA 3GPIA 5AKEA 1U1CA 1ZR4A 4YJGA 1IEXA 2SKEA 1SU7A 1FSGA 2XXJA 1W2HA 4IOJA 1DXYA 1XZFA 3IQHX 2IW3A 3KLOA 5DZSA 3T9EA 1RXEA 3VYSB 1FP4B 3G0HA 5IDYA 3QGMA 4WX2B 1JWLA 3U3RA 1W52X 3JVVA 1G6KA 1TD1A 2V0CA 2W2KA 3IV7A 3KHSA 3CR3C 2I1WA 4OHXA 3UK7A 2XIQA 1JSXA 3L6EA 4Q1AA 2V7VA 1GGMA 3SP1A 3P71T 4ZI2A 4YX9A 1SBIA 3DR3A 5CB4F 1PGOA 3JASA 4AECA 4YV0A 4Z99A 1EM6A 4PO8A 4KN5A 2IY9A 1Z6PA 3DEFA 3UUFA 3O1IC 4I5FA 1XVUA 2ZDQA 5J2TB 1P17A 1E6WA 3K53A 1KBZA 4Q3CA 3TI7A 2HTEA 3T4UA 4RTPA 4B4VA 4KR2A 1QGYA 2Q6LA 3ES9A 4J2OA 4URVR 1HMPA 3ID6C 4K1LA 3WWZA 4ENQA 1G8KA 3JATB 1H5QA 2WD8A 4C2AA 1DC7A 5E9QA 3WKDA 5F2NA 2VTVA 2WA1A 3UGQA 4EUNA 4ALKA 2UVPB 2ZSEA 4LDZA 5BWBA 5FRDA 2Y1DA 2JAUA 1ZM9A 3EG9B 4BMOB 2YMMA 1KNQA 4GYJA 1QVWA 4ZHQF 2PD6A 3CF4A 2PU5A 3O93A 2NQTA 4FJ0A 1HE1C 4Q9NA 5AW2A 3TJZA 2YCBA 2V7PA 4HAXA 3C39A 2HXGA 3R76A 4AMGA 4CTKA 4YRNA 5AVTA 3NRBA 2ZZMA 2D5AA 4AULA 5HX7A 2HADA 3BKXA 5IUNC 3A3PA 4W5QA 1J1UA 1YO6A 4EYGA 4KNYA 4UMEA 1L8QA 2WRZA 1UWCA 4G8JA 5ALQA 3LXMA 1S7CA 2MSDB 3GVXA 3ER6A 4R1MA 2ZQZA 3BA6A 4KMOA 1TYEB 1U31A 3DKKA 4OMCA 4PS1A 3U19A 1K7SN 1FVXA 2EW1A 3E8XA 1FRNA 2QE7A 3G13A 1E3IA 1UPFA 3NDIA 3FPGA 4HXGA 4QJ5A 3GJ0A 3T7KA 2CBXA 1ZVQA 1N25A 3AB8A 1V9SA 4DV5B 3QEKA 1T9DA 4MVXA 4OK5A 2Z6AA 3JWPA 4J4HA 3WLHA 1N3IA 2XOEA 1S2GA 3B8EA 3ABOB 5BUSA 4LOKA 5AOAA 3N58A 1OXBB 2R60A 4MUHA 4FYMA 3UVEA 1N7HA 4Y2VA 1GTZA 4O4HA 1GAQA 2IP2A 4IAOA 3WKCA 4B47A 4C5AA 1Y8ZA 4WWHA 2ZIEA 1VE5A 4QXAA 4UHBA 4ZA2A 1NJ6A 2LR0A 3HJFA 2PT7A 4OJKA 3WJ1A 3EOBI 3HCCA 2PL9A 4ZARA 3ZXYA 2B1QA 1B3RA 3W3AD 4ZZ0A 1GVHA 1I1OA 2BTQB 5KEIA 2C96A 1T8UA 5IASA 3SDSA 5EZYA 1UBFA 1W85A 4I2VA 5H1YA 3EUEA 3Q98A 4CT4B 2ZJZA 2WMYA 3FTDA 3BBLA 3EFEA 4FMDF 1INLA 1FX1A 1JPUA 3PVZA 4N47A 3UFXA 5JCXA 3MJCA 3DCNA 2MYTA 3AHIA 2AJLI 1ISIA 2RKWA 3SEQA 2VJOA 3FJOA 4QG7A 2VA8A 4EDHA 1C50A 2Y1WA 4NYJR 3PPVA 2JGDA 3LQRA 2WHRA 3ZGXA 4EYEA 3A1TA 3SZGA 4UNRA 1A8PA 2FEAA 2ZI3A 4W1RA 2BSXA 2FW8A 1DE0A 4MI6A 2PXCA 5EVJA 5FCDA 4XUCA 4HNVA 3DMTC 4RNDB 5ALDA 2J31A 5E4YA 3VH2A 4BX3A 1MZVA 1N9GB 3W34A 3RCBA 1XLTC 2QLNA 3OTGA 2B6HA 1JXAA 1XQXA 1YTLA 1SCAA 3FCYA 2I8AA 4NDNE 4Z6KA 4MDEA 1Z6TA 2WIDA 5L6LB 1SN7A 2JB9A 4NV3A 1BMFA 4XJTA 4DIBA 1MTOA 5I4IA 3VR6A 1FU7A 4GWGA 4O4IA 1UK8A 5DNWA 3FBWA 4M8KA 3QE9Y 3D3EA 2OD2A 4G0ZA 2RJOA 4MGHA 4RANA 3F4KA 4AWBA 1Y1KE 1CEYA 1EBUA 2J7KA 3I2YX 1ISFA 2BFCB 1UP4A 5IAOA 3WAGA 3SIPA 2W2MA 2K87A 3DO8A 5JWOA 1MCZA 1BH6A 4MMYB 4HYYA 1A2BA 1WLSA 3K20A 4G8CA 1FCJA 4PX2A 3JQGB 2BHSA 5AD1A 3LCRA 5BNZA 4B75A 2E37A 5IAJA 3UA3A 2PHZA 4H6VA 3ZWCA 5B30A 1RXIA 3IP9A 4U2FA 2IZ6A 4GRAA 2Z04A 3K0EA 4YCJA 3PXCX 2A9PA 5EIFA 3UGTA 4ZVNA 2HBQA 4FTWA 2LPMA 3ZUPA 1TAGA 2EYUA 2DWUA 4F6CA 2YKGA 2D2EA 4L50A 2IHTA 4PZ0A 5A9TA 4UBKA 4LE2A 1GU1A 1XALA 1U6JA 4J6FA 4PQGA 2WKWA 1A7UA 1V9CA 1PK8A 5KWEA 1TNDA 2VDNB 3PPXA 2V65A 5BYJA 1X42A 2R00C 3A9CA 3ZNPA 5C1PA 5JH7F 2QVXX 4JOCA 1AUVA 3URMA 1MV5A 4UASA 3BFKA 5CITA 5I9LA 5F7XA 1Z7GA 3RV3A 2ZIWB 1UUFA 1I3OA 4AZWA 3I37X 2VNHA 2L17A 2WYWA 1RSZA 1DQPA 2VC2B 4KACA 3V33A 5BORA 4O1MA 1J39A 1NUTA 3C1OA 1GILA 5DX8A 5CEFA 3OWOA 2XYPA 4KYVA 4URHA 1FUUA 5BQOA 2I34A 4ZU6X 5KYYB 5DM4A 1B6TA 2I6UA 3EXEB 5C1IA 1ABFA 5D85A 1VBKA 1Z33A 3PRHA 4D9NA 1FS4A 1Y4AE 2PL3A 3MERA 3GPCA 4DCUA 1E2FA 1FYFA 1RI5A 1ZX1A 1CUVA 3BMCA 3SS7X 3L18A 2BH9A 3HKDB 4HUTA 5LP6A 1B2RA 1PZNA 1V6SA 3F0TA 5BSTA 3I6BA 3GCWA 1WOYA 3QPWA 2GBIA 4EUFA 4WCFA 4D98A 1GUDA 4EB8A 2W6ID 1Z83A 4DA9A 3EA0A 4ARAA 4C0SA 4DMRA 2CJXA 4WCDA 1ZEJA 4M1YA 1SBQA 2EHDA 3KQSA 4IFBA 3AKCA 3EJWA 3LM8A 2P4SA 4JLWA 5K0SA 1JG1A 1UDAA 2Z2XA 3C74A 2XXAB 4YMUA 5IAGA 2H8KA 4FE7A 2OE2A 4XASA 3CTPA 3D0RA 3ZK8A 1Q1ZA 3B3QA 4BP8A 4KX3A 4P4TA 5E3JA 2Q4DA 4I19A 3L6CA 3F4LA 3V1KA 4J1QA 4BNFA 5IH7A 5BN1A 4Z7QB 5D1HA 2YV2A 3H65A 5DP2A 3EUAA 5EMKA 5B2ZA 3P9PA 2C7RA 5C8YF 1E6UA 1EJBA 4B6RA 4B6QA 1HV8A 5L9AA 1Z2AA 3MGAA 3SK0A 1AGRA 3T99A 2WM2A 5JAQA 2VS1A 3KQPA 4YQEA 3B6JA 4CM9D 3T3DA 1CEEA 1B8UA 3R8FA 1XDUA 1A4RA 1Z82A 2B20A 1B0ZA 1C7IA 2FN9A 2IXTA 2YXLA 3I34X 3OCVA 3ADOA 1SK9A 1UF9A 4M1WA 1M7GA 3SZLA 2CDBA 2QBYB 1VP9A 5JT1A 4V02A 4W5HA 4E5PA 4P32A 1FE8A 2VNAA 1SVNA 4P4LA 1QMPA 4E08A 5JSHA 4DLUA 2DFTA 1Z7BA 5F77A 3DFKA 2ORIA 4OXIA 1RM0A 3DHNA 4IOLA 4MYCA 1HZJA 3BA1A 1QH0A 4WZAA 3CF2A 4HZGA 1NMEA 3BDIA 3ESBA 3BJMA 1ODTC 2X0NA 1PFVA 3FB4A 1E4YA 3X0DA 4DLSA 1G20A 1SEPA 2VOJA 3TX2A 1DO8A 2EDCA 4N0PA 5JC1A 1Y1QA 5DH9A 3K0AB 3QVGB 1V0JA 5EYPA 1CB0A 2XSZA 4JX8A 3V46A 1HDZA 1ZD4A 3FWPA 5D86A 1EQUA 2GK3A 4XXHA 3RUHA 1B6GA 3LO5A 3PX2A 1K7CA 1DEHA 3DAOA 1DO2A 5BRNA 4Q9JA 5A7HA 2NUTA 1EUDA 2WF7A 4ZIRA 1QRSA 4CTJA 4FFWA 1NVVR 4EKEA 2ZIVB 3DL7A 3TXAA 1NE2A 3O83A 1SQFA 1YDGA 3FNRA 3WB1A 4BFUA 1D0IA 1Y48E 2EG5A 1LBQA 1WSBA 3ONVA 1JHPA 4DBLE 1S1MA 3H9GA 4DQUA 4MQ4A 2BR3A 2ZPUA 1HKHA 4WACA 5H02A 2G06A 2GILA 3D6NB 4X1KA 3HDQA 3CIOA 1E96A 5A4AA 2UYYA 3M1IA 4TT3A 5BVGB 1L5RA 2YFQA 4MV8A 2LTAA 4FGJA 4U8GA 2B6NA 4B6GA 4A1OA 1UBEA 5GGXA 4MGEA 1ZXBA 1H66A 1NXWA 1T5SA 3L7IA 2GDJA 3ND8A 5J5AA 5EIBD 2YIMA 2VQSA 4J7XA 3VO1A 4FB4A 4I1UA 5FYDA 2PVCA 4BNIA 1P81A 1T4DA 3H3XA 2QTVA 1M76A 1W9HA 1S7GA 4WPGA 3KHKA 1UH5A 3TNFA 4DV1B 1E0AA 1YF3A 1RQRA 2JLXA 2AN5A 3BL5A 3SXUA 4ZQGA 1Q1QA 1DEXA 4IRMA 4DLZA 4JUBA 1JSLA 4ZQEA 2A9KA 3AW8A 3S70A 1YZFA 4G5HA 2NACA 1FFXA 1N5IA 3DOFA 3UMJA 4F21A 1KRWA 1N8KA 4DRYA 3S81A 1HG0A 1C4WA 5CBPA 4C4OA 5A3JA 2HMYB 5TT0A 3TLYA 2YQZA 4RHUA 4KQCA 1CX9B 2OK8A 1JEJA 3M82A 1L3IA 2ZRFA 4OIFA 4B7ZA 1JKXA 4DLAA 4GM0A 4ZGWA 5AKGA 3TW0A 2GJAA 4R05A 4GLFA 1I01A 4YGYA 1Y6ZA 5MGNA 3COZA 3NXKA 4F60A 4QGSA 4ZMSA 4GPBA 6ABPA 2FMXA 2QX9A 3R3YA 4JH0A 4U2CA 5C18A 2G28A 5IWAB 3MS7A 4OH1A 2BFFB 2WTEA 4FMPA 3TB4A 2WIBA 3EVAA 1DC4A 2Q41A 3R74A 1VSUA 4MR8A 4UNNA 2E7ZA 3K71B 1P44A 1VKNA 4YJFA 2JFZA 4PYMA 5IAAA 3AJRA 3EODA 4Q93A 3UO8B 1KZGB 1T26A 3IJEB 4JEMA 1NR5A 1XP5A 1FDOA 5KI6A 3U6KA 3H2BA 1ZVKA 1P9RA 4C4ZA 4HH3C 3AESB 4ESEA 2EW2A 4ZT7A 1W94A 1QGOA 5E3HA 2XTNA 1WDWB 1P6QA 4GWLA 2XA9A 3CLSC 2VPPA 5IZCA 5U4XA 4HAIA 5EMJA 3IALA 3KOWA 3WXBA 4D6YA 1CRZA 3KYJB 5LXTB 2XDQA 2P1ZA 2BVNA 4FQ7A 3VPAA 3RADC 1T9ZA 2OQIA 4Q4HB 1QG6A 1OX5A 1MO2A 3DUWA 2XGJA 2OYCA 4MIKA 4CV0A 4TV8A 5BW8A 1R9NA 1CJVC 1E1KA 1MC1A 1QCDA 3UJ8A 4DSUA 5JAUA 4CBVA 4KREA 4UHCA 4F4FA 4QUJA 2BGRA 2R68A 4IJVA 4TWRA 4S12A 2DU8A 4JVSB 4MV0A 3SQNA 4XE5A 4AB1A 4NY1A 1MUUA 2CD7A 2A0WA 3AR6A 4LWZA 1EP1B 1NF2A 2W4IA 4BNTA 5HJ5A 1EFVA 3LTNC 5AVUA 4KFUA 1JFTA 3O4HA 4ZU3A 3WGVA 3FTQA 1A8UA 5AESA 1RCUA 1MKYA 5TB5A 3LP8A 5I7SA 2BV3A 1C0IA 1SC6A 3GH3A 3NIFB 4QTUB 3VTFA 2NX2A 3CE6A 1DKMA 1I4LD 1R0CA 1JDVA 2FZ4A 1YUMA 2ROQA 4YP7A 4TN1A 1OASA 5AK3A 2JLAA 1NZJA 3KC2A 2VP2A 4XW2A 4COOA 4X3OA 1N6LA 2N0SA 4GI7A 3PI6A 3BK7A 5BQXA 3PIIA 1LGYA 3ROTA 4XVUA 3E9RA 5F4BA 2H1OA 5JASA 1FSSA 4P4SA 3SJAA 1QRTA 3WOHA 5H83A 4BNZA 4A82A 1ZNXA 1F51E 1OJLA 3OIVA 4B4WA 1N2EA 1WIWA 4C7BA 2OAGA 4PHCA 2QWXA 3A4TA 5GJVC 4Y7CA 2CCKA 3RC1A 3EZGA 1Z15A 3OOEA 4IBOA 1E6MA 2GPTA 1POWA 1UDXA 3A31A 3D8NA 5EJAA 1CXZA 3PXDA 2NO7A 4B32A 3CX3A 4TWJA 2HJRA 1TVCA 3UIEA 1PJBA 4LJLA 2WJ3A 4INAA 2ZANA 1TZKA 4YGXB 2EF1A 4BJ1A 1T43A 2FMHA 2ZRQA 3P2YA 1NDQA 1AKNA 2BEWA 3FWYA 4BMCA 3DLHA 2CVFA 4JS0A 4YJ2A 4INJA 1WPRA 2NV6A 4LJSA 1TM3E 1YJAA 3U37A 2I4MA 3EEIA 1NE7A 3KL4A 1JR2A 3UKDA 2R87A 1PDWA 2V6MA 2JJ1A 3I2JA 1KI6A 5JV5A 3BGVA 5JATA 1U8UA 4B34A 1QF7A 1AGPA 3GJ3A 3ZE6A 1KDVA 4FYKA 3SLRA 1YQDA 4FOPA 2CMHA 4KAXA 5CM2Z 3E5HA 5AUQA 3AP2A 4CQMA 3CVUA 2FWBA 3VOTA 2JVJA 1YB4A 3LBIA 3OQIA 3UV7A 3QV1A 5KDDA 2RI1A 1GUAA 2RKOA 2FLKA 3Q3JB 4HS9A 2ZBUA 4KIWA 4DSOA 4FN5A 2RHGB 4XYBA 3LPDA 4F4IA 4ZYXA 5AUNB 5FTJA 4E4YA 2YBEA 5F12A 1UQUA 2I7XA 1Y80A 2ZI6A 1H2EA 2FPOA 2Z5FA 2VYND 5C34B 4D8TA 4O4HB 1P2UA 2G63A 2PKXA 4KXWA 3A4VA 2ZUSA 3ZGYA 3C3CA 2ZRNA 1RW4A 3GRPA 1B3BA 1F9EA 1I5RA 1V2GA 3OAAA 4KAFA 5IK2A 5KYUB 1ZD3A 4FQ8A 1U3CA 2V6IA 3QELA 3WDSA 5EE1A 4AJOA 4WOCA 2PLAA 1N78A 4RPCA 1QFZA 3IVGA 3RAGA 1SB9A 1JXQA 3IMFA 4RE5A 4XDHA 3C5WP 1XHEA 3VPSA 4E11A 1IEQA 1M2VA 1JXMA 1VG9B 3UFXB 3G1WA 1A76A 2B2XA 1KO8A 2F9MA 1NFRA 2GB4A 2VPZA 3AB7A 3Q2KA 4M9QA 2RGXA 2VCEA 3D3KA 4W9NA 2OYRA 1LPAB 3WVNA 3CGGA 3MCAA 1PGJA 1KQOA 4LXTA 5KCMA 2HO5A 1U2QA 2EFGA 5DK6A 3BT7A 5C8DA 5TPZA 3SEZA 2XRMA 4TMVA 4V0QA 3E3LA 2ZUBA 1LDYA 3HMQA 3KPVA 3HKEB 4F5DA 3VHQA 2H5LA 2FCRA 2W2VA 3WK9A 3TF5A 3CEAA 4KXNA 4L8YA 3HVUA 3H9EO 1COWA 5J3JA 1DAIA 3VJLA 2BUAA 2GCPA 4QJ4A 4BJ3A 4EF6A 4JDPA 4KPEC 1VL5A 1YUBA 3PC2A 1FRQA 1T36A 2AYXA 4XSGA 1CJTC 1UXHA 3J80A 1I94B 5AKLA 1PBTA 2ASVA 2WKQA 4O4IB 3ZLUA 2W2LA 2C3YA 5EY5B 2IYSA 1MB0A 1USGA 3D8BA 3MFQA 4J0JA 2FJUA 3DOUA 5B1SA 4E32A 3G9TA 3DDWA 5H3CA 4AUMA 4C4TA 1KP9A 5BWOA 3O8OA 1GNVA 3ND5A 4QUBA 4WESA 2BLLA 2WVJA 4Q4LA 1V3TA 3WB2A 5E9JA 3QEBZ 5G0WA 1E8NA 2Q3MA 1ID8A 4NBUA 4G3XA 4MVJG 2V7XA 1LCIA 3OIDA 1XTPA 3K9LA 2QK4A 3DWGA 4HNAA 3EIWA 4KQ6A 3MTQA 1R6UA 4MV1A 2J3LA 3BF7A 3EUWA 1RZVA 2GWHA 2R3SA 3AF0A 3BHJA 1J42A 3SBEA 3ASYA 1YAHA 3OMXA 4JI3B 1A9PA 4OFBA 2H07A 2GHTA 4B3XA 4ERXA 2H2GA 3EC1A 2OCBA 5FUQA 5JZSA 3MMXA 4YUAA 1F0KA 3MRXA 3HDGA 5I5EA 1VDMA 1OTHA 2QVGA 4WNYA 2F64A 2SCUB 5ALPA 4ZAYA 3MS2A 4G0OA 1NOJA 1MOQA 1CUAA 1JA0A 3OP4A 4JDUA 1UXKA 5TDHA 2ZXFA 3VSCA 1JRLA 3ZOZA 3L4BA 1P8JA 2EQBA 3OE7A 3JAWA 4LV5B 4A0RA 3OTHA 5DXJA 4D3FA 5CFQA 5HWSA 5C9ZA 5AJUA 1DAGA 1SCKA 1KQGA 4MP8A 5BWLA 2C5AA 1CK4A 1X7GA 4IUCS 2C84A 2G70A 4L3OA 3D2LA 1GCUA 1W4ZA 1G9TA 2X9GA 3QUCA 5HF6A 2B8WA 3SJ7A 2DR2A 1KIMA 2ZJ2A 3RVQA 3GFOA 2ZWPA 4EH1A 1BE8A 1N5JA 2ZIFA 3HJHA 4WZZA 4MWOA 1W5FA 3AEQB 1HNNA 4DM4A 1RTTA 1H9CA 2O48X 1Z5PA 4KL8S 3VSAA 5BXYA 1SKMA 1Z0ZA 4WUVA 1IONA 1J1ZA 3NEYA 2DHDA 2HF7A 2R7MA 2ZSFA 1BHO1 2J0UB 5EUCA 3UMGA 4KOAA 5IYZA 2JG3A 3KUKA 4WE3A 5AHKA 1L5QA 5BNIA 5JD6A 1EGQA 2PUGA 4DXDA 1N57A 1T1RA 2BJWA 2A3NA 3TWOA 2CW5A 2L82A 2Y05A 5K6AA 3ZXSA 4ABTA 3EFBA 3S2GA 4IMIB 4I50F 4MWCA 1U0TA 3H1PA 3R3HA 4LW8A 4GC9A 5IC6A 1V7QA 5T3UA 1SIUA 2O3QA 2OR3A 4C0LA 1YTUA 3BERA 3NM4A 4XB6B 2VUTA 1JEAA 2O52A 3COYA 2BJVA 3JQ6A 2AXNA 5IHXA 2NXNA 4ARUA 3PUKA 1VG1A 3CN9A 3NPAA 4TTRA 4J16C 4NS4A 3WGLA 4D79A 4EABA 4NI5A 2PH5A 1SCUA 2NW6A 1NV9A 2X9NA 4KN6A 2O1EA 4E1VA 1Y1PA 3PNQA 4OSPA 1PNVA 1U1GA 4P22A 5D2CA 4CMIA 5C51B 2AE2A 2VYVD 3M6FA 3NGXA 5GOTA 1ZXXA 4AUKA 4K05A 1G19A 3R3JA 3DBRB 3OP1A 3DE7X 3VH4A 1Q2XA 4OHRA 1MAAA 5G0TA 2V7EA 1EZ1A 1L4FA 3BRSA 3O94A 3V2HA 4BYMA 4N7RA 1VKRA 1IAQA 3D8UA 3TGWA 1R8JA 4RZQA 1M2OB 2FUG6 3DJFA 3PNYA 4WZAB 3U44A 1T2AA 4PCAA 1NUQA 3HA3A 3VDXA 1P0IA 4ITRC 1EXNA 2O8CA 2V7UA 2V7QA 3F9IA 1Y7TA 5BW4A 2MSEB 2PX4A 1DTEA 1U0GA 2BSQA 3KPWA 4BNUA 4DA0A 4C1NA 4BZWA 4QNNA 1DTWA 3IE0A 3DDZX 3FGNA 4LA4A 5AHXA 4I36A 2PKEA 5EYPB 1Q0PA 4AY2A 1KL7A 3K0FA 2QTWB 3W5AA 3UBTA 1UAYA 1XSEA 1Z5OA 2NUTB 4PF1A 5HF8A 1EUDB 4ZIRB 5H59A 5FR2A 4UVEA 4JLUA 1DX4A 2CVQA 3DLTA 3B9RA 3ED5A 4KR9A 2IGBA 4FM9A 1QS0B 1S9DA 1VGQA 2HZBA 1KOFA 3HXTA 1MTZA 1XZMA 2JGLA 3B52X 3SIWA 2ZJOA 3JQRA 1H2HA 2PMFA 4OFXA 3GMIA 4PGAA 5FV7A 1N2JA 5KJEA 3QOYA 3TLJA 2R8ZA 2FUNB 4NHEA 3TQFA 4JSYA 5ILQA 4TRNA 3QTTA 2OHOA 5TF4A 3ZV3A 2Q9BA 5DXAA 3LX4A 3BGSA 2AUNA 1PR6A 3MJVA 1IN4A 3P94A 3R40A 4JSRA 4B7XA 3LMKA 1ZQ9A 4G56A 3GUVA 1NLYA 3W8DA 4EMBA 2FMKA 3RH0A 2ZAIA 2Y77A 4MDHA 4ASUD 2KBEA 4AS2A 1GPLA 3G2IA 4DAEA 2FZVA 5DNCA 3OCXA 3P0RA 1ZNQO 1XCOA 1XRJA 4YP0A 3DB2A 2REXB 2CF5A 4KVZA 2Q6OA 2QTVB 1QV9A 2EWWA 2ZBQA 4BGEA 3FPAA 1BH2A 4I99A 2WP0A 1EVYA 2NZXA 3D8SA 4CF3A 3SXUB 4LYHA 4RL6A 5T6BA 4H1WA 4EJSA 1ZNZA 3ESDA 3STWA 4BL5A 1FFXB 1IG3A 3FTCA 1QWOA 4XSVA 4Z9YA 4XYGA 1BX1A 1JZTA 3EGEA 2HPVA 2PKWA 1GQQA 3M3PA 3FUCA 1QH8A 1E3QA 1V5FA 1V96A 1BRTA 2TMKA 1V9LA 4CU2A 4ZVKA 1X7YA 3OUZA 3UHFA 1XNHA 3GEPA 3T3NA 2VDQB 1Y1SA 2VLIA 3V42A 3EEYA 4JOQA 2NN3C 2Z3WA 4D45A 2WJAA 1CF4A 2C7VA 3Q8WA 2OHGA 1Q0QA 2WQ7A 3FF1A 3M6UA 5BMOA 1NN1A 1JB9A 2C7BA 2K6GA 1E6EA 1UKYA 3GJ8A 4HL6A 3R7LA 4CF4A 1G38A 1ENPA 2NUAB 5FUMA 5AVKA 4J0KA 3VHLB 5IKPA 2G1PA 1R8XA 5B3JA 1A04A 1IZ8A 2X4GA 4E4RA 4IY1A 4YCLA 1F1JA 5LLDA 4HLQB 1M1YE 4D4LA 5K0FA 1XL0A 3FFAA 3MYRA 4OYHA 4BQPA 3ZEIA 1ZGAA 4I5DA 4NSNA 1UXIA 2JC3A 1YS7A 4GKKB 3AEKB 2IZ5A 2OK7A 3KYCA 4PR0A 2VJAA 4M53A 5IDVA 3VX4A 2AEJA 3EZLA 1NVBA 2XBUA 2NXCA 2XYQA 3UJHA 1OBFO 4A0HA 2ZAYA 4GEGA 1ETHA 3RJMA 1NASA 2X76A 4RK7A 4M0EA 4ZVRA 1G17A 4HVCA 2GX6A 4HDMA 4C0JA 1MT3A 2XDAA 4H7HA 5HK9A 3GD5A 3H1GA 4C01A 2DTDA 4FWTA 1H1LA 1P7WA 1WKVA 2OCKA 4LHEA 1JI3A 2A3RA 1ADBA 3ENWA 3SHFA 1QE5A 1S2LA 1VSQA 3JAKA 3MGKA 4TTJA 2CB9A 4DM7A 5KJCA 1R6TA 1WQ1R 2FKAA 3WHPA 5IWCA 1TJ4A 1P75A 1ZUD1 2QP9X 1PJ2A 3G8YA 5AW5A 2NWQA 1VCIA 3G6KA 1QGED 4Q3LA 1D4ZA 1N5KA 2FP3A 3TTUA 5FORA 1J97A 4QOFA 3RJZA 4DYHA 1RRFA 1MAUA 1U7ZA 1XTIA 3BMQB 2G07A 1H94A 3L43A 3OJOA 4J0GA 5ADUS 1BXRB 3D59A 3LH5A 5E8RA 5EKSA 5SICE 4LV6A 2PUVA 1PT7A 3OUUA 4XX1A 3VVLA 5BN3A 3L4JA 3B20A 5TQ2A 5G1NA 1R0YA 2X13A 4GZLA 2CUZA 5ESXA 2OPBA 4OBEA 4W7SA 2YRXA 2D0PB 1A5SB 3NP9A 3DEIA 4DKXA 2A5YB 3WJ7A 2BFNA 1N8NA 2GEKA 4OQLA 1PGNA 3NAZA 1LDBA 5IW8A 3AR9A 5C4GB 5E38A 4LJKA 4B7UA 1OZGA 1OWNA 1SIWA 1NAHA 3UGJA 1SUBA 4PAWA 4DLLA 3TUZC 1L8LA 1YZVA 3OIFA 1US8A 5I9BA 3QWBA 1DG3A 5AOVA 4CT5A 3DJYA 4C6TA 4H4DA 1EDOA 3N6RA 3W2GA 5A0TA 4C1BA 1KAOA 3ZU6A 4AJ1A 5AW0A 1YNOA 1N0UA 4BVEA 2BFBA 4KLNA 2ZPAA 3GZ4A 3VAZA 4NNPA 1KHTA 1PR4A 5FL3A 3GCZA 1D04A 1ZMTA 1NF8A 3H1EA 3L0IB 1YXMA 4JEHA 4HZUA 4J0CA 3KJZA 1SIOA 4RU1A 3RSZA 1OTXA 4E7OA 2OB1A 5A4JA 3TSOA 2Y1FA 4D9CA 3R0IA 3IDZA 3DE0X 3OFJA 5JSYA 3A3NA 3EAGA 2GASA 4OL0A 2EIXA 3T3IA 1DFIA 4KKVA 1GTJ1 3KVNA 2JAWA 3KB2A 1HDGO 2IDKA 4KFTA 4JI7B 3RVJA 1KP3A 2ODAA 1D9XA 2VHEA 4MKXA 4PAMA 3MBOA 3NJ4A 3OETA 2GZSA 3I9LA 3CCCA 1U1DA 3AL2A 1O1YA 3QELB 1NGSA 3T95A 3S2FA 1NIPA 3OLQA 3TI9A 1TIBA 2KE5A 3N8KA 3G0BA 4UU0A 3P20A 1EUZA 521PA 1VBNA 2Q5IA 1KI9A 2A67A 2IYXA 2QTHA 4M9CA 1FUIA 1ZI6A 1UK6A 4MV5A 1VI6A 2I80A 4DCTA 1SQ6A 2O7NA 2RHLA 1MPTA 3FPCA 3LKBA 4FCWA 4O29A 4P7FA 4HWKA 3K1YA 4QYSA 1PL0A 4LXGA 4PG7A 1R27A 5ECWA 3SLGA 4DF3A 5GONF 1L7QA 1OWLA 1J24A 1SCBA 2AI3A 2CE2X 2WD7B 2UUBB 1OLSA 2DBZA 2QX6A 2W11A 2YNMC 3LUHA 2FPIB 3F6PA 3UUGA 5AXBA 3ZD9A 3ZVNA 4HJXA 3OOYA 2RSLA 1N6OA 1XCJA 1JU9A 4G1VA 1S5PA 2W2XA 3AJEA 3BHMA 3ZY3A 2XRFA 3JZDA 3ER8A 3MYYA 5LZ4A 2CUNA 4IQ0A 1ZEMA 4RVOA 4PC6A 3WL7A 4EG7A 3F46A 1TMOA 3F7MA 4QYWA 1UBCA 2VRNA 5DULA 4NEQA 3VZCA 3PGXA 4F4HA 1RXWA 3AOEA 4BKOA 3GEIA 4DMHA 5KMGA 1RWVA 4RH3A 1FDUA 5JBIA 3R3ZA 4RZSA 3WIEA 2Y9MB 5F23A 3A1DA 2C4TA 1K3UB 3BOSA 3O8OB 5YASA 2AN4A 3HO1A 2HQBA 5F2KA 1MVNA 3V32A 4BRUA 4DRZA 3T3PB 1P4GA 4WV3A 1BE0A 2WJ4A 3E5MA 4DNXA 2QQ0A 3GCDA 3LGAA 4UBMA 4K03A 3GRYA 3QMVA 4HNAB 3AUUA 1VHJA 4PCLA 1GPKA 10MHA 4LQCA 3K09C 2WVHA 3MTAA 4MWDA 1H8HA 3P2IA 4KK4A 5GIPE 1MO3A 4TTSA 3JTMA 2CSXA 1NVGA 3KDPA 4HGQA 4KRXA 2G5GX 4PEVA 3LX8A 5EN4A 2REQB 4PR3A 3TEMA 5HR5A 5B58T 1HURA 5CPBA 5B4TA 4GU5A 4H7DA 3WP0A 2CT8A 3VSBA 5TF0A 3ZHOA 4B3SB 1IMJA 1OYYA 5JZOA 1IHUA 2NUPA 3H4VA 4TTTS 3VR4A 2PGAA 2GK6A 3TL3A 3HNRA 2IZOA 1M75A 1Q50A 1Z6YA 4I1VA 3Q40A 5FWYA 2V7GA 5TMDA 1NZDA 1NBMA 3JAWB 4YMIA 1XEWY 3N0WA 2HJVA 4L22A 1XQYA 4ND6A 1AZTA 4XLTA 4D5EA 4AMYA 5BSMA 1IUPA 1W4RA 2VTKA 2YNMD 1K7EB 3OCCA 4OMFG 5L3ZA 2DPHA 3U1VA 2JJ8A 2O6LA 3GFRA 1ZA1A 1G8MA 1RLJA 1GCAA 3EEBA 3PHLA 1A4UA 2A0KA 4BVAA 1SM4A 3HB0A 2ZJ7A 1ZMBA 1K0FA 3R24A 4X91A 4HNSA 1BCRA 3DV0A 4J43A 4WDRA 4YCNA 2DTEA 1YASA 4FEAA 3CEHA 5A9SB 5ITZB 2H51A 5HEKA 4B3FX 2UUCB 1CQZA 3FYUB 2Z0MA 1ACLA 2JCSA 3GJZA 4Q9DA 5HKBA 3CC8A 5CDFE 1TM7E 4N12A 1A97A 1LBTA 2CNNA 2FZKA 3UH1A 2C82A 2B8JA 4AN0A 4FOLA 1ZHFA 1GO2A 3W4KA 2AI2A 1QH1B 4AKGA 3U26A 2AZ4A 4K7JA 2IYRA 2OV4A 5AXAA 3W6NA 3BRCA 2FUCA 1A27A 5F3DA 1BO6A 5BSUA 1E9BA 1HEIA 3BRWA 2D2IA 3NHBA 2BN4A 1OE0A 1Q16A 3QK7A 2Q5HA 4XPZA 4JJ8A 5FBQB 4JI5B 1GFWA 2ICAA 4IDFA 3PKIA 2EKDA 4RJLA 2IEZA 2VJMA 5DEIA 1DADA 2VRCA 4X95A 1DX6A 3H8VA 2VWGA 3I9FA 1ZHOA 2UZ4A 2FV8A 1F4VA 4YJ3B 3G9XA 3A6FA 3ELUA 3HU5A 1EHIA 4DR7B 4PAOA 4JJ6A 4QUIA 4ZZ1A 4TTIA 3FOAA 4CG3A 3AFIA 2PRJA 3N0VA 3QSYA 2C3OA 2IIQA 4XRRA 1FNSA 2BMDA 2JLCA 1EDDA 3AF5A 3MBIA 1AKTA 3EQ6A 2GBGA 1CR1A 3CX8A 1JHVA 4D0NA 1E9RA 1WUKS 5FBKA 4YT2A 1ZOSA 2X4LA 3H6GA 3IP3A 5SY4A 3U5TA 1GNTA 4WSOA 1X3SA 3CW2A 2RCYA 1NVAA 1SGWA 3HDJA 1ISSA 1CUSA 4RPLA 2WFMA 2XRYA 3JQ9A 5KWVA 2QT0A 1VLMA 3EN0A 3KOMA 3L7LA 4L08A 4X3PA 1XNRB 4MYRA 1DT5A 3V9AA 1UJ4A 1EX7A 1R6AA 2OQ2A 3NTRA 2QJFA 4MITA 4DVGA 3ZW7A 2Z83A 2ASEA 3VV3A 4MUXA 2XCSB 2CDNA 4MJLA 1IHDA 3ESRA 2B4KA 1NLMA 2CNBA 2HJHA 4H59A 2G5PA 1UMCB 3BH0A 4KE8A 2AFHB 4MUJA 2O8CB 5LLSA 4ZDIA 3G02A 5TR9A 1MG0A 4PPGA 4CR6A 4QUKA 1GPWB 4EAAA 1DTWB 1RPTA 3ELWA 4NE9A 1IIBA 3GUUA 1TF7A 3CZ5A 3K0FB 1KK3A 4MW0A 5JSKA 4CFYA 4A8JB 2MHCA 1X70A 4POAA 2PZLA 2ZRMA 5EKUA 4MRRA 3IFSA 2OO5A 2PDAA 1NDUA 5DSZA 1NFFA 1E98A 3HBMA 1XZPA 4RQAA 4MA4A 3T3MB 1SUCA 2C94A 2QTAA 3HABA 3LLUA 4IDAA 3D31A 1P9WA 5C35A 1RJFA 3DMYA 4I9FA 3O7WA 3WTCA 2JA2A 4ZQFA 3OCZA 4L28A 5HZGA 2FPRA 5KWIA 4CKBB 4IKEA 1THGA 1XA3A 3OJLA 4BU1A 2IBTA 3ZD6A 2AHRA 2AKYA 3RSSA 5BV8A 4BVLA 2ZIGA 3NM5A 1B00A 2BEJA 3HB1A 4GEKA 5HFJA 4J7AA 3WGQA 1VHQA 1JYSA 5ANRB 4CLHA 5ELXA 4HB2A 1AK1A 1H2RS 3FMPB 4LPSA 3ZDAA 3HTXA 2O2EA 1EGHA 1K6IA 5T67A 1M66A 4EVRA 1EZZA 3ZY4A 4BBPA 2IS2A 2HA6A 1HFJA 3BK2A 3VU3A 1USIA 5CG2A 3PUWA 4KTTE 5AVJA 4PZYA 4C0XA 1IK6A 5DHPA 3K0KA 1TEVA 2JFYA 3BWCA 4C9BA 2C8LA 3PLAE 4MAAA 3MINA 3QKSB 1ISHA 2DR0A 3BIOA 3L7DA 2OVBA 1LFAA 1WY5A 2JGNA 2YXEA 4MQ6A 4ZVLA 5IC5A 3VPFA 2VJBA 3KEGA 4EJSB 1NQXA 2YWCA 1ZH0A 3L4EA 1A9SA 2HRZA 3I4CA 2GVNA 3ISJA 4KHPB 1YHZA 3ZBPA 1E1RD 3OM0A 2GN9A 1HFEL 1E2KA 2C9BA 1Y42X 1U2GA 3ABRB 4ZAFA 1BKSB 5KX5B 2DHQA 2WPNA 4DDTA 3V7UA 1UINA 1ODCA 2OFOA 3DKIA 3LQ2A 2PX2A 3DEYX 2JBAB 4G0PA 4ESVA 5J47A 1SC3A 4Q1EA 2OGWA 2CXNA 4F7DA 1NC1A 1NYRA 3DT6A 3E48A 4J90A 4I1YA 3ONNA 3GX1A 4ZYLA 1MMFB 5SZJA 1IOVA 1QBGA 3WLPA 1PWYE 2DCUA 2Z98A 4FFLA 4TRMA 4QQ8A 5F4ZA 3HL4A 2VF5X 4Y1EA 1UBUS 5DHRA 3T7AA 3F5FA 1HORA 4FHZA 5G0UA 1KYZA 1WD5A 2CUTA 2FN7A 4NPHA 4TRJA 2K5UA 2XUAA 1CJKC 4P31A 3RS2A 5EJ5A 4YDSA 4YFVA 5DNYB 5B58C 2VPIA 4R1PA 3U4QB 1QM5A 2D3TA 2IOHA 1E60A 2G4LA 3BKWA 3W2FA 4WQMA 4BS9A 3QENA 2A0FA 2FSUA 5IF3A 1VPEA 2HMTA 1KY4A 2VEDA 4WXEA 3B82A 3WDLA 3NHJA 2JL1A 2Z3ZA 4AO8A 4GOMD 3VZDA 4C4RA 3WBFA 3ZYCA 1ONBA 2PBZA 1XTUA 5TSDA 4EQ6A 1E2IA 3RTCA 2OGSA 3B38A 1O6FA 4MMXB 4DT1A 4UOZA 4F5EA 4JUIA 2WIFA 1WMBA 2RGCA 2RB5A 3R7BA 1APBA 3D3JA 1PS0A 3AZPA 3KJXA 3PDUA 4B8YA 2Z5VA 3OZAA 3LI2A 4J94A 4IIVA 3C14C 2EWVA 4OHBA 4OK6A 4PHHA 4WW0A 3RK4A 4CKYA 3D8TA 2R751 2C58A 3E27A 1T3SA 4KYUA 4N5LA 1QHNA 1FC0A 3WGYA 1H1LB 2GEUA 4D96A 4DSTA 1V25A 3SJUA 2Z1NA 4NQRA 1JYEA 4P33A 3G82C 4DR3B 2Z43A 4FX5A 1J0XO 4G41A 2OORC 3VOSA 2JDID 4QT0A 3U48A 4L7VA 1Q0RA 5LZ5A 2FDRA 4IOMA 3LYUA 3QBEA 3WSWA 4RYLA 4ERNA 2XWJI 2HWYA 1YQWA 2J8ZA 2ZYAA 3N1UA 1PUXA 3I1YA 4L78A 2BGUA 1T8PA 1P5RA 4YO8A 1Y9ZA 4B8ZA 5AWFC 1SH7A 1MC5A 1WD7A 2Q9AA 3H86A 5D84A 2PVSA 1E8DA 1WQ3A 1Y5MA 4P86A 1N2BA 4KLZA 2QRQA 5TQ2B 1EP3B 3H87A 1H22A 3RU7A 4HP8A 2OXEA 3AR5A 3FLMA 3KYIB 3PFFA 1JZSA 1GZ3A 1VCOA 2Q8NA 3NIWA 4KE6A 3T5AA 4RK6A 4UTRA 1CB7A 3KSUA 1U7DA 2OWDA 4RKQA 1I7LA 1VLZA 1AZWA 1XMJA 1YCFA 1T25A 3QRWA 3LKVA 3X44A 1BKDR 2EZTA 3WSTA 2Z56A 1N2GA 4K9NA 2OZPA 4BQSA 4HNUA 2RARA 4WNIA 1XLTA 1KO4A 2V74B 3NWPA 3R5FA 5DGHA 4DNQA 1BA2A 5ICMA 1WS6A 1GT6A 2VHWA 4HLUC 3JQAA 3IBGA 2IEDA 3JQFA 3C3BA 3IHWA 3JQEA 4Y8VA 3DFUA 5FPQA 2YJ5A 3WRVA 8GPBA 1L7DA 3EY4A 4WN9B 1I13A 1PR9A 3BTVA 3II6X 3ZXIA 2NVOA 3FYDA 2W8BA 2HD4A 3AERA 4RD1A 2YS6A 1O8BA 2FSVA 3PE3A 2GK4A 1DZ3A 3RRNA 4JU9A 2B25A 3BRQA 5CJPA 1W2GA 1E5VA 2ODBA 3TTYA 2AD5A 2B7LA 2RB4A 3U7FB 2YJZA 3DUFA 1EVKA 2CVHA 4OQZA 2IE8A 2P0AA 4KXLA 4NCBA 2FSGA 3DHVA 4ALNA 4QZVA 2RGBA 2Y1OA 4WH0A 2GGSA 3V4ZA 2WHEA 3VC3A 3OPMA 4PZZA 3STVA 3FY4A 2HQ1A 2ZYWX 3ZCPA 1CG6A 1TMKA 1WB6A 2GPWA 3SIRA 3OHPA 4IUDS 4ZDJA 1I7SB 3E9ZA 1XK6A 2DFNA 4JBHA 4UTXA 1FSZA 2QL6A 2LIVA 4ZEXA 2XW6A 5FLXA 4PQYA 1AKQA 1S2MA 2WF9A 3AHJA 4TLAA 2OUKA 1X77A 2DWPA 1PLKA 4GBMA 1AVTA 1IJFA 4JWKA 3T7JA 5CA0A 3C3PA 1PCXA 2Z2ZA 2HLNA 3WKEA 1SXPA 1SJ9A 2RGNC 1NVWQ 4RA6A 3LHSA 2EAUA 3IDAA 5EE3A 2BP7A 5IXYA 1Q0UA 1FFHA 2XD9A 3WADA 4OAOA 1U5BB 2ID8A 1NVDA 4CLDA 2BWJA 3DTVD 5C3UA 3V5NA 1E20A 2YWEA 1QO7A 2AHOA 4LAFA 2ID9A 3HUUA 1RE0A 3I42A 4P83A 3PGMA 3LT0A 1F5NA 5I7UA 3U3OA 2BCGY 2YIJA 1XRPA 4H17A 2JJ2A 1SBHA 1RQNA 3OCJA 5KNCH 2X6RA 4XVCA 2VJPA 2IU4A 1V2HE 2VP5A 3I39X 3RC8A 1S8FA 2HSDA 4XJSA 2CV0A 3PXAA 1WXDA 1G5HA 1E3JA 2ARKA 4UJ5A 1P62B 1NPYA 1ZCFA 4G24A 3KKMA 1FFCA 1V16A 2FFBA 3FMOB 4HX2A 5T4FA 3V7YA 5BSFA 3J81k 2AEMA 2R5FA 4AVYA 1X8KA 3K16A 4KP7A 5HILA 3NHWA 5COAA 5AW1A 1O8CA 2FPGB 4GOKA 1HE8B 4Y9SA 5M5BA 1YJQA 3PRKE 2JGFA 3R5TA 4X7BA 3LDFA 2F43B 3HEBA 1B7GO 5FOUA 3MXTA 4MUFA 2BKAA 2H5EA 4KTVE 1H1DA 2ODEA 1FW6A 3AO0B 1C7QA 2BDUA 3QU2A 4DOMA 3A2KA 2RGEA 5F1YA 2GD1O 2C4WA 1PJRA 4I08A 1JUDA 2CN1A 4PYLA 2QVCA 1XXHB 2QZZA 3KLPX 4MICA 1XF9A 5TPWB 4XWOA 4ARIA 1OAOC 3WQSB 4B2PA 1AUXA 1DQRA 2QROA 4GPIB 4BO9A 2W2OA 4E7PA 5EZ5A 2YJGA 3QMWA 2G9QA 1DRVA 1K5DA 1KSHA 1Z3CA 2QQEA 3A04A 3N0RA 4BOYA 2FPKA 2E5WA 2HEGA 3H84A 2JGIA 3NHPA 3P9QA 3GRCA 5A5FA 1IDOA 3BGIA 1DRKA 3BQNB 2E4WA 2RHTA 1ZD2P 3CZRA 4IVRA 2AG5A 4IXNA 2VI5A 4DR2B 2GM9A 2FZ5A 1W0CA 3ED1A 4IXMA 4X8LA 3E58A 4LISA 5J58A 1C30A 4FZ5A 4YAEA 4EY6A 4N40A 3KUDA 4UFNA 1R6VA 3OJEA 3DTVB 2D1RA 2P4HX 3DV0B 4ZFNA 1ODSA 3CO0S 4P0QB 2QPLA 1I4TD 4AXBA 2NTVA 3I28A 4MCIA 3ZQ6A 5T5QA 5JARA 1SZDA 4MWGA 1ZJZA 1A9XA 1M1YA 2E4XA 2V3VA 4B9EA 4IDDA 3TFQA 1MABB 4FBLA 1S2DA 3K8OE 3V1MA 3V8PA 1RWQA 2DEUA 4WVLA 3C41J 1DC8A 4KXXA 2IQIA 3I76A 4K3UA 1T2DA 3M1YA 4IFEA 1V4VA 3H1BA 4V38A 4HEA1 1Z75A 5FUYA 1OB5A 3M70A 2CLMB 4S35A 1KJ8A 3W5VA 4LYJA 2NSJA 4RSMA 3WG9A 3L7OA 1HT3A 2DFDA 2GCNA 2J08A 2NPOA 4OFWA 4MVJF 4AMUA 3HDHA 5EWLB 5LD2B 2AFHE 3TRHA 1DGQA 4L16A 2QSYA 2ZUVA 4OMUA 1CUZA 3MRVA 4D97A 1YIAA 1WHTB 2GMWA 1SUAA 2HX1A 4LI3X 4CIAA 2WIJA 2VJMB 1E64A 3TVDA 1QKJA 1BVUA 1XDSA 1BE1A 1RQLA 3DE3X 1T29A 2J9FA 3FGOA 4KVFA 4RHYA 1TPYA 5BR1A 1BJKA 3HJNA 3U7EB 4OHMA 2JGAA 1DELA 5G4KA 1BDJA 1SVUA 4XFDA 1NRWA 4TMXA 3VAAA 1MRSA 5FA8A 4JX9A 3QFRA 2ATXA 4H15A 3SXPA 1EMDA 4IWNA 2CNOA 1N0IA 3MK31 4R1SA 4CKEB 4YQZA 1H23A 1SC4A 3LIPA 4ZTZB 4JC0A 2F3RA 1RTKA 2GYVA 1KR5A 2QB5A 5KOHB 5ALIA 1FLAA 2OV3A 4J1SA 2CDRA 4GOND 4R31A 5TEWA 3IL2A 1C7JA 5DCYA 2QRGA 1GPJA 2WINI 1CY6A 4F2DA 1JKIA 1K1EA 1KJJA 4MJ3A 3SPXA 1R0WA 3AV0B 4D9KA 1KAMA 1S02A 3UMVA 3TLZA 4EI8A 3BIJA 1QC5A 5FWXA 1EM8B 4JLDA 1P80A 3MUEA 1RRCA 4ND7A 4F8EA 2OWEA 1HF3A 1LJ8A 1R8QA 4ZT4A 2O8BA 5BSVA 1UK9A 1XWFA 3B36A 2BR4A 2FE1A 3LDUA 4MKRA 3KCNA 2QN2A 3BS4A 3LL4A 3KQHA 3BXGA 3TJMA 4KITB 4M88A 5IVKA 3FKSD 4BUZA 1RHUA 4DMGA 2PIDA 4X8MA 2R0QC 4ES6A 1DVRA 1H3NA 3JR7A 2R65A 4QG3A 1I0IA 4AICA 4HH1A 3V97A 4MLDA 1X1DA 1JG2A 3IHLA 3K8QA 1U7OA 3H4MA 4LFAB 2JNWA 3WL6A 3ZD7A 1OXTA 3M7IA 4RZIA 4WA8A 3SR4A 3UAZA 4AAYA 2ZWOA 1SCIA 1M1XB 2JIQA 2QQFA 3UN1A 5G0SA 3NBFA 4M1ZA 3WLRA 5DJ5A 4HEJA 4NFLA 5FNVF 4M8SA 3AUKA 3JS5A 4U00A 2IHKA 3FNHA 1N75A 3GIDA 1KQPA 3K32A 1W9MA 2MINB 4HLDA 4KGXA 2ZR8A 4Q1BA 2EJBA 4UHFA 3B6KA 2JLVA 3IQDB 1JH8A 1MNQA 1U0HC 2GHIA 2HB6A 2MSWA 2YXPX 4JD5A 3VZSA 3R3UA 3ER9A 2NU8A 2W8ZA 1ZH4A 2JFWA 2H4YA 5K3FA 5KNCD 2OAEA 2JRCA 2JIBA 2GLXA 4DANA 3MINB 3TH5A 2PSHA 2WF6A 4X3CA 1YQUA 1TC2A 5I3CA 1DOAA 2P6MA 2MMCA 1Y3AA 4PGGA 5L3RA 3RVSA 2EU8A 1RWMA 4QJBA 4MW4A 1SEVA 2VXYA 1EK2A 5L40A 3O8QA 2FW0A 2NTJA 2Z4SA 5LWHA 4YCDA 2XADA 1ADCA 2HMVA 3WLQA 1AH2A 4N3BA 3CLTC 2OLEA 1ECBA 1U3GA 4DUGA 4G37A 3V8VA 2GPNA 2WG0A 2H0QA 3A0UA 4LJ7A 4V0NA 3VYVA 4DDHA 3ICQB 1JDPA 2WDZA 3I9OA 3IMKA 4CV1A 4B3GA 3C4VA 1FFYA 1V8FA 4YUYA 2WJJA 5ALVA 3N9IA 1PR0A 2Q1UA 2JLYA 3NFYA 1S8NA 2RGRA 3H5RA 2PV0A 2V6FA 1M8JA 1IUOA 3DBHB 3KKQA 4YRFA 1V5IA 1GQ2A 2C42A 3JARA 1I24A 1E2UA 4QPNA 2BKVA 3DVQX 2WFZA 3HRKA 2BZ1A 3UV3A 3WRXA 3O38A 5F3WB 2VBIA 4QRHA 4CVNA 2GF2A 3EULA 3RHFA 2VXBA 1XA4A 2P4UA 2BFMA 1Q1EA 3NYQA 4L0CA 3AJDA 2WE8A 4D9MA 4YT4A 2G9RA 3KHTA 4JNKA 1F1BA 3WTBA 1QTNA 5JALA 1I3CA 4AKTA 2OHIA 1GFIA 1TFUA 3HKCA 1E0SA 1HYQA 1KFJB 5T7BA 4D25A 2NVUA 1SU8A 3CF4G 4GE3A 3EWSA 5IAEA 4EQ6B 5CD9A 1KVTA 2SECE 2PSSA 4JYCA 2AMYA 1N8SA 1TA4A 1V1JA 3CUKA 5B37A 4MA5A 2QLMA 3LC0A 3QVWA 5TQ0A 3B51X 3EWAA 3HYSA 5BSGA 1B0AA 3Q3EA 4DRXB 3MQ2A 1G66A 2XPCA 5JO9A 3Q6NA 3OX2A 5MFZA 2NP7A 5C80A 3KQQA 3WMFA 1IOWA 4G1CA 3TIGA 5EJEA 4H2DA 5ICFA 3PJDA 1KJQA 1XA0A 2B1JA 3QE3A 4R98A 1QRUA 5F73A 3T3EA 3CLTD 1GYRA 1GYQA 3MSXA 3NHRA 5K2OA 2H17A 2OBYA 3D7MA 1NT2A 3OE4A 3P5BA 2NU7A 4X94A 3DEHA 4BQNA 1ANKA 2H1HA 1K63A 1MNAA 1NXXA 2ZP1A 3M1AA 3OFND 3WBKA 1VGVA 3PC8C 5CW2A 2DAPA 2OZLA 5FI3A 3T7EA 5IT9A 1UMBA 3TVTA 2FQQA 3MIIA 5AVVA 2MSKA 2IXBA 5E1BA 2XUQA 1FTQA 2HCRA 1IQUA 2IEIA 4AYWA 1YVUA 4B85A 2DHRA 4ZOLA 3DV2A 3REQB 3C85A 1ZGCA 1Z0KA 3LBHA 4B35A 2W6PA 4OOFA 1AM4D 5B3LA 1N2OA 2VQ3A 4ZCLA 5JS8A 2QTRA 3DBOB 5JAOA 3VR3D 4Z4QA 1P9NA 3ECCA 4EHIA 1JAXA 5TX7A 1JA1A 2AN9A 1BW9A 3WL4A 2G36A 1W4AA 3E70C 1OY1A 1Q3TA 2ZSJA 3WC4A 3P2MA 3RIMA 5TGDA 4Y0NA 4EZEA 5HHTA 2FGKA 3A1CA 3B2EA 4NMLA 1PS8A 3AUXA 4IP0A 3W1VA 2W8BB 721PA 4RKFA 4S3MA 1NXVA 2Y93A 3H05A 4TMFA 2DFVA 3VH3A 4HCJA 1L7PA 2PS3A 4Q4AB 4CKXA 1B23P 3KPYA 2VP9A 2CJWA 1FNNA 3JQDA 4WERA 2GRJA 3DUFB 3VTAA 4DG9A 3NS7A 5JNLA 2WABA 1ZL0A 4RPHA 2H92A 3DC7A 4M54A 1BE6A 1JQLB 1KKMA 4H4CA 4QDOA 3RT7A 2GR9A 3USZA 2I9PA 2E18A 1WQ4A 2QTBA 4A7PA 5KCZA 1TX4B 4I6GA 2LVBA 2ZUDA 5CJ2A 4YFYA 1ZMOA 1F8YA 4H08A 1VJGA 1XRNA 3PLNA 2H8GA 4UTOA 4MIYA 4G5YA 4Q48A 4EG5A 3T15A 3HBFA 4DA6A 1MPXA 1QK3A 4H3SA 5CT6A 5ILOA 1K97A 3U4IA 3S99A 5MN6A 1QO0D 1E1YA 1YMQA 4J9UE 3I9NA 5HZMA 2NZYA 4ND1A 1NMZA 3HP1A 1L5LA 1XO1A 4QGFA 1KK2A 3L49A 4U2KA 4F71A 5ADWA 3N5CA 4EPYA 2ES4A 1J0EA 1OA1A 1NTOA 4GMFA 1CIPA 1JLKA 2GN0A 5IVIA 4CKWB 4I8XA 2B78A 2EL7A 1C9EA 1OHHA 3I01M 1O97C 4MQFA 5EEHA 1C3JA 1FL9A 2BP7B 1JU3A 1TUBA 3MT8A 1QXSA 3MJTA 3LS2A 2ZB7A 1L4UA 4HQRA 3AY0A 1U8EA 2JD1A 1UKZA 4BWFB 1D8TA 4FNGA 4UUAA 1A4XA 1U1FA 3T5MA 2H1VA 1FDRA 4ZEVA 3OCUA 3DE6X 3OZBA 2BE9A 2YIVX 1FXSA 2GYWA 4P4GA 1T8YA 5ALZA 3RS8A 3VZQA 2AJTA 4CI0B 7ADHA 4O2AA 4QARA 4EVIA 4P4NA 3MJHA 4XGQA 4US0R 3DYIA 1Q3KA 3HCDA 4MUBA 2PL1A 2IHNA 3H0KA 3M8KA 3KEOA 1I8TA 1AHIA 2FMFA 1TJYA 2Q49A 3GDWA 1U2RA 1UZNA 1J25A 5DTMA 4CMEC 1Z0IA 1V16B 2BKUA 1RWXA 1VLLA 4NZYA 3BSWA 2C5HA 1OXMA 4TL8A 1YZ3A 3VZBA 4FYPA 4L0DA 1QF6A 2Z1DA 1ZZGA 3A3YA 2Q3EA 4ZRDA 3N2ZB 4G1EB 4RGYA 1GZSA 1Z37A 2H2WA 5FULA 5KUTA 4CL8A 4JI0B 4Q7JB 4Z0TA 1O94C 3R8XA 3FRHA 1ACJA 3IOCA 4W7IA 3EPRA 4N65A 4PYRA 5FTNA 4ENVA 3DZCA 5J2UA 1I5EA 3MLBA 3KEMA 4DL9A 1NPDA 4K9OA 4B46A 2X1HA 4TXLA 1DAHA 4QDKA 3TDNA 4DIFA 4BO0A 4J16A 1KAEA 3R7DA 1A96A 3WLTA 3BE8A 2IYLD 2QZPA 4O8ZA 1X1EA 1DAFA 4EA6A 4BE4A 2PLNA 2IOFK 4IVNA 1N32B 1D2HA 1CUIA 1K4MA 3GGPA 3K9GA 1A50B 5HG0A 1GGEA 4DNOA 4N82A 1JQBA 1O97D 3WHKA 4MW7A 1HNZB 1C4OA 4D46A 4EYSA 1GPYA 2YY7A 4E2YA 3TQCA 1C30B 5B2FA 1IC6A 1ZK2A 1FS6A 1JX6A 3WB0A 1DKNA 1NMQA 4UC0A 2R5NA <