2FWPA

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59n from the acidophilic bacterium acetobacter aceti, bound to isocair
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
159
structure length
159
Chain Sequence
b'SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSANRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Biochemical and Structural Studies of N(5)-Carboxyaminoimidazole Ribonucleotide Mutase from the Acidophilic Bacterium Acetobacter aceti.
pubmed doi rcsb
source organism Acetobacter aceti
molecule tags Lyase
total genus 50
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2fwpA00
2FWIA 4YCDA 1XMPA 2H31A 2NSJA 4YCJA 1O4VA 5BORA 5CVTA 2NSHA 4ZC8A 2FWAA 3ORSA 4JA0A 2FWPA 5CLHA 1QCZA 5C5DA 5CLIA 2FW1A 1D7AA 4YCBA 2ATEA 3KUUA 5CLJA 2FWBA 5CLGA 3RG8A 3OOWA 4ZMBA 4GRDA 2FWJA 4B4KA 4ZK2A 2FW6A 4AY4A 3OPQA 3RGGA 5BOSB 5BOSA 2FW8A 2NSLA 4AY3A 5CLFA 2FW7A 2YWXA 4Z7JA 3LP6A 1U11A 4YCCA 4ZJYA 5CTJA 3TRHA 2FW9A
chains in the Genus database with same CATH superfamily
3N3AC 4AROA 3QA9A 5C5CA 5KJEA 4LEIA 3I1YA 1N4DA 3BKWA 4LYHA 1Y6RA 5SICE 3JVUA 2CCGA 2LWIA 1KAHA 1YDMA 4OGLA 1QO0D 3SPXA 1ND5A 4ER7A 1X9GA 1VBNA 3O2SB 4FINA 4W5HA 1XZLA 5H7XA 5JLAA 2DVMA 4QQKA 1ZYUA 4CG2A 3SX4A 2B7BA 1WXDA 4B31A 1CQJB 2FFQA 3JQ9A 3PPXA 4DEVA 1W8DA 3ISJA 3ER8A 2YOGA 2Z6AA 1BZYA 1KSJA 4RFSB 2G25A 3DZ8A 4DVJA 3O7MA 4OFWA 3U4CA 4LAFA 4PHFA 1W4CA 1Z7BA 3M1IA 3UAXA 4DADA 1JE0A 2I22A 2I8CA 2IZOA 2C1ZA 4QQRA 3HR7A 3F5QA 4B83A 2XWBF 3KX2A 4AWXA 1QUEA 1OKKD 2VBGA 2WJIA 3Q7TA 4WE3A 5DNVA 4JLWA 3RSZA 5AT1A 4QUJA 4PYKA 3OPVA 1GKUB 3QVWA 2W8ZA 1PSDA 1PKXA 4WAUA 1N2GA 2XQKA 4WL0A 1I1HA 3MWEA 1C8BA 1R6VA 1ZJ5A 3OWOA 4JLJA 5YASA 3U7QA 2I1QA 1EXWA 2P6RA 2X0IA 2QLMA 4R9NA 2P9HA 4QSMA 2VZ8A 5DTIA 4BPBA 1XU4A 4ITRC 3DE0X 1KU0A 3DT6A 1I4OA 5DYNA 2AD1A 4D5GA 3B70A 2C7QA 4RAQA 1NASA 1WETA 1XZQA 5BO5A 3TPZA 1DMSA 3H5TA 1H9AA 2H65A 3KSDO 1JP7A 3SG0A 2BFNA 4LYAA 1E2UA 1JIJA 1JEDA 2OBBA 2ZRLA 1TJYA 4LX8A 5TPWA 1OFUA 4LX0A 4B6EA 1GL7A 2J48A 3ANYB 5CEEA 2FRXA 1M1NA 2M9MA 4X3PA 4UMDA 4WEQA 4HI0E 1G2IA 1VIMA 1W36D 2XUIA 4KL8S 2A78A 4JV5B 4JBHA 3HEBA 2YIJA 1G5IA 3DSRA 2IV7A 3VC7A 1ZVQA 2OENG 3LLMA 4MW6A 3AZQA 3TAUA 5BWOA 1K06A 2C2HA 4OM7A 1ZRHA 3GLRA 2QR2A 1SUAA 2C1XA 4KUHA 4A0SA 3WLTA 1IOWA 2PMWB 3SR3A 3RAFC 3RS7A 1TUIA 3GU3A 5DLYA 4N76A 1KO5A 3T7AA 3WWCA 1NXPA 1PJ2A 2YY5A 3BCHA 4H1UA 4E15A 4K8OA 3A3KA 3BB1A 4JB3A 3WGIA 1AIPA 1SUWA 2YYYA 3ZXXA 1G41A 4LJAA 4OFZA 5EXXA 3NOQA 1PJLA 2JKVA 4C1NA 3L8FA 4O02B 2QI9F 1E69A 2WIBA 1ZH4A 3UAWA 3OOHA 4XEUA 4KK3A 3NBUA 4AO7A 4U7WA 4DUPA 2OC9A 3HJTA 1XVTA 3QFFA 4KKVA 2Q9BA 3ON5A 4IH1A 2PKQP 1MENA 4KO3S 2PMBA 3EDYA 3LT0A 2RG1A 4F56A 3KT0A 4LJ4A 1W93A 2DR0A 1C4KA 1XDBA 1JAIA 3HJUA 1UM9A 3FOZA 3L1VA 2HZ7A 2QPTA 1DEKA 2PX6A 3IXMA 1GRVA 3JS5A 1WZIA 3QKRA 5DE3A 2PJDA 4FJ1A 1Z12A 1PJ3A 2QQFA 4IILA 5FUYA 5ITZA 2UZ1A 3MSCA 2Z8ZA 2VDVE 1VB3A 3NBAA 5CTJA 1P4GA 5IP5A 3BJMA 2G0AA 2PUEA 1N2SA 1P1HA 1JZTA 3CVOA 5AKIA 1NQAO 4G0OA 1PJRA 4KXQA 1JPJA 2JIQA 2QUIA 1FJHA 5DRYA 2A0FA 3WMFA 4R0MA 1XXHB 3OI7A 3ITDA 1Z88A 3ZHTA 2RIRA 2W6ID 5DDIP 4DDKA 4RCYA 2NVWA 3PC3A 1WXIA 5BVHA 4RESA 4KVAA 4RIIA 2Q5EA 2YJGA 4I4CA 3C2QA 3EX7C 1E2IA 3EMKA 4JR2A 3X3HA 2YHAA 4NYIR 2B1JA 1GA6A 1TI7A 3K4PA 3PSHA 3RHTA 3V4LA 3HJBA 1LEHA 1B6GA 4IEEA 2FAXA 2QPLA 4QPDA 1Q11A 3WKEA 1YZGA 5EEGA 3T9BA 3NXSA 3GPLA 2AH5A 4L02A 4H2DA 1SUDA 3K0BA 4KWHA 4OOEA 4TWRA 3ZU3A 1NE2A 3C3BA 3AIIA 3ILSA 2ZT6A 4S12A 1YR9A 3H9UA 3SZLA 2PTGA 4DNXA 4DA4A 4IYJA 4G6ZA 4KBFA 4NZZA 4LHZA 1N0HA 4PX9A 1SC9A 1TZCA 1XCLA 1J1ZA 2X9NA 3I9OA 5ANRB 4B44A 3JRXA 4HH1A 5TMDA 3HDGA 2ODWA 1XV5A 1FF9A 4HVAA 2P7HA 5EZQA 5CW2A 1EDDA 1P91A 3AZPA 2PSSA 2UYQA 4AG5A 1KEPA 2B1RA 5TF4A 4X1KA 2FKNA 1XLTC 2EL9A 3AJ9A 3JQ8A 2P3QA 3PF9A 4JMLA 3A6LA 5KVAA 1GDDA 1S2MA 2HSZA 2XUGA 4MVJM 1CJUC 2O8NA 4HNHA 1HLFA 3ZHZA 4N41A 1JB9A 2DSTA 3B13B 5B6IA 1JFTA 2BCEA 2ZAMA 2G9NA 2HYDA 2P9TA 3D8NA 4RK5A 2IOYA 1DC8A 4RYDA 2R5FA 1UPBA 4PXYA 5GZ3A 2GCOB 4KMOA 2XA9A 3BIOA 1QG0A 1RLTA 3LT4A 3Q11A 5KSPA 1ONBA 1UCFA 3GLHB 4UNRA 2XDQA 3CPJB 4RH1A 2A92A 1TL7C 2BFPA 2I7TA 1S8OA 1R5OA 3BM5A 3KOYA 4KWIA 3RS0A 2GZAA 1L3BA 3HKCB 2EXXA 1AQUA 4F46A 2R6FA 1WMDA 4GVXA 1QTNA 3KYDA 4UM8B 4WNAB 1DG1G 5BSFA 2ZQ5A 5I7EA 2GCIA 3PGA1 1PZMA 2ZKIA 3II6X 3GLGE 5I7VA 2QR3A 3FBWA 3I61A 1HETA 3IMEA 3LVQE 1EWRA 2P68A 2FPPA 5FWXB 2YN4A 5IKMA 2PT6A 5AJUA 1QHGA 1H3EA 2FNAA 5AESA 3ZCVA 1CUXA 3IIIA 5LFAA 4BLUA 4PGGA 5F9FA 4UEOA 3S28A 1ZP6A 4RZIA 2JJQA 4CHTA 2X1MA 1R64A 1E1MA 3TQTA 5GOTA 2HA5A 8AT1A 4AS1A 4FNOA 4HGZA 4IJUA 3VR0A 2PO5A 1KO8A 5EESA 1LQUA 2DERA 5FV4A 4TQAA 4IS2A 5ELLA 2JJ8A 4JP1A 2Z83A 1NG1A 4I9UA 4NCJA 3IA7A 3U4DA 2B92A 1BDMA 1KY3A 2ZDQA 2ZUVA 2IIVA 3DHWC 3HZZA 4KLZA 3AVVA 2C57A 4CMIA 1J2YA 4KPGA 1FMLA 1R9GA 2B21A 3BEDA 3JWHA 5TVGA 5FPKA 3QHPA 3LRTA 3V4RA 1I3MA 4RY2A 1S96A 2JFPA 1T8RA 1ZMTA 1KI4A 1HE5A 1GTMA 4H27A 1FL9A 5GY7A 4AUEA 3I9KA 1RJEA 3G5MA 3SQLA 4NEQA 2RHRA 2W37A 1J8QA 3P52A 1E4VA 5DCYA 1B26A 3DTNA 3KXLA 2QRMA 4X64B 3EY9A 5JECA 2EZUA 1KHHA 3VPDA 3V7FA 4A5OA 3BA6A 3KJFA 3HCWA 5I8PA 4UUMA 1RADA 2ASVA 3U5TA 1IJBA 4D26A 1JLLA 3BE8A 2W2LD 3I9FA 4L15A 1XTJA 1LX7A 5LSAA 2JGDB 2CJFA 4TT3D 2DHRA 3DHVA 4Y9UA 5M5BA 2KJQA 4WESA 5L51A 1G5TA 1ZGAA 3PC4A 1IVNA 1JPNA 1Z0KA 2EKLA 4S24A 1MNAA 1T9HA 4WY2A 2FN7A 4Z0PA 4XA8A 3HP7A 1RVDA 2BLNA 1G20A 3OM8A 4FONA 3DNFA 5GIOE 3DTTA 4BGUA 5KMGA 3I52A 2QP3A 3EZYA 2NU8B 4ZVMA 5TE9A 3LFUA 4WFJA 2IGTA 3QMMA 2PR7A 3D5EA 3EARA 5AJXA 2I62A 3ZI4A 3X1JA 1MFZA 3LTEA 4XR4A 3W5VA 3WK5A 3RQSA 2XT0A 4BV9A 5AUQA 3U26A 3ZU5A 4GMXA 4PLPA 1TA4A 4ZO7A 5FTWA 3SC4A 1FBNA 3ET5A 4UEJA 3I09A 5EZYA 1QF7A 2CVZA 4IIEA 2ZSFA 1W35A 1WLYA 2IWHA 1DTWA 3FNRA 1RBZA 3HO6A 4MV5A 3RRYA 1AB6A 1A88A 2FGJA 3R0XA 2QMHA 4QBGB 4PYNA 2IW1A 1GSAA 3ZIAA 1V39A 2WJ6A 2FX3A 3MJSA 3PDWA 3FROA 5E2IA 5KJFA 3T41A 3AR4A 1HNWB 2JAWA 3F7NA 2ZI3A 4JVOA 3FKJA 3O94A 5AHOA 3CF6R 2WIAA 2AN3A 4PNEA 3LGAA 5F3WB 3QLTA 5EJ5A 1WDKA 3RUDA 2ADMA 4QAJA 2FOIA 4IMJB 4RK0A 2GXQA 3FDXA 1YT5A 4HSGA 1ORWA 1KH2A 4E4YA 1CVLA 2DBQA 5EZ5A 1TTTA 4IKEA 1HYEA 4HMPA 2ZS9A 4K9QA 3S8EA 1JDZA 3CLTD 1A8SA 2MIIA 1UBCA 3RRFA 4MR8B 3UCEA 1UAAA 2I2AA 1EEHA 4OYLA 3ZHCA 4D43A 3C3KA 5BQPA 4GSLA 3LECA 4JLNA 4LJKA 4MK4A 3KOWA 1SFRA 2ZFUA 2W4MA 3E7WA 3VNBA 3FPJA 1KRHA 4HDKB 2OA0A 3TCNA 3H5RA 1T4CA 4G1VA 3H05A 3PR2B 5C8YB 1GWNA 3KD2A 1RCTE 2ADFA 2LXNA 2FWAA 3A1FA 1BD3A 3F97A 4WDRA 1TW3A 3BRQA 1BHJA 3D0QA 4C7JA 3L7MA 4KFUA 3LV8A 4MDHA 3HN6A 3UT5A 3WJ7A 1VRCA 1NVUQ 3HYCA 4N18A 4M55A 1VPLA 2HLDA 5KIAA 3A9RA 3G8YA 4IZHA 5AQ1A 1JR3A 1YI0A 4YV2A 4L9WA 1QOPB 3THXA 4CF3A 3AM4A 5E3JA 4BLTA 1DPFA 3KPVA 2PWZA 4RMHA 3TTTA 1UXHA 4EW3A 2H9YA 5AVVA 4L16A 5JAHA 4IQFA 4PSDA 1XZKA 3STUA 2V59A 3EPPA 4EAQA 2AMYA 5JTTA 2ZZNA 2G5TA 4IVQA 1TCAA 5EIWA 5B53A 4CM4B 1QQAA 1JU3A 3W3AH 3BUSA 2QT9A 4B79A 2O8BA 5BVGB 5BNIA 4GKAA 1EI9A 4MW7A 2OFOA 3WB0A 2CCJA 5F76A 3KYBA 3NONA 1TVKA 2NV0A 4JL6A 1K9VF 1WDLA 1C4XA 4ARAA 3E4DA 3OT5A 4FHZA 3QGMA 4GDMA 1RAHA 3MMZA 3D6MA 2W42A 3JWEA 5CVCA 3ABQB 4Q15A 3TJMA 4HAOA 3SBEA 4HEA1 1FFXB 4DLVA 3CNEA 4Y9DA 1ZY2A 5K6AA 1N2CB 1Y6ZA 3M5WA 4UEQA 4BO0A 3WGJA 5I45A 2NPFA 1YFZA 1P7CA 2WM8A 3R7SA 1Z2AA 2XUFA 2DOKA 1E9EA 3OQHA 3C98A 1BYUA 1I1OA 2BEWB 2QL7A 2X7JA 2GPNA 4ACAA 3I04M 3RD5A 3ZTYA 1TTHA 4YQZA 2ZWVA 1G63A 1CV2A 5CB6A 3O8OA 1AKUA 3LKDA 3QLVA 3MCAA 4FBLA 4GZ6A 1W73A 2FPUA 3K9BA 3LVBA 3G8CA 4X1OA 4BQPA 4DCJA 4ZYTA 3RRMA 2FWJA 2J9ZB 3D1VA 4DW8A 3IQEA 1IOLA 4HCJA 2VDRB 2WYWA 1P1BA 2OGZA 4KMSA 4XD2A 4Q9AA 1YKSA 4QBFA 4X1YA 2FW7A 1P3Y1 5D8DA 1IEWA 2ZTHA 1DBPA 3UUFA 3ZY2A 3NNSA 2EAUA 3W8RA 5ARBA 5L4LA 5L7TA 3N6XA 4FUQA 4U63A 4YP7A 1QIGA 5IBCA 4ZZ2A 1X2EA 3DJFA 1MAHA 1XCOA 2QTVB 2YXDA 1M6WA 1DAKA 2I4OA 3OCVA 2ZRJA 3AB7A 4GBMA 1NJGA 3DZJA 1VL6A 3W90A 3ZX5A 3S2FA 3AVQA 3WC4A 5IN4A 4ZALA 4DKXA 2Q6TA 1Q0QA 2XA2A 5LJIA 1KPHA 4PZCA 1CYDA 2ORIA 2YZ2A 1H6BA 4TV9F 1RYHA 3DEAA 1UT6A 2WJZB 5KOJA 1VE1A 5F78A 1QYDA 1E2DA 2B35A 5ADVA 4U7JA 4YRIA 2EBUA 2IXFA 3KU1A 3W9YA 4EHLA 5LQNA 4PZ0A 2HD4A 3IKJA 3NDRA 5E1BA 3I5XA 4XJTA 1KU6A 3VYVA 1BHQ1 1U5BA 1UDRA 4ZEVA 3VU8A 2GBFA 5LBUA 4P0TA 3F3KA 3SZOA 1E9DA 1M6VB 3QFCA 4JGBA 5C8DA 5FWNA 4MUGA 2GNPA 3OO0A 1ZVJA 1JHZA 3X1XA 3CJRA 3I39X 4NATA 4EGFA 2FW1A 3HXLA 3QKSB 5CCBA 5HUJA 3K73O 4L22A 4JQSA 1UP6A 1NUSA 3SR0A 5KREA 1HNXB 5DWDA 5ENZA 1X9HA 4J90A 1K63A 2DC1A 5LZ8A 5ICGA 3MXTA 2O06A 1PR6A 2VPIA 4HXYA 4JS0A 3O95A 2Q0QA 3KZVA 3ZWCA 2AUNA 2OO5C 1TRKA 2PPLA 3REFA 2IOFA 4XYEA 4DLKA 4LECA 4QXRA 5LA6A 2TSYB 4BECA 1GCIA 4TVKA 4OHZA 2HU7A 1K7YA 1OW3B 1MX5A 1IM5A 1WD5A 4JUBA 4OOFA 4PRLA 2X5NA 1DSSG 5F2EA 1I32A 4DNPA 1J39A 3SKYA 5INTA 1XTUA 1V1RB 1C3XA 4KVGA 3VZQA 3WGOA 1HT0A 3ZLUA 2ZZMA 1Z8HA 5F9MA 3X43A 5FOTA 1FP4A 3FNEA 2G1PA 1TT7A 1JDUA 4YBRA 5BN1A 1K5HA 2BFAA 3PRJA 2WHPA 3K0AB 1SVSA 3NNNA 4OLJA 3NUZA 1ZW6A 2HSDA 4D82A 4S0XA 1CUUA 5CDGA 1JHAA 3PB3A 4M0DA 1TEZA 2JIDA 2IODA 3DB2A 3E23A 3L46A 3CNLA 3G89A 3Q3IA 4WCFA 1V1MB 3ZH2A 1OA1A 3ZTTA 1Z74A 3FZNA 1C81A 4ACBA 1SXJB 2D06A 2DHQA 2O0KA 1WP4A 3EH2A 1FYDA 3JX9A 2WAMA 1G8SA 3V1LA 2WHRA 2WF5A 2P78A 5K6RA 3QMPA 4HYYA 1LRKA 3GC6A 2Q1YA 4YGXB 4UVEA 2HDHA 2EYQA 2GVDC 3WL8A 1KPGA 2PZFA 1SQ5A 5HA5A 4MLPA 4S04A 4N3CA 1W46A 1BGVA 2ZVJA 1AG9A 3THRA 3UJNA 4KO4S 1C0LA 2EOAA 2RHTA 3JYLA 3VZBA 4D9GA 5CFZA 2QT1A 4Q3KA 1XRMA 3P9IA 5H83A 1N2OA 2QYHA 3FPFA 3MXOA 1ITZA 1X80B 3NTLA 3B89A 2YV2A 1UFRA 4C4YA 4ZHSA 1B76A 1RQPA 1UQUA 3R7DA 5K4HA 2A5YB 3U39A 2E1PA 3QNWA 4EX6A 1FTYA 2VG8A 3ZOZA 3D5QA 5GV8A 5FYQA 2XQVA 3FG9A 3K9GA 1Y7LA 2DR3A 5CT6A 1U0SY 3C24A 1E5DA 2FFBA 2G04A 4O4HF 1JHRA 1XVIA 2HSEA 3C39A 5JWOA 1GDTA 3A9CA 5L45A 4D92A 5F77A 3V8RA 3CTMA 4D9IA 5FWYA 2OUIA 2B8JA 3O83A 1TQDA 4LG1A 4ZYLA 2PDAA 3RKSA 1FX0B 2WVHA 5J3JA 3GV0A 4C7KA 1PJSA 2A3RA 2MU1A 2X4LA 3HV2A 2NZXA 4EO9A 1X7HA 2QRGA 2BGMA 5AW2A 3ZD6A 4IXTA 1GSHA 4DRYA 4BZWA 4CMEA 4FSXA 4CM9D 3JTMA 3OZDA 5CJ2A 4JP5A 4EG1A 1LSOA 1Z18A 2JNWA 4O8CA 3SKVA 5IFLA 5LQKA 3ICPA 3GBVA 4N7MA 5DGHA 1ZFNA 1IE3A 1VC2A 1S02A 3UG6A 5ARDA 5KEIA 1DB3A 1P74A 2B5OA 3KB2A 3FNIA 2CXHA 2GTHA 1PQ4A 4QJ5A 2BBOA 3V34A 3LWZA 5AXBA 3N0RA 1AUXA 3M1AA 4DANA 5GVRA 3OFKA 1ISRA 2B8NA 2F43A 2F3SA 2O6HA 2GF9A 3LPNA 4IDBA 5IKPA 3DLAA 2YZNA 1I24A 4I8XA 4KXXA 1N2ZA 3A2NA 4MCIA 3PNVA 1MIHA 1U4OA 1NOJA 2IHKA 4L0CA 4LN1A 4HNTA 4G41A 5M7EA 1UZNA 4NHEA 4ENRA 1N25A 1T0HB 3PGVA 4MQ4A 5CXSA 5FBWB 1LPSA 3QFRA 2ZJAA 5G40A 5KNCA 5ERXA 5HP4A 3H17A 4OD0A 2J0UB 4CL3A 5CNKA 1EK5A 1LS6A 8LDHA 2WINI 3HXKA 1XEXA 3O74A 2NU9A 3MN1A 3NYIA 1HT2E 3ZGYA 4Y30A 2VTBB 4HQOA 3F9CA 3O90A 1P9RA 3EG5A 1FRNA 3Q40A 4JR0A 3RBAA 3TDKA 5JHGB 1OXBB 3EGXA 4XIFA 3G5UA 4ZVQA 2FMIA 5CLLA 3W4KA 3HKEA 2X3UA 1VLVA 4HDSB 4CLEA 1GA1A 2YZ7A 3IR5A 4HGYA 1NBMD 4QQFA 2ZJ4A 3U44B 4LTMA 4PIPA 3MB8A 1GDHA 1X19A 3QKUA 5SV2A 4J7XA 5JAMA 3QITA 1U2DA 4JKOA 5EFOA 2J3LA 1K6EA 4AKGA 2O2IA 2XLBA 4EA9A 3F67A 4LZOA 4E0BA 1JAXA 2HK6A 5HMLA 5F21A 4UBIA 4MYCA 4GX2A 1BH6A 4DIDA 4ENUA 3UENA 1U8CB 3L6UA 4Q1DA 2R7KA 2WJGA 1GYQA 1X7WB 3DAPA 2ZJYA 3B7WA 2UZAA 4MKZA 4ZO6A 5AOVA 1HT1E 4I1PA 1U1GA 2A1UA 3NVAA 2OD9A 4JLBA 3IUBA 2RHGB 3KDPA 5C18A 5F73A 2JD2A 1GLGA 3M82A 1Y3DE 3SIPA 2Z6QA 5PNTA 3LLSA 3SXUB 3ANXA 3G8BA 3A4MA 3AUJB 4G37A 1TYBE 4BJ3A 4M22A 1CUZA 1J9ZA 1WXWA 2D8AA 3L8CA 3P4XA 4TXNA 5IDYA 2UZIR 2RGDA 1O03A 4JH0A 1MPTA 2APJA 4ZT4A 3QOYA 2OQRA 3IT0A 1CLUA 4L8YA 4COOA 4F6LA 5CFMA 1WY5A 4CV2A 1JRLA 1I3LA 3OU6A 5ENDA 4AF8A 1J00A 2O4CA 4MI3A 2W22A 2WJJA 5AHRA 3OLYA 3DKRA 4RS3A 4YMTA 1G6KA 4HB2A 1M0SA 4MMYB 1YZQA 2DBZA 3CGGA 5H82A 1ESMA 2BYTA 5ALTA 1Z6PA 4HGPA 4Z9XA 1QHIA 3ZGOA 4GX5A 4C4RA 1LK5A 4DUZB 2AFIE 2NN3C 2W7TA 2CLDX 1SCJA 4DWOA 3WFZA 2GZMA 3AJEA 4ZVSA 3V2UA 2IBTA 5H8WA 4KPYA 2AI3A 4BZXA 5CIWA 1PYGA 1XQVA 2NZUG 2HQBA 2NP6A 4BBAA 3UOGA 2FMXA 1NHGA 2HDNB 2Z8YA 3L1JA 2BHNA 4LBWA 1RWBA 2ZT5A 4JLUA 1M73E 4O59O 4DR5B 1C9YA 3DDHA 4XDGA 4AP6A 2WE7A 2VQSA 4GT1A 4TT8A 3TXYA 3RSOA 4YYEA 3NFYA 2WU8A 3OPMA 4MUBA 4RVOA 1UPCA 3E03A 4C7MA 4WN3A 3K5IA 4K26A 7MDHA 1FP1D 1NNSA 1ZCZA 2G1AA 3CNOA 1N6LA 3GLKA 2W98A 5C32A 2X9LA 2GFHA 4RJJA 3QVSA 1S2GA 3SJUA 2CB9A 4JP3A 4XUGB 2HTFA 1KDZA 4IHJB 1E62A 5KCZA 3KBOA 4BNDB 3CN7A 5AKKA 1J09A 5FQNA 3R6DA 4AZ3B 1FTQA 2ILVA 3QKWA 1FNMA 1PJ8A 3UAOA 4ED9A 1RYZA 1VG1A 2ID9A 4HMQA 4YQYA 2D5BA 2X7XA 3NHMA 1VP3A 2CYCA 3D81A 5FA6A 4RGVA 3VTKA 4JYZA 3QNUA 4WN9A 4D3SA 1VPDA 2AMLA 3L4EA 5TQVA 3L8DA 3GYGA 4B2PA 1GPMA 1X70A 4N8EA 3PFBA 4EH1A 3N2IA 2JFWA 2E4AA 4P1ZA 1E94E 3H6KA 5KVSA 2VYQA 4B6RA 1VTKA 1NWHA 2O0JA 3IQXA 3RU7A 4XQ0A 1T5HX 1FLNA 1I36A 3H19A 1GFIA 1YZLA 2H1LA 1DJLA 1SHKA 2K5UA 3P2JA 1P8JA 2GJ4A 4HFJA 1T2AA 3J7TA 4OQFA 1U6IA 2OCAA 3QFTA 5NULA 3P9XA 4Y6RA 2I7XA 4FGKA 4P4UA 3U40A 4ARCA 3QU4A 1VA5A 4GICA 4MA0A 4OM8A 3A1UA 3B82A 2JA2A 3UANA 3HCFA 2UVDA 3CQ9A 4KIGA 1M9NA 4BLSA 4M0FA 4BXOB 1F4PA 2N46A 1V11A 2PZKA 5EG5A 5C3UA 3EDCA 1F8XA 2BUBA 1D8TA 1E32A 5B1DA 5DYWA 2ATCA 2IV3A 3RYIA 3RYHB 2Y2UA 1RRCA 3WIVA 5KYXB 4XKJA 1OPXA 1NW7A 4RU1A 3ADCA 3QVLA 1GUFA 4BVAA 1QFMA 4O1IA 5FBKA 5CBPB 1NW4A 4FFMA 1MO4A 2AG6A 3KAQA 2B7CA 1ZUIA 1QANA 2CUKA 3KOZA 3C6YA 3JZAA 3SDSA 5LMUB 1XMIA 3ZYZA 3ZVNA 3JW8A 4Z4GA 3FYUA 2R86A 4HN2A 2FN4A 1E0JA 5J2TA 3V5NA 3UQZA 4MKXA 2CLMB 3HU5A 1P9OA 1CB0A 1SKAA 1RAGA 2ZB8A 3CUVA 3FBGA 3TR0A 5JTUA 1XSEA 3ORYA 2PGNA 3EZLA 3G2QA 1E3WA 3GNQA 4CF6A 4ZRNA 2PRKA 2Q2QA 4MPJA 2PVSA 1N32B 5K4AA 1WZCA 2MYUA 1R6TA 3FTPA 4LE1A 2J07A 1VHQA 4ETIA 4XPIB 2OV4A 5IM5A 4NYJQ 4YRBA 4X92A 2VP4A 4GGPA 4OHRA 3NHSA 1FYVA 3SZ3A 4KE7A 2VCYA 5K8UA 2HF8A 1FFWA 1KJQA 4IX1A 1XTQA 5LZ4A 4EJ0A 3EQ2A 2I6FA 2V5UA 3COSA 4ZQCB 3KJZA 4C3UA 1WQ3A 4J91A 1JJAA 5LQDA 9LDBA 2YWJA 1PSWA 3K31A 4EECA 3AUKA 3N7AA 3EOAI 3KDAA 1GN9A 2DHDA 1JDTA 1BHSA 1CSEE 3FUCA 4PFKA 5GMOA 4CRWB 6AT1A 2V3VA 1YI8A 3K96A 2GA8A 2Y0PA 4HWPA 4TMVA 1HK7A 2GXUA 2UYYA 3E3LA 3KLMX 3LG2A 2IDKA 1WA5A 4MUHA 3CINA 2PQ6A 6REQA 3BMNA 5ALPA 3BHIA 1T6ZA 3HUTA 2C0CA 2ONCA 4FEAA 3MFYA 2C5LA 2IZ1A 2I4TA 1IN5A 3B5EA 3ZG6A 5EJFA 4KC0A 1H85A 4LXHA 4Y2RA 2PAAA 4I1YA 4MQEA 3DZIA 3FY4A 2WD8A 1VI5A 1PR2A 4QNRA 4DT1B 5KWSA 3O8CA 1Z2CA 1W88B 3BMQA 4A03A 2RK4A 4ZOLA 1KXJA 4YPOA 5CT4A 2QIOA 2W6QA 1KQFA 2XB2A 1OAOC 1SU6A 5M3BA 3LUPA 2C03A 1E5QA 1RQGA 3OZAA 2QAGA 4Q7LA 4Q4JA 5CVJA 1FNDA 4H16A 4ALKA 3ORRA 1ZL0A 1ID8A 3C14C 2OWEA 1EWKA 1KP3A 3UQYS 1JWAB 4N3NA 3UICA 4B43A 1J0AA 3CBGA 1OB2A 1YVDA 5C1BA 2FU5C 2GRAA 1XCGB 2H0QA 4JXKA 4MV1A 3VR4D 3HNOA 2ZS7A 4KNYA 3AB8A 2BH9A 4KEAA 2J30A 3N0XA 1P5JA 2GNOA 1KERA 1EWQA 1DC7A 2VDWB 4DMFA 4E1VA 3JARB 2Z2JA 1PL0A 2VUUA 4NBTA 5ECYA 4S05A 1THTA 4FCWA 4QDUA 3LU1A 2AZMA 4Q0MA 4RH3A 3K9QO 4YMHA 1UOPA 2F9FA 3QF4B 2CLKB 3H2JA 4YBZA 4Y2GA 3U61B 5B3JA 4XWAA 1ZJWA 3Q8KA 1YHZA 3KYCB 4BEWA 2SKEA 1QLHA 4NMMA 3UAYA 5EIOA 3TNLA 3VAZA 5AHWA 3AJAA 2QRQA 2NV2B 1OU0A 3DV0A 3FAZA 4H3VA 3UB3A 5K6TA 2QXYA 4J0CA 4YRNA 3O7WA 2JGLA 4XYMA 4KO2S 4F5WA 3MBIA 3HJRA 4HPWA 4EPYA 4F6RB 5DOZA 1QIEA 1XHLA 1FS6A 2D0OB 1J8MF 2SKDA 4CCSA 1M75A 1S3IA 4W1PA 1QV6A 4N12A 4AWAA 1R4AA 2CLOB 3OOJA 4FZJA 4YAFA 1Q2UA 3FVRA 4MLZA 5DHRA 3VRHA 5MHTA 5U4QA 2EQAA 3OICA 4XCQA 3N28A 5DLPA 2Y76A 1K6IA 4US1R 3WG9A 2QZPA 2R84A 1FY2A 1U8ZA 4L3WA 4L9RA 1ORTA 2YIMA 3ZKWB 2RIPA 4Q21A 4BP9A 1KEVA 4P7BA 1V5WA 3EIXA 1ZLXA 4Z1MD 3GY0A 2AF3C 3UK0A 8ABPA 4F3TA 3GRUA 2Q3FA 1SZPA 4XB2A 2Z8XA 3HHEA 2IW3A 3FGPA 3C7KA 2KMLA 2NZ2A 3SC2B 2HL6A 3D0KA 3C41J 2YHSA 2VS1A 4CGYA 3RROA 4X20A 2AFHB 2G36A 4BO4A 5KQGA 3QVUA 2DULA 3P7MA 3G2JA 4WZZA 3R74A 4CLDA 2XGSA 3QU2A 1T0UA 3RUCA 2BDEA 4M1OA 1ZMRA 2ZB4A 1WZUA 1Y3FE 5FHRA 5JMPA 3SSAA 4QG3A 1MJGA 4E46A 1H42A 2JVIA 3O5AA 4QDJA 3LDGA 2VP5A 3L06A 2FPIA 2WPDA 4M1EA 1VKZA 1SCAA 4CM8B 3ESBA 1VJ1A 1LFDB 4HWKA 2XMBA 5C3MA 1LLQA 1QE3A 3MTAA 1H3NA 4EBFA 3DBVO 2IOQA 2IYSA 3FVTA 3D3WB 2ZUTA 4FZRA 2ZSBA 1HC7A 1IEVA 2Q3DA 1YBFA 3DWFA 4HJXA 3K35A 4BEBA 4CUZA 5C2JB 4RK4A 3F5FA 4PRZA 1E1LA 1QS0B 5JDIA 1QAMA 2G9ZA 1FUUA 5C53B 2WQ7A 3TOVA 1Q7TA 2AK3A 1TEXA 1E79D 3BRSA 3D4LA 4OMFG 4YC7A 1QE0A 4YT5A 4A3SA 4TRRA 5DISB 2WSLA 1RZ3A 4RGYA 4RULA 4MP8A 3DO6A 1KBOA 1SBNE 3R2JA 4BVKA 2LKDA 2XNDD 4Q18A 2NPIA 1YS2X 2J3HA 3B53X 4WFIA 5HKKA 4ARBA 5KX5F 4KFSA 2XOKD 3H9BA 3A6HA 3D6UA 3GP5A 3OMLA 4D56A 5IVHA 3DE1X 2YXBA 3MHPA 1M6NA 2YHIA 1US8B 4MJXA 1KZHA 3M33A 4B1FA 4EI9A 3C3YA 5M04A 2CFCA 2ZS8A 4Y18A 4PN7A 2GTIA 3ZS9A 1NPYA 2MWMA 3F0TA 5IHPA 3PEEA 1GZ5A 2C7BA 1VZ2A 3THWA 3O8DA 3O4FA 4KDRA 2BHLA 2I3DA 3HA5A 4TQGA 3KEQA 3H9GA 2IH4A 1YR6A 3WP1B 3A25A 3Q6MA 2JFFA 2YBDA 2OQ2A 4JIGA 1KYIA 4L5CA 1IY9A 4BU1A 1RHRA 4W5WA 4E5MA 5JD6A 2FZVA 2ZRQA 3C5VA 3R40A 3T4XA 4YAGA 2BGJA 2H4XA 2ZR9A 3WP0A 1N9GB 4N49A 1DJOA 3NDIA 3RASA 5KWVA 1IEXA 2ONYA 5IC6A 1OXVA 2PGXA 4KQJA 4B3HA 3U4MA 2OKCA 2CXSA 3OHSX 4E88A 1QBGA 3JQAA 4UQOA 2BFBA 2Z5LA 1AM4D 1T1EA 1AHNA 1E60A 1NHWA 2I03A 1XN4A 4DLUA 4NFLA 4PRKA 4ND8B 2B34A 2Q29A 1P3DA 1QGYA 3R5HA 4BX0A 3GCXA 2PG3A 2O8CA 1OC4A 3J81A 1SCDA 2ZSAA 3BAFA 2C77A 1QRSA 1MB4A 2ZUFA 1UMCA 3E5HA 4J3NA 3GWZA 3IHKA 4JQZA 1LC0A 1CQIA 4GQAA 1COZA 4N5LA 4RNDB 4HDNB 1AGRA 1KK3A 3I1FA 4YJ2B 5ICEA 2R66A 3NWJA 1VLMA 1YOVA 3CZMA 3EXEA 2EJCA 1LPMA 1Z8FA 2Z08A 3PEYA 1MX9A 1WXGA 3VTAA 4DFDA 2FVYA 1X1AA 3G13A 4FHEA 1AKMA 1R4MB 2QUZA 4CKEB 3NRCA 5I7RA 1YJQA 1CRPA 1K7EB 2YV5A 2QW8A 2JJYA 2X0KA 3ASZA 3OLVA 4L2IA 2R751 2LDXA 4WEOA 3K7EA 4LJSA 4WKCA 4ENPA 2CXUA 3DZBA 2CL0X 3KEGA 3OX1A 4D3XA 1Y6FA 1JH8A 4PFJA 4S1WA 1V95A 2UDPA 3OFJA 2JAXA 1FDWA 1MXFA 3A4NA 4XJXA 2VSOA 3RK4A 4M9SA 4E5UA 5K45A 1Y6GA 4YUYA 3VJLA 2DETA 4ZVPA 4BRWA 1EFVB 3AOGA 2XCOA 3NBMA 3VPSA 2D0DA 5JNWA 3ZNNA 3M2TA 3TMKA 4EW1A 5KNBA 3KM0A 3SE0A 3HU2A 1SOUA 5CVEA 1BA3A 4JEIA 4YVFA 4E09A 4EPXA 3QU5A 3N07A 4ZPJA 2UXDB 3A6FA 3HADA 3N1UA 2QKYA 4PW0A 3NWBA 4REMA 3JAWA 1IONA 3L0SA 4F97A 2WSMA 3C6XA 1YE8A 1MB2A 1NJSA 2ZSIA 3PL5A 5CVDA 5KSYA 3NHWA 2B1QA 3A6DA 1X8KA 2E0IA 3MK31 4Q6BA 3BDIA 3Q12A 4YCLA 3AFOA 3QH4A 1L7NA 3WTCA 1G3RA 2ECQA 2I4RA 2DR2A 1PYOA 2FI1A 2REQA 1MQ8B 4DYDA 4ZA2A 4PLHA 1UDWA 1RC8A 5TMPA 2XUDA 5JZBA 3QUAA 1E3EA 1WHSB 2MSLA 3TSCA 4DLPA 1VE6A 3RTCA 3E84A 4NC9A 5EMNA 4ZIRB 1RDFA 3UV3A 2NYRA 2JEYA 1FLAA 3FW1A 3L1UA 3PD0A 5F3RA 1MF7A 3ZHOA 2NYVA 2UUPA 3DQQA 3EA5A 4F7WA 1DC6A 3D7SA 1H9CA 3DBRB 5LOVF 1NDHA 4YMGA 1SHLA 1ZX1A 2R1ZA 5B7GA 3OIYA 4CCWA 2XMQA 3QTLA 4R16A 1TM7E 2OVBA 3E22B 2HA4A 4YRCA 4RY9A 2RGRA 1EUCA 1EQ2A 3DP9A 3ESAA 3HC7A 1B8OA 3M4JA 3M6FA 2VXOA 4O4IB 4RKYA 1QZ3A 3OZIA 4BMSA 2QM7A 5FBQB 3WDKA 2QSUA 2JFOA 1Q57A 4ENWA 1WY7A 4RW0A 4UTXA 3WV4A 3IIKA 3IMFA 4M53A 5I8WA 2NXWA 3DPUA 3GFOA 1HFKA 5FR1A 1X92A 2EDCA 4LTNA 4BPRA 3U09A 3NO4A 3G88A 3NJRA 2DF8A 2WIGA 2FZKA 2HK9A 2PX3A 3A2MA 5DM4A 1LBEA 3R24A 2FF7A 2PL3A 1KSGA 2AR9A 2DQYA 3WL5A 5H3LA 5E38A 4WXHA 4KZKA 4IW3B 4OSPA 2AW3A 2PUGA 3FPCA 4ZOAA 4V0LA 4GW3A 5T3UA 5GJWC 3KXKA 2ZEJA 4AJOA 1JFFA 4L9SA 4REOA 2PH7A 5AHXA 3NOXA 1HLDA 3PCRB 4BTVA 3VHQA 3SVTA 4WY5A 2Q5FA 1PZGA 2Q7OE 2ZB7A 4DM7A 2PS0A 4WSOA 1ZHHA 4JELA 3E05A 1UOEA 2PZ8A 3FGOA 3PITA 4WA8A 3TIIA 3GLGB 1JEYB 4Y9RA 4ZOBA 4E2ZA 2C3UA 1J90A 1KS9A 2EW1A 3TRDA 2BKEA 4WKNA 1GRCA 4BUCA 3F5SA 3EVBA 4OU4A 2I6GA 2F64A 3FWKA 3F4KA 1PT8A 2IHBA 3GLTA 3JSAA 2ZITA 4LV5B 3EPRA 4PLGA 1EUDA 1LI5A 1VCOA 2P9ZA 3TLBA 3NBQA 4QWWA 4NNPA 1Z4IA 1KDPA 2QRZA 3UWKA 3KKMA 4F3YA 1TW2A 2PYDA 3CCFA 3L6CA 2QSYA 3UM9A 2PUTA 4DXHA 2YS6A 4YS6A 2E87A 3D7KA 2WAXA 2C9OA 1LXCA 5DHTA 1L8XA 1GG5A 1NQXA 2DPXA 1LFAA 4RTOA 1UWKA 1QHEA 2H9AA 2J3KA 3LPDA 3SDZA 3ZKAA 1EWYA 4MKGA 3LLUA 4Q7EA 4UAGA 1M76A 3JQCA 5ENVA 4RSHA 1T3GA 4RHFA 3B48A 4C7BA 1FRVA 1EKXA 1KC3A 1N2HA 3UK2A 3VI4B 5B2FA 1WL8A 2Y1DA 3OZRA 1FTNA 3R09A 1HOTA 3NYWA 4G4GA 5JD3A 4Q1EA 2WF6A 4H31A 1BX1A 2AN1A 1JEJA 2QG6A 3FI0A 2Q4EA 4L6AA 3HKBB 3BD6A 4Q34A 1NW3A 4ZO4A 1VJ0A 4EFKA 5KKNB 1R15A 2X8JB 3UT0A 2R65A 1KFJB 2IZ7A 3ZLJA 3BZUA 3NC4A 1QYVA 1GGMA 3KSMA 4CQLA 1PEYA 4WK6A 1NRXA 4RDHA 4BUZA 5IVDA 1CDEA 1OREA 5CLIA 5I5EA 4U2DA 2I91A 4CLOB 3WLSA 4U2BA 2ODPA 2JFBA 3ABZA 4I1SA 4MWOA 4ROTA 2ETVA 4WRRA 4KQ6A 1ADBA 2IEAA 3AHEA 3BT7A 1QXSA 2X0DA 2FLWA 2BMDA 3MINB 4EHBA 2ZUEA 2IOFK 3OWXA 2QSZA 2QWXA 4EHFA 1XO1A 2OAQ1 2IV2X 1W48A 1O7JA 3IUNA 1RHQA 5F1PA 3HEAA 4IIVA 5IYZB 2K2QB 3PHCA 4WBNF 1J9GA 2QVZX 5AIBA 3HWX1 3F96A 2QX9A 1C9EA 1E89A 2AQ8A 5HCIA 4OP3A 3HNPA 3O0DA 5JCOC 3B51X 3D5TA 2XIJA 3KVYA 3I45A 3G1UA 4WD3A 1PNRA 1I2MA 4XDHA 4LYFA 3RWOA 3VU9A 3P9KA 5LMZA 3MRSA 2BT4A 5FI5A 4A8JA 3OT4A 1WCIB 1AN0A 1L4BA 1RHKA 2CUNA 4JB0A 5DTEA 1V6CA 2CXTA 1BJRE 1WMEA 3RS2A 3Q7SA 4PNPA 1T2DA 1UPUA 2HDWA 1QH8B 3L7NA 4L07A 5J23A 5KVCA 2P9FA 1DEOA 3WRYA 1ZRSA 2JI6A 3AFNA 1GQYA 4MWEA 1F8FA 3X1KA 1NJFA 5I51A 3ZXSA 2ZIWB 3MPUA 3PG5A 4TTIA 1R5JA 1XROA 4O5AA 1EP3B 4I4TF 3PNLA 5IASA 3A0UA 5F7JA 4BV2A 1HEYA 4M37A 4FYYA 4RA6B 3NANA 3V2HA 4KNWA 4BNLA 5EY5B 5CB4B 2AJLI 4BLWA 2AOUA 4JXZA 2BTOA 3D6AA 2OR3A 2FK7A 3GYBA 1OFIA 1R50A 1NN3A 1EX7A 1ML3A 2WT8A 4HSEA 5IKOA 3WRXA 4GLOA 3CUTA 4L4YA 4C04A 1YVUA 4S1PA 2JIZD 2C20A 2CDNA 4URFA 5BN3A 4Q24A 3WADA 1P62B 1G60A 3AI7A 4WGGA 2IF2A 4QEDA 3EBOA 3AQIA 2DFDA 3GRZA 4ZCLA 1NXXA 2PUWA 4M1TA 3EVZA 5DT9A 4CT5A 2QAJA 4JJGA 4P53A 4ENTA 3CVVA 1KO7A 1PX2A 3WOVA 3IEVA 4L8VA 3D4NA 2H18A 5B1SA 1JSRA 5JVDB 2G6BA 1PL7A 1TQ6A 1BGWA 1WS6A 1NPDA 2XEXA 2B25A 1NVVR 2AC7A 5EPEA 3ZE8A 5J5VA 4RPLA 4B3CA 3MHTA 2VNKA 3DMGA 4MUKA 3ME5A 4OAOA 4A26A 1E1KA 3T5GA 3UAVA 3GJ0A 4FB4A 3TIXB 3C74A 4LHSA 2BP7A 1EK0A 4UBKA 1PJ4A 2YHBA 4MUNA 4A23A 5TQ0B 3H5WA 1I7DA 4HR7A 4PZZA 3AKCA 4GQIA 1Y63A 1Q1ZA 5DM70 5LN1A 5BQ5A 1PG0A 1W19A 4AX8A 3QZUA 3AEXA 5ARCA 3AHGA 4RV5A 1GNPA 1GRQA 2Q4OA 3BMCA 3MQ4A 3WNZA 3R0ZA 1H4TA 3REGA 4EENA 5CDTA 3WZMA 3SS7X 4NYMQ 1IAVA 5HWSA 3DBOB 4FX5A 2GMWA 5A0VA 1ULSA 4DDMA 3EAFA 4FX2A 3SEQA 1K3UB 1GGEA 1CJKC 1HEUA 2VF2A 3L3BA 4AFNA 1XCBA 2JI7A 4OUDB 3W5BA 4DZTA 3LA6A 3LD9A 3ROEA 3K72B 4PNZA 2EATA 1WCWA 4O2BA 3RVSA 5CM2Z 3L1KA 3I01A 1YRLA 4JYPA 2DJIA 4PZDA 2CL5A 2WJVA 5DH9A 3VGPA 3CE9A 5JEDA 1Y1LA 3W05A 1VQ1A 1KO1A 3HFRA 4RTMA 1QIJA 3DFFA 1VRWA 3HUDA 1M54A 2X42A 3C6KA 4HQNA 3QG1A 4QDKA 5K3CA 1I7QB 2PX2A 5K3EA 3NPAA 1MO2A 1KDVA 2HFJA 3HJFA 4AI6A 3DFUA 4BTLA 4XCVA 3BXOA 4HB0A 4I6GA 3H4TA 1D4OA 4YRZA 3IP7A 3V8EA 4NJMB 3D7NA 2G4CA 4IDHA 2HCJB 2W2VA 4FNAA 4MP3A 5HZGA 2HHJA 1E61A 5DHUA 5KTPA 1AKVA 1KZYC 1R0KA 2Q4RA 1U98A 4RZUA 2E85A 5CA1F 3TX2A 2QRVA 1SCIA 2QNBA 4ZGWA 1LWNA 5BR1A 3SHQA 1CD5A 3JASB 5F7XA 1EM8A 3B38A 2UU9B 4RD1A 5JE8A 3V4SA 4A73A 1P17A 1T36A 2O5RA 4RIGA 5A3VA 3UMJA 2FXVA 1CBUA 5BMVF 3PD7A 1M0EA 1QWSA 3P9CA 2VH2A 3CZCA 3WYAA 3MMXA 2FETA 4GOXA 1ZNQO 3UMFA 4OYRA 2ZR0A 2LVBA 4W7HA 2CV0A 2P3OA 4RH0A 3LCJA 3K9FC 2B2CA 1U7ZA 5LDGA 3TLYA 2D59A 3R6TA 4BU0A 1DWUA 2VP0A 4MV6A 2FFJA 2H1RA 1N5JA 3A4YA 2OGSA 1SKQA 5JANA 4XRRA 5LR6A 2QRPA 4I9HA 1FPQA 3AP3A 4TLMB 4JI6B 4DIKA 1COWD 2NZ8A 4J43A 2P2NA 2WWRA 3OTWA 4IXNA 3TFOA 1WSDA 1Z0IA 4OJYA 1P7YA 421PA 4KFCA 4EA8A 1NXVA 4DHEA 4URWR 2V7VA 1G9SA 3IPLA 3IURA 4Q3CA 3T5MA 5IVKA 2RGAA 3QEMA 1T9GS 3WDSA 1OCEA 1RAAA 1U8EA 4MAAA 1XDWA 4YIKA 4RJLA 5HX7A 3IYLW 4QKQA 3GW8A 3KQNA 3RFFA 3ZV5A 3BHJA 1Y4AE 2CFTA 2M32A 4KQFA 1U2GA 2R6JA 3R77A 4L3VA 3C6ZA 5BN5A 2FN3A 3RGWS 4LZWA 4TTAA 1KVQA 2F1IA 4QREA 5FWAA 3T9CA 3AJRA 1N36B 1L4MA 4KHPB 4Q1BA 3VYTB 2V8BA 3NTOA 4V1CI 4DNOA 2VHCA 2YRXA 5C8XA 1GNLA 1CX9B 3HEMA 2G67A 2VYND 4IIBA 1QV9A 4GWGA 1IQUA 2XAUA 3M6IA 4P6VF 3IBYA 4RK1A 5HFNA 1CJSA 5KSWB 1XZAA 4LOIA 3T5CA 4G0WA 3X0DA 5JSYA 3QXXA 5IKXA 3FRIA 2ANBA 3I53A 3W7BA 1TAGA 1BAPA 2VK2A 2JG3A 5A5VA 3DMTC 4MRSA 3INRA 4LI3X 4FI3C 2QZJA 2WFZA 2OO3A 2WSSA 3F6PA 5BW6B 2QMOA 2MYTA 1Y4DE 1J42A 1E4OA 2O07A 3QNMA 5HFJA 3O6VA 3L43A 3BIXA 4OMUA 3UFBA 4B6GA 4BNVA 2VNHA 3J80A 5DM60 3MLEA 5KMGB 3ZY4A 4DIEA 2GN9A 1QO0A 3PBKA 4N0QA 4Y0AA 3ZJ4A 5A5GA 5H4GA 3K4HA 5HM6A 2CHUA 3ESYA 3CJTA 3NIGB 1E3IA 1GAJA 4FS3A 2F1KA 3KQSA 3NEPX 3HY6A 3HU1A 1A1VA 3OEEA 3BK1A 3H97A 4I4TA 4EG3A 2I7CA 1TJNA 1TZBA 1NMXA 2P0YA 2WABA 2QORA 4WXRA 4ZQIA 3SE7A 4OGKA 4B7UA 3TUZC 4XQ9A 5EJ4A 4MAFA 4J1QA 2TRSB 1IATA 5AVXA 5I7OA 2PKXA 5KKAA 5DSTA 1Z4LA 4U7PB 3BRWD 4U7DA 3T3NA 3GLFB 3WYBA 1OKKA 3CLUC 5J2UB 3S1AA 2BFCB 3CZ5A 1K8QA 5ES4B 4C01A 4LOHA 4Z9AA 1Z39A 2VT7A 1SEVA 2IYVA 5JISA 2CVFA 1XB2A 4B3JA 5HRUA 1SGWA 1WRBA 3BXHA 1KFEB 2BHSA 3TL6A 3BGWA 4WW0A 4ZZIA 3PVSA 3RRNA 3NW9A 2C3YA 1W44A 2W83A 2AZ4A 1DRJA 2WJPA 4KR7A 3G2IA 2F3RA 4YRSA 4PICA 2IU0A 2JLQA 3MAAC 3AEQB 3V4PB 4I5DA 1OFUX 5IVIA 3R7AA 2XPCA 1XQ1A 4AMBA 2DGDA 4IL5A 1CY7A 1GUYA 3EH1A 4EF5A 1BOFA 2GPSA 1JKJB 2ZTUA 3KQWA 4B6SA 3U5ZB 1VCNA 2C5FA 2C9MA 1ORRA 1LH0A 4K9NA 4U02A 1CFJA 1O58A 1W29A 3CH4B 5AOAA 721PA 2EW8A 2HRZA 2FMHA 4F2HA 1DWOA 1O54A 3ZLTA 2A8YA 3KKEA 3ERCA 3TECE 4WKOA 2C7OA 1UANA 3KT8A 5B7QA 2WQ6A 1IY1A 2BFDB 3D2CA 1KYZA 3IUSA 2FGKA 2BSAA 4L4ZA 2GZSA 2OHJA 2FE4A 3QWFA 3KUCA 1KA9H 2C83A 1X7YA 3MMSA 4KFTA 4JJEA 4UDYX 5BWLA 4YWJA 4FKMA 4BNYA 4FD3A 4HHEA 3GDHA 4MI1A 2HV9A 4LQDA 2P69A 3PA6A 4ZQGA 2HH9A 2FX5A 1F4LA 4BFTA 3IL2A 2GASA 4KE6A 1WHTB 1BVRA 1BKDR 2O7SA 3PWTA 3LVFO 2EBWA 3VJRA 2AXNA 4R1LA 2MTBA 2OHVA 3GGPA 5K3BA 3T1QA 1K5DA 3GJRA 5FRDA 2QM8A 1MG5A 1Y7IA 3K1TA 2D5LA 4D6YA 4G81A 4WJKB 3L8YA 1P2VA 3AHFA 4MVJF 3TZCA 1UJ5A 4FTWA 1GZDA 2NVUB 1RAEA 2V45A 3QXGA 4N39A 1JMKC 5G0SA 3HTXA 5A4IS 2JJMA 2OCKA 4IUCS 2JI9A 1YJCA 3N70A 3CB2A 1KKMA 2X40A 221PA 4GZ3A 3V8VA 4C05A 5CA0B 5B4UA 3HCBA 1E2FA 5CA1A 5FX2A 5DGTA 4RVSA 4BFXA 1BRMA 3THYA 1FRQA 3T9EA 3DKIA 1JN0A 3K8OE 2HMUA 4DEYA 3EPKA 4XIGS 3M1YA 4TKUB 1DPGA 1VG8A 1DINA 2E9SA 2G1JA 2VF7A 4IEIA 4KK4A 5KYUB 2CXPA 4CEJA 5B36A 1E9AA 5E4YA 4Z53A 3UFXB 4E5VA 2HY7A 3Q9NA 5HQTA 2J5RA 3U4QA 1DIBA 4NZMA 2ZSHA 521PA 2ZSEA 5BMVA 1E59A 5AI9A 2AOTB 4DCCA 3H0CA 1UOQA 3CXUA 3IH5A 3LDHA 1X7XA 4YUVA 4BZPA 3FCEA 2I99A 4UREA 1CUWA 1FYEA 3IP9A 2MT9A 4IKPA 4OMCA 4RPKA 2B8EA 3RBXA 4ARZA 3K0SA 4YIHA 1C1DB 2PM8A 2GPWA 3K1AA 5AKLA 5AVKA 1QUFA 1CK4A 1G7SA 4US0R 3OKFA 4EF6A 1WPXA 1OFTA 2O2YA 3NYQA 4N1AA 3WAKA 2Y4NA 1BJTA 4E6PA 2JGFA 4YX9A 3CVUA 3KTAB 3KUXA 4WH0A 1VKOA 5BV1A 3KV1A 3EXFA 1D1QA 2B9EA 1V3QE 3MS7A 5IJ0A 5G4LA 4BCCA 5CK5A 4BB6A 4MWBA 4JBXA 1WZNA 3L6EA 4M4SA 3ZY6A 1C9DB 1XNRB 1PK9A 1PZHA 1TM5E 1UZMA 3D2BA 3GD5A 5AJVB 1XMXA 5FUBA 3O8BA 1V4NA 4OHMA 5JMWA 4WNIA 3W77A 4PM4A 3CR8A 4FMPA 4U4AA 1OZFA 2QTMA 5TF0A 5M29A 4RSMA 4XOUA 4EI8A 3OFNA 1RRGA 4LC0A 4REQB 4PHHA 1PS9A 1TLTA 1XYGA 2VQDA 2WNSA 2WM9B 3EBPA 3O38A 4RXUA 4I2VA 5I9TA 2GTPA 3IT2A 5FCDA 4ZMBA 1MJ5A 5DX1A 5HZKA 2FEPA 1DO8A 1Z4KA 4MEAA 2JIPA 1ZJZA 2VAVA 2Y77A 4UDNA 1ZVKA 2C1EA 3S99A 4RZXA 3DCYA 2AFIB 1K4YA 2G07A 3LDFA 1PE0A 1RWNA 2B99A 2EJBA 2OSBA 2OLKA 3HYRA 4IIJB 4W1SA 4ADSG 3VI3B 1TMKA 2NO0A 2PX8A 2X7HA 4OI0A 4HUJA 3ZEIA 1NZFA 4H08A 4CEIA 4H7EA 1EBBA 4I1IA 1N0WA 4NULA 5DEIA 4ZQBA 1OF1A 4F06A 2VNIA 1FMTA 4E4TA 1L4LA 2PQMA 2VQ6A 2W93A 4ZCTA 4WT7A 2R1VA 3OJXA 4EHJA 3C16C 3VDQA 3UBMA 4XWGA 5B58T 3R7FA 3SLKA 3VR5H 5K0CA 5CIYA 2KW5A 1ZHOA 3VYUB 5IW8A 4CTJA 2R44A 2LDBA 1A82A 4DQKA 3F6SA 4B6FA 3PC8A 2BL4A 3JQGA 3OLXA 4Y98A 5LUBA 4E3WA 1HYQA 4UBJA 3S3TA 3WX0A 2QTLA 2L17A 1C8LA 3NHUA 3UCFA 3HCNA 5I47A 1A0OA 4HFMA 4EJ6A 3K2BA 1AK9A 4OA8A 4UUQA 4IM7A 4YALA 2PANA 1D2RA 1JFRA 1JHDA 1MVOA 2DUUA 1ATZA 1Q1NA 4MGZR 4XR9A 1G291 1NYTA 2JH3A 4M7PA 4Q3LA 1RLIA 3VVMA 1WW2A 3D1LA 4GF5A 2O8BB 4ZKDA 4HTFA 1E92A 1UWCA 1D2EA 1X1EA 3B1ZA 2JLXA 1L5MA 2A5DA 3OTHA 4YP9A 1VMIA 3GDFA 2O14A 2YC2C 4KI7A 4KQHA 1PF7E 1M7HA 2ZYUX 3EUAA 4MVWA 5HGXA 4YMWA 2X19A 4Y9TA 1M6EX 4F86A 1M34E 2W2LA 5FLEX 1CEYA 1JHYA 2WZBA 4TT3A 4RYLA 4YRTA 4JQOA 4ZMSA 2QQEA 3JQ7B 1G21A 3LP6A 4ZO8A 4QYIB 1AZTA 3UWPA 4FWIB 5IT9A 4JYCA 4UNNA 3UGQA 2O8DA 2X4GA 4OHVA 2N0SA 3F6CA 4NECA 4BLQA 3AMVA 3TIFA 5ICSA 2OZVA 1L1EA 5FTLA 1VBKA 4V3CA 1N5KA 1RI5A 3DTVD 3TD2A 3AESB 1SVMA 1PI3A 1J33A 2SNIE 3TW6A 2GF2A 1SQFA 3NHJA 1D5CA 3OM1A 4KQEA 3S2UA 3IPXA 4TUYF 4CV1A 4CIWA 4ARUA 5C7OO 2JH8A 2Z9CA 1N7GA 3GQBB 2GO7A 1P2UA 4KAJA 3TLGB 5C8VA 2PIAA 1T9ZA 4RQAA 5EZ6B 1Q83A 2AQHA 4F9GA 1U0NA 5K3FA 3F8SA 4C2UA 4N7RA 3ZZTA 2XODA 1R4NA 4C4OA 3H2KA 3AI3A 5F5NA 5AP9A 1DE0A 2OFPA 2OV6A 4EAAA 1L8AA 4YACA 1PR4A 4MP6A 3VBCA 1Y6JA 2I3ZA 5K5EA 5LPNA 3GG9A 2PUBA 5HE8A 2IGBA 4JWTA 5DGXA 4N3GA 3O4VA 2R1TA 1NBAA 1KMMA 1UP7A 1WUHS 2ODNA 5D85A 4GE3A 4MXDA 5EP1A 1DMRA 2VRBA 1P1IA 1LLCA 4L5IA 3N6VA 1W30A 1ADFA 3DEJA 4N7BA 4MQMA 4UPVA 1Y3AA 3U3ZA 2YNMC 2C42A 3AGPA 4PPFA 2WWWA 2ZIXB 1W96A 3TUJC 3HJAA 1G0OA 1U65A 1X9IA 2ONKA 4KN6A 3W7VA 2BDTA 2GJSA 4OQPA 2GEKA 2PT7A 4TMWA 3ZHBA 1P3JA 4BKRA 3RAJA 1SUBA 1HG0A 1M2EA 3KNZA 4G5HA 2J85A 2FHSA 4MCAA 3WGZA 5JD5A 3L4BC 3TZ6A 1XL1A 5AXAA 3IDFA 5CYGA 3KQTA 3CRNA 3U7FB 3PEFA 4JB2A 5ALWA 2AOVA 1N2XA 1G2QA 3EQ9A 3N53A 4Z8XA 3RADC 2ZAIA 5TJHA 3FX2A 1R12A 1RABA 3A6PC 1X86B 3Q5EA 4DSUA 1DU4A 2F8LA 4G8DA 4J0FA 4MWDA 4N48A 2R8EA 2D1TA 2W6PA 2F3TA 4JKYA 1U90A 1T0BA 3M89A 3DONA 4FEGA 5G0TA 4TL8A 3VUFA 3NWEA 4P3YA 2QY9A 2YXEA 4MV8A 4IIFA 2JVKA 1PQUA 1YH3A 1D4AA 2PKEA 4GE0A 2YMPA 4PLVA 4F60A 3HVRA 1L3CA 3NRJA 2EZTA 4F4DA 2QMEA 3RI3A 1X1QA 3WYDA 1AUQA 4YJFA 4H6PA 3ZE2B 1J97A 3WIUA 1M2WA 1A9ZA 5A9RA 1P4SA 3K0CA 1Z6XA 2PRIA 1XZIA 4QUHA 5KOHA 1MAWA 3UTCA 2XJ4A 1LKZA 2XNKA 2EV9A 4JBGA 4JOBA 3ETGA 5EYPA 1G3IA 3L5OA 3STXA 3SVZA 1XNQB 1G8YA 3Q3JB 3Q3HA 1OX6A 5AI0A 2NMVA 3R5JA 1UUFA 1KJNA 4LYJA 1HDYA 4MVYA 1A77A 4URXR 1GD1O 3FPEA 2JFVA 5IZCA 1JKMA 1II8A 4OI4A 3GEHA 3IPYA 3D3KA 1KE1A 5KYYB 1JAZA 3R5TA 3T06B 1FTGA 2IYQA 2K7FA 1TJPB 5CDSA 5BUCA 4JX9A 3LT2A 2DKOA 4Q00A 4EHKA 5LDHA 3L92A 1AUVA 3E18A 4PN3A 3W34A 4KRYA 4D80A 1TT5B 3MBKA 4MYHA 5CX1B 5IC5A 5KAPA 3UHJA 5LP6F 1ISJA 5IDXA 4GBGA 4C88A 3BSWA 4MS4A 4BVEA 1X1DA 1M0WA 3P9QA 4GVPA 1UDXA 3GCZA 4NFSA 5ED0A 4R3UC 2F59A 5DP2A 5BWBA 4LVCA 2VJMB 1DWQA 2ZK7A 2NUPA 1AU9A 3I2FA 3DEKA 2R8OA 4Y2HA 4TS9A 3IAM6 4KJZA 4H35A 3MB5A 2N47A 5IMBA 5DNDA 3T94A 1QE5A 1OX4A 5BWNA 4K05A 3P0RA 5BUSA 3QHQA 4JMPA 2H2AA 4QTYA 4Q4CA 1WEHA 3AXTA 4FDTA 1ENPA 4M21A 4TPKA 1TCCA 1Z0SA 2VTDA 4BIIA 2WWYA 2HWYA 3MCZA 3S7ZA 2YY6A 3SF8A 1EQAA 3CUEF 1G5HA 3DA8A 3PXAA 4FLEA 5AOCA 4RF5A 3LQQA 1WMBA 2EKDA 2H4YA 2O2JA 1G98A 2TMDA 3PFIA 4GX0A 2JHAA 4YMIA 1BWQA 1RZRA 4IIHA 4TSKA 4YAUA 5CPFA 1GQOA 4L0DA 5F2KA 1ZXLA 1QPGA 2NU6B 2WNIA 5DM0A 5JNLA 5A4JA 3DOFA 3AFGA 3RQIA 2AZXA 1CVRA 3G1TA 1GLNA 2AMVA 4DPKA 3SSMA 3AG6A 1VSTA 1U9CA 1MHPA 1Z45A 4ZJYA 3U3RA 1P2TA 3Q3EA 4BMPB 3CTPA 2LCFA 1AKYA 4E5YA 1VSUA 1GPNA 4RQUA 1SURA 2ERCA 4JBLA 4TZ6A 1CUDA 2E1RA 1CY8A 5C5EA 1HPLA 1HTBA 2V58A 3LUJA 4P38A 2GOYA 4BMNA 3SJBA 3GDWA 2DLCX 2G4LA 4WHMA 3CLUD 1PLKA 3A6JA 3FFTA 1TCVA 2QQ0A 1RRFA 2HIMA 1RKXA 2HEGA 4PVCA 4Q9LA 1IN7A 5COQA 1GNQA 2XMSA 5CDUA 4BFCA 4CL2A 1MEJA 1T24A 2FMTA 1KJWA 2L42A 4TWBA 2EF0A 5JD4A 2GM4A 1E5LA 1X74A 2XUKA 1Z5OA 3FRJA 1HURA 4KRFA 3L18A 2OBXA 4C5CA 1MJFA 3KXIA 4M54A 1RJDA 2SCUA 3FVVA 4AY3A 4PO9A 3NGMA 2IH5A 1C3EA 1ESCA 2PCJA 2PGOA 3W8NA 3ZY3A 4MHTA 4TOIA 2PKCA 3AJDA 2KS6A 4HAZA 1M1YE 1G8MA 1V8ZA 4GR4A 1I2CA 5DM1A 3Q3CA 3AIMA 4LIPD 4XGIA 3DPIA 4QULA 3ZXIA 4KIUA 3WR5A 2QVCA 1G3QA 1O0CA 1DBRA 4DC0A 1OI3A 1ZDMA 4XLZA 1PZEA 1QK5A 3CX8A 3AEYA 3BWBA 1YS7A 2P62A 1R0LA 3NT5A 2VA9A 3U9SA 1DDIA 1LB1B 1QMGA 4BJ1A 4KODA 5HUHA 1N2IA 2QPAA 3TZEA 2X1LA 3DDWA 5JJCA 1WR8A 2ZT8A 1QC5A 4LFBB 1O08A 5C35A 3I42A 1KHTA 4NH0A 4X24A 3IXLA 3VC3A 2ZI7A 1FDRA 1MZVA 1F17A 4C4AA 1ODJA 3K20A 2QTBA 1EAMA 3OZCA 4E11A 4HO1X 1H2XA 1QM5A 2IIPA 3U0VA 1P81A 4RHEA 4PLCA 2NUAA 4O2RA 3QIAA 3ILYA 3IODA 5HEKA 5HF5A 4R98A 4I14A 2AJCA 2YOFA 5JADA 4TV9B 4A7PA 2QD4A 2C78A 4R8KA 1E99A 4V0KA 4PHGA 3D0RA 3PDIB 5DYGA 3GAFA 2CD9A 5IT0A 2BJWA 5HIKA 2P2DA 4BYMA 4L4UA 2G82A 1K6JA 2ZJ3A 5FEMA 1IBMB 2DPMA 3U6BA 2RGBA 2Z5GA 1PBNA 1PNTA 2GCEA 3KAJA 4EZEA 2PE5A 1IOVA 1OLOA 3TQSA 5BV8A 1L5SA 2X0NA 1J22A 3S2GA 2VJOA 3T3EA 3RJZA 1BMQA 3GJZA 4XX1A 5HSGA 1OGJA 2D1QA 3MD0A 3GVCA 3IO5A 3RS9A 2AE2A 1ADGA 1GSOA 1R6BX 2PMDA 1QNFA 3Q5DA 4Y6SA 1ZM4A 2KWIA 4DPMA 3P0EA 3B1KA 4TRJA 1SVNA 2AJDA 1NC3A 2GHQA 4OI1A 2BKAA 1ZOPA 2OB2A 1SOAA 1ICIA 2DUNA 5AM1A 3HDQA 1E7SA 4M0EA 3K8YA 4HF7A 5DP1A 2ZYTX 3MGBA 3ZQ4A 4CM9A 5K1ZA 2R5WA 4EYOA 2OY0A 1W1IA 4GMGA 3ZJYA 1YR1A 2A0UA 3O73A 1LDGA 2JAOA 2D1YA 3K15A 1LV8A 1KNXA 1Z2OX 4W5QA 2PZBA 3NOVA 2F4NA 3H2SA 2J9XB 3DH0A 4RACA 1AH2A 4QEKA 1F2TA 1XTTA 2EGHA 3DFZA 3TYXA 3V2IA 3CF4G 3RFUA 1FC0A 2PMFA 2JBAB 2WTXA 2ZXFA 3LC0A 1B00A 4A0HA 2FZLA 2Q3LA 2ZUWA 1L8LA 4H4CA 3WJ2A 3HJCA 3QBTA 1Z5WA 1ZL2A 1VA4A 2LV8A 2X58A 4X6LA 4YQFA 3GNSA 1FYFA 1XLTA 3DP7A 3D8BA 4AUNA 4BFYA 3H3JA 4HH0A 5HJEA 4WN9B 4ZMRA 4PQFA 1DRUA 1GPUA 4YI3A 4KQXA 5SY6A 4KX5A 3IIEA 2RDMA 1DAPA 3AP1A 3E3NA 4DTCA 4UTZA 2ATIA 4JI7B 2ENUA 1S2DA 3FNGA 3QX7A 1YJBA 2Y2VA 1M7BA 2IYYA 2VK8A 3FCXA 1AT1A 4MIOA 5A7FA 5CLJA 3HJHA 2D1FA 4EYQA 1GL9B 1F14A 3EK2A 1K6XA 5HRAA 1XDSA 1F60A 1GEGA 1RJWA 1UKCA 3PE6A 1Y4SA 2PMCA 3DS8A 3VX4A 4AW9A 1R4ZA 3B3GA 1KQGA 4KW7A 2VZ0A 3DYBA 5AJHA 5F23A 3GLIA 3QYFA 1CIPA 4K03A 1NBMA 1JJIA 2I3AA 3KTFA 4ZPXA 3UJHA 4CLRB 3SQXA 2O3QA 4LRQA 4LY0A 4DIOA 1HX7A 3IS3A 4NIMA 4O4HB 3WMRA 1TAQA 1JG6A 2MINB 2OYRA 5ELMA 1MGPA 2ZYVX 4OK3A 2GZDA 2P6UA 1I0LA 3GJ8A 4M8NE 1SHJA 5K0ZA 4TKVB 2NSDA 3VPBA 2EFJA 2YMMA 1EAYA 5EE1A 1N6KA 5C7LO 1R00A 1NX6A 2DTEA 3ZCXA 1FSFA 2FE1A 4PG4A 5GJVC 4Z3KA 1VE7A 4WA7A 1XP8A 4B9EA 3C4VA 4LDJA 5CM8B 4F9TA 2P9QA 3ULKA 4HRAA 3CZRA 3IVAA 3O4RA 2LNDA 1R0SA 4FGJA 4FCTA 4UU8A 2P11A 4A10A 5JS6A 4HAVA 4JT2A 4QICA 4IF4A 5SYMA 2I2BA 1Z0AA 2ISSD 1ORDA 4RAOA 1C0EA 1A9SA 4MS1A 3X1DA 2I29A 2QP4A 2OBMA 1FRFS 2XH8A 1QAOA 1S3SA 2WKRA 4TN5A 2ZJ5A 2OOSA 4URUR 4D4GA 5G1NA 4B6PA 1WCXA 2O3RA 2BEVA 3TB6A 3UA3A 1F7UA 2O7RA 4ZVTA 4JOSA 1Z5VA 4HNQA 2NU7A 1KVRA 2PGIA 2Q5CA 2WICA 2CVOA 2EWVA 2DPYA 3E6AA 4ZRMA 3M70A 1T9KA 3F1KA 3ZDAA 1J8VA 2EHDA 2P2LA 3IBCA 5BYAA 1KDRA 4MPTA 3HA3A 3OTQA 1J23A 2VT6A 3I1JA 4UPEA 1HSOA 4ZI3A 3T7TA 3CRRA 4MVJE 2HX1A 5L9AA 1W9MA 2AR0A 1JLMA 2XMGA 2HF7A 1W7AA 1OYOA 3FWHA 1C0IA 1GCAA 4ZVVA 3YASA 4OXIA 2GGSA 1LTQA 4B0OA 1BNCA 1P18A 2D0IA 4C2TA 1CR2A 3FH0A 3B6IA 2POQX 3LYAA 2E6UX 2KLBA 2H1OA 4MRMA 2FZGA 4AK9A 3D4BA 4GPD1 3DL0A 4ALNA 3DVQX 3OESA 2VJLA 3T9FA 2WNHA 2HT6A 3I34X 4MQEB 2PPVA 1WCV1 3GEIA 2ZTMA 4Z0TA 2AJ8A 1ISIA 2NO1A 4TMXA 3ZHVA 5EHZA 2DX7A 3GFBA 1KIMA 1KJJA 1MIOB 1XTIA 2CK3D 2XE6A 1YRHA 4DMHA 4WZBE 4Y2VA 4XCXA 3H7IA 1WF6A 1C1XB 1P45A 4IDDA 2W2MA 1O9GA 2XKAA 3ZHYA 1WBBA 4EUNA 1KEWA 1SCNE 4JIMA 3PIDA 2AN9A 3AKEA 4KMMA 2H5JA 3EGOA 3RVLA 1G59A 3KFVA 4P7KA 4MYSA 3ZWKA 2JKYA 4BX2A 2W6JD 5JS1A 2V7EA 3EGDB 3KOXA 4DIUA 3FWYA 5AI5A 4CPDA 5DYTA 1JR3D 3OCWA 4W5TA 2GVNA 2JRCA 1QTIA 1YR3A 3JR3A 1VMAA 3TQFA 3ZNPA 2H1SA 2O1SA 1CR6A 1FQJA 1U9JA 3JALB 3CLSC 2QG4A 4K0RA 1QGAA 2PD6A 2YNMD 3G5TA 3UWDA 3WVNA 4WVLA 1EGVB 4MV0A 2HQ1A 5EQFA 5CEFA 2Z1DA 5EL0A 1CEXA 3NXKA 4RQTA 3O47A 4G01B 1DHRA 1MEOA 4YJKA 4XLTA 5TT1A 3LUHA 5DK4A 1GT91 1USVA 4G9BA 4QHTA 4HBGA 3CPSA 4NENB 1GIAA 4I9FA 4ZD6A 4N0DA 5ER9A 1BMFD 1CC1S 4KAXA 4U9HS 1EBFA 4G1CA 4MQ6A 4ZVOA 3RSFA 5FUWA 1GYPA 3G0DA 1NJ1A 3EQZA 5EHNA 3A1EA 1AHIA 1V48A 1IPFA 1L5YA 1YAHA 1CWUA 2AWNA 1LF5A 2JH9A 4RX1A 4WOPA 3OQ6A 5THXA 3WE7A 3BGIA 4BVLA 3ZH9B 3ZN2A 2DEUA 1GO2A 1MOSA 2IQIA 4NJEA 4AS2A 1T2FA 1BS1A 1UK9A 1Y33E 1DCMA 2P9YA 3FNFA 1M8PA 2ZLBA 2P7IA 4F93B 3FTQA 3IJPA 1IXZA 4OYHA 1T0IA 2Q1WA 2R60A 1PT9A 1ZH6A 3JQEA 3D9QX 4LQCA 4L72A 4DL9A 4YPVA 4J9VA 4Y0VA 1K6MA 2AQKA 1LPOA 3A9UA 3ICVA 1XJCA 4Y67A 3RIYA 2OV1A 4D81A 5B6JA 1NG9A 1Y9EA 4B84A 4UUNA 4CKWB 4JLOA 2VA8A 4M7OA 2XYHA 2YWCA 1EVKA 2WKSA 1USKA 2P1RA 4FOPA 2DFVA 3N7TA 3EDQA 1SU8A 3IRVA 3NQ41 5EXDA 2NOAA 1D3AA 4ZXPA 1S2NA 2N1BA 2O05A 1HQYE 2NYAA 2WFAA 1T4MA 3IDAA 4E07A 1DWPA 4Z7OB 2Y9PB 5JRJA 3U7GA 3HCOA 3CX3A 4TMFA 4DCSA 1L4FA 1YZFA 3BXZA 3GGDA 1C1YA 2HIGA 1PS0A 5KWIA 1XL0A 1CETA 1J2EA 1NFQA 1XRLA 2NVOA 2XR1A 5LQMA 1N1MA 4CTNA 5LYJF 1KOLA 2IEBA 3TAHA 2P4EA 2PLAA 3L7IA 4YRAA 5AVRA 5DM2A 2A30A 1EDEA 1XALA 3EVGA 2CEKA 1D6SA 4GM1A 3AM5A 4X84A 2B69A 3GR6A 1Z35A 1ZESA 4PXAA 4UTOA 2VQFB 5C1PA 2NUTB 3ZE1B 3H87A 1NI4A 5TPZD 2IWRA 4EQ6A 3T1YB 2FG7C 4KDCA 1TECE 4OP2A 1NMQA 2NTJA 3QW4B 1TM2A 1RQRA 3FDZB 3INYA 5BXQC 1D2MA 2X9VA 2W9XA 1BFDA 3PHJA 3FNQA 3NUQA 3D8UA 13PKA 1ECPA 1PNVA 2ATXA 3RDPA 1E3LA 1SVIA 5T4FA 3ZXYA 1V16A 4RKRA 1ZSVA 4BO7A 1N78A 1L4HA 3FLEA 3I9JA 4RV9A 3CUYA 2A94A 3KETA 2C4KA 4KHZA 2WWXA 3E5MA 2FMKA 5LP6B 2ISCA 1Z07A 2IP4A 3NEAA 5EKXA 4D98A 1O6BA 1ZCJA 2JGRA 3HLKA 3OKAA 1JHMA 4ZVNA 4BCBA 1ECBA 5IT4A 2CVPA 3VR4A 1C30A 3T3HA 4DAOA 1JL3A 2ODBA 3PC7A 1A7AA 2EVWX 3HVUA 3PL1A 1GAWA 2CJWA 2VJBA 5TS3A 3WWDA 2OM2A 1IRXA 3W8EA 1HNNA 4ZDJA 1Z3CA 4CKBA 1NMZA 1Y8QA 3FMIA 5AK6A 2OLJA 4QASA 4JJ4A 4IQGA 4P4TA 4MULA 4WKBA 3QOWA 4WMLA 3R8CA 1S89A 1M2OB 1NRWA 2XA1A 1ZM7A 5HHTA 2H1VA 4GLBA 1IHYA 3ZHRA 5L3SB 4IDEA 2H7VA 2YZMA 3KUDA 3BKXA 3LUCA 3CSDA 1P19A 3G2LA 1RWXA 3MMPA 3L8ZA 2JCXA 3PFGA 2G5PA 4BNNA 2B1IA 4YV0A 1VLLA 2PSHA 3SLRA 2IX9A 2PEYA 2OCLA 2XHEA 5IJZA 1TKRA 4GGOA 1AJEA 4O1MA 4W9NC 2W2NA 5C1IA 2NT4A 1H2RS 3V2GA 1VSQA 2OESA 3WXMA 2V7XA 4J8PA 1W5AA 4FZ3A 4DMMA 4UBLA 1AE1A 1TKAA 1AHPA 2VCHA 1ELOA 1L1RA 2JCSA 2WE8A 1SD1A 2NUBA 2BSXA 2XAAA 1JJFA 1FUYB 1RLOA 3DUFB 3EZXA 5BW5A 3HDJA 2R6ZA 4IPTA 1CW2B 1Z0ZA 1KL7A 4G1MB 5EVCA 3RYFA 2OO5A 4Z1MA 1OTYA 3D6JA 4GKBA 1JB1A 2HNBA 4WVFA 1MC8A 2ZIEA 3OLQA 1L5GB 4WERA 3TCKA 4M6WA 3ZWBA 1TD9A 2C8VA 2NNLD 1TX4B 2W6NA 3GJQA 3MQ2A 3UJ6A 2QJFA 2XCRB 3OJOA 4J16C 4ZGBA 2F3QA 4KQGA 3QF7A 2C0PA 2WP0A 4K9PA 3PR1A 2K7ZA 1GQ2A 4IQ8A 2HIHA 4AP5A 3QU7A 3UGJA 3KD3A 4XDYA 1DTEA 3HXOA 3LNCA 4ZDKA 4ZHQA 1PL8A 2B94A 1EPUA 2ICAA 4RADA 1D6NA 4UBOA 3S0JA 5A05A 4B4WA 4NG4A 4O4JF 4AJ1A 2BKXA 3DCIA 1WZEA 2Z8YM 4H3HB 4P5PA 2E49A 4B82A 3W79A 7REQA 4V2UA 4AX4A 1Y8AA 1JDVA 1R0YA 3QXJA 1ISMA 1KJYA 1E1CB 1UDCA 1AMUA 5ETJA 2AF4C 1JDBC 5EP4A 3ZQJA 2OG2A 3JAWB 1FJGB 4M0LA 4S1OA 1ZD8A 3DPSA 3E27A 4FN4A 3G9QA 4UCQA 2ZYHA 3U49A 4WBXC 4D45A 1CQWA 1ORIA 1SBCA 1I7SB 3E7PA 1NVDA 3R3XA 1GM5A 4B17A 3JRNA 1OA0A 3T3DA 3MOIA 3A9TA 4OGGA 3U9TA 2BMJA 4UNSA 4F4JA 2R97A 1SUFA 2VDPB 4HFRA 6LDHA 5D3MB 4IJ6A 3S40A 1ZQ9A 2M6RA 1BKSB 1E79A 3LL4A 5EHXA 4AJPA 3EC1A 1JBQA 4IXWA 2PS9A 3O1HB 1SWWA 3PK0A 5I9NA 4WNCA 3BPSA 3K3PA 4KAFA 4RANA 3T12A 3TRIA 4QLBA 4IP0A 4EZIA 3TE7A 5ICCA 5LQCA 3O3OB 2XNDA 1XC7A 4JJKA 2YICA 5A6VA 4ZU3A 5IUJC 3BSSA 1S1MA 5ULLA 2PGDA 4CHGA 5JQGF 4H7HA 4BS9A 1K8ZB 1XMVA 5BSKA 2NTVA 2H29A 3GGCA 1KAEA 4ALIA 1ETHA 2W58A 4J0JA 5EWJB 5B1YA 3K0FA 1SVWA 4B81A 1YRYE 4C9BA 4FYIA 2GD1O 4JJZA 1Q1BA 2BGRA 3N2NA 5GZ1A 5IU6A 1DEHA 1QFZA 2Y05A 3BQ9A 4EA6A 2XXJA 1IXSB 4CM6A 1KZ7B 1J2TA 2HRCA 4NV1A 4MOWA 4OX9Y 3QVJA 4QBIA 4KGXA 3EGCA 4FBMA 5L4NA 2BZ0A 3EG9B 4JJFA 3OBIA 2R0QC 1NYQA 1PAUA 3CZAA 4PFSA 5HIIA 3B8HA 4N8SA 1KMHA 3BMOA 1FCJA 3IV9A 4ND4A 4U7FA 3O9ZA 1UXKA 3U3DA 3B1WA 5DBHX 5FAXA 2PUAA 1ECJA 3D54D 4Y6OA 1DC5A 5K99A 4BN4A 2V7BA 4X9XA 4YAEA 3CSUA 4RUKA 3GH3A 3LCRA 3M4NA 2ZYIA 4DYVA 1DAFA 2ZYSA 4IYRA 3GUYA 4E2WA 1N7JA 1QQ6A 3G0BA 3FCCA 3G1WA 1DJPA 4BQQA 1CP3A 2JW5A 3ZW8A 1OSNA 1RBQA 1SUCA 5G4KA 1IMOA 1M1UA 7ABPA 4FIZA 2XDAA 1YS1X 4R2IA 3X1MA 4Z4FA 1AHHA 2IS2A 2OHOA 3EF0A 2RGEA 4GL2A 3P0IA 3RIGA 3AF4A 4G3XA 1Y98A 4B2YA 3H5NA 4LOJA 4C7VA 1ZGBA 2IUTA 3IOMA 1XZBA 4Q3AA 4YP6A 4ZOQI 3NUGA 5ABPA 1P9WA 3SXJA 3W2HA 5IJ9B 4MQ5A 2ZGVA 3EC7A 1MB3A 2QV7A 1QH0A 1MABA 2VAPA 4FXOA 1PD0A 1ZEMA 4UQLA 3KJGA 4DC1A 4OV6B 4I5FA 4LZZA 2BRUC 2AW5A 1N5RA 2UVPB 2P3SA 2IXGA 3DG9A 4G0NA 1BXKA 3B3AA 4UATA 1DBWA 5AH0A 4AB1A 4EFDA 1VGRA 1ZOIA 1QX4A 3NDBB 3TZHA 4A82A 2VJAA 3S2ZA 3LTNC 4YLGA 5KX5B 4C4XA 3FOWA 1Z7YA 5FXMA 3UYLA 4X90A 2PGAA 4WFQA 6GPBA 5DNWA 2K87A 1OASA 1YGYA 2ZIAA 3EEBA 1WABA 2GEVA 3Q4GA 2EP5A 2PL5A 4IHAA 1AXEA 1B1CA 1DKQA 1PBTA 1TO6A 4G24A 4G97A 4YJ3F 1IY0A 3QKTA 3RB8A 3FUTA 4AF7A 1PHPA 4I55F 4ZYYA 1UMDA 2H16A 2CNOA 5JH7F 1C3LA 5HW0A 2XBUA 4JQCA 4EY8A 1E5TA 3L8MA 2W2TA 1RACA 1KDOA 3C4QA 1RIIA 4HUQB 1IBKB 4LWOA 2FW0A 1KGSA 1GAQA 1NOKA 2Y71A 3U62A 5JZOA 3H1AA 1XD8A 1C7FA 4BQEA 5IFKA 1GVHA 1T2EA 1GAXA 4UVDA 4GIBA 2Q2VA 5LZ9A 2PUJA 1USGA 3WICA 3W2TA 2J33A 1DJMA 1P5HA 3P4YA 1XNHA 4HGQA 5CCEA 2ZWAA 1VPWA 3TLZA 2XNHA 4JBIA 4BN0A 2CFRA 5FNVF 5HKAA 3S44A 4LYDA 4YLYA 1QU2A 1MXHA 4PCAA 2XRYA 3NG1A 1GTG1 3E2PA 3QQPA 5JRDS 4F6CA 4AZ0A 1F06A 1XTRA 4OY3A 1ZK2A 3D6TB 2V0CA 2XV1A 3C1UA 4YK7A 1NF8A 5B37A 2P4UA 2WMNB 1W59A 3GEDA 3I6BA 4P3PA 4I50F 1OXXK 3ZOKA 4XUDA 3DMYA 3KQYA 4H4DA 1NP7A 2BTEA 2ET6A 4L0MA 1XD2A 1SA0A 1VHTA 2P1ZA 4GLFA 1F8UA 1OAAA 1WW8A 2R85A 2VUSA 3HI6A 4BKMA 2D62A 1PDVA 2Z9BA 2PWAA 3SQNA 2IA5A 5EP3A 4D4JA 4HN4B 1RJGA 3G17A 3MM4A 2DAPA 2O2XA 3BFKA 4CODB 3ZZ1A 4U0JA 1EGQA 4FFSA 1G8KA 2W48A 5BMOA 3KZNA 3CO0S 5FNZA 2FYTA 4A4DA 3G3EA 2COEA 4J2TA 1RR6A 3HWRA 2B1GA 3NAQA 4ESHA 5BSEA 5FD8A 3MWLA 4XB1A 2JK1A 4UXIA 3WBJA 6PFKA 3JY6A 1OTHA 3CN9A 5K03A 4FZVA 2MMCA 3RTDA 1VYUA 2QV0A 3HYSA 4JC4A 1EUYA 1WTAA 3T0GA 4EFNA 5FFMA 3RSLA 3HH8A 1Q15A 2ZI6A 4OBBA 3UMSA 3K1YA 3PPWA 2Q4BA 3WO0A 1SXQA 2GPAA 5DCLA 1JUDA 3IERA 1LK7A 1M8KA 1J5EB 3HJGA 4DUGD 1AQIA 2YUIA 4XEHA 3DLCA 1Z6GA 2BEUB 1WXQA 2PGJA 3NTXA 2EFEB 1GQFA 4M0PA 3WKAA 5KSOA 3G2NA 4NMXB 3UHOA 3F6YA 5JS7A 1F4VA 1UWVA 3I8OA 3HO1A 3FTNA 1DT5A 1ZRMA 2DLNA 4TYNA 1QRRA