4DGQA

Crystal structure of non-heme chloroperoxidase from burkholderia cenocepacia
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
277
structure length
277
Chain Sequence
SMGTVTTKDGVEIFYKDWGPRDAKVIHFHHGWPLSSDDWDAQLLFFVNKGFRVVAHDRRGHGRSSQVWDGHDMDHYADDAAAVVEKLGTHGAMHVGHSTGGGEVVRYIARHGERNVSKAVLISSVPPLMVKTSSNPNGTPKSVFDDFQAHVAANRAQFYLDVPAGPFYGYNRPGAKPSEGVIYNWWRQGMMGSTKAQYDGIVAFSQTDFTNDLKGITIPVLVIHGDDDQVVPYADSGVLSAKLVKNGKLITYKGAPHGIPTTHADKVNADLLEFLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Non-heme chloroperoxidase from Burkholderia cenocepacia
rcsb
source organism Burkholderia cenocepacia
molecule tags Oxidoreductase
molecule keywords Non-heme chloroperoxidase
total genus 112
structure length 277
sequence length 277
chains with identical sequence B, C
ec nomenclature ec 1.11.1.10: Chloride peroxidase.
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4dgqA00
1LNSA 1HL7A 4J0CA 5AKEA 2ORYA 3WL8A 1XQVA 3IUMA 4H7IA 5KREA 5DWDA 4DSZA 2ZVDA 4UHBA 5FLKA 2W6CX 5EHQA 3EQ8A 4MWSA 1ZICA 5CURA 2O7RA 4JEIA 1BCSA 3VVMA 4QWWA 1E89A 3R3ZA 2WU4A 5LZ9A 1EDEA 2HHAA 4RE6A 1N5RA 4EZIA 1UXOA 4AN1A 5IKXA 3P2MA 3FVTA 5CT9A 3O0DA 1MO2A 4PQEA 1DTEA 4XIIA 2R11A 4HRXA 1A8SA 1CUUA 1MNAA 3AZPA 3BDIA 1UT6A 4K2AA 5AOCA 2ZJ7A 2WSLA 4DMKA 2GBCA 3C6BA 4BVLA 4H18A 3W06A 2VJDA 2CZQA 4KAAA 3G0GA 2XUJA 2OQIA 4M0EA 4BAZA 5JALA 2EDAA 3OPMA 4BATA 5AKJA 4DM7A 5FPPA 3S8YA 4LYDA 5AM1A 3O9MA 1XZEA 2J3QA 3N2ZB 2QKYA 3WZMA 3WWOA 2FJ0A 2VQ6A 5CXUA 4KJXA 4G8DA 1FFAA 2X8BA 1H23A 1DWOA 3EQ9A 5AKLA 3G9TA 2V98A 4Q1VA 3C8DA 1CR6A 4MQLA 2ZYIA 5BV7A 2ACEA 3T52A 1XZIA 3GA7A 1ETHA 2JGJA 3O4JA 2QJWA 4GEGA 3V9AA 5CH5A 5JARA 5AM0A 1A88A 3I6ZA 4EA6A 3SK0A 2C5GA 3K2IA 1HLGA 2XT0A 5EI5A 2BUBA 5CBKA 2WJ6A 2VSQA 4EUSA 5FXMA 1ZGBA 5ALFA 1XQXA 2YH2A 3Q8WA 5K3EA 3A6ZA 3ED1A 4B0PA 2XLCA 4N8DA 1ODSA 3I28A 5ALGA 1XRLA 3DDUA 1ZD2P 3WWPA 4J0JA 1QIFA 2WG1A 5CH8A 4Y2YA 4B82A 3BIWA 1PV1A 2XE4A 2AJCA 5E4YA 2C4HA 2YASA 4UHFA 2X5XA 1JT2A 1CUFA 5JAUA 4QDTA 4B0OA 1LPMA 3DL4A 1L7QA 1ACLA 1UK7A 3F9CA 2HDWA 3FSGA 1W1IA 5ALTA 2VF2A 4QNNA 2XUQA 3FYUB 5DNWA 3DLTA 3WKDA 2CBGA 1WPRA 3PFCA 5FRDA 2J4FA 4AO8A 3HACA 3X3HA 3QMWA 3H2GA 3RM3A 3AZQA 1F8UA 3D4LA 4DSAA 4PO3X 3R40A 5CT5A 3WKBA 2AXEA 4DTCA 1ZI9A 5CW2A 4OYLA 2O2HA 3WK7A 3G0BA 4O08A 4EY4A 4QLAA 1XRRA 1TAHA 5JYCA 2O2IA 4YPVA 4HXGA 2QVBA 2XUKA 3FLEA 5IVKA 2E3JA 4PSUA 5HF6A 1DQYA 3G7NA 2OLEA 3ESAA 2WU3A 3WQHA 3G0CA 4U2FA 2RAUA 3KD2A 4OB6A 2RONA 1AC5A 3R41A 1CVLA 2ROQA 3BF8A 1UK9A 5HK9A 4FBLA 5BOVA 4UHDA 3LIIA 3FLBA 3C6ZA 1YR2A 2PSDA 4BB0A 5AM2A 5D6OA 1OCEA 3QZUA 4ETWA 5AH0A 1DWPA 4MQMA 1B6GA 5FV4A 4PNZA 3I6YA 3WKAA 4BVJA 2PX6A 1IVYA 5A62A 1Y37A 4ARAA 3WIOA 2QTBA 4G9EA 1TCBA 4CIBA 3TEJA 3C5VA 1HQDA 4W9RA 4YASA 5LP1A 1GPNA 1FFCA 1THGA 4QA9A 1F0NA 2AJBA 1CUIA 5DJ5A 6YASA 3H2IA 1G66A 4UHCA 2K2QB 2OGZA 2HA3A 1HKHA 3CCCA 2JGMA 3F97A 5AKGA 5AK3A 5SYMA 1XZDA 1J06A 1IZ8A 4A16A 4W63A 4Y2XA 3M83A 4C4YA 1Q0ZA 4LHEA 3FYTA 5IVDA 4B81A 4QLOA 1TKRA 3W9BA 4EB0A 1XZCA 1KU0A 1CPYA 3VVLA 4KEAA 3QYJA 5BWBA 4G5XA 1QIEA 3G02A 3IULA 3IUNA 2H7XA 1QIKA 4G1FA 1ZI6A 2WQZA 4AB1A 4B9EA 1IUOA 4PSDA 4ZREA 3BJMA 1R4ZA 7YASA 5JIBA 1NU8A 2JEZA 3OOSA 3AUKA 4JNCA 4MEBA 5LIPA 1N1MA 1ACJA 3CCBA 3H17A 1T2NA 2HU7A 3STWA 2DHCA 1UOQA 5D7BA 5HZGA 3D2AA 1J2EA 3Q0TA 1Y7IA 4OB7A 2PUHA 1O6FA 1AX9A 1VOTA 5J3JA 1VXRA 4E15A 3EIOA 2WHPA 1E8MA 4OYYA 5JADA 5C7YA 2BUCA 1CUAA 1E5TA 2ZSHA 1YAHA 1XZGA 4BRSA 1H2ZA 3H19A 4BDSA 1BROA 4X90A 1QLWA 5HK8A 1E66A 3BDVA 2WTMA 1CLEA 5LKRA 5ALKA 2I3DA 5K3DA 2WLSA 3OM8A 1VKHA 2GYWA 3T4UA 1DWQA 4X93A 1QIMA 4UHEA 1DT5A 4X95A 1EK2A 4U2GA 4XJVA 5C8XA 1DINA 1P0QA 1XZLA 3OTQA 1UKCA 3H04A 1G4HA 1EVQA 5E4JA 4GHWA 3ICWA 1UOPA 2WG2A 4P93A 4Y9SA 1EA5A 3FNBA 2BFNA 3SWWA 1AQLA 1FSSA 1KEZA 5AICA 3ESCA 3LS2A 1ZJ5A 3WA6A 4KE8A 4X71A 1QGED 4RNCA 4HAIA 3WKCA 1TQHA 5LZ8A 5FP0A 5EIEA 4J0HA 3WJ1A 4Y2VA 4OU4A 2XQKA 3HRHA 3KWFA 1O6GA 3DCNA 3FCYA 4FLEA 4C89A 2DHDA 4H7JA 5YASA 4B7ZA 2ES4A 5AKHA 5HKBA 1JU3A 3QPAA 3PFBA 1VXOA 5JZBA 5HKAA 2PSJA 2BUAA 3ESDA 1VE6A 3WWDA 1K63A 3PF9A 4Y7DA 4LIPD 3WK4A 4UBKA 5HF5A 1THTA 3R0VA 4AZ0A 4WFJA 3OG9A 5ALXA 2BCEA 3PUHA 3STXA 2QJRA 2XUHA 4CFSA 3PICA 4ITVA 1Q83A 4X94A 4DMHA 5A71A 5CT4A 3VJMA 3ICVA 2V97A 4H7EA 4LXIA 1W52X 4DLNA 3U1TA 3RLIA 1TCAA 4J0GA 1U8EA 4GI1A 3MUOA 4IH4A 2VJCA 4Q05A 5D3ZA 4UUQA 3AILA 4BC0A 4KYVA 4X7BA 1XLWA 4X97A 3DOIA 1BEZA 4J0IA 4EY7A 4GECA 2WIKA 5LZ5A 4BAUA 3M81A 2WUDA 2D0DA 2ZYSA 1IUPA 2WUGA 1XZFA 4I19A 5AK6A 2HRQA 3STYA 1L7RA 4E11A 1VE7A 2QOEA 4HS9A 4A5SA 2IX9A 2WIDA 2JGIA 4Y2SA 2ZYRA 5ALRA 1CFJA 1LPNA 1TIBA 4I4CA 4Q34A 2JF0A 1HPLA 1H22A 1QOZA 5HCUA 1SCKA 5JATA 5C8VA 3SX4A 2RIPA 5CMLA 4UBIA 2WUFA 2VT7A 2B9VA 2CKMA 2PM8A 1VA5A 5AKKA 5HFAA 2XUGA 3AZOA 3C6YA 2XUOA 4ZV9A 4DYHA 4N8EA 1LPPA 5AOBA 4LKOA 1QFMA 1NX9A 3W05A 1WB5A 2JGKA 1AGYA 2RI6A 4PW0A 2HU5A 4OCZA 5ALJA 1NU6A 5ALSA 4Y2QA 2VT6A 4JUIA 5AI8A 4FOLA 5AKXA 3I1YA 2OCLA 1K5PA 1QJ4A 4BE9A 4E46A 4HZGA 1GKKA 2Q0XA 4GWLA 4OSEA 3U0VA 1A7UA 3PI6A 5I8PA 2OXEA 3N0TA 5ALLA 1QIIA 4FNMA 4UFNA 3FCXA 5DTJA 3WWCA 1CUDA 1P0MA 3FAKA 2BKLA 5ALEA 2J4CA 3G0DA 2R8BA 2OAGA 1R1DA 4CG1A 4UBJA 1D07A 1FFDA 1YA8A 1CRLA 4KRYA 1ODTC 1ZOIA 4IH9A 2HFJA 1XLVA 2QS9A 4H7FA 3ZWQA 1JJFA 4BZWA 2XUPA 4HTAA 1W75A 4FLFA 2H9YA 1X70A 3C8HA 3WWEA 3QPCA 3O4GA 3B3QA 1K6EA 3H18A 3VISA 4FKBA 4Y2RA 4H0CA 2OAEA 3BE8A 2WHPB 4B9AA 2Z3WA 1CEXA 3ANSA 3HZOA 5ALWA 3ZLTA 4Y2PA 1R50A 3CXUA 1UZAA 4WY8A 3BJRA 4WFKA 2QR5A 1JFRA 1RP1A 4G9GA 5FDFA 1M33A 1JMKC 3AFIA 2GYVA 3WK6A 3UUFA 2BGNA 2HA7A 1QFSA 3CN9A 2PU7A 5I9IA 1EX9A 1YB6A 1EINA 3NGMA 3IVMA 3QMMA 3R3VA 3D59A 2WTNA 1YASA 2VAXA 3LP5A 2OGSA 2RGUA 4KAJA 1Q0RA 1USWA 1FFBA 1ISPA 5JZ9A 1CUEA 1KU6A 5AI6A 4H7DA 4FNGA 1X2BA 2G5PA 2G4LA 1EB9A 1JJBA 5DYYA 2Z8XA 3BXPA 2QMQA 2CEKA 4LXHA 5EIAA 4ZI5A 2WFZA 1SC9A 4OPMA 5AKYA 3O4HA 3HABA 5LZ4A 1UOOA 3R3YA 4AO6A 3RK4A 3V1NA 1J1IA 5ALZA 1YS2X 4U2DA 5EIHA 1EI9A 1XZKA 1XRNA 3OC0A 4L9AA 4AMYA 3M82A 3KDAA 3I1IA 1PJAA 4M0MA 5BWCA 2XQJA 3R3WA 3RARA 3A2MA 3WZLA 2WFMA 4X91A 4GLBA 3WYDA 1WOMA 4BYMA 3C6XA 1Z68A 3E1GA 4X6YA 5AM3A 4WY5A 1Q84A 4Z49A 3EF3A 3GELA 2HA4A 2JIDA 5AKIA 4A23A 5CRIA 1QIDA 1MAHA 4G8BA 4CCYB 1CUGA 1H2YA 4FHZA 3DYVA 2D5LA 1XZJA 4BAGA 2HA5A 3H1AA 2C0PA 3I6MA 4N5IX 3I2HA 2XMDA 5ESRA 1JJIA 1ODCA 1ORWA 4UBNA 1CUZA 3HXKA 2VATA 1BU8A 4OU5A 2GBGA 1MX5A 3EBLA 5EFZA 2G63A 4NVRA 1CV2A 4BE4A 3AINA 1DT3A 3B12A 2WHRA 1QO9A 4DMFA 5A2GA 1VJ5A 3JW8A 2QRUA 3PE6A 2XDWA 4MYDA 1BN7A 2DR0A 4XVCA 3ZPXA 4INZA 1EDBA 4DNOA 1XRQA 3FLAA 1GPKA 3VKFA 4B83A 2NW6A 5E4TA 2XMCA 2GBFA 3RKSA 1R9MA 4Q3KA 4XX1A 3I2IA 1F0PA 3W04A 3FVRA 5C81A 4J7AA 3JYHA 1G42A 4WCVA 1ORVA 2GBIA 3HLKA 4H7KA 2ZJ6A 3FYUA 1XZMA 2XUIA 1ZD3A 1U2EA 2XI4A 2H1IA 4BP9A 3UUEA 2ONCA 4DGQA 1SOMA 1F6WA 1K8QA 1R3DA 1DQZA 1P0IA 2WUEA 1TCCA 1LPOA 5AI4A 2Y6UA 5LZ2A 1S8OA 1IZ7A 4WJLA 2VTVA 3A70A 2WIGA 1VZ2A 2OCIA 1LLFA 3WK8A 3GUUA 2XMZA 4UFOA 4RE5A 1ZIXA 5DTIA 2H7YA 2ZJFA 3AJAA 1GKLA 4W1QA 2I78A 4FLMA 1JKMA 3F96A 4DMCA 2HA2A 3QITA 1LZLA 3D2CA 1SCQA 5AHXA 4U2BA 4C87A 5EHXA 5JAHA 2CUTA 4K6KA 4BRZA 2PKYX 5HQ3B 2O7VA 5CH3A 2PSHA 5FKJA 2AJLI 4EY5A 1WB4A 3VDXA 1YSCA 2OCKA 3FOBA 2HU8A 3SC2A 3W9UA 1R9NA 2HIHA 4HVTA 4FDMA 4PSCA 2HRRA 3E3AA 4MJ3A 4KE7A 5AK5A 5HFNA 2JGEA 4ZV7A 4B6GA 1BE0A 3WL7A 1QO7A 5KBYA 3QH4A 1UK8A 1MN6A 1XROA 3ZI7A 1ZD4A 4LXGA 2XB6A 3MUNA 1XKLA 1XQYA 5K3BA 4IQ4A 5DNVA 1BN6A 2PSEA 4CIAA 4W1RA 1AKNA 4J03A 3WL6A 4G4IA 4BDTA 4QDUA 3BWXA 5CT6A 3BF7A 5AI9A 5JAPA 4J3JA 2XMGA 4GXNA 3QVMA 2QM0A 3PF8A 2DHEA 2QXTA 1DU4A 1YA4A 5ALIA 2DCMA 3UMJA 4FFWA 4BCDA 4FTWA 1FJ2A 3IDAA 2WJ4A 1QIJA 4YX9A 1EDDA 1U4NA 3WIBA 4L0CA 2Z8ZA 2VJAA 3YASA 1AZWA 3NOXA 2OGTA 5A7HA 3ILSA 1J07A 3IURA 4H77A 2PL5A 4YK7A 3FWHA 3GFFA 5AIAA 4MWTA 3WYNA 1QIGA 1JI3A 4K5QA 2JBWA 1PFQA 4U2CA 3NUZA 5ALUA 4DNQA 5D3KA 1GQRA 2HA0A 3KWJA 3QBJA 5HQ3A 1HBJA 2BGRA 4QEKA 5AI5A 4Y2TA 3EQ7A 5ALVA 4OUKX 4X00A 5AO9A 2UZ0A 1A8QA 4Y2JA 4BCCA 3GBSA 4PV7A 1H2XA 2XMBA 4B85A 3D0KA 3I2FA 3ANTA 4AO7A 3C5WP 1EHYA 2V96A 1XRPA 5JASA 1L7AA 1W4LA 1C4XA 5ALPA 3B5EA 3O4IA 2PU5A 5FPQA 4AMZA 4FWBA 3C70A 3VJKA 4X6UA 2WILA 4F60A 3MGAA 2XUDA 4DIUA 1XZAA 3WLAA 2ZSIA 1QTIA 5AJHA 4FFVA 2QXUA 4E14A 4G8CA 4BP8A 4ZXFA 1MJ5A 3DD5A 2ZYHA 2VAVA 3E0XA 4IHAA 5IH7A 3E4DA 2DQYA 4MYSA 4DNFA 2IITA 4UPDA 3AIOA 2OG1A 1MT3A 4OB8A 1IMJA 1I6WA 3F98A 1GGVA 3IUQA 3ZLVA 2FJPA 1VZ3A 4X85A 2WIFA 4ARBA 2JGLA 2I03A 4Q3LA 3HEAA 5FOQA 1CUYA 4BTVA 4W1SA 3DS8A 5DNUA 4XWGA 4BVKA 4F0JA 1MX9A 2FX5A 3A2NA 4EBBA 4WDQA 4HRYA 2BJHA 2DSNA 2QT9A 2WKWA 2PSFA 5AP9A 2FUKA 1EB8A 3BL8A 1JMYA 3L1JA 1SCIA 5FUMA 4K6HA 1RYYA 4M0FA 5ALHA 3VXKA 4X3CA 3AIMA 4TVKA 1EVEA 2HFKA 4GDMA 1CUJA 1OILA 2BAGA 1GPLA 3TGLA 4F21A 2DQZA 4UHHA 1CUXA 2Z5GA 5ALYA 5DLPA 1E3QA 1CUSA 4Q3OA 5LZ7A 2AJDA 5AM4A 1XZHA 2HADA 3ZV7A 2PBLA 1IUNA 3D5EA 1MNQA 2XUFA 1QTRA 1X2EA 3JWEA 4X6XA 3C43A 3KXPA 2C5FA 3C87A 4BZZA 4KE9A 4UFPA 1TK3A 3WL5A 3S2ZA 4L72A 1CQWA 1AURA 2Y2UA 2C58A 3HI4A 1GZ7A 4F5ZA 5ISMA 5T4EA 4J0KA 4KACA 5IVHA 2DFPA 3IB3A 4AXBA 5K3AA 3I2KA 1YCDA 5DYTA 3L1HA 1MX1A 1FFEA 1BRTA 4ZGBA 2XMRA 2XMSA 3DEAA 5IVIA 3OURA 2HL6A 1P0PA 4FBMA 1K4YA 1QONA 1TRHA 1EXWA 3D3NA 4AZ3A 1UWCA 2WFLA 4AN0A 2VA9A 1YAJA 3V1MA 2CJPA 4UBOA 4EY6A 4HXEB 1N5MA 2QUBA 5CT8A 1LZKA 4W1PA 4K6GA 3KOOA 4WDRA 4QDXA 3TRDA 2OQVA 4QE3A 4H7HA 5ALQA 3M3DA 5K5EA 2H7CA 2XMQA 4KAFA 5JAOA 3G9XA 4EY8A 1AUOA 1MU0A 4BCBA 1LPSA 3I2JA 1YB7A 4AQDA 2WM2A 2B61A 4NMWA 5HF8A 3G0IA 5AIBA 4BC1A 2OPHA 1G5FA 3WA7A 4J0DA 1CUHA 2LIPA 5KWJA 2RHWA 1XLUA 4C6HA 1XFDA 4P08A 2CMFA 4JH0A 3H1BA 2G5TA 5K3FB 5C8ZA 4FMPA 4MXDA 2CB9A 1YS1X 3DL7A 1LPBB 5F4ZA 4ROTA 3V48A 5KWIA 4JYPA 3D2BA 3DYIA 4QDZA 3WI7A 3QPDA 2WHQA 1CIJA 1LBSA 4PF1A 5T4HA 1CUWA 3DKKA 3QMVA 1ZIYA 3R3XA 1WHTA 3FBWA 3F8SA 5AM5A 5CTAA 1ZGCA 2B4KA 1EH5A 1LGYA 3I2GA 3G9ZA 3IA2A 5AKZA 3DNMA 4WFIA 1LPAB 4MEAA 3IIIA 2ACKA 1AMNA 1E8NA 5HF9A 3K9BA 2HA6A 3WKEA 2B20A 2Y6VA 3F67A 3H2JA 1T4MA 3HC7A 3DQZA 3CN7A 4GBGA 4D9JA 2X76A 1XQWA 3O95A 5K3FA 4TGLA 3HSSA 2C0QA 4L3WA 3HYSA 1CUVA 5DYWA 4I3FA 5A7FA 5AK4A 2HM7A 3DOHA 4BTLA 3A2LA 4CG2A 4S0XA 3STUA 4G4JA 1DX6A 5T4BA 4KRXA 5AI0A 4CI9A 3H0CA 4NZZA 4QWMA 1ZJ4A 2Y1KA 2VJBA 2PPLA 5JZSA 2WFLB 4RPCA 5LLSA 4IH1A 4C88A 2PUJA 4CCWA 2I3ZA 2GYUA 3W2TA 5H3HA 1OXMA 1ZI8A 1JU4A 3ESBA 3WK9A 2WG0A 4GW3A 3K6KA 3GROA 4TPKA 1C7IA 5EHZA 5JD6A 5ALMA 1EK1A 1B41A 3ZLUA 2VEOA 3FSGD 1WPXA 5CXXA 4KE6A 1MPXA 2O2GA 1LBTA 1UFOA 4H35A 1GQSA 1GXSA 1UKBA 3D7RA 2Y2VA 5AOAA 3HJUA 3MVEA 2WJ3A 3WMRA 2GZSA 2JEYA 2ECFA 1RWQA 2V9ZA 2W22A 4Y2UA 3LIPA 2OCGA 4LYEA 1XZBA 5JD5A 4OD0A 1QIHA 3DJYA 1UKAA 2P8SA 3L1IA 2QUAA 5A6VA 4AX4A 1N8SA 5JANA 2XLBA 2GZRA 1VA4A 3FYUC 4UBLA 1HDEA 4N8SA 1DX4A 1BCRA 1XRMA 4CCYA 4CG3A 1MTZA 3WJ2A 4ZRDA 3WK5A 1A8UA 2EDCA 2PVSA 2EEPA 1QZ3A 1WM1A 3O9VA 5ALDA 4X92A 5E2IA 4G4GA 1SFRA 4B80A 2C7BA 3PUIA 4N5HX 1UK6A 5SYNA 1R88A 3LCRA 3LLCA 3DKRA 4V2IA 4IO0A 1BEEA 2XQIA 4C01A 3NWOA 3C45A 2XQGA 2J3DA 2AJ8A 1GT6A 3R3UA 5JD4A 3STVA 5ALNA 5K3CA 5T4FA 2RHTA 1U65A 3TJMA 2YYSA 5ALOA 4P92A 1H2WA 4KR0A 3VJLA 5EGNA 4JYMA 1ZD5A 2JGFA 4RGYA 3BIXA 4P9NA 3PDCA 5LYYA 2Z3ZA 4UBMA 1MAAA 4U2EA 4DNPA 5LKAA 1QE3A 2XQFA 1WHSA 1W76A 4EHBA 5I7UA 3H2HA 2YXPX 1CQZA 1W6RA 1E8DA 5EHNA 4Q82A 4NS4A 4HXFB 4BBZA 4B84A 1VLQA 2IIVA 4QDOA 3V1KA 4C4ZA 2QZPA 3AIKA 1C7JA 1XKTA 3H2KA 3GZJA 3STTA 2WIJA 3IBTA 3IUJA 1CUBA 1WCYA 1WB6A 1CUCA 3KSRA 4QZVA 4C4XA 3V1LA 3G9UA 2XUAA 3G8YA 1BS9A 3QM1A 4ZWNA 5A7GA 1Y7HA
chains in the Genus database with same CATH superfamily
3U09A 1LNSA 2BF7A 2L69A 4TTTS 2Y9PB 6ABPA 4MPDA 1HL7A 1UIRA 1PFUA 1FS4A 2XA1A 1W35A 3KVNA 4ALMA 4RA6A 2E6KA 1F8GA 3B13B 1SCBA 4E08A 2WJAA 4U5XA 2LV8A 3C1AA 1LDNA 1G59A 1ORTA 1PCXA 1NF2A 2WRZA 4JI8B 4KO8A 3CH7A 3KQWA 2CLEB 2XQVA 3FNIA 4W82A 2FR8A 5B64A 1VBNA 3FPBA 2HYIC 3FSRA 4GAEA 3UB2A 1EDZA 4GMDA 4A82A 2W6CX 4WCVA 5EEGA 1ZICA 4V1CI 4ENRA 1KJYA 5CGQB 2QN6A 2IWHA 2NOAA 1T5TA 3LECA 3VVMA 1E89A 1L7NA 2RBEA 4ZIRA 1KO7A 5KQSA 2QJOA 1XTKA 1H93A 2CV1A 4MUIA 3OIUA 3EMKA 2Q3LA 4ZVUA 1PEDA 3KB2A 1RAFA 5LMZA 3FTEA 4XUEA 5JH7B 2GPYA 1DBRA 4LV5B 3T1HB 2BBSA 2W4MA 4RHEA 5B3AA 5DI3B 1SULA 3EGVA 3OIYA 3GP5A 3FVTA 2YL2A 3HBFA 4TTSA 1PJCA 3QUQA 1U2ZA 4CKEA 5JXJA 1MOZA 1EFTA 1R8JA 2R11A 3D3EA 4HRXA 4XIIA 4MRMB 5DLYA 2FDCA 2NZXA 5CEEA 4ALKA 3E7WA 1CUUA 2AE2A 2XTMA 1MNAA 4NMHA 3AZPA 3K6RA 2VJYA 1UBJS 1XYYA 4FP9A 4UU7A 3X1XA 2DB3A 2N75A 3SF0A 3K9WA 2C2HA 2ODEA 5EQTA 5MGBA 1NW8A 2ZT7A 2Q4BA 2YWBA 3ZW7A 4CHGA 5KOJA 1DOZA 3AUUA 3AF6A 8MHTA 5I48A 5DHAA 4AZTA 3EW7A 3KYJB 4KQXA 1PEYA 2WSLA 3GD7A 2HSZA 4LZJA 2V3WA 3UMSA 3D3WB 2JARA 2V7GA 3C6BA 2AYXA 4K9RA 1T1EA 3M8KA 3C6MA 4RPLA 4H3VA 2PS1A 2Y3IA 1BAPA 4IMIB 4GP6A 3ZX5A 2G9ZA 3IYLW 4I08A 1VGQA 5J4VA 1N6KA 4AWAA 1TX4B 2OQIA 4KIJA 4IVQA 2REOA 4FE3A 2HLDD 5LQDA 4BAZA 1YB1A 3OZDA 4WNCA 2ATIA 2EDAA 1XK6A 2O23A 2W43A 2BHLA 3LA6A 2HK8A 4LJ9A 3ZXYA 3S8YA 1W48A 5EJGA 2Z6UA 1JA1A 5CFLA 3RSZA 3V4RA 5AM1A 1B16A 1CY2A 1Y4UA 4EZBA 3C3JA 3O9MA 3CEAA 3R2JA 3RFTA 2YYYA 5ESWA 2Y77A 1XZEA 4I4TA 5K1ZA 4HH3C 3S40A 4YXWD 2O20A 2YICA 3KTAB 3N2ZB 2VF4X 3GXOA 2QRZA 2HREA 4L7VA 2QU7A 4NRDA 4JELA 3WTBA 5COBA 3QHQA 3KTFA 1P18A 4KJXA 1RFGE 1SA0B 1FFAA 2RGYA 3K2BA 3C14C 2X8BA 4B6QA 3EVAA 4IG4A 5C0OE 3UGTA 2XMPA 3SX2A 3DXXA 2Z2KA 1BD3A 4LHVA 3H9QA 3DLIA 1UFQA 1CR6A 4B4UA 5BV7A 3RV4A 3UGJA 4FU0A 3C74A 1THZA 1NDUA 3QOXA 4B6SA 1X7ZB 1FPQA 1MVNA 1YZYA 1CEYA 1YB5A 4O4LA 1HSZA 4UZFA 1DRWA 3DBLA 1OE0A 2C94A 3OOEA 4JHLA 4JP3A 5BV1A 1ZXBA 2Y1WA 4ZPJA 3S1SA 2EX4A 3EWNA 3MSCA 4D8WA 5CH5A 5SZKB 1XAIA 2I7DA 2Q27A 3WSWA 1QTQA 1TF5A 2PGLA 4GKKB 1YUBA 2C83A 4PRZA 4JXZA 5P8WA 1Z5VA 1F4LA 1SB8A 1E6EA 4QD3A 2G0NA 2PV0A 3WQRA 1SUCA 2NP7A 3QPBA 4F8JA 2CC2A 4UE2A 2FOXA 4EUSA 1ZGBA 4FK8A 4M89A 1LBIA 1D6NA 1A5ZA 1Z13A 5ALFA 1KGSA 2F9LA 4FKMA 4IDNA 3V5NA 5EJ5A 4B32A 1NXTA 3U4QA 3KFVA 1U8XX 3O74A 4DRXB 4JQCA 3DAOA 3FFXA 3V8PA 1WZ2A 4CEJA 1QG0A 1KVRA 1SEVA 3FUWA 1I6LA 3QLVA 4N8DA 3ZYZA 4GGMX 3OFNA 3QV2A 4H1UA 3A10A 4MOWA 1ZD2P 3WWPA 4YCCA 4QAJA 3TKLA 4J0JA 1QIFA 3X2EA 4CKCB 3WGYA 1BWPA 3BIWA 3TW8B 1DIOB 3KXDA 4Z1MD 2HSWA 3B2NA 5GIPE 2E7ZA 1HDIA 1KI8A 1YNOA 4JJ7A 2XE4A 2AJCA 2V0NA 2SECE 4HPXB 1GAEO 1Y9EA 3CH4B 1A8PA 1HWYA 4UHFA 2X5XA 3N74A 1TC1A 1EG7A 1COWA 2PBZA 3NIGB 4L2IA 2LKDA 2XCLA 4HEQA 1USUA 2NU6A 4QDTA 1KJWA 2O8BB 1M2WA 4TL8A 3U56A 3W9SA 3BICA 2F62A 2GHIA 5B37A 1UXHA 2VPWA 1GT91 2PRSA 1E18A 2PSSA 3FHJA 3GHYA 4GZ3A 1JP7A 3NH9A 4K9OA 4L15A 3QKIA 4J6EA 1UK7A 3MNFA 3ABRB 3CEJA 1U8YA 3IPLA 4K03A 2HDWA 3VAZA 1P7PA 1X94A 4KOAA 1XAGA 3DR5A 1JI0A 5IC5A 1CF4A 2G9NA 5IP5A 2Y68A 3W5JA 3OKCA 3Q4GA 4PCAA 4Z0NA 1SHTX 2W2TA 4LOJA 2IZ7A 4DDKA 1A4XA 1VDMA 2OMEA 1UJMA 2WDZA 2ZRAA 4LJAA 1LDBA 5DNWA 2ACWA 3K8QA 3DLTA 1LH0A 2EF0A 3V97A 4FYHA 1Z15A 1T43A 3MUEA 4JKIA 2UZIR 1L1RA 3MCTA 2Q1SA 3UWSA 3W8EA 5BMVA 1C9JA 3CR3C 4YCMA 2GK3A 5IEJA 1JEYA 5I9TA 1F5SA 4GLFA 1DPFA 3WYBA 4BEVA 2EIXA 2WMYA 1L7BA 5IW8A 4DLBA 4R31A 1P81A 3RM3A 3FTFA 1XMVA 3PK0A 1F8UA 3AYZB 3D31A 4FT2A 4C1NA 1E4OA 3JQGB 4B35A 3NHMA 8GPBA 3KZXA 2JFVA 4GOLD 4L5AA 4GOMD 5IJAA 3WFZA 2EBFX 2AXEA 3NHJA 4UMEA 4H7PA 3UYLA 4NCKA 3VR6A 1ZO8A 4RQBA 3ULKA 1HFJA 3VR4H 4H9GA 2O2HA 2ZWAA 1YU9A 4G5GA 3WK7A 3O8OB 4O08A 1Z2AA 1GGJA 4WIAA 1V0JA 1FLDA 3AM4A 3MT9A 2IDKA 2EYQA 5DV9A 1U28A 1D1TA 4JASB 2XKKA 4XRRA 2ECOA 3KVRA 3WO0A 3AUXA 3QG1A 2B2NA 3MRVA 3P19A 1OXSC 2O2IA 3A06A 2A1IA 1J6UA 3L7KA 4WLOA 1L7EA 1U5AA 4DYVA 4BEWA 4ZZ2A 1FYFA 5C7LO 3EGDB 1P4HA 5IVKA 1OJ7A 2H16A 4GPD1 5B3KA 4BRWA 3EULA 3RKRA 3TLEA 3A1SA 1A5TA 3D54D 2GAAA 4MKZA 1EWRA 5HF6A 5IF9A 2OLEA 3ESAA 1J5PA 1EEHA 1UDXA 3DKVA 4BO4A 4HNTA 5IYZB 2JFGA 2YJNA 4MIYA 2YDXA 5IWAB 4QJ4A 1ZGJA 2Z5FA 2A9RA 3KD2A 4D9CA 3OI7A 2ENUA 1G9XA 8ATCA 2ZULA 2XGSA 3BF8A 5C53B 4E1VA 1NUQA 3WX0A 5HK9A 1X92A 3G9QA 2RG1A 3LHSA 3LIIA 4KCGA 5TF0A 3K31A 3GP3A 4Q7EA 4BQSA 5LN1A 4LSGA 3OTHA 2WWGA 2YOGA 1W9HA 3C6ZA 1G21B 1FNCA 3ZQ6A 2Z58A 3EPPA 1Y7TA 5P21A 4IOLA 4DQDA 1BGXT 1BXKA 1R0KA 3S1AA 4DBVO 5KVCA 3NKVA 4MCHA 2B21A 3BIFA 1TLLA 2C3YA 4JJIA 5GZ3A 5KNDH 4JP8A 3M4JA 4G2TA 3G2KA 3FETA 2QYHA 4DIOA 5KQPA 2CXSA 2HDOA 4PHTA 1D5CA 4ETWA 5JG7A 1KMNA 2WWHA 3N59A 3P0EA 1DWPA 4KVAA 4OKNA 4TXLA 4PLWA 1TF7A 4JWTA 3TZBA 1GYPA 1IRXA 4XR9A 2DPMA 4U9IS 4NOLA 2JAPA 4FFNA 5GV7A 1SWWA 3DFIA 3ABOB 4LRXA 4TV9B 1RLUA 3P94A 1QYWA 1WNFA 2ZJAA 2OA0A 2B25A 1BXRA 1VI2A 2JJYA 2A1TS 2Y1GA 3AHIA 3QIVA 5IZCC 2ZM5A 2DVMA 1P8AA 2VYND 2AHOA 2JHGA 2P30A 3HZRA 1W8DA 1L3CA 3ZDEA 5KSWB 4ZHQB 4AZ0B 5A5FA 2PJRA 3PHGA 4I1YA 1BCRB 3RH0A 3RD5A 3ZG6A 3RIHA 4YASA 4BLTA 5LP1A 3CUWA 1DUVG 4RDHA 2GPWA 4FGKA 4UDOA 5AW1A 2J5BA 4M88A 3PIIA 4YRLA 3IRVA 1F5NA 2GN1A 1F0NA 2J9RA 5IARA 2DBRA 4O4JF 4ARUA 4C06A 3EVTA 2GZHA 3PSAA 2JFUA 1A0OA 3IEPA 3NFRA 2CE2X 2XOEA 1CUIA 3BTVA 4EIWA 2BFAA 1NRXA 1EWYA 2RHHA 3OCZA 1T3HA 1Q11A 1T3SA 2ZK7A 1ZPDA 1TM4E 1G66A 3VYRB 1BEUB 3V4LA 4UHCA 4EDHA 1PZHA 4XCXA 2XE6A 2HA3A 4YTEA 3LD9A 5BQOA 1HKHA 2W6PA 3EXAA 3G8CA 4TN1A 3F97A 4YC7A 1CC1S 2C9MA 1OFUX 2VLIA 1L3IA 1NJ2A 2D1TA 1K6MA 2PRIA 3DTVB 1K5GA 3G2PA 5D6NA 1J06A 4HLUA 5IXYA 2PO7A 4A16A 3E3MA 2DQSA 2I4TA 2EATA 4Y2XA 5DHRA 3D4PA 3MW8A 2X4LA 1SUWA 2P79A 3RJ5A 1E94E 4K0RA 5ITVA 3TNDA 4LHEA 2JLWA 3FYTA 4IV8A 4W8OA 1MC5A 4U02A 5BR7A 5CFZA 1QLHA 4UVGA 1YDHA 4QLOA 5EP2A 5FBLB 5DGIA 1KYTA 3SYMA 1TKRA 3W9BA 4V0NA 5KKCA 1G6Q1 4TYNA 3L9XA 5CB0A 4IIYA 1HRKA 3GJ4A 2ETVA 4WNIA 1SVSA 5G53C 1GGKA 3OZCA 3E1SA 5HOEA 3WTCA 1VB5A 5BWBA 1QIEA 1HE5A 1U99A 2ZAYA 2ZSJA 2NSLA 3AEKA 3D6JA 3G02A 3IULA 1Q7EA 3BRSA 3WOVA 2H7XA 2ZJBA 1YR8A 1QIKA 2X7XA 3VDMA 3B9PA 2FB9A 1A1VA 2HWWA 2OD9A 1YZNA 2HJRA 4G1FA 1JMVA 2WNIA 2B0JA 2I3BA 3I6QA 2RGWA 3FPEA 3KT8A 3T9DA 2QL5A 4RORA 3ZBQA 4FCVA 3EPHA 3DL0A 3AL0C 4I99A 2XWBF 3R77A 1W88A 4WKGA 1T25A 2B82A 3F5FA 2JLAA 2GLXA 1ANKA 1FC0A 4PSDA 2ZVPX 3BJMA 4AJ9A 1PJ4A 3GCDA 3GUYA 2GJ4A 2DHQA 1UPTA 3NAZA 4OBXA 4BLQA 4FMDB 1R4ZA 3F8WA 4GMHA 3NJ4A 3LT5A 4C0AC 3GLGE 3OOSA 1N3IA 3HPQA 5LQRA 2HPHA 1KDZA 3LZDA 2G67A 3JRXA 2R8OA 2BLLA 5TQ0A 3HVJA 3UF0A 5FEUA 1ACJA 2YNMA 5B53A 1YFZA 3KD3A 4II7A 1PG5A 5NLLA 2V8OA 4E32A 4EJSA 5L3QB 5A4DA 3HFGA 2HU7A 2ZJ1A 1OSNA 3EDQA 4ARZB 3S7TA 1UKYA 2BDTA 1Q57A 3STWA 3ONDA 3ZCVA 2YX1A 3TFQA 4D9IA 5D7BA 1M73E 4EMTA 2HCFA 2Q5QA 4IKPA 2YXBA 2NPFA 3ZH9B 1J2EA 3GLIB 1WW8A 2FZWA 3AUJB 3FMIA 4N6NA 1LLCA 4M0DA 1TJYA 1Y7IA 3TW6A 1J2RA 2KLBA 2RARA 1Z9BA 2GCGA 3I30X 2PUHA 4FOSA 2UU9B 4QJ5A 1YVRA 1BDBA 4S1VA 2OP1A 5C4GB 1IZZA 4C30A 1VOTA 2HSDA 3ZTWA 1VXRA 5J3JA 3JAKB 2X4DA 4AROA 4OYYA 2VT2A 3GDFA 1QQ5A 3CLTD 3TSCA 3LLSA 1C0IA 3DFUA 3FF1A 4Q19A 4EW2A 3LGSA 3ZD7A 1O95D 5TEWA 2WIAA 4JENA 2C2WA 3CGWA 4AK9A 4L74A 1ILEA 2C82A 2Z6QA 3ADDA 3C3MA 3M4ZA 1TECE 2ZSHA 5ED0A 4C43A 2J45A 5EZ5A 2FSVC 1RCUA 2HUPA 3H19A 3DGFC 4KQ1A 2WPDA 4ZEOA 3MWYW 2CXHA 1BROA 1QLWA 2O0MA 4YIHA 4CMJA 4N03A 2YHIB 5K8LA 5HK8A 2H08A 1E66A 2O6LA 1ZM3A 1JAHA 3I72A 4ISBA 4YQYA 3I1JA 2IIQA 2W2VA 4O2AF 4RKQA 1Q17A 4D4HA 4FFRA 1MT0A 4LNHA 1BZYA 1D4AA 1VP3A 2HIMA 2LRHA 2OO7A 1OTXA 3F3YA 1A82A 1FX0B 1II8B 3LWZA 5D84A 2OAP1 4IIUA 2Y67A 2I3DA 3F6RA 3P9NA 4P3NA 3IP3A 4XWOA 1D8AA 3GB9A 1G2QA 3WSTA 1M5RA 1WAMA 3DBHA 4FQ7A 1YONA 1P62B 1YDWA 5LB4A 3T4UA 4UCWA 1EUZA 1OA0A 2E1RA 3D6MA 1DWQA 1N9ZA 1QG2A 2E48A 3C7KA 1CR2A 1LTKA 3QF7A 4JXJA 6ADHA 4GOKA 1UODA 4K9KA 4EHBA 4WKBA 1HQYE 1YRBA 1T9KA 1KMHA 1LW6E 2JIPA 2OV1A 2V5VA 2QP3A 3REGA 3OTQA 2ZUVA 1NVGA 1BX0A 1GCGA 1YE5A 1EE2A 1EUCA 5BR1A 3HB4X 3O75A 3GEPA 1WQ1R 2V4ZA 3QEKA 1OQAA 2GN4A 4GHWA 4ZD6A 1VDZA 4DSNA 3LCUA 4KUEA 1UAGA 2HC9A 1RWKA 3Q0IA 4P93A 4D4JA 4HWRA 2A4KA 5FUVA 3FUTA 3WY9A 4A8HA 3FNBA 3OPNA 2DULA 1SD1A 2PA3A 1WDWB 2BFNA 3L07A 5IZCA 3PGMA 3HU2A 1H0HA 4MX8A 1XJ5A 3G2QA 3P4XA 4JLJA 1P1CA 4NJOA 1N9GA 5EE3A 1L5YA 4M8KA 1YV9A 1QQAA 5T8KC 3PYXA 1P9OA 1RWPA 1ZJ5A 2QE7A 2VH2A 2Y05A 3WA6A 4QM6A 2QTTA 2XZDA 3EOAI 3N39C 4XGQA 3WNDA 4DLSA 3ND5A 3IE2A 5K8IA 3LHDA 1XG5A 4I50F 1RMQA 1O95C 4U3JB 3ROMA 1U0EA 1KI9A 2FR1A 5EWJA 2IPOA 3AEQA 4R2MA 1YT5A 2HF2A 3QKUA 4C07A 3G2OA 5SY6A 1GTSA 2N47A 4DJDC 3BCRA 1EVYA 4OHWA 2YN0A 1P1BA 3LX8A 1JHVA 2F3SA 2RGGA 3HRHA 2H4JA 2IW3A 1GPBA 3L0ZA 3OZWA 2JD1A 2FDXA 1GZ4A 2WICA 3DCNA 4G25A 4FLEA 1PEKE 2D1SA 4N18A 4PXYA 4DQLA 4LVNA 5YASA 2IW1A 4OQ4A 3COJA 1SVMA 3GT3A 1VFNA 1IYZA 2ES4A 1C3VA 1V1MA 4MV8A 5HKBA 1JU3A 3O3MB 4Z4HA 4K28A 2A7QA 2R6JA 4UQPA 4KDRA 4CHTA 3KJGA 1RQ7A 2OGUA 1PAUA 1GGFA 3DD1A 3GK3A 4PBTA 1W36C 2CJXA 1VXOA 4S35A 4BU0A 5JZBA 5F1OA 4MQFB 3MJSA 2I33A 4XWAA 4ZYYA 3IQDB 3RSQA 3T7SA 1E96A 5JFGA 3MMSA 2HBRA 1J9ZA 3ESDA 5CA0A 3VQTA 4MJLA 3WWDA 1FU8A 4F71A 3ZDDA 3EGDA 3KTDA 4LZOA 3FWPA 1OB5A 4LIPD 1L5SA 4X5OA 3WK4A 5C32A 4UBKA 4AQ7A 5EGSA 5L8VA 2FUEA 3LZ6A 2OFFA 5K0TA 3TXAA 4WFJA 3SQNA 1ECFA 5ALXA 3D4OA 1JWBB 3F7MA 3STXA 3HYNA 1K7FB 3KKNA 1ES9A 1H9BA 4NSNA 1KY3A 3CZQA 4LE1A 3ZLJA 1D4ZA 2VDVE 4I1PA 1CF9A 1DL5A 4NFYA 5EUCA 4YY3B 4PX3A 2O8VA 3N2KA 2BH2A 1DBWA 1Q83A 1JSRA 2Y1CA 3VU3A 3SIXA 1I3KA 4JP5A 4RMIA 4X62B 5ELXA 3EB9A 2GO1A 5AD1A 4IDHA 1RE0A 4I3GA 4BO2A 3L7NA 4DLNA 3AERA 2WBLC 4EFKA 1TCAA 2VSNA 4GI1A 4BFZA 2P77A 5KYYB 4R9RA 4XIFA 1HOTA 4BNGA 4IH4A 3S2FA 4Q05A 2EQAA 3GT0A 2P9QA 1MRSA 3LUPA 1PWXA 4EUHA 2ZI4A 3AILA 4KVGA 3T3IA 3PQ2A 3PR1A 3NAQA 1YDMA 3T9EA 3EZFA 4X7BA 3SM9A 5EMJA 5JWOA 5KSPA 3PDWA 1XNRB 3M1IA 1DWUA 4J0IA 4EY7A 4GECA 4YJDA 4L3VA 4WVFA 4IHQA 3N9IA 3TM4A 5A4MS 1X7WA 1L4LA 4IFTA 1B93A 1RYFA 1A71A 2WIKA 5LZ5A 3SHFA 1Y8CA 4BAUA 5A5VA 3M81A 5JJIA 5CYGA 2R7MA 2C7VA 2NT3A 1IUPA 1BA3A 1SUFA 1U28C 2VHJA 3A3PA 3LGAA 3ZTTA 5JSQA 1JLLA 5IEBA 2ZRGA 5AVSA 3C4VA 3CPEA 3GR6A 4X41A 1UP6A 4ZDKA 3E48A 3RWBA 3AYXB 4NF2A 4PS0A 3BMNB 4MHOA 5CUQA 3ROEA 3TZCA 2A57A 3OECA 3UK7A 1R5NA 3N6RA 1VE7A 3E5HA 4R5MA 4RABA 5T67A 2QOEA 2WJIA 2WZDA 2ILTA 4A5SA 4YAUA 3QEMB 1GPH1 1TL7C 4P35A 1U3CA 4DANA 1PBTA 1V8ZA 3OU6A 2ZYRA 5TMDA 1CFJA 1LPNA 1D9XA 2FKAA 3RVOA 5A4JA 1Y6GA 1X7DA 4F84A 1W19A 2C78A 3E81A 4LSZA 3EPLA 4I4CA 3AV0B 3EXFB 3L04A 1NW5A 4Q34A 2QHXA 2XVMA 3QIAA 4DY4A 3HB1A 2A78A 1NC1A 1SCAA 3B6IA 1DFIA 4DYDA 1EE9A 4E5VA 3NP7A 1WG8A 3CXRA 3UK2A 3IUEA 1H22A 1HDGO 2IODA 2QZZA 4KWIA 2PIAA 3OFSA 2EG9A 4O25A 4P3XA 1TLFA 2G7MC 2DLCX 5EE1A 3RSLA 1OPRA 1EGQA 4DFDA 5REQB 3O6VA 4LF9B 4E30A 3GO4A 2WUVA 4RPHA 1QK3A 4QTYA 4TYWA 2C7GA 1FVXA 2ZQZA 4TYPA 5CMLA 4BOYA 3UJBA 4CLOB 3U5ZB 3KQNA 4ES6A 2B9VA 1RM5A 2PM8A 1A2BA 1YRQA 2QTVB 2X41A 3I04A 4ILKA 5LYJA 5KPDA 5KKAA 1AV7A 1Y8AA 3OPXA 1N4AA 2C04A 4NBTA 2C4MA 3TO5A 1ZGHA 2PYDA 2ZUBA 2JIZD 1D6JA 5EKUA 2IPXA 5FO1A 1NJGA 3OQOA 3T0IA 2AXPA 4FN5A 3AR5A 2I65A 1QFMA 2ZCUA 1PGQA 3DLCA 5J58A 2VP0A 1GTMA 2CD7A 1PT9A 1NV9A 2UYYA 1NX9A 3GDWA 3W05A 3D7KA 2I4LA 2AEFA 1M8PA 2JGKA 1EG2A 2WWFA 5C5IA 1OVGA 2XVZA 3QWHA 2VXCA 5JTUA 3DE7X 2RI6A 2IEYA 4KFSA 3PJGA 3QVOA 4KXYA 3LE8A 2AW5A 2HU5A 2Z30A 3THSA 5I8ZA 1N4DA 1P9LA 1U3TA 4UASA 2G25A 1ZSNA 1XTQA 1ZUIA 2QTMA 1F48A 1M8KA 1I2BA 1DC4A 1V4VA 2FWAA 5C18A 2CF5A 1OOEA 4FOLA 5KHLB 1JR6A 4E2WA 2J32A 5AKXA 3I1YA 1MH1A 1K5PA 1UINA 4CMKA 3JQFC 4MGIR 4XEHA 2IS1A 3FJOA 3HB0A 3KQQA 4K2HA 4WNYA 5IJWA 2AI3A 3DJFA 2ZJ0A 5CTJA 3COVA 4GWLA 4OSEA 4TKLA 4B1FA 4B75A 3EARA 1G291 4L6AA 1P74A 3SXPA 1SVKA 1E79D 3ZXUB 3ZCPA 3O2NA 3FR8A 4TZ6A 5E0OA 5LU9A 4ZFNA 1N2SA 3B9BA 5HDBB 3F73A 3PQEA 4XUDA 1Z2NX 2GPSA 4W6ZA 1GHTA 4GSKA 1V7ZA 3NDJA 3VYVA 1JG4A 3QUSA 5HOQA 4HC4A 1NGSA 2WWWA 4KN5A 2H06A 4Z4QA 4PQFA 4AWBA 4HDCA 4GVPA 1XXHA 1J9GA 2YWDA 3FCXA 1T5IA 5DTJA 1WDLA 4QBFA 4UOQA 2CL5A 2H5IA 2KS6A 2RJNA 1CUDA 3RVLA 4D6XA 4K8OA 3DMHA 3L6BA 4P3PA 5JISA 3AF0A 4GC9A 1FBTA 1HTBA 2VI5A 3ZHYA 2DOKA 3CLRD 4YPOA 3AC0A 4YS6A 3WIUA 4PC6A 4E5SA 4WN9B 2VZ8A 3DKIA 4EHKA 1L4GA 2OAGA 1HE2A 1MB9A 1PSDA 5FLXA 3V6LA 3P0IA 4DG9A 1ZCFA 1JHOA 2VKQA 3UENA 2BKEA 2NAFA 3QVVA 1FFDA 1YA8A 4TX1A 3RNOA 3KB8A 3A3YA 4IJKA 1CRLA 5JMWA 1ODTC 5DI3A 4AU1A 5ENZA 1KDTA 2QWXA 4BQPA 1D9ZA 2QS9A 1TDJA 3ZWQA 1JJFA 1GJRA 1AVTA 1F12A 3W2EA 1NBWB 5I7VA 1I3LA 1MB2A 2XYQA 3JRNA 1C80A 2P4EA 1QZTA 2EFCB 4CEIB 1C4OA 4AURA 2H3HA 4FLFA 3AEUB 4YRSA 4G0ZA 2Q3HA 3C8HA 1EHCA 3PHCA 4MS4A 2J9GA 4MGYR 1VMAA 2XWSA 1TW2A 3MQ4A 1V7QA 4ZHQF 1MV8A 5T6BA 2Z95A 5KC8A 2Q5FA 3B3QA 1FJHA 3QY9A 3NBZC 3M4XA 3NIBA 1NXQA 3HPRA 1VC2A 3ZH2A 3FX2A 2PMKA 2NUAB 1KEVA 2WWVD 4LNUA 1KZ9A 1E5QA 4IO1A 4FKBA 4G85A 4Y2RA 4YUYA 3MINB 4S1TA 3U3RA 1SCDA 2WHPB 2O52A 2Q5JA 3ADOA 1DJMA 4B9AA 4HB2A 1M76A 4FCWA 1NWCA 4GSLA 4FOPA 2A3NA 3IMCA 1CS0A 3RKUA 3A9RA 1PUIA 4ZCLA 1OBFO 4YAOA 5HQJA 3RV3A 3H6KA 4XAQA 4NZ9A 4JVNA 3WDMA 4B87A 2JJ1D 3ECAA 5J2TB 1UZAA 2I4OA 2VYVA 1XTJA 2Q3FA 5C1DA 3LPMA 1AKMA 2JD2A 3AQ4A 4N5NA 3O31A 3K0SA 5JNVA 4BDTA 5IABA 5T64A 5FPKA 3QEJA 4HN4B 4Y7CA 1QGOA 1ESMA 2LVBA 2ZJ2A 5FYQA 2GYVA 1JFLA 3ZU2A 1ZIOA 3LVFO 1SZJG 2HA7A 3HO6A 3FOFC 1JECA 2IUSA 2J33A 1B6SA 2HJSA 4BJ3A 5B4UA 3WNVA 3V1UA 3WMEA 5F9FA 3G7UA 4EG6A 3BRWA 1UL1X 1YR1A 2O2XA 3LDAA 4PZDA 4EPYA 4NBKA 3UQYS 3NGMA 1J9EA 3JCZA 3M5PA 3QMMA 1X7GA 3R3VA 1U6KA 5FOXA 3C3KA 3D59A 2SICE 2AV6A 4HDNA 1TU4A 1TZCA 2GWRA 4RPGA 3B7GA 3V33A 1GG2A 2FW1A 5THQA 1F3LA 2WTNA 3VX3A 2Q0SA 5ERGB 2PUTA 1V45E 2VAXA 2PZ8A 2OGSA 3HGQA 3THXA 3BB1A 3HV0A 2B1JA 2CV2A 1DSSG 3B70A 4O0LA 1JAIA 5C34B 3I1FA 2EX0A 3R4VA 3SZGA 1MCZA 3H4TA 2CMGA 1D2GA 3SZLA 1ZJYA 5A6SA 1SXHA 1W0KD 1JDVA 2CE7A 3CWQA 3IPXA 3FGNA 3DONA 5CYPA 5C35A 4IHJF 2ZJ3A 3GUVA 4UTOA 4KO1S 2XTZA 2EERA 1KU6A 2CLDX 2E4ZA 3DOCA 4H7DA 4L0MA 1QORA 3KVYA 4CJXA 4E2FA 1AKYA 2HT6A 1GG9A 1BH2A 1NQVA 3V4SA 2SKDA 2YXDA 2DR3A 1VJ0A 1X2BA 2G5PA 2PDAA 1KYYA 3HS3A 4QC2A 1KZHA 3TE7A 3BA1A 3OCCA 5CNIA 1XT6A 2ZB7A 5IUNC 5L6MB 3KC2A 5K01A 3ICPA 1KK1A 3N2EA 2CNNA 4HMQA 2BR5A 4HH1A 3K9CA 3BXPA 5CX1A 1U9IA 3M6WA 2YN4A 2J3MA 4IS3A 3VPFA 4DV3B 2CYBA 4LGYA 4ZI5A 2DR2A 2IHVA 4PRLA 3NBAA 4YCDA 4HMOA 1SC9A 4R5HA 5HZMA 1QBGA 3M49A 4DC9A 5AKYA 3SYRA 3KFXA 2ZSUA 3MGGA 1IATA 2A9JA 3A4NA 2ZR9A 3ETJA 3D02A 1QR6A 2EFEB 2HJWA 3IR5A 1YFKA 1ZAYA 1PK9A 5LZ4A 1LJLA 3DMYA 1QO0A 1IVNA 2BFDA 3INGA 5DXAA 1QP4A 1X8XA 3IQIX 3KOMA 3ETNA 3FOCA 4QUGA 2FEPA 2UZAA 4M46A 2CXNA 3RASA 1YS2X 2P27A 1PT6A 2PMFA 5EIHA 5BY2A 1PWZA 3TL2A 1WSBA 1W0JD 1XRNA 4D8XA 3RFXA 5BORA 4RY2A 4AMYA 5CAEB 2FEKA 3VTKA 1T2DA 3HEMA 4KYUA 2NU9A 4M0MA 4RH3A 5BWCA 2CF6A 2XQJA 3R3WA 4PU0A 2Q6OA 1STOA 1X9IA 2PT7A 1ILWA 1JEAA 2GA8A 4OI1A 2GAOA 2SHKA 1S9DA 5E6UA 3ZGXA 1VHDA 2IUUA 3Q98A 4ZZ1A 4G0NA 1B1CA 2WFMA 2V4MA 1M6NA 2AZMA 4GLBA 1PNQA 3WYDA 1WOMA 2XZOA 1GYRA 2W2MA 3VU0A 3PIDA 3TPFA 4BWVA 1FOEB 4TV9F 1TM1E 1HR0B 1THMA 2PGAA 2X3FA 2X40A 3BK7A 1FW8A 3OY7A 4R1SA 1JALA 3GZNB 1FDIA 3GPLA 3N0XA 4CRWB 2OLKA 3ABZA 4OP2A 4V2UA 2DX7A 2JJ1A 1Y81A 2D4HA 3ITNA 4A0SA 3AJDA 1UANA 3G2IA 1P1IA 4RK0A 4AAYA 2H0RA 1CEQA 2FMIA 2HA4A 1U6JA 3AT1A 3CCFA 2CUNA 3KZ1E 2Z9BA 3SOPA 3FVQA 4A27A 3INTA 4BLVA 4G8BA 1MQ9A 4HB3A 2OFXA 2YJTD 2R44A 5DEIA 4DM3A 5HYVA 3SFZA 3DYVA 1D0SA 5D5PA 5DK6A 3B9RA 3B52X 2W2KB 4EF5A 4Z99A 2GN2A 2WOJA 2HA5A 5EQJB 3RRMA 2OFPA 3DLAA 4ZXPA 3T1VA 1OYOA 3OLCX 3R3HA 2B1QA 3AHJA 3E58A 4WZAE 4AP9A 4BHTA 4O2BA 2GESA 5TY0A 3RODA 1UQTA 3ASVA 1MO4A 3LY8A 3B1VA 3FCCA 5KKNB 2RD2A 2QMEA 3IPAA 4P4NA 5ESRA 4ARVA 1Z08A 3KBOA 1NZJA 3VR3A 3OEEA 1ODCA 3TXYA 1N0VC 2M32A 2CWDA 4PNHA 5DHFA 1C29B 1C4WA 3KE8A 2VQ3A 4UBNA 2RGBA 4ED9A 4EVIA 1XMJA 4TTRA 5FL3A 4OP1A 1HYQA 5AUQA 3MFYA 4B2YA 4C7XA 1Z0FA 4LE0A 4M22A 3THWB 2FVXA 5TS2A 1MQ8B 4YMWA 1IG0A 4NBWA 1MX5A 3CBGA 4B74A 3EBLA 5B4VA 3LUKA 4NVRA 5G1PA 4QFDA 5JNWA 3SP1A 5IF3A 1OU0A 4R1UA 4D9EA 4OO3A 5AJYA 3KQUA 1NRJB 3E2PA 4DMGA 3GAMA 4FHGA 2MWMA 4EJ6A 4MIKA 2WHRA 4DW8A 2SCUA 3IUSA 4ECEA 4H1WA 2HNBA 4US0R 4YT5A 3SOZA 1DHTA 3QELB 2REBA 4EFDA 1P75A 4YRAA 3FOEC 4D80A 2L0XA 1J25A 1TYBE 4PYKA 2F3TA 2XDWA 4JGGA 1P5ZB 1QFYA 2FWBA 3AHCA 2P2YA 3QKTA 3K0AB 4NV0A 4AICA 5CHEA 3ZPXA 2UUAB 3Q6MA 1N77A 1EDBA 2GO7A 4FFPA 5DOZA 1KL7A 2ZLBA 5H02A 3G2HA 3KT3A 2H1CA 2I2WA 1A9RA 4I1SA 1Z29A 2QQGA 1GPKA 2AW3A 4B83A 4JV5B 3DKPA 2NW6A 3GNLA 3ZWPA 4KPUA 4LJYA 5TR9A 4AYWA 2BZ1A 2IP4A 4U9HS 2XOXA 1JXQA 4OLFA 5DW3A 3TG8A 3O8BA 1NJ6A 4FDUA 3QW4B 1R9MA 5EP3A 1CT9A 4XX1A 3I2IA 3KX2A 3O4VA 3VOSA 2O2EA 3RCBA 6AT1A 4B4KA 2VJQA 4TV8B 1H6BA 5IAGA 3HG7A 1PJZA 5EE9A 5C81A 1I1NA 4C3ZA 2X9LA 3TLKA 4UDNA 1G42A 3DEFA 1HNWB 1JH9A 1JQ3A 1NNEA 3LQ1A 4YLYA 1RHQA 2GBIA 1QVWA 3BL5A 4MS1A 3ZS9A 4B3GA 3V8QA 1PFYA 1W4RA 3UXYA 2QT0A 3OM0A 1F0KA 3COSA 3EGEA 3NS7A 4IIXA 3DE6X 4JJ8A 2C54A 4MS3B 4US2R 4C08A 1KJ9A 1XZMA 2EC5A 3PGLA 4LDRA 2Q9UA 4IIGA 4ZI7A 4D9HA 1NRIA 2X1LA 1X74A 1S1CA 1ISFA 2ADOA 4MGHA 3P26A 4LPKA 2QRJA 1U0TA 2QRHA 3UUGA 2PKWA 4NJEA 2JIOA 2ZW9A 3RQSA 2O0HA 2PJDA 1H9AA 2FWJA 2R96A 3K9HA 1F6WA 4L3OA 1R6AA 5K20A 5GMOA 4EKIA 2X8JA 1EUYA 1E62A 4P32A 4N1AA 4PINA 2HO4A 1YVUA 2HF7A 4L8VA 3L7DA 2AXNA 2DERA 1GEGA 4FZRA 1PDVA 1TCCA 5H1YA 5LJIA 5IDQA 2ZGVA 4AG6A 3WLKX 1Z35A 2Y6UA 4ZKEA 2PLNA 4PAGA 3V4OA 1EFRA 1FU7A 2QI9F 2Y1EA 2KW5A 2ZB2A 2OCDA 3ELYA 1Q6YA 3A70A 5FOUA 4F86A 3IDSA 3NDIA 1U2GA 3PPXA 4LX0A 2Q5IA 2GJ8A 2X5JO 4BUZA 3ZHUA 3IIJA 2LW7A 2V65A 3ZY3A 4PLFA 2YHIA 2VQFB 5CEJA 2ZJFA 4W1QA 1OFTA 3EG9A 1NP7A 4OX9B 3QF4A 4ZVOA 3JQQA 1JKMA 3LUGA 3Q12A 5HDQA 2C0CA 4LX8A 1EPUA 1XU7A 4XW2A 5LPNA 1YACA 3ZVKA 4D26A 3D6HA 5HRAA 1BOFA 4F9GA 5TQJA 3B1JA 2CJWB 1KZGB 2BMFA 4G24A 2B37A 3ICOA 3OX3A 2GCPA 2BM0A 3HO8A 1J22A 4ZK6A 4R8MA 1E9CA 1CQPA 1R0LA 4QYMA 4TKVB 4Z8YA 4AS1A 4R9SA 4YJ3A 4D6YA 3PCRB 4ROSA 3E8XA 3MG9A 2ZUTA 4Z6KA 1SCQA 3RUPA 3MD9A 1E0AA 4U2BA 2F90A 3SVTA 2PKRA 4Z9XA 2BP7A 3VZCA 3JQFA 3A32A 3T5CA 3JWJA 4M1OA 4K9DA 3HXTA 4F4IA 2WA1A 4HL6A 3GG9A 1IMOA 4AS3A 1ZITA 2YVLA 3PPVA 4JB0A 1ZNXA 4YYEA 4GE3A 3AF5A 2YUTA 4XDGA 5I7RA 4M8IA 1ORHA 3NEYA 1ZNQO 2BFWA 4NG4A 4PO9A 4L78A 1TKCA 4Y6QA 1VE5A 3MWJA 1ZVJA 5HTOA 2ON6A 2CLFB 1USGA 1EFPB 2AUTA 2WJZB 1YSCA 2OCKA 2GRAA 2YRXA 1WMFA 1X1RA 3FOBA 4L5IA 2HU8A 2R00A 2C00A 2EOAA 1B15A 4YDSA 4CMEC 4DXAA 1Z7EA 4EEKA 3OZUA 3TLZA 2H18A 1UBCA 3E3AA 4MJ3A 3AETB 4KE7A 4OJYA 1TEHA 3MRTA 5AK5A 3PXDA 2JI6A 1HLDA 2XRYA 2YV1A 5MHTA 2JGEA 3TD6A 4ARSA 3RHFA 4ZV7A 3PFNA 2OZVA 2V7VA 2OHGA 1G38A 3ACBA 2P65A 1U0GA 3RS0A 4EHDA 3R6WA 2PD3A 4RCVA 1L7XA 5IT0A 4B6FA 1E6CA 1G5PA 1U9JA 2JJ2D 3DG9A 5KBYA 1DC6A 1UK8A 1YZKA 2IUFA 2PL1A 4N7JA 3AEKB 1MO5A 3TQOA 2JJMA 1EUQA 1QGYA 2OMKA 2PYIA 2YMMA 1ZD4A 4K9SA 4MI3A 1VLJA 3FNGA 1J8YF 2XB6A 1HNXB 2JATA 4GR9A 1PFWA 2WVGA 1XQYA 1BSVA 1AK2A 3JSAA 5K3BA 2FCAA 4IYJA 3ANLA 1SJ9A 5UKDA 4IQ4A 2XPCA 4MWCA 4EUFA 1I1OA 2WT9A 1OXTA 5DNVA 5AQEA 3TJRA 1VYHA 3PQDA 4H6XA 5EKDA 5KYXB 4CIAA 3BOSA 3HJHA 3M6FA 1JBEA 2ZUCA 4J03A 3HY6A 4JNKA 5F2EA 3UPDA 4M0UA 4DBZA 4G4IA 4DUPA 2MCFA 1OT5A 4M1SA 4C29A 3S2SA 5AI9A 5ADHA 1ORDA 1QVZA 1R0SA 1X7XB 2EBHX 3DVSX 3L6UA 3RBAA 4IBOA 3NC1C 2P5UA 4KN6A 7AT1A 3DZCA 5AXCA 1VMDA 5BQXA 1PBNA 2XGMA 4Q00A 1EK0A 1NHGA 5ERYA 1U9ZA 4GUDA 3WRXA 1D2MA 3OETA 3RADC 3FKJA 4YP9A 2QXTA 1QHXA 1DU4A 1UKZA 2J46A 4L07A 1YA4A 4Q7MB 3CX7A 3OICA 3PWTA 3UJ6A 1OB2A 1TYCA 1Y7PA 1XC7A 2PQ2A 4FTWA 4L73A 1A9PA 2WJ4A 1JQEA 1IHPA 2QGZA 2GXQA 5DX1A 3SYLA 3GU3A 5CEFA 3CNQS 4UDYX 5KNBA 3MUFA 3VI4B 1YIAA 2XT6A 4HX5A 4PNEA 2XEXA 1X1TA 5G4KA 3VC2A 1D2CA 1GGEA 1RAEA 4MV0A 4C5CA 2Z8ZA 4ISCA 2HMWA 1BXGB 2PGOA 1QYRA 5T6MA 1VBMA 2WVJA 5BVGB 1D2NA 1E2BA 3EUAA 1XF1A 3ET5A 5FWAA 1AZWA 1N2CE 1E1QA 2G17A 2OGTA 4GP7A 4O2RA 4YAWA 5A7HA 3T5TA 2ZI6A 3ILSA 4REOA 1AGXA 1U7UA 4YK7A 1OWLA 1SNYA 2I9KA 3CUSA 2FG7C 4H1VA 5DGTA 4ND7A 4NARA 2WF5A 3GFFA 4AJIA 4R2XA 1HDOA 1NURA 4E7OA 1OKKD 4MWTA 1QZXA 3WYNA 5KNCH 2ZR0A 4DR3B 5CYOA 1ZBQA 4GYKA 2E82A 3UJAA 3TEMA 3WJ2A 1OH8A 1M2OA 3NTVA 1KWKA 1E2MA 3M0EA 2F1IA 1PU2A 1UJ2A 4WASA 4X1OA 3RVNA 1PFQA 1ZK3A 2WV7A 4U2CA 3LM8A 3NUZA 4HDNB 3NBMA 3L6OO 5LLTA 4KR2A 4BO9A 2W93A 3CNOA 3OU7A 2HA0A 3RS2A 1HBJA 3Q3JB 5I4KA 2R4TA 4V0LA 2Y76A 1RPAA 3LQKA 1U3GA 2FLKA 3QU2A 3X1DA 4ER7A 2B1RA 1F3OA 4WXHA 4YRGA 3DR3A 3NDBB 1CTQA 2NSHA 2VK2A 1II8A 1UBMS 2X14A 2O14A 3UPTA 4OGLA 4IDQA 2A1UA 1I0LA 3QKRA 4C0HA 2R6ZA 1Y1RA 2C9DA 2FWMX 3T0GA 1JG1A 2AFIE 3IHKA 5JJBA 2Z4RA 1M1UA 1WSDA 2OCXA 1LTQA 4Y6OA 4CM7A 1A8QA 1ZA1A 4DPMA 1ZLXA 5L3SB 3LKDA 3FROA 3GBSA 3WNQA 2LD4A 3DAHA 4PV7A 5AXAA 2FMTA 4I55A 4UEWA 4UEOA 3NH6A 2XMBA 3LQRA 3W3AH 4B85A 5HX7A 2FPGB 4IJVA 4MMXB 5H59A 3HUDA 1DP4A 3KELA 2IV3A 3HUTA 2I1WA 5KTKA 1LK5A 3FIJA 1Y1PA 2Y0BA 3IJPA 2G71A 4N82A 4BQEA 3MZ0A 5HG0A 5JASA 5KQGA 4CNQA 1N6OA 3DWIA 1T35A 2QX9A 3LPDA 4L8YA 1W85B 5A5DA 4X1YB 3GEDA 1ZMRA 3PEUA 4JI5B 4XGIA 5CLFA 2PU5A 3PHJA 4AMZA 4Y8VA 4G5FA 4Z7NB 2IUEA 5ECWA 3WAKA 2FPPB 1CIVA 4G41A 2VXYA 2ZRCA 2R1TA 3AM5A 4DHWA 1BA2A 3DDSA 3H9JA 1JDZA 2GEVA 3S44A 1SBYA 3B85A 3MGAA 4ALIA 4F60A 2C42A 4YONB 3OCWA 3PC2A 3WNZA 1Z82A 4IDEA 3R5XA 1QRDA 5LMUB 1L4EA 2ZSIA 1QTIA 3D0RA 4ND5A 3GAFA 3TLBA 4FFVA 1H5UA 4KBYA 2XSZD 4JYAB 1CJBA 3RAFC 3R5TA 2FE4A 4R2JA 4C7OA 4OBBA 4UD2A 3C0KA 4QGFA 2D7JA 4D8TA 1DG1G 2BJVA 2CLKB 3CUEF 1ZL0A 4R16A 1SKAA 2C1EA 1N5KA 1ZMOA 4LOLA 4AIIA 1JWAB 1RWXA 1XVAA 5L6LB 1R6VA 4EGJA 1AQUA 4UATA 2XYHA 3HB9A 1Q1EA 2PRZA 3EMDA 1DFGA 1JDBB 1SKQA 1W88B 2DQYA 3DF9A 1DKRA 1NZFA 2EL9A 2I7CA 1NOJA 2V3VA 4FINA 4JR0A 2NO7A 4RJ2A 4ETMA 1RTKA 3PTAA 4FOOA 3V9PA 3O1HB 1MT3A 4I9UA 1Q7GA 1OFIA 3EIQA 2EKQA 1IMJA 4OB8A 5E7QA 4RVNA 3UH1A 1GGVA 3P4UA 4PYRA 3GRYA 2ECKA 3C1TA 1VZ3A 2HMVA 4NMLA 3W77A 3HKEA 2BYTA 3CH5A 1ZRNA 2PH1A 1XBTA 3AI1A 2IOFK 4LC0A 4KPYA 3RC1A 2HWXA 4BNDA 3HUFA 4E5KA 2R1TB 3KVVA 3E6AA 4BMZA 5JVDB 5FOQA 1TZ2A 3WNBA 3GYBA 3QE0A 3QPVA 3FZQA 1W1WA 4BTVA 1EQAA 1QG4A 1WUYA 3LJKA 4UU1A 3DS8A 1EEXB 2BZGA 2FR0A 5HJEA 2Q07A 1OWNA 3NBFA 5L53A 4QM7A 3B89A 4CKYA 3RFFA 1D2AA 3LTEA 1MX9A 2IXEA 1WO8A 4X63A 4B76A 1KERA 1GSOA 3ED5A 3H2YA 2YMQA 4WDQA 1Q3TA 1EMDA 4MHSA 4TTPA 5J9FA 2QT9A 3NETA 5F7XA 4UM7A 4XA8A 4YDQA 2QYOA 4F9FA 1JNXX 3GOHA 4QOIA 2ZTMA 2GJSA 4XYEA 3SDZA 3OT5A 4MYRA 3AY7A 5ELLA 5KTRA 4DHEA 2FZGA 1QDUA 1RYYA 3E7XA 3GFQA 5THKA 5L4LA 3ZZNA 3UBTA 4TS4A 2WYUA 3O1IC 4BO8A 4UXJA 2O1EA 1I94B 1CHDA 4TXHA 3KAKA 4X3CA 1ML4A 1UWLA 2HTFA 2F55A 2PX2A 4AD8A 3ORQA 4CT4B 1L4BA 1EVEA 2HFKA 2QM8A 3P4YA 4LJ7A 4H3HB 2EJBA 4GDMA 5D00A 2IEDA 4LJSA 4ZC8A 3BMQA 3S1LA 3WYEA 2XADA 2I54A 2PFSA 5LDDC 1GPLA 2J3KA 4NX2A 3PNSA 5FB3A 1HE4A 2IZ1A 4F21A 2VYQA 1E92A 3L40A 4JVSB 1REQB 3CUTA 4WNAB 1CUXA 4WZBA 2OXCA 5AVQA 2Z5GA 3MWDA 5ALYA 1LSJA 5L45A 5I8WA 1PL7A 2NO0A 2FFRA 2EVWX 3I01A 3G5LA 2FPXA 4LSWA 5EPOA 1QP0A 1MD9A 5LZ7A 2WKSA 3OT1A 4DOMA 3RE1A 5E4FA 2X4GA 1NMZA 4CL0A 1M6YA 2QI9C 4J0QA 2C61A 1T4DA 1WBDA 1R0RE 3EPKA 1N2XA 3JWEA 3SXJA 2ZBRA 4YR9A 1TMYA 3FRJA 4BZZA 4MARA 3A31A 1GLVA 2RB4A 4KE9A 4BU1A 4HV4A 3E22A 1GRNA 5DCWA 3I9LA 4MKIA 1VL0A 1TO1E 4DC0A 5IT4A 3S2ZA 4L72A 4QXQA 3Q8XB 1EDOA 1KNXA 1MG5A 1RWOA 2BZSA 2Y2UA 3BZUA 2AR7A 3HHPA 3CNEA 1PJQA 4HNGA 1NI4A 2GJAA 1IZ0A 1P2GA 4YIKA 3V46A 5ISMA 5A4KA 3AW9A 1A9ZA 3NFYA 2R9VA 2Q7DA 5IVHA 1KK2A 4AKEA 1KYZA 3NEJA 4YRMA 2J9ZB 4Q4AA 3IS3A 4GYYA 2B7CA 3NNSA 4LXTA 3DLHA 2XW6A 4GS5A 4LRTB 5H83A 3IEVA 3BG5A 5LP6A 3F1KA 5F1PA 2GBLA 3DE3X 2JLRA 3TOCA 2EFDB 1HI9A 1OZ0A 2VAPA 4EECA 1PJ3A 2RHRA 4H60A 1T4GA 3CT6A 3VSBA 1JJVA 1J0CA 1FFEA 1KI1A 4K9QA 2XMRA 1CCWA 3HN6A 3N7TA 1NW4A 3C6QA 1E4EB 2HL6A 3ZUGA 1P0PA 3LUBA 1QDLB 4BBJA 1NL3A 4YDRA 1RI1A 3BB3A 5CB4A 2CLHB 3PXEA 4QU5A 1QONA 2GZDA 2JL1A 3BJIC 4I1OA 4DRZA 4LYHA 2Q3MA 2YOFA 1O4VA 3FNEA 2QNBA 2I34A 3GLHE 4HGYA 3T5BA 4EVSA 3V1TC 3C8UA 2LGJA 3OCXA 1DTWB 4OHCA 4ZVLA 4DJ5X 5IM4F 3L7LA 1P17A 3TB4A 2DUMA 5GAJA 2AS0A 1Y4SA 1RT9A 1ZHFA 4MRMA 3GNTA 4DVGA 4N39A 1PR1A 3GJRA 2XVAA 3LW7A 4MRRA 1RQLA 3I58A 2XNDD 1LV8A 4NPHA 3HM9A 1T2FA 2V7UA 3DVAA 4LWPA 1DC8A 1MJNA 5CT8A 3UJHA 1M66A 3BH0A 1N2HA 1PD1A 1OIXA 2VF5X 4M53A 2QPTA 2PX5A 5F5NA 3CRRA 7GPBA 1C2YA 2WWIA 1BIFA 4R9VA 4XQ0A 2Y92A 2FZVA 1KY4A 2RCYA 3U48A 1OHHA 1XVVA 2BFOA 5BN1A 3KE9A 4P5EA 4DIMA 2NZYA 3ETCA 5AM5A 1RHUA 4QE3A 1IZYA 1NYTA 3E9CA 4I55B 3CINA 1CZOA 3L46A 2P6PA 4KAFA 4PR0A 3E9MA 4W5OA 3A6FA 3QXXA 3OC6A 2OOKA 2X3YA 4D4GA 1RRFA 3BTSA 5F2NA 4TLEA 2DBVO 3JTEA 1JH8A 1LPSA 1E1MA 4UUPA 2I67A 1YB7A 2VYCA 3A1VA 3T5PA 4AQDA 2PCLA 5LBIA 1S4MA 1DE0A 1DMSA 1RDFA 4M1QA 1Y4DE 4BUJA 5AVTA 1USKA 3LDFA 4OI2A 1HE1C 3OE4A 4D0GA 1TPYA 3ZHRA 4KR6A 1XDUA 4YACA 5HXAA 4TSFD 2X9QA 1B0UA 3H9CA 4BC1A 5K3SA 1CE8A 3BC1A 3PWZA 1IULA 1A9XB 1C4KA 1WW2A 5TPZD 1W7AA 1P2TA 1KAQA 3SKXA 4NENB 1EWVA 3WA7A 5HJ5A 1OY1A 4L2IB 1RYNA 4D0NA 4IIBA 3TMKA 1R0XA 2X0JA 2EQ5A 2M1XA 4U2KA 5HMLA 2X2EA 4BO7A 4X8MA 3M6XA 1NBEA 4CKXA 3P45A 4A03A 4B6OA 2JGDA 2CMFA 3BK1A 3TIFA 5K8CA 3ROQA 1KMMA 4GMGA 4KIWA 1UIMA 3PE3A 4ZANA 4U6SA 2NZ8A 3WYGA 2NZJA 2CB9A 2C7PA 3DL7A 3ONEA 4F5YA 3OTOB 5BRAA 5F4ZA 1JYEA 5LWHA 3ABIA 1A2QA 5EYPA 1H1LA 3E22B 3R75A 4JYPA 2BDEA 2YYZA 5BQPA 2H59A 4M1MA 2P8JA 3OEYA 4X20A 2QW1A 1T8PA 1NBMD 2QTAA 4N76A 3Q7EA 2NO5A 2Z2YA 4BJ6A 3CE9A 4KN8A 1Z75A 3NHWA 3RAGA 1QGZA 4EPXA 1CIJA 2H52A 4NFSA 1RD4A 1CQJB 4IQ0A 3PZRA 3SPXA 4XIGS 1P91A 1U63A 3CB2A 4J1NA 3ANXA 3HJNA 4OGWA 1GPWB 4AUKA 2VHUA 4B7CA 1FMJA 1CUWA 1MXHA 4A8JB 1Z8HA 2GK7A 1ZIYA 1RYEA 1TZJA 2QLNA 3ZHZA 3VO2A 1I8TA 1CZLA 3FSJX 3LNCA 5JCJA 1JQ5A 1WHTA 1UPXA 1SCNE 2KQUA 3KQYA 4JBIA 2JAHA 4OIMA 3J81k 4QT4A 1VPWA 3KM0A 3JYNA 2W42A 1LGYA 4YAEA 1H1TA 2FRDA 5IBRA 4A0QA 4BNMA 4ARIA 3QUAA 1R8QA 1RP7A 3KR9A 1RFLA 5FBHA 4FEGA 4Z4FA 4MS3A 1AKWA 4YJ2F 1HNZB 1G63A 2IUYA 3IIIA 2CVOA 2VLBA 1KS9A 3IVCA 1Q0PA 3IAUA 2QN8A 3C7CB 5CX4A 1NBMA 3C3DA 2HA6A 2HK6A 3L43A 4MO9A 1QFXA 1IU9A 4P4LA 2YVKA 5G4LA 3V8BA 1BD4A 4NEGA 5EVJA 1XNQB 2Y1XA 3KRTA 4NULA 2JK0A 2B20A 3GEIA 2DY1A 4MUNA 3R7LA 1TZBA 3ZHVA 4EJ2A 2OYRA 5J23A 2PNFA 1AUQA 1HRDA 2XRMA 4PR3A 1T4MA 1JQBA 3DV0B 3DQZA 3HC7A 3K35A 4D45A 4D9JA 1RQXA 2HSJA 1OLSA 1XTRA 4PAOA 4LCBA 5KDDA 3O95A 2EP7A 2W7TA 2NNWB 2ZYUX 5L95A 3RJMA 1E7QA 2OCBA 1KP2A 3L06A 1MUUA 4CXMA 3R5JA 4IYRA 3N6VA 4TGLA 4NZOA 5KNCD 4PLCA 4B3DA 3MTDA 2HLPA 3ZZUA 2EJVA 3CW9A 1RLJA 2WF7A 3OEED 4LK2A 4UEQA 2IHNA 3FMFA 1GCIA 4KDFA 3OZEA 1R9GA 3ZN2A 2A94A 4MV3A 3ZWAA 4ETIA 4Z0PA 2GTPA 1M5UA 3KLOA 3U49A 4ZOAA 4KRXA 2G72A 5KTMA 5AI0A 1AU9A 4P5PA 3JPYA 4QICA 3H0CA 2RGRA 1DFHA 3O4RA 4QOSA 4O4JA 1TFRA 1QWSA 2XH8A 2NTJA 2GEKA 3FJ1A 1VE3A 3M6AA 1DRVA 4JDPA 3SBOA 3K0CA 3WVNA 5PGMA 2GTHA 1JKFA 1OFVA 3KZMA 5JLAA 3PX2A 1ID1A 3HXMA 1W25A 2I76A 1E69A 3U60B 4Q03A 1KJIA 1BMDA 3GQBA 2WFLB 1QNLA 1N2JA 3CNBA 3H9GA 4G07A 4E1BA 5FWNA 4IH1A 5GZ1A 4QPJC 4EPRA 3TD2A 3W8FA 2X9NA 5EZQA 4MYHA 3R7FA 1Z12A 4FR2A 2M2IA 4L9WA 5D7NA 4AMUA 2GUWA 1ZVVA 3QHPA 4AY3A 1MDBA 3TRFA 3UN1A 3GCGA 1TQ6A 1OXMA 2LIVA 1XDGA 1JHPA 1ZK4A 2JI4A 1ZI8A 1IHUA 1YOBA 1JU4A 1O6ZA 3GCXA 3FNRA 5E9JA 3HFRA 1QNFA 4LC9A 2WAOA 3JARA 4I1IA 5KMGB 1W5AA 4YREA 3GFRA 2WG0A 2Y27A 4FGUA 4O2BB 4UM5A 1Y3FE 4YQZA 1FUIA 5JH7A 3G68A 4G8JA 4CTNA 1C7IA 2IQIA 3FNQA 4M9RA 5SV2A 1FZQA 1V25A 5C2JB 2OL4A 3M33A 2NTEA 1W96A 1SBZA 1WUKS 2GEJA 4NTZA 1D2RA 3GLFA 5ALMA 3MS7A 3QVLA 2NX2A 4L08A 4TVSA 1P9RA 1W0CA 3AVOA 4UVDA 3EXEA 2VEOA 5FNVA 4E22A 4IQGA 2VH1A 5LXTB 5JI3E 4Q48A 3H4MA 4DSOA 4HPJB 3D0OA 3V3KA 2BHTA 1XDDA 2GFHA 1HDRA 4XVRA 4IMPA 4WXRA 1I3CA 1QZUA 2IU0A 2HHHB 1GXSA 1UKBA 5ICGA 1O54A 4UUBA 4DLYA 3KXKA 2EZUA 3L6EA 1ATZA 1GSHA 5E6RA 4E03A 1TMOA 1Z6YA 3GLSA 5AOAA 4ZN6A 2CWWA 1QX3A 4ZRNA 2FN3A 4NBLA 2VJMA 2NQ8A 5BT8A 5B7GA 1K08A 2WJ3A 3AF1A 4M7PA 1M34E 1MX3A 1ETUA 3H6HA 3DWFA 4O2BF 2JEYA 3OT1B 2ECFA 4D9MA 1DAFA 1BS2A 1XVIA 2WM9B 4C78A 2Q1XA 3B3FA 5TGDA 5DXFA 1I2ZA 2NLOA 3AESA 1REQA 2DFDA 2EKBA 2FQQA 2V9CA 4WZBB 5JD5A 3RS3A 2BEUA 4QPDA 5CFOA 1Q91A 3K1AA 1QK5A 1DQSA 3NT5A 3HY4A 3BMXA 2ICAA 3TMYA 3DJYA 3DHWC 2HUNA 2QUAA 2C92A 4DL9A 3OX1A 1NZDA 2XCOA 4RCZA 4W5JA 2QK4A 4U8GA 1JYFA 3NMUF 1XOIA 1IN1A 3RUCA 4W4TA 1H42A 2DLDA 3WGGA 1I1QB 1KBQA 3HFJA 2H31A 4E07A 4LF6B 4N8SA 4M8SA 2PD6A 4J90A 1PJRA 3OVMA 4PGHA 4AFNA 4ZOQI 4AY4A 1BCRA 3BD8A 3G89A 3CTPA 1BCSB 2BISA 4CM4A 3IEIA 1IJKA 5CVDA 4ZRDA 2ZG6A 3QJGA 1TGYA 4NYJR 3F3SA 4OI4A 4TKMA 6REQA 2PUVA 4LDNA 4FVTA 3CSUA 1X1DA 4GKVA 3UVEA 5C80A 4GX2A 3UATA 3H9BA 2X6TA 2VQSA 1M1YA 1SXGA 2PMEA 4CV0A 3NAMA 3S27A 4N6OA 3BFJA 3SJZA 2QLBA 3CG0A 4G4GA 3S5UA 2NTNA 3QOFA 4B80A 3ZE1B 5JYBA 2C7BA 2BM9A 2VF7A 2J08A 1YRWA 2FXVA 3NIDB 1XTIA 4N5HX 4ZVRA 5J2UF 1DKMA 1TTQB 2FVYA 3U4GA 2WYHA 5SYNA 1FMFA 1S3SA 2J09A 4KQCA 4UAUA 1M10A 1LY1A 1V11A 2BKXA 3K8OE 4KFRA 4OQDA 1MDFA 3PNVA 4IO0A 4V2IA 5HA5A 1BEEA 4M1KA 2K87A 3R09A 3U39A 3KWLA 2RGNC 1G21E 1KRXA 4UW9A 5JMPA 1WZEA 2QUIA 4DDMA 3T9AA 3KKMA 1SQFA 1KO4A 3G1UA 2QTNA 4G37A 1U1DA 3RO7A 2AJ8A 5AVOA 5SZIA 2A92A 1QX4A 3EPRA 4AF6A 1T5SA 3C48A 4LW8A 3JZMA 1GV1A 3KKEA 1VYUA 4CMAA 2BGIA 4CN9A 3C3CA 4P3YA 4ZYUA 4QRHA 1WSAA 3PEWA 1YL6A 2GJ9A 2C2OA 1I0IA 1H94A 1IOVA 3NT2A 1R8YA 1Y3AA 3K1AB 3RS4A 4KQGA 2LCFA 2YYSA 4LHWA 1B2LA 2OC4A 1UF9A 3GJSA 5ALOA 4UJ3A 3FPGA 3SM3A 2JLUA 3REFA 1EIWA 4JI2B 4W5TA 1NQUA 2NO9A 1BNCA 2XE7A 3DZIA 1NUAA 1JZTA 4QBGB 4Y0NA 5ICMA 2X1VA 3BIXA 4C3OB 1EGVB 2B36A 4HOYA 1NW3A 2JIRA 4BQIA 4WK4B 3OO0A 1T0BA 3BSYA 3SZOA 2YIJA 3ZHCA 3L02A 3VSAA 3DOOA 1W1UA 4KQ2A 2VWQA 1GU7A 3DBVO 2YXNA 4DLLA 1LI5A 2GUGA 3MT7A 3OKAA 2B6NA 3R4CA 2P5YA 3GFTA 5I7UA 1P2SA 5G3ZA 3HL4A 1NY6A 2PK3A 1GXSB 1OUMA 1T8YA 1WCIA 1Y1TA 3U44A 4KKXB 2A9QA 4RVDA 4F6LA 1VYVA 2NYRA 4V0MA 4RVHA 2OXRA 3MINA 4CV1A 5JS7A 1T9DA 3WOHA 1QV7A 4NS4A 1P29A 3MCVA 4UULA 5A4AA 4MDEA 4HADA 1PQUA 3DZ8A 4Z0HO 3SSOA 4Q9IA 2EW8A 1FFXB 1UT5A 3QI7A 1V6CA 2Z4TA 2DGDA 4HB0A 1W85A 4AY6A 3BFVA 2HI0A 2OZLA 4IV5A 2IIVA 4DA7A 3A4VA 4ILEA 5BUCA 4C4PA 4GU5