4DGQA

Crystal structure of non-heme chloroperoxidase from burkholderia cenocepacia
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
277
structure length
277
Chain Sequence
SMGTVTTKDGVEIFYKDWGPRDAKVIHFHHGWPLSSDDWDAQLLFFVNKGFRVVAHDRRGHGRSSQVWDGHDMDHYADDAAAVVEKLGTHGAMHVGHSTGGGEVVRYIARHGERNVSKAVLISSVPPLMVKTSSNPNGTPKSVFDDFQAHVAANRAQFYLDVPAGPFYGYNRPGAKPSEGVIYNWWRQGMMGSTKAQYDGIVAFSQTDFTNDLKGITIPVLVIHGDDDQVVPYADSGVLSAKLVKNGKLITYKGAPHGIPTTHADKVNADLLEFLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Non-heme chloroperoxidase from Burkholderia cenocepacia
rcsb
source organism Burkholderia cenocepacia
molecule tags Oxidoreductase
molecule keywords Non-heme chloroperoxidase
total genus 112
structure length 277
sequence length 277
chains with identical sequence B, C
ec nomenclature ec 1.11.1.10: Chloride peroxidase.
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4dgqA00
4Y2UA 2V96A 2ECFA 5CW2A 1IZ7A 5ESRA 4INZA 3WKAA 4HZGA 2GBGA 1ZI9A 5HK8A 3A2LA 3FVRA 4X6YA 1YB6A 1Y7IA 1AGYA 2I03A 5HQ3B 3DCNA 5DNUA 2ZSIA 5FDFA 1BS9A 2DHEA 3WKEA 1BRTA 3BF7A 3AIKA 1F0PA 2HA4A 2QJWA 3VJKA 4Y2QA 4BCDA 5LZ9A 2XB6A 3STWA 5AKLA 2VQ6A 3DL4A 4MJ3A 3OURA 1H2ZA 3GA7A 2I3ZA 3EIOA 3M83A 4PSUA 5KBYA 4WFKA 2V98A 1XRMA 2JGKA 3ZWQA 4H7IA 3MUOA 4BZWA 3I1IA 5IVIA 1G66A 4UBMA 4L0CA 3QMMA 2HA2A 2WSLA 1HL7A 4CCWA 1FFBA 2RAUA 4BAUA 3WKDA 1CUDA 1CEXA 1DT5A 1MPXA 3STXA 1XZDA 3HLKA 5CT4A 5LLSA 2HL6A 2XMRA 2Z8XA 3D7RA 2XQKA 2QUBA 4OD0A 4JYMA 1EVEA 1TK3A 2HA7A 1YS2X 2CEKA 1QIFA 4WFIA 1QO9A 4EHBA 1Q84A 1G4HA 5AI9A 5CURA 1RYYA 3IA2A 3VDXA 1MX5A 1EK1A 5HZGA 1MNQA 2ROQA 4OYLA 1UT6A 5ALJA 2JGLA 3IUMA 1LZKA 2PVSA 2OCGA 1THGA 4IHAA 3R3YA 2K2QB 3F98A 4BAGA 3WWPA 4EB0A 2I78A 5IH7A 1QIDA 2XUOA 5D6OA 5ALPA 4QE3A 2XUQA 1FJ2A 2NW6A 4IO0A 5A7GA 1T2NA 4C88A 2ZJ6A 1E3QA 2PSEA 2WJ6A 4QDUA 2B4KA 3H2JA 4FNMA 1MAAA 4KRYA 4X90A 4B80A 2WIJA 1U4NA 1XRLA 3WK9A 4CCYB 2RHTA 5CT5A 3WLAA 2XMQA 5I9IA 3I6YA 1EINA 1KEZA 3AINA 5HF9A 2B9VA 4K6HA 1R9MA 3R40A 5FRDA 4BATA 5JATA 2HHAA 5BWCA 1AURA 5C8VA 3DEAA 4RE5A 2PM8A 5JAPA 3OG9A 3ESAA 3OC0A 3AILA 1YS1X 5IKXA 1MX1A 4QWWA 3MVEA 3W2TA 1TIBA 3ESDA 2QZPA 4PNZA 4U2EA 4ZV7A 5BV7A 3I28A 1XZEA 3QPDA 5AI4A 3T52A 4WDRA 1UZAA 4J0HA 1A7UA 4G4JA 3ICWA 1EXWA 4J0KA 1CVLA 3ZLUA 3FAKA 2B20A 3M3DA 4UHCA 1IZ8A 3BXPA 2WG1A 4EY6A 4EA6A 2Y2VA 3PFCA 4ZGBA 3ZV7A 5CXXA 2C4HA 1QFMA 4G1FA 3R3VA 5E2IA 1H2YA 5ALEA 1ODSA 4V2IA 5AP9A 3H1AA 4LKOA 1YB7A 1BN7A 5DJ5A 2EDCA 4OU5A 4Y2PA 4KE9A 1XRRA 2ORYA 2GBCA 3U1TA 1THTA 2CB9A 3I2GA 2XMGA 5DNWA 4LIPD 3EF3A 2Y6UA 4JH0A 3HC7A 5C8ZA 3VKFA 2C0QA 1GQSA 2XMBA 1DWOA 4AN0A 2XMSA 4H7KA 3IULA 3QVMA 5H3HA 1GPLA 1ZIYA 3PFBA 2BUBA 3KD2A 1L7AA 4B9AA 5IVDA 5D3ZA 1YAJA 1JKMA 2VEOA 4HAIA 4X71A 4B85A 1XRPA 4PSDA 2PUJA 2CUTA 5C8XA 2DHDA 2JGEA 5K3BA 1UKAA 2CMFA 4LYDA 2QTBA 3WMRA 4AMZA 4Q3LA 3C8DA 2JF0A 4DNFA 3C87A 4KJXA 2BKLA 1NU6A 5HF6A 3DOHA 1XROA 5AK4A 4K2AA 2JGMA 4X91A 4BE4A 1VZ3A 1KU0A 2VA9A 1DU4A 4KAFA 1WM1A 3VXKA 5JD4A 1UK9A 2BJHA 4LYEA 1ZD4A 3FLAA 1VXRA 5AJHA 3BJRA 5EI5A 5LZ5A 4ZXFA 3V48A 1WOMA 1R50A 5EIAA 1PFQA 2AJCA 4L3WA 4CIBA 1CUFA 1MU0A 3VJMA 4HVTA 1RP1A 1F6WA 3GELA 3D4LA 5LYYA 4CG2A 4J0CA 5DNVA 4BP8A 3G7NA 1QIGA 4EY7A 4QDZA 3GUUA 3A2MA 5A62A 4Y7DA 5ALQA 5ALUA 3O9VA 3E4DA 4EZIA 2DQZA 1VLQA 2OQVA 1ACLA 3NUZA 1BEEA 1XZLA 3IIIA 4ZI5A 5IVHA 4FNGA 1A88A 2OPHA 5CT9A 3K6KA 2PU5A 3RARA 1R1DA 1ZGCA 6YASA 2VTVA 3C45A 2D0DA 2D5LA 3SK0A 4KACA 3HSSA 3U0VA 1CUSA 3DKKA 5AKXA 4N8EA 5AIBA 3ZI7A 4FKBA 4KE7A 2XQJA 1MT3A 4RNCA 5ALRA 5AM4A 3NWOA 3HZOA 3DOIA 4Y2RA 3RM3A 4H18A 1ODCA 2QR5A 1XQVA 4UBOA 4BVJA 3WZMA 2ZVDA 5DYWA 3UUEA 3O4IA 3R3ZA 4B83A 3GFFA 3TGLA 5HQ3A 3LIPA 1ACJA 3W9BA 3I2JA 4GBGA 5LP1A 1RWQA 4UBLA 1E66A 4HRYA 1I6WA 2R11A 5EIHA 4FWBA 5EHNA 1LZLA 4A23A 1ZJ5A 1UOPA 1X2EA 5DTJA 2ZSHA 3R3XA 4XIIA 3G0BA 1OCEA 3V1KA 3AFIA 4JNCA 2X5XA 3AJAA 2G4LA 4AN1A 3EQ7A 2Z3WA 3IBTA 2HFJA 2WILA 4W1QA 4BRZA 1LNSA 1UK6A 2PX6A 5T4HA 3FSGD 4A5SA 4J0DA 1FFAA 2QUAA 4NMWA 2RHWA 3CCCA 2OGZA 1E8MA 3V9AA 4HTAA 2QOEA 1PV1A 4KRXA 5AKEA 5DTIA 1CUHA 3T4UA 5ALFA 1CUUA 5F4ZA 4BP9A 4RPCA 4M0MA 4X97A 4AX4A 3D0KA 2X8BA 1AC5A 1FFDA 4W1SA 5CTAA 4H7HA 3FVTA 3WL6A 2VJDA 3M81A 4ZRDA 4LHEA 4U2BA 2OCLA 1MTZA 1YA4A 4AO6A 5AI8A 3W05A 4BC0A 2HA0A 1YA8A 2I3DA 4UBKA 1CPYA 1OXMA 4UHFA 3BL8A 2VT7A 5DWDA 1F0NA 1MNAA 1VJ5A 4GECA 1N5MA 1QO7A 2GZSA 1C7JA 5JADA 1LBSA 2J3QA 2HU7A 4GWLA 1UK7A 4FOLA 2XUAA 3L1IA 3P2MA 1Z68A 4Y2SA 1S8OA 1DQZA 4C87A 4TGLA 4QNNA 3H17A 1MN6A 3QPAA 4P93A 2VF2A 1EA5A 4DMKA 3H0CA 5SYMA 2GYUA 3STUA 5I8PA 4AZ3A 1E8NA 3SC2A 2DHCA 2AJ8A 5ALKA 1XQWA 5AM2A 3AZQA 4FBLA 4Q3KA 3JW8A 5ALHA 3B3QA 4DLNA 5A6VA 5ALGA 2OCKA 4UBJA 2O2GA 4UPDA 5CMLA 5AKIA 3UUFA 1SCIA 1USWA 4HXEB 4DMCA 1GPNA 1M33A 1DQYA 4HS9A 3OOSA 1GPKA 1WB5A 3IB3A 2BUAA 5AM1A 4KYVA 2E3JA 2QXTA 3BDIA 4OSEA 4BAZA 2QKYA 3ICVA 1N1MA 1K63A 1CIJA 1G42A 2PSDA 1H23A 1XRNA 2DSNA 3OPMA 4I19A 1BCSA 2XUHA 3I1YA 2OAEA 2HRRA 4QDOA 1XZJA 1NU8A 2WG0A 3H2HA 1CUEA 3NOXA 3DYIA 3AUKA 3CXUA 2WFLA 4BDTA 3C5VA 3PUHA 3RLIA 2J3DA 2OLEA 3N2ZB 1CUXA 1R9NA 2BGRA 4L72A 5K3AA 5A7HA 5KREA 3G0GA 4F5ZA 3I2FA 2XUDA 1ZI8A 2ZJ7A 2H1IA 2ACKA 1QTRA 4S0XA 4RE6A 2Z8ZA 3H2IA 1DINA 1IVYA 5JAOA 4C6HA 5AI5A 4U2GA 3HYSA 4OU4A 4FFVA 1XRQA 3F9CA 1CUWA 4DMHA 2GZRA 4KE8A 2WKWA 2AJLI 3FYUC 4N5HX 4UHEA 4BDSA 5EGNA 3FSGA 3FCYA 2Y2UA 4B81A 4YX9A 1HQDA 2QVBA 3UMJA 2ZJFA 4Y2JA 1E5TA 4AB1A 1G5FA 4I4CA 1PJAA 4P9NA 3E0XA 1SCKA 4WDQA 2G5PA 2WUEA 2W6CX 4BCBA 1L7RA 3W9UA 1AKNA 4W1RA 4ARAA 5HKAA 4C01A 2V9ZA 1CUBA 3LP5A 1ZD2P 2XUJA 4X92A 1KU6A 2YASA 4GI1A 1CRLA 1JFRA 2PL5A 5CT8A 3FWHA 4MYSA 3HXKA 1WHTA 5AKKA 1GKKA 2BUCA 5FOQA 1VA4A 5AOAA 3ZLTA 2Z3ZA 3IDAA 3IVMA 2WHPB 1ZD5A 2WUDA 1JI3A 2B61A 2ONCA 2UZ0A 3JWEA 2RONA 1EB8A 4BZZA 2J4FA 1WPXA 4W63A 3PF8A 5E4YA 4DM7A 2WIGA 2FJ0A 1UFOA 3WWCA 1XZCA 4J0JA 5ALNA 4UFOA 2O2IA 3QM1A 1VA5A 5LKAA 1EDEA 3MUNA 4Y9SA 3WA7A 1NX9A 2VT6A 2FX5A 4X85A 4JEIA 3O4JA 1XQYA 1J2EA 3E3AA 2WFLB 3D2CA 3D5EA 1ZI6A 3ED1A 3KWFA 4UBIA 5EIEA 5DYTA 1JJIA 2WHRA 5BWBA 4DSZA 2XLCA 4MEAA 2O2HA 4MQMA 1EX9A 4ZV9A 5JIBA 5JZSA 3A70A 1QONA 1YR2A 3STTA 4AO8A 2JEYA 1QIHA 2OQIA 4EY8A 4KR0A 3WKCA 4X93A 4ZWNA 5IVKA 5ALXA 1AZWA 3WYDA 3WWDA 5ALMA 1B41A 3W04A 1LPNA 2XQIA 1XQXA 3DD5A 5K3FA 2XQFA 5CRIA 3BF8A 4B7ZA 3DYVA 3Q8WA 3R3WA 3WA6A 4DYHA 2CJPA 3R41A 1R3DA 2WHPA 4J0GA 3GBSA 5E4TA 3I2HA 3PF9A 4K6KA 3DLTA 4EBBA 3H2GA 3STYA 2XQGA 3AIOA 4WY8A 1LPOA 1W4LA 4X94A 2JEZA 4Q05A 3W06A 2XMCA 2VJAA 4B0OA 4PO3X 2PU7A 4U2DA 1F8UA 2Z5GA 3FNBA 4AQDA 1L7QA 5ALDA 3HRHA 4DIUA 3L1HA 1U8EA 2C0PA 4UHHA 5AK5A 4UUQA 2XDWA 2OG1A 2GYWA 1C4XA 1JMYA 2G63A 3C70A 4CG3A 1XZIA 3PICA 1WB4A 4B82A 2QJRA 1DWQA 3V1MA 1P0QA 4UFNA 3PUIA 4X95A 4BTVA 4X3CA 1EHYA 4H7FA 1DX4A 1WCYA 1ZJ4A 4A16A 3O95A 5LZ4A 5FPPA 4FLEA 3PDCA 4IH1A 2EEPA 2O7RA 4XX1A 5A2GA 4P08A 2AXEA 3C5WP 2WQZA 4OPMA 3AZOA 2H7CA 1XZBA 1YAHA 4CFSA 4HXFB 1CFJA 1VXOA 4GHWA 5AKGA 2WLSA 1ORVA 3VVLA 1H2XA 5AH0A 3F96A 2HFKA 1BEZA 2C58A 5EHZA 3YASA 4Y2YA 4BRSA 4FMPA 4CIAA 5LKRA 1DT3A 4W1PA 3BIXA 3S8YA 4E11A 4PV7A 3LCRA 1R88A 3FYTA 3PI6A 4PSCA 5CXUA 3A6ZA 1UOOA 5J3JA 3K9BA 1U2EA 2JGJA 4FHZA 3BJMA 1SCQA 2O7VA 2PPLA 2QM0A 2WFZA 3EQ8A 1XLVA 2HM7A 2WTNA 4LXHA 5HKBA 2ZYIA 2CKMA 2ZYRA 5ALOA 3WK4A 2RGUA 4AXBA 1BE0A 3WKBA 4JUIA 3QBJA 3DJYA 1XZGA 1UXOA 1ZGBA 4UBNA 2GBIA 1IUOA 4M0EA 1XZFA 1WB6A 5CH5A 4AMYA 5ALTA 3GROA 5ALIA 4BYMA 1GQRA 5AKYA 2BFNA 5T4EA 3HJUA 4X00A 3WK7A 5JD5A 2IIVA 1H22A 5EFZA 1XZMA 1BU8A 5ALZA 2AJBA 4NZZA 5BOVA 3HABA 5DLPA 4Y2VA 1CLEA 1K6EA 4BE9A 1HPLA 4B6GA 3C43A 3HACA 1IMJA 3F8SA 4GXNA 5FUMA 2BGNA 2P8SA 5ISMA 1EB9A 1J1IA 2H7XA 3R0VA 1TCAA 3G02A 4OYYA 1XFDA 1CUYA 3KSRA 3L1JA 4OCZA 3FLBA 1JT2A 1XZAA 1XZHA 5KWIA 4DSAA 3OTQA 3FBWA 4KAAA 4G9EA 3QYJA 1JJBA 4C4ZA 1AMNA 3F67A 4L9AA 4YPVA 1VE6A 5AK6A 5D7BA 1IUNA 1FFEA 4PF1A 4GLBA 1T4MA 3FCXA 1MO2A 4G8DA 2YXPX 2IITA 1JU3A 2QT9A 4N8DA 2IX9A 3G9TA 3JYHA 1YCDA 2WUFA 1QFSA 3D59A 3H2KA 3BIWA 4B9EA 1YASA 5AKJA 5DYYA 3IUJA 3KOOA 1EVQA 1JU4A 4BVKA 5FKJA 2G5TA 1D07A 1DWPA 3X3HA 2V97A 2WFMA 4J3JA 1UK8A 1W76A 4G8CA 4FLMA 4H0CA 1CUGA 5AKZA 5I7UA 4K5QA 2Y1KA 4Q1VA 2VAXA 4CI9A 3H18A 1Q83A 3O4GA 2ES4A 1OILA 1VZ2A 4KE6A 3WL8A 1WPRA 1TAHA 2YH2A 4OB8A 3WL5A 3D3NA 4H35A 5JAUA 1TCCA 5K3FB 4H77A 4QA9A 3V1LA 5AK3A 5AOCA 1IUPA 1XKLA 2R8BA 5K5EA 4MYDA 4QEKA 5AM0A 3ANTA 3GZJA 4OB7A 4QWMA 2XI4A 4WY5A 2WU4A 3CCBA 5HF8A 1LBTA 4BVLA 5JZ9A 5AI0A 1FSSA 3K2IA 4EUSA 2DCMA 2BCEA 3OM8A 3G9XA 3BDVA 2VATA 5HFNA 5CH3A 5JASA 5HFAA 3H1BA 4WJLA 3G9UA 4GEGA 3QPCA 2AJDA 1GKLA 2WIKA 3WIOA 1Y37A 3DDUA 2OCIA 2ZYHA 3C8HA 3I2KA 1GT6A 2PSHA 1XZKA 3I2IA 2PBLA 4TVKA 1QGED 1AQLA 4WCVA 1E8DA 1LPSA 4MWTA 4FDMA 5CH8A 3TJMA 5AI6A 3QZUA 5HK9A 1Q0ZA 4MQLA 1BN6A 5ALSA 1Y7HA 2XMDA 3Q0TA 1N8SA 3A2NA 3S2ZA 3FYUB 3IUQA 2C5FA 3D2BA 5ALYA 1QE3A 2QRUA 3WK8A 1XLUA 3VVMA 2CZQA 2Y6VA 1CUJA 3H04A 3HEAA 1CUCA 1K4YA 4BTLA 3TEJA 4ZREA 1ZICA 4F0JA 4MWSA 3WL7A 4C89A 1EK2A 2H7YA 4PW0A 3C6ZA 3STVA 4H7EA 4WFJA 5A71A 2WIFA 5T4BA 3ESBA 4G5XA 3KWJA 4U2CA 2WUGA 2XUKA 5LIPA 1P0MA 2OXEA 1ZOIA 3RKSA 3O4HA 4QZVA 4GDMA 2WHQA 5AICA 3EBLA 2ZYSA 1CQZA 3O0DA 1EH5A 3AIMA 2XLBA 2VJBA 1JJFA 1ZIXA 3ESCA 3FOBA 4Q82A 2PUHA 4I3FA 2HU8A 4AO7A 4HXGA 1TQHA 1ISPA 1J07A 4U2FA 4J7AA 4AZ0A 3VJLA 1QIEA 3BWXA 3DNMA 3G0IA 2FJPA 5AM5A 4PQEA 2H9YA 1SOMA 5EHXA 4KAJA 3QITA 4XVCA 2OAGA 4FFWA 3D2AA 4ITVA 3WK5A 3BE8A 4UFPA 2FUKA 2EDAA 1EDBA 2J4CA 4NS4A 4DNOA 5AOBA 4Y2TA 1H2WA 3DL7A 5FP0A 4FBMA 3G9ZA 2WJ4A 4LXIA 3FYUA 3G8YA 1FFCA 2ACEA 1Q0RA 3WWOA 3WZLA 2W22A 3VISA 3QMWA 5AM3A 5AIAA 2XMZA 2RIPA 5JANA 1ZD3A 4DTCA 1YSCA 5T4FA 3RK4A 3ANSA 2XE4A 1P0IA 3R3UA 1O6FA 2OGSA 4DNQA 4RGYA 5LZ7A 2X76A 1GXSA 4QLOA 5HCUA 1CUZA 1UOQA 2HU5A 3F97A 1VE7A 4UHBA 2VAVA 4CCYA 3QH4A 1BCRA 4G4GA 1E89A 2HA5A 4N8SA 4DNPA 2RI6A 4OB6A 2QXUA 2LIPA 3G0DA 3NGMA 3O9MA 1VOTA 4H7JA 4J0IA 2WIDA 3MGAA 4KEAA 2C7BA 4OUKX 1CUVA 3DKRA 1QLWA 3WQHA 5KWJA 4JYPA 1ETHA 3M82A 4E46A 3PE6A 3HI4A 1MX9A 2WJ3A 2YYSA 5E4JA 2PKYX 2PSFA 1HDEA 1N5RA 4EY5A 4TPKA 4UHDA 4FLFA 1QTIA 1EDDA 1A8SA 1HLGA 3V1NA 5LZ8A 2HADA 3E1GA 1K5PA 3B12A 3LIIA 3ILSA 4W9RA 1TKRA 3FLEA 5SYNA 1CV2A 2JBWA 1QIIA 3EQ9A 1TRHA 4F21A 5K3CA 2GBFA 3LS2A 3I6MA 4HRXA 4G8BA 1QIMA 2WU3A 1LPPA 3IURA 2XUPA 1O6GA 5LZ2A 1ODTC 2XT0A 4MEBA 4EY4A 3B5EA 4IH9A 3C6BA 5C81A 3G0CA 4Q34A 1QOZA 2HDWA 5D3KA 1A8UA 5ALVA 5JAHA 3QMVA 1UKCA 3WJ1A 4D9JA 1HKHA 1GGVA 1QJ4A 2XUFA 2OGTA 2BAGA 5JD6A 4YK7A 3CN7A 1B6GA 1DTEA 2QMQA 3C6YA 2HRQA 4QDXA 2XUIA 5FPQA 1CUIA 2JGIA 1A8QA 1XKTA 1QIKA 5K3EA 2WG2A 1W1IA 1LPAB 5JALA 5ALWA 1K8QA 3ZPXA 1UKBA 2Q0XA 4N5IX 1LPBB 1AUOA 3DS8A 5FXMA 1X70A 4G9GA 2XUGA 4H7DA 3SX4A 4P92A 2DFPA 4BB0A 1X2BA 5EHQA 2DR0A 2QS9A 4F60A 1QZ3A 2VSQA 4O08A 1SFRA 4G4IA 3DQZA 5YASA 1SC9A 1W52X 2VJCA 1J06A 5AO9A 4GW3A 5JYCA 5ALLA 1WHSA 4QLAA 1AX9A 4J03A 4ETWA 4BCCA 1LLFA 3WJ2A 1VKHA 4C4YA 1EI9A 3CN9A 4X6XA 1W6RA 5CT6A 3WK6A 4X7BA 4E14A 4Q3OA 3C6XA 5K3DA 4X6UA 4IQ4A 3TRDA 1TCBA 3H19A 4NVRA 5JZBA 2JGFA 3KXPA 4XJVA 1ORWA 5C7YA 4Y2XA 4ARBA 3WI7A 4DGQA 1P0PA 4BC1A 4ROTA 1DX6A 1QIJA 4YASA 1C7IA 4E15A 4MXDA 1UWCA 1HBJA 1U65A 1CQWA 1W75A 1XLWA 2WM2A 3WIBA 3WWEA 3ZLVA 4B84A 5CBKA 2GYVA 4QDTA 1MJ5A 4IH4A 3SWWA 4XWGA 5HF5A 1JMKC 3KDAA 2HIHA 1R4ZA 5AHXA 4K6GA 2CBGA 1LPMA 3WYNA 4FTWA 2C5GA 4M0FA 1CR6A 5AKHA 1BROA 2DQYA 3LLCA 4B0PA 5A7FA 2HA3A 2PSJA 4LXGA 5FLKA 4DMFA 3IUNA 1GZ7A 4Z49A 3N0TA 5FV4A 4C4XA 1MAHA 7YASA 2HA6A 1CUAA 3AZPA 2WTMA 1LGYA 5JARA 4BBZA 4CG1A 2JIDA 3I6ZA
chains in the Genus database with same CATH superfamily
2R00A 3P0EA 4N82A 4YBZA 2FRDC 4CM8A 2ECFA 5ICSA 2VPYA 1Z7WA 3AR9A 1II8B 2AHOA 4EJ0A 4KPFC 3OO0A 4POAA 4KIUA 5JXHA 2RHOA 2P27A 2Q2NA 4C06A 5D8DA 3UCFA 4KKVA 4D0GA 1J56A 1NUAA 2P2LA 3LBHA 1YO6A 3MGCA 1FYDA 1BX1A 2CLKB 3EGXA 3V4PB 3WKAA 1JEOA 1D8AA 4II7A 1ADYA 2GBGA 2Q4TA 3CX4A 4QU9A 2VPWA 4QREA 3Q8MA 1ZI9A 1PYDA 4DCGA 4IZOA 2ASVA 3UH1A 4LBVA 3A2LA 5JC8A 3I92A 1E7YA 3U9LA 2ENWA 1XXHB 3MCWA 4LJ7A 5KTPA 1TM4E 1IU9A 1R18A 3GLHA 4JP5A 1BQ4A 2BFBA 4IDQA 1S4MA 1T25A 3P94A 5LLDA 3NHBA 1HNNA 5H59A 5P21A 4BZXA 3REOA 3TQQA 3ZE7A 4YO8A 4B3BA 3K32A 4PZYA 4GGMX 3UK7A 5HQ3B 3KPWA 3TFQA 1H66A 3OE7D 4YP0A 3HJBA 4EFNA 3FYDA 3BIFA 4J1NA 4EKGA 4ESOA 5KQGA 5HFJA 2A14A 4D8XA 4HDQB 4HRVA 3WKEA 5DX1A 2R5FA 5LQDA 4IV0A 3SD7A 2C78A 3TTYA 3VR0A 2FW9A 5L7WA 1P4JA 3ZD6A 1E79A 1F0PA 4OKNA 3AONB 4KQJA 4LJAA 5FBVB 4G0UA 4B40A 4FJ2A 4FOOA 3I9KA 3M3HA 1YZKA 1WW3A 5I9TA 1EXMA 2D54A 3ND9A 3RANA 1C8KA 2Y71A 4HY3A 5DMXA 4CQMD 4BNLA 1XPRA 1GFIA 3I9OA 2EVWX 1KERA 3USZA 1VDMA 2ST1A 3OPNA 2NOAA 3EIOA 1ULZA 1M6VB 2BKVA 3D7KA 4PSUA 5IAKA 5JISA 5KOHA 1V11A 3LHFA 4B3RB 1RYEA 3HG7A 4Q4DA 5HE8A 1H6CA 2DHRA 3N86A 2PH5A 4EJ2A 1DCMA 1GCIA 4BLOA 1XRMA 3E1SA 2BFCB 1UBJS 2GF9A 5HIMA 2CFIA 3ZWQA 4CN8A 3UHOA 4K2HA 4KYTA 1NXTA 2F1KA 3HUEA 1ZRNA 4HAZA 4KBYA 3RHFA 4RDXA 2HA2A 1LJUA 3EMKA 3UT0A 1HRDA 3IAS6 3NEYA 1FFBA 3T8YA 2DLNA 1U1FA 3WKDA 4FZVA 1GQYA 2DUJA 1IN1A 4DXDA 1MPXA 4HPJB 1Q19A 1EMDA 3HLKA 5CT4A 2QX9A 1WVMA 2OFXA 2HL6A 2PWZA 1ZG3A 2GZMA 1AV6A 3D7RA 3KTOA 4WIAA 4DIOA 4REOA 1YDHA 4DA0A 1H6BA 1QHFA 4LC1A 5CDFA 3JATB 3TDMA 3UWPA 4TZTA 2HF2A 4JYMA 1TK3A 1UMBB 2C04A 2HA7A 4U3JA 4NSNA 4OQDA 4YUAA 2CEKA 2XY4A 3WXBA 1E3TA 4WFIA 1CRQA 5JMWA 4QQKA 1YJBA 5T64A 3FIJA 1OV4A 4UAJA 1QG4A 3SJCA 4R6XA 3KJIA 3K70D 4JUFA 4MCHA 1ESDA 5D84A 3NAQA 4E1AA 3WYAA 2JRLA 2YRFA 2ZB3A 1WU8A 1BDMA 1Z39A 2GXAA 1DO0A 4BMNA 2IT1A 3G5AA 1H2EA 3MT7A 3KJQA 1GGKA 2GK3A 3PNMA 1WDKA 3ZCRA 3H5AA 4DLSA 2OM2A 3HB4X 2FXIA 3BC1A 4JYBA 4NMLA 5GGXA 3UMCA 1RC8A 3VDXA 4EENA 4NV3A 3BYZA 1MX5A 2WNIA 3RBAA 4RJJA 1WCWA 3AVPA 1BJTA 1IB6A 1OXXK 4IX1A 4Z9XA 1NTOA 2CE7A 1UFVA 2VTBB 1UJBA 1M8JA 2OPBA 1BWPA 3HM2A 4NDNE 1H9BA 3MC1A 1AGNA 1X7XB 3EC1A 3R6LA 2CFOA 3LY7A 3R7BA 4GC9A 3TIVA 2CVOA 2HQBA 4ZYWA 3SXUB 2D7CA 1O08A 4QOGA 3QUTA 1KKMA 3OOEA 2NU9A 3D8RA 2BFEA 3IUMA 3N8GA 4HTFB 4KQXA 2PVSA 4OHVA 4PLCA 4QPZA 1Q0QA 2FW0A 5FBWB 2XCQA 3GFPA 3NOVA 3GGDA 1UJNA 1XTZA 1M7GA 3CURA 4B4VA 3ZQUA 1D2MA 3JASB 5TXGA 4B5KA 1Z38A 4BAGA 1E77A 2E6UX 1PYOA 2O7QA 2J5BA 1FXWA 2Q49A 2Q27A 2VG8A 3EVEA 1N8NA 2Q8QA 4PLGA 1YIDA 2A7XA 4IGAA 5JAQA 4EB0A 5C5CA 5IH7A 4KQ6A 3GZNB 1OROA 3BK7A 5JJLA 3SBEA 5KYGA 4AYTA 4FDUA 1E2GA 1QCCA 1NF9A 3SMVA 3RF7A 3JQ8A 5E2BA 3SR0A 5CLLA 4RORA 4LHVA 4HGQA 3AVVA 4IS2A 3ECCA 5ESXA 1KPIA 2SKDA 2P4EA 5DRYA 3SOZA 3WQSB 4GNRA 5HOQA 3HP7A 1KRWA 1M75A 4LF5B 1YI8A 3EFHA 4DBLE 4DKXA 5AVTA 5JY1A 1T2NA 4G0YA 4MA0A 1WXXA 3KD3A 4JMPA 4RV9A 3EDRA 4PRLA 4QUAA 4Z1MA 4DR3B 1UDXA 2B4KA 3H2JA 2WM8A 4FEAA 3QE3A 4LQDA 3DA8A 3IBYA 5FF9A 1E0KA 1I2ZA 4GYYA 2QORA 4PFQA 1DAKA 1RRPA 2ECKA 3OOJA 4G65A 3ZJ4A 1T35A 4GOJA 4CIDA 3K9GA 4ZU3A 2IX3A 2RHTA 4O5AA 4GYWA 2ZRKA 4ZVRA 4AF8A 4PGFA 4MKZA 4R1UA 3U3OA 5CB0A 4CM1A 1RPZA 3UUWA 4IRUB 3SYTA 2PKCA 4KAXA 1XK7A 1SH7A 1I9GA 3EXEA 4Q1FA 2CNKA 3HVRA 2ZVQX 4O2AB 1UEXC 3ZWXA 5H02A 2JIQA 3KQQA 721PA 5PNTA 2VQ3A 3R40A 5J2TA 1WUIS 4JELA 2JLBA 2HHAA 3BE5A 3PT5A 5C8VA 1JR3E 2A1TS 3BHJA 4FFLA 1RC1A 3ECAA 1G21E 4HD8A 1NRJB 1GL6A 3OC0A 1GYRA 2NUBA 3WNQA 4MVCA 4WERA 1UPUA 2OORA 4U63A 4DEXA 3AILA 3N75A 3LD9A 5JDIC 4C0QC 1PKXA 1PJBA 2R4QA 3TLGA 1JSXA 1NMYA 2FQQA 3KJGA 4ZARA 4QWWA 3WLEA 3MVEA 4M2LA 4IIJF 4QVKA 3PLAE 1K8YB 2O3UA 4D8TA 1WUYA 3FDZA 1TIBA 1Z8HA 2MR5A 3ESDA 1DBWA 3CH6A 3KTDA 3JZIA 4TN5A 5FPSA 3RK0A 3RS8A 4U2EA 1BFUA 4I0WB 5D6NA 3RUFA 3ZH9B 5JS6A 1SG0A 3K6SB 1B15A 4ZV7A 5AUNB 1XEWX 3G89A 4G5QA 1R8QA 1ANKA 3IQXA 3I5UA 1N5IA 3RSGA 4DHWA 3EY9A 2YFQA 1Z88A 3OMXA 3BWYA 3QPDA 3IMEA 4JEMA 4N7JA 4OBEA 2X77A 4WEQA 5AI4A 3W2GA 5B7QA 4CEIA 2JH3A 4YT4A 1MAWA 2G9ZA 1E94E 2Y76A 1WKCA 4OQPA 4B87A 2XVYA 2A78A 4D4MA 1E1YA 2XB9A 3GRPA 2PZGA 4MIEA 3IVRA 1R0RE 3TR0A 4CDNA 1D2AA 1UDRA 3INGA 3ISVA 1EXWA 3L1VA 1TFRA 4G0OA 1GDTA 3K96A 4YRQA 4Z0PA 3UK1A 5JW6A 4ERXA 2L19A 3ZLUA 3AT1A 3FAKA 4X1OA 4HNRA 4NHOA 4GPIB 3RIXA 2ODEA 4JKIA 2IV3A 2CSXA 2V7TA 3NYIA 1NW4A 1KR2A 3NBMA 2QAGC 4WCFB 4MWEA 2P6PA 2LVBA 1YIOA 3O1HB 4X6LA 4EA6A 4WLUA 1YMVA 1JR6A 5LWQA 4M38A 2ID4A 3VKGA 2E0IA 2D74A 1L5HB 3LPLA 1MB4A 4XGKA 1CY2A 2FJUA 1T2EA 1EZ4A 4F72A 1OTXA 3JQ7A 3WNZA 5DV9A 1Z5NA 2R66A 3OMLA 5EZYB 4B71A 1J2YA 4XVUA 2JB9A 4HATA 1C1DB 2UUCB 4HDKA 2GMWA 4TRJA 1GZ4A 3OU7A 3WGYA 4F46A 1R0BA 2ZBEA 5ANRB 1QWOA 1SCBA 2IOQA 2SECE 2V5AA 3HB7A 4MR7A 5GONA 1ZD9A 2NYRA 5GIOE 4BX0A 2EDCA 3B36A 4PBRA 3IMFA 1SUBA 1LLDA 5KCZA 2WF6A 4B31A 3BHNA 1RWWA 2O7NA 4IV8A 1J00A 3KPVA 2LGJA 5EAIA 4RSHA 2PPVA 2WOOA 2XMGA 2HMYB 2DGDA 2QAGA 2ZR9A 3KOWA 3BE6A 4LIPD 2FZWA 5DNWA 4BIIA 2CSUA 2ZTMA 2I6SA 4XRGA 4A2QA 3I0MA 4DLTA 4UVDA 5FTNA 5E8JA 3FPHA 1IY8A 2HPAA 4PG4A 1QX4A 4PR3A 4JKYA 3RNOA 4R41A 3DP9A 4EDHA 3DMPA 3BFPA 6REQA 2XMSA 4YR9A 1XAGA 2XEXA 4KVGA 5B1YA 1NQWA 3I2YX 5JS7A 1ZIYA 2W2VA 5L7YA 4KWEA 5BMVF 5DO9A 3CVYA 3M8KA 1V96A 1HNXB 3FTDA 4ZQFA 2REOA 4D6YA 5DCYA 1IM8A 2FUG6 3GZNA 3KOYA 3V32A 3WXMA 4AY3A 2MINB 1TJYA 4IEIA 4Q1EA 1D6SA 1JR3D 3LOUA 4HQNA 4KXQA 3UM9A 3ID6C 4F6RA 2VEOA 2H5EA 4G5OA 2GEDA 2RHMA 1ZITA 4Z4HA 2JBAA 1APBA 3IALA 3HXOA 4L75A 2UDPA 4B85A 1XRPA 2GHQA 2QN9A 4ND7A 4BO5A 4UTPA 3OT1B 1EWVA 4OJQA 4N0DA 4PSDA 4EKDA 5BSKA 1E9CA 3KB8A 4RM2A 5AW4A 3IVXA 5BV2P 2DHDA 1G291 1U2DA 1WO8A 5G1OA 2HJRA 3CKKA 2YYZA 3FDFA 3I9V1 4M36A 5CYFA 3GQVA 3BX1A 3N3AC 3DVAA 3JYNA 1OFIA 4B3GA 3M4ZA 3B8EA 3GPBA 4YJGA 3ZGZA 4YI3A 2AMJA 3GN2A 3ZCUA 3EVAA 5B57C 3NPAA 2YOFA 1BMTA 4DILA 1ZJYA 2LRHA 2ZRGA 4BBPA 4FC7A 3AO0B 1M0WA 2GR9A 4R7ZA 3N2KB 2BMWA 2Y68A 3C8DA 2ZUSA 3FCEA 3O73A 1Y0BA 4Z99A 2B0JA 3BRSA 4FI3C 2WOJA 5EXTA 3KZOA 3HCPA 2OD2A 1ILWA 4M7OA 5FULA 3LTEA 1OC2A 1QBKC 3R1IA 2QB5A 3IP7A 4HSEA 3VR4D 3WBJA 4Z9YA 4F1JA 1SC4A 1TYAE 5H16A 5F52A 4F7DA 1VBFA 1SELA 4M9ZA 1OWLA 1WOYA 3OZUA 4XYMA 3PXDA 4Z4GA 4WX2B 1XEWY 3HVIA 5AK4A 1EK0A 4K2AA 4YRDA 3MMNA 1CVRA 1DRVA 3OZXA 1ZNZA 1E3LA 5HDBB 4BGVA 4BE4A 3QNWA 1C3XA 5AESA 3S2IA 4BIMA 1K0UA 2DTEA 4WA7A 4WOCA 1IMOA 3GT4A 5LC1A 5BN5A 3UTDA 1RCUA 2DG2A 1TAUA 4HCJA 2KE5A 2ZJ1A 3HJGA 3WGUA 1QB7A 3FLAA 1SZDA 3GLHE 2IP2A 2ZJ3A 4ZO8A 1ZD8A 2CHEA 3BJRA 4ER5A 2V4MA 1L7EA 1E2UA 1IC6A 1N0VC 5CJJA 3ADOA 3FBGA 4KR3A 1TTPB 4MW9A 1KI9A 1G3UA 3V48A 5ITVA 2I4NA 4DV7B 4ON9A 1TZCA 4IICA 1WMEA 4NEGA 1KO5A 2FEOA 1WOMA 3OSUA 1PBNA 2CNBA 3RKUA 3BORA 1ZJJA 1VP9A 4FXPA 5ER6A 1YS6A 2AJCA 4L3WA 4CIBA 4JSTA 1MU0A 3IP8A 4AWBA 4YMWA 3DE4X 2ZRDA 3H5NA 2VF4X 1WS6A 4MS4A 3QI2A 5ESDA 4AJIA 4Q7JB 1ESNA 1RI4A 3HWX1 1KJJA 3Q6NA 4LVOA 3WNVA 4BPBA 3NBAA 2PQ6A 3OCCA 1TU0A 4KN9S 4OXNA 3ZDBA 5LYYA 2XWJI 1J9EA 1RFGE 2WR8A 3LHIA 2KM1A 3FCSB 4MQUA 4ER7A 5BN3A 4A1OA 3G7NA 3KP1A 2ASEA 4WJKB 2AR9A 3E5RA 1TIKA 3OQBA 2VS1A 4H1UA 1UR5A 4HNAB 1LDMA 1TMGE 5JYBA 2ON6A 2REBA 3F90A 2LWIA 1OGJA 4DBZA 5K8TA 1ZMOA 4TL7A 2IP4A 2QE6A 3X44A 3ZCQA 4DMUB 4G0NA 3HVJA 3R7WB 2OENG 4GM1A 2HJHA 4OYRA 1UZUA 4XB6B 4YT5A 4YS6A 2WTBA 3RHSA 1MA3A 1SBIA 3AW9A 1T9HA 1XTUA 2IDKA 4HVAA 1HETA 3FCUB 2W00A 2PRKA 2OQVA 3KSAC 7MDHA 1TMKA 1E62A 3LZDA 3LLUA 3L7DA 2H85A 2CNWD 1TIPA 2AOXA 3FHOA 2GM9A 2YNMA 4RELA 2WWXA 3D6JA 1XU4A 1NUTA 2DUNA 4YB8A 4H6VA 4BTEA 2OILA 5FTKA 5ULLA 3HO8A 4P8RA 2OZPA 1IIRA 3A6EA 2D13A 3EGVA 4INPA 4J07A 2GYYA 4L2IA 1D7OA 2HXGA 4O59O 2OPHA 3QU5A 2JLWA 1VQ1A 3N2IA 2YBEA 5KJEA 1O94C 4FYKA 5CT9A 4KGZA 4KPEC 1CHDA 1RKUA 2NVOA 3WQRA 1E5VA 3U4QA 1I5RA 2FPKA 2LCFA 2V9PA 3H05A 4KV7A 4N9WA 1D0IA 3NUQA 3OTWA 1H9AA 3GFRA 4S3MA 1L4YA 1TZBA 4F93B 4ARCA 2FZEA 4FD2A 2D0DA 4N4AA 3HSSA 3FJOA 6ABPA 5F33A 2L17A 5GAJA 2ISQA 1XWWA 1E3SA 4LGYA 3DTVA 4BMSA 5FBLB 4NLLA 1P4GA 4AX8A 3GGGA 1D09A 2YMMA 1V41E 4RFSA 4WCDA 4V1CB 5LMZA 1XVUA 1SVIA 2Q9CA 5BMVA 3ME5A 4Z9FA 3JD2A 4Z0NA 1KBZA 3T5DA 4BKQA 1PGPA 5LXTA 4CKYA 2ZI6A 4FKBA 4DV0B 2Z98A 1KJ9A 4QPJC 1VMIA 1CZOA 2FQYA 4GI7A 4KE7A 3IAM1 2XQJA 1MT3A 1KHTA 2F90A 3DVQX 5CK4A 3SYRA 4F9EA 3OTOB 2HLNA 3SIWA 3FNFA 1V7PC 2J8ZA 2Q46A 2RGGA 2F8LA 1F0KA 5H7XA 4QT0A 2COEA 4UDXX 1UZMA 3LNCA 3PL1A 4RM3A 4Y2RA 2NP7A 1R4MB 1K7CA 3U49A 3IQIX 1BXGB 4IZ6A 1K97A 3LC0A 4UOZA 1JQBA 3RSZA 4H18A 3L7MA 3SVLA 1WKVA 2JJYA 2OHXA 2W6JD 3WNBA 4LVCA 4GL4A 3GJTA 1R4NB 2P4QA 1OW3B 3LLSA 5CYOA 4N01A 3VU9A 2KB0A 2XNKA 2YVLA 3FOFC 1OX5A 1BE8A 3RG2A 1PYGA 1U9CA 1XQVA 2Z83A 1KNXA 4IDCA 4A8JB 1M6HA 2ZVDA 4BVJA 1RLIA 2OFWA 4I4TF 3R3ZA 4B83A 5BR4A 2N42A 3ZVRA 3QW2A 2ZPUA 3RT1A 3FHCB 3GFFA 4KMSA 1G5IA 3E82A 2IHVA 2JFOA 3KM0A 3OBBA 4MQ5A 5HQ3A 1U81A 2DFLA 4NNJA 2OHFA 1H6DA 3MWKA 2QJTA 4GBGA 4YRFA 2VXOA 3UYLA 1RWQA 2WP8J 1L8OA 4UBLA 3VOAA 4DCTA 3ONVA 5LD2C 3KQVA 3EPLA 3URMA 3T9BA 4YAUA 4HRYA 1PCXA 4PAOA 1AV7A 4JYZA 2R11A 5HCNA 2LUOA 5BXQC 4WASA 1SURA 2CVQA 3PYLA 4XVHA 4TKLA 5KWSA 1VSTA 3BILA 5IHPA 5JNVA 3AKDA 4INAA 4TLBA 1GPUA 3KPUA 5EHNA 4XPIB 1CZLA 1KARA 3CF2A 4L7QA 3TX6A 4A23A 3DPIA 1OZFA 4HH0A 4CQJA 1X2EA 1DHRA 3PB3A 4WXYB 4YREA 3LGSA 2FGJA 3R3XA 3K9WA 4A8TA 2ZSUA 3QVGA 1GNVA 4EB3A 3ZIAD 1KWGA 5KNLA 3U0BA 1YBAA 3RYFA 2IXBA 3SY8A 3AM4A 2OWDA 1I30A 2BPOA 3H3FA 1NQUA 1H1LA 2X5XA 4UDYX 2IEIA 1FP2A 3RRBA 5E8RA 3SJUA 3VVBA 4AN1A 5A5DA 2MOKA 4CLOA 1NPYA 1U63A 3IBTA 5T67A 1EFLA 1QANA 2HFJA 1YB2A 1FUYB 3BXEA 3FPGA 5K7SA 3PYXA 4MRMB 4POOA 4RZSA 5IJ9B 3Q3IA 4OKSA 4LNAA 5T4HA 3P0HA 3DW3X 4J0DA 1H0HA 1GG8A 3QUBA 1X1QA 2IW3A 3VHXA 2QTVB 3P2OA 4D74A 2FSVA 3Q8KA 3LH5A 1V5EA 4HTAA 2QOEA 4XEUA 2Q4OA 2R1ZA 3GXBA 3SDZA 2OY0A 5CGZA 4AJKA 3NO4A 2ZIUB 2IU0A 3IXLA 3T7IA 1CUUA 1WPGA 5F4ZA 3WX0A 2PAFA 2QD3A 3SLRA 1RRGA 3E7WA 1JH9A 3IUPA 1VCIA 4QBFA 5TE9A 4B75A 4TMFA 2IZ6A 4AX4A 3GMSA 4YY3B 2I1WA 2N3ZA 3MTQA 4MS3A 2X8BA 1FNNA 4I1PA 2H08A 5CTAA 4HC4A 3TZCA 4DV6B 1UM9B 2VJDA 1W49A 3O8OB 2AZDA 1VRVA 2F1JA 1UPFA 1OVGA 4M8IA 4Q7KA 5ERXA 3X43A 1Q95A 3FI0A 4G89A 1IVSA 4MITA 3VPFA 2ZI3A 1Y8CA 1GPAA 1Y6RA 2D8AA 3NHWA 4HAXA 4MWCA 5EJ9A 3CSDA 3VC7A 4UMVA 5ICCA 1YA4A 4BY9E 3WRXA 4BLUA 3MB5A 2IUEA 1WQ3A 3W05A 1XEFA 4EB6B 1E3DA 1QS0B 1V48A 2FW1A 3DDHA 1YA8A 4JR1A 4DV3B 1UJCA 4RK4A 1KQNA 2WWVD 2HZ7A 1GTG1 2NTYC 4UHFA 2ZYDA 2WJZB 4M1MA 2EX0A 2QPOA 3E0QA 4DA4A 4S1VA 1PWEA 5DWDA 2B1RA 3TWOA 3G5UA 2FPXA 2LTAA 4L02A 3M89A 1WA5A 1YFZA 2B8TA 3A4IA 2R47A 3R75A 2YYYA 1VJ5A 2M1XA 3T3DA 2VN8A 4UNPA 4JDPA 3RYTC 5L40A 1FNMA 4K03A 1XF1A 3TSWA 4EEKA 1I1OA 1NBMA 1U3WA 1C8LA 2GZSA 1WXDA 2IJGX 3EZFA 4R68A 5ES3A 5BT9A 3U2QA 4DAOA 4DNXA 3M1LA 2RBKA 2XE8A 3BZBA 3ELUA 5GMOA 4MVJI 1L1FA 5JMOA 4GWLA 3EQZA 3K1ZA 1UK7A 3N7TA 2XUAA 5KOJB 1NNUA 1FU4A 1WDLA 4BJ6A 5TQVA 4MQ6A 4Y2SA 1YRQA 1Z0AA 4EG6A 4S04A 2X8AA 3EGDB 1G8GA 2QQGA 3B6EA 4JWKA 4MB2A 5TRTA 3GJQA 5K05A 3R7AA 4BGUA 4KR7A 2J48A 3AM3A 4QNNA 4MWBA 4TGLA 5DVZA 2RGNA 2WU1A 3H17A 2EV9A 5E4FA 1Z4MA 4DCNA 1DC4A 5LR6A 4B3IA 2PNFA 4D0SA 1J7JA 1QBGA 1EA5A 3VSDA 4YAWA 4MS1A 2HIGA 4NYJR 2C7PA 1XC7A 2JVJA 3I5XA 5SYMA 3OU2A 4F91B 2GCGA 2ZWMA 5TMDA 1NQAO 4D3ZA 4EG7A 1KAEA 3AR7A 1B0ZA 1KEPA 1E8NA 1Q21A 5K2OA 4JUAA 2OV6A 1PGNA 4ZDJA 3SC2A 1FNDA 1O0SA 5HS6A 4BFWA 2XD9A 4IY1A 5F1KA 1XHEA 2AJ8A 5ALKA 3G17A 5IP5A 2EFCB 4MWZA 4YRAA 5DLEA 4Z7NB 3DO8A 4YMLA 3LL4A 3B3QA 4DLNA 1RHUA 3OZVA 3AP2A 4ZI3A 2OCKA 1XD8A 4UBJA 3ROXA 4D80A 1PJCA 1ST2A 2Q5IA 3KKMA 5CMLA 1AVTA 3JQ7B 1N2SA 1D03A 2JFQA 2VHCA 5E9QA 5KOJA 4KWTA 2BBWA 5AVJA 3SHTA 1DVRA 4XQGA 4QXOA 3EFEA 4HXEB 1CQPA 2AI3A 3AJ9A 4QTXA 2D2XA 5CLJA 1XCJA 5JZMA 1WQ4A 5CUQA 4C6SA 2O8FB 2EFDB 3SQOA 3OOSA 5C31A 5CDTA 1SY7A 3T5TA 1WB5A 3P20A 1S4QA 3KO8A 4MKFA 5D87A 2MSDB 4KYVA 4L5AA 3F2IA 2UYOA 3MF4A 3PHLA 4BQFA 2E3JA 4G4SP 2A2ZA 4KW7A 3MS4A 2Q0SA 4P0QB 4F6CA 2GA8A 1GILA 1IAVA 2FCAA 2VSOA 3A9TA 3BGIA 3DBIA 4NONA 2HB6A 2GNOA 2IVFA 2QMYA 3Q2IA 2CVHA 4DZZA 1TEHA 3CZ9A 1FLAA 5EE0A 5I7VA 3V8BA 1N1MA 1K63A 1CIJA 4Y0AA 3RBZA 4E51A 4EX6A 2QTAA 3KQTA 3RJMA 2UUBB 2X0NA 1PWZA 4PSVA 4FN5A 4QJBA 5C0OE 3X1XA 2CNWA 2GN6A 1COWA 1V8ZA 4LN1A 2I6UA 3RYIA 5EKXA 4DLRA 3JWGA 5MF6A 3HA5A 1GY8A 1SQ5A 1V37A 3GJ6A 3LY8A 3K09A 3PEEA 2V8BA 3PXXA 3S1AA 1GAXA 2YY7A 2XUHA 4TZ6A 1MEEA 1DUSA 1Z5OA 1ULUA 2IY9A 3E48A 1W8IA 2CY0A 5HE9A 5I9SA 2OAEA 1ILEA 3KE8A 1FP1D 3NAGA 3NJ8A 2CFTA 1QGZA 1R16A 1HNWB 5EE5B 1QC5B 1IPHA 1R8XA 4BLWA 2RGWA 2QRVA 3H2HA 3FWPA 3L0PA 2J0QA 2FXVA 2C2KA 3U61B 4J1TC 5MGBA 3KCQA 2YWRA 3LVRE 3AVXA 3L6EA 1NXQA 3O47A 2B4YA 4ZO9A 5SICE 1KDVA 1KOLA 4MIKA 3COVA 2FN7A 1HGXA 1NJ5A 5IS2A 2WFLA 1NW5A 3C5VA 1A96A 2QEQA 4ILEA 5JY6A 5BN5B 3QPBA 2OLEA 3GI1A 4A2PA 2GEKA 3V80A 3K7EA 1CUXA 1W5EA 3N2YA 1IOWA 4M1EA 5T3UA 5JSFA 1ZVVA 4L72A 1W6UA 1TXGA 1AF7A 3OM1A 1EWYA 3R6WA 3CUWA 3OFVA 5A7HA 2ZJ0A 3AF1A 2NZUG 5BV8A 1FRNA 1QHSA 4MUBA 5AJYA 4DL9A 3K09C 3UB4A 1A72A 4WLFA 2XUDA 1LV7A 1OFHA 1RRMA 3MAGA 5I5EA 3OPVA 2NIPA 3IJPA 2RE8A 2LDBA 4ICIA 4MB0A 1B00A 2GJ8A 2H8KA 1OU0A 2WMYA 2C98A 3KLBA 1V5FA 4S0XA 2J1LA 4PC2A 4FB5A 2QJFA 3Q6MA 5G2OA 1P1IA 1JDUA 3OIFA 3S2YA 4DHEA 1W25A 3HYSA 2ZGVA 3QMPA 2YQZA 1U7OA 3VO1A 2AXNA 3MGBA 1KEUA 5B36A 3I9MA 4I4LA 4O02B 4MRPA 1M6YA 3NB0A 3GP5A 4R40A 2ZTHA 3CINA 1XRQA 5FLYA 2ZAOA 5TARA 3F9CA 2A67A 3RAJA 1ZW6A 1DC6A 4TTIA 3QKRB 3OHPA 2X19A 1JF8A 3KU1A 1JIUA 2BGJA 3OT1A 6REQB 2ZRMA 1SQ0A 1KQ3A 1DOZA 3NHZA 4PE5B 3E70C 5IEJA 2WNSA 1ZSYA 1JKXA 4BDSA 5JRDS 2OESA 2YW2A 1CY1A 2WB4A 4TT3A 2PFKA 3JZAA 5EGNA 1FMJA 3JQGB 1X9IA 4HX5A 2OBBA 2B92A 4RPKA 2Y2UA 5TQJA 4F86A 1JHMA 1WSAA 2N46A 1WP4A 1WUJS 2B7CA 3HKBA 4XQEA 2XYPA 1SBTA 2I6TA 3BMOB 4N5MA 3IR7A 5TJHA 2X0DA 4AJPA 1KTIA 3KUCA 3GFSA 4AB1A 2J07A 5BNZA 3M6UA 2WAMA 2ZSBA 1PJAA 3ZHBA 3RK1A 3BERA 2YWFA 2O1WA 4WDQA 2G5PA 1Z18A 3RNLA 1DKOA 2H63A 3B1XA 4BO4A 3JAMA 2XJ9A 3PZBA 1N2CB 1X7DA 2NAFA 2Z9BA 1ENPA 1MHPA 1PNTA 4DANA 5JV5A 3GFVA 2ECOA 2HIAA 3I52A 4E2YA 4DA6A 1I2BA 1XN4A 1MB3A 3NTOA 4I6GA 5EZYF 4N76A 3U6BA 2IODA 4MTCA 3UK6A 4COKA 1KU6A 3HNRA 1QDUA 4GAEA 1SC6A 4FZ5A 1Y33E 10MHA 4O4IA 1UC5B 2F6RA 1HK7A 2MIIA 1Z29A 2ODTX 3JALA 2PL5A 3IESA 4HYTA 2GFHA 3O8QB 3F6CA 3GRZA 2I2BA 2OORC 2YZGA 3CNHA 2XGGA 2D2FA 4IKPA 3C5EA 4M1YA 5CPFA 5L6LB 2ZM5A 5FOQA 1PR0A 1VYVA 1YGPA 3RSLA 1P73A 3CLTD 5AOAA 3UFBA 1NG9A 3QHQA 1P9WA 2NO6A 2ZB2A 2A1TR 4KPUA 4Y1FA 1IAQA 3VH4A 1F20A 4YYEA 3MHPA 1AZSC 4AT1A 4NCNA 5KYTA 3KKOA 2DY0A 3SU8A 4HN2A 3KL4A 3UJCA 3P9XA 4LUCA 4N03A 1R6TA 2ZAMA 3COYA 4ZVPA 3SVZA 3ZE1B 1RRVA 1RWVA 3PQ8A 1IN6A 1PUJA 3A1FA 3M6IA 1KY5A 5HQJA 1B42A 4IIEA 1NZDA 5HMMA 4XVQA 1H4QA 3FZQA 1FXSA 4X84A 3GA5A 4K6OA 4QTZA 5FWXA 4D97A 1J97A 4G07A 4GI2A 3BKWA 5JXWA 1DEXA 2QTZA 1XN1A 3L0IB 4B6JA 3JWEA 3OCWA 2RONA 3FG9A 3R09A 4ASUD 4AMUA 3DC7A 1A4UA 2J30A 5ICMA 4QVGA 4B48A 3KFVA 1HDOA 5E4YA 3C5HA 1UMDB 2FJ0A 3VYUB 4UNRA 5D1NA 4YP9A 3ZZ1A 5HVNA 4E70A 4PU0A 2ZE7A 1RWXA 4J0JA 4JFRA 3B1KA 3H4VA 1REQB 4ONEA 4GYKA 2YVAA 4U7WA 1WBBA 2I9KA 5LKAA 1G6HA 5HYVA 4MGHA 1QYCA 3ETCA 5A4JA 5K0EA 1ISHA 3W2FA 3FUVA 3D54D 3NYWA 4Y9SA 3OICA 1C30B 1NX9A 3MOIA 1WBDA 3WLHA 3QF4A 4UTVA 4ZCSA 1XA0A 2FX5A 2PT7A 2RG1A 1HT0A 3HPRA 4X85A 3X0DA 3LF1A 2W43A 1N8KA 3ZD8A 4DVGA 1NXSA 4G97A 4PLZA 3NIBA 1E0SA 1ZDMA 4OMUA 3NI2A 1T10A 2XNCA 3EBPA 2V74B 1WP9A 4GVPA 4JJIA 4PGAA 1J2EA 5JSQA 4QEZA 2ZS7A 1ZI6A 3A9WA 3RVMA 2IQ5A 2D00A 2W2LD 1KEVA 4TMYA 3VNQA 3MERA 1P2GA 1G2PA 1Y98A 1XNGA 2CLLB 2R65A 4HGPA 4YRGA 3GMDA 3K2QA 1P1CA 4EPXA 5EIEA 1U04A 1YS9A 2FEKA 4KN8A 3N2EA 4DSOA 4NI5A 1HA3A 2XLCA 4WL0A 3EGEA 2W6MA 1GZUA 5EEHA 1CEQA 1ODIA 1LK0A 2IDJA 4OQZA 4DLWA 5JZSA 3BTOA 5AVYA 3PNQA 3A70A 5JSYA 2JD0A 3EGCA 2QUHA 2M6LA 1XJ0A 2IOFK 2JH9A 3M6XA 3NIDB 3MT8A 4MUHA 3WGQA 3TS1A 1X3SA 2FHPA 3T3MB 4DRYA 1JN0A 1QIHA 3CEPB 3LLVA 3QLJA 3QUQA 4JD5A 4P83A 3AOGA 5CVTA 2EJBA 4O2AA 1Q74A 3EXAA 4D9CA 4HK4A 2B3TA 3L2OB 3JQ6A 2J3KA 1C1XB 2P2YA 4IHJA 3BA6A 4X93A 5IVKA 2I55A 3SEQA 1JAYA 1SVSA 4ABTA 2EKPA 2O23A 5H81A 1AUPA 5J4YA 2H9IA 3H6GA 3W04A 1Z0SA 1SCDA 3GRVA 4L8FA 4M22A 4C04A 1SU7A 1PJ8A 2GJ4A 2XQIA 4WNIA 1ZD1A 4XQ0A 1TYEB 1XQXA 1PUXA 3A36A 3V9PA 4A91A 1EUCB 1RWKA 2GRUA 1W85A 1XDZA 2VPPA 3Q7RA 4OM7A 5K0GA 4L5JA 2LE0A 3CVVA 1BMFA 2QTHA 3BF8A 3QJGA 4B4WA 4R8LA 4YQFA 3GN1A 3KYDA 3DYVA 3RTBA 1VL8A 4CM8B 3QLVA 1KI1A 1FE8A 2HEGA 4GE0A 3R3WA 1W48A 4ZAFA 2OV2A 2YJ3A 2C2ZA 4DYHA 5HX7A 4DMGA 3DBLB 4FOSA 1H65A 3PXUA 5GIPE 1ADJA 1ZK1A 2WHPA 3C1AA 3HKBB 1JQKA 2DSTA 2GPTA 1F2TA 3Q7IA 3TXAA 5JDIA 5KQRA 1M34E 5JAIA 3GBSA 3H6KA 3QWHA 1W4RA 4OXRA 3RJ5A 4H0NA 3I2HA 4D26A 1LF0A 2E1PA 1GU7A 3B3JA 3N2KA 3ULKA 4GPTA 1XDUA 3I9V6 4JKOA 4EBBA 3T7CA 1DXOA 1BVHA 3DDWA 2G04A 2OA0A 1V3UA 2PV0A 3JQFA 3WMXA 1XIVA 1CJTC 2RGXA 2IYVA 2IZZA 2P78A 4N9QA 1PNVA 5IDVA 3VZDA 4B0OA 3ZCSA 4NE9A 3C6MA 5NULA 5JO0A 2AG6A 5CB8A 1Q0PA 1BHQ1 1B0UA 3FJ1A 4TX1A 4TRNA 4X65B 4R2IA 4GF5A 3L7CA 5KO2A 1D0SA 2A0XA 1T8WA 4YH1A 4RLFA 3B9QA 2FDCA 2FWMX 1RMQA 5ALDA 3W1WA 1MA0A 1R8YA 1LVGA 3DMDA 3NQ41 4G1BA 4LMPA 5IYZF 3AVOA 4YDHB 3O2NA 3SXPA 4DIUA 3ROQA 1GQQA 4TLMB 4ALLA 2XXAB 4I1UA 3MJVA 4UUQA 4EPRA 4R0MA 4IOLA 1QO0A 4MW1A 3WLOA 5DHFA 5BR7A 2X9GA 5JH7A 3AHFA 5D5HA 2VBCA 3P4UA 2QG4A 1NW9B 3B1ZA 4BQNA 4C0BA 1JMYA 2G63A 4CG3A 2WLTA 3ONNA 2VDWB 3DXFA 3T4EA 3PICA 4D4IA 1WB4A 2D7JA 4M89A 4B82A 1O57A 4Z4QA 2UUPA 4WOKA 5CFNA 4HXYA 2VQEB 3R5KA 1CY0A 4E5DA 2V58A 3CLSC 1VG1A 4EF6A 1ODJA 1YJ5A 5HCIA 1N2BA 1T3LA 3CQ9A 4HNHA 5LBUA 3U3MA 4EATA 1RHRA 1SKYE 4G2NA 4KOEC 2BLNA 2XX3A 4ZQHA 4TWIA 4U9IS 2VNKA 4H3SA 4DQ0A 1KZ1A 3MMXA 3DOFA 3O6VA 4II2A 4X95A 4HV4A 4G09A 2ZUEA 1AZLA 4BKOA 4PRYA 5MN6A 1U1DA 1KQFA 2QXYA 4H7FA 5AHRA 2VDJA 3ND5A 1AK9A 5T57A 1ZLXA 2B4TO 2JAXA 1NN5A 3ELYA 1EM8A 2NQ2C 4CM6A 5CCXA 4A16A 4AXXA 3O95A 5CVVA 4N7BA 2KQUA 2UZ3A 3NR2A 4KIFA 5ELMA 2HJWA 3QU7A 2B2CA 1YQUA 1NR7A 3I1FA 4QQNA 1U5BA 4IH1A 5KYYA 3U5ZB 2EEPA 3MINA 4YJ3A 2H29A 1PT6A 3CKLA 4CLOB 3KSUA 4U7PB 3A6LA 3ZYZA 4BLSA 3H0EA 4XX1A 1WE2A 3WSVA 2AXEA 1P5HA 5KJ6A 5AW3A 4BO0A 4CFSA 2Q7XA 4WXRA 4Q4JB 4HN4B 4KX5A 1X94A 4HXFB 4TROA 3GD7A 4XFDA 4C78A 2TSYB 3VC1A 3H5OA 3CWCA 1XFAA 1VJGA 5HILA 3H0KA 2VZEA 1ZGJA 4BWGA 5B4TA 2F43B 1GSIA 3CUKA 1MIOB 4L4UA 4X60A 5G0TA 7REQA 1H2XA 3F7NA 3T12A 5AH0A 1L5FA 4P4NA 2HFKA 1CP2A 1CVIA 1BEZA 4U5XA 2C58A 2Z57A 4N0MA 5H68A 1G4UR 1TF2A 1ZW1A 3CWZA 3HKCB 3QVXA 4FMCB 1IJEA 4Y2YA 3V8PA 2FPIB 1RJ9B 4CZ2A 4CIAA 1JQ3A 2H4JA 3KWMA 4W1PA 3BIXA 2IH2A 2DMRA 4O4LB 1M9NA 2XH8A 4UE6A 2L18A 4D9FA 1H8ED 3ZVLA 5LQAA 1WVGA 4EQZA 2AR0A 1UKVY 1EYZA 1XZPA 3HCBA 3WFZA 2GS9A 5L95A 3FRIA 1NONA 3N0WA 3SKVA 1Y5IA 2CZGA 5LB4A 2LCQA 5CXUA 3GT0A 2D2IA 1MUUA 2NUAA 3A6ZA 1K7XB 4UCWA 4XSHA 1UOOA 4WKCA 3TSAA 4K88A 4WJZA 4KLRA 4FHZA 1AGRA 1HQKA 3K30A 1SUPA 4E4RA 2QLMA 1ZHFA 3MMZA 2C4NA 2FP4A 3SFTA 2F3SA 2ZRFA 1SCQA 5IJ0A 3KWLA 4RDCA 1BZYA 2ZJ4A 2IE0A 2PPLA 3WYGA 2I2AA 1BCSB 1FTWA 2BTOA 2RHBA 2X9VA 3B82A 1RBQA 3DE6X 3CT6A 3GUVA 2NWQA 4FJ0A 2H1OA 3GUYA 1TYDE 2V6FA 4KI7A 4GL2A 4MVJE 5HKBA 5B55A 4BEBA 4JR0A 3VSBA 3N8DA 2ZYIA 3EFOA 3L9WA 4UVEA 3JD4A 1D5WA 3RAGA 3VPCA 5F98A 1ZN8A 4G0VA 2X0JA 3MOGA 2Q2QA 3TTXA 5LNK6 3JZDA 1FRQA 2NVUB 3DJYA 2ODNA 1XZGA 4EKNB 3M4YA 1QKJA 2RIRA 2WU8A 3KTAB 1V1MA 3IYLW 2DBYA 1DELA 3GJ4A 4ZCPA 3P0JA 1L8LA 1C0PA 3EAGA 1IUOA 4M9RA 2DUMA 1P5RA 2F55A 3WBKA 4JB2A 4F56A 3MJSA 2LW7A 1PLLA 2A9KA 4KQFA 1JB1A 4PANA 2PVCA 3VFDA 1P7PA 3H2SA 4AZ3B 4OXXA 4L9WA 1Z0UA 2AOTB 3HE3A 1WMSA 3GROA 4NU6A 3QKTA 3KAQA 1QDEA 4KODA 3RBXA 3H1FA 1G3QA 2NU8A 1G6KA 5EY5B 5KU7A 1J20A 1CJMA 1YR1A 3GEGA 3O8QA 5CDYA 3P27A 4OVKA 5JD5A 2O59A 4V3CA 1S96A 2BI4A 3VR5H 2AJBA 2C83A 1ONNA 5LL6P 4D02A 2C96A 1WJGA 4GKAA 4NZZA 4UREA 2A1IA 3T06B 1K3TA 1RWBA 2QRHA 3CNLA 4MINA 3BH6A 5DLPA 2IK8A 4PRKA 5J47A 1HX7A 1K6EA 3ZV4A 4BE9A 3SEAA 4B6GA 2R00C 3HACA 2RGYA 3KQYA 4YONB 1MJNA 2RKBA 1H1TA 1HE8B 4UM9D 4HLQB 4C21A 4PFJA 4R9RA 2C2BA 3VHXB 4JNKA 1DG9A 2DKOA 3V2GA 4TWRA 4P98A 4K0KB 2Z5VA 4BVBA 4C5BA 4WBNF 4N3BA 4ZVVA 2VT2A 2QU8A 5BW6B 4HS4A 2V0GA 3IEMA 1Z08A 4AWXA 2GCOB 2PX4A 2XBUA 2Z43A 3I5MA 3KSRA 3L1JA 4OCZA 5I7FA 5KYXB 3NKLA 4MV8A 1XZAA 1UDAA 4BQSA 1FBNA 1FPMA 4F97A 5A06A 4CTKA 5DHTA 1H2FA 1NUSA 2BP7B 2VRWA 4FFNA 3WMFA 1O58A 4KG7A 1F2DA 1C3JA 4AW9A 3JQGA 3IAXA 4KAAA 1BXZA 3BMQB 3W8EA 2EKLA 2ZTSA 2ZIGA 1S2LA 1F2UB 1E6EA 1LLQA 2BMFA 3IMGA 3ZNQA 4EG4A 3H65A 1AMNA 4GH5A 1JHPA 4FDTA 1VE6A 3TMYA 1UH5A 1NVVQ 3CT4A 4FGKA 2QGZA 3E9ZA 3BJZA 5L6MB 2XZPA 1FFEA 2ZFUA 2I5PO 3W7VA 2J45A 4B4KA 1FFYA 2JLQA 2CXPA 4E7PA 3GRAA 3UAGA 1RBZA 4QPPA 1I3OA 1ONBA 1PAUA 2FG5A 4DIFA 3CJRA 4RLSA 1G4AE 1OYYA 3BWDD 1MO2A 4YJHA 5FL3A 3X1YA 4LYJA 3GFOA 5AOVA 3EWIA 4EMTA 5KMGB 4MHTA 1SK8A 3K0AA 4EL0A 1PDWA 2QT9A 1UXJA 4N8DA 3AF4A 2X8WA 1SVNA 3D8TA 3G9TA 3C74A 2AF3C 1GJRA 2MYPA 5FA8A 1EIWA 3M9XA 3AUUA 1IQPA 1G21A 2BR3A 2IYUA 4N5DA 1SXJD 1GSHA 3NRJA 3TMKA 4HJXA 3CPEA 3NGLA 1GU1A 3SIPA 4A92A 1L8QA 2AMFA 2ODQA 3LOQA 5CLQA 2QGFA 1ZCAA 5EN4A 4B9EA 2YDYA 5ADHA 1G38A 1A7AA 4FFBB 2E4VA 4I14A 3K53A 2QLFA 2BI8A 4EVQA 1VRWA 1SQFA 1Z0JA 3IUJA 1PNRA 2A9QA 3IEKA 4ALJA 1U0OC 2NXCA 1YR9A 4RFVA 4W7IA 2HWYA 3ZWOA 5EJ5A 3PHGA 4H1VA 3D4PA 1GKYA 1NAHA 5FKJA 2FEWB 3D8UA 4ENUA 4X66B 4ZN6A 1XMPA 5JS1A 4TXMA 4B2YA 4DJFC 3F49S 2C7QA 4D9MA 5DKFA 3DGEC 3QFHA 4GMFA 3ZC3A 4E4YA 5A4AA 1CQJB 3ZU4A 3NWPA 3DAHA 3DOJA 1W76A 4EYSA 2R84A 4G8CA 5EMHA 4F1KA 4IVRA 2ATIA 1Z8FA 4C4SA 2XITA 1YR7A 2D0PB 4JLAA 5EJEA 3UICA 4US0R 2DP4E 4EJ6A 3F2VA 4GOOD 1WG8A 1EM8B 1PJZA 1E6KA 3KOUA 1VCNA 4G1EB 1UXIA 1A5SB 3C41J 2GVNA 2DBRA 3H18A 1O77A 1YMQA 2O9JA 1Q83A 3N39C 4MKXA 4REMA 2ES4A 1DB3A 5FPTA 1KMMA 4FHGA 3RTDA 4EUKA 5B12A 2NYUA 2RDMA 1KZHA 1TAHA 4EITA 4ZDWA 1HYHA 3D3NA 5JAUA 2GILA 4M1SA 4OP2A 2VHXA 4F4UA 4IUYA 1KC1A 1TA4A 3I72A 4GXRA 4OYHA 4QA9A 1BA2A 1F9AA 1ZXBA 4O4IF 3EXHB 4ND2A 4URZR 4ETNA 1N5OX 4PTZA 1YDWA 4RV4A 1IUPA 5GM1A 3S29A 1XKLA 2IEGA 5DW3A 3PSAA 4OXIA 2R8BA 1ULTA 1Z6YA 1L5WA 2DJIA 1J5EB 1ZK0A 5F1YA 1O87A 1K86A 4QEDA 1VL6A 4Y1EA 3AFNA 1L5NA 4QEKA 1JKJB 2GD1O 5AJVB 1SKMA 2QM7A 4NENA 1MABA 1OOEA 3GZJA 1VSQA 4UCFA 4D0RA 2RGDA 4MI1A 4JEHA 4YUXA 3U16A 5DDIP 4L78A 4O8ZA 5DNYB 2EG5A 2XI4A 3AUSA 2O52A 3PFNA 3O93A 3HJHA 4QIHA 4QHYA 2WU4A 2BGIA 4B7UA 1T6NA 1W88A 4YWJA 2Y1DA 4NV1A 2Q07A 5AI0A 1E4EA 4B35A 4PINA 3JSXA 4P7GA 1I80A 1TLLA 5B1SA 1R0YA 1FSSA 4B34A 4C76A 5CFLA 1WHSB 4OA5A 1JG6A 3ADKA 3HUTA 3K2IA 1UT8A 1KI3A 4XOIA 2AMYA 3EHEA 5JHHB 1QG2A 3CNNA 4ZKEA 5AHWA 3DTYA 5JS8A 3N6XA 2BCEA 3DLIA 3OM8A 2KJQA 2FWPA 4FQ7A 1FNSA 3DVLA 4IIGA 1YDGA 4RHXA 5KEIA 5KC9A 2WIAA 2VATA 4MI9A 5BQ5A 4EO4A 4QARA 1IHPA 1FQJA 3ND8A 3U4GA 1E1DA 4KZPA 1IIBA 2W6PA 3IAAA 1CY7A 2FOXA 3RVKA 3O31A 1OXVA 4LRXA 5FUWA 1P6QA 4KR6A 3P32A 2HMAA 4AQYB 1DJPA 1PW7A 4ZZ3A 1EFUA 3LXXA 2Q45A 1OLUB 3G9UA 1B6TA 4M9XA 4N3GA 4MW2A 5LN1A 1R0SA 2IYOA 3BGSA 3BMCB 1T4BA 2C54A 4US1R 1CJVC 4EPTA 3H97A 4RENA 2RHJA 1WXHA 3LVQE 4Q7LA 1BDHA 2WIKA 1Q57A 3WIOA 2B0CA 4EGQA 1Y37A 4LQ4A 2JATA 4RPGA 4D4HA 1EUCA 3SYMA 4LMRA 1V39A 2V3VA 2YV1A 3K72B 1HSOA 3L0SA 4XYLA 1RMYA 2IOHA 1MC8A 2C1ZA 1Y5NA 2PSHA 1J8MF 2W2TA 3GWZA 3I2IA 3MJDA 4AS2A 5IG2A 3CJTA 1AQLA 1RQ7A 2ENUA 4URUR 3TTVA 4WK2B 1TU3A 3DF9A 3GJZA 4NG4A 1B73A 4Z6KA 2EZ8A 1OZHA 2VEDA 4H9GA 3Q3HA 4IM7A 4TWZA 1ZH4A 4JLBA 4GRDA 4W9NC 5DFAA 4CKWB 2ISCA 2RGRA 5HK9A 3QZUA 1DPGA 4EWLA 4ZANA 1B93A 1MXHA 2P3SA 1Y7HA 2HH9A 4M3NA 5ALSA 5IC6A 3WC4A 3KPYA 1Z6XA 3QA9A 2NU6A 2NTNA 3IUQA 2Z4SA 2JJ2A 4NTZA 5EJ7A 1ENZA 1OZ0A 3ORFA 3DV0B 1M2GA 5IASA 2QRUA 2IZ0A 1XLUA 3UBMA 1EEXB 1Q5PA 3UKDA 4C1NA 3SHFA 3AERB 3PUKA 4D7AA 3OE1A 3WV4A 4LOKA 2HF8A 4D9GA 3K3PA 1PS8A 2R8RA 5DW0A 1TZKA 4GZ6A 3TCKA 1M1NB 1ZCJA 3H8WA 4WNYA 3S2EA 4GU5A 1OAAA 4LTNA 4WVFA 1U3TA 5LP6B 1SKAA 1PBTA 1ZA1A 2DKFA 2IGBA 1VSBA 2H3EA 2C42A 4OIMA 4DZTA 5BVGB 2EW8A 4WESA 2VOJA 2AVNA 1QVAA 2H7YA 4L5BA 2QRGA 4TLAA 3TD2A 2ABWA 3VDMA 3QEOA 2FRVA 2Z2JA 4LWZA 5KTOA 2D2EA 1G3IA 1A95A 3ZY3A 2OBFA 2B4AA 1H4TA 1B8OA 1DX9A 2RGNC 2VTEA 3IQWA 4YMSA 3LUCA 3T7EA 4B4DA 5IZCA 3PNOA 1MW9X 4KPGA 3ESBA 3K5WA 1P6XA 2FWAA 1DIRA 4G5XA 2GVZC 3KWJA 4EO9A 3PU6A 1F8FA 4NS1A 4X8MA 3WB9A 1P4RA 5HKOA 2H6EA 3L8HA 5IH3A 2ZVPX 4OV6B 3TVYA 2JVKA 1UAGA 2E9SA 2OBXA 3CVOA 3GOQA 4MKRA 2V5VA 3ZU2A 2OXEA 5LIPA 4O4HB 1ZOIA 1MG5A 2Q50A 3QEMA 3O4HA 4NZNA 5L3SA 1PNQA 4C4PA 5D5PA 2PEYA 2H4ZA 4DJJA 2Z1NA 4GDMA 1Z28A 2ILVA 2WHQA 4YXFA 4JC0A 2ZYSA 2C97A 4NH4A 2P9FA 1Y5MA 3NLLA 1OE0A 2CLFB 5I9NA 3O0DA 1U0NA 1VL2A 4XCQA 2XSZA 4L9RA 4GG1A 3B1FA 1BDJA 1U0SY 4G0MA 2G1PA 3ZV6A 1QV9A 2JGNA 3F4BA 4XSVA 4QRHA 2ZTUA 3VNSA 2VAPA 1I2DA 3AHDA 2PUHA 3HVKA 3IIJA 3VR3D 4CMJA 4I3FA 4EFKA 4ZHQF 3VSAA 4JZKA 2XAAA 4XD7D 2BCJQ 4JXJA 4KK4A 4AO7A 4OLBA 4FYVA 3F47A 2HQRA 1X1DA 4FJ1A 1SCAA 3EE6A 3K35A 4J7AA 1ZJZA 3QW4B 1UP7A 2QRPA 3CF4A 1DSSG 2R1VA 1QIEA 4FFDA 5K01A 1SHUX 4N12A 1U0BB 4Y6GB 1Q7RA 2V8OA 3USES 1W59A 4B47A 4JLOA 4LOLA 4C2UA 1WCIA 1WUHS 3PXGA 2ZR7A 4JA0A 2FJPA 2B4QA 2JD2A 1CQIA 1TJ5A 4TWAA 4XCVA 5AM5A 4FFPA 2HLPA 1BOFA 3QXHA 2E4YA 3AL3A 1ZAKA 3VHQA 1Y8ZA 2AEJA 3JQRA 4TYMA 5DHPA 2GLTA 3N59A 3PPIA 5LP6C 4UCXA 3ED5A 4O5OA 5A4MS 2I2FA 3PXCX 2C8VA 2XVMA 4LTMA 1E4EB 2YS6A 4ITVA 3WK5A 1GTZA 2P9EA 2W2KA 3IUEA 3B1VA 2FUKA 1FP4B 1AJEA 2ISSD 1O6ZA 4NS4A 4DNOA 3BZUA 2RFLA 3QOXA 2XOKA 4FGLA 3PKJA 3OT4A 4NE2A 3QOWA 2LKCA 5DI3B 5E3JA 4L22A 3N28A 4X7MA 4IIHA 5TS2A 3V33A 4CL2A 3EDMA 1QF6A 4K40A 4QC2A 1Y4UA 16PKA 2QD2A 3CXRA 5SV2A 3UJ9A 1GZSA 3L8CA 1A98A 2IYZA 1UBHS 3EC7A 3I6IA 3WP0A 4AKGA 1YBVA 4FYHA 4RKRA 3KOMA 4DCSA 2CBXA 3FYUA 5G0WA 3IR5A 4LRYA 2O5RA 3UIEA 4DT1B 1XOIA 2Z1MA 3LHKA 1MKYA 4R5MA 1GZ6A 3S2FA 1RABA 2Z3VA 3WWOA 4UTXA 2P9BA 3UEOA 1XYGA 3WZLA 4NIMA 1G20E 3EPRA 4TYPA 2W8BA 2OHHA 2G1KA 4ZQCB 4CM4B 1F06A 5G4LA 3RRFA 3DTVB 5EKDA 1H8HA 5C1OA 4EW2A 2FW8A 3IJRA 1BNCA 3LI2A 5FL7A 5BR1A 2RIPA 3LQKA 3V5NA 2J6CA 2QT0A 2VDVE 3W3AD 3FTEA 4XUEA 2G76A 4GWKA 2AI1A 3G5TA 1Y34E 2EU8A 4OHWA 3RK4A 4BBJA 3NUGA 4AS1A 4PYIA 2FPIA 2GPBA 3BOSA 3FNRA 2K4MA 4PYKA 4TWJA 3LDHA 4X1YA 4ZOLB 4WZAE 5IXJA 4JYAB 1FJHA 1L2TA 3OX2A 4LE1A 3EWSA 4ZCLA 1SPXA 4GKJB 2BDEA 3E7XA 3BAZA 1A9TA 4ZCRA 1ECBA 2OO3A 1T43A 2AW5A 1CUZA 1MJHA 1UOQA 3EIXA 1SUSA 3F97A 3L82B 4PCLA 5A3RA 5GY7A 2IUTA 1C0IA 1ECPA 3I42A 1E4VA 4RZHA 1Z26A 1N6NA 3K94A 4NABA 4PAGA 2YXDA 2VAVA 2GO7A 2X9LA 4D4LA 5T7BA 4CCYA 3P7MA 1JQ5A 4DCJA 5HW0A 1YUNA 3T9EA 1FQKA 1T9BA 5LWHA 3DO5A 2I76A 2IHUA 4TS4A 1VIYA 2X9QA 2A33A 4AFNA 3NJ4A 2IWRA 4ZVSA 2HSEA 3AOEA 1AIPA 1QCYA 4RVFA 1EK6A 3B6KA 1XBTA 4A03A 1N9ZA 2LZ0A 2WQ7A 1DADA 1E2HA 2C2HA 4X8OA 1W34A 4EW6A 1F38A 1YRWA 3DHWC 5ITZB 4N8SA 1AO3A 4UD6A 1II0A 2EIXA 3U4HA 4MCAA 4LOHA 4RTJA 4FDLA 3CMMA 1NRWA 3DOOA 4KBFA 3RRMA 1V9SA 3BVPA 3EVNA 3DUWA 2ZRNA 4P7JA 3G0HA 2Q1TA 4J0IA 4M0CA 2WIDA 2DOKA 1GA4A 1QVZA 2AG1A 1G5HA 1YDFA 4HFJA 1CUVA 4L9SA 1SBYA 4M7RA 3VKUA 2HWXA 3DKRA 3DEZA 3MWJA 5TMEA 3MWDB 5KQMA 1WL8A 3GT7A 1ETHA 1KI7A 3ZDRA 2IUFA 1SHTX 3GFBA 3M1IA 1S9DA 3A31A 2UXBB 4K9KA 3AJDA 5CCEA 3H5WA 5LU8A 1NSYA 1F9EA 5FV7A 4EARA 4AC9A 4DG5A 1ZOOA 2HXYA 4K28A 5LQNA 4DREA 1IBKB 2WD7B 1M1YA 4PPFA 5IARA 3TNFA 3COWA 4DY4A 2BSQA 4LAFA 1EDDA 1A8SA 4UEOA 2KW5A 1EAYA 3UC9A 3V1NA 3E1GA 2L2QA 3PC4A 3ILSA 4W9RA 3B9RA 5SYNA 2DBZA 1QPBA 2HCBA 3D8BA 1ZM3A 1G5TA 3DT9A 1Z36A 2O6HA 3I3SR 3BGVA 3BJEA 2PXXA 3HYLA 3KEGA 3LX6A 4U6SA 4DLXA 4YV1A 2ZT8A 3S81A 4GMKA 3LBYA 3T5AA 3EQ9A 3MJTA 1C9DB 3JX9A 2FY8A 3BRWD 2FYTA 3CG0A 3IO3A 3LS2A 1A9XB 2I8AA 3JPWA 2PUEA 1M1NA 2E82A 2JW5A 1P77A 1QIMA 4NYMR 2WF5A 5E6UA 4B46A 1EGAA 2XUPA 4UJ5A 2PX2A 3GFQA 3MJFA 1G41A 2XKAA 3AEQB 3F9IA 2I34A 2RH9B 5LOVA 3L0OA 3OZCA 5HM8A 2IHZA 5GV7A 1QPZA 2Z9CA 2H4XA 3QNUA 4PPNA 1MQ8B 3FAZA 3LX4A 4IH9A 3Q4GA 4BFTA 4U0JA 1HMYA 2NP6A 1QHYA 1NQXA 5C81A 3OIUA 3OIGA 4H3HB 3EEIA 1NC3A 1X3LA 4G01B 5AT1A 4DLZA 3U7FB 1NGSA 3GGSA 3QF7A 2WHYA 3RQSA 4L08A 1BH2A 1GGNA 2UVDA 4JX9A 4KXVA 4OOFA 1JJ7A 4TMTA 3P9SA 4EBFA 4HL6A 5EXSA 2JIPA 3EGIA 4JBNA 3CEAA 3NNNA 4EVSA 3OIDA 4FQ5A 3H1TA 5EPEA 1YD7A 1ZXLA 3IT2A 5C7OO 3BHMA 3K2BA 2AWOA 3PXAA 4Q9LA 4BLQA 1R3UA 2PLNA 2UZ1B 3C3WA 1AKYA 2Q7DA 4EJSB 4RADA 1KQGA 4PYRA 5CHEA 4MCIA 5TT0A 2OFFA 2YUIA 1E4OA 2AT1A 1AB6A 2JCVA 1GGFA 5DYIA 3HY6A 3RABA 3TRFA 1H69A 3PDIA 1UBEA 4Y6OA 3C6YA 3R7DA 4EJFA 4QAJA 5B6IA 1BAPA 4JI4B 5FR2A 2AC2A 2JGIA 2FUNB 2BCGY 1QIKA 1VMEA 5COAA 5K3EA 3GDFA 3AETB 3TIIA 3NBUA 1M34A 3LBAA 1R4MA 4EAQA 3GDOA 3MTEA 4GX2A 3TQOA 2YJNA 4P4TA 2CVZA 3OBIA 4N5IX 1XNJA 1JQAA 3KAKA 2BM9A 1BMQA 1RJWA 2PRJA 4YFYA 3SC6A 1LPBB 1AUOA 4IWXA 1XB2A 1K8ZB 1LJ8A 3DS8A 3R2JA 5JYEA 1XP8A 5FXMA 1X70A 1M76A 3L1KA 4HB2A 4G9GA 4XR4A 3TD9A 3UGKA 1U3FA 1JA9A 3QKSB 2R1VB 4N49A 2J9FB 2WPDA 4Z8YA 1T1JA 2SBTA 3F6PA 5DBOA 3SX4A 4QPDA 3AESB 3QLUA 1Q3TA 1MBZA 3HB0A 2J0UB 3GJ8A 2MMGA 3EG9B 1T3TA 4NX2A 3PTLA 4MULA 3SSAA 2DFPA 1B3RA 1GSOA 1NM5C 1WWKA 4X7PA 1NFRA 1SKBA 2PV7A 4BB0A 2VHTA 5KVVA 3M1YA 5EHQA 2B2NA 5L51A 1FDRA 4F60A 1FK8A 3MWLA 4DR2B 5AVXA 4TLLB 3H2YA 1C29B 1E2LA 4YP7A 1WNFA 1C3EA 4Z2YA 1N9GA 5HZHA 4G4IA 2QMUA 1EG2A 3DQZA 4NZPA 2YKGA 1Q0TA 3IP9A 1U8TA 2YIJA 4JXXA 4I6JA 2PUFA 2Z04A 3COZA 4TKMA 4G5YA 2YYAA 2ZQYA 4IW3B 1FP4A 4IV5A 1SWVA 2EYUA 5ALLA 4GUAA 5AO9A 3W3ZB 3RUIA 1E7QA 3I37X 4YO7A 4OHYA 3THOA 2P5SA 5AXAA 3QY0A 4ETWA 4QYXA 2V7EA 1US8B 1VECA 1UBCA 1M0EA 1SHKA 1RM3A 4C4YA 5JOQA 1Z0ZA 1EI9A 1NMZA 3A6HA 1JXAA 3CN9A 4PFKA 4I2VA 5EP3A 1IQ0A 2C5LA 4R54A 1LDGA 5K2MA 3U9SA 4DB4A 3IT3A 1JTFA 4Q3OA 2RI0A 1ULAA 2H1HA 1P2UA 4WBXC 4IQGA 5REQB 4X6UA 1G20A 5L3QA 4MARA 5THQA 2GAIA 4LDJA 2QAJA 1G8PA 4K46A 2R8XA 3WGLA 3ZWPA 5JZBA 1P72A 2JGFA 3IS3A 3ZHCA 2DC1A 3PNSA 1ORWA 3OZTA 5C7YA 3ACBA 3MQ2A 3K16A 2QE7A 2VRCD 4R2HA 4WVLA 5EWLB 1CIPA 3FPFA 5C8YA 2OCDA 3FDJA 1KJYA 4BC1A 4ROTA 3VR6H 4ZJZA 1DX6A 3V34A 4BNYA 2X2PA 3EXG2 3WO1A 5JSZA 4EABA 1NMQA 3WSWA 3VNVA 1RWOA 3JRNA 1FW8A 1V8OA 4UM7A 4E15A 5BV1