3KKNA

Crystal structure of h-ras t35s in complex with gppnhp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Structural basis for conformational dynamics of GTP-bound Ras protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 65
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kknA00
3CWZA 1M7BA 1OKKA 3ZD6A 4HB4A 1CJVC 1OSNA 4QM6A 2IXGA 4NHOA 4B35A 3B1ZA 2JLVA 2NG1A 4PC7A 4A2WA 3UANA 2O8FB 1XMVA 3EZ6A 2P3SA 3BE4A 521PA 2L0XA 4UJ5A 4B32A 3MLEA 4FMCB 1IXZA 5HZKA 3GLGB 2JLSA 2ZYTX 1G4UR 4I99A 4YMTA 4MITA 5BN3A 4B2PA 1OLOA 2G83A 4R7ZA 3TW4A 1TMKA 3ZZ0A 1UKZA 2J5XA 3JVUA 2PZEA 2C5LA 4LV5B 2A5FA 1OH6A 1QVAA 5EZ6B 4ASUA 4BQSA 1MH1A 4JL6A 5GVSA 4O3MA 1NBME 2H17A 3VR2A 5DISB 5CDFA 1XD2B 3AQ4A 4IRUB 3GP8A 1W36B 4PZYA 4B71A 1T0HB 2IT1A 4Q1FA 3LAWA 5KSPA 3RANA 4A36A 2F1RA 1N5IA 4UNRA 3AGQA 2ORIA 1G3MA 4S2EA 1FNNA 5EUMA 2P6NA 1II9A 1RJ9B 4YMSA 3IBGA 1KSFX 2BM0A 2QAJA 3W5JA 1VIYA 1X8LA 1W4RA 2NOAA 1QZXA 4FCVA 4Q19A 1EXMA 3JZAA 5A0FA 4D6PA 4PHGA 1RPZA 3GLFB 1SZPA 4TMWA 3BH6A 4URZR 3FE2A 2IUSA 1CIPA 4Z51A 1QVRA 2CVHA 2EWVA 2V54A 3H4MA 3I73A 3KTAA 1NBMA 2ZVQX 2NIPA 2FNAA 3AKYA 3W6OA 3BB4A 5A4JA 1G64A 4M21A 2FH5B 3IQXA 1QG4A 2C8VA 1A5TA 3W8NA 4MKHA 1G18A 1UM8A 2WKPA 1U81A 5FOUA 3VX3A 2QRZA 2BHRA 4EFLA 2QNRA 4Q9LA 4F4CA 5AUQA 5FOXA 5UKDA 4AI6A 1NY5A 4X8HA 4HAUA 3T5DA 1QBKC 4PTLA 4FMCF 1WB9A 1IXRC 2IX3A 2PLRA 3EA0A 2JLXA 3RRYA 1QRAA 2ZE6A 3P27A 4M9ZA 2BMFA 1DTSA 5FUYA 4BFSA 3PQCA 1TTTA 2R6AA 1VPLA 4X8OA 4MGZR 5DYGA 1ESMA 3W6PA 3RABA 3AKEA 3FOZA 5TARA 4LX0A 4MQBA 1FUKA 3NC0C 4AKHA 1VCNA 5EXPA 5HKKA 1UKYA 4B48A 1E6CA 2ZR9A 1EWRA 1U0LA 2EYQA 2QN6A 3N70A 2A2ZA 2ZYVX 3U3KA 1TF5A 3NG1A 2DWPA 2W2TA 1Z0FA 1D8TA 2AKYA 4YMWA 2BMJA 3LLMA 3L0SA 4D4MA 2ZJYA 3WYGA 2FX3A 1YE8A 1OYYA 2B7CA 1RVDA 4M1OA 2EWWA 4N0EA 1G5TA 2G6BA 3AEZA 2MSCB 1R2QA 4P32A 1R8QA 5JJLA 2C2HA 1KI6A 5FPSA 4N1AA 2VF7A 1EGAA 5JHGB 3K0AA 1WQ1R 5L3QA 1N5JA 4AYTA 2VP9A 5AUPB 2J46A 3FVQA 3Q7PA 3U5ZB 1BMFA 2GZDA 2ZJ5A 2ZR7A 2XOKA 2VLIA 4HAVA 1E1QD 4HLQB 4LK2A 3QG5A 5L3SA 2LKDA 2UKDA 3HU2A 3NDPA 5GJVC 3ZVRA 3AM1A 1UBCA 1KI1A 1ZYUA 1CULC 3ZZUA 1TADA 2AK2A 3VHXA 5FH9A 2CCJA 1NN1A 2AX4A 3LVRE 2IXEA 4XWKA 4AY2A 4XD7A 2E9SA 1GITA 4OHVA 4RZUA 5FPHA 3SS8A 5JSZA 4KFTA 4QJ4A 1RRGA 4RFSA 4TN1A 3DM5A 4EPXA 1MV5A 1KI7A 1FX0B 2BBTA 2R44A 1MRSA 1R0XA 2RKOA 3EARA 1T3SA 2GESA 4GSYA 1UKVY 3MWKA 3QVVA 3THXB 1SKQA 4YDSA 1XTJA 3R9WA 3A4NA 4QOSA 1IAQA 2LKCA 3H1TA 3Q5EA 1WE2A 1Z83A 2ZE8A 1P60A 5SZJA 4WIAA 3HP1A 5LD2C 2V7QD 4JJKA 3QIAA 2GNOA 3PFIA 5CJ2A 4BE7B 2Q9CA 4F38A 2JJ1D 3L8YA 4IDOA 1E2EA 4NONA 3IO5A 4A0GA 1KO1A 3I1FA 4D25A 2QI9C 5KO2A 4C2TA 4Q66C 5FOTA 4OJQA 3CNNA 3DEFA 3KZ1E 3RRZA 3NXSA 1XMSA 1VECA 3FHOA 1IBRA 2BEJA 1E79D 4Q4LA 1TF2A 3QKRA 2BEKA 3QBVA 5P21A 3ZIAA 1CEEA 3FMPB 3VTKA 1N5KA 1FUUA 3UMRA 2XTZA 2GETA 3EWSA 3AVYA 1AZSC 2R6FA 2ZUBA 2GVDC 2FFQA 4G3XA 2ORVA 1FW6A 1Z2AA 3NHBA 3Q5DA 5FL7A 1KAGA 1M7HA 2RCNA 3BIFA 4EPRA 4JLAA 1RRPA 1MABA 3B1XA 3RWMB 4HAWA 1XFAA 1OIWA 4DLYA 3EIEA 1CJTC 1E0JA 3H2YA 3QKSA 1J8YF 2XZOA 5L3VA 2OBNA 3CO5A 1H8HA 3GJ3A 4F7WA 1ZINA 1HA3A 5AR1A 1R8SA 3UIEA 4EDHA 3ONWA 4LYAA 5L8VA 4MRRA 4WW0A 3DM9B 1N3BA 1NVVR 3U44A 1E9CA 3M0EA 5EP3A 4Z54A 1J2JA 2HCJB 4TYWA 2R8RA 3B1YA 4LJAA 3RS0A 2QAGB 3LW7A 1E2JA 2RGCA 2ZANA 4I81A 3FMFA 1UF9A 3IIJA 1P73A 4YONB 4AKEA 2RH5A 3NH9A 2QU8A 1IM2A 3B8HA 3K53A 3Q7QA 3TE6A 5E7MA 4Z8XA 4PHFA 3WBKA 1NNEA 3UWOA 1QF9A 5J4HA 2FA9A 2QA5A 2WIBA 4TL8A 3ZVLA 2ZQ5A 4A0FA 1E69A 1Z8FA 3R8CA 5DGXA 2ZS8A 1A82A 3T1VA 2A78A 2OSBA 3SHFA 4KITB 4XH9B 2GF0A 2QQEA 4D4JA 2FZLA 2RAPA 2PX3A 4AG6A 2RB4A 1ZC4A 2F43A 5LDDC 2GJKA 3FMIA 1Q22A 2FG5A 2C78A 1TEXA 1ZNZA 2OCAA 4C0KA 2ZJZA 2B92A 1N6RA 2WSSD 3SJZA 4MDEA 4TZ0A 1YRBA 2OFWA 3FKQA 4CEHA 4CDGA 2CE2X 1G7SA 4X8LA 1OH8A 3REFA 2TMKA 3RLFA 2GVZC 5ANRB 4ZI3A 2F1HA 4EIWA 2FFAA 5DYIA 2WJGA 3HR7A 2EFDB 1ZIPA 2V1XA 2Z6VA 5CK4A 1TAGA 2ZAMA 5CYOA 3VKWA 3TQCA 2I3BA 1Z5ZA 2GJAA 2J45A 1OB2A 2IYXA 4JLVA 3K09A 1AQYA 2R6CA 4DB2A 2V55B 3B13B 5KTYA 5JI2E 1OXSC 2ZAOA 3RRNA 4QL3A 1SXJC 1E2KA 1R0WA 4Q1AA 1NN0A 1IY2A 4QJ3A 2VP5A 3FTQA 3U60B 2QORA 3M4YA 3KTAB 4URUR 3EPKA 2GCOA 1YZUA 2D3WA 5SZKB 1KO4A 4D0LB 4Q21A 3FFBA 1E98A 4LBWA 2HF8A 1N0UA 1TU4A 3KKMA 4G01B 1GNPA 3VR5A 5AUOB 4JLBA 4BGDA 2YC4C 2WJJA 4JKYA 3B6EA 2IC5A 2ZRHA 2ZRAA 1Q1ZA 4Q7MB 1HYQA 3FPAA 4K46A 4D81A 2FSIA 1J90A 2OV2A 1P2VA 2Z83A 1N6NA 2CL0X 4ZCLA 4C0AC 1WBBA 1GAJA 1MO6A 1ZMXA 3BH0A 3CX8A 3L82B 3QKUA 4N3NA 5B57C 3PEYA 1XZQA 2ZJBA 3QJYA 1G8YA 1PUIA 1OW3B 1GKYA 2FPKA 4TQ9A 1IXSB 1Z6XA 4ACBA 4DUGA 2GEDA 3CRQA 3WNBA 2O8CA 4GPTA 4ESHA 1UEJA 3FYHA 2CLDX 3BB1A 2XJ9A 3CRW1 2HLDA 1XX6A 1CR4A 2P67A 2X1VA 4OK5A 1G291 4E03A 3TRFA 2ZSAA 8OHMA 4L5BA 1P6XA 3ZS8A 3RDPA 1D9ZA 4LHYA 1P7CA 3B9QA 5J4LA 2GEUA 1SKYE 1YRAA 2J0VA 1O87A 1VHLA 3L0IB 2ZJOA 3OIVA 1HEIA 4OHZA 4DZZA 1U98A 5KSYA 1WBDA 2CL7X 4E22A 1KI6B 1W0JD 3TH5A 1AGPA 4TLCA 2GXSA 3K0AB 3LRPA 5L3QB 3E1SA 4IXMA 2QY9A 2GDJA 2ZROA 3ADDA 1QHIA 3AVPA 1IY0A 221PA 4GDFA 3PJRA 2WKRA 3QEOA 2XNDA 4NZYA 5JBQA 5CITA 4DT1B 4WAUA 1VDZA 2DY1A 4ZKEA 1Q12A 1R0ZA 2Q9BA 5LB4A 4XIGS 4B3FX 2PH1A 4MH0R 5AWFC 4U02A 2E1RA 1Q20A 2QM7A 5C2JB 3OEEA 4WZAE 5HE9A 1JJ7A 2QEQA 4KYIB 1SXJE 4XSHA 4QC2A 1D2NA 2SHKA 4DIEA 1Q1BA 2EFEB 1DS6A 3B2EA 1GRRA 5LPNA 1AS0A 2D62A 4WVFA 1OYWA 1YR9A 1G8HA 1GOTA 3GJ8A 2X2EA 2YWEA 4XWAA 3W8RA 3T61A 2PBRA 2BCGY 4OHYA 2J0UA 2OCPA 5AK0A 2PT5A 4BFZA 4L9WA 1LS1A 4C4PA 3KQUA 2W58A 3CH4B 1JI0A 2JJ2D 2V4ZA 4LC0A 3O8DA 3ND8A 5C46F 1RKBA 5GJBA 3VR3A 2IK8A 3PUWA 5CK5A 1H65A 4Q47A 1KIMA 5JJIA 5JEDA 2WICA 1G7RA 1LNZA 2RGEA 3CR7A 3QPWA 1M6NA 1SXJA 5FL3A 4KHZA 1Y3AA 2QTHA 3LV8A 1XEXA 4KVGA 4M1WA 1FP7A 1LF5A 3KDSE 3KJGA 2CK3D 2CVFA 3KX2A 4GL2A 3TSOA 3QKRB 4Y0AA 2ERXA 1E4YA 4IJMA 4TMTA 2FOLA 3HJNA 2C95A 4J0QA 1ZJ6A 5EXXA 1F2UA 1W49A 3VNVA 1FTNA 1XRJA 4LPSA 3CB4A 3AB3A 1FQJA 2X2FA 3WRXC 1U9IC 1KOFA 3GQBA 1KI9A 4LI0A 5JSZB 5CYPA 4UXHA 3LD9A 2JIZD 1LV7A 3T1OA 1GIAA 1E9RA 3QKSB 4GP7A 2RGNC 4HLUA 3GLHE 5J47A 4EPTA 2G3YA 3CRVA 1QDEA 1E3MA 4HSEA 2D4HA 3SQXA 1T8UA 4XVQA 1W1WA 4XSGA 2AK3A 3T15A 4HYYA 2GZAA 3U44B 1HQCA 2IYYA 2QUZA 4US1R 1IN8A 4NCJA 1CRQA 2OCYC 4DSOA 4LJYA 3CKLA 1EWQA 1ZM7A 2MSEB 1I4DD 4E09A 4NPHA 5JCPA 1I2MA 1XXHE 1CXZA 3EAQA 4DWJA 3O8CA 5LBIA 1NMZA 1F6BA 1G5PA 2ZRNA 1LW7A 4A6XA 1MR3F 3B9PA 1DAHA 3W90A 3K70D 3IKJA 2ZVPX 1KJZA 5AJXA 4Q48A 5FI0B 2XJ4A 3HU1A 4C0SA 2R6GA 2Q9AA 4HUTA 3QSYA 3E2IA 3K8YA 1W5TA 2QT0A 1KMHB 4KLZA 3I32A 2HT1A 1CP2A 1DAMA 2V3CC 3GLHA 2NO9A 4URWR 4R71A 1DO0A 1OB5A 2WM9B 2F43B 2OCBA 2IL1A 1ZM2A 4TYQA 2H5EA 3AF4A 4NCIA 2ZRFA 2G0TA 4RCZA 2GAOA 421PA 3LNCA 3BGWA 2QPTA 1T91A 5FUXA 4CEHB 4NBSA 1J8MF 3HU3A 2IHYA 3SHWA 1N5LA 1XXHA 1E1QA 4B3CA 1E2DA 1MO3A 2FFBA 3OZXA 4HB0A 1NMXA 2J59A 3DO6A 4G0NA 2X8AA 4OJKA 3RS2A 4YLGA 3N2IA 4JBXA 4XOIA 1T8TA 4GNKA 4ZDJA 2XTNA 3QUSA 4BEBA 4P4SB 3BD9A 5KYKA 4BZPA 2DFNA 4QRHA 2WHXA 2VA8A 5BW8A 1NRJB 3THYA 4OK6A 4IHQA 3X1XA 4EQ6A 4AKIA 1OT3A 2GHIA 2YWGA 4NYMQ 1E9BA 2GJ8A 1KI3A 2B6HA 2OT3B 4LYFA 2F1JA 4CGZA 2WJIA 2WSMA 1W4AA 2HUPA 2ATVA 2FWRA 1OH5A 2GCOB 2IEYA 4GFDA 1TPZA 1ESNA 1ZAKA 4QBGB 5KSZA 2PMKA 5LD2B 4A4DA 1QHSA 3LW8A 1G20E 2J1LA 1E96A 1XTKA 2QP4A 2ZYUX 3JZMA 1Q57A 2VP0A 4IKEA 4LHZA 4LSGA 4TTRA 1OHHD 1E1RD 1TEVA 2AL7A 3A4LA 3TBKA 3UMFA 4NH0A 1U8YA 4I1UA 1GILA 3EA5A 1OIXA 1JAHA 4HATA 4RJLA 3TIFA 4GZLA 3VAAA 4P3YA 1ZU5A 3R8FA 1RIFA 1XU4A 4B6FA 2WJYA 1CJMA 2WWWA 3DDCA 3KJIA 2DHRA 2GXUA 2ASEA 2Y8EA 3GJ5A 3VU9B 1SHKA 5EE5B 3U4QA 2QBYA 2O8CB 1U9IA 1Z22A 2IS1A 2BWJA 5IK2D 3BORA 3IPXA 4PAOA 4KFRA 4JVLA 1KZ7B 1FMLA 2B7BA 2WWHA 2XTMA 4Z1MA 3AF1A 3MWLA 4PPFA 2RGNA 4Q1CA 3ZS9A 1UBFA 2YC2C 5DN6D 5FPKA 1M34E 2C9CA 3RVBA 1CR2A 3L0PA 4V0LA 1F3OA 1GKUB 3GJ4A 1KSGA 2IHBA 4JL8A 2ZS9A 3RS4A 2PEZA 3NEJA 2ZU0C 4GOKA 2XEXA 3VMFA 1E2HA 1TQ2A 3HR8A 3T1TA 4DHEA 4OHWA 1HQYE 2EVWX 4YXWA 3ADBA 3KQLA 2NO1A 2QGNA 4OK3A 4ZIRB 3UATA 2IYUA 4TMKA 1PLKA 3QKTA 1D2MA 1TNDA 4JVSB 1OFIA 4Q4AA 2BCJQ 4Q4JB 1AKYA 1LB1B 3BBPA 3HPRA 1QHHB 3PV0A 5DH9A 4C3ZA 1IN7A 1FP6A 2QQ0A 3QOFA 3CF0A 1G8GA 4OI0A 2O8EA 2GAAA 2IS2A 4DCVA 1XCMA 3MUFA 1KY3A 1SKYB 2CJWA 2BBOA 2VEDA 2ZTSA 4HB2A 1BIFA 5F9HA 5DNYB 1AN0A 2JLWA 3EPJA 5JJKA 3U3OA 1UBEA 5KDLA 3PCRB 3KKPA 2CXXA 1E2PA 2AXNA 1WMSA 1MO5A 1WDTA 3THWB 2J0UB 1NP6A 2REXB 2ZRLA 1H8ED 1Z3IX 1KSJA 2X77A 2BDTA 4TQAA 4A82A 4KFSA 4C0HA 5FUVA 3X1YA 1Z63A 1YR6A 1WRBA 2PX0A 3BAFA 2WPDD 1Z06A 3UXMA 4DDVA 4NCKA 1CJUC 2CE7A 4Q7LA 3RHFA 1ZRHA 4QNMA 3VR4A 4NDZA 1E2MA 3AGPA 2IYTA 3TVTA 1ZBDA 3SFZA 2ZM5A 2HDNB 4UXIA 1J7KA 3A4MA 2RHMA 4B33A 3GLIB 1UFQA 2BVNA 2CCKA 1SXJB 5EP2A 2JLZA 1KNQA 3AVXA 3PUZA 3A37A 2VHUA 1KHTA 1AQUA 4PQFA 2JLQA 1UBGA 1KK2A 2NPIA 2QMUA 1NF3A 3C16C 2PL3A 5E3HA 4BFVA 3EPLA 1AKEA 3OF5A 4DKXA 1IONA 4DEYA 1W36D 2XITA 3VR6A 5JHHB 1XEFA 3ZVMA 2W0MA 3I8SA 1JEDA 2FV8A 1BYUA 2DR3A 1BS1A 5C4MA 2J0QA 2J3EA 3HYRA 4HAZA 4F4JA 1Q3HA 2Z4SA 4TSFA 1ZP6A 4H9GA 1TUEA 5FI1B 4OQXA 1WCV1 3LQRA 3U3RA 1I4LD 2IBMA 1VMAA 1YHNA 1NI3A 2XSZD 2ZI3A 2H7VA 3KUDA 1X1SA 1JJVA 1GDDA 1IJFA 3AP1A 4HZUA 5KPDA 3RS7A 3WMFA 3K0CC 3RC8A 1SGWA 2OG2A 4MYTA 4DRZA 3DPUA 3HWSA 1LTQA 1ODFA 3SE0A 2ZJAA 1UPTA 1ZD1A 4RVCA 3KFVA 3P20A 1GM5A 4D26A 3FKSD 2HEIA 1XJQA 5K8LA 3AKDA 1N0VC 3CRMA 4KYUA 1DE0A 4FINA 5C18A 5JFGA 1HUQA 3BS4A 2VQSA 1GSIA 1ZIOA 3RSLA 2ATXA 2HF9A 1NN5A 1YZNA 3GD7A 4ERNA 3F5FA 3U7HB 1KO5A 2W6IA 4GT1A 2CL6X 2BJVA 1UKEA 3MJRA 2KI5A 4MRPA 2A5GA 3K70C 2W6JD 1RC8A 2OBMA 2ZPTX 2CLCX 2O8DA 3OIWA 3ZYCA 4M4SA 1TQ4A 2LWIA 1N6HA 3SYKA 1HT1E 1M2OB 1GG2A 4IVRA 1W0JA 2YWFA 2ZE7A 4ABYA 4U7DA 1FL9A 4HUQA 3RS5A 2FSGA 1WP9A 4B47A 4DSNA 2XXAA 4M22A 2NZJA 2ONKA 4ARZA 5EE9A 1WF3A 2CEAA 1VG0B 1IN4A 1YVDA 2BBSA 3A6PC 2PCLA 1NIJA 1E0AA 2VHQA 4NYIQ 4EUNA 5J5CA 3W6NA 4P0TA 2OM2A 2QG6A 3GEHA 1E2GA 2QRNA 3KL4A 4JBWA 3AP2A 3X1WA 3EIQA 3MD0A 1GWNA 2A3RA 4XVUA 4XWOA 3THYB 4EQ6B 2RGDA 2BKEA 2RGGA 1ZUHA 3ZH9B 4AC9A 2WWGA 3D8BA 2QE7A 4JLPA 4A92A 4ZDKA 4DVGA 1LY1A 1V5WA 4YMVA 2WIAA 2G77B 4M1KA 2CHGA 4L16A 4ZDWA 1AZTA 2GK6A 2R2AA 4OHXA 2VL7A 3RRMA 4AKGA 1R7RA 2KBFA 5KUTA 4R2IA 2VHTA 3CX6A 5DHFA 1LF0A 4DSTA 3G0HA 1L7VC 2ZR0A 4OQFA 4UXJA 3KXIA 1S8FA 2I1QA 1N6PA 2QTVB 4B76A 1T5LA 1OXXK 1W4BA 4FI3C 4NKRA 2C9YA 3VNUA 1DAIA 5FBLB 4IDHA 2QPAA 4YC7A 4AYWA 2N46A 4LJ5A 2FGKA 2WBLC 2VSOA 1XTRA 4DLRA 3OESA 4BFUA 5EQTA 1X86B 1R0YA 2QBYB 2ZRGA 2X19A 3SFVA 3TSZA 4PQRA 4ZCMA 4PQYA 3IO3A 3CUEF 3QF7A 3Q3JB 2J41A 4JKIA 1G9XA 4DC9A 2C9OA 2JAQA 5C4GB 3SYNA 1DARA 5EUQB 4NYJQ 4P31A 2QENA 3FFAA 4GP6A 1NVWQ 2NGRA 4DDWA 3EASA 1X1RA 4BEJA 1CU1A 2PEYA 2PMDA 1NLFA 2RGXA 4TQUS 4BFYA 2ANCA 4TZ6A 2G9NA 4X8MA 2F7SA 3I5XA 2F9MA 4JMPA 4V0ME 2JDIA 1GZSA 1XMJA 5SZHB 3GJXC 2IYRA 2DFKB 3F3YA 5TB5A 2N1BA 1W0KA 3C5CA 2BOVA 4D0NA 2J7PA 3OAAD 1Z0IA 3OE7D 4A2PA 2D7DA 1DEKA 2IWHA 4DLTA 4F93B 4HEJA 4Q4AB 3TR0A 3W34A 3MAAC 4YMUA 1GNQA 1T0JB 2P0EA 2Z5FA 1OE0A 4XVRA 4UNNA 721PA 3LH5A 2NO0A 5GADl 3AVTA 4I1SA 2ZJ2A 3OFNA 2G0NA 1G5RA 1B23P 1E32A 2CMKA 2XB2A 2XX3A 1P75A 4RKEA 2GJ9A 4QXAA 1S3SA 4JLJA 4HDQB 4XTRA 5FBWB 4C2UA 3LDAA 2E87A 4GMXA 5F9FA 1TF7A 2OZEA 2VSXA 4ON9A 5J4VA 4PX9A 1Z2CA 1IHUA 3JVVA 4PFSA 4V0MA 3PXGA 3NBYC 4LZZA 4DCTA 1G3IA 1RFLA 1OF1A 2H57A 4NE2A 5CJPA 4NU0A 4EKDA 4URVR 5DIFA 5KU1A 4PSKA 1OKKD 2CLSA 1XNJA 2Q3HA 4O0MA 4A8JC 1SVMA 1UEIA 2W2VA 1Z0KA 3LBHA 5FOVA 3C15C 1XEWX 3I62A 4NYMR 3A1VA 4IVPA 4QGAA 2WAXA 3LX8A 2IF2A 4WZ6A 1P2UA 2QPOA 3QENA 1EG7A 3PENA 5D3MA 5IHPA 2V9PA 2AN9A 4JSYA 1XZPA 2ZYWX 3SU8A 2A5JA 5FOSA 4NP6A 1JXMA 3U3MA 1P3JA 3NBXX 3S1AA 4ASUD 4C0BA 1JQJC 2D2FA 2D74A 2QMOA 1U8ZA 4F91B 3F8TA 1C1YA 3KQKA 4LBYA 3I72A 5CB6A 1P2TA 2AD1A 1P9NA 3D6TB 4W5HA 1XPRA 1VCIA 4LOAA 4DCNA 3DKVA 3QVUA 1HY3A 3GJ7A 1NKTA 5G3ZA 2FEOA 2QP9X 3MGCA 3QF4A 4IEEA 3L2OB 4BZXA 1TUIA 1JR3E 1FOEB 4TTPA 1RW4A 1NMYA 1SQ5A 3GJ0A 5CM8B 1W7AA 2WMOB 3OEHA 1G7TA 4HZUB 1L4YA 2RMKA 4KLNA 2NPFA 2VHCA 3SJBA 3ZQ6A 2NZ8A 2C03A 5K8TA 1P9WA 3VX4A 3R7WA 1XTIA 1G1MA 4B44A 2ZREA 4DCSA 2QMEA 1ZUIA 5DHAA 4RD1A 2D06A 4RZXA 4A15A 4PHTA 2ZRMA 4WA7A 5C1BA 3K0EA 4PC2A 1NBMD 2ZRJA 2OFXA 4CT5A 1ZM9A 1U99A 3LO5A 3WHLA 1EK0A 3RNLA 4QM7A 2P5SA 1COWA 4KU4A 4RD4A 3IHLA 4BASA 1S96A 2MSDB 3QPVA 5F3WB 1V43A 1QHNA 4UNPA 2QSZA 4IXNA 1W47A 2JLUA 3I8XA 1OJLA 3WNDA 1EFRA 3SBEA 2GEVA 4FCWA 4HI0E 5FR2A 3CF6R 4B6EA 1KDTA 4D82A 1JR3A 3MMPA 4MYHA 3IIKA 2O8DB 5CLQA 5JRZA 4MRVA 3IQWA 2F55A 1HV8A 1KI4A 3K0FA 1KDRA 3U7FB 3A1UA 4ZKDA 2ZI4A 1KSHA 1X8JA 4FCTA 1GKIA 4RD0A 1N6OA 4TYPA 4HUQB 5HKKD 2HXSA 4C7OA 3AH8A 2XXAB 4TT3A 4AK9A 1R5NA 2BM1A 3ICEA 2MMCA 3AVWA 3N5CA 4A2QA 4HDOB 2BMEA 1LFDB 4GZMA 5L3SB 3KXLA 4A9AA 3MRSA 5AJYA 1G21E 1KYIA 3K9NA 2IS6A 2ZITA 4QGFA 4JSTA 4D4LA 2NO6A 1G6HA 1CS4C 3PVSA 4IOJA 4M0LA 4UJ3A 4A0HA 1BMFD 1XDBA 3AUXA 4RZ3A 4B74A 3F0TA 1AA9A 1CR0A 1Q1EA 2AD5A 2BIFA 3QBTA 4LHXA 4RFSB 4A8JA 3KFXA 3K9HA 4R98A 4B2IA 4BFXA 1RRCA 2UZ3A 6Q21A 1G16A 2KJQA 2ZSEA 3KB1A 3EPHA 3T12A 5B30A 2H92A 2ZI7A 2K5UA 3ASYA 1JAIA 4G5QA 4Y0VA 1K6MA 2OILA 3L0OA 1YR8A 2DWQA 2G88A 3DOEA 3LQQA 4WOPA 2IYVA 3FGNA 3SOPA 4XD7D 3AVOA 1S0UA 1VHTA 2VF8A 4ZO4A 4CYMA 2O8FA 4PO9A 3TUIC 4BFTA 5FBVB 2KWIA 3B82A 4I1VA 2ZEJA 4HAYA 1XCGB 4Q03A 5JI3E 3QY0A 4I4LA 4Q9HA 2AXPA 1YZGA 4BFWA 4D80A 1EX7A 3WRYC 2QMHA 1SVOA 4UQOA 1B0UA 1Q44A 3BH7A 5FR1A 4II7A 2B8TA 2VRWA 4Q02A 4MDFA 3MSXA 3ETLA 1AM4D 1G3UA 2QTFA 4QHYA 4NTZA 3DVLA 2OLKA 3N2EA 2Z43A 3A1WA 4TLAA 2V1UA 3K9GA 4PAMA 1NLYA 1KKMA 1PV4A 1MABB 1EFTA 3CNLA 1T4GA 1N0WA 2GWHA 4B3XA 3TGPA 3TNFA 4PANA 1JPJA 3QXXA 4URYR 3WMEA 3K9LA 5KNBA 4IOLA 5BN4A 1Q1QA 1Z29A 2WAYA 5DO9A 1ZM4A 3WYAA 3ZIAD 3O8RA 2MMGA 3EC1A 4KAXA 4H1VA 3AKCA 2IF0A 2R9VA 2J0SA 3MCAA 4HLDA 1P5ZB 4QHSA 2ECKA 3THOA 4AWXA 1NLZA 5GVRA 3WP1B 5FTMA 1DG3A 4GOJA 1BYIA 5FL7D 5FBQB 3X1ZA 3GFPA 4O2RA 4AYXA 1ZC3A 2HT6A 4KBFA 4AIIA 3GEEA 4PC1A 1H8HD 5GJWC 1Z08A 1E2NA 3GMTA 4XJXA 4HDCA 1CRPA 4GOXA 3IGFA 4B2LA 3BXZA 4BLOA 2AHOA 3AF3A 4IW3B 5TXGA 3EG5A 1NIPA 5DSZA 3VKGA 2C98A 1SVSA 3B78A 4DLWA 4MGIR 3BFKA 3DL0A 4Q1EA 3V4RA 2QZ4A 4MA4A 3V4FA 1Z47A 4Q9IA 1KDOA 4QHTA 4V0OA 4NYIR 4ITRC 2F3RA 4HAXA 1O3YA 1OV4A 3IHWA 4NCNA 4GRAA 3AP3A 5EP4A 1GL9B 3QG1A 5BWMA 2QAGC 3TSWA 3LBNA 5E7IA 1D6JA 1G3QA 4Q7KA 3NDBB 1ELOA 1ZNWA 1VTKA 4RD2A 3VKHA 5D3MB 1DADA 1PUJA 2ZRIA 3SR0A 2QM8A 3S1AB 3CH5A 4JLKA 5JWOA 4MKGA 3CNOA 2VP4A 3TKLA 3WMGA 3DMNA 1KMQA 1ZNYA 3KB2A 3B85A 3QNUA 3GFTA 1OFTA 2QROA 3T34A 4O2LA 2CDNA 1HE1C 1R4AA 1U2RA 1ZW6A 2EU8A 4G5OA 1K5GA 1GL7A 4CRWB 4TMXA 4Q5IA 3QF4B 1JALA 1W48A 4JLOA 1XB2A 4RD3A 1Z0JA 4A1FA 2WMNB 1KGDA 1ZU4A 4BRUA 1J99A 5TVKA 1ZVQA 2GJSA 4BLRA 5J4KA 4DDUA 4B3BA 1M7GA 5FPTA 1JR6A 5IT5A 1Q21A 3CM0A 3R7WB 4NYJR 3GCGA 5FOWA 2QT1A 2V7QA 2YOGA 4KI0A 4MUBA 4N0DA 5JZVA 1M1YE 1P72A 2JJ1A 1XPUA 2IS4A 1FX0A 4IVQA 4O25A 2OFOA 3T35A 2ZSFA 2H18A 2WOJA 3EC2A 3AV0B 4YDHB 1E9FA 1E79A 3TR5A 4PZLA 3IDQA 2CBZA 4QBFA 1UADA 1CKEA 4LUCA 4JBYA 2IXFA 4CZ2A 1RYHA 2ZETA 1TX4B 3FMOB 3G5UA 1CF4A 3I3SR 1LS6A 1II8A 4B73A 1X8KA 4Q18A 3H0KA 3MFYA 1FNMA 4OL0A 1P61B 5H1YA 4KODA 2BBWA 5SZIA 3C4JA 4DUGD 3CX7A 2Q3FA 3ZJYA 4TYYA 5B58C 1QHYA 1JXOA 3DKPA 4C7OB 5HR5A 3WXMA 2HLDD 4RFVA 2NMVA 1IQPA 2PLFA 2JGNA 3D31A 2Q3MA 4BLPA 1XMIA 3EXAA 3SN6A 1W4CA 1XTQA 2OESA 3U3JA 1Q3TA 1XJCA 5HZHA 1R5BA 2KBEA 4R2HA 5KDOA 4P33A 2CNWD 3LWNA 4EPVA 2F1IA 3LY5A 3P26A 5HTKA 1ZNXA 3AVVA 1RE0A 1KAOA 1T5IA 4ILEA 3W3ZB 3AF2A 3GPLA 3Q85A 1OIVA 4TMVA 1N2CE 1E9EA 1L4UA 4FN5A 2OLJA 1JNYA 2QSYA 4A8JB 2XNDD 4FMDB 3RWOA 2O8BA 1EX6A 1DAGA 3KKQA 1D2EA 2JCSA 3TK1A 4OQNA 3OHMA 5E95A 3OEED 4D2IA 1YZTA 1DO2A 3SJAA 4BECA 4NL4H 3ND9A 1JECA 1U0HC 3ZLJA 2ZUDA 4PXAA 1GVNB 2KE5A 1ZCAA 2BC9A 2WSSA 621PA 4Z8YA 1AS2A 2B8WA 2GCNA 3I4LA 2H8KA 4MKIA 3T1QA 1G41A 4Q4HA 1FMJA 5B2ZA 4RY2A 4W9MC 1IY1A 4JT4A 4M1YA 3UWKA 4ZI2A 3MWYW 2A7QA 3CLVA 3FWYA 1XCPA 5FTLA 3LFUA 1VG8A 1XEXB 3SEAA 3M1IA 5EE3A 1Z0DA 3TVDA 1YZQA 3QXHA 2F9LA 1RZ3A 1DOAA 1T6NA 1FQKA 1NVXQ 4PC3A 1OXVA 2O0HA 4LC1A 3PEUA 4KJZA 3LXXA 4DLVA 3SDZA 1P4SA 2Q21A 4PZZA 3WNCA 1F2UB 3U2QA 2IYLD 3J81k 1T3LA 2ZSDA 1E2LA 2GILA 1QHGA 1SVLA 3CW2A 4JYCA 1VG1A 4U00A 1TQDA 1DAFA 4LBZA 1SXJD 1VKJA 1MOZA 1OH7A 1PLLA 1U8AA 4W5JA 2FSHA 3CPEA 1U0JA 4R9UC 2P5TB 3TJZA 2ZRCA 1MT0A 4ZPXA 1G7CA 4LRWA 3EZFA 4M9XA 1TL7C 4KO8A 3B1WA 1GUAA 2J87A 3NHAA 3Q72A 4OI1A 3KXKA 2O0KA 4WXRA 3B1VA 4FMDF 3QE0A 4CIDA 5JWRA 3QXCA 5AUNB 4TL7A 3AF0A 2OXCA 2REBA 5ELXA 4UKDA 4AD8A 4LHVA 4BRWA 3U7GA 3PUYA 3ECCA 4IDQA 2R62A 2OO7A 3FHTA 1WA5A 3FB4A 3K1JA 4OBEA 1W5SA 1E0KA 2V6IA 2A9KA 3R9IA 4GBMA 3KQNA 2IUTA 1NL3A 1HH4A 2BMDA 2A5DA 1K8RA 4LJ8A 5KOYA 1II0A 4IFBA 4LHWA 3GLHB 1A4RA 2YNMA 2ZE5A 3RYTC 4H1UA 2YOFA 4K8OA 2D2EA 1KK0A 3KKNA 3BWDD 2WJHA 2ODEA 2ONJA 3WYFA 4B43A 2UZIR 1F5NA 4PR0A 2XZLA 5F98A 1N6KA 2DBYA 5JEEA 4L4UA 4C30A 1A1VA 1DVRA 3LX5A 4IOKA 5EE1A 1XXHB 1HT2E 2C99A 1XTSA 4OQMA 3SJCA 3NH6A 1RRFA 4FWIB 2AWOA 1ZD8A 5L3RA 2EFGA 1JB1A 2FEMA 4DSUA 4F4IA 5JLJA 1A2KC 1UDXA 1NKSA 3G82C 3A1SA 1FZQA 2ZJ8A 2PZFA 1US8A 4LJ4A 2XAUA 2WOOA 2QP3A 4MKFA 3BC1A 2DFLA 3ZQJA 5HE8A 4C9BA 3DMDA 2YVUA 4DT1A 2VTKA 4D4KA 4W5WA 2AFIE 4TYNA 4QKQA 1OFUX 3IEUA 3T06B 2IWRA 1G19A 2YWHA 3HYTA 1MRNA 1FTSA 2ZIAA 5AJVB 4DLZA 2JJ2A 2NTYC 3VR1A 2HJGA 3QI2A 3PR1A 4Q9KA 5G40A 2KB0A 2QGZA 3BOSA 1SVKA 4PAQA 3ICQB 1YKSA 2VP2A 2FZ4A 1S1MA 4TWZA 3DOFA 3BJIC 2CHQA 5FTNA 4B3DA 4IFEA 4LYHA 4CVNA 4Q1DA 4KCGA 3K09C 5KHOC 4M53A 3C14C 4YQFA 4C0QC 2EFCB 4RCYA 3MG9A 4QNRA 1DELA 2R65A 3PIRA 5LB2A 4ZV4A 1S1CA 2ZUCA 3U4QB 1AK2A 3ZZTA 4V03A 2CK3A 2ZSBA 1DPFA 1A2BA 1XD9A 2EYUA 3KUCA 4MYCA 4XTCS 2GBLC 1R6BX 2LCFA 3Q9LA 1BOFA 4M1SA 4BZQA 2HYIC 1F60A 2YV5A 2JASA 2VP6A 4JLNA 3D7MA 3CZPA 4ESVA 2DPXA 4DIDA 2GXAA 1YU9A 2F6RA 1II8B 2W0SA 4FWTA 3IEVA 1YJ5A 4POAA 1D5CA 2IYZA 5CLLA 1M8PA 3K0CA 2JIZA 3LBIA 2YZ2A 2IYSA 4B75A 3CPHA 4LCBA 4PO1A 4TMZA 1E9SA 1KI2A 5BXQC 2HV8A 1KZGB 4FW9A 1IJEA 1BKDR 5TDHA 1L2TA 4QG7A 3BRWD 5JRJA 4CEIA 2AR7A 4RD6A 1VCOA 1X6VA 5B64A 4Z1MD 1KNXA 1NG9A 2AWNA 1NJGA 1SVIA 3MJHA 4JLMA 4BPBA 1TQ6A 3GJ6A 4CEJA 1R10A 1P62B 2ZRDA 1AS3A 2CCGA 2ODWA 4BLSA 4Q1BA 3UPUA 2WVJA 4LV6A 1PVOA 2F3TA 3VFDA 5KDDA 4EJSC 3KJHA 1BH2A 2O8EB 2FMXA 1UJ2A 3U7EB 4L15A 1XBTA 2GKSA 1G6OA 4LV8B 1NY6A 1XPOA 4EPWA 2CJWB 3R20A 4YXWD 5JWHA 5HCNA 5HPYB 1QHXA 2C04A 4E5UA 2O8BB 4LYJA 3RC3A 1CTQA 2VH5R 4QGGA 1KY2A 2J7KA 3NC1C 4QBHA 5EE0A 3RSOA 3TAUA 2VBCA 4OYHA 3CWQA 4DBLC 4HB3A 3TUZC 2RGAA 1ZD9A 3RAPR 1G3RA 4HZIA 4Q4HB 5E7JA 1A7JA 1KMHA 2QL6A 2HJVA 3TMKA 4WBSA 1KO8A 4MRNA 1X3SA 3UG6A 4M8NE 3TW8B 4MUAA 4KSBA 4QFMA 4HLCA 3A36A 1Z6AA 4AG5A 3UMSA 2AFHE 3L8ZA 2ODBA 5EXSA 2BJWA 5FTJA 2FPMA 5K8IA 3O47A 3K0SA 1E4VA 1Z28A 2PJZA 3DHWC 3PUVA 2BKUA 2YOHA 2Q6TA 1F2TA 4GI7A 1XEWY 1P2SA 1JBKA 2OAP1 5DI3A 3KKOA 1ZM3A 2CHVA 2JA1A 4UNQA 4LY6A 3T5GA 1HE8B 3VHLB 2RGBA 1W36C 2OE2A 4WXPA 5JMTA 4BLQA 2ZU6A 2AKAB 4P4SA 3SYLA 4OI2A 2FE4A 4LDJA 1D9XA 2IUUA 4P4TA 5F2EA 2ZRBA 2OAQ1 1OHHA 3HPQA 2GTPA 1E1RA 3IIMA 4PPQA 3SZRA 5EJEA 2GBLA 1CLUA 1GFIA 2B21A 4PSAA 2P6RA 3W5IA 1C4OA 4TSFD 1IN5A 3U6BA 3E70C 3HDTA 3C7KA 3EZ9A 2A5YB 4TLEA 4PO8A 3EIHA 3NWJA 3ZGXA 3CBQA 5IK2A 3BB3A 4DLXA 1VYUA 4Q7JB 3IPYA 4PSVA 1GRNA 1G17A 2W83A 5DN6A 3TAHA 4TL6A 4HLUC 1ETUA 1G8PA 2YJTD 2YKGA 1GL6A 3GFOA 3RS3A 4D0GA 4MYUA 2DCUA 1NVUQ 1NN3A 3CF2A 4K81B 3VU9A 3DZ8A 1KO7A 1VCMA 5KNDA 4JJZA 4JZKA 1EESA 3QXSA 1NSFA 2OXRA 1Z6TA 3P32A 5FPYA 1GTVA 2W00A 1P9RA 2ODNA 5BYJA 2UVQA 4ARZB 4M9SA 4EJSA 3ASZA 5CB8A 1Z0AA 2VYFA 2NO7A 2H1LA 2W6ID 2FF7A 3UKDA 1HTWA 2IYQA 2C77A 1E9AA 1IN6A 4LJ7A 4URXR 3FDIA 2C96A 3SI7A 2CNWA 4BWYA 2VPPA 3P4XA 3GLGE 2OEPA 1SHZA 4M9QA 5M04A 2J9RA 4IDPA 3X1DA 4BLTA 2O52A 5H70A 4IDNA 3W3AA 5FTKA 1US8B 3A8TA 5D3QA 1EFHA 3C41J 4ZIRA 1W2GA 2GCPA 4LJ9A 4Q9JA 2I4IA 4ACAA 2XOKD 5EZ5A 4DLUA 1I4TD 2FFHA 4V0KA 1DBSA 1E2FA 3BERA 4Q4JA 5KPJA 4DCUA 4GMDA 1I2DA 4M2LA 4RSGA 1H8EA 2JEOA 5KNCA 1QHHA 3DZDA 1ANKA 1NJFA 2OHFA 5DI9A 4PPGA 2VHJA 4A6PA 2P2LA 3GLIE 3MWJA 4CW7A 2HCBA 3NIBA 3SNHA 4EFNA 3QQ5A 3X2SA 3PEWA 4OI4A 5AJZA 2WTUA 2WPDA 2GZHA 1DAEA 1VYVA 4PC6A 2QE7D 1KJWA 5JS7A 2FPLA 2YINC 1FFHA 4KV9A 2Q0HA 4KFUA 4KSCA 1F48A 1YR7A 1AJEA 1XJ0A 3PG5A 5IF9A 3GLGA 3GLFE 1U90A 2N42A 5IRCD 3THWA 2HXYA 1VG9B 1WXQA 3E5HA 1N6IA 5CIQA 1W2HA 3WHKA 2IA5A 4US2R 2O5VA 1AGRA 1G4AE 2GK7A 3NKVA 1Q0UA 3ADKA 3ZVNA 1KJYA 2OUKA 1XD2A 3KQHA 4Q01A 2FU5C 2RHDA 2Z0MA 5KSOA 2GXQA 3A58B 1CBUA 3SC3A 1S2MA 1CJKC 2I1VB 4DLSA 2ORWA 4IOMA 1E94E 1EFUA 4M1MA 3V9PA 2G1KA 3GLIA 3CPJB 4JLDA 1RJ9A 3NBZC 4G5SA 1LVGA 5CIWA 2XSZA 5DLQC 3C5HA 4CEIB 5H8WA 3WBJA 4CT4B 3C8UA 3H86A 3OIYA 5BQ5A 4FMBB 4NMMA 3UK6A 3GLFA 3PUXA 4S35A 2GF9A 1HURA 3EZ2A 2DWOA 4RZ2A 4MGKR 4CEJB 2XGJA 2ERYA 1BO6A 1GP2A 2ZRKA 1E2QA 1MKYA 3IBYA 4JS0A 1UDWA 1C9KA 5GJCA 2P65A 2WJVA 3FKSA 4OQLA 4DEXA 4EPYA 1DG1G 2OBLA 3ZDQA 1YZLA 3K70B 1L8QA 3O8BA 2JDID 4ZCIA 2ANBA 2EW1A 4KBGA 5FFMA 3PITA 2WWFA 1S9DA 3NBFA 1JQLB 2GA8A 4KVAA 5TV2A 1W0KD 1ZCBA 1NSTA 2A30A 4P4UA 1T9HA 2J7PD 2FGJA 3NVAA 1OPXA 2KSQA 3QXJA 2FN4A 1FPMA 1YZKA 1N25A 3W9YA 2W6JA 4LPKA 4F92B 4B3GA 3CONA 4C0LA 5AJWA 1CR1A 5E4FA 2VO1A 1KK3A 2WWIA 4FIDA 2DYKA 2WZQA 3B5JA 3OFND 2GRJA 1KTVA 3I92A 4LJ6A 3TUJC 1E99A 4G5RA 1KDPA 1VIAA 4A0RA 1U94A 821PA 3BK7A 1NVVQ 1VYTA 2VSFA 3CZQA 3LXRA 1Y63A 2ZRPA 2XB4A 5HCIA 4TLBA 3BFVA 4MRSA 4OKSA 3A1TA 4WZBE 2WV9A 2V8OA 3GEIA 1DAKA 1G8FA 1MO4A 5JCZA 3R9XA 1E9DA 1K5DA 1W46A 2XZPA 3LA6A 1E0SA 3IUYA 3EWAA 4L9SA 4U5XA 4TL9A 4JL5A 1NG1A 2PT7A 2REOA 3LLUA 3P4YA 3REGA 2WWXA 1IOZA 3TLXA 1GRQA 3CRRA 2H16A 1PZNA 3M6AA 4BUJA 4NCHA 1F2TB 3IILA 1N6LA 3NTUA 4DDTA 4TLDA 2Z4RA 5DI3B 4V02A 3NEYA 2BV3A 1RYFA 4QGHA 4FD2A 2NQ2C 4KXFB 3KJEA 4JT2A 2ZS7A 4M1TA 4JYBA 3I61A 1PLJA 3WY9A 5JS8A 2WKQA 1XP8A 2XNSA 3EX7C 3WP0A 1OFHA 2JATA 4MGYR 3CR8A 1SVWA 3L43A 4JVMA 3CIOA 4B34A 2DB3A 3UG7A 1E2IA 4DXAA 1Z07A 2JJ8A 2JLRA 3BFXA 3ADCA 5J4YA 5G41A 4I1OA 5TY0A 1S3GA 1XF9A 4TTQA 5FBRB 1EFCA 2EFHB 3OIUA 1OXUA 3PEVA 1YQTA 4DJTA 3SBDA 3QEJA 1R5OA 3FHCB 5A5GA 3THXA 1KI8A 3H84A 1KKLA 4LGMA 3OEHD 3U61B 3AVQA 4JVNA 1S9HA 2WWYA 3Q8XB 2D7CA 3QPUA 3AUYA 3EZ7A 1SULA 5G3YA 4V0NA 4EAQA 2G1JA 2V6JA 2EQBA 1JEEA 3P1JA 1Z6GA 1M74A 3VQTA 2JLYA 3K0FB 4CF7A 3ZD7A 1GNRA 4FXPA 1UAAA 2ZI6A 2PCJA 2ZI5A 2YHSA 1AIPA 4LBVA 2PJRA 2W2XA 4E07A 2IW3A 1COWD 4PHHA 4QJ5A 3EW9A 4EFMA 1XD8A 4Q00A 4G5GA 2FDCA 1ONBA 4W7SA 5BYKA 2FSFA 1EFRD 3OAAA 4EJSB 3OE7A 4C0JA 4IEIA 3AVUA 2IEZA 4LWZA 4L8GA 3V00A 1JPNA 1JR3D 2HYDA 4QBIA 5K8UA 2O0JA 2ZXUA 4UNSA 5DE3A 5EP1A 5BN5A 3SQWA 1Z6YA 2R6DA 1QG2A 4G1UC 121PA 4ZDIA 3I5YA 2PZGA 2IYWA 5H68A 4AURA 1TU3A 3U6KA 5TMPA 2DFTA 5CM9C 1T3HA 5FUWA 1KK1A 1J70A 2YYZA 3B60A 4TT3D 5EXTA 5G53C 5JECA 1S4QA 2FJUA 3D3QA 3B7GA 4JIMA 5CDFE 5J40A 1ZUNB 1XWIA 4RKFA 5IDVA 2P6UA 3LVQE 1W44A 2VIIA 3TQFA 4DB4A 1PJRA 2QAGA 2ZI9A 4PPNA 4US0R 1OXTA
chains in the Genus database with same CATH superfamily
3CWZA 4LNUA 1F0NA 3MTGA 4UAJA 4JHLA 1J23A 1CJVC 2OD2A 2Z58A 2X0EA 5BRJA 1D2AA 3ED5A 3DT8A 1K0FA 2G36A 2I6GA 4DMMA 3LUBA 2JFNA 4FGJA 4B35A 3JWJA 2VAPA 4PC7A 2JLVA 1UDBA 5DP2A 1EK6A 1EUDA 1XQWA 2NAFA 3G2IA 3LJKA 4L22A 3GUYA 5KX5A 1M1NA 3K1AB 3DMTC 3M6LA 4ROTA 2NZ2A 4FMCB 4WKGA 1SQ0A 2YCLA 2WD7B 1HNXB 2JCBA 4H1WA 1N8NA 4I99A 4YMTA 1KZ4A 3WO1A 1OLOA 3TW4A 1CQJA 2OVFA 3ZZ0A 621PA 1OH6A 1L5NA 1EZZA 3R6WA 5H4HA 2A5FA 1L4HA 4YRCA 3N2YA 2L42A 3VYTB 2C4UA 1MH1A 4JL6A 3L0YA 3VR2A 1MB2A 1K97A 1DDGA 2BGIA 4FBMA 3GBVA 3PJEA 3ESBA 4UEKA 1W36B 4B71A 1HDYA 3VR3D 1IFXA 2R6HA 4KRGA 3SM3A 3VU1A 2C3OA 5TPZA 4QX6A 5BO5A 1W0CA 1CVLA 2HTFA 2PQ0A 3KT3A 3M9WA 1N5IA 4JWKA 3WGMA 1G3MA 4S2EA 5I7VA 4JZYA 3TWOA 3O8LA 1J20A 2IXDA 4JUBA 2XT9A 4HY3A 4AUMA 4BO6A 2P6NA 4F9FA 1KXJA 4NBTA 4YMSA 5I48A 1CNFA 1P4AA 1TW2A 1AGYA 4IIYA 3PIIA 3FCAA 2WUGA 3ZJ4A 4B6RA 2VYQA 1H42A 1NJ2A 2A0WA 4EA7A 1QZXA 4EB6A 4D6PA 1EXMA 2PTHA 1SQFA 4L5AA 1QH8A 5A0FA 4D6YA 1JFFA 2VCYA 1RPZA 3GLFB 3T9DA 1J8DA 3ZH2A 2OHIA 3KQOA 4Z7QB 3HJUA 3FE2A 5TGTA 2VSYA 1CIPA 4NV0A 4WNCA 2CVHA 1ZI9A 1UC5B 3MHTA 2FNAA 2MYTA 4H0NA 1K2VN 4CUKA 1B41A 4YV1A 4JB2A 3IQXA 1UJ6A 1SU7A 4BNDA 2P75A 3E8MA 9ABPA 4S0ZA 1OGJA 4MKHA 5LJLA 1WXXA 2CW5A 2D1TA 2PJDA 3A14A 3L49A 1Y42X 3MBKA 4Q16A 2H1CA 4HXFB 5KAMA 3COVA 4EX7A 1JS1X 5I9TA 3QFTA 2QNRA 2CYBA 1FSGA 3W4KA 1PK7A 2XCOA 1TUBA 4X8HA 4YPOA 3FSGA 3ZHTA 4ITUA 3GRPA 3NHUA 4FMCF 1NE2A 1NVAA 1PJTA 3DBLA 3NYIA 2PLRA 3EA0A 4U9UA 3SXJA 2OD7A 3ZGNA 1QRAA 5KYXA 1ECBA 5JISA 2ZE6A 2JLXA 1Q0TA 1DJMA 2XH8A 1THZA 2BMFA 3KU4A 3P27A 4M9ZA 3PQCA 4OCZA 2ZLBA 1U8UA 3JYLA 2PBFA 2VAVA 3H5LA 4I50A 4X8OA 5DYGA 3ZHQA 4B9EA 4LI3X 3NHWA 3QVOA 4MQBA 3A4VA 2FN8A 3KCQA 3QIVA 1VCNA 4PV7A 1PVVA 1K0UA 1UKYA 5D5HA 4FYVA 3WFJA 1EWRA 4CM9A 4MPRA 5J3JA 1NRXA 2ZYVX 2O3SA 5DGTA 3NG1A 1LK5A 3P5BA 1PF7E 1K86A 2QYOA 5K0JA 1FQWA 2C5AA 2BH9A 1NNUA 1PJ8A 2IOFA 3L0SA 3RAGA 1OYYA 2B7CA 3FWZA 3VH4A 4JWTA 5I9LA 1J97A 4F8JA 3LKDA 4JN6B 2ZIUB 1BA2A 2C54A 2MSCB 4XVHA 3HYNA 4P32A 5LBUA 1R8QA 2LRHA 4PQGA 4QQNA 3WVNA 3BCUA 5LMZA 4CF6A 1KI6A 5FPSA 1B15A 4LISA 3V1TC 3FAKA 2VF7A 5KB3A 1EGAA 2K87A 3I28A 1N5JA 5AUPB 4IHJA 4UUMA 5KJCA 2EF1A 4WADA 1PL7A 3G2QA 2GZDA 2BL4A 4HEA6 3WGUA 2BSAA 2H1OA 2ZR7A 4X95A 1QFSA 4EJ2A 1YS1X 4G23A 1E1QD 1A3CA 2HCFA 4J4BA 3QG5A 1YUMA 3BL5A 3E03A 4UMFA 2O20A 4F1JA 2ATIA 2I3GA 4YMHA 1UBCA 3D9QX 3DLHA 1CJSA 1CULC 1ZYUA 2WFLB 2W90A 1SZDA 3WK7A 2ZYGA 3LVRE 3FOCA 1JG2A 3TCXB 1Q15A 4ZYZA 2IXEA 1TRHA 1PYGA 1UBNA 4NXNB 1IH8A 2BHLA 5BT9A 4DG9A 4BNFA 4H3SA 1GITA 4OHVA 5HQTA 3SS8A 4MRMA 3OOWA 1SBCA 4C29A 1RRGA 3KR2A 4EHBA 5JSZA 1TK2A 3STXA 1M5RA 2TMDA 1B6GA 4CIWA 1MV5A 1KI7A 5JYDA 2VT6A 3IQHX 1DL5A 5ES3A 2RKOA 3WLFA 5CXSA 2WTMA 2I4RA 3MWKA 4O63O 3THXB 1MAUA 3JQFC 1P4HA 2VQEB 5BUCA 4DV7B 2PNFA 3OLXA 5JAPA 1FP4B 5AXCA 3KSDO 3V4LA 3A4NA 3CT4A 4MI3A 4ZT4A 3B6MA 4PLCA 4QOSA 3TB4A 4CUJA 2GPSA 3VPHA 3H2IA 2I2FA 5SZJA 1N2OA 3RC7A 1G5IA 2HA2A 4MQLA 4C20A 4RACA 5FX2A 2GNOA 1ZH8A 3ZBQA 5JUWA 3QLJA 3PFIA 3U7IA 3WJAA 3L3BA 3L8YA 2HRDA 4NONA 4ZVPA 1KO1A 3DEYX 5KVCA 2M6RA 1GZ4A 1UIRA 4YCBA 4D42A 1RMTA 2PS9A 3DEFA 1U2TA 5HVNA 1XMSA 5A4FS 1UK6A 1R8YA 2DPLA 2XV1A 2ZBUA 5FQNA 3HA3A 4OEHA 4UAUA 5ERGB 2BEKA 5BPHA 1YBHA 5AVYA 1SXHA 4N65A 1HYGA 1U9JA 1U28C 2QRVA 4HFNA 4HNAB 4IL5A 1FUUA 3EWSA 3GLQA 2X6TA 1K7XB 4H77A 4G3XA 1AZLA 1E5TA 4G84A 2ORVA 4C2BA 4EH1A 4UHBA 5F1PA 4ME6A 4MAMA 4YWJA 5EMMA 1PZMA 2BGJA 1IB0A 3F8WA 4Y6RA 4IO1A 1MABA 4QARA 4HAWA 5IVIA 3UW3A 5J63A 2A0XA 5LQUA 4JOQA 4ZAFA 2CLOB 1DAPA 3T7DA 4RNCA 4AJ4A 5C4IA 1D2RA 2G07A 4ZZ0A 3ESCA 4RAQA 1T6BY 1ZINA 3STHA 1HA3A 1U3DA 2OHJA 2RK3A 2GI4A 4LWQA 4RA6A 1YFKA 1AF4A 5L8VA 4MRRA 1K8QA 2XWPA 3CGWA 3EWNA 5EIAA 3Q6IA 1MX1A 4EEZA 4B7XA 1A4IA 3TJRA 4CKCB 4JCCA 4OHKA 2OBXA 3ABZA 2JFOA 3B1YA 4LHEA 4DCPA 5KYUB 1D03A 3ICPA 1VGVA 2QAGB 3AY6A 1E2JA 3KVVA 1T9CA 3LW7A 1FMFA 4I81A 1JGTA 1BGWA 1TIKA 1ULAA 5D00A 4AKEA 2QU7A 1GXSB 5HS6A 3CINA 5BQOA 4DE5A 1ACJA 5IWCA 3DDZX 3T3GA 1NNEA 4DR5B 1QF9A 3DXZA 4CN9A 1W87A 2FW0A 3ZG6A 4GKBA 4M0FA 3U3DA 3QPAA 4L8LA 3DUWA 4LXQA 2OSBA 1CYDA 1LDGA 1ORTA 1Z4PX 5IMBA 3WFIA 2P68A 2GF0A 4MXDA 3VAYA 2Q6IA 3ZWAA 2QQEA 4D4JA 1T36A 3LIIA 3GJYA 3R7SA 3RT9A 2PX3A 2V0NA 1QE5A 4AG6A 5LIRA 1UFKA 5LDDC 1ADJA 1JE1A 3VZPA 3ZS8A 3PXDA 4A5OA 3H7IA 1GGJA 2O06A 4OYYA 2O5EA 2OYCA 3QA3E 2ZK7A 3ZDBA 1X1QA 3CSDA 4M46A 4MDEA 3AM3A 5T4EA 2RCYA 2OFWA 4CEHA 5ALYA 4G86A 1EHYA 2O7NA 2Q3CA 4IHKA 2R8EA 3REFA 2TMKA 3ZDEA 5BNFA 3WKDA 4ZI3A 1V3UA 2DBRA 4BEWA 1CZNA 2EFDB 3EFHA 4OQZA 5THXA 4EG5A 2W6PA 2Z6VA 3QU9A 1TAGA 2ZAMA 1VDMA 2I3BA 1Z5ZA 1OB2A 5T3YA 5BV8A 2G5TA 4H17A 1AQYA 2A9JA 2R6CA 2WUWE 2V55B 3B13B 1S3FA 1UP7A 1T6XA 4E1BA 1GKKA 1SKAA 2WHPB 3OO1A 5HF6A 2B3DA 1R0WA 4WNAA 4Q1AA 1PFVA 2C84A 4WINA 3BGVA 4FOTA 1JZQA 1VE1A 3FTQA 1KAHA 3LC1O 3AY3A 3N76A 2QORA 4K9LA 2VQFB 1NQVA 3KTAB 1LDMA 2W4MA 1OGIA 2CDCA 2FR1A 2MU1A 5AVZA 5HUQA 5SZKB 1U0EA 5J5VA 3RF6A 3VKVA 2KPOA 1ULUA 1UCFA 1Y1KE 4OP3A 1KEVA 4NABA 1Q17A 3H1PA 1VSTA 2HF8A 1N0UA 3IBTA 3KKMA 4J7XA 4MWSA 4CLOB 2NADA 3PT9A 1E3WB 1XNHA 3K1TA 2EKLA 1J0AA 2WJWA 1ACLA 2F2TA 5JSUA 3HTXA 2YC4C 1O5IA 1WEKA 2WJJA 4R69A 9ATCA 2Q62A 2IC5A 2J3LA 2ZRHA 2ZRAA 3E22B 3OKPA 4Q7MB 3V9AA 2H2WA 2I3ZA 3ISVA 4K46A 3N7TA 4F5WA 2Z83A 4ZCLA 1X9HA 2OOSA 3TI9A 4GBJA 3GN2A 2AZXA 3L82B 3C70A 1KQPA 1NWHA 5HBRA 3U49A 5HZMA 4W5TA 3UN1A 1GD1O 3KUXA 4TQ9A 4MV8A 4UU7A 1Z4QA 2I6UA 5A3SA 5B1SA 1ECJA 2GR9A 5AIBA 2O8CA 4GPTA 1N7JA 5I7FA 1UEJA 2DH6A 2CLDX 1Y33E 2HLDA 5DTMA 1RR6A 5DULA 5TNXA 5JIBA 1W29A 3M5CA 4GPEA 4E03A 5I8PA 1P80A 4G5FA 3RDPA 2CJFA 1M2HA 1UBUS 1OPRA 2ZT5A 1P7CA 3MGKA 3TLGA 3ZHVA 1S02A 3B9QA 1W88A 4L5CA 4G2NA 5J4LA 4NMHA 2NZYA 3U4HA 2J0VA 3HG7A 1ONOA 5T4FA 3OIVA 2BTOA 4U7PB 1GO2A 5SYNA 2BYTA 4ESOA 1U98A 5KSYA 1FDWA 2P5YA 2YJ4A 3EGDB 1BGVA 1JUDA 5DHRA 4E22A 3TH5A 2O9JA 1R0BA 2ALJA 2PFSA 3PDUA 1BHJA 3K0AB 4AJPA 2NPOA 1EVQA 4QWWA 1RNLA 5J1TB 1VJ0A 1W9MA 4W9NC 1EMDA 1CQWA 3ZLVA 1U63A 1NR7A 4ADSG 4CMEC 3QEOA 1T0BA 2X7HA 2O2YA 3JVEA 4JP3A 4II2A 2XCLA 1GQFA 4I1RA 4QNNA 4WAUA 3ZU6A 1QQBA 1Q12A 2D5AA 4DILA 1YB1A 2Y1FA 3UYKA 3CUYA 1CETA 4MH0R 3M70A 4MW5A 4OH7A 2Q4OA 4U02A 3KZXA 3LGXA 4FOLA 1UPXA 2E1RA 3C3DA 4E08A 5C1DA 2QM7A 4KVZA 4CNQA 3M1YA 4JAVC 4KYIB 3GMDA 4XSHA 2MSKA 4OHBA 4TOIA 4WFQA 2ZXEA 1Q1BA 1QC5B 3G1WA 4MVJG 1DS6A 4TZKA 3MWGA 2VHZA 5DGDA 3T0FA 5LPNA 1M0WA 3MB8A 1B3BA 1YR9A 1FP2A 4MV5A 1C7RA 3EEQA 4NI5A 1GOTA 3N8KA 2HK8A 3SMQA 4MQEB 3GEBA 2X2EA 5JNUA 2AEFA 1MB4A 4XWAA 3W8RA 3LHSA 2FMIA 3T61A 4PZ9A 3W2HA 2BCGY 3HBFA 4D74A 4EF4A 3MJTA 3KOUA 3IUJA 3X1MA 4WOKA 5H81A 4H08A 1WXFA 3SC2A 4L9WA 1RWWA 3KLBA 3KQUA 4RIEA 2R7AA 3M6VA 3DFMA 5IEBA 4B1FA 1VZ2A 1U80A 5EJAA 3GGPA 2HMAA 1T5HX 2EP5A 5GJBA 4WEOA 2XECA 3PUWA 4ZTZB 4M9CA 1EWVA 3PGJA 4TV8B 3OOHA 2RH4A 4Q47A 3BPSA 1ZHHA 4K87A 3R7DA 2C5HA 1OI3A 3V1MA 5JEDA 2P4UA 3NWPA 1M6NA 1SXJA 4OIMA 4IVNA 3UMBA 3AI1A 4I5EA 2JFBA 2DUJA 5DN9A 2QTHA 3KYDA 2GTHA 3S99A 1CEXA 3ND7A 3VDXA 4CQNA 1V6AA 2VJCA 1IHYA 4GXQA 4LNHA 1RLUA 1UFOA 2ERXA 2YS7A 1EIZA 4OP1A 3GJRA 2GZ1A 3ELUA 3TRKA 1GPDG 3ITDA 1QCYA 5HQJA 4Z7OB 4UUNA 1FTNA 3WRWA 4ZAZA 4LPSA 4PTZA 1JSCA 2X2FA 3QVLA 3ELWA 5DNCA 1L4FA 2BSXA 5ED4A 1KI9A 5CYPA 5LJIA 5A5DA 3NHPA 1LV7A 1CFJA 1GIAA 3GARA 4YFYA 1P3DA 4DJEC 3UMJA 1QDEA 2NT4A 2D4HA 4BMZA 4R0NA 1T8UA 2XRYA 3OT1B 3AESA 1WSDA 4HYYA 5CD1A 1O4WA 3U44B 4CIVA 2IYYA 3WIDA 3VPDA 3MT8A 2AN1A 4PZUA 3QI7A 1IN8A 4NCJA 5A2QA 2GZ3A 2XUZA 4LJYA 4MS3A 1O8CA 4D6XA 1XOIA 4O0LA 5JZ9A 1NNSA 3A9VA 1Z2PX 1L5OA 1HRDA 1EP9A 7MHTA 1F6BA 4OHCA 5CFOA 1LW7A 1U7OA 1DAHA 5JAIA 2B30A 1HNNA 3IKJA 5FI0B 4FSDA 5JNWA 4F2HA 3HU1A 4GZ3A 4ISBA 5AW0A 4HUTA 4LAFA 2H9IA 4MQUA 3QSYA 5H80A 3WYEA 1MB9A 3OQ1A 3K8YA 4I08A 4TV8F 5B1IA 2PSSA 1Q6YA 2C2MA 2LTAA 2W2PA 4S1PA 5JMWA 5C7IO 2AFRA 3GLHA 5EXEA 4J29A 2UVPB 4DDWA 4R71A 4UZFA 2J5QA 1ZK2A 4FDAA 2F43B 1LJ8A 4JC5A 2IL1A 4D79A 4G5YA 4E2FA 4RJTA 2WTNA 4WOBA 4L5YA 4NFLA 1B8PA 3TNJA 2AX3A 4WKBA 2G0TA 5J1SB 5FV7A 1ZK1A 2C9BA 4UEWA 5K0FA 1VXRA 5FA5A 4JI5B 3LNCA 1LDEA 2GVNA 4AN0A 1QUEA 2QM3A 4NBSA 2WHYA 3KYCA 5ALFA 1KARA 1T2VA 2CC2A 2B61A 2WUVA 3DE0X 1MT3A 2P0YA 3K1ZA 3GFGA 4BMDA 4N0MA 1E2DA 4HB0A 2FFBA 5CLFA 4BNNA 4J49A 2J59A 1JN0A 2FCAA 3DO6A 4IJKA 1DJLA 4JJ7A 3N2IA 4OJKA 3NOOA 3RS2A 3ST7A 4DMGA 3Q1LA 2C31A 2O5RA 3DMYA 4OREX 5C5EA 2WYIA 2I4MA 1F17A 4LFCB 1WEHA 4BEBA 3OSUA 2FW8A 4PLHA 1M66A 2R6JA 3I9V1 1WW8A 3BGOS 2WHXA 1MPXA 1NXTA 1LBTA 4H18A 1NRJB 2D54A 3KTDA 4OK6A 1MN6A 4M0KA 4EQ6A 3THYA 1EINA 1OT3A 2GHIA 2I2XB 4NYMQ 3S7TA 4OJYA 1TDJA 3UM9A 2GPYA 1XK6A 2F1JA 3IXLA 2R7MA 3K5WA 2WJIA 2WSMA 5I7RA 3L5KA 2HUPA 2ATVA 4MJXA 1EVLA 4HSGA 4NEHB 4D4IA 2GCOB 1Q7CA 1VE6A 1K7YA 1C14A 1RXVA 2IXAA 1EJ6A 1WWKA 1TPZA 1E6EA 5LD2B 2V5VA 2PMKA 5AK3A 1DWUA 1KZYC 3LU1A 4CF4A 5JXGA 3GL9A 3BA1A 5DCLA 4AQDA 5C7LO 3PPWA 2JHAA 1QV6A 2A5LA 4PPYA 5TT0A 2QRJA 3VZCA 3X44A 4BIIA 1Q57A 1VHDA 1OASA 2VP0A 1YBVA 1RT9A 3AEUA 1TEVA 1IPHA 2HK6A 2X4LA 3FOWA 1GARA 3IP9A 4IIGA 1LBEA 3TBKA 3ZV7A 5JOQA 3D1VA 1GILA 1NDUA 1NQUA 1QRRA 1XKLA 1RYEA 2DPHA 1DKNA 3UJ7A 3VAAA 4FFVA 1X39A 1LC3A 4YYEA 3RVDA 1HETA 1MOQA 2IODA 2DHRA 2L18A 3GJ5A 3QFFA 5H83A 4AJ1A 3EVEA 3CNEA 3O2SB 4EB3A 2FY8A 4PLGA 4XM0A 4P98A 4ZOBA 3UTDA 3V3TA 1U9IA 2XMBA 3LGSA 3O1JC 1Y8RB 1Z22A 3WGYA 2IS1A 2AE2A 2B69A 4QYTA 5IK2D 3F8SA 5EJMA 4JVLA 3IR7A 3UWDA 2B7BA 2WWHA 1PJ3A 1KPGA 1ZCFA 2MR6A 4Z1MA 3MWLA 2YMQA 4Q1CA 4C5CA 2WTEA 1UBFA 5IM5A 1NPYA 4NZZA 3GY0A 2C9CA 2A57A 1NQTA 2NU6A 4IEFB 1CR2A 2X9VA 4B82A 3L0PA 5EIFA 5EKSA 3SWWA 1J8VA 3ZXYA 1L1QA 4HFMA 1GKUB 2E4AA 3GJ4A 1KSGA 1QK4A 1SCDA 1XMOB 4X45A 3NEJA 1D2GA 3ZW7A 5C3MA 1YVRA 2QD2A 4RTSA 3BKXA 1TCCA 2WWTA 4WE3A 4AF6A 1FJXA 3HR8A 3TQIA 4DHEA 3GT7A 3U4GA 3OM1A 4PZAA 3KQLA 1GTRA 1GPAA 1X7ZA 1XLVA 4MVWA 4TMKA 1PLKA 3QKTA 1Z7BA 4B09A 1C41A 4YDQA 3VXKA 1OFIA 3EBPA 3H9BA 2CY0A 1RP7A 2F1OA 1KC1A 1MCZA 1NJ5A 3SK0A 4WXMA 1KVUA 1WUHS 4HGQA 1V47A 5CAEA 2KX7A 3O7MA 3UVEA 3KJXA 3BTUA 3A70A 4F4UA 2NXEA 5TQ2B 1MJ5A 3CF0A 3OQ6A 2NSDA 2AUNA 2O8EA 2DHEA 3HXPA 4HFRA 1XCMA 1B8NA 2WQ7A 1XU9A 4FYIA 3W3AD 3SKYA 2DUNA 4P80A 4ZV9A 2WG2A 4KYVA 1WMDA 1M2VA 2JLWA 4OLJA 2PIDA 2CXXA 2XDAA 3M1LA 1E2PA 4AICA 3Q3HA 3HKBB 4E1AA 1S7CA 2OORA 2REXB 2VDRB 2ZRLA 4OLBA 2I1LA 1QE3A 1KSJA 1TCUA 4IWYA 1X9IA 4CKEB 3OZVA 2WUDA 2BDTA 2QD1A 5L7YA 3RR2A 2XMCA 4X3CA 1BX3A 4ZAYA 2WJZB 5FUVA 4JJ4A 4NCAA 2JW5A 1TQ8A 2WPDD 4WLVA 1Z06A 3HO6A 4ZO7A 4BVGA 1WQ3A 2HDHA 1DRJA 2OL4A 3I6ZA 3DMHA 3LUHA 4QRDA 5DFAA 3RHFA 3UGTA 3VR4A 4F4HA 3FLMA 1ULSA 1BG6A 1W85A 3LUPA 3N75A 1ZN2A 2A9OA 3PL5A 4NAHA 4UXIA 4XLLA 1AK1A 2X0IA 3BSWA 1L4LA 2DTDA 2W2LD 1HF3A 2BVNA 4WESA 4R7GA 5EP2A 3G5MA 1EGVB 1WTAA 3E0XA 3BEDA 1UBGA 2B4RO 4FGKA 3NNNA 3TTTA 4MW4A 4XM2A 4O5OA 3VVBA 3RVNA 3GRZA 1RZRD 1XMPA 2J67A 5JR3A 3EVAA 4LK3A 2XW6A 3EPLA 3MJCA 2Z95A 1L5FA 2QUAA 5K6TA 1D1TA 2DPYA 2NO4A 1X2BA 1FVXA 4YMGA 2PX2A 2YASA 5DP1A 3WYBA 3KEQA 4U2EA 1A27A 2CWDA 2FV8A 4MP8A 4B85A 2DR3A 3OU2A 3WB2A 2J3EA 5M5BA 2AG0A 4IILA 5EIBD 4D8XA 1NAIA 4HAZA 1DJNA 3URMA 2Z4SA 2BP7B 2LVBA 2EEZA 4BGIA 2VBFA 4FDMA 1T8RA 2AXEA 4TS4A 1J1IA 1Z7YA 4LYGA 3LQRA 3U3RA 1WOYA 1I4LD 4MLDA 2H4HA 3OUUA 2H7VA 3TL6A 3USZA 1X1SA 2Z5LA 4BRZA 3HACA 4HZUA 3ZVKA 2NTVA 4Y2SA 4A6EA 2EBFX 1P2FA 3RS7A 4D8UA 1CF2O 1ZD5A 2V6FA 2YW9A 3AJ8A 3IPAA 4DQXA 1ADBA 3C6BA 1S2IA 4EFKA 5BWOA 4KX3A 4RYLA 4OUKX 1MC5A 3HY6A 2YICA 3SE0A 4OQPA 2ZJAA 1CZUA 3Q9NA 2QVBA 1GM5A 2H2DA 2HMTA 1GJRA 2Q6OA 4P93A 3W5HA 1UR5A 5DOZA 2HEIA 3QITA 2IY7A 3V8NA 1XJQA 4D45A 3OLWA 5FWNA 1CR6A 5FWYB 1FCJA 1N0VC 2XZTA 2WU1A 5K8LA 3JTEA 4JSRA 1SELA 1YOBA 1HUQA 1KJQA 2VQSA 1HWYA 1ULBA 3RSLA 4HXYA 3QU5A 4RK1A 3HUFA 4OOFA 1DIAA 1XR3A 3W6ZA 4D4MA 5DPMA 2PTGA 3U7HB 1KO5A 3HJGA 4HDRB 4YRRA 5E1BA 5FD8A 1AHNA 2E4ZA 4YRBA 2KI5A 4AJJA 3PPXA 2O2JA 2M6KA 2W6JD 5ALEA 3HKCA 3R0QA 4RKQA 4BO0A 4PZEA 5HIKA 4WCFA 3R9XB 2RI0A 4M4SA 4WUTA 3WO0A 3CJTA 8ADHA 1I7QB 4Q3KA 1ICEA 1MJNA 1GG2A 2AJDA 1JEAA 4BMXA 2OMKA 1FYFA 1W0JA 3WJ2A 1O95C 1FL9A 2GX6A 3N39C 5DTEA 2PFGA 1QJ4A 2PSHA 2FSGA 2GEBA 2JGDA 2W8ZA 2ZFUA 3PICA 1RRMA 2QL9A 4FDLA 5HNKA 3QRWA 1NQ5A 4M22A 1ZVMA 2WM2A 1I0ZA 4O4JB 1JYFA 3WG9A 4JELA 1ODJA 5EE9A 1WF3A 1D4OA 4HWPA 1SEPA 4MVJF 3MERA 2PCLA 2DQYA 2OC9A 3H2HA 4KLCA 1TT5A 2W11A 2VHQA 3CLTD 1A5SB 4WKOA 4E2YA 3NHMA 2OM2A 3NIWA 1NHGA 2DM6A 2QG6A 4NVRA 1WG8A 2FXIA 6CHYA 4AZ3B 5LLSA 1X19A 3IA2A 4IZ6A 3EIQA 1YQEA 4H3HB 4M89A 4MS1B 3G1UA 1UDRA 1E92A 2G1PA 2RGDA 1XN4A 1XL0A 4UHJA 1Y98A 3CVUA 4AC9A 3D8BA 1M3SA 2Q3JA 3VSBA 3EXEA 3AUJB 5B53A 2I78A 2AC4A 1LY1A 4NU8X 1DINA 1PNVA 1G4HA 2G77B 1VC2A 2CHGA 2G72A 2R1VB 4ZDWA 1PN3A 4E4YA 1XTPA 4YAFA 1X1EA 2ZOSA 1OAOA 3L0CA 4AKGA 1BQ4A 5KUTA 3IEXA 5LWQA 5BNWA 2VHTA 3CX6A 3BRQA 4ZZ3A 2QRHA 1MF7A 2ZR0A 1REQB 4OQFA 1PFGA 2ZIVB 2IU3A 2DTXA 3HI4A 1EXWA 1O08A 1V8PA 5D3ZA 4BAGA 5ER6A 1ZA2A 3OBIA 2QPLA 1T1GA 4UU1A 3TLJA 2DZDA 1LEHA 2PWZA 3QV2A 1RHMA 4HMQA 2F8MA 4KE7A 4IDHA 2QPAA 4LJ5A 1XZEA 2FN3A 2ZYIA 1VI5A 5F52A 4J0FA 1JDJA 4BFUA 3NMUF 4GKKB 1Y3FE 2YJNA 1M72A 2W2KB 1R0YA 2QBYB 1DBVO 1XRQA 2ZRGA 3ZY4A 3AF5A 1P39A 2BONA 3KQPA 4QPZA 4Y67A 2MINA 3CUEF 3RVRA 2O3UA 1E1CB 4JKIA 1G9XA 5JDIC 3NPMA 3RFFA 2JAQA 2HRRA 1JJFA 3A32A 2HAEA 2JIPA 3IL2A 4N8EA 4EYSA 3ANTA 3R5FA 4O4JF 2GN9A 1WZNA 1ZESA 4GP6A 4D02A 1EE9A 1X1RA 4BEJA 3ZWQA 4H7EA 1P1IA 1Y5IA 2PEYA 2WIFA 1WXIA 2PMDA 1JDTA 3IT0A 1BWSA 5BN5B 3C8HA 1QIIA 1ZW1A 5KTPA 4N03A 5L4NA 4TZ6A 2F7SA 2H4JA 2QTBA 3NBAA 2CNOA 5HIAA 2IV2X 4A2CA 1MJGM 2FPIA 3GDOA 3GJXC 5CB0A 4KLAA 5EWMB 1XIVA 2N1BA 5D7NA 4FONA 4K0KB 3C5CA 3FTPA 3KHUA 5ICMA 2A92A 4XQCA 2FMHA 2YVAA 4ABTA 1Z0IA 1Y3CE 3OE7D 3BXEA 4QYMA 2XUHA 5EJ6A 2W2OA 3R2JA 4MV4A 3EUAA 1A5AB 3TQOA 4P3XA 1DEKA 4DLTA 4F93B 3STVA 1NVKA 4HEJA 4Q4AB 3W34A 2AMFA 4EKIA 2Z5FA 2Q46A 4R5HA 3ZHYA 4FGWA 4WA8A 2C07A 3T7AA 2HJHA 3TIXB 5AK5A 1OLXA 2NU8A 3LKVA 3ZZNA 3S0JA 2ZJ2A 3AFGA 1E1LA 3WSWA 1OCEA 1E32A 2CMKA 2WPNA 2XX3A 1DKMA 1TI7A 1P75A 3GYBA 4RKEA 5A6SB 4ZCRA 3VO1A 4C2UA 1KVTA 4XTRA 3TB6A 1UXIA 1GNSA 4ZYLA 4LF5B 1C0LA 3M7IA 1M1ZA 2E87A 1VE5A 3D0QA 2F64A 4JVOA 2OZEA 2Z8XA 3WIUA 3PX2A 3RHTA 3V7NA 2AOUB 4ON9A 3F5SA 1JEQA 4PX9A 5ILOA 3JVVA 5BN3B 1FS4A 2OMEA 4KMSA 3RC9A 2X0FA 4EI8A 4HD8A 4LS3A 1JSZA 4LZZA 1XZJA 2BZGA 3O95A 2IZ6A 3R3YA 4GPAA 4DCTA 4Z4GA 2C57A 4EKDA 1RYBA 1KE1A 3JQAD 3IAXA 3PQ6A 3WKBA 1VJRA 5DEOA 3N07A 1L3BA 3HYLA 4ZP1A 2GK4A 4JB0A 4C6RA 3OHSX 4C6TA 4C4YA 2I7VA 3RTGA 1TO1E 3I42A 3RAFC 2YFYA 3L6EA 4X1IB 3FYDA 1QV7A 2GB4A 1PDVA 4HH0A 3TQQA 4EW1A 1GTJ1 1ZOLA 3VH1A 3E05A 3LBAA 5TE9A 4F7DA 5IHXA 4ARCA 1R27A 4I55B 4ZI7A 1ABBA 2VT2A 4OFXA 4BIMA 4DEVA 1T5OA 3D3JA 2QPOA 3ET4A 1EG7A 4JSYA 4PVCA 2ZYWX 3GUZA 1FLAA 1DDIA 2BGLA 2UYQA 3E2MA 3S4YA 3S1AA 3DNPA 5CBKA 1O6FA 4S1TA 4B17A 1U8ZA 4MTCA 3F8TA 1C1YA 2JGJA 4ZAXA 1K3TA 4YREA 4C87A 4IDDA 2ZUFA 3RT7A 3CTPA 4W5HA 4EHNA 1K3UB 1MQ8B 1ZVKA 3C1OA 2PPLA 2Y3IA 4EZIA 5B7GA 3E7DA 3DKVA 3OFVA 1HY3A 2G67A 2NUTB 2WNSA 3R4CA 3ZDXB 4HQNA 4G0WA 3GJ7A 1AXEA 3BHNA 2FEOA 1EP1B 3CX4A 3QF4A 1R64A 1V96A 4BZXA 4FMPA 1U9YA 3BIOA 4C7VA 1SQ5A 5CM8B 2D8AA 2EXXA 3DE6X 4KQCA 3ROFA 1VJCA 4OQYA 4R3UC 3H5TA 4HV4A 1L4YA 1QVZA 1FDVA 1JH9A 5EIBC 3DYVA 5E6SA 1XAHA 2HL6A 4BVFA 1MV8A 2NPFA 3SJBA 3QX7A 1V5FA 1DEXA 2X0RA 3H6GA 3FSEA 4L8VA 5G0SA 3VX4A 2ZYDA 4ZVNA 3CY6A 1ZUIA 5DHAA 2O2GA 2D06A 3R0XA 3O2JA 4MARA 4RZXA 4X6YA 4NU5A 1DRUA 3W06A 3MB5A 2PZLA 4TVKA 2FPPB 1NBMD 5ESDA 3ZK8A 2E0IA 4CT5A 4TRNA 1U31A 1E1DA 1U99A 2FMUA 4DLKA 3T3PB 1EK0A 3UJ8A 4QUKA 5DBFA 5BSUA 1COWA 5K2OA 4LOHA 1OU0A 3MJFA 3IHLA 2A4MA 3UB2A 4OV6B 1GTZA 1JMVA 5DEIA 1TJ4A 1Z2EA 1FTWA 2QSZA 3I8XA 5ALQA 1ISHA 1P0QA 3WV4A 4HWKA 5MHTA 4B6EA 2PGLA 4EX6A 2QX8A 4I55F 1JR3A 3MMPA 4MYHA 3R0IA 5I7OA 2Y99A 3NBKA 2AG1A 1S6YA 2HH9A 2W48A 3THRA 2F55A 2WV7A 5CJJA 4AUKA 3U7FB 2B2NA 4OGLA 1GDTA 4KXWA 2VPTA 1ILWA 3L4BA 1YRLA 3Q3IA 5EWLB 4MUIA 1N6OA 2BKLA 4HUQB 3FBWA 4U7HA 5HKKD 4EW6A 4FWBA 3GDHA 2F48A 2D59A 4C7OA 4UTZA 3KUKA 4QFDA 3EDQA 2O23A 2XXAB 4EJ0A 2AQIA 3HLTA 5JD6A 4ZEWA 2NX2A 1GUYA 1Z45A 4AK9A 1KFCB 3CJRA 3OLYA 5DWVA 4DAOA 1S7GA 3DA8A 4KACA 3GPIA 3P9YA 3FZEA 2BMEA 2JPDA 2YIMA 3H5NA 3R41A 1LFDB 3H0EA 2CFCA 5JG7A 1GZ6A 4E6PA 5CMLA 1NX9A 1U7UA 4NX2A 1YQ9A 1Z88A 4KBYA 3K9NA 2PUFA 3KU1A 3EAGA 2IS6A 4IY1A 2ODPA 5JQWA 1I3LA 4H1TA 4JSTA 2VTBA 1SPXA 2B94A 2O2SA 3HGMA 3UF0A 4KXXA 1KZ9A 1PGQA 5E4TA 4FEYA 5F1YA 2XRZA 1VB5A 2VOJA 5HOEA 1EBBA 5A4AA 3H2KA 1BKYA 3EGVA 1Y9DA 3CLTC 3DV0A 4GP9A 3AEQA 4A0HA 1XDBA 4IMPA 4B74A 3NUZA 1AA9A 2EJVA 3Q8WA 1ZXXA 3B3FA 3ETJA 3K9HA 3DTVB 3KFXA 3U40A 2JARA 3C3EA 3VZQA 4BFXA 4F3YA 2UZ3A 3PDIA 1JA0A 2VNKA 1NBIA 2VJDA 1PBNA 4D0SA 1OMOA 4JBNA 4TWAA 1A2QA 2ZSEA 4RSHA 3P9CA 1BW9A 2HM7A 5C32A 3ECSA 1KYYA 1QGYA 2A9QA 1DBQA 2DPGA 2HRQA 3M6WA 4OB7A 2H92A 4Y0VA 3O4RA 4HWGA 1JAIA 4HYEA 4C4ZA 3U19A 5CNJA 5DGIA 3V6MA 1UQRA 2AV6A 4IYRA 4PM4A 3BT7A 1QF6A 1LPNA 2IYVA 1OBCA 2Y1XA 3I9FA 1Z82A 2OHOA 3BTVA 3TOSA 1DMSA 4XD7D 4KDEA 3CVYA 1OA1A 2EGUA 2Q29A 2FG6C 1MUUA 4AJ9A 5ER9A 1CQXA 1T2CA 2WHRA 2C59A 2L69A 3G59A 2KWIA 2VYVD 3B82A 1P9OA 1U9CA 3ZQ4A 1XCGB 2BUAA 2OQ2A 3O3MB 1S2DA 3QY0A 2FZVA 4OGFA 4EDFA 4YJFB 5JI3E 1V4NA 4BNYA 1AB6A 4M0MA 2GLUA 3SY8A 3HWRA 4RS3A 1EX7A 3EPPA 3WRYC 3E9QA 4JUCA 2NSJA 1HDIA 3A2NA 1B0UA 4CG3A 3F9IA 4MWCA 1FVFA 3GB9A 4II7A 5FR1A 3W2IA 1I3CA 3QXGA 3SZ3A 4MDFA 1UWKA 2OCGA 2ZDGA 3MSXA 4L8WB 3DHVA 2WP8J 1G3UA 2VJKA 3P2MA 4QWMA 4X7MA 4NTZA 4QO7A 3ZJ5A 3DVLA 4Z3KA 1FDSA 5AHKA 1WU8A 1C5KA 2UZAA 3AFIA 3N2EA 3ZU2A 2ZBGA 3W9BA 5KMGA 2R0QC 1F7UA 4PAMA 2YHIA 1NLYA 3TAXA 1A5BB 3GROA 1PV4A 4ISCA 1EFTA 1ODSA 1WMEA 1T4GA 1N0WA 4XUCA 3A3YA 3AHDA 4LOJA 4P0PB 2GA9A 1JPJA 2Q0SA 3AHGA 3P0HA 2C7VA 4K6CA 4URYR 4BXOB 3K9LA 3ZXUB 2QTTA 3G23A 1YB5A 2OV6A 1XZKA 3GXBA 1Q1QA 4RTNA 2XODA 3G7NA 2X0DA 4HR7A 5EJ8A 3ROZA 5KNCA 3WYAA 3P2YA 3EC1A 4PRKA 5JBIA 1NU8A 2NQ8A 3AKCA 1TVEA 4YA6A 4HLDA 4DMUB 3RK4A 2OENG 1NLZA 3FETA 3KQTA 5B1YA 3F1K<