3KKNA

Crystal structure of h-ras t35s in complex with gppnhp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Structural basis for conformational dynamics of GTP-bound Ras protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 65
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kknA00
4AKEA 1KMQA 4DLSA 1N6PA 3DMDA 3GJ0A 5FI0B 4PZYA 3T5DA 2QGNA 3M6AA 3WNDA 2LCFA 3RRMA 1YR6A 3U7EB 1ZU4A 2DYKA 3KXKA 1OV4A 2FH5B 2ZUBA 1JAHA 3GLIA 2P6UA 3GQBA 5TVKA 3U61B 1O87A 3J81k 5JWOA 1N5IA 3P4YA 3QNUA 4GBMA 5HPYB 2OLKA 4TYPA 4MDFA 4OI2A 1NY6A 4KYUA 2JCSA 3GFOA 3I72A 5BN4A 4PR0A 2OE2A 4OYHA 2WHXA 1QVRA 4QC2A 1Z22A 3GLHE 3IO3A 1P9NA 4WZBE 3A8TA 2C77A 1Q3HA 3EAQA 3IEUA 4JVLA 5GADl 4Q19A 4Q4AA 1WBDA 1OYYA 2Q21A 2QBYA 1YU9A 1TF5A 4NP6A 4RZXA 4QBGB 4EJSC 1XRJA 3A1TA 5BWMA 2YJTD 5KHOC 4D4MA 2GA8A 1TU4A 1XWIA 3I5XA 4LJ4A 4WIAA 5JMTA 4NYMQ 1II8B 1OXTA 2DR3A 2RGBA 1DG3A 1IN6A 2QPAA 1KZ7B 2UZIR 4WOPA 1W2HA 1VKJA 2WPDA 4KBGA 1Z6AA 2J45A 1B0UA 1KYIA 1MO4A 4JZKA 1H8ED 4MRSA 1XX6A 5LDDC 4N1AA 1GM5A 2EWVA 1DTSA 1JB1A 5BQ5A 3NH9A 3ZS8A 4IFBA 4MYUA 1Q57A 1YZLA 4PO8A 2OG2A 4B2IA 3SNHA 3WY9A 2C95A 1Z83A 2GXSA 3GLFE 2VA8A 5TV2A 4LHZA 3U7FB 2V1XA 1CJMA 3IKJA 5L3QB 5TDHA 3TQCA 3ZIAD 4RFVA 1XXHA 4TYYA 4DJTA 4NL4H 1YZTA 1JR6A 4KO8A 2EFEB 2V7QA 4KODA 2IEZA 2WAYA 3CM0A 3TVTA 4TZ0A 2C96A 2QA5A 2UVQA 1QHGA 2GZHA 2A5YB 3U2QA 5L3SA 3B1VA 1CR2A 1UEJA 2WSSA 3FKSA 3L0IB 3DHWC 3LV8A 4URZR 2PZGA 3THOA 1QVAA 1EFTA 1XMJA 1XCPA 3PUWA 2R2AA 1IXRC 4CW7A 4A6PA 4BUJA 1CJKC 1GDDA 3LLUA 1AZSC 5H68A 1IXSB 5DHAA 1NN1A 4GI7A 1RIFA 5DO9A 1WDTA 2X1VA 4MRNA 2IW3A 4Q1FA 3SR0A 2PLRA 2G6BA 1P73A 1KSFX 1WB9A 3EX7C 1EFRA 1AGPA 1IBRA 2JLRA 2D7CA 1N6RA 1RVDA 3AVQA 3O47A 2PCLA 1E9CA 4LHVA 4D4JA 1JEEA 1GILA 4E09A 3AF2A 2J1LA 3ZD7A 3VNVA 4LYFA 1NKTA 2A5JA 1KHTA 2VEDA 2GJ8A 4D26A 4RVCA 3Q72A 3WRXC 3KL4A 4BE7B 1QF9A 4KXFB 3GJXC 3A1SA 2H17A 3A4NA 5EP1A 1XMIA 3L8YA 3FGNA 4BLOA 2W2VA 5FBLB 2J7PA 2GK7A 4Q1DA 3KB1A 5FL7D 4OJKA 4D0NA 5L3RA 1FUUA 3I3SR 3K0FA 5JJLA 5FOWA 3IUYA 1L2TA 1G5RA 3QPWA 1R6BX 1SVWA 2CCJA 4TWZA 3W3AA 5EE0A 1CJUC 3DVLA 4XOIA 3PUZA 2WSMA 1E0AA 4TTQA 3EIEA 5KSOA 4O0MA 4TMZA 1DVRA 3VX3A 3SN6A 3WYFA 1H65A 4UNQA 3FHTA 1EFHA 4V0ME 4TSFD 2ERYA 5FTLA 3S1AB 2J0SA 3DKVA 4TMWA 3E2IA 3QF7A 4MYHA 3W5JA 4CVNA 3NBFA 3AP3A 1OSNA 3KKPA 5C18A 4V02A 2PJZA 2FFAA 3DZDA 2ZU6A 3EPLA 4PHHA 2NO6A 1U0LA 4NH0A 4EPXA 1AS0A 2ZJYA 2ZRCA 4KHZA 2YKGA 3X1DA 2JJ2A 4EQ6B 5C4MA 2DWPA 4LHYA 1IJFA 2MMCA 2ANCA 3PFIA 4DC9A 5BXQC 2PT7A 2JLYA 3DOEA 4L9WA 1EFUA 1FW6A 2HYIC 2ZRFA 5J4HA 1K5DA 1JNYA 3VTKA 2PJRA 4US1R 5E7IA 2IWRA 4XTCS 2NO1A 4QKQA 3VKHA 3LY5A 1R0YA 5E3HA 2YWFA 2PEYA 3EARA 1R2QA 4H9GA 5B58C 3U5ZB 4Z1MA 5CLLA 3LQRA 2O8BA 1NVVR 2GF0A 4DLUA 1EWRA 1Q20A 4DDUA 3QPUA 4D6PA 2V54A 5E7MA 1MT0A 1OW3B 3TR5A 2WWGA 4CEJB 3SQWA 2VLIA 3PEVA 1P3JA 1N5KA 4LY6A 1MABB 1XDBA 1XTSA 4NZYA 5FUYA 1JI0A 4Q4LA 4WW0A 2BJWA 2GAOA 4UXIA 3TJZA 1WE2A 1KSGA 3AF3A 4OK6A 1B23P 4KLNA 4RJLA 2ZSDA 2H7VA 4RCYA 2VP4A 3IO5A 4BASA 1FOEB 3W34A 3PEUA 3HU2A 4EPWA 2JJ1D 3TUIC 5K8IA 1S96A 4QFMA 1N6IA 1TU3A 3ZZ0A 4KVGA 3C41J 4DWJA 3FFBA 2BMDA 4Q1CA 4DB4A 1OB2A 3WMGA 1FX0A 4G5RA 3U7HB 3R9WA 2ORVA 3P1JA 2XNDA 4Q21A 4E07A 4ZIRB 1IXZA 1E2DA 2FWRA 2FU5C 2DCUA 3DEFA 5EE5B 5EP2A 1VHTA 4C30A 3IIKA 1G18A 4POAA 1X1RA 2PMKA 1EGAA 3LA6A 4ILEA 2WMNB 2R6FA 3GLGB 2QN6A 4JLVA 3GCGA 4O3MA 5EP4A 5KO2A 1YZGA 4KI0A 1OKKD 2ODNA 1E2FA 1SGWA 2GJAA 4C4PA 1HT1E 1Z29A 1J90A 2OFXA 1VDZA 1X8LA 2ZI3A 1SQ5A 3D6TB 1I4DD 3OEEA 3MUFA 3PITA 4M21A 1T8TA 4JLOA 4NPHA 3QXJA 1XJQA 2HUPA 2IHBA 3SS8A 1P4SA 3VR5A 3Q7PA 1GWNA 2G77B 1Q21A 2WAXA 4KFTA 1BH2A 4ASUA 3SDZA 3ZYCA 4II7A 4B34A 2XOKA 2KBFA 3BGWA 3HYTA 1XTKA 521PA 5KU1A 3KKQA 3TSOA 1JPJA 1LW7A 2JLUA 2GCNA 2D62A 3X1XA 3RABA 1N6LA 3EIQA 3KTAA 3WBKA 1M2OB 1ZVQA 4ZIRA 1YZQA 1ZIPA 4PC6A 3TVDA 4EAQA 1TPZA 3ETLA 3GLGA 1JECA 2WKPA 5IK2D 2F1RA 4AD8A 2ZR7A 3C7KA 1G7RA 1P2SA 4FCWA 2JAQA 4RD1A 3ZGXA 4XWAA 3VU9A 2F43A 2W6IA 1Y63A 3U3OA 4DIEA 1AJEA 4HI0E 2BBTA 4XIGS 2FF7A 2ZE6A 3W6PA 1KAGA 2XZOA 2CLCX 1XPUA 1N5LA 2XSZD 3ZQ6A 5HE8A 1ZUIA 4DCUA 4IVQA 1ZM3A 2WV9A 4LUCA 4QNMA 4LJYA 4IDNA 4FIDA 2BJVA 2C8VA 3E70C 1R10A 1UKYA 4EPYA 4QJ4A 2JIZA 4ACAA 3OIUA 1U99A 4PX9A 2WWFA 4LC0A 4MGZR 1NKSA 4F4IA 3SHWA 2GEVA 3EC1A 5KSPA 3CX8A 3PUYA 2FPKA 2FEOA 3EPKA 1F3OA 4KITB 2GTPA 5FL3A 4B3DA 4CEHB 5IRCD 1FMJA 3NC1C 3TSWA 2G0TA 3HU3A 4TMKA 1KI2A 2KI5A 1OXXK 5FI1B 2RMKA 1KO5A 3U4QB 3G82C 1AKEA 1NIJA 3EA5A 4CDGA 2AK3A 3QKRB 5EQTA 4DLYA 1G9XA 5JEEA 2N46A 3RNLA 4L8GA 1XNJA 1A2BA 4TT3A 4FMDF 2G0NA 2ZPTX 5EXTA 4B3GA 2P5TB 2WWWA 3U3MA 2YINC 1CP2A 1MO6A 1W36B 1KJWA 1F2TA 5JS7A 1OXSC 1BMFD 1ZNZA 4P0TA 4MUBA 3T15A 3QXHA 5AJVB 4Q9KA 2ONJA 2XB2A 4XD7A 1XTJA 2FJUA 1N6OA 1WMSA 1OH8A 4G5SA 1CRPA 1J8YF 3QF4B 3VX4A 2PEZA 4TMXA 3PUVA 5LD2C 2R6GA 4AKIA 1UKEA 3KXIA 3D8BA 1G3RA 3VR6A 2WKRA 1RFLA 3TW8B 1BIFA 3SYKA 4CEHA 2GVZC 3ZVMA 1US8B 1PLLA 2RGGA 1JR3E 1TQ4A 2XXAA 2BEKA 4HSEA 3BIFA 4TYWA 4US2R 5F9FA 4D82A 1RW4A 1Z47A 1W0KA 4Q01A 4QGHA 3MWKA 3H2YA 4MKFA 4QG7A 3CBQA 4OBEA 4EDHA 3DKPA 2ZETA 3BH0A 4C2TA 3JVUA 1KMHA 5KNCA 1G16A 3GJ7A 4URYR 1OFUX 2DPXA 4RD0A 1G20E 1D2NA 3KKMA 2P0EA 1P62B 1YRAA 2FGKA 2OXCA 3BERA 4PQRA 4IHQA 4Q00A 2BIFA 2Z5FA 5BYJA 3AKYA 2OV2A 3BB4A 2ZRBA 2ZJ8A 4A82A 2FPLA 4X8MA 4BFYA 3OEHA 4B2PA 4F4JA 1H8HD 5P21A 4HAUA 3B13B 3QVVA 1XD8A 121PA 2AX4A 1NG1A 1FTSA 4CF7A 1F60A 2GNOA 3A37A 4LGMA 3B1ZA 3SU8A 4Q7MB 2OT3B 3LXXA 1US8A 3FMOB 3MMPA 2QENA 4AYTA 4DSTA 4IXMA 1G7CA 1ZIOA 1DO2A 2ORIA 1AQUA 1JJ7A 1GL6A 4FINA 1IM2A 4Q1AA 4C3ZA 2XZLA 2IYSA 3GP8A 4NU0A 3HPRA 1G3MA 1LS6A 1I4LD 5GJCA 3UG7A 3SEAA 2WJIA 2QNRA 4CZ2A 2D74A 1UDWA 2CL6X 3HPQA 2CDNA 3FWYA 3SOPA 4GMDA 4YDSA 4FWIB 1JJVA 1N5JA 2PCJA 1SVLA 1WQ1R 2ZS7A 4XH9B 1E32A 1KDOA 3CWZA 5SZKB 3LAWA 2B7BA 1E2IA 3MAAC 4M1KA 2J0UB 1SXJE 4TLDA 1E9EA 3PEYA 2OAP1 4P32A 3OFND 1EXMA 5JFGA 1W4RA 3AVUA 3Q85A 2ZRDA 3GPLA 2BCJQ 3U6KA 4YONB 1IHUA 2CK3D 1TQ2A 2R44A 1K5GA 5HKKD 1ZRHA 4OQNA 2DWQA 1CLUA 2QUZA 3I8SA 4LSGA 3NBZC 3CWQA 4PFSA 1E1QD 4TLAA 3RSLA 3Q8XB 3SBDA 1XFAA 2CXXA 1T91A 3GLHB 4BFUA 3T1VA 3THXA 5J47A 1D9XA 4FD2A 1F5NA 1GZSA 3UATA 3CKLA 3AF4A 3LBHA 1OFTA 4Q47A 1N6NA 3BH7A 5C4GB 1WF3A 3NEYA 2ZUCA 4QM6A 4RFSB 5FUXA 1HY3A 1P9RA 4GT1A 4GZMA 3CR8A 4PC7A 4RD2A 2W6JD 4XVUA 3THYB 2OCAA 1RC8A 3FMPB 2IUSA 2JLQA 3NBXX 5DN6D 1XTIA 2IHYA 3CNOA 3TLXA 4F4CA 1GL9B 1GNRA 2IYXA 2R6DA 4LCBA 3TAUA 1UADA 1P7CA 3FHOA 3N2IA 3B7GA 1N25A 2V6IA 5TXGA 4M1YA 2AKYA 4XWKA 2HF9A 2V8OA 2CE7A 2ZRPA 1SHKA 1VYTA 3I92A 1UPTA 2Z4SA 4EIWA 4ESVA 3GLHA 4GMXA 3E1SA 1HEIA 3B5JA 1Q22A 2R6CA 2WKQA 4EPRA 5CITA 4LHXA 3SJCA 4V0KA 2XAUA 5CM8B 2J0QA 2O0HA 3IDQA 4BFTA 1KSHA 2OCBA 2GKSA 3RSOA 1AS2A 3QG1A 2IUUA 5KOYA 1G5PA 4GPTA 4RFSA 1DAEA 4LDJA 2Y8EA 5JEDA 5FPSA 1ODFA 3BD9A 4DCVA 1SXJD 1HA3A 3THYA 3TH5A 4S35A 3ZJYA 4UQOA 1E2PA 2O5VA 1COWA 1HUQA 5FPYA 3WNBA 3GJ5A 2NPFA 1E9RA 1NBMD 4KAXA 1G4AE 5AJXA 4MITA 3HWSA 1G1MA 2ZREA 3FKQA 2EFHB 2AWOA 2GHIA 1G6OA 1VECA 5B30A 5JSZA 4BWYA 2QORA 2O8CA 2EW1A 4ARZA 3NG1A 5JI2E 1ANKA 1JXMA 5BYKA 2I4IA 1E9DA 1W4BA 4PAQA 4C0HA 4UXHA 5FL7A 3BE4A 2LWIA 2QROA 2RCNA 4UJ5A 1KI1A 3TNFA 4YXWA 3CH5A 3GLFA 1EESA 2XTZA 1JQJC 2IS1A 1AK2A 3K9HA 4JMPA 5EE9A 2QTHA 3Q3JB 1Z6GA 3IBGA 3TBKA 3KFVA 5KPDA 4ZCIA 4N0DA 2ZUDA 1LVGA 2EVWX 4M2LA 2FFBA 5CYOA 4HB0A 2HLDA 2BEJA 2C78A 3NH6A 4OKSA 2O0KA 4TQUS 4LK2A 1ZM2A 2DFLA 3EXAA 3KJEA 4LJAA 1G7SA 3CNNA 1MH1A 1S2MA 4LBZA 3VAAA 2BCGY 1KY3A 1Z8FA 3RWOA 2VP6A 4ZI2A 1E2NA 2G1JA 1N0WA 1YR8A 2EYQA 5LB2A 3VR4A 4P4SA 3KJHA 3L0SA 1G3IA 2CJWB 4E03A 2PBRA 4A0RA 4YDHB 1U8ZA 5DGXA 4H1VA 3EZ7A 5B64A 4KFRA 1TF2A 3W5IA 2VHCA 5L8VA 2QTFA 4HLUA 4URWR 2ZRMA 4D80A 4FN5A 2Z6VA 4RZUA 4XSGA 2ATVA 2AXNA 3TRFA 1RE0A 4LC1A 1SVOA 2P5SA 2G83A 3C15C 3QXXA 4KSBA 3VMFA 2BM1A 1HE8B 3H4MA 1G8YA 2DFKB 2QPOA 1UKVY 2Z0MA 3M0EA 4M22A 4HYYA 1SULA 1S1MA 2BM0A 3RWMB 3UMSA 4PSAA 4ZDKA 3K70C 4A15A 5G3YA 1AM4D 1VYVA 3AEZA 4DSUA 4FWTA 1U9IA 4JKIA 5J4KA 2JDID 3BOSA 4BFZA 1FL9A 3SC3A 2NOAA 1ZUNB 4RZ3A 1P9WA 3MG9A 3Q7QA 3K0CA 4MKHA 1CR0A 4C0AC 2VP9A 1EWQA 3TE6A 5FOTA 3B9QA 3L0PA 4R2HA 5EZ6B 5GJBA 1XEFA 2CJWA 2W00A 1QHHB 2ZRGA 3CZPA 2XJ9A 4GP6A 2JJ1A 4N0EA 4MKIA 3CZQA 3KUDA 4X8HA 5L3VA 2AFIE 4DCSA 3SBEA 1IONA 4IRUB 1XJ0A 4V0MA 2ZVQX 2O8EB 4DEXA 1PUIA 3LRPA 3T1TA 4IFEA 5IT5A 3AGQA 3OE7D 5FOVA 5K8LA 3GJ6A 2XB4A 1T3SA 2N42A 2REBA 1MOZA 1OKKA 1NG9A 1PV4A 3CO5A 2ZJ2A 3V4RA 3GEEA 3D3QA 4D0LB 1L8QA 3QY0A 4OJQA 3RC8A 4IKEA 2OILA 4P4UA 3QSYA 2JLWA 4PZLA 4HUQB 4IDQA 5D3MB 1TX4B 3HDTA 3PG5A 4M0LA 3WBJA 1N3BA 1XBTA 3K0AB 5HTKA 3LFUA 1YKSA 2Q9CA 3TK1A 1A1VA 2B8WA 3W8RA 4ZCLA 1Z6TA 4UNPA 4UNNA 2WIBA 3ICEA 2ZS8A 1KIMA 3NKVA 4KV9A 4QXAA 2P67A 4GRAA 1J7KA 1KKLA 4QOSA 1ZNXA 4IDHA 3SHFA 1U98A 4DHEA 4CYMA 2EU8A 4M9XA 3F5FA 2CL7X 721PA 1W0JA 2ZEJA 2YHSA 2B6HA 2QE7D 3QPVA 2OCYC 2VL7A 2B7CA 2KBEA 4QHTA 3W6OA 2BMJA 1II8A 3I1FA 3Q5DA 1VCIA 3LDAA 3QUSA 4XVRA 3RAPR 5CJPA 4ZV4A 3UG6A 3QEOA 1GITA 3H0KA 5FBQB 1JEDA 2X2EA 5ANRB 1G19A 1IN4A 1S0UA 4EUNA 4JSYA 4OL0A 4Q9JA 2J0VA 4HUQA 3FOZA 2FPMA 4JYCA 2B21A 4QNRA 1LF0A 2HT1A 4HB4A 1RRCA 1Z3IX 3H84A 1KDPA 1P75A 2V55B 2TMKA 1G8FA 5L3QA 1AA9A 1XCGB 2MSDB 1RJ9B 2BMFA 1KJYA 3AGPA 1S8FA 1Z5ZA 3T34A 1PJRA 3K9LA 1TQ6A 4A6XA 4AI6A 4NYJR 1XD2B 1VYUA 2HT6A 4TQ9A 4FW9A 1T3HA 2F7SA 3G5UA 3LBNA 2GCPA 3OAAD 1P60A 3EZFA 4BECA 4D4LA 2CL0X 1MO3A 1Z6XA 3U6BA 2QTVB 4K8OA 4B3XA 2QAGB 3V9PA 4DCTA 2PH1A 4NONA 1UJ2A 3I62A 2FOLA 2WJGA 4BZQA 5DE3A 1OIWA 3KFXA 4LX0A 2GEUA 3BFXA 2ZI5A 2W0MA 4B3BA 3GJ3A 4L5BA 2GETA 5A0FA 2ZAOA 3TMKA 2KE5A 4G3XA 3ZVNA 2IBMA 4RD6A 3MWJA 2AHOA 1KNQA 2BWJA 4HB3A 1KO4A 3PUXA 5G53C 1R8SA 5F3WB 5TMPA 1YR7A 1VG0B 3B1XA 1XD2A 5CDFE 5FPTA 4K81B 5J4LA 2VHJA 1OXUA 3LQQA 4W5JA 3PR1A 2VBCA 3GEHA 3BFVA 2ZE5A 4I1SA 2W58A 2BC9A 1NVXQ 5FTJA 1ZM4A 3L8ZA 2CHVA 1QRAA 4Q9IA 2GJSA 2F55A 3LVRE 4DUGD 1E6CA 1SKYB 2GEDA 3M1IA 2F6RA 3TUZC 1D8TA 3KKNA 4EKDA 2QMEA 4R2IA 4HATA 4BZXA 4U7DA 1NMYA 2FSGA 4TL8A 1TAGA 1XTRA 4B2LA 2GAAA 3SJAA 1RKBA 5LBIA 2D4HA 3UMRA 5HZHA 1LY1A 4QBHA 1TQDA 1FP7A 1RRPA 1RYFA 4LOAA 3S1AA 2FSFA 2Q0HA 4E22A 2QEQA 3GJ4A 4NE2A 5UKDA 4YMTA 4RKFA 4NYIR 3PCRB 3THWB 4I1OA 3I32A 3QKSB 2BKEA 5CLQA 4EQ6A 2ZYTX 2EFCB 4TYNA 1CRQA 2YVUA 3QKUA 4JL8A 2XX3A 1DE0A 1ZM9A 2IS2A 1L4UA 3NDPA 4HAWA 3KQKA 4FMBB 1Q12A 1V5WA 2VP0A 4AKGA 1OE0A 1NN3A 2OESA 4UKDA 2C5LA 4C7OB 1NIPA 2PT5A 1TUEA 4KFUA 3FTQA 3CF6R 1VPLA 1CJVC 3A58B 4Q4JB 2WJHA 3I8XA 1KO7A 4U02A 3IIMA 2P65A 5AUQA 2BVNA 5J5CA 3LWNA 2A5FA 4XVQA 2ZS9A 5DSZA 4PAOA 3AH8A 1GNPA 1I2DA 2ZSAA 1MRNA 5CIQA 4PC2A 1XD9A 2GK6A 1T6NA 4LYJA 4AC9A 1KI9A 4CEJA 1OHHA 1OPXA 4M1OA 2D2FA 2RGCA 4M53A 2HEIA 1AGRA 1MABA 3RLFA 3THWA 4XWOA 2ZITA 1JR3A 4HLUC 1KOFA 2BDTA 4TL7A 4LYAA 4URUR 1LF5A 4ITRC 4D81A 1FNMA 5EZ5A 3LX8A 3T1OA 2FEMA 3CB4A 5FH9A 2HF8A 2Q6TA 1G64A 2C2HA 3A1VA 4JYBA 4BLRA 3EWAA 4LYHA 4TLEA 2RGXA 3VR1A 1D2MA 4PC1A 1ELOA 2OFOA 4WXPA 2NPIA 1Q1BA 3ZLJA 4C7OA 2CBZA 2EFDB 5KNDA 1YE8A 2ERXA 2QPTA 4MYTA 2GESA 4LPKA 4JLJA 1WBBA 1N6HA 1E9FA 1JQLB 3V00A 2WPDD 1MKYA 1X8JA 3K0CC 2YWGA 4LV8B 3NEJA 4B47A 1SXJB 3LW7A 3VQTA 2IF0A 1WP9A 3R20A 4JIMA 4MDEA 1HYQA 2H92A 1CR4A 4Q18A 5FTMA 3P27A 3FFAA 2F9LA 1E0JA 2JASA 2CEAA 2Q3FA 1ZNWA 4X8OA 2ZRLA 1E96A 3K9NA 1UF9A 2JEOA 3AF1A 4OI1A 1ZJ6A 3EG5A 2ZRNA 4IOMA 1HT2E 3IPYA 2V7QD 3LBIA 2VPPA 5KSYA 4JLDA 2OUKA 3SFVA 2A30A 4KFSA 3CF2A 3RHFA 5DYIA 1AZTA 4PPGA 4B44A 3BWDD 4KCGA 4QGAA 2IS4A 1RYHA 4FXPA 2WSSD 4Q02A 3TQFA 2YWHA 4MQBA 4BRUA 1II0A 4G0NA 2ZI6A 1AQYA 1XPOA 3EZ6A 2EFGA 3UWOA 1Z0AA 2FSHA 2ZQ5A 4MUAA 1PZNA 4C0QC 3B82A 4R98A 5AUPB 2YWEA 2ZSBA 4PQFA 5DISB 5EXPA 3W8NA 4TYQA 3SQXA 3CW2A 5GVSA 2IYZA 2RGNA 3X2SA 2J3EA 3OIVA 4OI0A 2DFTA 2OHFA 2CNWD 1DAHA 3ADDA 4XSHA 1XZPA 1YVDA 4DLZA 5C46F 1BO6A 1EFRD 1RZ3A 1KDRA 5GJVC 5CYPA 2HJGA 5C2JB 5EJEA 1KSJA 4B48A 1SKYE 4ZDIA 2NMVA 4MKGA 1X1SA 2EQBA 4WZAE 2AL7A 2A9KA 2H5EA 4HLDA 4B3CA 3FDIA 1WCV1 1R0WA 3V4FA 4DSNA 3B60A 4A2PA 4BEJA 2J41A 1F2UB 5C1BA 5EUQB 3ASZA 4NYMR 1VMAA 2RHMA 3R8FA 4EJSB 2J7PD 4LBWA 5CB6A 4EFLA 2G1KA 4HAZA 1MR3F 1ZAKA 3W90A 2W2XA 1SVKA 1Z0IA 5AJZA 4BEBA 2XGJA 4A36A 1GOTA 4Q5IA 4DT1B 1E1RA 1G8GA 4JBYA 2XTMA 4J0QA 1E9SA 3R7WB 1HQYE 2FZ4A 2DHRA 1UM8A 3I5YA 2A78A 5F98A 3U4QA 3NTUA 4Q03A 2CHGA 4YMVA 2ZI4A 1S1CA 1F48A 3QKRA 3IQXA 3O8DA 1OB5A 2IYTA 3WP0A 1P61B 2QMHA 1KO1A 3AUYA 2IUTA 5G41A 2E9SA 4DB2A 2VSOA 5AJWA 2ZXUA 3DM9B 3AVOA 4DDVA 3C14C 2H1LA 2JJ2D 4HEJA 1RPZA 2A7QA 4I4LA 4PHGA 1F2UA 2CLDX 1YR9A 3B6EA 2VSFA 3QF4A 1T0JB 4EJSA 2BHRA 2QQ0A 2WWXA 4OQMA 4A8JB 2QG6A 2IYVA 4DLTA 1VHLA 3LVQE 2ODWA 4RKEA 2IYYA 4PO1A 2ONKA 1HURA 3OESA 5FPHA 4IDOA 3RS3A 2GJKA 3R7WA 4OHVA 2F1IA 2WM9B 4MGYR 3OIWA 5EE3A 2JDIA 4IDPA 3CR7A 4YLGA 5M04A 4Z1MD 2VQSA 2H16A 2LKDA 2IC5A 5AK0A 4LV5B 1GG2A 2GBLA 3N5CA 4F93B 1GRQA 2KB0A 2ZRIA 3D7MA 4M1WA 5J4YA 4IEEA 3NIBA 2FSIA 3CX6A 4F38A 2VHQA 4D2IA 2VSXA 3SZRA 1WRBA 1R4AA 3MRSA 4A2WA 1E2KA 1R5BA 2PL3A 3ADKA 1E9AA 3TR0A 2AR7A 1XU4A 3I4LA 2FNAA 3L43A 4PHFA 1Z06A 3UKDA 2ANBA 5SZJA 1A2KC 3SE0A 3TGPA 2O8DB 4FCVA 4A8JA 3CF0A 1XEWX 1QHYA 1JXOA 1XP8A 1ZD9A 1NBME 4JSTA 2ATXA 4M8NE 1PLJA 3FB4A 2ZYVX 4A4DA 2I3BA 3D31A 1FTNA 2F1JA 3QKTA 1DELA 1T9HA 3PXGA 4GDFA 3HYRA 4E5UA 4QJ3A 1MO5A 1TF7A 2XNDD 3RS0A 1H8EA 3LW8A 1A4RA 3NC0C 1YZUA 4O2RA 1FNNA 4WAUA 4FI3C 1Z0FA 1ZM7A 821PA 3X1ZA 2WTUA 1IOZA 2ZYUX 4KBFA 4D4KA 2NIPA 5JECA 1VCMA 2WJJA 2P2LA 1TUIA 1X8KA 1KAOA 3WMEA 4C0LA 2XITA 3IQWA 2RAPA 2UKDA 3AKEA 4PSKA 3OEED 3ZIAA 5FOSA 2XZPA 4M1MA 3ASYA 1UDXA 4TTPA 5KSZA 2J0UA 4IOKA 4DSOA 3VR3A 3HJNA 3KKOA 4ESHA 1G291 4WZ6A 4JLMA 3CLVA 5KDDA 3ICQB 4YMUA 4B3FX 2XNSA 3NBYC 4XJXA 3UK6A 1RRGA 2ZU0C 4ASUD 1E69A 1AKYA 1N0VC 4N3NA 2XOKD 4LHWA 4A92A 1ZD8A 1DAFA 4LI0A 4OK5A 4TL9A 1M1YE 1R7RA 1W48A 2JLZA 4NCJA 1ESMA 4M9SA 4B73A 1KI3A 4FMCB 1V43A 2RGDA 3AVPA 5ELXA 1A82A 2DBYA 2L0XA 4MGIR 2R6AA 5FTKA 3TIFA 2IXEA 4UXJA 5EP3A 4ZDWA 2WIAA 3RS5A 4CEIB 1GVNB 4PZZA 2P6RA 2FZLA 2ZJZA 1KI6B 2NGRA 1N2CE 3MCAA 2WWHA 1D5CA 5IHPA 4OQXA 3AVYA 3DO6A 4HDQB 1NVVQ 1Q44A 5EXXA 1ZU5A 1S9DA 3U44B 1P2VA 5EUMA 4A0GA 4ZKDA 1YQTA 3CRW1 2VF8A 1NF3A 1SHZA 1VG9B 1DO0A 3IILA 5CK4A 2R8RA 2ZM5A 1KZGB 3WYGA 2QMUA 4NYIQ 1TNDA 1Q0UA 1Q1EA 2W6ID 5EXSA 3NDBB 1E99A 4R71A 3MWLA 2O52A 2FG5A 2NO7A 4TZ6A 3RYTC 3FVQA 4ZCMA 3OZXA 2OBLA 4Q4HB 3U7GA 3KJIA 4JBXA 1XF9A 1BKDR 2DFNA 2V4ZA 2ZJ5A 4LJ8A 4YMWA 1A7JA 2JIZD 1K8RA 5AWFC 5CB8A 2YC2C 1EG7A 5DI3B 2J59A 2QM8A 2ZSEA 4Z54A 2GVDC 5JJKA 2ODEA 1G41A 2MSCB 1NSFA 4GNKA 2JJ8A 3AKCA 3M4YA 1YRBA 5JHGB 4CEIA 4D25A 3AF0A 4WBSA 4C0BA 3DPUA 1KGDA 2C99A 3HP1A 3ZQJA 1QG2A 2VH5R 2CVHA 4GFDA 4EFNA 1EFCA 3TSZA 3RANA 5HCIA 4OK3A 2CVFA 4NBSA 1IY0A 3RS7A 4Y0VA 3IHLA 1J70A 4TSFA 4L15A 3RS4A 1E2HA 4Z8XA 4DLVA 1E79D 4NKRA 1Z07A 2OXRA 4TT3D 1RRFA 4GZLA 4HAYA 1OIXA 1KY2A 1E98A 4O25A 4UNSA 2PX0A 4DXAA 2N1BA 1CF4A 3REFA 4Q7LA 3K70D 3U60B 2QP3A 3T61A 2ZE8A 4XD7D 4F92B 1GRRA 4PPQA 3UIEA 2W2TA 1DPFA 1JALA 2BBSA 4QGGA 3AKDA 1SVSA 3L2OB 5TB5A 1XCMA 4NMMA 3CNLA 1E2LA 5H1YA 1KO8A 1GL7A 2RGNC 3GEIA 2RGEA 1P2TA 1ONBA 4Q4JA 1W1WA 4DDWA 3ND9A 2F3TA 4LRWA 4A2QA 1QHNA 3GLIB 1W2GA 2NTYC 3QQ5A 3AVVA 3KJGA 4PANA 2J7KA 3R8CA 4DLXA 1IN8A 3OHMA 3QEJA 1W0KD 1TEVA 1DAIA 1BOFA 3AVTA 5J40A 2VIIA 1UBFA 4LBYA 3KZ1E 4Q4AB 3QG5A 2HCBA 3BH6A 3C5CA 3O8BA 2QBYB 3WXMA 3IGFA 2J5XA 4DLRA 3OEHD 4O2LA 3WYAA 1KK1A 1HH4A 3PEWA 1DAKA 4ABYA 1ZCBA 4PHTA 2IXFA 2I1QA 4V0OA 2AK2A 2ZJBA 4YC7A 4PXAA 4LPSA 1PLKA 2D7DA 5JCPA 1Z0KA 4LJ6A 5E7JA 3FHCB 1D2EA 2ZRHA 2OM2A 4TTRA 2HXYA 3T1QA 1CJTC 1GRNA 3EWSA 1NJGA 4MRVA 1U0HC 2J46A 3AM1A 3GMTA 1DOAA 1XJCA 1NNEA 3VKGA 3DOFA 5B57C 4CGZA 1Z6YA 4UNRA 3CX7A 2VRWA 4AURA 3AB3A 5CDFA 1W36C 1JBKA 4QGFA 2REOA 1W47A 4OHYA 5DHFA 4LJ5A 2XTNA 4BLTA 2DY1A 2AD1A 5IF9A 2IYLD 3OF5A 3KDSE 4HDOB 1T5LA 1XXHB 2AD5A 1CU1A 1ESNA 4P3YA 1NN5A 1X6VA 2KWIA 4NCIA 2V9PA 3F3YA 2ASEA 3TW4A 5KDLA 3KXLA 2P3SA 1S4QA 3NVAA 3K53A 5L3SB 2CMKA 2VHTA 1QHHA 1DAMA 5FFMA 3K9GA 3ADCA 1O3YA 5HR5A 4QBIA 1P72A 2F3RA 2WJYA 1GKUB 3LH5A 3A1WA 1E4YA 5G40A 5AUNB 4RD4A 5KTYA 2G3YA 1P2UA 3OIYA 5K8UA 3QBVA 4QL3A 3WMFA 3MJRA 2GBLC 4TMVA 3RDPA 3CRVA 3EW9A 4BQSA 2GCOB 2O8EA 1C4OA 2NO0A 3CPHA 4WXRA 5LD2B 2ZANA 1FUKA 2QP9X 3H86A 4M4SA 4Q9HA 4ZI3A 3EPJA 2GZDA 5FOUA 1U81A 1N0UA 3DM5A 4LZZA 1PUJA 3ZD6A 3TAHA 4C0KA 3K09A 2ZTSA 5IK2A 3X1WA 2ZAMA 1QDEA 1DBSA 3UMFA 1NRJB 3C4JA 1W4AA 2WWIA 3TKLA 4I1UA 4U00A 4PO9A 2JLXA 4B6EA 1D6JA 3BB3A 4A8JC 3U3JA 1HTWA 2QZ4A 3C8UA 5D3MA 1NY5A 4JLAA 4IOJA 3K0AA 2XSZA 3MSXA 2LKCA 1S9HA 1FMLA 1ZUHA 1KK3A 1ZC3A 3N2EA 2D2EA 2SHKA 5SZHB 2IYUA 3E5HA 4DLWA 4PSVA 1ZW6A 3P20A 1JAIA 4DCNA 1P5ZB 2RH5A 3BORA 3NHAA 4IXNA 1QHSA 2GCOA 3EIHA 2V1UA 3C5HA 4KYIB 3K0FB 5AR1A 3UWKA 3KQNA 3WRYC 3QI2A 1HQCA 1PVOA 2ZRJA 2CNWA 4URVR 2FGJA 2REXB 3B78A 5K8TA 1LNZA 1S3GA 3EASA 1W44A 4LBVA 1ETUA 1E0SA 1COWD 5FOXA 4QJ5A 2ZR9A 4V0NA 4CIDA 5A5GA 2YOHA 2OCPA 2Q9AA 3A4LA 1M6NA 4G5QA 3LNCA 1BMFA 1KNXA 4F7WA 4G1UC 1T3LA 3GLIE 2NO9A 3RRYA 3ZVLA 2YV5A 2DB3A 3K0EA 3T12A 2IX3A 5H8WA 1NVWQ 2YC4C 1RJ9A 1Z0JA 4DEYA 3PENA 1I4TD 2H8KA 4AK9A 3CIOA 4XTRA 2Z83A 1M7BA 1K6MA 3T5GA 2G88A 1VIYA 3BK7A 3VHLB 1CR1A 3QE0A 1DADA 4YXWD 4US0R 5JZVA 1UBEA 2C9CA 5JI3E 1NJFA 4BFSA 1DARA 1U2RA 2A5DA 4IVRA 4NCKA 3SYNA 3VR2A 3EZ2A 2JGNA 5DYGA 2OBNA 1CS4C 4Q66C 3MGCA 2QAGA 1G8PA 1KTVA 3KB2A 4JLBA 2HLDD 2ZIAA 5E4FA 2O8BB 4QRHA 3ADBA 4RSGA 4D0GA 4Q9LA 2GXUA 1OH7A 4CRWB 3KUCA 2FX3A 4IOLA 3FYHA 3BB1A 5HE9A 2OAQ1 4I81A 4EPVA 1TTTA 3B1WA 5LPNA 1GFIA 3PVSA 1YHNA 1NMXA 1H8HA 1Y3AA 3QBTA 2QGZA 2Q3HA 4DVGA 3SI7A 1TADA 1Z0DA 4Y0AA 2WVJA 4HDCA 1CXZA 5JS8A 1SVMA 2YOGA 3HR7A 4Q7KA 3AP2A 4TMTA 2ZI9A 4B32A 1M34E 1XXHE 1W46A 3ZZTA 1MV5A 1FX0B 1CIPA 2RKOA 3ECCA 2FA9A 3QJYA 3BRWD 4OQLA 5DI9A 1L7VC 1TEXA 2IYWA 2JATA 1KI4A 3QIAA 4C9BA 5BN5A 2C9YA 3A6PC 4AIIA 1KK0A 4CT4B 1CBUA 1NSTA 1EX6A 1Z2AA 2EYUA 4IVPA 3U3RA 8OHMA 1ZINA 4B43A 1HV8A 2H18A 4Q1EA 3C16C 3LLMA 1GP2A 2F9MA 2ZRAA 4HB2A 3MLEA 1VCOA 4OHZA 5JCZA 3CRMA 1UAAA 4HZUB 1QHXA 2ZI7A 1FQJA 3A1UA 3BS4A 4GOKA 3VHXA 1J99A 1E2GA 4EFMA 3OFNA 2QM7A 2MMGA 1G3UA 4LJ7A 3UXMA 2KSQA 4LWZA 1OJLA 3A36A 1SKQA 2CK3A 3QKSA 5HKKA 4ERNA 2MSEB 1N6KA 3LX5A 5KPJA 2VYFA 2FE4A 1Z08A 1Z28A 1E1QA 5B2ZA 221PA 3QENA 4OHXA 4PAMA 1X3SA 3KTAB 2GZAA 5IDVA 5F9HA 2JA1A 1OH6A 3MFYA 2CCKA 3NXSA 4ON9A 3GFPA 3NWJA 3TUJC 3DZ8A 5E95A 1R5NA 1XEXB 3P32A 3PQCA 1VG8A 2GXQA 2VF7A 1U9IC 2QMOA 4Q1BA 1NLFA 2BBWA 4QHYA 4OI4A 1BYUA 4M1TA 2GF9A 3EZ9A 4WVFA 3KQHA 4GOJA 3AVXA 2W6JA 4HZUA 3RVBA 4JL5A 1R0ZA 5TY0A 3IIJA 3VU9B 2F43B 4KU4A 3L82B 5DN6A 3EC2A 1IAQA 3WNCA 2AKAB 3BAFA 2UZ3A 4L4UA 4L9SA 5JWHA 4YQFA 1KDTA 4DKXA 2X2FA 3LXRA 3REGA 1YZKA 1CEEA 3ND8A 4GOXA 2WICA 3PJRA 4BFVA 4UJ3A 4DDTA 1Q3TA 2PMDA 3QXSA 5CM9C 1G3QA 4JVNA 4PC3A 1ZBDA 4NCHA 4ZPXA 5CIWA 3T06B 2OLJA 3GJ8A 1FZQA 4Z8YA 1W0JD 3B1YA 1E2JA 5FUWA 1ZD1A 4W7SA 2GRJA 1ZC4A 1XEXA 1WA5A 2B8TA 3B8HA 3FKSD 3K0SA 4HLCA 4I1VA 1J8MF 2QAJA 1U8AA 5A4JA 1I2MA 2QT0A 2HDNB 1KI8A 1LFDB 4B74A 2FDCA 2R9VA 1IQPA 3NHBA 2Q3MA 1VG1A 3O8CA 1SXJA 4B6FA 3ONWA 2VHUA 2PX3A 4RY2A 2OBMA 4C0SA 1NLZA 5KYKA 4LV6A 2CLSA 3AP1A 1F6BA 4MRRA 3ZS9A 5AUOB 4JVSB 2B92A 1E9BA 4BPBA 3FMIA 1NBMA 2ZROA 2RHDA 3CPEA 2HV8A 4NDZA 1F2TB 4RZ2A 4W5HA 3A4MA 3QXCA 1VIAA 1GTVA 1FP6A 1SZPA 3RRZA 3K70B 1BYIA 3LO5A 2NQ2C 4BRWA 2CE2X 2FFHA 2FN4A 2OSBA 1E94E 5DIFA 2IT1A 2WOOA 1IY2A 3FE2A 3JVVA 1AN0A 5JRJA 1XMVA 1EK0A 4C0JA 4B35A 3P26A 2K5UA 4DIDA 2VO1A 4JJKA 5DH9A 2IEYA 2IK8A 4JLKA 2WOJA 5FR1A 3LD9A 3QVUA 1WXQA 4AG6A 5HZKA 3K09C 2XXAB 4RD3A 4JKYA 2WZQA 3B9PA 4IW3B 5GJWC 2HCJB 4K46A 4W5WA 1OYWA 2NG1A 2VP5A 3HR8A 1L4YA 2QP4A 4NCNA 3EPHA 1E79A 2KJQA 4QBFA 2AN9A 5SZIA 4OQFA 1KMHB 5HCNA 1R0XA 2Q9BA 4G5OA 4HAXA 5DNYB 4HLQB 1GNQA 1G21E 1C9KA 4AG5A 2RGAA 4MH0R 4F91B 4ZDJA 4G5GA 2BOVA 3CRRA 1T0HB 3JZAA 4KLZA 4Z51A 2IXGA 1OFIA 4HUTA 3MJHA 1E2MA 3DMNA 4PPNA 2BKUA 2Z43A 1C1YA 5JHHB 1J2JA 4FMDB 2PZFA 1IJEA 3F8TA 4URXR 4JVMA 4JT4A 1IN5A 2XEXA 3ZZUA 1YJ5A 2ZR0A 2OFWA 4IJMA 1IY1A 3W9YA 1T8UA 3SFZA 2QL6A 2OEPA 4P33A 3SJZA 1KI7A 1GAJA 1QBKC 1X86B 4S2EA 1M7GA 2W83A 1TMKA 3AVWA 3ZH9B 2GJ9A 1NVUQ 1U8YA 4R7ZA 2ZRKA 1E4VA 4B75A 4DT1A 5KNBA 1AS3A 4NHOA 5JRZA 1E3MA 2V3CC 4KJZA 2X8AA 1E0KA 2C9OA 3VKWA 3B85A 2HXSA 3U3KA 3KX2A 3Q9LA 1EX7A 1DEKA 5JWRA 1OT3A 2X19A 2O0JA 1IN7A 1LS1A 3SYLA 2IS6A 3GLGE 4M9ZA 1D9ZA 3FMFA 5F2EA 3EA0A 3RRNA 4GL2A 1E2EA 1YZNA 4WA7A 4B33A 4B76A 3CH4B 3K8YA 4NYJQ 1G6HA 1W5TA 2BBOA 2IYQA 2JLSA 4OHWA 5D3QA 3ZVRA 2QRZA 4AKHA 3R9IA 3KQUA 2A2ZA 2QAGC 5BN3A 1S3SA 2JLVA 4EPTA 2ECKA 4MYCA 4BFWA 4JJZA 3AUXA 3THXB 1T5IA 4JLPA 1II9A 3OE7A 3SJBA 4M9QA 3GFTA 4DBLC 5H70A 1XPRA 4ZKEA 1W4CA 1CTQA 1UBCA 3Q5EA 1LV7A 1KKMA 4JS0A 4MRPA 4NTZA 4P4TA 2FFQA 4R9UC 4V0LA 5EE1A 4ACBA 2O8FB 2ZYWX 3VNUA 1DG1G 2HYDA 2R65A 2A5GA 3IBYA 5JBQA 1KJZA 3WP1B 1FPMA 2IA5A 3IHWA 1OH5A 1OHHD 1QHIA 2HJVA 2AFHE 3RS2A 2RB4A 4HAVA 5FR2A 3RC3A 3WHKA 5CJ2A 1JR3D 3K1JA 2GXAA 5GVRA 4MA4A 3W6NA 3ZDQA 1UBGA 2NZJA 2QU8A 1GSIA 2IYRA 2YZ2A 4FMCF 4TLBA 1M8PA 3FPAA 3G0HA 1OLOA 4GP7A 1P6XA 4AY2A 5G3ZA 2IWHA 2GILA 2O8DA 2YOFA 2IL1A 2ZSFA 3CONA 2VP2A 2QE7A 4CT5A 3CUEF 2EWWA 2QSYA 3PIRA 1T4GA 1UFQA 5DLQC 1GKYA 2CCGA 2GWHA 2D06A 2FV8A 2A3RA 1LB1B 2P6NA 1VTKA 2WJVA 4LJ9A 421PA 2C04A 2WMOB 1ZP6A 1R5OA 1LTQA 1JPNA 3MWYW 2AXPA 2O8FA 1OFHA 4B71A 4IEIA 4QM7A 1BS1A 2QT1A 1XTQA 1ZNYA 3MD0A 1VCNA 2H57A 2I1VB 4PPFA 3UPUA 1DAGA 4G01B 4PQYA 3VFDA 2WBLC 4AYWA 1CULC 2ZJAA 4JBWA 4U5XA 3I73A 4AWXA 1Q1QA 3KQLA 1W7AA 5JSZB 1AIPA 1FFHA 2O8CB 4W9MC 4P31A 3AV0B 3CRQA 1QZXA 4ARZB 1GUAA 2QSZA 2BV3A 4X8LA 4BFXA 3GD7A 2QRNA 5J4VA 1W5SA 4QHSA 2C03A 5FBVB 4YMSA 1M7HA 3WHLA 4JT2A 2F1HA 1UKZA 1KK2A 2PLFA 3OAAA 3GLFB 4TQAA 4V03A 2BMEA 1SVIA 1G17A 3I61A 2VTKA 1XMSA 1OIVA 1HE1C 1FQKA 2Z4RA 2WWYA 4A0FA 3QOFA 4RCZA 4ZO4A 1R8QA 1G8HA 1ZYUA 1KI6A 1DS6A 3PV0A 2OZEA 4MGKR 1MRSA 4BZPA 1QG4A 2NZ8A 4Q7JB 1ZMXA 2YYZA 3T35A 3U44A 3BBPA 4KVAA 4TL6A 4BLPA 1GIAA 4BLSA 3H1TA 4JLNA 2ZVPX 2AWNA 5TARA 1OF1A 2J87A 1NI3A 5FBWB 2W0SA 5FUVA 4P4SB 2ZE7A 4JL6A 1A5TA 2CHQA 2QY9A 1OXVA 3AQ4A 2FMXA 4BLQA 2XJ4A 1UEIA 4PTLA 4Q4HA 4KSCA 5FBRB 2QI9C 2E87A 5KUTA 3B2EA 2ODBA 4FCTA 3BXZA 1E2QA 5KDOA 3N70A 3IEVA 4A1FA 1SXJC 4L16A 1G4UR 2V6JA 1NP6A 1TL7C 3JZMA 5DI3A 5LB4A 1M74A 4DUGA 4DZZA 3BC1A 1Z2CA 5JJIA 1W49A 3DL0A 3BJIC 4DRZA 4I99A 2QQEA 4TLCA 1E1RD 3IPXA 2G9NA 3CPJB 1Z63A 3HU1A 1NMZA 2IF2A 3UANA 1Q1ZA 4BGDA 5CK5A 6Q21A 1CKEA 621PA 2OO7A 4M1SA 1GKIA 2ZJOA 2ORWA 2YNMA 2E1RA 3DDCA 4Q48A 4A0HA 5BW8A 3P4XA 3O8RA 1U0JA 2C98A 4C2UA 1ZCAA 1U90A 1G5TA 5AJYA 1NLYA 5JLJA 3BFKA 1XB2A 2GDJA 1NL3A 1U94A 2X77A 1W36D 1XZQA 2D3WA 1G7TA 2J9RA 3F0TA 5FTNA 5FPKA 3L0OA 4TN1A 3R9XA 1XEWY 4HZIA 4A9AA 4H1UA 4AYXA 1NN0A 3X1YA 2DWOA 2R62A 2PZEA 3W3ZB 4GSYA
chains in the Genus database with same CATH superfamily
3VI3B 1P39A 1KMQA 4RX1A 1REQB 3OPMA 3UA3A 3ZBPA 4BY9E 2Z2YA 3DVSX 3E3MA 1NVDA 3WNDA 1GG5A 1RWMA 2G9ZA 4ZYLA 4M86A 1RR6A 3C3EA 1TJ5A 1PR1A 2DYKA 3BMCB 2Y77A 2Q7OE 1JFRA 5AIBA 4P7BA 1PFQA 1QIMA 4IHJA 5AVTA 1O5TA 4GBMA 3D6JA 4JR1A 2OLKA 5IJZA 4WJKB 1NY6A 1KDVA 2JCSA 2WHXA 5A4AA 1Z22A 3GLHE 3AESA 1Y4AE 3A8TA 1QWOA 4K86A 2JFNA 4QAJA 3EAQA 2Z58A 4UAJA 3IEUA 4OIMA 5EFZA 5LYJA 4YDQA 3T5MA 4Q19A 4XZ3A 2DT8A 5F1KA 5K3EA 5GADl 5B1SA 2LTAA 2MTBA 3IXLA 4PBSA 1DJNA 4CG0A 1K89A 4YI3A 2QBYA 2I7VA 4IGEA 2WA2A 4Q7EA 4OMCA 5IDYA 4N76A 4MS3B 4LZJA 1WZUA 1AUOA 1EZ4A 1PBTA 2WJ6A 4E5MA 5EJ4A 3PNQA 1DT3A 3JQFA 4MV9A 3WX0A 2Q2QA 3ZXYA 2PZBA 1T5SA 1TU4A 3KPYA 1H2HA 3I5XA 3BDVA 4LJ4A 3ZHZA 3DOOA 3FVVA 1YIAA 5AHKA 5AW9A 3RAFC 4EYSA 3PYMA 2XZLA 1TRHA 4MXDA 1KZ7B 2WSLA 2XF8A 4ZQHA 4O2BF 1VKJA 1Z6AA 2I1WA 5ALQA 5GONB 4KXYA 1WDLA 1K7YA 1CUJA 1KYIA 4GKVA 4MRSA 2I66A 1L4EA 1SUEA 5LDDC 4N1AA 5G1PA 1NHWA 2P4UA 1DTSA 1QFSA 1QRUA 2XYGA 4OHKA 4PO8A 2JGFA 4B2IA 4YUAA 2OP0A 3WY9A 5CGQB 3M6MD 5GOTA 5TV2A 2H06A 5A62A 1T1RA 3TQCA 5C52B 3U37A 2Y1KA 3WAGA 2J6BA 1HOTA 4NL4H 1YZTA 3WFZA 1OT5A 3PPYA 3ZLTA 1JR6A 2QVYX 4L0DA 3QNMA 5DGIA 2EFEB 4AMVA 1VKRA 1XQ6A 5BVHA 4L95C 3VR3D 4R8SA 4G4JA 2E6UX 2WAYA 3ZGOA 1GAXA 3IA7A 4IJUA 3UUFA 3IURA 4U3JB 2JLWA 2QA5A 2UVQA 3U2QA 3BSYA 4XYBA 2A5YB 4W5QA 4BU0A 1CQIB 1P7VA 5FWXA 3VO9A 1R6TA 1T43A 1C2YA 3DHWC 3VAYA 1SD5A 3LV8A 3WKEA 3DD1A 3AWIA 3GEDA 1DV1A 3THOA 4C4XA 1LEHA 3EOAI 2MT9A 1XMJA 1ZJ4A 2XUIA 1XCPA 3PUWA 1CUBA 1B8NA 3PQ5A 2R2AA 4MTLA 5HDBB 5C8XA 1CJKC 3LLUA 2QMYA 3AXTA 1HQDA 4C3VA 4NZPA 3IDOA 3CKYA 4DTIA 5ITVA 5B3AA 5LC1A 1AK1A 1XLTC 3KYCB 1DV2A 5DHAA 4Q05A 4RM3A 4G1EB 4EF6A 4ZMRA 4MRNA 4UOZA 3NHLA 1SWVA 1U4NA 2PLRA 5DCWA 4NXNB 1R4NB 3UPTA 4ALJA 1P73A 3MS7A 2NVOA 3DQZA 4FBMA 2C5GA 3VISA 1MMFB 1WB9A 2D7CA 3HO1A 5DPMA 3S99A 1CRLA 3H1GA 2X6RA 4LHVA 3MGKA 4E09A 4Y9DA 3CF4A 3DF9A 4FE3A 2I3AA 2A5JA 4HFMA 5T57A 4MS1A 3R4CA 5F76A 1FU8A 3WLAA 4EITA 3FYCA 1M72A 4HDMA 3PNOA 2A0YA 1XKQA 3DLAA 5EP1A 2JAXA 1P0MA 3PEEA 4BNYA 1XAHA 3ITNA 2Y1OA 5FBLB 1JH9A 2GK7A 1LNQA 2KLHA 4Q1DA 2O50A 4PRKA 2Q45A 5GM2A 4OJKA 4V24A 1EIZA 5L3RA 2X76A 4ZAWA 4X95A 4ND3A 5FOWA 3G5TA 3IUYA 1L2TA 1G5RA 2BFBA 3QPWA 3LCCA 2B5WA 4S1PA 4WK2B 1IBKB 3I6MA 4I9GA 2XYQA 3S2GA 4C7OA 4Y6RA 4I5EA 2CMFA 3VSEA 5KSOA 3EIEA 4HN9A 3TSCA 4YP5A 2YY7A 1O6FA 4BO0A 5BUZA 1DVRA 2D1RA 3SHVA 5AI5A 2EZUA 1EQUA 1DXHA 1N5RA 1VGRA 2QXUA 4PGAA 1LSSA 4UEQA 2NU8B 3WYFA 2ERYA 5FTLA 3S1AB 2J0SA 4INZA 4TMWA 1C50A 1ZGGA 3B3GA 1Q16A 3NBFA 1OSNA 3O95A 4V02A 2DM6A 2PJZA 5E3JA 2FFAA 4BVHA 5AJTA 2ZU6A 3EGEA 4Q3CA 4G1FA 1U0LA 2OQIA 4EPXA 1ORTA 1WF6A 2Q0XA 4UHEA 4WY2A 3VZBA 3KQYA 2JJ2A 5BXYA 4XWTA 1HE3A 1MA0A 2VJBA 1O94A 2DWPA 3KJNA 2MMCA 2ANCA 1NRIA 3FPEA 4LHYA 5TQJA 1FDUA 4ZV7A 5IUJC 5J23A 1DXOA 1CHDA 5TQ2A 2F2TA 3FBGA 4QYXA 1BXRB 1LW6E 1VE9A 1T2VA 2Z9BA 5AOAA 3DOEA 3TOXA 3IRUA 5DNWA 3VR4D 3WK8A 2B35A 2WJ4A 1I7PA 1XIVA 2ZRFA 4P3KA 3UAWA 2O19A 3ICWA 3IP7A 3RNOA 5IASA 2BGMA 3CH7A 3M8KA 3VTKA 4BE9A 3LT5A 3T3NA 2PJRA 1GZVA 3FX2A 3SSMA 4FXOA 3UJ7A 1TZMA 1CK4A 2NO1A 3VKHA 2XH8A 1WL8A 2YWFA 4A5SA 3GPIA 4MYDA 4YQYA 2VR1A 3TL2A 5I5EA 4Z1MA 4XM1A 2ETVA 1OU0A 4JI8B 5KC8A 1QCCA 4C07A 3PJFA 1S3IA 3I2JA 2R96A 2V54A 3O73A 5E7MA 1MT0A 1OW3B 4F84A 3VH4A 1QGZA 2Y0PA 1QIFA 4CEJB 4RBNA 1FYXA 3ENNA 5JZOA 1L8LA 3WZ2A 1VOTA 4OLJA 4Q4LA 3LIPA 2VBFA 2BJWA 4UXIA 3ZXXA 3PQDA 4OJMX 3TJZA 4CNQA 5F5NA 2EIHA 2OY0A 4X64B 5BSEA 1B23P 3NNNA 3LE8A 3TQQA 3EY4A 4UFNA 4WI1A 5K7SA 4EF4A 4L08A 5HHTA 4OMUA 2BMVA 4ZQGA 2V03A 4F7DA 4B6OA 2Z08A 3F8WA 4EGCB 4U7GA 1XRSB 1B42A 3BHNA 2R7MA 2VDMB 2G4LA 2Z98A 3HU2A 2CLHB 3PEUA 4A23A 6NULA 3U4IA 2YCBA 5DM4A 3TUIC 3NRBA 1NJ8A 1N6IA 1PJSA 1UP4A 3C41J 3TTYA 2QI9F 2VUSA 2BMDA 5FHRA 2CNNA 3KXPA 1K63A 1AHHA 4DB4A 2VSYA 3U7HB 1QZZA 2YNMC 2PUVA 4BVEA 3R9WA 4KR2A 2C92A 1M1NB 3EIUA 3ELWA 4PFJA 4F5DA 4M9UA 3DO8A 4IGKA 1E2DA 2DHEA 4ZI7F 2QLTA 4YV7A 1OX4A 3EXG1 3V7WA 2I76A 4JHLA 1VHTA 4OUDB 5EP2A 3IIKA 1G18A 4POAA 1X1RA 2IP1A 4H3SA 1EGAA 1Q0QA 3G2PA 2J6IA 2QN6A 3PNLA 1JTVA 4JLVA 4LYYA 4ZC1A 1ONSA 4KI0A 1F20A 2J09A 4RA9B 5KO2A 2ODNA 1SGWA 1E60A 1UBJS 1ESZA 2LW7A 1J90A 3NBKA 3P2EA 4OU4A 4ENTA 3EF1A 3OPYI 1I4DD 2JRCA 4H7JA 4RUKA 5ALHA 2NU6B 3LUJA 3KQLA 2GAIA 1T8TA 3W4KA 5IFLA 1C9YA 4MKXA 3ZY6A 2WVHA 3ORQA 1MHPA 1C7JA 5B36A 5KYTA 1BA3A 5B6JA 3Q7PA 1T0PA 3AINA 2I9PA 4E15A 4GGOA 4B6PA 4CKYA 4KFTA 1ZONA 3NUGA 5ITWA 4B34A 3FNFA 3IE1A 1D1SA 3HYTA 521PA 2FUCA 1QK3A 2CVZA 2LCQA 2JLUA 1JPJA 1J25A 2G17A 4O1MA 3WGJA 3OMXA 5IARA 2PM8A 3KR9A 2D62A 1JLSA 1QGUA 4IMPA 3I1JA 4ND2A 4G0QA 3WBKA 3FUTA 1I80A 2DVMA 4ZIRA 3ZHBA 2QTNA 1VIVA 3OP4A 2IOFA 4PC6A 3V4SA 4BB0A 1NBHA 3C8HA 3ZPXA 1JECA 2CMDA 1F0KA 1RHRA 3AC0A 1SZCA 3FPGA 3OLVA 2GZ2A 5IK2D 3P9KA 4NQRA 1EGHA 4NOMA 2XCIA 2Y99A 2IY8A 2XVYA 3O4VA 1P2SA 1JLLA 4DR1B 1PJ4A 4Q3OA 3ZGXA 1IVSA 1IJKA 1RPJA 2VK8A 4DIEA 4HI0E 1F4LA 5CCDA 1E6UA 3I23A 3SR4A 2FF7A 4L1KA 3X44A 1KAGA 2QJFA 4KXQA 5BR4A 4LZWA 4EA8A 2WE8A 1ZUIA 4HAIA 1PTKA 4TWRA 5I3CA 4QNMA 4RMGA 3VO2A 4F4UA 3HG7A 3Q6MA 4R2KA 5CDTA 1QQTA 3IHTA 4IDNA 5DNVA 2QRMA 1Z0UA 3OUUA 3PKZA 4WNYA 2BJVA 3E70C 1M67A 1R10A 4G8JA 4EPYA 1SUPA 2BI8A 3SE7A 4PX9A 4LDAA 1U3DA 4PZUA 2DPMA 1J0BA 5CDHA 3PUYA 3F5SA 2PUAA 2YJGA 2IW1A 2BGKA 3NHPA 4KWHA 3ZE0B 5A05A 1RHUA 2XKBA 5FL3A 1KEEA 2FSVC 3S55A 4IWXA 1G9TA 3H1BA 2ZXFA 4AO6A 4C0WA 1YL7A 4TMKA 3E82A 5FI1B 3WGMA 2VKTA 3K3PA 1GCAA 1KO5A 4JYPA 4HMQA 3FNIA 4P3NA 4TWIA 4CDGA 5JEEA 2AK3A 1CB7A 5EQTA 4A73A 4PINA 2QMZA 5F3DA 1T5BA 1Z74A 3TD6A 5J3JA 13PKA 2G0NA 5F7JA 1C9DB 3DZBA 3EVCA 2WKWA 1F2TA 3ABRB 3BCRA 3G5MA 5JS7A 4MIOA 3EB9A 3QXHA 5AJVB 3KETA 1NI4A 1FPQA 2BE7A 1FDWA 3NZEA 3SSAA 5FDFA 2XB2A 4YJ3A 5BURA 1AKTA 1NW8A 1BGWA 1N6OA 3I83A 1F17A 1L4LA 3FF4A 4H7DA 1KYYA 5IJ9A 3QF4B 2TSYB 2PEZA 4BKUA 1NUTA 3FN4A 1A9OA 2IDMA 3GGPA 3KYDB 3TDMA 1UKEA 4AKIA 4R1TA 2FW8A 3KXIA 4J0GA 3EVBA 2DXIA 3UMGA 4HGZA 5LP6C 2QX6A 3EDCA 1BIFA 3EQ2A 3SYKA 1JI3A 3DPSA 2DLNA 1NUPA 2PGLA 4ZO8A 1MOQA 4HSEA 4ML3A 3BIFA 1NW4A 1GRCA 2MHCA 3IJRA 4RS4A 3WLIA 3IBFA 1Z47A 1A9RA 1W0KA 1MF7A 2C8KA 3EXG2 3ZX5A 1DLJA 1WY7A 4JUBA 2HIGA 4DMGA 4OB6A 4O4IA 2V8BA 1PUXA 2QRHA 4C2TA 4FHZA 4ZANA 4ETMA 2MSKA 2V65A 1L5RA 1YFZA 3KVVA 1I8TA 5KNCA 3JRXA 4G36A 3IDSA 2WF6A 3G0GA 5I3ZA 1AUQA 1OFUX 1MC4A 4G85A 1D2NA 3IS3A 5ICFA 4TM7A 1ZICA 1BDMA 1YRAA 2YMMA 3G59A 1J0XO 2OXCA 4PQRA 4Q00A 3NVKI 2Z5FA 1P7YA 3M1YA 1IYZA 2QB5A 2ZRBA 4AKSA 5JAMA 4ALMA 1I51A 4B2PA 1JDNA 5P21A 2PRKA 4HAUA 4W7HA 4ZEMA 2RH9B 2UAGA 1XD8A 3EZGA 1Q2UA 3DL4A 5TR9A 4WT7A 5CVUA 5ILQA 1ECGA 4HTAA 3B1ZA 4NBUA 4GMGA 3P9ZA 3SU8A 2IEBA 4Q7MB 1L5YA 2OT3B 5FQNA 3RQIA 4YMLA 1VKHA 4IXMA 1GTZA 4GGMX 1R0BA 1UAYA 1GL6A 1JJ7A 1T24A 1TDJA 1YK1A 2H4XA 2NXJA 2QGFA 3DWIA 4IIDA 4R41A 3EK2A 2E4YA 5DTRA 5JDIC 4H31A 4YUVA 2B30A 1NQWA 3BWYA 3G68A 3R9KA 5JNUA 5A3VA 4OAOA 5A6SB 1XVUA 1I4LD 5AMXA 3O9ZA 2JA2A 2X7JA 3SEAA 1A5BB 4CZ2A 1X13A 3OQPA 1UDWA 1NRWA 1X3LA 2RHCA 3E2PA 2P9BA 3HPQA 1CUSA 4O4HB 4BQQA 4CHTA 5JMWA 3I0NA 2BHSA 3PP8A 3Q7IA 4NF2A 1U0GA 2QXYA 4EZBA 3FWZA 3VH3A 1WQ1R 3OJOA 1E8NA 1W8IA 2ZS7A 1RXEA 3LPAA 3NGXA 2KM1A 4XH9B 4ZEXA 2DSTA 3R5JA 1L5KA 1EINA 3OECA 5F7ZA 2B7BA 1E2IA 3RYIA 2J0UB 1ZO8A 4QGBA 4TLDA 2UUCB 4L8WB 1LLCA 1CVLA 1E9EA 3A6EA 5JSQA 2VQ6A 1N9GB 2QZPA 2CYBA 3GPLA 5KYGA 1VP3A 1FK8A 3CMMA 5CH8A 4PIPA 2CK3D 4RHTA 4Z4HA 4DV5B 5B53A 3SG0A 2CZCA 2QUZA 2A1TS 3P9IA 2XY4A 1QB8A 3NBZC 1WUKS 1GCOA 1XT6A 1JJAA 4JP5A 2DMRA 3NRCA 4QIHA 4Q39A 4FLMA 4RSHA 1PKEA 4TLAA 4XVHA 4PYQA 3N76A 2ZSHA 3DEJA 3K92A 3PCXA 1LBSA 3Q8WA 1S8OA 4NPAA 1F5NA 3PXBA 1GZSA 5E6SB 1LX7A 3AF4A 2ZBEA 3LBHA 4DZRA 1XLWA 2HX1A 3S2YA 3L1UA 3NHUA 4GM0A 4LISA 1BDHA 3AG6A 4B2YA 3KSUA 5C4GB 1R4MB 3NEYA 1L6RA 4QM6A 4CR8A 1K5PA 1HY3A 4O1IA 1M8KA 2WT9A 4F4FA 1IQ0A 2GLXA 5DXAA 5ALWA 3IFSA 3PCTA 4XVUA 5D7BA 4NBNA 4AMZA 4M38A 1U3GA 5AVKA 5B4VA 3FMPB 4PZ9A 2Z4TA 4XQEA 2V0GA 5H16A 4HV4A 4GKBA 3WO0A 1AKRA 3RU2A 2KW5A 3FM9A 1UADA 3LKVA 2ZUFA 3NHMA 3FPKA 1P7CA 4TOIA 3RHSA 4R2MA 4CMJA 3UGKA 4JMLA 5KOHA 1T6ZA 5H02A 1C9NA 1ULAA 2WJZB 3OZUA 3RTCA 2I4MA 2V6IA 2PS3A 1WLYA 1Z2EA 4P38A 1RVV1 2HHCA 2RHJA 2Q2OA 5I7EA 1U7PA 4J1TA 1SHKA 1USKA 3AJAA 4GLBA 3I92A 2Q3CA 4B3SB 2FUNB 3AR9A 1I01A 5FEMA 3VX3A 3E1SA 4ESVA 4EPRA 2G04A 2WKQA 3BIOA 5F35A 4BKMA 1UJCA 3VH2A 1GTL1 4OHPA 2VUTA 4V0KA 3PX2A 4BFTA 3JQAA 1FC0A 3VDXA 2XWQA 1X1QA 1AS2A 4L6AA 2WYWA 4DA4A 5B58T 3ZLUA 4X71A 4IXWA 5ADHA 3R5FA 4MB2A 1X1CA 1PG2A 1Y9ZA 3WSTA 2WB4A 3TEMA 3DCYA 4S35A 4AROA 4UQOA 2WYVA 5I8WA 1COWA 1HUQA 5FPYA 4HOYA 4LOIA 3RSCA 1KH3A 4A8TA 1NUUA 2NPFA 2RSLA 4MARA 2NPOA 2V9ZA 2J3QA 3U4MA 3WB2A 3D0KA 5D00A 3GN1A 3GLVA 1KH2A 1P7WA 2NSDA 4JJAA 1ODJA 2WMYA 4C6TA 2LPMA 1X7XA 2O7SA 3Q0EA 4BGIA 3N6XA 3JAMA 3SEFA 1H3NA 3FCAA 2HQBA 2O8CA 1NVGA 2K6GA 2GBFA 4KXMA 1PWZA 1ONOA 3SZGA 4MP8A 4ARZA 2GPJA 2XMSA 1ANKA 3GV0A 5CXSA 5JI2E 1PK8A 1Y7LA 1OVMA 1KYQA 1E9DA 4HGYA 2IH4A 1W4BA 1V1RA 2NSHA 1WW2A 2D5LA 3EH2A 2QIOA 3BE4A 4R1OA 1I33A 2GN1A 2HNAA 2LWIA 3FNQA 3P9NA 3PTAA 1LJUA 1Z3CA 3TNFA 1Z7YA 5COAA 3RYFB 4RANA 2GM5A 4IILA 4EA6A 4V1CI 1NATA 3CH5A 3KWFA 1TZBA 3MTBA 4NJEA 5EIBD 5BNIA 2FW0A 3ZWYA 1JQJC 1X92A 4JMPA 1H0HA 3Q3JB 3VGJA 1Z6GA 2OKCA 3HMKA 2JANA 2QVGA 4GW3A 5KC9A 4M2LA 1H3EA 2HLDA 4HTFB 4YP0A 4OXNA 2AZ4A 4N65A 3CEPB 4LJKA 2QQGA 4DG9A 1VZ2A 2I8LA 3RM3A 3NH6A 4NCXA 1Z4KA 4HS4A 4PCVA 3KP1A 4LK2A 1BA2A 1XRRA 2DFLA 2DSNA 2YVQA 3EXAA 3GRPA 4ZQBA 3ZIDA 1G7SA 4EY8A 2OV6A 3QGMA 3ZDAA 3N8HA 4GP9A 1T4BA 4ZOAA 2BD0A 1AE1A 4X1YA 3WQRA 2ODPA 3Q41A 3T5CA 1AMNA 5DK4A 3BL8A 4RA6A 4DBVO 4TWBA 2G1JA 4W1SA 3PRKE 2QJWA 1CQZA 2EKPA 2D4AA 3WL5A 1DSSG 3RC7A 2HZBA 3I1IA 3SJ7A 3L0SA 2I4OA 1VP9A 2CJWB 3DDHA 2PBRA 5G0WA 4E03A 5MHTA 4BDSA 4YDHB 4N3BA 3SIRA 4ZXFA 4KMSA 2VHCA 3H5AA 4HLUA 3UCXA 3OMLA 4ZPJA 4ZGWA 2ZRMA 4RM2A 4X6XA 4W4TA 3QPDA 5HKOA 1R18A 2CJYA 4C7BA 1T34A 1Z5OA 2AXNA 4C43A 4RGBA 3BRWA 3QXXA 4GLJA 5D51S 1CFJA 3H4MA 3IHKA 5IAJA 1HFWA 2QPOA 4RHYA 3M0EA 3GELA 2DFPA 1SULA 1M6WA 3P2JA 3OIDA 3RWMB 3ZEIA 4AMUA 5I7RA 5KNBD 3K70C 5TS3A 3PXUA 4DSUA 4EYQA 1U9IA 1YIDA 4BFZA 2ZT5A 1W76A 3QFTA 1RC1A 1GEGA 2HIAA 4RZ3A 4AN1A 4P92A 2YHUA 5K3OA 3N59A 1W88A 1CR0A 4BL5A 5HIJA 4KMOA 3SM9A 1D0SA 1OR8A 3O8QA 3CNEA 3VR5H 1I1OA 3L0PA 4R2HA 3GR6A 1AX9A 5GJBA 4NVRA 1XEFA 4CM6A 1IJBA 4DOMA 1PQ4A 3PGVA 5KCZA 4YYEA 2WB2A 1S5PA 3IEMA 2FSPA 4IX9A 5CA1F 4RL6A 1OTHA 2AFIE 4PX3A 4ZALA 5CNKA 1F3LA 4L78A 1SQSA 3NKFA 3SBEA 1IONA 1QGDA 2FG7C 2VZ9A 4OJTA 4DRXA 3COVA 2ZVQX 3CLUC 3ELDA 5IFKA 1REQA 2V9CA 1HBJA 3MVEA 4KEAA 1O89A 2WFLB 1JHVA 2BN4A 4IFEA 1CV2A 2LE0A 5SY9A 2VPYA 3NONA 4CMCA 1ICIA 2IXDA 3BMCA 3AM4A 5FOVA 2BE9A 1LGYA 1MB0A 1T3SA 4QYMA 4Q3LA 4WK6A 2JEZA 1MOZA 1OKKA 4IIVA 4DREA 3R77A 4E33A 1PV4A 2FY8A 3HY3A 2VDKB 3D3QA 4JQCA 4D0LB 4C7JA 4TSRA 1U2SA 1H42A 2OILA 3EYWA 1L5OA 1U28C 3A2NA 1KQFA 2O5EA 4GZ6A 4UHCA 4R2LA 5D3MB 3FOAA 4G9BA 1L7NA 4KDEA 1T8YA 3DKKA 1ORWA 4IIBA 3FY4A 4ZQCB 1ISFA 3EXEB 1Q0RA 3L1IA 5J1SB 5DV9A 3O3OB 1A1VA 3U62A 1XZNA 1OX5A 2B8WA 2ACEA 4UU1A 4ZCLA 1Z6TA 4U2CA 2YWBA 2P9FA 2O0MA 3ICEA 4I6EA 1KIMA 1U7ZA 4BXOB 5JS6A 4MS3A 4OHFA 4QOSA 4IDHA 3SHFA 1U98A 5A4MS 4IUBS 3SS9X 2EU8A 4CYMA 3F5FA 721PA 4NEQA 2ZEJA 1K4MA 4I3FA 1OFUA 2PVSA 2HF7A 3L0CA 1AHIA 2OCYC 2VL7A 1AY0A 3PQFA 1BTOA 2KBEA 1BD3A 3UWDA 4H15A 1VCIA 3GRZA 4LSWA 3L05A 3GEPA 4TM8A 1O77A 1MHTA 1GITA 1R9JA 3D8SA 3H0KA 3TPFA 1JEDA 3DDNA 5GONA 2GTIA 3TB4A 5ALSA 1G19A 3ANNA 3P94A 1QAMA 2Q1TA 4FVTA 2Z2ZA 4IGFA 4OSPA 1S0UA 5CFZA 4AJOA 2IZZA 3HM9A 2D59A 2J0VA 4M55A 2FPMA 1XWFA 2DC1A 4QNRA 4FW8A 4L7QA 3IT0A 4PGFA 5E38A 4HB4A 4FZJA 3V3KA 3WSVA 5BWLA 5JE8A 2HT1A 2IE8A 3H84A 4H6VA 1AHNA 4BTVA 1UQTA 3G85A 1C0IA 3B20A 1WKCA 2KMLA 4ZAYA 4ZK2A 3N2GB 1G8FA 2X40A 3R3HA 4K8RB 1KWKA 2E21A 1XCGB 1JKFA 3OU7A 4GYYA 2C7OA 1HWYA 1YQDA 1GPMA 1S8FA 1IHXA 4G1VA 4CM8A 2Z09A 3T34A 5EMKA 1XL0A 5HJ7A 1VMKA 1YL6A 1TQ6A 1L1QA 4A6XA 4DSAA 1UWVA 4U39A 3VR6H 1IBSA 2R7NA 3DEYX 1ADFA 4F97A 4LS3A 1K1EA 4L07A 4MQLA 5AM2A 4I4TA 1CQIA 3P19A 2ZIXB 3TCKA 2PV7A 4LECA 4UTRA 1OD6A 2A9FA 2Q4OA 5J5AA 4ETNA 2QTVB 3N2LA 1NE7A 2B3DA 4K8OA 5C31A 1V39A 2QAGB 4B3XA 1PFKA 4QOHA 4DCTA 2VHVA 1UJ2A 2G5TA 4IX1A 4HPJB 4F6CA 1RYEA 1NASA 2ZI5A 4UBIA 3DE6X 3QFCA 5EEGA 1IQUA 3I01A 3OG9A 4NPCA 4ZRMA 4G3XA 4OOEA 3DT9A 3PUJA 1TVKB 3U0BA 4GPD1 4FZ5A 2IBMA 4RD6A 1U7DA 2NUTB 1YNSA 1KNQA 1DIGA 1KO4A 3NT2A 1GPDG 3BWXA 4L4SA 4L74A 5G53C 1YR7A 3CURA 4WOCA 3W4JA 4JJIA 3B1XA 4DQKA 1ZISA 3Q7SA 3LQ1A 5CDFE 5HMMA 2LZ0A 5HK8A 2C9DA 2D7JA 2VHJA 1OXUA 2BEUB 4XGKA 4JJEA 2B8JA 3UGTA 4CTKA 3ZHXA 4BWFB 3C7TA 1JVBA 2DKOA 3KZXA 4I1SA 4GPIB 1ATZA 5IUKC 2BC9A 1NVXQ 4C87A 1XHEA 5DMHA 3HKBB 4BMYA 3KEMA 4LVCA 1QRAA 4KMRA 4Q9IA 2GJSA 1G8MA 1UP7A 4XSVA 1SKYB 3K5WA 5BN5B 4WZAB 4KN9S 1UZMA 3H1AA 4RXMA 1O6CA 3O3CA 5TF4A 4H7PA 4R2IA 1HKHA 3LIIA 1E92A 1NF8A 1NMYA 4EKDA 4U7DA 2O05A 1J5EB 1JAXA 4TL8A 4CQMD 1TAGA 3MAGA 2O7NA 2C88A 3H42B 2WJAA 3EGXB 3DW1X 1MD9A 3SJAA 5LBIA 3V48A 2WZDA 1JDBC 3K2QA 3I01M 3FCEA 1ORVA 4HRAA 1LY1A 3RVQA 3WRWA 4HJXA 4BVJA 4GL4A 1VSVA 1J7JA 3S1AA 3VHXB 2G7ZA 4E22A 1A8QA 2Q6OA 4YO7A 1TGYA 2YCLA 2M6RA 4NE2A 5UKDA 3ZE2B 3ZQUA 4J91A 2DUNA 3H2BA 3F7OA 3C2QA 5EZYF 5A3RA 3ZE1B 2E4AA 2POQX 4HNUA 3THWB 2BKEA 1Q5PA 1OWNA 1YAJA 4I55B 4D9NA 1M6YA 5BW5A 1BCSB 1CRQA 3TJRA 5LNK6 2Z6AA 2QLFA 3NDPA 2PX2A 1BXRA 3KQKA 4DYDA 4PWZA 5AKGA 4UNIA 1OE0A 1ORRA 1H69A 1XAJA 3EVZA 4GVLA 5ALNA 2OESA 8ATCA 3RIXA 4UKDA 3JW8A 4C7OB 3I58A 1YJAA 2ADOA 1N3IA 3CF6R 1VPLA 1RIIA 2F3PA 5J2UB 4ZAVA 3I8XA 2EJUA 1LBIA 2BVNA 1FJXA 4MQ5A 4FILA 3ZLVA 3SZOA 3TCXB 2B7LA 4RGQA 2ZS9A 3GHYA 1JV2B 3F4LA 1IEVA 5DSZA 1WUIS 4U7HA 1I2DA 3D6VA 4ENUA 4MV4A 2ZSAA 2IELA 5EKXA 4PC2A 4MUFA 1MJGA 2R4QA 5TJ9A 4FIZA 1ZD5A 6ADHA 1YUNA 2FETA 2HLPA 2RIPA 3MCTA 4CEJA 4M53A 5EPEA 5JNLA 2RGCA 5H5JA 3RE1A 1JEYA 3DFKA 2FQ1A 3VC2A 4DA0A 4DUPA 3FTFA 1VKNA 1JR3A 4D81A 1KOFA 2FQWA 5M34A 4INJA 1K6XA 3FWNA 2FLVA 3LX8A 4Y2UA 3A1EA 3LHIA 1H4SA 3T1OA 1MLDA 2HF8A 1KMCA 1G64A 5CT4A 4GWGA 5D86A 1TVMA 2C2HA 2R85A 3A1VA 3LP6A 4JYBA 4L6CA 5AW5A 5AQEA 4BLRA 4BN0A 5HM8A 3W79A 1L4NA 1U7XA 2X3FA 3R3YA 1Q1BA 2J3KA 3T3OA 4E14A 3B36A 3ET4A 3A04A 3CEMA 4L27A 3WLEA 3W5CA 3RQSA 3G7UA 4C03A 4HX2A 2G82A 3ZXIA 1LX6A 4WCDA 2Q6IA 1AB6A 1TD9A 1E9FA 3DWGA 3P9XA 3V00A 3EVGA 3ZOKA 3K0CC 1YMVA 4PYIA 5JH7F 4LV8B 1M1NA 1OBHA 4B47A 4C1NA 4GKJB 2PRZA 3MJTA 2IF0A 2H5JA 2QUHA 4KO3S 4OHMA 2R5WA 4NV0A 1MIOB 1HYQA 1S7GA 2H92A 3KU1A 5AKLA 5FTMA 1Q95A 3WMWA 3U1BA 2VQEB 3FFAA 1MJGM 2CEAA 1M3SA 1MV8A 1HEUA 1ZNWA 3AJ9A 1VBMA 2QUJA 3DYBA 3T0FA 2CVOA 4X00A 1E96A 4RA9A 1EVLA 3I2FA 2CXNA 3VPAA 2RKWA 2F3UA 1ZJ6A 3EG5A 3L4SO 4QPJC 2NU6A 3C1OA 3LGAA 4IOMA 2WUEA 3LFTA 3EXHB 1O1YA 2Q6KA 2WMDA 2P30A 3TGWA 1YI0A 5I7FA 1TKBA 4KFSA 4N8SA 4G67A 3HGQA 2J4DA 3E4DA 4DPLA 1AZTA 4W6ZA 4DR4B 3N2NA 1OAOC 3BWDD 3CV3A 1EQAA 4BX9A 4TV8B 4FYWA 1RYHA 3X3HA 2PLNA 4WACA 3NRJA 3N7TA 2C3OA 5LJLA 4YV1A 1X70A 4WHMA 3QEKA 4QELA 1AQYA 2B1IA 3EZ6A 4ZT6A 4AKTA 1XPOA 3VNVA 4JR2A 3WL3A 1E4OA 3ZWWA 3ZK9A 4F0JA 1PZNA 1LSUA 2NZYA 3H8VA 3M5PA 1THGA 3PXEA 2ZSBA 3HJUA 4PQFA 1HQKA 3FBTA 5DYNA 5EXPA 4A2CA 1C3OB 2IOFK 4FQ7A 4TYQA 4N0QA 3BK2A 3CW2A 2VXOA 1KBOA 1PT8A 1T9DA 2X41A 2RGNA 2JCYA 3X2SA 4LXYA 3HL4A 1WPQA 3B5EA 4OI0A 1BE6A 5LYYA 2CNWD 4MKRA 1RI4A 2W8BB 3SMVA 2HJWA 3KZKA 4BGUA 3JQ9A 1EFRD 5GJVC 2WF8A 2BLLA 2Q07A 5KYNA 2JIBA 3HFSA 4FCCA 4I66A 1QSGA 1KSJA 1IU9A 3H2KA 2NMVA 2PH7A 1AF7A 1X1SA 4JXXA 2Q3BA 4UD6A 4QUKA 1M2EA 2OO5A 4MWCA 1PS8A 2WG1A 2VNHA 1DI0A 1DGQA 2G9RA 4CPDA 1R0WA 3V4FA 4DSNA 3B60A 3DO5A 4A2PA 4UHJA 5IUNC 1BX0A 3ZDDA 1F2UB 1DNPA 4G0PA 3T7RA 1FSGA 5C1BA 2P77A 1R8JA 1QR6A 4YCSA 1VMAA 2CF5A 1J9GA 4MDYA 2IV7A 3SZMA 1YOVB 4EFLA 2G1KA 1KVRA 1K68A 2BISA 2HGZA 4HAZA 4RV5A 1MR3F 3SQMA 3IOEA 1SEVA 5B4TA 3L40A 4L5JA 4AF6A 4A36A 3FCCA 3C6YA 3DLTA 1BFDA 4MCHA 1E1RA 2XTMA 1DOHA 2VQ3A 4AWBA 2JFQA 1QK4A 2DHRA 1JVSA 5DGDA 3NTUA 1SOWA 2QRLA 2ZI4A 3HKEB 4MI9A 4P5PA 5AKJA 2GM3A 1QH1B 2AJDA 3IQXA 2AG8A 3O8DA 1XZHA 2IYTA 3T54A 4BWGA 4RTKA 4Q15A 2WHPB 2WNSA 5ALFA 1QXSA 4R3UC 1JMVA 3FROA 3OCVA 3E9MA 3KPWA 4KN5A 2ZSJA 3H2ZA 1LDNA 2UUOA 3HB4X 4R9NA 2ZXUA 1SCQA 3WJAA 2AE1A 3UJ8A 3C14C 2H1LA 2PT6A 1J2RA 4JC0A 3ZH2A 3ROFA 3O4IA 1IOLA 1ZUD1 1T35A 1ZSNA 5C3MA 5CBPB 3SYMA 2WUFA 2VSFA 1N2ZA 3EZXA 3KR2A 1DB3A 1ENYA 2IOHA 3QF4A 2XCUA 4QU8A 2ALJA 2E2WA 1A5ZA 3M9XA 4REQB 4TTIA 5WRFA 3VZRA 3DLHA 4A8JB 3FETA 2QG6A 3NWEA 4DLTA 3A3KA 4GE3A 4ZVLA 5IPFA 1EPUA 2KX7A 2QRVB 1VBKA 5LXTF 3PGA1 3AMVA 3MQ4A 2EBUA 4KQMA 1HURA 3M4XA 1KC1A 1B41A 2Q5CA 4KWTA 3UJNA 3CX3A 1NM5A 5T67A 5ALRA 2ORYA 2F1IA 4KJXA 2UUBB 4DXDA 4WRRA 3TQOA 2C9MA 2H16A 1Z4MA 3VBCA 2HMSA 4B7UA 4DANA 2PZMA 3KV3O 3QEMB 3VSDA 3HBFA 2HLNA 5ALPA 2VK1A 2V4UA 2VDLB 1T26A 1W9HA 3NAQA 4OPMA 3IMEA 3STVA 4C2AA 1PFUA 3A9RA 3AFOA 3OWXA 3SF8B 4QASA 4N5MA 3DNPA 1P3DA 3GDOA 5KWSA 1R5BA 1UFVA 4XQGA 3TR0A 4FC6A 4LWPA 1XU4A 1EXWA 2LDXA 3EJ6A 5IAKA 1FJHA 5EC8A 1Z36A 3L6EA 4R3WA 3T3IA 3NOQA 4H0CA 1Z06A 4H1TA 2BRUC 5SZJA 4ZO7A 1A2KC 2I6QA 1EJ6A 3KEGA 1CUUA 1XEWX 1ZD9A 3EIFA 1NBME 1P8AA 4XQ0A 3ELBA 1I4EB 4MVJA 1XELA 1CE8A 3FB4A 2ZYVX 4A4DA 4Q9AA 1FTNA 4Y2XA 4BX0A 4OHCA 2J9ZB 4LDPA 4MP6A 1T9HA 4XD2A 4GDFA 3WTCA 4E5UA 3AUTA 4QJ3A 3E23A 3SC6A 1ZVMA 2FG6C 3RS0A 3AWDA 3T4PA 5ELMA 4NARA 1T10A 3FLEA 3O4HA 1YZUA 3PFCA 4WLFA 3WBBA 5IDQA 3GDFA 5AH0A 1W30A 1Z0FA 3UMCA 1JP7A 1Q14A 3C43A 4O4HA 4PZDA 4TS1A 2OXTA 1OGYA 2NIPA 3U0VA 2WJJA 3M6IA 4D4KA 1X8KA 4UMFA 1KAOA 3PNVA 2Z57A 4K40A 1P0PA 4C0LA 1VJDA 5LQKA 2JH9A 1TVCA 1VYHA 3I2YX 4MW0A 4UBLA 4XQCA 1I24A 2XB8A 4J0EA 5FOSA 4G4IA 1S4MA 3PGKA 3IJ5A 3K1AB 2MSNA 1UDXA 2TMGA 5KSZA 2J0UA 5F51A 4DSOA 1H1LB 1AKWA 4A10A 3AERB 3HJNA 4M0EA 4JUDX 4ESHA 4J9VA 2FEKA 3GNLA 3CLVA 1U9ZA 3PUKA 3M4NA 4JEHA 3HDVA 5DOVA 4Y6PA 5H83A 3SXPA 4EVSA 3H5NA 4I2VA 4M88A 3S2ZA 1QPGA 2C5FA 2BP7A 2PLWA 3GJRA 4MVJM 4X20B 2QT9A 4U8HA 4A92A 4YJGB 4OK5A 1HL3A 1W48A