3KKNA

Crystal structure of h-ras t35s in complex with gppnhp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GTPase HRas
publication title Structural basis for conformational dynamics of GTP-bound Ras protein
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kknA00
3P1JA 1MRSA 3KTAA 2OFOA 2IS4A 4IOKA 3LRPA 3OHMA 4BEJA 3IDQA 1YZGA 2OEPA 1P2TA 3EIQA 3I8SA 1QG2A 2EW1A 4PO9A 4JJZA 2GXAA 1E2EA 4RSGA 2QSZA 3CPEA 4RVCA 4E22A 4GPTA 3WP0A 4NDZA 2DR3A 2R6GA 5DISB 5E7MA 4A2PA 4C0KA 1Z47A 4PO8A 5FBRB 1A2KC 3NWJA 5FTJA 4W5HA 2NO9A 5KSZA 3UXMA 1BOFA 4JL6A 3FGNA 3CH5A 3K09C 3KDSE 5EJEA 1ANKA 5EP2A 2WWHA 1K8RA 1OLOA 1P2SA 4OQMA 4BFTA 3G0HA 2IA5A 3IBGA 4JVMA 1YJ5A 3WYGA 1U0HC 3NVAA 5F3WB 1PLKA 3HP1A 1P3JA 5JCPA 3T1VA 1UF9A 3A58B 1II8A 4DB2A 1X8JA 4C7OB 1ZRHA 2D2EA 4E07A 5LBIA 3VR2A 1E1QA 2EVWX 4CW7A 5FOXA 1XMIA 4LBZA 1OF1A 3RVBA 3SQWA 3O47A 4V02A 1N5IA 3PFIA 4O0MA 3ONWA 2G0TA 3LXXA 2DWQA 2XNDD 3QKUA 1IN8A 1Q3HA 2OT3B 2C03A 4RCYA 2D62A 1WA5A 3QPUA 4LHZA 4CYMA 2R62A 2J41A 4BFXA 3JVUA 5JWOA 2RGAA 2XAUA 1E2HA 4DLXA 5C1BA 4Q4JB 2J0UA 2P5SA 2IK8A 1P9WA 3THXB 3WNDA 5DIFA 3TE6A 3EW9A 1N0VC 1G8YA 5J4VA 3BFXA 5DYGA 2Z83A 1F2TA 3Q9LA 4JBWA 4LRWA 3CR7A 4D25A 1OXVA 2PLRA 4G5GA 1ODFA 2EWWA 1OB5A 3L82B 4P4SA 5LB4A 1J7KA 3FFAA 1MABA 4TYQA 1KTVA 4Q9HA 4NCNA 4V0KA 2ERYA 3TUIC 3QBTA 3KQLA 4PR0A 1Q1ZA 4Z1MA 3THYB 3FMIA 3ZGXA 4UNSA 5IK2A 2X77A 1E79A 1S2MA 1GP2A 2R6AA 3KKOA 3ASYA 2G77B 2JLVA 1H8ED 5EZ6B 3HYRA 3ZIAA 1JECA 5KNCA 2A7QA 1AGRA 1ZM4A 4L16A 1FPMA 3SBEA 4A15A 3PCRB 2XZPA 2PZEA 2QSYA 2WWGA 3IQXA 4R7ZA 4GSYA 1NN3A 2C2HA 3PV0A 4HZUB 5CLQA 1VYUA 2QENA 1PUIA 2ZRCA 3CW2A 3TR5A 3VR1A 3ZVMA 2FEMA 1T4GA 1DAFA 4KSBA 1UJ2A 4KODA 2GEUA 4TLDA 4BUJA 2QP9X 3KJGA 4JKIA 5SZIA 3MFYA 1CLUA 1KZGB 3IILA 5HCIA 4LHVA 4O25A 4BWYA 4BZQA 5F9FA 1FX0A 5KSOA 3PXGA 5EXPA 3LWNA 3BH6A 3L2OB 5K8UA 2G0NA 4KYUA 3T1OA 3GLFA 1MT0A 2IYYA 3BK7A 2XJ4A 3KXKA 2O0HA 5FL7D 1E2NA 5JWRA 5F2EA 1XTJA 2FWRA 3T5DA 4G5QA 3GEIA 1HTWA 3EX7C 2ZRHA 2WSMA 2JEOA 3B60A 2H16A 3W5IA 1TL7C 1XD2B 4LY6A 4PAQA 2RHMA 1JI0A 4PPQA 5JS7A 2ONJA 4M2LA 2ZVPX 2V4ZA 2FPMA 4OI0A 2YOHA 3NDBB 3F8TA 1DAHA 4UNPA 5AJWA 5C4GB 1J8YF 3VR4A 2CJWA 5EZ5A 4PHFA 2O8BB 1UKVY 2ZUDA 3AV0B 1OPXA 2V6JA 3NC1C 1SVLA 2RGGA 1XD8A 1GUAA 4TMTA 4Q47A 4CRWB 2IYZA 3VHLB 1X1RA 3WNBA 5KTYA 4B3FX 5L3QA 2GXSA 4NKRA 1UKZA 5FOVA 1KK0A 3RYTC 4IDHA 2Q9BA 2XEXA 1E0AA 3BFVA 1KMHB 2ZS8A 1T3LA 3KJIA 2RGCA 4B47A 1JR3E 1KI4A 2CEAA 5F98A 2VYFA 2QMUA 5G41A 5GJVC 2HLDD 1BIFA 3CH4B 3B1YA 3HR7A 2WBLC 2ZUCA 1VG1A 3DM9B 2XTMA 3P26A 4Q9LA 621PA 4FWTA 3LLMA 2GNOA 5HE9A 4KLNA 1GTVA 2PZGA 3HR8A 3ZLJA 4AYTA 4PC2A 2OSBA 3CNLA 1BO6A 2F1JA 4OHXA 1P7CA 3KUDA 2NO7A 1F60A 1YZNA 1E2MA 2QN6A 4PO1A 4XD7D 1JALA 3UATA 3JVVA 2AHOA 2GESA 1DBSA 1SQ5A 4EJSA 3GJ8A 1CR2A 2H57A 2F1RA 3LAWA 1ZNZA 2DFTA 1W0KA 2QAJA 3TW4A 3EASA 4Z54A 4F91B 1OXTA 3I1FA 1AIPA 3C16C 1UBCA 5DI3A 1OV4A 3M0EA 1RW4A 4QGGA 1TU4A 1N6HA 3SHWA 4HB3A 1TPZA 2AL7A 4M1YA 2GZHA 2IC5A 1SVIA 2GBLC 4N0EA 3QBVA 2ORIA 1NJGA 3P4YA 3QF7A 4IJMA 5GJCA 3RS5A 4UJ5A 1YHNA 2ZJAA 2ZM5A 3RS3A 1SVSA 2IHYA 2Y8EA 1N5JA 1NKSA 4R2IA 1OFIA 2CCKA 1XD9A 1SVOA 2IYQA 3NG1A 4DDUA 1ZINA 2V3CC 3FFBA 5F9HA 2MSCB 1G8HA 3D8BA 4DSOA 1EESA 1OYWA 4D4JA 1HEIA 4NPHA 2C9YA 3UWOA 2YHSA 4LDJA 4Y0VA 1E69A 4IVRA 1EX7A 1QHSA 2P3SA 2ZYTX 3KQNA 2JJ2A 2UZIR 5JRZA 5A5GA 1LNZA 2X8AA 3I4LA 1KHTA 4GOJA 4TT3D 1VG8A 1X86B 3ND9A 5TB5A 3LXRA 2GJ9A 2O52A 5JZVA 2AR7A 3CF0A 1JXMA 3R8CA 5J5CA 3TGPA 5FTLA 2OO7A 2VP5A 1A4RA 5CB6A 2HT6A 3P20A 2IXEA 1G20E 5JBQA 1E2DA 3D6TB 4NCKA 5SZJA 4S2EA 1COWD 3HPRA 4HAZA 2NO6A 4KSCA 4FW9A 3T34A 1KOFA 1ZD1A 2J7PA 1NKTA 2ZI9A 3QXHA 4BZXA 4NYIQ 4GZLA 1ZYUA 4MRPA 1KDRA 2BC9A 2PCJA 3E5HA 4NCIA 3D7MA 2FN4A 3N70A 2Q21A 1RVDA 2WKQA 4XVRA 5E3HA 2J7KA 1JBKA 1GAJA 4GL2A 1IN7A 1CP2A 2OAP1 2QROA 2ZE6A 5GJBA 1NY6A 1RJ9B 2BM1A 2O5VA 1EFUA 2D7DA 4LBYA 4MRNA 3B1XA 1MOZA 1R0WA 3HJNA 2N46A 4B73A 2V6IA 2FPKA 4P33A 2AXPA 4QBHA 3WBJA 1J8MF 1TNDA 2QA5A 2PBRA 4NYIR 4L5BA 5FPSA 2FFHA 2FU5C 3PUZA 3VMFA 4Q4AA 4BGDA 4Q21A 1AS2A 2HYIC 2WICA 1Z0DA 3PR1A 2REXB 4L9SA 4V0OA 3RS7A 1N6NA 3EPKA 1U8YA 2QAGC 5C18A 1WF3A 2V8OA 4KFRA 1AZSC 1G3RA 2F43A 2ZEJA 3ZS8A 5FI1B 2TMKA 2OXRA 4JIMA 2W2XA 2XXAB 2QBYA 1ETUA 3UANA 3N2IA 4OHYA 1P62B 4D4KA 4B3GA 1E2GA 3CIOA 3I5YA 4QGHA 3JZAA 2XOKD 4WVFA 1VYVA 1WBDA 1XNJA 3FMOB 1FL9A 2CNWD 4BFUA 3Q5EA 2DCUA 1E1RD 1T0HB 3OAAD 3H0KA 1U0JA 1WCV1 1LY1A 1R10A 3MWLA 3AUYA 2JLZA 2VEDA 4M1KA 3U44B 1TMKA 3E2IA 3P4XA 1N6IA 4NTZA 1M34E 5DSZA 2R2AA 2R65A 1GKYA 2GK6A 2ZSAA 2ZAOA 4MA4A 2XNSA 3SU8A 2FZ4A 3AVOA 4QBGB 4EFLA 3CF6R 1OSNA 1ESMA 1VECA 1R7RA 1Q1EA 1UDWA 2P6UA 4OQNA 4TZ0A 4XH9B 1ESNA 1IN6A 1P6XA 1R5NA 1SZPA 2OCBA 4CT5A 3Q3JB 1CXZA 1OIXA 4MYHA 3FPAA 3E1SA 1NMYA 3C4JA 2R6DA 4A2WA 1QF9A 4WXPA 3GJXC 2A78A 4M9XA 3ICEA 2ATXA 2C98A 1LW7A 4LPKA 3FB4A 2DFLA 1AN0A 4C7OA 5EE5B 4P3YA 4LPSA 1Z0JA 3QVUA 2YZ2A 4TL7A 3VFDA 2NZJA 4RKFA 4XIGS 4BFVA 4CZ2A 2BVNA 1W0JA 4W9MC 4DLYA 1Q1QA 1P9RA 4TMWA 2BKUA 2JLSA 1R0ZA 4EKDA 1O87A 1M7HA 2HXYA 4OJQA 1JEEA 3AKDA 1MKYA 5DYIA 2V7QA 4JLKA 1OE0A 4BZPA 2CL7X 1E32A 1VIYA 2ZU0C 1NNEA 4GP6A 1ZC4A 1II9A 2W0MA 2B92A 4Q02A 3MUFA 4RZXA 1KI7A 1MH1A 4JSTA 5E95A 4YMUA 1QHYA 1S9HA 3ZDQA 3I72A 2QEQA 4UNNA 1FP6A 2OAQ1 1OH8A 4Q4JA 2IEYA 4KVGA 5JJIA 2P65A 1N6RA 1FTNA 4WA7A 3THXA 3RS2A 1X8KA 3VTKA 2WMNB 2BV3A 3X1WA 1ZU5A 1VG0B 3VHXA 4QHYA 4KXFB 5AUPB 4LYFA 4RY2A 4HSEA 2IYXA 4US0R 1OIVA 1Q44A 2FSHA 2CMKA 1NBME 1NBMD 1FMJA 2HF9A 2OLKA 3PEUA 5BN5A 4DKXA 3LY5A 1FTSA 3TJZA 3M4YA 3BGWA 2GWHA 3GD7A 4TN1A 1F48A 3NBFA 1KSFX 3IO5A 2RGXA 1LTQA 5DH9A 3GP8A 4OJKA 4MYUA 2W6JD 2VLIA 5EP4A 2JCSA 1E94E 4J0QA 4URVR 3A4LA 3KFVA 4DUGA 1GIAA 4A4DA 1ZM7A 1HY3A 3TMKA 1AJEA 3Q8XB 3WMGA 2JJ1A 3DZDA 3AVUA 2IEZA 1KO4A 5GADl 3WMFA 1MV5A 3A1SA 4HZUA 4IDNA 2G1KA 3T15A 5LB2A 4DLWA 4DSUA 4TYNA 1DARA 3LBIA 2A5YB 4WW0A 1TEXA 3VKWA 2IS1A 1GDDA 2JLUA 1N0WA 3ZVRA 2WSSD 3K0FB 1G7RA 1S0UA 1JPJA 3DOFA 3QIAA 4GMDA 3SI7A 1U9IC 4JBXA 4MKFA 2BCGY 3K0AB 1QHIA 4FN5A 3IGFA 4JL8A 3QKSB 1XJCA 4DHEA 2ZE7A 1TTTA 1Z6XA 2HF8A 1W44A 1T8UA 4FD2A 4NBSA 3OF5A 3EZ6A 2QGNA 2GDJA 3X1XA 3I73A 4QGAA 4LV8B 1GRNA 3BS4A 4U7DA 4IHQA 1XD2A 1ZJ6A 1SXJC 2ZUBA 2JA1A 1ZD9A 3A1VA 3U2QA 2GEVA 3VR6A 3TH5A 3DOEA 3KJEA 1DEKA 1E2FA 3B5JA 1QVAA 5JJLA 3WHLA 1W49A 4F4CA 2A5FA 2CCGA 2DYKA 3QEJA 1G5PA 3T5GA 4OKSA 2O8BA 3SE0A 3TNFA 2KB0A 1TAGA 2ZJYA 4AKIA 4EPTA 4MRSA 3GLIB 4U02A 2NZ8A 5TV2A 1W48A 3L43A 4DLUA 2JIZD 4TQAA 3QSYA 4IDQA 4H1VA 3BBPA 2JLXA 3B1ZA 3CRQA 4LWZA 3UMSA 4FI3C 3OIWA 4MKIA 5CM8B 1AQUA 4TTRA 2O8EA 4K46A 1I2DA 1YE8A 1M7GA 3C41J 1EXMA 4BRWA 2BEKA 2JAQA 4C4PA 2LWIA 5HZHA 4MDFA 2Q9CA 4IXMA 2FA9A 4V0LA 5J4HA 4QC2A 2YOGA 2GBLA 4DLSA 2VO1A 3A6PC 4HAWA 1Q1BA 4JLPA 1TEVA 3EZ7A 4TLBA 3UMRA 2BHRA 2ZRMA 1XCPA 2WJJA 3VNUA 4QRHA 4IFEA 3W6PA 3TUJC 4KI0A 3QXXA 1R5BA 3AKCA 1VIAA 4M9SA 4JYBA 4IRUB 3DO6A 1KJWA 1PZNA 4M1MA 1N5KA 1XTSA 2W2VA 1G3QA 4XSHA 5DGXA 3VR3A 4OHWA 1NVWQ 4V0MA 5CIQA 3WP1B 3PIRA 4JS0A 3ZVNA 3H86A 3RRNA 5JMTA 2AN9A 2CHQA 3MCAA 1D2MA 3NBYC 2MSDB 2EU8A 3U7GA 4D2IA 2GCNA 4BFWA 1P75A 4QFMA 1VKJA 2ZJ2A 1G19A 2VP9A 4QJ3A 2GETA 4PPNA 1FP7A 1XEWY 2UKDA 1YZKA 2GHIA 4CEIB 421PA 2QE7D 4QNMA 2PZFA 2AWOA 1M6NA 4GBMA 1R2QA 1IXRC 2YOFA 3VU9B 3BC1A 3VX4A 4BE7B 3SFZA 1E6CA 2NO0A 4D0GA 4LJ7A 3QEOA 1KI3A 1X1SA 2BM0A 2VIIA 4HLCA 1U94A 4M4SA 4PHHA 5FUVA 3EPHA 4QJ4A 2JLQA 1Z07A 2FE4A 4EFMA 1IY1A 3Q5DA 3PITA 3ADBA 4B34A 2JDIA 4NH0A 3FOZA 3N5CA 1G64A 1SULA 1NRJB 2GVZC 2VBCA 2ZI7A 4DIEA 5FPKA 1XDBA 1XTKA 3TVDA 4Z51A 4HDOB 3DM5A 4ON9A 1RIFA 1LF0A 4M8NE 2HYDA 4EDHA 2NTYC 4TMZA 2H1LA 1BH2A 4ZCMA 5KO2A 5CJ2A 1T3HA 4EUNA 2FGKA 3V4RA 4PSKA 1P2UA 4AC9A 4M1SA 3LNCA 3OESA 5KSPA 3QXSA 3LLUA 1NP6A 3QOFA 3T06B 4D6PA 1FW6A 3U61B 2WOJA 3FWYA 3H84A 3NC0C 1UAAA 3OEHA 4ZCLA 3L0OA 3R8FA 1JEDA 4OHZA 2UZ3A 2IHBA 2V54A 3PUYA 1T8TA 2BIFA 2V1XA 3DPUA 2BMDA 4YQFA 3AF2A 2WWXA 3BAFA 3SYKA 1T6NA 1UBFA 5AJXA 1KY3A 4JLJA 2C9OA 1SVWA 4C30A 3QY0A 3BJIC 5DHAA 4B76A 1FUKA 4DC9A 2J87A 3L0SA 4Q4HB 3VQTA 1CJVC 5DO9A 5K8LA 3A4MA 2RAPA 1T5LA 3L0IB 3VKGA 1KGDA 1L2TA 4ZIRA 1E9RA 1GITA 5JJKA 5KU1A 1MO3A 1RJ9A 1M74A 4Y0AA 2LCFA 1G5RA 4IW3B 3QENA 4KITB 1OKKD 2WKPA 3AVVA 3MJHA 3O8DA 5AWFC 4B6EA 4BLRA 5EXSA 4PZLA 3QJYA 1BMFD 3SR0A 5IRCD 1QHXA 4LJYA 3ADDA 221PA 2AKAB 5CITA 1V5WA 3BE4A 1JAIA 2QI9C 5GVSA 1U98A 4YLGA 1OFTA 1E1QD 2EFGA 2O8DB 2ZJOA 5HPYB 4IFBA 3CRW1 4ZDJA 3FKQA 1G3UA 1HH4A 2WMOB 2XXAA 2IYUA 1BS1A 3IQWA 1TF5A 1GZSA 1YR9A 4FCWA 3SBDA 4X8HA 2XZLA 1II0A 1BKDR 2CL0X 4B75A 1V43A 4KFSA 2KSQA 3BIFA 5C46F 1CIPA 1J2JA 1VTKA 1ZUIA 2CVHA 3SJCA 3K53A 3U44A 2YWEA 1I4DD 5LD2B 2C77A 1P2VA 1NIPA 1WP9A 1XMJA 1GKIA 4XWOA 4M53A 2AD5A 3K0CC 4MUAA 5HCNA 1IAQA 1AZTA 1G9XA 1QG4A 4I1VA 1HURA 4ZI3A 2F1IA 2OLJA 1OYYA 4RCZA 3IIKA 4URXR 4LGMA 2KWIA 3BWDD 2XNDA 2ZJ5A 4GI7A 1UM8A 4IVPA 5FPYA 5J4LA 1G7CA 2E9SA 1VCOA 3AF3A 4FMDF 1IJFA 1DO2A 2QU8A 3BB3A 2GTPA 3B78A 3EPLA 2QY9A 4PQRA 5TARA 4F93B 1F6BA 3IBYA 4Q4LA 1E9EA 1VPLA 4KJZA 4EPXA 3R20A 5IK2D 1JAHA 4RFVA 3NDPA 2EYUA 3GLGB 1NIJA 3CBQA 4IOMA 3HPQA 2IS2A 3IKJA 1QHNA 2BOVA 3ZIAD 3PUXA 3RLFA 1P72A 4X8LA 1S3GA 5LD2C 1O3YA 4UNRA 2GAAA 2YNMA 5D3MB 5J47A 3LA6A 2FZLA 1P73A 2GCOB 4RD1A 5H68A 3SYNA 3ZQ6A 4TSFD 2GZDA 5FBVB 1DTSA 1NSFA 3CONA 3T12A 1G7TA 1IXSB 2J0SA 1D5CA 3E70C 5JS8A 4AG5A 1WRBA 4HLUA 1ZU4A 4URUR 3RABA 2A5GA 1KJYA 4DJTA 4YXWD 1H8EA 1YKSA 4HUQB 1X8LA 2QUZA 3H4MA 4R2HA 4TQUS 2FPLA 3Q72A 4PHTA 5GJWC 3WYFA 1UKYA 2FOLA 4FMCF 3RC8A 4RD0A 1SXJE 1SXJD 2R6CA 1ZD8A 2GJAA 3EC1A 4KU4A 4ZDIA 4B43A 4V0NA 3D31A 1VMAA 1NJFA 3AVTA 4RZ3A 4D4LA 4JMPA 5L3VA 1DAMA 1OH5A 1R8QA 3KZ1E 2CDNA 4LHYA 4C0JA 2V1UA 4URYR 3HDTA 1GOTA 3AVWA 1S4QA 2IYLD 3AGPA 5HKKD 1U8ZA 2FSGA 4US1R 1DG3A 1RE0A 2CL6X 3NH9A 1HV8A 2PEZA 1N0UA 2MSEB 2JLWA 4LV6A 1IN5A 3EARA 1E0KA 1UEIA 1RRGA 3IPYA 3LQRA 5HR5A 4NU0A 1YZQA 1K5GA 1GWNA 4HZIA 4NL4H 2I1QA 3K70D 1XEXB 4FXPA 1OIWA 4JT2A 5DE3A 3UMFA 4Q1DA 4B3CA 1R0XA 1YZTA 1W4RA 1ZNXA 3IIMA 2BJWA 2GF0A 3MWKA 3OEED 2EYQA 4ZCIA 3K0FA 4PZYA 1ZMXA 3P32A 2WIAA 4A82A 3OFNA 3RAPR 3C5HA 3R9WA 3LD9A 1HT2E 5KOYA 3SEAA 1HQYE 1NMZA 5AJZA 3K0AA 4HYYA 1Z2CA 4XVQA 1FZQA 2BCJQ 3GJ4A 3U6BA 2O8FB 1DAGA 1LB1B 3QKSA 2I4IA 2IYVA 1YVDA 3GLIE 2ZR9A 1XBTA 1W4BA 3W34A 1G21E 1N3BA 2AX4A 3THWB 5JHHB 1XXHB 2FJUA 1NN1A 1U8AA 2OV2A 4B3DA 1NVVQ 2P6NA 1XPUA 1XWIA 4HATA 1JR3A 1OT3A 2VP4A 3CRVA 1KI1A 4LJ8A 2C9CA 4WXRA 1M2OB 3AVYA 4ZDKA 2WV9A 2RMKA 2G83A 2PX3A 4PAMA 3H1TA 1XJ0A 4B44A 5L3SB 1E2QA 1Q12A 1G17A 2VHUA 3BORA 721PA 2ZU6A 2ZITA 5TDHA 4D81A 3CNNA 4CEHB 4TYWA 4I4LA 1QHHA 2WIBA 1NVVR 2VSXA 2WVJA 3C7KA 3GEEA 4A8JB 4HUTA 4JL5A 5JI2E 2QORA 4XD7A 3U3RA 5JLJA 1E2IA 2O0JA 4DCUA 1MR3F 2FF7A 2ZI6A 4DCNA 1XPRA 2GVDC 4MUBA 3FVQA 2GJKA 4B33A 1XTRA 3QXCA 2IF2A 1IONA 2QP3A 2WWIA 2XSZD 3W6OA 1EFTA 1NVUQ 1N6LA 1DPFA 2REOA 2GJSA 3CPJB 2RHDA 1PUJA 2VP0A 4B6FA 3LO5A 3B9QA 3M1IA 2AWNA 2P2LA 3GJ7A 1F2UB 3SYLA 3FHCB 4GP7A 2QZ4A 4IEEA 1AM4D 2R8RA 1DE0A 1NF3A 3QKTA 2ZSBA 3WRYC 3UK6A 4BLOA 4R98A 1CTQA 1KK2A 3UWKA 2ZIAA 2QAGB 3MRSA 4Q1EA 1KSGA 2WAYA 4BQSA 1A1VA 3QG5A 1ZCAA 3WRXC 5CJPA 2ODBA 4YDHB 2ZRLA 3OE7D 3X2SA 2ZRIA 4A8JC 4LJ4A 2QM7A 2ZSFA 4WZ6A 4FCTA 4CEIA 4DRZA 4TT3A 1L8QA 4MDEA 1KMQA 4RJLA 4ERNA 1Q21A 4Q9KA 4IOLA 4HEJA 2W6ID 4OI4A 3VU9A 1QDEA 1H8HD 2ZSDA 3QPVA 2WJGA 2WOOA 2IS6A 2XTNA 5KPJA 3KQUA 1E4VA 1FNMA 3KTAB 3NEJA 1F5NA 2C8VA 1EK0A 3TLXA 5BXQC 5FTKA 4HAYA 1COWA 2HJGA 3W90A 2QMEA 3LQQA 4BECA 2OCPA 5FOTA 1S1MA 2NQ2C 2B21A 3WBKA 1ZBDA 1Z0FA 3K09A 2IUTA 4KYIB 1ZC3A 2GAOA 2QGZA 1FUUA 2EFEB 2ORWA 5M04A 1XZQA 2QM8A 3ZZTA 1JXOA 5A4JA 3KB1A 5KDDA 3K9GA 2OFWA 5IHPA 2VHCA 1Z0KA 5TY0A 1Y63A 1IN4A 1D9ZA 2YYZA 4MKHA 3PUVA 5DN6D 3U7FB 3ZD7A 3A8TA 1CJUC 3I61A 4G3XA 1QBKC 3HYTA 4Q7MB 2OHFA 4M22A 2ZXUA 1RC8A 4IKEA 1W36D 1GRQA 1Q0UA 1Q57A 5JHGB 1W46A 4TMXA 4QBIA 1II8B 2ZPTX 3SJAA 5AR1A 3TK1A 2FG5A 3U5ZB 1XCGB 3BD9A 2FFAA 1RYHA 4Q1FA 4TYPA 1R0YA 1G41A 1R5OA 3KUCA 3ZQJA 2CHVA 2PH1A 1BYUA 3PG5A 4LCBA 4Q4HA 3P27A 3WYAA 3X1DA 3AF1A 3KX2A 2EWVA 1YU9A 3HU3A 5JSZB 1Z6TA 2EFDB 5FOUA 4QNRA 4Q19A 2X1VA 3PEYA 2QMHA 4Q7KA 2GKSA 2LKCA 2ONKA 3EWSA 1CR0A 4YDSA 4QHTA 4X8OA 1ZM9A 2XOKA 4FIDA 4XSGA 2JLYA 4TWZA 1G8GA 2VQSA 4N0DA 2XTZA 3OAAA 1E1RA 1W1WA 3TKLA 2Q3MA 1LF5A 1KJZA 3GFTA 3RHFA 2ZROA 5FH9A 1W2GA 1EG7A 2CE7A 4PC6A 2CCJA 2XJ9A 4LBVA 3DKVA 4HAUA 1EFRD 3OZXA 4GFDA 1S1CA 3FMFA 5HZKA 4DZZA 2IX3A 1OHHA 3B7GA 2AFHE 3LX5A 2ZRGA 1PV4A 2O8DA 3TRFA 1W0JD 1PVOA 4Q9IA 1CJKC 2Z4RA 3KXIA 1OJLA 3MWYW 2ZRFA 3PJRA 1P60A 3PUWA 4Q1BA 1MABB 1Z6AA 3ICQB 1CRPA 2QQEA 3LV8A 4NCHA 2ZAMA 1HUQA 1D2EA 2F6RA 3LW8A 2DWOA 2ZJ8A 1CR1A 2RGEA 4MKGA 2DWPA 4P32A 3QQ5A 1TF2A 1XRJA 1XTQA 3K9NA 4OBEA 1YRAA 4P31A 5KPDA 5EQTA 4ESHA 1WQ1R 1HE8B 3NTUA 1AK2A 4HAXA 3GLGE 2V9PA 1E2KA 4LHXA 5KDLA 4BLTA 2ZETA 4A36A 3C15C 4KLZA 4CGZA 5JCZA 2VHQA 1Z2AA 4EFNA 3EA5A 3CWQA 2WJIA 5CB8A 5ELXA 4G5RA 5C4MA 4DEXA 2OFXA 2AK2A 5G40A 3A37A 3THYA 3ADKA 1JQJC 2OCYC 1YR8A 3BB4A 3RRZA 4JYCA 3GLGA 3WMEA 1XP8A 3NIBA 4KAXA 2NOAA 1E9DA 3C8UA 4KFUA 2P6RA 4DIDA 3WY9A 3ZVLA 4C0HA 2GXQA 1SXJB 4NYMR 1E0JA 4TMVA 1TQ2A 3T61A 1XEWX 1OH7A 4IXNA 1SKYE 2ZI4A 5D3MA 2ZTSA 2IWHA 3EAQA 3SN6A 1NBMA 2H17A 2GCOA 5G3YA 1F3OA 2IW3A 3SJBA 5AUOB 4ASUA 3CKLA 1VDZA 1IHUA 2PT5A 3U4QB 1DVRA 2BKEA 4CF7A 4TL6A 3CM0A 1JB1A 2A5JA 3FKSD 4N3NA 3F0TA 2W6JA 2YC2C 4MRVA 4HUQA 3AVXA 3W3AA 2PX0A 3GQBA 2IUSA 4I1SA 2AKYA 3CZQA 1UFQA 2C04A 4RD4A 4TL8A 3TAHA 2RGBA 4K8OA 1E99A 3U3JA 4C0LA 2BBOA 2ZREA 5B64A 4P4TA 4DVGA 3MD0A 2WKRA 1AA9A 2W83A 2ZQ5A 4MRRA 1N2CE 4RFSB 2D2FA 2BMFA 3K70B 4A0FA 1B0UA 4TLAA 4TMKA 1ZIPA 3UG6A 4C2UA 1WXQA 1IY2A 4CIDA 5EXXA 4F4IA 2YKGA 1OB2A 4B2PA 2O8CB 4C0SA 4B2IA 1TUIA 3THOA 4O3MA 4KBGA 1NLFA 3J81k 1UBGA 5JI3E 1KAGA 4A9AA 3BERA 1G18A 5FTMA 5UKDA 4TZ6A 2HUPA 4PC1A 2DFNA 4FWIB 3U60B 1R6BX 2H18A 4AKEA 4QGFA 4XTRA 3RSOA 1W5TA 4QBFA 4WBSA 4BPBA 4A6XA 1GG2A 1MO5A 4D0LB 5CIWA 1XXHE 1RKBA 1NL3A 1KMHA 4I99A 2PJRA 3ADCA 2QPOA 4IEIA 4DEYA 1S9DA 3IO3A 3GLHB 4ILEA 1KIMA 1HQCA 1X6VA 4H1UA 4MITA 1Z28A 3UIEA 4JLOA 4TLCA 3GFOA 5EUQB 3K70C 1S96A 1UDXA 1QRAA 1R8SA 2H7VA 2VPPA 4TLEA 2QQ0A 3EG5A 2BBWA 3GPLA 5BQ5A 2KBFA 4DDWA 2JIZA 1Q20A 3BH0A 2REBA 3WHKA 1GRRA 2OE2A 3DZ8A 3BXZA 2Q6TA 5JEDA 3T1QA 2WAXA 4OYHA 2F3TA 3THWA 3SZRA 2YC4C 2XB4A 3QUSA 3CO5A 3GJ5A 4YC7A 2E1RA 5AUQA 4MGZR 4A0HA 5AUNB 3R9XA 2O0KA 4DWJA 1L4YA 2ATVA 2VSOA 1ZP6A 4P4UA 4LC1A 1DO0A 2CLSA 1CS4C 2CHGA 2X2FA 3R9IA 4EQ6B 3EA0A 2FV8A 2J45A 2OXCA 4D0NA 4FMBB 1GKUB 3L8ZA 1E9CA 2FGJA 5L3SA 3AB3A 4OHVA 3AP3A 4WZAE 2WPDA 1FQKA 2GK7A 2ZANA 1J99A 4CEHA 2YV5A 3SJZA 2ZR7A 1KO7A 4ITRC 4TTPA 4D82A 3KB2A 3DHWC 4A8JA 3OIVA 4A1FA 1MO4A 1VG9B 3GJ3A 3A4NA 2YWGA 1LS6A 4EPVA 3CLVA 4PPGA 5KNDA 2BBTA 1S8FA 2N42A 1RRFA 4LV5B 2DY1A 1DAIA 5FUWA 4TQ9A 2QE7A 2H5EA 3U3OA 2VHTA 4BFZA 3K0SA 3IHWA 3GJ6A 1KI8A 2CK3D 4JLDA 4C2TA 3EWAA 2QTFA 1XFAA 1B23P 2OG2A 2HCBA 1RZ3A 1GFIA 4JT4A 1ZNYA 2NPIA 1N6PA 4V03A 1LS1A 3X1YA 4B3BA 4B48A 1PLLA 4NZYA 4E5UA 5P21A 1GILA 2R9VA 2CVFA 2UVQA 4LUCA 4NYJQ 1XJQA 2ORVA 2OCAA 4M1TA 2PJZA 1U81A 2MMGA 3CWZA 4KO8A 3QNUA 3TAUA 2RKOA 1KKLA 3OEHD 6Q21A 2ZS7A 3VR5A 4ACAA 2W0SA 2QAGA 2HJVA 2GEDA 1N25A 2QT1A 2NPFA 2WWYA 1E2PA 2FH5B 4C3ZA 4UNQA 4RZUA 1ONBA 3QXJA 1XZPA 2BMJA 2BEJA 2VF7A 1VHTA 2ZYWX 4BEBA 2IL1A 1A7JA 5KHOC 3FHOA 1G4UR 3BB1A 3TUZC 4LOAA 5AK0A 2J5XA 4NYJR 3SDZA 2YVUA 4II7A 4L4UA 2A9KA 3U7EB 1YZLA 2D74A 4LJ5A 1EFHA 2WWFA 4LJ6A 3RNLA 1KO1A 1WMSA 4F7WA 4UJ3A 3ND8A 2F7SA 2BJVA 1W36B 4ZI2A 1W4CA 2J1LA 4EPRA 2WJYA 3DDCA 1KYIA 1T9HA 1Z22A 2IWRA 3T1TA 4DT1B 3SC3A 4G01B 4POAA 4PAOA 3PENA 3AEZA 3SHFA 2AXNA 1U2RA 2FFBA 2WWWA 3IPXA 3CB4A 5BYJA 1Z5ZA 3F5FA 2FSIA 4LSGA 1NLZA 4N1AA 4CVNA 4KVAA 2XX3A 2OUKA 4PX9A 3VNVA 4LJAA 2FEOA 4ARZB 4CDGA 2F9MA 2A30A 2G9NA 2ANCA 2CBZA 1HT1E 2VP2A 3FE2A 4JVSB 1T91A 3OIYA 4HB4A 1OKKA 2C95A 1CR4A 1ZNWA 5G53C 1BMFA 3NH6A 3CRMA 3DL0A 5FTNA 3D3QA 4JJKA 4UXJA 4XWAA 4NONA 4KV9A 3TSZA 5KSYA 3I8XA 2QP4A 4PSAA 4RZ2A 3CX7A 1W36C 2F9LA 3I92A 4GT1A 4LK2A 2AK3A 2QPAA 5JSZA 4M21A 4QM6A 2P0EA 3CUEF 4LYHA 3QPWA 1CJTC 5G3ZA 1NSTA 1FQJA 2NO1A 1XMSA 2J59A 3ZH9B 1G6OA 2PCLA 1NLYA 2DBYA 3B85A 3IEVA 4DLRA 1BYIA 3V9PA 2XITA 1JPNA 1US8B 1YR6A 4B32A 5SZKB 3SQXA 1PLJA 4Q48A 4Z1MD 4W7SA 3V00A 1C1YA 1E79D 3GMTA 4EAQA 1G6HA 5BW8A 4ZKEA 3AVPA 1EFCA 2BBSA 1TQ4A 2PMDA 1KDTA 3RWOA 3HWSA 5A0FA 1LV7A 2C5LA 4F38A 4CEJB 4IVQA 2K5UA 2R44A 3MWJA 3W5JA 3GEHA 1H65A 3QI2A 1AS3A 4G1UC 5JECA 3RSLA 3QE0A 2J9RA 2GXUA 4D80A 1W2HA 1KKMA 3LW7A 2VRWA 2OBLA 2X2EA 3KL4A 3U6KA 3SOPA 4D26A 2Z0MA 1DG1G 5B58C 1QZXA 2ZE5A 1EWRA 4IDPA 5J4KA 3TSOA 3AKEA 4GOXA 4YMTA 2AFIE 5L8VA 4M1WA 2ZRAA 1D9XA 2AD1A 5FPHA 1IM2A 2IBMA 1YR7A 4W5JA 3AUXA 3B82A 2EFCB 2Q3HA 2ZRKA 2YJTD 5B2ZA 2Q3FA 5EE3A 4MGIR 3NXSA 4HB0A 1SKYB 1GL6A 1P9NA 4GNKA 1JJ7A 1Z08A 2A3RA 3GLFE 1MRNA 2FMXA 2ZRPA 2D7CA 3B9PA 2B8TA 5FBLB 2F1HA 4TSFA 2G88A 1CBUA 1T5IA 5FPTA 2G1JA 1U9IA 4LJ9A 4FMDB 3KKPA 3MJRA 4G0NA 2ZRNA 3QKRB 4ZV4A 5CLLA 4F92B 2CLCX 2Z43A 1TADA 1NY5A 3I3SR 3QF4B 4G5OA 4YXWA 1E3MA 4DXAA 4ZDWA 5FUYA 5HTKA 3EXAA 4AWXA 1E9BA 1N6KA 1P5ZB 4PC7A 3C14C 8OHMA 1FOEB 4RKEA 5FOWA 3IUYA 3O8RA 1SXJA 4AD8A 1A82A 4UQOA 2RGDA 3U3MA 5FL7A 1IQPA 1M8PA 4AKGA 2IF0A 4DSTA 3KJHA 3QG1A 2IYWA 4XVUA 1Z63A 1GL9B 2Q0HA 3ECCA 1SVMA 3SS8A 4FINA 3ZZ0A 2IXGA 3HU2A 1CEEA 3U4QA 5HKKA 1FMLA 3G82C 2ZE8A 4G5SA 1J70A 5FBQB 1TF7A 1OH6A 2YWHA 4U00A 3LDAA 4BLSA 3AM1A 4HDCA 3OFND 4M0LA 2XGJA 3SNHA 3H2YA 5DI9A 1HA3A 3NHBA 4JLVA 3S1AB 4GOKA 2CLDX 3MG9A 4D4MA 3I62A 2ASEA 2OILA 2G3YA 5BN3A 4OQXA 1TX4B 2QG6A 2JJ8A 4IOJA 3I5XA 4FMCB 4K81B 4MYTA 4RFSA 2O8EB 4AI6A 1ZIOA 3W8NA 3W9YA 2PT7A 4EIWA 1IY0A 2DB3A 5FR1A 2HXSA 1JR3D 1M7BA 2O8CA 4RD3A 3OEEA 2DFKB 5DLQC 2VSFA 2HLDA 3LX8A 4PTLA 1W0KD 3GLHE 1OXSC 2DPXA 2C78A 4JLNA 2FFQA 4B2LA 5CDFE 2C96A 1RYFA 3EC2A 2XZOA 1E9AA 1HE1C 5H8WA 4RD2A 3UKDA 5AJVB 2LKDA 1S3SA 3U3KA 4TTQA 4OK5A 3GLIA 1G3MA 1ZM2A 1Z29A 4LHWA 2KE5A 2WM9B 821PA 3AF0A 3KKNA 4QOSA 5TVKA 4AURA 4A6PA 1YQTA 1Z83A 2YINC 1Z06A 3BH7A 1CJMA 1A5TA 2J3EA 1E9FA 1E4YA 4QHSA 1RRCA 1NG9A 3EZ9A 3TQCA 3GLHA 4DBLC 1DS6A 3R7WB 5CDFA 3GFPA 2IYTA 3RDPA 2D4HA 5IDVA 1GM5A 2JJ2D 3GCGA 3MGCA 5EUMA 3RRMA 4WZBE 5H70A 2ZRJA 1WDTA 1KZ7B 3LVQE 2BDTA 5DHFA 1GNPA 1VHLA 3O8BA 1UEJA 4JBYA 1OXXK 1TUEA 2ODNA 2ODWA 4KFTA 1GNQA 1X3SA 1GNRA 4AYXA 1KI6B 3TR0A 2GF9A 3RWMB 4A2QA 4I81A 2SHKA 2IXFA 5H1YA 1Z6GA 1VYTA 4KBFA 4JVLA 2XSZA 3L8YA 2ANBA 4EQ6A 4XTCS 4LYAA 1CF4A 2J7PD 4UXHA 2QRZA 5EE9A 5EP3A 3EZFA 4Q01A 3LH5A 1EGAA 1D6JA 2I3BA 1G5TA 2VTKA 1I4TD 3BRWD 4JVNA 5TXGA 2ZVQX 1WBBA 3CR8A 4O2LA 4DCSA 1VCIA 2RGNC 2ZS9A 1JR6A 2J0QA 2KBEA 3K9HA 4OQFA 4QJ5A 1HYQA 4OK6A 2WHXA 4WIAA 1LFDB 2NIPA 4NMMA 3K1JA 3SFVA 3RANA 2W2TA 4AG6A 4GRAA 3AQ4A 3OE7A 4JZKA 4Q18A 4Q9JA 3IIJA 4LC0A 3REFA 4C0QC 4AKHA 3B2EA 2B7CA 3N2EA 3EPJA 2PLFA 4HI0E 3KKQA 1AS0A 1KDOA 1KI2A 2JATA 2JLRA 3DVLA 3K8YA 1U99A 1KO5A 1NVXQ 2PL3A 1KSJA 1CU1A 1KI9A 2W6IA 4ZIRB 2ZYUX 5FI0B 1H8HA 4H9GA 4MYCA 1RRPA 2CE2X 5IF9A 4C9BA 4Q66C 2GZAA 3V4FA 3JZMA 1MO6A 4MGYR 3NBZC 4DDVA 1D8TA 1SKQA 3CZPA 1L4UA 1ELOA 2PMKA 1C4OA 4AIIA 4I1UA 1G7SA 2V55B 5FOSA 3FTQA 3REGA 2Q9AA 1E9SA 4ESVA 2ZI5A 4L8GA 4BRUA 5KUTA 2Z6VA 1CKEA 3EZ2A 1KAOA 5FBWB 5DN6A 2H8KA 1GL7A 1M1YE 1Q22A 4ZKDA 4NHOA 5CYOA 1I2MA 2NGRA 3B6EA 3K0CA 1KNQA 2E87A 3KXLA 1XTIA 2CNWA 2GRJA 4Q5IA 4DT1A 2KI5A 4EPYA 3A1UA 4BLPA 1NN0A 1OFHA 2GILA 1WE2A 4KCGA 4S35A 521PA 4LI0A 4A0RA 1TU3A 4XJXA 4EPWA 2J0UB 1OHHD 4WOPA 2VHJA 4XOIA 1ZM3A 2QTVB 3K0EA 4Q00A 4B71A 4HLDA 1K5DA 4ARZA 2NG1A 2GCPA 2W00A 4LBWA 5EE1A 2ZYVX 1DAEA 1N5LA 1OXUA 2KJQA 1F2TB 3DKPA 4RD6A 5E7IA 3TSWA 1SHZA 1ZW6A 5E7JA 3WNCA 4DB4A 5KDOA 3MLEA 3NEYA 1AQYA 3TVTA 2FSFA 4P4SB 2ZR0A 4YONB 2R6FA 3IEUA 1E96A 2V7QD 2WTUA 1XB2A 2ZJBA 1NN5A 4HB2A 1G1MA 3AP1A 2HDNB 5JWHA 1EFRA 1UADA 3L0PA 1E0SA 2RB4A 4W5WA 3T35A 1R4AA 4OQLA 3B13B 1Z8FA 2PEYA 1YZUA 2VL7A 3W6NA 2QRNA 3DMNA 3DMDA 5TMPA 1SGWA 2P5TB 5JRJA 1UKEA 1XX6A 1W4AA 4PQFA 2QL6A 1N6OA 2VP6A 4M9QA 1JQLB 5D3QA 3ZZUA 2Z4SA 4B35A 1KK3A 1XF9A 1QHGA 4NYMQ 2RCNA 1XEFA 4ZPXA 1XU4A 2A5DA 3CX6A 4E09A 4QKQA 2GJ8A 1US8A 3A36A 1XCMA 4O2RA 2EQBA 1U0LA 3G5UA 4MQBA 5J4YA 4LYJA 2HEIA 1XPOA 2OESA 4B3XA 3RC3A 5J40A 4B74A 3AF4A 3U7HB 5FUXA 3B8HA 1FX0B 3PQCA 4L9WA 3LBHA 3LBNA 2W58A 3F3YA 1W47A 4CEJA 4DUGD 2IT1A 4DLZA 4JLBA 1DOAA 2XB2A 3GLFB 3Q7PA 4GMXA 2JJ1D 2IYRA 4WAUA 4BFYA 4TL9A 2F3RA 4PQYA 4BFSA 5K8IA 3ZS9A 1Z3IX 4UXIA 5BWMA 1EWQA 5JFGA 4ASUD 2HCJB 2DHRA 1IJEA 1EX6A 4AYWA 1SHKA 2D3WA 5AJYA 2X19A 1A2BA 1KDPA 4M9ZA 1AKYA 1G8FA 3FYHA 2CJWB 3TIFA 3QVVA 4OK3A 4ACBA 2B7BA 4TYYA 2N1BA 4HLUC 4BLQA 3ZJYA 1TQ6A 1E2LA 2J0VA 3KFXA 3MSXA 3NBXX 4QXAA 3KQKA 3ZYCA 5L3QB 1JNYA 4OI1A 1I4LD 4MGKR 4Q03A 2RH5A 3O8CA 4GZMA 4Q7LA 5EP1A 5EE0A 3RS0A 5CK4A 4A0GA 2HV8A 3QKRA 5JEEA 3FKSA 2GA8A 2D06A 3EIHA 3QF4A 1FNNA 2WSSA 2Z5FA 4BASA 4C0BA 1G3IA 4JKYA 3FHTA 2CXXA 2HT1A 3OIUA 1WB9A 5K8TA 1Y3AA 3IHLA 1CRQA 3CPHA 3RRYA 4DLTA 5BYKA 1GSIA 1Z6YA 4R71A 4Q1AA 4PFSA 3ETLA 3X1ZA 2VA8A 5SZHB 4DCTA 4PSVA 2MMCA 2NMVA 3M6AA 1UBEA 5HE8A 3Q85A 3TBKA 1DELA 4GDFA 4AY2A 2EFHB 2QNRA 3MMPA 4P0TA 2JASA 2ECKA 4URWR 2OZEA 4MH0R 4EJSB 2JGNA 4U5XA 1YRBA 1ZCBA 4DDTA 3PEVA 1E98A 1XEXA 2FNAA 1NMXA 1G291 1OW3B 1JJVA 1DAKA 2QPTA 2WJHA 3CF2A 3HU1A 1J90A 3RS4A 3PVSA 5DI3B 2ZI3A 3LFUA 2YWFA 3UG7A 2BMEA 1PJRA 2H92A 1DADA 2ZRBA 5CK5A 4LX0A 2F55A 1Q3TA 4JLAA 4PZZA 4LZZA 3B1WA 1QHHB 1VCMA 4OL0A 3S1AA 3LVRE 3AGQA 3VX3A 4HDQB 2O8FA 1KY2A 3W8RA 4QL3A 4YMSA 1ZUHA 4V0ME 5FL3A 5DNYB 1ZVQA 3NKVA 5KNBA 2IYSA 1XXHA 3W3ZB 5FFMA 3AVQA 5FR2A 4PANA 3ZD6A 3WXMA 3TQFA 2WZQA 5C2JB 4I1OA 2OBNA 1RPZA 2BWJA 2G6BA 4NE2A 2J46A 1K6MA 4Q1CA 4HLQB 1GVNB 2ODEA 3FDIA 2QTHA 3BFKA 1NI3A 1G16A 1VCNA 2P67A 1Z0IA 2ZSEA 121PA 2ZRDA 2L0XA 2WPDD 4EJSC 2B8WA 2VF8A 4URZR 1KO8A 3UPUA 1RFLA 1KSHA 1P4SA 4UKDA 3NHAA 4ABYA 1E2JA 4Z8YA 4IDOA 2A2ZA 1KNXA 4KHZA 1AGPA 4AK9A 1L7VC 1D2NA 4DLVA 1FFHA 4HAVA 5GVRA 1C9KA 1LVGA 2JDID 2OM2A 4E03A 2ZJZA 4DSNA 1TQDA 1Z0AA 5LDDC 3KQHA 1NG1A 4Z8XA 3R7WA 1ZUNB 1IBRA 1XMVA 2OBMA 4R9UC 2RGNA 2FDCA 3GJ0A 5B30A 4PPFA 1T0JB 4YMWA 3BOSA 1W5SA 5CM9C 1U90A 1P61B 3FMPB 1QVRA 5CYPA 5E4FA 5EXTA 3B1VA 3ASZA 1F2UA 1UPTA 2C99A 3CNOA 4M1OA 3C5CA 3PEWA 4ZO4A 1KK1A 1OFUX 1IOZA 4US2R 2I1VB 2B6HA 3DEFA 3CX8A 4A92A 2IUUA 1AKEA 1ZAKA 3I32A 1KI6A 2FX3A 4XWKA 3KKMA 4JLMA 4NP6A 5IT5A 1G4AE 1G8PA 3CRRA 2VH5R 4JSYA 2ERXA 3MAAC 4Q4AB 1SVKA 4OI2A 4PHGA 2QMOA 2CK3A 3AH8A 5BN4A 1CULC 4YMVA 5LPNA 3A1TA 5KYKA 4Q7JB 3K9LA 3VKHA 3EIEA 4L15A 2F43B 4NCJA 3TW8B 4CT4B 5L3RA 1W7AA 4F4JA 3A1WA 4DCVA 4C0AC 2WJVA 3AP2A 4QM7A 5ANRB 4PC3A 4QG7A 1T3SA 2QBYB 1IXZA 4PXAA 2QT0A 3Q7QA 4X8MA 4FCVA 5B57C 3AKYA 3VAAA
chains in the Genus database with same CATH superfamily
1EKXA 1MRSA 3GH3A 3W8DA 2IS4A 3B48A 3LRPA 5JVDA 3U7QA 2H2DA 1E59A 1NR5A 3IDQA 1PS8A 4I9GA 3WJ2A 3NHSA 1H1LB 3RYHB 1DQZA 1P0CA 3GNTA 3BJEA 4RSGA 4TOIA 3CPEA 3VVBA 3COYA 3WP0A 3TTUA 2Y77A 3TQSA 3VKVA 1RKXA 2DR3A 4UHHA 3JWHA 1VL8A 1TK2A 4X85A 4HRXA 3HV0A 3WJAA 4QOFA 2IY7A 5LWHA 3L9XA 1PDVA 5BSUA 2ZK7A 3UXMA 5LC1A 4MQLA 5B1DA 3JD2A 1ESDA 3KDSE 1X80A 3EUAA 5EJEA 3OQ1A 3HRIA 3EEOA 1USUA 2V65A 2CUNA 1MC8A 4M8SA 2R00A 1P2SA 5EFZA 1MFPA 2XXBA 2PQ6A 3G3EA 1LI7A 3NVAA 1PLKA 3H2BA 3PBKA 4J0GA 2C7OA 2IOQA 4AUEA 1XWFA 3WTCA 2H5LA 3VPAA 2OGWA 2Y1DA 3A6JA 4QTTB 2PUVA 4DB2A 4S1PA 1CS0B 2ID9A 2BDUA 1M2VA 1R00A 2H7CA 3BGOS 4NEGA 1JG3A 5ARBA 4TTIA 4E07A 3NM5A 4PFQA 4ZQFA 4GBJA 5I9SA 4IJVA 4RVNA 2EVWX 4RETA 1KP3A 2ZWAA 2PX5A 1SQGA 1U4OA 4B6SA 2HFKA 2JBAB 2CYAA 3N2LA 4PYIA 3VPFA 5JS6A 1CYDA 3SQWA 3O47A 1N5IA 4O0MA 1GUFA 2G0TA 5IX8A 2DWQA 2XNDD 4TSKA 1HQDA 2DOKA 3UAZA 2R0QC 3ZCTA 1RNLA 1XF1A 1FXWF 4LKRA 3DLCA 4G84A 4P7GA 4TM7A 1V4NA 5IT0A 1YCDA 2DBZA 2I55A 5HRUA 3QPUA 2QN2A 2R62A 4AMZA 3P9NA 1M2WA 1NBAA 4Y9RA 1RJWA 4BTEA 1KVRA 3JVUA 1BDHA 2AG5A 4KWEA 3ICPA 3LU1A 1NBIA 3MT0A 3QU5A 4O59O 5LZ9A 2XRZA 4DLXA 1IE3A 4RL4A 4B85A 3FXAA 3WNDA 2O2EA 4DNFA 2UXCB 1BHQ1 4OMCA 5CT8A 2R1ZA 5BR4A 3EVTA 2EJTA 2IYEA 5K0ZA 4NZMA 3FYUA 3JQPA 4DVJA 2O2XA 1OXVA 2PLRA 5ALUA 1RBYA 3W7BA 2EWWA 4R68A 3L82B 3ZG6A 3FTPA 5LXTA 2YNMD 1J7KA 3M89A 3O6VA 1A9PA 3ROKA 1MH9A 4O2BA 5F64A 1XL0A 4PYRA 5DGHA 1BRTA 1HGXA 4R5HA 5SICE 3TUIC 4PR0A 4YAWA 1VE7A 3ZHSA 4ARVA 5FD8A 5REQA 5BN1A 1MB0A 3T9DA 5IK2A 4N82A 3G1WA 3SMQA 1DQPA 1WEKA 1U8CB 4G81A 4MUGA 4B5LA 1U6IA 2WUWE 4OXKA 6YASA 1Y7HA 3NI2A 3QEKA 4LJKA 5KYYB 3D7SA 2IQIA 4UEQA 2JLVA 1H8ED 2K6GA 2PWAA 4PYJA 1OYOA 2PBZA 5IT9A 3D2LA 2WIDA 3DEJA 2YW9A 3HYRA 3TB6A 1K7CA 3RIMA 4DNPA 4DG8A 4L16A 3HUFA 2WVAA 3EEQA 4QGBA 5K0SA 5ARCA 4TRNA 1BG6A 3ZHOA 4D3XA 3IQXA 1VSUA 1HZZC 1JDZA 2OZPA 4GSYA 3D8TA 4R7ZA 5HKLA 4EG6A 1KMIY 3TR5A 4HZUB 5HEKA 1E62A 2QENA 1PUIA 2I29A 3DMRA 4JLSA 3TZBA 5BV7A 3NLLA 2FEMA 3ZVMA 1NASA 1MFZA 2E5FA 4TLDA 1YJBA 3G0IA 4BNDB 4BUJA 4RDXA 3BMCA 3DFKA 4EY7A 3MFYA 3V7FA 1NRXA 1GXSA 4CM4A 4DV4B 2C57A 1IK6A 1R9JA 2DSNA 3QE3A 5HCIA 1YFLA 4LHVA 2ZUEA 3D0OA 3DE4X 5F9FA 1ULZA 4YV7A 3X3HA 5CB4B 2ACKA 4AZTA 1NUHA 3AY6A 3O93A 3F7NA 5EXPA 2ZG6A 3KV3O 4CCSA 5IFLA 3DZJA 5K8UA 3L2OB 2G0NA 2G7ZA 2H3EA 4KYUA 1YL5A 5U9CA 5AW5A 1YCGA 3WLIA 1MT0A 2BFEB 2OORA 2XJ4A 1EX9A 3H11A 4OSOA 1E2NA 3B6MA 1XZLA 2HA2A 3QOWA 1IQUA 2C2KA 2R1TA 4G5QA 3FF1A 5F2EA 3WL7A 4AKSA 5FJJA 3EX7C 4FQ7A 1POWA 1HM5A 2JEOA 3V55A 1A71A 2AH5A 1DCKA 4HGRA 1W9MA 4PAQA 2RHMA 1JI0A 2J5RA 4NULA 4RKWA 3ZLBA 1YZ3A 5DM60 4M6WA 2FPMA 2RHBA 4XSVA 4OI0A 1XK7A 2VPWA 2Q7OE 4DUYB 4P5DA 2CHEA 2QM0A 2JRLA 1NFRA 4FU0A 1EK2A 4BATA 3HK2A 1YRQA 4KOEC 2RH8A 1GTG1 1MJGA 1S2OA 3EYAA 5EZ5A 4RK4A 3FSGD 2O8BB 1LK0A 5A03A 4DM3A 1KQNA 3AV0B 5F1YA 1OPXA 1QIGA 1Y98A 1F6DA 2BISA 1JIIA 3LRTA 3ZYZA 1YB7A 4DLKA 4TMTA 3VHLB 4Y2GA 4NX2A 2RJNA 4B3FX 5KTYA 1EVKA 1U9ZA 2EAUA 3EMBA 3E22B 2D5BA 1YOVB 4FLEA 1XP5A 1KK0A 3I30X 1CCWA 2Q9BA 4I9HA 4FGSA 3JATB 4RHCA 4INPA 4QT4A 1T3LA 1PQ4A 1UC4B 1WMEA 3KJIA 3VDNB 1XNGA 1P5RA 1P2GA 3K72B 4B47A 2CEAA 5JOQA 2O0LA 5G41A 5H3HA 2AEMA 5IKMA 4J3JA 1RYYA 3HMQA 1NRWA 1ZL2A 3ROMA 2PX2A 7YASA 3W5HA 2XTMA 1XVVA 3NEPX 1Y9ZA 4HXEB 1SUEA 1VBFA 4KLNA 4D6YA 3V2UA 2PZGA 3C2QA 1SG9A 4BB9A 4CN9A 3OA2A 3CNLA 1BO6A 1T5OA 1JWBB 3I2HA 3KUDA 3CUKA 4UD6A 1F51E 3ELYA 2EGUA 2BGKA 3EZXA 4UCQA 3E3LA 1SA0B 3O4FA 4NG5A 3VYWA 1E2MA 4XD7D 2DSTA 3W2GA 2RH4A 3C6KA 4CMKA 2GESA 1DBSA 3PXDA 4PYKA 3S2FA 2I62A 4EJSA 4OKIA 4YX9A 4GOLD 1WHTB 2G76A 4LGCA 3TW4A 1ESCA 1X7WB 3D6HA 4O4IA 4LK3A 1LDBA 4XIYA 1OXTA 4KIJA 3T9EA 3BULA 3CEMA 3SDSA 4HEA6 1OV4A 4KC0A 1TU4A 4NJEA 2H1VA 1K88A 4RIFA 4M1YA 2GZHA 4N7JA 2ZBGA 4F9TA 1SVIA 2GBLC 4N0EA 2WD7B 4MI1A 2ORIA 1NJGA 3P4YA 3QF7A 3QWBA 4IJMA 1JH9A 1EE2A 2ZJAA 3DT6A 4LZAA 4BRSA 4S05A 3RS3A 4D8UA 1SVSA 1U3WA 2IHYA 2Y8EA 1N5JA 3G17A 4PYNA 4UVEA 2OFFA 4F56A 3OQ6A 1UBHS 2XMSA 1KJ8A 2JF0A 1IQ0A 1ZINA 2V3CC 1G8HA 4X1YA 5IC5A 3KR0A 2X42A 1I3KA 2QRQA 3AQIA 3UWOA 3D3KA 4GR9A 3IYLW 5HDBB 4Y0VA 1CG6A 1MPXA 4FFVA 1W52X 3KLOA 3I2KA 4QWWA 1JKFA 4XCVA 1JHDA 4QX6A 1A5ZA 1QGOA 1BU5A 2P3SA 2ZIXB 3PP8A 3MJVA 5JRZA 4ZO8A 2X8AA 1SWVA 4GOJA 4R8VA 3R76A 3IKMB 4WZBA 4YT2A 5G0WA 2OQ2A 3IAM1 5IJ9A 2GJ9A 3JQEA 3MTDA 5JZVA 3OPVA 5LL6P 2XNKA 5AK5A 4QEKA 2AR7A 1GNLA 3E3NA 1NNLA 2DPLA 1JN0A 2AI2A 1O5IA 3OQBA 4Q6BA 4L72A 4N0MA 3VSCA 2GO7A 1JVNA 4I55F 1XTTA 3TGPA 2Q5JA 2OO7A 3GDOA 3VO2A 4MRAA 4UUNA 4URHA 2XW6A 2VG8A 3QUAA 4OCZA 4PZEA 1G20E 2G9RA 3IXQA 3GEGA 3PT5A 5JBQA 3L4KA 4LCJA 2AOVA 4FZ5A 4DIOA 2VYVA 1E2DA 4S1TA 1NUTA 1VMEA 3I1IA 5AI8A 4S2EA 1N2OA 1NJ2A 3QA9A 3D3NA 4KSCA 4FW9A 4YRZA 1PL0A 1TOAA 3UOAB 2J7PA 4ZU3A 4QDJA 5I8ZA 2RIRA 1KC1A 3CNBA 3WK5A 1AQJA 3LIPA 5IU6A 1BD4A 1YIDA 2WNSA 5ALPA 1PWHA 1UXOA 2WKQA 3ZEIA 1Y6FA 5FQOA 3OJEA 3T7TA 3VO8A 2EEPA 2FSVA 3H0CA 4ZA2A 1CP2A 4R1QA 4Y6GB 5LDHA 3N1UA 2WG2A 3WIVA 1KWGA 5GJBA 4MV7A 2H08A 3IOMA 3DXYA 1GPNA 4LBYA 3ED1A 4HTFA 2MHCA 4B73A 2W2LD 2N46A 4E32A 3G9XA 2V6IA 3HI4A 4WCDA 2AXPA 1P0FA 4QBHA 5DLDA 3WBJA 3HUUA 1N8TA 5BV8A 2UV8A 3OM8A 1CQPA 3TNLA 1MC1A 4KUEA 2FFHA 4UHFA 1XLVA 2AQHA 3PUZA 1EZ1A 3VMFA 4ZN6A 2EEZA 1Z0DA 3IEXA 3RS7A 3VGJA 5LMUB 1Z9BA 4KMMA 4OY3A 2DKOA 1WF3A 4HKTA 4D4IA 3LY7A 1AZSC 3IUBA 1SUWA 3DZCA 3FNBA 3ZS8A 3CLUD 4E7PA 4ZHQF 4EUKA 5LWQA 1V11A 4PLFA 1KZ1A 3PKJA 2XXAB 2OECA 3Q0EA 3WX0A 4Z4FA 2LXNA 1ULSA 4NSNA 4B3GA 2X7XA 2XOKD 3VOBA 4WVFA 1VYVA 4F71A 4EJFA 1XNJA 3FMOB 2CNWD 4JVOA 4BFUA 3Q5EA 1QCYA 2ES4A 1H1LA 4OO3A 4MWDA 3ZU3A 5LU8A 4RHFA 1QTRA 1U0JA 3YASA 4YAEA 4DJAA 3LQ1A 5E3JA 3KZKA 2HA3A 4NPCA 1HDCA 1BSVA 1N6IA 1IULA 3KT8A 2R65A 3PD7A 2GK6A 2AB0A 4ENTA 1ISSA 2XNSA 4YO7A 5EEHA 2XUJA 3AVOA 1Y8CA 2IV2X 3COPA 1P31A 1S8OA 1T2FA 3FYCA 1UOPA 2EQ5A 3CF6R 1OSNA 1HDOA 2C97A 5G4LA 4EFLA 4YYEA 1C2TA 4EHHA 5K3OA 1Q1EA 1UDWA 1SCUB 2VQDA 2ZT8A 4TZ0A 1ABFA 1SURA 2FCRA 3GFSA 3CE9A 3M83A 1JQBA 3DAFA 3BEDA 4EUHA 1R5NA 2Z8YA 1QHEA 4CT5A 1PEYA 2ZLBA 3ZNQA 4GGMX 1GV1A 1Q91A 1NT2A 1Y1PA 2PU5A 5F1OA 2TECE 1OILA 3G2LA 2E4WA 2TMYA 3PQ7A 2JGLA 3Q9NA 3FRJA 2IUFA 4WXPA 3DEIA 3U13A 3H5NA 4BCCA 4A5OA 3W04A 4G65A 3FB4A 1CS0A 5GM1A 3TOCA 4NK5A 2XTJA 3MCWA 4P3YA 4LPSA 2FE1A 1TC1A 4MMXB 4YUXA 4U1RA 4JIGA 4N48A 2QIOA 3QVUA 1Y3DE 1LDNA 1LGYA 3VI4B 2A0YA 2DUNA 4CZ2A 1K8YB 4LNAA 5LKRA 3ZVKA 3KETA 1XU9A 1KEPA 2JBAA 2BFFB 4DLYA 2PT9A 3O4RA 5JNVA 1IPEA 5K0FA 3H04A 4MW7A 1BN6A 2IYPA 1KZHA 5BUQA 4Y2SA 1Z5UA 3X2EA 2NX2A 1M54A 3NIDB 4OJQA 2HXYA 5E2IA 3EXFB 7MHTA 1CZKA 3QLVA 5EHXA 2CLKB 1MKYA 4LE0A 1DDIA 1NKVA 1ODIA 2BMVA 1E32A 2DECA 2XY4A 2Z2YA 2ZWIA 5K3FB 3T9FA 2HB6A 4CI9A 4CMEC 4YCCA 3WOVA 1II9A 1MHPA 1GPUA 1WPQA 3RFTA 3LF2A 4O1HA 4BVKA 1H2ZA 2EJWA 1WSBA 2C5GA 2CSUA 5E95A 4O63O 4OMFG 3U3ZA 1MOPA 4QXOA 4YMUA 4ZK2A 2Z6QA 5JTUA 1ID1A 5DCWA 2N75A 2WJZB 3H42B 2PKEA 5EHNA 4ESVA 4KVGA 2HXGA 4GE0A 2SECE 4G6ZA 4DG9A 4FYWA 3WZ2A 5HYVA 2Q7DA 2JJQA 2BLNA 2ZBFA 2ZCVA 1GPBA 4YUZA 4BMSA 5FBHA 1VLZA 5FB3A 1MB9A 1ZZGA 3O4VA 4QHYA 4BX8A 5AUPB 4RY2A 3PVZA 1NU6A 2PT6A 1NZJA 2R8PA 3GZJA 2IYXA 2MINB 3IESA 2PO7A 1XDWA 2FSHA 5HGJA 2CMKA 1NBME 3PEUA 4J1QA 1SB9A 4DKXA 3LY5A 1FTSA 2I9KA 2Z9CA 3CVOA 3O03A 3TM4A 1IBKB 2GWHA 4P7BA 3DYVA 2IHTA 4TN1A 1QRTA 3F98A 3VSDA 4PTYA 2GD1O 3IO5A 5ECGC 1PGOA 3BXHA 5DH9A 2YNMC 5KYYA 4MYUA 2W6JD 4LAFA 3GVPA 4KN8A 2JCSA 1NW5A 3F8SA 4XGNA 3BGDA 3EVZA 5JAHA 2AXEA 1JFLA 3KZXA 3WLRA 1BQEA 3C43A 3DWFA 3KFVA 3ZV5A 2I2WA 2Y6VA 4QA9A 3ZC3A 4RCVA 5EMKA 2JJ1A 2JS7A 1NM5C 4HDKA 1RXVA 3LXUX 3D3EA 1Q17A 1KO4A 1YHZA 3RF6A 4GG1A 3A1SA 2C5SA 4HZUA 4EGAA 4L3VA 1KZYC 1D2CA 2GAJA 2QWXA 3BDVA 3R7BA 4CPDA 2QVXX 4JDPA 4DSUA 2VJLA 4BNDA 1DARA 4QPPA 1Y1KE 4KDFA 3L0DA 3AY7A 4OFWA 2IIBA 5DRYA 3N6RA 3KVRA 4A8TA 4WL0A 1GUDA 1S0UA 1I6WA 3QIAA 2NZUG 1LQTA 5CB4A 1YA6A 1JKJB 5CNIA 3K0AB 1GZ5A 5BQPA 1B41A 4RJJA 3FLBA 1WZNA 2XNHA 3KLPX 3LC7O 1XMQB 1WV1A 1L3BA 1HZJA 2IXAA 3B51X 4JX9A 4BJ5A 4NS4A 5THQA 5BSEA 4KV7A 3UMVA 4ENVA 4OB6A 4HO1X 4O2AF 3RSGA 1T8UA 4NOJA 1E18A 2E48A 5FOQA 2QGNA 1ZFNA 4FYYA 3I73A 4RU1A 4U7DA 4LJSA 1USVA 1ZJ6A 3BTVA 4IHQA 2CV2A 4A16A 5CT9A 4ZTBA 4OHRA 5EJMA 1Y1RA 3DOEA 4FFPA 3KJEA 4X97A 5L9AA 3LPCA 2VK4A 4GBGA 5E9JA 5M34A 3ESYA 5JXHA 3RRJA 3WHLA 5JJLA 1RS0A 2BUBA 5B3LA 3ES9A 3QEJA 3TW0A 4DRXA 4OKSA 2O8BA 2LIPA 2SCUB 4K6FA 1E1YA 2KB0A 1TK3A 2ZJYA 4R9NA 4C87A 3UK2A 1FSFA 1EXVA 1EK5A 3DLIA 2Z1MA 4DLUA 3FB1A 4KWTA 3NP7A 4H1VA 4QYIB 3CSSA 3CRQA 3E22A 1UFOA 4MKIA 1ZBQA 1YOVA 4E51A 1AQUA 1UBNA 3H18A 4YRTA 4K46A 5CCXA 4RWEA 1M7GA 3C41J 3JATA 3LPLA 1CHDA 1KPHA 3HJGA 4O4JF 3ZLVA 5HZHA 1EEHA 4MDFA 5C8ZA 3MD9A 4IQFA 4EMSA 3GX1A 1VL5A 4R54A 4X65B 4L5AA 4L5JA 3A6PC 4UMDA 4F8YA 3LHSA 1QIIA 5JE8A 1TEVA 3SPXA 5L53A 3OCJA 1OZFA 4FBGA 1XCPA 4MWEA 3VNUA 2Q5QA 1QH1B 4U2FA 4UW9A 3UOWA 2VHZA 3OUZA 4KI0A 4D9FA 3WWOA 3AKCA 4EECA 1VIAA 5ITWA 5IYZB 4IAOA 5JANA 1J24A 4RSMA 1N5KA 3F78A 4XSHA 1XVTA 4IGAA 1VHWA 2Q7XA 5CIQA 4Z4HA 4CTJA 4CLHA 4JS0A 4UE2A 5D00A 5LZ4A 1QP8A 3BCUA 3PFKA 2PUFA 2ACWA 1SA0A 3SOZA 1IAVA 1YZFA 3CLRD 3D0QA 4B2YA 2MSDB 4C0WA 4D8YA 3ZWAA 4KR2A 4MVWA 5JAMA 1WSAA 2JC3A 1WHTA 1P1FA 2UKDA 4BMVA 2GHIA 4NFYA 3TZHA 4AJ4A 3DP7A 3NKFA 4HQOA 3CXRA 2DHDA 3EHEA 4RXMA 4OSEA 3ZHVA 3ZI0A 4UVIA 3BAZA 2L19A 1JUDA 1PFVA 2PZFA 4HNSA 3PJDA 1ZH6A 1L5WA 1W6UA 4NRDA 2VAVA 2XLCA 3KP1A 1GNSA 3TJRA 3NT4A 4PRYA 3CVVA 3PUHA 3BC1A 2J07A 2I99A 3A6EA 4ARBA 3SP1A 4HWKA 3EN0A 3IE2A 2F4NA 1E3WA 1V7QA 2CXOA 1HMYA 4WLOA 3CEPB 4I5GA 4QJ4A 3WOHA 3PITA 4HCJA 4K0KB 3R7LA 4B34A 1J9EA 2FWJA 3KU1A 5EY5B 3IDSA 1SULA 1V3QE 2VBCA 4A7PA 3SC6A 1XDBA 3TVDA 1FDUA 2JBHA 2AEFA 3F3MA 3MZ0A 4HDOB 4INJA 2RCYA 3UH0A 1LF0A 2WM8A 3NPMA 3OKAA 1DC5A 4L0MA 1M2FA 4AJOA 4C6HA 2H1LA 5JZSA 3WGIA 4JBHA 4FT2A 2C1XA 4DQLA 3QJ5A 1O96B 5H16A 1RABA 4ALIA 5B53A 2ILVA 9LDBA 3L41A 3OESA 4KI7A 3UT5A 3LLUA 1V7PC 2ZDGA 2HPZA 4N0PA 5C5EA 1NP6A 1JQEA 3T06B 2NWQA 3KYDB 3C3YA 3FWYA 3H84A 4KO3S 4UM7A 4EELA 1UK7A 3OEHA 3OZCA 2WSBA 1HRKA 1PFQA 4ZZ0A 1BC5A 1KZ9A 1D2HA 3PUYA 2ZPUA 1QJ4A 2V1XA 3DPUA 1HXHA 2BM9A 2R8XA 5EQJB 4WJLA 3ZWMA 2HJRA 1UBFA 1WCYA 2O7RA 2G1PA 1KY3A 1PP4A 2C9OA 5EWLB 4C30A 3NKLA 3MJFA 2QUBA 4JASB 4J1TA 2HHAA 5J3JA 3ZDAA 5FPPA 4YRRA 4BTVA 3FWPA 3L0SA 3K2BA 2IOFA 3N8KA 4R1OA 1EQ2A 3KCQA 3VQTA 1PFGA 1ZCFA 1YDEA 2VUUA 1JG1A 4Z9XA 1XDSA 1T5LA 1WD5A 4F21A 1KGDA 1L2TA 1OBVA 2R4TA 3KQQA 4BLTA 4ZIRA 1UXHA 4QVIA 5JJKA 4FCCA 4FN4A 4RTSA 1GLVA 3DKIA 4KSYA 3AJ9A 3CCCA 1JA0A 1B42A 2LCFA 4IW3B 2V6GA 5JARA 1G8KA 3PA8A 4E88A 4YFYA 4CMBA 4KITB 4RS4A 3AVVA 1AKWA 1L4NA 1KYVA 2L82A 1J5EB 3T95A 1E63A 5HQTA 2G06A 1YOBA 1CSEE 1BMFD 2ZAYA 2UUBB 3FPBA 3ZWNA 1H4TA 2ZWOA 2IV3A 4UOZA 5KX5B 1K97A 5KNDH 2C20A 4P3PA 4UTNA 3U1VA 3TTWA 3FCSB 4UDXX 3HB5X 2AC2A 4X95A 2BZSA 4A2CA 3OJXA 1JAIA 5GVSA 1BROA 2FMIA 2LD4A 2XE4A 2YZ7A 1KR2A 3HCPA 3HVUA 4HS9A 4Q3EA 1OFTA 4LTMA 3VR2D 2YVAA 3RU7A 5JCOA 4IFBA 1ZH0A 5JISA 1TLTA 5G02A 1SUIA 1HH4A 4N3BA 2XXAA 2IYUA 3LC1O 3UM9A 2ZWMA 3IQWA 1WXEA 4DIBA 5HP4A 4FCWA 8ABPA 3L46A 2XZLA 1GG9A 2P4HX 2EF0A 4B75A 3RGGA 4CM7A 1PX0A 2MOKA 1VE9A 3R24A 1S02A 4BC0A 1JG7A 3G68A 3B1KA 3KLBA 5C7IO 1CIPA 1J2JA 2CVHA 6GPBA 5L3ZA 2NP7A 2B4AA 3Q2KA 3MBKA 4WFQA 1BA2A 1N32B 1NOJA 2YWEA 1Y4UA 2ZT7A 4JC0A 1XJWA 1XMJA 1NIPA 1P0PA 1TTPB 1WP9A 2X9GA 1RI3A 2AFHB 1RYNA 2I80A 4FB5A 3WTBA 3WA7A 4PIMA 1SBTA 1E1DA 1PI3A 2IPAB 3K0CC 4XUEA 3F49S 3OLZA 1Z0SA 5HCNA 4I1VA 2E5LB 2VCYA 4IG9A 1ZGCA 4HV4A 4RCZA 3QLUC 1U5AA 4BCBA 2PGOA 3ROQA 1IHXA 3OLCX 1GTRA 4NR0A 1F8GA 4AG3A 2QYOA 3MB8A 4M3NA 1T13A 1NI4B 2HU5A 3OZWA 4IVPA 4MEAA 2VAWA 3TL3A 2Q5CA 2E9SA 3MUNA 1CJBA 1ENZA 4G24A 1IJFA 3QELB 4NECA 1U4NA 3BB3A 3TFWA 4DDMA 4A8PA 2QY9A 5TARA 4M1EA 5I9NA 2A0WA 5TGTA 5JZ9A 2DETA 3IBYA 4Q4LA 1VPLA 5F23A 2HU8A 5H9VA 1EGVB 1ADFA 1JS1X 2ATEA 3G2MA 2HR1A 4AS1A 4WSOA 3WNZA 2DPGA 3M2PA 1B6TA 4RFVA 1U0OC 4S1NA 3RKRA 4BZWA 5KWJA 3GLGB 3CBQA 4IOMA 3T7EA 5DP1A 1MX1A 1ODLA 3IKJA 3HO1A 2IS2A 3PICA 1BDMA 3IL2A 1O77A 1WUJS 1PV2A 3P0HA 3RAFC 3UICA 3HVRA 3LDGA 3RW9A 2BFFA 3CVJA 1AUQA 3PUXA 3NYQA 3RLFA 3HTXA 3CURA 3C3KA 1S3GA 3NUZA 5LD2C 5PGMA 4QPDA 3EZYA 5J47A 4L6IA 1L5LA 2B7LA 3ND7A 4I6GA 3SYNA 3GMDA 5K3FA 3TGWA 3AZQA 2GZDA 4ED9A 5FBVB 1DTSA 1NSFA 3ADOA 4PWZA 1TECE 2FSUA 2NXWA 3BQMB 2CXRA 1G7TA 1D5CA 4HLUA 2C0PA 2XMGA 3G79A 1DMRA 3RABA 3OEYA 2PGAA 2Q1YA 4MV8A 4D0SA 2WYOA 1YKSA 3H2SA 5T67A 5T41A 2QUZA 1FDSA 1HF3A 2C4MA 3WYFA 3VXKA 4ZEVA 3L9WA 2JVKA 3VV3A 2FX5A 3UXHA 1I33A 1DT5A 3EC1A 2ET6A 2UVDA 3CTPA 3M6UA 5B4TA 1Q95A 1WQ4A 2MINA 1SC4A 1E6WA 3D31A 3G0CA 1NJFA 2H9YA 4B43A 1L7MA 2NYAA 1QBGA 3R09A 3U31A 1CY0A 1QG0A 4RZ3A 4ZPJA 2M98A 3AR6A 1SNYA 4BVJA 3KYBA 3KZ1E 1GU0A 3DMFA 4LHYA 2IZZA 5FBKA 3DFUA 2RHOA 2F2TA 4HQRA 4CETA 5HKKD 1FC0A 2IYOA 4Y7CA 2A4MA 5K45A 1Y81A 4US1R 3PA6A 2G9VA 1H2HA 3DV0B 3PWKA 2QX7A 1O9BA 2WTNA 4JLWA 2QJRA 2Q46A 1CLEA 3B3JA 3ESXA 3KNZA 4LV6A 4MW2A 2ZBPA 1SHLA 4RO0A 5B6JA 3LCVB 4YAUA 2JLWA 5A5GA 4B83A 1VHJA 2G9QA 1PK7A 2XADA 3PJFA 4O4LA 4EWLA 4OFXA 4LY9A 5CRIA 2P69A 3QOYA 4QDZA 3RVSA 1VL0A 2Z98A 5TR9A 5D6OA 3TCKA 4EI7A 4B82A 1RZRD 1VSVA 1MB3A 2A9PA 3WK9A 1PZEA 3PYLA 2VWHA 4JI7B 1USIA 2ACEA 4KG7A 2RG7A 4ERXA 4WE3A 4B3CA 2Z3WA 1R0XA 1ZNXA 3UXYA 3VA7A 3HCNA 4IO1A 2FTKE 3CUYA 8ADHA 3OEED 2EYQA 3GLKA 1KEKA 2PQMA 2WIAA 4A82A 4MYDA 3HB9A 3PXAA 3CGWA 4C4ZA 3RU9A 1JKJA 3AR9A 4BHTA 1NMZA 3K0AA 4DANA 1N5RA 1DAGA 4PX2A 3H3FA 1XLTA 3W8FA 5J2UF 2RI1A 1JZTA 3JASB 2W6MA 4UMEA 5E0OA 1W4BA 3GDGA 4WA8A 3TD9A 3USZA 4B3MB 4UEOA 1DWOA 1GPWB 1XXHB 1UH5A 3AR5A 3D3WA 4MJLA 3DBLB 3EGIA 4B3DA 2PRSA 3IELA 1W19A 1CUDA 2WB2A 3R9XB 4HATA 4Z7JA 2R47A 2VP4A 1QQ5A 4RPKA 4U9HS 2C9CA 1JU3A 4PONA 4WXRA 3TRIA 5KKCA 3CUUA 3CS3A 2WV9A 5CT4A 4MB0A 2WU4A 3N7TA 2G83A 2A14A 2GK3A 2PX3A 2CYBA 4FNOA 4PAMA 2XCQA 2XE6A 3UF0A 3B6JA 3AB8A 1RBQA 2Q2NA 4OUDB 1E2QA 5L3SB 1IOVA 1EUCB 2GX6A 3I2IA 3BORA 2QK4A 721PA 2QRHA 3EQZA 1AG9A 3CNNA 4X60A 5CX1B 2O4UX 4KXUA 1WW2A 2WIBA 4QYIA 5JD3A 3R1IA 2V97A 2C59A 3C7KA 3H9UA 2IRWA 3EUFA 3M5CA 3I9LA 4JL5A 2GYWA 1E2IA 1PKXA 4UUQA 1GNTA 5DLEA 4DCUA 4RMHA 4DCNA 2XKBA 1GGNA 5F4ZA 1UT6A 5FV7A 3MTQA 1NNSA 2FPRA 1TC2A 4YEDA 2ZGVA 3IKTA 4C6SA 4FUQA 5DYYA 2QTTA 4YJDA 3I83A 3CVXA 1IONA 2QP3A 1IH8A 2WWIA 3FG9A 3TIGA 5HOEA 3LUDA 1EFTA 2XYVA 1I13A 1NVUQ 4KPUB 5JPDA 1DDGA 1JDUA 1FFWA 1OREA 2A57A 2GJSA 3E9MA 1EJ2A 1PUJA 2I6SA 2JD1A 2QL5A 3LK6A 3MMSA 4UHKA 4EZIA 1Z7EA 3G6KA 1VPDA 4GH5A 3UUWA 5LVAA 4PXSA 3CVUA 3FYDA 2CZQA 4C04A 3GJ7A 4LI3X 4XQ0A 2QR3A 4BBZA 4Z0PA 1JDNA 1KAEA 1AUPA 3DT8A 1ZJ5A 2R8RA 4HQ6A 1XJ5A 2HK9A 3PWSA 3GEPA 4H60A 4P5EA 1Y6RA 1YI0A 3E1KA 1CTQA 5M3BA 3UK6A 4BLOA 1U5BA 1A76A 4C5CA 1TW2A 1KSGA 2OKCA 4EI9A 5JAZA 1ZHHA 1ZCAA 1KHHA 2C82A 2OV3A 1U7OA 3PD1A 1C4WA 5CJPA 2I6QA 4RM3A 1ISJA 1I6LA 5LP6C 3X2SA 4ARUA 4EYKA 3F2IA 3LVFO 4FCTA 4TS4A 4CEIA 4YT8A 1EB9A 3KKKA 1L8QA 4MVYA 4TT3A 1ZWKA 3CLRC 5C3UA 2FR8C 1KMQA 4MDEA 5KJ1A 1BHSA 3KT6A 1C3JA 3BE5A 5HM8A 2I7VA 3IV7A 4JHXA 5SY6A 2DQSA 2W6ID 3FI0A 2B1QA 3GFRA 3I6IA 4YJFB 4AJHA 2ZBVA 3STTA 3CINA 3TPFA 4WV3A 2QX4A 1EFVB 2ZYHA 2VTDA 4JCOA 3AOEC 4F4DA 3PDUA 4FS3A 2Q1XA 1H0KA 5EFOA 3KTAB 1FNMA 2Q9UA 1WDKA 5EAIA 4E31A 1K1EA 3KQUA 2IYAA 13PKA 2C8VA 4TXHA 1ECLA 5EZSA 5FTKA 1COWA 4RXTA 4Q39A 2BH9A 4YP6A 1K98A 4CG0A 4DY6A 3AR8A 2OCPA 1LCIA 3M33A 3V42A 4FDAA 1HYGA 3K09A 4MQ5A 3DNMA 3UV3A 4BS9A 1JEYB 4FK8A 1K6IA 2OOSA 1ZC3A 4Z4IA 2ORWA 4REMA 2JIOA 2QM8A 3V2GA 1K4YA 1JXOA 3WLPA 1SU4A 5KDDA 5GPBA 3LJKA 4X66B 2VSYA 1NBWB 5TY0A 1YDFA 2AJTA 1IN4A 1D9ZA 3PUVA 1RPNA 1TA9A 2A9RA 4G3XA 1QBKC 3HYTA 3I61A 1KH2A 4ZQEA 2H2WA 4IKEA 2WY2D 2V0GA 1NXXA 1Q0UA 2JGAA 3AU8A 4QATA 4JB8A 5DBGA 2ZM6B 4UBOA 3GC6A 3SJAA 5ICSA 2H0AA 2PVCA 1LQUA 1XCGB 3BD9A 3ACDA 5EWLA 1QQAA 4WFIA 1CWUA 3MK31 1D5WA 1ISRA 4PBTA 3ZQJA 4G1CA 3X1DA 1AU9A 2M6SA 4CFSA 2EWVA 4KYTA 3HU3A 5ICMA 5JSZB 1TIKA 1C3XA 1ZOLA 2H1HA 2RE8A 3QFRA 2O14A 1QG6A 4L7VA 2QMHA 2EDAA 4R7GA 3K32A 1GGFA 4DEVA 5B1YA 1U2GA 1ZM9A 3I9FA 2XNJA 4FIDA 4EW2A 5EJ7A 2JLYA 2ZIZA 2EBUA 1N36B 4N0DA 1X0XA 3N76A 4O0LA 5KTKA 3HJCA 4LTNA 3TKLA 4DZRA 3HJFA 1QYIA 3G0GA 1BS9A 2VJAA 2D8AA 3P0EA 3SQMA 3ZKAA 2XRFA 2ZROA 5LNK1 5KX5A 1EUDA 1T9BA 5D87A 1L5GB 1EFRD 5DPMA 3PNSA 1DC3A 1S1CA 3TW6A 3SYTA 2AFHE 3FETA 2ESRA 3LX5A 5IVIA 1NW4A 1AMOA 4IJQA 1ZA1A 1T4DA 3DHEA 2FN9A 2XV1A 1DJQA 2Z4RA 3KXIA 3L7DA 1S8AA 4BJ3A 1M10A 4X92A 4ZHQB 1E7YA 4TVKA 3PJRA 1P60A 3PUWA 1D07A 1Q19A 1DC6A 1UODA 1Z6AA 3OHPA 4GX0A 4R1SA 5DWQA 3JARA 4ZV7A 4BMYA 4BVFA 2DEUA 3DLPX 3LV8A 1PVDA 1IEQA 2XHZA 4LWOA 3ITEA 4P3OA 3KKLA 4LE1A 5IARA 1U8EA 2XH8A 4I6EA 2ZPAA 2B0CA 2AF3C 1X7YB 2XCUA 1AZLA 3LW8A 3GFQA 3VYRB 1XZBA 3EVFA 3ZCSA 1VMKA 3JAMA 1KAHA 4L76A 1XZEA 4B7XA 3QQ5A 1D03A 3R3VA 3P9SA 4I36A 1WSDA 2DTXA 3WWDA 1UC5B 3B3QA 3OJLA 1KJ9A 3O95A 4KXYA 3CEHA 4HAXA 3OZIA 3IHTA 3C3EA 2V9PA 4GM0A 5L6LB 2Q62A 2P9FA 3GLGE 1ZONA 4LHXA 5KDLA 1BZYA 1NE7A 2H4FA 3UJ6A 3C15C 2YS6A 1VKOA 5HRAA 4JP1A 3VZRA 5J23A 1B6GA 3OCVA 4QUHA 3KYCA 4CGZA 2H2HA 2Z3ZA 5JCZA 1E5QA 2ZWPA 3BT7A 3KJFA 1Z2AA 1VLHA 2NT4A 3QELA 3PHIA 1YQQA 1E66A 1K75A 2LBPA 2WJIA 3CWQA 3OIGA 4UU0A 5CTJA 2VF4X 5ABPA 3H2JA 2VZ9A 4EARA 5C4MA 1GRVA 2FG7C 1Z8DA 2CDAA 2O2ZA 2AK2A 2Q2OA 4REQB 3U80A 4PGHA 2Q0QA 2GVNA 2HSWA 4U6NA 2OCYC 5CVDA 1SBCA 1YR8A 4S0ZA 1TMGE 4BEVA 1U3DA 3GLGA 1C4KA 1C3OB 1L7NA 3EXHA 2CV0A 3L7CA 2JFBA 4H3HB 4RA9B 3WLNA 2GT1A 1A5BB 3NIBA 3ICOA 4KAXA 4ALLA 4B09A 4DIDA 1CT9A 3WY9A 3DMTC 2HGSA 3S3TA 3KWMA 3ZVLA 4C0HA 1SXJB 4NYMR 3RH0A 2Q8QA 1RWOA 1TQ2A 4L95C 2BDEA 1JT2A 1U8UA 1SK9A 4IXNA 4Y2VA 1TUBB 2ZI4A 4EHBA 3SN6A 3ITKA 5DFAA 4ZCQA 4FYJA 1R0SA 4PQEA 2NZYA 2IW3A 2FKAA 3E4CA 3BILA 1S6YA 5ALIA 4FNGA 3OWHA 3E7DA 3QM1A 1NVAA 4L9AA 2VZ0A 4HX9A 1NQ5A 4MS1B 2GN6A 4K9QA 4N3NA 3ZDYB 1B8OA 4QDXA 4DA0A 2DFPA 5HIIA 1NPDA 2YIMA 2GZSA 2JZCA 3KR9A 2W22A 5HIAA 1G38A 3DD1A 2YZMA 3EEFA 3HVIA 2PX8A 2FCAA 2EIXA 1LPMA 3I34X 3KSAC