3G7NA

Crystal structure of a triacylglycerol lipase from penicillium expansum at 1.3
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
258
structure length
254
Chain Sequence
ATADAAAFPDLHRAAKLSSAAYTGCIGKAFDVTIVKRIYDLVTDTNGFVGYSTEKKTIAVIMRGSTTITDIDIALITPELSGVTFPSDVKIMRGVHRPWSAVHDTIITEVKALIAKYPDYTLEAVGHSLGGALTSIAHVALAQNFPDKSLVSNALNAFPIGNQAWADFGTAQAGTFNRGNNVLDGVPNMYSSPLVNFKHYGTEYYSSGTEASTVKCEGQRDKSCSAGNGMYAVTPGHIASFGVVMLTAGCGYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a triacylglycerol lipase from Penicillium expansum at 1.3 A determined by sulfur SAD
pubmed doi rcsb
source organism Penicillium expansum
molecule tags Hydrolase
molecule keywords Lipase
total genus 83
structure length 254
sequence length 258
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2009-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3g7nA00
4GW3A 3V1LA 3ZPXA 1DWOA 1NU8A 1MX5A 2EDAA 3HC7A 3T52A 5JARA 1H23A 5J3JA 1YASA 4KAFA 3FWHA 1ACJA 5AKIA 4H7EA 1IZ8A 2XMDA 4H7DA 3ANSA 5CXUA 1XRQA 3ESDA 3DQZA 4TPKA 4KACA 1QIEA 2WHPA 4Y2SA 3STWA 2HA7A 1QIGA 3G9XA 2ZVDA 3HLKA 3R3WA 2CBGA 3BF8A 2HA3A 1EK2A 1YA8A 4ZWNA 1ORWA 2G63A 2Z3WA 3QPDA 3D7RA 1T4MA 1DWPA 4JYPA 3IUJA 4OU4A 3FNBA 1NX9A 2UZ0A 2DQZA 2Y2VA 1K63A 2XUFA 2CJPA 1JI3A 4X6XA 3CCCA 4C6HA 1AX9A 4QDZA 1LPOA 5IVIA 2H7YA 3GFFA 4YX9A 2VJBA 1R9NA 1W76A 2ECFA 1LZLA 1CQZA 5LIPA 1VJ5A 2PUJA 1VE7A 1EDDA 2PUHA 1L7RA 2J3DA 4MQMA 3STVA 2WJ3A 4X6UA 1A8QA 2DSNA 3C5WP 5EIAA 2HFJA 4GI1A 5AKEA 3ANTA 4HZGA 1MAHA 2Z5GA 4E46A 1F6WA 3QBJA 2WFZA 2PSJA 1G5FA 1FFCA 2H1IA 5AKKA 4NS4A 3LLCA 3WKEA 5T4BA 1JJBA 1ZD3A 4MQLA 3EF3A 5DYTA 4J0IA 2YYSA 2OAGA 4L72A 4F0JA 1CUYA 2HFKA 3I2IA 5ALOA 4X94A 3STYA 1LPPA 3M82A 1B41A 1P0QA 2XUAA 5LZ7A 5AIBA 2GZSA 5HF8A 2WIKA 4EY6A 3WK7A 1WHSA 2WUDA 2WIFA 2JBWA 1GKLA 5AKGA 1GQRA 1MX9A 4NZZA 4UHCA 3QPAA 2HU8A 2YXPX 3F8SA 3FYTA 4CCYA 3FLAA 2XMBA 3OOSA 2RAUA 4ROTA 5CH8A 2BAGA 1BCSA 1MTZA 1QFSA 2WUEA 5IH7A 2WIGA 4BP8A 4K6GA 3WJ2A 2WILA 4C4XA 2WUGA 3BDIA 3PF8A 3P2MA 1ZD2P 4YASA 1XKLA 4UBJA 1HLGA 2WTNA 3IUMA 4PO3X 3IBTA 3W2TA 1BCRA 1ETHA 3PDCA 1THGA 3W9BA 3KOOA 1JMYA 1SFRA 5AKHA 1O6FA 1XZFA 5DYYA 2JGLA 3W06A 4ZI5A 3WWCA 3WK5A 3JWEA 1Z68A 2HU5A 3K9BA 5CMLA 2ACEA 4RE5A 5AKYA 5E4TA 3FCXA 2B4KA 2C7BA 2AJ8A 4DMFA 3H18A 1Q84A 3B12A 1WB5A 2VEOA 5ALFA 4DMCA 4CIBA 5DNVA 3AZPA 4Y2QA 2YASA 1E8NA 3AZOA 1TAHA 4B82A 1E5TA 4CI9A 2AJBA 2OPHA 1ACLA 4PQEA 4C01A 3WKAA 2IITA 4KYVA 2LIPA 1BU8A 4AN1A 2AJLI 4FBMA 5A71A 1XRNA 2XMCA 2HDWA 2JIDA 4N8DA 5C81A 5AK3A 4H35A 1QTRA 5ALYA 3BL8A 5JD6A 2VJCA 1R9MA 5D3ZA 4HAIA 5CT5A 2ROQA 1KU6A 2HRRA 3ZI7A 3BWXA 1ZI6A 1HPLA 3WL7A 2QMQA 4AO7A 3D2CA 4FKBA 2Z3ZA 3R3VA 2V98A 3O9VA 3A70A 5BWBA 5KREA 2VAVA 2GBCA 2XUQA 4A23A 1VA5A 3F96A 3H0CA 4BRSA 3R3YA 1H2WA 3F67A 1FFAA 4HVTA 3GROA 3TRDA 3DOIA 3GELA 1XZEA 4DMKA 1ODTC 2E3JA 5D6OA 1BN6A 4GWLA 1JT2A 4H77A 3SK0A 2WUFA 1UK9A 4AZ0A 1W6RA 3FVRA 3CN9A 2OCIA 3I2KA 3NGMA 2VA9A 5HQ3B 3WLAA 1CUVA 1A88A 1XRPA 4X71A 5E2IA 5AI8A 1IZ7A 3AIKA 1JU4A 2JEYA 1IMJA 1F0PA 4LXHA 5AI5A 2ZYIA 3EBLA 4JNCA 2PX6A 4OD0A 3QVMA 5AKXA 1RWQA 3WIBA 4X85A 1PFQA 4RPCA 3SX4A 1VA4A 3LS2A 3QPCA 4J0DA 4XIIA 1EB9A 4HS9A 4L0CA 5HKAA 2VF2A 1TIBA 1WOMA 4UUQA 1MPXA 2VQ6A 2ZJ6A 3LIIA 3QH4A 1QONA 4PW0A 1OCEA 1QJ4A 3QITA 1DU4A 3VISA 3C6XA 5ALLA 2P8SA 3ESAA 4OUKX 4B9EA 5CT9A 1J07A 2ES4A 3G7NA 2DR0A 4Q82A 5AOCA 1WB4A 4U2BA 3DYIA 2BUAA 2YH2A 2O2HA 4W63A 3STUA 1JU3A 1QOZA 5AOBA 1ZI8A 5AI6A 4TGLA 1E8MA 3AFIA 1T2NA 4OSEA 5EHXA 2QXTA 4X6YA 3IIIA 3PUHA 2I3ZA 1JFRA 4DMHA 1PJAA 2XQJA 3VVMA 3IVMA 1JJIA 4OB7A 4QLAA 2CB9A 1H2YA 5AI0A 4KRYA 1UOOA 1ODSA 1E8DA 1ZGCA 1KU0A 3IUQA 1EX9A 3I2GA 2C5GA 5JZ9A 5D3KA 3W04A 4X92A 5K3FB 4OYYA 2BCEA 3A2NA 4KJXA 2B20A 2WIDA 4OB8A 1YSCA 3C45A 4DYHA 1LNSA 4BVKA 5JAUA 5D7BA 3M81A 4GEGA 3ICVA 4RGYA 1AUOA 4H0CA 1WCYA 3WL5A 2JGIA 4L9AA 1USWA 3F9CA 3OPMA 1CVLA 2QUBA 5ALIA 3E3AA 1EHYA 1BRTA 3H2IA 4FFVA 4Q1VA 2WFMA 4Y2PA 3IULA 3DL7A 3PICA 2FJPA 1HDEA 5T4HA 4AX4A 3CCBA 3G8YA 5FPQA 4OYLA 4H7JA 1HKHA 1LPAB 1CUHA 4MJ3A 3V9AA 4TVKA 5HFAA 3WMRA 5JD5A 5JZSA 2WJ6A 2PU7A 5LKAA 4WDRA 2B61A 2DFPA 3LCRA 5AH0A 5ALMA 2HM7A 1QIFA 2QM0A 3QYJA 1XQWA 2DQYA 5EHZA 3G0BA 5K3DA 5AK6A 2EDCA 1X70A 2O7RA 2OGSA 4F60A 2GYVA 3H2JA 1UOPA 3HACA 4H7KA 4DNQA 1SCKA 2D0DA 5LLSA 2XLBA 1L7QA 4DSAA 3N2ZB 4X00A 3MUOA 2JGEA 4WCVA 1P0PA 3L1IA 1WM1A 1ZIYA 5ALDA 2G5PA 3AILA 2QXUA 2W6CX 5EHNA 5ALQA 1N8SA 3V1NA 2RHTA 4BTLA 4J0HA 3WA7A 1R50A 4RNCA 1X2BA 5ALJA 2WFLB 2K2QB 1AC5A 2J4FA 5ALWA 3C6YA 4MEBA 2OCKA 3GUUA 1SCIA 3D5EA 4LXIA 5LZ4A 2X76A 4FLMA 1BE0A 1DINA 4PSCA 1U8EA 3GZJA 4HRYA 1CUFA 3N0TA 3VJKA 2PKYX 1EK1A 1TRHA 2GBFA 2Q0XA 5EFZA 1EVQA 3BF7A 1K8QA 1N1MA 1G42A 2OCLA 3OG9A 3WK8A 4QNNA 4WJLA 3DDUA 1CUJA 3LIPA 1N5MA 4J03A 3SWWA 2OCGA 4E11A 1XRRA 2O7VA 4L3WA 2GYUA 5A2GA 2O2IA 1CUDA 3WK6A 2WU3A 2JF0A 5A62A 2PSDA 4WY5A 4UBNA 5BV7A 1Y37A 3L1HA 1VXOA 5FXMA 5BWCA 5SYNA 1G4HA 3ZLVA 5F4ZA 4BAZA 4C88A 4WFKA 3FYUA 1XZIA 5HZGA 4EUSA 3FSGA 4K6KA 4FDMA 7YASA 1CUEA 3VXKA 4HXFB 3H1BA 1XZCA 3MUNA 4K2AA 4JH0A 1U4NA 4Y9SA 4JEIA 2CEKA 1SOMA 5YASA 5ESRA 4U2EA 1MN6A 3VJMA 4CG2A 4UBMA 4W1PA 1CUUA 2C5FA 1UXOA 4J3JA 5K3AA 4UBIA 4WFIA 1MAAA 4LYEA 4DGQA 1XZDA 1ZD5A 3E1GA 4AZ3A 2QTBA 2PM8A 1LLFA 1MNAA 3T4UA 2VTVA 4X7BA 4V2IA 2VSQA 4G5XA 4HXEB 1XKTA 3MVEA 5IKXA 4WDQA 4BDTA 5CW2A 1FJ2A 4EA6A 2Y2UA 4GHWA 4DNFA 1MNQA 1XQVA 5I7UA 5CURA 4UFNA 2OG1A 4QZVA 3ESCA 4AXBA 2QR5A 3ZLTA 5EIEA 3RKSA 4G8CA 3K2IA 4BCBA 4ARBA 4XX1A 3WZLA 3H2KA 4DSZA 5A6VA 3D4LA 5KBYA 1MO2A 2J3QA 5DNWA 5I8PA 2GBGA 1YB7A 5LP1A 5CH3A 4H7HA 1XLUA 2BUCA 5AHXA 4YK7A 3DKRA 4FBLA 1QFMA 2CMFA 4KE8A 3I1IA 3D0KA 4H18A 3DCNA 3DYVA 3VKFA 1A8UA 1TCAA 2XE4A 4Y2UA 1R1DA 3W05A 2WKWA 5ALGA 1Y7HA 4CG1A 3RM3A 4K5QA 3FVTA 1VLQA 2D5LA 2WU4A 4U2GA 4KE7A 4DNPA 1H2XA 1YAHA 4UFOA 2DHEA 3HRHA 5EHQA 4CCYB 1R88A 4B81A 2QKYA 4DTCA 4BE4A 2FJ0A 5C8ZA 1KEZA 2X5XA 4X97A 3C8HA 3BDVA 1IUOA 5AOAA 4F5ZA 2JGKA 1EB8A 3I2JA 3WYDA 2OAEA 1CUSA 4GDMA 1XRLA 4OCZA 2OXEA 4ZV9A 3NOXA 4UHHA 5AKZA 2QJWA 4Z49A 4IH4A 3M83A 5JANA 1LBSA 2R11A 1BEZA 1GXSA 5DTIA 4FMPA 1Q0ZA 2PVSA 3PI6A 2XUDA 5E4YA 5JZBA 1UKBA 4G4IA 3DLTA 1DX4A 5LYYA 3DD5A 1EXWA 5K3CA 4IQ4A 5JASA 1CFJA 2XUHA 2QVBA 4EY4A 2XMZA 5AM2A 3WKBA 1CUGA 4CFSA 3GA7A 1TCCA 4UPDA 5HK9A 3PUIA 2HA0A 1VZ3A 1GT6A 4BDSA 2JGMA 1ORVA 4G4JA 4Y2RA 4BTVA 4AO6A 3OC0A 4I19A 1R4ZA 3V1MA 2WM2A 4IHAA 4BB0A 2VT7A 3AUKA 4O08A 3O4GA 3DL4A 4EY8A 3AIMA 3H2GA 1UFOA 3FOBA 2DHDA 5ALZA 4ZXFA 5ALRA 3ESBA 4QA9A 2XUGA 3AINA 2ONCA 2WHRA 3PFBA 4S0XA 5AP9A 1E66A 1DWQA 2Y6UA 1EI9A 3U0VA 3STXA 1UK6A 1WHTA 2WHQA 3C87A 2XT0A 5KWJA 3TGLA 1W75A 3STTA 3KD2A 1JJFA 3B3QA 1Q0RA 2Z8ZA 1K5PA 5JALA 3FYUC 1BEEA 4Y2XA 3KWJA 4UHDA 4LHEA 2FX5A 4BAGA 3WYNA 4W1QA 2ZYRA 5FRDA 4H7IA 2BJHA 5HF9A 1XZLA 1QIDA 5AK5A 3WL6A 1GPLA 1DQZA 1J1IA 4D9JA 5JYCA 1AMNA 4FTWA 1XZAA 4EY5A 3I2HA 1IUNA 4QLOA 5JATA 3WQHA 3HI4A 4MEAA 2OQIA 3EQ8A 5E4JA 2HRQA 4N5HX 4ZREA 2V96A 1CV2A 3R0VA 3WK4A 1CR6A 2WJ4A 2XMQA 4BRZA 1SCQA 4P93A 4QEKA 1ZJ5A 1QTIA 4RE6A 3AIOA 2JEZA 2PU5A 2XUJA 1K6EA 5FUMA 2OGTA 2WSLA 3I6ZA 4LYDA 3FCYA 5EIHA 2OLEA 1I6WA 5DLPA 1PV1A 4BATA 3OM8A 2WHPB 4C89A 3IA2A 1MT3A 1UWCA 1TKRA 3H1AA 1QO9A 1VXRA 4Y2JA 1DT5A 4X91A 1BN7A 5H3HA 1QIIA 3L1JA 1ZIXA 4OU5A 4A5SA 4QWMA 1G66A 1D07A 4KEAA 4C4ZA 1XLVA 3E0XA 2CKMA 2XLCA 3C70A 4GXNA 4NVRA 1LGYA 5JADA 3O95A 5CTAA 1K4YA 4DLNA 1XZMA 2IX9A 5K3FA 1VE6A 2V97A 5ALVA 5K5EA 1C4XA 1ZD4A 4G8BA 1S8OA 3EQ7A 5FDFA 2XUOA 5CRIA 4BVJA 1IVYA 3W9UA 4LKOA 2WQZA 1YCDA 2EEPA 3WWEA 1GGVA 4GLBA 3A2MA 3YASA 3C8DA 4OPMA 2XQIA 1YA4A 1XZHA 3WA6A 5A7GA 1ODCA 3HZOA 2RIPA 4AO8A 3H17A 4FWBA 4IH1A 1H22A 1W4LA 2XMRA 3VDXA 1MU0A 1RYYA 3GBSA 1OXMA 1ISPA 1QGED 3H2HA 2PBLA 2B9VA 3WWOA 5AIAA 2OGZA 2ZSIA 4B9AA 5CBKA 3C6BA 1A7UA 5AM1A 1U65A 2XMGA 1E89A 4Q34A 2J4CA 1FSSA 3AZQA 5K3EA 3O4HA 1GPNA 1TK3A 4ARAA 3NUZA 5AI4A 3DJYA 5JD4A 3HSSA 1JKMA 1QO7A 2QUAA 1N5RA 2HU7A 4XJVA 1XQXA 2HA4A 4PV7A 5ALXA 1EINA 1HBJA 4Q3KA 1GPKA 5FKJA 4P92A 2PL5A 4KE6A 2H9YA 5ALNA 4WFJA 5AM5A 3BE8A 3R40A 1U2EA 3A6ZA 4FLEA 4AQDA 3S8YA 4FLFA 5HCUA 1SC9A 2GYWA 3D59A 4B85A 3FYUB 1AKNA 1QE3A 3DKKA 3CXUA 1EH5A 4Q3LA 3HXKA 3I6MA 2WLSA 1E3QA 4J0CA 2HADA 3BIXA 1YR2A 2XQKA 2JGJA 1HQDA 5CT6A 2RI6A 4DM7A 5AM3A 1VZ2A 2VJDA 3BJRA 3NWOA 2Z8XA 3ZV7A 3C43A 1AQLA 2XUIA 3FLBA 4H7FA 1Y7IA 4W9RA 3OURA 3JYHA 1FFDA 3WI7A 3O9MA 4J7AA 2PPLA 1WPRA 1CRLA 1VOTA 2BFNA 2XI4A 4QDOA 1MX1A 3G0IA 4BP9A 2RONA 5HQ3A 1JMKC 3RARA 2IIVA 3ZWQA 1C7JA 2JGFA 4E15A 1QLWA 3G0GA 1CLEA 4YPVA 3TEJA 5AKLA 4QDXA 4Q3OA 2QOEA 5FLKA 3G0DA 1UZAA 5ALHA 4X90A 4W1RA 3UUEA 1W1IA 4Y7DA 2HIHA 3RLIA 4U2CA 3O0DA 1XLWA 2XDWA 1YS2X 4QE3A 1YAJA 3JW8A 2WTMA 3I2FA 4QWWA 3TJMA 4P08A 1P0IA 4EHBA 1GQSA 3WZMA 5DNUA 2ZYSA 5HF5A 2G5TA 4DNOA 1QIHA 1TCBA 2XMSA 4XWGA 1CUWA 2HHAA 4G9GA 3SC2A 3BXPA 4AMYA 3QM1A 1CUBA 4EB0A 4M0FA 1LZKA 4KAAA 2C0PA 3WWDA 5HFNA 4AMZA 4J0GA 2DCMA 5AM0A 5BOVA 3R3UA 2PSFA 5ALPA 3K6KA 4ZRDA 5AK4A 4G4GA 4MXDA 5AO9A 1ZICA 1XFDA 4NMWA 4N8SA 4MYDA 2ACKA 4INZA 4Y2VA 3PFCA 2VATA 5K3BA 4G1FA 1DX6A 2WIJA 4F21A 4MYSA 4FFWA 2QT9A 3MGAA 3DS8A 2FUKA 5AI9A 5LZ8A 2XUKA 1Q83A 4LIPD 3EIOA 1AGYA 1HL7A 3F97A 1DTEA 1CIJA 3WJ1A 4B7ZA 2C4HA 2XB6A 4BCDA 5AJHA 3ILSA 1BS9A 5IVHA 2VJAA 2XUPA 3E4DA 4KRXA 4EY7A 5EI5A 2OQVA 3R41A 4DIUA 4ZGBA 4BZWA 5ISMA 1ZI9A 3M3DA 1M33A 2PSHA 2WG1A 4P9NA 5JAHA 3WKDA 5CT4A 5JAPA 2HL6A 4ZV7A 3I28A 1DQYA 3PF9A 5AM4A 1OILA 5A7HA 3G9TA 4WY8A 1EDBA 2QJRA 4E14A 2HA5A 3VVLA 5DYWA 1QIMA 1CEXA 4UBLA 4BC1A 2BGNA 1UK7A 4W1SA 4ETWA 3FLEA 4B84A 4U2DA 4M0EA 3UMJA 3QZUA 3G9UA 3PE6A 5DJ5A 5FP0A 2DHCA 3DNMA 2V9ZA 2WG0A 1J2EA 4UHBA 1LPMA 4FHZA 5JAOA 2W22A 1XROA 4CG3A 3FAKA 2XQFA 3KSRA 4LXGA 3AJAA 3X3HA 5T4FA 2AJDA 1GZ7A 2BUBA 5DTJA 4G9EA 3LP5A 5ALKA 1CUZA 2NW6A 4EZIA 2CZQA 4GECA 4UHEA 1CQWA 5I9IA 4QDUA 4OB6A 1YB6A 1F0NA 5FV4A 4K6HA 1B6GA 1FFEA 2O2GA 2ZYHA 2XQGA 4N8EA 1UOQA 5AKJA 3HEAA 2WFLA 1MJ5A 3H04A 4Y2TA 4G8DA 4FOLA 4BAUA 1THTA 2GBIA 3BIWA 1EVEA 3CN7A 1ZJ4A 3WK9A 4X95A 4IH9A 3WWPA 1O6GA 2Y1KA 4IO0A 2H7CA 3ZLUA 4PSUA 4X3CA 4AN0A 4MWTA 3KDAA 4JUIA 5C8VA 4KAJA 3V48A 3Q0TA 5C8XA 1UK8A 3WL8A 1TQHA 4U2FA 3EQ9A 4A16A 4BYMA 4X93A 1A8SA 4J0JA 1ZOIA 2I78A 1UKAA 3HABA 3O4JA 1XZGA 4BBZA 3VJLA 3FBWA 2QS9A 4CCWA 2ZSHA 4I3FA 2BGRA 4Y2YA 5ALEA 3FSGD 1VKHA 4PF1A 1W52X 1XQYA 4UBOA 4UHFA 2CUTA 4I4CA 4MWSA 3G02A 5HKBA 3IURA 5C7YA 1ZGBA 3KWFA 5CT8A 4FNMA 2HA2A 5HF6A 4CIAA 1XRMA 1XZBA 5FPPA 5ALSA 3ED1A 5IVKA 1EDEA 4HXGA 1FFBA 4Q05A 1XZKA 4QDTA 1GKKA 1CUIA 1XZJA 3D2AA 1R3DA 3BJMA 1UKCA 5CH5A 2BKLA 1AURA 3WKCA 3I6YA 3HJUA 4BVLA 5AICA 4B80A 2R8BA 2VAXA 2H7XA 4KR0A 2I3DA 4PSDA 4GBGA 1P0MA 2VT6A 4B83A 5LZ2A 3R3XA 6YASA 1CUXA 3R3ZA 1AZWA 3UUFA 4B0OA 2X8BA 2G4LA 3D3NA 5A7FA 1CPYA 3B5EA 2C58A 2Y6VA 4UBKA 1CUCA 4UFPA 1IUPA 3Q8WA 3IB3A 1F8UA 4HRXA 3QMVA 2AXEA 1RP1A 3DOHA 4XVCA 3WIOA 4B0PA 2C0QA 5T4EA 2RHWA 5JIBA 2ZJFA 1WB6A 1QZ3A 1BROA 1X2EA 1NU6A 2AJCA 4C87A 3DEAA 5EGNA 1WPXA 1QIKA 3V1KA 3D2BA 3QMMA 1CUAA 3H19A 5IVDA 1QIJA 5CXXA 4BC0A 3OTQA 2QZPA 2HA6A 1C7IA 3IUNA 2GZRA 5FOQA 1LPBB 3A2LA 3G9ZA 2ZJ7A 4EBBA 1J06A 2ORYA 3KXPA 5HK8A 4BZZA 1LPSA 5LKRA 2I03A 3O4IA 5ALUA 4ITVA 4BCCA 5ALTA 4KE9A 5SYMA 3C5VA 4JYMA 4FNGA 1DT3A 3U1TA 4C4YA 1UT6A 3QMWA 4J0KA 4B6GA 1LPNA 4HTAA 3C6ZA 3IDAA 5LZ5A 4AB1A 3I1YA 5LZ9A 1YS1X 3ICWA 2RGUA 3F98A 4PNZA 3RK4A 2PSEA 5DWDA 3S2ZA 1LBTA 5KWIA 2QRUA 2WG2A 1H2ZA 3G0CA 4M0MA 1L7AA 4N5IX 3HYSA 4BE9A 1EA5A
chains in the Genus database with same CATH superfamily
3PEVA 1BQ4A 2FWNA 3DWFA 2ZUTA 4QLBA 3BCRA 1DFHA 5DCLA 3EZLA 2FMIA 3KHSA 2ATVA 4AL4A 3LOQA 4R2JA 1H66A 5DM0A 1TOAA 4G85A 3GRAA 4UZFA 4ID3A 3W2FA 5A4DA 1XXLA 3OM1A 5A1JA 1SUAA 3UO8B 4LZPA 4ZOQI 2O05A 1BCSB 1RZUA 1G1MA 1E7QA 2ZBVA 5GAJA 5I9LA 2JFOA 3ODPA 2G40A 1IWOA 3AR9A 1H9CA 1ACJA 3FUCA 5M3BA 1IYZA 5AKIA 1RHKA 3CVUA 1VLLA 5GGYA 1R66A 1UBLS 1Z4QA 1B2LA 6GPBA 3AUUA 5D84A 4DAOA 4XDHA 1PLJA 5CXUA 4PVCA 3C8UA 1U6JA 2QV0A 2WJGA 1LH0A 1C0PA 3H65A 4JT2A 4OIFA 2O7QA 4ZAVA 4N39A 1V8DA 5FWAA 5F9MA 4Y2SA 1A8HA 3L8ZA 4O2RA 4I36A 1FX0A 3D3WB 3CU5A 2J9YB 3C24A 1CZUA 2EZ4A 2J6IA 3EXG1 1X9HA 1A77A 3LD9A 4D0RA 3LQ4A 3TAXA 3L9XA 3T1OA 3QOXA 1VHQA 5CW1A 4DG8A 3AJDA 4D0SA 1MVOA 1K6IA 5JYDA 2YCLA 3CVWA 2P0YA 3WYAA 2BBOA 1NJ5A 1D09A 3BF8A 4DDTA 4YJKA 1O4WA 3NCTA 4NI5A 1ZUIA 2X4DA 3SF0A 3SCZA 4ZYVA 3GBVA 5DNYB 1A5BB 1GJRA 2PWBA 3FI0A 4KIFA 4ZWNA 4B2IA 1HE3A 1Z6GA 1P3JA 1FFSA 3CKYA 4L51A 3AOEA 3HDTA 2AUNA 2B25A 2G63A 3I9V1 4EEZA 1B8VA 1XL1A 1F48A 2GJ4A 1AXEA 1YOBA 1VKNA 3KJNA 2Z3WA 1BDIA 3NBFA 4ZEWA 1T4MA 2R7LA 1DWPA 5BR4A 4MGHA 1RSZA 3P2EA 4MQEA 1BX3A 4YRJA 1RE1A 5T3YA 3LYAA 4YQYA 1O97C 2V7XA 3JQAD 3FSRA 4FOSA 4YO7A 2OECA 3K9GA 4Q6BA 4MUEA 1MOSA 2UZ0A 3MLAA 4Z8YA 5G0VA 4XCQA 4DRZA 5DXAA 4GI7A 4OA5A 1QPZA 4AY6A 1K63A 2XUFA 3E53A 4D3SA 5JAIA 4G0YA 2CJPA 4Q66C 1E0JA 2AFHB 4RVSA 4IIEA 4TKVB 2EFGA 1RMQA 5FI3A 1SUSA 7MHTA 3AEXA 5HKKA 4C6HA 1P2DA 4I81A 1QGZA 2D2XA 4LKRA 5FBZA 3LU1A 3VNRA 1QFYA 3DXXA 3GRPA 2PBFA 4KB5A 3KSBC 4JA0A 1CR4A 5HCNA 4XYLA 4FU0A 2HNAA 4OAQA 2BFDB 2C3OA 1ECCA 1KJJA 2VJBA 1R9NA 1Z22A 1R8YA 3U4MA 4CKBA 1UXIA 2FWJA 4M8SA 1PWXA 3GRRA 3TNLA 4WL0A 3X43A 1VJ5A 5EMKA 2SNIE 1BH2A 1G2QA 1Y3FE 4OIMA 3V3KA 3RAEC 2XRZA 1VE7A 1XEXA 2QSJA 2Z2KA 4JT8A 1EDDA 4NONA 3FPGA 2C59A 2IYPA 5BN5A 5LOVB 4X6UA 4RS4A 3WYBA 3RU3A 3GJXC 3AI2A 1JQ3A 1KVRA 4M1OA 4NNOA 3FTPA 1WU7A 3MGGA 4FGJA 4FMDF 4KV9A 4HH0A 1LQTA 3IRVA 5EIAA 1KQOA 4TQGA 3FGZA 1DKLA 1P0CA 4ON9A 2NVUB 1C2TA 2PKCA 1C3OB 1MAHA 1N57A 3A8TA 2YINC 4F9EA 3MYRA 3KJXA 1RM5A 2BGWA 2ZS8A 3P9XA 4S2EA 1GCIA 3AY3A 1SUWA 1OXBB 2IYQA 3IP9A 4LI0A 2WFZA 2IY7A 5IZCC 1ZNZA 3ZD8A 4AS2A 3BB4A 2B7BA 1OYVA 2FE4A 4S3MA 1IHOA 4NS4A 5AKKA 3CPHA 1KVTA 1CC1S 3LLCA 5IDVA 1P5RA 2Y0CA 3WKEA 5T4BA 2P30A 3OZRA 4M6WB 2C83A 3O8QB 3OMXA 4J0IA 4L4XA 5JYEA 4BV2A 3CURA 5I9SA 4DB4A 2BMVA 4BO8A 1OY1A 5LFAA 3KZVA 5AHOA 1PLLA 1PWZA 4UJ5A 5DV9A 4EQZA 2RK6A 2JKZA 3A4VA 3AHFA 5ALOA 5EJGA 2PS9A 1LPPA 2EFJA 2O8CA 1CEEA 2X5NA 4KLRA 1P0QA 2Y1EA 2GKGA 5EAIA 1XE3A 2GZSA 1IU9A 2OCYC 2W6ID 1M72A 1TZMA 3QKUA 4MPTA 4Q3DA 1F2VA 5HF8A 4KNWA 4YECA 3GV0A 4UU7A 2FZCA 4ZGWA 4UNNA 1SC1A 5JC8A 3CZMA 2C2GA 3ZE7A 5A9SA 5KQRA 5LQNA 4YFVA 2CXTA 4IXNA 3UQYS 3ZHRA 4C4PA 4MQBA 2P6UA 2VDVE 1OHHA 5IABA 1J2UA 1IEXA 4EMBA 4JOCA 1JGTA 2CD7A 5H8WA 3AIIA 3UFBA 2VWHA 3QI2A 3CGGA 2W6IA 4NZZA 2IV2X 1SKQA 1WMBA 4IIYA 4NSNA 3VNSA 1Z5OA 3EFOA 4U0KA 3GA5A 1PE0A 4WLUA 1UFQA 2PDAA 4V0NA 5KSYA 1TEVA 2I4NA 4CCYA 4FM9A 1PTJC 2RKWA 5PNTA 2PV7A 3D1JA 3W6PA 1C9DB 4AMBA 3FOCA 4MW4A 5LWHA 4XB1A 1BCSA 1MTZA 3FCOA 3OBIA 5DYIA 4AC9A 5H4HA 5J23A 2OV3A 1CYDA 2WUEA 3HY3A 5CJ2A 3TZCA 3DAFA 5AVVA 1NMXA 5IH7A 5A6SB 1ELOA 1HL3A 2YXEA 3HGTA 3WJ2A 3W5BA 2UVDA 2QGNA 2WILA 4WNIA 4HDCA 1RHUA 1B26A 4MKFA 1D4AA 4P0PB 1D1QA 3TKAA 1ZD2P 2ARKA 4OXIA 2O4UX 3GRCA 4CM4B 4OFXA 2D1QA 5BOSA 2WTNA 2FG5A 4PO3X 4RF5A 3HXLA 1EFTA 1L4BA 2IODA 4I6EA 2QLFA 4HDQB 3IBTA 4HQ6A 1O94C 4E33A 4ZAYA 1I2ZA 3IIMA 3G5UA 2CNKA 2E87A 3JQ8A 1E59A 2G5GX 4BWVA 2FMFA 4PBSA 1NGSA 4BLWA 4X1KA 1JKXA 2BWJA 3RVOA 4JLDA 3VAYA 1A4IA 1JMYA 5IJ9A 4MHTA 2SKDA 1ZS9A 3BJIC 1PLKA 3H2ZA 3K5HA 4O25A 1OLXA 1GN9A 3I09A 4MOWA 5KWSA 4MVJM 2XSZD 3W06A 5SY9A 3U40A 1ZCBA 4RH0A 3BIOA 1MDFA 1SBYA 4ZI5A 4EVQA 3K70D 4G0OA 3IODA 3DAYA 4RV5A 1K4MA 1DRKA 2J41A 2V03A 4Q4HB 2V5VA 3FUXA 4MS3A 4BPRA 4B09A 1A50B 1TYZA 3HSYA 3LRTA 1L6RA 3ZQ6A 3B6ZA 2H4JA 1PGQA 4TKUA 1C7ZA 3RRFA 1Z68A 2BGGA 1KZ6A 2HU5A 3IA7A 3THYB 1NVUQ 3O7WA 3AFNA 3OEEA 3N28A 3GDGA 1AK9A 2QMEA 4ZO8A 1Z5UA 2IV7A 5E4TA 5EQDA 4A15A 4DR6B 3FCXA 3KD3A 3TBKA 3EEBA 1N8KA 3LWDA 3RGGA 4MARA 2IS1A 1QH8B 2AJ8A 3VDNB 2WMNB 5L3QA 3P2OA 1Q84A 3B12A 4DQUA 4HDAA 3G7SA 3GIDA 1EFVB 1OT3A 1V1MB 4OP2A 3G2NA 1ZVQA 1I3NA 1UH5A 3SN6A 1GDHA 2WLTA 3H3XA 4HK4A 5ED4A 3N5CA 4DMCA 3DEFA 3CNLA 4HRVA 3THXB 2AKAB 2XOXA 1K86A 3GFSA 4Y2QA 3ZWYA 1T4CA 4JI7B 1OA1A 3HCOA 5B4VA 1GP2A 1NI3A 2PT9A 1R6BX 4DVJA 2P0AA 2P9BA 3MSCA 3UWDA 1XMQB 3SSNA 2OPHA 1ZK4A 2Q3JA 3I3SR 4ZIRB 1NR1A 3UT5A 2HIAA 4DB2A 2O8FA 1Z5WA 2IITA 1DP4A 3OZBA 1WUHS 2DUNA 1A3CA 3PNMA 3JRWA 3NGXA 2J3LA 1E7SA 1LC3A 4FBMA 3FM9A 2F43A 5THKA 5I7WA 1OAKA 3KXLA 4N0QA 1MG5A 4WBXC 3ENKA 3NVKI 1GSHA 1Q57A 3AC0A 3VR4D 1MEOA 4N8DA 3I01M 4UE2A 5HS4A 5AK3A 4H35A 2ZDGA 1JDBB 2PLFA 1XCMA 5BN5B 4AG6A 1XD8A 5CAEA 4CF5A 3UB4A 2PUCA 3NJRA 4E1AA 4FYJA 4Z1MA 3CH6A 5CT5A 1OGIA 3PGJA 2PH3A 1QPGA 1KU6A 1UOEA 3PWTA 3BN3A 3BWXA 1ZI6A 2CXPA 4N18A 4OBWA 4QYTA 4KXXA 3HRKA 3HKCB 3NFRA 1ZAYA 2RARA 3OCYA 4Q4HA 4L8YA 3L4SO 3O9VA 5BWBA 4KYTA 4CKWB 2I4RA 9ATCA 2VCEA 4OK6A 1Z62A 3IC5A 1YJXA 4G1BA 4O4JB 5LMNB 1FFAA 2CT8A 2AN9A 4HVTA 4KQKA 4IO1A 2QVYX 5TR9A 4ZOCA 1I7PA 2NGRA 2C4TA 4I8IA 1XYYA 2HNKA 3DA8A 4KGVA 2QGFA 4DMKA 3ZLJA 1ODTC 4CQMD 1SB8A 1ZNQO 2AG8A 3DH0A 4HGQA 4L4ZA 4I5EA 3LT1A 2FF5A 2DKFA 2ZWAA 3CX8A 4WESA 2E3JA 4ZO7A 3NIBA 5D6OA 3WMEA 2QL7A 4KL8S 3V46A 5JT1A 4WN9B 1MH1A 2DPHA 1G8SA 2NADA 3Q7RA 4GUAA 1U8CB 2QNBA 2VYVD 4WI1A 4X20A 3IQEA 1FP4A 3P20A 3UUWA 3EDOA 3K0CA 4NZOA 2WUFA 1QXSA 4TQUS 4AZ0A 4F2WA 2BYTA 4HDKA 3DEYX 4YAWA 4QNRA 1MKYA 2AYXA 2C2YA 1V9CA 2KQUA 3ELYA 3MIZA 4MB6A 4W82A 3QLTA 4E2FA 4C0BA 1ILWA 2X0KA 4JJ7A 3NGMA 5I3ZA 3FUTA 3ED5A 3ZWOA 2JAOA 2X8LA 4EARA 4G86A 1I7NA 3ROEA 4DLBA 2WKSA 1RYFA 4X71A 1M9NA 1EBUA 1UT8A 5JISA 1CT9A 3Q3JB 2Q1XA 5JXIA 4IHQA 5L7YA 3L6UA 4DAEA 5LNK6 2VZLA 4G9BA 1DUIA 3PWZA 2OBYA 3ND6A 4JJ8A 4RA6A 4P7JA 2RHHA 3DONA 1Q2XA 2ZYIA 3RC7A 4CMEC 2W8BA 1NQUA 3S99A 1GGMA 2CDNA 2FPGB 4C21A 3BGWA 5E6UB 4OAPA 5EZQA 3TMAA 5JJLA 3GZTB 1YMQA 5A3JA 2DZDA 4MR9B 4JB0A 1U5CA 5E3JA 1H3EA 1FFGA 4M8IA 2QK4A 4CTKA 5H9WA 3U49A 5K8JB 2FQXA 4PC6A 5CB8A 1PFQA 4A6PA 2QSYA 4E5MA 4D4GA 3SHFA 4TT3D 1OH8A 1KMNA 3CMMA 3T9AA 5J2TA 1G5RA 1ZH8A 2ZQZA 3CW8X 3KKQA 5DI3A 2B21A 3EEQA 3OKCA 1CQJB 1EB9A 3MCTA 3OLYA 5CK4A 1PJSA 1QR6A 1S3SA 1UWVA 4IIJB 2OP1A 4IAOA 2FETA 4M54A 4L0CA 4RWEA 5HKAA 3KZNA 2QL6A 3CG4A 3WR5A 1DV1A 4BO1A 3THYA 3FIUA 2ZJ6A 2J5KA 2PANA 3LIIA 2H2AA 3V1YA 4I3HA 3SHQA 1QONA 4F8EA 4MKGA 5JNVA 3D7NA 4K87A 2JHGA 1OCEA 4ZT5A 5KTPA 4XI9A 1DU4A 7REQB 3C6XA 2PD3A 1GLNA 5ALLA 4DDHA 4Q0MA 5B1EA 1UIMA 3RBZA 1OXUA 3RC2A 3O47A 4K2HA 4QNMA 1J07A 3ABIA 4ZRMA 2OVBA 4OGKA 1T1JA 2BFCB 3PD1A 4AJ2A 2E82A 4IQ0A 3G7NA 1I1QB 1TK2A 4N0MA 2DR0A 4UUAA 3GGCA 4MVYA 2NU8A 1N7HA 2ZU0C 3QEMB 3I52A 1Z6XA 3SHVA 1VB3A 5C4MA 4FZVA 4AZVA 3FHOA 1CP3A 4QJ4A 3LJKA 2NO4A 4Z5XA 3ZBPA 3E5HA 4B3DA 2I9KA 4W63A 4F12A 1YXMA 4KR3A 1M34A 3WAJA 4Q01A 3JRXA 1ZI8A 2JATA 3IQFA 2XA2A 2VNJA 2D2VA 1O54A 2C7PA 2HMWA 1YD7A 1RJDA 2V6JA 4FVTA 3RROA 4HJRA 4BGVA 2YZ7A 3LX8A 3GEGA 4WXPA 2N75A 1KI3A 1U0SY 3IILA 2QLMA 5A5EA 4QL3A 3S1AB 4BNHA 5KSOA 1C1XB 3ME5A 4Q12A 4RD2A 3RUHA 3MIIA 1RR6A 3E3OA 1COZA 4KGDA 2GESA 3S2IA 1JFRA 1I3OA 2XIQA 3DMTA 1KRHA 3O8OB 4DA6A 1PJAA 1CDOA 3TVTA 2IHBA 4ISCA 3S27A 3VR4A 3ZDXB 4TLBA 4XWTA 3ZHUA 4R1NA 4BMXA 2CB9A 3LFUA 5DVZA 1GA1A 2CLSA 1GPYA 3O94A 3RWMB 2OMKA 2IZ7A 4KG7A 4DJAA 1U7HA 2TYSB 4LYYA 2EGUA 4DCUA 4R2HA 3ZV6A 1Z18A 2QW1A 4LTMA 3DE2X 4D6PA 5EZYB 4M0PA 5F64A 1K2WA 2B6HA 3IB6A 4PINA 1OC4A 3V7UA 1NOKA 3G9QA 3ICOA 4M88A 1PIWA 4OMUA 5ARCA 2DR3A 2XTZA 4PSKA 3W04A 4R01A 1CIVA 4CKCB 1J5EB 5EQFA 3K6RA 4ZI7A 1LXCA 1C1HA 1UDRA 1DEXA 4C5CA 1SHUX 1UPTA 3S5UA 3NNSA 5KYYA 2IX3A 1WF3A 2BCEA 1QCDA 1PS9A 2EC5A 4FCTA 5D00A 1UJMA 1EX6A 1O5OA 2R8RA 5LLTA 1B76A 1QUEA 2JCSA 2QE6A 2WIDA 4IDFA 4KJXA 3TPZA 1SIBE 1XMXA 1E6MA 2E9SA 4L2IA 3MXTA 4OFZA 4DYHA 1LNSA 2WR8A 1OMOA 1R0KA 5JAUA 4LSWA 4RJJA 4G2NA 4JFAA 3LXXA 3L0IB 3OE4A 5D7BA 5IT9A 2E21A 1KO8A 3N5KA 5K6AC 4DEXA 3PEFA 2LTAA 1AUOA 4HR7A 1R15A 1UBFA 4RZ2A 5DWVA 1KE2A 2HC9A 4E5PA 1TK9A 3K1AA 3Q7SA 2JGIA 2VA8A 4KI0A 4TX1A 3WL5A 2B82A 4I9GA 4B4WA 1ST2A 2P6PA 3PFGA 2I7DA 3AYXB 1Y7PA 1KRXA 3FW1A 4YIHA 1S2IA 1SBNE 4NJMA 4DUGA 2VCYA 4LPKA 3BMNA 1NVWQ 2MSLA 4N9WA 3JQRA 2QG6A 4X8OA 4Z0TA 4B8WA 2OCPA 1EHYA 2G17A 1QB7A 2D5CA 2JJMA 2AB0A 4AMUA 4LGCA 3QF7A 5HHTA 4JBIA 5DBOA 2OB1A 2VN8A 3O0TA 1WDMA 4K9MA 4Q1VA 3ZXSA 2OLJA 1WZEA 4Z86A 4BNNA 5FBQB 4N5MA 3RCBA 1PX2A 4MVJG 1PCXA 1GZVA 1UKZA 2C2BA 4KU4A 3GA0A 2BP7B 2NYUA 1C1XA 2DTEA 2P6OA 1U5BB 4X1YB 2B92A 1OBCA 2H51A 1TM2A 2HSZA 2XNKA 1XNRB 5TS3A 1ECBA 4PYMA 1EWQA 4MW0A 1GILA 2C29D 4N1AA 4OEHA 5EJ4A 2I80A 2XYPA 5KDDA 5KSPA 1TO2E 5CEFA 3MINA 2CUNA 2ZR8A 4RDHA 1E1MA 1V7ZA 3ROXA 1BDJA 3KIPA 4MV9A 3V9AA 4IIGA 4D9GA 5G40A 4JBLA 1PYDA 2QUIA 1YUBA 5F3DA 3G23A 4KQWA 1J4AA 5JD5A 5EE5B 2BKAA 3KHUA 4WK0B 2GEBA 4A0HA 2Z43A 2NACA 3OKFA 4LOHA 2QAGA 4MUYA 4WDRA 2B61A 1UPCA 4XYEA 1GD1O 3QJ5A 3V4VB 3LWNA 4JQZA 1FLNA 3LC7O 1GAEO 3RYTC 3EODA 2VHTA 1EFLA 3QWAA 3FROA 4DV1B 3EEIA 2W11A 2GXQA 3C3EA 3IVRA 4RDCA 1W34A 4J75A 4MR7A 4BQRA 4XWWA 5KNLA 2Y8EA 4OQMA 1MBZA 4TL8A 4WJZA 3QYJA 3FIJA 3W77A 5HE8A 4V2UA 3K4PA 3L7IA 3EIHA 3R1IA 3KEGA 4JLSA 3B6EA 1ORTA 5K3DA 4QO8A 4AM8A 1XCPA 2I33A 2GAJA 1A9QA 1AT1A 1KMHB 1UC9A 1XHEA 4KXQA 3RBVA 1DS6A 4QGFA 5FQNA 3VPGA 2W2KA 1QP0A 1XTVA 1L1FA 1EYZA 2E1RA 1UDCA 1ONPA 1UJ6A 3WTBA 1KYXA 2YIDA 3HACA 3R2JA 3H84A 1W5AA 3WQQA 2VQEB 4RD1A 1F2TB 1QVRA 2WP0A 4XTCS 1FLDA 5AVQA 2D0DA 1RXCA 4XVHA 3QY9A 2IU3A 2Q5IA 1S2OA 3KOUA 4F5WA 2CB0A 1QANA 4ZJYA 2J0QA 3MS7A 4FE3A 1G8GA 2VYQA 3ZJ5A 4EL0A 4EH1A 2JH3A 1M83A 3L1IA 1DTSA 3C7TA 3NKVA 1CLUA 1MRNA 1XU7A 4PFQA 4ALKA 3ZWCA 4DA0A 4ETMA 2Z8YA 5F2EA 4WNAA 3OJEA 2HDHA 3VU8A 5LVAA 2BW0A 5IMSA 3HVRA 1NW7A 3D6FA 1J23A 4EJ2A 5FTNA 4NULA 4S24A 1MZVA 4XUCA 1IAVA 3L4JA 5DT2A 1DKNA 2BM9A 3DKPA 5BRNA 3AYZB 4LRSB 4YUYA 3LI2A 1RI4A 2FEAA 3LUJA 4PR0A 3NW9A 2I2DA 4RNCA 3ZD9A 3RK0A 3K70B 3L8GA 4II7A 4MICA 1I0LA 2Q3DA 3JQ9C 2FLVA 5BORA 4F6RB 2J4FA 2OBLA 3S1AA 1U1FA 1NW8A 2X7JA 1YZGA 3G2LA 3CKLA 2JZOA 1U7OA 2QY9A 4BVGA 5A1TA 1K8XB 4KBGA 2PV0A 3FWPA 1V47A 4R31A 1YZVA 5K2MA 4QVGA 3EPHA 2W8ZA 4LXIA 4YT2A 1SGWA 2FUEA 1X1DA 1B1AA 1Q1NA 2NMVA 2CWDA 1BE0A 4PSCA 3ZVKA 1EFRA 1MO3A 3N2KA 3GZJA 4DBVO 4D8UA 4OHVA 2CE7A 7REQA 2D00A 1BOOA 2Q4EA 1T8UA 3L7DA 3V5NA 3WLQA 1ADGA 3ZW9A 1EK1A 1KJ8A 2IYSA 2GBFA 2E2WA 2P9JA 2Q0XA 2WSSD 3IP5A 4J2TA 3DFZA 4GZ5A 1HDXA 3T06B 3W5VA 2HK9A 3BXEA 4ZICA 3QENA 1N9GA 2J87A 2ADOA 3OG9A 2PNJA 1KYIA 3JQGA 1T9AA 3K0FB 4WZAA 4FFOA 1VG0B 3ZHQA 3E5MA 1LBHA 1KJWA 1VIVA 3Q8XB 3WFIA 1GZ3A 5TQVA 4C07A 1OPRA 4PYQA 5J1TB 2CLOB 4JVMA 3TIGA 2WJYA 4Q15A 4AURA 5A05A 3SWWA 2OCGA 3U60B 4FCWA 3HDVA 3MBIA 2I5PO 4ENTA 3KP1A 1XR3A 1XRRA 3MGBA 3R6WA 4P3KA 4U6QA 1S4MA 4ZOBA 3SE0A 3W7AA 4FMCF 1PD0A 2IZ0A 5T67A 3WGTA 1Q7GA 3PSHA 1QV7A 2F1IA 2VG8A 1TT5A 2O2IA 4XPZA 1CUDA 3WK6A 1EUDB 4L8FA 1U8TA 3N59A 1QK4A 3O8OA 4UQOA 1EM8A 1BFDA 2OV2A 2FK8A 2W70A 1Q0LA 1Q21A 4Y0VA 1WW8A 1GAXA 3ND7A 2ZK7A 3RU9A 3L1HA 4UUNA 1X1TA 3GUYA 3HB1A 1C5KA 4DLLA 1RBMA 2GD1O 4GSYA 4U7GA 4I4LA 5FXMA 5ITSA 1U2TA 4KXVA 3HP1A 3JX9A 2VRCA 3FYHA 4K9PA 5FNVF 3TBFA 2CXQA 4AYXA 1ZK3A 1YS4A 3KVNA 4QOFA 4RZIA 4XZ3A 5AVKA 3WNVA 4M60A 4EF5A 1TIKA 2XGGA 2GVZC 4KPUA 3PKIA 4ZA2A 3UWKA 1V4VA 1OBVA 5GZ3A 1V5WA 4K6KA 4RLFA 1RIFA 2EFHB 4HFJA 3FNHA 4PZEA 7YASA 3ZG6A 3SIPA 1CUEA 2JI7A 1PVDA 2C42A 1DG3A 3R44A 4JXJA 4NS1A 4WVFA 3TM5A 2V4MA 3H1BA 4ZDJA 5CA0F 1AKYA 1CY7A 2HD4A 3L1VA 3MM4A 3N0VA 4Q00A 4UTXA 4FCCA 2Q0SA 3MUNA 4K2AA 2P2DA 1EUCA 1Q50A 4OHWA 3ZNNA 3F2VA 4RHUA 4JIMA 3M4YA 1U4NA 1D3AA 1D2NA 3H99A 2CJFA 4JEIA 2CEKA 2GXSA 4LX8A 1Q3TA 4JXKA 4KIUA 2WAMA 1RXUA 2ZT7A 4HSGA 2AF3C 3GLHB 2RSLA 1F14A 2XVYA 3GCWA 4LJKA 1T2CA 3LL7A 4HFRA 1MN6A 4U2EA 4R40A 2GEUA 2VK4A 4YV1A 4W1PA 3AR3A 4HI0E 2XADA 3OD1A 2E7ZA 1A5AB 1OGJA 3JYOA 1CUUA 4O6VA 4BNJA 5BO5A 4CV0A 2AV6A 4DHWA 3ID6C 3FCSB 3IAM6 1TNDA 2JEOA 1T36A 4WFIA 5KHOC 3UKJA 4NZPA 3AI7A 3CLHA 4J1TC 3WLLA 4DGQA 2HMSA 3EGCA 1HE2A 1RLUA 5ER6A 2PLWA 3HVJA 3RV3A 1E1QA 3NHSA 4XGRA 3ZC3A 3FDIA 2PZAA 4YQFA 1Y1PA 1FNCA 3E1GA 4J2OA 3Q5DA 1JPJA 2IYYA 2QTBA 3VC3A 3FZNA 2DB3A 4KWHA 3EUFA 2Q3LA 3N07A 2BRUA 1MOPA 1MNAA 3HB5X 1KYWA 1W46A 4N40A 2CJYA 5BUQA 2K2WA 4ADSG 4YPOA 3BEOA 2Q3CA 1VC2A 2VSQA 3A31A 2PA3A 4G5XA 4EJFA 4A0SA 1H0SA 3G2PA 5ICGA 1C9MA 2X6TA 1P80A 2BD0A 2QXYA 1QG0A 2YWFA 4RNDB 2P77A 2F67A 2O3SA 3SQOA 5LYJB 4Q9HA 1XZQA 4BDTA 1PEYA 3E5NA 3PDIB 5CW2A 4P83A 4V3CA 3CLSD 1R37A 4MV6A 4PYKA 3IQIX 4D8XA 1Q3HA 3ISTA 4NABA 3UWMA 3ZE1B 1GGEA 4P7BA 4DA8A 1IJFA 4B6QA 2VHEA 3CONA 2G9ZA 3HCAA 3PBKA 4W8GA 5DGIA 3AHJA 3BH6A 3VTFA 2OWDA 1G8JA 5F73A 1R7RA 1UC8A 3GDFA 3BGVA 2OG1A 2HIMA 1Y98A 3RT1A 1XDBA 3L3BA 3W3ZB 3TLYA 3C98A 2E5LB 1FDSA 1WLYA 4WCDA 3TQHA 5I7FA 4KTTE 5EIEA 1HEIA 1KZYC 3UK1A 3RVNA 3H5IA 3C3CA 3LH5A 1N2OA 1ODIA 3QVLA 5I47A 2Z30A 4F6CA 1LC0A 2R1UA 3JYNA 3EOZA 3O91A 3LC1O 4BCBA 2QN6A 2LXNA 1K2VN 1TAGA 3LBHA 3H2KA 3LHSA 4G25A 5A6VA 4LNHA 2NWQA 4NY1A 1NDQA 3TCNA 2P7IA 2GF0A 1MGPA 3THSA 3CF4G 3ND8A 4COOA 4PLWA 1VMEA 3MRSA 3VO1A 3QVTA 1GZSA 1MO2A 2Z09A 4RCYA 1E3JA 1ULUA 4RQAA 3FGPA 3KSZO 4M8NE 3VKVA 2CBZA 3ROZA 3PXAA 1D4FA 2IYUA 4RPGA 4JJEA 1IJEA 3TOVA 2AR0A 3A25A 4KZKA 2HKIA 1P29A 2DBYA 2GBGA 4X1KB 5LB4A 3U5ZB 3CWQA 3JXEA 5FOXA 2H2HA 2R60A 1L4GA 4L0MA 4AIIA 3VPBA 4DBLE 1S7GA 5C53B 4DA4A 1MB3A 4U8GA 3ZVNA 1XLUA 1HY3A 3UT6A 3IKJA 2J8ZA 3ZZUA 5IXSA 1ZK1A 2I7XA 3HEMA 3R24A 4LOJA 1XK7A 2H59A 4FBLA 1QFMA 3EK2A 3HDGA 3INGA 4IXMA 4QJ5A 4TV8B 1BWQA 5I9MA 3SFTA 5AW1A 5JXGA 5JRDS 2EG5A 3Q3CA 4KE8A 4R1LA 5LYJF 3B20A 4KPEC 3IXQA 4Q1EA 2WF8A 5TGZA 1CY4A 1G60A 2ZEJA 2WBLC 3GLIE 5ILQA 5LMUB 3EXHA 1OYYA 4D96A 4QEDA 3WP0A 1R1DA 1KK2A 3M1LA 2BFBA 2WKWA 1BNCA 1JHOA 5ALGA 1EIZA 4R8SA 4C0LA 3MELA 3FB1A 3QXHA 4H7PA 3IS3A 3T7CA 3PC2A 1XD2B 1VFNA 1CK4A 4M1KA 3ZU3A 5B7NA 4US0R 4DMRA 4K5QA 1BJTA 4QU5A 5CDTA 1F20A 1VLQA 2OORA 4IRXA 2C61A 5JAZA 3SIWA 4U2GA 2JJYA 4YV7A 3FHJA 2Z2JA 2PIDA 4DNPA 3BXHA 2ON6A 3VI3B 4ZQIA 4BNIA 5JU6A 2IC5A 4J1SA 3GZNA 3M6UA 4UFOA 1KWKA 2E4XA 5E6SB 1JF8A 4O4IA 5JNRA 3LUBA 3T3OA 1W0CA 2H5JA 2WV7A 4OJMX 4PGAA 2DHEA 3BAFA 1QO0A 3KTOA 3L5KA 3G82C 3M5WA 5EHQA 4C03A 1C30A 1DAMA 3WDKA 1E7WA 1QE5A 2XYGA 4PO9A 4R3WA 4HWOA 4JB2A 2I2AA 1KI7A 2ZXEA 3KS9A 4H3SA 1P62B 4M9RA 4NH4A 4AQ7A 2QKYA 4X6LA 1J0AA 4R0MA 4EZEA 2ORVA 4DTCA 4BE4A 5ILGA 1MDBA 5EJEA 2B98A 3VYTB 3N6RA 5AHKA 1JEQA 1Q0QA 2FQWA 2DP4E 1E7RA 4IQFA 4ZVMA 1R74A 4YAIA 1I36A 5JTUA 2JFNA 4II3A 3OQJA 1S3GA 3D8SA 4EA7A 3TEFA 1I3MA 5E1OA 3I0NA 1ZCFA 1IUOA 4WNAB 5BOSB 1EB8A 1N7IA 5HKLA 3E3NA 3OUZA 2G9RA 4WERA 4PSAA 2ZTVA 1BWSA 1M2VB 2BZSA 1KDRA 1NM5C 4H6PA 4MS1A 5HFJA 4A6XA 1J99A 1FDRA 4OCZA 4CKZA 1HZJA 1ZN7A 1U8FO 3AVXA 2BBSA 2WVHA 1JZQA 1J8FA 3DZFA 1U1EA 4BTEA 1FPMA 3PUZA 4ZAGA 1M2GA 4LJ4A 4O4JF 3CMCO 3VH1A 2CNOA 1AUXA 4TSRA 3DZJA 16PKA 4IH4A 3ZWNA 2VDNB 5SZJA 5CDSA 2EIHA 3WB9A 4BFZA 1XELA 2A84A 1IBCA 2GEDA 3JATA 4P33A 1Q19A 3OAAA 5KEIA 2R11A 3ZVRA 5FUQA 1VQ1A 2ZKIA 4FR0A 5EEGA 2W42A 3M6VA 1BEZA 1RMYA 4PLZA 1GXSA 5GADl 1THMA 4JGBA 4CF7A 4D4LA 4P4GA 3T9BA 4PX9A 4OA8A 2QZ4A 1EGVB 4HEA1 2ACVA 1BD4A 2XUDA 1J9EA 2TS1A 2JRLA 4YT8A 3E23A 1I0IA 1RXYA 5E4YA 5FR2A 3EZ7A 1UKBA 3ES9A 5A3QA 3LWBA 4MWDA 1YDMA 4EYEA 4YI5A 3LY7A 2ZPUA 2ATEA 1HMYA 1ZC4A 4O5OA 1Z26A 4MYUA 4F3TA 4H17A 1CEQA 2A59A 3VC1A 5CEJA 4PNHA 2AFIB 1U8UA 2R84A 2V1XA 2P9TA 3M1YA 4HMOA 1X9IA 1X7ZA 2XUHA 3TI7A 3RS8A 3R0QA 4ZHQB 5CA1F 5DCYA 4Z1OA 4NYJQ 2CYCA 4EY4A 1LF5A 1M5TA 3LY8A 4RA9A 3WKBA 5B6JA 4G07A 4AKGA 3VKUA 2EF1A 5CPFA 4F7WA 2PUFA 3UOGA 1U2PA 1I7SB 3FOZA 4ND1A 3NFYA 2BM1A 2C3PA 1Z5VA 3IDOA 2V9PA 4E1BA 3WDMA 1KMMA 2FCAA 2B36A 4CG0A 5C9ZA 3PUIA 1H6CA 4OI0A 3VKHA 2HA0A 3KAKA 3EVDA 4MS3B 4UQPA 5CLLA 4MHOA 1JB1A 4CDMA 1CXZA 1QKJA 1PBTA 4DXHA 1NKSA 1ORVA 3OJOA 4G4JA 3PUJA 4Y2RA 4D99A 3SOPA 4FNAA 3DLIA 4HB3A 2X8JA 1U90A 1HLPA 1KXZA 1DIAA 3OC0A 1ECLA 3I9NA 4I19A 1L5GB 4GOOD 1HDZA 1TPZA 4RHEA 2HWUA 1ZNYA 1VTKA 1R4ZA 2G4VA 2QX6A 2XRMA 3E9MA 2Q6IA 4MV1A 4IIJF 5BUSA 5EE1A 4E22A 5JS8A 3DMNA 3V1MA 4B87A 3ZU5A 3M49A 1KY2A 3C48A 5L3SA 4FW9A 2WM2A 4KZPA 4DREA 3L6DA 1NI5A 5BURA 1JWBB 2XR1A 4Z3DA 3RYIB 3ZWDA 2VC2B 3W3AD 3AUKA 3HKBA 5MFZA 1QDEA 3U3RA 4JJIA 1Q1ZA 2W58A 4BLVA 3LLUA 3DAGA 3MZ0A 1O96A 1E5DA 1YRLA 3O38A 4P36A 5EWJA 2Y1LA 3UNXA 4Z4EA 3LV8A 3DL4A 2HQSA 4N82A 5KX5A 1UPXA 4P22A 3MF4A 3VZSA 2II6A 3AIMA 3LRPA 3PLNA 1KR2A 3F4LA 1UFOA 4OUDA 4BKRA 5IK2A 1D9ZA 4LVNA 5ALZA 4I1UA 3UW3A 2XCRB 3Q8LA 4F4DA 3NPMA 2B7LA 5ENDA 3A4MA 2XUGA 3A37A 3LUAA 4ZOLB 2O4CA 4EHAA 1DCKA 1P4GA 3HFRA 2WWHA 3LSYA 1PJZA 4YN3A 2QAJA 3QUAA 2ONCA 3GLHA 1Y3DE 2AF4C 1E2QA 2XVMA 5AP9A 5BSWA 5JZOA 2OO5C 4QUDA 5G0WA 1BKDR 1QHFA 1E66A 3LGSA 4TYQA 5JSZB 2YC4C 4KIWA 3U4GA 1EXDA 3U0VA 2M6SA 1UUFA 3STXA 1PL7A 2O5RA 2WHQA 3C87A 5C31A 2P35A 3MFQA 5E95A 1W75A 1CS0A 5TMEA 4AY3A 2O8DA 3STTA 4MLCA 4YYZA 3AO0B 4F5YA 2NTNA 1V1JA 1QYWA 3TSYA 4V1CB 1VLMA 1BHSA 2JFHA 3BXOA 4GRAA 2V6GA 1U2SA 1A9TA 1OLUB 2L2QA 2YBDA 2ONYA 5LQDA 1L4HA 3JD4A 4PZDA 1XPOA 2J9XB 1JJ7A 2CLLB 1DKMA 5EL0A 2FX5A 2E6KA 1DC5A 4IV0A 2RCNA 3CO0S 4BAGA 4DY6A 1TI7A 3R7WB 4QQKA 4EHNA 3NH9A 1ADJA 4LSGA 5HX7A 4KMMA 4PRLA 1FU4A 2PZFA 5GZ1A 3P9RA 5C3MA 5HF9A 1ZN8A 2PNFA 3R8CA 5HRUA 2GA9A 2OCAA 3AR2A 5FWYA 2CSXA 4DLKA 1U4OA 1DQZA 1NA5A 2RK4A 1J1IA 4B3RB 1N5KA 3GIWA 1OXVA 1TTQB 4D9JA 4OHFA 4EB8A 3GFVA 4XVRA 5JYCA 3T3PB 1CSEE 4FTWA 4YALA 2J9GA 3ZH9B 3O74A 4INOA 4DIEA 1S6YA 1YNOA 1P2VA 1BVRA 1IUNA 3OZCA 3DV0B 5JATA 1KC3A 2YZMA 3AUSA 1Z82A 3GFBA 3PNLA 4PSVA 1U3TA 1PK7A 3IALA 4PYNA 4ARZA 3HI4A 1M6VA 1IL0A 2X0NA 3HNOA 4QXQA 2NG1A 3H9QA 3LHFA 5KYUB 3I76A 2XZOA 1SXQA 4TMVA 3RUAA 1KL7A 3OEHA 1ZM2A 1XJCA 1L5QA 2M1ZA 4UMDA 2CV1A 3TRFA 3WBFA 5IAAA 3O5AA 2HJWA 5H3LA 1OR8A 1V8ZA 2XMQA 5B5SA 3JQFA 3MNFA 2BFDA 2GPAA 4YYEA 2HF2A 1T2FA 1PYOA 1PJ4A 1V3VA 1SCQA 1S8NA 1O97D 3B48A 3AEUA 1M2OB 3HUUA 4NDZA 4TTAA 3RVRA 4QEKA 3S68A 3VJRA 1QTIA 3TM4A 5FPYA 1CR2A 4I1OA 4RE6A 2QVCA 5DEIA 3V2IA 1RI1A 5CDYA 1HDRA 1T91A 1K6EA 5FUMA 1JS1X 3ROPA 2ZJ3A 5FR1A 3TSZA 1P7CA 1T9DA 2QROA 5ECWA 3FCYA 3PUWA 4BFLA 4IDOA 1U02A 1KERA 4K9SA 4R9UC 4WKOA 1R5JA 4FR5A 3ILHA 1G8YA 4BATA 2XTNA 1I3KA 5AW0A 2F9MA 3EIUA 4C89A 1Z6QA 4CFYA 3RNOA 4BN5A 4KMRA 1SKAA 2R6FA 3JQ6A 3LP6A 3P5BA 4GPAA 3WAGA 3RSFA 1FMFA 1QNFA 2ISSD 2FGKA 4QXAA 2GK4A 1P4HA 3VGJA 4X7PA 1UWCA 4XM2A 4HB4A 2C7QA 4WE3A 1PT6A 5IM4F 1QO9A 2NTEA 3QKWA 3TNYA 5IEJA 1VXRA 3PT9A 4JI1B 1D2EA 1HDOA 1WSAA 2JJQA 3G0OA 5E4FA 1YI0A 2YYZA 4K7JA 5I6DA 1UMBB 4DEYA 4L5YA 1DG1G 3M2TA 2ID8A 1SBCA 3KKPA 3MCZA 4JVLA 2H1FA 2VSNA 5E8JA 5GJWC 5CB4A 2VLBA 1ZIXA 4PQYA 4DCJA 3T1YB 2AEJA 3PQ2A 1DCMA 4LI3X 3FSEA 4MZDA 4RORA 5AUQA 1NSTA 2JLZA 3LPCA 5H1YA 4RK4A 1D07A 2IHKA 3KJEA 1XXHB 3VNUA 1RLIA 3RIGA 2CKMA 1C9JA 2C4NA 3IJRA 4IS3A 2XLCA 2GRAA 2IP1A 3D8HA 4DJDC 3M89A 1P44A 2FEPA 3IOYA 5CTAA 3JQDA 1GU1A 3UH0A 4QFBA 4YS6A 5JCOC 5K3FA 3QX3A 2SECE 3HG7A 1QP8A 4RKWA 2WB2A 5ALVA 2Q8PA 2GHTA 4CYMA 2V7TA 3MCWA 1C4XA 1P5ZB 2AYYA 3I73A 1U2ZA 3A4IA 4R54A 2AYZA 5IKPA 3QEBZ 4AJIA 2XB2A 1O03A 4UHKA 1CERA 2DFLA 3PVZA 3EZYA 3TW8A 1GGFA 4MQ6A 1QGDA 1X74A 1XB2A 2XUOA 4DR3B 4NXMB 3JYLA 2MYNA 3Q41A 3WFJA 1IVYA 4FDLA 2BGIA 1CHDA 1F5SA 4UUPA 1P33A 3DVQX 5TY0A 4C7MA 2H5LA 3LUCA 3QBDA 1XI2A 4QU0A 2A5JA 4KKXB 3ICEA 3NETA 4U5XA 4ZU1X 1OOEA 3GFTA 3VTZA 3RSOA 2YJ4A 3U7RA 2ZZKA 4GDFA 3KTDA 3EPPA 1RHJA 2PGJA 1SURA 1YA4A 5COBA 2N46A 2JIOA 2O8DB 2WP8J 1IJKA 3HZOA 3D0OA 1N32B 1EVZA 2NOAA 3KYDB 4NECA 4AO8A 2AL7A 3AI1A 1CBUA 2H85A 4GR4A 4URUR 3CR3C 7MDHA 3AHHA 2KW5A 1GR0A 2FUCA 4NAUA 1CDDA 1JALA 4EVSA 3LY9A 3S0JA 3RUDA 1L5HB 1H22A 2Z98A 1W4LA 3C85A 5FL3A 2XMRA 1AQJA 3QX8A 3VR6H 4MPPA 3LNTA 5DF1A 2P27A 1LDBA 1WSBA 2Z57A 3CGWA 5DPMA 3SJAA 4FXPA 1L5SA 2PMFA 4YMHA 4KTVE 2HMUA 2H7VA 1ZRHA 2CY0A 1HT2E 2ZIFA 3P45A 4UKDA 3IL2A 1T0JB 3H2HA 2PBLA 1HEYA 4R71A 1RQNA 3WWOA 1Q22A 1JL3A 1LX7A 1PJ8A 2C82A 2OGZA 3PRYA 2CVHA 5AIAA 5DCWA 4B45A 1FF9A 3EWSA 2YNMC 5FNZA 1WETA 1YC5A 4GNRA 2RGNA 4L4YA 3EEOA 3IPLA 3WL4A 3UPUA 2PCJA 1V1MA 3L6BA 1RRVA 3ZXIA 2VUSA 3GOQA 1T10A 4Q34A 3B2QA 3CRVA 2J4CA 2JAQA 3EARA 3AZQA 2P2CA 3JVEA 4FDAA 4RK7A 5DFAA 1W6UA 4CFZA 1GNQA 4PO1A 3O2JA 2R00C 5DM2A 5HIJA 1V5EA 4FXOA 1PZMA 3EZ2A 4IGKA 4NENA 5JD4A 1PQUA 2ZI5A 1JKMA 1GRVA 5E6RA 3M34A 1QRDA 1E2DA 4KIJA 4E03A 2QUAA 2R6DA 1N25A 2R4UA 5AW8A 2HPAA 2REOA 4N49A 5CX1B 4XJVA 3ZS9A 3X1YA 3GEDA 5CD9A 1A7AA 3E3MA 3JVIA 2JIPA 5GONB 2V0NA 4IEEA 4BVFA 2HA4A 1M75A 3R4VA 3WTCA 1R6VA 1E79D 1M1NB 2C57A 5CCDA 2CHUA 8ATCA 4OSOA 3UJDA 4JGIA 1X42A 1L7EA 4AG3A 1VSBA 3QA9A 4PS1A 2AN1A 4M6WA 1WUYA 3KEOA 3G2IA 4PX5A 3UJ3X 1X7YA 3KXKA 4PHFA 1IEQA 2FLKA 4CMEA 4GOND 4EFMA 2BFMA 2J59A 3PX3A 4FDTA 4FUQA 6REQA 3IHLA 3K9FC 3BA1A 3MJHA 5EIOA 1GQOA 4PC7A 2G28A 2HDOA 1Z5GA 2IDZA 1ZJJA 2BE9A 1I9GA 3R40A 1U2EA 1X80A 4LYAA 3VR6A 4JKYA 1RQGA 1T0IA 1CVIA 1VSTA 5HCUA 1H6DA 1Y6GA 3UKDA 3UTCA 3D81A 5EXXA 2X1HA 3CBQA 1OIVA 3OPYI 3FYUB 5CB4F 1AKNA 4MI3A 5AYVA 4PNEA 1JR3A 1NAHA 4IDGA 4Q9IA 4JLKA 3R9IA 3HO8A 1L4YA 1EH5A 1P3Y1 4KLAA 2VSFA 5LU8A 3NONA 2X3FA 3HXKA 3NGLA 4Y2HA 1W0JD 3I6MA 3HKBB 5KMGA 2R6GA 1GG8A 1B2RA 1YDGA 1E3QA 4MDYA 1CJKC 2AEMA 2IHNA 2V7EA 1S2NA 2PAAA 2XOKD 3EGEA 3NDPA 5FTMA 5KX5B 3TLZA 2QN1A 2D1TA 5A3RA 5K0ZA 1M8PA 3U37A 4G5SA 3LBAA 4EAQA 4DM7A 1UBHS 3MC1A 2AMFA 1ZH2A 4JC5A 3IEMA 2VJDA 3WYGA 2DTXA 3DTNA 3DD1A 3HN6A 3HLYA 4EUKA 4ENWA 4YROA 2PGLA 2WFAA 3B38A 4XTRA 4NQRA 1WUJS 2GN2A 3KXIA 4DR7B 3MEQA 2DLDA 4WECA 5KNDD 4AW9A 4MYHA 4BZPA 1JILA 2I76A 4TYNA 2XD9A 3PQ8A 1J2RA 1DB3A 5FA6A 3N53A 4TWIA 1GQYA 3O9MA 3TIIA 3CPSA 3K15A 4LF4B 4E7OA 1QLHA 2CCGA 1ENPA 2VAWA 2IQ5A 4FJ1A 4I9HA 1I3LA 2VF8A 2ZRIA 3H75A 1XDDA 4QDOA 2E85A 2QTMA 2FJUA 3SS9X 2GMWA 2RONA 3I61A 5HQ3A 1LTHR 1X0XA 3LBFA 2ZRCA 2ISQA 3HN2A 2VDQB 3OCVA 1Z6PA 2H31A 3PXEA 2BEKA 4JP1A 4PC1A 2FPXA 2V7VA 4UW9A 2WSSA 1C7JA 2JGFA 4GWGA 4C7JA 4YRDA 1CLEA 3ILYA 1TM1E 1IXZA 4G5FA 3F8WA 1TM3E 1JXMA 2IYEA 4NNPA 3TEJA 4QREA 1Z6ZA 1ZD9A 2GD6A 2EKQA 2ZUCA 1SR8A 4G5OA 5AKLA 1R9GA 1Z35A 4QDXA 3JZIA 3ZQUA 1E6KA 4HADA 5DP1A 2O7SA 1KFEB 1KJNA 5HOQA 2VJLA 4KSBA 1SZCA 1B93A 3C3AA 1OW3B 3E7FA 2QQGA 3PPWA 1RWMA 3HWX1 4Y67A 3UMSA 1RWPA 1VE9A 3KB1A 1ARZA 2NAPA 3I6QA 4X90A 5A9RA 3UK0A 4C7OA 1EFUA 3ZWWA 2Q50A 2D54A 1MB2A 2J0UA 1Z12A 3GT7A 3IYLW 4K3UA 2O3TA 4LUCA 5E9WA 1AZSC 2HYIC 3F7MA 1CJCA 4QTXA 3O0DA 1M54A 2YWEA 1KS2A 5F77A 3NQ41 3T38A 3C97A 1NVAA 4HMQA 4JL5A 2XBLA 1RFLA 1POXA 3E9QA 5KTYA 2GXUA 2JAUA 4MKIA 3UK2A 4RKYA 4EENA 1C41A 1NIPA 2P9YA 2WNIA 4P08A 1M7BA 1PSZA 2QI9F 4NBVA 1G98A 1H5QA 2C4VA 2C5EA 3WQBA 1MAUA 4RMIA 3EPLA 2HBZA 2X2OA 3WZMA 2I7CA 2ZUBA 2WJWA 2ZJZA 4K86A 4PPGA 4YRCA 1KE1A 1WXDA 3KPYA 2FRVA 1KP2A 2OCXA 2ZIZA 5LLDA 4RFLA 3VI4B 4I0WB 1RXSA 2GCGA 4NK5A 1IOZA 1BJKA 4BFSA 1QU2A 1F17A 1DO8A 2IF2A 1HDYA 2FP4A 3BCHA 4YR9A 1JYEA 1MC1A 3HCPA 3BD7A 3P2IA 3BXPA 3WFZA 4B1FA 5JVDB 3IP1A 2VJMB 2VJPA 4P35A 2VP4A 3IXLA 4RJTA 2XAUA 3LA8A 5B4UA 3ELBA 3KZOA 5CLGA 4U6SA 3AY7A 5B7GA 1K1EA 2CDRA 1UF9A 3MPOA 3CYFA 4RK1A 3WWDA 3EUAA 4R84A 5L4LA 4AMZA 2OO3A 4JXZA 2FUG1 1WXXA 1ODLA 2FVYA 4JXXA 3SJZA 4XGQA 4ENRA 5BOVA 2VOEA 3TYXA 2NUBA 3UW1A 3DKIA 4MVXA 4UEOA 3UMBA 2AZXA 3JWIA 3M5CA 2RHBA 1ES9A 1ULZA 1J49A 4E32A 4RS3A 2BR4A 4N7MA 4MQFB 5IBRA 5A2QA 2ACWA 3TH5A 1TLLA 2G88A 3ASYA 1MXFA 2FMUA 3MTIA 4LECA 3JR7A 1Y6QA 3T3EA 5LQUA 2H92A 3EFBA 4ZCTA 5AO9A 1VHJA 1KI6B 1M1YB 2IZ5A 4A92A 1UBEA 3PEWA 1N2IA 3NTXA 1Q0PA 4IQGA 2AW3A 4KXUA 4URZR 2V54A 4PNPA 5H81A 3NOQA 4INZA 1O6BA 4DPKA 2FY8A 3PFCA 2DWQA 2VATA 3A7EA 5KOJA 1FLAA 1EUCB 4W5JA 4E31A 4N48A 2QX4A 3DTVA 3BHNA 4QC2A 3W8DA 1X3LA 1BO6A 3GUHA 4HH3C 1HC7A 3B7GA 3R5JA 5FTWA 3UGQA 4D81A 2DLNA 2QT9A 3GG2A 4FFWA 4IIBA 4ZI7F 1WQ3A 2G0NA 2GCIA 2KI5A 1GSIA 1QWSA 3DS8A 3ZKWA 4B3TB 4ID9A 1Q83A 2EBWA 3UOAB 5DI3B 4N76A 3PHCA 3ELWA 2Z9DA 1E6LA 3WRWA 1VJTA 1HXHA 5IK2D 3U56A 2VHXA 4CU2A 4YGXB 1RQLA 1YZLA 1ZP6A 4CM5A 3NDBB 2DBQA 2J33A 3FMGA 4KQGA 2GCOA 2WI8A 4RHFA 4URVR 2K7FA 1PQYA 3WJ1A 3W34A 1ABFA 1FQOA 2FMKA 4QBGB 2I6XA 5FTKA 5G1PA 1Z4JA 3W5UA 2KPOA 1YF3A 3AVVA 1C3JA 3ILSA 1ZRMA 1XMSA 2Q8NA 2X23A 3BWMA 2PKRA 2PFSA 4PXYA 1XNQB 3QE4A 2WTEA 1HM5A 2JBAA 2RE8A 2W2LA 2ZI7A 5LXTF 4F3KA 5IAOA 4CIDA 3MD0A 4KGZA 5B1DA 4MCIA 1WCXA 3E4DA 4PYIA 1ADCA 1H9AA 3L4BC 2X9VA 4OXRA 1A04A 2C7GA 2MU1A 1FK8A 2ZJAA 4ZJUA 5KZMB 1Z0IA 2R4QA 1TA4A 3PEEA 3R75A 1RC8A 4EF6A 1BWPA 1WULS 5CAEB 1KY5A 3GMTA 3DMDA 4KXFB 3TBHA 1NBWB 3ZHCA 4E0BA 1ZI9A 2UZAA 1G8AA 2OLKA 4BLPA 1JFSA 4YJFA 1WRBA 3M3DA 3ZNOA 3VX4A 1RLTA 1ZYUA 5LXTA 3DW3X 4A1FA 3KDSE 5LDGA 4KIGA 2PSHA 3VV3A 4L50A 4TV9A 5JAHA 1U9IC 4JI6B 3G1UA 5CT4A 2FHPA 4C4SA 4HNTA 5JAPA 1SOVA 4EUEA 4RF3A 2YZGA 3I28A 3PF9A 3V8EA 3L6EA 3SC3A 2NPOA 5EZ6B 421PA 4ARSA 1U99A 2QJRA 3DO8A 1LEHA 1VSQA 2FR1A 2OZPA 2PKQP 3DG9A 5DE3A 3RUFA 3NBAA 5DYWA 3VAAA 2BGNA 3DOEA 1JVSA 3FPJA 3S2GA 4ZVSA 5DRYA 1XTJA 2EW1A 3R3JA 4ETWA 1A2KC 3P0IA 1ONBA 3FLEA 1ZIDA 4RMJA 4C1NA 2DJ5A 1A96A 4H9GA 1DUSA 1ECJA 2H11A 2Y1CA 4U2DA 1SXJA 2HLHA 2P4UA 1VYTA 2BFBB 2QUJA 3QZUA 4M0EA 2FSHA 2O57A 3ITEA 4FHGA 2NSYA 3DKVA 2Q3FA 1XAGA 1C4WA 1KFKB 3PE6A 5DJ5A 3LT2A 1P3DA 5EKUA 5FP0A 3RBXA 3KQQA 1YRQA 3W8NA 3TD9A 3MGKA 4KP7A 3PPXA 1ZOLA 3DNMA 5GOZA 1NWHA 4XFDA 2B4YA 2IPNA 1X7HA 4YDRA 4YRGA 5CA1B 3EBPA 2PQ6A 2IDMA 4ENPA 2Q8QA 3JU3A 1R8XA 1VPTA 2NZUG 3N75A 2GAOA 2ZRFA 4FHZA 2X8WA 2WA2A 3V33A 3AL2A 1LKZA 5H9VA 3NOVA 4U2KA 3RKRA 1L7MA 1AQ6A 1XVUA 2ZAGA 1FLVA 5FFNA 1IZ9A 4M3NA 4RIHA 1H2FA 3X3HA 2IYXA 4LJ9A 5T4FA 4XRGA 1IJBA 5AW9A 1N8NA 3U9LA 3Q11A 2V6FA 4G9EA 4H1UA 1IE3A 2BHRA 4QAQA 1QZUA 4DCTA 1CUZA 1E4YA 3OZAA 4TUYA 5EVJA 3S1LA 1LU9A 1C3VA 2ZWPA 4EZIA 2RB4A 2GPSA 4M1SA 3PD0A 1BGWA 3RW9A 1W59A 1K68A 1KPHA 2HF9A 3JQQA 4M8LA 4YAUA 4RTJA 5ESXA 3BJEA 4XVUA 4YRMA 3BFPA 4QDKA 3F74A 1RYNA 4CL2A 4QDUA 3ADOA 1C0EA 2PH5A 3KX2A 3O03A 3U7EB 5FV4A 4K6HA 2C8KA 3CF0A 1W2HA 1ND5A 1FFEA 1WMAA 3QRWA 4Z9FA 4C0XA 3FG9A 3QSGA 2CV0A 3LQYA 5FB3A 3THWA 5AKJA 4KO4S 2PUBA 5DGTA 1YBMA 4EGSA 1KQGA 1CY8A 1SIWA 1CJSA 3VPAA 1KIMA 4WA8A 2HGSA 1THTA 2PG3A 2R87A 4QOEA 1EVEA 3VKGA 1CP2A 1WXEA 2BF7A 3CLSC 3PDJA 4QAJA 2ZDHA 1KEKA 4L6CA 3GAAA 2VFAA 1Q16A 1T9ZA 5JQGA 1UT5A 4AZTA 5HP4A 2HPHA 1QO0D 4JL6A 5LL6P 3WWPA 3O1HB 5AUNB 2H7CA 3SKYA 5CNJA 3LVFO 4ND8A 1DJLA 3SU8A 5EFOA 1NW6A 3QUQA 1WP4A 4X3CA 5TSDA 4N01A 4LZAA 2YV2A 2PO5A 3IJEB 4DT1A 2RHLA 3J81k 1HTBA 3KM0A 1WE2A 2EFEB 1P7WA 1BW9A 1RXEA 5BN4B 1Q74A 3SX0A 3M4XA 2QTWB 4TYMA 4QYWA 5AOVA 1ECPA 2RAFA 1RYBA 1K97A 1K7FB 2D06A 4K03A 4CCSA 2AQ8A 4KVGA 1FNNA 1SU6A 2A6PA 1UK8A 2WPNA 2PX4A 1E9FA 3AB7A 1WOYA 2Q3BA 3K9LA 1DKPA 3KQTA 4KNVA 3WL8A 4A16A 1KO7A 2R25B 1V8OA 3L92A 4P84A 3RASA 3VR5H 2HJHA 1ZOIA 2FSFA 2MSCB 1YVUA 4P5EA 4YJ3B 4EI2A 1UADA 2I78A 3D6UA 4Y2GA 3KE9A 5HZMA 4LWQA 1FXUA 1EWVA 1H65A 1RRFA 2VXOA 3HDQA 4OHXA 3DMTC 4TYPA 4WLOA 3PE4A 4QECA 4R7TA 3PIRA 3O4JA 1XZGA 4BBZA 5ICSA 4RYDA 1COWA 1Z6AA 3C3PA 2AEEA 4V1CA 2QVXX 4IRUB 3O1JC 5C7IO 5L95A 1R4NB 1VKOA 1B6SA 5DHUA 4LRUA 1W52X 4DWOA 3KLBA 1XQYA 4CVNA 4HRAA 4UBOA 4F85A 4DR2B 8OHMA 2PMKA 4G36A 3AX6A 1UBTS 3V4SA 4E21A 1R0XA 5FADA 1E9BA 5B3JA 4EB6B 1QSGA 1V6AA 5HKBA 3B9RA 5FI1B 1G9XA 3P4UA 1MC8A 3K09A 3NWPA 1QCCA 2BRUC 2DLCX 1JEEA 1LTQA 2BHNA 3IEPA 4C04A 4CUZA 2DWOA 2X0DA 5BSGA 4DCVA 2BBWA 5CT8A 2BFFA 3DAOA 2I67A 4FNMA 3QELA 4MGKR 3F5MA 4CM9A 5THXA 4Z7OB 2HA2A 1O6CA 3P1JA 2IUUA 3AOGA 5SZIA 2VHZA 4FFNA 3UH1A 2DRIA 1V3UA 4JVOA 5TF4A 3VPCA 5ALSA 1F0KA 2Y1OA 4URHA 1PR5A 3LVQE 4YACA 4FYPA 1XTUA 2C7RA 4GLFA 3D64A 1UODA 4ARZB 1QOPB 5CB6A 1IXYA 4FQ5A 3L1KA 4PPQA 1V7CA 3KUUA 3ZBTA 4NLLA 4Q3BA 4TKVA 4QDTA 1GKKA 1XZJA 4TKMA 5BWMA 4Z4FA 4YUVA 2NUTB 3BJMA 4GP6A 5CH5A 1PX0A 4MP3A 3UBMA 1JLLB 4JD5A 1KGSA 4JUDX 5HM6A 4DV0B 1BA2A 4F9GA 2EYQA 3X1MA 3I6YA 2QBYA 4BVLA 4XLZA 1I51A 4TRNA 1SQGA 2E49A 4ERXA 5B58C 1ILEA 4YBRA 2GUGA 2I3DA 1SD1A 4KFSA 3DNPA 4XLTA 4AYWA 1IN4A 2Q9BA 4UOZA 4DDMA 1CUXA 1YJBA 2VWGA 1NP3A 3DT8A 2ZBDA 1BFKA 4BXOA 4C2TA 1FJGB 1C3EA 5D5PA 2VUUA 2X2PA 3K53A 1N1EA 4U00A 2QLJA 3PHBE 4DDWA 4ZZ3A 4X1OA 5DM60 4BU0A 4OY3A 3MHTA 2C58A 2CHGA 4RZSA 1UJBA 3K0AA 4UBKA 2F55A 1CUCA 1RC1A 1R0SA 2RG7A 4NJOA 1X8KA 1Z88A 3TINA 3IB3A 4L27A 2BPOA 4PLVA 3UFXA 1TTTA 4KKVA 1DOZA 1Y8AA 1M2HA 2OBFA 4KPGA 3DMYA 1G8FA 1PHPA 1D8TA 1OH6A 4GM1A 1YMVA 3GVPA 4AZ3B 3CE6A 3AR4A 4NBSA 4WJKB 3F6RA 1K89A 3IKVA 4BO5A 2Q2QA 3WIOA 1GDTA 1HE1C 1W47A 5T4EA 5JIBA 4US1R 4JUCA 5C1PA 1GV1A 5C8YA 1I1NA 5HJ5A 3CRNA 3PENA 2CD9A 2C98A 4O2AA 2WWGA 4YJGB 2TSYB 3M3PA 3P0HA 1MO5A 4X9XA 2QRQA 2ZGVA 3D4NA 3C7AA 4KWIA 3LKDA 2AN3A 5ES4B 1X2EA 3S2SA 2PY6A 2ATXA 4PC3A 1JR3D 1JLSA 1OWOA 4QBHA 3KOZA 3L7NA 1NBEA 4NAHA 3AU8A 3DEAA 1IPEA 2OSBA 3EOAI 2ZS9A 3GJ6A 3H9GA 4G23A 1ZXBA 2DPGA 3A7DA 1WPXA 3FJOA 3ISJA 4NJEA 4YREA 3RKUA 4NICA 1DSSG 2QD3A 4G5QA 1H0KA 1ZO8A 4OQLA 5LBUA 4NNJA 1RHQA 1ZXLA 4QU8A 5JLAA 4BL5A 3N8KA 3EEYA 5SICE 1PFWA 2R7KA 2JHPA 2XCOA 1JR6A 3H19A 2DKOA 1J5PA 4I1IA 3FNIA 1GNPA 4S1WA 4HDSA 2CXOA 3RRYA 1UBGA 1ZISA 2O2XA 2OA0A 3OIYA 2GILA 4JC4A 4ZZIA 5ES3A 4EO9A 1F7UA 2QQ5A 5E38A 1DADA 5FA8A 4FFBA 5FOQA 2ETVA 4QUGA 3O4RA 2VJKA 2P9QA 3GYGA 2HMYB 1QHEA 4EBBA 3ZD6A 2W6JD 2J7PD 4FEYA 5BV1A 5CNKA 4BZZA 4BBAA 1UC4B 2H07A 5LKRA 1LBEA 2CGEA 2I03A 1P1KA 2X3YA 4Y9DA 1IPHA 5FF9A 5GPBA 2NQ2C 3EYWA 3SIXA 3V00A 5ALUA 3WAKA 2H4WA 2BMJA 1N2SA 1MPTA 2R7MA 3U6BA 4MRVA 2HHHB 2YZKA 3GRUA 4GMGA 1XP8A 1A1SA 1G21B 2MOKA 5FWNA 3LBYA 4V0QA 2LWIA 3O84A 2QTHA 2LDBA 3IT0A 4FC6A 1UT6A 3GJRA 4Y6QA 5AD1A 3KR0A 4D44A 1NNI1 4RLHA 2ATCA 3PR1A 1Q6YA 1RJ9B 1VJ1A 1LPNA 1AN0A 2CNBA 5AXAA 3C6ZA 3AHCA 2RI0A 4RUKA 5LZ5A 3OCCA 5LQSA 2Y05A 1TF2A 2CMDA 1CJBA