3G7NA

Crystal structure of a triacylglycerol lipase from penicillium expansum at 1.3
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
258
structure length
254
Chain Sequence
b'ATADAAAFPDLHRAAKLSSAAYTGCIGKAFDVTIVKRIYDLVTDTNGFVGYSTEKKTIAVIMRGSTTITDIDIALITPELSGVTFPSDVKIMRGVHRPWSAVHDTIITEVKALIAKYPDYTLEAVGHSLGGALTSIAHVALAQNFPDKSLVSNALNAFPIGNQAWADFGTAQAGTFNRGNNVLDGVPNMYSSPLVNFKHYGTEYYSSGTEASTVKCEGQRDKSCSAGNGMYAVTPGHIASFGVVMLTAGCGYLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase
publication title Crystal structure of a triacylglycerol lipase from Penicillium expansum at 1.3 A determined by sulfur SAD
pubmed doi rcsb
source organism Penicillium expansum
molecule tags Hydrolase
total genus 83
structure length 254
sequence length 258
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2009-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3g7nA00
1A7UA 1EINA 2O2IA 2BUBA 3DL7A 4X00A 4TPKA 2I3DA 1YA8A 3G7NA 2ZYIA 2BCEA 3QYJA 3DCNA 3ED1A 3L1JA 2C7BA 1DWOA 3HEAA 5D7BA 1QIEA 3KOOA 2RGUA 3WKCA 3C87A 5AI6A 1VA4A 4GDMA 5ALXA 4FOLA 1X70A 1GKKA 5HKBA 3V9AA 1ZI8A 3EBLA 2QS9A 3VDXA 5DNWA 1J06A 1QJ4A 3O4GA 4CIBA 1MNQA 2JGLA 2H9YA 1TCCA 4AZ0A 1EHYA 4YX9A 1KU6A 3O9MA 2VT6A 3PFCA 2VQ6A 4UFPA 5FKJA 3WK9A 1EK2A 3IUJA 1EDDA 2QMQA 1RP1A 5FLKA 4BZZA 5DNUA 2C0PA 3X3HA 2O7VA 5LKAA 4KRYA 1WB6A 2D0DA 1JJBA 5ALQA 4B9EA 5AJHA 5DYTA 5HZGA 1BU8A 1BE0A 3R3YA 3VISA 2VJBA 1LZLA 6YASA 2QUBA 1MX5A 5FRDA 3STXA 3W9UA 4NVRA 4FFWA 4EY7A 3WYNA 4QDUA 5HF5A 4WY5A 3RM3A 4H35A 2W22A 5T4HA 3W2TA 3H19A 7YASA 1CUJA 4BYMA 3AZQA 5K3AA 4MWSA 4UBJA 2ZJFA 5LIPA 1DT3A 1QE3A 4X93A 5ALDA 4U2CA 1OCEA 1AGYA 3I1YA 4ZV7A 4G9EA 5AOAA 4DGQA 1Q83A 2Y2UA 2XDWA 1B41A 4Y2RA 4Q3KA 2J4FA 4H7IA 4BRZA 3H0CA 1CUHA 5CH3A 2HA3A 3H1BA 1XZMA 3A2NA 2GZRA 1C4XA 1JMYA 1ZD5A 1WOMA 1RWQA 1E3QA 1LPOA 1U65A 5KWIA 1EB9A 5EI5A 4BDSA 4WFJA 2EEPA 2QT9A 4IQ4A 1XZBA 4DMCA 1XLUA 1ZIXA 4C4YA 4U2GA 4FHZA 2AJ8A 1GGVA 5JAOA 5BWCA 2X76A 2WHQA 4OYYA 4H7EA 2CUTA 4GBGA 2XMQA 1YCDA 1TCAA 1USWA 5LZ8A 5E2IA 2QJWA 3FVRA 2HDWA 4GW3A 3BDIA 3U1TA 2ZYHA 5JASA 3Q8WA 4AMYA 1CUWA 1W6RA 2I78A 3MVEA 1E8DA 3EQ7A 2XUHA 2ACKA 3R3VA 1LPPA 4KAJA 3F67A 3QPCA 4MXDA 1M33A 3KDAA 2Z8ZA 4J7AA 4G9GA 4C89A 4X6YA 3R3ZA 2PL5A 3OTQA 5EHZA 4FNMA 5K3EA 4OB6A 2PU5A 3AZOA 4GHWA 1QZ3A 4NZZA 5HFNA 2HIHA 4QDOA 2OQVA 2JGJA 3F8SA 2WHPA 4Y2SA 5FP0A 1UKBA 1IZ8A 2WJ6A 1R4ZA 5AKXA 5HF9A 2WJ4A 1VA5A 4J3JA 5IKXA 2PSEA 2V98A 1CIJA 4Q3OA 1ZI6A 3V1NA 2XQKA 2XMCA 4X71A 2B4KA 1N5RA 1WM1A 2UZ0A 2DHCA 4EB0A 3STYA 4BC1A 1QIIA 4G5XA 2XUGA 3SX4A 5JALA 2XUPA 4BAZA 3NOXA 3SWWA 5SYMA 1FSSA 4UBOA 4B84A 4BAUA 3Q0TA 2PVSA 4IO0A 5DYWA 2OCIA 1QO7A 4N8DA 4QWMA 4AQDA 4Y2JA 1U4NA 4CG2A 1UK8A 3EIOA 5ALTA 3U0VA 4I4CA 5A7GA 1ZJ4A 4BP9A 1KEZA 2QXUA 3K9BA 1DINA 1NU6A 5ALYA 4HVTA 4H7DA 3V1KA 3I2IA 3ILSA 4CFSA 3JWEA 3HXKA 2G5TA 4DTCA 4N5IX 4G4IA 4HS9A 4UBIA 1XLWA 3O4HA 1XZLA 5FV4A 3HACA 2Q0XA 2VEOA 2WQZA 3SK0A 5CTAA 1ACLA 4QLAA 1UKCA 3UMJA 1BCSA 5I8PA 1P0MA 5ALUA 3HYSA 3A2MA 4BRSA 4U2FA 2Z3WA 4B81A 4J0GA 4N5HX 3ESBA 1AZWA 1BROA 5EGNA 2O7RA 2OCGA 3I6YA 4HTAA 4WDRA 2RHTA 1A8UA 1W4LA 3I2FA 5AK5A 4CCYB 2QOEA 5JYCA 3G9TA 3GA7A 4TGLA 4B83A 2J4CA 3CN9A 1QLWA 3IUMA 2PX6A 1G5FA 4G4GA 1QFMA 2DR0A 3WLAA 4QLOA 3C6YA 4G4JA 1W75A 1MAAA 1MPXA 1WPRA 3H18A 1O6GA 4UFOA 1QIGA 1LGYA 3B5EA 2PUHA 5JD4A 4Y2QA 1WHSA 3TGLA 4W1PA 4LYEA 4P9NA 4QDZA 5AHXA 1TKRA 4Q05A 1P0PA 4JYPA 1N8SA 1CUEA 4ZWNA 5KREA 2WU4A 3ICVA 4BE9A 3WKDA 3W05A 3EQ9A 4EHBA 5E4YA 4OPMA 3OG9A 4BCCA 3K2IA 4W1QA 2QR5A 1EI9A 4OYLA 5C8ZA 1LLFA 5FOQA 5DNVA 3RKSA 2PPLA 4DNQA 1ODTC 4RE6A 3KWFA 2WTMA 1DX4A 4W63A 5CT6A 4BVKA 2I03A 2CZQA 4OSEA 3O0DA 5LYYA 1DTEA 1QONA 3I1IA 3IA2A 3PICA 2WUDA 1XZAA 3DL4A 1LPNA 1EB8A 4BCDA 2G63A 3R0VA 4U2BA 5ALPA 4OUKX 3A6ZA 4Y2VA 3WL5A 3VJLA 2XMDA 2ES4A 2Y2VA 1EVEA 1WB4A 1XZJA 2JEYA 4JNCA 3WMRA 3R41A 5AKYA 2IITA 4MEAA 2CBGA 3E1GA 4LXGA 2J3QA 2AJCA 1XFDA 5FUMA 2WIJA 4DSZA 3P2MA 4KJXA 5JANA 3V1MA 3G0CA 3WWOA 1MNAA 4OU4A 2JBWA 5IVKA 2XUQA 4O08A 1CQZA 4JH0A 4IH4A 4N8SA 5SYNA 2XQFA 1MX9A 1WHTA 5HCUA 2OGSA 4UBLA 1ZD4A 5CMLA 2XUDA 1MJ5A 4ROTA 3FBWA 1H2XA 3QMVA 5DJ5A 3JYHA 2XUFA 4GWLA 1BN6A 4EY8A 2VJAA 3M83A 5K3FA 3A70A 4AO6A 4FFVA 5CH8A 3C6ZA 4K6HA 2Z3ZA 1GQRA 3HC7A 2QKYA 2RAUA 4J0HA 5BV7A 2C5GA 4KE6A 1XZIA 3FYUC 2PUJA 1CUUA 1U8EA 5D3ZA 1LNSA 1VZ2A 2B20A 2DSNA 2HA7A 3B12A 3OOSA 2X8BA 4X85A 5K3CA 1LZKA 4B80A 4U2DA 3D59A 1HL7A 4FWBA 5CXXA 2VJCA 4AMZA 5I9IA 4L0CA 4UHHA 1UWCA 1N1MA 4BATA 1AX9A 2RHWA 1QFSA 2QXTA 1JFRA 2RONA 3EQ8A 1SCKA 3WL7A 3G9XA 4ZXFA 4XVCA 1C7IA 3M82A 3N0TA 1FFEA 3HSSA 4RNCA 2BGRA 3CN7A 3H17A 1IMJA 3R40A 4BVLA 3FLBA 1UKAA 2DQZA 1QIDA 3PF8A 4C87A 3O4JA 2Y1KA 1QIJA 4HZGA 5CH5A 1GPKA 1WPXA 5EIAA 2WTNA 3C5VA 2XMZA 3UUEA 1E5TA 4QEKA 4Q3LA 2H1IA 4LXHA 4YPVA 4RPCA 2GBCA 5ALGA 4XJVA 2WFLA 2ZJ6A 1W1IA 4INZA 4PSCA 4IH9A 1IVYA 3F96A 1TK3A 3O95A 2JIDA 5AICA 1DU4A 1G66A 1N5MA 3C45A 2D5LA 2H7YA 2HL6A 1UOOA 2ZYRA 4Q1VA 5HF8A 3DOHA 2JGEA 5AP9A 1CV2A 1QTIA 2C0QA 4UHBA 4UHDA 5LZ9A 5CURA 5AKHA 2WG2A 1CEXA 2XE4A 5EHQA 3ZLTA 4KYVA 1L7RA 4XWGA 1CUVA 2OAEA 2XQJA 4I19A 1GQSA 3TEJA 5JIBA 1AC5A 1HQDA 1YASA 3KWJA 4Y2PA 1XRPA 4YK7A 2YASA 4NS4A 4X92A 1IUPA 2JGIA 3G9ZA 2WJ3A 4Z49A 4WY8A 3G0GA 1EX9A 3AIKA 1F0NA 4BE4A 4WJLA 1VE6A 4H18A 2CJPA 1MO2A 3FYUB 1Y37A 1KU0A 1CPYA 1L7AA 2HA5A 1E66A 2HADA 2WILA 2GYWA 3C8HA 1QTRA 2AJLI 4KAAA 3V48A 1XZFA 2OQIA 2I3ZA 5HF6A 1SOMA 4W1RA 5AOBA 1R1DA 5CW2A 3GROA 2XMGA 4X3CA 3WIBA 4EUSA 4PF1A 4DMHA 4U2EA 5CRIA 4B0PA 1JT2A 1R3DA 2BGNA 2DHEA 4G8CA 5T4FA 1U2EA 4MJ3A 5C81A 4G8BA 5JADA 5AOCA 2GYVA 3GBSA 4EY4A 3DQZA 5C8VA 4Y9SA 3LCRA 5IH7A 4EA6A 5AI9A 3LIIA 4OCZA 3BL8A 5AI8A 4WCVA 4WFKA 3NWOA 3R3UA 4A5SA 3IUQA 1XRNA 4PQEA 2OGTA 2XUJA 3DS8A 4H77A 3PUHA 4K2AA 4AO8A 2JGFA 5ALIA 5C7YA 1CUIA 4X7BA 3VXKA 4M0MA 5EIEA 3WWPA 3DDUA 5T4EA 2XUIA 2GBGA 1D07A 1TIBA 3WA7A 3I28A 4BP8A 2WIDA 1ORWA 3R3XA 3DYVA 1W52X 2XT0A 5JAUA 4DNPA 2ZJ7A 4FBLA 2NW6A 3ICWA 3OC0A 5AK4A 4I3FA 5ISMA 5AIAA 3WZLA 1XKTA 2FUKA 5ALOA 1QIMA 1SCQA 5LZ7A 1EH5A 4HXGA 5LP1A 5H3HA 3PI6A 4BTVA 4BVJA 3AINA 3IURA 2XMSA 3AIOA 3BF7A 4FMPA 1DWPA 4G8DA 5AK6A 1JU3A 4Y2YA 2H7CA 2G4LA 3ESCA 1H2WA 4KEAA 4C88A 4DIUA 1H2YA 1MU0A 1AKNA 3WA6A 4LYDA 2VATA 1R9NA 2V9ZA 5JAHA 2XMBA 4G1FA 3IDAA 3L1HA 3WI7A 5DWDA 3R3WA 3RLIA 2Y6VA 1CUXA 2O2HA 3DLTA 4X91A 1QGED 4KAFA 4QNNA 5AKJA 5LZ2A 2YYSA 3WK7A 1GPNA 2XLCA 1Y7HA 5AIBA 5K3FB 3STTA 5K3BA 4AO7A 4X6UA 1CQWA 3H2HA 3KXPA 1HLGA 1SCIA 3G02A 4BB0A 4EZIA 2PKYX 4QA9A 2XQGA 4UHFA 4S0XA 4MWTA 4QE3A 4FLEA 1VXOA 5ALLA 2IX9A 1IUNA 1UOPA 4WFIA 4NMWA 1XKLA 3ZV7A 3K6KA 3NUZA 2GZSA 3FSGD 4AZ3A 2HM7A 1QO9A 5AH0A 4Y7DA 4ZGBA 4DSAA 1CFJA 4CCWA 2XLBA 1HPLA 1EA5A 2Z5GA 3C6XA 3DEAA 4P08A 3DKKA 3LP5A 2ZYSA 3WL8A 4ZREA 1QIKA 5ALNA 3IB3A 1HBJA 2OPHA 1CUAA 2HRQA 4HAIA 1R9MA 1K6EA 1FFDA 4UFNA 5A7FA 2QVBA 2OLEA 1FJ2A 3WL6A 3STUA 2RI6A 3HLKA 5A6VA 4QWWA 3NGMA 1ACJA 1A8QA 4EBBA 2HA6A 5CXUA 4OU5A 1ODSA 4BDTA 1CUDA 1YS2X 3BDVA 2V97A 5IVDA 1YAHA 4OB7A 3CCCA 3WYDA 3T4UA 3LLCA 1DWQA 3YASA 5CT5A 4ETWA 2PBLA 3FWHA 4GECA 5AKEA 1UXOA 3WWCA 2HU7A 2ACEA 3W06A 2RIPA 1CLEA 2PSDA 3BF8A 4H7HA 2GYUA 3WWEA 4ZI5A 4C4XA 4MEBA 1PFQA 1DX6A 3MUOA 1YA4A 1GT6A 5HFAA 3BJMA 3H2JA 3JW8A 5ALEA 4UPDA 4UBNA 4W1SA 1DQZA 1AURA 3GUUA 4JEIA 4P93A 1CUSA 3ZWQA 1SFRA 3C43A 5E4TA 3T52A 3C8DA 1THTA 3HABA 5CT8A 5DYYA 1G42A 3G8YA 3WK5A 1AMNA 3STWA 2VA9A 3N2ZB 4B9AA 3GELA 5AKZA 2WIFA 1CUGA 1ZGBA 1CR6A 4K5QA 1ZD2P 5AI5A 3IBTA 2WLSA 2ZSHA 5FPPA 5A71A 1YB6A 3QZUA 1XZHA 1GXSA 1CUBA 5AKGA 1XQWA 5AM3A 3C5WP 1Q0RA 1Q84A 3FOBA 1WB5A 1VE7A 3LIPA 1XZEA 5HK9A 3F98A 4GXNA 5I7UA 5ESRA 5HQ3A 1MX1A 4N8EA 3S8YA 1CUCA 1CUYA 4RGYA 3GZJA 4IHAA 5D6OA 4CCYA 4P92A 2VJDA 3C70A 1ZICA 3WZMA 1ZOIA 4PW0A 4OD0A 4UUQA 3HRHA 1XRMA 4V2IA 4BC0A 1QIFA 3VVMA 3TJMA 4GEGA 4L72A 5EHNA 3RARA 2VAVA 2WHRA 5EIHA 2BUCA 2FJPA 1QOZA 4ARAA 1HKHA 3DOIA 4KE7A 4XX1A 1UK7A 5JD5A 2HRRA 5E4JA 4FDMA 3D2AA 3FSGA 5LLSA 2WHPB 4CG1A 1CUFA 5JZ9A 2BAGA 1MT3A 4C4ZA 3BIWA 3E3AA 2E3JA 4F60A 1ZJ5A 1H2ZA 3AUKA 3VKFA 1J1IA 3E0XA 3MUNA 5ALRA 4LHEA 3QH4A 5AO9A 5ALZA 5ALFA 2WKWA 1EVQA 4RE5A 4EY6A 3AFIA 1XZCA 5KBYA 1K4YA 4HXEB 1S8OA 4LKOA 4TVKA 3D4LA 2QM0A 4L3WA 2WG1A 1E8MA 5CBKA 2PSHA 3QPAA 5EHXA 4UHCA 4AX4A 3ZI7A 3CCBA 1UZAA 3KSRA 1RYYA 3WKAA 4H7KA 3QBJA 2JGKA 3I6ZA 4FLMA 2WSLA 4KE8A 1HDEA 1L7QA 4GI1A 4HXFB 3W9BA 5AKLA 2WUGA 3WK8A 5C8XA 5J3JA 3W04A 4E11A 1XQYA 4CI9A 3AZPA 4KE9A 2WFMA 2WG0A 4MQLA 1ZGCA 5A2GA 3H2GA 1K63A 1ORVA 4X97A 2H7XA 2FX5A 4IH1A 3FNBA 3LS2A 3DJYA 3H04A 4DMKA 2HA0A 1JU4A 1C7JA 1A88A 4PV7A 2VTVA 1SC9A 4ZRDA 3WKBA 1Q0ZA 1XZKA 3D2BA 3F97A 4FLFA 2VT7A 4B85A 4H7JA 5A7HA 1EDEA 3BIXA 5LZ4A 4DNFA 1CUZA 2CEKA 4H7FA 2FJ0A 3WIOA 1EDBA 1YS1X 4CIAA 4L9AA 3AILA 1UK6A 1XRQA 2PSJA 2C58A 3GFFA 2OCLA 2HU8A 3DYIA 2WIGA 2OXEA 3IIIA 2R8BA 4J0DA 2DQYA 1DQYA 2XUKA 3VJMA 4ITVA 2C4HA 1VZ3A 1ODCA 4AB1A 3ANSA 1PJAA 3PE6A 5AM2A 5KWJA 1X2EA 3AJAA 3H2IA 3ANTA 2O2GA 4XIIA 1W76A 3QVMA 1X2BA 2DFPA 4JYMA 3DKRA 2DHDA 2R11A 1NU8A 1BN7A 1JI3A 1GKLA 4B82A 1BRTA 4J0JA 5CT4A 4B0OA 4BTLA 2ECFA 4ARBA 1ISPA 1XQXA 2GBFA 3PFBA 4E46A 3MGAA 3ESDA 1XROA 4DMFA 1YSCA 3QPDA 2BFNA 2PSFA 5FPQA 2HA4A 1YR2A 5JZSA 3O9VA 2X5XA 3UUFA 4AXBA 1UFOA 1VXRA 5ALSA 4H0CA 4J0KA 1LPBB 5AKIA 5ALMA 3PDCA 3FAKA 1F8UA 5DLPA 3VVLA 3F9CA 4X94A 2QRUA 4JUIA 5AK3A 5T4BA 5LZ5A 5JAPA 1B6GA 1EXWA 2DCMA 1LPMA 1QIHA 2YXPX 1WCYA 4QDXA 1MTZA 1JMKC 2GBIA 3C6BA 4BAGA 4K6KA 3M3DA 1CVLA 3D2CA 3FVTA 5JZBA 4E14A 1O6FA 1J2EA 2C5FA 2ZSIA 1P0IA 3HI4A 4J03A 3S2ZA 4C01A 3IULA 5IVIA 5HKAA 3QITA 1UT6A 3FYTA 3OPMA 2EDAA 2XB6A 3IUNA 1AQLA 2OAGA 3AIMA 5A62A 2ZVDA 3QM1A 2Y6UA 5DTJA 5K3DA 4BBZA 2QJRA 4W9RA 2WIKA 2OGZA 1TQHA 2XUAA 4KACA 3BWXA 5D3KA 3H1AA 3FCXA 5AM5A 3DD5A 4X90A 5YASA 2EDCA 2Z8XA 4J0CA 5ALHA 2ORYA 1FFAA 4FTWA 5DTIA 4MYSA 5JARA 2JEZA 2B9VA 4GLBA 1P0QA 1A8SA 1ZI9A 2BJHA 4QZVA 3L1IA 3DNMA 4FKBA 2CKMA 2JGMA 5FDFA 3WWDA 2VSQA 3D0KA 1BEZA 1YB7A 1LBTA 1IUOA 5ALVA 1H22A 5HQ3B 2ONCA 1YAJA 2BKLA 3ZPXA 1XQVA 2XI4A 5AI0A 4EY5A 3HJUA 5ALJA 1R88A 4M0EA 2XMRA 3FLAA 4Q82A 3WJ2A 1AUOA 3O4IA 1OXMA 3KD2A 3I2GA 3D5EA 3QMWA 3V1LA 4AN0A 3OURA 3FYUA 1GPLA 1EK1A 2HU5A 5CT9A 4FNGA 4KRXA 1JJIA 3CXUA 1E8NA 3FLEA 4DM7A 4Y2UA 3I2JA 4AN1A 4B6GA 3WK4A 2WFZA 1BCRA 2AJBA 2QUAA 5JATA 3G9UA 5K5EA 4HRXA 4HRYA 4QDTA 2OCKA 1G4HA 3OM8A 1MN6A 3G0IA 1UK9A 4K6GA 2J3DA 1XLVA 2HFKA 4X6XA 3ESAA 3VJKA 2WUEA 4M0FA 2XQIA 5AM1A 1ZD3A 4Y2XA 3PUIA 4DLNA 5AI4A 3WQHA 3HZOA 4Q34A 1Y7IA 2K2QB 1ZIYA 1UOQA 5ALWA 4X95A 3A2LA 1XRLA 1CRLA 1K8QA 5AM4A 1TAHA 5ALKA 1VKHA 3BE8A 1GZ7A 1FFBA 2ROQA 2HA2A 1E89A 1LPSA 4OB8A 1ETHA 3QMMA 5BWBA 4CG3A 1VLQA 4YASA 4FBMA 2WFLB 1THGA 2B61A 3TRDA 3EF3A 4UBKA 2JF0A 4KR0A 1VOTA 5LKRA 4ZV9A 1TRHA 2CB9A 4E15A 5EFZA 3WJ1A 4UBMA 5BOVA 1R50A 4PSDA 4PO3X 2XUOA 1J07A 2BUAA 2IIVA 1MAHA 4A23A 1T2NA 2G5PA 4MYDA 1LBSA 3PF9A 4C6HA 4D9JA 3SC2A 1BS9A 3ZLUA 3I2HA 4J0IA 1JJFA 4Y2TA 3B3QA 5AKKA 3I6MA 3D3NA 1Z68A 2LIPA 5AM0A 1OILA 4DYHA 2YH2A 3WK6A 1XRRA 1FFCA 4WDQA 1PV1A 2QTBA 1NX9A 3H2KA 1F6WA 3M81A 1H23A 2WUFA 1TCBA 1T4MA 2HFJA 5HK8A 2VAXA 2VF2A 1XZGA 4PNZA 3RK4A 4DNOA 2PM8A 3IVMA 1I6WA 3I2KA 2PU7A 4B7ZA 4PSUA 4MQMA 1BEEA 3E4DA 4F5ZA 4LIPD 4F21A 3ZLVA 2HHAA 3D7RA 2QZPA 3BJRA 1XZDA 2CMFA 5F4ZA 4UHEA 5JD6A 2W6CX 2AXEA 1IZ7A 3G0DA 3G0BA 3FCYA 3WKEA 4BZWA 1VJ5A 4LXIA 5IVHA 1F0PA 2AJDA 1LPAB 2P8SA 1K5PA 2V96A 2WU3A 2OG1A 4F0JA 4BCBA 2WM2A 5FXMA 3STVA 4A16A 1DT5A 3BXPA 1JKMA
chains in the Genus database with same CATH superfamily
1PQUA 3ZCRA 3GFBA 3T3NA 3SXUB 4WBXC 5J23A 2XXAB 4K8RB 1LLCA 1RFGE 1ZISA 5BWNA 4QTYA 3PIDA 2HO4A 2WBLC 2DUWA 4X00A 1JIQA 1QAOA 2I3DA 3WGIA 1YA8A 2BGKA 3G7NA 4RTNA 2B0CA 3RS4A 3NV7A 3QYJA 3ZH2A 5CFNA 3DE5X 3R0ZA 1G8GA 4CM4B 4IZIA 1VSUA 2VDLB 4KDEA 4JY7A 2C7BA 5AR1A 3HKEA 1ORTA 1GNVA 5BW6B 1XTTA 3RQSA 1QIEA 1V48A 4BN4A 4BZXA 1YIDA 1XL1A 2HK8A 2RGUA 3GAFA 5LYJB 1VA4A 4GDMA 5ALXA 4FOLA 3D54D 3KR2A 1GKKA 1ODFA 4IJVA 3SIXA 3I61A 4AWXA 4MHOA 2ZT7A 3ORYA 4A2PA 1TYZA 1G7CA 4MUNA 3KYIB 1LLQA 2RGCA 4FOPA 4JWTA 2YICA 2XVXA 2VXBA 3IOBA 1ZI8A 3OIFA 3V4ZA 3EH1A 2IDZA 3T7IA 1FTWA 3KKPA 2D4HA 1RP7A 4LJAA 1QJ4A 2GERA 3WYGA 2IBTA 2YJ3A 2NQTA 2GHTA 5FBWB 1B43A 4OXXA 5AW6A 3R3HA 4UQLA 1AGXA 2J9RA 4OJYA 5IH3A 1YFJA 3HM2A 1BOOA 3ODPA 3KB1A 2H9YA 1T24A 3F3MA 5HYVA 4I9GA 2F6RA 5IJ0A 3KM0A 1PJ3A 4I6JA 4N9QA 2VT6A 3I0MA 1F17A 3CNHA 5EIXA 1QM5A 3IMCA 3NEJA 3GMIA 4O2AF 3TXAA 4R5MA 4ONEA 5ERYA 3WDSA 1DBWA 1G7RA 3G23A 4Q7MB 4C05A 5ABPA 3IUJA 3IODA 3GLIA 2GBPA 4BZZA 4D3XA 2AN9A 2OBYA 2P9QA 3BH6A 2C0PA 1ZINA 3F8WA 4WAUA 2O7VA 5DNUA 3WLJA 2JCBA 1FFSA 1Z39A 2IEZA 2RHOA 4JVNA 3R4VA 2D0DA 5KDOA 5ALQA 1XU4A 3PQ4A 4L57A 5AHRA 5AJHA 5DYTA 2RJOA 4U1RA 1NW4A 1W88B 1BU8A 2JKVA 3F9RA 3R3YA 3TCNA 2RHCA 5C7YA 4KNYA 1UMKA 3GY0A 2IPNA 5KWSA 2Z8YA 4GF5A 1UXHA 5IFKA 1H6BA 3C3XA 6YASA 1B0AA 1Z62A 2BMFA 1QOQB 2KB0A 3JPWA 3KJEA 1JKFA 1MX5A 4HEA1 3TLGB 4B5KA 2R6R1 5KWVA 4E51A 3I3SR 1FRFS 4FS8A 3UK7A 3W6OA 4PR0A 2RH5A 2Y1EA 4FUTA 5KNBD 3G1UA 1WPQA 3UMCA 1M2WA 2E18A 4AG6A 2D62A 4DWOA 2E89A 4MWCA 4WNCA 1MJHA 3IJPA 3P9XA 3S4YA 3WQSB 4NQZA 1I4OA 3HL4A 4QDUA 4PZUA 4CM3A 2JLUA 4I3HA 1NQTA 4TKVA 3VV3A 4CF5A 1R6BX 2AG0A 2W2MA 2ZB7A 2C5LA 4RSRA 3RRYA 1XHLA 2AR7A 1J0BA 4BJHB 5I01A 4P3KA 4UTOA 3TG2A 4DR3B 3U1VA 3ZXSA 1YL6A 3BFKA 3SJAA 3V9PA 5CDGA 3ESYA 4N3NA 2FR0A 5T4HA 3EPPA 3GC6A 4RS3A 3T38A 4OHZA 1VIMA 3EIWA 2A1IA 5KNCA 1U0NA 2HGZA 2O3JA 3HZRA 5C37A 1O2DA 1Q6ZA 1UMDB 2XOKD 4OGGA 4X1YA 4BYMA 3ZIDA 1DG3A 3GW8A 2IEYA 1T8YA 4FI3F 2ZJFA 2ZUUA 3BD9A 4LZWA 4XTRA 1NTRA 4UD2A 1E2IA 1AQJA 3N2EA 1P3DA 2HH9A 1OCEA 5G40A 4NTZA 3P9PA 2REXB 3Q40A 3TD2A 3ZU5A 4XVHA 1J8QA 2EZ9A 4DYDA 2DBQA 2J48A 4H60A 2QT0A 3EGWA 3EPHA 3E22A 4I14A 3KQNA 2W6ID 2WC1A 4ZV7A 3VR5D 4DGQA 1Q83A 4Q3DA 4YMIA 5CDUA 3FG9A 1V16B 2REQA 1A2KC 1VL2A 2XDWA 5FBHA 4JLVA 5G02A 4IICA 2KM1A 4S05A 3PD1A 2R65A 3ABOB 4F3NA 4YMGA 2GGSA 4KQ1A 1WXGA 4RVUA 3GGPA 1MDBA 3ADPA 1UC5B 3OETA 2D6FA 4PR3A 4EZBA 4RPGA 4Q1BA 4TSFA 1L4KA 4Q3CA 4A8JA 3IAM1 2PKCA 1TZBA 2ODBA 2AOWA 3KQOA 1XAGA 2J6BA 3IR7A 2V3VA 2HA3A 4ZQIA 3S1SA 1UM9A 3WGNA 2QN7A 3VTKA 3H1BA 3GNSA 1N3IA 3RC2A 3NYIA 3UOGA 4IV5A 4NATA 4LF6B 4NZ9A 1ICEA 2JFPA 2D8MA 3D5QA 1X13A 2C1EA 3GLFE 3ELBA 3ZV6A 1U5CA 3UT5B 1Y1QA 1ZD5A 3KQWA 4G5FA 2CEAA 4OHXA 1MX3A 4P98A 1JR3E 1E3QA 3KPJA 3U7QA 4OI4A 5KTSA 3JYOA 4QREA 2NAPA 2W6NA 3JYQA 3PFWO 1FP4A 4CR8A 2FGKA 2ZSEA 2Y9PB 4KCGA 4CI0B 2GA9A 1CJTC 2GVDC 3I9V1 4E6PA 1NUQA 4B2YA 2OZEA 1ZMTA 5G1PA 1PZGA 3K32A 5EI5A 5KIAA 2EEPA 1ZYUA 3GVIA 1C9NA 1GKIA 4MUAA 5TC4A 1NUUA 1YRHA 2CK3D 3HXMA 4DMCA 4AJJA 2GTPA 4JVOA 3NVMB 2G25A 3HNRA 1BD3A 1OE0A 2DY1A 2ZSKA 1XLUA 1SD2A 2XYQA 1ZIXA 2VZ9A 4AZTA 2GF0A 4KQFA 1XMQB 3R7SA 4MO9A 2BDEA 3WXMA 1Y1PA 5JSQA 3FTDA 1DC7A 4YN3A 3S28A 4EJSB 4ENVA 5JAOA 2NAFA 4WOPA 3K5IA 4DABA 4TVSA 2HCFA 2X76A 4KXMA 4LS3A 5LPNA 1M34B 4OL9A 1DC5A 3SKYA 3GXBA 3CX3A 1SVNA 2XMQA 3KHSA 2FPPA 5C18A 4JC0A 2GCIA 3D6TB 3EISA 1V9LA 5C46F 2PS1A 4ZOLA 2O54A 1RBQA 2BR5A 4QRIA 3DHYA 3T9BA 3OCJA 1ZDMA 4NF2A 3LVBA 4Q4HB 3VNSA 4YT5A 4GW3A 2PRIA 1SQFA 2F1IA 5EIBC 2O2EA 1QYCA 4Q1FA 4M9SA 4AX8A 1P8AA 3AL0C 2I4RA 3BB4A 1TCUA 3JQAA 1N5IA 1W6RA 1J21A 4RPJA 5I9NA 1O03A 1ZM9A 3PPWA 2I78A 2VEDA 5K0ZA 1IEWA 1N2HA 1VYVA 4YBRA 2QAGA 3H5AA 2EYUA 3PVSA 2FSIA 4TMFA 1XTJA 1T6YA 1PUJA 1E2GA 2FN8A 3DONA 2ACKA 3R3VA 4GGPA 1LPPA 2YXDA 2LKCA 1AH2A 1GCGA 2UYGA 4YTEA 1P1KA 2NLOA 1W93A 4PHTA 4Q5IA 4DDVA 1JB9A 1UXIA 4FHCA 4WA7A 1WXXA 3OH8A 3TOSA 4PYIA 1PG2A 4HNAB 1VFPA 3OICA 1SKAA 3L9WA 1CB7A 1W0JD 2BTQA 3F71A 5KHOC 5HHTA 1EFHA 4X6YA 3SZGA 5I7WA 1LSUA 2LUOA 1D0IA 1SXGA 3EMKA 3U2QA 2I8AA 5HA5A 4EGQA 1KMIY 3WSVA 1S2MA 2VDQB 5ESXA 1IDN1 1WNFA 4AAYA 1QZ3A 3IT1A 4NZZA 1XNQB 4LK2A 5HFNA 3ZD7A 2BOVA 4FMCF 4ETNA 1CZRA 4KW7A 1NNEA 4C22A 2BEWA 5FL7A 1J0CA 4TUYA 4TQAA 5T57A 2O1EA 3BHJA 3G7SA 4HBZA 5EXTA 4NPHA 2G9NA 1VIAA 1W2HA 3LHSA 2C1ZA 4J3JA 4EPRA 3MGKA 4DPKA 1YB4A 4U3JA 1XTUA 3QTLA 2PSEA 2IY8A 1K7EB 3JWJA 5HM6A 5IC4A 3NZEA 4Q3OA 1SU8A 1ZI6A 3V1NA 3EGXA 5HKLA 3PQFA 5BXYA 3TB6A 1RM5A 1NBEA 2NTYC 3ASVA 5JCZA 2B4KA 3HJGA 4D5EA 2V9CA 4IJ5A 1P4RA 4C1BA 5KMGB 5KOJA 4Y8VA 2FDCA 3OMLA 3LXXA 1OLXB 1KOGA 2BFBA 3STYA 1MXFA 4C5CA 3CUWA 2XUPA 1NC3A 1U9IC 4H27A 4BAZA 4ER3A 5M3BA 3NOXA 3AR2A 3HB1A 4DGSA 3Q72A 3SDZA 1FSSA 3OZVA 5EZQA 5FTWA 3PXUA 4BAUA 4NARA 4XR4A 3MIZA 4KXUA 4TT8A 3E5HA 1JYEA 3R0JA 4TVBA 1KETA 2PVSA 5EJ6A 3ZZMA 3PD0A 4AF7A 3DMFA 4QOHA 2HLPA 3DXZA 3K0CC 4HEJA 2P79A 2ANBA 1H66A 2QIOA 3R6TA 4Y2JA 1J0DA 2X0JA 2HMSA 3CZQA 3RJ5A 2HRDA 2YV5A 3VR2A 1GZ6A 3GZNA 3KJFA 4AZVA 1RWNA 4CN8A 1C3JA 2Y0DA 3EIOA 3PGKA 4FN4A 3AHHA 1Z5ZA 4CTKA 2XZDA 4RA9B 5ER6A 4I4CA 5A7GA 4ZCPA 3LHFA 4FC6A 2NGRA 3ONDA 1Y1LA 2GD1O 3O4VA 1RYNA 3K9BA 3KPYA 4IQ8A 3MOSA 3L6RA 2MT9A 3KSZO 3GJ7A 4PY2A 1DINA 4R1OA 5ALYA 2ZWMA 3ZHZA 3DEIA 2R1ZA 4HVTA 2Y68A 1WETA 1IZ0A 4PICA 1PWHA 1YQUA 3BCHA 4R8MA 3TLMA 4BFZA 3OX2A 4MUJA 4M1TA 2OUIA 3JWEA 3PJDA 1SXIA 2C2YA 4RZ3A 1A98A 2GCOA 3ZC3A 4MUBA 1KI4A 4H15A 1I2CA 4UBIA 5DSTA 3RYHB 1A5TA 2I9KA 4S1PA 4TYYA 5FV4A 1I3NA 4JJIA 5BNZA 1T1IA 1IYZA 3VR4A 4NCJA 4UEOA 4XJSA 2EP8A 1X7XA 3HACA 4Z6KA 1R12A 2EKQA 2VEOA 1F12A 5KQRA 4JJ4A 4IIJA 4IWYA 1W7AA 2WJWA 4NZNA 3CH4B 4R1QA 4EUHA 4QLAA 3KELA 2V7QD 3CB4A 2BDTA 1ID1A 3GRVA 4NY1A 2HWUA 2BI8A 3MBOA 4LHSA 3BBLA 1P0MA 3A27A 2P6PA 5I8PA 3TG8A 2R5FA 2VHTA 3RKUA 1PS9A 4BRSA 5AFSA 4U2FA 4BGVA 4I50B 3C3EA 3K2EA 2Z3WA 2QN2A 1NG1A 1U02A 4OFBA 3RPEA 2H00A 3K9NA 1BX1A 3ESBA 1VYUA 2AYXA 1P1FA 1C30B 3WGQA 4ECAA 5BW4A 1L8XA 5HRAA 2FPIA 1VGVA 5B4UA 4DRZA 2IYNA 2PMCA 4V0NA 4XWOA 3OECA 4J16C 1KI2A 4EPYA 1JHRA 2OCGA 4KQXA 2VDWA 3WLRA 1OJ7A 4DMRA 5K0LA 2EQBA 3GJRA 4WDRA 4NZOA 3SIRA 2ZUCA 1P61B 4JKIA 4UNNA 5DT2A 2UXDB 2WYVA 3V8EA 2B7LA 3WLNA 3LFUA 4AMBA 3SZMA 2W6OA 5EWLA 3UAXA 1Y98A 1HT0A 2J9YB 4JL6A 4CL3A 1J20A 3T3OA 4G0WA 1JFTA 1N78A 4MW4A 4F46A 1U7ZA 3DF9A 3PQDA 3BXZA 3V2HA 4CCYB 2IH4A 5EMMA 3PHLA 3AL3A 1ZONA 3KV1A 3SF0A 3P0IA 5TMEA 2XKJE 3TI7A 3I5XA 5EJ2A 1AK2A 2FWBA 2VH2A 4G86A 3GA7A 4Y7CA 3CVXA 4GH5A 4N5DA 4B83A 3ZDZB 4F9GA 2IIPA 2QTMA 3I73A 4OQDA 4ZT7A 4C30A 1FNNA 1Y3DE 3AFNA 3CN9A 3NYRA 5C8YF 3L4JA 1YDFA 5CA0A 5LJLA 3ETHA 4PRLA 1M74A 3V4RA 5JDCA 3T9EA 3SEQA 4M89A 3JD3A 4KREA 5EIBD 2AH5A 3RRBA 1CE8A 1JG4A 2E5FA 4BO6A 3OESA 1N57A 1G5FA 2LR0A 3MCWA 5JC1A 4JB0A 3ZW9A 4S2EA 1UJNA 1Q6YA 4RK1A 3UMVA 1W5SA 2KHZA 2C7OA 2G6BA 3TNYA 3UJDA 3DT6A 3DKPA 3GJYA 2GJ8A 5DEOA 1T0JB 5NULA 2A4KA 2B8TA 1CNMA 3C6YA 1MAAA 4G4JA 1VJGA 2VRCA 2IHNA 3O8OA 5CB4A 4MV8A 2QY6A 4UFOA 3N8NA 3NKFA 1QIGA 4HKTA 4IQ0A 3TGWA 2JBAB 2Z6AA 1D2HA 2Q41A 5K03A 4H4EA 1X1RA 1Z8HA 2CXTA 1ZM4A 3B5EA 2XOXA 5CFLA 2PUHA 1RT9A 4FR5A 4JFAA 1WHSA 2FK8A 3OP1A 2N1MA 5KOHB 3PHHA 1KJZA 3Q2KA 4O29A 4UNQA 4YONB 5G0TA 5F23A 1TDJA 3C98A 4UU7A 2C7PA 1ENZA 1X3LA 1CZUA 1G2QA 1MRNA 4QVKA 5CLGA 2FCRA 2TMDA 1VMDA 2BBTA 4Q05A 2WU0A 4RC9A 2HV9A 3SD7A 3SHFA 1UOEA 4C0WA 1G3QA 3OX1A 5MDHA 3I5UA 3LT1A 2FTKE 4AMGA 3UCEA 4JYPA 3SBOA 4HTFA 1PJSA 3I58A 1U1GA 2O8DA 5BQOA 1RLOA 1UP7A 3PZRA 1CUEA 2XE7A 4Y2HA 4AP9A 1BMTA 2ZTUA 1PD0A 5KREA 2WU4A 3OWXA 2NTJA 3WKDA 2EHJA 3O3MB 2BKEA 6AT1A 5FWDA 1KI6A 2H65A 4HDNA 2QUHA 1X7WA 4CMHA 1T6BY 2PIDA 5C8ZA 2H0AA 3TSAA 3RG2A 3NOOA 1ZH0A 2XX3A 2H18A 3GRRA 5J9FA 4AJPA 3RKSA 3LM8A 1Z0SA 5BQPA 2IOFK 3ZGNA 2JJQA 1ODTC 2H5JA 2ODPA 1M6VA 4O8ZA 1X87A 4Z1MD 4G25A 3CLTD 4MP6A 3ENQA 2I8LA 4HAUA 2GRJA 3ZQJA 5L40A 3ZOKA 5M7EA 1JZQA 5LSAA 4PE5B 3U4AA 1O5TA 1CC1S 4OSEA 2OY0A 1CNEA 3GLRA 1YWGO 1ILWA 1PDVA 2PGOA 3GVCA 1OY1A 4YS6A 3WRXA 1B8NA 2GN2A 1ISFA 1NUAA 3B6EA 4NH0A 3RFTA 2LNDA 3VTAA 3C4VA 2BMEA 1DAGA 4JCOA 4CEJA 4V0RA 2C99A 1ECCA 3V1UA 1CLUA 4WCFB 2H0QA 1U94A 1XZAA 3QG1A 4HMPA 4NBLA 2IYVA 5CDYA 3U4QB 3K70C 2ZULA 3EIXA 4QTUB 2B1GA 2CXNA 4IIBA 2G63A 2PGJA 5J4HA 3QVXA 4U2BA 1T3GA 4MVJI 2F55A 3BG5A 1CF4A 2XNDA 2XSZD 2XGSA 1Q5PA 1XJWA 3GGJA 2MINA 3SMQA 4B32A 3KQLA 4YV1A 2NO0A 1UJ2A 3FWKA 4X8MA 3V6MA 1GNSA 3WSTA 9LDTA 2YFKA 5BN4B 3W6UA 5C3MA 1ZXXA 4O4JB 4U7GA 4BX2A 3WL5A 1GIAA 1ZO8A 3PUXA 3VJLA 2COKA 2R6AA 4NYJQ 3V34A 1TM1E 2JIPA 3TZQA 1F6DA 3IUBA 2Y2VA 4ZJUA 1J24A 2E49A 2H4YA 3B36A 3WYFA 1WB4A 3IKJA 1BSVA 3W5VA 3E05A 5DHUA 3WB1A 2YINC 5LD2B 1EFVB 3C39A 2Q5EA 1E1KA 1FE8A 1ESCA 1L7DA 2JANA 2QRVA 2W4IA 4KK3A 4XFJA 1NW7A 3M6AA 2WP0A 3TOVA 1KPGA 3W4JA 4MHTA 3DLCA 1YUBA 4QOIA 1X7YA 3QX8A 3FGOA 5BUCA 5KYNA 1DOZA 1FXWA 3I34X 4EHDA 4G97A 3HUEA 4QPPA 1R4MA 2XBLA 3EY9A 3LYLA 4LXGA 5E2BA 1V26A 1TT5B 2EHDA 2AJCA 1XFDA 2WFAA 4JITA 4RVNA 3TMAA 1B14A 4D7AA 5FUMA 2WIJA 4DSZA 4KJXA 4KQWA 2G1AA 3VOBA 1MNAA 2A1UB 2FW9A 2FFHA 2JBWA 4ZAVA 7MHTA 1E2BA 3WS7A 1E4OA 1GJRA 1UADA 2BEJA 1NL3A 4XGRA 1RMYA 2ZJ0A 3PRKE 2XYRA 1CD5A 4Q16A 1PWZA 2VNIA 2YVLA 3LQFA 3THSA 3V5NA 5I9BA 5H0IA 3Q5GA 1Z5WA 3Q3HA 2BWJA 3U6KA 1QR6A 4B43A 3QE4A 3VH3A 1YZNA 4XKJA 5FUVA 1IE3A 5TXGA 2LIVA 4YCAA 4JI7B 3KJIA 1FW8A 4NBRA 1P29A 2PZGA 3A31A 1ZEJA 5HUHA 1OROA 1M66A 3A6EA 3IAXA 4E07A 3U3JA 5M2QA 3ELWA 1U6IA 3N74A 3R5KA 4UBLA 1IXRC 1JLRA 2KE5A 3C41J 4MCAA 1ZD4A 5H16A 2CDRA 2XUDA 3GGDA 3ON5A 2IQ5A 5EUQB 4B6FA 5H9WA 3RQIA 4B34A 1MV5A 2WVAA 3ASYA 3CGGA 3F49S 4AUNA 3FBWA 2N46A 5KAMA 1D4OA 1WZNA 2DR2A 3JYHA 3L0BA 4FK8A 3OF3A 4YB8A 4YUWA 4LWPA 5IKPA 4I66A 4KN6A 2IP4A 1BN6A 2CFIA 2J3KA 1QBGA 2DPLA 1E7MA 3LWNA 3H8JA 4JBNA 1RHJA 3HYRA 4BFYA 1UQUA 3M83A 1WCXA 3IQFA 3HKCA 3DAOA 4W9MC 1MEEA 3BOSA 4UTXA 4AY3A 1LDEA 1E2EA 1H42A 1I32A 1OFUA 2VDMB 1SCBA 3GH1A 4FDLA 3ETGA 2AF3C 3CUYA 3RAPR 1GQRA 4UXJA 4L50A 3A1TA 4R01A 4J0HA 1Q1QA 3T5MA 3H3JA 5IU6A 4F4FA 5DHAA 4XI9A 1XZIA 3RIEA 3U7FB 3C6MA 1LLUA 2GWRA 3DFZA 1KO5A 3ETCA 3DQQA 1LVGA 3NTLA 4E94A 3GMTA 5DN6D 1VCOA 3K0BA 4QUBA 5JNUA 1LNSA 3M6FA 4P0QB 1P1HA 5T67A 1NUSA 2B20A 3E0QA 4NAUA 3TZCA 3PCXA 3T1QA 2X8BA 3GFQA 4TTPA 4D4MA 4ISBA 5EYPA 1VTKA 4HUJA 4X85A 3NFYA 5K3CA 3URKA 2P2LA 1Z13A 1LZKA 1V8DA 3PKZA 2ZWVA 3B2NA 3VX4A 4X7PA 3JAKB 1M5UA 4DB2A 1RYFA 2G28A 5FWAA 3D59A 5J5AA 1HL7A 2KBEA 2TMYA 4X45A 1ZUIA 4X84A 3VPXA 3O21A 3GNQA 2LPMA 1JDTA 1S7GA 1BH6A 3ME5A 4Q4DA 5BSHA 5I9IA 4ND8A 4R5HA 3A1CA 3UA3A 1UWCA 1CS0B 3DEZA 1EZ1A 1YL7A 4V0QA 1T9KA 2INGX 4LBWA 1N1MA 5EWMA 2C07A 1OBHA 4JYBA 4L78A 1Q19A 1QFSA 4GM0A 4WK4B 1YGPA 2HF8A 3P2YA 5BNFA 2P9TA 3P19A 1ZNXA 9GPBA 5BR8B 1SCKA 2NU6A 3G9XA 4ZXFA 2PX0A 1H65A 3LG2A 3S2GA 1B1CA 1C50A 1FFEA 1S02A 2PUWA 3L18A 3CZ5A 4C6RA 4PINA 4BNJA 2YHIA 4UCFA 3DT9A 1RD4A 4C4AA 5TPWA 4ED9A 2G0TA 2K4MA 2A67A 1Y9JA 3R7NA 3BJEA 1M2NA 4PM4A 2FX3A 2XKBA 4XYGA 4F04A 3UGJA 1KYZA 1R0YA 3ZEAA 4AU1A 5TVGA 4MUYA 2NXNA 3ETDA 1QK5A 3HCAA 1VHJA 2B7BA 4FILA 4U3JB 1N77A 4U02A 3PBKA 4CUKA 1PVVA 4H3HB 1QIDA 1AKQA 3JQBC 4C43A 4GR4A 4C87A 3OZCA 5CH5A 4PQGA 2CFTA 2WHXA 2PHZA 4N18A 3TFQA 5ARBA 2P6RA 4MQEA 2Y1XA 4OQFA 4MULA 1FSGA 1ZX1A 4WUVA 4MUXA 4Q6BA 3P1JA 2ZVQX 4GAEA 1A5AB 5FOWA 1V9CA 4JLMA 2UUBB 3ETEA 5FUXA 4AYTA 2Z43A 2IH5A 1NHWA 2H2DA 2OC4A 3C5VA 4DCCA 2H2IA 4EKGA 3N2GA 3SX0A 4QEKA 2OV1A 3SQXA 1Z0DA 4WXPA 4YQFA 2H1IA 3UJNA 4QJ3A 4YPVA 1OZHA 1T5LA 2AFIE 2PKEA 1VRCA 2GPWA 1N6RA 2FCAA 2QLNA 4PONA 4RH1A 1P3Y1 3AR4A 5U4XA 3AKDA 4XJVA 3DL0A 3K70D 4DV5B 4JUFA 1W1IA 4L4ZA 3JR3A 4GICA 3PNLA 2ZXFA 1GN8A 1F6BA 3EA5A 4OKNA 3DULA 1TLLA 3MQFA 4ZAZA 4MNTA 1SKYE 2ZT6A 4Y6PA 5B6PA 1AO0A 3QLVC 1NNLA 4B6SA 4KUGA 1DU4A 1K0UA 3ZHXA 3BE4A 1FYEA 2PBZA 1G66A 4KIUA 4QGBA 2GPAA 3WNDA 5LLDA 4DXAA 1N5MA 3T0IA 1JILA 2VPTA 1DCKA 2D5LA 3Q8MA 4GR9A 1G4AE 2B37A 2ISQA 1XMIA 3QEJA 2H7YA 3RBAA 3BWCA 2DERA 5CFOA 1HRDA 3RVRA 4KDCA 2VP4A 1UOOA 1O1YA 2FFRA 4QYSA 4MA4A 4MI1A 1WTAA 3ZV4A 1YVDA 2IBMA 1Z8NA 1Z6QA 4ZALA 3LA8A 4Q1VA 5HF8A 1FXUA 1LX7A 5A03A 4JIGA 1YONA 2XT9A 3UOAB 2GEFA 1CV2A 2E2WA 3MS2A 4M8SA 4D6PA 3EZFA 3FPJA 1TGVA 5JMTA 4LZZA 4UHDA 1T13A 1H0KA 2AOVA 2XXBA 4B3FX 1ZJJA 4CFZA 4D4IA 3IVAA 5LZ9A 1B7GO 3FHOA 2WG2A 4A6DA 2H07A 1RRGA 5FNZA 3FOWA 1QP8A 4GO1A 1ULTA 2HMVA 4LC0A 5H3LA 4QYTA 1X7XB 2RGNC 1OLOA 3ZLTA 4ALIA 3MK31 5H81A 1R0CA 4TMVA 3JXEA 3V2IA 3LBAA 1J8DA 5CDFA 4MUKA 2E9SA 1TM3E 5FTKA 1JLKA 2AT1A 3VR6H 1CDDA 3K6SA 5LMUB 1E9RA 3C7AA 3COVA 4P2BA 3R9XB 2UVPA 1QAQA 3HQ4O 5DF1A 1NPTO 1MQAA 1EM8B 2OZKA 5E3JA 1M2VA 4ARVA 2NX2A 1CUVA 2VAWA 2OAEA 2XQJA 4KNWA 4OHCA 1GY8A 5AW3A 1YBFA 4Q4JB 4DIOA 4FDUA 2J9ZB 3WR5A 4B3TB 1QK3A 4DR2B 2WYOA 2ZRLA 3DXXA 1JYSA 2R8PA 5F4BA 5DI9A 1FNBA 1LX6A 1TMOA 1AC5A 3OLVA 5EKUA 1HQDA 2OB1A 2ZREA 2B82A 1YASA 4GFDA 5JD3A 2VPWA 3QU9A 4B87A 1Z5VA 5ER9A 1OX5A 1BMFA 4QXPA 3TUJC 4NJEA 1CF2O 2JD2A 1NVGA 2GPYA 4N7MA 4QGSA 5BURA 3QLJA 5EWLB 4B35A 3QU5A 3GP5A 1A27A 1RTTA 3PQCA 4MV7A 4ZHQF 5C1DA 1GRQA 1WE2A 4TS4A 3U26A 3CBQA 4CIDA 5KX5F 1XP8A 2I4LA 2JDIA 3OUTA 5GWXA 2JGIA 5I5GA 3TIGA 1O4WA 4V3CA 3RIMA 1ZR2A 1NY5A 2AFHA 4I1RA 4Z49A 4YEDA 1EX9A 3W5HA 1NYRA 1NTOA 2CLMB 1MJNA 2AI2A 3QVGB 1KJJA 3S5JA 3TQIA 3MTAA 1ML3A 1J9EA 4YRBA 3PGLA 4TLMB 1MJFA 1QYXA 5L4SA 3A1SA 2CJPA 4CT5A 2PX4A 2Q6KA 3FYUB 2HWXA 3IPYA 5IHPA 1NJFA 4CFYA 4F4DA 2YCLA 2GJSA 4E2ZA 1DJOA 2HA5A 3D1LA 4O33A 1E66A 1QNLA 2OUKA 1PFKA 1SBYA 2B8NA 2ZJBA 2VWHA 4MPTA 2WY2D 4KGXA 3OAAD 3ZU2A 1DRKA 3W5JA 3BIJA 3C8HA 3G79A 4ZTBA 3U3MA 4O4HB 4W5TA 5GPBA 2DBVO 2IHYA 2PUTA 2YR0A 4KAAA 4KSYA 3F1LA 3UB4A 2A0YA 5CB4B 5K6AC 1X8JA 1QH8B 1T6ZA 2WJJA 1J0EA 3SR4A 3K53A 5FA8A 3WLQA 5AOBA 2HSZA 3GUCA 4CJXA 1EXNA 1QQTA 1T2FA 2WDZA 2CXSA 1U7PA 4C1NA 3EAFA 1MB0A 3AQ4A 4PFJA 5COQA 4Z7JA 2V55B 4FFNA 3F3KA 4D2IA 3V97A 4JDPA 4RFVA 5FWXA 3CUUA 3G88A 4EUSA 4WD3A 4U2EA 4M1SA 4DCNA 1GEGA 3QNMA 1QBKC 4B0PA 4A3SA 1V5WA 5HX7A 3PDIA 3GRYA 2R87A 3SG0A 3WJAA 1ZESA 5FOTA 3UJHA 2DHEA 3HO1A 2JLQA 1ULBA 5B58T 5C81A 5C9ZA 1I94B 2EXXA 2EW8A 1IULA 3K8QA 3GRUA 3TNJA 4CHTA 3BKWA 3FDFA 1EUDA 3BA6A 2NZJA 3HHPA 1VL6A 3OU7A 3P0RA 3ZCQA 1V25A 2JGDA 5AOCA 4EY4A 1YZGA 2QQ0A 3GBSA 2UZ1B 2CFRA 1OU0A 4PO1A 1KFBB 4JLKA 2ZIEA 3JATB 4MGYR 1KVSA 1KI6B 1GITA 1PQPA 2ATXA 4MUIA 4TZKA 3SZ3A 2FE4A 3ROMA 4RNDB 4IPTA 1YHZA 5LQUA 2Q2VA 4WFKA 2QMUA 2ZB3A 3NWOA 1CVIA 3W78A 3J7AC 1Y8AA 2Y05A 4A5SA 3X1XA 4FCTA 2HUPA 1EBBA 3DE1X 4J1QA 5AQ1A 3NGLA 4CM8A 4IZ6A 3KYDA 5TMPA 1VSVA 2YHSA 3LY9A 2GESA 4P5DA 1LFAA 1UWVA 3UHJA 2Z2XA 4PQEA 2AI1A 5KNDH 4NNOA 4PBRA 4JBWA 3NM6B 2A9VA 2RBEA 2L17A 4FMDB 3FFBA 4JGIA 4JL5A 3FTCA 4L9RA 4RHFA 5EG5A 1RPZA 2QL6A 1UBFA 1KBZA 1X7GA 4U2KA 4ZCIA 1XTPA 4RF5A 4PXAA 2FNAA 4AO8A 4C9BA 4F9EA 4BGEA 3DLHA 1ZM7A 1XELA 2C83A 3B85A 3H83A 1BDMA 3QIAA 1TUEA 4UDNA 4AKHA 4O2AA 3VXKA 4M0MA 3OOYA 2EX0A 4HNTA 5GIPE 3OTGA 3LC1O 4N40A 3VAZA 2PT6A 2O2JA 3PB3A 3CB2A 3MD0A 3N7TA 5DASA 4Q3BA 1O6ZA 2B8EA 2XUIA 2F9LA 1TC2A 1YS9A 2W70A 3E8SA 4IV8A 1FJGB 3WRYC 1WL8A 4U00A 2NYVA 2L2QA 5CP8A 1QP4A 1D07A 2C3MA 2WKSA 4BP8A 1YC5A 4MYRA 2BGUA 2P9CA 1SHKA 1XCJA 3LLVA 2IFTA 1M6EX 3DYVA 4IVRA 1P2UA 4DNPA 1D2RA 5EHGA 2XWJI 3FWYA 3RK0A 3SC2B 1B74A 2FU5C 3AP3A 1CJVC 1AKEA 2ZANA 2GO1A 1YI1A 1Y3AA 2DPHA 5ISMA 1YRAA 5AIAA 3WZLA 4G4SP 2FP4B 4QUJA 4G0MA 4ZVVA 1QIMA 3AF6A 4BMNA 2AV6A 2IZZA 2HREA 2QRVB 3T3EA 1N0UA 4UTPA 3F1KA 2FPOA 5H3HA 1N9KA 3GPCA 1I7LA 3L84A 4QU0A 3AINA 3CWCA 3EGDB 1JTFA 5AK6A 2W00A 3WIEA 1JU3A 3UYLA 4ALKA 3OE7D 1RPNA 3ZE2B 1YIOA 1W73A 2ONKA 3DFUA 4MW2A 4XSGA 1H2WA 3OIWA 4MMZB 4BQPA 4HY3A 3IHTA 5BP7A 3AY3A 3UKOA 3HCDA 3R6WA 5BR4A 3HBJA 4Z8YA 1TYEB 3SNHA 3EEYA 1EAMA 1K3FA 2Z5FA 1OXXK 2RH4A 4ZD6A 3WA6A 1IY8A 3U7HB 2CLHB 1JFSA 2AEMA 1Y5RA 2RKWA 1DC3A 3DH0A 2ONJA 3I1JA 3IDAA 3ZDAA 1O6CA 1B73A 3L7YA 2FWRA 4Z4CA 4MYTA 4KBYA 3RLIA 3R7WB 4YJHA 2D2XA 3QX9A 4ND5A 1QHGA 3JQ9C 5CX1A 5KI6A 1CUXA 2NNWB 2O2HA 1KQ3A 3GFGA 3K6JA 4V0SA 5B7QA 5CBPB 2BFDA 1XALA 5KCZA 3FNEA 4QNNA 2B21A 1L4YA 3OOWA 3LX5A 3BJIC 4INJA 1ETUA 1JX6A 1MAVA 5AKJA 1AA6A 1PWYE 1XBTA 2Z1DA 4BLTA 3V4VB 1CYEA 4ZPJA 1OYOA 3R77A 4M36A 3P0EA 3NETA 1Y7HA 3HMQA 3RS2A 1JDBC 2ISSD 1E0AA 3B5IA 3FZQA 4D6XA 5BSKA 3GJTA 4AO7A 1L5GB 4KIJA 2K6GA 3EW9A 4FU0A 4J75A 4RANA 3RHTA 4JLPA 3T1OA 3TSZA 1HDGO 1CQWA 3IDFA 3VOAA 4C78A 8ABPA 4UMEA 4TKUA 3AIIA 3RRXA 3W5IA 4NG4A 1DC4A 3KXPA 1EK6A 2YWFA 1P39A 1HLGA 2EFYA 2WK1A 1C7QA 1SCIA 3WGUA 2SBTA 5U9CA 2GWHA 3GUZA 1ZVVA 2J0QA 2FG5A 4CBVA 3G2KA 4FYWA 4HWGA 4NJMA 2OGWA 1TF2A 3PQ8A 3OWOA 4G67A 4MB2A 4FLEA 1VXOA 2O1XA 2IX9A 4P4SB 2NU7A 3EVFA 2YCBA 5FOUA 1HE3A 1JIJA 5JSKA 1Y1RA 2VQSA 2Q50A 5K8VA 4QQ8A 5BV1A 1W0CA 1W96A 3KXLA 3LW8A 4LQCA 3K6KA 3OM0A 4HQKA 2AE2A 2HJGA 5D84A 4A2WA 3AKEA 1A2BA 3MJHA 4RMNA 4R6XA 1CB0A 4ZGBA 2HUNA 1CFJA 1P0FA 1CZHA 2BKAA 2JAUA 1FFGA 1HPLA 5J58A 1E2NA 3DEAA 3LOUA 2FPXA 4P08A 4YNBA 1LF0A 4OA8A 3O90A 3PX7A 4LGVA 1ULZA 1CRPA 3CRZA 2OEPA 2QSZA 3P4XA 3QXXA 2L0XA 1QIKA 1U11A 2ATIA 2JH8A 1WMAA 4MOWA 4R9SA 4TMXA 1WEHA 2I2WA 4X7RA 1HBJA 1JSRA 4TTIA 5T3UA 3SC3A 4LY9A 3R75A 4PFKA 1VG1A 2X22A 5JSYA 1UJ5A 1FQJA 4DANA 1K7FB 1JTVA 2Z30A 1E2JA 4BS9A 3OFKA 4F7DA 4YXWA 2WIBA 1XQ6A 1UPAA 2NSLA 5C4GB 3IAM6 1JA9A 2LD4A 2IIBA 2YHIB 1EG7A 3W3AA 3TNDA 4CQLA 3ANLA 1U28A 2YW9A 2O3SA 6CHYA 3D31A 4RPKA 1YK1A 4W8HA 4EG7A 5I8WA 1ODIA 1J2TA 3RVNA 4BKMA 4AFNA 1C9KA 1WQ4A 2JPDA 2BV3A 5CM8B 2RCYA 1ACJA 2O8FB 1A8QA 3IIKA 2GAOA 3NHZA 4W5NA 3OIUA 5EJ7A 1PGQA 2G76A 1CSEE 4OK3A 2VHCA 3KK0A 1XA0A 4IRUB 3TNFA 4GLLA 3IB6A 5A9SB 4QSHA 4BDTA 3GAZA 4RENA 4ENWA 1PZHA 5MGNA 2V97A 5K8LA 4XZ3A 1KH3A 1FBNA 1GNQA 1KY2A 1NJ8A 2P27A 4BQNA 3WYDA 1FFWA 1HZZC 1G8SA 1KDRA 1X0XA 1Z82A 1MO6A 3T4UA 1UBSB 1AUVA 1GCIA 5CG2A 1DWQA 3YASA 1Z3IX 1NBWB 1JSZA 3AEQA 4LMAA 2R751 5CT5A 2PBLA 3FWHA 3R3SA 4GECA 2QK4A 3EF0A 5B3AA 5BSFA 2ZUFA 2C4KA 2RK4A 3DKVA 1UXOA 2BFCB 2QW1A 1WZCA 2MSCB 2X4DA 1SEVA 4KO8A 4FPXA 2JLAA 3W06A 5BRJA 1QYDA 4ZCMA 4LAFA 1AXGA 2VXOA 3DTVB 4G1BA 2QAIA 2XBMA 2E1PA 2RKBA 3DZCA 2OO5C 4Q03A 1G20B 3V1YA 1OI2A 4AKEA 4C0JA 4D02A 3FH0A 2CXQA 3H1EA 1N2CB 1DX6A 3ABQB 5FULA 3SE7A 5JQGA 3T7TA 2OP1A 2G07A 2OM2A 2ON6A 4RIFA 3ZU6A 3UAYA 1L4HA 1Y7PA 2FK7A 3HDTA 3JW8A 1F9AA 4JR1A 4PO8A 4UPDA 5K9ZA 3EDMA 3K1YA 4PTZA 4YXFA 1W8DA 4YRFA 3TS1A 2C0CA 1A77A 1T3TA 2QE7D 3T7CA 1L4UA 4J8PA 1QX3A 1BA2A 1E2QA 5DXJA 4B44A 2QTVA 3ZCTA 2C92A 5J4LA 5C8DA 3SGLA 4P93A 4DM4A 3OQNA 3QELA 5IASA 1Q77A 4I1IA 1NONA 3NBUA 3CEJA 3FB1A 4J1NA 1XJ5A 2GEJA 1GTZA 3FJ1A 2F17A 1NJ6A 2I7TA 3BHNA 1GGMA 1YOVA 4HBGA 4LZJA 4OYRA 4RBNA 4F2PA 1BHO1 1JVNA 2VYQA 2WD7B 1H93A 5DBIA 5E4TA 3T52A 1ILEA 4N65A 1V6CA 4XVUA 4MWGA 5CT8A 2VZLA 4K26A 2BEVB 4MW1A 4PYMA 3TZLA 3J81k 5DYYA 3DBLB 1G42A 2O4UX 3TZHA 3WWZA 2GEKA 2G17A 3DCYA 3UMYA 1GADO 3CKYA 3DB1A 2Z6VA 2QDXA 4CEIA 3EARA 4D99A 5CEEA 2IHVA 4R84A 2VA9A 1W5FA 3GELA 3O8CA 4ETIA 2XBUA 4LZLA 2IXEA 1XQ9A 4NDNE 3WX0A 1C8BA 4G4SO 1E3MA 4BWYA 4C0SA 3HUTA 3ONNA 1NFRA 2E5WA 1CR6A 1F9EA 1WMSA 2X2FA 4K5QA 1TD9A 2RAFA 2ZEJA 3BS4A 3KL2A 4BNIA 5L95A 4FJ2A 2L19A 1NBME 5DMXA 3W8FA 4E1BA 5GQSA 3ZY5A 4KIFA 2ZSHA 1UBKS 1I0IA 1CZOA 1UUFA 4ZO4A 2QUJA 2OLKA 2IY9A 1GZSA 4EOGA 1HQKA 1R5NA 2HHLA 2ZW9A 1G3MA 1GXSA 3VBCA 2VG8A 5E7JA 4IYJA 3VTFA 3F6SA 5KVAA 5F73A 5TJ9A 5AM3A 1EGQA 1WB5A 4LXUA 4RMJA 2IHBA 5L9AA 1EUYA 4E7PA 3H6HA 1VE7A 1Q3KA 4G0QA 4NICA 1TKAA 3FPAA 4MJXA 3F98A 3CBGA 1JQJC 5I7UA 2L69A 2JI7A 5TJHA 5AW8A 4Y0AA 1F7UA 2H5LA 4XYBA 4CZ2A 2EU8A 2JZCA 3NYWA 4HDRB 5CYFA 4A7PA 1RNLA 1YBAA 5CCDA 3OX3A 5JSUA 3TSYA 5B1HA 2PMBA 4ZI7F 4G36A 2C3YA 1HMPA 4D3ZA 1JWLA 2Z98A 4IINA 1G6Q1 1UPFA 2JLVA 2P7HA 4DAEA 1VG8A 4KX5A 4INOA 1TEVA 1XXLA 4J1TC 3NUGA 4S12A 3EDRA 4Y98A 1TOAA 5D3MB 4AG5A 4D98A 4PYQA 3RTAA 4PG4A 2A35A 1OWNA 4YP5A 3PL1A 3G17A 3EZGA 4V2IA 3HV2A 5I4KA 3HK2A 3VVMA 1BVYF 5JMPA 5FIUA 3OSUA 1LBHA 2EWVA 1R9JA 4UCQA 3WHLA 4YJGB 4LQ4A 2Q62A 1FPMA 1OF1A 4PX2A 3C4JA 4MS3A 3MZ0A 4HHEA 2ZRPA 4M9CA 1G5RA 2HSWA 3KVYA 2ZVPX 4ZRNA 5EHNA 5IT4A 1IJKA 4B8YA 4GPIB 3UFXA 1JG2A 5DXFA 4LRSB 5L3ZA 1X92A 2CV0A 1VCHA 2BTOA 5EQTA 5I4CA 3T3GA 2TYSB 1A9RA 3A6LA 1OTXA 1PNVA 4TN1A 1VDMA 3LD9A 4UU8A 1UZMA 3PHCA 4K6FA 2GD0A 3I01A 3R44A 4M88A 4OLJA 5C8YA 1SVUA 3RRJA 4V0MA 1WMBA 2AXNA 2QTRA 5IAJA 1QOZA 4PZCA 1N7GA 1HKHA 2JAQA 4XX1A 4UAJA 1UJMA 3IXQA 3OBIA 4DCTA 1Q7CA 1H9AA 3C3WA 1R4NB 1GRRA 4YLEA 4AJEA 5JD5A 5CVUA 1FNCA 3KSBC 4J4HA 4U4AA 2VKQA 1O0SA 2DGDA 4J2HA 4W8OA 5E1MA 1R66A 4PLZA 3K9CA 5AESA 1JLMA 2F3RA 3TW6A 1T10A 2Z2YA 1QHHB 1CUFA 4FKMA 4ENSA 3H16A 2BAGA 4WWHA 5JZ9A 1QPGA 3KUDA 4PS1A 1AT1A 5I3ZA 3E18A 2XB4A 3PE3A 4F84A 1GPUA 2W8BA 2YOGA 2GTIA 4PG7A 2E3JA 3IGFA 3N76A 1W49A 1ZJ5A 3B8EA 4LOIA 5JDIC 2BGIA 3KQYA 3AUKA 5EMLA 4DW8A 1JEEA 1N25A 3G82C 4KJZA 1WUTA 1OHHA 2DPYA 2QA5A 5AO9A 4PCLA 4C6SA 2OYCA 2X1MA 4ND7A 2GBLC 2VQEB 1P1BA 2BC9A 3B1ZA 5DULA 1EUZA 3FWPA 3ZHTA 3RVPA 4QG3A 5DYGA 2OK7A 1Z45A 2WNIA 1QFZA 1Y3IA 2H48A 1NI3A 4WACA 3KFLA 4RY9A 2H2FA 4L5CA 3V3TA 3CG0A 1SUIA 4I9FA 3W5CA 3QIVA 4HSEA 1K4YA 3H9UA 4MICA 4CF4A 2JLXA 3AMVA 1KIFA 3OEYA 1X19A 3KYBA 3G85A 5LDGA 4UEJA 4CMKA 2VDVE 4MZDA 2X4GA 4ZOQI 4ZQGA 4B3DA 3ORRA 2QTFA 3GB9A 4Z4EA 2FUNB 3KJXA 1YJXA 4L4RA 3F6RA 3E3LA 1SU7A 4L3WA 1RAGA 1U7HA 1WXHA 4PRKA 4ZQCB 3S2SA 3IIJA 1WUYA 4TX1A 4Y6OA 4DV0B 1JG3A 3FGZA 3NIGB 5FAXA 4BGDA 2PZMA 2OZLA 2EKLA 3BN3A 3KHTA 5DLDA 3RV3A 5JXGA 3QPAA 1LDNA 3ZYZA 1SRQA 5EHXA 3KHKA 3PU6A 3ZE9A 3AM1A 1R0BA 3ZI7A 1POWA 3EFOB 3KLNA 2ZIFA 4Y6SA 4ZU6X 3UJCA 1UZAA 4GT1A 3KSRA 5EZYB 3QPBA 3KVRA 3R74A 1U0FA 1DJQA 4ZODA 3PLRA 3ROZA 4ZGWA 3V7WA 4KR2A 5FOVA 4US0R 5CEFA 3C3KA 1IQPA 1R6TA 3NR2A 2CL0X 4BLQA 5ED4A 2PCJA 2AB0A 5TB5A 1KGDA 2O7NA 2IOYA 2XVYA 3GA5A 3I30X 4GI1A 4XQ9A 3T94A 2BCGY 1J22A 5AKLA 2Z0MA 1UQTA 3RUHA 3VGPA 2RH8A 2JA1A 3ZGYA 4EA7A 3OZ7A 4AM8A 2V5AA 3FMVA 4YBZA 1XQYA 5IKMA 2FETA 5IBCA 5KQLA 5LQRA 4YRCA 3HN6A 2Q5QA 1M1UA 2AD1A 521PA 4ZZ0A 3KTAA 4PQRA 4PPQA 4PGAA 4UM9D 3TW0A 2EW1A 2G1UA 4ZOBA 3ZWKA 3CO5A 3JQ7B 2IKQA 4HDOB 4ZYYA 3HL0A 2W93A 2ECPA 1E98A 4HQOA 4RQAA 1AS0A 3DKIA 2WWVD 3ZWXA 3ER6A 1RABA 1O95A 1NR5A 2NO5A 2HX1A 2YRFA 2W6PA 1HYQA 3GT0A 5HS4A 5FR2A 3U1BA 3R8FA 3L6DA 3CT4A 3TX2A 3FDZB 4NNJA 3L92A 4LJ5A 4CQMA 2Z2KA 4CUJA 1PEAA 3UKDA 4DXHA 2OKCA 2P68A 3A9WA 3AEKA 1BCSB 1DUSA 2H57A 1OVGA 4OHRA 3VZBA 1QUFA 2O7QA 3DJYA 3MMZA 4LTDA 4DMKA 5FBLB 3HA7A 1JU4A 1L5QA 3VKGA 4F6CA 4BB5A 1YE5A 4U7HA 1N1GA 4A0FA 6REQA 2VTVA 4MVCA 2RGWA 2VH1A 3RLFA 4EUNA 1QYWA 3IA7A 4ZRDA 2ZTLA 4GWGA 3PUYA 2OXTA 3D2BA 3L2OB 5H02A 3THXA 2CSXA 2HBYA 1V7CA 2XCLA 3Q7QA 3CSDA 4TV9F 4UAVA 3AUJB 5A7HA 1NVVR 4RH0A 3E82A 2ZE7A 3VAYA 4UOEA 4YUYA 4MUEA 5L3SA 3GZ4A 1C81A 4EKYA 3GEDA 5F64A 3CEAA 4N3BA 3T1VA 5IWCA 2N3ZA 2DXIA 3R6GA 1RAIA 2WTAA 3B9PA 3BL5A 1U0OC 4R2HA 1C7FA 3HPQA 4HJXA 4ZPXA 1K7XB 2VSOA 1XTBA 2YW2A 1GAQA 1IAVA 3U39A 4MPJA 4ENTA 4FJ1A 3EPKA 2VTBB 1TQ8A 2OCLA 2B1RA 2HU8A 1L5SA 3QLUC 4UTVA 2O0LA 4YT4A 1LU9A 2J87A 3PR3A 4D1YA 2OXEA 3IIIA 3OWHA 5JCXA 1U7XA 1A4UA 4MWEA 4QUIA 3PYXA 4J0DA 2DQYA 1NDQA 4TKUB 5A4AA 5TVKA 1Z0IA 2J8ZA 3IUYA 1M5TA 4YJ2A 1VSBA 2R2GA 2DOKA 2W2NA 1LFDB 3CY6A 2XUKA 4NE9A 1N0VC 1ZIDA 2G04A 3CINA 4DKXA 5BWOA 4BLWA 3AUFA 5AM2A 1K8YB 3SLGA 1MKYA 2IPMA 3WV5A 1YRLA 4YCMA 1DQPA 1NW8A 1X2EA 4IJ6A 1J1UA 3ANTA 5CD9A 1JDJA 1W76A 1XEXB 4RKRA 3RSCA 3WNCA 1T0PA 1EMDA 5BSGA 4KYIB 2DFPA 3IEPA 3MJDA 5KDDA 4JYMA 4UPVA 5EERA 1U3TA 2IYTA 4MQ4A 3GLHB 3RTCA 2DHDA 3AHJA 4E32A 4IR7A 1FBTA 2VPIA 1WXWA 1IZYA 2Q4DA 4YWJA 4R41A 5KTKA 3LUHA 4AY2A 3ESXA 5B2FA 3AR8A 2YOHA 4HB2A 4B82A 2CHUA 2IOQA 1P19A 3W6PA 4BTLA 4KPEC 4ARBA 1EVJA 2IXBA 4HDMA 4R8RA 4O63O 1HL3A 5JZVA 5BWLA 4LRYA 5DPMA 4IVPA 2QL7A 3HJTA 5F7OA 3HXOA 1TJ4A 1GRVA 1MFZA 3SYNA 1E5DA 4UMFA 3ZK8A 1CQJA 2A3RA 3GLUA 2GSDA 4BNNA 4BZPA 4QFDA 4ZIRA 1U2GA 1ENPA 2C2GA 1ZIOA 1O4VA 1FP2A 4QGHA 5A4MS 2BHNA 2X5NA 4CMEC 4JHLA 1UJCA 4FIZA 3S0JA 1UFQA 3KLBA 1DC6A 1EAYA 2QRGA 1Q3TA 3IXMA 3KT8A 3KS9A 5DGDA 3SNKA 8OHMA 2JG3A 1IXSB 3CLHA 2JI6A 1PJBA 5EOVA 2R6GA 4O4IF 1YSCA 3QF4A 3GGSA 4O0LA 2WJPA 1RM3A 3UGKA 1DAKA 3O75A 3AT1A 3OFND 1SCAA 3QPDA 1P9OA 4TL7A 5DP1A 3OPYI 3TLXA 4EHJA 1RHUA 3C97A 4JXZA 1E2LA 1MAUA 4TKLA 3V8BA 1D4AA 5IKEA 5JO0A 2V5UA 4PZPA 1KVRA 4K9LA 5J2TF 5K6RA 3M6UA 2GZMA 3F4KA 1I3MA 2W2OA 2X4IA 4CKCB 2PQ6A 5LN1A 1E9SA 2EFGA 2EL7A 3OOHA 4QECA 1AGNA 1WSBA 1Z5GA 2OBXA 2QSJA 3A10A 4JGGA 3J80A 2BP7B 1QQ5A 5JNTA 4HVLA 3LFTA 4NAVA 1LPBB 1PLLA 2BFFA 3TDMA 2O3QA 3O5AA 2YZNA 4CV3A 3HV0A 3PDCA 2VUSA 3FAKA 3JS5A 1XN1A 5DNEA 3MINA 6LDHA 2ZTSA 4EB6B 2WWYA 2M1XA 4DMUB 1AJEA 2NNLD 1ABEA 1SWWA 3OC6A 4HNHA 4R6WA 1AG9A 3BRWD 2FUCA 4X65B 3EZYA 2ZT5A 4K28A 1UMBA 3TX6A 3UJ9A 4C3UA 1COWA 3V55A 3C3DA 5E6UA 3ENVA 3VC2A 1YE8A 2EFCB 3JV7A 3IP3A 3MSXA 4BJ6A 4CV1A 1DRUA 2DCMA 2VHWA 2Z5VA 3GLIE 2FH5B 4B3XA 4Q7EA 2XIJA 1A9PA 1QIHA 3T34A 3JQGB 4CEHA 2P9FA 1VHDA 1XUOA 4TXJA 2VZ0A 1W4AA 3C3YA 2W58A 3L5KA 1Z2NX 3BWYA 3W9YA 1NXQA 4L5IA 1UP6A 3LRTA 4LGMA 3WSWA 4HGOA 3IT2A 1BE6A 1KIAA 3BPSA 1JQDA 3QFCA 2OV4A 3FDIA 3NHUA 1P7WA 4JC5A 3C6BA 4GXTA 3RABA 1U0HC 3IE1A 3MJSA 1LUAA 2WF6A 1YS4A 3TTTA 1KAMA 3M3DA 5HGJA 4ON9A 2AOTA 4MIEA 4E14A 1OXTA 1XAIA 3EIUA 4QULA 3CHYA 1O6FA 1VECA 2ET6A 4A6EA 4EA8A 1M7HA 4HDKA 4EFMA 4FE4A 4US1R 5CFQA 1MORA 2AX3A 4EITA 3TKYA 2XCIA 4JJ6A 1TUIA 3P2IA 3S2ZA 1JR3D 5DW3A 2AMFA 1AUXA 2X14A 3B1VA 4MROA 1SBZA 4YDSA 4C01A 4DLBA 5ARCA 1IBKB 2Q1UA 3O74A 1YOVB 1UFKA 2WNSA 3KEMA 2C3OA 2OBFA 3QITA 3AK4A 1WF3A 1EKXA 1NQXA 3UCXA 3ZWYA 3VKWA 2GNPA 1AQLA 2YC2C 1V7QA 5D2CA 3TLCA 4R71A 2OSVA 5A62A 2BEUA 4LZAA 5B57C 3WLEA 1JQLB 3O2JA 3IAEA 3COPA 2W83A 1VPLA 1V3TA 2Y6UA 3GH3A 3K8YA 3QA3E 4PFSA 4UVHA 5K3DA 3WRVA 4BBZA 1G21B 4QQFA 4B3JA 2UXCB 1TM5E 1SG0A 2VDNB 2WIKA 4GYKA 4X54A 2DLNA 4UOZA 1AKTA 2HTFA 4W7SA 4BX8A 3BORA 5FNVF 4YAJA 1N2OA 1W2GA 2CXUA 3PFIA 4OP1A 4G5GA 1D6NA 4WFQA 4AF6A 1X42A 1FUEA 1K7YA 2EDCA 1SQ0A 2Z8XA 3PGXA 1TK9A 4J0CA 4CNBA 4ENPA 1Q0TA 1E9CA 2EZ8A 2KPOA 1BA3A 3ECCA 2WVJA 4PC6A 4WL0A 5DM60 4BNGA 2J0UB 4P86A 3PENA 3H3XA 5JG7A 1Z4MA 2AOXA 2FEPA 2A8YA 4KYTA 3GAAA 1WUIS 2P9HA 2X0KA 3D0QA 3A58B 4OOFA 1A8SA 1Z63A 1USVA 1BDBA 5JBIA 4KQ6A 3DNMA 4FKBA 1JA1A 2P11A 4WKCA 2CKMA 1RCTE 2I80A 3EA0A 2JGMA 3W8EA 2VP2A 1GAWA 5CCXA 3BGVA 3RAEC 3LK7A 4CLRB 1B42A 1KJ8A 1XWFA 3GWGA 3GYGA 4EG4A 4K46A 1Z4JA 1I7DA 1T5OA 4F2GA 1JEDA 1EPUA 1N5OX 1QDUA 1R5OA 3INNA 3LF2A 4NCIA 1IUOA 1T91A 5ALVA 1H22A 4FZ3A 4F4HA 2ONCA 2WVHA 3A1FA 4D8YA 5L3QA 3A6FA 1XQVA 2ZE8A 2BR3A 4PPGA 5ALJA 3EVZA 3JRWA 1P5JA 3UK2A 1M0TA 3GMDA 4IMRA 4OI2A 3T8YA 1F2TA 2ZJYA 2CMHA 2EWWA 2NZYA 1I7PA 2P62A 4KDFA 3GFTA 2VDOB 3U7RA 4Q82A 3KB2A 3CZ4A 1D6SA 1Y5NA 3MIIA 4CLOB 3AEYA 2G77B 2QE6A 1AUOA 3GQBA 3CUVA 1NI5A 2NU8A 3KZ1E 3D5EA 4PXYA 3FCAA 4ABYA 2TSYB 2HYIC 1D2MA 1VBFA 2E48A 4W5WA 3T9AA 3V1LA 1C9DB 2LW7A 3ZVLA 3OURA 4GOLD 5G0VA 2H59A 2M6RA 4FYVA 4PYJA 5KX5A 3CMMA 1GPLA 3H1TA 1L0BA 1GUYA 4LBZA 3GI1A 4KFCA 2WD8A 3PDWA 4G9BA 5EE3A 4EI9A 2Q6LA 1CQIB 3AGPA 4RF4A 4RS4A 1PV4A 2Q2NA 1FFXA 5E7IA 4RTPA 1QCYA 5DHPA 3ILHA 3LY7A 3ZN2A 2P67A 2NP6A 3BX1A 3I2JA 1G1AA 1RQPA 3QKRB 4I2NA 1PV2A 1RRCA 3DLAA 1M1YB 1X8LA 1XC7A 4IEFB 5CB6A 2MHCA 1YVUA 3CNLA 1BCRA 1F51E 1P4JA 2VCYA 1Q0PA 2BGLA 3NXKA 4GZ6A 4GOJA 2BPOA 2I3AA 1YBMA 3QF7A 3NPAA 3USZA 2FMIA 1FLDA 2HJWA 4GPAA 5DTQA 3UMMA 4U7DA 1B4DA 2PMFA 1B0PA 3GDWA 3L7CA 4QRDA 4RAQA 1II0A 3G0HA 2OFFA 5KUTA 1MN6A 1E3WA 2C94A 3IAS1 4FQ7A 5D1HA 3TM5A 3A8TA 5CVVA 4I55F 4X6XA 4LZNA 3I8XA 3ESAA 1WZUA 4D4KA 3NWJA 4RMIA 1DXYA 1KJQA 2XQIA 3TZKA 4E30A 2ODAA 1LC0A 2XW6A 1I3KA 3QVOA 4DLNA 4LNHA 1TQ2A 2EJWA 4MJLA 2QMOA 4EMUA 1H8EA 4I4LA 2FQWA 4DADA 3DDCA 2K2QB 4WLUA 1SM4A 5BOSB 2FSUA 3CLSC 5DH9A 4WADA 1C3LA 1G291 2GZ3A 3E5RA 3OQHA 1E77A 3Q7PA 1ZHOA 1VE1A 1P33A 4GI2A 4AKIA 1N5KA 3ZX4A 1XU7A 2XNHA 3Q1KA 1Y8CA 1DKOA 1T3SA 3LUFA 5C4IA 4C4RA 2YNMC 5LC1A 3E9DA 1XRLA 5AM4A 1T1JA 4B45A 1TAHA 5ALKA 2V59A 1KRHA 2I22A 2I67A 4D6YA 1GPMA 2D54A 1FVXA 1FFBA 2OWDA 4F86A 1PUIA 2P6NA 1BS1A 1E6MA 1KXJA 3CZMA 5EC8A 5IBQA 2G5GX 3H2ZA 4V02A 1DHRA 3QLTA 1E89A 1KEVA 2PZKA 4LFCB 1UKZA 2CJFA 1ETHA 2ISCA 3QMMA 3W5AA 3EE6A 1X6VA 2AW5A 4II2A 1DLJA 4PVCA 3I62A 1ZVMA 5EXDA 3A9CA 1VLQA 3ZE8A 1DAMA 2DEUA 2V65A 4TTSA 1WG8A 1D2NA 2P40A 1A4XA 2B61A 3R7BA 1QGUA 1SBTA 3KJQA 2R6ZA 5I9LA 2ZSUA 3MJ4A 4KXVA 2Q9BA 4OA5A 4WOCA 4BNDA 3HHEA 3ZQUA 1NWHA 1Z7WA 3OLYA 5ERGB 4FFBA 2B4YA 3GN1A 2E55A 3JVIA 3SBXA 3K9GA 3VSAA 1KYYA 2FRDA 3ADCA 2PMKA 2O3RA 3NALA 4LNUA 2ZBUA 4DC9A 2V0CA 3MQ4A 2P41A 2QBYB 4Y67A 2JD1A 1EX7A 2OSBA 2OYSA 4CWAA 3ST7A 3WJ1A 2F8TA 5D7NA 1EWRA 3IELA 3E7WA 4LTMA 4MV3A 5FPHA 3WYAA 5HVNA 2XUOA 4QFMA 3V46A 4EPVA 3FPLA 4TOIA 2BUAA 3DFIA 1ECBA 3ZV3A 4A8TA 4A23A 4RFSB 3QFFA 2XDAA 4UUBA 1N33B 3JY6A 1XVLA 2Z09A 4MYDA 5B64A 3RYIA 2KBFA 3LHDA 2QTHA 1Z0FA 1LBSA 4FD3A 1KOLA 3P9CA 4PIPA 4CGZA 2ONYA 4D74A 3A6KA 1WMFA 1Z7EA 1ZK0A 4C6HA 1BS9A 1P9LA 3OFVA 4XEHA 3M0EA 4D3SA 2O5EA 1SD1A 2VYND 1GUFA 1JDNA 2YIDA 3B9QA 3A4LA 5KTPA 4B40A 4WN9B 3DOEA 1IIRA 3CKKA 4R81A 2FWNA 1W8IA 4XDGA 5JU6A 5CAEA 4P4TA 4UQOA 3JRXA 4RK0A 5SV2A 2DQKA 4MH0R 4Q19A 2GO7A 3I6MA 5AKKA 1Z68A 2EZTA 3KB6A 3LSTA 5IJ9A 2LIPA 4DV3B 1DQRA 4YROA 5DKFA 2V8BA 1Q3HA 3EQ2A 2FMKA 3W6ZA 2BY4A 1NF9A 2YH2A 3GARA 4AUKA 5AW1A 3WK6A 3PWKA 1QMGA 2YBEA 3NBAA 4PO9A 4N3CA 4WDQA 2G40A 1N7IA 2FPSA 3NOVA 2VYVD 3HYCA 1E1RA 1NVMB 4IDPA 4ARIA 1F6WA 4PFQA 1DL5A 3AB7A 4I1YA 4H1VA 3SLKA 1Y6ZA 4YCJA 1XPJA 3ZNQA 2JS7A 3U16A 4KFRA 1CETA 3KDSE 4CMIB 2FF5A 4PNZA 3RK4A 1OFUX 3IOYA 2ZQYA 3TI9A 4M7OA 5DCWA 1MBZA 2RHBA 1I6KA 2P2DA 4M99A 3ORQA 4C07A 2XHZA 4OG2A 4YWHA 1Z4IA 1SUPA 4KH0A 4UVDA 5B3KA 3THXB 3NIBA 3ENNA 4CT0A 2P2NA 2I71A 4J3NA 4KIWA 1C4WA 1PGOA 4KZKA 1JG1A 2I55A 1XMXA 3F3SA 2ZIUB 4JJFA 3F0TA 4F5ZA 4DMLA 2HIGA 2BVNA