3G7NA

Crystal structure of a triacylglycerol lipase from penicillium expansum at 1.3
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
258
structure length
254
Chain Sequence
ATADAAAFPDLHRAAKLSSAAYTGCIGKAFDVTIVKRIYDLVTDTNGFVGYSTEKKTIAVIMRGSTTITDIDIALITPELSGVTFPSDVKIMRGVHRPWSAVHDTIITEVKALIAKYPDYTLEAVGHSLGGALTSIAHVALAQNFPDKSLVSNALNAFPIGNQAWADFGTAQAGTFNRGNNVLDGVPNMYSSPLVNFKHYGTEYYSSGTEASTVKCEGQRDKSCSAGNGMYAVTPGHIASFGVVMLTAGCGYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase
publication title Crystal structure of a triacylglycerol lipase from Penicillium expansum at 1.3 A determined by sulfur SAD
pubmed doi rcsb
source organism Penicillium expansum
molecule tags Hydrolase
total genus 83
structure length 254
sequence length 258
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2009-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3g7nA00
3AIOA 1C7JA 5CXXA 5JZBA 3IB3A 1DINA 4CG1A 4BZZA 3HYSA 2ES4A 5HF8A 3R3XA 2CBGA 1CUIA 4I4CA 1ODCA 1ACJA 4K5QA 1G42A 1VXOA 4C4XA 3WQHA 2XUDA 3QMWA 4G8DA 4TVKA 2WIGA 2ORYA 2DHCA 4F0JA 4JYPA 3OOSA 1XROA 3WL5A 1CLEA 1IZ8A 4QWWA 4U2CA 3FCXA 2ZYIA 3FCYA 1HLGA 5HZGA 2XUGA 2ACKA 2DR0A 2FX5A 5DYYA 5A71A 3DNMA 2ZSHA 2OGTA 1BEZA 4PQEA 1MX5A 1GKLA 1XZJA 1LGYA 3OM8A 1ZI6A 2BUBA 2G5PA 1TKRA 2OAGA 3QMMA 4H0CA 4DSZA 1JU4A 2XQJA 2XMQA 3OPMA 2AJCA 4X6XA 3IUNA 1R9NA 2XT0A 1BCSA 1U4NA 3HABA 1A8SA 3G8YA 3HJUA 2OCKA 2G4LA 2R11A 2PM8A 3N0TA 3KDAA 3PFCA 5DNVA 4G4JA 4H7HA 5AI5A 3HZOA 1MO2A 3AINA 4BP8A 3I2GA 5DJ5A 2XB6A 4XVCA 5AM1A 4EY8A 3JYHA 2WG0A 4RNCA 5ALZA 4V2IA 2WUGA 4FBMA 3Q0TA 5CMLA 4LXHA 4KE7A 5ALQA 1EDDA 1XQWA 3BJRA 4P08A 4PSCA 1GQRA 4EA6A 4X3CA 1H2ZA 1K6EA 2PUHA 3ICWA 5LZ2A 4O08A 4QZVA 1KEZA 3R40A 1J06A 1DWOA 2WHPA 4GEGA 1O6FA 2BJHA 5AKKA 4LKOA 1LBTA 2PU7A 4G5XA 2XUFA 5AKHA 1PJAA 4DTCA 2OGSA 4DLNA 1HDEA 1ZI8A 3D2BA 4DNQA 3SK0A 5CXUA 1QTRA 4BE4A 1X2EA 1XZBA 4X93A 2XUOA 4AZ3A 5EIAA 2CKMA 4IH4A 4A23A 4GWLA 1SCIA 1XZFA 5BWCA 4KAAA 4L72A 1THGA 1UK8A 2H7YA 3FOBA 3M83A 3VKFA 4LIPD 1P0QA 3R0VA 2PU5A 4BC0A 4C87A 2J4CA 1FFAA 1TIBA 4C89A 1EVEA 3QVMA 4H7EA 4K6HA 3QPAA 1SCQA 2OLEA 1ZIYA 3OC0A 2J3DA 4UFPA 3PI6A 5E4TA 1XQYA 2VJBA 4P93A 5FPQA 1WB5A 4X91A 5J3JA 1SOMA 1IMJA 3FYUA 4KACA 4UHBA 1MAAA 3VVLA 1C7IA 3AIMA 3D3NA 4X95A 3WZLA 1DX4A 4Q1VA 2QJRA 1LPBB 2J4FA 4Y7DA 2I3DA 4BRZA 3ZLUA 2WFZA 3STTA 4F60A 5ALUA 3B3QA 5JALA 2JGJA 1CPYA 3WIBA 2HRRA 1USWA 1UK7A 2PSFA 5ALWA 3UUEA 1ZJ5A 4UBMA 1LBSA 3IUMA 3WL8A 3HC7A 5DYWA 4DMCA 1CIJA 3FYUC 5AKIA 5C8VA 2BFNA 4OYLA 4B6GA 1LPOA 2QTBA 3A6ZA 5DNWA 3SX4A 5K3DA 2XQGA 2DHEA 4UHEA 4H35A 4AO6A 4W9RA 2OG1A 5EHQA 4H7FA 1CUSA 1MT3A 3GZJA 1A7UA 2HA5A 4AQDA 5BV7A 2QUAA 4NZZA 4B81A 4JNCA 4MEBA 1YA4A 3BJMA 2OCGA 4K2AA 1QFMA 5SYMA 5HK8A 3I6YA 5JATA 4OUKX 1BU8A 1QIKA 5EHZA 3BIWA 1E8MA 1MNAA 1L7AA 3IURA 3MGAA 3IVMA 1N5MA 1XLWA 4Q3LA 5I7UA 4UHCA 2DSNA 2QMQA 3Q8WA 2DHDA 3KOOA 2XMGA 4RE5A 2QRUA 2B4KA 2Y2UA 4GBGA 3BF7A 1ORWA 2VAXA 1R3DA 3R3UA 3A2LA 3PF9A 5AI4A 5IVIA 1LPAB 2OCLA 5IVHA 2IITA 2H1IA 1PV1A 1CQZA 1NX9A 3VJMA 4Y2PA 3V1LA 2HM7A 4X7BA 5ALTA 4RPCA 1JJIA 1QO7A 5D3ZA 5T4EA 3BWXA 3CCCA 5AK4A 2OGZA 4BAGA 1XRNA 1AX9A 4BCCA 4KYVA 4YPVA 1GXSA 1XFDA 4X97A 3KWJA 3N2ZB 4W1QA 3DYVA 4QWMA 2BGNA 3W9BA 4OB7A 2GBGA 3CCBA 3ZLVA 1DTEA 1MJ5A 2XUPA 3E0XA 2IIVA 1EXWA 2HU5A 1XRRA 1A8UA 2V96A 4UBLA 3WZMA 5CW2A 1J07A 5AM2A 4FLEA 1J1IA 1MX9A 3SWWA 3ANSA 1MNQA 4Y2VA 5AI8A 1E66A 5JD4A 3C6XA 3LIPA 3WKEA 4UPDA 1TCCA 3MUOA 1UOPA 3I2JA 1EVQA 3D0KA 3IULA 5K3CA 3L1HA 1FFBA 3PUHA 4FKBA 5ALJA 1BEEA 4ZGBA 2PBLA 1IVYA 1M33A 3F98A 2VJCA 5CT5A 5K3FA 2XUJA 2JBWA 3NGMA 5AP9A 3H1AA 1XRPA 2ZVDA 5KREA 4W1RA 1CUBA 2WSLA 1CEXA 3KSRA 2W6CX 2G63A 2ZJ6A 2XMCA 5AM0A 5DTIA 5AOBA 4KRXA 3T4UA 4M0FA 2HHAA 4RGYA 4FDMA 4B0PA 3ANTA 5JIBA 3QM1A 1AZWA 1HBJA 5KBYA 1CUFA 1W4LA 1Q0ZA 2PSJA 6YASA 3C5VA 3D4LA 4QDOA 5HF6A 2DQYA 4BAUA 3AZOA 4QDZA 3TEJA 4B80A 3CN9A 4ETWA 3KD2A 3WK5A 4DMKA 5C81A 4FLMA 2RGUA 3FYTA 4U2FA 3DL7A 3S8YA 2HA6A 4TGLA 4JYMA 4KE8A 4LHEA 2X8BA 4J0DA 2Z3ZA 1AKNA 1TAHA 4G4GA 3F67A 1JT2A 4W63A 1N8SA 2D0DA 5AK3A 1AC5A 4FLFA 1Z68A 3RLIA 5IVKA 1XRMA 2VAVA 1WCYA 2XQFA 1R50A 1SCKA 5F4ZA 3V1NA 1VXRA 3QPCA 1CUYA 4EUSA 4PF1A 2FUKA 2WFLA 1F0PA 3G9TA 4B9AA 5ALNA 3EIOA 4RE6A 2AJ8A 3EBLA 5FXMA 3V48A 4L9AA 3C6ZA 1DT3A 4QDUA 4Y2UA 2CB9A 5AOAA 5CH3A 1WB4A 1XKLA 4HXEB 1BN7A 4ZV7A 5C8XA 4BE9A 1ZGBA 2RHWA 3A2MA 1VKHA 2XUAA 4QEKA 3A70A 3E1GA 2CJPA 2H7XA 1ZD4A 5H3HA 1C4XA 3FWHA 3QBJA 4MWTA 3C6YA 1XZLA 3H18A 3STWA 1L7QA 5SYNA 4BCDA 2PKYX 4G4IA 5AKLA 3PICA 5FPPA 3STVA 3F97A 3HSSA 1YAJA 4FNMA 1B41A 3NUZA 3HRHA 4KAFA 4QA9A 2QJWA 3QH4A 2DQZA 2VT6A 4DSAA 3WK8A 5I9IA 2ROQA 3LLCA 3ZV7A 1XLVA 5I8PA 2AJBA 3G0IA 3WK4A 3IA2A 3WKBA 5YASA 1MN6A 1CUEA 2VT7A 4KEAA 5LP1A 5EHXA 2C0QA 4GI1A 4EY7A 5LIPA 1EI9A 1YB6A 3STYA 2HA7A 4FTWA 2WM2A 2XLBA 2JEYA 4AN1A 1EH5A 1LZLA 5AKXA 5JAHA 2WFLB 5D7BA 2HDWA 4NS4A 2RONA 4UBKA 3DKRA 4KJXA 1BCRA 4I3FA 3PDCA 1P0IA 1XRQA 5FDFA 3WMRA 3M82A 4WCVA 1K8QA 1XZCA 2C4HA 1ISPA 4ARAA 2JIDA 4OYYA 2ZJFA 5AKGA 3YASA 3WYNA 1EDBA 1LZKA 3MVEA 2IX9A 1XZKA 4GLBA 4B85A 1XZHA 2WG1A 2I78A 3CN7A 1CUDA 5AIBA 2OQIA 2WTNA 4MYSA 3DLTA 3ESDA 4N8SA 3DS8A 1BS9A 3EF3A 5EHNA 3BDIA 1H2WA 4C6HA 2B61A 4G1FA 4BCBA 5CBKA 5ISMA 1R88A 5AHXA 4TPKA 4KRYA 1EDEA 3UMJA 1CRLA 5T4BA 3RKSA 4Y2RA 2DFPA 5ALMA 1YS2X 3AZQA 4Y2SA 1TQHA 4BZWA 2FJ0A 1N1MA 1P0MA 1I6WA 3O9VA 1YA8A 5LZ7A 3WKAA 3C70A 4JUIA 4EZIA 3WIOA 4PSUA 4E46A 4BTVA 2QS9A 4H7IA 2OXEA 3GELA 2PPLA 4X6UA 2D5LA 1OILA 2PUJA 3WJ2A 1BE0A 5ALSA 3HXKA 1ACLA 1GGVA 4J0HA 4X6YA 2AJLI 4H7KA 1UZAA 3WWPA 2WUEA 1CUJA 5AKZA 3W05A 1E8DA 1F8UA 3V9AA 5AKJA 5AH0A 4EHBA 2C7BA 2V9ZA 1QGED 3WKDA 4DIUA 4QNNA 3ZLTA 1BN6A 5C7YA 4GDMA 2WHPB 5LLSA 3K6KA 1GPNA 2WU4A 1VE6A 4BYMA 2HADA 5EIHA 1X70A 1MTZA 4CI9A 3H17A 3TJMA 3C5WP 7YASA 1TCBA 1QJ4A 3WLAA 1WOMA 3G02A 1EB9A 3HEAA 1R9MA 4N5HX 4OU5A 2WILA 4MYDA 3KXPA 4HTAA 2RIPA 1W6RA 5T4HA 5FOQA 5BWBA 5ALOA 5E2IA 5AK5A 3BXPA 3RM3A 1PFQA 2RI6A 4ITVA 4G9EA 3DL4A 2WJ3A 3WL7A 5FV4A 4OB8A 4F21A 3RK4A 4J03A 3ESBA 3QZUA 4CFSA 5JD5A 1KU6A 5JZ9A 1NU6A 1ODSA 1QLWA 1GKKA 1UK9A 3V1KA 4LYEA 2NW6A 2PSHA 2GYUA 4ZREA 4DNFA 1YR2A 1VE7A 1CQWA 4NMWA 5AI0A 1QIMA 1Q84A 1ZD2P 4ARBA 4CG3A 1W1IA 2OAEA 3HLKA 3FYUB 1R1DA 1Y7HA 3DDUA 5A6VA 2GYWA 1LLFA 5FP0A 2K2QB 5AO9A 3WKCA 3G0GA 4BVLA 5CT6A 5AIAA 3WK6A 3BF8A 2QUBA 2X5XA 5JANA 5D6OA 4WY8A 3PE6A 4GW3A 1XQVA 2Z5GA 3D5EA 5JAUA 5AI6A 1CUHA 1Q0RA 4XIIA 5JAPA 2JGEA 3RARA 2XQKA 5LKAA 1DU4A 2WG2A 2VEOA 1AMNA 4C01A 3TGLA 2W22A 4MWSA 4UFOA 1HPLA 4WJLA 4CCYA 2WIKA 3C43A 4OU4A 4WDQA 5AKYA 1XZAA 4JH0A 2YH2A 3DYIA 1U8EA 3ILSA 1DQZA 3P2MA 4MJ3A 5CT9A 1F0NA 1GQSA 1Y37A 1OCEA 2BKLA 5CURA 3IDAA 3I28A 3WWEA 3AILA 1T2NA 5K3AA 3W9UA 5D3KA 4QE3A 1WPXA 4YK7A 3ESCA 1XZEA 1HL7A 1FFDA 1W76A 5C8ZA 1QZ3A 4UUQA 5ALDA 1TCAA 2O2IA 3FNBA 2O7RA 4C4ZA 4DNPA 1NU8A 5HK9A 4LXGA 2I3ZA 1JI3A 1XZMA 1ZOIA 2JGIA 4F5ZA 1YAHA 2WFMA 4G8CA 3O95A 4U2EA 2HRQA 3D2CA 3STXA 3H04A 2XUQA 4DGQA 3F8SA 1CUGA 3C6BA 2XI4A 2GBIA 2UZ0A 3U0VA 4U2GA 3EQ7A 1JMYA 1CUVA 5K5EA 5HF9A 1VZ3A 4UHFA 1UKCA 4EBBA 2WTMA 1YB7A 4OSEA 4PO3X 2WKWA 4WFKA 5CH5A 5DLPA 2C5FA 2VA9A 1VA5A 2GYVA 3H2JA 2HA2A 4AX4A 2V97A 4ZWNA 5HKAA 2HA3A 1QIHA 3FAKA 4Q82A 4IHAA 1RYYA 4QLOA 3F96A 3C8DA 2WIFA 2HU8A 3VJLA 2HA4A 1ZD3A 1TRHA 3L1JA 4BRSA 1VLQA 5AK6A 1QIEA 1SC9A 4Y2QA 3BDVA 4BATA 2WUDA 4G8BA 3GROA 4PW0A 2J3QA 2ZYSA 2HIHA 2WJ4A 3GFFA 4FNGA 3W2TA 1AGYA 4W1SA 2QOEA 4CIBA 2PL5A 4BVKA 1X2BA 1CUWA 1QIDA 1WHSA 1E5TA 5A2GA 5BOVA 3I2FA 2BCEA 1QOZA 5EGNA 4FMPA 3M81A 3FLBA 4YX9A 2VF2A 1CUXA 2JGFA 4ZXFA 2FJPA 3U1TA 1YASA 1O6GA 4YASA 4ZRDA 4OB6A 4XX1A 4J0GA 4HXGA 4BP9A 4BBZA 1UK6A 4JEIA 5ALYA 3FVRA 4OCZA 4KR0A 4AXBA 1YS1X 3OURA 1ZJ4A 4J0IA 1OXMA 3H2IA 3WWCA 5AKEA 3M3DA 4Z49A 5K3FB 1EK2A 3W06A 3HI4A 5AOCA 4J3JA 2QR5A 4IQ4A 3I6ZA 4Y2YA 1ETHA 1QONA 1HQDA 2HL6A 1IZ7A 1UOOA 1XKTA 3C87A 4Y9SA 5ALXA 2LIPA 4H77A 1VOTA 3G0DA 4FBLA 2XQIA 3TRDA 3IUQA 1U65A 4K6KA 1MU0A 4P9NA 1T4MA 1CUZA 5FKJA 4B0OA 2PSDA 1LNSA 4KAJA 2Y2VA 1U2EA 2WIDA 3B12A 2ONCA 3DKKA 4Y2JA 3R3WA 2H9YA 1UFOA 4FOLA 1S8OA 1XZIA 4X94A 1JJFA 2ZYHA 5E4JA 5AM4A 4BB0A 2HFJA 4U2DA 4U2BA 3O4IA 4J0JA 2QT9A 5EIEA 2O2HA 1H2YA 4AMZA 5AI9A 4LYDA 5EI5A 1W52X 3I2KA 5LKRA 4IH1A 3QYJA 4S0XA 3O4HA 3EQ9A 3R3YA 3WA7A 2Y6VA 4FFVA 1CV2A 3AZPA 1G4HA 2B20A 1F6WA 4FFWA 1VZ2A 1ZGCA 2XDWA 4B9EA 2YYSA 5ESRA 4N5IX 2JEZA 1H22A 5HF5A 5ALEA 1E3QA 4AO8A 1H23A 3I2IA 3WK7A 4B7ZA 1LPSA 3GBSA 4H7DA 5ALFA 4AB1A 1ZICA 4PV7A 3ZI7A 4HZGA 4X92A 5A62A 5ALVA 2XMZA 2QKYA 3VXKA 2CMFA 2O2GA 1UKAA 4UBOA 1B6GA 3QMVA 1GZ7A 4MQMA 2XUHA 2C58A 3DD5A 2VTVA 2QVBA 3IBTA 3S2ZA 1ZIXA 5K3EA 5JADA 4H18A 1ORVA 3K2IA 3WYDA 4DYHA 1IUNA 5IH7A 2HFKA 4J0KA 1CVLA 5FRDA 4M0EA 1N5RA 3R3ZA 2RHTA 3WI7A 3PFBA 3JWEA 4PNZA 4KE6A 4HRXA 5HKBA 1AURA 1XQXA 1QIJA 4QDTA 1SFRA 2Z3WA 5DNUA 2XLCA 3SC2A 2WIJA 3GA7A 3ESAA 1A8QA 4L0CA 3DQZA 2BGRA 3WWOA 3O9MA 5HQ3A 2C0PA 2OPHA 4DM7A 3I1IA 3WA6A 1K4YA 1G66A 5E4YA 4DMFA 4UHDA 3OG9A 4BDTA 2OQVA 4FHZA 2V98A 3DOHA 4BC1A 2PX6A 1FSSA 1FFEA 3L1IA 4UBNA 2WLSA 5ALKA 3H2HA 3H2KA 4J7AA 3PUIA 2ZJ7A 2VATA 1DWQA 4EY4A 3CXUA 1QIGA 5DWDA 5IVDA 3G0BA 3WJ1A 3LIIA 2BAGA 1WM1A 5CRIA 1K5PA 1L7RA 3G0CA 1G5FA 1YSCA 5HFAA 1GPLA 3K9BA 1THTA 4BAZA 2Y6UA 4AZ0A 5AJHA 1QIIA 2XMRA 2CUTA 5JAOA 2VJDA 1XLUA 2H7CA 4HRYA 1A88A 3H0CA 3G9XA 5JD6A 4CG2A 3V1MA 4Q3OA 1H2XA 2R8BA 5HFNA 4C4YA 1Q83A 4P92A 3GUUA 3E3AA 1XZGA 2PSEA 1LPPA 4AMYA 3WWDA 3DCNA 2XMBA 1CUAA 1CFJA 5HQ3B 5ALHA 3ED1A 1CUUA 1QO9A 2EEPA 1W75A 2WJ6A 2Y1KA 5LZ9A 4B82A 4BTLA 3I1YA 2XMSA 3H1BA 1WB6A 5JYCA 3C45A 4N8EA 2RAUA 3VISA 5DYTA 1XZDA 1WPRA 4A16A 4EY6A 4D9JA 1EINA 2C5GA 2VSQA 4IO0A 1QTIA 1UXOA 1GT6A 1R4ZA 4UBJA 3FSGD 3WL6A 2GBFA 1CR6A 3FLAA 1BRTA 3G9ZA 4IH9A 4Q34A 1UOQA 2JF0A 5T4FA 1K63A 4WFJA 2WU3A 2HA0A 3C8HA 1TK3A 5CT4A 1MX1A 1YCDA 5LZ4A 4KE9A 4ZV9A 1DWPA 4QDXA 1UKBA 1ODTC 3AIKA 3NOXA 3VVMA 4WY5A 2WHQA 3FSGA 4LXIA 2Z8ZA 5LZ8A 4GECA 1JU3A 4K6GA 2QM0A 4M0MA 3I6MA 2JGKA 3O4JA 4GHWA 5K3BA 1XRLA 5EFZA 3EQ8A 4WDRA 5JARA 1LPMA 1DX6A 5KWJA 1ZI9A 2JGMA 1JJBA 3W04A 1QFSA 1D07A 5JASA 2EDCA 3DJYA 3NWOA 3ZWQA 4AO7A 5ALIA 1BROA 4MXDA 2CEKA 3ICVA 1FJ2A 3UUFA 1E89A 4I19A 5A7GA 2AJDA 5AICA 3R3VA 3AFIA 4MQLA 2VQ6A 4MEAA 4AN0A 1VJ5A 4H7JA 3H19A 4ROTA 3D2AA 3DOIA 4EY5A 5HCUA 4Y2TA 1EHYA 5FUMA 5JZSA 4CIAA 5AM3A 4NVRA 3FLEA 4XWGA 5A7FA 4C88A 2ZSIA 3R41A 2DCMA 1DT5A 2OCIA 1QIFA 4DNOA 4EB0A 1VA4A 2VJAA 1ZD5A 4OD0A 4Q05A 4BVJA 3OTQA 1Y7IA 2WUFA 2XMDA 2AXEA 4HAIA 2O7VA 3E4DA 2JGLA 3LCRA 4L3WA 3QPDA 4OPMA 4X71A 3WK9A 2QZPA 4HS9A 4N8DA 3BL8A 2XUKA 1CUCA 1EX9A 5ALRA 3FBWA 2WQZA 3G7NA 2I03A 4E15A 2XUIA 4CCYB 2Q0XA 3LP5A 3QITA 1MAHA 4B84A 1UWCA 3H2GA 5KWIA 3BIXA 4UBIA 1LPNA 3O0DA 3IIIA 4Q3KA 2XE4A 4QLAA 3KWFA 3MUNA 1MPXA 4E14A 5IKXA 1IUOA 3T52A 3X3HA 2G5TA 4HXFB 4DMHA 2YXPX 1GPKA 3PF8A 1E8NA 3IUJA 1FFCA 5ALGA 1JMKC 5LZ5A 2ZYRA 5A7HA 2HU7A 1RWQA 4ZI5A 2BUAA 1IUPA 2BUCA 3FVTA 4G9GA 1JFRA 4X00A 4E11A 5LYYA 5ALPA 2GZRA 3D59A 1J2EA 2ACEA 4BDSA 4INZA 4GXNA 1HKHA 1AQLA 5ALLA 2YASA 3BE8A 1EK1A 1RP1A 1UT6A 3STUA 3F9CA 5FLKA 1DQYA 3AJAA 4XJVA 2PVSA 2ECFA 4WFIA 3I2HA 3VDXA 1EA5A 4X85A 3JW8A 5CTAA 3A2NA 4PSDA 3DEAA 4J0CA 4HVTA 2B9VA 4FWBA 2QXTA 2P8SA 3O4GA 5AM5A 3VJKA 5CH8A 2EDAA 1P0PA 4CCWA 3D7RA 1QE3A 1KU0A 5CT8A 2Z8XA 3LS2A 2WHRA 4UHHA 4W1PA 2E3JA 4UFNA 2QXUA 4X90A 1AUOA 5DTJA 2X76A 3HACA 2GZSA 3G9UA 4Y2XA 3ZPXA 2CZQA 1JKMA 4B83A 2GBCA 3B5EA 3AUKA 1EB8A 1WHTA 4A5SA
chains in the Genus database with same CATH superfamily
3PQEA 1F12A 2RBKA 4XE5A 4B1FA 4RIGA 3OQOA 4ATNA 3CB4A 2IUEA 2Q46A 2YWDA 2IA5A 4JDPA 1W8DA 3PHGA 4TOIA 3RUPA 2YXLA 4RDHA 4CG1A 2Q1WA 3PG5A 4ZT6A 1VRWA 4B4OA 1M9NA 1Z6TA 2O3JA 2NUAB 2ALJA 1YFLA 1UBGA 1Z7EA 4E6PA 2HHJA 3SDBA 5AUNB 2O3UA 4I9NA 1D04A 2DULA 3LY8A 3QNWA 4NR0A 1MO6A 1WQ4A 1Z4LA 3LGSA 2CLEB 3PRHA 1KDYA 3H5LA 3HDVA 1N5JA 1RLOA 1XF9A 1YIAA 1W30A 1FYDA 4B6OA 5C8YA 1U2SA 3QXSA 4B87A 4D82A 1ODCA 2NZVG 4DUGA 3UMRA 2YXNA 1G42A 2XCLA 1FYWA 4K5QA 2R6AA 3GLGA 4LZJA 1A4UA 4IZ6A 5BXQC 2AW3A 1ZUHA 2MYUA 1P9NA 2WIGA 2DHCA 3DCIA 4NHEA 3ZHRA 2M9MA 4I50B 4F92B 1R6TA 2QSZA 3MTBA 2DE0X 3R8CA 4RVOA 1HNNA 2Y05A 3QF4A 4D1YA 1YCFA 1TM4E 3KZVA 2BSXA 4NFLA 3N2NA 5THQA 2CDBA 2VHVA 3I6QA 4B3RB 1NLFA 2XYQA 2Q6KA 4BN5A 1T2VA 5AFSA 4A8JC 2PKXA 2XUGA 4JJGA 4B71A 1L3BA 4OI1A 1G55A 1TT7A 5EIWA 3COWA 5LD2B 4KOAA 1SB8A 3QOYA 2QK4A 1A4IA 3ZGXA 3OESA 1T0JB 4FQ7A 4J4TA 2YFHA 4QGHA 1PZEA 5FOXA 2ECQA 1LI5A 1MX5A 1WV0A 4TKZA 2V5AA 3ZQKA 3EFHA 4BY9E 2OQ2A 3CNOA 4MYHA 1NVVQ 1ONOA 4KQ1A 2P75A 1XZJA 4MINA 4RK1A 2B34A 1E2HA 3N2YA 4OJTA 4BVGA 2YZGA 5ICCA 2O8DB 3AY7A 1KI8A 5SZKB 3DE6X 1ZI6A 4NDAA 1JYFA 1C8KA 2BGMA 2G5PA 2OHJA 1CP3A 1OLSA 3RTAA 3BTOA 4HNQA 5F7XA 2NXJA 4CLOA 1N75A 2GPSA 4H0CA 4AP6A 4LE2A 3ORYA 5FBVB 4G8JA 4BNTA 2XQJA 1FNDA 2VHUA 3ADKA 5FNVF 4A8PA 3AB8A 3D8BA 3AWDA 5SYAA 4EB6B 3COJA 4TWAA 4AAYA 2B92A 5BWMA 4GZLA 1T8YA 3VV2A 5IFLA 4ZQFA 3SHOA 3IUNA 4LQLA 4MPDA 3RVPA 1FDWA 2ZLBA 1FTNA 1JFTA 4WNIA 4G0UA 1U4NA 3HCDA 1IPFA 4TMKA 2YN2A 2XB2A 1KO1A 5ARDA 4RHFA 2MHCA 3ZD6A 2WI8A 1XVUA 2HNBA 2HQRA 4KIGA 5LIRA 5A9SB 3HXLA 2TMYA 2FR0A 4FI3F 4N12A 2R11A 1XRJA 4ZJUA 2HV8A 3I34X 3KDAA 4OFXA 3W3ZB 4MH0R 5AI5A 4YAGA 3IO5A 4LRXA 2R44A 3KT3A 2J9ZB 3I2GA 5ANRB 1RSZA 2QNBA 3TTVA 1UOEA 1WMBA 2BDUA 4Q48A 3BRWA 1L4YA 4U3JA 3NOVA 2QN3A 5K8JB 1VSBA 4BASA 1TTHA 3KXIA 3L0SA 4LDZA 1IVNA 2HIMA 2D00A 4RNCA 1KXJA 4LQDA 1M34E 1ONBA 4V2IA 5JH7A 5CB8A 1YQWA 3CRW1 2PGLA 2EGHA 2X9QA 4ER7A 1KYQA 4PYNA 3UMBA 2W58A 4FHGA 4QM7A 1XWIA 2LV8A 3Q0TA 5ALQA 1SC3A 4BKMA 4Z7JA 1WZEA 1W88A 2WT4A 3T6KA 4BWVA 4KVGA 3L5OA 1ZMRA 5C8YB 1GQRA 1X7WA 2B25A 5HUHA 2GLTA 2H9IA 3Q5GA 4GI3A 4ZYUA 1IHOA 5DM4A 5CK4A 4AKGA 3GLGB 3PT9A 1DMRA 1L7NA 1H2ZA 1MXFA 1VFPA 1K6EA 2JJ2D 4LKRA 4X3CA 4X20B 1YS7A 2P78A 2PUHA 5DULA 2ZI5A 4K40A 5LZ2A 4YNBA 5HGXA 1TYCA 1Z6XA 1N2ZA 2JIMA 3GRAA 4KNWA 1E0KA 1KYYA 4R5MA 4QZVA 2E85A 3R40A 4GEGA 1DWOA 2PYIA 5IBRA 5L4NA 3QA9A 5C9ZA 3G2NA 3MT7A 2AEJA 1PEYA 5AKKA 5E1DA 4D4KA 4IKOA 2PRYA 4KREA 1OWMA 3Q7IA 1P1BA 3QKRA 5K0ZA 2II6A 2JVIA 1FP2A 4BS9A 4MWZA 1JZSA 1CJMA 2PIDA 3D81A 4F1WA 5BPHA 5L6LB 3CUKA 1K8XB 3FETA 1PSDA 1I2BA 1YE3A 2IY9A 2Q1XA 2H5EA 4NBKA 3D2BA 3NRCA 3QKUA 4R7ZA 4FR5A 4BFZA 5ILOA 1IMOA 3SK0A 5ES4B 3ML1A 3O9ZA 1CS0A 5TMDA 4KQMA 4F9FA 5CXUA 1EP3B 2QP4A 2PL3A 3ITNA 3RHZA 2BMFA 2XADA 1L4KA 4D0GA 4FYYA 2JFHA 2OXRA 4YT5A 5CB4B 2XUOA 5TT1A 4IY1A 1RPNA 2RFLA 1E1QD 1OLSB 3DEIA 3JALA 4GWLA 2FG7C 1P7PA 4CLOB 2CN1A 2AVNA 1HM5A 4MV1A 4C7JA 1BMDA 5FUQA 5JWOA 3M83A 3A25A 4HUQB 4DEYA 3PQDA 4LIPD 3R0VA 1S1MA 3FB1A 2RC6A 3MS7A 3PUVA 1MC4A 4I9UA 1YNOA 4WKBA 5H83A 5KYGA 2WQ6A 1XNQB 4I36A 5K4HA 3DCJA 1CSEE 1NOJA 1QH8B 2J4CA 3VSCA 1BVYF 1QV7A 2JIBA 2D2VA 1WLSA 1V5WA 2BI4A 2ZT6A 3LHSA 3AFMA 3TNFA 4Z1MD 1VHQA 2VUSA 3EXEB 1Z15A 1T9ZA 2C3UA 2HWKA 1YK0A 4H7EA 1IZZA 4D8VA 3H5RA 2IC5A 3KTAB 4ND8B 1E79A 1NBMA 3OC0A 4F97A 2XB8A 4U7FA 1WUHS 1YZFA 1XYYA 4MICA 2VJBA 5JJCA 3D8RA 2FSPA 1LI4A 2CE7A 1ST3A 3O1LA 5IJ9A 1AKEA 3K71B 1KAGA 4U3JB 1N6HA 3AXTA 2FEXA 2CBZA 5DASA 5DO9A 4X91A 1GRQA 4FXPA 1VCOA 3K5PA 2WZDA 3QX8A 1KZ9A 2X86A 3FYUA 4H16A 2JFOA 3DFIA 4GG1A 3ZKWA 4B6QA 1F3OA 2B9EA 3JQCA 1K3UB 5DGDA 2GPYA 1LTHR 3KQHA 4QSMA 1GCAA 4FJ2A 4EHNA 3AIMA 3D3NA 1H94A 3RIHA 4TQ9A 2GD0A 2LXNA 3ZK8A 1YQUA 1PE0A 1J99A 1R2QA 2IXEA 4JBHA 4U7TB 5KAMA 3QBTA 3WZLA 2W98A 3OTOB 1X7WB 2YJNA 3LTNC 1KO4A 1QYRA 1H0HA 4GPEA 2QAGC 3MGCA 2J4FA 2UAGA 3BXZA 4US1R 1ZWKA 1BYUA 2I3DA 2ZWIA 1QHHA 1WUJS 2FRDC 3E7XA 3NASA 4R1LA 3RUCA 5A5EA 2F55A 3HTXA 4IL5A 3B3QA 5AW9A 5JALA 5K03A 3WWYA 1F0KA 3TDMA 4CEIA 1CFZA 2CFCA 2UVPB 1V6CA 3FUCA 2GDZA 1G1MA 5BVHA 1KMMA 1W46A 5CFZA 4YMSA 1KMNA 3ETGA 2WTEA 3L18A 2PS9A 2NIPA 3FBGA 3DM5A 3GR6A 3T3IA 2AL7A 4QG7A 2ECPA 1QH1B 4UTOA 4ZQCB 3PUKA 4G0ZA 5M5BA 4TYQA 1DKRA 1BD3A 4V0OA 1LBSA 1OBCA 4LWOA 4NNPA 2Q2NA 3IUMA 1ZC3A 3GLHA 1ICEA 4GOJA 2C9ZA 4G3XA 4FCTA 4KQXA 4FX5A 1B8PA 2JAHA 2BFNA 3HYTA 3TWOA 3EW7A 4LJAA 1GCGA 1IXKA 4ZHQB 5G0WA 2ZZNA 3QVOA 4FOTA 3H8VA 4FFRA 3A6ZA 1TTQB 1PCXA 2BLLA 1VBFA 4D3FA 1GAEO 2VOJA 4TYNA 4GRAA 1LVUA 4FFMA 3SJBA 4D96A 4EVRA 2C00A 1U3DA 4UHEA 2Q1YA 1P2UA 3JALB 1F17A 3E9ZA 3HL4A 1DZ3A 4WOPA 5KC8A 1N32B 1QG2A 5JJLA 1GGMA 1XMXA 4G01B 5HZMA 1P31A 4QX6A 3VYRB 1MT3A 3O8QB 2A6PA 1PIWA 4UD2A 2Q45A 3I9JA 1WULS 3GZJA 3OIFA 1X3LA 2ZDGA 3NONA 2QUAA 2PUGA 1ISJA 2D3WA 4B81A 3ZXIA 2Y3IA 3S29A 4BJHB 3A3YA 4Q02A 1EJ0A 3R5SA 4RKQA 1NMSA 3ZW8A 2KSQA 4EENA 2ZDHA 2Q4EA 1Q3KA 4MEBA 5JXHA 3IXLA 5ENZA 3MLEA 4Q7KA 3EGDB 2B1JA 3OCYA 3RV3A 4GXTA 1YA4A 3BJMA 3TLGA 2RARA 2OCGA 4K2AA 3U60B 4FHDA 4BFWA 4IV0A 1NF9A 4RO0A 4ZQIA 4BNXA 4YR7A 1UINA 3IQDB 1IATA 1VYTA 5G0VA 3C85A 3V00A 4LX8A 2RC5A 2AF3C 4XB2A 4BMVA 3K5HA 2WVHA 3BWBA 4HP8A 5LA6A 3V7NA 3BBPA 1YB4A 1P3JA 4L0QA 2JGDA 4D7AA 4HZUB 1BU8A 1LB1B 4AYTA 4B3GA 4LX0A 2DLDA 1NRJB 3AEZA 5JSFA 4KUHA 3VTKA 1O5OA 5FR2A 3R0JA 4CEJA 1NR1A 3KS9A 2O19A 3C8UA 3ZKWB 4CM8B 4GE3A 1MNAA 5IJZA 1Q0HA 2W6PA 1THZA 1JKXA 3MGAA 3TK1A 4TTIA 4ALKA 4IJWA 3TB6A 1WG8A 3AHEA 4RSGA 3ZGZA 3D6FA 1IHYA 1F8FA 1HTWA 2G71A 3W7VA 3Q8WA 1CIPA 1GUFA 3CBGA 4JWKA 7MDHA 1N2CE 2DTXA 1EWVA 2XMGA 4HLUC 3DG9A 4RE5A 3H87A 1FRNA 3OM9A 2JLXA 2BSQA 4AZ0B 1FLNA 2QRUA 4MUKA 2B4KA 3C1UA 3OZAA 1QHHB 4GBGA 2RGNC 1P61B 6REQA 4CEIB 3CR8A 3R7AA 3PWZA 1R3DA 2RKBA 3R3UA 1N5LA 2PTHA 4NBSA 3Q3CA 4TTVA 1DL5A 3SKYA 2R8ZA 1Z25A 3KYDA 4YRAA 2P5SA 5F23A 5PNTA 4QVIA 3K4HA 2H2DA 3A1NA 5EQTA 3SLGA 3ZJUA 4MVJG 1PV1A 1CQZA 2FWNA 1Y7LA 4YR9A 4OG2A 4ZTBA 5IKOA 4ENTA 1MH1A 4F11A 4EYGA 1JR6A 4R16A 2G9VA 3PCRB 3JR3A 1IBLB 5SY6A 2VPXA 4NCKA 5EZYA 3DVQX 3VZSA 4EZEA 1LNZA 3E3LA 4D81A 5CFRA 3LVQE 3C3WA 1ZGHA 2O3QA 3KPJA 4F2WA 4P6VF 1M74A 1FUUA 5BSWA 5GVSA 3KZCA 2C8JA 3OJLA 4FOSA 4G4SO 3MLBA 2L19A 4JIGA 1Q1ZA 1RADA 3E9CA 2C77A 3PRJA 1GAXA 2B7LA 2QVYX 3F0TA 3H86A 4JOCA 4XQCA 2VUUA 2OXCA 3KJHA 3BGDA 3DOCA 3I6BA 2GJ9A 4PR0A 4XFKA 4BCCA 2AOTA 4IICA 2DFDA 3VYTB 5FUYA 1BXZA 1Q0QA 1ZUD1 2GEBA 2GUWA 4JT2A 4R1SA 1DCTA 2AMFA 2J0UA 1GTL1 1H4TA 1XFDA 2OHXA 4J7CA 5EJMA 4AVYA 1P72A 4FE4A 2VF4X 3PD0A 4EPYA 3U9SA 3ZQUA 1E4EA 5J59A 2WQ7A 4U00A 4WI1A 2AE1A 2O2ZA 1GY8A 2GFQA 3CF4A 4MRRA 4I5EA 4RU1A 5E6UA 2RE8A 2FMXA 5DEOA 4IHJF 2ISQA 3UXHA 4RA9B 4W1QA 6PFKA 1RM5A 3QXJA 4DHEA 3AIIA 1S2GA 2Y0BA 1C30A 4R9UC 4UTZA 4ZYYA 3W9BA 4YJ2F 2V6FA 4B09A 2D4AA 2NU7B 3GVCA 3M7IA 1H8ED 1ACMA 5GZ6A 3CZRA 3VM6A 5IT9A 4XYLA 1HFJA 3GDFA 1YQDA 1HMYA 1ZA1A 2CDRA 1SULA 2A5DA 4FMBB 4MI9A 4PGGA 3TM5A 3BDAA 1JPUA 1MJ5A 3JRXA 2ZSUA 3TNJA 3CLKA 1MOSA 2B5OA 3S2FA 2PUWA 1W5SA 4CEHB 4O4IF 5DBHX 1PX2A 2YDYA 1K86A 4S2UA 4TLMB 1OH6A 1G60A 1I5EA 2QT0A 1LBEA 2GTPA 3FXAA 4IMJB 5IAEA 1U5AA 1O97D 2HU5A 1IHDA 1NP7A 1R4NB 2M1XA 3B85A 2K5UA 3E9NA 4JXKA 4MVJH 5ER9A 3U0BA 4YI3A 2F1KA 2ZQZA 5LM3A 4BFXA 2CFSA 4FCVA 3E8XA 2X8JA 3WI7A 1ZCBA 5AMXA 5SZHB 3FGNA 1TF5A 3AP3A 4BX0A 4Q7EA 5SY9A 8MHTA 1E1NA 2RCNA 2Y8EA 3GC6A 4TS9A 4ZYTA 4B2YA 4QUKA 1NQVA 4H3VA 5EE9A 2ZBVA 4S1NA 5AI8A 1GGNA 3ISTA 4O4LA 1HR0B 5EKDA 1MX3A 5JD4A 2B2XA 4EYEA 3I3OA 1CNFA 1U9CA 3LIPA 4UPDA 1VCMA 2PVPA 3K1YA 2G17A 3MUOA 4MLZA 1YA6A 1UOPA 3R0IA 4C08A 4CPDA 6REQB 1EVQA 2ZJ5A 3AVUA 1E18A 1JTVA 3TW8A 1PHPA 5G53C 1F2DA 2Y1FA 1LNQA 4ZALA 4A0FA 5D87A 4B17A 5IDWA 1Q3HA 2EQBA 3BK7A 4EQ6A 3DFKA 4W8OA 4BNLA 2QN7A 1AQYA 1DJLA 2UUPA 3LCVB 4J2OA 4FKBA 3KYDB 3EVBA 4HZIA 5FTKA 3ELUA 3QHPA 1WS6A 4PS1A 1H2BA 1T5HX 4PGMA 2VNSA 3OH8A 4HGYA 5EMKA 1AG9A 1M33A 4RIIA 4GLOA 3MXTA 2VJCA 2WYIA 2J4DA 5EZYB 4XSVA 1X13A 1T5TA 5HKOA 3NGMA 3SSMA 4DWWA 3A2KA 5AP9A 3A0UA 3VA7A 2QN1A 3QTLA 1DJPA 1S2MA 4MYRA 3GPCA 4HH4A 2QL7A 1JBKA 2ERXA 1YZHA 3C4QA 4G0NA 3HUTA 1KAOA 5IAOA 5KREA 4DLUA 4XIJA 3UT0A 1CUBA 1Z2CA 2QM3A 2WSLA 5BW8A 2QYHA 3CPJB 1FY2A 1DAIA 4XB6B 4RTNA 1TO6A 2Q4RA 4AXXA 2VT3A 3UAZA 1D1PA 1R12A 3LJKA 1WMAA 4UDOA 2XMCA 4YDHB 5DTIA 1FFXB 1EUDA 3BD7A 1RKUA 4FS3A 5GVRA 5BN4B 4K28A 4HKTA 3PDUA 1CQXA 3DM9B 1E4EB 2GXSA 1XAHA 4N6OA 1CJKC 1Z0JA 2XOKA 4RGYA 1T4CA 3IAS6 4IOKA 1QVVA 1VDZA 1LDBA 2ORVA 2EKZA 3MWEB 4B0PA 5FDFA 3CKMA 5JIBA 5AXDA 1BTOA 1YI1A 2G0NA 1C30B 1Z33A 3RYTC 3CC8A 5KBYA 1SPBS 1OXXK 5DBIA 2DC1A 3E58A 2NU6A 1W4LA 2VDVE 3NBFA 4BNKA 2XBMA 5HG0A 2GK3A 2PSJA 2MSCB 1V8FA 1C2TA 2D06A 3P32A 4TX1A 1T9BA 3VPCA 6YASA 1ZH0A 4Q01A 3Q87B 4UEOA 1YBFA 2DQYA 3RHTA 1UODA 2IE0A 4GPD1 4BAUA 4D92A 4ECEA 2FMUA 2RJNA 3NTXA 1XVIA 1SKQA 4DZRA 2VXYA 3E9EA 5TR9A 3PP8A 3TEJA 1EQ2A 1JZTA 2R8RA 1UH5A 3WQSB 2D59A 4ZOQI 3X1ZA 1XALA 3L7CA 4B80A 3ODPA 1PR3A 1G9TA 3FUUA 3EY4A 2X8JB 3S2EA 5C81A 2R66A 1JW9B 3H8JA 4FLMA 4XYBA 3FYTA 3W4IA 1L8LA 1NE7A 1O6BA 2WW8A 1XIVA 2GO1A 5F76A 2HA6A 4X65B 4Y18A 3SC6A 1DRVA 4JYMA 2FQXA 2GUGA 4TVSA 1U3TA 2JBHA 3NT4A 3ZNPA 1J4AA 1NUAA 3OZFA 4MO2A 1YFZA 4PC2A 1T9AA 3I05A 2B2NA 4IUCS 5AJWA 3Q3VA 4KPEC 3F67A 3DYBA 5FT9A 3TW8B 4W63A 5DM60 2C2MA 4KTTE 1DJQA 4I9FA 3SZUA 3EIEA 3RAEC 1MF7A 1HEIA 1AC5A 2Y0CA 4CUJA 1BFDA 2O9JA 4BKUA 1UT8A 1WUKS 3GT0A 1P19A 4J16C 3RLIA 4D74A 2EP5A 2V7EA 1DOAA 2O0JA 3BD9A 3O73A 4JR2A 2VAVA 2K7FA 4A15A 4GGPA 1MQ8B 1RKBA 1JALA 3DW3X 3A14A 4GPAA 5B3AA 3ZDQA 5KHOC 1U5BA 3GOQA 3GF4A 2DGDA 3HLYA 3ANXA 1VXRA 1YMUA 9ATCA 3MUEA 1RZVA 1HA3A 3FY4A 3ACBA 4AT1A 5JJ5A 1E2GA 4A7PA 4OO3A 5ER6A 1CUYA 3O8BA 4N5NA 3ASVA 4EELA 1Q0LA 2YY7A 4NHOA 4PF1A 3RVQA 4C14A 1Q22A 3G79A 4CWAA 3G9TA 3UKJA 3JARA 3LWZA 4K05A 4GO1A 1FBTA 2FFAA 3MPUA 1I32A 2AJ8A 4HH1A 2R7AA 4UMVA 4AUMA 4ZRNA 4U7GA 4R0NA 1KZ1A 3C6ZA 1DT3A 1W5EA 1SA0A 2CB9A 2R4UA 3IT1A 5DGIA 1EUDB 4JBNA 2EHJA 3FSEA 1V1MA 3CLSD 4L22A 2AOWA 1OLUA 3FNHA 4JLJA 1DNPA 1U7HA 4ZV7A 1J22A 3L8HA 4LJ4A 2QI9F 3JQ7A 5CXSA 2LWIA 1TPZA 4JVMA 1FYXA 4KHZA 5K0NA 4ZK6A 4ZMBA 4U9IS 5FL3A 2W5UA 3A2MA 4DPLA 4JJEA 2WWGA 3H84A 5FUWA 2Z5VA 5SZJA 2V03A 4ZICA 4N3AA 4PE5B 2CJPA 4A6DA 2NU6B 3HCCA 1IJKA 3AMVA 3M70A 4DSOA 2ZUEA 2NSHA 4AZWA 1ZD4A 5TPWA 3T7IA 2JARA 4Q1DA 3MJCA 3C7TA 5H3HA 1C4XA 1DTWA 2A5JA 2Q9AA 2YV2A 5KDOA 4PZ9A 1E6KA 3N2LA 3ZV3A 4ERNA 3OTIA 2FPPA 3LD9A 5HCNA 3C6YA 1EXDA 3FCSB 2ZJ2A 1L7MA 2FSVA 2OE2A 2Q8QA 1KI9A 1OY1A 1XJ5A 3M0EA 4JP3A 3JXEA 2RHGB 4K03A 5DLEA 4WIAA 5SYNA 3WVNA 3DHWC 4G4IA 4UUPA 5AVYA 3HRKA 5BW6B 2CLHB 1X39A 3PICA 2DQKA 3ER6A 4NBUA 4YJHB 3SC3A 3WRWA 1K6JA 2NM0A 3JPYA 1RWWA 5T7BA 2OO5A 4JX9A 2IELA 4Q1BA 1KI4A 3N2KA 1YAJA 5HQJA 4U9UA 2WF8A 3VPSA 4YMHA 4UUAA 4F3NA 1B41A 4ILKA 3INNA 4JSTA 1TYAE 3GJRA 4KAFA 3DUFB 4YDSA 2YJ5A 3F3MA 4KFUA 2DM6A 1E3TA 2D1YA 5CNMA 4BFYA 3OX2A 4D41A 3K70C 3P9RA 4DCGA 4KFRA 4Y6PA 3ZCVA 1R15A 1ZINA 3D6MA 1Q2XA 2VT6A 3EIUA 4D3DA 1EIZA 3F2IA 3ABRB 4HG2A 1ZM3A 1SQ5A 3ZV7A 2WJIA 1W4AA 4CXMA 1B3BA 4ZYWA 2NADA 5E38A 3MWDA 1KSHA 4B3FX 5I8PA 1AT1A 1AGRA 5GIPE 1XNHA 3N7UA 1XSEA 3D8UA 2CXRA 2J09A 4G84A 3HCBA 4MQEA 3HU2A 1AK2A 2HBQA 5EN4A 3VBCA 1YGYA 3F4LA 4EA9A 5MGNA 3GZ4A 4KEAA 3DCYA 3W90A 2XW6A 5B4VA 3H2YA 1G1AA 4YRQA 3T4EA 4OFZA 1I6KA 1U0EA 4KYUA 3L1UA 3CZAA 4OLAA 4NYIR 5KKCA 2CNOA 3JY6A 4XXHA 5DNAA 2AEFA 4QNRA 1G5TA 1NQOA 6GPBA 2WM2A 4OLHA 3SM9A 1J33A 4EKYA 5JNVA 2LKDA 1LZLA 1D4OA 1P45A 3PB3A 2LKCA 1R6AA 1DKUA 1N1GA 1XDGA 4LXYA 1NW7A 3S28A 3WGMA 3ZE8A 1E3JA 3DOOA 1MQSA 3JARB 2FFBA 1E1KA 2PWPA 2SCUA 4LOJA 1K6IA 2HDWA 3TL3A 1N0UA 2AMVA 4A4DA 4BU1A 1RCUA 1DX9A 4PX5A 4JBYA 5E9JA 5F1OA 5IC6A 1JEYB 1I0LA 4UBKA 3RVRA 2OEPA 4A8JB 3DKRA 5DGXA 4K86A 1RPZA 2ZAMA 4HSGA 4YUYA 1ZCFA 1SA0B 3EBPA 2ZRPA 1OMOA 1XZCA 1ISPA 1JR4A 1RW4A 1WA5A 1V1MB 3MF4A 2BOVA 4A2QA 1RAAA 4PICA 2DH5A 3NRJA 3TNLA 3RRYA 1O0BA 1OA0A 5G41A 3JQ7B 3C7KA 1R27A 4O02B 4LZPA 1U0TA 1LZKA 3Q0IA 1IIBA 5HA5A 4MYTA 1AQNA 3GW8A 2FR1A 3KSAC 1ZK2A 3IAEA 4KSBA 4EX7A 2W2MA 3NC1C 2MSLA 5FNVA 4M8SA 2PFGA 5LMUB 1T4BA 1XZHA 3OX3A 4HEQA 3CMCO 3A1DA 1GL9B 1IY9A 5TQJA 1RC0A 3U4HA 4JD5A 4DL9A 2WG1A 4PX2A 4XFDA 2ZS9A 5TPWB 4AKEA 2RHMA 1MB2A 3DOFA 2ZR7A 3NNDA 3PWTA 3FPAA 4M87A 1I4WA 1DTWB 3KR9A 3U48A 4D9GA 3RREA 3HFJA 3T1NA 4JLNA 5C4GB 3DLTA 2GPBA 1LDEA 1B76A 2YMPA 1OX6A 5JBQA 1GEEA 1KIAA 2IGTA 3H5NA 3DS8A 2WSYB 3EDRA 4YXFA 4L8FA 1ADGA 3ZGYA 4ARVA 4EDFA 2HU2A 2CV0A 5G4KA 5EHNA 1SG0A 1JDJA 1VMEA 2X23A 3TL6A 4PIMA 3ZHZA 4O2LA 1JHRA 3KJZA 3VKHA 1QM5A 4JKYA 3V32A 4HMPA 5LFAA 2B61A 4JP1A 1B0PA 3KPWA 1IEVA 2E49A 3C4JA 3MJ4A 3KB6A 4FZ3A 5BSTA 5FA6A 2ODTX 3K0AA 3D02A 3LX8A 5CBKA 1BDHA 3N2KB 3DMTC 3I8OA 3HVKA 2XKJE 3OCCA 4DR6B 3KC2A 2GXAA 1AK1A 1UPAA 3FVQA 4BHTA 1PG2A 1RI4A 1E0SA 3KZMA 4WLVA 2DB3A 4DDHA 3GG2A 1CRLA 2BFCB 3RKSA 3TLYA 3RSSA 2WM9B 2DQSA 4XYEA 1U1CA 2XGJA 2JJMA 1K8ZB 1SXJD 5ESXA 1Z83A 1YHZA 3ROFA 2I6UA 5JU6A 1S2NA 2AXQA 4Y2RA 5C31A 3Q10A 2P1DA 3QE0A 3MWDB 1G17A 1Q44A 2DECA 4RADA 2A9FA 5ALMA 4OBEA 1E64A 1U3WA 5A04A 2WWRA 1GTVA 2YVKA 3AR3A 3LDGA 4YRNA 4QULA 1HDOA 1JDSA 4R8KA 2HQ1A 4DZZA 2IFTA 1R6XA 4BZWA 4LMPA 1P0MA 5KVSA 5HIKA 3R5KA 3QUTA 5C1IA 3O9VA 1BCSB 1NIPA 2X2FA 1UBKS 2YJ4A 9MHTA 4FWIB 4ZVSA 1R0BA 3ZX5A 4DLZA 2VF8A 2BGWA 1EGHA 5JR3A 1H2EA 5KTKA 3G5UA 4K0RA 3P71T 1UP7A 1U7ZA 4XCVA 2AFIA 2VZLA 3S2SA 3ZWAA 4H7IA 5CFLA 1PD1A 4IDEA 1O9BA 3DFFA 4P53A 1X86B 5FLEX 3T0GA 1DGQA 4CKCA 1JJAA 2YNMC 3FTPA 3NBZC 2R1VB 1P7YA 3V8NA 1SGWA 3IQIX 4HAZA 4C0SA 5KS2A 3FJ1A 1TCUA 4GMXA 2PGDA 2X1HA 4BTEA 5ALSA 3Q88A 1UDXA 1QCDA 4BEBA 5KNCH 1KR5A 1ACLA 2P90A 4EJ0A 1VLMA 4J0HA 2AJLI 1IQ0A 4X6YA 4DF3A 1XGKA 3GRPA 4YUAA 1QS0A 3IT0A 5K2OA 1DEOA 1G5PA 3QV1A 5FH9A 1PZGA 1TECE 2B6NA 3RASA 3NHSA 1JR3D 1VSQA 2I6TA 2C82A 3K1TA 3UK0A 4EM6A 1OSNA 4OGGA 4XUCA 2ASVA 3H2ZA 5CAEA 3GUVA 3U5TA 1NVVR 2B8WA 2HPZA 2HN9A 2ZTVA 2C9CA 5EUBA 4DE5A 3W05A 2FSFA 2Z1MA 3ZZMA 1I5RA 5CNKA 5GGYA 2O7SA 2LNDA 1QVAA 1PZMA 1JS1X 2OWEA 3HUEA 4OQEA 5T5QA 5AKJA 1PNVA 5AH0A 3HDHA 4CIVA 2ID9A 1RQPA 2BN4A 2V9ZA 1QGED 1OFTA 3BE5A 3FHCB 3P2YA 4HLQB 4R3NA 4U63A 3WKDA 1BMFA 1JDBC 1P1JA 4X66B 2N42A 3ZLTA 4H6WA 1HQKA 5HIIA 3DFMA 3U2QA 3W9YA 4EMTA 4FDLA 3BBLA 3JWJA 5FEMA 3WLQA 2JLUA 2WY2D 3FSJX 2JIZA 2PS0A 2IRWA 1QG6A 2FOIA 1ZUWA 4KIWA 2OVBA 3K6KA 4DMUB 4G85A 1VE6A 3PPYA 4TWJA 3TOXA 4GLJA 4BYMA 4R0MA 1G8KA 2WYWA 4HWTA 4AD8A 2GJAA 2HADA 3G68A 1QG0A 2A58A 2OB2A 1XTTA 1F14A 3CUEF 4UZEA 1VLVA 1K8YB 1MTZA 2HRZA 4NSNA 3TJMA 1UMDB 3DP9A 3QU7A 4CLRA 5FHQA 2KYRA 1JPNA 2BFDA 3C5WP 3HGTA 3LUHA 4QOIA 7YASA 3CUWA 1OX5A 5K6RA 2GARA 1TCBA 1ULZA 2J5QA 5FPKA 4O59O 1OVGA 1B0UA 1QJ4A 3DE5X 3WLAA 1N9KA 3HEAA 4NU5A 3EMVA 1TQ6A 2WILA 4FYVA 4JJZA 2C04A 4HTAA 2W2KA 1I6LA 1W6RA 3L84A 1T1RA 1T36A 5CITA 1FU7A 2FEMA 2RGXA 3G82C 2IP4A 2I1WA 1ZG3A 3NKVA 3ACCA 3RM3A 1YL6A 3R77A 3KYJB 4MPRA 3AFOA 4AULA 2HBZA 4X6LA 2JLBA 4G9EA 2I1QA 5FV4A 3RK4A 1Z8HA 4MA5A 4B3IA 4E2ZA 2JLRA 2P6RA 1KPHA 4CFSA 3BZWA 2VP3A 3NLLA 3NV7A 4FXOA 1KU6A 1OBHA 2CLKB 4MR7A 3CRVA 2QAGB 4IIYA 4CDRA 4NATA 3GK3A 4RC9A 3WRYC 1DRKA 1PQYA 2I91A 3NT5A 3DL2A 3FDIA 1Z2DA 3QPVA 1KDZA 1ODSA 1WMSA 3L8FA 3KAPA 3FAZA 3SG0A 3U7QA 5JNSA 1KP9A 4JU8A 2DG2A 3V1KA 2NNLD 2PUBA 4FEGA 3WGOA 2B7BA 4LYEA 4KXNA 2C88A 3FFBA 2JCYA 2NZJA 4R1NA 1EFCA 2NW6A 2C83A 2PSHA 1QK3A 5BV8A 1YZQA 3U1BA 4GQAA 4CKCB 3KUXA 4ZREA 1XTKA 2DSTA 5KVQA 5LQRA 3K8QA 2PJUA 3P20A 2HRCA 2O2EA 1YR2A 4ZAZA 2OENG 5KYVA 2E6UX 4Z3DA 3MFQA 2QRNA 5BSUA 5TQ0B 4NMWA 2PZJA 1TYEB 4Q39A 1LVGA 1QIMA 1QKKA 4ARUA 1M7HA 5ES3A 2WSSD 3BB3A 4TQUS 4B3JA 3T7CA 3UXYA 4ER3A 3VJRA 1LWOA 3VPGA 1R1DA 1QS0B 2HO5A 4QATA 4DLWA 1VYVA 1A27A 3DDUA 4JQYA 16PKA 3B82A 5AW7A 5JSQA 2GYWA 4QPDA 2ZRMA 4RETA 4Q00A 4YCNA 4EVSA 1B73A 5FP0A 3ZQ4A 5JFGA 1NSFA 2JCVA 3K09C 5AO9A 4EHDA 3IVRA 1TK9A 3G0GA 1M34B 4BVLA 5KSPA 5EAIA 1AUQA 1KEPA 1ONNA 2ZUWA 3DMHA 5AIAA 1D2EA 2QUBA 3P26A 1DUIA 1BKYA 1XMJA 2X15A 3NGLA 4H7PA 2CUZA 2VJNA 2VDMB 1WMEA 3AU8A 4ON9A 3SE7A 1OXKB 4XTRA 2ZTLA 4OTZA 1MB0A 4BMNA 2HT1A 1DBWA 1MH9A 3D0RA 3D5EA 2FP4A 5HUQA 1RBYA 1NZJA 3PC2A 2WU8A 3H97A 5ITVA 1U0RA 3CR7A 5JXWA 2VYVD 5KQPA 1Q0RA 2NZXA 5LKAA 4FFBA 1QU3A 3NX4A 4UJ5A 3LFUA 2HXGA 4WZBA 1Z4QA 1HV8A 2G9RA 2ZPUA 3WWZA 1ZKMA 4CR6A 1AMNA 4L8VA 5K01A 2F8TA 5EXPA 5TMBA 1G7SA 4UFOA 1HMPA 1D1QA 1TA9A 3EDQA 4B33A 5AW3A 4DV2B 2F48A 4YVFA 3F47A 1NQUA 3P94A 3R5HA 4O0LA 5T6BA 2PLRA 1U4OA 4GT1A 5AKYA 3ZUGA 1KL7A 5FUXA 4DY6A 3DO6A 3JD2A 5F5LA 4YRKA 3OJWA 1B6RA 5FPHA 5C5CA 1O5IA 3ZQJA 4CG0A 4DYVA 4B6SA 4YLYA 5F21A 1Z06A 1ISIA 2YN0A 3B2NA 3D0OA 4H08A 2MT9A 2ODNA 4Q19A 5JEEA 1BJTA 3ETCA 4BFCA 3BIOA 3KEQA 3UMMA 4YXWA 2WZBA 1E62A 4E5DA 1E0JA 1ONPA 3LV8A 4PY2A 3PQ4A 1F0NA 1OCEA 2BKLA 8ATCA 1H42A 1KAQA 2PXHA 1RXSA 2XCIA 2H5LA 3RNLA 3INYA 1T2AA 5MN4A 1Z0UA 4KQWA 4ZO7A 3P9CA 1G8MA 4MR7B 4QYIA 5FEUA 1E3EA 3ND7A 3P0FA 2PGAA 1VBMA 4ZVRA 3W9UA 1M2JA 4F06A 2XNKA 2Q6IA 3SX2A 3NT2A 5FNZA 3U7QB 1ESDA 3UOGA 3EGWA 1WPXA 2H4HA 2RGAA 4KGZA 2AEEA 4AN4A 5JVDF 1IM5A 5L7WA 2WAAA 1Y1QA 2PBZA 4BNVA 3JYOA 4NOJA 4P4LA 1RT9A 1GTJ1 1XV5A 4JBIA 3U09A 2BE7A 2EGGA 4RS4A 1LRKA 3LZCA 3V8QA 4AKTA 1HL7A 3AL0C 1FFDA 1N57A 2MSDB 3FNGA 1SEPA 2BMDA 4M88A 3RYFA 3THYA 4G0VA 1RHUA 2KBEA 5FNVB 4Q3CA 4IQFA 3ZCSA 4D26A 2I54A 2WE7A 3C97A 1OPRA 4IRXA 1PT9A 3M33A 2IS6A 1ISRA 4PYQA 5AVJA 2W6MA 3OZIA 3CVOA 5DMXA 2OZLA 3JYLA 4L3OA 3A6DA 5IG2A 1P0FA 1NU8A 4I5DA 1L5HA 4PLYA 1UC9A 1V0JA 4ZO6A 4KR6A 4ZJPA 4KQKA 1RACA 2ZP1A 1Z6ZA 4AWBA 3NHAA 3P0HA 3DEZA 1IZYA 4XWOA 1O87A 2Z08A 3FOZA 2Y27A 4IIHA 2HRQA 1P7ZA 1A82A 3D2CA 3STXA 4C7OA 1T5BA 3VAYA 4KRFA 2QNIA 1CRQA 3KSMA 3TD2A 4BNDB 1KIFA 4FFOA 2XUQA 3TCKA 3OZCA 4RANA 3OOEA 5KYXA 5BR8B 4JEUA 3LXMA 2VSYA 2AR7A 3Q8XB 3DC7A 2V74B 3LPLA 1TJYA 4JJ8A 3JQAD 2XI4A 4LSMA 5LBIA 2R9VA 2ZQ5A 3IA7A 3SDZA 5BV1A 5E8RA 5EINA 4YJ2A 3EQ7A 2Q5OA 4G5RA 1QFJA 4QOHA 1NVUQ 1XDUA 4RQBA 2IK8A 3UJPA 2P9HA 4CKEA 1JRLA 1PS9A 3CZCA 2VJYA 3DXXA 1VZ3A 2NU8A 5K9ZA 4OHMA 1UKCA 2BELA 4XVUA 3TSAA 4BBAA 2FFHA 4EBBA 2WJGA 3U6KA 4ZAXA 4R01A 3I73A 4LRYA 2QL9A 1YC2A 3P5SA 4HH0A 3WXBA 4BKQA 3OZWA 2WKWA 5K0BA 1A9RA 5IWAB 2CK3A 1KKUA 4V0ME 3ADOA 2BTEA 5INTA 2J5KA 4FR0A 2C5FA 4RZHA 2Z6QA 3WICA 2P3QA 3SR4A 4BVAA 4GVXA 1MDBA 5HPYB 1EFAA 1U2GA 3MB5A 3FM9A 4TLBA 2WVJA 3N8KA 2V97A 3ZJ5A 1HTTA 3I62A 4C22A 1YDMA 2XT9A 3A1UA 3FAKA 2JAOA 1PJTA 2JVKA 3NVDA 1I2MA 5CX1A 3QVJA 4URHA 2VHQA 4MROA 3ZHSA 1U0OC 2P9TA 3T1QA 3PXDA 1ZL0A 2DLCX 2EWMA 4GYYA 5A5DA 4Y1RA 3RBXA 1VE5A 3GT4A 1AKUA 4WT7A 3VZBA 4J3FA 4P58A 1ZD3A 3WGYA 2YQ5A 1TRHA 3DLCA 4QYIB 5IJWA 4AY5A 3RVDA 3SGLA 4P33A 1X14A 4BRSA 3QNMA 4ZD6A 1I8TA 4HQKA 1T5SA 4FN5A 4Y2QA 1XEAA 1D1TA 4X0EA 3B1XA 1WSDA 1GLGA 3ASYA 3DF9A 3TPCA 4N82A 3OBBA 3SHTA 1NTRA 4HT3B 1N77A 1UIRA 1KJ9A 2VPTA 3PRKE 5HE9A 3E5RA 4LJKA 1SVWA 4PW0A 4P3YA 3WMXA 2X13A 1O95C 3RYFB 3CH4B 2H4YA 1UJ5A 2KLHA 3FYHA 4LF9B 4BPRA 5CR9A 3G7SA 2VH1A 5DN6A 2R96A 3AHIA 3DTNA 1I7LA 3NUQA 3K0BA 1UKZA 3K7EA 4N40A 4J9UE 2WU1A 4RK0A 2QOEA 3JQFC 2BW0A 1DLIA 3LPAA 3IR6A 1V11A 1CUWA 4TMTA 4MZDA 3RC2A 4BVKA 2PX5A 1FNNA 3PXAA 1QIDA 2J9FA 5LN1A 2G88A 2OZLB 4P34A 4L1KA 1NVBA 1WHSA 3Q0EA 1SUCA 3QE3A 4NF2A 4V3CA 4D44A 5A2GA 2ZRFA 5JSZA 4EGSA 4LDJA 2BCEA 4HEA1 1S3SA 2O0KA 2P2CA 4MJXA 4XX0B 1HG1A 4MV3A 3VR5H 1XELA 2ZK7A 1WTAA 4YX9A 2R3SA 1T3LA 1DKNA 5EESA 1CUXA 1S3FA 1PRYA 4TSFD 3IJPA 1KWKA 2D5AA 3RUFA 3R23A 1UPTA 1VMKA 3HI6A 4P7FA 2X6RA 5TY0A 3E15A 1FX0B 1TMKA 1YASA 2QY9A 3NEAA 4B3XA 4YASA 2Y1GA 4OHVA 1CDDA 2ZI6A 5KYXB 1GTRA 5EYPA 4BBZA 4BGEA 2KQUA 1U0FA 1N2CB 1U7UA 2EEZA 2IYXA 3KDPA 4O5AA 3KKOA 2B4QA 2X14A 3O03A 1YZKA 4IXDA 4Z0HO 2DRIA 4KR0A 4YJ2B 1EG2A 4AF7A 4IZIA 1QB8A 2FZKA 3ESRA 1SCDA 3M34A 1Y0BA 1XX6A 4AXBA 4J49A 2O0HA 1YS1X 4BMCA 1ZJ4A 3OY2A 4J0IA 4YAKA 4PG7A 3AF2A 1FVXA 4DQDA 1W0KA 1RRPA 2J3HA 1HSZA 3KU1A 3PNMA 1OXMA 4EPVA 1H2AS 1Z0ZA 3ANMA 3H2IA 3H5TA 5AKEA 2WKPA 4BNWA 3Q12A 5K3FB 3ZBPA 2ZKLA 1EK2A 4IX1A 1DELA 4E7OA 5JY6A 3HI4A 3CUYA 1WMFA 1WSWA 3DAOA 1T0HB 5CPFA 5GPBA 4BL5A 2VRWA 1G5IA 4P82A 1UDAA 1UWKA 3JVVA 2CHEA 1ZMXA 4PYIA 4QTTB 3R7NA 4ZMRA 1MABB 3I6ZA 2PFSA 5EE3A 1JIQA 3B1YA 4Z9YA 1QONA 3GT7A 1DQRA 3IHWA 3WMFA 3K6SA 2D0OB 1ZOLA 3GPLA 4MUYA 4E13A 5FA8A 4IIEA 4QT4A 2HL6A 2Q99A 3NOOA 3A3NA 4Y9SA 2LIPA 3QE9Y 4CN9A 3KQUA 3OPXA 1NNLA 4RY0A 4Y1RB 2HWXA 2AR9A 2A5FA 1VOTA 3I9V6 4CMIA 1KA9H 3K8ZA 3KZ1E 5AVKA 2AC7A 1KZHA 1M1YE 5MFZA 3TRDA 1I01A 1LX6A 3PNLA 5GGXA 4EPRA 3OP4A 1FW6A 4TZ0A 4EBFA 4JI6B 1JIVA 1WXEA 2F59A 3FRHA 3OE1A 2H1HA 3C74A 3M8KA 2JCXA 2AIRA 4PFKA 1HYHA 5AHKA 1N3YA 3V42A 5DBEX 3O2NA 4QHTA 4P9NA 2GF2A 4MV8A 1HDGO 1T4MA 4O4HB 3UK7A 3WOHA 2C8VA 3SF0A 3TR5A 3IIKA 4CMEC 1YUBA 4B0OA 3HG7A 2C5SA 2H92A 5M04A 2AWNA 2CNBA 2PSDA 3ETDA 3GPDG 5F1KA 4YAIA 2J59A 2IYUA 2LIVA 3B7WA 4G86A 2Y2VA 4IVPA 4TS1A 4NQZA 3MGBA 5EY5B 3LGXA 4BVBA 3GWGA 1U2EA 2AFHE 1U1EA 2FN4A 3MMSA 3P9XA 4ESHA 4YAFA 4AYXA 1V11B 2P35A 2QM8A 2J6IA 3MTQA 4L5JA 3WGNA 3K16A 2Y1EA 2J9FB 3MMNA 3R3WA 3J7TA 4LHVA 1S8OA 1KS9A 3MT8A 1C3JA 4GSYA 1T9GR 3GP3A 1PYGA 1ZCJA 4RHCA 4X94A 1QYXA 5AM4A 3S7TA 5D86A 1OFHA 1UBLS 3DOEA 3IP7A 4I1UA 4U2DA 3WYEA 4LY6A 4BV8A 5B36A 4JQOA 1H4QA 1I3MA 2HK6A 3P7MA 2GA9A 3A4TA 2D0PB 3FWNA 1X8LA 1P3DA 4FMDF 4RBNA 5ECDA 5BYJA 2GCNA 1RKVA 4ZCSA 1DCKA 4QFDA 4A91A 4J0JA 1FX1A 3MFYA 5KYWA 1E2KA 1KRWA 1JG6A 1O54A 5EZ6B 5EYPB 4ZT5A 3DDSA 1RXYA 4A10A 1PWYE 2WJJA 2RG1A 1TJ5A 3TQCA 5A3QA 1LCIA 1R8SA 4AMZA 4HX5A 4LYDA 4W5OA 1E9AA 1G20E 3TEMA 2A1TS 4I5FA 4R6WA 4QELA 1OU4A 1Z7YA 4POAA 2Q49A 2Z4RA 3L1VA 3A7DA 1AOXA 3CLRC 1YH3A 1QRRA 2JJYA 3GJ3A 4GLLA 5KCMA 1N0WA 3HKCA 2DYKA 3DBRA 2I7DA 4KP7A 4TM7A 2PX8A 3AQIA 3NV9A 1SAYA 3PQ2A 4ERXA 5B3KA 1KKLA 2W43A 4OQNA 5IABA 3R9XA 1Y1PA 4ZAFA 1IM8A 5COAA 1CV2A 3FIJA 4MRPA 1TQ4A 3IEKA 1FTQA 4L76A 1VB3A 3ZNQA 3K9GA 4MDFA 5ESWA 1SBHA 2XDWA 1W85A 1KEVA 2YYSA 3S2UA 4Y0VA 2C3MA 1L9XA 5E2AA 5ESRA 4YQYA 5LOVB 1TRKA 3CPHA 5JSKA 3Q7SA 4KLCA 2EZUA 3KXDA 5HF5A 4F5DA 1E2BA 4RY9A 1K7SN 4HCJA 3K5IA 4PPGA 5D3MA 4D79A 5KUTA 3UUGA 2YKGA 1RKQA 2H1VA 4QAJA 4QOSA 3CLVA 1R5OA 2W7TA 5B4TA 5IRCD 3DMTA 3WK7A 4EHLA 2V7TA 4DIOA 1FQJA 1P7WA 1M6EX 2FQYA 2M98A 3WGGA 4CMIB 3LL7A 5EMMA 1D5WA 1L4HA 1JKJA 1XCJA 2AZTA 3OD1A 5A62A 4XJSA 1XEWX 3VH3A 4E1VA 3IKVA 4KBYA 2BCJQ 2QTHA 3LQYA 2QKYA 3V46A 2WSIA 3EXG2 2H4WA 4PANA 1Y1SA 1B6GA 1HFEL 4RZIA 3B1KA 3HPQA 3VGPA 2VH5R 1KZGB 1RPAA 4NV1A 4CQMA 4WA8A 1ZN9A 5LNK6 3A6KA 5H16A 4HY3A 4GOLD 3S1LA 4FB4A 4ZARA 2VF7A 1I9GA 2ZBFA 5J5AA 2FWRA 3BOSA 4UZSA 3IDFA 3NQ41 1Q6ZA 1SU7A 2A1UA 3V8VA 3KJEA 4JLSA 1GKYA 4KKXB 1ZIXA 5L7YA 3E05A 1O94D 2R1UA 1LBQA 2J48A 2DMRA 3U4GA 4GP7A 2ZI3A 2YHSA 1ORVA 4H18A 3ZVLA 3GCWA 1F0YA 1KIMA 1SXGA 4DYHA 2C2YA 4HFNA 1KR2A 4GNRA 3FI9A 4MP8A 2IP2A 5JXGA 3ND6A 4KI7A 5EE0A 4JLDA 1FSZA 2FZLA 2ZRQA 3B20A 3DHNA 2JRLA 2EYUA 1M2WA 3M6WA 4Q6WA 4TV9B 3UHPA 4EGJA 4OHYA 3ZGVA 1UADA 1NI5A 3D7SA 4KIUA 4AY2A 1LX7A 3R3ZA 3EXHC 3EC7A 2XNDD 3H3FA 4LAFA 4W5HA 5BQFA 1R0WA 1RZUA 3JWEA 3VSAA 2JASA 1AKMA 5FAXA 1QMPA 2BHRA 4KMSA 4N6NA 3ZOKA 2ZIGA 4C7XA 5KYWB 1EDOA 3IEPA 1YJQA 2NO6A 2O2SA 1AURA 3GFQA 1NP3A 1DAMA 3NI2A 1P3Y1 2VBCA 1BWRA 4LRWA 4XVQA 3V34A 1O4VA 3OFVA 3DLIA 3V8RA 1I7SB 1FMFA 2Q0SA 2XLCA 3SC2A 1A0OA 1PZXA 1TIPA 2NG1A 1W93A 1G5HA 1M75A 2YV1A 4B74A 3BFPA 1SBQA 3GA7A 2V3VA 3BCSA 3HKCB 4LV5B 3ESAA 3UAXA 4FEYA 5L3SA 1PHRA 1TGYA 3OU2A 4Q4HA 2DBVO 2CZCA 2BGRA 2QT1A 1WRBA 4GL4A 4PIPA 3WGHA 3R9XB 2DTDA 4CBVA 1GILA 3NG1A 4INJA 1YDEA 1DSSG 4E1BA 1EEXB 1VHTA 1CY6A 5A0VA 1T0IA 1V4NA 2FTKE 1T8TA 2XAAA 4ROSA 4XLZA 4Z7QB 5LJLA 2LBPA 4OM8A 1N8TA 1WKVA 2QAIA 2JLVA 4IZHA 1YCGA 1M54A 3PGJA 2Z2ZA 3MNFA 3OG9A 2DUMA 3GT3A 3NIBA 4ALMA 4BC1A 4V0NA 2PX6A 2V7QA 2J7PD 2VNHA 4JA2A 4LC0A 5D3MB 2BRUC 1VKOA 3EARA 3L1IA 5T57A 5TGTA 4B47A 4B2IA 1BCRB 1CVRA 2BISA 1NXSA 1K0UA 1O9HA 1Z4NA 1M2EA 3F3YA 5ALKA 4YP6A 4EP1A 3QF7A 4BUCA 4LBWA 621PA 3TVTA 3O2SB 2XVAA 4FCCA 4I46A 5LPNA 4IINA 3DGFC 3DMPA 3IDZA 3LLMA 5FIUA 5HMLA 3LNCA 1FFHA 2GH1A 4J7AA 4EJFA 1A1SA 2GAAA 2BDEA 2VHEA 2X9LA 3PUIA 5JSYA 4RMGA 1I51A 1DWQA 2IXGA 2QRMA 3MK31 2JFVA 3TAHA 1JHXA 1TPYA 4LCBA 2G8NA 2WF5A 4GMFA 3MD9A 3V9PA 2OV4A 5IVDA 3T8YA 3D64A 1ES9A 2A1IA 2BTQA 4RPHA 4U39A 3ZYZA 1N36B 4CT4B 4UC0A 3NTRA 4MVJM 4X8MA 4CQMB 4ZK2A 4D0SA 2J0VA 2AV6A 1DHTA 3WJ1A 1BX3A 1O8BA 1P44A 5JAMA 5ERXA 3LIIA 4K1XA 2Z4TA 4C0QC 2HSWA 4GICA 4JUAA 2BMVA 3A58B 2A1UB 1US8B 2RHCA 1JX6A 1PL7A 1SK9A 2VYND 2XR1A 3N6XA 2R1ZA 3LHIA 1L7RA 3QG1A 3G0CA 4E4YA 2XCRB 3B3JA 1BOFA 1USIA 4I55F 1R66A 2O52A 1JILA 2IDKA 2H1OA 4DILA 3N70A 4FGLA 5HGJA 3L4BA 3DOUA 4POOA 1P6UA 2Y6UA 4JUFA 3SQXA 1RM4A 3AHDA 3OIUA 5FTNA 3IPXA 1N1DA 5LB4A 3E23A 1SURA 3NTUA 5BYBA 5TS2A 2DETA 1I0ZA 3AI2A 2X7JA 5JEDA 1QIIA 1C8BA 2UUBB 2Z2KA 2XMRA 1VL0A 5J23A 2J41A 5LLDA 1U5CA 3ZU4A 1OJ7A 3PPXA 3HNRA 2YQZA 2YCBA 1ZSNA 1BWQA 2FDRA 3G9XA 4M89A 1PK7A 1VLHA 1H65A 3DB1A 1TM7E 4HWOA 2GVDC 1IPHA 5FJJA 4DXDA 3T15A 3V1MA 2HR1A 3AW9A 2P11A 3HO6A 4A0SA 4UVEA 1MW8X 1ULHA 5HFNA 3CVUA 1QE5A 3RIEA 2G7ZA 1D8AA 3O92A 3SC2B 3FPGA 4G1UC 3MJTA 2VHXA 2PSEA 1I3CA 4RH0A 2YUTA 1PT8A 3DEYX 4LZNA 5DSTA 4GC9A 4DRXA 5BN3A 1OZHA 5KINB 1Y7TA 4RD2A 4DLYA 5L3SB 3ZDDA 1WZCA 5HW0A 5JQWA 4Q4HB 4S05A 1ZJWA 4OHXA 2VDWB 1TZMA 1DADA 1JDBB 2C98A 4YMLA 3LY9A 2VYQA 1CFJA 1EGMB 1RMYA 2CNNA 2GO7A 1L5LA 4KMOA 4CUZA 5ICEA 3NVAA 1XKQA 2EJWA 4CKWA 3EC2A 3V8EA 1IWPB 4MW0A 2Y1KA 1Y4SA 1JE1A 4XWKA 4C20A 2UYGA 4JBWA 3I23A 4BTLA 5L7TA 3ESZA 4BB5A 1WB6A 5DVZA 4XDZA 4WLEA 1ZPDA 4O1MA 2VJMB 4TL9A 3BH0A 2GHRA 2P6MA 3DDHA 3E2PA 4MVJP 1C81A 4WVFA 2G80A 3GAMA 3KEGA 4RKFA 4EJMA 3F8TA 1H1LA 1FVHA 3PE3A 1B2LA 1E9DA 1XZDA 2D5CA 5H3LA 3BFJA 1D6NA 1K89A 1N2HA 1KP2A 2CXTA 1HDYA 2P79A 2ZRJA 1P9RA 1W34A 3FMOB 4XUGB 3HB5X 3W3AD 4IPTA 3D3EA 3HVRA 3QLVC 1D7OA 1MZPA 2GJKA 3PZBA 4WINA 1UXOA 1GT6A 1SD5A 3HK2A 1RM3A 4GWGA 2AZ4A 5G1NA 1COZA 3FSGD 3GGPA 5ED0A 1SELA 2C1ZA 2C31A 4DZTA 1CR6A 4EUHA 1BRTA 3G9ZA 4HFJA 2IUYA 3I9OA 4E4RA 1Z2PX 2Q41A 3TZLA 4N41A 3E6AA 2OV8A 1ZXBA 3CW2A 3OKAA 3PUWA 3C5EA 4O4JA 5CIQA 5FF9A 2HYDA 3C8HA 1DG9A 1SO8A 3D3JA 4HDSA 2WP8J 1NN0A 2FFJA 2H4ZA 4IIBA 3PHCA 5A9TA 3X1DA 1X94A 2BTQB 4EI7A 1U8YA 1YCDA 4G0QA 1B8VA 3TZCA 2GCEA 2IW3A 1YMVA 4GX5A 3RS9A 2DBQA 4ZV9A 1DWPA 1FDVA 1GR0A 4IFBA 1QP0A 3OU6A 1SUWA 1OKKA 2A0YA 2X0JA 3RJ9A 3BH6A 4DWOA 2BMWA 2I9KA 2OBMA 1GFSA 4LFCB 2F2TA 2HEIA 1IZ9A 4KLNA 4F1KA 2BFFA 3H9BA 1VMIA 1MENA 2Q6LA 2GWRA 2WT8A 3NH9A 3QW4B 2EZ8A 5I9MA 4OMDA 3LXXA 4LXIA 4D8UA 1EFRA 1SIBE 2M6KA 3R09A 5FL7A 4LTDA 4BLVA 1BHSA 3T4XA 5A02A 1DAEA 4K9KA 1DBRA 2R2GA 1KAHA 1RBZA 2AT1A 3H11A 2L82A 5LZ8A 3DE4X 1ZQ1A 1ZEJA 3E5NA 4S2EA 4XVRA 2FPOA 4N6GA 2BPOA 3G8BA 1WCIA 4E07A 5C1BA 5EJEA 2W71A 1X0XA 4Q5IA 4ZTZB 3EY9A 3C3MA 1QOQB 4XCQA 3I1JA 2H0AA 3JWPA 3L0DA 2HZBA 1BYIA 1SZJG 2WPDD 4KG7A 1FZTA 1TEHA 1UFQA 1X0VA 4R8RA 1FMCA 4CIYA 5BMVF 5HSGA 4JC5A 5KEIA 5FUBA 2B5VA 1OWLA 3WE7A 5KWJA 2O5CA 4JJ4A 3ZHVA 1NQ5A 3HDYA 4KPUA 2I9PA 1OYYA 2YS7A 3QIVA 1H5UA 1QQTA 3HWWA 3BTSA 4NZNA 4KBFA 3VYSB 2RHDA 3ZLBA 4MUJA 3IMCA 1Q17A 2A86A 2B35A 3AVPA 4O29A 4OI2A 5DFAA 4Z0TA 3QY9A 2UUCB 1OYVA 4TQAA 3FDXA 3OLXA 5KB3A 3DA8A 2R6JA 5GOZA 5JY1A 2WVAA 5ALIA 1DC3A 3WLRA 4MHTA 2CEKA 4LJ9A 2CEAA 1FJ2A 2JHGA 3GCXA 3MRTA 4JC0A 3TS1A 4F4FA 1XTIA 4NBVA 1MPTA 2PO7A 2YVUA 3GGJA 4H3KB 5A7GA 4CKWB 4BECA 2CBXA 1PDWA 1VQ1A 1QFXA 3H9QA 3OD5A 2PUTA 1OV6A 4OEHA 3R3VA 5AICA 3C24A 3DONA 1DLJA 2D74A 1Q77A 4AN0A 5BXYA 4O2BB 5JPDA 4GOXA 1T9HA 4R1OA 5ICFA 2Z9BA 3ESXA 2QJFA 3Q2OA 4JJIA 1CY0A 3KUDA 4IV8A 3RBZA 4LHXA 5HCUA 3VR5D 4EY5A 1G2OA 1Q91A 2YFKA 4INAA 2Q3CA 5B12A 3JQQA 1ZN7A 1ECGA 2BIFA 1X80A 3EBOA 1H1LB 3GEMA 3V4VB 4DPKA 1WZNA 2UVDA 4NI5A 2YX1A 5K09A 1TO1E 2RGRA 3MAAC 5K6AC 1RQRA 5A7FA 3R0QA 3ZCPA 2ZXUA 4EGCB 4OX9B 1C1DB 3VZDA 1NN1A 3VR3A 5EA2A 4URVR 1V2GA 2P7HA 2A14A 2QUHA 1NC1A 4OQDA 1PV4A 3C1TA 2DCMA 3OECA 4YV2A 2HC9A 1DT5A 4TTRA 1M7BA 4ENVA 2OCIA 4O4JB 4B79A 4EB0A 2O3SA 2PX2A 2G04A 3EA0A 1QGYA 4HDSB 2GKOA 4OD0A 2MCFA 4BVJA 4Q05A 5F64A 2ZE6A 5ITZA 3TX2A 3OTQA 1JXMA 2V5UA 1T8PA 2WUFA 5FWYA 2IU6A 3ETNA 2QLJA 3HUFA 3TIXB 4U7DA 4Y7CA 1SVUA 2QTMA 4HAIA 1SCNE 2AYXA 3MRVA 1OI4A 1OFVA 4P4GA 2PGJA 3N8GA 3QPDA 1DO0A 4OPMA 4E51A 1KSFX 2AQHA 1SCAA 2BFFB 2HD4A 1ADYA 5JVDA 1CEQA 4AKIA 1NBIA 3KZXA 4CKYA 4JWTA 2VPYA 2I2XB 1RYZA 4TT3A 1EK6A 2QN8A 2XUKA 2TMGA 2KB0A 2R8OA 1G4AE 2AG0A 3RS8A 2LE0A 2NO1A 4EITA 3ZLJA 1PFWA 3ROGA 1QBKC 2OBFA 4IGEA 2COUA 1GNSA 1F8XA 4WWHA 1JHPA 1IUKA 1WBBA 4CL2A 3ZVKA 4HJXA 1PUXA 4NENB 3P19A 2XUIA 5A6SB 3NHKA 1T2CA 2QSYA 5DMHA 1KZ4A 4RH3A 2H48A 2HBYA 3NYWA 5HKLA 4QTYA 1YR7A 3KETA 4B84A 1RLJA 3JQFA 3TBFA 3CO5A 1JKFA 1U7DA 3BIXA 2QW1A 1WF3A 4DMRA 3PQ6A 2QA5A 1BXKA 1U2RA 2K2WA 4D97A 1SM4A 3KL2A 3K8YA 3BQMB 5ECGC 4J75A 5IM4F 2I4NA 3KWFA 2BI7A 4MW9A 4QOEA 4WXRA 3GLFE 1O0SA 3PGKA 4QXOA 1UWVA 2P2LA 3CE6A 3ENZA 3MSXA 1EFVB 3EEQA 4M1SA 2W37A 5IKXA 5J9FA 2AC2A 3AGPA 4JLVA 2GTHA 3UTCA 3WLSA 1ZDMA 1TEVA 1NVWQ 1LRJA 2FPKA 2BGIA 4U7PB 1Z0KA 1U8XX 2DJ5A 3O3OB 3PF8A 1TLFA 4HDRB 4QJ4A 1Z08A 4JEMA 4X1IA 3IUJA 4ER6A 3HB9A 3PDIA 5JTUA 3UOAB 5KYTA 3VR2D 1KDPA 3ZDFA 2X3YA 1W1UA 3FMPB 4REQB 1YVUA 4EH1A 5J1SB 5A7HA 2QDKA 4IJUA 3BT7A 4R81A 2R47A 1Z73A 4X5OA 1D2MA 1SKUA 2X4DA 4O2AF 4DAOA 3RFFA 3TLEA 5KSYA 3VR4H 1N6IA 1Z6AA 1RMTA 1I7PA 3FVTA 4M8LA 4J1TA 3COPA 4BB6A 5CFPA 1L5MA 1YONA 2JI9A 2LCFA 4ZYZA 3KELA 3TE6A 4CLHA 1J9GA 1GZSA 3HSYA 4BX9A 3BFVA 3GMDA 4JQSA 5K0TA 3RF7A 2D2EA 1Z7BA 5ALPA 2AQ8A 2OSVA 3VAZA 4MOWA 4YFYA 2ZBRA 2YJTD 1QDEA 4AX8A 1VB5A 2VDJA 4YCAA 5IASA 1UAYA 5FOWA 4KV7A 4GXNA 3WHLA 2E4WA 2R7LA 2YY6A 1XRSB 2Z58A 3TXYA 1RRCA 4OQ4A 1SVLA 1LF0A 5CHEA 3LDHA 5DGCA 4GVPA 2Q3DA 1DVRA 2XYGA 2AVDA 3IOCA 3STUA 1BH2A 4LRSB 2ZB3A 3VUFA 3F9CA 4IIDA 1DQYA 1DPFA 1KYVA 1LTKA 3OO0A