3G7NA

Crystal structure of a triacylglycerol lipase from penicillium expansum at 1.3
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
258
structure length
254
Chain Sequence
ATADAAAFPDLHRAAKLSSAAYTGCIGKAFDVTIVKRIYDLVTDTNGFVGYSTEKKTIAVIMRGSTTITDIDIALITPELSGVTFPSDVKIMRGVHRPWSAVHDTIITEVKALIAKYPDYTLEAVGHSLGGALTSIAHVALAQNFPDKSLVSNALNAFPIGNQAWADFGTAQAGTFNRGNNVLDGVPNMYSSPLVNFKHYGTEYYSSGTEASTVKCEGQRDKSCSAGNGMYAVTPGHIASFGVVMLTAGCGYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Lipase
publication title Crystal structure of a triacylglycerol lipase from Penicillium expansum at 1.3 A determined by sulfur SAD
pubmed doi rcsb
source organism Penicillium expansum
total genus 83
structure length 254
sequence length 258
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2009-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3g7nA00
1IUPA 3QH4A 1JJIA 2HRRA 3SX4A 4EHBA 4E15A 1E89A 2XMZA 4KAJA 1CLEA 4MEAA 3HSSA 3OC0A 3NUZA 3ILSA 3B3QA 1CUYA 1RWQA 3D4LA 3K6KA 5K3AA 3SC2A 3E1GA 5CH8A 3GA7A 4G9EA 2C58A 4CCWA 2VF2A 2WJ4A 1QONA 3ZWQA 5IVKA 4TGLA 1EH5A 4LHEA 2HHAA 2H7CA 5AKIA 1LPBB 3HYSA 1MNAA 1YAHA 2WQZA 2JBWA 5HKBA 2GYWA 1CUAA 4N5IX 4FFVA 4WFJA 4PSUA 2OXEA 4HRXA 1LPMA 1NU6A 2WFLB 1F8UA 4OPMA 1Y7IA 3EQ7A 5YASA 1R9MA 2IIVA 3U1TA 4WFKA 3LCRA 5DWDA 4B0OA 3R3UA 1TCBA 3VKFA 4BVLA 3LS2A 5AKZA 4Z49A 1ACJA 3V1NA 2PUJA 4A23A 3ZLTA 4KE6A 5E2IA 2B9VA 3ICVA 4YASA 3JW8A 4UBLA 1UOQA 2HU7A 4B9AA 1GPNA 5JZBA 4BAUA 1W52X 1YS1X 3QBJA 5LKRA 5DNWA 5ALJA 4FNGA 4XWGA 3DEAA 3V1MA 1YASA 4GLBA 2P8SA 2RHWA 5LKAA 1MPXA 2JGKA 4PO3X 3FSGA 1QIDA 3C70A 3C87A 5CMLA 1ZD2P 3FLBA 1PV1A 1XLUA 5C81A 3HJUA 1Y7HA 1Y37A 4ZV7A 4BC1A 4BDTA 4A16A 2PSDA 2Q0XA 2ZVDA 1TCCA 4PQEA 5LZ4A 3DQZA 4B80A 4KE7A 2OPHA 1J06A 4X71A 4INZA 2O2HA 4M0MA 5AOAA 3R41A 5HCUA 4X00A 3DNMA 3R40A 2XUOA 1XRRA 1YAJA 2RAUA 3WKAA 4QNNA 1KU0A 2J3QA 3WIOA 5K3FB 5T4HA 2QMQA 2PU7A 4FTWA 2BJHA 3PF8A 2GZSA 4GWLA 1U2EA 1LPPA 4J0KA 3G9ZA 4JYMA 1QTIA 4NMWA 3AINA 3D2AA 3FAKA 1XRQA 5ALGA 1MAAA 5A2GA 3W04A 4FHZA 5CTAA 4Q82A 3FYTA 1LGYA 3IULA 4EY7A 1EX9A 1R3DA 4DMHA 4AN1A 2HA6A 3W05A 2WKWA 4UFPA 3OPMA 2HA7A 2CB9A 3LIPA 3H17A 4DLNA 1GQSA 2HA5A 2H7XA 1BS9A 1P0MA 4I4CA 3AJAA 2XI4A 3FBWA 2PBLA 1JU4A 3BJRA 1XQWA 4H7JA 3WA6A 3G0BA 3H04A 3A2MA 2GBGA 1HL7A 3GROA 2IITA 4GW3A 3HABA 4CCYB 1DX4A 5A7HA 5IVIA 1CIJA 2XMSA 2R11A 3PICA 2GBFA 5AIAA 5FV4A 4U2BA 3B12A 4MWSA 1CUJA 5CT9A 1R4ZA 1A8QA 5EHZA 3IB3A 4AO6A 2BGRA 4F60A 1XLWA 4QEKA 3RK4A 4X85A 1THTA 5ALIA 1H2ZA 5ALLA 1CUZA 4H7KA 4W1PA 1ODTC 5EIHA 1VZ3A 2YYSA 3NOXA 3B5EA 2ZJFA 2JGLA 4ROTA 4OB6A 2QR5A 3I2IA 1BE0A 1EINA 2NW6A 2WIKA 2B61A 4PSCA 2VT6A 2O7VA 3ZI7A 5AJHA 3OOSA 1BCSA 4OUKX 2ECFA 4Y2UA 2HIHA 5K3BA 4MEBA 2ES4A 5ALHA 4JH0A 1W1IA 3H2JA 3UUEA 2OCLA 5F4ZA 4EB0A 1MX5A 5JANA 1YA4A 1CUUA 1ACLA 4AO8A 4CI9A 3QYJA 2CKMA 2DHCA 3HACA 2BCEA 3WIBA 1CUHA 2AJLI 3DL4A 3MUNA 4UBOA 4W9RA 1CV2A 4H7EA 2XUFA 1F6WA 1WPXA 5ALPA 3W2TA 4KE9A 4UHDA 4BYMA 2R8BA 4KAAA 4AZ3A 4QLOA 3RKSA 2HM7A 5AI0A 1UK6A 1XLVA 5DYWA 2ZSIA 2WFMA 3W9UA 4BBZA 4FDMA 4WDQA 1LPSA 4QWWA 5K5EA 1DT5A 2JGIA 3PF9A 3FLAA 5C7YA 4H0CA 2BFNA 4ARBA 1MTZA 3STWA 5DNUA 2ACKA 1UKCA 4FMPA 1USWA 2WHPB 4BVKA 4DNPA 2XLCA 4F0JA 1SCQA 2XUIA 5JALA 3DYIA 2UZ0A 2WJ3A 2C5GA 1VKHA 1JU3A 3GZJA 4OSEA 3HEAA 1C7JA 1FJ2A 1IZ7A 1L7QA 4AMZA 3CN7A 1E3QA 1ORWA 3V9AA 4HTAA 3WJ1A 1ORVA 4F21A 3A2NA 3FOBA 1AGYA 4Q34A 2J4FA 2BAGA 3G0GA 4UBMA 3F8SA 3IUMA 3G0CA 1IVYA 2WHQA 1X2EA 2HA2A 3STUA 1CUBA 1XZKA 2BKLA 3QVMA 1TK3A 4BB0A 2WTNA 4ITVA 3GELA 1B6GA 4X6XA 5LZ5A 2ZYIA 5JAUA 4HVTA 3IUJA 1QTRA 3UUFA 2HA3A 4DM7A 5I7UA 4FOLA 3Q8WA 4AB1A 3LIIA 4FWBA 5HF5A 1CUVA 3DKRA 4E14A 5FDFA 4CIBA 3VJMA 4Y2VA 3WKBA 4ZXFA 1EDBA 1QGED 1WPRA 5HF9A 1CUWA 5ALFA 1VXRA 3BWXA 1CUFA 2V97A 4IH4A 4E11A 4FLMA 3FLEA 3KOOA 5KBYA 5CURA 5AKXA 3QM1A 3MUOA 2G5PA 5DTIA 2X76A 1MT3A 1LZKA 3TGLA 1VA5A 5AK3A 1O6GA 1B41A 5A6VA 1EB8A 3ANTA 1R1DA 4BCDA 1AUOA 1VLQA 5ALVA 3V1KA 3DOIA 5ALKA 4CFSA 2WG2A 4PF1A 3P2MA 1MX9A 1GZ7A 3DLTA 1Q84A 1EXWA 2GBIA 2JGJA 2XLBA 1TCAA 3QITA 2ZYRA 5CW2A 3PFCA 1C4XA 4UHHA 4GEGA 2PSHA 2XMRA 5CH3A 1ZGBA 3AIOA 1QO7A 3O9VA 4LXHA 2OGZA 1P0IA 4XIIA 3C6BA 3H0CA 2D5LA 2B20A 2Y2VA 5AKYA 3HLKA 1AZWA 2YH2A 1DINA 2QVBA 4DMCA 2H9YA 1ZGCA 2BUBA 1UOPA 1AKNA 3FYUC 1FFEA 2XE4A 2Y6UA 4B82A 1E8MA 4KAFA 3R3WA 4LIPD 4LYEA 1H22A 2QM0A 3KWJA 5HF8A 3R3VA 3A70A 3O0DA 3DD5A 3WL8A 4TVKA 5AI9A 1P0PA 4ZRDA 1IMJA 2QKYA 1WB5A 4X93A 5J3JA 4Y9SA 4QDTA 4N8SA 1ETHA 1W76A 1GXSA 2CEKA 4EY6A 4Y2SA 1HKHA 3VDXA 1LBTA 3CN9A 1QIJA 2Z8XA 4JYPA 2OCKA 3G8YA 4UBKA 2DR0A 4BE9A 3WWOA 3R3YA 1DTEA 3PUHA 1CEXA 1H23A 4G9GA 3C6XA 4QA9A 2QXUA 2WG0A 2Z3WA 3WA7A 1LPNA 5ALEA 3HZOA 4EY4A 1MO2A 4F5ZA 3AFIA 3WYNA 4RGYA 2XMQA 5AP9A 3AZPA 3ESCA 5D3ZA 1R9NA 2BUAA 5CT5A 2QT9A 4KYVA 1XZCA 4CG3A 4QDUA 3WLAA 3QPCA 3W9BA 3STTA 3WZLA 5HKAA 3WKEA 1E8NA 1JI3A 5AK4A 2HA4A 3H19A 3H2IA 3SWWA 5C8ZA 3IA2A 5AKLA 2AXEA 1BCRA 5A7FA 4J03A 1LPOA 2VATA 1WHSA 2XUHA 5HFNA 1AURA 3H2KA 4V2IA 2PUHA 3G9XA 1IUNA 1BROA 4L9AA 2C0QA 2DQYA 2WTMA 1QZ3A 5AOCA 5KREA 4H77A 2ACEA 1H2YA 2G63A 3CCCA 5JATA 4P93A 3C5WP 1UK7A 4X7BA 3IURA 3EBLA 2PVSA 4W1QA 4MYDA 2XUGA 1XZBA 2BUCA 5ALNA 3G7NA 4B83A 1A7UA 1XZMA 5ALTA 5E4TA 1TKRA 3QMMA 3ED1A 4AZ0A 3OTQA 1OILA 2HADA 3BIXA 1XZLA 1CUIA 3OURA 2PSEA 5DTJA 4U2CA 2AJCA 2PSJA 1P0QA 2JEYA 4ZGBA 1QFMA 1BU8A 4H7DA 1A8SA 3BE8A 3DJYA 5ALSA 5EGNA 4MXDA 3HRHA 2ONCA 5AKKA 1ZD5A 5SYNA 1K6EA 1XZGA 2IX9A 5H3HA 3QMWA 1N5RA 2XQFA 4B7ZA 1CUEA 2Z3ZA 3I28A 4JEIA 2V9ZA 3DYVA 3CCBA 5CBKA 3V48A 2GBCA 4WFIA 5IH7A 3FVRA 4G4JA 1RYYA 2HDWA 3WI7A 4UUQA 4Y2TA 5KWIA 1YB6A 3C8DA 4X6YA 5ESRA 4GI1A 4P9NA 4EUSA 5CT6A 2WILA 2ZSHA 4CG1A 1YR2A 4P92A 3OG9A 5ALQA 4IH9A 1M33A 3HC7A 1SFRA 3FVTA 4NZZA 4X90A 5EIEA 1CR6A 4NVRA 5HK8A 1VJ5A 1UT6A 3DDUA 5ALOA 3DOHA 3V1LA 5AM3A 1U8EA 5FLKA 4QDOA 5ALMA 2WJ6A 4X95A 1EDEA 5CT4A 1UFOA 1XQXA 4AN0A 5T4BA 3AILA 2HFJA 4B0PA 1DT3A 5ALWA 2VEOA 4BP9A 4Q3LA 4BDSA 2V98A 4RNCA 1ZJ5A 1CUGA 2QRUA 4OB7A 5HQ3B 3BXPA 3K2IA 3G02A 2DHEA 4BCCA 2JGEA 4DMFA 5C8VA 2XMBA 1EVQA 4G4IA 4OD0A 1R88A 3AIMA 4IHAA 4TPKA 4M0FA 1PJAA 4WDRA 5HQ3A 1QOZA 1UK8A 5CXXA 2DFPA 3SK0A 1YSCA 3DL7A 2XUKA 1KU6A 4FBLA 5I9IA 5D7BA 5AM0A 2PPLA 1XKTA 3WK9A 2GYUA 5T4EA 3WWDA 1ZJ4A 1D07A 2ZJ7A 3AZQA 1N8SA 3E3AA 2HU5A 3IDAA 2CUTA 4AO7A 4X97A 3H1AA 1SCIA 2QS9A 1I6WA 4ZI5A 1JKMA 2HL6A 5C8XA 2FJPA 4BCBA 3DCNA 4LXGA 2Y1KA 1CUSA 1THGA 3AIKA 3KXPA 5IVDA 4DYHA 2XQGA 1J07A 1EI9A 4MWTA 4OU5A 5K3DA 5IKXA 4DNFA 3O4JA 3U0VA 4QDXA 4HXFB 2XQIA 5AK6A 2FX5A 4HS9A 5HF6A 1X2BA 3BJMA 2OQIA 4C4XA 3I6YA 3ANSA 3M83A 1JMKC 4U2FA 5JD4A 3LP5A 3WWPA 5LZ8A 4HXEB 1ZIXA 1FFBA 2VTVA 2FJ0A 1K63A 4K6HA 1DWQA 2HFKA 5JAOA 3N2ZB 4DSZA 1N1MA 1K5PA 4J7AA 1CQWA 4X3CA 1XZIA 2I03A 3IUNA 2JIDA 6YASA 4MQLA 4H7HA 5ALYA 2QUAA 1BN7A 2XB6A 4XX1A 1EB9A 3D2BA 2WUDA 5FPPA 4WY8A 3WL6A 5EHXA 4WY5A 1WHTA 5KWJA 5SYMA 1N5MA 1WOMA 4G8CA 4HZGA 4Q1VA 2WFZA 4X92A 5ALXA 2VJBA 1AX9A 3I1YA 5IVHA 4G8BA 3I2JA 4Y2JA 1JFRA 4H35A 5JD6A 4Y7DA 3FYUA 4FLEA 4C01A 3F97A 1BEEA 1HBJA 2W6CX 4IH1A 3D59A 5E4JA 4D9JA 4KRYA 3R3ZA 4J0GA 1Q0ZA 2RGUA 4Y2PA 3ESDA 5T4FA 2OLEA 4B84A 1NX9A 2C4HA 1JJFA 1YS2X 5JD5A 2PL5A 5I8PA 2XDWA 4EY8A 4OYYA 2RHTA 5AIBA 3ZLUA 4N5HX 3FSGD 5CH5A 1XROA 2QTBA 1SCKA 3PDCA 4UFNA 4A5SA 5A71A 2VT7A 3H18A 1XZFA 5FXMA 4FNMA 3EQ8A 2PX6A 2QJRA 2WIGA 1HPLA 1W75A 2WIJA 2ZJ6A 3DS8A 1LLFA 2WIFA 1HDEA 4LYDA 5LZ2A 5K3EA 1VZ2A 4FFWA 5LZ7A 3QMVA 3WKCA 1NU8A 1CQZA 4U2EA 3O4IA 2AJ8A 4IQ4A 3IIIA 5HFAA 5BOVA 4H7IA 4OU4A 1WB6A 4AMYA 1UXOA 5HZGA 5AKJA 3WWEA 2QJWA 3NGMA 4BATA 1CUCA 2O2GA 3WK4A 1IZ8A 3Q0TA 3R0VA 4G4GA 1XZEA 1QO9A 5D6OA 4PNZA 3BF7A 4PV7A 4C87A 1MX1A 4ARAA 1QIMA 4GXNA 5FRDA 1ZD4A 4L3WA 1CVLA 4MJ3A 3DKKA 4Q3OA 2XT0A 4C6HA 2HRQA 1YA8A 3WK5A 3VISA 1QIEA 1EVEA 4J0JA 5LLSA 5BWBA 2JGMA 1H2WA 2OAEA 3ESBA 1BEZA 2X5XA 1GKKA 2QXTA 3MVEA 4ETWA 5JZ9A 1FFDA 2YXPX 5DNVA 1GQRA 4KEAA 2XUAA 5FP0A 2CZQA 3H2HA 4Q3KA 4GHWA 4X94A 3RM3A 2WLSA 1E5TA 5AKEA 1G5FA 1X70A 5JASA 4ZWNA 4CIAA 3BDVA 3S2ZA 4BTVA 1G42A 1WM1A 3F96A 1OCEA 1J1IA 1MN6A 5BV7A 3BL8A 4C88A 3WZMA 3ZV7A 5AM5A 5K3CA 4W1RA 2XUPA 3D3NA 3O4GA 1ISPA 4K2AA 4M0EA 3BF8A 2C7BA 2EDCA 3KDAA 1LZLA 4BTLA 1AC5A 1CRLA 2QUBA 4KACA 2VSQA 4RPCA 1GKLA 4GDMA 1QIIA 4FLFA 2O2IA 1LPAB 1KEZA 2D0DA 3JWEA 1FFCA 3VVMA 2HA0A 3C45A 5AKGA 1K4YA 3C8HA 5CXUA 1GPKA 3D0KA 4J0CA 1VA4A 5EIAA 2ROQA 5DYYA 1OXMA 2WFLA 4LXIA 4DMKA 3ZPXA 5ISMA 2WU3A 1EK2A 2YASA 1AMNA 2XUJA 1UKAA 1W4LA 3GBSA 4UFOA 5EHNA 1L7AA 1JT2A 2FUKA 1VE7A 1G4HA 1QLWA 3F67A 4X91A 1F0NA 1MJ5A 2DSNA 4HAIA 1ZIYA 4B6GA 3IBTA 4EBBA 1XQVA 1C7IA 3O9MA 1HQDA 3RARA 1JMYA 1WCYA 3HXKA 3L1HA 2WUGA 1EHYA 1ZICA 7YASA 2O7RA 1DWPA 2CMFA 5EHQA 1BRTA 2J3DA 4IO0A 4YPVA 3RLIA 5ALDA 4AX4A 1J2EA 1EDDA 4C4ZA 2EDAA 5AK5A 1Q0RA 1VXOA 3C5VA 5JARA 3E0XA 1IUOA 1XRPA 2Y2UA 1R50A 3UMJA 1QIFA 3TJMA 5LZ9A 4B85A 4E46A 5AI5A 3D7RA 3NWOA 3F9CA 4S0XA 1XZJA 3IVMA 4UPDA 5JYCA 1QFSA 2JF0A 2XUDA 3PFBA 4MQMA 3R3XA 5EFZA 3M3DA 1TAHA 4RE5A 3STXA 1AQLA 3IUQA 2PKYX 2ORYA 3BIWA 4QLAA 4L72A 1UWCA 1BN6A 2AJDA 5K3FA 4K6GA 4KR0A 4NS4A 4L0CA 2H7YA 1QE3A 2Y6VA 4BE4A 4H7FA 4XVCA 2CBGA 3WYDA 2ZYHA 5AM4A 3FCXA 5ALZA 1DQZA 3S8YA 4I3FA 1JJBA 1W6RA 3HI4A 1UK9A 4YX9A 5JAHA 2VJCA 3M82A 3VXKA 3TEJA 2PU5A 3C43A 1QIHA 4HXGA 3WK6A 5LIPA 3L1JA 3O95A 1ZI9A 5FOQA 1XRMA 4N8EA 3MGAA 3VJKA 3KSRA 5HK9A 1TQHA 2DQZA 3I1IA 4PW0A 4GECA 2B4KA 3A6ZA 1DWOA 1EK1A 3L1IA 1TIBA 2RI6A 4G8DA 3FCYA 3K9BA 4QE3A 4BAZA 1CPYA 3O4HA 1LBSA 4C89A 4CCYA 4DNQA 3QZUA 3F98A 4B9EA 5JIBA 2VJAA 3PE6A 3M81A 4C4YA 4DGQA 3PUIA 2VQ6A 2OG1A 4DNOA 2W22A 1FSSA 1ZI6A 4QWMA 5LP1A 2C0PA 3AUKA 4YK7A 5AO9A 4XJVA 2I3ZA 2I3DA 2GZRA 3STYA 1XRLA 4BP8A 1EA5A 5JZSA 4EY5A 4BRZA 3VJLA 3N0TA 1U65A 3I6ZA 1XZAA 1WB4A 2WUEA 1XRNA 3WMRA 4G5XA 5A7GA 1QJ4A 1T4MA 3D5EA 3OM8A 3H2GA 4Y2YA 4FKBA 1LNSA 2XUQA 2RIPA 3WWCA 1RP1A 3VVLA 2VJDA 3QPDA 4KJXA 5AH0A 3I2HA 1CUXA 2OGTA 2OGSA 4UBNA 1UOOA 4W1SA 4BC0A 1L7RA 1XQYA 4JUIA 3LLCA 3STVA 2JEZA 1YB7A 5A62A 1XZHA 3T52A 1MU0A 5FUMA 5AM1A 1S8OA 2G5TA 4H18A 2RONA 3G0DA 2VA9A 1ODSA 2QOEA 2XQJA 4BAGA 5AI6A 3KD2A 2QZPA 2WHRA 1E66A 5DJ5A 4OYLA 5LYYA 4J3JA 4O08A 1ODCA 1K8QA 1FFAA 2WUFA 4AQDA 3KWFA 3QPAA 3W06A 1VOTA 3WK8A 3YASA 1QIKA 4KE8A 5AM2A 2WIDA 4Q05A 3WK7A 2XMGA 4DSAA 2ZYSA 4U2GA 4EZIA 1TRHA 3GUUA 2VAVA 4N8DA 1XZDA 2I78A 1DQYA 1ZOIA 3EQ9A 1CUDA 3I2FA 2WHPA 4EA6A 3I2GA 1ZI8A 1QIGA 4OCZA 3ZLVA 3CXUA 4I19A 5AHXA 5ALUA 1XKLA 1U4NA 1SOMA 3FYUB 3TRDA 4RE6A 4QZVA 4Y2QA 4ZREA 3A2LA 4P08A 5JAPA 2Z5GA 2G4LA 5E4YA 4HRYA 3T4UA 5DLPA 4BZZA 2WU4A 3G0IA 1O6FA 1UKBA 3H1BA 2C5FA 5CT8A 4GBGA 1G66A 4DIUA 1CFJA 5EI5A 4B81A 3WQHA 1PFQA 1GT6A 5DYTA 4WCVA 3FWHA 2XQKA 4UHCA 2V96A 4ZV9A 1YCDA 2WG1A 3I2KA 3WKDA 1MAHA 2WM2A 5ALRA 4BZWA 2GYVA 1HLGA 4W63A 3GFFA 4U2DA 2OQVA 2CJPA 4DTCA 5JADA 2PSFA 2LIPA 2OCIA 4LKOA 1XFDA 3ESAA 3JYHA 4J0IA 4BVJA 2WSLA 1VE6A 4Y2XA 4BRSA 4PSDA 5CRIA 3G9TA 2AJBA 4J0HA 2XMCA 5BWCA 2JGFA 2OAGA 4JNCA 1H2XA 1F0PA 2DHDA 3G9UA 4Y2RA 3WL7A 3D2CA 2VAXA 1Q83A 5AI4A 1SC9A 4AXBA 5AICA 4X6UA 4CG2A 2BGNA 3AZOA 1DU4A 2J4CA 2HU8A 4UHBA 4WJLA 3EF3A 1A88A 2OCGA 3X3HA 3BDIA 3E4DA 2X8BA 4K5QA 5AI8A 3FNBA 2H1IA 1T2NA 1E8DA 3C6YA 1DX6A 2DCMA 1UZAA 4J0DA 2E3JA 4QDZA 5FKJA 5FPQA 4G1FA 4MYSA 3WL5A 3PI6A 2XMDA 4UHFA 4KRXA 3WJ2A 4UHEA 5D3KA 3C6ZA 4K6KA 1GPLA 3EIOA 2K2QB 1A8UA 1GGVA 4UBIA 1ZD3A 3ICWA 4OB8A 4UBJA 2Z8ZA 1Z68A 2PM8A 2EEPA 1MNQA 3I6MA 5AOBA 4FBMA 5AKHA
chains in the Genus database with same CATH superfamily
1P18A 3Q6MA 4O4IA 1MX3A 3GLGA 1IUPA 1DQRA 3SX4A 1ZCZA 4LECA 2P7IA 1E89A 3DUWA 2IL1A 4LOIA 3OZBA 1CLEA 3BWEA 1POWA 1Q77A 2CK3A 1KI2A 4WFQA 3WHIA 2ID4A 3ZY5A 1W46A 2ZRQA 3AL3A 5A3RA 5DEOA 1NR5A 2MSDB 3RIYA 4RHFA 1G2IA 1ZJ6A 2DZDA 3ILSA 1J22A 5E7JA 1R3UA 2GWHA 1RWQA 1D7AA 1N3IA 1KC3A 3K6KA 2A3RA 4IQ8A 3CLRD 2AN9A 2WD7B 1F7VA 1NOJA 4KN5A 3IQXA 5C4GB 3VU1A 5H8WA 3AC0A 1T2DA 1PX2A 4QIHA 1PKEA 3E84A 3UMVA 5BN5A 2I76A 3GA7A 4UHJA 2EQ5A 2H4YA 4MCHA 4GKAA 1TW3A 3SKVA 4ZI7F 2VFAA 4V3BA 5EVJA 1BHO1 4QPJC 4HMOA 3CRZA 3MCAA 1CZOA 3TRKA 1U04A 1AK2A 3JQFC 2H4ZA 2VF2A 3IPYA 5ER6A 3V80A 3ZWQA 1QONA 1YQWA 4OL9A 4P86A 1E2UA 4ITRC 1N3BA 1N9GB 2POQX 4XGRA 3RBVA 1HYGA 1T8WA 2ZJ4A 1ONPA 3KSMA 2NVUB 1JAHA 3B5JA 4TGLA 4ZQHA 2LNDA 4AYTA 2DBVO 2P9FA 4K9PA 3UTCA 1QV9A 1B8NA 2ZRPA 2FN9A 2HHAA 2H7CA 5J5AA 4O4LF 4PYRA 2O8FB 1QWSA 4HDSB 3HYSA 1KI6A 3MWDA 3MJRA 4NZPA 1VSBA 3O83A 5KQLA 4RTMA 1EBFA 4ZO4A 5TMPA 2BM0A 5HKBA 4QFCA 2COUA 4RFSB 1JLLA 2J9YB 1O5TA 2HY7A 1CDDA 3EGOA 3ZW9A 5K6AC 2D06A 1C7FA 5A4IS 3TKYA 5IXJA 4D43A 1ESEA 5JQGB 5LNK6 1SVMA 5GIPE 1IYZA 6NULA 4GOLD 2GK6A 3LHFA 4FR2A 4L07A 4L4YA 1FFYA 1N5KA 4BLVA 3U6KA 3EQ7A 3OTOB 1TKBA 2RG7A 5YASA 2IIVA 3QVGA 4GX1A 3HKBA 3MPUA 4XVHA 3RUCA 4CUKA 1K9SA 2RHLA 3ZD9A 2PLFA 2IYOA 4KMRA 2R6R1 4LWOA 4M86A 1Q0PA 3W5IA 3BTOA 3ABSB 2JI8A 2WK1A 2IXAA 3MUFA 5D5QA 2I4IA 4CEHB 3A6KA 5AKZA 4EGJA 2EFGA 3V1NA 2PUJA 2RGYA 1V3QE 5THXA 3EOZA 4O1MA 1SKYB 1B1CA 3WAJA 2R7KA 4S0ZA 2R6AA 2PCLA 4GDFA 4P82A 1ZXLA 4ZAZA 3TFQA 1N0WA 1YQDA 2FXIA 3JVUA 1D2NA 2XTNA 1T1GA 1OAOC 1VQ1A 2F1OA 1WZEA 1UOQA 3GJ4A 1ODIA 1X3LA 4D4KA 3L92A 3JALB 4MYRA 4JVOA 5JXJA 1GPNA 4P54A 4KSCA 4V0LA 2R25B 5M5BA 4WJZA 3H9EO 3WLIA 2X6QA 1YS1X 2IUEA 2O0KA 1MAUA 3QU7A 1XOIA 2GMWA 1E2BA 2BFBB 3N8NA 3NCTA 5CNJA 5B30A 1PHRA 5GZ1A 3W5DA 3DR5A 1QHEA 2ICAA 5JAQA 1Y8RB 1Q7BA 3DEAA 4ZT7A 4DN6A 1C9MA 2ZRNA 1AKYA 1RJFA 2CYCA 3ED5A 3KZOA 1UXJA 1YASA 3PI7A 3PUXA 3KO8A 4PGMA 4QYXA 3DTVD 4UU1A 1KXZA 1WUHS 2VQFB 4G0QA 4N3NA 1U28C 5L53A 2YFYA 3H42B 2NUBA 3I39X 3EGWA 1Q3TA 3PQDA 2JGKA 2ODPA 5ED0A 4PO3X 2CNDA 4CZ2A 3PEVA 2IXEA 2G71A 3VMMA 1F8FA 2BV3A 2HOQA 3G68A 1Q3KA 2EEZA 2P9JA 3C4VA 4UMVA 3U16A 3MQFA 1U6IA 3NOQA 3R5XA 4Q4DA 1NOKA 4M7WA 1FX0B 4R9VA 4KGZA 5CMLA 1ZD2P 1PV1A 4RKFA 3RNOA 3LAWA 2E55A 1F4PA 3DM9B 3NALA 5BMOA 3GEPA 1D5CA 3HJGA 2Q21A 4ZI3A 3CLSC 1I5OA 4JUCA 3U7EB 5L3SA 3HYNA 3I01M 1FQWA 3RAPR 2WJHA 3K5HA 4NDAA 4ZV7A 4BC1A 4NE7A 4BDTA 4BUCA 4I9FA 3KSBC 3K6JA 3WISA 2DBQA 3ZV3A 4PHFA 1C2TA 2ZVDA 1PE0A 3AR4A 4ZQEA 4QBHA 1LJUA 2IDKA 4WNYA 4RLSA 2DH6A 1W0JA 1FU4A 1PT8A 1XSEA 3I45A 5DF1A 4CM4A 5LZ4A 4IGKA 1ZUD1 3DQZA 3EARA 3ZU2A 4B80A 3ND8A 3QLJA 4HDMA 4QGBA 1QDEA 1N5OX 1ZA1A 1XPUA 3QJ5A 3BMNA 4JLJA 2X1VA 1CS0A 3GJZA 3USES 3UT0A 1RAAA 3UC9A 5DGCA 1U0GA 2VYCA 2A9OA 4X71A 1XTIA 3HR7A 1UZUA 1JZSA 2EQBA 3EGVA 3R41A 2NXWA 5BOSB 4UMEA 1VBMA 3R40A 4NYMQ 4X1YA 4XVUA 4EJSC 4A8HA 1RWNA 1UM9B 1ODJA 3QWBA 1FLDA 1NQTA 2ZSFA 1R15A 3THXA 3BT7A 2Q2OA 1FVHA 1JQJC 2J3QA 2JJ1A 1LDMA 3E9CA 3LTEA 1XL1A 5IMSA 2EQAA 2R1VA 4RKRA 2ZULA 5K3FB 4FWTA 1T9KA 3KQMA 1Q0QA 3TSZA 4DEVA 3KR2A 3S1LA 3O2NA 4D0NA 3NYWA 1D2HA 2GZMA 2IVFA 4Y3UA 5KYUB 1KEVA 1P6QA 1WZNA 2ZUEA 3FG9A 1RLMA 5FJIA 2C97A 2Q1SA 1T2UA 5EP3A 4CW7A 3PF8A 4ZDIA 1YCHA 2CNOA 1GZ6A 1HDIA 2UYGA 3MJDA 4GWLA 4TWJA 5COQA 4EA8A 1T35A 4E6PA 3TLGA 2P9BA 5HUQA 1RQGA 1CJKC 4J0KA 4JYMA 1E3JA 1ANKA 3A1NA 4XE5A 1AS0A 4NMWA 3AINA 1O87A 4JI3B 4C6RA 5A9SB 4P98A 4MDFA 3U7QA 4NV0A 3JZDA 4YRQA 1RWVA 1RWPA 4UTNA 3MB8A 1Z8HA 1ZIOA 1GZVA 5A2GA 2MYUA 1G18A 1STOA 2NSLA 3G5TA 5G1NA 4XI9A 4Q82A 5IN5A 4LVCA 3TGPA 1K8XB 4I8DA 1XUOA 1W47A 2GS9A 1EX9A 2AFVA 4HNRA 4Q3CA 3THWA 3JXEA 3GT0A 3Q7IA 1M5TA 4OGFA 1OTYA 1P4AA 3OZAA 4DMHA 721PA 2PD6A 1WW3A 3BMCA 5EWMB 4MKZA 1DX9A 1ZLXA 4EYSA 2GZHA 1ECCA 2MMGA 2ZTMA 1CQJA 2HA7A 4RSRA 3V6MA 5BN1A 3ZCRA 3N7UA 1PU2A 5EKDA 5FTWA 4Y9DA 1EK6A 1E96A 4MA0A 2F43A 4FQ7A 1OI3A 3RS5A 4OREX 1YJAA 4CMCA 1HX7A 1FUKA 1EK0A 3I04A 2NUAB 1FTSA 2HA5A 2H7XA 2E18A 3D81A 1TT5B 2GCIA 3HP1A 3IAM6 3PQ7A 3QOXA 1CERA 2O3QA 4XPIB 2K2WA 1VRWA 4ZTBA 4EVIA 4Y6OA 5CB6A 3E7XA 5CNKA 2VT3A 4MCAA 3KZCA 5DZSA 1S3SA 4JHLA 4AIIA 3GLIB 4MW2A 5IK2A 1IAQA 1RTTA 2FLKA 5ESWA 1JU4A 5F7OA 2FX3A 4XR4A 3K5WA 4JQOA 3ZV4A 4BBJA 2FSFA 3SQLA 3DXYA 1ZINA 1MRNA 3A2MA 4JXZA 2J48A 1PBNA 5GQSA 5E0OA 5FOVA 2IITA 2DULA 2NUTA 2X7XA 1NF9A 3VPXA 4HK4A 1RXVA 4IX1A 4MPJA 3B6EA 4YC7A 2Q6VA 2X0IA 1CHDA 3C1UA 3KDPA 5G40A 5EG5A 4IFEA 5CFMA 1WXWA 4KRFA 3NWEA 2ZUWA 3G2PA 3C4JA 3EMVA 4MGEA 2XMSA 2FW6A 2OV1A 1JNYA 3H5TA 4JBWA 3PICA 1Z2OX 2GBFA 5TB5A 2IA5A 2R6HA 1R0RE 3A4VA 5FV4A 5IZ4A 5E6SA 1IG3A 2QAJA 3KJZA 3IR6A 5A9RA 1ZSVA 1H3EA 2B34A 4MWSA 3O03A 2FHSA 1A8QA 1J99A 4MTCA 1WE2A 4PAQA 1O57A 2O07A 3CC8A 4G24A 1CDOA 1QLHA 1DJPA 2ABWA 3IB3A 3WICA 3ABZA 1OX5A 3G82C 3U80A 3ETDA 4D97A 4QEKA 4URHA 3AU8A 2FWMX 2GZ3A 3LZDA 1XWIA 1THTA 3OCJA 3UFXA 3IXMA 1E1LA 5ALIA 2BSQA 1CUZA 2W0MA 3H9GA 4JC5A 1XJCA 5EIHA 1ODTC 5TJHA 4RDCA 4JUBA 2YYSA 3OQBA 4NNJA 5EP2A 4NCJA 4PGAA 4W5NA 4LVUA 3V7WA 4LG1A 3IC5A 2DWUA 4B3MB 1Y33E 2ZWOA 1I24A 4ROTA 2EC5A 1LK0A 2GM9A 1M2WA 3QF4A 4RCYA 2RHHA 5FOTA 2CXRA 1O97D 2QP4A 4EHLA 2I29A 1E1QA 1IEXA 3ZVLA 2MOKA 1FLNA 3A58B 5F12A 1DIRA 2YN4A 3OM9A 2JD1A 3PIDA 2WIKA 2B61A 1A04A 1O08A 3CVJA 4TLDA 2O7VA 2O8DA 2HMVA 2OILA 2X3UA 3BILA 3HKDA 4DABA 2V3WA 1CW2B 1K8YB 3PNYA 5DIZA 4OMDA 1VM6A 5AJHA 1WUYA 5F78A 1PR9A 2WU8A 4BEVA 2QW8A 2ZDHA 3DZFA 1KFKB 2OCDA 1M5RA 1HSZA 2BM1A 2ECFA 3JQ7B 2E48A 2GLXA 1PTJA 1YZLA 4I7EA 2C5HA 1DCMA 1JWAB 3LY8A 4MEBA 5G0TA 5G02A 4YUVA 1NUUA 3S99A 4QASA 4WESB 4XYBA 3VSAA 1OT3A 1A9YA 2Q45A 1Y5LA 1W1IA 3QX7A 2OCLA 2YNMC 3UUEA 5JS6A 3EIWA 3SYNA 2X14A 4AO8A 3ZXIA 3WGUA 1NJ5A 3EDMA 2CW5A 2HBYA 1FFGA 2B99A 1U2SA 2IY7A 2X2OA 3P0HA 4KHZA 4ERXA 4CXMA 3QYJA 1XVUA 2O8NA 2Z56A 5DM1A 3PIRA 3PYLA 3FNQA 2WMDA 1CS4C 5ICFA 4G23A 1QQAA 1NXTA 5IARA 3EISA 1XALA 5B4UA 3NX4A 3HB4X 1XKXA 2HJ9A 1VMIA 3BWCA 1USKA 2I66A 3EASA 3IAUA 1J8QA 1RADA 3WG9A 3LSYA 2RBEA 3GJRA 2I55A 5DI9A 1VIYA 2AJLI 3DL4A 5JZMA 1NLYA 2I7TA 1F0KA 4DDVA 2Q3HA 3TUIC 1X1AA 4BVBA 1Y6JA 5JU6A 4GSLA 1C30A 1KMQA 4H3KB 5H1YA 4DIBA 4QRHA 4AKGA 3X1MA 5I01A 4QXMA 1AF4A 3ZKWB 1SM4A 2G3YA 3ANXA 4H7EA 1MV5A 4HSEA 4IUCS 1NASA 1YR9A 2C2KA 4M7PA 4ZEOA 1SK9A 3EG9B 2ZREA 3NANA 2Y05A 3W4JA 2C2GA 4X3PA 4B44A 1YVPA 1NXPA 1AT1A 2HF2A 1WBDA 3ELWA 4M6WA 4LYJA 2WWYA 4NCBA 4Z9BA 3H6KA 3UGTA 3AW8A 1KSHA 5ALPA 3VYSB 3DHVA 4ISCA 3W2TA 4ZCMA 6CHYA 4UHDA 3NC0C 2VC2B 4BYMA 3BC1A 1BYIA 4N0MA 4XCQA 4D4MA 1S7GA 1YF3A 4KXQA 2HM7A 3L6OO 3ZEIA 4LVNA 1XLVA 3JYPA 2B21A 1U9IC 3NRJA 3UF0A 3GZTB 3N1UA 1O9GA 3MYRA 4J7UA 5KX5F 1GDDA 3KL2A 4FDMA 2C8JA 3IOCA 1REQA 4JODA 2G1PA 1EFKA 1LPSA 1B2LA 1LNZA 2WYHA 2WEKA 3CUSA 3DO5A 3KWLA 3F4LA 3P96A 3RJZA 3LZCA 3DYBA 1KA9H 9GPBA 1J5EB 8MHTA 3L8CA 2IKSA 3OQPA 3SF0A 4YALA 1PK7A 4CKBB 1LV8A 3MD0A 4X20B 1L4NA 4CMIB 1Z36A 3SJ7A 1KYXA 5AQ1A 4JOQA 1N2IA 2V7VA 3RAGA 5JPCA 2BFNA 2O0JA 1KZ7B 1MTZA 1U1CA 3A26A 3QOWA 2EW8A 3OF2A 4IIYA 1GPJA 2NLOA 3RC7A 2WUVA 1UBFA 1EFVA 4TKLA 4M76B 1D4OA 1FU8A 1T5OA 1Y8AA 2YXNA 3KYDB 4TQAA 1N36B 1YI8A 1MHTA 1CVRA 1NY5A 1R6UA 2FE4A 2CNWD 5FR2A 2ACKA 1EWRA 1UKCA 2BZGA 3LOUA 5DTMA 2BKEA 1U2DC 3OT4A 3VYVA 3WOVA 3ETGA 3T5CA 2JLUA 1XK7A 1J23A 4TRNA 2ATVA 2LW7A 4FGUA 2VKTA 1OFUX 2F1IA 2XLCA 1IDOA 2ZIEA 4G2NA 4DZZA 4F0JA 2D1QA 4KNYA 1SCQA 2ZU0C 2ZWMA 2OV3A 3O84A 4GZ6A 1YL7A 3ITEA 2UZ0A 4YP6A 3U2QA 4B40A 4GQBA 2C5GA 3PXXA 3X1KA 1SZJG 3VOAA 4J1NA 2XPCA 3AY3A 4WCFC 5K51A 4BECA 2HYIC 1EFUA 4F91B 3HEAA 2QTNA 1FJ2A 2PUBA 5KHAA 2IS4A 1NBMD 2AEMA 3AONB 1ZUNA 2HU2A 3O8QB 4IMRA 4FYKA 4NULA 3TVTA 4YDQA 1L7QA 3RV4A 4L5JA 5I5EA 1WCIA 3G2NA 3TZHA 2HMWA 3CLVA 3OHMA 1S96A 4L15A 1SUWA 1ORWA 3VZCA 5EAIA 3WSWA 5J43A 1E79A 3G13A 3HCDA 3AUTA 4OK6A 4Q18A 2P6RA 2IYNA 3HWX1 3PPVA 4F21A 1TCUA 1PV2A 4UULA 2PPVA 3A2NA 2VK4A 3FOBA 1O5IA 4CIYA 2F8SA 1WMBA 2NWQA 3ZVKA 3QEOA 4AL4A 4CF3A 1GU7A 1VC2A 5ESDA 3R8XA 1BJRE 3IUMA 4LE0A 4MR7A 2JGDA 3IP6A 2ZZKA 5LMCA 5FA6A 3KL4A 3UCEA 2HA2A 3MC1A 4XJTA 5HSGA 1DADA 1PQPA 3ORHA 4MVYA 5LXTF 1CUBA 2DLDA 4XIGS 2GPNA 2OXIA 1NXWA 2BISA 3QVMA 2NV6A 4JBHA 1BE8A 3SBXA 3AL2A 5LZ5A 1SUEA 3NHLA 2QQFA 4QODA 1MV8A 3L7AA 2MR5A 2C82A 4I5FA 4A0GA 4RIEA 1DJMA 2W2LA 3DSRA 1M0WA 1WTCA 3WGZA 1LX6A 5HJ2A 1MOPA 2FI1A 3X0DA 3ABQB 5KPDA 4BVAA 1MOSA 1TA4A 3ANNA 1SEPA 1RI5A 4KYTA 2R5WA 4BHTA 4ZFNA 4HYTA 3OHPA 5BN3B 1B42A 1UIMA 3S1AB 3OX2A 4KMOA 3QQPA 5BNZA 5I7RA 3AHHA 3K6SB 5CIYA 3U4HA 3WGOA 4DM7A 2ZBPA 3GLFA 8ADHA 5I7UA 1JIIA 1X1QA 2P0YA 3Q8WA 2NP6A 3AJ8A 3BWYA 3EVGA 3ON5A 3O47A 2XIJA 2XSZA 3LIIA 4WLOA 4EOGA 4YJ3F 4ZZ0A 5KYYB 2FNAA 5HF5A 1ZONA 4E14A 1TD9A 2BMWA 3M0EA 3LE8A 2LDBA 3PDHA 5FV7A 3T3NA 4EPTA 1NJSA 4NPCA 2EG9A 1T1SA 4W8HA 4E4RA 2D74A 4YRRA 1AHHA 1KYYA 3D1VA 4N82A 1A5ZA 4XRRA 2X0EA 2GJ4A 3LKVA 1F3LA 4PLPA 5ELXA 1OXSC 5IJAA 2FTKE 1EGQA 1EDBA 1T9GS 3VSDA 1UP6A 1KE2A 5FULA 1TVMA 1PUIA 4C22A 1LWOA 1WPRA 3HKEA 4RVCA 3D6NB 2N9UA 3SU8A 2QTGA 4C0SA 1YVUA 4MMZB 3KQSA 4EAQA 3Q6IA 1IM2A 4EJFA 4YRSA 1PSZA 5C18A 4LKRA 1VXRA 3T99A 3CX7A 3BWXA 5EIBC 3KHKA 2WM9B 4W7HA 1YDEA 2ZR7A 3NM5A 1A76A 3ZBUA 1Y82A 5JNWA 1AQNA 4S05A 5FNZA 2A5LA 2YYYA 3KOOA 1D1SA 4YXWD 3ROKA 4FYMA 3VVCA 4HAZA 4HFNA 3ESXA 4CI0B 3IKTA 4YHBA 2ZZNA 4BO8A 2ZRCA 4IHJA 5DTIA 4RK1A 1MT3A 4D5EA 1YTLA 3BH0A 3AJEA 4EJ6A 1T1RA 1VA5A 2O52A 1MFPA 1P45A 4G37A 4F4UA 5IUNC 3OZIA 4M8LA 1B41A 4A1FA 3ELYA 4YECA 1PGOA 2NAPA 5C34B 5FWDA 3E5MA 1UMBA 2QTTA 4C7OA 4HN2A 4CFSA 3OBIA 2JL1A 3DDHA 2EJBA 3P2MA 4BMZA 1QG4A 5FEMA 3TPCA 5FHRA 1GZ7A 3QBEA 1GNTA 3M6LA 1E0KA 2JLCA 3BRSA 4LNAA 4O4IF 4UNRA 1PQYA 2IVZA 2B3TA 2XZDA 1EZ4A 3FOEC 1N57A 1Y7PA 2IYXA 3UAWA 4NNOA 3U56A 3K4HA 3KXDA 4H3HB 1ADBA 2QWXA 3HUDA 4UHHA 3MGBA 1PL6A 4GICA 2HQRA 3KSUA 1LUAA 1K27A 2G1AA 3AIOA 3BCHA 1QO7A 1F20A 1QP4A 1L2TA 1LV7A 2NG1A 3O9VA 1L7XA 3CR3C 3QVSA 4JOBA 1PI3A 2A0UA 3C6BA 4IEEA 5FL3A 2B78A 2ECOA 2VRWA 3PQ4A 4H6PA 1FBTA 3G2HA 4WBNB 2QTRA 4O4IB 4KSYA 4WK4B 2PX3A 4B3XA 3K1AA 4C2TA 4EP1A 1FNSA 5EWLA 5JAIA 1DINA 1T9BA 3IPAA 3QYPA 2PUDA 4UTZA 2QVBA 3AVPA 4WZAE 3CNOA 1HLFA 1CQIA 5JR3A 4IIEA 5HW0A 1AKNA 1GZ4A 1OX6A 2Q9AA 2XEXA 4PONA 4HZIA 1SXJA 1O4VA 2ZT8A 4JKYA 3MRXA 1ZQ1A 1U3TA 1JG3A 4JJZA 1FLVA 4KAFA 4RZXA 4YRDA 1LF5A 3MLEA 4XJXA 2ZAGA 3Q7TA 5BN5B 1JR2A 1Z2PX 2FQWA 2WAMA 3EIQA 4UXJA 4ZT3A 1O58A 3PFHA 1HLDA 4FFMA 4GP7A 3MJFA 4XLLA 5EHIA 2FR8C 3U4CA 1MC5A 5E8JA 4PZZA 1JRLA 1N6NA 2Q3CA 3I9V6 1QHFA 2YWXA 1F17A 2W4QA 4IUBS 2NTYC 3DD5A 2VN8A 3PV0A 2NO5A 1AKQA 3WL8A 4EG8A 1KQOA 1NULA 5L51A 1Z4JA 1G59A 4GE0A 4HB2A 1J0BA 5B5SA 3JAKB 2CSUA 2X1LA 4J7XA 4R1LA 5AI9A 4OSPA 1AV7A 2G72A 4DMRA 5LLDA 1VB3A 3QLEA 1EU1A 2EIXA 1P4RA 3T3HA 5FI5A 4YJDA 4EKIA 1VE5A 3B1WA 3ZNOA 4GI3A 1KI6B 1SB8A 1M0EA 4QDTA 2HNBA 1E0DA 5LQUA 2BGIA 2R79A 3UJCA 1NN5A 4EENA 2PXAA 4ML3A 3MMXA 3WLRA 1ETHA 3E5NA 3FPFA 4A0SA 1JN0A 4LDJA 4BO6A 4LQDA 4PXYA 1L5GB 3O2QB 2AKYA 3MOSA 3GUVA 4K3VA 3Q10A 2VJOA 1YFKA 2IZZA 3Q5DA 4XTRA 1CFZA 3C1TA 4MAFA 1Z5GA 1UFRA 3K09C 3QVUA 3Q4GA 3DLHA 1LJLA 1Y3HA 3A36A 1C50A 4C6TA 4Y2SA 3WV4A 1A8HA 3SF8A 1US8B 4CYMA 1E18A 1P60A 4U4AA 3VAYA 3GRKA 5HDBB 1OOEA 4AKIA 3LY5A 2A6PA 3K30A 4JYPA 2JAHA 1V2HE 5K0EA 4KPYA 3QPVA 1EM6A 3W2GA 1DO0A 3P32A 3TTYA 1B6RA 5CIWA 4R69A 5D51S 5BWMA 1OH5A 4CQJA 1V3TA 5KQGA 2HYDA 3D3JA 3LX5A 1GZHB 3WWOA 1RPAA 1HR0B 3R3YA 3PUHA 2VPZA 1VLZA 3FPLA 3I0MA 3GYBA 1CSEE 2WWVD 3RYIB 5JNLA 4GM0A 4ZC8A 3W5VA 4G9GA 2B1IA 3LHDA 3ZWNA 1DKPA 2WP8J 5G41A 4RS3A 4G5GA 4IJKA 4KWIA 1QORA 3B3FA 4Q4AA 3AKZA 1N0HA 2IEZA 1K7SN 2AOWA 5KNCD 4R40A 2KHZA 4UM9B 3COPA 5DBFA 1V8DA 3RC2A 4FN4A 4HGQA 1DCTA 4LISA 4KFCA 1MO2A 3WDMA 4D56A 4MUYA 1ECBA 1P81A 2BIFA 4V0NA 2BCJQ 3G85A 3QPBA 4HWSA 3ZWWA 1WSDA 3GPIA 4EGFA 3U3MA 1GTG1 2FMFA 5AP9A 2X77A 3AZPA 4Q9KA 1KARA 1ZGGA 3TEFA 5I3CA 2W58A 2E21A 1VPWA 3AWDA 2L0XA 1YACA 3BZWA 1DG1G 6ABPA 1Y4AE 2LD4A 3PRYA 2NXCA 3D3EA 3MCUA 5FBHA 4L27A 3MINB 4R54A 1XZCA 1GTSA 2XWQA 1XDWA 4QDUA 4UARA 3PJFA 4X1KA 3ZDDA 4IDEA 1XXHE 2GDZA 3W9BA 3PXGA 3RK1A 4YMTA 4TZ6A 1E20A 1ZK3A 2B37A 1UMCA 3WZLA 4RY9A 3KYJB 2ZUUA 4WLUA 5EJ9A 5GVRA 4WJKB 1MRSA 1JI3A 3SSMA 4LHSA 4IDPA 1HYEA 4U6NA 1VHWA 1Z83A 4EHFA 1Y89A 2F62A 1OBHA 1ND6A 2HA4A 3GFSA 3QU2A 4BGIA 4CM8A 2JLRA 1FZTA 4OHPA 1NONA 2GKSA 3MSCA 4QXQA 1PJBA 4FYPA 3PDWA 2X0FA 3OTGA 4TSKA 3T5TA 3VNSA 3ZUPA 1NSYA 1GEGA 3CSSA 1X38A 1DLJA 3IELA 4HGRA 5EXSA 1Z62A 1UXKA 2BEUB 2WWXA 3IA2A 1ZDMA 2WJWA 3PFFA 4IHQA 3LPLA 3UBTA 1B3RA 4D98A 1HY3A 5K09A 2AXEA 1JLHA 3EUEA 1G8FA 2C59A 1NYTA 5FIUA 4DIFA 1GL9B 3RD5A 3NKLA 3EPPA 3KUKA 2XZOA 2NVOA 1QQ5A 3F78A 4FMCB 3TW0A 1WHSA 3QQ5A 2IUUA 3L3BA 4ZANA 4JC4A 2NTVA 2QK4A 1A1VA 2A4KA 1RXIA 2W00A 3BK2A 2HWWA 4HDMB 1I7DA 4QBGB 1EHCA 1U0RA 2IZ6A 3WBFA 1UH5A 3BMNB 1A7JA 3OEHD 3L4BC 1CS0B 4I9HA 1KDPA 1ZC4A 3D4BA 1F12A 2I2CA 4BZQA 3LI2A 3H5AA 1KPHA 3Q7PA 3LPCA 4E5DA 2VUTA 2CXOA 3LX4A 5C5EA 2WYUA 5KOJB 1Z8NA 4L9AA 3ZTWA 1U2QA 2DQYA 3Q7SA 4D5GA 1E9BA 5CB4F 1CE8B 2NM0A 4L50A 3FFXA 2I4NA 4MS4A 3BD8A 4W5HA 1TGVA 4H77A 3RW9A 4W9MC 3CCCA 3THXB 2QTAA 3C5WP 4OYRA 1UK7A 4WGGA 4KQXA 2G07A 2R1VB 5A1TA 2AB0A 4HZUA 2QSYA 1NRJB 5A05A 3W2HA 3IURA 4E2YA 1TU0A 3PJEA 4UATA 4LYGA 2PVSA 4Z7JA 4YUWA 2C5EA 4AZ0B 3EVBA 1W36B 1CNEA 1K75A 3R23A 2B8NA 3H3XA 3PD1A 3JQCA 5ALNA 1J8YF 2BHRA 4B83A 1XZMA 1RFLA 1YL6A 3PHBE 5ALTA 5KOJA 1T3HA 5B58T 4KNVA 4ZDWA 4F4FA 1TKRA 2JLSA 4FE4A 4NBKA 3TLGB 2ZAYA 2O5RA 4MIYA 5B2ZA 3M6MD 3K8QA 4EG7A 4EB6A 3RASA 1OILA 1UBSB 4BMOB 3R9XA 4LFBB 3U7QB 4A6XA 3K32A 4U7HA 5G1PA 3G1TA 3T6KA 1QMPA 2CXSA 3P2OA 4ZO8A 2FPMA 4RTNA 3EVZA 3TTTA 1RR6A 2ZE6A 2ZR8A 2JH8A 2PSEA 3NFRA 1DARA 5DTJA 3DW3X 4U2CA 1GNQA 1P0QA 3OIWA 5DM60 1XAJA 2Z2IA 3AV0B 3THWB 3IGFA 3C7TA 4D81A 4H7DA 3BE8A 1NXVA 3MLBA 3NTQA 5HTKA 4B4WA 5EGNA 2W93A 2OKGA 3BMCB 1CQJB 3RAJA 1QLJA 1EVKA 1ZD5A 2W2MA 3LA6A 5A4KA 1VLJA 2F43B 1U3FA 1K6EA 2HJWA 1WDLA 1IL0A 1TQ8A 5I9TA 3WLTA 4C4OA 2H9IA 3OWXA 1KO1A 3H2ZA 4TKVA 3F0TA 5FTNA 3MWGA 1G3RA 2BRUA 1N5RA 3OAAD 1KE1A 1DP4A 1Q1GA 4ME6A 1TK2A 1AUPA 3B7PA 2B2XA 4GOND 5JANA 5EMHA 1CUEA 4CTNA 1NVFA 1WEHA 1SKQA 2HRZA 3LWDA 1R0YA 3W6PA 4BNYA 3ECCA 3QW2A 2JI9A 1SO8A 2M1XA 4EVRA 2RI1A 3CCBA 4J91A 1G9TA 1BS2A 1EX1A 1HSOA 2GF9A 1A1SA 4D6PA 4EW1A 4L78A 2P9TA 4WFIA 2YJTD 2IEAA 1RYYA 4G4JA 3ZI4A 1GJRA 4E7PA 4TKUB 3G2QA 4N5NA 2NUTB 1OXKB 1D2EA 1XTPA 4IDHA 3WJAA 3JWGA 3WI7A 4DG9A 4UUQA 1DJNA 4RVSA 3P9XA 2OR3A 3PL1A 4KQ2A 4RVUA 3HUFA 4YI3A 3RTDA 3ZWMA 5KWIA 5ESRA 4TSFA 3C97A 4H59A 1A2OA 3ETLA 3R7NA 3AT1A 2GN0A 3GRRA 2VR1A 3C6QA 3QEBZ 4X1OA 3AFHA 2YS7A 1DC6A 1V4NA 1BAPA 2I8LA 2ZSHA 5CT6A 3WNBA 4L8VA 4F3YA 1DO8A 1UQRA 3GCDA 3GNSA 5E6SB 1YRQA 2PSSA 3GDWA 4Q37A 1N77A 1XTZA 4RQBA 5ALQA 3HUEA 3OQMA 1KJIA 4JI4B 4D4GA 4RV9A 2FN8A 4F4DA 3D6TB 4FU0A 4M54A 1DAEA 1KGDA 1YJCA 3PC8A 4TZ0A 2QPAA 1Z4KA 4NZZA 2WI8A 3UFXB 2JFNA 1R0CA 3WGMA 3FOCA 4AZSA 4NVRA 1DMRA 4YRGA 3BJIC 4PFSA 1KIAA 1H94A 1BFDA 1ZMTA 3DDUA 3MYYA 3QNWA 2PUEA 3AF6A 1UBKS 2V54A 4MMXB 1XR3A 3FFBA 2SCUB 3D7SA 3TQRA 3NJ8A 3FTEA 1IJBA 1PS9A 3KQUA 5AM3A 5C51B 2DWOA 2HMYB 1C4WA 3QF4B 3UKOA 4F9EA 3DZIA 5LP6F 1U8EA 5FLKA 4C7VA 5I4CA 4NS1A 4QOSA 2JIPA 1ZVVA 5FBVB 3VO2A 5EIFA 1NF2A 1U3WA 4G07A 4U0KA 4AW9A 3NLLA 1FYWA 4NFHA 2O19A 2J4DA 1QZTA 1E4YA 4MRAA 2CF5A 3HKDB 1P1FA 4BMCA 1XQXA 2VTDA 4YCLA 1T9DA 5HOQA 5BYKA 1TJNA 1SVKA 2PBRA 1C3VA 2WYIA 4B0PA 3O21A 5ALWA 2XXJA 2XJ4A 3QTTA 2P9CA 2D7CA 2QX7A 4BDSA 1O5OA 2QVGA 1W5TA 3ODPA 4WIAA 1TMYA 4HGNA 1X9HA 2F64A 3ONWA 3TQQA 2YN0A 4XWKA 2EWMA 1L5WA 2WWRA 3IILA 4J16A 2KMLA 2J5XA 3H6GA 1K3TA 3H9BA 2PS3A 5IXSA 2BBSA 2ON6A 4YRCA 5B4VA 2TYSB 2ZRBA 2IKQA 4AAYA 5B12A 2N46A 4A0QA 1J1ZA 3LDUA 1R88A 1FJXA 2GILA 1MBZA 2TRSB 3O73A 4INOA 3ZWCA 3K96A 3HY4A 4M0FA 1SBZA 2X8JA 2YUIA 4MVJA 4BIMA 1UK8A 2BN4A 2C20A 3SC2B 2CUZA 1I30A 1JR3D 3DTVB 3G3EA 4FC6A 4J0FA 4JB8A 5DGIA 4IXTA 6ADHA 3DMFA 2REQA 1OB2A 3AR5A 4FYWA 3OZSA 3KT0A 1XKTA 1TXGA 4HGPA 2GYUA 2I3GA 4HWPA 1V47A 2B4YA 1XDZA 2O2SA 4RA6A 3KKEA 1D07A 2RHJA 2ZJ7A 4M6WB 5C4MA 5H9WA 5EVCA 2XXAB 1N8SA 1GPBA 1F8XA 3MOIA 1K5HA 4MR8A 3ZDFA 3OCZA 3A9CA 2P5YA 4ND3A 4PZDA 1Z07A 2CUTA 4U63A 5IJZA 4AO7A 1Z8FA 3FMPB 3IAXA 5B7PA 4WXYB 1GPWB 2IWHA 3LCUA 4BU1A 4YGYA 1I1QB 2CFSA 1QWOA 4LX8A 1KAGA 4QSHA 1FYXA 1N6LA 4ZI5A 3VH4A 4G5RA 1HDCA 3OF5A 1XCBA 1X15A 2DFLA 4FZ5A 4NJMA 3ZW8A 3GCWA 4F9TA 4DV7B 1W87A 2RSLA 2FJPA 3V46A 1RKUA 2W48A 1Y1LA 3DCNA 1I4TD 2Y1KA 1POXA 1CUSA 3OX3A 4LXGA 5JOQA 2FQXA 4H3SA 3FCCA 2YRXA 2DQKA 3N8DA 3R76A 2IUYA 3KK0A 4LDRA 1C1YA 4LJ8A 3BWVA 2Q07A 3QVWA 3E3NA 4MUKA 3BFVA 3ZJ5A 1AG9A 1EQ2A 1H2RS 2JFXA 5IKXA 3KQNA 3U0VA 3DKVA 1JB1A 1TZJA 2KW5A 2I1QA 3INRA 4LHZA 1LTHR 2JFBA 4HXFB 1KZ6A 5IKPA 2CCGA 1T4CA 1YB1A 2AFRA 4LSGA 4D82A 1IHYA 3W4KA 4N7MA 4KQJA 1EUCA 2C07A 3M5PA 3OE5A 4JUAA 1V6CA 4HUJA 4LTNA 2NO1A 3ETNA 4ZPJA 1F14A 3A06A 5AW3A 1E9EA 1CJBA 4L73A 4TMYA 4A10A 3JD3A 2H4XA 1EUDA 4KFRA 3UJ3X 1BRMA 1J0DA 2A0XA 4H7PA 3G2LA 3IIEA 1JKIA 4QOGA 1I2CA 1YZYA 1LB1B 2C31A 3EN0A 5B6PA 3DBLA 2FW0A 3GN2A 5LZ8A 2GJ8A 3MAJA 3S0JA 5FI1B 3TPZA 1FFBA 2BKUA 2VTVA 4Z1MD 5D8DA 5AW6A 3GJXC 1UC5B 1ZUNB 1DWQA 1P7YA 2XD4A 1HDRA 4L4XA 2HLNA 4HN9A 1WCIB 3VGJA 4CF7A 1K5PA 4PG7A 3ZE2B 1LRLA 3BOSA 5FTMA 2X4GA 2I03A 4BVFA 3EPKA 3IUNA 2VRBA 4N5LA 4ENQA 4GYJA 1Y8ZA 221PA 1A8PA 3SX2A 4CIWA 3GB9A 1XAGA 1JIQA 2PVCA 3UJAA 2R7NA 3W7VA 1ONNA 1K06A 1P0CA 3LUBA 2C7OA 1JSZA 3VX4A 1RE0A 1W0CA 1NYQA 4MR7B 5TQ2B 4R81A 1Z0KA 5DHFA 2C4VA 4JENA 2ZUTA 3ZTYA 4XSGA 5JDCC 1MEJA 3PD7A 5IBRA 3SJBA 1KI8A 2O2DA 2D59A 3D2BA 1ZO8A 4XDZA 1XTQA 2R7AA 4CLRA 1OVMA 4I5IA 3T9FA 2BY4A 3EC2A 1C3XA 4KQFA 2IPAB 2J8ZA 3WL6A 1G5QA 5EHXA 4FZJA 4GP9A 4UEJA 2B83A 4F2WA 1V1RB 1N5MA 1VE1A 5CB8A 4BKOA 4BNDA 2BI8A 1PG2A 4NZMA 3BH6A 4X92A 1X0VA 2W6IA 3EXHA 4HNAA 1GRQA 1W59A 4OMUA 2W2PA 3I1YA 3QU9A 4QU0A 1G7RA 3CKKA 3UB2A 4I8XA 3NYIA 1XTRA 3OAAA 4W9NA 3MGCA 5LNK1 4P4GA 2CHFA 2TMKA 3GPBA 1MQ9A 3VR4A 3W2IA 3M6IA 5ADVA 5JD6A 2BP7A 2QTLA 4TV9A 5E0KB 5LP6C 4EHNA 1V9CA 4FLEA 3GLFB 3CH6A 2CCKA 3TXXA 1IXKA 1DEKA 1BEEA 3GEEA 4D99A 2YVQA 4LK3A 4C05A 1WXDA 4KN9S 2VNIA 4QUGA 2I7XA 3B3GA 5CR9A 5GINE 3QV2A 5DYIA 3ZBPA 4YUAA 5ECDA 5I4BA 3KKNA 2VSXA 1DCKA 3F1KA 1C80A 4BRUA 4IIDA 3WLKX 4CBVA 2HIGA 2YMMA 3S2FA 5D00A 4NAUA 5DN9A 4F92B 1PAUA 2YZKA 4EPVA 2MCFA 3N2GA 5CVDA 1L5FA 3AETB 3M6VA 1BHJA 5JCPA 1YS2X 1Z73A 1T9HA 2PL5A 2QE7D 5I8PA 2BKAA 4ARVA 1N92A 1XJ0A 3Q0IA 4IHJF 3HDGA 1S2IA 2L69A 3FYCA 4OYYA 2HR1A 1YU9A 2R1ZA 3HKEB 4GPAA 4JN6B 5HIKA 4FOSA 5E3HA 4C6SA 2EYQA 3FSGD 5CH5A 1NUHA 3B1KA 1VDZA 3L7BA 3N6VA 3K0HA 3PDCA 1KR2A 5CDUA 1UBHS 4EMTA 5F5LA 4CKCB 3LC2O 4HG2A 2JANA 1XEWY 2X58A 2YDXA 4JC8A 1EJBA 4CFYA 2B4AA 5CDYA 1PVOA 1X9GA 3LQFA 2W7TA 3EQ8A 4E3WA 3P19A 1DI0A 3PXBA 2QYSA 3FRHA 5DM4A 3VPCA 1P5FA 1RZVA 1HPLA 2V6JA 1GARA 5GAJA 1MXHA 1RM3A 1W75A 2WIJA 2ZJ6A 4RVHA 4FFRA 3ZD8A 5SYAA 4D41A 1M8PA 4KAXA 2J0EA 1H8ED 1U4SA 1BA2A 2GN4A 3BWBA 1GG8A 3VOTA 2NO9A 2IYYA 3PG5A 2AX3A 2IYQA 2PX5A 5K3EA 2D2XA 1NQ5A 3DNPA 1UMBB 3WQRA 2IY9A 1XC7A 5FBQB 2GSWA 3B1XA 3GUCA 3D5QA 4WKNA 4MRMA 1K6IA 4HTFA 4O4HA 3RF7A 4DV2B 3O7MA 3FKSA 1DQPA 1ORRA 1UWVA 2AJ8A 3DVAB 1WSWA 3ODGA 3IIIA 2N47A 2P8JA 3L7MA 2ZBEA 4US1R 5BV8A 1W7AA 3GFTA 4E51A 1FS5A 1QOQB 1V11A 4H7IA 1G3MA 2C9YA 2IW1A 4D1YA 3K0AA 3LQ2A 1GRVA 4LNUA 3TSCA 1KR5A 4NC9A 5B6IA 4HGOA 2OWEA 1TQ4A 3MBKA 5E6RB 5KB3A 1UXOA 5HZGA 5JC1A 2ZIFA 5AKJA 3L6EA 3HXPA 4DJTA 3GFQA 4JBLA 1NUSA 2LUOA 3QMPA 4ZQIA 3WWEA 3TIGA 4BL5A 1RKBA 3T3IA 4YJ2A 2NTNA 2WT9A 4BATA 1IZ8A 3R0VA 5KC9A 4G4GA 1WW2A 1JYSA 2DF8A 1VLLA 2OZLB 4JROA 4UTPA 3AHGA 1YOBA 3LPAA 3NV7A 4OFWA 1XZEA 4OQXA 1QO9A 5D6OA 1JA0A 4YMIA 1PT7A 1H66A 3K1AB 3UMFA 2QVYX 4L8LA 5EWLB 4COOA 4TM8A 1U7DA 5DX8A 1MX1A 4F4IA 2GQ0A 3GVCA 1QIMA 3AM3A 3ZCXA 4RD4A 2H2HA 5ES3A 1L4HA 4NQRA 1V3VA 2N42A 1S2MA 1L5ZA 3TO5A 2NMVA 3LK7A 4L3WA 2E4XA 1CVLA 3UMGA 4EVSA 4KH0A 4MJ3A 3LQQA 3GW8A 3F4KA 2XT0A 3OH8A 4TYYA 2HRQA 4UXIA 1GNPA 5J1SB 2D5BA 5DXAA 2GAFA 3I92A 3PEUA 2KM1A 3EH2A 2DXIA 5EKXA 5TMBA 4K0RA 5EMNA 4C08A 1YQEA 4CMAA 2FQ1A 4LXYA 2BM8A 3GIWA 3EC1A 3NS7A 5DW3A 5EQDA 3TSAA 3U0BA 3UJ6A 3WQHA 3K16A 4I6JA 3Q8KA 3TX2A 1ORDA 4MYTA 4U7FA 1EVEA 2PO5A 4QHTA 1C4OA 5A06A 1HO3A 4TUYA 4PS1A 3JQRA 4FDVA 4M9CA 5IP5A 3VHXB 2P6OA 5EQFA 5EIXA 1DNPA 2VOJA 2OAEA 3N2NA 3CKYA 5BW8A 2X5XA 1KI3A 3FNRA 4PC3A 1WUTA 3JQ9C 2JFPA 2ZTUA 3BIFA 3QE2A 2FZGA 4EVQA 3MVEA 2QLTA 3CIFA 3MJEA 4QJIA 3PRHA 1FUYB 1I3LA 1Y1RA 2GPTA 2XUAA 1PIWA 3TOVA 2O2EA 5IN4A 3GFPA 2AA3A 2NP7A 4HQRA 4HLCA 1E2DA 4JZYA 3UGQA 1I1NA 3GNTA 3R74A 4ENWA 4LTDA 4LRQA 4JI5B 1A9QA 1HM5A 1VJGA 3FPSA 3OZTA 4IIJB 4U00A 3U9SA 3A8TA 1CRZA 2H92A 2IW3A 3C41J 2I87A 4HPWA 4PIMA 1RWMA 5DTEA 5DNYB 3SF8B 3KJQA 3QKIA 1QP7A 4OJNA 4TZKA 4E0BA 4ZWNA 4B3BA 1KVUA 2ZRDA 3AJDA 3BDVA 4BTVA 4DADA 2ZU6A 4DW8A 4G41A 2C2MA 1XK6A 3FTNA 3JQEA 1ZSYA 1WM1A 1OZGA 3F96A 3OA0A 4S35A 3JZAA 5DSTA 2OECA 2OE2A 1OCEA 1F06A 4HH4A 4Q1AA 3ZN2A 5U4XA 4D0SA 1YQGA 3ENWA 5A5VA 3BL8A 3I34X 4PLCA 4ZN6A 3VO8A 1E6LA 1R00A 1RHUA 3BK7A 5AM5A 4FKZA 1OJLA 4C2AA 2G04A 1VE3A 3NJ4A 1C3OA 2PXXA 1XRJA 1D03A 2CY0A 2CV0A 3D3NA 4C9BA 3O4GA 4M1MA 3NVKI 4RY2A 4BBPA 2CBXA 4Q39A 2Z5VA 1AHNA 1G8SA 2DM6A 3VR5D 4ADSG 1A3CA 1DDGA 2OHHA 5B1YA 2EDCA 4FJ2A 5CA1A 4MS1B 1EUZA 3BD7A 4BTLA 1AC5A 1W0KD 3ZZMA 2VSQA 3T7JA 2LP4Y 5JSUA 2VHJA 3MAGA 2WMOB 5HDQA 3X44A 3G89A 1GZSA 1J8MF 3VAAA 1BD3A 5B3KA 4GDMA 1ZNWA 3IV9A 4AZTA 1OLSB 4AZVA 2HSDA 1GKIA 4CKWA 1QIIA 1HDXA 3NORA 1E7WA 1JHRA 3KVYA 4FLFA 4HQ0A 4QBIA 5AD1A 2ZRMA 1WCXA 2BEWB 3LDFA 1MCZA 4N49A 3JWEA 5A6SB 1WG8A 1QZZA 1NW6A 2DH5A 2YQ4A 1PR6A 2GXSA 4I55B 4KKVA 4OKIA 5GOZA 5K4AA 3RQSA 3MG9A 4N9QA 4MW4A 4F5EA 1LK5A 4TROA 1M8KA 4GPZA 5COBA 2X9LA 4P31A 4TLMB 3C8HA 4TYMA 4CQNA 4N41A 4OI0A 1GPKA 3ESYA 3D0KA 1OHHA 2IZ7A 3LSTA 2JZOA 1RWWA 4EI8A 3C3PA 2PD4A 4MUGA 2WFLA 4CNBA 4DMKA 3H9QA 3ZPXA 1UMCB 2WU3A 3UQYS 3MELA 1EK2A 1MHPA 3CLTD 1VI2A 5C53B 2OQ2A 3KQTA 3ZGZA 4MGYR 3B78A 4B3TB 2VO1A 3BMXA 5ENDA 3N2KA 4FGZA 4A2QA 2PLWA 2RG1A 3HVKA 5E6UB 1N6HA 1K7XB 1II8A 1CYEA 2H07A 4UFOA 3CJRA 5TV2A 1TADA 3IFSA 3MJTA 3WIEA 5CLJA 3B9PA 3S2IA 2VHTA 1LC0A 5B1DA 3MGKA 2FY8A 3EXIA 3H5LA 2FUKA 1U9ZA 4OA5A 5BWLA 2FPLA 1VE7A 3OFJA 1G4HA 1RYBA 1ORTA 1QLWA 3T9CA 2YJNA 3EX7C 1CD5A 4X91A 4ETNA 1YVEI 4F2DA 4MGHA 3OIFA 3OZCA 4BV3A 1ZIYA 4PLVA 5IX8A 4EBBA 1Z5UA 2LCIA 3VTZA 3L0OA 4QD3A 3Q8LA 1WHSB 1XTUA 1NDQA 1L7BA 3OFVA 4C0LA 5HM8A 5LR6A 1HETA 1QHSA 2C9ZA 4MQFB 1E9FA 4G0YA 3AYXB 1XFAA 2BTEA 1HDOA 1XCLA 3WSTA 3C6MA 2UKDA 4KXUA 2H29A 3HXKA 5H81A 5SZHB 2X13A 2WT4A 3RF6A 1J7KA 1V4VA 2WJPA 3PGJA 4C2UA 1R74A 2IF2A 2A2ZA 1EHYA 1ZICA 4PE5B 1U8TA 5IAGA 1XN4A 1AXRA 4PAGA 3GMTA 1P2DA 1PK9A 1AK1A 4IV0A 1C0IA 1Z06A 2FPGA 3EMKA 4HDRA 4CQMD 4DRZA 5BMVB 1K9VF 2P9ZA 2PD3A 5F1PA 5ITZA 1TUBA 5L9AA 1WKCA 4IDAA 3JAMA 3GUYA 3DT8A 2UYOA 4EI9A 2TMDA 4G65A 1XP8A 1S2DA 4CIAA 4N48A 1J2EA 5LMNB 1G6OA 1JGTA 3FSJX 1AUQA 1WXXA 2ECQA 1W73A 3OJLA 4HZUB 2XNDD 4Q3DA 3P9PA 1F51E 3VNBA 3PP8A 4M87A 5AK5A 1XVIA 8ATCA 1X1CA 1WAMA 2AMYA 3TZLA 2JD2A 2Y99A 1VXOA 2ZDQA 4ZCSA 3NJRA 5E9JA 1UPCA 4OH1A 3W5CA 1E9CA 2F4NA 4OL0A 1IUOA 1H8EA 3USZA 3WX0A 1XRPA 4I5DA 4CWAA 5CFLA 1MF7A 5LM3A 2Y2UA 3HJCA 3L4KA 1ATIA 1RI1A 2J0UA 3RSGA 4C4RA 3TDKA 2GN8A 1QIFA 2ADOA 5IC5A 4ETIA 1IN8A 1BO6A 1JZTA 4TWIA 2C57A 4B85A 1SCAA 2A5YB 4KI7A 4HEA6 2NYAA 3D8NA 5JS2A 5FADA 3D7RA 3AM5A 1R4MB 2PIAA 1YS6A 1QYWA 2G83A 3IT3A 3PE3A 2Z98A 5HRAA 3CKMA 3KLNA 4IOJA 3OE4A 1PDVA 4V39A 1KXJA 5LLTA 1XVTA 2DPMA 4AX8A 2JF0A 2BZ1A 1FTWA 4MQMA 1LI5A 1L8LA 1NP3A 2NN3C 1KSJA 4OJKA 5EFZA 1KMCA 4WZZA 2YZGA 2HMTA 5CXQA 2PE5A 3Q9UA 3ADOA 2GEJA 2Y66A 2FEMA 2HCRA 4BJ5A 4YAEA 2YYAA 2KWIA 1O89A 4L4UA 3EQZA 2CD9A 5L7YA 5FUBA 3T0GA 3PC6A 2O8VA 2R2GA 3FVWA 3CJQA 1OWPA 3CH5A 2ORYA 3I4FA 1NJGA 4N7RA 4MIOA 4OUDA 3L07A 3HJRA 4OF4A 5B1EA 2A1TS 4WK6A 3BIWA 4TKVB 4X8MA 1CR0A 5DYNA 2VK1A 4KR2A 2I22A 1EVJA 5HMMA 3ZWDA 1HL3A 3PC3A 2AVDA 2ZK7A 5LMZA 2D13A 4B31A 3EUAA 2XVZA 3NTUA 2VTBA 4IJUA 4O1IA 3ENVA 4L0CA 3G49A 1JHAA 2H2IA 2H7YA 5DHSA 5JDIA 1OH6A 1HDZA 3C3MA 4P4NA 4BE4A 5HZHA 5CXSA 2ALJA 3UV6A 3EXAA 4HVCA 3TNJA 3OCUA 1QRUA 3PUJA 3SD7A 2GN9A 4WWHA 3JX9A 3U3ZA 3QPUA 5ITSA 3PXEA 3UGKA 3EXG2 3HU5A 5I7SA 1TTHA 2VYFA 2WYOA 3FZNA 3ROEA 4L2IB 2P27A 1TYEB 3KOUA 2OO3A 2QRZA 2XR1A 4FT4A 1KQNA 3REQB 1WY7A 2XRZA 1OWLA 2PRSA 3B6IA 2YBDA 3EVDA 3KZVA 2ECKA 2QX6A 3O6VA 3QSGA 3UJ9A 2X19A 1JJBA 4FHCA 1UFQA 2FWBA 3B6KA 2IEDA 1NBAA 3FR8A 3Q88A 1T25A 4TL8A 3PNOA 2HXYA 2GCPA 3LUHA 5L3ZA 1RRPA 4DANA 1CETA 4YX9A 3Q2KA 3FHJA 3TQTA 1E6EA 3AQ4A 5IM4F 2CKDA 2K6GA 3IO3A 4JSYA 4BNHA 4MDHA 1QYIA 1T0PA 3AJRA 2FN4A 4X41A 4YCBA 1IEVA 4EEKA 1MZPA 1G21E 3SFTA 1UT5A 2E37A 4FYHA 1KAOA 3WK6A 4A8PA 3DOCA 5AUQA 5LIPA 3O95A 3EY9A 1EFDN 3PNPA 5SZIA 4QRDA 1A9ZA 2GVDC 5IBCA 2PUGA 5HM6A 9MHTA 3NYRA 3HHPA 3MGAA 3AB7A 2A86A 4MVJG 3KSRA 3VJKA 5HK9A 5JYBA 1D6SA 1YS9A 3L93A 3NKVA 2AYYA 3I1IA 4FE7A 4G0UA 3IVAA 4MKHA 4S04A 4NBUA 3V1YA 1DWOA 1FDSA 1QANA 4YP0A 4KR6A 1RLIA 2E4ZA 3VM6A 3Q6NA 2DWPA 4UAJA 1IATA 2P91A 4QUBA 2JHFA 1SOWA 3PWSA 2FJUA 2H18A 3A0UA 3C7CB 4QE3A 3WRYA 3WQSB 4BAZA 3P9CA 4U5XA 4RMIA 3RYHA 1KMMA 4CIDA 1UXHA 4J0EA 5FPSA 2SICE 3GD7A 3KZNA 1XDGA 4RK7A 1JR6A 1J4AA 4IUYA 1NHGA 1HQCA 1HZZC 1U3UA 1HK7A 2A94A 2WJZB 4CCYA 3QZUA 2WQ7A 1D9XA 1E2LA 4MYHA 5TPWA 1HFJA 4ESEA 2G70A 5KOIA 1VL6A 3A9SA 5AUNB 2H8KA 3KTAB 1PEYA 1ZMBA 2C8VA 4U6QA 1RKQA 2VJAA 4B32A 3EW9A 1DKNA 2JAPA 1GWNA 2R85A 1EKXA 2BZ0A 3PUIA 3SKYA 5CYFA 3V3TA 3ZK8A 1SA0B 3A3NA 4QBTA 2DFNA 4L22A 1V71A 1YHNA 1KJZA 3VH3A 3RUFA 3SG0A 4NK4A 1NATA 1KKLA 3EGIA 2A9PA 1OXXK 4U9HS 3T41A 5KMGA 1ZMRA 5IS2A 1P19A 2VJMA 3H16A 1ZM9A 5EE1A 3AUKA 4EB8A 1U2GC 2WHEA 2XBLA 3N8GA 3RAFC 3DE6X 2GHRA 2YKGA 2I3ZA 3KOWA 4OQLA 1ZUWA 1JLKA 2RGNA 2X8JB 1DEXA 2VH1A 3IHTA 4K9KA 1GGEA 1K2VN 4PY2A 5IZCA 1XTSA 2D0OB 3BBLA 3QP9A 4RA9A 3MEQA 1AKVA 1E1NA 3MTAA 3RABA 2BGMA 2IE0A 4F6LA 5JZSA 1NW3A 2O3JA 1U0EA 1BA3A 2H48A 2REQB 4XPZA 3KPWA 2Z8YM 1HYQA 1NBWB 1TPZA 1XT6A 1XPJA 3HR4A 5EXXA 1FVOA 1BDMA 1XZAA 1KMIY 4D9GA 5JSQA 1I2BA 3NDPA 4E22A 2A9FA 1Q7GA 3NIBA 1WB4A 2JI6A 2GFIA 2CLIB 4DV3B 1Y4SA 1SQSA 1F3OA 1ONBA 4KN8A 4ZQBA 5A7GA 1AH2A 1F2UA 1IM8A 3OM8A 3H2GA 4P3OA 4C4AA 3QIVA 1KYZA 4UUNA 1LNSA 2FWRA 2GCGA 2INGX 2VP9A 3JTMA 3E4CA 3JWPA 1EGHA 2RIPA 3IKMB 4M83A 3WR5A 4EARA 4I6GA 2RD2A 2Q5OA 3VVLA 2VJDA 2PZ8A 3QPDA 4FUQA 1C9DB 2ZTLA 1F60A 3BB1A 1OMOA 3FUCA 3OWHA 4M38A 5FBKA 4Z8XA 3AESB 5H4GA 3GL9A 1QVAA 4JIGA 2H2FA 4Q1FA 1P80A 4NQZA 4XH9B 3E3MA 3WLSA 1E4EA 3GLKA 4BB6A 4NJMB 4BC0A 3KZ1E 4R16A 3ADDA 3QK7A 1RQLA 2PH1A 5JTUA 1XQYA 1EG7A 4JUIA 1K88A 3ADBA 3U44A 3STVA 3PT9A 5EEHA 3SIPA 3PGA1 3W4IA 2GCEA 4B3HA 5CW1A 4E2FA 4WK2B 2QRNA 1GU1A 4KZKA 3UXHA 5D3MB 3V8QA 2XADA 3QG5A 4WOCA 3ISTA 2H5EA 2QTZA 1MU0A 3REFA 1ZOPA 3HDHA 4MVCA 2H52A 3DZKA 5F76A 6Q21A 2PCJA 1G3IA 1OKKD 1PJ3A 2ZXFA 3FI0A 2RONA 3CLUC 4M8SA 1QRTA 2AE1A 1YMQA 1ODSA 1ZMOA 4MJLA 2OYCA 3V00A 2OA0A 4Z4IA 1AM4D 2R4UA 4DDTA 2QMEA 3CFYA 4GNKA 1DG3A 2CLCX 5TMDA 2WA1A 4DWJA 1UT8A 4K0KB 3JQBC 2A9VA 4WW0A 3FAZA 4BKRA 2O5EA 5THKA 4OP2A 2QZPA 3A1TA 2OCAA 3OZFA 1EUDB 1QYDA 3GI1A 1G16A 4LBZA 3CB2A 2EU8A 3DOJA 4J3JA 3UJ8A 1SZPA 5DLYA 1W1WA 4ZVUA 3FTDA 1BDIA 2GPAA 1FFAA 3JAWB 4OGLA 2CNKA 3DBLB 3ZWOA 4JJEA 4RPJA 1PJSA 5AK0A 1Y7TA 3CQ9A 3IVGA 4UUPA 3VZDA 4TKMA 1XMVA 2OXFA 4QECA 4BLPA 1HNXB 1DAKA 2WPNA 3CF0A 4GFDA 4URUR 5AW5A 1DJQA 4ZQGA 1I32A 3THOA 4NRDA 2YX1A 5MF6A 1MGOA 1TVKA 3LU1A 2RGDA 3IDZA 6PFKA 3KWFA 2H1HA 3NAQA 3KUUA 1BQEA 2FQYA 3QPAA 2VP0A 1YRHA 1NX6A 3WK8A 1IHOA 1OI7A 4OV6B 1J42A 3IJRA 5AW9A 3L79A 1QTNA 2GK4A 2HLDA 4HAYA 4RCVA 5JH7B 2V7PA 2DMRA 3VKVA 2GO7A 3FOAA 4N12A 3GAAA 3ZCQA 4ZYXA 1NVUQ 4Q1CA 3ZW7A 5I9BA 2H06A 3MK31 5AM2A 2IU4A 3A4LA 4Q9AA 2OO7A 3C1AA 3JV7A 4Q05A 3IDFA 2V5AA 3KSAC 2FRDA 4KXMA 2XMGA 3FGNA 4JVSB 2ZYSA 3GVIA 3ASVA 4A73A 3AR2A 3GUUA 3TIIA 4YS6A 3L7IA 1XZDA 2I78A 1CY4A 1O2DA 3BXXA 4MWEA 3TR5A 3ZHZA 2VPQA 3C3JA 3Q15C 3EWNA 5I9MA 1A82A 1CUDA 2C9CA 4R84A 5BRNA 3GXBA 4AG6A 4EA6A 2ZT6A 1MLDA 1XKQA 2XBUA 4HNAB 4J3NA 4OCZA 1QIGA 3R8FA 4HDAA 3DZJA 5TQVA 4HQOA 3VSCA 4EEXA 1RYEA 2WZCA 5ALUA 3MAAC 1U4NA 3JYQA 4E21A 3BHIA 5HIIA 1MH1A 5FBZA 3SR0A 1SOMA 2BP7B 2I2AA 2ZEJA 3E82A 4GVXA 4TV9B 4X8LA 4HLUC 3C5EA 1GKYA 2HIAA 5BURA 3HYLA 3KCQA 4IJWA 2XBMA 1BX3A 3N7AA 2WVHA 3P0FA 3TK1A 2NSJA 1ML3A 4XXHA 1QHHB 2WF8A 2HRBA 5E4YA 1RYMA 5JI2E 4BZZA 3AOEC 1EEXB 1O6FA 3X43A 1JEJA 4TLBA 1G41A 3WNQA 2GNAA 1YVRA 5AJXA 2MINA 2JBAA 4IWXA 5CT8A 3HLTA 1G66A 4DLYA 1CFJA 4B81A 3GC6A 1M73E 2RJOA 3DFUA 1AO3A 2CXQA 4QVGA 1PFQA 4RK4A 4LQCA 1GT6A 5EKTA 5ICCA 1HTBA 3E0QA 5B58C 4WECA 2V5VA 3NBZC 5FR1A 1XAHA 5G4LA 3S2SA 5JXGA 3DZDA 4ZV9A 4JMLA 1OC4A 3SZGA 2Y76A 2ZYGA 1AS3A 3WKDA 3ZG6A 4Z4QA 4ETMA 4Z54A 1GSAA 1IHUA 3R2JA 2QLBA 1J2JA 1HLGA 3H2YA 3W8RA 3ZDEA 4W63A 4GEKA 4YV2A 2LCFA 2UYCA 3PCXA 1N2SA 1PGPA 1UR5A 2D1FA 3FUTA 4NMXB 5EQJB 2YJ5A 3NHBA 3TRIA 3ZOKA 1XJQA 4B8ZA 5BQOA 1P75A 2ZAIA 1G63A 4O4HF 3V4PB 4DC9A 5LWQA 3O8OA 1UBGA 4NF2A 4QEDA 1Q0SA 4UCQA 3OO0A 4JLNA 4L6AA 4C7KA 1N2CE 1BWRA 1M75A 3O1IC 3RWMB 4V0ME 4M8NE 2OCIA 1A5BB 4CODB 4R1PA 2DUWA 4K7JA 3KKLA 3JYHA 1LDEA 1VE6A 2EW2A 4H9GA 5K0JA 2YRFA 5CRIA 3P9QA 4PAWA 3OLWA 2XMCA 4BO4A 4FD3A 1RI3A 2IHZA 2JAXA 4XFJA 4ZRMA 3A4YA 2B1QA 3N3BC 2VYND 4YJ2F 1QGUA 1KS9A 4HTFB 2G0AA 2ZDGA 1X87A 3NHKA 2Z6QA 1X80A 2DHDA 3HCEA 2DPXA 4AUKA 4JY7A 2MR6A 3OUTA 1P5RA 1VRCA 4S24A 1XIVA 1V11B 3KXLA 5DBGA 1Q83A 3DL0A 1TM4E 2PS1A 3K0AB 4NBTA 4DLVA 3UH0A 1SC9A 4ZTUB 4AXBA 2Q5JA 2ZJ8A 2HCTA 3QVOA 1DU4A 1BFKA 5TX7A 4HN4B 5TT1A 4NI5A 4UNIA 3R6WA 1JEDA 1R27A 3X3HA 3LGXA 1WMSA 4AWXA 2P78A 1E59A 4V3CA 2X8BA 4XWOA 1WCV1 4MUBA 3AXSA 3E1KA 3FNBA 3OQIB 5CJJA 3OWOA 1EQAA 1PN3A 2ORVA 1V5WA 1T2NA