1BE1A

Glutamate mutase (b12-binding subunit), nmr, minimized average structure
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
137
structure length
137
Chain Sequence
MEKKTIVLGVIGSDCHAVGNKILDHSFTNAGFNVVNIGVLSSQEDFINAAIETKADLICVSSLYGQGEIDCKGLREKCDEAGLKGIKLFVGGNIVVGKQNWPDVEQRFKAMGFDRVYPPGTSPETTIADMKEVLGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords GLUTAMATE MUTASE
publication title How a protein prepares for B12 binding: structure and dynamics of the B12-binding subunit of glutamate mutase from Clostridium tetanomorphum
pubmed doi rcsb
source organism Clostridium tetanomorphum
total genus 21
structure length 137
sequence length 137
ec nomenclature ec 5.4.99.1: Methylaspartate mutase.
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02310 B12-binding B12 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 1be1A00
4HH1A 4R3UC 2XIQA 3REQB 3REQA 3KOWA 1XRSB 3BICA 4HEHA 4HH3C 1ID8A 1REQA 4HH0A 1REQB 5C8DA 2XIJA 1E1CA 1K7YA 1E1CB 1B1AA 3EZXA 6REQA 6REQB 1K98A 5REQA 5REQB 3BULA 3KP1A 1CCWA 1I9CA 1FMFA 1BE1A 2I2XB 3KOXA 4Q37A 3KOZA 3KOYA 2YXBA 7REQB 2REQA 4JGIA 2REQB 3IVAA 4REQB 7REQA 1BMTA 4REQA 3WHPA 3IV9A 1CB7A 1Y80A
chains in the Genus database with same CATH superfamily
1QYCA 2I6UA 1YS1X 3C8DA 2FEMA 3NYRA 4IIFA 2P91A 1AA9A 3VJRA 4YMLA 2G76A 1RNLA 1UEXC 3ESCA 5CFRA 3K0SA 1TC1A 1YCHA 3IFSA 4OHOA 3TTSA 4DA4A 5AVSA 3IVXA 3ZX5A 5E4FA 2EV9A 4HWPA 2CNKA 4EELA 3QGMA 4OXRA 5LZ7A 5K8VA 1M73E 4O4IA 1UBNA 3NG1A 3U19A 1TW2A 1ZVVA 2G70A 1TK2A 1C3OB 1Y8AA 3GFOA 3QE2A 2WM3A 1O5OA 2A9PA 1NXXA 2BGNA 2Y0DA 3QFRA 3QXXA 2BMAA 1F4LA 4JLSA 3MTEA 4KKVA 5FCDA 1YIDA 1A1SA 1RIIA 2JGIA 2BFPA 3LIPA 4XVQA 4XPIB 2ZLBA 3BE6A 1M34A 3CLVA 3H2IA 1J8VA 4WMLA 1HQDA 3A1CA 4JXKA 5ALEA 5DYGA 5F2EA 2KS6A 3L2OB 2HO5A 1UOPA 4GPEA 4OIMA 4D96A 4ETMA 4NJMB 4ZI2A 4BLVA 2FLWA 4EUHA 4MWCA 1R9NA 4N7RA 4Z51A 4Z1OA 4ZYXA 2X5OA 3EGIA 3FSEA 3RUHA 1SPBS 4YR7A 1LLDA 4JUBA 4ZVMA 5J47A 4OI4A 2L18A 4WXRA 3HADA 4WKOA 2W42A 1XPJA 1ZGBA 3DBHB 4BMYA 1RBQA 5FR2A 4DEYA 2W93A 1E1QD 1QVAA 1Z3IX 1ZOPA 2UUPA 4MTCA 3C3JA 3IKTA 1LPBB 5EUBA 1SUCA 1XZCA 3BMCA 1T0IA 2P90A 4HWOA 2AJDA 2NTVA 4UTOA 4MVWA 5JQGF 5DIFA 3BGSA 1C1DA 2CFIA 3WRYC 2G5CA 2HZ7A 1JZQA 4GVPA 1F8YA 1XZQA 2DT8A 3S2GA 4C4ZA 2X14A 3PC8A 4R8SA 4ZVTA 1ULUA 2OZLA 4G0QA 2B5WA 1G4HA 1ZUNA 5DULA 4DMFA 5IFKA 1QRAA 3C45A 1JFRA 3E4DA 3AFNA 3UFXB 1GPDG 3GDFA 4R4JA 1NA5A 1KVTA 3PR3A 5JFTA 2HQBA 2OO5C 3FBWA 2W58A 2OFXA 4OB7A 4DANA 2EF1A 2E4ZA 1VHWA 2Y67A 4HFJA 4IJMA 5B3JA 2H2WA 1OX4B 3FDFA 4AYTA 1WB4A 5SYMA 3GDOA 3QOXA 1QAOA 5H02A 2XKKA 2YOHA 3ZE8A 2IDKA 1M72A 1Z12A 3ZIAA 4C0KA 2GAAA 2NQ2C 3OE5A 4M0DA 4INOA 2GDJA 1FFXB 2HCTA 2IIQA 2TS1A 4WN3A 2B36A 3BRQA 3UV3A 3WWZA 4B2LA 3T0GA 4KO8A 3HJTA 4GWKA 1IAVA 1ZINA 4A0SA 2X2PA 1T9KA 2C96A 1E64A 1JFFA 1F2TA 3ABIA 3MBKA 5EE9A 3RRNA 5C7OO 2GPYA 2ATXA 4MI3A 2IXBA 1KVSA 4AJHA 4WNAA 3CF0A 4TMFA 5K6AA 3AI1A 2B61A 2OBMA 3L1HA 3ROXA 1SCIA 2SCUA 1CY0A 3I1IA 2O3SA 4RACA 3DCIA 1ZBDA 1EI9A 4DSNA 1KPHA 2OSVA 1TRKA 1MD9A 4L02A 1A9TA 1JJIA 5C80A 5EIHA 2V54A 2QN7A 4WT7A 3IT3A 3Q9UA 1MX1A 2G25A 3U3DA 1R6AA 2A86A 3NAQA 2Q2WA 3KSZO 1KDVA 4DSZA 2QSUA 5FQOA 5T6BA 1RS0A 2F3TA 4IIUA 3EIOA 2QHXA 1P31A 5E1MA 1Z5NA 4BNGA 3GG2A 1Z5VA 2ZZNA 1VHLA 1JSRA 1MJFA 5DYIA 1WD5A 1WKCA 4L74A 4IMPA 3VR5A 3ZS9A 2QDKA 3ZCSA 1Q15A 2MYPA 5JSQA 5K8JB 5A4FS 3WHLA 1NWCA 2GX6A 2AFVA 3D4PA 4DXAA 1XF1A 3X3HA 2XMSA 3VMFA 4F60A 5BPHA 2IIVA 2R8OA 2LCQA 4M54A 5LC1A 3UEOA 4KCGA 1TFUA 2ZRHA 5IAJA 4Z0PA 2OVFA 1C9NA 3GPCA 3OWXA 1RW4A 3AKEA 3DBRA 4JI0B 4ALLA 4Z4FA 2VNJA 3BXHA 1JDUA 2W2KB 4G81A 1NFRA 4YDQA 1K5HA 1SD5A 3JW8A 3SGLA 3I39X 5KTPA 1SHJA 2A9JA 2FWMX 4DRYA 1BEZA 2CL7X 2QXTA 2ZPTX 5HDQA 4AX8A 2BFDA 3TG2A 2CV0A 3REOA 3DB1A 3GRFA 5T64A 5BV2P 1O96A 2YWDA 4G1UC 1WA5A 3DC7A 4ONEA 4PGFA 4IKPA 3OPYI 1MF7A 2GLTA 4S1PA 2DHCA 3QBTA 4B3SB 2P5UA 1M2VA 5E4TA 4RXUA 1NMYA 3QX3A 4DGSA 4NG4A 3X43A 4PBRA 3TQSA 1GGEA 1PT9A 1GAJA 1TW3A 2VDLB 3D2CA 2G0TA 3KEMA 1TF7A 2FDXA 5ERXA 2OV3A 4R84A 3QPBA 2IY8A 5IZCC 4HG2A 4LYFA 4QOJA 3SC2B 3CZRA 5C1DA 1PTJC 1A50B 2JHCA 4NBVA 5E3HA 5B4UA 2FFAA 2Z1DA 4LI3X 5C8YB 2PHZA 4XUEA 3ZTWA 2V7QA 4MIYA 4FKMA 4AKTA 5IDYA 3KD3A 4EI9A 1H69A 1K8YB 1G9XA 3QVJA 2IDZA 5LDGA 3R9IA 3T3IA 3MWFA 3SY8A 1QCYA 2IOFA 1T3GA 4UXIA 2YYYA 3OT4A 2PBLA 4C7BA 1L8LA 2H1IA 5CNIA 1WXFA 2ZUFA 1B6TA 1XHLA 2W6JD 3AEYA 4OJMX 3X2EA 5LL6P 1O94A 1YB6A 2PZFA 2WF8A 3KDAA 3EWAA 5F33A 3D8SA 3T9EA 1N33B 3GWGA 3M1YA 4LJYA 2Q0HA 4X84A 4JNCA 2OGUA 4IS3A 3N7UA 1K6XA 2XMPA 3R3WA 4CF3A 1JIJA 2H5JA 2PKQP 3NTXA 1DQPA 2NUAA 4AZ3B 1EK1A 3LPLA 5L3ZA 1I24A 4N65A 4RVCA 3LP6A 3EFHA 1PUIA 1KDTA 3SYLA 3ZH9B 3WQHA 3CSSA 1ADBA 4HDNA 5EGSA 1UK7A 3TL6A 3RK0A 5LIRA 2FZLA 5IXJA 1W59A 4PAGA 3DL7A 2DP4E 2Q4EA 4B35A 4DPMA 1R64A 3N76A 2FVXA 1GM5A 1Y82A 2FQYA 1IE3A 3FZYA 3GY0A 1FYFA 3HCNA 4JY7A 5CXSA 4YRPA 1NNUA 1HDIA 4ZAGA 3TSZA 3UK7A 1SOUA 4BWYA 1FYXA 3WLSA 4YMHA 1D0VA 1Y8QA 1YZYA 4G1BA 4Q21A 5HKAA 3UUFA 4FW8A 4DQXA 1DE0A 3AONB 3QLVC 4N5HX 5AXBA 3DEKA 3AL2A 3OEED 4YCBA 3SJAA 3FOFC 2A0WA 1T5HX 1BSVA 4DC0A 1VBKA 2FG5A 5IK2D 1HLDA 1JA9A 1KVQA 1EKXA 1OROA 1SR8A 2X9VA 3GFTA 2EX4A 4M55A 2JH3A 2ZQZA 5D00A 1Y6FA 5IRCD 3P52A 2EP5A 3P5SA 3MXTA 1G66A 3OEWA 3EDOA 1BKDR 2R00A 4Z8XA 3DXFA 1O6FA 2ZRAA 3C5CA 3EPPA 1QIHA 1TT5A 2PZAA 4G9EA 4BY9E 3CNQS 5KKCA 4O4IB 2Y1CA 5CVUA 2XNCA 2JJ8A 4EATA 2X9GA 4D6XA 8LDHA 3HBFA 5TXGA 1CEEA 4GI2A 2HA5A 2GGSA 1CDZA 2JFYA 1W8DA 4ZAWA 1M34B 3D7LA 4D4HA 4FMDF 4UHFA 8MHTA 4XVCA 1L5VA 5ALHA 5BQ3A 4R31A 4YRNA 1VLHA 3QLJA 3HJHA 3C4QA 1UMDA 1UPUA 3ML1A 3NHJA 3WAJA 4JLKA 3L84A 2XECA 4C2AA 1LZKA 1AD2A 4MV1A 1G2QA 5M3BA 4FK8A 5TMEA 5A4AA 3NWBA 4MR7A 3BHJA 1ZO8A 3SU8A 2FN3A 2JEZA 2AC2A 3SSNA 3CYFA 3H1EA 3OFVA 3BMCB 3VZRA 1OWNA 1YBMA 1RWXA 4WH0A 4GLFA 2OV4A 4TVBA 5AVXA 3STHA 3CRMA 1L6RA 1XN1A 3D7SA 2YMPA 4MUFA 5CM9C 4IJ6A 1G291 1NQUA 1YJCA 4FSHA 1ZUNB 2X41A 2VHXA 3Q7RA 4RCVA 1U28A 5LMNB 2CV1A 1WZNA 1J70A 2PSSA 4FFMA 2P9TA 2CJFA 3G8AA 4LWOA 4Q0MA 5FKJA 3ZZNA 1C3XA 1Z35A 3EY4A 4N1AA 3G8YA 3FBTA 5GTDA 4PRYA 1WSDA 5TPZD 1PHPA 5CLGA 1CRWG 5D1NA 4C7MA 2XUQA 1UFKA 4CDMA 5BWCA 2O8EA 5HMMA 3DMRA 1EFUA 1R88A 2X1HA 5ALMA 4QT4A 4L22A 3GJSA 1COWA 2BKVA 2QRMA 1QIEA 3JZDA 1ODCA 3O4VA 4IPTA 1THGA 4AN4A 2BBSA 1BQEA 3WOHA 4C4OA 2VZ9A 1JFFB 2PL9A 1V9SA 4MTLA 1QRRA 5BNIA 1GO2A 1YK1A 2QXUA 3N8HA 2ZBFA 3I12A 3IHLA 1Z4QA 4WNAB 1JR6A 3DP9A 2ACEA 3DE7X 2C2MA 3HKCA 4N5MA 4M76B 2H29A 2IE8A 3DBVO 1HDCA 3TLGA 2SCUB 3NETA 3WL7A 2BHSA 2JFWA 4BX0A 4EGAA 4FLEA 2N3ZA 1ZK3A 2I2DA 4FBGA 3K5PA 2RHWA 1GZVA 2XXJA 1XKXA 3IMFA 3ND9A 3PI6A 2VLIA 3TSWA 2PUEA 5E8JA 2NYRA 3ZDCA 2GPSA 5FO1A 4AG3A 5GONF 4ZVUA 2NACA 3TF5A 3W6UA 4EP1A 3HSKA 5I7EA 2W90A 1NSYA 1NVGA 1UJNA 1R3DA 1PZMA 1G20E 4CTKA 3HUUA 3QVVA 3AVYA 2QUKA 3ETNA 5A4DA 4OBWA 2EARA 1QP8A 2F1JA 2F00A 1JFLA 3FLMA 1NW9B 1IN4A 2VRCD 5E9WA 1AMOA 4W9NC 3MD9A 3KHSA 1XWIA 1T2CA 1EM6A 2GN6A 1BMQA 1WOYA 1V45E 2H9AA 3B1ZA 1RHQA 3P0JA 4GX0A 1AKTA 2VA9A 3IIJA 4FPXA 3OM8A 2QLJA 3NTRA 2YY7A 2IHBA 4DHEA 1IVNA 4BUJA 1N34B 1UADA 2ZJ3A 2ZT8A 3DC2A 3R3UA 1IY8A 1GCAA 3HY6A 1JSZA 1SY7A 2AXQA 2PT6A 4IG4A 4OJTA 5CFLA 5CVEA 2EBHX 1SC1A 1UKZA 3RKRA 5IKEA 1FBTA 1YCFA 1CULC 1DG1G 2Q3JA 3C5HA 1NN3A 3FWPA 1GAWA 3N2KA 3UUEA 4B46A 3GFBA 2IT1A 3DBRB 3R5HA 4B48A 1O95A 5LUBA 1X9GA 3U4IA 4CM6A 4OP3A 3OQBA 5AMXA 3ZZ1A 4MKXA 4XAQA 3HXTA 4JI1B 5DHUA 1I33A 4MIEA 4B3RB 1QC5A 1KO8A 2E1PA 3KHTA 2BFDB 1KK3A 4KQCA 4TZKA 3ABQB 1XTUA 3NGLA 3PDHA 3TAHA 1YRQA 3PDWA 2B20A 4MQMA 4MUIA 2JCVA 4WNCA 2I6QA 3VPBA 3ZDAA 3TNDA 5KC8A 3C1AA 1B76A 3V2IA 3ZYZA 4L2IA 5JXJA 4P81A 5IPFA 4HRAA 1M2VB 1P4SA 3NHRA 1JBQA 2WIAA 2B8WA 1X38A 1L5QA 3H8SA 1R6VA 4QDZA 4FFPA 2QRGA 3KYBA 5E0OA 4R9VA 2QPAA 2WD9A 3CA8A 3PQ5A 2D59A 2VOEA 1SQ6A 4JVSB 2H1SA 4A9AA 4KI0A 2HK8A 3ZV5A 2W2PA 2WU1A 2ON6A 1R8SA 3DM5A 2QTAA 4QYMA 4B71A 1VPWA 4Q48A 1S2DA 2FSVA 2JJ1A 4B6PA 1GZUA 1F8FA 1QAQA 2VDNB 4LC0A 4ZYLA 4NULA 1ZU5A 3GX1A 5KNBH 1I1NA 2AOTA 3WYFA 5K0EA 5I9BA 1IBSA 4WIAA 4JROA 4O4HA 2F3SA 3S5UA 3WLQA 1RRPA 5KYWA 1OVGA 4N9QA 4J16A 2OAP1 3NHKA 3MJCA 1DFIA 3PPVA 3RNOA 4AMVA 3WTCA 2VEDA 1BS1A 2OK8A 4H7EA 3FDXA 4YDHB 4JV5B 2ZIFA 3Q5DA 1YKSA 1DPGA 3FRIA 3G85A 1OFTA 3K0BA 4REQB 4X3OA 2H17A 3LC0A 4X62B 4XWGA 3V9AA 3S1AA 1Y4DE 2NUAB 3X1WA 3E6AA 1NVEA 5AQ1A 1RWWA 4LHWA 2O7VA 3RLFA 4F6RB 4PX2A 1KEZA 4XWYA 1KKLA 1O8CA 3I37X 4HDNB 4NEGA 4WERA 3JQGA 1F4PA 1W5EA 2Y0BA 1E61A 1YBHA 4DLUA 1V4BA 3QY0A 5ALVA 2IW1A 2IYRA 3TEFA 4JUAA 1YGYA 4EGQA 1OI7A 5SV2A 4PG8A 3HV2A 2WF6A 2XUFA 3VKGA 3VHLB 1J5XA 5HYVA 4P80A 4ED9A 4TMYA 1EXVA 4MR8A 3AVTA 1YR8A 1F48A 2ODQA 3P2OA 3TFQA 1NZJA 3NOVA 3V4VB 4EZEA 1Y8QB 4LXUA 3OUUA 1I0IA 2OGSA 2NSYA 2JKYA 4KMOA 1A1VA 4D5EA 4LRTB 4N0PA 4DNFA 3TTUA 1I1QB 2NT3A 1Q16A 1P4RA 4N5NA 3WNBA 4J0CA 4GUDA 4C7VA 3VC2A 3M34A 3K16A 3E0QA 1RXIA 1YQQA 2SNIE 5FB3A 3UFBA 2XWPA 3GARA 3WMWA 3MS7A 3G6WA 3GFGA 1KO5A 4X8HA 2ZTUA 1Y1PA 3EFOA 3M6FA 4LV6A 1T4MA 4EJ6A 1TGVA 1TT5B 2N42A 2RI1A 4LDJA 4LE1A 4PZCA 4Y2RA 4A8JA 3W5CA 3CLUD 4OY3A 4L75A 3VSDA 4EB3A 5CA1B 3VFDA 3C41J 1W96A 3SKVA 2ID9A 3ISVA 3AZPA 1DQYA 1TLTA 4G5OA 4WA7A 3ZLUA 2QORA 1DIHA 1MKYA 2J33A 5EJ2A 2F17A 2II6A 2Y2UA 3LPMA 2XRFA 3AEUA 3AG5A 5K0NA 4EUEA 5C31A 2IZ1A 4FN5A 4BX9A 1T1EA 4HHEA 3B60A 3LCVB 3L0CA 4OHFA 2EEZA 2YVAA 5FPSA 1MVLA 1U7HA 3C15C 5E4JA 4RPJA 2OUIA 3PNVA 4D8VA 3HCCA 1UMDB 1DOHA 3K0AA 1Y7PA 1GL7A 2AG8A 1Y7HA 2CZCA 4RPLA 3CTPA 3I8OA 2C5HA 1G55A 3DEYX 1OBCA 1V25A 4UBJA 3DE2X 1BHQ1 1XTQA 2GAIA 2PS9A 4MR7B 3ZDQA 5CA1F 2BMDA 4MDYA 5IH3A 2YZNA 3QEJA 4B3GA 4YHBA 1ORRA 3PXUA 1KKMA 2Q5CA 4CTMA 1DRUA 5B55A 2O59A 1KQPA 3DZGA 2H2GA 2OHVA 2CZGA 5JCJD 3HO1A 4U3JA 3RC1A 3OIYA 1M5RA 1XIVA 4R16A 1DKQA 3B52X 1Y48E 2Q6LA 3GCZA 4LZOA 4XPZA 5SZHB 5AVVA 1XCPA 1SB9A 2VAPA 3R41A 1C7ZA 3SI7A 4C14A 2XGMA 2O14A 3QJYA 2CMGA 1E96A 2BFBA 3PNPA 3UW1A 1WKBA 3HR8A 6YASA 4Q3OA 9GPBA 2ASEA 4PG5A 4EHAA 1MEJA 4LYGA 2QL6A 4D57A 3PX7A 2QZZA 4ZVRA 2O8EB 2D1TA 3D6MA 1CUZA 2JEOA 4WK2B 1EMDA 1N7JA 2GEVA 1VLZA 5B6IA 1J09A 4O0MA 4JOBA 4TLMB 3AI7A 3UK1A 1EG7A 4TKLA 2VP4A 1CLEA 1EWRA 3IIMA 3SXJA 2VJAA 1II0A 4AP9A 4N7BA 3PG5A 4K8RB 3WB9A 1J24A 2CNDA 1U1GA 2QNIA 2R66A 5AI5A 3NU1A 1VA4A 2OCGA 3PJEA 5TS3A 3VU0A 4B3JA 1A2OA 1F5SA 1G20A 3ZJ4A 1QH0A 2Z2XA 1Y33E 4IOJA 3HKCB 3TLGB 2WDZA 1YU9A 2F3UA 3KAKA 3JD0A 2QN1A 4YT2A 1N2ZA 3CS3A 4U7TB 4UNIA 1KEWA 1NZDA 2ZAGA 2JIRA 3DDUA 1D9ZA 1QQ6A 3CNEA 1DTWB 2NNLD 2GM4A 1Z82A 9LDTA 3B8EA 4IIDA 3TSAA 2YDYA 2V5UA 1OA0A 2FWPA 1Z4OA 1T5DX 3ANXA 3NXKA 1EK6A 2Q4BA 1PN3A 2ZCVA 4FZJA 4TQ9A 5AH0A 2XUZA 4GBMA 1NXOA 4RE5A 1XAGA 4ZOBA 2RGXA 4AZVA 1IEQA 1YQDA 1AXGA 3VPDA 1I01A 1NU8A 2J3IA 2PZEA 1XSEA 4GL4A 4G9BA 1YDWA 4TYPA 5AOVA 4E03A 1N9GA 5FEMA 5KJCA 1NMEA 5EJ5A 3J80A 3QMVA 4F6RA 1S0UA 1P29A 3GJ5A 1J20A 4NOJA 1NVBA 3GJQA 4LK2A 5JROA 5GP1A 2Z5GA 2R68A 3R8CA 1FP4A 3KPVA 3SD7A 1T2VA 2ZRCA 3GMIA 3P9PA 4R05A 4XSVA 1KXZA 2P6OA 2DPXA 5G4LA 1P6QA 2OZKA 3GF4A 5ENVA 3OO0A 4DLTA 2NVBA 2X7JA 4RIGA 5B3JC 1D04A 1E18A 1JW9B 1ZWLA 2VHUA 4FHGA 3DCNA 3TI7A 3UWDA 4E08A 2A30A 3PXDA 3N2KB 3DL2A 3ETLA 3A1EA 3E03A 3RJ5A 4QTYA 2DC1A 3VRHA 5JSZA 4U7HA 1OAOA 5ENZA 4OEHA 3ZWMA 3M1LA 3O4HA 3L1UA 4X95A 4J8PA 1CEQA 1SO8A 2C84A 4YRTA 4CKWB 2PZMA 3G02A 4LOIA 2IYLD 3SVZA 1YB4A 1P2UA 2FSHA 2YC4C 1UJ5A 3F6SA 1QC5B 4R1MA 3H65A 3O0DA 3UMRA 1PR9A 1BMDA 4RFSA 5IABA 4V02A 4CM8A 4WX2B 3C74A 1OWPA 1X1TA 3ON5A 4YJ3F 3RYCB 1W30A 5D01A 3U4GA 4CMHA 2VIIA 4HAUA 5BSMA 1QP7A 4L2IB 3G2MA 3UHPA 4TRJA 4D4KA 5IT4A 4BU1A 4EYGA 5BN4A 4EBFA 4FWBA 1U9CA 3VZQA 3GLTA 3E35A 4LZJA 3S44A 3HPRA 4BU0A 5C5DA 2XUJA 4ND7A 1LW6E 2FX3A 2VHJA 3KOXA 4KEAA 1Z68A 4RTNA 1J7JA 3I61A 1H6CA 5FULA 3ZNQA 1PS9A 4IVRA 4RY0A 3ONVA 3L8CA 1C1XA 1E3LA 1UBTS 2HL6A 4V0NA 4OHZA 2V03A 3JASA 4TQUS 4N8SA 5IUNC 3ADKA 4KIJA 3KTDA 1BW9A 4KQEA 2J9ZB 4QVGA 2DYKA 2HSGA 2Z2JA 4NF2A 4G25A 1FNSA 3DZIA 4J49A 4A5OA 1I14A 5LKRA 2QOEA 3MSXA 1T9CA 1KEKA 3C1TA 2AOTB 4MV8A 1K8ZB 2YZGA 4KPUA 3B48A 4B6QA 1PL8A 4OVKA 2NV6A 3NVDA 4QJ3A 3KTOA 2ZIXB 5FF9A 1WWKA 3OZTA 2H1CA 3TPCA 2VF4X 3B89A 3OM1A 1TE2A 2AKYA 3A9VA 3HB4X 2ZS8A 3KZKA 4L1KA 2O5RA 1J0CA 2AD5A 2EJWA 2GTPA 4RK5A 1L7NA 3CVOA 1MC4A 3FMFA 4S1VA 3AM5A 4BCCA 1IC6A 5HW0A 5KYGA 3NH9A 1X94A 4BQQA 4P7JA 4OSPA 3U61B 4L9AA 4Y9TA 4PAMA 4CHGA 1CUSA 3BORA 4QFDA 1FU7A 2EGUA 2GARA 5D6NA 5K0JA 1B7GO 1Z0IA 5DN6D 3N9IA 3DTTA 3FKJA 5GM1A 3EUWA 1GRCA 3VPFA 5JADA 2PUCA 1RAHA 1R2QA 4LA4A 3JQGB 1N75A 3B3JA 3VZBA 4BFVA 1MORA 2G09A 2HA2A 3JD3A 4UEKA 5HG0A 1RJFA 3H0EA 4U7FA 3L7NA 3RBAA 3BOSA 3ZUPA 4BWFB 3FNQA 4UNRA 1XG5A 3JWPA 2DUJA 1EUCA 2VP2A 3OZBA 1NE7A 1WW3A 3IJ5A 4MR8B 1R0ZA 2GZ1A 3A06A 1DINA 4PANA 4HAYA 5FA6A 1U5AA 4UVDA 3PUHA 7REQA 1PU2A 2KQUA 5EPEA 5ESRA 3NIWA 3IQIX 5THXA 3WGQA 1MIHA 1HK7A 1T34A 2HHAA 1X8KA 3FJYA 3WXBA 4E32A 4MUAA 1XEWY 1H42A 1YE5A 1DKNA 2F7SA 1R8YA 1MHPA 2WJYA 4ODIA 4PZDA 2HTFA 5DHFA 2EP8A 4JGGA 2FW8A 1E7SA 1MP0A 2JPDA 4FHZA 4Y6OA 3THYA 1ONOA 2RH5A 1ULZA 1Y6JA 2G17A 3EFOB 4R8KA 4WKBA 5EMMA 3EEOA 1YJQA 1EBFA 2HBZA 1BDHA 4A8JB 3ABRB 4JELA 1VTKA 1SOVA 1Z37A 4HSGA 2RK4A 1EGMB 3DOEA 2Q27A 1T15A 2Y1EA 3NJ8A 4B9AA 4J4BA 2NVUA 3L4BC 2R8YA 4IXMA 1E3IA 4IHJA 3R5FA 4JCOA 3IV7A 5K8TA 1C7FA 1Q92A 1X7WA 2X76A 4Y2UA 4YP1A 4HVAA 2V6BA 1YWGO 4DV3B 1YOBA 2JFOA 3BZWA 5FPQA 1T2UA 3RTBA 3OX3A 1F8UA 3D8NA 4IRUB 4RWZA 4J90A 3W6PA 3ZDBA 3K0AB 5FAXA 5JASA 1CKEA 2VJKA 5B4VA 2NSLA 3AI2A 4NYIR 3V8MA 4AROA 5ALXA 3H11A 4BLUA 2GBLA 3LQ1A 2IYWA 5FBKA 1BWSA 1SQFA 1HZZA 4BO1A 1V6CA 2AKAB 1KXJA 1A9PA 2JAHA 3ICVA 2DB3A 2YIVX 4WXHA 1Q0LA 3AXSA 3G0CA 4JJZA 2JLVA 3Q12A 4TS9A 2LDXA 4U3JB 4NP6A 1FBNA 2G4CA 3HPQA 4UAUA 1HPLA 3RVPA 2QVZX 3S6JA 2VTEA 3VVLA 3IXQA 4PBTA 5KCZA 2XKBA 3ADCA 3V4RA 1BWPA 3U39A 3NDBB 4UCQA 1F1JA 3BL8A 3LDHA 4P4SA 1QO9A 2BFBB 4YI5A 5TJ9A 3RC7A 1Q0TA 4HJXA 2R8EA 3RVJA 2HJHA 4KAFA 3BHNA 1M8KA 2DPHA 1DKRA 1S1MA 1TRHA 3T9FA 5I51A 4AKGA 3KBBA 4PC3A 3THOA 4AG5A 1X3LA 2R00C 3PIDA 4JUFA 3GD7A 4D6YA 1D5WA 2WFZA 1Y3DE 2M6SA 2W4IA 5H5JA 1NU6A 5EQJB 2N1BA 2C8JA 1TMOA 1BDMA 1PX2A 2RSLA 3AJ9A 4JGIA 4RVHA 5JNWA 3U49A 3SEZA 1MRSA 3MELA 3EE6A 4CM3A 3IDQA 4JU9A 4DIMA 2YINC 1QKKA 2ROQA 1G20B 3UT0A 1VPTA 3VR6H 4A03A 3TZKA 1GA1A 4C7XA 2FWNA 4E15A 3KKMA 3O8BA 1WV1A 1VI2A 4EUKA 1JMKC 4MZDA 2B0CA 4CG1A 3JD4A 2ZQ5A 3OLXA 2FUG6 2J5BA 1XU7A 3TNYA 2QG6A 3FIJA 4IOLA 3DF7A 4IIVA 1KZ4A 4FHDA 4P3PA 5EKTA 3QHPA 5L53A 2J87A 3A9SA 3MUEA 2J85A 1GSIA 1KRXA 4I4LA 2YVLA 1HY3A 1US8A 1HFWA 3D6AA 4W6QA 3C3XA 3NDPA 4C0XA 5TVKA 2DKNA 4LBWA 2FSGA 2Q6OA 5JZVA 3DLHA 1IFXA 1WLYA 1CJSA 4CMIA 2BPOA 2D2XA 1YQ9A 2ISSD 4O8CA 1VLVA 4TRNA 3KAJA 1ZSYA 3HJFA 1N9GB 4EW6A 1ZNQO 1LX7A 3CZAA 4H7HA 4HFMA 4J1NA 5JQWA 3QHAA 3SHQA 3VO1A 1UBGA 2JIMA 1CJVC 2EC5A 1CIVA 1TM3E 5DBIA 4EB8A 6Q21A 4LV8B 3DBOB 3RSFA 1WULS 3CX4A 3V7FA 2ZCJA 2XVXA 4H1VA 1FP4B 3PGKA 1C4KA 1E1YA 1II8A 1O89A 1QX3A 2B8EA 2IC5A 2OP0A 3BDVA 4A6EA 4K28A 2HY7A 4MUBA 3EK2A 1ZG3A 1VPDA 1A7AA 1Z8NA 5AKEA 2FW9A 3L41A 2FW7A 4K6FA 4AICA 2ZUEA 2WIBA 4QUBA 5IJ9A 5K6TA 2CHUA 2MCFA 4UREA 5I9SA 2XNKA 3AILA 4Q7LA 2BOVA 3RS4A 4X7BA 1XPRA 2DUMA 3O94A 5JSZB 1MBZA 1Z2DA 3PC3A 4FQ7A 4M0PA 2GZ2A 2UUOA 4W63A 3A6KA 1AQJA 2FKAA 1N9KA 4MWSA 4JHXA 4Q3CA 3WYCA 4EEKA 2QBYA 1QONA 1WHSA 1E3MA 4MYRA 1WOMA 1A9YA 2IUFA 3PQCA 3BE5A 1PQ4A 5EERA 3WFIA 3RVOA 3VQTA 4PLFA 5E1DA 1ZCJA 1HNNA 1O97D 2PO7A 3OJOA 2HA6A 3FPJA 3IQHX 3IHTA 3OQ1A 3PQFA 4ND6A 5ICEA 5FFFA 1E60A 1T1RA 3I6YA 3OG9A 4H4EA 4TV8F 2Q1WA 3D6UA 3PX3A 5BN4B 4CYMA 3VPXA 2X0JA 1FQOA 4IGAA 4Q18A 3E82A 3KZVA 3OBIA 1YAHA 4AIIA 4BZZA 1DQRA 2K5UA 3WLPA 3AOGA 1YV9A 3OE7D 1GV1A 3UM9A 4U0KA 5TR9A 3H83A 3SHFA 3TH5A 2CCJA 2KI5A 4A7PA 1C1XB 3KSRA 4AF6A 4MKFA 3JASB 1IXKA 3BMOA 4UASA 1XWFA 2W6JA 2A9VA 4JC5A 1BW9B 4R9NA 5BURA 4TQAA 4F72A 2XITA 2YH2A 1GNSA 5HS6A 2AEEA 4XRGA 4Q47A 1FTGA 2WMOB 1YVDA 1SHKA 5ALJA 1WXEA 2QGFA 3T38A 2VL7A 3GQVA 3UOWA 5HUJA 3O84A 4KPUB 4NHOA 5JJ5A 4D3XA 1SUDA 5H8WA 4QNNA 5C3UA 1OJ7A 4QFBA 2P2NA 3WLIA 3Q11A 5EA2A 4R6XA 3UA4A 3W04A 5JAZA 1FRQA 3CVYA 2HV9A 1XPOA 3K6KA 4RWEA 4FWTA 2YW9A 1OIXA 2NXWA 3DZBA 5AKGA 5JPDA 3R7DA 1GG8A 1LI7A 2D4HA 1LC3A 5K3SA 3ENQA 5JHHB 3PKIA 1NUPA 2PXHA 4FZ3A 2HGZA 1C1YA 2B94A 2YS6A 2UYGA 13PKA 3OEEA 5CTJA 4UFOA 4HXGA 4DWWA 3PTAA 2PT5A 1XK6A 4LSMA 1XMVA 2P9GA 2ZU6A 5IK2A 1MDFA 4EA7A 5DX0A 2ACWA 1YK0A 1ZH8A 2WMDA 4JK3A 5FXMA 5JD3A 2Z9BA 5ULLA 1VG1A 1N0WA 1EUCB 3R3VA 5AJYA 3MPOA 5AR1A 1IOZA 2EDAA 2FEPA 3V55A 3WP1B 2AOXA 1PGQA 3GFFA 4GX2A 5IC5A 4AIRA 4BP8A 1DIOB 2JD2A 3LPNA 2IYVA 3DUFA 2CNOA 1KOFA 4BNNA 4ZDJA 5DNEA 3T61A 3RHTA 3RJTA 5LMUB 2YN2A 2P2LA 2EJBA 4A3SA 2UU9B 3RVBA 3R7NA 3T4EA 4GD3Q 1PJRA 2WK1A 1E7RA 3O5AA 5EXDA 5CCBA 1KQNA 1RQNA 1KE1A 3FYSA 5DGDA 2VUUA 4OGKA 3WGNA 5BN5B 2HD4A 2IZOA 3R3XA 1XFDA 3E84A 3WGJA 4Z7NB 3LW7A 4IP0A 4DLYA 2SICE 3THYB 2Z08A 4U9HS 2V5AA 3T4PA 2OXEA 1ZJWA 1JFTA 3ZVNA 5HM6A 1JT2A 2BM8A 3VNSA 1Z8DA 2W48A 2REXB 4Q1CA 4X1OA 1MT0A 4H77A 3KEOA 3DNPA 3MW8A 3V00A 5JTTA 1BG6A 1WDLA 5FRDA 2V7WA 1KK2A 2JA2A 2NVUB 4PY2A 4LF9B 4ZEVA 4CKWA 1UBOS 2HW8A 3FB4A 3SBXA 1X7WB 3FOZA 2CXTA 2BBWA 1A0OA 3IKMB 1W8IA 4LHZA 3E9YA 4JQYA 2DPLA 1PEKE 1T3LA 2OC4A 3JQ7A 1LDEA 3FNFA 2ZB3A 1HRKA 4UNSA 4B9EA 2CMFA 4LIPD 4HVLA 1DBWA 3FCSB 3N3AC 4DJEC 3NASA 2WLSA 5GJCA 4XWWA 4LNUA 4LHEA 1UPAA 4H08A 3VR4D 4LEIA 4RZIA 5IHPA 3AF1A 1TK3A 3UMCA 1FDUA 3H11B 1L1FA 1CTQA 1NMSA 3MUOA 4RLHA 2PS1A 2QVYX 4YRZA 1Q0PA 4FOOA 4ZVVA 4L16A 3GO4A 3X1JA 4QDJA 5TPZA 2J30A 1XQWA 1KBZA 4KQHA 4EF5A 5FPHA 1GGJA 4LSZA 4PQRA 3X1XA 3HNRA 1O58A 2PLAA 3BBLA 4OK3A 5LB2A 3PEWA 3BSFA 2VHYA 4YJGA 1LBQA 2DFKB 2Y1WA 3KV1A 3PICA 5TLSA 1VJRA 1B0AA 1YBFA 3DMYA 4P4SB 3I2FA 4FKZA 2PUDA 4MUGA 1Z0FA 1YZFA 3V7UA 3GJZA 2AYYA 3A0UA 3HU3A 3JAKA 2X0EA 3WWEA 2QBYB 4DG5A 5F98A 4XQ9A 2PUVA 2V9CA 4LRWA 2M98A 2SKCA 4P3KA 4BGVA 2ZTVA 1BHO1 3A3NA 4K87A 1J23A 2H0AA 3G2QA 4YUZA 5JIBA 4HC4A 4RTSA 1SXIA 3LOQA 1FFBA 2MYTA 2B1GA 1XMSA 3P2KA 4YUWA 1OFUA 2A9OA 1XK7A 3F96A 4JDUA 1SKUA 2AXEA 2I2WA 2WSSD 3H8WA 4IZIA 3RYHB 1HETA 1TVKB 3UQZA 4OD0A 5JO0A 2V6MA 1O6BA 1JEDA 4S1NA 3QEMA 3WO1A 1QQ7A 2E4XA 3AIOA 4G63A 3B6KA 2J41A 3P26A 4IXDA 3WK7A 1W46A 5C35A 2RB4A 1YUBA 2UZ0A 2CVQA 3M9LA 4PZZA 2FWBA 2XJ9A 5DHAA 3CNLA 4ZOCA 1FUEA 3TECE 2BZ0A 5EKDA 1W7AA 1QE0A 2BJWA 1YQUA 2IXAA 2RGDA 3NKVA 1EB9A 1QIIA 2P2CA 2Q5LA 1RBMA 1KMMA 3AR9A 1US8B 3FOCA 1UFQA 2C5SA 3EWIA 1E7QA 4LW8A 4RFLA 2FPGA 1QJCA 1RRFA 1CETA 4IV5A 2R5NA 1VE6A 1ODKA 2Y6UA 4KI7A 2RJOA 3W1EA 1WF6A 3JU3A 1OLUA 1THMA 3EIWA 4GT1A 3DLTA 4AUMA 4R2HA 3VR6A 4RKFA 5K8LA 2IUTA 3W7AA 4N4AA 4R7ZA 1W581 1U2RA 3DGFC 3IEIA 4AUEA 5KTOA 1LC0A 5JPIA 3L8GA 5MFPA 1II8B 3EPRA 5CG2A 3S8EA 2GLUA 2ZT5A 1UM8A 3E7FA 4FR2A 1UMBA 2JG3A 3VDXA 4F86A 1TCBA 2JDIA 4BN0A 1DNPA 2GAOA 2NLOA 1FRNA 2R2AA 2YL2A 3AX6A 3WZ2A 4JVOA 1ORTA 5CB0A 4M88A 4XM2A 5IJ9B 2QGZA 1RYZA 1SG6A 1G5FA 3WMXA 4AWBA 4BNHA 2CYBA 4QUDA 4HBGA 5JD4A 1GGVA 1PJCA 2HU8A 4QXOA 2NP6A 1V8PA 3PVCA 2FN9A 3DZCA 5BUQA 2NX2A 2AN5A 2OO7A 3UUWA 4JUIA 2Z3WA 2E2WA 5DBFA 3Q10A 2M1XA 3PR1A 1WHSB 1D6MA 2AL7A 4MA5A 3WGKA 4H4DA 2Q07A 2G40A 5KHLB 4XWTA 1D5CA 3PGA1 3WBFA 1VCOA 3M5DA 4F6CA 4D81A 4XWOA 2GN9A 1DBIA 2B69A 4JEMA 1GVNB 2REBA 5JS7A 3ETDA 4N76A 2QVXX 3EWNA 3HB7A 4XLTA 4XRRA 4LX8A 1KI6A 3LXMA 1J39A 2I03A 5AK0A 5JXWA 5IAAA 1CCWA 5L3VA 3HCWA 3T12A 4UXHA 3ZHBA 1OAKA 2DMRA 4OQNA 2QX9A 1WBBA 2C5EA 3F7NA 1KJZA 4RGQA 5FDFA 1DPFA 3DZHA 1AK2A 1L4EA 1WXXA 5DXFA 4CI9A 1GNLA 1PSWA 2VR1A 3TSCA 2X7XA 2VQDA 1RQ2A 4BHTA 1QHNA 3BMOB 3ESQA 5HCNA 3ZW8A 2R9VA 3RARA 2QW8A 1VL6A 2Y9MB 4JDPA 4DLLA 1Q1ZA 2TSYB 3FIUA 3GNTA 4L5BA 3B7WA 3BQNB 4OA5A 5CLHA 3LVQE 5KTTA 4YAIA 1OXXK 2IYSA 2Y76A 721PA 3Q9SA 5LD2B 3G68A 4L6AA 4R5MA 1ECJA 1G8PA 3F7TA 3HBLA 3PQ4A 4BC0A 3IURA 4C6TA 1TYZA 3DLBA 5EIFA 3FYCA 5P8WA 3H5IA 3YASA 3ZHTA 5E6SA 3O4IA 4G65A 1PFWA 2CHVA 4E4YA 3MTAA 1Z38A 3IOBA 4XIFA 3G1WA 4DDTA 2RGNC 5IVHA 1LK0A 2QLNA 2LCIA 4IQGA 2LR0A 3OX4A 3Q3VA 1XU9A 3UXEA 3JPYA 5EI5A 2IYYA 3I1FA 4FILA 3SDZA 1H3EA 1YS2X 4D4MA 4URXR 2QTHA 3Q5GA 3QLTA 5DTQA 2V1UA 3R5JA 2EZ8A 3ZGNA 1RBZA 3MRXA 1W4CA 3FRJA 5HUHA 1IN7A 1UT6A 4IO1A 4J6EA 3SXPA 2ZWAA 2JCSA 1IH8A 2QQ5A 5HIMA 2IPNA 1TJ5A 2P5YA 3EARA 1QH1A 2A84A 2X2EA 1DC6A 3UANA 4MPTA 1XALA 2D5CA 1PZGA 5C4IA 5A2QA 4F7WA 2MWMA 3IL2A 2QSJA 1RADA 2WDPA 2RIRA 4Q4JA 4QPJC 3SBOA 2BRUA 2FP4A 1J42A 4GSLA 4PIMA 2PS0A 2QYHA 5BNWA 3R0XA 1DAHA 3QPDA 1E9CA 2FVYA 3DUFB 3VZDA 2FMHA 2VJYA 3EDCA 4YQZA 1Z29A 1KI1A 4R8VA 1YE3A 5D7NA 1ESDA 1XELA 4XM1A 1WB5A 4PGGA 2QENA 5EJ9A 4Q39A 5JEEA 4L8FA 2VDWA 2WKPA 2Z8XA 3UJCA 1H2WA 4ZMSA 3AR4A 3UVEA 2IX3A 3S8YA 3QEKA 4CQMA 4HAZA 1E2EA 5GMOA 1VXOA 2XA9A 3O82A 4NPCA 2C2XA 1NXVA 2HXSA 4LXIA 4XVHA 5B1IA 3HL0A 3KZOA 4YR9A 2QW1A 3OPXA 1SOAA 1FZQA 5AW9A 1T0UA 4O2RA 3R7AA 1PT7A 3KUDA 2Y68A 5IVPA 1TEXA 1CQWA 1E92A 3RC3A 3SR3A 4CPDA 2ATIA 1TKBA 2DHEA 3A2LA 1QB8A 1GEEA 1C7RA 1EVEA 2JGEA 4TSFA 5I7WA 1FY2A 1FU8A 3G2JA 2WG1A 1SN7A 1UDAA 3ZJUA 4QOFA 2IYQA 4RSRA 1SRQA 5B2FA 2XZLA 3SZLA 3HVJA 3JQ7B 2XF8A 3E22B 4KWTA 4JBNA 5EIOA 3BWVA 3K0KA 1KDOA 2WTEA 4H7PA 3A14A 5BVGA 4LNUB 4G5QA 2IS2A 1RYFA 2PZKA 3QKSA 3NAGA 4FFBA 3EQZA 4Y18A 4C3OB 3GEIA 1K7CA 3ZEAA 1YQTA 2P4EA 2YWGA 3DO8A 4B4OA 1DWOA 1Z36A 2V9PA 1K66A 3HDGA 2P68A 3MRTA 4G8BA 4WFQA 2XNHA 4WGFA 2VKQA 1QTNA 2DSTA 3G9ZA 1AKMA 4CEJA 2CLMB 3O8QA 2CLHB 3GFPA 2H7YA 2P1RA 2RHRA 2QUBA 2C78A 4TOIA 3NBYC 5CT9A 1SURA 2YIJA 2IV7A 1E5DA 4JWTA 5C37A 1RP7A 4UPVA 3IC5A 4GOLD 1VE9A 2AJ8A 1NM5A 5ALFA 4HGQA 4B2IA 2XYVA 4YJGB 4R0MA 1TUGA 2Z6UA 4WJLA 4BVAA 4C4AA 1JTEA 1CB0A 1PQWA 2C77A 2X8LA 1L5RA 2C4HA 2Q50A 1IHUA 3MUFA 5T41A 5AW4A 1AHNA 4MX8A 2NU9B 1WABA 2VHEA 3NUZA 1GY8A 2FN4A 2RJNA 4BWVA 4AMZA 2G9VA 1FTYA 1HL3A 3H4TA 3JPWA 3JAKB 5M2QA 5IVKA 1JALA 1T6XA 2J59A 5KWJA 3WNQA 4B74A 3HDYA 3PHBE 3RT7A 1XMIA 4QTXA 3SC6A 2X8WA 2FOXA 2WJPA 1D3AA 3P2EA 1A4XA 1I10A 4PO9A 2G4VA 5FOVA 3OT1A 2GO1A 4PXSA 2ZUSA 3QBDA 2BI8A 1UZNA 3QV2A 4F9FA 5KINB 1GPJA 3G2NA 4JX8A 4TYYA 2ZWIA 2B6HA 3C1UA 6AT1A 3DHEA 4IYRA 3QEMB 2AZDA 4HQKA 4K5QA 4UMVA 4Z4HA 1CR6A 3K2QA 4Q05A 2E1RA 5L95A 2GDZA 5C4GB 2PKYX 2R8PA 4MIKA 3E9MA 3ESBA 1T91A 3QFTA 3HBAA 5AJTA 5LB4A 5KJ1A 2VK1A 1DLIA 1DAIA 2PGNA 4ITUA 3AXTA 3ZHZA 2AN9A 1QK3A 3O83A 1XT6A 3CGGA 3LT2A 4MPPA 3EPJA 1SBQA 3QPCA 1SH7A 1MOQA 2X5JO 4ZJUA 4JNKA 2JCYA 3E0XA 4YFVA 4UQLA 3OZDA 3O74A 1RDFA 3MOGA 4Q6WA 5EZQA 4ZTBA 1H85A 1U80A 1ZIXA 2EQAA 1LS6A 1XDSA 2ERCA 2FPGB 2NXNA 1CBUA 1P77A 4DIUA 5CLJA 1X7GA 1OLUB 4IXWA 4OMDA 3ZE0B 1GXSB 5FQNA 3SSAA 1MUUA 4AJJA 3UIEA 1U8TA 3UGJA 1HE2A 2DPYA 2EL9A 1LSJA 2FCRA 3C6QA 4P0QB 4RA6A 1F20A 3NBMA 1IOLA 4RZXA 4F6LA 1S2IA 4HUQA 5BMVF 4A0QA 1BEUB 1LK7A 1VG9B 1UBUS 1KE2A 4AJNA 2O7SA 1UMBB 1RWNA 2R5WA 3WGTA 4S2EA 2LUOA 2YOFA 3AFIA 1AXRA 3LXUX 5IM4A 4C87A 4US2R 1OA1A 2QRVA 4C78A 3HXLA 1GLVA 1JN0A 3UH0A 5IH7A 4PEVA 4IFBA 1U0OC 1GU7A 4MQEA 4XLLA 4DBLC 2YMQA 3TCKA 1Z88A 2NG1A 1MGPA 4YC7A 3HLTA 3N05A 1T4DA 3U7HB 1YOVA 4CEHA 2WJIA 4NIMA 4O59O 4P4UA 1NSFA 1XEAA 3HXMA 2YVUA 4F3KA 4BJ6A 1L7BA 2R1TA 1IAQA 1P9OA 3AUFA 4JODA 5IKMA 1RAFA 3RVDA 1MZPA 1UBKS 3JARB 4CNBA 3BTSA 2Z5FA 2A35A 2P5SA 3ZGVA 3RKUA 2VS1A 4RGYA 5A7HA 2OWDA 4RU1A 2J9GA 1KI6B 3CLTC 1Y1QA 4CKXA 2I99A 1TZ2A 4F0JA 1SHZA 3ZXUB 2CGEA 2GPTA 2PXAA 1E3DA 3RUEA 4V03A 1IN6A 3T5BA 4EZIA 4F85A 4QREA 4JXZA 1JQEA 3HXQA 1Q0HA 1M0WA 3UA3A 1V8ZA 4Q7EA 3GD5A 2I9KA 4EI7A 4OHRA 4JSTA 1M2OA 1MQAA 5AHKA 4BLRA 4YP9A 4L7QA 3IHWA 1QGUA 4ZVLA 4KACA 4HH4A 3X1KA 4D9NA 1ISPA 2JHFA 4E33A 5HZKA 4GUAA 4LXHA 1XEXB 3COYA 3FPBA 2HQ1A 3OOYA 3TKAA 1D2MA 2BEVA 1Q7GA 2BAGA 4XOIA 1N25A 3RC2A 2JIPA 1AKNA 1X1EA 5GGYA 1IJFA 4BLOA 4PNEA 4PSKA 1UCFA 1JJFA 2EJCA 4P31A 3ZDRA 5FD8A 1G0OA 3MS2A 5E6SB 2FW6A 3S2ZA 2HIGA 4S12A 5D1HA 1G42A 3R7LA 2P6UA 1DQNA 1ZBQA 5DNCA 2FHSA 3I2JA 4N18A 2JGDA 5ARBA 1J1UA 5EUQB 1XMXA 4UCWA 2P2ZA 3DP7A 3PITA 2Z4SA 2LBPA 4GU5A 2C2WA 4JLAA 1A5TA 1SCKA 2C5AA 2WB2A 3GMTA 4BMNA 3VO9A 3A1TA 1WVIA 1JQAA 1RSZA 4CT0A 3I9NA 5EVCA 4E22A 3OX1A 5C2JB 4UPDA 3I28A 2XCOA 1OFGA 3PLNA 4QT0A 2C59A 1DL5A 4RYLA 1QH1B 4BO7A 3I9KA 1JHRA 1FNBA 2H54A 3QIAA 2QR2A 4BTLA 4N3BA 4DYDA 2RGCA 1T8TA 1NX6A 4RZUA 3K1YA 3V8VA 1R1DA 4WBNA 3FFWA 2HPVA 1RPAA 1PBTA 5A7FA 2GJSA 4CFSA 2ZI7A 2PYDA 2Q49A 4Q4JB 3V1MA 2ONJA 2FP4B 2LKDA 5CDUA 2RB5A 3IX7A 4JASB 3D5EA 5BVHA 4US1R 4NCBA 5SY4A 3OZWA 3H19A 1TADA 1FDIA 1O5IA 2SBTA 4RDXA 1EIZA 3GA0A 3PQDA 4ZOLA 2OFFA 3UMVA 1YCGA 3RHZA 5JAUA 3LFHA 1KIAA 3MTGA 2VDWB 2VP6A 5FNVA 1G5RA 1M1YE 4M1YA 4URYR 5T67A 5FL7D 1A9SA 1U2ZA 4QQKA 4OO3A 4P36A 1D6SA 2G63A 3P97A 4ZHQF 1X7XB 4Z5XA 1D1TA 2DBRA 2JNWA 4YCAA 5K05A 1Z0AA 1BX0A 4QTZA 2ETVA 4F4CA 4R41A 1BKYA 2ZI4A 2FQ1A 4XM0A 5BV1A 1ZHOA 3A1VA 1P61B 4U5QA 3IH5A 1G16A 1RCTE 3IQGX 4MCAA 4W8GA 5TDHA 5EMHA 3OSUA 1E4YA 4HDRA 2VXCA 3U4QA 1YIOA 3LS2A 4TKUA 5F3WB 3NV9A 4H7DA 3VH3A 3M33A 3PEFA 2G6TA 2E4YA 4D45A 3C16C 1VE5A 4K6HA 2FPUA 5EJ4A 2GPAA 3D4NA 1KIMA 3ELDA 2H2HA 5BVGB 1IZYA 4JT9A 3SEFA 4C0LA 1JEYB 1STOA 3QKSB 4S35A 4QLOA 2A0KA 1GPKA 2POCA 4DWVA 2H07A 4MQ4A 4I8IA 3SSMA 4OBXA 4PYQA 4BE9A 1YS6A 5ELXA 4BXOA 3PZRA 4MAMA 3WRWA 1Y7IA 4H1HA 4KNYA 4PFJA 3TJRA 2DLDA 3GLKA 3LNCA 3O8QB 1E0DA 3EASA 1N7GA 2XLCA 4C1BA 1QYWA 3IR7A 2XVAA 4DMKA 2BLNA 4E5NA 4PONA 2GSWA 4ZAXA 4CDRA 3DPIA 1XZGA 2BSXA 4KNWA 3ZNPA 3DZJA 3WRVA 1F0PA 1LLFA 4EQ6B 3L7AA 2XMCA 2I4IA 3M2PA 3OQHA 1JHOA 4TYQA 2ZG6A 2HX1A 4X41A 4YK7A 3RFTA 1VQ1A 2EOAA 4R2JA 1GKYA 3RAJA 3ITDA 1JPNA 4U9UA 4PC2A 3RIXA 2JVKA 2OQ2A 2YYZA 4BOYA 4R8LA 4QDUA 5CMLA 3UAZA 4C6RA 5M04A 1TGYA 4XD7A 4URVR 4QULA 2PIAA 2CLSA 1J9ZA 1U8CB 3DFZA 3QIVA 1BGXT 1PD1A 2Z4TA 4DRZA 3OT1B 3TUIC 4FWIB 3W5BA 3RAPR 3C6XA 2YXBA 4HAWA 1UZAA 1ND5A 4F93B 2AMJA 4QA9A 4TT3D 1EJ2A 1IWBB 2HO4A 2IDJA 5HKKD 4M0FA 1GFIA 3KKEA 3FPHA 3IV6A 3AVVA 4ZDIA 5L7YA 3P0RA 2X3YA 4OQEA 5DNVA 3HS3A 5B6JA 2WJGA 4OAQA 1GL3A 5JMTA 3TMYA 2F3RA 4DSOA 1IHPA 2O3TA 3K2IA 3ND5A 2IGTA 1B3RA 4G5YA 2G0NA 2NO5A 5F21A 1KARA 1W88A 2GZHA 1WW8A 4GPD1 1U1CA 4G3XA 4C0AC 1PHRA 5HIJA 1NVWQ 2PBZA 4D4IA 1A7JA 2BTQA 3QTBA 3B2NA 3QUBA 5E1OA 3WLLA 1CUCA 1GNRA 1FRZA 1SHTX 5I48A 1Y3IA 1WUHS 4JC8A 2O8DA 3DOCA 1T9HA 3TBKA 1EFDN 3WAGA 1HORA 4PLGA 4QU8A 4UMEA 2C31A 2CFSA 3IAAA 4RPIA 2HB6A 1K5DA 1EYZA 4RA6B 3TNLA 1KFCB 3UICA 3WNDA 5IKOA 2A1TS 3HU1A 4ZMRA 2PV0A 4RMGA 3LFTA 3CVVA 3SKXA 2TMDA 3HMKA 2YHAA 3D6HA 2Z5LA 3EVGA 4MQFA 2FE4A 1CDEA 2Q9CA 4J0IA 2PSFA 2GO7A 2QUAA 3CJTA 4XGQA 4RLFA 4E3WA 3L0PA 4MLDA 2I2XB 1XV5A 5LYJA 2QQGA 5A62A 1EDOA 2QRVB 2B4RO 1FCJA 3PRYA 3I45A 3PC6A 4ILEA 1W0JA 4TMZA 2EKBA 2JFQA 3FCXA 4UUPA 4MQEB 3SF0A 1NATA 1PG5A 1UJBA 1JB1A 1WDTA 3EOZA 3AB8A 3JV7A 4HD8A 2KM1A 5LZ4A 3A2KA 3VISA 3G8DA 1EPUA 1TUIA 2YFQA 1VG0B 1YOVB 3L1JA 5DX8A 2OHIA 3GJ6A 3SQLA 4YYEA 5AUNB 3IRUA 4CEHB 3KOWA 4K7JA 4LQLA 4NY1A 3OE7A 1OR8A 1T1SA 1JXQA 1TKRA 2J4DA 2YR0A 3DPSA 3GG9A 3K0FB 4G4SP 4DXHA 3H86A 4KLCA 1FXWA 1IHOA 4F5WA 3PFNA 3IXMA 3U62A 1I6MA 4LXGA 1NF2A 1K4KA 1U1FA 2ZDHA 3DDZX 4LRUA 4CODB 2QTGA 3L8EA 3CWCA 2R7NA 3D9QX 4MRRA 2C4VA 1W36B 2WZDA 1P1BA 2IEBA 4MYCA 1L4NA 2E55A 3IOEA 1U8YA 3C5EA 4HQRA 5COQA 5JAPA 1TK9A 1YS9A 2JFXA 1LWNA 2O0LA 1JTFA 1CS0A 1ZKDA 2WNHA 3RSZA 3BWXA 5CLLA 3O9ZA 2RGYA 2DHQA 1FTQA 2DOKA 4HFNA 4M98A 2ZDQA 4WUTA 2C3UA 4JOQA 4YRJA 2ZRGA 5LQCA 2X86A 2BGJA 1YDGA 4ENTA 3RUIA 4J2HA 4XQGA 1QGUB 5A4IS 3R5XA 5JSKA 4YY3B 4J2TA 3E1KA 3HYCA 4OQFA 1RCUA 3B6MA 4MGHA 4XIIA 5AJUA 2PUGA 1JGTA 2BEVB 1OOEA 2KYRA 4LN1A 2WWTA 3TQRA 2XOKD 4TVKA 1JKIA 4FE4A 4D8TA 1Q1QA 5CR9A 3IESA 2JF0A 2HNBA 3G88A 2YWXA 4Q37A 1F14A 2QPLA 3K0HA 5EIBD 4GP6A 2PSEA 4A16A 2QL7A 2QW0X 4C2BA 2A33A 4QFCA 4WEOA 3GA5A 2JGDB 1RE1A 1T6YA 3HCBA 4PRLA 3REGA 4RGBA 3V4PB 4IMIB 1FW6A 3FYDA 3PCXA 2W22A 3QPAA 4WNYA 2QMYA 3HWRA 4JI5B 3ROGA 1GIAA 3UN1A 4YGYA 5I3ZA 1VBNA 2LP4Y 3A4MA 3U26A 4IDGA 1GPNA 3ONNA 4BP3A 4X8OA 4DZRA 2R1UA 2Q0SA 1U81A 2VDRB 4LDZA 1FJGB 1JMVA 1YRYE 3VBEA 1TVCA 2PD4A 1ACMA 5A1JA 2IEAA 3H75A 3F3KA 4LYAA 4I50B 4M1MA 3VTFA 5DHQA 4WBNB 2RE8A 2XBMA 4FQ5A 4YQEA 1UOEA 5FWXB 4NMMA 4ITRC 4LHYA 2K7ZA 5FV4A 1B0UA 2ILVA 1Q7BA 2MSEB 2GZRA 4QELA 1HC7A 5C1OA 1PFUA 2HQOA 5K0TA 3R0ZA 4AWXA 4BDTA 4I5GA 5IJXA 3BN3A 3OOHA 4BX3A 2ATEA 2IYOA 4ZOLB 3RASA 2ZSDA 3NHUA 3ONDA 4KBGA 4ZQEA 3T3PB 1XR3A 3WK5A 2F62A 5AKLA 4ARCA 3FI0A 2BTOA 5FNVB 2G5PA 3ESRA 4D46A 2HCJB 2XOXA 3I9JA 3HZHA 1UKBA 1N2EA 2ASVA 4O8ZA 3DQPA 4X8LA 3PC4A 2Q29A 3VR3D 3ENKA 1HG0A 2Z04A 2JCGA 1K86A 1ZIPA 3IMCA 1R8QA 4I50F 3WGZA 3W06A 4JS0A 2BEJA 2WWXA 5DM60 1O3YA 5LLSA 2CLKB 2O0JA 2Y66A 4KZKA 5DXJA 2IYXA 2XUIA 3I62A 4DMGA 2HA3A 5FTJA 1V4NA 3ANMA 2J48A 4MI1A 5NLLA 4EW1A 1O54A 4Q34A 1G8GA 1H23A 3VR2D 3I2YX 4F4UA 4HDRB 4ZOLF 1TA4A 4BMVA 3U4QB 3PUWA 1KYIA 3IODA 4TKUB 4RLQA 1XMQB 1QIJA 1M54A 4PTYA 4BX2A 4ZCRA 1GTG1 1Z6PA 4TKMA 5F9FA 2GNPA 4M7RA 1OU4A 4YPOA 1UDWA 2DWPA 2VI5A 2XAUA 1TAHA 3QX8A 4ARZA 1SXPA 4O6VA 1PJ4A 5EUCA 1ZL2A 1TA9A 3AV0B 2O8NA 2O07A 1DO8A 4LJ6A 2IHVA 4NMWA 5DM70 4HX2A 4POOA 4WY5A 1IOVA 4PV7A 3B9BA 4EKNB 4ML3A 4D5GA 3N2GA 4CV0A 2ADFA 1K7SN 2VVTA 4UUNA 5J2UF 2WFMA 4MVJI 4UHDA 3O2SB 2KX7A 5FI0B 4YECA 1LF0A 4MS4A 4BXOB 3O9MA 4M0LA 2ORWA 3PRJA 1L3BA 4CMAA 3DKIA 3IA7A 2LIPA 2XUDA 2R6ZA 3AHGA 3H87A 1Q7CA 2YX1A 4PIPA 5K20A 4D9IA 4YQYA 3KVNA 1VGRA 1KAQA 2DKOA 2QP4A 4NOKA 1W9HA 2IZ7A 5HK9A 3VO2A 1UODA 2R62A 4QYXA 4B40A 1XLTA 1U7XA 1W0KD 3REQB 5KDDA 5KTKA 5CX1A 4MB0A 2PUWA 4DWJA 2I78A 4D3YA 5KOJA 2YJ4A 3PUKA 4TN1A 3G13A 6NULA 2JLWA 3LUKA 3ULKA 4F06A 1V5GA 3NYIA 4Q4LA 2WG2A 2VYND 3OHPA 4RAOA 4ENUA 1X7YA 1RABA 1P7CA 1JHPA 5TNXA 3K0EA 4EOGA 3HGMA 2ID8A 1U3DA 2VK8A 4D0NA 4PQEA 1T0JB 2PCLA 4H6XA 4MKGA 1NVXQ 1UXOA 5LZ5A 1OE0A 1CP2A 1HF3A 1LF5A 1LK5A 4H16A 1DJLA 3TK1A 4DCSA 4R1TA 4S1WA 1UC5B 2OXCA 2YJNA 3R09A 1Q7EA 3V8RA 3KL2A 1Q11A 4GKAA 3GPLA 1DT3A 4Q03A 3I3OA 4QX6A 1JPVA 1MZVA 1OZGA 1PO7A 4AZSA 1WR8A 3ODGA 3M3DA 1O08A 4H7IA 1S02A 4BAUA 1W88B 2BGGA 4AO8A 2HEIA 4RZ3A 5HIIA 1IIRA 1IQUA 2C2OA 4X3CA 5FLYA 2CXSA 3CIOA 3DEFA 5TMDA 2Y99A 1UPTA 3E58A 3G5MA 2BTQB 3ZWKA 5JBNA 1X1AA 4LWPA 2MJLA 4PCAA 1CY8A 5BR1A 3B5EA 2P9CA 4M49A 2H8KA 4U7GA 4K3UA 2O8DB 4EJ2A 2Y77A 5CLQA 1ZESA 2DAPA 3O9VA 3T7EA 3VVCA 2CLCX 5BSEA 2GPNA 3KC2A 4OHWA 4J7AA 5TQJA 1Z13A 1WCIA 1IRIA 3OQIB 5DWDA 4YP6A 1JJBA 4R9RA 1T13A 3G5AA 3DAOA 2FPOA 4V38A 4TVOA 4CRWB 4YXFA 1GR1A 1P7PA 2VJQA 3A58B 4OFZA 4TMVA 3R9KA 2AMVA 3INGA 3NIGB 3WL6A 5IWAB 5F3RA 1V9CA 3HN7A 1ODLA 4MS3A 4IVNA 2VWGA 2X8BA 4MQFB 4P5EA 2ZROA 2WSBA 2VUSA 3GLUA 3NV7A 5EG5A 3S4YA 3TRDA 3W6NA 3C3YA 2Q4RA 4KO1S 2MSKA 2XVMA 3F6CA 3ADBA 4TYNA 4QU9A 1AO0A 1U3TA 2EFYA 3GJTA 1XTJA 3IB3A 1BROA 1Z06A 2CDBA 2V7UA 4V0ME 5DV9A 2J8ZA 2FPLA 1HKHA 5LBUA 5KYUA 2P30A 2ECFA 4MW2A 3UGKA 3H4MA 2Q5HA 2XYRA 1VFPA 2PANA 4X24A 2NMVA 4Q12A 1VHJA 4L0QA 1KKUA 1KO4A 1RC8A 1NBWB 3ONFA 3HJNA 3ZX4A 2YY6A 1IJBA 2DWUA 3DNFA 4YREA 1VL2A 4G4GA 1Z8FA 1MAWA 4FYXA 4YAUA 4H4CA 3DB2A 2XWQA 4OMCA 1Y5RA 1TZKA 1VECA 5CDGA 3OJFA 1SMKA 4PCVA 1WMAA 4UAJA 2K7FA 4E2XA 3E23A 4LYJA 3F78A 2PH5A 1QNLA 1IBRA 2VDQB 4M22A 5FPTA 3T7IA 3TW0A 1MO4A 3MWEB 3I42A 3T3GA 2YIDA 4HQFA 3PUIA 4H3HB 1P62B 5LOVA 2HFKA 3ESZA 3JS5A 2WQ7A 4MV6A 2QJTA 2RAUA 1ML4A 3KOYA 3CE9A 1JXMA 1M7GA 4DADA 4TWAA 2DLCX 4PG6A 3ORQA 5AI9A 3PT5A 2Z1MA 5EKXA 4BGEA 3A9UA 3U9SA 4JJKA 2C58A 1CRZA 2Q5IA 5FORA 1XTBA 4ZHSA 1I3LA 5ER9A 3KQSA 4WINA 3V6LA 4EG6A 3D1JA 3QX9A 4PSUA 2AF4C 4TVSA 5I4BA 3T3NA 3D7MA 5HTOA 1YONA 1TM1E 3ZKWB 4D41A 2IHUA 3JVIA 2QV0A 4H35A 1SUWA 3JVUA 3NT4A 1L7EA 4KQ9A 4PAWA 3RBXA 3GLQA 3IQZA 1P2DA 2CKDA 1L7VC 4EHIA 1VCMA 4GPZA 4C4PA 5ALYA 5I7HA 2ZRDA 3ZDZB 1M74A 4OX9Y 1S2MA 3H7AA 2IVFA 2C9CA 4RNDB 1M1UA 3L82B 2AW5A 1EXWA 4K40A 2JFBA 3G9QA 3DPUA 4UHCA 5ILQA 4QDOA 2GM5A 4LXXA 1P0IA 4N0QA 1R5JA 2H1OA 3GUVA 1FYWA 4LDRA 3W0LB 5HIAA 2NSJA 1EH5A 4Q3DA 4Z3OA 4Y0NA 2YZ7A 1EFRA 1SUAA 4JYMA 2AG1A 3W8DA 5BR4A 2Z8YA 1MPTA 1SC4A 1Y9JA 4PPYA 1BHJA 2HK7A 1EESA 4FE3A 4OXKA 5CUQA 5SY9A 1JNYA 4E2ZA 2OBYA 5C8XA 2HU7A 1M1YB 3JVDA 4U63A 5HOQA 3QM1A 4OV6B 4RTPA 3SNHA 1F06A 5LVAA 1E2IA 4V3BA 3H5OA 1L4BA 4LECA 3KXIA 1U0BB 1B15A 2QRLA 5CYGA 4AF7A 2P9BA 1Z74A 4KIGA 4YCDA 3OTGA 1E2FA 2VJBA 1J07A 2L82A 3H1FA 1GWNA 3ILSA 1Y80A 4ND3A 1JBEA 1H4TA 4X54A 3VNQA 5IN4A 1ZVJA 4YUYA 4X66B 4OL9A 3IPLA 3CXRA 2PKQO 4EMBA 3ZQUA 1T9GS 1GKUB 1Y7TA 1TPYA 3UMFA 4WFIA 3BXEA 4XVUA 1TYCA 4KUHA 4MVJD 4BGUA 1ELOA 5F9HA 3UBMA 3PXXA 3F6EX 4G0PA 8ABPA 5IDQA 3WQSB 4XX1A 1F60A 1RXVA 5F1OA 5EJ8A 1DEOA 3V4ZA 5DNDA 2GMWA 2WHXA 3D4LA 4ILKA 5PNTA 3U3MA 2KBFA 4C05A 2A5DA 4X63A 4D0GA 1NY6A 1S2NA 2OHHA 1BE1A 1XLVA 1VMIA 2JGKA 2O8VA 2XQIA 4Q9NA 4L72A 5SYAA 1E5LA 1ZPDA 3P1JA 3SZMA 3T8YA 4V0LA 1H2FA 3WNVA 4XQ0A 1XZEA 3EIUA 3RIEA 2GZMA 3GHHA 3IDSA 4MITA 2KW5A 3K1JA 5DSXA 5KVAA 5ALRA 1PWYE 1A4IA 5E7IA 2GD1O 4AQDA 4UE3S 3AQ4A 3UMGA 1C14A 3GLHE 3N5CA 4PLYA 5D2CA 4ARZB 2LTAA 4D3DA 4R7GA 4EHBA 3WKCA 2EL7A 5B57C 1YMVA 1V7QA 2ZRBA 5TJHA 2O3RA 2PLNA 1B6RA 3AKDA 5KZMB 4UW9A 1MO6A 3N2GB 2VQSA 5B12A 5GADl 3TXAA 2QJRA 4ZTZB 1UT8A 3IP8A 1R0RE 3R20A 3NWPA 1TJYA 4MS4B 3EPLA 4I1IA 2YWFA 3LUFA 5EL0A 1V39A 3BWMA 1TLFA 5JY1A 5L7TA 3U7GA 1W5AA 3PTZA 5D3KA 1NRXA 1W6RA 3NZEA 1R4ZA 2Q1SA 4JLJA 4TXNA 1KETA 3L7KA 3G7SA 4D8YA 3H6GA 4IHQA 4ACBA 5CX1B 4ZEWA 2PD6A 5EE5B 2WSLA 5KOJB 2B3TA 3CFYA 3KFXA 4DSUA 3GN1A 3CPJB 4PGHA 1KDYA 4Q1FA 1N3LA 2Q6VA 3K6RA 2Q8QA 3L0SA 4D82A 5J4VA 4TV9A 5JAMA 2QG4A 3IUSA 2VUTA 4X0EA 3JQ9C 4F1KA 3IDOA 5LYYA 3PLRA 1GTVA 4NABA 2QJOA 2YIMA 5J4YA 1E2MA 2JIZA 4TLBA 3QI7A 2O19A 4FYPA 1X7YB 4DKJA 2GFQA 2GN2A 1MAVA 2P1ZA 3ABZA 4HWKA 2PFKA 4CLHA 1K3UB 3NWEA 3UB3A 4C1NA 4CTNA 4DV6B 3LWDA 1KC3A 1MG0A 1S2LA 3LUJA 5B58T 1Z18A 5C52B 1DBVO 5K4AA 2X1VA 4BKPA 5K0LA 4G89A 3VGJA 2E18A 1VE3A 4YDRA 4BVLA 2KLBA 1ZAYA 1HNWB 2A3NA 1ZN8A 2JLQA 4PSCA 1QIDA 1B16A 1R50A 1BFUA 1QZ3A 1X39A 2FPKA 1TVMA 2JHGA 1HT2E 1C41A 3DV0A 2W2LD 3DT9A 2VTBB 3I64A 3ICCA 1PV1A 2EQBA 1AS2A 1SUPA 2ZDGA 5LLTA 1KERA 1UXIA 2HRRA 3KLOA 1YQWA 1W94A 1RZUA 4JLWA 3VAAA 1GVHA 3CW9A 3ZDXB 4A82A 4E88A 3TIFA 5JBIA 1PJQA 4X7RA 4FYJA 2G9QA 2I76A 4KJXA 3ZQKA 2QL5A 4LAFA 1ZSVA 1XDZA 2BL4A 1HMPA 3A11A 1M3SA 2R6HA 2ZB8A 3OICA 4G85A 4M1ZA 4YJFA 5EP2A 3LHIA 5IW8A 2RHOA 4XARA 3FNIA 1JG6A 2FUG1 4I81A 1T3ZA 2B7LA 4JA2A 2GUWA 4JP5A 4CI0B 1N6KA 3TB6A 1YA6A 3DT8A 2HCBA 5AD1A 4KIFA 4II3A 3ZHOA 2G1AA 5FLXA 1IHDA 1MJNA 2DFDA 2H4HA 4ANFA 2P7HA 4B6RA 3PX2A 3EIHA 2XY4A 1LUAA 1EDEA 2XYHA 4UHBA 3EZXA 4OSOA 3WS7A 4YH1A 4Z4GA 1XJ0A 1R0KA 3GRZA 3TLCA 1GZ4A 2RD2A 4B4WA 1NUSA 1QHFA 4MS3B 1JWAB 3VNVA 4D4GA 2VCEA 5F23A 1PWZA 1YSCA 3INNA 3FZEA 2JARA 3GUUA 2EFDB 3NM4A 1NV8A 1TJNA 3QU9A 4GRIA 4QHTA 5CXXA 2WWRA 3Q9NA 3ROTA 4B45A 2MR5A 1W4ZA 5I7SA 1EXDA 4MGYR 3DDSA 1UBJS 2BBTA 3C3BA 4IEFB 4Q5IA 4YV0A 4JB3A 5F2NA 1YULA 5KYUB 2DFLA 2OBBA 3ANTA 4L3VA 3CVXA 3KZNA 1NTRA 2YNMC 5ABPA 3PLAE 1WBDA 1LA2A 1KTVA 3DEAA 5F3DA 1PG2A 1RQXA 3P2YA 4LMBA 2Z2KA 4CKYA 4J2OA 2EBWA 2XOEA 2PZBA 3NI2A 4FHEA 4Q9DA 2PX5A 3K9NA 1D6NA 4DDUA 4RTKA 3CG4A 4FT2A 4R8MA 2XGSA 2A67A 4OOFA 4BMPB 4M46A 2CEAA 1TZCA 2BCGY 2W6ZA 5D51S 4F21A 2A0XA 1BU5A 1PF7E 3EMVA 2A9KA 3H5VA 2IUYA 3L4EA 1C7QA 1BDBA 1TQ4A 2BEKA 1EGQA 3K09A 4CIBA 2RBEA 1WX1A 1MNAA 1YJ5A 4LYDA 2L42A 4L3OA 4QM7A 2OG2A 5BW8A 4Z0NA 1C8BA 5CK5A 4E09A 4HQ6A 1EINA 5U4QA 2ECQA 2CXQA 2X2FA 4ZPJA 1LPNA 3MLBA 1GKIA 3OZAA 3FYUC 5E2BA 1Q95A 1R5BA 3NOOA 4Y9DA 3WRXC 5ADWA 1Y63A 3EG5A 1DKPA 3FHJA 1J49A 1M8FA 3M6VA 4YRBA 3AR6A 4J9UE 2ZYDA 5A2GA 4BO4A 1KO7A 5CFNA 1NI5A 1PLKA 3HGQA 4RCZA 2C5BA 2EKZA 1E2QA 3IP7A 2CWWA 2E48A 2AD1A 1VLLA 3DZDA 3ZHRA 5ICMA 3NTQA 3VNUA 1YNOA 4DM7A 5K5EA 5G3YA 1I94B 1CUIA 2O57A 4EMSA 1U98A 3WL8A 4KBYA 3MGCA 4UTZA 1NXWA 4DMMA 5TY0A 1SVLA 3MWDA 1H2XA 3KQQA 2GFHA 1KZHA 2YV2A 1J21A 2FR0A 2P69A 2ZWVA 3QU4A 1F9EA 1L5LA 3RR2A 4FS3A 3IR5A 4D9FA 1TMKA 3DEIA 1ZS9A 5LN1A 1LPMA 4G23A 4IUCS 4K9MA 2GTHA 2ENWA 3GXBA 2EERA 2Z8YM 1HT1E 1DO2A 2WSYB 3GRRA 2QM8A 3CJRA 5KSZA 5LQUA 2WJ3A 1TJ4A 5BWMA 5KSPA 5CIYA 1KWKA 4KPEC 4YROA 1P1RA 3H13A 1SPXA 4WKNA 4AK9A 4U2GA 5JCOC 1HNZB 1I51A 3HM2A 4N3CA 3M9XA 4MLPA 3O8RA 4Q9IA 2QM3A 5CBKA 3O3MB 1AA6A 4EFKA 3DCJA 2OFOA 3A6GA 4UAVA 3V2HA 2W37A 2VZLA 1CXZA 1O8BA 4HLUC 5JZOA 1BIFA 2FSPA 1FFEA 2HK6A 4KLNA 1ZJZA 1KH1A 3L43A 4BVJA 1KK0A 1QP4A 3SR0A 1MFZA 2OG1A 2GRAA 1V5IA 4O2AA 1E3SA 3AO0B 4Y7CA 4HVCA 1Z15A 2K87A 3I6ZA 3QXJA 1Y3HA 4M8LA 3RBZA 3RROA 1ISFA 2BKEA 4FC7A 2OQVA 3X0DA 4BNXA 1AJEA 4RVGA 2A1UB 3IELA 4NCXA 3NFYA 1M9NA 3VPSA 3CF6R 4EO4A 4PPNA 5CEFA 4GLJA 2BSAA 2OHXA 3WWCA 4JEUA 1IM2A 5LU9A 1E3TA 1CR0A 3KPJA 4UM8B 2W71A 2YWJA 3OTOB 4RSMA 2ZI5A 1DAOA 4GPTA 1E98A 3RVLA 3IBCA 3HRHA 2QEQA 5F9MA 4L9RA 3ZWCA 1DRJA 3SK0A 2DWQA 2PMDA 3BIFA 1LRKA 1XZIA 1ZM2A 3GCGA 4OFXA 3R1IA 4WFKA 4A2QA 5JZSA 4ZCTA 2VYQA 3KJGA 1N5MA 1S5PA 2WU8A 4HNSA 4PZYA 4AULA 4EHJA 1BOOA 4YBZA 3ZBTA 3KPUA 4OHUA 5BOVA 4K0KB 1Q14A 2X3FA 3EVEA 5A0TA 1Z4MA 2CJWA 2ZJ0A 1W48A 2QUIA 1U9IC 2H1FA 3BJMA 8OHMA 2HHJA 1GZDA 1C29B 2DECA 2X13A 4M36A 1NHWA 4YDSA 1JX6A 2OXIA 3RK4A 3UHJA 2JATA 4EEXA 1TO1E 4M38A 4HLQB 3Q1KA 2Q2QA 3H2JA 3AF3A 4WWHA 1UBMS 3F5FA 3U81A 4AUKA 1U7DA 2HWXA 1YKGA 1U7TA 4RANA 2WOJA 1PVOA 1KYVA 3U3OA 1XF9A 2OO3A 5DTRA 2H18A 1W5BA 3PNLA 4FEEA 4FONA 5HZHA 1UT5A 2Q0XA 4Z1MA 4N7JA 3KJNA 4LDAA 3HVRA 1DXYA 4RDIA 2HMAA 2VFAA 2Z2YA 4L78A 3MWGA 3QUCA 4YT8A 3E70C 5C7LO 5HKOA 4ZZIA 3K94A 4TV9B 1VBFA 3ELUA 4B7CA 2H5IA 3RUDA 1OZAA 2JD0A 2QMZA 2ZTLA 1MO2A 3CH7A 5IBCA 2IKSA 2PVCA 4RY8A 5SZKB 2I91A 3W79A 1MOZA 5DYWA 1RLMA 3DLPX 1XVIA 4RK4A 2EFEB 3IAS6 3K9QO 4TPKA 4RF4A 5H59A 3BGDA 4CMEA 1YFJA 1SOMA 1HDZA 1LSOA 5K4GA 4QSMA 1BMTA 1Z4NA 1I2ZA 1U0NA 2ICAA 5EWJA 1G9TA 1DMSA 4Q1BA 4K9OA 4QQ8A 4Q4CA 5KBYA 1A69A 1E2HA 4XYLA 1K27A 3U7RA 5IASA 2Q45A 5B3AA 3WNZA 2RDMA 2X9LA 3WK4A 4L28A 4DCJA 4Y7DA 2PXXA 3S68A 4LX0A 2JFZA 4RIIA 4YCLA 3DV0B 1E58A 3WGGA 3NCHA 1DCMA 4OYRA 3PUYA 4B85A 1MXHA 2XDAA 3C43A 2OCLA 4LJLA 2JI8A 3KQNA 4LNAA 3CRNA 1W1UA 4YMIA 2RHTA 3VGPA 3MF4A 3G2LA 2ANBA 2E37A 4WEQA 1D8AA 2RH4A 1X13A 4PLPA 5AKXA 3VX3A 1NSTA 1MB4A 2H92A 4YJFB 4PYOA 4HCJA 3CUYA 4MRMA 4C7KA 3GNQA 4DLNA 3FTEA 1O1YA 5LA6A 5JSHA 7MHTA 1X87A 2XODA 1V16B 3H42B 2FK7A 1NHGA 3I4FA 2V3WA 2XVYA 4P2GA 5AJXA 5FPPA 4RL4A 4YV1A 4CLDA 3WMRA 5JS6A 4RQBA 5LMZA 5CGZA 1JDVA 1XLTC 1KY5A 1KMQA 1M2JA 2J3LA 2CLDX 3BXZA 4MVXA 4P4GA 3V2GA 3W9YA 3BWEA 4KR2A 4V0RA 4YALA 3MSCA 3W2GA 4WD3A 4DJDC 4PYKA 3M83A 4JLOA 1V3QE 2VXYA 4TLLB 4JL6A 5BYKA 4DKXA 3TNFA 4GO1A 1ZXXA 1R5OA 1HQKA 5H16A 4ZT5A 3COJA 1N0UA 2B8JA 3DWIA 3E9RA 4HZUB 3IBYA 5F7ZA 5AESA 4MWTA 4Y6QA 1NONA 3LUGA 1SBYA 4X6XA 5HCIA 5B7QA 2IU4A 1ILEA 4A4DA 2LRHA 1K97A 3DD1A 2R4UA 4U2KA 1CDDA 1JKJA 2PYZA 3MFYA 3FPCA 3R4VA 1UKAA 1U0FA 3KJIA 1F2DA 5H80A 5LBIA 5A0VA 3VYSB 4I4TF 3H1PA 3TX6A 1A04A 1AXEA 2G08A 2YJ5A 5BUZA 1IG3A 1KOLA 1GFZA 4BQIA 5K3CA 3A2MA 5ALIA 3LUCA 2GBPA 2XMRA 2GN1A 4UUOA 3UWSA 1R8JA 5CDHA 2FPWA 2H5EA 3CX6A 2WWGA 3H7IA 2J9FB 2ORED 4JA0A 3BS4A 4DEXA 5E2AA 4EARA 4YQFA 1MA3A 2DHRA 1P1JA 3IVCA 4ZJYA 3K30A 5CA0A 1NJSA 2XOKA 3K15A 3M6IA 2A7XA 1QU3A 1OIWA 1QNFA 3FRHA 5ADVA 1R15A 1QRSA 2AX4A 1F0KA 1BXZA 1P7ZA 1PT5A 2YC2C 3IUNA 2G6BA 4FEYA 1X15A 3PNQA 5AFSA 2VBIA 1ZRHA 5D85A 3OZGA 2CZQA 2PTGA 1R9JA 2XDQA 3BMQA 3Q2OA 4GRAA 4GSKA 3N8KA 5JWOA 4S04A 2UUAB 4YLGA 4B7ZA 3W4JA 1M10A 3N0VA 4K6GA 4RK7A 5DYYA 2BC9A 2C1XA 4MO2A 4UVIA 1BXKA 2I8AA 2J9XB 4OLFA 1G4UR 2ZSUA 3KQTA 4QECA 3NP7A 5AI4A 3SX4A 1R3UA 2IHKA 4YAGA 3IB6A 4ZAYA 4URUR 5TVGA 1Q1GA 4KH0A 2ZWMA 4ROTA 2XB6A 3VZPA 4HEA6 1EFKA 4YN3A 2FXIA 1AGXA 3MWDB 4KRXA 2AOVA 5ALTA 3D6TB 1PJBA 4A91A 4JN6B 4NBNA 3V3TA 4YACA 1YIAA 3NVKI 3GT7A 3F6PA 4Q1VA 4XEUA 5FWNA 2A88A 1Y1SA 3LVRE 1B8VA 3EVCA 1G8YA 3GLFE 4D4JA 2C4KA 3WZLA 1F7UA 3F3SA 4J0HA 4F56A 3F8WA 4ZI7A 1ZK2A 5A5VA 1YZKA 4U6SA 3L5OA 4EKDA 4RMHA 3LHDA 5DKFA 3A9CA 5DHSA 4KC0A 1ZN2A 4E13A 4Z9FA 2XB2A 4CF6A 1SWVA 5AW7A 3B20A 4N8DA 2CFCA 2CHEA 3D02A 4UPEA 3ASYA 1FFYA 4UDXX 5DU2A 5KUTA 4ZRMA 4B79A 2BJVA 4IH9A 4U6QA 3KDSE 4X8MA 1GGFA 1P4GA 1QE3A 3I30X 3JQBA 4IG9A 5ALWA 3OQMA 4NV3A 2H63A 2YJTD 1OUMA 3E4CA 4I2VA 5JCZA 4ME6A 3L6EA 5CYPA 1Y5NA 4XTCS 4Y2GA 1X8JA 4O2AB 1YDFA 4OQQA 3VR2A 4JLVA 4F3YA 3AV3A 5L51A 1TTTA 1ZISA 4DCCA 5BSUA 4HNVA 4EUNA 3KQKA 1QLWA 1BXRA 3I01A 3KEGA 2XH8A 4MVJE 3ZWNA 2FX2A 4JJ8A 3VJKA 3GLHB 3OKFA 3THSA 2FUEA 3BFVA 2FA9A 2W2TA 4LOKA 4X90A 2VUHB 4TUYA 4D3ZA 3FGPA 3K31A 4XB6B 1EXMA 5I5GA 5YASA 4CEIA 3SBEA 2A2ZA 5LLDA 4LJ4A 3DOOA 4G84A 1UDBA 1JEEA 1ZVMA 2JGRA 3D1VA 5DYNA 1T24A 3ZWOA 1PLJA 5BWBA 4FVTA 5IZ4A 4P54A 1KQ3A 3ENWA 1EDBA 1VE1A 2HI0A 2AI1A 3C97A 3T9DA 1X6VA 2W70A 3U5ZB 1FNCA 3LOUA 1VKOA 4IJKA 1ISSA 2X5KO 4IF6A 5FOUA 3USZA 3B6JA 1JLRA 1KEEB 4GXQA 3N59A 1NPDA 2VDKB 3E27A 5EKSA 4RHTA 5JEDA 5JFGA 5JPCA 4C4XA 1ECCA 2OB1A 3KKKA 4E5KA 2CJWB 4H60A 3NBXX 1OASA 3JTMA 3MA0A 3OPNA 2YWCA 3L0IB 5G1NA 5KQRA 4KMMA 4MEBA 3MILA 3OJCA 2JJ2D 4G67A 3N70A 4UEQA 1QG6A 1KVRA 1JWLA 2VNAA 5J63A 3KLMX 1CWUA 4P0PB 3BXPA 4ER7A 3HR4A 2GNOA 3X1DA 4U4AA 1X74A 2QA5A 1GQFA 3KJQA 4MKHA 5CK4A 5DO9A 3CX8A 3LUBA 3AJAA 3KTAA 4ZKDA 4MRPA 1BJKA 3EG9A 4K6KA 3Q40A 5I9IA 5HK8A 4LGYA 2O1XA 4F4DA 5C0OE 2ZYHA 1SCUA 5FNZA 1Q21A 1MABA 2I3AA 3SQOA 4DLWA 4EUSA 1CZKA 4RVDA 2ZPUA 2B78A 5EXSA 1YGPA 5IARA 3Q8XB 4J1TA 2C04A 4DQLA 5FOQA 5JU6A 3OLWA 2M6KA 1XE3A 4AU1A 4HMOA 4WK4B 2I6XA 3HJGA 3IEKA 3U4CA 3WIEA 2WE7A 4ETIA 1DGQA 1BXGA 4CIXA 1XI2A 3R9XA 2QZ9A 3HY3A 2ZJOA 3MIIA 1RM0A 2ID7A