1BE1A

Glutamate mutase (b12-binding subunit), nmr, minimized average structure
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
137
structure length
137
Chain Sequence
MEKKTIVLGVIGSDCHAVGNKILDHSFTNAGFNVVNIGVLSSQEDFINAAIETKADLICVSSLYGQGEIDCKGLREKCDEAGLKGIKLFVGGNIVVGKQNWPDVEQRFKAMGFDRVYPPGTSPETTIADMKEVLGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How a protein prepares for B12 binding: structure and dynamics of the B12-binding subunit of glutamate mutase from Clostridium tetanomorphum
pubmed doi rcsb
source organism Clostridium tetanomorphum
molecule tags Isomerase
molecule keywords GLUTAMATE MUTASE
total genus 21
structure length 137
sequence length 137
ec nomenclature ec 5.4.99.1: Methylaspartate mutase.
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02310 B12-binding B12 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 1be1A00
6REQB 1FMFA 1B1AA 4HEHA 2XIJA 3KOZA 7REQA 3BULA 1CCWA 1Y80A 1E1CA 3KOYA 3BICA 5REQA 7REQB 1BE1A 1BMTA 4JGIA 1K7YA 5REQB 3IV9A 3KOXA 4R3UC 2YXBA 2XIQA 1CB7A 3KP1A 1REQA 1I9CA 4REQA 2I2XB 1REQB 6REQA 5C8DA 2REQA 3EZXA 4HH0A 3REQA 1K98A 4HH3C 4Q37A 2REQB 3IVAA 1E1CB 3KOWA 3WHPA 3REQB 4HH1A 4REQB 1ID8A 1XRSB
chains in the Genus database with same CATH superfamily
1COWA 4CW7A 2FTKE 2GKGA 4JC8A 4CT5A 1KAGA 4MPDA 4E2FA 2FXVA 2JJYA 2ZYVX 4L5JA 4HYTA 3ZUGA 2OFXA 1YZNA 3Q8WA 1GFSA 2HGZA 2R4UA 4JAVC 5LDHA 4IV5A 3KQSA 3UATA 1KJJA 2JGDA 3L4BC 4BBZA 1S1CA 1FLNA 4QKQA 7GPBA 1NI3A 1FP4B 1S0UA 3FB4A 3KJZA 3IP3A 2VXYA 3UQYS 4BECA 5JRDS 2CL5A 4C0LA 4AF7A 4O2BB 4QQNA 2GOYA 3DC7A 4B6QA 3LY8A 1PW7A 2NZUG 5DBFA 1WU8A 1T25A 3RU2A 2B9EA 1DKUA 1R4MA 2Z98A 3OCCA 4B8ZA 1VI2A 2O0HA 3GUYA 4LZJA 4X61A 5C5DA 3OLVA 3ZXUB 4D25A 2Q9UA 3IEIA 4DUZB 3JCZA 3F8SA 3JQ9A 4UM5A 4X65B 3TVTA 3WMRA 1W76A 4PHTA 4BX9A 3AJ8A 3TQCA 3U4QB 4X71A 1PJLA 5AHWA 3D02A 3ETHA 4DIEA 2JI6A 2EP7A 3CIFA 1DU4A 1V7CA 1M8JA 1Q20A 2CCKA 3DMTA 4FEEA 2OHVA 3OZVA 2JI9A 3KBOA 4DSAA 3N2KB 4OMCA 1QG4A 1VHJA 3ANSA 3B1FA 3CYFA 3B8EA 4PZ9A 2VDOB 3CZCA 1DS6A 3RKRA 4A0SA 4CU5A 2HK9A 1V3UA 1O8BA 4RYDA 2CYCA 4EPYA 1USKA 4EF4A 3DWGA 5K3AA 4RZ3A 4G86A 1E9CA 4KFSA 4RIIA 1A9PA 1FB5A 3OM0A 4X24A 1Y3IA 1TF5A 2XUZA 1BN6A 2GARA 4LNUA 1DTEA 2W00A 1KDYA 4P1ZA 1XZBA 3PDHA 3EZFA 4CPDA 1GQQA 3N2IA 4X3OA 3F73A 4B3CA 1HI9A 2RJNA 5AI9A 4AECA 2YIDA 4QXRA 1ISHA 1WKVA 2IU4A 3GU3A 3LPNA 4M9ZA 4NTZA 5IUKC 4DE5A 1YDEA 2NUPA 4BUJA 2QGNA 3TDKA 3RWMB 3UJBA 5AM4A 2WD8A 3D4PA 2FG6C 3S3TA 4GMFA 4KRGA 2LNDA 2W22A 1X15A 4KLNA 9ATCA 1G64A 3CH6A 1PF7E 3LQQA 4CRWB 2AZXA 4FDAA 5HMLA 2IZOA 1CY4A 5FPKA 2IUYA 5JY1A 4CGZA 3IE1A 1Z0FA 4YLGA 2HLNA 3SCZA 3TW0A 3N9IA 2E5WA 4LEIA 4HATA 1VXRA 4HLCA 3LBYA 1OBCA 5AUOB 3VDRA 2M6RA 1SRQA 4TKVB 2QYHA 2WHEA 3SJUA 1M8FA 3INYA 3WGKA 3FOFC 1SC9A 2QZ9A 4DWWA 2FDCA 2XT6A 1C30B 1VIVA 2CWDA 1E6UA 4IZOA 2XOEA 4EGAA 1A4IA 2BDUA 5AFSA 2VJCA 1FJHA 2YUTA 2BZGA 2PZEA 3FCXA 3U7FB 1W9HA 4FE3A 2IGBA 2XGSA 2QLJA 2AA3A 3I58A 3LQFA 3USZA 1P4SA 4HH0A 2ATVA 3PUXA 2WMNB 4EKGA 2MSWA 4DC9A 2JFOA 2XUIA 1BA3A 2NU7A 4I3FA 2BJWA 4OHMA 4LE1A 3F90A 3H8JA 3DB2A 3MAJA 4WLOA 5K0NA 3S40A 4PVCA 1EFKA 4M9XA 2OPHA 4DBZA 3IL2A 1QCCA 5AKIA 3TGWA 2JFUA 4HXEB 4EB8A 1UKYA 4B35A 2QXTA 1XKTA 5IT4A 1Y3CE 1IUKA 4UOQA 3MERA 5D1HA 2QY9A 4KFTA 1RQNA 4GECA 2EBHX 2G5PA 3C1UA 4KMOA 3UXEA 2XB8A 4B0PA 1P73A 3DBLA 2JLBA 3OEED 2PZLA 1QTIA 2HWWA 2FPGB 3FVTA 3JQAB 4HR7A 1XAHA 2YN0A 4ETMA 3UUFA 1YDGA 2E1PA 3V4VB 2CV0A 1ZEMA 2HO4A 3N0TA 3GMDA 5FA8A 2AYXA 1YBMA 3KYJB 2Z6AA 1R3UA 4G5FA 4AJEA 2GCOA 2PD4A 3LQ2A 3QNWA 4G4JA 4AJHA 1OLUB 1Z3CA 4EA7A 1DAEA 4L5IA 2OBBA 1SUBA 3F6PA 3PR3A 2H9IA 5J9FA 2JKVA 5HYVA 3L2OB 3ZWBA 2AN1A 2WM8A 2GD0A 4ITRC 5TIIA 4KU4A 4F5ZA 1X7GA 4QPJC 5NULA 3WV5A 3I39X 1PHRA 2R1UA 2H3HA 4P2BA 3V4OA 5JVDF 3OT5A 4JL5A 2DR2A 4G1VA 1YA6A 3FWNA 4FR0A 4R16A 4NYMQ 4CV1A 2KHZA 3W2IA 1ZLXA 2HRZA 4A2WA 5HKOA 2IBMA 3OIGA 4YUZA 3GGSA 3EISA 4GPEA 2J8ZA 3FNIA 3KU4A 3SEQA 4RTRA 5KVVA 4UTPA 5IHXA 3MOGA 4A91A 1EHCA 2EZUA 3T4XA 3VH1A 1QX4A 1F4VA 1XQ9A 1IULA 3DLIA 5EHNA 5KWIA 4IVRA 3L6RA 3K71B 4EITA 3ND5A 2VWHA 4J0DA 4DT1B 5A0TA 2Q41A 3KSMA 4LNAA 1H2YA 3OF5A 4X7PA 3OQ6A 4B4WA 4BGIA 3EVDA 3EUFA 2B1GA 1D3AA 3FPSA 3L4KA 1RXYA 4QT4A 1SZCA 1F14A 1HDRA 2WJGA 5FULA 2UZ4A 1IRIA 2XUFA 4EYEA 2OV6A 3AUTA 3H2KA 1CJCA 1NONA 1K75A 4DMRA 2RGRA 3ESQA 3QBEA 4H1VA 2FMXA 3TLYA 4EW2A 4EEKA 1NRXA 5LOVF 1U0GA 3OFVA 4P3XA 3IPYA 3ORSA 3N8GA 1QF7A 2A1TS 5EL0A 4ZJYA 1B7GO 1M34A 3EZXA 3JYHA 3FUVA 1W6UA 4GLLA 5CDUA 5K0SA 3L1HA 4DSUA 4X94A 4MS3B 3A3YA 5ADVA 4CM9D 4FIDA 1PV1A 3AUXA 4C21A 1CQXA 1BWRA 5IKEA 3JQGB 4XW2A 3X1KA 2HMTA 4HO1X 1ZH4A 3GV0A 3W0LB 4QBGB 2R97A 3H0KA 4UEOA 2WTBA 3D5TA 3LDGA 3R7BA 3NFYA 2ZSAA 1DKMA 2XA1A 3CG4A 4UAGA 5H4GA 4RIEA 1NMEA 4QYIA 2FG7C 1GUAA 5FR1A 2WUWE 3IB3A 1JPNA 5CLJA 2P27A 4ZDWA 3I04M 4YHHB 5LD2B 1SD1A 4X1IB 3AF0A 1Z7WA 1BHO1 1POXA 4UTXA 3G8AA 3H87A 4G0QA 1TVMA 1YK0A 1H2BA 3AM5A 3CVOA 4X20A 1VJ0A 2YY7A 4JZKA 4YECA 5T4BA 3FVVA 5JNTA 3UT6A 2HA5A 2K5UA 3FI9A 5JIBA 5L45A 2QENA 5JS1A 2Z95A 3DEKA 3AVWA 1FBNA 1A9OA 1Z0DA 2QV0A 4E09A 1T29A 2QPOA 4EG1A 2GAFA 1UMDB 2PBRA 3GLGB 3SICE 2O07A 4RL6A 5AJVB 4YV1A 4CIAA 4KBGA 1ZP6A 2PVCA 1MJHA 4WY5A 2IPMA 1HR0B 2GRAA 1JDNA 4DAEA 1XEXB 2VSFA 1K6IA 3O94A 4ZZ3A 2I80A 4UU8A 1RBZA 5HF9A 3V8EA 4LY6A 3ZS8A 5E4TA 4PSAA 2ZDGA 3NDBB 2Q2QA 2INGX 5AVUA 3OA0A 1D07A 3M2PA 1M1YE 4L0MA 4MVCA 4ZXPA 3WQBA 2IOQA 2KJQA 2RBKA 4WOPA 3WK5A 5A9RA 3PC8C 5T57A 2I6UA 4IWYA 1X1SA 4HUQB 4IKEA 4XX0A 3C48A 3KWFA 4WK6A 1M8KA 2EL7A 2JDIA 4Q6WA 2JFYA 1H94A 3A6KA 1J0BA 1SCDA 2ZUTA 1XXLA 1U7ZA 2R66A 3QW4B 4WLFA 1KAOA 2WUVA 4YDHB 3V3TA 4KTTE 4LX0A 4EO7A 4FHCA 2VTBA 2R1TB 2OSVA 5KEIA 3TI7A 2EOAA 3EVGA 4FILA 4FP9A 3PE6A 4OOEA 5GADl 1Y7PA 1NLYA 2DULA 3SPXA 4IDAA 3E8XA 2LBPA 3KHSA 3DDWA 1U2GC 1QKIA 4J0QA 1FYFA 2LV8A 3INGA 1D09A 1Z5NA 2ECKA 5LLDA 4OIMA 2ZR7A 5HJ7A 4UJ3A 1WZCA 1EE1A 1I32A 3S8EA 4QYTA 1E2NA 2JGEA 4EECA 1WQ4A 2C1XA 4DCPA 5KJCA 2ATEA 1WW2A 1W5TA 5L3SA 3TD2A 3RB8A 4LVOA 2XB2A 3WAKA 5C1OA 1XMQB 2WEKA 1E9VA 4FS3A 3NHKA 4URZR 1QFXA 2BEVA 3H2JA 4GO1A 4L7VA 1HT0A 1ZXXA 2D13A 3CPHA 2QM8A 3PFIA 4MW1A 1Q0RA 5ALDA 5LBTA 3RYIA 2J9GA 2ADFA 3ME5A 1IHXA 4Y2XA 3ZQUA 4PFKA 2ID7A 3B53X 1AX9A 4LQ4A 4J76A 3RVKA 3ZVKA 1N77A 2IEGA 1J99A 1NIJA 3K8OE 2BFOA 2YUIA 3M49A 1VMEA 4F97A 4KR2A 4G0WA 3CWQA 1PZMA 1XA0A 3GP5A 1R4NB 2WJYA 2WNHA 1RHMA 2IYNA 4RKFA 4Y2HA 5EWLB 3V4ZA 3N1UA 3UWMA 1SN7A 2YZ2A 3AERB 4NIMA 1QGUB 3HY4A 4RVUA 5A1TA 3OKAA 1NUAA 3RWBA 1A9XB 5A4FS 4P80A 1QE0A 4QWMA 2CYAA 4TM7A 4WE3A 5K3OA 2W8BA 1XTQA 3LFTA 1OPXA 3EZYA 2OKGA 5EXSA 1PCXA 2WHYA 3LAWA 1MEEA 2Z5VA 2ZQZA 3PD0A 4MCJA 1VBNA 4HEHA 5ITZA 3AFOA 1F12A 1SCUA 3OMXA 1ETHA 2WF6A 3DV2A 3D8NA 4MO9A 2ZE8A 5DYNA 4DT1A 1T1EA 2OHOA 4Y6LA 1X87A 3SX0A 1CTQA 1RXUA 1O6FA 2VHCA 3ESYA 4GVPA 2BHNA 2R5WA 2ZCJA 3PC7A 3PNSA 2ATCA 1EWTA 1SO8A 4QFMA 3X43A 1Y5IA 1A77A 4I8IA 4B3IA 3K73O 1WQ1R 5TV2A 1PDOA 3EXHA 1JQBA 2D8MA 3TAXA 1ABBA 2EFJA 1AQNA 2VT3A 4WFKA 3V8PA 4ON9A 4YP0A 1HX7A 3NAGA 4P98A 4IUCS 2OYSA 3TJRA 2RONA 1XZKA 3ACBA 4FFDA 2E5FA 4TXJA 4AB1A 2EG9A 3PBKA 5BRAA 1WUKS 1YS9A 1JFLA 1JVBA 1K2WA 4PHCA 4EDHA 1DEOA 1P0CA 2VTKA 3G8YA 3U6BA 3L6BA 3LT1A 4BV8A 4Z51A 2C0CA 3GB9A 3RF7A 3SKVA 3VBEA 2EDAA 1J97A 4HGPA 2QEQA 2BGUA 4NCJA 5LQJA 4QFDA 4QYIB 3ADKA 3BZWA 2X23A 3QF4B 4FB4A 5H81A 4ENSA 3OQ1A 1V43A 4YRSA 5JNSA 5K45A 1QRDA 1WBJB 4LNUB 3D8TA 3TIIA 2H1HA 3V6LA 4OHBA 2O2XA 1JQAA 4M36A 1AO3A 3TO5A 4ZOBA 4G37A 1J0CA 2DKOA 4GH5A 2ZPAA 2FQYA 1ADCA 1XXHE 2HEIA 2NXCA 4YNBA 1R10A 3UBMA 4AMZA 1Z6GA 1DRWA 3BILA 1RRMA 3VSCA 4UD2A 4EG6A 5FV4A 3VH3A 3IS3A 2Q4BA 2WAXA 2E55A 3VBCA 2A1TR 2M1ZA 3JVVA 2TYSB 3FMOB 4PZUA 4QSMA 4C29A 1JL3A 3G2QA 5LDDC 3UBTA 1KK0A 1S4QA 2ACWA 5COBA 1PZGA 4WLVA 2PL1A 4YMSA 2JGNA 3D1LA 1XXHB 3F4KA 3TZLA 3R9XB 5EPEA 1OHHD 1Z4QA 2GPAA 2YASA 5EESA 3MWDA 1JQEA 2XUGA 4J6FA 1T4CA 3UC5A 1JSRA 1KU6A 2DMRA 4X1YB 3DO8A 2WIBA 3WB1A 4K9NA 5BSKA 1EP1B 1JMVA 2H00A 1F0PA 3ZBUA 1UDCA 1G291 3SHOA 3H05A 2UZ3A 2EW8A 1SD2A 4KIFA 4U6NA 2N1BA 3EDOA 3ER6A 1MNQA 8LDHA 4GW3A 4MVJM 5JMPA 4AUMA 5GZ6A 2OGZA 4HN2A 4GLJA 1WF6A 5FL7A 1P5ZB 4DJJA 1XRMA 1I24A 2CHFA 1J49A 2OZPA 2WUGA 1IRXA 1NA5A 3C8ZA 3JQAD 2C2KA 3IH5A 4LXHA 1Z8FA 2PO7A 2ZS9A 3C41J 2WJAA 4XB2A 3PUHA 4DV1B 2B9VA 2QVZX 1UJNA 3LP8A 4OV6B 1UWCA 4R9SA 5FPHA 3SHQA 4QJBA 4MEBA 1D9ZA 1GCAA 1QHEA 1AH2A 2CL7X 3H99A 3KG2A 2QJTA 4L75A 1IXZA 2Y1KA 3KO8A 3NC4A 4AICA 4P92A 2DLNA 5CYOA 1WSWA 4FGLA 5LBIA 3GP8A 3BWYA 2H4XA 3QKRB 1YA4A 3KELA 1U1EA 3AW8A 4G85A 3ZY3A 1RQ7A 4MVYA 4KIWA 3ROPA 5EY5B 3WLLA 2P2ZA 3C3JA 1GAXA 1AKWA 4YDQA 1OD6A 4MUEA 5BW6B 3IQWA 4XGRA 1KR5A 2DLCX 4XE5A 1EI9A 1WDMA 4MEJA 1SKYE 1VQ1A 3JQBC 4WOCA 5F3RA 2G72A 4W99A 3KEFA 1A9ZA 1SHUX 3ANYB 3NVAA 1A8SA 1CNFA 4YRJA 3K6RA 3JZMA 5JDIA 3FDXA 3GG2A 1V5EA 3AERA 5FJIA 2ZAGA 3UUGA 2A30A 1TQ4A 2QVYX 5DI3A 4B8YA 4OI0A 1YL7A 2G0AA 1I36A 3DZGA 4KDRA 4M37A 2GWRA 4JP2A 4KV9A 5PNTA 3RVNA 4P34A 2B34A 1XZMA 4KSCA 4QATA 3AEKA 4I1RA 2YW9A 2GTIA 3DFKA 2ZSFA 4NCNA 4Q24A 2P9BA 2F6RA 1ECPA 1Z6TA 3ABOB 5HOQA 5JUWA 1O2DA 2W2LA 2VUTA 4X63A 1SXJA 4M1WA 2J0UA 1EEHA 1BTOA 1MQSA 2JL1A 1DELA 2ZAYA 2AWNA 1ZU4A 1BXKA 3DZFA 1NU8A 1T0UA 1DWPA 4LHVA 1ES9A 3WGZA 1P7CA 4HXFB 3S4YA 1E9RA 4YPFA 4ENQA 2C4VA 2CZCA 2DFTA 2R1VB 4HRVA 4LPSA 3OIVA 4WTOA 3B1KA 4B3BA 3MTBA 3QWAA 4KOAA 5I9IA 1VM6A 5EXDA 3KJGA 3R6TA 1I3NA 3FNRA 5SZJA 4NCAA 4WXMA 1S3FA 1XG5A 2ZUCA 4E2YA 4W9MC 3IEVA 4ALKA 1QK5A 3HI6A 4ZHSA 4DYDA 4QFBA 3ILHA 1U5CA 4F6RB 4CI0B 1PNTA 1C3EA 2GSWA 5HA5A 4BMDA 4I4TA 3U3JA 4OU5A 2AF4C 3UICA 2EFEB 1FSFA 3CW9A 3KK0A 4P54A 1F38A 3KJIA 2R47A 4LHSA 3ZGLA 2XSZD 5GVSA 5LMNB 1UCFA 2B36A 2A92A 3D64A 3HKEB 2CSUA 5DCUA 4C0AC 1K5PA 4J1QA 2QKYA 2R60A 3AXTA 4L0CA 6CHYA 3Q3JB 3E4DA 2XV1A 3IBYA 2BN4A 3DBLB 3OCXA 3H9GA 1IOZA 1C1XB 4E2ZA 2VPQA 3IV6A 6LDHA 1BE8A 4ER5A 1CQIA 4UBKA 3R2JA 2W6PA 3OIUA 2FUG1 4RVOA 3ZKWA 2ZJYA 4RV5A 8OHMA 1GPBA 3QJYA 4EG3A 4QIHA 2B7LA 2RCYA 4L85A 3K8QA 5HDQA 2AZDA 4MICA 3W5DA 1Y1SA 1RPNA 3GZNB 1L5RA 4LYDA 3DTTA 4DV0B 2I33A 3I1IA 4IIUA 3ZD8A 3ESXA 5BUQA 3D6JA 3LKDA 3AVVA 4PC7A 1FIUA 4LXQA 2Y4NA 1HG1A 3SY8A 4BMNA 5FX2A 3R3WA 1LKZA 1BFDA 1Q0SA 3BL5A 4QBKA 4M1SA 2DBYA 1VMKA 1U9IA 4RF3A 4DIBA 4M98A 5LQCA 3GRFA 1UMDA 5L4LA 1YUMA 2AR0A 3D6HA 3EXIB 4L22A 4XB1A 4WCFB 3GJSA 4B2PA 1ONNA 5ICMA 2NZJA 3Q3EA 4D8WA 1G9SA 3HGMA 1AJEA 5LQKA 2FEOA 1Q7GA 2RG7A 1WUJS 2PZ8A 3DL7A 1KO4A 3ONVA 1XPUA 5BMVB 3JS5A 2O20A 1N0WA 2EJVA 2NXJA 2RGWA 2G4LA 3GLHB 1QDUA 4L8FA 1ZD4A 3GI1A 4AYTA 3ZJVA 1QBGA 5EMJA 2JIZD 3GYBA 3LF2A 4K9RA 2VATA 1EFCA 3Q7TA 2AQHA 4HG2A 4Q18A 1PFKA 5GMOA 4L9AA 4JDPA 1P1RA 1U1DA 3O4GA 1Y37A 2HAEA 1XTVA 8ADHA 3EAGA 4GAEA 3VKGA 3RTBA 1I3OA 1KVRA 1KFCB 1ZI8A 2ZJ2A 3MUFA 3P2MA 4HK4A 2EQAA 4KZPA 4Q00A 4RIFA 5DP2A 3I9V6 5IW8A 2JZOA 3ROKA 4BJ5A 1JA1A 3FAKA 2XF2A 3K53A 3R3SA 5E1DA 1KAEA 2BL4A 3ACCA 3WDSA 1Q7TA 2IELA 2O48X 1L5QA 1QHHA 2WTXA 3M4JA 2Q9BA 2A0UA 1D1TA 2FW6A 3FFXA 4KB5A 4M60A 4OXIA 3RK1A 2BBWA 1MOZA 2FOIA 3UA3A 3ZY2A 1M7HA 4TUYA 5TQVA 4CMHA 2DWCA 2FEKA 2O8DB 1GN8A 3AV0B 3D8RA 4TV8B 3SBEA 5DHFA 3VOSA 1LI7A 2EF1A 3BHJA 3OZXA 4J9UE 3OLYA 4CUJA 4W63A 2WF5A 1JWBB 5CBKA 2C61A 2C8LA 2DG2A 3OJCA 2WZDA 3K96A 1Y42X 1B8UA 4MYUA 5DBGA 1BMQA 1VLJA 4EZIA 1JF8A 2OZLB 2B37A 2GK6A 4N6GA 5JBNA 5LQDA 1U0TA 2NX2A 3HJHA 4C4SA 3QXHA 2WWVD 3TZQA 1DOZA 1KRHA 1VRCA 3K0HA 3MT8A 4EUNA 3ENKA 3AESB 3LVBA 4XWWA 4ZARA 5AVRA 4QPNA 1JDTA 3A2MA 3GROA 4QVIA 1QBKC 5JU6A 3A31A 4NBRA 3KSZO 3LXUX 2FRDC 2NIPA 2WJZB 4I55A 4K6FA 3IOEA 1DC8A 2ZAIA 4TN5A 4BC1A 1V5WA 3GP3A 4XYGA 2BFMA 5C18A 4JVSB 4MR8B 4NABA 1T5TA 2V45A 4L50A 1YH3A 4MQFB 4O2BA 1J24A 2ZLBA 3ROQA 4MWZA 3F9RA 4EG5A 4KSYA 1AMNA 3GLGA 3SG0A 1E3WA 2G5CA 1HT3A 2Y9PB 3A10A 1P9NA 4PCLA 1Y4AE 2D1FA 2YZKA 1CIPA 4MCIA 3T5AA 1OB5A 5IAKA 4XJVA 5FBLB 2CBXA 4P22A 3T5PA 4XQGA 1GTZA 5DHQA 5TMBA 4ZDKA 4MPJA 3M6VA 1LQUA 4GOLD 2GXUA 2Q3HA 4LBZA 4OQDA 2QQGA 2LIVA 3GD5A 3GH3A 3NC1C 3ZNPA 3N2ZB 1SKQA 2FH5B 4YV7A 3WZMA 3ZBPA 1JWLA 2H31A 4QRHA 2D7JA 3LU1A 4D80A 4DV7B 2G1PA 1F1BA 4DWJA 3N2GA 4CKBA 3BD6A 2V7VA 3QVLA 2B92A 1GQFA 3W7AA 2MSDB 5JBIA 2IIPA 1LH0A 4IH1A 1I30A 1NNI1 1N32B 1JR2A 2C9MA 4UDXX 2GFHA 3G7NA 3HM2A 3OX2A 4INPA 5FNVA 1JV2B 3RUCA 2ZIEA 5DM60 1VLLA 2YJZA 5CA0A 4FFSA 2C7VA 2B3DA 3G1TA 5BYAA 3PQ4A 1AN0A 1FUKA 2Q6VA 3CF0A 1GNVA 1J0DA 3OWHA 4Q1VA 1SVOA 4RVGA 5FFFA 1BG6A 4U7HA 4MS4A 4UUPA 4F12A 4CGYA 2C7QA 2KI5A 1XD9A 1M8GA 2BYTA 1KA9H 3ZE1B 4C4TA 3OIWA 4KHPB 5G1OA 3M4ZA 2OGUA 3NOVA 1L8AA 4FZ3A 2QB5A 4TYQA 3EGEA 5A7HA 4Q3OA 3DFMA 4HX5A 1FFBA 2ID4A 1G16A 1ESEA 1L5ZA 2WU8A 1OXBB 1QRSA 3LO5A 4CYMA 3GN2A 3QGMA 4WVFA 2O54A 2JAOA 4UBNA 1SC4A 1BRTA 3GRVA 1WD7A 2GBIA 2JD0A 3BHIA 4UU0A 2OXFA 1RZRD 3U4HA 4EL0A 2FU5C 1XNRB 2YFKA 3ICVA 4QXAA 1FNCA 3HXPA 4ESHA 1JXMA 3LUGA 1NBEA 4LDQA 1ZM2A 2L82A 4TKVA 3VZPA 1P45A 1ZJJA 2FPIB 1XWFA 1VB3A 4PLCA 1HSZA 2Z4TA 4X3PA 4RSHA 1YKFA 4LOIA 3WL7A 4X8MA 3LHDA 4K5QA 4ARAA 1Z7EA 4HMPA 3C74A 1KERA 3CC8A 3U09A 3AW9A 4H2DA 4F6LA 1G2PA 3A28A 1RIIA 2JIDA 1GLNA 3E3AA 2BM1A 2QK4A 3MCUA 1TM1E 1XZDA 2WG0A 5JYBA 2JLWA 4KIUA 1E1NA 1L5GB 5D51S 4Z9XA 1GL3A 1SCIA 3AFIA 2NQ8A 3EARA 4J91A 4QULA 4LVUA 3OT1A 3L01A 4N9WA 4B3XA 2W48A 2REOA 1YQQA 4FOTA 5BPHA 1NG9A 3ZI7A 2FI1A 3I1FA 4KQKA 1UJCA 4RK4A 4EFMA 1OV4A 3I6YA 3OJXA 3TUZC 3AR5A 5BP7A 4WEQA 1L5HB 1NOKA 1TLLA 2X0EA 2BUAA 3ZWCA 4JBYA 4GZ6A 5GZ3A 2O8EA 5A5DA 2ZROA 3DUWA 3I9KA 2EJTA 4BBPA 3WISA 4EVIA 1PQ4A 1D03A 1C3OB 3H2SA 1CUWA 4XIJA 2LD4A 1AG9A 4KWHA 3ZY4A 2VZ9A 3CW2A 1V0JA 3V97A 2PNJA 1CJUC 3CUUA 2CLDX 3R0JA 5C4IA 3FZQA 4DR7B 4JJAA 1SCJA 1CE8B 2CHVA 2HADA 3KALA 3PUJA 4NICA 1FFSA 1ZM3A 4ER3A 5LMCA 1C1HA 3PXAA 5ELLA 1U0LA 2JVKA 2V96A 3EQ6A 1FMLA 1J7KA 1GKUB 2FW9A 1NPTO 1Q0UA 2NU6B 2PL5A 4I6GA 3GLIE 4NYIR 1R8JA 3U3KA 3CUKA 4FDVA 1FS4A 4B7AA 5ES4B 2A1UA 4B9EA 3LQ1A 3T9DA 5A0FA 3L6OO 3CVXA 3WGNA 4K05A 1OFHA 2ZT5A 1V45E 5KWEA 1SZPA 4NBKA 4WCDA 4IVPA 1LLFA 3WIDA 1Z34A 2QJFA 4FXPA 4AW9A 2B8WA 4LDPA 4BZWA 4TSKA 2WV9A 1Q1BA 1DDIA 5F21A 2GRUA 2HCRA 4UREA 5JS8A 3F9CA 1SAYA 4X20B 4F2GA 4HNAB 3QUCA 3RSSA 4DHWA 4KXNA 3Q2KA 1P61B 2ODBA 4PF1A 2OG1A 4JUDX 2Y99A 3D6VA 2X2PA 1HM5A 4E07A 1P60A 2PQ2A 4YQZA 1FDVA 1ENYA 2OBMA 1UZUA 3K1TA 1HY3A 3W8FA 4NCBA 3U7JA 4P33A 4PBTA 5K3SA 1VL6A 4JI1B 3M1LA 3W2TA 4J1NA 1LK7A 2CMKA 5AVSA 5CP8A 2NXNA 2RHGB 2JFGA 3CUEF 3NBQA 3WB9A 4E88A 4F1KA 2AGVA 1FDWA 1KI8A 3C45A 2EZTA 1AGXA 5DSXA 1QS0A 1VYVA 1W1UA 1Y1QA 3P9KA 1G8SA 3UOWA 2JJMA 1VE6A 5B3KA 5GTDA 4EM6A 4BO3A 4KXFB 1PLJA 4JY7A 5EMKA 4C43A 1V3TA 2A9OA 2E4XA 3EY9A 4DY4A 4AQYB 2DX7A 2GPBA 1JE1A 1SVUA 2L69A 4PNHA 3L41A 4AN4A 3H1PA 1BH2A 4I19A 2BDTA 2NO5A 3LNCA 4HDRB 3W8NA 3ZLTA 1XZIA 4CFZA 3VTAA 3K0SA 1GN9A 1AHIA 3CUWA 1K08A 2ZDQA 4ARIA 3JQFA 1AHPA 1F0KA 2CDAA 3K94A 4UXIA 5CNJA 4DA4A 3IOCA 1GOTA 5EUCA 1IIBA 2W6ZA 4HEJA 2XRMA 1ISFA 5KX5A 1MZPA 2XYQA 2ORWA 2WWXA 4UFPA 2ZRPA 4KCGA 1D2EA 2Q3FA 1TYCA 5DYYA 3EZNA 4JLWA 4LA4A 5FTWA 1A7UA 1CIJA 3VR4D 2ZJZA 2HBYA 2B35A 4ZCSA 1SA0B 3IDAA 4N8DA 1WP4A 3RYIB 2OMKA 4C05A 4MV5A 5DWQA 1L3BA 2B8EA 4ECAA 1WETA 3K35A 3M9WA 3I6QA 4P4SA 2H48A 2MMGA 3AY6A 5B1DA 2Q5QA 4Z0PA 1RCTE 4ANFA 4H4CA 2HRBA 3GT3A 3T3HA 3UFXA 5A7FA 3SXUB 4TVBA 1DX4A 3EBOA 1A8QA 1D9XA 1N0UA 2PH7A 3WB2A 2PWBA 3SNKA 5IMBA 5JNWA 2PMBA 4N7BA 2BR5A 4YRDA 1XVVA 4UHEA 3OC6A 3WL6A 3QTLA 3VO1A 1S4MA 4DRYA 5TS3A 1JEEA 2D2IA 3G2LA 4GBJA 2JLQA 4K7JA 4PSVA 1OKKA 3ONFA 3PKIA 1N5KA 1OKKD 1PT6A 3WIBA 2W98A 3HLYA 4MQLA 3T12A 3U9LA 5LWQA 1ICIA 1WPGA 2QRGA 3EG9A 1ND5A 4NV1A 1B8NA 1NBWB 2A1IA 2JK1A 2O2HA 3PFFA 4IDHA 3R4CA 3QVGB 3E18A 3I3SR 4AFNA 3RABA 2F9MA 2WAOA 2YY6A 4DCMA 4I7EA 4F4JA 5FTJA 3RDPA 3ZV5A 4CFYA 3UANA 3PENA 2P79A 3ZGYA 4CL8A 3N8HA 4XB6B 2JJ1D 2FUCA 1JEDA 2PRYA 3C8HA 2IITA 1B6SA 2AOXA 1Y7LA 2PRKA 3EIEA 3HCBA 5AVVA 5KCZA 3KQLA 1J1ZA 1I14A 2VJYA 1U11A 3SE0A 1QIIA 2HXGA 1N7GA 2YINC 4M0UA 4HC4A 1II8B 3OD5A 3E5HA 5DT9A 3VPSA 4R2IA 1TZ2A 3PHJA 4TWJA 1G8GA 2ZYDA 1E1CB 1DBSA 1XDWA 1HURA 3JRNA 1RRFA 4TUYB 3TFWA 2Q4OA 5IVHA 1UPTA 2Z6QA 4LRXA 5GONF 4FMCF 4F3KA 3F78A 1OI2A 2YIJA 1Y81A 1DV2A 2XUQA 2PX8A 3MBOA 4XSHA 3WAJA 3AB3A 4Y2TA 1G3UA 3OMLA 4LY3A 4OYLA 4UULA 1A9XA 3A0UA 1HWYA 3O4RA 1JZQA 1OY1A 3R23A 2A0YA 3EOZA 3OZUA 2WTEA 4LV6A 1V6CA 3JQFC 3WSWA 3V6MA 1KWKA 1SKAA 2VT6A 4DIUA 5GPBA 2QQ0A 3WA6A 2XX3A 2F4NA 2FJUA 4D4JA 2FOLA 1T9GR 3AWIA 3FY4A 4WXYB 4ND3A 3ZCUA 2Y71A 4BQSA 5AUPB 5TF0A 4L72A 3VR6D 3ZNOA 5LYJB 1IEQA 5KPDA 1ZHFA 4US1R 1YZGA 5AXBA 3WBFA 1LI5A 3C3KA 4D9CA 4PQGA 3E15A 3S2UA 1ONOA 2JG3A 4D82A 1AY0A 5C7LO 3BKWA 3CIOA 2KQUA 4U0JA 1XAJA 3L07A 2IYVA 1KBQA 1BVRA 1M10A 1NVAA 2WPDD 1KY2A 3PQ2A 5F5NA 1X9GA 4R31A 5M29A 2FSIA 2WDPA 1ATIA 1Z2DA 4XYLA 4MWTA 1EJ0A 1I3KA 4LX8A 1ZZGA 4V1CI 5KYYA 3EASA 4YAGA 5TJ9A 1TK9A 2BONA 2DE0X 4MDHA 3CPSA 1E63A 2QAIA 4D9NA 5JCJA 1YULA 1NI5A 4J16A 4H27A 2XZDA 3PNMA 3GLHA 1YJXA 4IEFB 1RHUA 1ZAYA 1B16A 1YSCA 1SBCA 2A2ZA 1J9EA 3KHTA 4RD1A 2PRZA 4RL4A 2IW1A 4TGLA 5FBVB 2FUG6 2Z09A 2QQEA 1Q2UA 2ZIZA 2J87A 2AVNA 3S68A 3TE7A 1UAYA 3K72B 2Z8ZA 1XALA 2GEDA 3KT6A 4QX6A 4YN3A 4CKWA 5AKZA 1MFPA 2FK7A 2C5LA 4GQBA 1D0SA 1RMYA 3WMXA 2ECQA 2X5XA 4QYSA 1S96A 3HB4X 1Y34E 2CW5A 1JLHA 1H2HA 2GX6A 3NU1A 4TTTS 5DB4A 4OYYA 3KB8A 4QUBA 1QHHB 1ZOIA 2ISCA 2RKOA 5JZBA 3MSXA 4L78A 3F74A 4XAQA 1K6MA 4O2LA 1CY8A 3ZY5A 5AVTA 1EFHA 3TQSA 4YJ2A 1KHTA 2WYVA 4TV8A 4ZZ1A 2C82A 3MELA 4J0IA 1XWWA 1L7AA 4LSMA 3TQOA 5K6RA 2QTWB 4WBNF 3RIHA 3K1AA 1QU3A 3A2LA 3OLQA 4HNQA 3OU7A 5AW9A 1WU7A 1YCHA 1GSOA 2XXJA 3FBTA 3HCRA 1JKIA 1T3SA 4PANA 2JFNA 2Q5HA 5CVCA 3I09A 4RD2A 1ST2A 5F1KA 1Z0KA 2Z5LA 5J63A 3TRHA 4J1TC 2XR1A 3O8RA 2FPLA 2WV7A 1NXWA 3KTDA 3UA4A 4CETA 1UBCA 2JF0A 3G0BA 4UAVA 4YJFB 4XFKA 3EA4A 3G0CA 3THWA 1RC0A 4O4HF 4NNOA 1D8TA 3QP9A 4PX3A 3LDHA 1Y9DA 2DLDA 1I2ZA 3MOSA 1OJ7A 3DC2A 4PYJA 3KUDA 1PRYA 1DIGA 1RI4A 1XQ6A 1NVEA 3B36A 1UC5B 3UJHA 2QIPA 3ZHZA 4G01B 4A92A 3T9FA 1E89A 1PD0A 3AEKB 3W06A 1KMNA 1EX1A 2OM2A 4EHDA 2JIOA 1JHPA 1TYEB 5B6PA 5C53B 5ICSA 1PT7A 4TLDA 5LKRA 4JVLA 2NUAB 4U9HS 3LA6A 3IHTA 4MROA 4D9EA 1U8TA 3DKPA 3T41A 4C0WA 1DBWA 1YHZA 5KWVA 2AZMA 1TCUA 5EJAA 4IDDA 1KEUA 1NVVR 1Z28A 4EKDA 3KE8A 3E6AA 2W9XA 2AOTA 3WRYC 4B09A 3AETB 1ZJZA 3ZWNA 1TUBA 1BDBA 2FFHA 5C7IO 4P32A 1GZDA 2YWEA 3FA2A 3P27A 1U04A 3W9BA 4E1BA 1F1JA 3QBTA 2JKYA 5KDOA 2CMDA 3BIWA 2OAQ1 2Q3DA 4HNUA 2P8JA 1KZ4A 2Q5EA 5EQFA 4EOGA 4TQAA 1QH1A 1YU6A 4GKAA 1FXUA 5JD4A 2C99A 1L8XA 3EWIA 3ZNNA 2ODPA 5HJ2A 1ZD5A 4OHCA 2GXQA 1TKRA 4V3BA 3Q3GE 3WL3A 2PSFA 3Q7PA 3QVUA 1NQAO 3VVLA 1PQWA 4KL8S 4M0PA 5EIXA 2BM0A 2C88A 3P0EA 1MW8X 1EBUA 4Y2RA 1NXOA 4P36A 1JKJA 1CS0B 1JE0A 2IT1A 2PBFA 3WZ2A 3LIIA 2XXAA 4GP9A 1DQRA 2JJ1A 3WLRA 2AQ8A 2ZIXB 1HFWA 5G2OA 3V4FA 5BV2P 2ZRAA 1E61A 3ZZ0A 1K1EA 2EC5A 1UXJA 3KD2A 1G8AA 4EKEA 2YN2A 5CVJA 4KXUA 5KHOC 2OHHA 3FIJA 2V7QA 4JA2A 4BE4A 3TRJA 1NTOA 3UAZA 3S2ZA 1IWPB 1UODA 3EMVA 4YQEA 2CGEA 2ZXUA 5A3SA 5DF1A 4DVJA 1UBGA 1KTIA 1K7CA 4GOXA 4AP9A 2JA2A 4L95C 4FYKA 4Y9SA 1KPIA 2FGJA 4LECA 1EVYA 1E3MA 4EUFA 1Z73A 1QUFA 3FN4A 2B98A 1Y98A 3ZU6A 2NUPB 1FP7A 5JYDA 3GIWA 4A4DA 3W5UA 1KYVA 3M89A 1ST3A 1ZUHA 2RHWA 3GFVA 1X0VA 4J43A 3FLBA 5BWLA 1LDNA 2HMVA 4J2OA 4BMYA 2FFRA 1BU8A 3EPLA 4PGAA 3EFEA 2B4TO 2LVBA 3I2GA 4PHHA 4AZVA 2H6EA 4YYZA 2FWNA 4YT2A 1SIOA 5K4HA 1YGYA 4KWCA 5B58C 1ZNQO 3VOBA 2GEBA 2N46A 1A4UA 2GR9A 4WNIA 3E7FA 2UYQA 1BMFD 4DIKA 3IAXA 3IUMA 1TT5B 3P0RA 2VF7A 1FP4A 3RPEA 4PIVA 1XVIA 2KLHA 2FZEA 3FUXA 2GF0A 1JIUA 2X6RA 4XOUA 5EWJA 4EK9A 5EXEA 1O54A 1XNHA 1OCEA 4YMHA 1MA3A 1QIDA 1XD2B 3CZQA 4BVEA 1NVDA 2Q1XA 2WU1A 1KO8A 3T7TA 2PWAA 4IGKA 4JLAA 2NUBA 4MX8A 2I55A 3G9TA 4XARA 3UWKA 3WKDA 3ZZTA 5IMSA 5JISA 5AKYA 2BOVA 2PXCA 1M6VB 3HUDA 1C1XA 4RCYA 5FBQB 1ZK4A 5KSPA 3T54A 4PRLA 3DZKA 3KP1A 4F5YA 2UUOA 4RTLA 3O75A 3JYOA 3EVFA 1J1UA 3BSYA 5ICCA 3OCVA 4IDBA 5LFAA 5KQSA 1US8A 3EPKA 1H5QA 1YQDA 3C3CA 2GN1A 2FPMA 1V5FA 1N2ZA 1NVVQ 5TT0A 4RDIA 3AVYA 2W58A 2XCRB 1KYTA 1BJKA 1D1PA 2PSHA 2BCJQ 1P9OA 4XUGB 2HWXA 5CTJA 3AUFA 3EHEA 4ZQEA 5EERA 2AE2A 4RKWA 5A1JA 4ZYWA 2F9LA 3R0IA 3PK0A 4MA4A 4RUKA 2OUKA 4Y6SA 5CXSA 5CB4A 1AMOA 4E6PA 5GM1A 4TRMA 3FW1A 1DRVA 3BXHA 4UNPA 3RU9A 2WP0A 4L8GA 5JTUA 5JZ9A 1KZYC 2J6CA 3DZ8A 1YUNA 5FWYA 1Z7BA 3TG2A 5DHSA 2XT0A 5JJBA 3X2SA 1M0WA 2ZUBA 3L0DA 1X3SA 2R8YA 5DCWA 3L8DA 1AD2A 3WLSA 4E4RA 2C5AA 4DIFA 3TFQA 1UXIA 4G2TA 3TEMA 4EB6A 4W5TA 2HEGA 1JAHA 2XVXA 3BRWA 5BN1A 1HXHA 3AI1A 3FGOA 3VQTA 2ZU0C 4REOA 4CNBA 4F72A 4WXRA 3VV2A 2W90A 3O6VA 5J2TA 1IJKA 1KJNA 2X0NA 5TDHA 1U8FO 4C7KA 5TQ0A 1OBVA 2AV6A 2PS1A 2OO5C 5LUBA 1PNRA 4KFCA 2A9PA 5BMVA 1HDXA 2J6IA 2VF2A 4MDEA 2DERA 2P3OA 4XD2A 1KVTA 5HEKA 4BNDA 3F1LA 1RQLA 1E96A 3M6WA 4BVFA 2L19A 1QAQA 3KOYA 4UHJA 5DE3A 3ZS9A 1BQ4A 3GEHA 3V2UA 1C3LA 1C14A 4M0LA 1C0IA 3RUPA 5YASA 5JNRA 4QDUA 2H8KA 5AUQA 5CX4A 3PVSA 2QLBA 3QU2A 5HE8A 3JD1A 3V5NA 3R09A 5HF6A 2EFYA 5LJLA 4DUYB 2Y05A 1RLMA 3EG9B 4MAMA 3LHSA 4E70A 1P4GA 1X1DA 1OILA 4FKBA 3RYTC 3BXOA 3GMIA 3O8BA 2VDNB 4BO1A 5C80A 1U7PA 2X0RA 3FBWA 3QVGA 4XPIB 5U4XA 2QP9X 1JKMA 1QYVA 2BY4A 1W85A 3MCZA 1E62A 2O8DA 3G5MA 2QN3A 4UNRA 2BSAA 1W4RA 3L1JA 1A98A 5U9CA 2HU2A 2FHPA 2OCXA 1KK1A 1XTJA 2C3YA 4QYMA 3D3EA 2DGDA 5TS2A 3TQQA 2AHRA 4NZZA 2BGKA 4ENVA 5G3ZA 4C22A 1G9TA 2ZIFA 1D2HA 1SM4A 3U2QA 4FK8A 1JIXA 2GSDA 3RVSA 2PT9A 1NP3A 2JGLA 4Z4QA 1M2GA 3C4JA 1L7QA 3H8WA 3KKLA 1E3LA 5FL3A 2Q1TA 3FHTA 1X0XA 3V8BA 4CQLB 2PFSA 3V7WA 4TMFA 3C3DA 2JB9A 4MI9A 1V37A 2VAPA 2TMGA 4FWIB 5ALSA 1SH7A 4C0BA 1NW8A 1CQJB 4U7TB 5EJ6A 1U5AA 1EESA 2AD5A 2FPGA 1EVIA 2VK1A 3MGGA 5FWAA 3E1SA 4MW7A 3TH5A 1R6DA 1QCZA 1X7XA 2GLTA 4JR2A 4WZZA 4WKPA 5E7JA 1QZTA 3DDHA 1JTEA 5GOZA 2K6GA 4MQFA 2GB4A 2Q5OA 5BR1A 1Q1ZA 5AW5A 5JWOA 3DE4X 1GTSA 3BMOA 1DHTA 4ZT7A 1AQIA 3N74A 4RY2A 1W73A 3TTWA 1S8NA 4XQ0A 3SC3A 3KQYA 2AS0A 3DDNA 3KZ1E 1IUNA 5KTOA 2QHXA 2DFVA 1UEIA 1VE9A 5C7OO 5AKKA 5B3JC 2F59A 1XDDA 4DLPA 1ZKDA 2P4QA 2OLKA 1V6AA 1R0XA 3COSA 3IEUA 4WFQA 5J2UF 3MT7A 1HZZA 1RTTA 1C2YA 3QI7A 3U7EB 3B78A 4CF7A 3HBMA 2EKLA 2FG5A 3VNQA 5B4TA 2HUPA 1EWYA 3DQQA 3U4IA 4OQYA 1WXHA 2B82A 4AY5A 5I7FA 4FVTA 2HYIC 1MNAA 1RQ2A 3UK0A 3WWCA 1E5XA 4QDKA 4MVJE 4HDNB 2JNWA 2J3QA 2CNLA 3E9ZA 3ESBA 3WNBA 3IAEA 4LIPD 5B53A 4EBFA 5LD2C 1MO3A 4D8XA 1G1MA 4BO9A 2WSLA 4LJLA 2X9GA 3OZCA 4D4KA 4HQNA 1WW8A 1JHQA 3L7KA 1LJ8A 3PR1A 3OQOA 1YNOA 1GG8A 1SCKA 4RD0A 1SHZA 2ZUSA 4PIMA 1QF6A 4B7UA 4FD2A 1IIRA 3QZUA 1GZSA 4MLZA 1IM8A 4JVMA 1E1RD 3REQA 3T3PB 4IVQA 5LZ7A 5D7BA 2QUIA 4E5NA 1Z6YA 3WLTA 1FU4A 1L7VC 3MN1A 3KR0A 4TTRA 1XVLA 3RAGA 3W3AD 1J0EA 4TKUA 3P9PA 2ZRQA 3QENA 4M1MA 5KQGA 3PHGA 3QELA 1DQNA 3VTFA 2QROA 2D00A 3K4QA 1SZJG 1DFGA 1JT2A 3H75A 4QUDA 5AOBA 2O06A 1EXDA 3IUBA 1PJCA 1LSUA 4QBHA 1G55A 4G23A 4MTLA 2Y3IA 5T41A 2UDPA 2FZ4A 6ABPA 5G0VA 3RCBA 2C9ZA 3NHZA 2DPGA 2YXDA 3MPUA 4C7JA 1W36C 2CEAA 3IP7A 5LQAA 2NU6A 1N8TA 2Q3MA 8ATCA 3KQMA 1OMOA 1O87A 2OB2A 3V9PA 2A1UB 1MGOA 1D0IA 2VOJA 3AR9A 2HA7A 2JGAA 1H8HA 4QJ3A 2I7CA 3D6MA 1CYEA 1ADYA 2QW8A 4MYRA 1LX7A 1G8KA 1AS0A 3S55A 4GP7A 4AUKA 2HMWA 3LQRA 4FSXA 1ECCA 5IC5A 1M5RA 1EWRA 3QIAA 4O2AA 1F2TA 3RFUA 3O84A 2BBOA 4NU8X 4J49A 1O0BA 3OPVA 3GZTB 3QVMA 4Q3EA 3UYKA 3ZHRA 5C8ZA 1XZCA 2P68A 1CYDA 1K7FB 2HPAA 2OBLA 2PL9A 2W6JA 3LP5A 1JTVA 3CNNA 3OZGA 4J16C 4M49A 4OFWA 1DQYA 4RC9A 4X6UA 2QORA 3LOQA 1CEQA 4ZT4A 2HSDA 3QE9Y 3L6CA 2BISA 3FCAA 3I0ZA 4ZZIA 1XX6A 4KOEC 3GJRA 4E0BA 2Q7XA 1NT2A 2C04A 5EOVA 3VC3A 3EGIA 4Z49A 3NASA 1OYOA 3B2NA 3G68A 3U4GA 1QRUA 3DMYA 2VC2B 2GPSA 4HFRA 4A8HA 3E2IA 4TKZA 5AP9A 3F0TA 4BCDA 1DQSA 1KJQA 1IVNA 1MVLA 2QMEA 3KOUA 4S24A 4BNFA 5JI2E 4PC2A 1JA9A 4HVTA 4TN1A 4MV0A 4PBSA 1A2KC 5D8DA 1L7MA 2Z08A 2VRBA 2XT9A 2GPWA 2GKSA 4PAWA 1AT1A 3QJGA 1U31A 1GAWA 1ULSA 2ZIGA 1WVMA 3GA5A 1MTOA 2M6KA 2BRUC 4G0YA 3LX4A 4WKNA 1DRJA 1ZCZA 4OAQA 3HFSA 4R83A 2ON6A 2W4IA 4NMWA 1Z0SA 4NZOA 4DA9A 3IXLA 2QF7A 2ZRJA 3OE7D 1HTWA 1DBIA 2CEKA 4CV0A 1YB7A 3G2JA 4N8SA 3EZ9A 1CS0A 1HFEL 4P7JA 1G3IA 1T13A 1BCRB 3G8CA 2H7CA 5B1EA 2K7ZA 3IO3A 5CB8A 3QY0A 2XUAA 1JECA 2ERXA 4E5DA 2GESA 2I1VB 1M1NB 1QG2A 1PKEA 2ZBGA 5B7GA 3A4TA 3HUEA 2QTMA 3A8TA 3HJNA 3OFNA 1ONBA 2R3SA 1LFDB 1LRJA 1YCFA 1VKHA 3ADPA 3WR5A 4MWDA 5HRUA 3MWEA 3O7WA 3UNXA 1YIAA 3SC6A 5TLSA 4IDEA 1M3SA 2YXEA 4WBXC 3W2GA 4X9XA 3F5FA 2HV9A 1LGYA 2XMDA 4ZCPA 1ADBA 3WS7A 1C4KA 2JBWA 4TWBA 1X94A 4JC4A 3P0IA 3UTDA 1YAJA 3PLAE 1P7WA 3AI7A 4OFZA 5H9VA 3G13A 3VJKA 3I9V1 4EJ0A 3GJ4A 3CE6A 5ECYA 1SG6A 1TQHA 1B1AA 3H5RA 4YO7A 1M1XB 1JLMA 3QLUA 2ILVA 2GHIA 4YH1A 3KJXA 1QHYA 3CM0A 3F6EX 4IF4A 4LS3A 2J9YB 3NNNA 3IA2A 5LQSA 3FMGA 5TF4A 1MO5A 2A88A 2PX0A 4LDRA 1IBMB 4LY9A 1V9CA 4MR9B 1GAQA 3G2NA 3WDKA 1YQ9A 4CCWA 3NMUF 1SU8A 3OJEA 1YB2A 2QGZA 4YJHA 5FBWB 2F00A 2QG6A 2DH6A 4PAGA 3QMWA 5IM4F 3IJPA 3QQPA 3ZIUA 5TT1A 4BMXA 3PQ8A 4CMCA 1S2GA 2X8JB 3W8EA 4EI2A 5FTLA 3OQBA 2BJHA 3TCNA 3TPFA 2UU9B 3N7UA 4NKRA 2FYTA 1KJ9A 1O6CA 5J59A 3DZIA 4GRIA 3CJRA 3WHIA 1OBFO 1YV9A 3HE3A 1NYTA 3F3MA 4ARZB 2IYRA 1XZPA 2ECPA 4OHXA 3FM9A 4L9WA 4R81A 4X44A 4ZQBA 3WYFA 3AX6A 4TKUB 3N2LA 1FMCA 1Z17A 4IQ4A 1Q44A 4WOBA 5JD3A 2GCOB 2OB1A 2WE8A 4Y18A 1BGVA 4BXOA 3O38A 1T8TA 4BRSA 3JASA 2Z0MA 3LC7O 1T2VA 4Q82A 4TLEA 4BMCA 5MGNA 1I4TD 3L9XA 1JKJB 3E22B 4BQQA 1MAHA 2XXAB 4OK5A 2JKZA 1YC2A 2LCFA 4LXUA 1M2KA 3KIPA 3KVNA 3TR6A 4ZANA 3QPBA 4N0QA 2JCXA 5F2OA 1KIFA 3FPLA 2EGHA 2FFAA 1SUSA 1PDVA 1WDTA 2DHDA 4KC0A 4P08A 4U7PB 3U7QA 1ACMA 1KEVA 4YUVA 1NZDA 2WLTA 3PZBA 1O97C 2ABWA 5ILGA 3RM3A 3ZU4A 1FVOA 3HJAA 1JPVA 1TGVA 2GCEA 3NWOA 2CLKB 1EDDA 4MQBA 1MP0A 1OAOC 1SXJD 1RYDA 3EXAA 5ITSA 1TE2A 4GXTA 5KKAA 2I4LA 1XZNA 2W6MA 2X5NA 1NNSA 2XNDD 1TQDA 2YS6A 2WYOA 3DYVA 2GCPA 4ZV4A 3Q0IA 2OFWA 3T5DA 3COPA 3WC4A 1UPUA 4ER6A 5BWMA 1FNSA 2CB0A 5F9HA 2YHAA 1XDGA 2HQRA 3KB2A 4C06A 5JFOA 1T36A 4FFBA 4UEQA 3UAGA 3RS9A 1Z15A 1T5DX 4LF6B 3CEPB 1NGSA 1QR2A 1ZL2A 1NW3A 3HSYA 1OIWA 2B7BA 5P21A 1FRVA 3AHHA 2REXB 2QZJA 3MMXA 1JHDA 4PGFA 5J1TB 5SYNA 1VCNA 2JAPA 1H23A 4WUVA 3ETGA 1GPDG 1PWYE 2VP3A 1RJ9A 2Z2IA 5G02A 3U6KA 1U2DA 1WB6A 1WWKA 2I3ZA 2OCDA 4KGVA 3U7RA 3PFBA 3WBKA 5BNFA 4J2TA 3R5XA 4KQEA 1YJBA 5I51A 5FOUA 4CEIB 2EX0A 3HBLA 4QU5A 4R01A 2IY7A 4JQCA 1KZ1A 1FFXA 5FD8A 3ZWPA 2YY5A 3NX4A 4E11A 3Q15C 1QRTA 4MKFA 4F6RA 1M6VA 1ORIA 1XN4A 3LZCA 4FBGA 1JQLB 2WIFA 5FUXA 3GDHA 3N39C 3NGLA 2PMKA 5FO1A 4IHKA 2CLOB 3LW7A 1S01A 4UM9B 2FE1A 2NQTA 5AOAA 3CCCA 2BGLA 1L5OA 4MWOA 2AC7A 2A0XA 3ON5A 4PSCA 5AM2A 5KU1A 1R0SA 3DT8A 4V38A 4AL4A 2GLXA 4RAQA 5MN5A 5G41A 4EWLA 2ZYTX 1Q11A 1N6LA 1IN8A 1NVKA 1JN0A 4HFJA 3FBGA 4L76A 2I8CA 4KNVA 2FSUA 4FUTA 3LUBA 3M1IA 3LLVA 4HB3A 4R1NA 3W90A 1OB2A 4GMKA 3LKVA 3P4XA 3CUTA 2PKQP 4X1YA 1A04A 4KUGA 2HMAA 3L8FA 3RQSA 3UF0A 3O2SB 4BLWA 4EFDA 7MDHA 2C5HA 2AG1A 3KXLA 1A4XA 3F97A 3NXSA 1ZZEA 4M1OA 1IWOA 3L40A 3LVFO 1XEXA 3NBZC 2Q3BA 5DI3B 5H70A 5F7JA 3WVNA 1CF4A 1WO8A 4IJQA 1T9ZA 3PUVA 4EGJA 3ISJA 4RZQA 3UMGA 3VZRA 4B75A 3Q8LA 5AW3A 3JYNA 4YS6A 5FL7D 1TM2A 1VECA 3I0NA 5LP6B 5PGMA 1NLZA 3ECCA 3E9YA 3GJTA 1JIKA 3G2IA 3DP9A 4AY6A 2F55A 3P97A 1YGPA 2JGDB 5SV2A 1VIMA 2ZB3A 4ITUA 1WLSA 1CERA 2HNAA 1U28C 2CB9A 3OTWA 5EMMA 3KPJA 4R6XA 4YJHB 1N4AA 3U1VA 3LTEA 3MGAA 2DFDA 2CHGA 1NYLA 3EE6A 4YRTA 3G7SA 3F46A 1V35A 1NW9B 2YS7A 4PYNA 3WKCA 1O6GA 5CVTA 5LU8A 2R1VA 4BNGA 2AOWA 4RX1A 2JIPA 3H4TA 1OOEA 1EFRA 5ARDA 3WQRA 4UNIA 1E9BA 1GJRA 3B51X 1BAPA 1C9EA 3NPMA 3H6HA 4UM8B 2XUDA 1N1GA 3A6ZA 3TTVA 3UXHA 4CXMA 1RAGA 4W9RA 1Q77A 4KPUA 3GDOA 5CCEA 2HKIA 5CEFA 1UMBA 3H11B 3CS3A 1ORDA 3H1BA 2GAAA 3ERCA 1G2OA 2KM1A 3R6GA 2XCSB 3WLAA 1NMQA 4FWBA 4JXKA 1KZGB 2WHXA 4I66A 1E4EA 4HQ6A 1OIXA 1G66A 1PSWA 2X0FA 3AZQA 3N0RA 4RF4A 5TVGA 3CX4A 1KVQA 4HLDA 4Z0HO 5AESA 5I7WA 1AHNA 1PFVA 1UOQA 3T9BA 1JU9A 2RGDA 4EHLA 2X2EA 3E8MA 3STVA 4J7UA 1RJDA 2EJUA 5JLAA 4IIJF 5EC8A 1OYVA 2Y67A 5IDYA 4DLSA 1UDXA 3W6PA 3L4JA 1QYRA 1ISIA 3OOEA 3GFOA 4MW2A 2VNSA 5DM1A 1SXJB 3WNQA 2IHKA 2BUCA 1EMDA 1L4YA 2IHJA 2NYRA 4LI3X 5FOQA 2QRUA 4QZVA 4OQ4A 4PTZA 2HT1A 2A35A 4P53A 2PTGA 1E2GA 1FDTA 1NY6A 3VR6A 5J23A 1UUFA 3STUA 1X1TA 2V7XA 3HGTA 3LO8A 3AKDA 3ELUA 4PLZA 4XTRA 4I46A 5CLGA 4ZO9A 5IP5A 5HM8A 1RKVA 4CODB 3TLZA 4YRBA 2ZJ7A 2PQMA 2YJ4A 3DHWC 2OHJA 1YDWA 4OEHA 4LF7B 1OX6A 2I2DA 2KPOA 3RANA 1IPEA 1AUPA 2GLUA 3IBFA 2PUJA 4FLMA 4ILEA 4LE0A 4CUKA 4PQFA 4ZYYA 4LTDA 1OH8A 3LL7A 1BQ3A 3UH0A 1N92A 5T3UA 1I33A 3BJRA 1NHWA 4KVGA 2A59A 3GVXA 2EKDA 2QD3A 4M55A 3AY0A 1LPPA 2RGCA 1FXWF 2ONKA 2QV7A 4BDTA 3SBXA 3ADBA 4ESVA 1B8PA 3IJ5A 2FFQA 2FZVA 2PXHA 2DKFA 3N2GB 1HV8A 3U61B 1Y6JA 3E3OA 2AIRA 2F43A 3L4BA 3ZDFA 2PZAA 3DOFA 1V4BA 1T6BY 2D5LA 3Q0EA 4ISCA 4LHWA 2AQIA 4Y1FA 4AZTA 3MQ2A 2WVJA 1XJ5A 2WJ4A 4QEKA 2PUTA 3L1KA 3ORFA 2GDZA 3OOSA 4UHHA 721PA 3HKBA 4DXHA 1QM5A 1F5NA 3SNHA 3KQUA 2ODQA 3T7JA 4DMMA 3EEYA 2I3AA 2G77B 4Y0NA 3HTXA 4RKQA 3IPRA 4IKOA 5EXTA 4TL6A 5EPUA 4MOWA 4MMXB 5LMUB 1MW9X 1M75A 4ID3A 4Q7JB 4BNDB 3ZQJA 1USGA 3B3AA 5DLDA 4N3CA 4U5QA 4EKIA 4ZPJA 4IMRA 1JNYA 4G9GA 1HETA 4L5BA 3ZJYA 1H9CA 1Z13A 3D0QA 3AILA 2YH2A 3WGVA 3OIDA 4HDSB 3Q41A 5AXDA 2H4WA 2CK3A 3MT0A 3O9ZA 3GLHE 3MJDA 3VO9A 2Q0SA 1EXVA 1DMSA 2YC4C 5CCDA 2GM9A 3IP9A 5E4YA 5FBRB 3ULKA 4U9UA 2XDWA 4BEJA 3TIVA 3LD9A 4A1FA 2ZE5A 5M34A 1G2IA 2WDZA 1BJRE 1E32A 4CVNA 3WSTA 5LXTF 1F06A 3O1LA 4GWKA 4YLYA 3G1WA 4WH0A 3RJMA 3TSWA 3O26A 2WUEA 3JWPA 3K30A 2V6BA 4RKEA 4EH1A 1UKBA 3V2GA 3TS1A 4AXXA 1N6HA 4D92A 5JQGA 3MGBA 2H2FA 4YCSA 4P7BA 4EQ6A 2R0QC 3H6KA 3O4IA 2J3KA 2HI0A 2CNKA 1CJMA 2WAYA 4G0XA 4HB0A 1FRFS 4MNTA 4UVHA 3D6NB 4JMPA 1GZVA 3HZHA 3D7NA 5FFMA 4ZVUA 4EUSA 2P35A 1WCIA 4EGSA 1DCKA 1HLGA 1R16A 1CCWA 3A4NA 4MR9A 4Q1EA 4LVCA 3W7BA 1W59A 1LS6A 3PHIA 3R3VA 4EGQA 4QJIA 3U4MA 1KFKB 1YL5A 3NEYA 3ETDA 3I62A 1Z4OA 1US8B 1FVFA 3K5PA 5EZYB 3RH0A 1QNLA 1TUGA 1XTPA 3QYFA 5J4YA 3HNPA 2VA8A 3K6KA 4LSWA 2QZZA 2IZ7A 3DMRA 4WFJA 1O0SA 4D79A 4OYHA 5FUYA 5JXGA 1XAGA 1PGQA 3Q5EA 2XWSA 3EUAA 1CLEA 1CRZA 1I1NA 3PHLA 4LCBA 3D7RA 4N7MA 1MOSA 4C0JA 1QH8B 3A7DA 3EMKA 4UOEA 2HXYA 2OZKA 5K8VA 2JANA 4ZJZA 2ZBFA 2ZJ6A 4D96A 1XB2A 4H7EA 1T1JA 3QVOA 2Q4RA 3L77A 4N1AA 4G0VA 3DXFA 5K99A 1ESNA 1MZVA 1UEXC 2D2FA 4NMMA 3UXMA 2IU3A 5FTKA 5KDDA 4XWOA 2RK6A 1IB0A 3TNJA 3VV3A 3CRZA 5DK6A 1YJAA 1E3EA 1UT5A 1NQ5A 2Q9AA 3FSRA 3ZCTA 3G17A 4R4JA 4G3XA 4IYJA 3GCGA 2EEZA 5HX7A 1GV1A 2CXXA 5DYIA 5TQ0B 3SJZA 1ZRNA 5D86A 2WOOA 3U7IA 3FWZA 4ZWNA 1BVHA 2ZI7A 1X1QA 1N5IA 1T1RA 2BFDB 2P69A 1L4FA 2VYQA 3H0EA 2I4IA 4IOLA 4ND7A 1H2RS 3DE0X 1KRXA 3K32A 1BKDR 3ZDYB 1O58A 3I32A 3LFHA 4N5DA 1UC9A 5GY7A 4HDKB 5KQPA 1YTUA 2FSVC 2ZT6A 1GG5A 1U0SY 3HBJA 4O4LF 4PG8A 1MVNA 4RVCA 1C4OA 2CVPA 2QTRA 4HWKA 3TAUA 4P35A 3UJPA 1Q0TA 1TYDE 2FWRA 2CMGA 1Q21A 2PFGA 3ZU2A 4LGCA 4CKBB 1EK5A 4QVKA 4WKOA 3TLKA 1ZWKA 4GDFA 1AM4D 3TSCA 3UB2A 3FWHA 1BX0A 1QWSA 4HN4B 4WJKB 7AT1A 1RAEA 4AX4A 2WZCA 5IEBA 2IIBA 1OW3B 2V6MA 1CZNA 2QL5A 1DUSA 1W2WB 4GMHA 4ND8A 2WJVA 4AN1A 3LS2A 4RWZA 2R96A 1LBTA 2C9DA 3V2HA 2V3CC 2CYBA 3P45A 1YJ5A 3E58A 3EF0A 2FSSA 3HSKA 4DW8A 4FNMA 2I4NA 1IY1A 2R6ZA 3EGDB 2DM6A 3DAPA 4MITA 1TMGE 2HIMA 4CM6A 3MW8A 2GN2A 3GEPA 4D3FA 4AVYA 4PC3A 4DEVA 1KEPA 1U3GA 3K3PA 2I22A 3PHHA 1LA2A 1U6JA 1GZHB 1OZAA 3L1IA 3I52A 3OHSX 5ECWA 3ML1A 3VKHA 5E9WA 3VAYA 3PSHA 2YFQA 4W6ZA 3ZZ1A 4WX2B 4AYXA 1YU9A 5ALLA 5HBGA 3OIYA 3P7MA 1Z4MA 2C7BA 4Q1AA 4EW1A 3VR4A 2N1MA 5A6SB 3JYQA 2E2WA 2P9CA 3E9RA 1DEAA 1L7NA 3BS4A 3E22A 4OM7A 3ST7A 1D2MA 3E1GA 3ZNQA 2ZI3A 1SBHA 3DCJA 4R2MA 3VYVA 3ZLUA 5DNVA 3ZR4B 3GLRA 1KJIA 5AHOA 3UJ6A 5KJ6A 1LVGA 2JIRA 1PJBA 1BX1A 3AU8A 1PBNA 4L07A 2CC2A 2EG5A 3WP1B 2AX3A 1MOPA 1T1SA 1U2TA 1YR8A 2NXEA 2PLAA 2SICE 1AB6A 3BWDD 3O4FA 4FW9A 5FNZA 5FXMA 4DA7A 3A04A 2OC4A 5IUNC 1T5OA 1ZS9A 3OCJA 2ZTHA 1N2IA 3OE4A 5EWLA 3ZD6A 6ADHA 1HKHA 1ZHHA 1UDRA 4F8YA 1XQXA 1W94A 1UBMS 3IHWA 3BA6A 1IN1A 4FZRA 4K87A 2JLCA 2QX8A 1FFHA 5JWHA 1NRWA 1HORA 2PEZA 4B74A 5LP6A 2OWDA 1SUIA 3CNEA 3EXHC 5K3EA 1FLDA 2NO6A 3ENQA 1PEYA 3HB9A 4BGEA 1OE0A 2FPPB 4QUEA 3RFCA 3U4QA 4DEXA 5ALUA 4I9FA 4L4ZA 5CLIA 1P8JA 1II0A 1YR1A 2BP7B 2XZLA 3HU2A 4AWXA 1RWKA 4LQLA 4DZTA 4PO1A 4AZ3A 5KNBD 1VC2A 3KLPX 5L3VA 2Y1EA 3H9CA 3I2IA 2W2VA 2B2CA 1Y7TA 3ZEAA 4XZ3A 2I1QA 3UKOA 4V0LA 2B4QA 4URXR 2ECFA 4IX1A 3DYBA 3BIFA 2P67A 1NDQA 3DXXA 1XYGA 4R05A 2QZPA 4LW8A 2H9AA 4AURA 5DEOA 4NXNB 3REFA 2CHUA 2FSGA 4AJOA 1HE8B 4FYYA 2PYIA 1PR2A 1PL6A 4Q39A 1H2AS 4YCMA 5JE8A 3TZKA 3F7MA 3B5IA 2L18A 3GAAA 3RRYA 1DZIA 4UD6A 1JEYB 1CV2A 3A4IA 1FX0B 1C4XA 3SMVA 2O8CA 4PQYA 4BB9A 1XQWA 4HUJA 5J58A 3FVWA 4Y1RA 5HFAA 5LN1A 3BC1A 1LFAA 3ONNA 3F5DA 2QW0X 4DJFC 2NVUA 3DH0A 3ZWDA 4ZAFA 1E77A 1NQXA 1XRPA 4XRRA 4KQWA 2WHQA 1KR2A 1G21E 2VPIA 2XMGA 3B1XA 5C8XA 1QQ7A 1CHNA 3OFKA 5K0ZA 3E03A 4GOOD 3DGFC 2VTEA 4HOYA 4WLUA 5JEEA 3K70D 3EIHA 4PFJA 2O7RA 3HZZA 3G6WA 2GBLC 3I6IA 3RHTA 4LOJA 3ZBQA 4F21A 1CVIA 4M4SA 1OI4A 1EVEA 1ZUNB 1NBMD 4KO2S 3RC1A 3BK1A 1U98A 4XD7D 4QTTB 2AVDA 2Z57A 3BGVA 4Z8XA 4BNHA 4AIRA 5K8LA 2OCAA 1YJCA 4W1PA 2O2GA 4GBMA 4LZOA 1CUJA 1J9GA 1WR8A 2CN1A 2A9RA 2YYZA 4PICA 5GV8A 3WNVA 3IR7A 3UFXB 1PBTA 1DNPA 5G40A 3CEHA 2CXOA 5MN6A 1T8YA 4R84A 2E4WA 3PGMA 4JLPA 5HCUA 3X1ZA 5BSHA 1E1YA 4A8PA 1HG0A 4EA8A 4DYVA 4BLOA 3RSZA 9LDTA 2GPYA 3CZ9A 5FLEX 4BP1A 3CVYA 4G89A 2NMVA 1JDSA 2IYUA 5F4BA 5THKA 1TTPB 3NBAA 3JVDA 5ICEA 5MFPA 1VJTA 1ZAKA 1E2UA 2Z4SA 3ANMA 2R7KA 3BH7A 4O4JA 2P78A 2ZRHA 3DOHA 1TJ5A 1QYXA 2HPVA 3LW8A 4CLXA 1GFIA 1T2UA 3GNTA 3WKAA 4HXYA 1H4VB 4RFSA 1JJAA 2G7ZA 4UUNA 4DSZA 2QTBA 3N05A 1T6ZA 1ZM7A 2AMYA 3AF5A 3OVMA 1E2FA 3PV0A 4QAJA 4FFPA 3RV3A 5ALWA 3U40A 2NVOA 2HA0A 4G97A 1P5JA 1OFUA 3DAFA 5EA2A 3WGQA 4JZYA 4KW7A 4CIDA 2AL7A 3UHJA 4DPLA 1MR3F 3OETA 3UV7A 3NYIA 3OZEA 1EK2A 3TUJC 4S1WA 4DIDA 3G9QA 5ALFA 3WJ2A 3AHGA 2QTFA 4AD8A 1WZUA 4JFAA 4PE5B 3A1CA 5CA1B 3O93A 1ZQ9A 1E4EB 1VMAA 3IMEA 5HVNA 4RSMA 1HGXA 2J0EA 3I4CA 1H05A 2FW8A 2IXBA 2QRPA 3WDLA 4B46A 1C8BA 4L4SA 4U8GA 3WNCA 3F67A 4D9HA 1FFCA 1H4SA 3GLQA 3HA2A 1L1EA 5FWYB 2YX1A 3OY2A 4R1LA 2X42A 5EJIA 5A71A 1JFRA 5CRIA 3QXJA 4JGGA 3NTLA 4ZU3A 3T5GA 3W34A 4AJNA 4MUAA 4CKEB 1BS9A 3TGLA 4CL0A 1R8YA 1ISMA 2WI8A 3DULA 4EMTA 1UBNA 1YCGA 1VG9B 3DD1A 1SBTA 2HSGA 1O6ZA 3AF1A 5BR7A 3BXZA 1L5LA 3DKRA 1ZSYA 1YMVA 4NWIA 3HHEA 4D3ZA 1GNSA 4JBHA 4WNCA 1Z2AA 5H68A 2L2QA 3B2EA 2XMQA 1GL9B 2AK2A 1WS6A 3M3DA 1TCVA 4B6PA 5FF9A 4KMMA 3COZA 4C6RA 3FCUB 4R7GA 3GLGE 2EZ9A 2IOHA 1YOVB 4NNJA 1UKVY 3DOUA 4RK5A 3CX7A 1DKRA 1P1KA 2XMZA 1NPYA 3MWKA 4O1IA 1HYEA 1UBSB 4DR3B 4J8PA 3JAMA 3OEHD 1J06A 5ADUS 3O9MA 5DNAA 3AQIA 4FB5A 3NJRA 1DJMA 3G0DA 1I6KA 1T4GA 1W9MA 3H13A 1JDBB 3PC8A 4TVKA 3NAZA 1UQUA 2NZVG 2JFFA 1PJRA 4UCWA 3TNLA 2YYAA 1J42A 3JV7A 5BVGA 4WK4B 3L7AA 2YJGA 4HLQB 1GTVA 3ZWXA 1PDWA 1Q83A 3BAFA 4GRAA 2P90A 1NJ8A 2HNKA 3EQ9A 1CZLA 2Q2OA 1VDZA 4OGWA 1A95A 3SKYA 1JG7A 2FP3A 4KYVA 2OK8A 1NRJB 2BFAA 3H9QA 1ECJA 2F43B 2Q7DA 3UXYA 1QGAA 3DMFA 4OCZA 3SGLA 1PVOA 2MDTA 3WLJA 4DLTA 1GSAA 1PW5A 3MJRA 3PQFA 3UGKA 4E31A 2AI2A 2CXNA 1JDUA 3VDQA 1IEWA 1QRRA 1JHVA 3QPCA 3P2JA 1BVYF 4Q3BA 3VYUB 2ZRDA 5HK9A 4JSYA 4OSPA 5DXAA 2EJBA 3I30X 4GBGA 4LRTB 2PSEA 1T4DA 2P1DA 1LVHA 3MYRA 2YWJA 3X1MA 4MWEA 5B7PA 2IIQA 3WGYA 1VHDA 5ILQA 4YDSA 3KCNA 1OT3A 3AUAA 3BRQA 3R41A 3B38A 5F5LA 2O1EA 4C5BA 4YWJA 1XCMA 1A76A 5CXQA 1KSFX 3W3ZB 2C97A 2P7HA 3OCZA 4NG4A 4B0OA 4LFAB 1POWA 1ISRA 1SHKA 2WK1A 3H5OA 4BL5A 3BRSA 1QF9A 3SSOA 2IP4A 4YRZA 5IYZA 1GUZA 3MS4A 5KWJA 3ENVA 2NVBA 1JPUA 2QXUA 2CLSA 5AKJA 5HFJA 4EY7A 2IQIA 3CHYA 2IVFA 3R1IA 4E94A 3M3PA 4B87A 1T9HA 3HGQA 3G9UA 3Q5DA 4IDQA 4DA8A 5JC1A 2ODEA 3E82A 4M0CA 4G2NA 1DPGA 1N5DA 4F46A 2WF8A 1N3YA 4GOKA 1EVQA 4C7OA 2EL9A 2QR5A 1DAMA 2IHTA 2R6AA 3CCFA 4NI5A 1YR9A 2HK8A 3DMNA 2YWCA 3Q7EA 2WFLA 4PO3X 4UMVA 5HF8A 1ZC3A 4BKQA 3KWLA 4XLLA 1C9NA 5I9LA 3VAZA 2Z8XA 3EGVA 3DTYA 3AB7A 3IMGA 2DHCA 4BX0A 3T95A 1P1IA 1AKEA 1V41E 2ZPTX 1ZDMA 1DKOA 3A32A 3NXKA 1NBME 4ZJUA 3ZHUA 2WG2A 3C3BA 3JAWB 1FSZA 3TLCA 5K05A 3B13B 3N0XA 4QDXA 1KC1A 2P9GA 2QW1A 1F20A 1J2RA 2V74B 3BM5A 1Y3FE 3PUYA 2QGFA 5BQ3A 2Q2VA 3KZOA 1FZQA 2BGRA 2CKDA 2OESA 4N6OA 5H1YA 3ZX4A 1E1QA 1SVLA 1RXWA 2DU8A 3CR7A 2X13A 5DT2A 4K8OA 3ZK7A 1XD2A 1GGFA 1RRKA 4KO8A 1PGNA 4UXHA 2Q8NA 5JOQA 5L3SB 4BMZA 3DNMA 5KNDD 2EWMA 5A4IS 2BVNA 4PG6A 2VYVD 1AKTA 4O6VA 1ML4A 3ONDA 5DYWA 4FMBB 4B6FA 3DAHA 4I5IA 1D6NA 1PSZA 1XO1A 1Z33A 3ANXA 3UWPA 4D44A 2XLBA 1WMAA 4IJ5A 3AUYA 4I50F 1MO4A 1DAOA 4PN3A 3GUUA 821PA 1RFLA 4B6GA 1F17A 4LRYA 5DYGA 2X7HA 3LM8A 3TR0A 2QE6A 3EIFA 3H5NA 3FYUB 4UC0A 1R4NA 1CZHA 2GRJA 5DHTA 5EMHA 3II6X 2O2IA 1WX1A 4FHGA 4R2WA 2O8BA 2XD9A 1Z8HA 5HE9A 2Z5GA 4CIBA 1X19A 2NGRA 1MC8A 5CB4B 3K2BA 3JWHA 3QKIA 3AB8A 1IWBB 3DE2X 1H8EA 1U0EA 2ZE6A 4C20A 5EUBA 4HP8A 1LDEA 1P1FA 1TLFA 4H7IA 3V4PB 1UR5A 4URVR 3A2KA 2XUJA 3Q7RA 3ND8A 4GVXA 4PQRA 3E8SA 3O3CA 1EDBA 4XIFA 1L4KA 1AK9A 1YZHA 1JEQA 4R68A 3V3KA 1MUUA 1RD4A 2RK4A 1CY2A 1ESZA 4U2EA 6NULA 1NNEA 3L8GA 4BVAA 4E51A 1E9SA 4D42A 3W4KA 3EFHA 4TLLB 3EFOB 3NRJA 4IIDA 3FNQA 3PIIA 4GKJB 1M73E 2IV3A 2OG2A 2Y1OA 5JAQA 1M74A 1MENA 3AETA 1LJUA 1Z5VA 1VL1A 3AIKA 3DF9A 3K05A 4MO2A 4MV1A 2DR0A 3EXG2 2GYVA 4OA5A 2WTMA 3TI9A 1X1AA 5CURA 3FDZB 2WWIA 4YCAA 1NJFA 4Z4CA 3PR2B 1XZGA 1Q57A 4F04A 3ORQA 3OZIA 5D5PA 3T3IA 4OGFA 1A5ZA 1HDOA 4B6SA 5EE3A 3DL4A 4AS3A 2J45A 4LFCB 1TZKA 2OO3A 2N47A 1RXCA 2QN8A 4GMDA 4QU0A 4XGKA 3DVRX 4L6IA 1A3CA 2JEYA 2QD2A 5IXSA 3L0CA 1PEDA 4KODA 3BE8A 3ZVRA 1WG8A 4J9VA 4NZNA 1A96A 3ZH9B 2BAGA 5KSOA 2AG6A 2WVHA 2GFQA 3T9CA 4OK3A 2DCMA 3NONA 3A6JA 3W9SA 5HP4A 1KZHA 2NO4A 4RTOA 3ZTYA 3NWPA 1NXPA 3C3MA 1QVWA 1F2UB 1VYUA 2QX7A 2OK7A 2V7GA 2IE8A 3B6IA 3EVAA 1Y1RA 1X7WA 3IKJA 4LQDA 2FPWA 2XHEA 3QM1A 1A2OA 1AXRA 3GRKA 4MS4B 4Z8YA 2BCEA 3R7SA 4BRWA 1IHPA 3K0CA 5JV5A 2WMOB 1DWQA 3EXFA 2HF7A 4OMUA 121PA 2GO7A 1BA2A 1GUFA 4RQBA 5B36A 1YRYE 3F8TA 4CKZA 3HVRA 2PWPA 4V0ME 4E14A 2WA1A 3E53A 2PMDA 4R1OA 2IIVA 2QM0A 2MR5A 3TW4A 1L4MA 1IOVA 1MDBA 1RCFA 2PKQO 3L49A 4IGIA 1UK7A 2C3OA 3HMQA 3QVJA 5A7GA 5JJ5A 1JJBA 3UEOA 2ALJA 4KV7A 1HQCA 3HFRA 4NLLA 4KYUA 1KPHA 1TB4A 1DRUA 1F2VA 3BX1A 3ROTA 5LMZA 2H1OA 1VSQA 3W9UA 3AEUB 2OCKA 3IAUA 4J3NA 2PR2A 3B6KA 4IJVA 2G3YA 4A0QA 3EULA 3ETJA 1NMZA 3LX6A 4YMUA 4W5NA 1MIOA 1OTYA 3X0DA 3ZV3A 2CK3D 5KHAA 4U39A 1G0OA 3UK6A 2XE4A 1E7MA 3HABA 2FRDA 2WWHA 4WRRA 1FU7A 4KVFA 2VPPA 4PHFA 3ZHQA 4F71A 4YMVA 3A6GA 4BGDA 2V3WA 1WXFA 3QE2A 4ZOLF 4BNNA 5AVYA 3DDCA 2ZW9A 3UK1A 5E1OA 5JXWA 4M88A 4F4HA 1NIPA 3TOVA 4P3NA 1NT4A 4YV2A 4LDZA 2DEUA 4RIHA 4F5DA 4JX9A 2PBLA 2XF8A 5EXPA 5IARA 4F9TA 5EQTA 1V2HE 1IBKB 4XCQA 3ZWVA 2VCEA 3C8MA 2YQZA 3NTVA 5BOSA 2BHRA 2FPPA 2JFXA 3KKMA 1J8DA 5H59A 1Z0ZA 3OD1A 1D5WA 3R7AA 4CKWB 5IPFA 3KHKA 2FZLA 4OHWA 2VYNA 3Q9SA 1H1TA 2PKCA 1AGYA 2F9FA 1OXVA 1Q7EA 3G2KA 1E1RA 5IJXA 5AUNB 2MINB 4V1CA 2DJIA 3FYCA 3E27A 1GYQA 3PB3A 4N5IX 1D5CA 2VHVA 2OORC 2PG3A 4TKLA 2I66A 4BLQA 2ZZNA 3G85A 3DMTC 1ZKMA 4FGKA 3KJEA 4I36A 4IQGA 5F1YA 1DMRA 4BP9A 1EQ2A 1K7YA 1DIAA 2HL6A 2NPIA 2QLFA 1U8ZA 2XWQA 5D1NA 5BSRA 1NP7A 4XM1A 3VH4A 3RC8A 1IY0A 2VDPB 1G3RA 3PPVA 3TSOA 4PSUA 4HFNA 4RS4A 1OFUX 2O2DA 3KB1A 2HA6A 5ESXA 2I2FA 5DGHA 4JUIA 5IC4A 5D3QA 4UQPA 3JVIA 2MSLA 1XDUA 1M1YB 3GXOA 3LYUA 3DO5A 3U44A 4DRZA 2YOGA 1U2ZA 5BQOA 4G9EA 4NEHB 1FLVA 5JH7B 4RZUA 3T3OA 3OE1A 5KOHB 4O4IA 1TU4A 2LDBA 1AMUA 2X7XA 1OX5A 2C2HA 4KQIA 1VKNA 2FF5A 2FETA 3T0FA 3NS7A 3CRVA 2VKTA 3EQ8A 4I3HA 3FGZA 1VCIA 1BE6A 3MD9A 4F3RA 2GDJA 1YQEA 5EP1A 4TRJA 1T1IA 3CEMA 3NIFB 4X1OA 3GA0A 2O9JA 4I2NA 5CT6A 3SZGA 4PW0A 3VYSB 5BNTA 1OXXK 2IP1A 3U16A 3ISVA 3FPGA 2GPTA 1XVUA 4L1KA 2VNIA 3QK7A 4PYLA 1H85A 4G63A 4XOIA 4ZHQF 5ITZB 3ADCA 3ABRB 3GAMA 3P9SA 1BD4A 4JN6B 2FPUA 5TXGA 3RUEA 4BU1A 2H2WA 1S2OA 2Y1LA 2QVXX 5FBZA 1IXYA 5B4VA 2BMEA 3K9GA 2Q5JA 1E2BA 4LV8B 4QXMA 4RY8A 1A5TA 3HA7A 5JASA 1N36B 3AFGA 3DT6A 1XZLA 4INAA 4Z4IA 4M8SA 1PR4A 3E61A 5JSZB 1UINA 3AEQA 3JZIA 3OF3A 1HBJA 1SPBS 2CLCX 1W29A 4MUMA 5FUMA 2CSXA 5EJ9A 1PQYA 4V0RA 4JYPA 2W93A 2HF9A 3OQHA 4WGGA 4IV0A 1ODJA 2GYYA 2QAJA 3OTOB 1WULS 5BVGB 4ZI7F 5C34B 3D4NA 2E21A 4RWEA 3SHTA 4M54A 4IILA 3SYRA 3ZCQA 4CQLA 3CNHA 3NIGB 1EYZA 2DSTA 4FPXA 4WJZA 5FTNA 1BE0A 1NKSA 2CMFA 3I5YA 1RQXA 3GD7A 1YACA 1RI1A 2JLYA 3AG6A 2QDKA 2QE7D 4OQQA 2JVIA 3EXFB 1XTKA 1IN6A 5BO5A 5KPJA 5HZMA 2ZIUB 1JJIA 2A0FA 1VLZA 3GQBB 1LZLA 4EB3A 1Q5PA 4JLOA 1EX9A 4ZI2A 4QU8A 2ZVPX 2HQSA 4LDAA 5CA1A 3ABZA 4F96A 4WVLA 4N49A 3V46A 4RA9B 1RI3A 1PAUA 4JBLA 3V1NA 2PSJA 5SICE 5HPYB 2CJWB 4NR0A 3PTLA 1E1LA 4V0OA 1D7AA 1SVWA 1V11B 5HIJA 2JVJA 4MEAA 5EKSA 3GT4A 3BSWA 1FNMA 3UJ7A 5I7OA 4OHFA 3S8YA 1PIWA 1G8PA 1W4AA 1ORWA 4K9OA 1USVA 1Q0QA 4Y2SA 4CR7A 4G24A 1T6YA 4CEJA 2FKNA 1Y63A 4GX2A 3AO0B 2QVBA 1PSDA 1V9SA 1AK2A 2PGIA 4HDNA 4XRGA 1UL1X 2JJ2D 4G25A 2JBHA 5AD1A 4A36A 2Q1SA 3C6YA 1ZBQA 1R6AA 3QMVA 1I5RA 3X44A 2P4UA 1AXEA 2XE7A 4OK6A 3F4LA 3OAAD 4RVHA 4EMSA 4JEHA 2HLDA 4EUKA 4I5FA 1PE0A 1CJTC 2EHDA 1NKVA 1X8KA 3GPDG 3LGAA 4XCXA 5GJVC 1GTL1 4E7OA 2HH9A 2Q6LA 2WAMA 1YVPA 1PWZA 1QK3A 1RS0A 2H0RA 2OP0A 3GFQA 3O47A 4LWZA 2VUIB 3HUFA 1G5RA 2KWIA 4FTWA 2JASA 3BDVA 4CCAA 3HK2A 1TEVA 3GVPA 3U0BA 1IK6A 2VCYA 3ELBA 1UC8A 4GHWA 3URMA 3IDSA 5FH9A 4F56A 1ZH6A 4PG4A 1VJDA 3FRHA 5HG0A 1B6TA 3GO4A 1KMIY 2FW1A 1H69A 2E18A 2O8VA 2QOEA 3FDIA 3I9MA 4NU5A 3CR8A 1DINA 1G3QA 3PA6A 4M1QA 5I9SA 4CBVA 4DUGA 4PYIA 4IUDS 1UJ4A 3BXGA 1Z7YA 3QU7A 1GY8A 4MI6A 4FJ0A 3SQOA 4CMEA 1EU1A 4Q4JA 3U4DA