1BE1A

Glutamate mutase (b12-binding subunit), nmr, minimized average structure
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
137
structure length
137
Chain Sequence
MEKKTIVLGVIGSDCHAVGNKILDHSFTNAGFNVVNIGVLSSQEDFINAAIETKADLICVSSLYGQGEIDCKGLREKCDEAGLKGIKLFVGGNIVVGKQNWPDVEQRFKAMGFDRVYPPGTSPETTIADMKEVLGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMATE MUTASE
publication title How a protein prepares for B12 binding: structure and dynamics of the B12-binding subunit of glutamate mutase from Clostridium tetanomorphum
pubmed doi rcsb
source organism Clostridium tetanomorphum
molecule tags Isomerase
total genus 21
structure length 137
sequence length 137
ec nomenclature ec 5.4.99.1: Methylaspartate mutase.
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02310 B12-binding B12 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 1be1A00
1I9CA 3IV9A 4R3UC 4REQB 3REQA 3KOWA 7REQA 4Q37A 1REQA 1CB7A 2REQA 1B1AA 3BICA 1E1CB 3IVAA 5C8DA 4HH0A 1K7YA 6REQA 1BE1A 7REQB 1K98A 2XIQA 1REQB 3REQB 2REQB 2I2XB 3KOYA 3WHPA 5REQA 1FMFA 6REQB 2XIJA 2YXBA 4HH3C 5REQB 1ID8A 4JGIA 4HEHA 3KOZA 3BULA 4HH1A 1BMTA 1XRSB 3KP1A 4REQA 1Y80A 3EZXA 3KOXA 1E1CA 1CCWA
chains in the Genus database with same CATH superfamily
1JSXA 1LA2A 1XJWA 1XU4A 1SKYB 2AXQA 3D7SA 1F6WA 4KXNA 3A28A 1D2AA 1NF3A 3NKVA 3SFVA 2NT4A 4O4HA 3DAGA 4E5VA 3JALA 4EATA 4WNYA 1R0BA 4EJSA 1KY4A 4DIMA 2QD4A 1YDEA 1Y6RA 3HNPA 3VC2A 1YS1X 2HV9A 1K7FB 2H06A 5FX2A 1XO1A 4QHSA 4ZVUA 2VP0A 4DW8A 3WLPA 1WZCA 5K99A 5I9NA 3PV0A 4UATA 2IHTA 4ZPXA 2QX6A 2UZAA 5H9VA 4YYZA 2O8EB 3S2SA 3BXHA 4ZEVA 1BGXT 2H00A 1N7HA 3IMCA 3OU6A 1B0AA 1ZSYA 1W49A 2KW5A 3FTCA 4LK2A 4PAGA 4GL2A 2ZUCA 1VL1A 3NGLA 4WKCA 5BVHA 1Z4OA 4J7UA 4MROA 5EYPA 1UK9A 1FDOA 2IYZA 3MTBA 4IG4A 3UF0A 5EZ5A 4C22A 1N1EA 4L4SA 3BK1A 1PFUA 4KKXB 4RGVA 3T61A 1VZ3A 5CBPB 4JT2A 3KOYA 3HJUA 3FHJA 5DU2A 1VL8A 3HYCA 4NE9A 1C4XA 1IAVA 1T2EA 2BH9A 2OMEA 2R84A 2VP5A 3DZIA 3PUJA 4C4RA 4RPJA 4PM4A 1PJ4A 2Y8EA 4B3CA 3EULA 3A9UA 4RMHA 3BC1A 1OBHA 3IERA 2DX7A 5AJVB 3D54D 3D43A 4NP6A 4DMHA 4A91A 5A02A 4ALNA 4ODIA 1M6YA 4DMCA 3HKBA 3IDOA 1JF8A 4B75A 2YV5A 6CHYA 3VSEA 3ICVA 1AUVA 5THXA 2WTBA 1SD1A 5I7FA 2AMLA 3VSBA 1NBHA 4ER0A 4RAQA 1JJFA 4MJ3A 2OGTA 1GAXA 5BN3B 4YAUA 2K5UA 2WZBA 4QJIA 1C3OB 4TLDA 4HH4A 5DXAA 4PCLA 1K7YA 5DBGA 1NXSA 1B0PA 4BWVA 2Q3EA 4EELA 1R6UA 2G8LA 3W5HA 1JR4A 2P30A 2DT5A 4PYOA 4LN1A 3RS7A 4FIZA 2VLBA 1N6RA 3DA8A 4OYHA 5KTOA 5KZMB 2IVFA 2X76A 1TO2E 1YZKA 5B6PA 1EFRA 3D2CA 1OWNA 1HLFA 2UZ0A 3BMXA 2FQQA 1XLUA 3AKEA 3NXSA 3R3HA 4NG4A 2OENG 4KNWA 5CK4A 3DHEA 2XJ9A 2NG1A 3X0DA 2FW9A 1IJFA 1U8YA 5AJHA 4EY6A 2IU6A 3R7LA 1HLPA 4CL8A 3FDXA 3GFVA 2J9GA 2HLHA 2FFHA 1K8RA 1O57A 3UPTA 4MS1A 3O9VA 1JAZA 4WDQA 4IUYA 4U6NA 1ESEA 3FLBA 3L3BA 2Q1SA 4PLHA 1EK1A 3KNZA 3EEOA 1FSSA 3JATB 3IBTA 3EB9A 1M3SA 1XU7A 2XZPA 2FTKE 1IBMB 5T4BA 3NHKA 4Z0TA 3PL5A 4OHRA 3UANA 2R6R1 3UAYA 5KNDD 3QF4A 5KYXA 2YBDA 3EXHC 1GQFA 1IN6A 1YRYE 4O5OA 3HJHA 1HOTA 4RDXA 3NNSA 5K0EA 2CN1A 1EG2A 3TB4A 4TLMB 1ULUA 3LRTA 4QUIA 4PFJA 5A0VA 1ZD1A 2P40A 1E9SA 2IEBA 5MN5A 4PZ9A 5AK0A 4B2LA 2AOTB 4RELA 5CVEA 1HTBA 2SCUA 3CKYA 1YS9A 4L4RA 1R88A 3O8QA 1LLDA 1XD2A 3KV1A 4BNWA 1KZYC 1CVRA 4JOCA 2BFFB 2V97A 4AYWA 2B20A 2HRRA 1UBHS 1NUAA 1K68A 3HP1A 3JY6A 3VPDA 1DU4A 3EVGA 4QXMA 5JFGA 2QTGA 3UWSA 4EY5A 3JWGA 2F3RA 1FFXA 1SVIA 4HDSB 4JR1A 3W78A 2O1XA 3LCUA 4Q3OA 4CM9D 4ILEA 4YT2A 4LEIA 2COEA 2Z56A 4CV0A 4AAYA 1E1RD 3DYBA 3OZGA 4UULA 10MHA 3UW1A 1KSJA 4OM7A 2RKWA 4XRGA 4IGKA 5C4MA 2JLRA 4PLGA 4G0VA 1XPUA 3EGIA 1VG1A 3T0GA 2F1OA 3AVWA 1FLNA 2CXXA 4RD1A 4D9IA 1JMKC 3G2IA 1N6NA 1EVQA 3CEJA 1HZJA 4BKQA 3RRYA 4FMBB 5IKXA 1VA4A 3AFGA 1QH8B 2FUNB 2I4TA 1JIVA 2J9YB 2JIBA 2OTCA 4UM8B 1LVGA 3QOYA 2ZWPA 5A5EA 1KI7A 2WW8A 2VN8A 3AHJA 3KPYA 1Y1QA 1TA4A 5M5BA 3PPYA 4OYRA 2WB4A 1EWKA 2JARA 3IHTA 2WWWA 3VJLA 2I80A 3V1YA 1WQ3A 2WE7A 4D96A 5IKEA 3GJ3A 1O97D 1USUA 2AEEA 2LCFA 1LQTA 3IQWA 1WSDA 1ZS9A 4P4SA 4Y2JA 2PLAA 5EWLB 2XCQA 3P4YA 3WR5A 3ZU5A 2JGRA 4CBVA 4PRLA 4Q1BA 3WYCA 4QT4A 4KREA 2A9PA 3BSYA 4LGMA 2OMKA 4S05A 4L0DA 4UHFA 1SVWA 3Q3CA 4KLCA 1HF3A 4AL4A 2IPAB 3DBRA 5AW9A 1E69A 4MGIR 5JVDF 2QTVB 2ZS9A 1OZFA 1EFDN 4QBHA 3RI3A 4RA9B 3DMFA 5IAEA 1J0XO 4CQMD 4MVJA 1ZLXA 2O1SA 3L8MA 5IZCA 4GNRA 2BCGY 4HRYA 4KGVA 2VWPA 4N3NA 1RLIA 1UBTS 2WHQA 3OO1A 4D8VA 1IEXA 1Y7HA 3C74A 3FIUA 4PWZA 5B57C 1Z47A 3QXJA 1G7CA 4IAOA 2GBLA 1RI4A 3PQ4A 2M6KA 4ER6A 2EVWX 3AVXA 2BFOA 3NJ4A 1NXVA 5YASA 3I04A 2ZPAA 4UMDA 1L5NA 2VTVA 4LCEA 1DBIA 3PQDA 3NI2A 4HH0A 2AI2A 2MCFA 4FB4A 2CLFB 4R69A 5HEKA 1FBNA 5T5QA 2IXGA 3VPSA 1JZTA 3GPIA 4UM7A 4L6CA 3RE1A 4C0SA 1V2GA 1WPXA 3QBDA 2Z98A 4MS3A 1Q16A 3IDAA 5DHFA 3PA8A 3OIUA 4ZI7A 2W11A 1CRQA 1ZN9A 2QM3A 3T7RA 4BB6A 1RI2A 1CNFA 4B6SA 3M2PA 1O94A 4P4LA 4QFDA 4O1HA 3RAFC 2DFPA 2EYUA 5DGIA 4LRTB 4DV0B 4GPBA 1SD2A 4Y0NA 5JSZB 1QDEA 3KVYA 1KWKA 1G8AA 2Z5GA 1SIWA 4LZOA 4UBLA 3UV6A 4K9OA 5JH7F 1S96A 3L1UA 4HDAA 3I5YA 5HBRA 3ET5A 4F8YA 5JPCA 3P20A 3R8XA 3PR3A 3RD5A 4IOMA 4ML3A 5FHQA 4PG8A 3NDBB 1YXMA 3F8WA 2IPMA 3TZHA 2FI1A 3L0DA 5KTPA 1Z2AA 4KWIA 2ZYUX 4B0PA 3CLHA 2CFCA 3ZWWA 1XVTA 3D6NB 3NOOA 1JHPA 2I4IA 2X4GA 2Y6UA 1RQNA 3DO6A 3IGFA 4LIPD 1I4LD 1PV1A 5FL7D 3UMMA 2OBBA 2PL9A 3EFOA 3AEZA 2FP3A 2W0MA 1R8JA 3HN7A 1KNQA 3DBLB 1U2PA 1KBZA 4I4LA 5ALQA 1SVSA 2FOIA 4YUVA 1XJCA 3A1NA 2J7PD 4JMPA 2PD6A 3AXSA 1SK8A 3OT5A 4JSYA 4BQNA 4RBNA 1ZXLA 5JCOA 3CX7A 4D9KA 2P67A 2ZBPA 1O1YA 3QRWA 4XIYA 1L6IA 1XWFA 3REOA 2G06A 4E2ZA 3Q9UA 5DNUA 1I9CA 1HE4A 4MWZA 3AEQB 1HNZB 1VSUA 4GUAA 2HUPA 4HQ6A 4DLLA 2X0FA 2Q41A 5IK2D 1OZHA 3BL8A 1G16A 1HOXA 1RJFA 3QJ5A 4F3YA 1EXDA 1QRTA 2ATIA 3IBFA 5AVSA 1REQB 3WVNA 2R1ZA 3FDZA 1R0KA 3DPUA 3E1GA 4FHFA 3L4EA 4QULA 4DHEA 5DNCA 1QCDA 3OZUA 4KPYA 3PNQA 2F6RA 1ZGAA 4FQ7A 4N0QA 3UYKA 2O6HA 4FBMA 3AUFA 4G07A 2C7RA 3IHLA 1CUGA 3II6X 3SG0A 5IT5A 1FW8A 4UEOA 1U1FA 2E49A 2ONJA 5CA1B 5CP8A 2CKDA 4M4SA 4C0KA 4D97A 3Q7QA 4DRXA 4XPIA 4KUHA 2ZRNA 3ZD6A 1KFJB 3I42A 4JLDA 4F4UA 5KNBD 1R66A 1JA9A 1YUNA 3JR3A 2ZYWX 4O2AF 4RTJA 4IFBA 1U9IC 3HV2A 1K63A 1W85B 2ZRMA 3SBEA 2JKVA 1KR2A 2VT7A 3A31A 3E82A 4RHCA 3MGGA 3RJTA 1QVZA 4UBKA 2PAFA 3B3JA 3H3XA 1XOIA 4FU0A 5BWOA 2WDZA 2WMOB 5I4BA 2EARA 2F3SA 3U17A 3WKCA 3WO0A 1ZJYA 2IYUA 4QU5A 1XHLA 2XKKA 4JP3A 2AI3A 1JBQA 1JDBB 5FWDA 4IH1A 4X8MA 1K4MA 1M6NA 2EQBA 4UQOA 1XXHA 3N28A 2R751 2OV1A 2I1VB 2R8XA 3BS4A 3GAZA 3H1AA 3HFJA 4IMPA 4R54A 1SKQA 3IBSA 4OI2A 3T12A 1E7MA 2I62A 3ANNA 4ZYYA 1XMXA 1MEOA 4LF8B 3E6AA 5JI2E 4TS4A 4XPZA 4RK7A 1XKTA 1Z0AA 1QZXA 3CC8A 3DWEX 5KYVA 1UJMA 5JLAA 4A0FA 1CDOA 3OUTA 4LAFA 4AJHA 3KDPA 3W9UA 1DSSG 4UFPA 2ZXUA 3T95A 2GZMA 3D5EA 4H4CA 1JEQA 3OKFA 1XTBA 3HYRA 1WHSB 1CEYA 4UUBA 1CS0B 5A7FA 3MUOA 2PNFA 2Z4RA 4Y6OA 5BMVA 4CXMA 1A71A 2O4UX 3G2KA 5EKTA 1GUYA 1Q57A 4CM9A 3MCVA 3OLYA 3U13A 1FLAA 1UJ2A 3JASA 3L1JA 3PKJA 2G8NA 1E1RA 2VXCA 3LCJA 2PY6A 4EKYA 5DPMA 1GAJA 1X74A 4XVUA 1N33B 4YS6A 2HWKA 1GLNA 5BW8A 2HWUA 1IBRA 4FINA 4J49A 4MWBA 1ZNWA 4KQ2A 1DCFA 4V24A 1E0AA 3GPCA 3IQHX 5CYPA 1MJGA 5F1YA 2QR5A 1KGSA 4C21A 1GPLA 2GBIA 2J5XA 3ER8A 2X86A 5JAZA 2DPGA 4RULA 3OSZA 4FZJA 2HJ9A 1DKPA 3M5CA 4NR0A 4YAIA 4CLRB 4UE6A 3ESZA 4J03A 4N5NA 4X84A 1W75A 1BC5A 4HB0A 4YPOA 2V7VA 3JQ7B 2H4HA 3NBKA 5CMLA 3RIYA 1NBOA 3JWHA 3OCXA 2HN9A 4PVCA 5GJVC 4DA0A 3C3BA 1M0SA 4PAOA 2YCBA 4FD3A 1W88A 2NO5A 3RYTC 4MWGA 3MINB 2AOUA 1Z3IX 4KDEA 1KI4A 1DO0A 2IU3A 4X92A 2DHRA 4WCFA 1WMDA 4MWCA 4XIGS 4B3XA 1JDTA 1WUJS 4FCVA 3FDIA 3NFYA 2WSMA 1DXYA 5FWXA 1Z5NA 3SJZA 3TNYA 2DXIA 5ERXA 5M7EA 3D2LA 2QTWB 3DCYA 1B6SA 3K8YA 5ILQA 3ZNNA 3OP1A 4DAEA 1H1LB 2P1ZA 5AM4A 3UXMA 1LPAB 2RHRA 1WPGA 3GT3A 2C57A 2NYVA 1GADO 3SICE 2NUPA 2VJDA 3CNNA 2QD2A 2QLLA 3IKLA 2OHJA 1S9HA 4W7HA 5KVQA 1OXXK 4CQMA 1XDWA 1CS4C 1DJLA 3CNHA 4I3FA 2H9YA 2PE5A 4I7EA 1RC8A 4ZTBA 4MI1A 4XASA 3K15A 1KMNA 3PHBE 3GBPA 3U4AA 3MMZA 4G81A 5JAUA 2YBEA 4HB4A 1PF7E 1RADA 2R11A 4HRVA 5SV2A 1LC3A 3F6RA 5ALEA 3NFRA 3NC1C 3WBBA 1E9DA 2QSJA 2VPQA 4TV8A 3FB1A 5DASA 4AX4A 2Q50A 1JFLA 3H19A 3NYQA 5JYEA 2GHQA 3G1UA 3K30A 5AKKA 3M33A 1DJPA 1EVZA 4TQAA 3U39A 1C9NA 1F2VA 1ENPA 4NNJA 2GK4A 1GTZA 1N2ZA 5FPHA 3SX4A 3LHKA 4EVSA 2QRZA 1YB5A 2Z8ZA 2P3LA 4W5JA 4YP1A 4EHFA 1JQ3A 2QUAA 2K87A 3OF3A 1M7HA 4EEKA 4HVCA 5KOYA 1MB3A 2ATEA 5AKJA 4DCUA 1KO7A 4IJWA 5A7HA 1G5IA 3DL0A 1PJ3A 2FZEA 1B1AA 2WF5A 1NVFA 2NACA 2Q8PA 4R1MA 3NHLA 5J2TA 3EPPA 2GHRA 4XX0A 5TIIA 2Z6UA 3QU5A 4C0AC 2Y66A 1YDFA 5KQSA 1WSBA 4OQYA 5FTLA 4NU6A 2HSZA 5CX1A 1KF0A 1NW7A 1P6XA 2AG6A 3BXPA 3FRJA 1G0OA 5FL7A 4BVBA 4NSNA 5EQFA 4GKJB 2ZVQX 4WXEA 4Q3LA 5EJEA 3PX7A 4JJGA 5FUYA 3WYNA 4BMXA 4WZBB 2RHHA 2POQX 1QYRA 1QGZA 4DA8A 2J7PA 3MT9A 4ARAA 5KS2A 3F7NA 5FNVB 5LA6A 4GQBA 1VZ2A 1R4MB 4D9CA 3ENNA 4QA9A 1XNQB 4E3WA 2WY2D 4PPQA 3ELUA 4FHZA 4LQCA 1EDDA 2I78A 2RK3A 3H9CA 4DB2A 4X7PA 2X2EA 5BSUA 4I36A 4KXQA 5IK2A 3IP1A 3U44B 1T5OA 1TA0A 1KH2A 2P11A 3AH8A 4PIMA 4S0XA 5IDWA 1EIZA 5HNKA 1EFVA 5KJ1A 1TEXA 2G0NA 1OH7A 3QELB 3V42A 1OC4A 2KLBA 1T9DA 3FYUB 3SBOA 3INRA 1G9XA 2VCYA 3FVQA 1C30B 4YAWA 1CUBA 1DAPA 1GG9A 3MJTA 4NPAA 4DLRA 4DQKA 3Q88A 1C2TA 5GIOE 1BFKA 1KMMA 3VKGA 1ULSA 2YXDA 1D2CA 1M75A 4O4HF 4HUJA 2QVXX 4ESOA 3WGQA 4E1VA 1WABA 3FNQA 4CGZA 1ZEJA 4B48A 1AZTA 4E7OA 3KOUA 2WT4A 1Y1KE 5F1PA 4W5TA 2ZRFA 3PFKA 5KNBA 1YR7A 1NVBA 3SXUA 1Z7WA 1T4BA 2Z2IA 1AMUA 4ZCLA 1H5QA 1R9MA 1ADGA 4AN4A 3IJRA 5T8KA 3PPIA 1GNPA 3RLFA 1OHHD 4MVWA 1N1DA 5LZ7A 3EGXA 4CUZA 5FQNA 4H0CA 1DAIA 5CFMA 4BNMA 4EPRA 1ZOPA 3EG9A 3EVEA 1ZHHA 4OB8A 1TDJA 1LBTA 2YHIA 1WNFA 2QV0A 4FYKA 3IMGA 1CP3A 3LGAA 4FCTA 4TTSA 1NULA 1BFDA 3QK7A 2QRLA 4GPAA 4MX8A 1LKZA 3PXUA 4BYMA 4N9WA 4JLAA 2CXTA 4LVOA 2FSGA 3RQSA 4ECEA 3P9IA 1SKAA 3COPA 5KPJA 4IQFA 3TUJC 3DOFA 4G37A 2LE0A 3JQDA 3KU1A 5A3QA 2VHXA 4HQFA 1E9EA 5JXJA 1ECCA 6ADHA 4RHYA 3UW3A 1MQAA 1BH6A 1ZI9A 3IYLW 3RUDA 1I2AA 3DEYX 2BRUA 4MOWA 5BVGA 1EX9A 3GEBA 5FULA 3LUGA 2YZ7A 5GONA 4BWFB 5I7EA 1HM5A 1D2HA 5C8YA 4BATA 1YHZA 5ERYA 2PMFA 5A62A 3E9ZA 1C0IA 2HXYA 3KSUA 1FXUA 5FR1A 3I6MA 2CF5A 4L85A 4PZYA 1EFKA 5CURA 4FDLA 3RF7A 4YRIA 1FA9A 3I8OA 4OJYA 3I01M 3MWGA 4JXXA 3ZHZA 2N46A 4G0WA 2OFXA 4NJOA 3CJTA 3F2IA 3NBAA 1IHDA 4DCGA 3D02A 3RUAA 3GRKA 5B7NA 1JEYA 1Q3KA 4HAZA 5BSWA 1XZFA 1LH0A 2YIMA 1KMIY 1Z7EA 2PXHA 2YV4A 3AFHA 3DMRA 2ODBA 4PZEA 5CFOA 4J0HA 3W5UA 3A1UA 1XZ8A 2IGTA 1BRTA 1RI5A 1RKUA 4LCBA 2YRWA 3HKDA 4Q9KA 5E1BA 5CCDA 5P8WA 4NZZA 3URMA 4PRYA 4CL0A 5DM70 3SX2A 1L7RA 4PFSA 5AM5A 2AK2A 4K6OA 2QJWA 4TKUB 3IOEA 1FTSA 5JOQA 5BWLA 1BXGB 2C7GA 1MO2A 3FMGA 3UYLA 2AOXA 4DNQA 5LD2B 3U4MA 1M1UA 3WA7A 2QU8A 1NTRA 3C39A 3KQMA 4LOJA 1N25A 3JSAA 1YL7A 1T9KA 2C2ZA 2I2CA 1VIAA 4KC0A 5F9FA 3JVUA 3DLIA 1Y8CA 2ODQA 3OZDA 1XZAA 4OHZA 4AWXA 3IE1A 4CTOA 2FZWA 1YFKA 2Y0DA 2P5UA 5L7TA 2IXTA 1WV0A 1VI6A 2XE6A 3S27A 2AUNA 2RH5A 2AMYA 2D54A 2FPPA 5T41A 2WU1A 3S70A 5LDHA 3VI3B 5CXQA 1TM1E 1S7GA 2QPTA 1GNSA 4CLOA 5ESDA 3ILVA 2WD7A 2FV8A 3O9MA 2FMTA 1P6QA 4UAGA 4F71A 1YQTA 3GCGA 4ZRMA 1E94E 3FPKA 3TLZA 4RGQA 3TRJA 4U6SA 3BFPA 2FFJA 3BERA 3T5MA 3UHOA 2DECA 2XUHA 3P2OA 4M1OA 3E84A 3LPMA 2MYTA 3WJ7A 4JI4B 3PNMA 4MP3A 5E7MA 3UWPA 2ZLBA 3D8TA 3W90A 1QYWA 1BKSB 3VDQA 1IN7A 1FSZA 1P62B 2RB5A 3T52A 4DEXA 2GN6A 3ZDYB 1WZNA 4XM1A 4UE3S 1W52X 3LM8A 2HEGA 4QXAA 3IEXA 3ETLA 3O21A 4Q9NA 2G77B 3O6VA 3BMOA 3GUYA 4OXQA 5FOTA 2BZ1A 1PT7A 2Q21A 3C3AA 2IYXA 4S1TA 4KQMA 5J4KA 3LLVA 1HYHA 3BXGA 5I7SA 4AY2A 3GI1A 5HPYB 1SUEA 3S8YA 4ZWNA 1FYEA 2ZGVA 4C6RA 2NZWA 5ALSA 1U7XA 2CXHA 1EJBA 1Z9BA 1CUWA 2WVJA 1G9TA 4K2HA 3NIBA 4HC4A 4N0PA 5DGDA 2LDXA 3EOAI 3ACDA 3JTMA 1ZMRA 5AMXA 5EPOA 3TEFA 3X44A 3BD9A 3STYA 3ZK9A 4DCCA 1PYGA 4CEJA 1XROA 1RT9A 3K1TA 3WXBA 1JSRA 2Q6OA 3OQ1A 4Q12A 1HZZC 3RS9A 4UHJA 1FCJA 2VQSA 3ONNA 1UXOA 1KPGA 5KVCA 2BFDA 3N87A 3JQAD 4Y9DA 1DTWA 3M9LA 2QM8A 2Q3MA 5KYTA 4I81A 7REQA 1T91A 2GSDA 3B6JA 1O95C 1U31A 4IX9A 3I64A 4CHGA 1DTEA 1RXCA 3NETA 1X8JA 1AKWA 1Z2EA 1SBNE 3MJEA 3RROA 4NZNA 2YCLA 1JKIA 1SY7A 3B38A 3OE7D 1FNBA 5DLYA 4WI1A 2Q6LA 4DXAA 2FZKA 3TG8A 5CGZA 4HGNA 1T0IA 1WB6A 4PPGA 3HR4A 4FKMA 2VK8A 3DFIA 4BQFA 3QXCA 2WJWA 1K7CA 4HV4A 2YFYA 2CUNA 1ZIPA 1A50B 2KM1A 1DIOB 2O23A 1UBRS 2CLDX 4I1VA 4YCMA 4JEIA 1FFEA 4AN0A 4XD7D 2YWBA 2HMUA 3EFEA 1JWAB 3IEKA 1AZLA 2WWGA 1XZPA 3B3AA 4IVPA 3DAOA 3SC2A 1ZNZA 2P8SA 5G1PA 3CYFA 2A94A 3FKJA 4HGZA 4WKPA 2YY6A 3IUMA 4ZVSA 4B80A 2IBSA 3E05A 4PX2A 1KZHA 2BGKA 4OQLA 4GLJA 4R0VA 4B6JA 4ZI7F 3LVBA 2HZBA 5BR4A 1P5FA 3ROFA 2VP9A 4JHXA 4QREA 1CQJA 2DKNA 3LP8A 4GT1A 2AX3A 4II3A 4A27A 4XXHA 1GZ3A 1OHHA 1PT9A 4RIFA 3K8OE 2RB4A 4Q5IA 2Z09A 5JJKA 1BJKA 2MHCA 3P7MA 3OQ6A 3BCUA 1OWLA 2BAGA 3B13B 4GH5A 3LH5A 4Q7MB 2DUJA 2WPDD 2XMPA 2X22A 2HGZA 2PS3A 3KT6A 3SQLA 4TTVA 3S3TA 2HWWA 4RFVA 2G36A 4XSVA 4XQGA 2GCNA 5A4DA 1BN6A 2SNIE 1E6CA 5EC8A 4B6EA 1C5KA 1BNCA 1GPDG 5HM6A 5HJEA 4KYUA 1QQAA 1S4QA 1UC9A 2X42A 2WU3A 4CRWB 1WCWA 1N6PA 3AOEC 2FWRA 3BD6A 4L28A 2DLNA 5I7HA 1KEZA 1Q0ZA 4EG6A 1I3MA 1MQSA 5ALKA 3D64A 2JLCA 3Q98A 4G1UC 4M0PA 4Q7QA 2BH2A 1EFUA 3R5SA 3KWFA 1EVLA 2GPBA 3OJ0A 2OGSA 4HHEA 1WULS 4AY3A 1FP1D 4Z51A 2G1KA 4LZZA 1EFHA 5BUZA 4JBIA 3GA7A 5JPIA 2WJZB 5LZ2A 3LBNA 4H6WA 2DPHA 3CPEA 3LBFA 5DBIA 4KE7A 1L3BA 1VBFA 2F3PA 3SHVA 3CEHA 1W35A 2FPIB 3HJTA 3Q3EA 1DNPA 1PD0A 3BWBA 5EP3A 3RFTA 2ZOSA 1MXHA 2VFAA 3FGOA 3G82C 1K75A 5FBWB 4PINA 4ENRA 4ZFNA 5K0JA 5H70A 3KJZA 2OG1A 3N7TA 4FOLA 3AWIA 4NYJQ 5MGBA 2V5VA 3KJGA 2OYSA 1ZOOA 1KK2A 1OAKA 1BOOA 1JAXA 1KFEB 2JBHA 3PHHA 2M1XA 1XRSB 5DRYA 3AZPA 3R0ZA 4RKYA 4RVOA 4W1QA 3SJAA 1J97A 1VHQA 2HDNB 3SS9X 2OO5C 3TZ6A 2HCTA 3IQFA 2PGJA 1UQUA 4UU7A 4EI9A 2BE9A 3HBMA 3HU3A 3PENA 4FYWA 1P4JA 1T6XA 1Y9EA 1ES9A 2EKQA 2EJTA 2UVQA 4PS1A 3S29A 3UMVA 2EJWA 4DLYA 4XX1A 4WJKB 3TOZA 1X7YB 1JMVA 5BN5B 4DY6A 2F4NA 3RUEA 4O4JB 1J8FA 3SDZA 3AQ4A 2I3AA 1G20B 4Y1GA 1TK2A 1OAOC 3AKDA 1QE5A 3IVMA 3NTXA 5I9MA 1T4CA 1M2JA 1M6HA 3ZHCA 2H54A 4NOKA 5F9HA 3PFNA 1QV7A 2QRQA 5JMWA 2D1SA 3R74A 4CNQA 3KQTA 2WB2A 3I34X 1X7WB 3PEUA 2CBGA 1SC3A 3BDVA 3K5HA 3CONA 3FWYA 4O4IB 1P3Y1 2JGNA 2NU9A 3DE6X 3H7IA 4XLZA 3DJYA 4NH0A 1CCWA 1E6MA 4E6PA 4OSOA 4Z9BA 1UP4A 3AZQA 1T9GR 3IAM1 3LRPA 2NU6B 5IVHA 1IM2A 3ULKA 1IWPB 1J90A 4ZXFA 2VF5X 1SCUB 4X44A 3VZCA 1U2DC 1VG9B 2AC2A 2P0AA 2P4UA 3QXGA 3GLGB 1UPUA 3PGMA 3U6KA 4K86A 3FR7A 3VHLB 1OT5A 4RTRA 1PZHA 3HY3A 1WDLA 2Q6KA 3BE6A 3ZWOA 1WDKA 2E9SA 4AJNA 1V1RB 4CT5A 3L6UA 4P0TA 3L0OA 5L51A 1NRWA 1PTJC 5AKLA 1AKQA 4MGEA 2AJBA 3MMPA 4MUMA 4R9VA 3W2FA 1U4NA 4QRHA 1X13A 4NFHA 1QFSA 4RPKA 4YFVA 1RPNA 3AFMA 3ANMA 3DOEA 3GZTB 5TEVA 4C0QC 2ZKLA 3UXHA 2JK1A 2WVGA 2RE8A 2A0UA 4LOKA 4TV9A 2QD3A 2I6GA 2HDHA 3AGPA 4JOQA 4YLGA 3BJRA 4L9WA 1GGNA 4YPFA 1UM9A 1HYGA 2A59A 1AXGA 3C70A 4P6VF 1L7OA 4ZCMA 3FTDA 4J0DA 1SXQA 2C0PA 3RUCA 1Z07A 1YT5A 2CY0A 2H2DA 3ERCA 1QB8A 3QUBA 4QTZA 3CR3C 4YQEA 4HKTA 4JLPA 2X6RA 2OXEA 2UZIR 4LE2A 2X23A 4X61A 3SD7A 1MV5A 1THMA 4IGIA 2F3TA 2JL1A 3IP9A 4MQFA 4V1CI 1X8LA 2A1UA 2VJPA 1XLTA 4QPPA 4OHOA 1IZ9A 4RX1A 1GL9B 2IEAA 3NHYA 1AE1A 1KZGB 4FXPA 3H3JA 2C4HA 2ZETA 2J45A 1LSOA 3RSCA 6YASA 1N0UA 1EEHA 3FVWA 3IVXA 1Y1SA 2CEKA 4PXAA 4RCVA 1JQJC 2FPGA 2EHJA 3C4QA 2QZ4A 1O6FA 1R15A 3NOQA 2IT1A 3PHLA 2QVZX 3QU7A 3WGNA 1OX6A 1RWQA 4CM5A 4M1SA 2PWZA 2H92A 3SVTA 4WMLA 3L8YA 1IWOA 3QFCA 1EWYA 1PJ8A 5CM8B 5CTAA 5BOVA 421PA 3Q0IA 4XCVA 4L08A 3TD9A 1IIBA 4CT4B 4IWYA 1SCDA 4P98A 5AW8A 1CE8A 2J48A 3OE7A 3EAQA 5L3SB 5LQNA 2XMZA 3JRXA 3WFJA 3DTNA 1GPWB 1QVWA 1Q0UA 2QPAA 2Y27A 4BE9A 1MEJA 4X63A 2JFWA 2PMBA 5TNXA 1NPYA 3PXDA 4ZKDA 1KHHA 1W581 4GM0A 4BQPA 3IODA 5K0CA 1V4BA 1IEQA 3H86A 1ZBDA 3P19A 3D7MA 1RS0A 2DCUA 1AM4D 1B00A 1FX0A 2B6NA 2FPRA 2FJUA 1TLFA 4H7DA 4XD7A 1PJTA 3EK2A 3U7IA 1CIJA 1G1MA 1NRIA 4QOHA 2W5UA 2YOFA 4NECA 2ZAGA 3P5BA 5DXFA 3V3TA 4J1NA 4MCAA 3INGA 3JARA 4P7JA 2P1RA 1EVYA 3AG6A 4FWBA 4NCKA 3TE7A 1I4TD 4A2CA 3SVLA 1QNFA 4EM6A 2NZXA 1YO6A 4Y6GB 2BUCA 5IBPA 4IRUB 2EEPA 1EQAA 3AETB 1M8JA 3CSDA 2RBEA 3LT2A 3AR8A 3ZWNA 1ZGJA 2QJFA 1HTTA 2P6OA 3GHHA 3GRYA 3VC7A 1ABFA 1V0JA 2GLTA 3QY0A 1I0ZA 1XZJA 2WPDA 1JNYA 3MWJA 4MO9A 5BQOA 4M88A 1QKKA 1TQDA 1UC4B 3S5UA 5I4KA 3BIOA 3I1YA 4N03A 4O1IA 5I8ZA 2JLYA 4JYCA 3R8CA 3IT0A 3HJCA 3V9AA 3CVUA 2YWRA 1XJ5A 2PO7A 3I9MA 3DUFB 4RS3A 1ZA2A 1RSZA 5DYTA 5A7GA 2OORC 2OHOA 2XX3A 1CDEA 1JT9A 4L0QA 1M1YA 4V1CB 3BMCA 2BZ0A 3QKSB 3SIRA 5IH7A 3GMTA 3L7BA 2XV1A 1EXMA 1KZ7B 4DLNA 4D74A 3OEYA 3PIIA 3X43A 3WMWA 1U3GA 1H0HA 3EDOA 2O5CA 2YZGA 5JS7A 5LA6F 3MAAC 2OV4A 2PIDA 3VV3A 1R9JA 4BMDA 5HFAA 1ZUNB 1IXRC 3F1LA 4IXMA 4OGGA 4EG8A 1FMTA 4ALLA 4KVGA 1JKXA 3HB0A 3BD7A 4G24A 4DADA 4DDTA 4KE9A 4U7PB 4EW2A 2VQ3A 1XNHA 4PHFA 1OBVA 2XDWA 1T3HA 1QF7A 3WWPA 3OQOA 2D4AA 1HKHA 2AHOA 4UHDA 2M9MA 4KDFA 5DISB 4UQLA 2JEZA 5ED4A 2BZSA 1ZINA 1K3UB 4Y6RA 3MJRA 2MSCB 2PSEA 5AK3A 5AYVA 4A23A 4ARCA 1XGKA 5UKDA 4F9EA 4AKIA 4O2BB 3VPGA 1P2UA 3Q9LA 1N2IA 4DKJA 2AEJA 1L2TA 1BU8A 2ORYA 3G8CA 4MZXA 3RYFA 4E03A 4I2VA 1K27A 3IUQA 1PT6A 2X58A 2LZ0A 4B2PA 3LXMA 3K1ZA 3L4SO 2MSEB 2XNDD 1GGMA 3TUIC 4DMUB 3UUEA 1GZUA 4BVKA 2YKGA 3N5CA 1JLLB 4Q3CA 3ZVKA 4JYZA 5T6MA 4JUCA 1G21A 2VF8A 3Q6IA 2G1JA 1OA0A 4N6OA 4U5QA 4EVIA 1QTQA 4B74A 3DMTC 3RTGA 1ZI6A 1Y82A 2PLRA 2X0KA 4FM9A 1O0SA 2PGNA 1W19A 1C3XA 4KUEA 4EL0A 3ZHVA 4N5DA 3ZD7A 4B3GA 3RSGA 1U0SY 2P78A 3OH8A 1U81A 4ALJA 5E4YA 2VAVA 1PR3A 2FNAA 5DM0A 4ZDIA 1EA5A 3PRJA 4P2BA 3H9JA 4QVIA 3FOZA 1RQPA 1EVJA 4TZ0A 1KYXA 3JPWA 2I99A 1YDGA 3FBGA 2Z6VA 3HVHA 3LX4A 4LTNA 3KQQA 3SLGA 3UJCA 1QU2A 1EDZA 3HFGA 4JJZA 3HS3A 4L5JA 4P3KA 5B7QA 3N2ZB 3EHEA 1AK9A 5DNVA 1MJFA 1SVMA 3FMPB 4R68A 1FOEB 4UOQA 4JLOA 4CFZA 4DR5B 4ESVA 4HXEB 3ZHRA 5LP1A 4KRFA 2GXUA 4X90A 5HR5A 1MAVA 4I3GA 4MB2A 3KD3A 3ADKA 2HSGA 3A3OA 3ID6C 2B7LA 3WNQA 1WLYA 4GMGA 1UT6A 1YIAA 2VT3A 3I2HA 3WIOA 4EJ2A 4OU4A 4PHGA 4EG0A 5LMNB 2PZKA 1DIGA 4X7RA 1Q7TA 3HSYA 1F9AA 1TTTA 5GONF 4F1WA 1I4WA 4L4YA 1EHIA 5CNJA 5DZSA 2VI5A 3V6MA 2B8JA 2Y71A 5LC1A 4CM7A 5GM2A 2JD0A 4HDMA 4EB3A 5C8YF 4F5YA 4CT0A 1M1XB 1IOLA 1G63A 4LMBA 2JIDA 4CKEB 1VCIA 1QS0B 1QR6A 4PC1A 5WRFA 2OCIA 2ZTLA 5FPQA 5GVRA 2X6QA 4PYLA 2A9KA 4NS1A 1PNQA 1M2EA 3A3KA 5JO9A 4DUGD 1Y9ZA 3KAJA 4XCXA 1MKYA 2WD8A 4HEQA 5CA0A 3TJRA 1MO3A 1NXWA 4OKIA 4QJ5A 3LY9A 2R7KA 2X5JO 3ADPA 3ZWVA 3NEJA 3RKSA 5H1YA 5K09A 2ZUVA 5C9ZA 2FJPA 5DP2A 4R1QA 3HE3A 4U2KA 4Y9SA 3AG5A 5ALYA 4CM1A 2R00A 4LKOA 1Y4ZA 1NQTA 3R5FA 5B6JA 3QYPA 3THWB 1PV2A 4BFXA 4F86A 1Q2XA 1YUBA 4M83A 1XYYA 2Y1CA 3PQ2A 1YNSA 3Q2OA 1CEEA 1EP9A 4HD8A 4HBZA 4PEVA 3TDMA 4C0BA 4RTKA 2WWRA 4YUYA 3L1KA 2J7KA 1PCXA 1SB9A 2XUGA 1BQ3A 1VECA 3I30X 4DSUA 3ZVNA 1ZVVA 2EDCA 1S3FA 1CP2A 1NQ5A 1YQGA 3L46A 1ZMBA 2XBLA 4YJHB 5LP6C 1V7QA 2UYQA 2PKQP 1N8SA 3KYDA 3P0HA 5J2UB 1AT1A 4HDKB 4TX1A 3O75A 2Q2NA 3W8FA 3UVEA 1MC1A 3ZXYA 5DBFA 4JJKA 1ZH2A 1XDSA 5J40A 5B7GA 3H8SA 3T1TA 3Q85A 3VZQA 3PF8A 1VRVA 3ZOZA 4C1BA 4EAAA 5IRCD 3EDRA 3GDGA 4D8WA 1TZMA 3ORQA 1DCTA 1H22A 3E23A 1RQ7A 4MJXA 2ZCJA 1A2OA 2QX4A 2J3HA 1XVLA 1YMVA 1RZ3A 1ISRA 3ILYA 5U9CA 2FQWA 3EVAA 1CUEA 3GJRA 1VJDA 5A5DA 1UWLA 1I4DD 2DFKB 2VKQA 4FKZA 4EKDA 1AD2A 3ROTA 3WL4A 5DGTA 1Z35A 3R8FA 1SHTX 3PCXA 4XR9A 4BBJA 2IKSA 3IA2A 3GCZA 2WJ4A 3ZU4A 1KAMA 2GTIA 2YXLA 5FBKA 4QUDA 2BTQB 2MJLA 2X5NA 4FYVA 5EJ9A 4HDNA 4BMSA 2CSUA 4MZDA 4D4GA 1L8LA 4GKVA 4MICA 4YWJA 1S3SA 2IF0A 4P3PA 1Z2CA 4CM4B 3BFJA 4WINA 3GEDA 1B41A 1CJUC 3BA1A 1IXSB 1HT2E 1C50A 1Z29A 2WM8A 3IEIA 3LKDA 4MDYA 4CDRA 2TMDA 3T7EA 2AG8A 2IUSA 1CQWA 1SQ0A 3MWDA 5B4VA 5E6SB 1Q7GA 2GBCA 1W46A 4JXKA 4G6ZA 3GC6A 1CBUA 1NXXA 3GJ5A 3NTVA 5DH9A 1FFAA 2I8LA 4XKJA 2HPZA 2XDAA 4A6PA 2O0LA 4AB1A 4ZHQB 1SKBA 1G291 4IS3A 3AKCA 1QV9A 3TL3A 4CEHA 2YV2A 1I2MA 3PE6A 4O2LA 4Y6SA 4DJFC 4J07A 3O82A 1AF4A 2QE7D 3IUSA 1AGRA 4E31A 2QQ0A 3AI3A 3G2OA 1E5QA 5EMHA 2YW9A 4UFOA 3ZHXA 2QLTA 5J4YA 3W3AH 1NVXQ 5FTKA 1RHKA 5ADUS 5BURA 1KIAA 5C5DA 3AIOA 4OUDB 3CCBA 3H9GA 2EWWA 3VPFA 4KH1A 1RRCA 2WQ6A 3KZVA 1GSOA 1ZMXA 2XSZD 4C2AA 3AO0B 3BHMA 2A5FA 3OZWA 3BAFA 2DMRA 4HEA6 4AUKA 3RTBA 1E79D 4JKIA 5GZ6A 2X5KO 3OZBA 5KYKA 1GKUB 4I5EA 1RTKA 5LMZA 3K0FA 1GZ5A 4P84A 2GFIA 1C7ZA 5DBHX 4OHWA 2A5GA 1CR4A 3UH0A 3BL5A 1K6MA 5EUMA 2OC9A 5KX5F 1D3AA 1QZZA 4EPXA 3L6RA 5AP9A 4P8RA 5FLYA 4D45A 1TMKA 3KSRA 3QIVA 3KUUA 3WJ1A 2HCBA 4W6ZA 2B83A 1NRJB 1PNTA 1RLOA 4CCYB 2OY0A 5FT9A 1HYEA 2YQ5A 1ZCJA 4HNAA 4UBIA 2TSYB 2QEQA 4Q01A 2VXOA 1RFLA 4PTLA 4CDMA 2WAMA 4XLLA 4DRYA 1K8QA 2YINC 4TTJA 5JS6A 2ILVA 2WKRA 4M1ZA 2HYIC 2FN8A 2H0AA 3MB5A 3QNUA 4UBMA 3RAGA 1WTCA 3O8OB 4ND3A 2R6CA 4F2PA 1DARA 5EIFA 4NBSA 2RGWA 3UPUA 1UEXC 1L5QA 2I2WA 2B8WA 3PXXA 4KIJA 2ZJ4A 5EN4A 3ETJA 3HY4A 3QLVA 2SKDA 3P2JA 2B2NA 4I5DA 3IT3A 3ONVA 2RC5A 5CM9C 4Z7JA 3SQNA 1D2GA 1JR3E 2ZP1A 4X1YB 2ACWA 2IODA 4S2UA 1NMSA 2XD9A 3PHGA 1MFZA 1Q21A 4BAUA 2VBGA 4MPRA 3CVOA 1DZIA 1NMQA 2N47A 3AVPA 3HUUA 3NBQA 4I1UA 4JVOA 3ICEA 3JXEA 5JDCA 2Z5VA 1TQ2A 1XBTA 2PAAA 2QN1A 2OCGA 3FSEA 3GCXA 1P2DA 3HDQA 4ZQHA 4ZT3A 4C01A 4EFMA 2ZUTA 1A9XA 1T2VA 3LBHA 4BZQA 5G40A 1UJCA 3GEIA 4D92A 4LDPA 3KKKA 4X94A 1X80A 3MCZA 1O0BA 1VHLA 3ADDA 4KLNA 2NQTA 1VGVA 2C1XA 1E1QD 2QQ5A 4FMDF 1V3VA 4PANA 3H99A 4BQOA 2ZK7A 1NJGA 1KMHB 4QD3A 3FWHA 4D3DA 3E9DA 1JP7A 4DYVA 4ZAZA 3WAGA 4IIHA 3CW9A 1WCIB 1ZK3A 3BJMA 4LG1A 1X2EA 1BS9A 1U5BB 1XTTA 3IQGX 2HCJB 1S6YA 4KMRA 4RIHA 2J0UA 1I7QB 3DV9A 4OKNA 3BVPA 3QIAA 4JSRA 4Z1OA 5EQTA 3FCXA 2VF2A 4JA2A 1L5YA 4OXXA 3WQBA 1BD3A 2O2CA 4BIIA 2DWOA 5EQJB 2W2NA 1NM5A 1LY1A 3DP7A 2M98A 3TPCA 4BV3A 5TV2A 4TUYB 5AXDA 1MG5A 4GE0A 2MR6A 4HRXA 4PYIA 1U99A 2AOWA 3VHRA 2UZ3A 3C6BA 1ZUHA 2BSQA 1VRCA 4QPNA 3IQXA 1QAMA 4PCUA 5JSHA 4QXRA 3TLXA 1PUXA 4YAFA 2O19A 1W8DA 2J6BA 5CH3A 3QX9A 1GUBA 3C6KA 5HRCA 1MJ5A 1JAYA 1E2FA 2D2VA 2VZ9A 4TKVB 2XT9A 4F2GA 2OHGA 3H5RA 4OHPA 2IX3A 2JH8A 3FH0A 1UKEA 2IE0A 2P6MA 3DZFA 1I1HA 4JOSA 2BM1A 1E99A 2JGDB 1Y5LA 3FBWA 4JVNA 4EYEA 5KUTA 3HMQA 3W34A 5ALRA 3WP0A 1R5BA 1CV2A 3O4JA 2C1EA 3BAZA 1J9EA 5I9TA 2W6QA 3ED1A 3THXA 3EXHB 3A1EA 4LZJA 1UM8A 2P8JA 3SIPA 4ZOAA 1PX2A 1DHRA 1JQBA 1CZRA 2IYTA 1ZEMA 2J3KA 1JQKA 1NBME 1L7QA 2Q9CA 3CF0A 3F0TA 3C85A 4LNUA 3TOSA 4L0MA 1ZKMA 4TMXA 4TQ9A 4I99A 5ER6A 5JAHA 3PNPA 1ODSA 3GN2A 1VSTA 1Z17A 3L01A 4NATA 2B7CA 3UPDA 2MIIA 4WBNB 5IS2A 2ZIFA 3LNTA 2XXAB 3BHJA 1VE9A 3LUDA 2NUBA 4N3GA 5ALDA 1DJNA 4CCAA 2JI6A 1J9GA 3ECCA 4I9FA 1WEKA 1UAAA 1KAGA 3U31A 3W77A 4YC7A 3KUDA 1G7SA 2W2LD 1NLMA 1WETA 2XWSA 1IN8A 1QHIA 4X64B 2QN2A 4YAJA 1F8GA 2BDEA 4EYQA 3AHCA 4BP8A 1ZL0A 2G4VA 3NMUF 5DSZA 2VHQA 2LVBA 4MKFA 1K3TA 4E5SA 1SH7A 4MK4A 1N5KA 2ICAA 1GTMA 1SCQA 2C1ZA 1VE6A 3DEFA 1Z25A 3Q41A 1T3TA 4W9NA 1PT5A 2RBGA 3IFSA 2J4CA 4IIFA 3KJEA 4CPDA 2R9VA 2Q7DA 2Z58A 2C8KA 3GDHA 4QEDA 1CRPA 2J87A 4PO3X 3PD7A 1WUIS 3KELA 4G5SA 3SLRA 2EATA 3R6LA 4LY3A 4OSPA 1HE3A 1Z38A 2AFHB 2H18A 3H5AA 4AMVA 5M04A 3OT1B 1A2KC 2JEOA 1G64A 2AKAB 4E33A 3RYCB 4GF5A 1TGYA 1JTVA 2P5SA 1N0IA 3GJYA 3I9LA 4O4LA 4HWTA 521PA 1RPZA 2MYUA 2I8CA 4PVDA 4TV9F 2CF6A 1MB0A 2VH5R 3NALA 4L9RA 5EJ2A 3OG9A 5TR9A 5TX7A 1U0LA 3EQ7A 4G1VA 3T9BA 4ENWA 2B37A 3DEIA 3KQOA 2PT6A 1UZNA 4MYHA 1OH8A 4P5DA 1WV1A 4M1TA 1INLA 1T6BY 3P9KA 1FJ2A 1X15A 2QE7A 5CYFA 3B51X 4YYEA 4B2IA 4U2DA 1EK6A 2WE8A 1BDIA 4UNPA 5EJAA 3TECE 5AI8A 1W4AA 2OYCA 2ETVA 4IM7A 1AB6A 4ISCA 3CCCA 4QUEA 2W2KB 4Z53A 4JJ8A 3A6PC 3CRQA 1AS0A 5AI4A 4A8JC 2R8RA 2XSZA 2Q9AA 3U7EB 3AKYA 3OQIB 4RPIA 4ALMA 2QRUA 5BV2P 1E79A 3M34A 5F35A 2R4TA 4XYGA 1FSPA 3QA9A 3BGSA 2DP4E 3KSZO 4DARA 3PJRA 3C3YA 1BHQ1 2FR1A 2LGJA 3M6AA 3IVRA 3MELA 3VNAA 1NSTA 4UBOA 1YJXA 4M6WB 2OVFA 1M34A 2QYHA 5G0SA 5IVPA 3LW7A 4EARA 5BNIA 3B1VA 2ASEA 3JQFC 1L3IA 2IYVA 4XFKA 2IOFA 4EZEA 5AVVA 3H65A 1U1IA 4F91B 2QBYB 3N7AA 2TMKA 3G17A 1RBYA 1VLHA 2PFSA 3EVTA 4G5FA 4MPTA 3DDCA 4MUYA 1GPJA 4MUAA 3FZQA 1B2LA 3P71T 4RWEA 2QDXA 3CV3A 2P4HX 3AEUB 5JCXA 3V1KA 4LZPA 1H1TA 2HLDA 1G3QA 3HCDA 4LDNA 4K9QA 5F3DA 5KYGA 4EMSA 2DPXA 4W63A 5KTYA 3U3DA 4KPGA 4JVMA 1K7EB 2ZBFA 2I2FA 3PEWA 4RZSA 1GAWA 2WFLA 2JH9A 1KI8A 2QN7A 2WYIA 4G0OA 1OXUA 2NVUB 1FPMA 4ID3A 4W7IA 4PHTA 9ATCA 5ITZB 3DLAA 4PSVA 1N77A 1Z4KA 5J4VA 4MSUA 2A88A 5C1OA 1YZUA 1W0CA 1U2GC 5U4QA 1QONA 1U8EA 3DGFC 3IILA 4IOJA 1Z0IA 4ME6A 1HYBA 4ND1A 2AZDA 3AF5A 1O9GA 4B6OA 4B83A 4Z4QA 3RWMB 4OHCA 3P5SA 4YMWA 4I4CA 4RZQA 2KS6A 5JNWA 5JXIA 1UBFA 1WY5A 3HEMA 3LUFA 3MMSA 4C7XA 3LT4A 3FHLA 4UDYX 2E89A 2F90A 4H3SA 4I1IA 2QL6A 3JAKA 2OKGA 2BDTA 2ZVJA 5BYAA 2LUOA 1X0VA 1PBTA 3FHCB 2V5AA 5KPDA 3DHVA 1XZNA 5CR9A 1LRJA 2R1VB 3DWFA 2W8BA 5BSKA 1U28A 5CGQB 3WQQA 4LJAA 2YN0A 1WZUA 1FYVA 2WF8A 1GFSA 1S9DA 4B5KA 2FCAA 1U4SA 1GQSA 3E7DA 3KQVA 5A3SA 3VJKA 3U2QA 3FAZA 3PSHA 4ZVMA 5KKAA 2Q5QA 4CMIB 3GA0A 4KO2S 1K88A 5HFJA 4HAXA 4CMEC 1I36A 4JY7A 5KOIA 1IG3A 1CJSA 1YRWA 2G83A 3GYGA 1DOHA 4N82A 5FUWA 2Y0CA 1FK8A 1X7XB 2FF7A 3WMEA 3PDHA 2C0QA 4RACA 3VU0A 3T3OA 1IWBB 1ETUA 1T8YA 3A4MA 2UU9B 3ABSB 3HJFA 3ZZTA 4KXLA 3TNDA 4RJIA 3CLVA 3NKFA 2PSHA 3T9DA 3ZXSA 1NN5A 1Z4MA 1N7IA 3KQKA 1RYDA 4Z6KA 4DUZB 2PWAA 3FUTA 2V7TA 2ECQA 3D7KA 4IXDA 1MABA 4WXPA 2C4KA 2AJDA 1FTWA 2NU7B 4QE3A 1W6UA 4OP2A 5TVKA 1GRVA 3BBLA 4DDVA 2NUAA 5AW4A 4PO1A 2P41A 1W2WB 2E7ZA 1I6LA 5FPYA 4QYMA 2Q8NA 4HNQA 1DOAA 3HJAA 4RVSA 1ECGA 2AKYA 2HIGA 1I1OA 3VDMA 1TO1E 3B20A 2IXEA 4MVJE 3V4ZA 2PGOA 3TLAA 1PFWA 3DKIA 4N7MA 4XVRA 5EPUA 1WEHA 1LPSA 1EUDB 1GPNA 1TECE 2IPOA 3AEXA 2GPYA 4V0MA 4IDBA 5F5NA 1WCV1 1MJHA 2PPLA 1RXSA 1QVAA 5FR2A 3LA6A 4JB2A 4L57A 4TYWA 2OE2A 3KJIA 1CR0A 1EVEA 1BGVA 5CBPA 1ADYA 1VPTA 5ALNA 4CQLB 1MU0A 4GMHA 4Q47A 2FDXA 3IRVA 3I3OA 3CTPA 4QO7A 4XQEA 2X1LA 1XCJA 2FW7A 2NZUG 1XF9A 2I6XA 3G5UA 1I5RA 4L2IB 1R37A 5IJWA 4O33A 4WXMA 4QT0A 1J0DA 4RNDB 3ZZUA 1KEKA 1E2HA 1BWSA 1S2DA 2AJCA 4AWAA 3L6OO 1EGQA 2G25A 3JVEA 3OFJA 4OIMA 1V95A 4RKWA 5JTUA 2QYSA 4NE2A 3ZCPA 2CDRA 4YY3B 1NLFA 3RTEA 4BLUA 2Q3JA 2BJVA 1X7HA 2VF7A 3FZGA 4TKZA 1RRKA 3UMBA 4DZTA 4QRIA 5A6VA 5IKPA 5JROA 5BN3A 4Y2XA 1AX9A 1IY2A 3DW3X 1KO5A 2JA2A 5JSUA 2CL7X 3LY8A 3IO3A 4NPHA 1IUOA 3V4OA 5CH8A 3O94A 4QYSA 1ZP6A 1GNVA 3HGQA 1O4WA 4M99A 3H2IA 4JKYA 2NSLA 2BVNA 3DXYA 3KKMA 1YTUA 4G5QA 2OK7A 3OJEA 4M9CA 4YJDA 4Z9YA 3RWOA 3W3AD 5KOHB 1QE3A 2APJA 2HPHA 1T8RA 3GEHA 4Y2TA 4DMLA 3OPYI 1TCBA 4KMMA 5FIUA 3T54A 1CUXA 1VB5A 5B6IA 2ZI4A 3LQKA 1C1DB 4JVSB 2CUKA 3BULA 2FR8A 5DW0A 3LDHA 4BNGA 1Q77A 1YRHA 5DTIA 1GITA 2FWMX 3BJZA 3EZ9A 1FUKA 1ENZA 4P4TA 4MW0A 4PHHA 3QLUC 3V8QA 1KO8A 3CLSD 4QQRA 2PJDA 4R9SA 3U6BA 1XZHA 4WACA 3JATA 5EUBA 5TPWA 3V7NA 3OBBA 5TMEA 1WP9A 3VU1A 2ZSDA 1XK6A 2VBIA 1PS9A 5DBEX 2AS0A 1ZHFA 3CH6A 5E4TA 4D1YA 4DLKA 1IM5A 4ZMBA 2J33A 4P3YA 4KX5A 2HA4A 4LS3A 5DF1A 2R48A 4ZYWA 2E37A 1NNI1 4X00A 4C43A 3I0MA 2ID9A 4MUBA 4LF4B 1TLTA 1EZZA 1QYVA 3IKMB 3QVWA 4HX2A 5A9SB 4DV7B 4GBMA 2PWPA 3ND5A 4BN5A 1D8TA 3R1IA 1BWQA 1RHRA 1MRSA 2P5YA 1Z22A 2BFFA 4I5IA 1H2AS 2PG3A 1KH1A 4JLNA 3QKWA 1XX6A 4YJKA 2RH4A 2R8YA 1T24A 4TT3A 1RXIA 4HDSA 4IHKA 4XJSA 4J16A 1COWD 2HQSA 1NVWQ 4FOTA 3L1HA 1GGHA 3JRNA 3WYAA 1EDBA 4L6IA 1T15A 2WWIA 3DMNA 4JQCA 3J81A 2PU5A 3W5BA 2OD7A 1KEVA 3EISA 5TQVA 3V97A 1H6BA 2VPYA 1I9GA 1L8QA 3Q3VA 4PYRA 4BVAA 4EO9A 2PT7A 2VJMA 3OZIA 3VMFA 3PBKA 4ZI2A 5DM1A 3GY0A 1Y48E 4FQ5A 1XXHE 1GZHB 1AK2A 2CD9A 2WHEA 3M6XA 4G41A 2LV8A 2FZVA 3G9QA 4KH0A 5DGHA 4OOFA 5D00A 3X1YA 1T9BA 2XZTA 3PITA 4C78A 3CZRA 5JJ5A 1RVV1 3NBYC 5HDBB 1N4AA 1QH8A 4K46A 3UMFA 3K96A 1W93A 4CMBA 2QTBA 4UCWA 5IN4A 4FFWA 2C07A 1UZUA 3W0LB 3ZE8A 3L4KA 4A2PA 1F14A 5HK8A 3TRFA 4GOKA 3VAZA 3OOWA 3OPYB 3LY7A 2AZXA 1B8VA 3Q7IA 5BSMA 3HGTA 3LV8A 2VYND 5EE0A 1IDN1 4ZMRA 3UUWA 1BVUA 5EWLA 4RTOA 4BZZA 2HX1A 4IMIB 2XGGA 3VU3A 3PCTA 4XGNA 1FVXA 1WXQA 1I8TA 3NONA 4P0QB 4FEGA 1XKLA 3O4IA 3W9BA 1ND5A 1P9WA 1QTIA 4J1SA 4UTZA 3ZLTA 1PJBA 3CEMA 4KXVA 3WZLA 4GRAA 1U3VA 4S35A 4BNFA 4CFSA 5H82A 5C35A 1KARA 3WLLA 3ZUPA 3KQHA 4J43A 2QTVA 3GBSA 2C7QA 2JAOA 2HMSA 3ICOA 3NDJA 3BEDA 1UZMA 1TT5B 2DZDA 3K9WA 1E92A 4NZOA 4YN3A 2OOSA 3EVFA 4DY4A 1H8HD 1WB9A 2WINI 2WUVA 1DC4A 3QUCA 4QDZA 4C0XA 1UBMS 3ANSA 3E70C 3KT0A 4U2BA 1L8AA 1UKVY 3OQMA 1NA5A 5LZ8A 1RQGA 2VPXA 4F3NA 2GM9A 2CLIB 1A5TA 3ABZA 3MF4A 3OTOB 5I45A 5BYBA 2ZR9A 3RGWS 4QGBA 2JHCA 5CLLA 1JS1X 1KETA 3OF5A 2YJTD 2YX1A 5E0OA 4G25A 4YIHA 4TRMA 4BNDB 3DP9A 1PX0A 4FUTA 2P69A 1NP7A 3FN4A 1TM2A 4CIYA 2OWEA 2WIAA 3CA8A 1YU9A 3TINA 1V8PA 3NVAA 1XZMA 4IJ5A 3STXA 2ZS8A 3ZTYA 4BRSA 2Q5HA 1UWCA 5SZKB 2D8AA 4C6TA 2PX0A 4F4IA 2XOEA 2ZWIA 3GFSA 3ITDA 3JX9A 2W83A 5JSZA 2EL7A 4H59A 4JEMA 1EX7A 4R83A 3RAEC 1Q92A 5CDFA 2YZMA 3FDFA 4A16A 1DWPA 5CLQA 5IDXA 3ZQKA 1EXNA 5EFZA 3CGWA 4BDTA 1G5FA 5DULA 1SRQA 2FZ4A 2ANCA 3PI7A 1RWXA 4QLBA 1CJBA 3OBIA 3OEED 4IVNA 3KR9A 4RHEA 2B8NA 3ICCA 3EMBA 2BDUA 5C81A 4P31A 1T2FA 1SZCA 4DG5A 2SKCA 3GZJA 1L5MA 2RAFA 2ZTMA 2HPVA 4B09A 4BMZA 3ONDA 3M4ZA 3ZLVA 1YI8A 2KYRA 5LOVF 1RJWA 1VFNA 1Y6JA 2AZTA 3BXOA 4KRYA 4KXFB 4UU1A 1XPOA 3WNZA 1G6Q1 1EZ1A 2ZSJA 2OFFA 4I4NA 2VSQA 2V7PA 1G2QA 2PUBA 1XTSA 4EEZA 2V6BA 1BVHA 1J09A 2F7SA 5B3JC 5IAGA 1JDUA 1UKAA 1T2UA 5AIAA 2BGNA 4KE8A 1JG6A 2RHJA 5H81A 3TZBA 3GHYA 1MQ9A 3DE1X 5HQJA 1ZIXA 1VPVA 3QBVA 2YY5A 2WU8A 3ASUA 1X19A 1FYFA 1SOWA 3D3JA 1JALA 2JJQA 1REQA 2XH8A 3DH0A 1UIRA 1P5ZB 1F8XA 4Y0AA 2K6GA 3IV7A 4GU5A 4AJEA 3H8JA 4JODA 3TQQA 4G0NA 4I19A 1JHMA 5GM1A 1OTHA 1TUGA 1D2EA 2VPPA 2RCNA 9LDBA 1IMJA 1JBEA 4F0JA 4C2UA 1E3DA 2QHXA 2XJ4A 2ZB4A 3FNIA 5CA1A 4RVFA 2ZI3A 2CVPA 1QM5A 2W9XA 1XUOA 1OI3A 3CNEA 4AIIA 2R7LA 3L43A 2VDQB 2XITA 5ALTA 3VYWA 4YJ3A 5K0BA 1BEZA 2QUJA 1BA3A 3FPEA 4G5XA 1YKFA 2ZZKA 2C29D 4FTWA 1V48A 2EBWA 1HO3A 2BKEA 2JGKA 1BG6A 2HNKA 5FORA 4A82A 4CR8A 4ITVA 2B2XA 4QSMA 5IU6A 3BGVA 1T1RA 3R7BA 4U4AA 1L6RA 1ULZA 5DTEA 2VK4A 1EGAA 3U49A 2JFPA 5E8RA 1KJJA 1HUQA 7ADHA 4YJ2F 4GMKA 4MW6A 1Q74A 5TXGA 3C4JA 2AN4A 4BB9A 2PLWA 3HVRA 1NI4B 6REQB 3OMLA 3F6EX 4TXHA 4FBLA 1LVUA 3M6FA 3OZCA 4NOLA 2GN8A 2X40A 4MLZA 4MYTA 4QPZA 4MA4A 3WL6A 3ZQ4A 4E6EA 4EQ6A 2J3LA 3E9RA 2EGUA 2AFRA 3R6TA 1J20A 1PZFA 5E9QA 4GZ5A 3LDFA 4AUNA 1L5HB 2FDRA 4EHBA 3JQGA 3UWOA 3P9XA 4IYRA 4NBNA 1TKRA 1WY7A 1O6CA 2BBWA 2I76A 1DDIA 3PNSA 1GJRA 1XQYA 3ZV5A 3R23A 4MP6A 4IIJA 3PSAA 4BBAA 2OCXA 4QBGB 2R86A 5IF3A 1DWOA 1ODJA 4AZ3B 4B46A 1NXTA 5IAAA 4L8LA 4H4DA 4OTZA 5CX4A 9ABPA 1WHSA 1OASA 5IDYA 1CS0A 3L7JA 5KINB 2HADA 3P9NA 1COWA 4W1PA 1RAAA 3TJMA 2INGX 1Q7RA 1QK3A 3FJYA 3H2BA 5EAIA 2GDZA 2F1HA 3IALA 1RWKA 4URYR 1R0LA 4O08A 2NSJA 2GNOA 1Q14A 1I0IA 2QN9A 3Q1LA 4MCIA 4GP6A 4YTEA 4Z7OB 4WL0A 1I2DA 1HT1E 2FEXA 1JMYA 4ZYTA 1M0TA 1OH6A 3LO8A 1EK2A 5A5GA 5FUXA 3CRMA 5CPFA 2VNKA 3JZIA 1Z8HA 4ARUA 2F3UA 4G0ZA 4HJRA 5K3SA 4EGQA 1PEAA 1TPYA 5CYGA 2ZREA 3G8BA 3U7FB 4MIOA 2ZB8A 4F2DA 4Z8YA 4B71A 1RPAA 2JI9A 2IH4A 2IS6A 2G80A 4Z9AA 3V4LA 4BMPB 2BGWA 3GGDA 1B73A 2O2HA 2QENA 5AOVA 1BQ4A 4QXOA 5KHLB 4GXTA 4J0KA 2OLEA 1QJ4A 4DE5A 1FX1A 3JQ7A 2YMMA 5K51A 3GJQA 1WOMA 2FW8A 4FE7A 4TYPA 2GTHA 2V7GA 4K9DA 4ZOBA 3BD8A 5DNWA 2VYNA 2QSYA 5H3HA 3TFWA 3GFQA 5JYBA 4JYBA 4A6EA 5JJCA 2NTVA 4RESA 5EHXA 1QAOA 5IBCA 1J2JA 2YFQA 4WOBA 3ZK7A 3UV7A 1DC5A 4NI5A 3RK0A 4CM3A 1YJQA 2B9VA 1ZD5A 3A4LA 4M7WA 4Y1RA 5ENZA 4DR2B 3LLCA 1C41A 1Z06A 3P8ZA 3THSA 1GSAA 4RE6A 1R7RA 4HATA 3E1KA 1P80A 5K7SA 1OJ7A 2R65A 1S2NA 2GOYA 4LRXA 5CYOA 4LYAA 3K5WA 3DLTA 1H8HA 4Y98A 3HP4A 4B73A 4EF4A 4G0UA 3MBOA 4IXWA 1BN7A 3NM6B 4R9RA 2VKTA 4ZAGA 3RVSA 4KVZA 4IDPA 1V8DA 3LAWA 4DIOA 5JMOA 2CNNA 2E6KA 2Z8YA 5IPFA 4M0LA 2R1UA 3B48A 2V6FA 2I1LA 3VU9B 2BY4A 4GZLA 5MFZA 3FOFC 2YYZA 3B6IA 1E2IA 1OFHA 2WWTA 3NOVA 2XPCA 4IH4A 3OIYA 4XM2A 4D3FA 4QPCA 3L18A 2NM0A 4FOPA 5LQJA 4X65B 5FBLB 1KZ9A 3OF2A 4MR7B 2OZKA 3I39X 3KQPA 4JC4A 4TS9A 2FDCA 5CBKA 3I37X 2H2FA 3V1NA 4BV2A 2W4MA 4IOLA 1N2CE 4JJ7A 4PO8A 3SYTA 3TS1A 121PA 4NULA 1YAJA 3WV5A 3D4IA 4BOYA 3BIXA 3LUAA 3NHBA 1DX4A 1ODCA 3EPRA 1RYNA 1OD6A 1C9YA 1NWHA 1NAIA 1XCOA 3FAKA 4M55A 1KK0A 1P4SA 2WP8J 3DCNA 4HUTA 1G3RA 4QYIB 5CVJA 4C7JA 1GSIA 3OE1A 2E4VA 1L7AA 4O63O 5G0VA 3AFNA 1DO2A 1FXSA 1FQJA 3C97A 3OEEA 4MPPA 5J23A 3A2MA 4N4AA 1CY7A 1LPMA 1FP4B 1WNTA 1KI9A 3KBBA 4L50A 1ZD2P 1FQKA 4JDUA 4COKA 4EP1A 2GZDA 4DM4A 5A2QA 1UBCA 4XOIA 5BQ5A 3PNYA 2VEOA 3TE6A 1LNSA 2PUJA 5D6OA 3QITA 1AQNA 3D1VA 3R3YA 1U7PA 2DFDA 1G5QA 1OLOA 1FU7A 2EKBA 4S2EA 4PS0A 1QO7A 5JNVA 2X8JB 1I94B 1OYOA 1TT7A 1Y98A 4HFNA 3O4GA 2PMCA 3WI7A 3TMYA 1MB9A 3AUSA 1TXGA 4LY6A 5EEGA 3KLOA 5FTJA 3DNFA 3ZYCA 3TCKA 2WNSA 2QGNA 3RUHA 1P1IA 1DMRA 2CNBA 3Q6MA 4HRAA 3MSXA 1JHRA 3FFWA 5J59A 4DQUA 3U44A 3KZOA 3ABRB 5L6MB 1Q0PA 1ICEA 2AE1A 5F2KA 5IEJA 1A9QA 4EW1A 3U7HB 1WCYA 3K0CA 3R9KA 5H9WA 3L8HA 5JH7A 5IT9A 4C88A 1IZ7A 2JIMA 2Q2VA 1XD8A 5D6NA 3CJRA 1C30A 2A9VA 3GGJA 2EFGA 3MQ4A 1GG2A 4MR8B 3OQPA 1P5HA 1W4RA 3O74A 4YDSA 4YALA 4PX9A 5FUBA 1ZH6A 3GVXA 4I6GA 1B93A 4A0HA 4BFUA 1P81A 3QUTA 4KQEA 3ZLBA 3X1XA 4OQDA 3Q2KA 4LHXA 2HMTA 4IIYA 1TJNA 3F9CA 2FE1A 4RMNA 1ZK2A 1I01A 4RXMA 2Q5OA 1G2IA 3GARA 5AHXA 2HIMA 1TD1A 3AR3A 1O94C 1O77A 3WWOA 4XWOA 2JFNA 2JZNA 2F48A 2JLZA 4DVGA 3AEKB 1YCDA 4U1RA 3AY7A 4MKHA 2PN1A 3FZEA 3P0IA 1Z0FA 1IBSA 4FGZA 4FFVA 4U2GA 4BMNA 1QVRA 1PEDA 3ZJTA 2FXIA 2PZJA 2PZMA 5AUQA 5ALUA 3QBJA 4F92B 1EFTA 1EGMB 4Z9FA 5C37A 1ZL2A 4X1KB 5ARDA 1M6WA 2CBZA 3C6QA 1DUSA 3AL3A 4OG2A 4WLOA 2HBQA 2YJGA 4I8XA 3RT9A 4XVCA 2H48A 3ZD9A 5DI9A 2D2XA 3AY3A 4Q16A 4C3VA 2KLHA 4HAWA 1RCFA 4I8DA 3U61B 4DV6B 5GQSA 4DIKA 1QFZA 4BV9A 1ZUWA 4H27A 2VO1A 5IKOA 2ISQA 3ZTWA 1IHUA 3G0DA 5H3CA 1K92A 3PNOA 4M1QA 1GZVA 1D09A 3TSAA 3TCXB 3B89A 2FCRA 3EE6A 3WYGA 5AM3A 5IH3A 3GJTA 1YQWA 3VR6H 3ORFA 1P4AA 3UT5B 3DAHA 1PS0A 4ZQCB 1UBSB 3CQ9A 1QU3A 3GW8A 2WHXA 4GG1A 1F48A 4NX2A 3DBVO 4MGHA 4XDZA 2GN1A 4V38A 2DFNA 1FNDA 1CUZA 2REOA 2WTEA 4KBGA 2OP0A 4MPJA 2G9VA 1P1KA 3NO4A 1F0NA 1H0KA 1NVAA 2WIBA 2R1TB 2QX7A 3C41J 3IEPA 4N0EA 4RYDA 3IXQA 4UMEA 3W1WA 1K89A 4BNLA 3N6XA 1JHOA 4JC0A 2JAPA 1Y8RB 2KJQA 3AUJB 3C15C 2GM5A 2JCXA 3EBLA 3FF1A 3AEYA 4OHBA 5DSTA 5EVCA 2V9CA 1UH5A 3AZOA 4KV9A 2DETA 1TKBA 2DWQA 3RV3A 3DDUA 3I2YX 3U7QB 1NU6A 2WFAA 3BEOA 4EJMA 2HF7A 4Q1AA 4ZALA 2IPXA 1U4OA 4URWR 3F73A 3ZY2A 2P7HA 3WIUA 3H5WA 2NXWA 2XXBA 1G6HA 2FK8A 1XN4A 3O7WA 4P08A 2XRYA 2HZ7A 3WIVA 2LIPA 1QDLB 4WD3A 4JROA 1XFAA 3HYLA 3G89A 1EDEA 3TOVA 2QUHA 1MT3A 2VDPB 3IE0A 2QRJA 3IUPA 4KVFA 5E4JA 1BXGA 2CVHA 3IUNA 3KAKA 4HAOA 4ZAWA 3STTA 3UJDA 4RENA 1W6RA 5LQDA 4FR5A 3IV9A 4X93A 1Z4NA 2QTAA 2VT2A 1SGWA 1KMCA 3RW9A 3CXRA 3BKWA 2DWPA 1K7SN 2C3YA 2PQ6A 5TQ0A 2VJCA 3TD2A 1U9JA 5JLJA 4H7JA 2VHUA 4LZLA 3IP3A 4LOAA 5K2MA 3VTAA 2CDCA 4B6FA 4A73A 3LYAA 3QQPA 1GGFA 1KNXA 2P27A 4HXFB 4MHSA 4ESEA 1ILEA 4YDRA 1YFLA 3D8NA 1YC5A 3F46A 3EWNA 3DBHA 1J5EB 1OLSA 3QEMB 4IINA 4ZD6A 4AP6A 1AGNA 3I4FA 3U40A 1UCFA 5FD8A 2ONZA 3SNHA 1AKTA 2Q4OA 3KJQA 4NOMA 5ECDA 3PDIA 4UAUA 3RG2A 4HQOA 1ZSVA 5BV7A 3HSKA 2WJYA 1PWEA 3P2IA 3MRTA 4P4UA 4D5EA 4RJTA 3ES9A 4DV3B 1XQVA 3I73A 1QK4A 2G88A 3PR1A 4U9IS 1A97A 4Y2QA 5KDDA 2WWYA 3OVMA 4FSHA 3VGPA 2QTTA 4XYEA 2KBEA 3WHLA 4LYEA 1XPRA 3WGUA 1YR1A 2HXGA 2HJVA 3L5OA 3UJNA 4CEIB 1G2PA 4HQLA 4F85A 1ZWLA 3W8DA 4E5DA 2YXBA 5EIAA 2Z0MA 3M8KA 2O7VA 2XMDA 3AESB 2EJCA 1QFYA 2BKAA 4NC9A 3NTLA 3QLTA 4JJAA 3EPLA 2D1QA 3DZBA 3PVSA 2FN3A 2ENUA 1SC6A 3GU3A 4QYXA 2C92A 4MYSA 1KU0A 2R5WA 4HPWA 4Y9UA 3SYMA 3VH3A 4AF6A 4BJHB 4D99A 4RK5A 2Z1NA 4E21A 4R3UC 5ALFA 1ST3A 3A7DA 1KZ6A 1PWXA 3U7GA 4YEDA 2ZAYA 1PWHA 3IX7A 3ROEA 4F4DA 4O3FA 3TLCA 1ECBA 2PUHA 2MWMA 1QG0A 2B4AA 4O0MA 3PWSA 4YAEA 1AKEA 5FB3A 1OIXA 2F4VB 2BR3A 1Q22A 1K5PA 1P39A 3CIOA 3KCNA 2XTAA 3DULA 4DCSA 5ICEA 3ED5A 1ZN8A 1CIPA 2WZCA 4IDDA 1GGEA 1W2GA 1QKJA 3FPJA 1P1HA 2OBXA 4B4UA 1YA8A 2VAXA 1YRAA 1RJDA 5DJ5A 3U4GA 2GM4A 5D3MA 5FEUA 3L4BC 1UBOS 3W7AA 4U0JA 2RJNA 5JCJD 5J1SB 3HL4A 3RFUA 5DT2A 5KTKA 2J08A 2HQRA 3EDYA 3CX8A 3KO8A 4FEYA 4G97A 4FJ0A 4OVKA 5DLPA 1BJRE 3HV0A 1RYEA 1X77A 3D6MA 5AJUA 4G8JA 1GNQA 4II2A 2QRGA 3LYLA 5DM4A 1V3QE 5HMLA 1B0UA 2DM6A 1F0KA 1EB8A 2H11A 1E0JA 3E22B 2NTYC 4RV9A 3O7MA 1ENYA 4MDHA 4NHEA 4OIFA 1RPJA 1TYBE 3N53A 3P1JA 4RCZA 1NLZA 1PR0A 1OI4A 2WU4A 3OC6A 5DYWA 2E55A 2Z2YA 1MA3A 5JZSA 2DTXA 4KNYA 5LQSA 2GWHA 1ISJA 1U8UA 4J76A 4M0DA 4R3WA 2G5CA 1U7ZA 2VL7A 3LXXA 4HVAA 1GTJ1 5IZ4A 4WECA 1ILWA 2FYTA 2BLNA 2G08A 3OIWA 1G1AA 2W6NA 1SOVA 3LIPA 1CUYA 1CVLA 1FMJA 3RS0A 2V4MA 1KE1A 3SOZA 3SX0A 3RJZA 2Q3CA 1T5TA 2ZYTX 4ZDKA 4G8BA 2IZ7A 1SFRA 1XR3A 3NC0C 3PUWA 3STWA 4DR3B 3N59A 4BCBA 1YCFA 1STOA 3OOEA 2WQZA 2C8LA 1UJ5A 4NQRA 3MRXA 1NVMB 1I10A 2J07A 1ETHA 1Q95A 2OZEA 3A1SA 3GFOA 4LDQA 5GVSA 3C8DA 1RKVA 1IY1A 3FFTA 3LUCA 1Q91A 5ALHA 4PGGA 2GLUA 2VATA 3PGLA 4YRDA 3KQUA 2VP4A 2PLNA 2N42A 3HUDA 3MT8A 1GL3A 3P9PA 2X9NA 3GLVA 4KLRA 3H9BA 3CY6A 4LJKA 5GV7A 3UNXA 3RU2A 3MOSA 1ZVMA 1PGQA 3ZWYA 1PR6A 2CK3D 1ZC3A 2JK0A 4FFNA 4ZEWA 4NENA 4HSGA 3TTWA 2H4WA 2FKAA 2QRVB 4MKXA 2XDQB 4MGYR 4UQPA 4WLFA 3EVNA 1T4MA 5TSDA 2Y0PA 4ZVNA 5CITA 2CFSA 1DCKA 3WG9A 3GLIE 3PI6A 4R8LA 1KTVA 1FP7A 3KQYA 2Q9BA 3GLFA 3KTOA 5AVTA 1AQYA 1VIMA 2Q28A 2I22A 3R75A 2R6ZA 1YDMA 1TOAA 1MZPA 2FX5A 1XFDA 3F47A 4MNTA 1ND6A 3SC4A 3WDMA 1JRLA 3P9SA 4IGAA 1UFKA 3K8QA 3OAAD 3WLIA 4GYJA 1IEVA 1Y7LA 2OR3A 3AUKA 4YRQA 3GPDG 2BBOA 2D1FA 5B1EA 3UKDA 5KC8A 3I01A 5C1PA 1BWPA 4A0QA 2DAPA 2J8ZA 3PUKA 5K6TA 1XVIA 1KI2A 2VUSA 2ZKIA 4IWNA 1HT0A 1MPXA 2PBFA 5EE5B 5SYAA 3WDKA 4C5AA 4CTKA 2OXIA 2A35A 4JQOA 5CA1F 2FSFA 4HDCA 5AJXA 4GKKB 1M1YE 4URZR 4UTOA 1I80A 1V4NA 2ETXA 4D0SA 2GLXA 4DGSA 1G5HA 1EBUA 4IV5A 2R2AA 3C5WP 5HTOA 1Y3IA 2FWAA 2HA7A 1II8B 2AQKA 4IXTA 5T8KC 3OCVA 1JEAA 1OU0A 4CMJA 1U1DA 1MO6A 2WTMA 2NPFA 3F3MA 2QAGB 3G2HA 3Q8MA 2O7QA 8LDHA 2EZ4A 1Z6AA 2GRJA 3DZGA 1CY2A 3EASA 5E7QA 3RRFA 1FVHA 4EDHA 1GO2A 3WZ2A 3VX3A 5JAOA 4H1UA 4ZDWA 3ZTTA 4LDAA 5BN5A 1E4EA 3W6UA 3AM5A 1U0TA 3FLMA 4O4JA 4OREX 2EKPA 4Q1VA 1KYIA 1L4HA 2X13A 5IFLA 4ZRDA 2AQ8A 4TLBA 1IHOA 1PDOA 1Y1PA 4KLZA 3T7AA 2YZNA 2OG2A 3K1AA 5SZJA 1GNLA 1CULC 1K08A 4N8EA 2P9YA 2Z1DA 2YH2A 2LNDA 5DP1A 1JIQA 2VPZA 1VLZA 1VXRA 2P9ZA 1TC1A 3OJOA 1X7WA 3SSAA 3T9FA 2HA2A 4M8IA 4IHAA 2FK7A 2HF2A 1VL5A 2GXQA 4H17A 4IFIA 5DOZA 2CVFA 2CXOA 2A8YA 1JT2A 3FTFA 1ZICA 4OO3A 2FEMA 2VZ0A 1CERA 3ZV6A 4QEKA 1DQYA 3EX7C 2NU6A 1E59A 1J21A 1JYEA 3ELDA 4BZPA 3CR7A 2QZZA 4F5WA 1SCUA 2VHYA 3ROZA 4FEAA 4EHAA 1QANA 1J8MF 2FLVA 3GLGA 1E5TA 2L69A 1PYOA 1DRJA 1ULAA 2NN3C 5DMHA 3PUXA 3KTAA 1KHTA 3QI2A 3R44A 5LMUB 1WW3A 4DT1B 3E58A 3FPSA 3TBFA 3AQIA 2ZSFA 4AG6A 1UMDB 1ZBQA 4H0NA 4MKGA 3NAMA 3NATA 1T25A 2DB3A 3CLRD 1GILA 1FU8A 1Z28A 1L4FA 2IZ1A 1D2NA 3CH5A 4C30A 3GD7A 2FH5B 3G85A 4TVBA 2NSDA 3GOQA 3HRIA 4RVHA 4UCXA 2PUTA 3K6SB 5BORA 2YOHA 4Q93A 2OYRA 1NV9A 3H1GA 3PJDA 5BN1A 1XAGA 3O2NA 1WW8A 4BFZA 2IPLA 2Z1MA 3WTCA 3ZCTA 5JZVA 2NX2A 2J9FA 3PC8A 2XUOA 3BOSA 4RD0A 2VXYA 4LMPA 1AZWA 3FTEA 4YCAA 5HKAA 2A1IA 4W4TA 3WADA 4L02A 4DUPA 5IJ0B 2Z4TA 3K9CA 1SA0B 3ZGVA 1FMFA 1CY6A 4IDOA 4MEJA 5D5QA 4PXSA 2GZSA 2W2OA 2NO1A 1SUIA 1TC2A 1TMYA 4IO0A 4Q3BA 5GAJA 3WP1B 2ZW9A 2OD9A 1HDGO 3FF4A 4GR4A 4B4DA 2PKWA 4UJ5A 4M53A 1EUZA 5TF4A 1VRWA 3GGCA 4CFYA 3HM2A 1E62A 3OJXA 4RE5A 4US0R 5DX8A 4OGLA 1I33A 2ODNA 3ET4A 5HQTA 3W5AA 1A7KA 4ZGGA 4JC8A 5JCJA 4AC9A 2YNMD 4ZVPA 1DQSA 7YASA 3R7DA 3QW2A 1U0JA 1DPFA 2QLNA 2BFWA 3B36A 5CHEA 5DHUA 3HACA 3ZBUA 2RK4A 4GP7A 2G07A 4FSDA 4XWKA 1U94A 5L95A 1A9SA 1Q0QA 1CQIB 4XYBA 1JXAA 4LDJA 1WMFA 1SKUA 2GETA 4U6QA 1IB6A 4YJFA 1LDBA 2V7BA 3PLRA 2M2IA 2NZVG 5DCUA 1LGYA 3ABQB 4EA6A 2UYOA 3GJZA 5CD1A 1NNSA 3SAJA 2R7AA 4PONA 2VUIB 4GX2A 4HADA 4V0NA 3ZOKA 2AUTA 2BMAA 1SIBE 2FUG1 2IITA 2OHIA 2WYUA 3MWFA 3N07A 4Y9TA 3RUPA 4UU8A 1E58A 3ZWCA 1T9AA 3EZLA 1NC3A 1ZD3A 2DC1A 2YV3A 3A0UA 4INOA 2VJAA 4JYPA 1FFGA 1TVEA 1NMYA 1S8OA 1Z6QA 1W87A 4MW1A 3HCBA 3ND9A 3CLUC 4XVQA 1GZDA 2QT1A 2IUYA 2LW7A 3ZNOA 4XQ0A 4EKIA 4UPEA 1RJ9B 5HIMA 2O20A 5KWVA 2FP4B 2H7XA 4QELA 2F1JA 3QVLA 1DWUA 2DTEA 4PBTA 4UDXX 3RYHB 3SZLA 2FUCA 2BBTA 4RABA 3E9NA 4YT4A 2XLBA 1IB0A 3F4LA 1S89A 2V0GA 2A9QA 1PL6A 2BONA 3EVZA 1ORDA 1CUVA 4UNRA 4AQYB 4EG5A 2OXCA 3RK1A 4CNBA 2C3UA 4LHEA 1CYEA 1RRMA 2H52A 3KLPX 4W99A 2QG6A 4WA8A 1T6YA 5B1SA 3UT0A 4ZVOA 1A98A 1VCMA 1V4VA 3IPYA 5AUPB 4V1CA 2BM8A 2HT6A 4IIVA 1DC8A 2IXAA 2EKDA 2Y9PB 3KB6A 3TTUA 1N2EA 3C5EA 3PC7A 1IH8A 4HLQB 1E3MA 3IAEA 2ZWAA 1E9VA 4GFDA 2FFBA 5ESWA 3LIIA 1LCIA 5FPSA 5FNVF 2CK3A 1ZR4A 2ZATA 2D13A 1XF1A 2ODTX 3B1YA 4HH3C 2GESA 3R5JA 4BNXA 2BE7A 3DF9A 5HRAA 3HXLA 4KIUA 3LY5A 1IUKA 1KJNA 1QBGA 1WSAA 1S2LA 3LBAA 3OZRA 2D0IA 1QIIA 1VCHA 4BGDA 3AJ8A 1QWOA 3O38A 4FMCB 4GMDA 4MI6A 1SUCA 2O2YA 3AC0A 4A03A 4BQEA 1XWWA 2D1TA 3A26A 4GMXA 3LWDA 3THYB 4URUR 3VKHA 3H6KA 4I55B 3GLHE 2JA1A 3I09A 2WIGA 4OMCA 3OAAA 1MMFB 2ZU6A 1PFGA 4KR7A 1I14A 3T0FA 1ZCAA 2RCYA 3RNLA 1PD1A 1NMXA 1Y37A 2NV2B 2JGFA 4LQLA 4YR7A 3WL5A 5ALIA 1FEZA 3GVHA 4E08A 2YHUA 1YZNA 4F06A 1PR2A 3NIDB 3SQOA 3TNFA 2AWNA 2RC6A 2A57A 4BRZA 3HI4A 3TPZA 3UB2A 1CYDA 3F5FA 3FYUC 4BNKA 3RJ9A 5L9AA 1ZH4A 2RH8A 4E70A 1JG7A 6ABPA 2FW6A 3IUYA 2PRZA 5JD4A 1CW2B 2VRWA 1N9GB 1YQDA 3QQ5A 4L3WA 4WFKA 5DBOA 1E9FA 3K6JA 1FJGB 3CS3A 3SP1A 3SU8A 3ODGA 3OX2A 1UDXA 3LU1A 4TTAA 3QGMA 1MIOB 2C4WA 5K01A 1B74A 1CQZA 5LMCA 1I6MA 1XK7A 1W9MA 1WU8A 2ZM6B 3CCFA 3FOBA 3F5QA 3SHOA 4M1KA 4TSRA 1NVVR 2BEVB 4KO4S 4NU8X 4X6XA 4X20A 4FYJA 3GR6A 3QPCA 1V8BA 4MIEA 5JS2A 3IMFA 3SZMA 3ZJUA 1WKBA 5FYDA 2O5VA 5KSZA 2GUGA 3LT1A 2QE6A 5JNSA 1SCJA 1IOZA 1AMOA 5DTRA 1OCEA 2CSXA 1ANKA 3GVCA 1QH0A 1UZAA 3IO5A 4MCJA 3UICA 3B78A 4IJ6A 5JSYA 2G76A 2GAFA 2DSTA 2RGUA 1U90A