1BE1A

Glutamate mutase (b12-binding subunit), nmr, minimized average structure
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
137
structure length
137
Chain Sequence
b'MEKKTIVLGVIGSDCHAVGNKILDHSFTNAGFNVVNIGVLSSQEDFINAAIETKADLICVSSLYGQGEIDCKGLREKCDEAGLKGIKLFVGGNIVVGKQNWPDVEQRFKAMGFDRVYPPGTSPETTIADMKEVLGVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMATE MUTASE
molecule tags Isomerase
source organism Clostridium tetanomorphum
publication title How a protein prepares for B12 binding: structure and dynamics of the B12-binding subunit of glutamate mutase from Clostridium tetanomorphum
pubmed doi rcsb
total genus 21
structure length 137
sequence length 137
ec nomenclature ec 5.4.99.1: Methylaspartate mutase.
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02310 B12-binding B12 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 1be1A00
2XIQA 4REQA 1REQB 6REQB 7REQB 3REQB 4R3UC 3BULA 1I9CA 1E1CA 3IV9A 1B1AA 1CB7A 1REQA 3IVAA 4REQB 3EZXA 5REQB 3KOZA 1BMTA 4HH0A 2XIJA 5REQA 2REQB 3KOXA 3KOWA 1XRSB 4JGIA 1CCWA 2YXBA 2REQA 1Y80A 4Q37A 1K98A 1FMFA 1K7YA 2I2XB 5C8DA 4HH1A 3KP1A 6REQA 3BICA 7REQA 3REQA 3WHPA 3KOYA 4HEHA 1ID8A 1BE1A 4HH3C 1E1CB
chains in the Genus database with same CATH superfamily
1KK2A 2DCMA 1SFRA 2WUWE 3W78A 5IG2A 1C7RA 1E79A 3GVXA 1M33A 3MJDA 2CVOA 4IAOA 2ZQZA 1IZYA 1L7QA 3WJ2A 2ZYWX 4MGEA 4P31A 1JFLA 5TT1A 4H77A 2WFMA 3LFHA 1L7AA 1FCJA 4D4MA 2VP2A 1I1QB 3MWJA 4EGSA 3BGSA 1C1HA 1GZ4A 4TMKA 5D1HA 4AN4A 1S9DA 4UDOA 2QYOA 3IVCA 4NENA 1Z15A 1XZEA 4TGLA 3UJCA 2IRWA 2HTEA 2ZIAA 1AMNA 3T3PB 2ZEJA 3IR5A 3TQHA 4QRHA 1KBZA 1U2GA 1ZH2A 2XNHA 4RVSA 5HDQA 2C4UA 3FB4A 3O8QA 3W8DA 4UAVA 1H0HA 3BS4A 2HIHA 2HX1A 1L8OA 2IEDA 3AF3A 4FFPA 5JATA 2IH4A 4Z4EA 4ZPJA 1LK5A 2OHJA 3BMNB 3I6ZA 4FKBA 1AV7A 2ABWA 4OHOA 5EG5A 2LIPA 3C4JA 4CG1A 3T7SA 2EZ4A 5BNFA 2QX6A 1Q0HA 5KNBH 3G0CA 2YMPA 1RYMA 3K0FB 3OBBA 1JN0A 5AW4A 1TZ2A 4JL6A 2CEKA 3U7FB 3RVNA 4AZSA 4B7CA 3SS7X 4B6PA 1M76A 1TE2A 3TW8A 1R0KA 2L19A 1XAIA 3DA8A 2E7ZA 3RW9A 4HVTA 5EJ2A 3VR5A 1V0JA 4Z7NB 3PU6A 4CL3A 1E3DA 1D5CA 2MTBA 4GKAA 4CL2A 4XX0B 2G25A 3G2QA 5B3JC 4V24A 4F3KA 4A8TA 1NMYA 1U3CA 4Q93A 3V34A 5EGNA 3EUEA 2R4UA 4FMDF 1PDVA 4R4JA 4LXUA 4MI3A 2DX7A 1ZL0A 4TLAA 1JWBB 1NDUA 2W7TA 4IGKA 1OHHD 3GFPA 3OMXA 3AZQA 4IINA 4KRGA 4MWOA 2LTAA 4PV7A 1H8EA 2BV3A 4IXTA 1NI5A 3SK0A 3IOBA 2B6HA 4QNNA 4BO1A 1DKUA 3WL4A 1F6DA 3SF8A 4FB5A 5JH7B 1DT5A 2BFPA 2FKNA 3WKEA 3N8HA 4Z7QB 1P0MA 2ODWA 4D44A 4ACBA 3PHGA 3AP1A 4B85A 4B4VA 3I2YX 3R7DA 3UB2A 3JQRA 3L05A 2VQEB 1J7KA 3RJTA 1SOUA 2BGJA 3IJRA 3UT5B 1D03A 2GA8A 1EP1B 1L3BA 2JAPA 1HLDA 3MD0A 4Q1AA 4MLCA 4X8LA 5KU7A 2JEOA 2QEQA 1YNOA 2V6GA 3W5JA 3JASB 4FGUA 2V74B 1QZZA 1JS1X 5BO5A 1PQ4A 1SCUB 3NAMA 2PZGA 3M1LA 2R8OA 4HVCA 4EUHA 1QCCA 3P19A 1JIKA 1L7BA 3PA8A 4ZTBA 4ICIA 4L9WA 5DULA 3TW6A 1KTIA 5J40A 5BN4A 5LIPA 5TT0A 1RE0A 3N2NA 4Y1RA 1W7AA 1KO8A 1WLSA 2HPZA 2D5IA 2E9SA 1O95C 3FCXA 5ILOA 2GPJA 3HABA 1K75A 2PKWA 2GVZC 4PZ9A 2ADMA 2VC2B 1HTWA 1NXWA 1FMTA 1ZCBA 4IG9A 2M9MA 4CGYA 1RM3A 4XJXA 4EPRA 3R6DA 4AY4A 1D6MA 4JUIA 3RNOA 1JVNA 1EXVA 3LG2A 2I66A 3O4HA 5HZHA 5JTUA 3UJNA 3W77A 3KQKA 2WM2A 1A8UA 3P9KA 2D5LA 5KYGA 2HEIA 1NIPA 2FR0A 3G0IA 1AH2A 1OJLA 1R18A 3F7NA 4A2QA 2FK8A 1F1JA 4BVEA 3QOYA 1SBYA 4K9MA 3HDYA 4QDOA 5ALZA 5A7FA 5H0IA 4AW9A 3EEOA 4D25A 3TNJA 2E85A 2FF5A 2IHKA 2WOJA 2WG1A 3IOEA 3B13B 2ZU6A 3IHKA 4R8VA 4ZQHA 1Y1KE 1IONA 2GR9A 5EPEA 4KN5A 2IEBA 3D6NB 1ZVVA 2VR1A 3WISA 3OWOA 1ISFA 3K9BA 4DYDA 1U90A 2P2DA 2DU8A 2WNHA 2QTWB 2R1TA 3C70A 5JG7A 5LC1A 3RRXA 5A4MS 1DX6A 1FVHA 1BX3A 1NNLA 2ZRCA 1E32A 4F5YA 5G4KA 2IYWA 4BLPA 4WFQA 3QU7A 4JYCA 1Q21A 2W4QA 1HSZA 1HG0A 1FFDA 1JJBA 2UYGA 4GHWA 5EN4A 4ZV9A 3VHXA 5KOHA 3ZHZA 3W5DA 1J2TA 3OOJA 1CNFA 3ER9A 1G3RA 2JI6A 4HXFB 4QU9A 3NB0A 1U8XX 4HY3A 4L7VA 1U0NA 1X86B 3OF3A 1GXSA 4P7BA 4WBSA 1UJCA 5G4LA 4E4YA 2HXGA 1HNWB 3BWDD 5JUWA 1JF8A 3IVMA 3QNMA 4YBZA 4JBYA 4I3GA 1GTMA 1RC1A 3EHDA 3UT5A 4RZIA 2AXEA 2AMVA 1YJ5A 4DPKA 3LPNA 1EJ0A 2X6TA 3ZDRA 3QLVA 5B58C 1O77A 3GVIA 4N41A 1HDGO 5DGTA 2XUJA 5E9JA 5CYPA 1GPKA 2J3IA 2IBMA 2NM0A 1YR2A 5AW5A 5HR5A 4WASA 3E3AA 1JQJC 5J9FA 1DCKA 3OECA 5ALQA 2HLDD 3VTFA 1UM8A 2RMKA 1LW6E 2EJWA 2Q1XA 4B75A 2O2EA 2IUYA 4DABA 1XZLA 3AFNA 3P2JA 4RH3A 4XD2A 1DXOA 3OIFA 4MI1A 2XHZA 2XMRA 2Q3DA 3Q0IA 2EV9A 2ZI9A 2YXNA 4IHJF 3RIMA 4BLSA 1S2IA 3G85A 4GOOD 4LCBA 4Q4AB 3L5KA 4LOHA 4QG7A 1N57A 4QQ8A 1QFZA 3IO3A 5KOYA 2EF0A 4TQGA 3TUIC 4U7DA 2FUG1 3N0WA 4UTPA 3OEEA 3T3MB 1D1PA 3MLAA 4XDHA 5EQTA 1OLXB 1J99A 3KVYA 1RYHA 1VDMA 2G9ZA 3IMCA 3PE6A 1N9GA 1Y3DE 3EN0A 1E18A 1GZ3A 3IKMB 4YQYA 4X1OA 5G1NA 4GPZA 5AOVA 5HEKA 3GG2A 3KQWA 2I6XA 1EK0A 4OIMA 4HUQB 4AF8A 2OA0A 1K6XA 1DPGA 1I4LD 5EXTA 3N87A 3PI7A 4RTSA 1H65A 1I6MA 2ATXA 3H86A 1WF3A 5AHXA 5CEEA 1F60A 2WKQA 2B4QA 1UFRA 4YYZA 4NPHA 1KSFX 5IT4A 1LJ8A 2VDVE 4A03A 5BORA 1T0IA 5CLJA 1XEAA 1JEEA 2H9YA 2NTNA 4G1CA 2HJRA 5EIEA 2YY7A 3T1YB 2VEDA 3ZJUA 5HFAA 4R1PA 4ZT4A 1UM9A 4D9JA 4Q39A 3NHYA 1XVLA 4FNGA 3SYKA 1QWOA 3DDNA 4OSOA 3TCKA 3ZTTA 3WADA 3RRJA 1CR1A 2V7QD 1IOZA 1CQIA 2RKOA 4HX9A 2JBAA 4MQFA 2JASA 1NQOA 4S0ZA 3W90A 4FE4A 2PXCA 3EZXA 5I01A 3BKWA 3I9JA 4MRMB 2ZU0C 1G2PA 1SOMA 3G49A 5CYFA 5IUNC 4G5GA 1Y4AE 2I71A 1H6DA 4CEJB 4DRYA 4CF4A 1EJBA 4N0MA 5CAEA 4Q12A 1KH2A 1WKVA 1PWZA 2BGKA 3VPFA 2VF8A 1O0SA 4ZK2A 5EJ7A 1N6PA 3C2QA 1JQKA 3ISJA 3IXLA 3OZUA 4LZLA 4ZVOA 5JS1A 1FX0A 4JR2A 2L69A 4LF5B 1GQQA 5KX5A 5EXPA 2W98A 4GMKA 2EKDA 2ECFA 2HYDA 1GSHA 2IV3A 2P41A 1N3IA 2ZTHA 1RWPA 4QYIB 2BT4A 5AJWA 1PGPA 1UXJA 1F0YA 2HV9A 3OZWA 3AERB 4XIFA 4NYIR 2FPOA 3TIIA 2OHOA 3VVBA 2IUTA 2HRRA 2P69A 3IEXA 4Q02A 4O2RA 1O7JA 4KGDA 1X9HA 1FUUA 1NBEA 1P29A 1U8EA 2OCDA 2XQJA 4MSUA 1ZMOA 3W6ZA 4NI5A 3SN6A 3TFQA 3NDPA 1E64A 3BQNB 1M1YB 1FSPA 1SUEA 3ER6A 2KHZA 4L8GA 2NIPA 3U3KA 1M7GA 4UTRA 4OUKX 3JYPA 5HJ2A 2ECOA 4D9GA 5DM60 5EKDA 3ROPA 1FSSA 2W2TA 4NBLA 1SY7A 4FD2A 3ZJYA 2ZE6A 3MTIA 4QBGB 5G1PA 3COJA 2OHFA 4X93A 2WMYA 1AS0A 1XFAA 2I54A 3O82A 1WL8A 1RRFA 3OM1A 4RNDB 3R7WB 3GLGA 2FW6A 1M72A 2XXAA 5B1EA 1QK3A 3F97A 1GAJA 3CA8A 1JV2B 3VVLA 1K4KA 1WD5A 4IMIB 5D3MA 1BMDA 1N6NA 3A36A 2LRHA 3LHFA 2JZOA 4RF5A 2DHQA 1LC3A 1I6KA 1QO9A 2JNWA 4B8WA 2JPDA 1CHDA 1MC4A 1IQ0A 1QHGA 2B1IA 2FPGA 4FONA 3OC6A 3RYFB 3QFCA 1JTEA 2CJWB 2JCSA 3I6BA 2YDYA 3BCRA 4MPPA 1TZCA 2HJSA 1HNNA 3EZYA 3GRCA 4ZVLA 2LBPA 2H3EA 2JCGA 4XA8A 4FYJA 4DSUA 4J49A 3M1IA 1B8VA 1EK6A 1X2BA 1Y7IA 3N75A 2AKAB 2C57A 4JBGA 3KP1A 4ROTA 5ALIA 3NXSA 3BICA 4TKVA 1Q91A 3AR2A 5K6RA 3LQKA 3T7DA 2ONJA 4DCGA 2GBFA 2ZT7A 3DBOB 3UPUA 1EXNA 2BFMA 3PXAA 4IMJB 3OJCA 4J4TA 1E1LA 2YY5A 4QPCA 1M10A 3ZBTA 1ZHOA 1J6UA 3T1TA 3PYMA 2KX7A 4U2GA 5KYWA 1KQFA 3ZZNA 5JNWA 3R3HA 4MW5A 4HNHA 2G1KA 3N2LA 5DYYA 1ND6A 5K8UA 1EMDA 4GPIB 5FFNA 2JFOA 3GUCA 4ME6A 2W0SA 3G9ZA 3TOXA 3G2PA 3EX7C 2D2IA 2GEUA 2VHWA 4OQXA 1J0DA 2A5LA 1UMKA 2VNIA 3D6TB 4DMCA 1JJAA 3BGOS 5BXQC 3ZDAA 1IEWA 1R9GA 3C5WP 2GZ1A 2BI7A 3QUSA 4YDQA 3NHLA 3CVUA 1N8TA 1LB1B 2DKOA 2ETXA 3MS2A 1IIRA 1V96A 3OZAA 3MG9A 2PS0A 3BFXA 4DOMA 2X0EA 1G16A 3FOWA 4TKMA 3HKEB 3ZZMA 4G5HA 2VZLA 1N8SA 1FDOA 3BVPA 4LW8A 1SK8A 5F7ZA 3TUZC 4DLPA 2N9UA 3A9WA 4PNPA 4EYEA 5F9FA 1Y1RA 3DMDA 4XRGA 3EH2A 2H5EA 4MMYB 5CLFA 2ID7A 2IXTA 4NFLA 1GCOA 3CO0S 3VSAA 3GEMA 3PITA 4BO4A 4JNCA 1TW3A 1FDWA 1X2EA 4FWIB 3E22A 3IVXA 4LZNA 4XAQA 4YRSA 1COZA 4CIAA 3PNOA 1YDGA 1V71A 2CZQA 3IQEA 1G8MA 1W4RA 2WD7B 4N8EA 2A1TS 3IALA 1NJSA 1GG8A 2B2CA 4ESEA 4MYDA 5HIKA 2NAPA 1ULHA 3IAS1 4YRPA 1S9HA 4LOKA 4JP1A 2ECQA 5DXJA 3KSAC 5FQNA 1P1CA 3DNFA 1OXSC 1YS1X 4NOKA 3IUEA 3OZTA 3NETA 4ER7A 3OA0A 2ZBRA 3SGLA 1QRSA 1NF3A 3CM0A 4IIJF 5DIZA 1SZCA 4ITUA 2H1RA 1S2LA 3U7QB 2VF4X 2I03A 3T5PA 2YIDA 4EJSC 2IVZA 1KJIA 3IBSA 2GRUA 4PQEA 2PFSA 3L77A 2F48A 4ITRC 2QM0A 3WNQA 4U7HA 2B7LA 4O2BB 5IAGA 3CKKA 1B76A 3V1LA 2QRZA 1MIHA 1L5SA 2BCEA 3THOA 3ZGVA 1EXDA 3OH8A 1CUCA 1HZZC 3CLRC 4JUAA 5CLIA 4L2IB 1BFDA 3HP7A 2PL5A 4NJMA 4NVRA 2ZJ6A 1H0RA 2V45A 4YMTA 3G2KA 4RA6A 4MB0A 4EDFA 2D1SA 3ZY5A 4MVJI 1VMKA 1Z26A 1ARZA 1AS3A 1W1UA 2K2QB 3IDSA 2I6FA 3DEJA 3LY5A 1ZXBA 2ZSAA 3IJPA 4GO1A 4KGZA 9MHTA 2AMJA 3GRVA 6ABPA 2RARA 1TLTA 5BW6B 1VKJA 2XGGA 3LUBA 5CLGA 1CRZA 4XSVA 1DXQA 1LI5A 4XASA 3WVNA 3GJXC 1CY4A 3B89A 1GCAA 1PS0A 3CW2A 1IJKA 3UC9A 3L0ZA 3DZBA 3FUTA 2A5FA 2ZWPA 3LFTA 3LHSA 3AVYA 1R4AA 3W2GA 1K0UA 2PJUA 3FPJA 1Y0BA 4ETMA 2YQ4A 4RDIA 2ZE5A 4LV5B 4I9FA 1Z6XA 1MD9A 5IEJA 5EVCA 2BL4A 1DZ3A 2IHZA 4NWIA 4AZ3A 1Z7BA 3R20A 4YDRA 2R96A 4L22A 5JALA 2C5BA 2CEAA 1XAHA 1NSFA 1NRIA 2HTFA 1AIPA 3D31A 4PS1A 5DGXA 4QLAA 5A2QA 1YU6A 2AVDA 2BHNA 1A7JA 3R3WA 1KDYA 2G5GX 1I5RA 1KFJB 1N2XA 1N2EA 2TSYB 3ACBA 2HMVA 1CD5A 1QFSA 1BMTA 2ZYHA 3LOQA 5AIBA 1LDMA 1BXRA 4IOJA 2OILA 3V7NA 4L76A 4UPDA 3WJ1A 1P2BA 1ILWA 1ZK4A 4MYTA 1XTQA 4MVJM 1TYEB 3D6AA 1VLZA 4OKNA 3H4IA 4TV8B 4HMOA 4TUYB 2QJOA 4G81A 3HGTA 4TV9B 4AD8A 3HSYA 3WKBA 1I7SB 2J7PA 4DRZA 1GCGA 1SU6A 1K27A 3INYA 3WL7A 4LJYA 4QUHA 5A03A 2Q5LA 3GRPA 4EBFA 1A7KA 5I51A 4V1CI 1YZFA 5B3LA 4Q3OA 1WV0A 4XE5A 3ZG6A 1THGA 3I3OA 3LLMA 4HAYA 3CMCO 1JQ5A 1SHUX 5DH9A 4UOZA 4TUYF 2QTLA 5B4TA 3G3EA 3MJRA 3K20A 4IS2A 2AN1A 2PR2A 5C1IA 4A82A 1JEDA 4D02A 3LOUA 4MROA 2V8BA 3YASA 4QEDA 3K53A 5ARBA 3ADBA 2IYOA 1U5BA 3BREA 3NAZA 1QE0A 3PEFA 4BDTA 4BWYA 1RZRA 5JTTA 2RIPA 1DQRA 4H35A 4GECA 5I7UA 1ONOA 1T3SA 3KEGA 2XMSA 3FPKA 3T0IA 2QJTA 1HFJA 3NWBA 3V4RA 1AO3A 4HTFA 1Z63A 1KF0A 3AKEA 4DQXA 1ZJWA 4FP9A 5EMNA 1K66A 3LNCA 3OT5A 4RSHA 1YJXA 1YBAA 2HIAA 1OXXK 1V1MB 2WABA 2ZCVA 3GJSA 4GAEA 5ELLA 3TSZA 3M82A 1G291 1LRJA 2PQMA 3OETA 4I4NA 4ZALA 3TB6A 3D8NA 1WAMA 3SQWA 5KNLA 3CY6A 1P80A 4C4XA 2AA3A 4KBGA 2QGZA 2VTBA 1Y5RA 3LBHA 1SHZA 3QNUA 3R3YA 4GWLA 2ZUSA 3H2KA 3T5DA 4B3RB 3H2BA 3QPAA 4D9CA 1TAQA 1SXJA 1K1EA 1JLLB 3E1KA 3FZEA 3ND5A 4QHTA 4X63A 4D3XA 4EG8A 8OHMA 3WLQA 1QIFA 2Q6KA 5AW1A 3ZTYA 3AVVA 2O8CB 2Q1YA 2FU5C 3GP3A 5JARA 4P35A 2OP0A 4OVKA 4Z1OA 2F7SA 4QYIA 4ETIA 2IXFA 3C3CA 4BXOB 3HC7A 2J0UB 4MCIA 5E4JA 5A7GA 4Z2YA 3N2YA 4M7OA 1BZYA 3SJUA 4BEVA 5B7PA 2V0GA 3NHUA 2XYRA 4IZIA 2CCKA 5HIJA 3T9EA 5H83A 3BYZA 3LGSA 4B84A 2GLTA 1BXRB 2D3TA 1CZUA 3Q8LA 2EKQA 4FYIA 3SXJA 2GI4A 3WL8A 3I1FA 3X1YA 3LDHA 4D92A 1V5EA 1YI8A 2JKYA 1D6NA 3PDJA 4WZBB 1UADA 4L6CA 1H9AA 4FLFA 5F4ZA 5GOZA 3GCWA 3A4MA 2HA7A 4XVCA 5IVPA 3DR3A 1Y1QA 4RGBA 4NBUA 4JKYA 4E5PA 3KU4A 2J0VA 4GPD1 1O94A 5HK8A 4BFYA 4B7AA 3DCIA 2FUKA 2UYQA 3WLIA 4LRYA 5CDFA 5GV8A 1TCCA 1AGRA 1M2KA 1EP9A 3BWYA 3JX9A 3MWFA 1P77A 1WV1A 3E9MA 4MUGA 1TM1E 2BSAA 1YJQA 4X8MA 3TFWA 2BMVA 4D8VA 2QL7A 3IMEA 1JEAA 2AS0A 2O7RA 3IPRA 1QHYA 3NOQA 1KI9A 3OQIA 2A9KA 3IP9A 2FRDA 4QL3A 4ENVA 2F8SA 2QDKA 4RVHA 3QF4A 5TRTA 3ZIAD 1ZO8A 5JMWA 1B93A 1CUWA 4QXRA 3ZDBA 2O8FB 1O6FA 4IF4A 3C1UA 3L79A 1C3LA 1ECCA 2WNSA 4ESOA 1GFWA 1SVWA 1RKQA 4KE6A 3B2QA 1HSOA 4NY1A 2AOUA 5G0WA 4FUQA 5LP6F 3V3KA 1FMFA 2NZXA 3A26A 1WMDA 1TRHA 2ZAIA 2R7AA 3BAZA 3AYZB 3ZJTA 1QDEA 4B76A 1JZTA 1W9HA 5F76A 4DEVA 2AZTA 2ZSIA 3GU3A 2B94A 2PUHA 1YUNA 1MDBA 2LPMA 1X87A 1V1JA 1NI4B 3BD6A 4J0QA 4MCAA 2C04A 4WZAA 5BWBA 2FPWA 2UUPA 3WV4A 1VC2A 2YN2A 5JSFA 1E1CA 4QWMA 3WNZA 3JZFA 1G63A 3ZVKA 1DKNA 5F12A 1ENPA 2XH8A 2PK3A 4ZTZB 3MS7A 1JLLA 5IN4A 2C1XA 2GJ4A 5DHTA 1D4AA 2OD9A 2PV7A 2VHUA 1FMCA 2FEMA 1Q92A 1EEXB 1YKGA 4FUTA 2Z6UA 1H1DA 4W5WA 1I2AA 3N2EA 2FEXA 3B3JA 3Q3GE 3T06B 4FHGA 2FUCA 3S55A 9ATCA 3JQ9C 5FWDA 3VO1A 4FZVA 5JCPA 4Q5IA 2X8JA 2HXYA 2PWPA 1BDHA 3QTTA 1J2EA 1NE2A 2GEDA 2NOAA 1RYDA 1ZVJA 1IL0A 4OYYA 1DJPA 1NTRA 3JAKB 4HPWA 3I01M 1OREA 4LFCB 4A6EA 2C8VA 3N2KB 4MW6A 4F6RA 2BY4A 5B57C 1RS0A 1N5IA 1THZA 2GGSA 2P0AA 5K2MA 4N76A 3FYUB 1XZIA 5IAOA 5JAUA 2NU9B 3DEZA 5CBKA 5BNWA 1YI1A 3T1NA 1EM8A 2DY1A 2F1HA 2FG6C 2ZRGA 3HJGA 5DK6A 5TGTA 4EKYA 1JWAB 4C2BA 2MINA 4GOJA 3IPLA 2VRBA 5TPWA 3Q8KA 4C3UA 4RIHA 5J4HA 2FFAA 3H2ZA 4ZHQA 6ADHA 4V1CB 1F7VA 2OEPA 5E0OA 3RK1A 1Y48E 2G4LA 3BH6A 3DWIA 3G02A 4C4OA 2E18A 3UJ9A 1SXHA 1TU0A 1NL3A 4HLDA 1M2VB 3K8OE 5B1DA 4Q7MB 2GKSA 2FUEA 4DYHA 1PTJC 4HN9A 1U8UA 2BFEA 1MRZA 2PCJA 3DO6A 3JQQA 4Q7EA 4C5AA 3N1UA 1TNDA 3PF8A 4HGNA 4DMMA 4UW9A 3W8NA 2JCVA 1QIHA 2CHGA 1UJBA 3SM3A 3OD5A 4NDNE 1AZLA 3VU9B 2XAAA 3CSSA 2X3UA 1FDSA 3GCXA 1CC1S 4Q4JB 4C4YA 2CNOA 3D5TA 3EMKA 1UJ2A 3IDAA 3Q1KA 3UB4A 2F55A 1XAJA 3EIEA 1QCYA 2PVPA 5E6UB 2H65A 4KUEA 2BDTA 4OHMA 3KWLA 4PAGA 2ZETA 2HBRA 3EXG1 2FP4B 5IW8A 1Q1BA 1NVTA 1DOHA 4M2LA 4PLHA 5DNUA 2IU3A 4WBXC 2OK8A 3NOOA 2BMDA 2PMEA 3WKCA 4JB0A 3DVQX 1D6SA 5DGHA 2ODAA 1KAQA 1UIMA 4QGBA 1NJGA 2YFKA 3M6XA 3EQ8A 3UCXA 121PA 5C4IA 1GKLA 1IM2A 4HDSB 5LZ8A 3ONNA 2DTDA 4D45A 5H80A 4B31A 1T0HB 1NUHA 3LUJA 5B1SA 2QTRA 2R5WA 4GGOA 4M36A 3U3OA 5LQUA 2P6RA 1QKKA 3NQ41 4OXRA 1IZ8A 2GPYA 3GMIA 3RS3A 4OA5A 4NS1A 3BILA 3UOWA 3DEHA 2OYCA 2QSZA 1XVUA 2NYAA 3UMSA 4M0KA 5F9HA 2FMUA 4Q4HA 5KYKA 4J90A 2PZLA 3VO2A 3R7WA 4O1HA 3R7BA 3RG2A 4F5WA 4PX3A 3HUDA 3B3QA 1XZHA 1XKXA 2VT2A 2XADA 2UZ1A 4CLRA 4EZBA 1R64A 4MR9B 1PD1A 5A04A 4LHSA 3Q3JB 1GSOA 1EGAA 4D98A 4BMXA 4F96A 2BZ1A 3BD9A 1EX7A 3BX1A 3KXKA 1N2JA 1PWXA 4MVYA 3ZLBA 3R0JA 2XCLA 3ICWA 1UZNA 1JG1A 3MRTA 1HE2A 1KNXA 1QMPA 1Y6RA 3FZQA 4AO7A 3THYA 2BMEA 2WHEA 1BKSB 3QELB 1GO2A 1JG2A 5E9AA 2FDRA 3HS3A 4DM7A 4RC9A 3HXMA 1TEHA 4K9KA 1JALA 2GXQA 2C78A 1X92A 1XXHA 2GZRA 3GCGA 5DBEX 2KE5A 3D54D 3MPUA 3TAUA 1VIAA 3CN9A 1UBSB 1B26A 5JADA 2B9VA 3PQ8A 3OG9A 3R44A 3T9AA 1PUIA 3E6AA 3IPAA 2XR1A 4KQ9A 5K4HA 2MR5A 3BHJA 1UC5B 3JWGA 3KJHA 1G7SA 2Z5GA 3AEQA 4IUYA 5D3MB 3ADKA 2YXPX 3TDNA 3X1WA 2JF0A 2YBDA 2GEKA 4BMPB 4Q4CA 2NZ8A 4KUGA 3G0OA 1OPRA 4BJ6A 2YNMD 5FUBA 4DUYB 3PDIB 3Q7IA 3IUQA 1PQYA 3R3SA 4WX2B 4BHTA 5EZ6B 3DPUA 4KIJA 3CXRA 4CW7A 3EZ7A 1T9CA 4RWZA 3KQPA 3DPSA 4MK4A 1L7PA 5FA6A 4XDGA 2DLNA 1K8XB 3PXUA 2A0YA 3H8WA 4IY1A 3F6EX 5F1OA 2ZZKA 4NU5A 2AN9A 2I4NA 3EWAA 4L4XA 3ZEAA 4G2TA 3Q8MA 1NVKA 2FWNA 1E2QA 3IERA 1KYIA 4LKOA 3WKDA 2C96A 2G9QA 2PBRA 4N3AA 1EG7A 1NR1A 5FLKA 2CK3A 4HQNA 3E7FA 5IJ9B 3RK0A 5KYWB 2XSZD 3OEHD 1DTWA 1LBQA 2OV3A 4PYMA 4U9UA 4EL5A 4AMUA 5JJBA 2PMKA 1QGAA 3R0QA 4MKIA 4UC0A 1W36D 4WY5A 1J33A 3L0YA 3R3ZA 2QY9A 1FP7A 3R1IA 1XQ9A 2ZI5A 4U0KA 1U0BB 1SXJC 1XEFA 1TL7C 3ROTA 3HN7A 1E0DA 4NAHA 4Q9HA 4RGQA 5I4BA 5AUQA 1WDLA 2ZRQA 4ENPA 3LUFA 2JKZA 1N0UA 2REOA 1C29B 3MILA 2WAYA 4UKDA 4HGRA 3KPWA 2QZ9A 4YMLA 3VZSA 4KMSA 1S8FA 3OEWA 4S24A 4DMHA 2C2GA 2JGKA 2G04A 1UAYA 3SQOA 1NFRA 3EZ2A 4N49A 5FYQA 1YQWA 1XD2A 4HNAA 1G18A 4S1NA 3DSRA 3OQ6A 3AV0B 4PNHA 2NUAB 4BX0A 4M6WA 1N8NA 2NXNA 2H9AA 4X94A 2RHDA 2R2GA 1EBBA 4KQWA 1MPTA 2IIVA 4HAWA 4R41A 2ODQA 1J8QA 5KOJB 2GYUA 4WDQA 4CR8A 2EL7A 4DCVA 2JGLA 3CUUA 4YMVA 4YRFA 1PJ4A 1M5UA 4QHSA 2BE9A 4Y2XA 1GN9A 2C0CA 4AM8A 1ETUA 3O4JA 1Q83A 2PUCA 2IPNA 5KVCA 1N2SA 1WU8A 1QORA 4KSYA 1WXEA 3QWHA 5EHZA 4N1AA 1KYZA 4HUQA 3D3JA 2L2QA 2P9TA 3GB9A 1BYIA 3TRFA 4C5BA 2QOEA 1R5BA 2YIMA 2G72A 4XIIA 1YJAA 1ECJA 1SUCA 1XZKA 3A1EA 3KEOA 3OSUA 4OL0A 4DA9A 5IZCC 2W0MA 2G9NA 5CDGA 2G4VA 5CJJA 2GZDA 2GAAA 3NTQA 2YINC 3A6LA 3LT2A 3QXJA 4FOSA 3RSOA 3ZW9A 4AROA 4BO9A 4DSZA 1DC8A 4BCCA 1LJUA 4ZDIA 2OAEA 1VYTA 3UUFA 3M70A 3R5SA 1QGOA 4ZYZA 2P4UA 2R8YA 2Y99A 2ZRAA 2C92A 4L08A 1CR0A 2HK8A 4HDCA 4A0HA 1GYQA 4WEOA 3U4QA 2YVAA 1XGKA 4YAGA 2BR3A 4KXVA 4X65B 1SIOA 2YHSA 1OVMA 3NH9A 1UWVA 1W59A 2W2LD 3DE3X 3IAXA 2QAIA 4MPDA 1Z33A 4NL4H 3U5ZB 1RKXA 3PB3A 4GG1A 1SN7A 1DBRA 2D74A 2W4MA 3CRNA 3O2NA 4M22A 2GN6A 4ZODA 3VC7A 1ZFNA 3JVUA 1G3MA 2VAMA 2IXEA 1OLOA 4DMGA 4BNIA 5DLEA 1FPQA 3UVEA 1K8ZB 2F67A 5JS7A 1E20A 2VSOA 3IH5A 4W1QA 1FNCA 3L7CA 1XCLA 2BF7A 5AXAA 2NP7A 4ER0A 1PSDA 3LNTA 1PL6A 3ZVLA 3T9BA 3A9UA 4AFNA 1XLWA 2D7DA 3A1CA 3CYFA 3QHQA 1Y3CE 2ODPA 1QZ3A 3I2KA 3QF4B 4P32A 2O8FA 1NGSA 3P2KA 1F06A 3RU9A 3C5CA 1QF9A 1CZRA 3S1AB 1D3AA 2X42A 2J48A 5F78A 3SICE 3C1OA 1UMCA 3V00A 1M75A 2HRZA 2EZUA 3UJBA 2H5IA 4IIGA 3MWDA 3HXTA 1HT1E 1T4BA 3T7IA 3UXMA 1GDHA 2G6BA 3D43A 3GFQA 4DY6A 5DKFA 4F4UA 1P9WA 4GMGA 2HGZA 3FMFA 3RUHA 1LFDB 1JLKA 1T9KA 3AHDA 3PGXA 4NXNB 4UBKA 3N05A 1Z2CA 2PGNA 3BXGA 3LYLA 4KFRA 3JALB 1T5OA 4GM1A 1BMFD 4B2LA 4WK0B 4UHJA 1JWLA 2M2IA 1ZOLA 3KTDA 4G4GA 4G6ZA 2QE6A 4K9OA 1IEVA 3SQMA 2IXAA 3FA2A 2J6BA 1PJQA 1MAWA 1GPDG 4DY4A 3TFOA 3A7DA 2X5NA 4HB0A 5A0FA 3NU1A 3CCCA 4K6GA 4WJLA 5AOAA 4IBOA 1HM5A 1SJ9A 4K9NA 2Q07A 3AHIA 5A9SA 3J80A 2H18A 1T3LA 1FS6A 1U5AA 3GK3A 5IZCA 1NBHA 1XZDA 1GAQA 1EVQA 2KLHA 4IIJB 4KDRA 1PEKE 3TS1A 2Q8NA 3NDIA 3KQUA 1HTBA 4UTZA 4GX0A 3CUVA 3IS3A 3FSJX 3CLSC 1A9RA 1W96A 3CUEF 1RRVA 2FSFA 3ILVA 3SU8A 1CIPA 5CB4B 4E5DA 4P7FA 2H2GA 4PS0A 1DQPA 2H7XA 1YMQA 1OI2A 2KBEA 1FRZA 3HCOA 4JLDA 4U7TB 1QNFA 2UZIR 1SHLA 3PUHA 5HJ5A 4JJEA 1I7NA 3DGFC 4UHBA 1URPA 2C5AA 1U2TA 4OB7A 2O4CA 4K6KA 4N9WA 3ZCRA 5K3OA 2MSDB 1U94A 2ZRLA 4YUZA 2EGHA 1IZ9A 1PR6A 3JASA 4PTZA 1E3IA 3DZGA 1NYQA 1SQ0A 4EA7A 5HIIA 2FPXA 2JK0A 1QAOA 2QB5A 3LUAA 1BU5A 1YK0A 1QWSA 1WP9A 1U3TA 1LJLA 1CFJA 4XYEA 3C6KA 1R66A 1ZYUA 3SHWA 3I0ZA 3JVEA 5E6SA 1ZNXA 2VP4A 1MG5A 2HY7A 2BFOA 5J4YA 2OBMA 3CF2A 1GKKA 2ZAOA 4I08A 3DJYA 2CY0A 3JWPA 4FHFA 4U02A 1DX9A 3S70A 4R3UC 8MHTA 1RHMA 3Q7RA 1KSHA 1S3IA 4JXXA 1E2IA 4JT9A 1SWVA 1VKHA 2FFHA 4S12A 1SULA 3DZHA 1T5HX 3DLPX 5J1TB 4BUJA 4DA7A 3WWYA 2HDHA 2WSSD 1I10A 3F46A 4YT4A 4FWTA 5T4FA 1T91A 4WZBA 3ZHVA 3HEAA 1PU2A 5HKAA 3IJ5A 1A5BB 2C0QA 3LKVA 2QSJA 1WVGA 4YC7A 3DP7A 4BGDA 1TW2A 2B1RA 1P75A 2VRCD 3HFRA 4GZ6A 1IQUA 4D97A 4JENA 5KNCH 3VJMA 1TGVA 3UJHA 5B30A 3A2LA 3WWCA 3DG9A 4LHWA 4ZVKA 2ANCA 4QJIA 3AUAA 4S2EA 1IM8A 2G82A 4KQ1A 1VE9A 3QY9A 3QVGA 2WWXA 4I6EA 2OQ2A 2ZBDA 2EG9A 2XNKA 4E31A 3I4CA 2PRYA 3NS7A 2HF8A 2FW8A 4FLEA 1SOWA 3UAWA 1WD7A 3BSYA 4A0SA 1U9IC 5CW2A 3JQBC 1EQ2A 2Q7OE 1YASA 5KUTA 2NMVA 4UBJA 3MELA 1G5RA 4R1NA 1KVUA 5M34A 4ARAA 1NXOA 2AIRA 4EJFA 3L8YA 4F11A 4QM6A 2VPQA 2AWNA 4IIFA 1GTVA 1ZISA 3M81A 2P6MA 5CD9A 1GGNA 6REQA 4LDRA 1KHTA 3SX2A 1IUOA 4C03A 3EPHA 2XUAA 4YYEA 1W581 1ST3A 1LTKA 2CBZA 3A7EA 3GGJA 2DQYA 4M1KA 4PBTA 1Y9DA 5TS3A 3NIDB 3FCOA 2R00C 1CY8A 1XKQA 4AZTA 1MXHA 2XNCA 3BA1A 3LMKA 1XTVA 2DR3A 3GPCA 3HH8A 3GG9A 2ZM5A 4HXGA 1JG6A 4JCCA 3UQZA 1QFYA 4J03A 3T0FA 1N5JA 2JA1A 1T8YA 4NENB 5AJVB 4AL4A 5DBGA 1QK5A 3NJRA 4QT4A 3HHEA 5BQOA 1WHTB 5FQOA 3DL4A 5EXDA 3QXSA 2VYVA 3DZJA 2G8NA 2X7JA 4BFVA 2CV0A 3QE4A 2DE0X 4U2CA 1NMEA 1VKOA 3FF4A 2QVCA 2JJ2A 2F4NA 3BMOB 1Q15A 4TS9A 5DW0A 3W0LB 2XLBA 3IO5A 1O97C 5E2IA 4QVGA 2PV0A 1KO5A 4DCMA 3OIGA 4M8LA 4MAMA 4EG3A 3AJ8A 4UEOA 1V26A 5KDDA 5CIQA 1SBTA 2Q4RA 4FS3A 1YI0A 5LYJA 4FKMA 1KR2A 1DARA 3Q6MA 3QWIA 1X8LA 2B7CA 3FBWA 2VT7A 3EDQA 4FYXA 4KV9A 2IIQA 3IEKA 4X54A 3DP9A 3VC2A 4E1VA 1OKKA 2Z0MA 1SZPA 3HY6A 1N9GB 3FDZA 4KIUA 4QOJA 3A6DA 4WNAA 3ETGA 4XQCA 3VVMA 5E3HA 5BN5A 2CMHA 5EZYA 4HRVA 3TW8B 1Q7TA 1H8HA 2FWJA 2FWAA 1WDWB 1EUZA 2Q5QA 2VNKA 3EISA 2OB2A 2XB8A 5EWMA 4NMMA 3VO9A 3CB2A 4ZQIA 3OMWA 5F77A 2BM0A 4G1UC 3H9CA 1G42A 1ZW6A 2O2HA 3QYAA 1TO6A 1YQUA 3QI7A 4K46A 2R6ZA 5EGSA 4BASA 1DHRA 1G17A 4ALNA 5C8DA 3WIDA 3PRJA 3TQOA 3Q7TA 2NU8A 3ZE0B 4RVNA 1JAXA 2M1XA 1Z8NA 3NTVA 4Q4LA 1ZLYA 3DAOA 2F9LA 1KI4A 1YNSA 2CW5A 1KDZA 2GNPA 5CXSA 1KHHA 3KETA 1M6HA 1Y89A 4RZHA 2XCRB 5JJIA 2Y1LA 1PK8A 1R6TA 4DCNA 5BOSA 2FSSA 3DE2X 1OLUA 1ZD9A 3FN4A 3Q10A 5K09A 2D2EA 4HT3B 2DKFA 4B46A 2BFEB 5IAKA 1IXRC 3PNLA 2JJ1D 1U3WA 2TMKA 5DSXA 1W4ZA 3OQ1A 4HQ0A 4M0PA 4UBLA 1QG4A 3WIOA 5A4JA 1CBUA 2QUAA 3K30A 2AQHA 2RGDA 3R23A 3QKUA 4I8DA 1P73A 1KP9A 1USGA 3ABZA 4C4TA 1T5BA 4RD1A 3WLMA 3PICA 2ZJBA 3B36A 2W2OA 4GE3A 3ZD6A 2RGAA 2BJWA 4FZJA 5GJWC 4Z4CA 3A4IA 3DONA 3RFCA 1TPZA 1BCSB 4X45A 4N0PA 4RA9B 1YCHA 4AJLA 1RPAA 4BO3A 2QZSA 3DZFA 1R88A 1Z4OA 3ENWA 3NGLA 4H1TA 4L57A 3ZWAA 5JAOA 5K03A 1CPYA 3WYBA 4CG2A 5TGZA 2CXOA 3GMTA 1Y33E 5JYBA 2HOQA 1JP7A 4UDXX 2PZFA 1TCVA 2MINB 3EXHB 4GWGA 4K86A 4ROSA 3AVTA 3ICPA 3WSVA 5EHNA 3TF5A 1ADGA 2O2SA 3KWMA 1LVGA 4XM0A 4BN0A 4RAOA 1YRWA 3GEIA 3HR4A 3ZY3A 5CCDA 3ZWBA 3K5IA 3DHYA 3EQZA 3I28A 2P1ZA 1YZTA 3VYRB 1UK8A 1CDDA 4DEXA 2X9VA 2NU7B 1EWVA 1REQB 1IBSA 5FULA 3M6FA 2XXBA 1EGQA 2ZIWB 1C14A 1DV2A 4GMXA 2IEIA 1QBKC 4GF5A 5KQLA 4DVJA 5FJIA 2BKLA 3Q12A 4OBXA 3EULA 4RJTA 3ROMA 1TUGA 2XZPA 3ZUPA 5CB4F 2R6AA 2ZROA 3LGXA 2BI4A 1RKVA 4LGCA 1FL9A 4N54A 4OHBA 1LVUA 2BTQB 3RRYA 4EX7A 2O0JA 2E4VA 3GRRA 3GDHA 2ZJOA 4NEHB 4ARUA 4Q4DA 1Y6GA 4TMWA 1TTHA 2CJWA 4PXYA 3DKIA 4REMA 4DJTA 4HQOA 4OH7A 1ISSA 2ZRIA 1IC6A 2G5TA 3N28A 3QBVA 3H19A 1TYDE 3LF2A 3M6VA 3PFFA 5DNYB 2WYOA 1RIFA 2EFDB 2NT3A 3DZCA 1OLUB 1FYEA 3DEKA 3MMSA 4KVGA 3VZBA 2FDCA 3SKYA 1OXTA 1CR6A 4KI0A 2M98A 1Y8CA 1T15A 4QJ4A 2QVLA 2HPVA 1O3YA 3BEDA 4P0TA 4XWOA 3RUPA 5DN6D 5IC5A 4RFSB 2ZYRA 4HDOB 3V1YA 4H27A 5DU2A 4JEHA 1FRQA 3VX4A 2DRIA 2OBXA 1ODSA 4XFDA 2C7RA 2WPDA 4J0EA 2HMAA 4JVLA 4EY6A 5J1SB 1TJNA 2VJKA 2O9JA 4XD7D 1WIWA 2W43A 1ULSA 3NHSA 5COAA 3SEAA 4EUEA 4OQ4A 1ZU5A 3ETDA 3KSBC 1J7JA 4B32A 4DV5B 1J97A 1J09A 1TADA 1XZGA 1TKRA 3E35A 1GZ6A 4QPNA 3N76A 3WZ2A 5JEEA 4MUKA 5J2UB 3UMJA 1R3UA 3B85A 4H6WA 2AC4A 1F5NA 1XDSA 3TLEA 4C0SA 1E0SA 4PZUA 2O2JA 4PZAA 3KXDA 721PA 4GXQA 4HDNA 3MT8A 1KTVA 4I3FA 4C30A 3W6PA 5CIYA 2BFFA 1TZBA 3CGWA 3B1ZA 1EE2A 5H70A 2QM7A 4J0GA 4V0OA 1PGNA 1Z07A 5K0FA 2CWWA 2AOVA 1SUDA 2I2AA 2O3RA 3SZUA 2E55A 4UAUA 2ZSFA 4HBGA 1CVIA 1WRBA 4IVPA 1JI0A 2D13A 4RF3A 4RY9A 4Z0NA 2NUTB 5FPQA 4DJFC 4KQGA 2G76A 1YZYA 1AK1A 4JI1B 4LJKA 4M0MA 4NBSA 5HJ7A 5KO2A 4OGFA 3GZ4A 2PJZA 3F6PA 1B42A 3DOCA 1K3TA 2Q9CA 2F43B 3COVA 1YE5A 1JDJA 4DR7B 3KAPA 4Q3BA 3QPUA 4PR0A 1G5TA 2GRAA 3PD0A 2RAUA 3GIWA 1GAXA 4JWTA 4KTVE 3WMGA 1Q20A 5IULC 2IXDA 4L0DA 5HE9A 5ESXA 1AOXA 1ONSA 3WDSA 3PDIA 4BKPA 1SOVA 1ZY2A 1TZKA 1ZGAA 2QHXA 5CDYA 4B4OA 1IHDA 2NZYA 3B1VA 3IAM6 3KZNA 4MKFA 4J2HA 3Q41A 1N6LA 2V4ZA 2IWHA 3F8TA 4Q3NA 4JI2B 4YCBA 1U4SA 2OUKA 3GA5A 3LE8A 4K87A 4TL7A 2Y0EA 3BRCA 2R6GA 3EQ2A 3JYLA 3L7BA 4J3FA 2C3PA 4B73A 2WKPA 3BORA 5IMSA 3UATA 4Q18A 4PPNA 1QRRA 1SG6A 2YC2C 3KU1A 2ATCA 7AT1A 1LRLA 4RMIA 4Y6PA 4CTMA 2GSDA 4PHHA 3WMXA 3RKRA 1FFCA 4DJ5X 2WFLA 3V8MA 1IEQA 2I76A 5LNK1 2O54A 4PHFA 4XB2A 3SMQA 3KVNA 5K8CA 1Q57A 2E89A 2IQIA 4BMSA 3RTBA 3TLGB 5DNCA 5EY5B 1N0IA 2PGXA 2WINI 1BDBA 1K3FA 2VNAA 2JAXA 1KZ7B 3RE1A 4LRTB 5JOQA 3V7YA 3IL2A 1ONNA 1C5KA 3F96A 3FYTA 5IBCA 4HMPA 3ZGLA 3QXGA 2RBGA 3HQ4O 4FI3C 5AICA 2AJCA 4XGRA 3NEJA 4IQFA 2FZ5A 1JX6A 2FZWA 2VUHB 2UZ3A 3N8IA 1YHNA 1XQYA 2WHYA 5FPHA 1FFAA 2HN9A 1IXSB 3QUQA 3IIEA 4O0LA 4I6JA 3DQQA 3R7NA 3BZUA 1ACLA 3NNDA 3SEFA 4QUAA 2H2DA 4MV8A 4ARVA 4N5MA 3JVIA 1W5AA 5BN4B 4UNRA 2X0FA 3A3NA 1P4HA 1MB0A 2VT3A 4I1RA 1BH6A 4IWNA 4M1SA 4WOKA 3ZV3A 2Z2YA 1FBTA 1NG1A 1STOA 2CVPA 1SEPA 3L4SO 4G0OA 4DA0A 2V1UA 2CXXA 4XPIA 1EM8B 5D00A 1M1NA 1T8SA 4W6QA 3T4XA 2FKAA 3FDXA 3OU2A 5I8PA 3D8SA 3RS5A 1M1ZA 3SHQA 3C3YA 5MDHA 4A26A 4AUNA 4ZRNA 3ANXA 4WK2B 4FGLA 3IESA 3QOFA 4DR2B 1MO6A 2W37A 2ZUCA 3OCCA 1U7WA 2I7TA 1UBHS 3BRSA 2ATVA 1OLSA 1R3DA 2A8YA 3BJIC 4QTZA 5T4EA 4ZCQA 3RBAA 1VDZA 5A6SB 4B7ZA 2FMKA 2VHEA 4G4SP 1E2BA 4N82A 3IEUA 4GP6A 1P45A 3C4VA 2AUMA 3FKJA 1JJVA 3PFHA 2EEZA 2Q1SA 2YKGA 2OK7A 1WPGA 2F3PA 2Z04A 1QKJA 5H3HA 2WZDA 3WS7A 3D8HA 4WOJA 4ZOCA 3UMYA 2H4WA 1B2RA 1J9ZA 2WYUA 3LLUA 3N8DA 5ALUA 3C8MA 2ZRHA 4O63O 1KE1A 1YZGA 4DUPA 3DVAB 1S02A 2OGTA 4EL0A 1FQWA 3ZU5A 5JMOA 3E70C 4RSRA 4PO1A 2FSVA 2W2QA 4OP1A 4UD2A 4X90A 1N3YA 5IVDA 4M1EA 5BOSB 2XAUA 4DNXA 2YZ7A 3FJOA 4NBKA 4MGKR 3BH7A 3UY4A 4KVAA 5JISA 3M4XA 3LJKA 4EVQA 3RKSA 2E82A 2A59A 2R85A 3DKVA 4TTIA 3I5MA 4AJEA 4RS4A 1V4NA 1FUIA 1L2TA 2HUNA 3LD9A 5A7HA 1ZHFA 1MJGA 1XV5A 3ZY2A 4D56A 1DXHA 4QYTA 2QRQA 1OHHA 4HX5A 2Y9MB 1I32A 5KWSA 4GVLA 3E0QA 1H2ZA 2MYUA 2VP3A 1Q0PA 1EZ1A 1XVTA 1NULA 3EWNA 2XVMA 2B7BA 2Z98A 4DV2B 1QOZA 1EVZA 1UAGA 1P5HA 2BFBB 3HJCA 1KDRA 3AETB 3P9CA 4DKJA 5ALFA 5HQ3B 4BP9A 1MC8A 5KHLB 1ZMXA 2A7XA 2QMOA 3I45A 3L6UA 5K51A 3RF6A 3RRZA 2Q5EA 3L49A 2CFCA 2QQGA 3W1EA 1K63A 5AH0A 1KZGB 4A6PA 2A14A 1RZ3A 4JBXA 3A70A 5AR1A 3NWPA 2HMSA 2OQIA 2VUTA 5K6AC 2ZRFA 5HE8A 5C8YB 1MHPA 4M9SA 1Y4SA 3F4BA 2QROA 1N4DA 2X1HA 3BIJA 4WKCA 1PZMA 4RZQA 1RYEA 1X80B 4KLAA 3DBLB 3AUYA 3CG0A 4YNBA 1JIVA 1HO3A 4N8DA 2QLNA 3DOIA 2H07A 2HA0A 2HA5A 5J3JA 1USWA 1OA0A 3RPEA 3HPQA 1SBCA 1O6ZA 2BLNA 3O95A 2V6JA 1U0HC 3DMTA 3RYIB 1TM4E 3U2QA 1J56A 2Y1KA 4WERA 3OPVA 1FOEB 2WEKA 2WYVA 3QBJA 3AOGA 3ZD7A 1T13A 3K32A 5BNZA 3RV4A 1CUAA 3DZKA 3MNFA 1N33B 2WTAA 2XVYA 2Q5HA 4RIEA 2PFGA 1C3XA 1Q50A 3PA6A 4ZICA 2R0QC 1JHUA 1SQFA 1DBIA 1CIVA 4G5XA 5HKKD 4JYBA 5ER6A 3U44B 1GG2A 4DW8A 3A10A 3O21A 2JG3A 3QJ5A 2ZAMA 3IAFA 1P5ZB 4K8OA 5D3ZA 4F93B 5HZGA 1GYPA 3NHKA 3U37A 4KB5A 4IOMA 4PZ0A 4G0YA 4DARA 5FTWA 5B6PA 3C41J 2ZRDA 3KDPA 1PFVA 3B1KA 3JD2A 3VDMA 2JHCA 3DVRX 2ECKA 1E1RD 1LTQA 2XMBA 1N5MA 4L8VA 4Y2HA 4CNBA 4OJKA 3KUXA 3CLHA 3C98A 3EASA 3N74A 3DDOA 4O4JA 4TTSA 4ZVTA 4TRNA 3HUUA 3DPIA 3HM9A 3PXEA 2ROQA 1G5IA 2JFBA 1UK9A 2JATA 3CUSA 2V7PA 3F5FA 3D7KA 5HZMA 3KOZA 4F7DA 1NVUQ 3ED5A 1UPTA 4JLOA 2VJLA 3NV7A 3Q7PA 3C1TA 1V45E 1W0JD 3PUWA 4LJAA 4B71A 1Z2AA 4BN4A 4CQNA 4DMFA 2WSBA 1UZLA 3VOSA 4ABYA 4WLVA 4X91A 1T0UA 5A0VA 1W2GA 4GQBA 3ZNQA 3NDBB 4YGXB 3GN2A 1DUVG 2V5VA 1VPLA 4E5NA 4R2MA 2BGRA 3GFBA 4N3BA 3SJBA 1HZZA 3QBEA 3W8FA 4BPBA 3VPDA 4OJMX 3LL7A 1KYVA 3UJDA 4AO8A 4EQ6A 2UAGA 1KNQA 2JFGA 3ME5A 1ZEJA 1A88A 3KHSA 4OHCA 3TQIA 1ELOA 1CJUC 3WRVA 1GQSA 1YKFA 4EITA 4AYWA 5DM70 1MU0A 3FFWA 5FP0A 4S1OA 3RF7A 1GTJ1 2FE1A 4CLXA 1EFAA 2FI1A 4YCAA 5D2CA 4NESA 4I1VA 3I9V1 4YJ2F 4FMDB 1MAUA 1P1BA 1NN0A 5KKCA 1GRVA 1YU9A 1Z2DA 1EHYA 2ZTMA 3FR8A 4YRIA 1LKZA 1QFMA 3O38A 4GKVA 4BNWA 3PRHA 3PQ6A 3L7MA 4COKA 4HO1X 4CCAA 1B8NA 4OGGA 1HE4A 1I3CA 4JUCA 4BLRA 1AD2A 3GPLA 3C24A 4Q1FA 2D0DA 1USKA 3S7TA 4UM9D 2AFIE 5GM1A 3WHIA 1K2VN 4WA8A 5G0TA 4E6PA 1M74A 4MYSA 4L8YA 1FSFA 1MH9A 3O8OA 1PUXA 2R6FA 3O1JC 2W71A 4V2IA 5KKAA 3AB7A 4Q6BA 2PQ6A 1KO1A 3ZCQA 2BTOA 2Z3WA 2PUDA 2IE0A 2FUNB 4GMHA 4Q16A 3R8FA 3NAGA 5JCJD 4PSUA 2V9CA 3B8HA 1EK2A 1PQPA 4BFLA 3PQ4A 4RD3A 3FWKA 1HE1C 2IITA 3A9SA 1GNVA 3HWSA 1FVOA 1Z22A 5TQ0A 4HH3C 4ALKA 1BX0A 1SKQA 3TTXA 1C81A 2FP4A 1V9CA 1X7HA 2ZTVA 3AR6A 2NU8B 1RWQA 1CUHA 1DIBA 1ZIPA 1V7PC 2GNAA 3PC3A 2J3QA 4OXYA 5F4BA 3SAJA 2Q6VA 4TWBA 2YDXA 1GLVA 1MAVA 3GROA 5AJZA 3RSZA 4IIBA 5DLPA 2H3HA 4RBNA 2JLQA 4YMUA 2QSYA 3WDLA 1F12A 1NVVR 3B8EA 4FYWA 4KBFA 2V8OA 1Q3HA 3TIXB 4ZO9A 2D2FA 1L7OA 3V4OA 1GDDA 3COPA 2ZBPA 3FB1A 3JSAA 5HMMA 1F4VA 2O1EA 4MS4A 4MRAA 3M8KA 5FOSA 4WNIA 4PICA 3EG9A 3T4UA 4WIAA 3DT6A 4C89A 3HBMA 4RTPA 1ZUIA 2C4VA 1ATZA 1M1XB 1UT8A 3KZCA 1NOIA 1OYVA 4N9QA 1F2TB 3BTVA 3E4CA 3I9NA 5IKEA 1LQTA 1Z08A 2V55B 3PBKA 4XQ0A 1PX0A 4GWKA 4I8IA 1IDOA 1HQCA 1E3WB 1UC4B 2QXUA 3WBJA 1V48A 5DO9A 1W2HA 1SC3A 3ROKA 1WQ1R 3GJ6A 5CB4A 5KQPA 4O25A 2H11A 1M2HA 2Q99A 3BE4A 1LA2A 3SC4A 5CG1A 2A9OA 4K9QA 1Z68A 3GARA 3EZGA 2ZKLA 4ZOEA 4EHDA 3WGTA 1MKYA 1YZ3A 1UODA 4F2DA 2M1ZA 3RJMA 4UAJA 4KR0A 1KPHA 4KDEA 4CTNA 4UMDA 4URXR 3W7VA 4LHZA 3CX8A 4LOAA 1QS0A 4RAQA 2ZJFA 4C05A 5IVHA 5HSGA 2OBFA 3CV3A 2E0IA 5ED4A 5E38A 3BJMA 3EPKA 1FA9A 2H54A 1UDWA 1RFLA 5BYBA 1G0OA 1I7LA 3TD2A 4Z8XA 3K70B 2X9NA 3BMQA 4ILKA 4BNXA 5A6SA 3COYA 4Z4IA 3JRWA 1L8AA 4F0JA 3GF4A 2G07A 1F8FA 8GPBA 1WHSA 2PRZA 3QPCA 4RMGA 3I09A 1FMJA 1RHKA 4BB9A 3THSA 4G9BA 2P1RA 4G0MA 1Y9EA 2BKUA 4JROA 1H1TA 1BHSA 4YJFA 4IJWA 1XTJA 3E05A 3FTQA 3USCS 2PAAA 1EDDA 3KKKA 2HHLA 3PIDA 2NTYC 4Y0AA 2X0RA 4EB6B 2O2DA 3WL3A 3UWSA 4YK7A 5J59A 1ZJ6A 3BXHA 3P0JA 4L4ZA 1SVLA 1T2UA 3MOGA 1LDYA 3T7RA 3QX9A 2UVPB 1VJ5A 3E9QA 3QVXA 5ALRA 3ZV4A 4H7DA 3A0UA 5KTRA 1Q3TA 1A7UA 5FAKA 3IA2A 4TV9F 1YL6A 3WXBA 3RK4A 2D2XA 5D85A 3PUZA 1VI6A 2CL0X 2OVBA 3OP1A 2C7PA 2ZYVX 4UE6A 4INAA 3EUAA 3W4KA 1RC8A 2RHRA 2Y1CA 2OGWA 2WWRA 2J30A 2X15A 3D2CA 3L8FA 3WQBA 1Y7TA 1FK8A 1VRVA 5DZSA 4HDRB 3JQAD 4H6VA 4JY7A 3EXAA 4MUXA 4Y2VA 4B6JA 3FI0A 5TEWA 4P3PA 3ZGZA 5IHXA 3BXFA 1DKRA 1P2VA 4MV9A 4PLWA 4DLYA 2ZYDA 1TU4A 2C3MA 2OM2A 4C1NA 2J9YB 1C1DB 2C3YA 1B0ZA 3EF3A 5FOWA 5TF4A 3TUJC 3MCTA 3QLUA 1P6UA 1QB7A 3H2YA 4B79A 3H8VA 3C97A 3U16A 1A50B 1KAHA 4G5RA 1N36B 4L0QA 2JIBA 4G5YA 4NXMB 1TMGE 3U6KA 1R8QA 3N0TA 3PIRA 4HNTA 3RIGA 2A2ZA 3QTLA 4FIDA 3HDJA 5F7JA 3BPSA 3UWOA 4ANFA 2CHVA 2YJZA 2OZLB 2ZJYA 4I1SA 4DBLC 4BMVA 3NIWA 5I9LA 1F0NA 4WT7A 2Q4OA 3G7NA 3QM1A 1OXBB 2Q1TA 2ZLBA 3CZ9A 4YGYA 5F7OA 3QK7A 3EGXB 4RF2A 5LB4A 4CQLA 2AR7A 3QVMA 2I1WA 2DQKA 5EE9A 2GWHA 3FCCA 1AY0A 3QX8A 1IY0A 3OMLA 1BG6A 2J3MA 3PL1A 3T7AA 2J6CA 1HG1A 4V0NA 3BHMA 4O1IA 3K70D 2O20A 2AJTA 1MQAA 4XVQA 1WXFA 1XRQA 1GARA 4KODA 4PFSA 4F3YA 5EZYF 1PJLA 1QR6A 5LM3A 1TEZA 4YRAA 3T41A 4J7XA 4ODIA 1Q95A 2JLVA 2RE8A 1P1JA 4D74A 4PSKA 4HNRA 3JD0A 2VHXA 5EIWA 2A33A 2IP1A 3LO8A 4JEUA 4OXXA 5I9SA 4AN0A 2PMDA 1BDJA 3EVFA 4JUBA 2FZGA 1BCRA 1X9IA 3DXFA 3SF8B 1ABEA 1EHCA 1E6MA 1FJHA 1FC0A 1M83A 4KXYA 3RYFA 5L3VA 2Z4SA 3PVZA 1AUOA 2ZPTX 3P27A 4LXTA 4MUFA 2HWYA 1XJ0A 1N6OA 1XZBA 2JIRA 3ZWVA 3MCWA 3WMFA 1J24A 1J90A 2R60A 2Y67A 3RSSA 3TLMA 3GC6A 5EMJA 4NPAA 3C5EA 1CUJA 4GH5A 4L4RA 1I9CA 2BSXA 4BB6A 3F8WA 2V0CA 3EG5A 1K8RA 5EP4A 2BFDB 1T5SA 2WAXA 4LSZA 3CF6R 4WDRA 3TRIA 3E82A 4ZHQF 3HFGA 4DT1B 4B3DA 3JD4A 3H13A 5I4IA 3BGIA 1E62A 3DFMA 4IGFA 4KWCA 3UUEA 1A96A 2DWOA 3HA2A 1OVGA 2B30A 3PUXA 1CW2B 1JFFB 1RLUA 2DFNA 2HF7A 4UUBA 1TT5A 4LDAA 3D5EA 2B5OA 5EKSA 3TAXA 1Z5GA 4BFSA 4Y9UA 1HL7A 3QXXA 5K0GA 4IGAA 2PSSA 1VLVA 1J22A 4WGGA 4RTJA 4X41A 4L6AA 3IOMA 3C74A 5P8WA 1G7CA 1QHXA 2PKCA 1BWRA 4FDAA 4Q3AA 4C88A 1JIJA 2J9XB 1J2JA 1TUBA 3JZIA 1SHJA 5AM0A 4OLHA 1KVSA 3VHQA 3ZTWA 2N1BA 5MFZA 3QX3A 4G89A 4G01B 3FCYA 4OX9Y 3IB3A 2X8WA 4PW0A 1DHTA 3OFJA 3JYOA 1YOBA 2Q0SA 3B20A 1SUFA 1Q14A 4GC9A 1OF1A 3GZJA 3FDZB 1VL6A 5H7XA 3QPBA 4N5LA 3P8ZA 1C0LA 1GPBA 2GVNA 2RHWA 1PT8A 2GT1A 3CPJB 4RPCA 5DEOA 4DA8A 2UZAA 2GAIA 5F21A 1Q7BA 2XRFA 3TZHA 3ACCA 5TIIA 2FPIA 1G3UA 2PKRA 3HV2A 4F8EA 2GESA 1UJNA 4KFTA 3WLTA 1K7SN 4H16A 3R8CA 2ODEA 3C39A 3VH3A 4YPVA 1V3QE 3BDIA 3PPYA 1R15A 4RYDA 4BFZA 3H1FA 2LIVA 3NEPX 1RWWA 1CQJB 2B1JA 2I29A 3P9XA 1FDRA 3ESBA 2R6JA 1C1XA 1C30A 2ZBUA 5CDTA 1P2FA 4M87A 3QHPA 1REQA 4C7KA 4HAUA 5DSZA 4CKCA 5CH5A 5IWAB 2JLXA 3I62A 3ZBQA 4I99A 2C1ZA 5T6MA 1BDMA 2BBSA 2CL6X 4LEIA 1YZQA 2R8EA 4LMAA 5E1MA 5BMVB 5GJBA 1QC5B 2JHPA 4FFDA 4WLEA 4LUCA 1U3DA 5GQSA 1EX1A 2CXHA 3RHFA 4BXOA 3F2VA 5LU9A 3Q3IA 3HO8A 1DTSA 1GFZA 1XA0A 1NYRA 3PG5A 3TECE 4CM4B 1GTL1 2GAFA 2BEUA 2WTNA 3ZOZA 4MCHA 4MI9A 2QPTA 4FEGA 5C18A 3TG8A 2XZLA 1RTKA 1RXWA 4AYTA 1Z8DA 4ND8B 4BTVA 2ZRPA 2Q6LA 3STUA 3MZ0A 4BKQA 3SHOA 2O59A 4BQRA 5CFZA 1ZN9A 4II3A 5COQA 2CT8A 3NBKA 4CXMA 2IV2X 5FNZA 1IXKA 4FCTA 4KCGA 3U4HA 3K0EA 4JITA 2EZ9A 3BJZA 3WWZA 2GBCA 1OBOA 2I0FA 1JBKA 1DAPA 4UHDA 1WQ4A 3ZIUA 1XMVA 3OZDA 4TYMA 5AW0A 1WZIA 2QS9A 2BRUC 2XOKD 1GG5A 3PYXA 2Z6AA 2IBTA 4BFXA 2OO3A 4KHZA 1T8PA 3QEMA 4TSFD 3AH8A 4YJGB 3G89A 3IBYA 4FW9A 4MS1B 2DLCX 3WQQA 1EA5A 1ZJZA 5BT9A 2ALJA 5JCOA 5LP6B 3N59A 2PSEA 1JKIA 1CNMA 1ODTC 2O57A 3H8JA 3MTBA 1SCAA 1KFBB 4B45A 4DV4B 1WU7A 3PX7A 2WJ3A 5JZOA 1WXWA 3HUFA 4DIOA 5BSVA 2FLVA 1KIMA 3CQ9A 4AVYA 4PLCA 5CM2Z 4LJ7A 4P4NA 3C14C 1A4RA 3CF0A 4M9ZA 4NR0A 1Q84A 1V6SA 3N2GA 1U5CA 1RLOA 4JN6B 4LN1A 4N6OA 3C16C 4JIGA 5DBIA 1TIPA 5K0SA 1EWTA 4IGEA 3A1TA 1SKMA 3WGUA 5ENZA 1JHRA 2XDQA 2FG7C 1DKQA 1NYTA 2H63A 2OC4A 1N1GA 2R25B 3OZFA 4TUYA 1WO8A 4LKRA 4UNNA 2EKPA 5ITZA 5AT1A 2NPOA 5EP2A 1ZD8A 2XMGA 3PL5A 1L3CA 2WTEA 2X8BA 4P33A 4RK4A 4LDJA 2WU0A 1I0ZA 3M4YA 1BVUA 2GXSA 5AHWA 1ZD4A 2PU5A 3IXMA 1Y4DE 4DLBA 2FPPB 1D8TA 4GPBA 2X2FA 2AJ8A 3IEVA 4Q24A 2Q4DA 2PX3A 1UWKA 3CW9A 3FY4A 5FTKA 4YJKA 1XTIA 1XZFA 4X3OA 3QYFA 3KAKA 5CITA 4RFSA 2GEFA 4GR5A 1NBAA 1IIBA 1I2CA 2O7SA 1TMOA 4PYKA 5CT4A 4WESA 5C5CA 2YJ5A 3AVXA 4JOQA 3GLIA 3C6ZA 1KDOA 3UJPA 5IXSA 1HX7A 1CQXA 4Q9KA 3TXXA 1JDNA 4DDMA 3AI1A 3QKTA 5CJ2A 2WZCA 3OFKA 4G84A 4BAGA 1DWOA 1QOPB 3X1ZA 4MQ6A 1N2HA 2CC2A 5AKEA 1GGMA 1CUDA 1NT4A 3JZAA 4B8ZA 1X1BA 1RJFA 4UEJA 4FDUA 2PYIA 3U49A 5BQPA 1IBKB 3V42A 4R1OA 3RV3A 4YQFA 1QRUA 2GPSA 2C42A 3QKWA 3GOQA 4GQAA 4UQOA 5EWLB 3HGQA 1RQPA 4FFVA 3U3DA 3IDOA 3X3HA 3KT6A 2PRSA 1QVWA 2VNHA 1ESCA 4M60A 4CQMA 1A04A 1OI3A 3LA6A 3HI4A 2VFAA 1W4CA 1VXOA 3Q3HA 4NKRA 4R54A 2DY0A 3ET4A 3GUHA 3W34A 2C7GA 5F2EA 4C4SA 1RM5A 5C2JB 1E9BA 2XMPA 4WOCA 3T1VA 2NU6A 2EBWA 3A6PC 1Z4KA 2XKJE 3IP8A 3TL6A 1E9AA 3JARB 2JGJA 1W46A 3I2HA 1WWKA 3RWMB 3HJTA 5ALEA 3N2GB 5JO0A 3WSWA 5ECWA 3EW9A 2XUHA 3EC1A 5JSUA 1PGOA 3DYIA 3KEMA 2KB0A 3L6OO 5TSDA 1GEEA 3TK1A 4BVJA 1G5HA 3RJ9A 3DULA 4LE0A 4CIYA 1PG0A 5GY7A 2H2WA 1P2SA 1YS9A 3DDZX 4C7XA 1A9PA 4JUFA 3EGDA 4US0R 3ZV6A 1BD4A 1I33A 2Z9CA 5LZ9A 1B8PA 2FK7A 1P31A 2J6HA 3U60B 3A2MA 4NV0A 5EESA 2R6HA 3B9BA 1GGVA 3K1ZA 4IDAA 3TTSA 1M2EA 3V6LA 1P4AA 3DBRB 5IRCD 1RJ9A 2PN1A 2C0PA 2O14A 2WJZB 4NHEA 2R1TB 4HDSA 4NULA 1SUAA 3VTAA 4D80A 1Z16A 1E92A 3CW8X 4F5DA 1WUIS 1AGPA 4GMDA 1YRYE 3LBIA 3AHHA 2FA9A 2H1LA 4RY0A 1MOPA 3E81A 1WMEA 1U2PA 2QN3A 3TMAA 2UXBB 3O6VA 3D6UA 4JLUA 1SHKA 4HZUB 4JXJA 4MH0R 4DPLA 4BQNA 4F3RA 3W2HA 5JAZA 3IMFA 3H1GA 5F2OA 4B09A 3WB9A 3OTOB 4OM8A 3I39X 5INTA 4Z53A 1ID8A 2DQ4A 4EFKA 1AGYA 1N5DA 2DAPA 4TL6A 5KOIA 1X7YA 2Z2IA 4JSRA 1U31A 2WF9A 3BK2A 4BFTA 4YMGA 2DB3A 2Q3HA 4JBWA 4EHLA 4EEZA 4U2FA 4ZO7A 1C8KA 1QPGA 1X15A 4BE7B 3UT6A 3H7AA 2C7QA 1S3FA 5J47A 4UFPA 1YVUA 2FWRA 4KLNA 3RC1A 4CJXA 3AF0A 3F6YA 3CURA 3INNA 1QRDA 3EXHA 1KSJA 4PCAA 1ORWA 4IJ6A 3OM9A 3IV6A 5G02A 2A1TR 3B2NA 3L6DA 4BRUA 2A9PA 2FG5A 4L4YA 3WGZA 3HR8A 2QI9F 3G2NA 4BNJA 4FR0A 1JSCA 3BBLA 5FOUA 3PHLA 3ADDA 4GR4A 4HZIA 2HWXA 3P2MA 2H16A 4PCVA 1YE3A 2HT6A 1XX6A 1O0BA 1ZK3A 1YDEA 4I66A 4MPJA 1GFSA 2JFVA 3C3AA 3TSCA 1AF4A 3RM3A 4MZXA 2W5UA 3CC8A 1Q22A 2QYSA 3OUTA 4B9EA 5JBNA 1RZRD 2HMWA 3F67A 3KAQA 2PUGA 4CLEA 4HH0A 1CTQA 1VKRA 1OV4A 16PKA 3QI2A 4R83A 4DTIA 3AWDA 3DBHB 3Q2KA 4JLWA 1KU0A 2P9CA 4HJXA 2QG6A 5IUJC 5TMPA 4O3FA 5LMZA 2H5JA 3ONVA 5GGXA 3KUCA 3IHWA 3UO8B 3UYLA 3ZHBA 3KQYA 4C7BA 4Z4HA 3CKLA 1J5EB 1C4XA 2QNRA 1PQWA 2QKYA 2O05A 4TV9A 5D3QA 2O8DB 5JJKA 3JQGB 3NHJA 2QR3A 4ND6A 3DMHA 4FFBB 3OZEA 3NVKI 1OGJA 4RVGA 4N3CA 5DB4A 2QLLA 1THMA 2WKSA 5CH3A 3ZQKA 3FNGA 2E2WA 3HCEA 2FFBA 1J9EA 2E6UX 4LBZA 1RI2A 4RZ3A 1KAGA 4MA5A 4E14A 2KM1A 2AQ8A 3MGCA 3VR2D 3K2IA 4TKUA 3D0KA 1NSTA 1SIBE 2KS6A 2J41A 2ZYTX 3ITDA 3OIVA 4LMPA 3VV2A 4EB3A 4KACA 5K8IA 5LSAA 3A1SA 1T6BY 2FV8A 1AQYA 1T4MA 2NW6A 4UARA 4ZVPA 3RS9A 3WWEA 5IK2A 1GVNB 3G8AA 3LTNC 1T5TA 1SWWA 1X13A 1KVQA 3PUIA 2GEJA 1Z0AA 3A2KA 1VCIA 1PJAA 1RHUA 2QD4A 2HH9A 5CVCA 2BM8A 5I7OA 1OZHA 1EUDA 4QA9A 5EIOA 2QX4A 3C6BA 1QYIA 5LQCA 4TN1A 2CV1A 2J08A 3FD8A 5EKXA 1YULA 4GI2A 3EBLA 5AKIA 5C53B 1N1EA 2N75A 4LF4B 1A72A 1XT6A 3HLTA 1EX9A 3VDXA 4AJPA 1KQGA 5DCLA 3TTUA 3GLFA 2Q50A 1EFHA 4B3CA 3TGWA 1LQUA 3T5CA 3K6SA 1WMFA 4JC0A 3R6GA 3SC3A 2HSJA 4B44A 2Q29A 1II8B 2OFXA 2B8TA 1AJEA 3ISVA 2DXIA 3ZK7A 3A9RA 3FXAA 4RYLA 1TVKA 3TLCA 3OHSX 4QXPA 1R7RA 1FLVA 3I04M 4WXHA 4N01A 4POAA 3IUYA 4MEJA 1JU9A 2XSZA 4CCYB 1LBTA 4P4TA 4N7MA 1RM0A 1J25A 2J33A 4KBYA 2XE8A 3B9RA 4AY5A 2G80A 5LN1A 2C7OA 4WCFB 5D5QA 1GDTA 5K05A 2I2FA 3R3JA 5E8RA 3PDUA 3GLHA 4Y9TA 5JZVA 2ZJZA 1OH6A 2X0NA 5EE3A 2IS1A 4AKHA 5LL6P 2RJNA 4RQAA 1BA2A 3FTDA 4RIIA 4ATNA 2F1IA 2XE4A 2PSJA 4EKDA 4UASA 1U1DA 2WVAA 4AUEA 4HWGA 3T61A 4MQMA 4WN9B 2REQA 5J4VA 4LYEA 2KBFA 3WR5A 1ZN2A 2HYIC 4W7HA 5L6MB 2I1QA 1WF6A 4YIHA 4W9NC 3G9XA 4EJMA 1J0EA 2OCAA 1EJ6A 3BUSA 3VFDA 5ALKA 1LGYA 1ZM3A 4XSGA 1ADCA 3QUAA 2Z57A 4LXXA 1C7FA 2HMTA 2D1QA 3ESQA 3T3EA 2GILA 2NQTA 4PNZA 1FNNA 1TQHA 3NT4A 3COSA 4MTCA 3RAJA 3W5UA 2YXDA 3SPXA 1G8SA 2G70A 4K0RA 3S8MA 1XF9A 2IK8A 4E5VA 4L5IA 1P4RA 2LWIA 4LXHA 4M49A 3GUYA 1LSSA 1YJ8A 1VCMA 3G68A 3IR7A 3LX5A 1PHPA 3FFXA 1ISHA 4H17A 5JFOA 4KXNA 1H4QA 4UATA 4BEWA 2VAVA 1ZEMA 1YFKA 5AVVA 2NTJA 3FYSA 3O4VA 4Z4FA 1I4TD 2X5JO 4QSHA 1W85A 3KELA 1L4GA 1QK4A 1ZU4A 4XYBA 3ZKWB 4O3MA 2GO1A 2SKCA 3E9NA 1KDTA 3FM9A 3PENA 2IYLD 1ZC4A 5D87A 2V4MA 4DANA 3QTBA 3OM8A 3EVGA 2E49A 1NG9A 4Z9XA 3FZGA 1C4KA 2YMQA 1EFTA 1N2GA 1VMAA 1YQTA 5K1ZA 4JJKA 3HJRA 1FSZA 3D3EA 1B1CA 1QTRA 1W87A 3K9NA 3H5WA 2EU8A 3IE1A 2SCUA 2GERA 4HUJA 3VI3B 3MD9A 5KTYA 1Y8QB 1EQUA 2OENG 3BSWA 4CWAA 1Q6YA 1JBEA 3EGXA 1MX1A 2P4QA 3DOEA 3P4YA 4LSGA 1KY3A 4Q47A 5KWVA 4ZEWA 2C03A 4BBAA 3DE5X 5AKZA 3KKQA 5DLQC 1DL5A 5K45A 3ZHUA 4JBNA 5D1NA 1L4LA 3HCPA 2GM3A 4DE5A 3PGLA 2PKYX 4CCWA 5JCOC 4I9NA 4IXWA 4WECA 4BQFA 2C2XA 1T9AA 1XOIA 2FJUA 3EAQA 4C4ZA 4D8WA 5ESDA 1I24A 2BR5A 3IXQA 4FBMA 4AJ2A 4BNLA 1QAQA 4OFZA 2CL7X 4UQLA 1ZK1A 4M9XA 1BW9B 1A9QA 1GSAA 3V80A 2RKBA 4PONA 3S4YA 5A9SB 3FOCA 3N53A 5F35A 3FPBA 3ZW8A 2Y1FA 4F9EA 3TNFA 1I6WA 3EVBA 1NE7A 1YRLA 4TVBA 4EX6A 2J59A 1T4DA 4YCNA 3Q7QA 3DYVA 4MYUA 2LKCA 5HBRA 1Z88A 3IQFA 1X3SA 1UBFA 2VPZA 3GLQA 5JAMA 4K81B 1ZX1A 4XKJA 1SCNE 3WA6A 3JZMA 2YYSA 1V37A 2I8AA 4PAMA 1ZR2A 2MSEB 1OWMA 2YFYA 2Z8YM 1C4OA 3A4VA 4KR2A 5JNUA 4DADA 1EWRA 3LXUX 3OKFA 3WBBA 4RTMA 4JI6B 1XZQA 3V8EA 4A0QA 1W93A 3ZZ0A 3PLAE 1NR5A 2YW9A 2K2WA 1X14A 4UFNA 4C06A 3J7AC 1FYDA 3FSGA 3NHRA 2P77A 4IW3B 4TVKA 4WLUA 1XPOA 3D4LA 4DLZA 3AIIA 4LHVA 1BKDR 4H3HB 5DNVA 2PUAA 1BN6A 2N3ZA 5C52B 3RVSA 1KA9H 2NACA 1O95A 1T8UA 2HCRA 4HI0E 4TMFA 3UK2A 1PVDA 1OIXA 2WV9A 5BVGB 4X3PA 4EW3A 5CXUA 4QDUA 1HXHA 1LX6A 2X8JB 3QKRA 3E48A 1DINA 2BM9A 2MYTA 2XBLA 3NRJA 1YQ9A 2E48A 5CFPA 1U99A 4EKEA 3Q2IA 1L4KA 1XBTA 1OT5A 3EY4A 3F7TA 1PYGA 3K1AB 3O83A 4JP5A 4D0RA 1H2RS 1MQ8B 4K88A 4CL8A 1GUYA 4YVFA 4ZGBA 1M0TA 2DGDA 2OFFA 3UV6A 4NC9A 3KWFA 1TA0A 3CZMA 4INJA 3ENKA 1UEJA 1DFIA 1YV9A 2V97A 3N8GA 3OVMA 1ZSYA 2IZ1A 2F8MA 1Y1SA 1JB9A 2GZ3A 2XQFA 3DTVA 3EIHA 4UULA 2COEA 3W05A 3GQVA 1X7ZB 3ZVRA 2EX0A 1G20E 4FFRA 1JHQA 4R5HA 4QAQA 3HCWA 1BH2A 4MWCA 4B43A 2CD9A 4DSAA 1NY5A 3S8EA 2XCUA 3VQTA 1AQNA 3KTFA 1GR0A 2CXPA 4E3WA 2P6PA 3K9GA 2GRJA 4R2JA 4XCVA 2Y77A 4I4IA 2YNMA 3BDAA 1BMQA 1WCIB 4WLOA 3AIOA 3RVBA 4B7XA 3QSYA 1D5WA 1HRKA 6AT1A 2CDRA 3ZU2A 4RABA 4EHFA 3HCDA 3JQGA 3SXPA 5KYXA 1Z6YA 1YA6A 1FRVA 1K6MA 1ZZEA 3BIOA 2WA2A 3BQMB 1AG9A 4YN3A 3SX0A 4BNVA 4B0PA 4R2IA 5KYYB 2EHDA 7ADHA 5LIRA 2CFTA 1YZNA 4P4SA 3VR6H 2HM7A 1PLLA 2C5HA 1CIJA 2GKGA 3JQ9A 2LZ0A 3SBXA 4MO2A 10MHA 1ISPA 4D79A 5KNDA 3CG4A 3A6GA 2GPTA 3EXEA 4R40A 3MM4A 3RFUA 3STVA 2CK3D 4KNYA 5E1DA 3OOYA 3CBQA 4LYAA 3JR7A 4FHCA 3RIEA 5HTOA 3EODA 3SHFA 4MWGA 2MMGA 3KJZA 1O4VA 5H68A 4A6XA 1W76A 4LQ4A 4G4JA 1VGVA 4A0RA 3N3BC 2JGAA 1G60A 1IULA 2C8KA 1GZDA 2YC4C 3IURA 4GD3Q 3N6XA 4LXQA 3VR4D 1CRQA 4TXNA 2DUNA 5IPFA 3L1VA 3CH7A 4MS1A 1JHDA 1YIOA 2WSIA 5K0NA 1CUXA 3U80A 4QOEA 2P5SA 3TZLA 4KXWA 5K4AA 4PRLA 1B73A 3QX7A 1CYEA 4NCBA 2W9XA 3HP4A 3P9NA 3SLRA 3FF1A 3BQ9A 1MIOB 3BOSA 2HO5A 3KS9A 3M2PA 3NGMA 3TNDA 5HF8A 5JT1A 3E18A 1ISJA 5FBQB 1F1BA 2WF6A 4KPFC 2VPWA 1JHXA 1XF1A 4FEEA 1OBVA 3IX7A 4IXDA 3RGWS 1GQYA 2DUWA 4WFJA 3O0DA 4Q7JB 5C8ZA 3WLNA 1D04A 4GM0A 2B1QA 2P8JA 4R0MA 1E6WA 1NMZA 2VDRB 3GZNB 2V3VA 4ND5A 4RUKA 4ZT5A 4ZVVA 5C31A 1KH3A 3UMBA 1T1EA 4KFUA 4AXXA 4A16A 4MQEA 4TMVA 4JYPA 3ZOKA 4DAOA 2BN4A 4TM8A 4KH1A 4UNPA 4MVXA 2FEKA 2NX2A 1PTKA 4WV3A 5B1YA 3TG2A 3GD5A 4JBLA 1XQ1A 2M32A 4UU7A 2JAUA 1ZVMA 2AR9A 4RMJA 3ZLJA 1SU7A 2P3LA 1U0JA 1LSJA 2BMFA 3ZE8A 1SPXA 2HZBA 4GPAA 4ABTA 3HB5X 4I55A 3OAAA 2Q5OA 5J2UF 4BNYA 2DHCA 5DI3B 2HHJA 5AXCA 2O2XA 3SQXA 1AN0A 3I2FA 3QVSA 5FHQA 3V4FA 4IZHA 3JQ8B 3DVAA 1P8JA 1NQVA 5L7WA 4IJVA 5CBPB 3KOOA 3R7LA 1FTQA 1U2QA 4MEBA 4BEBA 1A0OA 4B3GA 4JU8A 2AEMA 2JH9A 4BYMA 4GKBA 2HF2A 5FL3A 3VTZA 2PA0A 4OKIA 4UDNA 3OT1B 1FVFA 1NSYA 4PTYA 1QQ6A 5THKA 1CZKA 3DBRA 4ZCRA 3MSCA 4UUMA 5JQGF 2JIDA 1ODCA 5AM1A 5FLXA 2WTMA 4ZC8A 1CUIA 3HWX1 5JWHA 4TRMA 1Y3HA 1E6UA 2MOKA 1P81A 1OTYA 4PXSA 3GH3A 4U3JB 2GYVA 2PPVA 2XNSA 1LS6A 5JFGA 5KNCA 3M3HA 1PWEA 1JEQB 5COBA 5CA0A 2VQFB 1O87A 1QXSA 2ZP1A 4FEAA 1D4FA 5LMCA 2OE2A 3CRVA 2EX4A 3DQPA 4UVIA 3WGVA 1N6IA 3ANMA 3AUXA 3AO0B 1U0LA 4PC3A 1GQRA 5AKKA 3LT0A 1TT5B 5AKLA 4CKWA 3I34X 1Y1TA 4BO0A 2BHSA 4BVFA 1O5TA 3FNHA 3TE6A 3H5RA 1K06A 4RW0A 4KRFA 2MDTA 5JAPA 3QFRA 4MAAA 4NMHA 3ZHTA 1A8HA 1FRNA 4XSHA 3QFFA 3W1WA 3LC1O 1M6WA 1PUJA 2XB2A 2D8MA 2P5YA 4EO4A 3HCNA 2X76A 4P7KA 2VLIA 3NBQA 3QP9A 4JQSA 3TMKA 1PWYE 1TA9A 3HEBA 5HTKA 1ODKA 2F59A 4ERNA 2CJFA 3B1YA 1W4BA 5IC4A 1QRTA 1AE1A 3PNQA 3WAJA 2JRLA 5K4GA 4PPFA 1YMUA 2D62A 5HKBA 2AF3C 4KFSA 3LF1A 3H18A 5EJGA 2O23A 2PLAA 5A5FA 2DPLA 3IULA 2ES4A 1P6QA 5IBPA 4HNUA 5JD5A 1IBMB 1VHWA 2F1KA 4EKNB 5G2OA 1QV7A 1PL7A 1O94D 1U7TA 4RV5A 1VPTA 2WUFA 5FBHA 2SHKA 4U6SA 2WTBA 3GL9A 3H3JA 1Z38A 5NLLA 3MTQA 3PKJA 1Z0JA 4X1YA 3ZVNA 3BWBA 4ZOLA 4XEUA 3FVRA 2D7CA 4R1LA 1W9MA 4AKIA 4MR8B 2NGRA 4IKEA 3EPLA 5HRCA 2HI0A 3OJXA 3CJTA 4H18A 5HF9A 4RZSA 3WLJA 4D8TA 5BRJA 1VJCA 1T0BA 4UNSA 3AL2A 1BE6A 1P7VA 3NZEA 3ZZ1A 5LU8A 1AGNA 4JR0A 4MNTA 1JVBA 2BJHA 1P8AA 4C76A 1TKCA 1X8KA 1V9SA 4X8HA 4KO8A 3ZZTA 2VHTA 3IPYA 2WDPA 1C3EA 4HB3A 1JSLA 1KJNA 2QQEA 3OLCX 4OJQA 3TCNA 5A06A 2AGVA 3MRVA 4IDFA 4HMQA 5DHRA 3PJRA 2ID8A 1E1YA 1XA4A 4Q3KA 3GFTA 1XR3A 1RKBA 5A3JA 5LA6A 2BEUB 2GCGA 4K0KB 3WMRA 1FTWA 4ZI2A 5ITZB 4GL2A 2IW1A 2P2GA 3H1EA 4IEIA 2PT5A 3WLOA 1PL0A 3FOZA 2CLHB 2PKQO 2WU8A 2DH6A 3IVAA 3MQ2A 4WPGA 3RAPR 3J7TA 5L9AA 1JDTA 1KK0A 2Z8ZA 3VHXB 3AHGA 1EAYA 2FSIA 3FYUC 1V8FA 3JY6A 4IMRA 3I5XA 3CZAA 5DSTA 3QEKA 2H7CA 2P68A 1I01A 2RIRA 5D5PA 4QWWA 2F3RA 1KL7A 1BHO1 1IVNA 2YZMA 4B3HA 2J67A 3BXOA 1EA7A 1CY0A 2IYVA 2EFCB 4YONB 4CF6A 1ZH0A 5LKRA 1F8YA 1X74A 5JZBA 3DZIA 3H5NA 4IZ6A 4OMDA 3QU9A 1Z13A 2Z09A 3U7RA 1XDUA 3V4ZA 3ZS8A 5FWXB 2C82A