1BE1A

Glutamate mutase (b12-binding subunit), nmr, minimized average structure
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
137
structure length
137
Chain Sequence
MEKKTIVLGVIGSDCHAVGNKILDHSFTNAGFNVVNIGVLSSQEDFINAAIETKADLICVSSLYGQGEIDCKGLREKCDEAGLKGIKLFVGGNIVVGKQNWPDVEQRFKAMGFDRVYPPGTSPETTIADMKEVLGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How a protein prepares for B12 binding: structure and dynamics of the B12-binding subunit of glutamate mutase from Clostridium tetanomorphum
pubmed doi rcsb
source organism Clostridium tetanomorphum
molecule tags Isomerase
molecule keywords GLUTAMATE MUTASE
total genus 21
structure length 137
sequence length 137
ec nomenclature ec 5.4.99.1: Methylaspartate mutase.
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02310 B12-binding B12 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 1be1A00
3KP1A 1REQB 3WHPA 1CCWA 3KOXA 7REQB 1ID8A 1I9CA 5REQB 1BE1A 7REQA 4HH1A 4R3UC 6REQA 3EZXA 1FMFA 1REQA 6REQB 1BMTA 3REQB 4JGIA 3REQA 1E1CA 2REQB 5C8DA 3KOZA 5REQA 2YXBA 4REQA 1XRSB 1E1CB 2REQA 3IV9A 4HEHA 4REQB 1K98A 3BULA 1K7YA 1CB7A 1B1AA 3KOYA 4HH3C 4Q37A 3IVAA 3BICA 2XIJA 1Y80A 2I2XB 2XIQA 3KOWA 4HH0A
chains in the Genus database with same CATH superfamily
4KNWA 2NVBA 2ATCA 1ND6A 1SZDA 4EY5A 1EGVB 3L8DA 3D3QA 3FFTA 3WGYA 3WLTA 4IMPA 3DEHA 2BM9A 3ESXA 3FZNA 3IAFA 4MYSA 1J97A 1ZBDA 4WNAA 1U2ZA 4LXIA 5IZCA 1NVVQ 3O1JC 2AHRA 3H5TA 3LY8A 3QXGA 3BRSA 2ZTMA 1H4TA 4NI5A 4EJMA 2GCPA 1XYVA 1LJLA 3DPIA 4ZAGA 2PRJA 3FWNA 3HJCA 4LYJA 5JISA 1HG1A 1UZUA 5KJFA 4RK6A 1QH1B 3TLKA 2DBZA 5TSDA 1SQSA 2VPTA 4DR1B 4WOPA 3QPDA 1RKQA 2IOHA 1JV2B 3EXHC 3HCDA 5JPIA 1BD3A 1NR1A 2Z30A 4QUHA 2Q1WA 3LO5A 3VHRA 4AJKA 3NH9A 1P8JA 1U0FA 2VJPA 4FYMA 1BROA 2HV8A 1T9GS 5CVTA 3GRKA 2GK6A 4QXMA 5HKAA 4HDKB 1SKAA 1VQ1A 2J45A 4QQ8A 1TZKA 3ZBPA 4AXBA 3DF9A 5KVAA 2RG1A 3PD1A 4ZT3A 1FSPA 1BS9A 1NM5A 1SK8A 1WMAA 3WYGA 1XJ5A 4B6GA 4FYPA 3AFOA 3TUJC 1FUEA 1PFQA 3DMRA 3SC6A 4Q82A 2MSLA 4EITA 2R6DA 2GM4A 2PG3A 1P2FA 3WB1A 1E2IA 4BJ1A 3IH5A 3D3EA 1EFRA 1UBJS 3FCEA 3R3XA 5LXTB 2GZHA 1AN0A 3GZ4A 1Y5RA 4F5ZA 3EEOA 4TL9A 1RE1A 3KAJA 4PG5A 3TNJA 5I7EA 2BSAA 1USKA 2HKIA 2BZ0A 2Q4RA 1JKFA 4WOCA 2IS2A 1J06A 2YWGA 4OUDB 5LP6F 1VM6A 3CEMA 3NM4A 4JIMA 2X8BA 2VQSA 3GPCA 4C6TA 3U3RA 1QNLA 1MIOA 4F91B 1XALA 3OTGA 4BL5A 2XLBA 4KQIA 1ESZA 3D6UA 1A9RA 2HLDA 2Y1LA 4OVKA 5KNBD 3LY9A 3G6WA 3M34A 4M0FA 3U7EB 4BO1A 3ZV4A 4MYHA 1PFYA 1NVMB 2BTQB 3CN9A 4OHPA 1HI9A 3UAGA 4EVSA 2J9FB 1T5HX 3LCRA 5CLFA 4LBWA 3PTZA 4MSUA 2VH5R 1WF6A 1I5OA 2AQ8A 3CMCO 3EQ6A 5D01A 5EWJB 1C5KA 4CMGA 1D2HA 3HU5A 2R6AA 4ZT5A 4IMRA 3CG0A 3Q85A 4F9TA 3WTBA 1J1UA 4IIJB 4KN9S 1Q6YA 3NM5A 3ROEA 1N0WA 3WRYC 1TEHA 3ITDA 4GMFA 2O3SA 4C06A 1V1RB 3HEAA 2JGDA 1P75A 1PNVA 2ZWOA 3LIIA 1QYCA 4HYQA 3TYXA 2ZEJA 2FV8A 4V39A 2W6JA 3K9BA 3FRHA 3T52A 5K2MA 3ZWCA 2OHFA 4YJDA 4DG5A 1GNQA 5ELXA 4XEHA 4CUJA 4AC9A 4OJYA 4G5FA 4YLGA 5DM1A 3K6SA 4BO2A 2PD3A 1PFVA 3O74A 2ZKIA 5A0TA 1N2HA 3A28A 3IBYA 5CDFA 4E07A 2M6LA 1HDOA 2OM2A 3HN2A 1PFGA 3GB9A 2EZTA 1EVQA 1OZFA 4JJEA 3UFXB 5GVRA 1Z47A 2VEDA 4K9SA 1DLIA 4U6NA 1TKAA 3CNQS 3L7OA 1E4YA 3X1KA 3EWSA 2DBRA 3Q2IA 5L7YA 3TS1A 4RIGA 2YWXA 4PCAA 1MO5A 2O1XA 1TPZA 5FBQB 3D43A 1DC8A 2WICA 4AZ0B 1WHSA 4LWOA 1JNYA 5GV7A 3W6PA 1N1EA 1ZK3A 2CLOB 2F43B 4HQNA 4IAOA 3BFVA 4FU0A 3W9SA 1G55A 2OQVA 1HNXB 3PGLA 2LR0A 3VHQA 2J30A 2ODAA 4FFBB 4ZO6A 4ZANA 1RXUA 2AN5A 2OKGA 2HF8A 3GNQA 1M54A 2BM1A 4CMJA 2B7CA 2A0YA 2EBUA 2W6QA 2WKRA 2E85A 2WSLA 3D8NA 3ORHA 1UDRA 2IHKA 4AWXA 1V5GA 3ASVA 4N0MA 3OVMA 5CLQA 3OOJA 4AB1A 4LF5B 1HL7A 4FBLA 5FH9A 4KQJA 3COSA 3IIMA 1TZ2A 2PBZA 5IJXA 4CM1A 1T3ZA 2WHYA 4KWIA 5IC5A 3K9HA 4O4JF 3S2ZA 1Q16A 3A7DA 4FKBA 1AUXA 3KWLA 3KLPX 4BTVA 1ZZEA 2I7DA 2B6HA 3E61A 2J6HA 1AHNA 1FYVA 4QNNA 1V4VA 3O3CA 5E9AA 4BP9A 3O8RA 1UUFA 1G3MA 3MJVA 2QUZA 3L0IB 1OWOA 4QYXA 5ALNA 1ZN2A 1W0JA 3LT4A 4KXLA 2HCJB 4R05A 3I01M 4PCVA 4XA8A 4PZEA 5ALJA 3UAZA 4YJHB 1OX4B 5DLYA 4RVUA 3RU2A 5BWCA 3OF5A 4ZYXA 3TZHA 3AIIA 1A9ZA 3PUVA 2YMQA 4MKZA 3QENA 4L4RA 1HTBA 4P22A 3TGWA 4YP0A 4XFJA 4X20B 5HE9A 3OE1A 3UMMA 2OV1A 3U4QA 2ONJA 2L0XA 4FN5A 4JJFA 1ZVJA 1RJDA 4BNKA 5G02A 4B3MB 2PTGA 4KNYA 5ECYA 3AP1A 1W36C 2C95A 3SC3A 1NF9A 1KYWA 3MTGA 4MVJP 2ABWA 3QE4A 4P0TA 5FLYA 2P1RA 1NVAA 3GFQA 3KPWA 1B16A 4IQ4A 4Q03A 3WGMA 1R8QA 1N2XA 1XJCA 4GZ3A 1KPGA 2FZ5A 2Z3ZA 4MVJM 4DPLA 5HFAA 3VPDA 2XT6A 4BQOA 2O5CA 5CEFA 1EVJA 1V45E 3BIOA 3MUEA 1R27A 1XRRA 5EPEA 3IDAA 3DWGA 4DLZA 2NIPA 4RPKA 3TX6A 3L84A 4AG6A 2ZZNA 3E9CA 1UBTS 2PBRA 3L7IA 2C3OA 4P3YA 2DXIA 4PYKA 2ZSBA 1FK8A 1XIVA 4US0R 3ZDQA 2CLIB 1U9IC 1HYGA 2HCFA 3D1LA 2EZ4A 3C87A 4XFKA 1NHGA 1SY7A 2OL4A 2XAUA 4M21A 5JMTA 4BEBA 2Q6TA 1UOPA 5F64A 5IABA 3PLRA 1E5LA 4YRJA 3GA0A 2E0IA 1A5TA 1R8JA 2CUZA 1XCBA 2X0EA 2QV7A 4KFRA 2FPPB 2JFVA 2QB5A 2YV4A 3ETNA 3MMNA 3AFMA 3STHA 2OCIA 3V8QA 4II2A 1PLLA 2I2XB 3UJNA 2P6NA 2ANBA 1JDJA 2DWQA 4MPDA 4V1CB 1I4EB 3W05A 3CKYA 1QTRA 1VE1A 5BT9A 1CERA 1PW7A 5K3DA 3CVYA 1F7UA 2FG6C 4FILA 1LX7A 1K1EA 2QMOA 1A2KC 3JAWA 3L6OO 3OM8A 4O29A 4BFCA 1LLCA 9MHTA 1ZVVA 1U8YA 3UIEA 1E32A 4OTZA 2QSYA 3ADDA 1R5NA 4XSVA 1H65A 2O8FB 5BXYA 3UTDA 3H6KA 2QWXA 3S5UA 5CNKA 3OQIB 3Q5DA 5CAEA 1TADA 4YUWA 4TKVA 4OMUA 1JJ7A 4KIJA 4L0QA 1E3IA 4M6WA 2ECFA 4YWJA 1CEEA 4BMNA 3SJCA 1W29A 1M67A 2DLCX 2V59A 3VDMA 1GYQA 2EFCB 2WTAA 3GRFA 3DZ8A 2N0SA 3AETA 3GA5A 1L1EA 1FX0A 1UKCA 2XAAA 2PGAA 1EI9A 1DJLA 4B73A 2ALJA 3PX2A 3RUEA 3KSRA 3A7EA 1CUIA 1HMYA 1WXQA 2JH9A 3TSOA 4DYHA 1QU2A 4D26A 1WKVA 2VUSA 4HB4A 3G8YA 4PXAA 2O8BB 1W1WA 4J1SA 4LTNA 4FMPA 4KYIB 3CB2A 4HZUA 3L8FA 3C5VA 4REQA 3W3AH 4BX9A 3FDXA 1KVRA 3D7NA 4NZYA 1I7QB 4G6ZA 1IUNA 1SEVA 3VPFA 1QE3A 2XQJA 5A6SA 1YJBA 4ZYTA 1LTKA 2BFDB 3KU1A 3UXMA 2ERYA 1IHOA 2QGNA 3HJFA 1WHTA 2PO5A 5AKZA 1HE1C 1MIHA 1VJ1A 3BD7A 4H16A 3COVA 3PGXA 2A35A 5T6BA 1KU0A 1UK8A 3PNMA 4I2VA 4MINA 2V9PA 1RNLA 4BHTA 3I9MA 1VKHA 2H06A 1D1SA 1KU6A 2O7RA 2PXCA 3NBMA 3PPIA 3PT5A 4N7MA 4YAFA 3G2OA 3S2YA 5EEHA 3U7QB 4C87A 5KWVA 3LCVB 3N53A 2AD5A 1V9SA 3WJAA 3R5KA 3OLWA 1F9AA 3JYNA 4NY1A 4BGDA 4FFSA 5JCPA 5KOJB 1Y82A 4INJA 1V7ZA 2PUBA 1YCHA 1ZESA 2Q3JA 3OFSA 4J2OA 5ALLA 2AEMA 3J7AC 2CB0A 2CXSA 1ZONA 4WKCA 3TLCA 5JWRA 5K4HA 1I2BA 2CMFA 1KVQA 1L8AA 5BORA 3EFHA 3K72B 1TCCA 3MRVA 3RRMA 4BRWA 1W7AA 3PB3A 3ZJTA 3NH6A 1JDPA 5BQOA 1OLSA 1A95A 3IVXA 3PYMA 1KO1A 1N3YA 4TL6A 3UJBA 5EWLB 4KWEA 4JQSA 2D62A 1Z74A 1P17A 2ODTX 1YH3A 3EPRA 3KWJA 4B3HA 1F0KA 3RTDA 1RQGA 3CF4A 4QWWA 4D74A 3H86A 3BCHA 2XE7A 4LCBA 3L79A 4X7RA 4LSGA 4C0JA 1L5HA 3RNOA 1XQ1A 3CF6R 4PVCA 4UARA 1QCDA 2VCHA 5TJHA 3EXHA 2Y9MB 1DT3A 1NKTA 2NZ8A 2XOXA 3CNOA 1ZRHA 4GZLA 5ERGB 4JJAA 2UVPB 3ELYA 4BNDB 2HZBA 3HCRA 1E4OA 1I4TD 3IE1A 1YAHA 1E2JA 4INAA 2FDRA 1N1DA 3F6CA 4HQFA 2BGIA 2YXNA 1AGYA 5DE3A 3FFAA 4H7FA 1SU7A 2OXCA 4JBWA 1BW9B 1K8ZB 3IALA 3N8IA 3K6SB 4ZAVA 3BGWA 4M1ZA 4BFSA 3VKHA 1M72A 3SXPA 1G21E 4L57A 1WIWA 4OXIA 1RWPA 4PIPA 1Z4IA 2PZGA 5FTWA 3QVGA 2GI4A 4YLEA 1A9YA 2X1HA 1YKFA 3HNPA 3T9CA 4F72A 3QKUA 4Y2HA 5EKUA 1KJQA 1TJ4A 2EGUA 3IIKA 1TVCA 1OWLA 3NJRA 3N70A 5EGNA 5IKOA 5C8YB 5JZ9A 1U8XX 1GFSA 1ZH8A 1WBJB 4QGFA 4JASB 1X7HA 4ZJPA 2JFGA 4K6KA 3Q7TA 4HZIA 3E9ZA 4HY3A 1O96A 3UWSA 4KXFB 2B9VA 2CLDX 3C4JA 5DYIA 3SNHA 1YASA 2FRDA 3AP3A 3B38A 2LBPA 2I03A 3K8YA 3NQ41 2A9RA 2OY0A 4GVPA 4NBVA 4WK4B 5CURA 5L6MB 3B5JA 1G38A 1GPUA 3RSSA 1VLJA 3D0RA 2K87A 5EWJA 1OV4A 1EZZA 1A2QA 3IHTA 3BGSA 3JSXA 4YTEA 5LFAA 3NR2A 4TSFD 1AUVA 1NG1A 4NU0A 3TW4A 1FNDA 3LKBA 3C1UA 3O8OA 1XVAA 3IT0A 4GQIA 5FPHA 4DDMA 1NKVA 721PA 5HK9A 1P0IA 4MA4A 4KJXA 2W11A 2J41A 2J7PA 2R86A 3CRVA 2JFFA 3MWJA 5F2KA 5M04A 2PZEA 4EQ6B 4Z9YA 4RPGA 1O95A 2IYPA 5HILA 3IDFA 5AYVA 3ZHSA 1GOTA 3ZGLA 5EE9A 1C8BA 3G8DA 3V6LA 3WIVA 1XQYA 1F6BA 1P5JA 1P2VA 1F8YA 3KO8A 1DDOA 3S2EA 3SQOA 1XZDA 3STUA 3T1OA 1Y8RA 1K06A 4AL4A 2AC2A 4XDZA 1CZKA 3VPSA 4BVJA 1RC8A 4I1RA 3V6MA 4OQ4A 1E9BA 1GD1O 2I7VA 3ONVA 1LDNA 3RS7A 4JQCA 4HUQA 1KEVA 1CE8B 1RKXA 3DL0A 1QVWA 3HEBA 3K4QA 4PAOA 5DYNA 5LXTF 3KT0A 4EMBA 3OE4A 4GBGA 3LY7A 4JB0A 4YFYA 3WLJA 1PNQA 2QAGB 3B82A 3ZE2B 2RG7A 5JW6A 1LSOA 1BFDA 2ECPA 4ZTZB 5CDHA 4RYLA 3A6GA 1SNYA 2G71A 2R85A 4DIMA 4B2YA 2I2FA 1J2UA 2PCLA 4GOJA 3M4JA 4P92A 4WZBE 3ZGXA 4BNJA 5TMBA 1XEFA 3SM9A 3UTCA 1BJRE 1R66A 5IKEA 3SIRA 2E37A 1CVLA 1O4WA 3K70C 1BMDA 2VDLB 2AE2A 4NMXB 5IH7A 1TQ8A 2XA1A 4BLUA 4DREA 2A9JA 1S2MA 2Z8XA 1DBSA 1OH5A 3OJCA 3BX1A 1Z88A 1KYQA 1YJXA 2NVOA 3M8KA 4Q1VA 4UVHA 4JI1B 3IKLA 1K9VF 1U0GA 3JQDA 3TAHA 1GKUB 3ASYA 4TWIA 4E4YA 4EZIA 1UOQA 3HEMA 4KWCA 4YRAA 5JYBA 3VQTA 3CZ4A 4DV3B 1YDFA 3DMGA 3N2NA 1U3FA 2MDTA 1UF9A 3B53X 1JIJA 3AOEA 3FNQA 2AUNA 4QTZA 5K05A 4Q9LA 5EXEA 2JGAA 1Y9ZA 1Z45A 2OGZA 3DVRX 1JFFB 4G24A 1UJCA 3ZWVA 2HQSA 1TD1A 5FD8A 3NYIA 3WL6A 3CQ9A 3KL2A 4MEBA 4P9NA 3IQEA 4ZOCA 4JCOA 4ZT6A 1AS3A 3C1TA 1X86B 3FTQA 2X0DA 3UK1A 2Q1SA 3VZPA 1XR3A 2P6PA 2P1DA 5CJPA 4LJ9A 3O0TA 1CFJA 2Y68A 2XKAA 1ZJZA 4JMLA 1D6SA 3EX7C 2BDEA 2FR8C 2ZT6A 1BCRA 2B1QA 4EPVA 5BWNA 1V9LA 2I22A 4WQMA 2BF4A 2A6PA 5FNVA 3DOJA 2PGXA 2HC9A 5DGTA 3ABIA 2ZPUA 1WCWA 2X8JA 1THZA 2LGJA 2VHCA 3AKDA 3D8RA 3R5JA 4PTZA 5CPFA 5DK6A 4ZCSA 4UAUA 2EHDA 3ROGA 2BTQA 3WIEA 1PDWA 3NM6B 3HQ4O 4ZZ3A 3WIOA 5CBPA 1MB3A 3OLYA 1SCBA 4WBNF 1UCFA 3I64A 2QU7A 3A1TA 1WDTA 1J2JA 2OBBA 1QKIA 1U8EA 2FQQA 2HGZA 3ON5A 1LBIA 2O8FA 4FHCA 1CUBA 3IPRA 4AQYB 2B0CA 3GUVA 2ZRFA 3I5XA 3KAKA 2R5NA 1HT3A 2QTMA 4Z9AA 2B99A 4ZI3A 2B4AA 5DSTA 3VZCA 1CUJA 4QU0A 4JLKA 3UMYA 2ZSEA 5AVKA 4D4GA 2AR7A 4RWEA 4XJVA 1J24A 1JKIA 1G42A 2HMVA 3DYIA 3EVFA 3JPWA 3V3TA 2ZB8A 2I4IA 2JHCA 4KLAA 2GARA 3S8EA 1KPHA 3Q0TA 1FDRA 2EERA 4FC6A 4HX5A 1ACMA 4ZEWA 3QFSA 5HCIA 1KEWA 1SBIA 2ZWPA 1R88A 2VP5A 3E1GA 3FYUC 3MG9A 5DHPA 4EKEA 2HHLA 3IR7A 1L5RA 2NSDA 3T5BA 1VMIA 1TLLA 2IH5A 4ZFNA 3QVXA 4JFAA 1V3QE 1UH5A 3UMRA 1VG0B 5K1ZA 3WICA 1PL8A 4R1OA 2YJGA 1YFKA 2VK1A 1G9SA 5FORA 2ROQA 3LWDA 5KYUA 4I19A 1P2TA 2CBGA 5JI3E 4OKSA 4BQNA 3P2MA 1NN3A 4KXXA 5LDHA 2V55B 3HMQA 1Z7EA 4YP9A 5YASA 2IFTA 1AD2A 1C0KA 2G0AA 3KK0A 5T67A 5MFPA 2V6BA 3FLEA 1GKKA 1UQRA 2OBFA 3FI0A 4FI3C 5J63A 3SVLA 3UBTA 4KIUA 4F3TA 5JSYA 5FHQA 4A1OA 3ZIAD 4C2BA 1EZ1A 3L0PA 5E9JA 5DT2A 3H8VA 4LA4A 5KREA 1YS1X 2FW6A 4UTRA 1LS6A 5HQTA 2GK7A 1M6EX 3CYFA 4Z49A 1PWEA 4ID3A 4F86A 2FE4A 3DMTA 3KKKA 5B4UA 4S0ZA 4C0AC 3ZK8A 1WWKA 3R6LA 1BXGA 2OB2A 2IY8A 5CBKA 3BE6A 3U4MA 5JVDF 3RH0A 3ENKA 2BMWA 3JYHA 1Z0FA 3KKMA 4MGIR 2AW5A 3OZDA 4L07A 4YCDA 3ZVRA 2K2WA 1JEDA 3X43A 2XTJA 4G0PA 1JU3A 3PV0A 1JHRA 4DE5A 3UAYA 4O2BB 3P0RA 1SM4A 2QJFA 4DV4B 3ITEA 4KO4S 1EJ2A 1NOJA 2ZJ4A 3G79A 2V4UA 1RI2A 4TV9A 1HURA 4ZVMA 2GNOA 4O63O 4G23A 4IICA 3FUTA 4DKXA 3LOUA 5BUQA 1V3TA 3PDUA 5D86A 1KI4A 2A88A 4MVYA 1M2FA 4PIVA 5DBHX 2PT6A 2B25A 3M6FA 4DG8A 2GHRA 2WKWA 3TQHA 3AJAA 5HPYB 2JIMA 3IQWA 4CTNA 2AMJA 3ZY6A 3HFJA 4REQB 4U3JB 1E20A 1VBFA 5ALEA 1PLKA 4RTKA 3AIMA 3I2GA 3CWZA 3OU7A 3ZYZA 2FVYA 1V5EA 2ZU6A 4C4TA 4ZEMA 4NPCA 2ZOSA 4RNDB 2QM8A 3EFOA 2ZJZA 2SKCA 1UBMS 2PL3A 1L7NA 3C48A 3O8DA 1QR2A 2AJDA 1Q5PA 4G4IA 5AO9A 8LDHA 5ICMA 2ZZMA 3V1YA 4PAGA 1WB9A 4GPZA 1LBHA 3SZOA 5U1PA 1UFQA 3TD2A 4E5KA 2YX1A 4DLUA 1E1KA 3SNKA 2I3AA 1IN4A 2YZ7A 4ALJA 3UO8B 4TXMA 4DY6A 5LZ7A 1SUSA 2YWDA 3OF3A 2IPAB 4U6SA 3Q7EA 3H2ZA 2OG2A 1NVTA 5BNIA 4HWPA 2IU0A 2HV9A 3FGOA 2BI8A 5EAIA 2ZSKA 1FTWA 1C3EA 5DBGA 2XIJA 5KHOC 4MV6A 2UZ3A 3DFMA 2R4QA 5FA8A 3HN6A 1YA8A 1NDQA 1CR0A 4Y6GB 4FKZA 5G1OA 5G41A 4POAA 5I7AA 1EXMA 2QJRA 3MGCA 4BZZA 5IU6A 1AO3A 1I1NA 2J5BA 4I4LA 2DHDA 1KEUA 1SRQA 2JRCA 4DV6B 2GB4A 4ENVA 3GRYA 5EZQA 4TL8A 4BVHA 3P4UA 5IYZA 5DGHA 4ZVSA 4MB0A 4P3PA 1QBGA 1KBZA 3CVWA 3M3HA 2X5KO 3QVVA 4RKRA 3VR0A 4UREA 4V02A 2ACWA 2DFTA 4Z4HA 3WKAA 4XM0A 1G8YA 2PH1A 4OHZA 2D2EA 3BA6A 3DOUA 5IMSA 1HMPA 4DBLC 3MTDA 3SXJA 4C7OB 4Y6OA 1PD0A 1PTKA 2DQKA 2EARA 2Y0BA 4AYTA 1S7GA 2AYXA 2H7VA 1QHGA 3M70A 3VKGA 2JFZA 2QMUA 3NG1A 3W8NA 3OUUA 3F6YA 2VDJA 4IF4A 2P41A 1KJWA 4N0QA 1O5IA 1NATA 2I4MA 3R3VA 1H1TA 3O4RA 3RARA 2QLJA 5LM3A 2JCSA 3OO0A 1Q91A 3CTMA 4HDQB 1G66A 3U0BA 3DVAB 4RWZA 4E31A 1DELA 1CE8A 1QVZA 4CI0B 4NE2A 5F12A 4DLBA 1XEWX 1YFLA 1WU8A 3KVRA 1XZAA 2DKFA 1X9IA 1JTVA 1KI6A 3EZ2A 4M6WB 1O96B 2MMGA 5E9QA 1OX5A 1MJGA 2W70A 1JXQA 2IYSA 3WGJA 4E5VA 3ZVNA 3K0CA 4QG3A 1F38A 1WMEA 3THRA 4P4SB 3D9QX 2LTAA 4KLZA 3EQ8A 4PQEA 4UBIA 3VTZA 4M0MA 4AJHA 4MUAA 5LMNB 1SELA 1E1QA 4NG4A 4KEAA 4UE6A 1VMEA 4EPXA 4ZMSA 1K08A 1J00A 1OFIA 3FYCA 3HH8A 4RK4A 2XBUA 3WJ1A 4KDFA 3GU3A 4G4SP 3B20A 4GOND 2Q5LA 4P4GA 4M9RA 4Y8VA 4UFOA 1GAXA 1FSSA 2AD1A 3IHLA 4XQEA 4V3BA 3SJAA 4D0GA 5KTPA 3PYXA 3S6JA 1SVSA 1LRLA 1VE5A 2FRDC 3JZIA 3KPJA 4DJJA 2COKA 4EAAA 3VR6A 1E2MA 3NBZC 3EA0A 3JARB 1NF3A 1LH0A 1TIPA 1U7XA 4QRHA 5CPBA 2H1CA 3CIFA 1PUJA 2Q3BA 3KQTA 2NTJA 1XU9A 1UK6A 2WHPA 3I53A 4HGPA 1SHJA 4Q7LA 4XEUA 3A4MA 3FW1A 3BRQA 1T2UA 2XITA 3WAKA 1QVVA 2GD0A 2Q28A 2X6QA 1E7QA 2VJOA 4QDXA 5U9CA 3GLVA 5I7FA 3P2JA 3O9MA 3O7MA 4Y2UA 3KR9A 3FSGA 3EHDA 3JYLA 5THXA 1PX2A 3REGA 4D97A 4A7PA 1T0BA 4UM9D 1OHHD 4ZI5A 4CLRA 3HGTA 3C7DB 2XVAA 3S28A 1JG4A 4WGGA 3W5SA 6ABPA 1M6YA 1AZTA 2DX7A 4OV6B 5H3LA 4D80A 3ESAA 1DGQA 4BZPA 4D9CA 3K32A 3FB4A 3LC0A 3OIFA 4IFIA 2W37A 4ZQHA 3F5DA 1BX0A 3S1SA 5A9SA 2Y3IA 1GUBA 4XIJA 2WJAA 4AJEA 2G1PA 1LY1A 4JOQA 2Z09A 3P9RA 2BV3A 3WJ7A 4B6RA 1SIBE 3AF0A 4F9EA 4CV3A 2ZRDA 1CFZA 2FOIA 2IPOA 3CUWA 2NPOA 3GMTA 3BRCA 3GI1A 4L6IA 1T8TA 5JBNA 5EMMA 4QO8A 1ZGAA 5BOVA 3K0AB 1Z28A 5CM8B 4MQEB 1IBRA 2TYSB 4ZVNA 1FYFA 1W96A 5ECGC 2DWUA 1U7WA 2A3NA 1K27A 1OC4A 2H6EA 3LVFO 5EJ2A 3G0HA 1Z6XA 2A67A 2O7QA 5IT9A 2UZ4A 3B51X 5K8VA 4IIDA 4IPTA 2FJ0A 2BBSA 3QEOA 3T0GA 5AUQA 3WKDA 1I7SB 4UBNA 2R0QC 5FI3A 1N6RA 2Q3DA 4YRFA 5HIIA 4ZYVA 3DFZA 5LLTA 5H1YA 4RTRA 2CNLA 3FOBA 3AM5A 3RBAA 4B85A 4JYMA 3HDHA 4WLVA 2ZRHA 4HJRA 4IJUA 4DUPA 4G5RA 4EG3A 3OURA 3NKFA 4IYJA 2WQ7A 4XYGA 3EXFB 1P1JA 1WVMA 1KEZA 2YUIA 1PP4A 4R2KA 4W1RA 2AQHA 2OHGA 4K9KA 2QYSA 1GTG1 1ZN7A 1FDUA 4FOLA 3C3WA 5JWOA 3LV8A 4RORA 2P2DA 3DOHA 1OHHA 2XUDA 3OQ6A 4L9AA 4DIFA 1MDBA 2JC3A 1LBTA 2NQTA 2ZYTX 2OBYA 1Z0ZA 1P1BA 1M1ZA 3WL7A 4N8EA 1LWNA 1JYSA 1DUIA 1WMDA 3OJEA 4HDKA 1XZKA 3R9XB 1QP8A 4NPHA 2AS0A 3HVIA 2IE8A 5MHTA 1O8CA 3OA2A 4QAJA 3RHFA 4H35A 2C0QA 2YW9A 4F7WA 4AT1A 4LXGA 1JAZA 3TXXA 4OM7A 1E9FA 4RJJA 4C5AA 1UJ4A 4L2IA 3OLCX 4H27A 3S0JA 3PJRA 1BKYA 3DDOA 3K7EA 4LY0A 3MT7A 1VHTA 2JLBA 3HR7A 2BEKA 3T7SA 3UMCA 2GETA 1RCTE 5CCXA 1BWRA 4R6XA 5JEDA 1Y8CA 2Q8NA 4OBWA 4G0YA 5EXPA 5ALVA 5BXQC 3T1HB 1ZVKA 3DULA 2EATA 3KKEA 4MJ7A 3NTQA 2RARA 3QV1A 3PE4A 2AEEA 1CLEA 1SWVA 3U4CA 1ZA1A 4BVEA 1RRMA 4F4JA 1T9GR 1K6XA 2J48A 1NMXA 1Z4PX 4FNGA 4KVZA 4JI4B 1ZLYA 1TE2A 1ZGGA 3H1BA 2LCIA 2LCFA 3K96A 3AFIA 1JJAA 2AWNA 2BHTA 1UANA 3OQBA 1XQXA 3E1SA 3VKVA 2EGGA 1PI3A 5CVDA 4URZR 1JS1X 2O7SA 5HCNA 5LQJA 3QKSA 2NZ2A 5CM9C 2GN6A 1VGRA 4I4NA 4J0QA 1A4RA 1K5GA 2FF7A 3BMXA 2WDPA 3CHYA 4R2MA 5F2OA 3I4FA 1O4VA 2WVJA 4D9JA 3GIWA 4ER3A 5CCBA 3AUSA 5TMPA 3KYIB 3K5PA 5CEJA 2QTZA 1APBA 3BJIC 2ZVDA 4DSAA 3HP1A 3ZHRA 2WUGA 2TMGA 2YOHA 4ZZ2A 1R2QA 2PJUA 5C8VA 3R41A 4OGGA 4PZUA 2HQRA 1GUAA 4NV3A 3SKXA 1PR2A 3WR5A 4LDJA 4YH1A 1QX4A 3GVCA 3JY6A 3FOEC 1KH1A 5GONF 4B5LA 2HADA 3BXHA 2WU4A 3N39C 1VPLA 2ZIAA 1JTFA 2WM9B 3T34A 4MWOA 3O26A 3VOSA 4RLHA 2ZS7A 1UBHS 1UR5A 1PT5A 2MTBA 1U0NA 4KDRA 3SKYA 1E9SA 1JQ5A 2RKWA 2EFHB 3DT9A 4BQRA 3BB3A 4NC9A 1NFRA 3C8DA 3NGXA 1QMPA 2FMXA 2RK6A 4HDNB 4NDZA 2E5WA 3LX5A 1VGQA 4FGJA 2GBLC 1L5YA 4XLZA 4O8CA 1EUDA 2HOQA 1EGMB 1T10A 3INTA 2E55A 4IYRA 1X0VA 3KUKA 4EBBA 1L7PA 3LBYA 5CK5A 1HZZA 1X8XA 1Z75A 4TVKA 1TRKA 3WMFA 4KN5A 2KI5A 3K1JA 3UM9A 3P2OA 2N9UA 1EFVA 1SUCA 2VP4A 3QLUA 4J7UA 4NRDA 1VRCA 5ESRA 1Y34E 4B3DA 3WYDA 2XVXA 1E5VA 1PCXA 1ZNXA 1HDRA 4FS3A 2WU1A 2YFYA 4NU6A 3AP2A 1WLSA 3SF0A 4N54A 1Q0HA 4LSZA 1L8LA 3CE9A 4JB8A 4OXNA 4CBVA 1RJWA 1Y5IA 2XA2A 1RTKA 3RG2A 5AW1A 4GKJB 1M83A 1R9JA 1Q44A 2YN2A 4RGQA 1L1FA 2NP6A 2D5CA 2BCJQ 4LZWA 1NT2A 3RI3A 2UYCA 3JD2A 5J3JA 1Y6GA 3MRXA 1TYZA 2VNHA 5GGXA 4OSOA 5LOVF 2YZKA 5CU7A 1RLOA 2OLJA 1GJRA 2BH9A 3I37X 1U4OA 3UHJA 2DR2A 1TX4B 4KI0A 4Z7JA 1ZD1A 3X1MA 2XVMA 2AYZA 2FU5C 3G7NA 5EYPB 5GZ1A 2LZ0A 5THQA 3W5CA 3L77A 1T0JB 4U9IS 4LNUA 5ADUS 2Z04A 1TQ4A 1MH9A 3W2FA 3ZVMA 1E89A 1GZ6A 1ZA2A 1F6DA 2A94A 3CO0S 4U2EA 2G6BA 4DRXA 3DR3A 1GKIA 3GVIA 4IY1A 1SXHA 1P9WA 1OX4A 1KVSA 3HL4A 4F6RB 3GFBA 4UEJA 1KY5A 3PNQA 1TU0A 3ED5A 2OZLA 4RC9A 3EEQA 4DM7A 1GA1A 1VDMA 3BERA 3IOEA 3AQIA 1EQUA 1T8SA 1J0EA 3DBIA 4H7PA 1T5BA 1W25A 3QWHA 4K6MA 3TW6A 3FAZA 3L5OA 1EEXB 1MB9A 5FFNA 2O2ZA 3F6RA 2GF9A 4O2BF 1E9AA 5BVHB 4YRPA 3V1MA 3EDMA 1DV2A 1XTIA 3W78A 5KI6A 1U31A 3TSWA 2GN4A 1NR5A 3MJHA 4Z3OA 3MWEB 1XJ0A 2Z2ZA 5CYFA 4YO8A 1NHWA 3T9AA 2CVOA 4FZVA 3TR6A 4C7OA 4N76A 4UJ5A 3OP1A 2BY4A 2H48A 2BEUB 3IESA 1WSBA 2CFTA 3O75A 4V0QA 3JZFA 5B3LA 1Z5OA 1G20E 2ORIA 3GRRA 4RFSA 3GG2A 3NRBA 4UVGA 3AI7A 3HP4A 2DUMA 4R3UC 1T6ZA 2GLTA 2J67A 2QW0X 3G8CA 4AG3A 4INOA 3HADA 1M3SA 3E53A 4RE6A 1BGXT 1JHAA 1TGYA 1ZN8A 1ADFA 3M6WA 3GL9A 1FMTA 1D03A 5BNTA 4LF6B 1UBSB 2A0KA 3C7TA 3DQZA 2C4MA 3PPVA 4V03A 4M7OA 2R68A 4WNAB 5ARCA 5ARBA 2WOOA 1MQ9A 4CLHA 4P08A 3D1JA 1ZNQO 3E7PA 1KXZA 2R25B 4MIKA 4NVRA 2B2XA 1N0IA 2H1VA 2NWQA 3T5CA 1OKKD 4BDTA 4CMHA 5K0ZA 1RP7A 1NVBA 4AX8A 3ZE1B 3OWHA 5JSHA 1GGHA 2Y27A 1NBAA 2JGKA 4BV8A 3H2JA 1O89A 3M5DA 3OQMA 1KDPA 5KYGA 1FUKA 2O2GA 3HZRA 4PZYA 2ZJ8A 3EOBI 2RAFA 4R01A 1KGDA 2QZZA 4G2NA 3ZIDA 4YRCA 4BDSA 4IJMA 3A11A 1TT5B 5G4KA 3IQIX 3RRFA 1PJTA 4ZCLA 3JZMA 1WCXA 1ZICA 2H2FA 2W2VA 3K0AA 4BJ6A 1NNSA 4ALLA 1V16A 1KZ4A 5AKHA 5LQAA 2W2LA 3M5WA 3WQQA 3CVVA 2B1RA 2IYNA 2WD8A 1GSAA 1Z6QA 5K51A 4RKEA 2PLWA 5CAEB 2QPTA 1MNQA 5SY4A 2BFBA 3GQVA 3OECA 4FGWA 5DO9A 4BPRA 1Z39A 3ACCA 3KPYA 4P5PA 3Q87B 4E3WA 1NVKA 1TA0A 5JOQA 1AKEA 2BD0A 5IAKA 1B8PA 1DX4A 1Y7HA 5ILQA 1IE3A 3TQOA 2NQ2C 1PR5A 3U49A 5AWFC 4UNPA 4OLJA 1B0ZA 2PZKA 3C5CA 4Q9JA 2AK3A 1BX1A 2ZJ7A 4Y2YA 3EFEA 1PWYE 1L5ZA 2ZIGA 3EVZA 4QO7A 5JY1A 1PS9A 2VDMB 2IEGA 5I4BA 2XGJA 1OWNA 4AY4A 1SKUA 3FCSB 3QF7A 2KLBA 4L22A 1LPMA 4X66B 5H7XA 4CM3A 3BH6A 4BNUA 1QCYA 4LHSA 3ZZTA 2OUKA 4FHEA 2GVZC 2J9FA 2X5NA 4GLLA 4R69A 4TWAA 1Y5MA 3G2JA 4TV8B 5E4YA 1UBOS 1UT8A 3JATB 3UQYS 3MS4A 4PRKA 1PGNA 3MS2A 5AFSA 3RFCA 1WL8A 5IJAA 3PFGA 5L4NA 1QPZA 1W4ZA 3GMIA 2O05A 3B78A 3LHKA 4HNSA 4FONA 2AG6A 5AJUA 1JXAA 1JDUA 4IW3B 4B6OA 3GUUA 3QPCA 3ODGA 1JPVA 3GYGA 1P4RA 1A9QA 1PEAA 2JLYA 3LUGA 3R75A 3QE9Y 1E1YA 1VE9A 1L5LA 4LY9A 1CR6A 4P58A 5KOJA 2Q07A 5B30A 1E1DA 1FFSA 2B98A 1I6WA 3H5WA 4NATA 2J6IA 3OJLA 1HQKA 5FWYA 5HFJA 2ILTA 1E3QA 3RDPA 3WSTA 2GEVA 2JASA 1N2GA 3LQYA 4JBNA 4JP2A 2CDNA 1SKBA 1Z6GA 4MUFA 5EJGA 5P8WA 2DPHA 2NT3A 4I8IA 2VSFA 3VTKA 4BE7B 2WHQA 2CK3A 1UKBA 2GS9A 5BV8A 2ZIFA 4JAVC 1WV0A 2C5GA 3WTCA 4BJHB 2A5FA 3U1BA 5TQ0A 3BL5A 4N3AA 4AKHA 4C4PA 3G5MA 3FD8A 1NFQA 4LTMA 2D7JA 1MZVA 3O84A 3CG4A 2QQGA 2X3FA 3GBVA 4X20A 3TZCA 4F92B 1ZEMA 1JKXA 2C5FA 5JNRA 5KVVA 2CDRA 4PGHA 3QNWA 4RD6A 4BZXA 5CD1A 3MMPA 1FFEA 4EZEA 4HRAA 5AXBA 1K8RA 1NW6A 2I2DA 3AEQA 3E3OA 5G0UA 1N5DA 2NPIA 4W5JA 4DCJA 1L4YA 1T6BY 3KJXA 4NULA 1C7FA 3R5XA 4W5OA 1DNPA 2UZAA 3TTWA 4DTIA 2XSZA 5CMLA 3LAWA 3ICVA 1GRNA 4RVCA 4H7HA 2YJTD 5E2AA 4A03A 2CLEB 1LFDB 3K2IA 3D2BA 3LYHA 2Q7XA 4GEKA 4WXEA 4G0NA 4TSFA 3U3KA 4AI6A 2D5AA 2IIBA 8ADHA 3ER9A 3PLNA 3IMCA 3QEMB 4FK8A 1G6Q1 3D54D 1KFEB 2QX9A 1D8TA 4D81A 4QPJC 3DCYA 1GV0A 1Z62A 4JR0A 3GR6A 3DMDA 1UPCA 2OPBA 4W9NC 2IU4A 3AOEC 3D5TA 3WYNA 5F7XA 5FYQA 1BXRB 2OHVA 1SFRA 5I9BA 1SG0A 1K6MA 4L73A 5E3HA 5IM4A 1YQTA 4O6VA 2JEZA 4AMVA 1AQJA 1RWQA 2CNWD 3QWAA 4HLCA 4RBNA 2AE1A 3OEWA 3KVVA 4ZK2A 4IO0A 1E6MA 4O2AF 5KHAA 2PKYX 3FLMA 1TO1E 2FEWB 3ICOA 1OLXB 1NVUQ 3V8RA 4C4OA 2ID9A 1YBFA 2QE6A 5IBRA 1DEOA 4OXQA 4OYHA 2FUG6 3PGVA 4AM8A 4AMUA 3AUYA 4LC0A 3ZXIA 4DXAA 1OGYA 1TUIA 1WZNA 4ILKA 3IP1A 4F06A 5HX7A 2RGRA 2J6CA 1GTRA 1EHCA 3WL4A 2HQ1A 3K1TA 4ASUA 1XZNA 5SY9A 3IR5A 5J1TB 5CA0B 4F85A 3D6JA 5EUBA 2JIRA 4ZYZA 2C5HA 5HKKD 5DKFA 3KIPA 5FP0A 4U2DA 1IBKB 4FJ1A 4RD2A 1CDEA 4JI0B 1EKXA 4JNKA 3K05A 1HFWA 1Q95A 1NRXA 2VRWA 3AMVA 4BNXA 2TS1A 3VJKA 4ZCTA 5H3HA 2DH5A 4EHAA 3QE2A 4X97A 1XDBA 3OPNA 1KZHA 4XUCA 3E3AA 3EZGA 3OZAA 4AJPA 2C1EA 5CCEA 1Z35A 1L5OA 1ONNA 2Q0HA 2DUNA 3HHPA 4IDCA 4NHOA 3ZZMA 4E88A 1J5XA 2BFOA 2GXUA 2ZI3A 4L4YA 4YPOA 1YK0A 1FNSA 1RTTA 1FL9A 3DEAA 2O0KA 3EXG1 4YDSA 5FNVF 4NNPA 4RMGA 1J8QA 1L8QA 2FSVA 5DMXA 5A3SA 2NN3C 4W82A 2RHHA 2WG1A 4FFPA 4WAUA 4AMBA 4XD2A 3RUPA 5B7GA 1RFLA 3P0JA 5FXMA 4M9ZA 3T94A 5AUPB 5IVHA 4QVKA 2XJ4A 4YC7A 1C8KA 2NXJA 4Z2YA 1HF3A 4HTFB 4G4SO 3STXA 3BHJA 4OQYA 4ZI7B 5KYXA 3OLXA 1PNTA 3EIUA 2AEJA 2VG8A 1Q0RA 3CO5A 3HA3A 3O3NB 4M1EA 3QWFA 2CNDA 5DHTA 5H9VA 2B1IA 1XU4A 5HUHA 4FKMA 3CUSA 4RVHA 2D0OB 1J1IA 4IV0A 4Z0PA 1CC1S 4TXNA 4BWGA 3B5EA 1H85A 3ECCA 2QZSA 3HB0A 3H1GA 4B7XA 1A77A 1A72A 2UZ0A 2IW1A 3LPAA 5MN6A 4IL5A 5DCUA 2D3TA 1KJYA 2QRNA 1T1IA 3DOIA 2Y6UA 3JWEA 4RHFA 4DJEC 5KWJA 4OXYA 1SQFA 4C43A 3KBBA 4H59A 2FKAA 5FTNA 3H5LA 4KYVA 3R7WB 3Q8LA 4UOEA 5ERYA 1AZWA 1MQAA 4QNRA 1DC3A 2A3RA 2JIZA 4OQFA 5J40A 3GUYA 3TDNA 4ZKDA 1L1QA 4GF5A 4AX4A 3EH2A 4YP6A 4YRNA 3DDNA 4GP9A 1FPMA 3WLHA 1V43A 3BCRA 3HA2A 1CY7A 3I5AA 3B1YA 3AB7A 5HS4A 1B1AA 4K9NA 4QTXA 3MJSA 3V7NA 2PEZA 1MB0A 4ER7A 1JR3A 2JFHA 2FK8A 2C31A 2GF0A 3MTBA 2XMDA 2VF4X 3E5MA 1H1LA 1C7EA 1UPFA 4WL0A 1TFUA 3ITNA 5SZJA 2BKAA 2XGMA 3R20A 3MSCA 3VZBA 1KIAA 5F7ZA 1V26A 3RS9A 4FFDA 4HN9A 5GTDA 1GO2A 3DHEA 3HR8A 4NE7A 1O08A 4P35A 3ANMA 5LSAA 5I48A 4Q4JA 1EX7A 2AZXA 3Q41A 1GILA 4WCFC 2XW6A 3FA2A 1A7JA 1NL3A 1MC5A 2F8SA 2OA0A 2V5VA 5DM2A 4EGFA 5E8RA 3OJFA 1BAPA 4J8PA 1K89A 5FOXA 3ZXXA 1PE0A 1JFTA 3TZ6A 3A6KA 4K87A 4Q18A 5LMUB 1CNMA 3LZDA 3V42A 3RADC 1ZAKA 1E4EB 1QGED 4DLPA 5KYYB 2Q5FA 3D3KA 3J81k 2ID4A 1AE1A 4QLBA 4N40A 2GLUA 2FWJA 5G0TA 2ONYA 2QTFA 1OZHA 3WRVA 4P81A 4L9WA 5DGCA 1J0DA 3GRPA 4MCHA 5J5AA 3UW1A 1LD3A 1DT5A 1AY0A 1UWVA 2VUUA 1V5FA 3E22B 1MJGM 1SU8A 2M6SA 3DLIA 1U1EA 4KWHA 2PS0A 2RB4A 5ADWA 4BBJA 2AYYA 4W5TA 1RAGA 2CWDA 3A1WA 1JG1A 2ID8A 3TLXA 3WMEA 3WY9A 3ZE0B 4B83A 1GGEA 5KMGA 3OQOA 3Q3EA 2XDAA 2VKTA 5IFKA 2GXQA 1M7HA 3HSYA 2JEYA 4QDOA 4BGIA 4CR6A 3D7MA 2AHOA 2BFFB 2UYGA 3B13B 2RC6A 4ZVUA 3UAOA 4CTKA 3DPUA 2FWPA 1OAOA 1AMNA 2X8LA 2XXAA 4GM0A 3EXHB 4DC0A 3KSZO 3FDZA 1KHTA 2B30A 1DTEA 3E7DA 1T5DX 3KSUA 2WY2D 2CVQA 3RKUA 2ZXEA 4EUHA 2AC4A 2FZLA 3SDSA 3KV3O 4W5NA 3UCXA 1Q1QA 5KTYA 2AF4C 2EKDA 2ESRA 3NVMB 1G5QA 1R6DA 3MXOA 3V9AA 2N75A 1L8XA 1RCUA 4GQAA 3VHLB 4MW5A 3WWPA 1DOAA 1MAVA 2ZE8A 3A2NA 1R50A 2PX8A 1Z17A 2P9BA 4S1VA 2WP0A 1BQ4A 1Y7TA 3FNHA 3MJEA 4L85A 3KR1A 3GP5A 3I6QA 4LK3A 2VJKA 5CA1F 1D09A 4O2BA 1N6OA 4HH4A 4M9QA 3C3CA 5H82A 1I6LA 4V3CA 5I51A 4MV0A 4XQ9A 1K98A 1RSZA 1FVFA 3WBBA 2IXAA 1H8ED 3GCGA 1DAPA 1GQSA 4IF6A 4KV9A 3EEBA 3U4IA 3HZHA 5EMJA 4DABA 3RIYA 3NKLA 1DFHA 1GFWA 2LRHA 3FRIA 3H11A 2H4WA 2HEGA 2WP8J 1YRYE 1TJNA 3G0CA 3U26A 3AWDA 2QD2A 2NZJA 2MR6A 4ZT7A 5IKXA 4L08A 2VBIA 3QPBA 3ELUA 5A2GA 3U5ZB 3BMQB 3E5NA 4MA0A 1B6GA 2J59A 1NU6A 2JLSA 1JIKA 4NSNA 3G0BA 4RMHA 3ML1A 2O5VA 3E1KA 2FDXA 4Y1RA 3QMPA 1MMFB 4OHKA 1E1CA 3CA8A 3M6IA 3K35A 4PO1A 1D4AA 2VAXA 2BKVA 3A9VA 2IEYA 3E82A 1D9XA 1BG6A 1XYGA 2WQZA 1H23A 1WB6A 3L04A 4MIOA 4RVOA 1Y8QA 2PCJA 4QBIA 3NTUA 1V0JA 2FLKA 4BE4A 4HHEA 4LG1A 4OJMX 1R6UA 2WJ6A 4FSHA 4WZZA 4DLYA 4YDHB 5BSWA 4XX0A 3OX2A 1RAEA 2FMKA 3TQCA 3BMNB 1W5SA 3MCUA 5G1NA 1VHJA 2R97A 5JE8A 4CM4A 2PN1A 3LSTA 5TT0A 4RFSB 4J0KA 1TUBA 4KYUA 1V96A 3Q7RA 2W2KB 3DE4X 4H08A 1NUQA 1G3IA 4MX8A 1LTQA 1WULS 3CY6A 5C80A 2VHXA 1VL8A 1H69A 2PIDA 4D8YA 5CXQA 4X6YA 2HNAA 4XSGA 4JR2A 5CT6A 3C98A 1X87A 1WXIA 1JMVA 1KYXA 2OAEA 4HLUC 2OM6A 2ZJ5A 4KLNA 3OFVA 3OZRA 3ZYCA 4BBAA 1EFCA 1XXHA 2EEPA 1J39A 2ZUEA 5LJIA 1DTWA 2G76A 2MYUA 2ORWA 2FMHA 2FFQA 2AC7A 2I4LA 1ISSA 3OCWA 3C16C 4N49A 1LSSA 1QRDA 1XA0A 2VUTA 1PT6A 1XEWY 2QZJA 1KJNA 1DIBA 1PEKE 5AJZA 2O59A 4MW2A 1FDOA 2P6UA 1ENZA 1RWBA 2DJIA 1IOVA 3FWHA 3EZ9A 4I7EA 2FZVA 4B71A 5CVCA 5IJZA 1RYDA 3ADPA 1YOBA 2Z8YA 3H2HA 2FZKA 2O9JA 3K5IA 1IWOA 4B2PA 4ZVQA 2CL7X 1XMPA 3F3KA 3GDGA 5BWMA 3VH1A 4RJLA 2B36A 1FVHA 3IQXA 4BMXA 2PUEA 5JO9A 3KSDO 1TZCA 1XG5A 4OQPA 4P2BA 5ISMA 3KQWA 4N8DA 3E0XA 5DWQA 1KAGA 4J4TA 2BUBA 4L95C 5IG2A 1YQWA 3CC8A 3I72A 3QOXA 1IN6A 1JIVA 2W93A 3OICA 4JJ7A 4MV7A 2VDPB 2VHZA 9ABPA 4NU8X 2KWIA 2DUUA 5I01A 4ANFA 4UMEA 2TECE 3DE6X 3U44A 1RXYA 1S4QA 3LHIA 3R6TA 1RAAA 4WMLA 3KPVA 4O4LB 5T4BA 3CW2A 4DS3A 4K9MA 2O6HA 3F2VA 3GLGE 3UMBA 3PC8C 4EB0A 1ZVMA 3FMPB 4G0OA 3NWPA 3EC2A 4C05A 1DRVA 1SBYA 3CSDA 4EGCB 2IZOA 1HK7A 3IPYA 4YY3B 4L3WA 4WLEA 4FIDA 3W8EA 3I09A 2CVPA 3LNTA 5IAEA 2HN9A 1WDMA 1VIMA 2JGNA 3JQEA 1V4BA 1DWQA 4MA5A 4UZFA 3SIWA 4EJFA 3O4JA 4QGHA 2OO5A 4H3VA 3TDKA 6Q21A 1MENA 3WLQA 2I78A 4HEHA 2XA9A 5FNVB 4J0GA 1M2HA 2RHDA 5HMLA 4YLYA 5B1HA 1G1MA 5DNWA 5JAMA 1ZNWA 5AR1A 3V1NA 1P29A 5DLEA 1U2QA 2QENA 4U4AA 1FCJA 1VL2A 2I2CA 1SB9A 5HJ5A 3GHYA 1YQGA 3PRJA 5FUWA 2O8EA 4NH0A 2IOFA 3NT2A 1KH3A 3QVMA 2VQ3A 3QWIA 3BXOA 4XZ3A 3UJAA 4EUKA 2H1WA 1TZMA 5H59A 4AQDA 1E7YA 3PSAA 5H68A 4FB4A 5LWHA 1ECCA 2JJYA 3JYQA 5EMLA 2H54A 4BOYA 3MB5A 4O4IF 2OCLA 3DW3X 2AI1A 1R15A 2JI7A 4B2LA 2OD7A 4M9UA 7AT1A 3B3FA 4MGEA 4RA9A 1TYEB 4I14A 1BXGB 3W77A 3L7YA 4C4YA 3MS7A 3OIVA 1BYUA 4D2IA 2QYHA 3AQ4A 3OKFA 4IZ6A 1PJ2A 3COZA 3IIIA 1ZL0A 5E95A 1P0PA 2PRSA 3AY6A 4C20A 3SOPA 4TKZA 5GM1A 1Y3IA 5I9IA 5EPUA 1A7UA 5ALZA 4C30A 3R3ZA 4IV5A 2GPBA 1W8DA 1M2OA 3WZMA 4PX3A 4ZAXA 1C0IA 4I0WB 1FOEB 2NSYA 3HO8A 3AOGA 1YQEA 3DHWC 3NHLA 4J1TC 2E4UA 4LJ5A 4W1SA 3OD1A 3G9UA 4RTQA 3CEJA 1RVDA 3T9EA 4K5QA 2Y4OA 4JLWA 1G5TA 2A5JA 3NHFA 4ZOAA 2BGRA 3DD5A 1GTL1 3ZVKA 2G07A 3SY8A 1W5AA 2I99A 2GPWA 4FSXA 4UPEA 4HWKA 1KAHA 2QIPA 4FYIA 3W4KA 3NXKA 4RL4A 2WV7A 3AEQB 3FVQA 4B82A 4E2FA 1GM5A 2MSWA 5SY6A 1L7XA 4OGLA 4PYQA 4XPIA 1FP1D 1QF9A 1XT6A 2GM3A 4CM5A 1R9GA 5GADl 2UUOA 3ZK9A 2QRPA 1EM8A 1YBHA 4MP6A 1Y1KE 4R8LA 1OREA 2BWJA 1T5IA 4NL4H 2P0EA 2N3ZA 3HGQA 1X8JA 3QBVA 5TIIA 3CRNA 3GJ6A 4FX2A 4RFLA 1R0KA 2O0HA 2C5SA 1RZVA 4OUDA 5EXXA 5BYJA 4ZREA 2P4SA 5KVSA 4OSPA 5LYYA 2Q41A 4EW1A 3R7DA 1WNFA 1BE6A 1EX6A 2YY6A 3UGKA 3UY4A 3PNBA 5K4AA 2X14A 1SC1A 1E9DA 5JVDB 5BSTA 4G09A 4CTJA 4F97A 4DV7B 1JN0A 2Y2UA 4AKIA 1E2LA 2A14A 2X0NA 2QN3A 1LI7A 1T9HA 5C3UA 3OOSA 2FQWA 3DBRB 4NCIA 2EFYA 2ON6A 3RTBA 3HCBA 1UXIA 3KOWA 1I9GA 5E0KB 1ECFA 1Y1QA 5LBUA 4E0BA 1W44A 3WGNA 3NUZA 4I5DA 4DPMA 3QA3E 2YHBA 2R44A 1UP6A 4R2XA 2Q8QA 2X4LA 2XJ9A 4KXWA 5GZ6A 4DN6A 1KTIA 1ID1A 1XZIA 3EMKA 2ZRJA 5K3SA 5A4FS 4CQMD 1GGJA 1KJZA 2QTLA 2A1IA 2FQXA 2WBLC 2QL5A 1NI4A 5AH0A 3UHAA 4B0OA 4PGFA 4EP1A 5EIXA 1QQ5A 4OJQA 4OJNA 2WJIA 5DISB 1ZGZA 2B4RO 1NFFA 4FE7A 2WINI 5DLQC 4RACA 5DFAA 3IBCA 4B9AA 4ZHQF 5K03A 4F71A 4X3CA 2XYHA 1UJ5A 3T9FA 5B1EA 5HRUA 2VTBA 1TKCA 2IYUA 2J87A 1UWLA 1OCEA 3NCHA 3E81A 3RIHA 2VQDA 3CLKA 3QYFA 2Z6UA 2F00A 2W6ID 4HPWA 4LN1A 4FFVA 5DZSA 2WSSA 2YHAA 4HFNA 1KK0A 1RFGE 4M8NE 4RZSA 3T41A 3GLTA 2ZRMA 2B0JA 4RXUA 1EXNA 2SNIE 2FR1A 2I3ZA 3IPLA 5HF9A 4EHBA 2E4VA 1NUHA 1OILA 3BZUA 1WCV1 2ZYDA 4QDZA 4TTAA 4EKNB 2XI4A 3LZCA 3DBHA 5C1OA 1UBUS 3E8XA 1ZW6A 3CXRA 1DDIA 1GNPA 1U8CB 3C8MA 4Q6BA 4BFVA 4Y1EA 4JR1A 3SP1A 1TFRA 3FZQA 2FN3A 1JT9A 1XD8A 1B2RA 3OPQA 4M99A 3ICWA 1UJMA 4NZ9A 5CGQB 4R9NA 4JLBA 3TWOA 6NULA 3B6ZA 4PRZA 5K3EA 4RD4A 4BWFB 3LT1A 1FNNA 4MV1A 2ZUDA 3RIXA 4TYNA 4C2UA 1QIHA 1W2HA 4KQ6A 4HXGA 3T4XA 4FVTA 3AH8A 4RLQA 1FC0A 4I08A 1MPTA 2IRWA 3BC1A 1TJYA 5K6TA 2HTFA 1NXWA 4ZU6X 1YJQA 1T4MA 3U7GA 1BSVA 5IVKA 3PX3A 3DV0B 1MVOA 1OFUA 3HDYA 3UICA 2J5QA 3RVNA 4G5HA 3E9RA 4ZV9A 4N41A 2QTHA 2VUIB 1VJDA 4NMLA 4WCVA 3AF6A 3B7GA 5B6JA 2NUTB 1FFHA 2NZVG 4O33A 2CXTA 3WC4A 2YY7A 4IOLA 2HSJA 1GPKA 4JVNA 3FPJA 3HYLA 1YL7A 4OFWA 2QRVA 3KHUA 3NIGB 3T3MB 1F8GA 5AI0A 3NANA 2GWRA 1R9MA 4KX3A 3BM5A 5PNTA 2EW8A 3T5MA 3OX4A 2ONKA 1FW6A 1IZ0A 2QROA 4MP8A 4LJLA 4I1PA 4BFYA 5I9TA 1BVYF 1ORIA 1E7RA 2C2GA 2SCUA 4G01B 4WINA 1G6HA 3HU3A 1Q77A 4G1UC 1G2PA 5D6NA 3PNKA 4B46A 5C1BA 5IMBA 2WJPA 3F1KA 4NYJQ 1THGA 2A7XA 4X64B 1DWPA 3DKKA 4JVOA 3EF0A 4K3UA 3QFCA 3D6VA 3K0CC 3T06B 3VR6H 4ZYYA 2R8BA 4YT2A 1C0LA 1P72A 1YDGA 2XZOA 3B9QA 4OX9B 1Q22A 1NBMD 1QYWA 1TO2E 2VR1A 3IC5A 4FGKA 4IFEA 3WWOA 1S5PA 2FOXA 3I4LA 4KRYA 3EQZA 4TSRA 1PG2A 2XCLA 4A0GA 2YMLA 4ZRDA 4A8JA 3AEUB 1FUIA 1HDGO 4D0LB 2GM5A 1UPUA 3ZWQA 1BYIA 2E6UX 2YJ6A 4GH5A 3T1VA 5FTLA 1UXGA 1CQZA 3OO1A 5JFOA 3BOSA 2CGEA 4L5JA 5SICE 3N74A 3PZRA 1E2KA 4PNHA 4QG7A 1DPFA 1IM8A 3RAFC 5BWLA 4EI2A 4EAQA 3U9TA 4F1JA 4F6RA 5JNTA 5L53A 4CQNA 2PSSA 1QAOA 3TLMA 4MWTA 5AI8A 3TKLA 2NU6B 1X15A 4Q1CA 2VDKB 4IXNA 5E6RA 1FBTA 4JYCA 1JZSA 3JRWA 3LDFA 3IKVA 3WA7A 5HZMA 4LWPA 5F9HA 1CTQA 3IVMA 3PUHA 1ZX1A 4CTMA 3PHJA 4HGYA 2BMVA 3FWPA 4AUKA 4DSZA 4MYRA 2ZRLA 3X3HA 1VCMA 4CKEA 2OGTA 1T3SA 2HMUA 4UHFA 3NNSA 3LIPA 2QVBA 1IBMB 1BXZA 4P7GA 5A9SB 2V7QD 5HS6A 2H2DA 3LRXA 1LDYA 3PNYA 4C7XA 5I47A 1P2GA 2HGSA 1E98A 4XGIA 2ZWMA 1LSUA 1JKJB 4F5EA 1B74A 5KCZA 1ZKDA 1F4VA 1XJWA 4MUHA 5KYWA 2QS9A 4S1NA 1WZEA 2WZCA 1VG1A 4CQLA 5LDGA 4LJAA 1P74A 2W71A 1IXZA 1NBME 2C04A 4N0EA 4N5HX 4WGFA 3NV9A 1FY2A 5JAPA 2G4CA 4DR2B 3QPAA 3WRWA 2XWBF 3CLHA 1VHQA 3IBTA 2EG9A 4XARA 1Q7CA 3I28A 1W5BA 3IAHA 4U00A 1O95D 2FXVA 5CT4A 5BT8A 3K70B 4D9EA 3HACA 4FSDA 1U7ZA 3NBFA 3KB6A 4JVLA 4KUHA 5EZ6B 2F1RA 4HNVA 3KHSA 4L8LA 1OVMA 5EE3A 5B4VA 2ZE6A 2KPOA 2RD2A 1GL3A 3RKSA 1TCAA 1PVOA 3MCWA 4QPPA 4MUNA 1REQA 2AEFA 3IELA 3PIDA 3PUZA 3CKLA 4CWAA 1KYIA 1B6TA 2A1TS 4JVSB 2A9VA 1EGAA 1NZFA 4FUTA 2CY0A 4WA8A 3GJXC 3FOFC 1DJOA 1A4IA 4DCTA 5JXWA 1SHZA 1I3LA 3WB0A 5J2TB 4XIYA 4GI3A 5DDIP 4JJ6A 3HUDA 1B1CA 1JALA 3S99A 5K3AA 2ZJ1A 4I9HA 4RA6B 4RHXA 4X1YB 4LJ6A 2R9VA 5D5HA 3ROMA 1C80A 3PHHA 1KR5A 4DMLA 1AQUA 1ODSA 1ZJ6A 5A4MS 5B4TA 4ARSA 5T4EA 2OK7A 1WW8A 2VO1A 3HY4A 1PSZA 4ATNA 4JBHA 1W5FA 5KDDA 4O5AA 4Z2AA 5M3BA 3RAPR 3SYRA 4CKXA 1OMOA 1QRRA 4IH1A 3VGJA 1Z2PX 3EF3A 3B3JA 5IJ0B 3VRHA 1YACA 4GXRA 3VI3B 3H3JA 1IVYA 4ICIA 1WXDA 4PYOA 5ITSA 1UBLS 1RRGA 5LIRA 3RYIA 5LVAA 1G5FA 1KEEA 4D9IA 1ZKMA 1TCBA 3NATA 3AKEA 2GZMA 2HJVA 2Y99A 1HE5A 4C7JA 1RC0A 1QFYA 4AFNA 3VAZA 3KJGA 2YJZA 2NYAA 2VRCA 1ZEJA 2Z1DA 3I0NA 4OGKA 1EXDA 2UAGA 1OLOA 2FQYA 3RC9A 4GWGA 3A05A 3BDAA 4IIJF 3SLKA 4BC1A 4E2WA 2ZQYA 5KPJA 3CPEA 1YAJA 1LA2A 3O1IC 2O2EA 5IWCA 1BS1A 1K5HA 1LVGA 2PZAA 4JC8A 4UCWA 4C88A 4YJFA 3ZDRA 1YFZA 5BR7A 1WETA 1ZRNA 1OLSB 2X6RA 3AWIA 1EB9A 1CF2O 3OTWA 4AULA 5AVZA 1DQSA 1OU0A 1SOAA 3ENVA 3M81A 1CQIA 3CR8A 3FCXA 4LOKA 3GZJA 4N65A 1GL9B 2PM8A 3FYSA 1QQ7A 2XUAA 1NPTO 2YJ4A 4L75A 4HI0E 4J2HA 4MHSA 2XQVA 3BWDD 4KN6A 3IHKA 2B8WA 2VJAA 1C9MA 3FPHA 2F1IA 3HUUA 5E8JA 1VP9A 2NSJA 3O0DA 2RGEA 4X45A 5DRTA 4HEJA 1FFGA 3ENWA 3LFHA 4RPJA 4ZCMA 2FSPA 5TY0A 2H00A 1FJ2A 2IK8A 5DYTA 4HUTA 2FPUA 2OHIA 3K0BA 1WDLA 4KQCA 3FUVA 1EHIA 5EGSA 4ZRMA 3H4MA 5EXSA 4A1FA 4CMKA 4FHGA 1PJBA 2H08A 4XYEA 4TZ0A 3M5CA 1X1AA 3UMSA 5IC4A 3ESBA 4GOMD 5DSZA 3EVDA 2ETVA 4M7RA 2IPXA 3BHIA 2DP4E 1AOXA 1VLQA 3E2IA 2QE7D 4KV7A 4NR0A 1IB0A 2FWAA 5EYPA 4C0WA 5K2OA 2EBFX 3EMVA 1UDXA 1BHO1 4G26A 4HGNA 2BUCA 2ORED 4RHYA 4W8OA 3PUIA 5E7MA 1PBNA 4FM9A 2G36A 3HBAA 3F9CA 1VSTA 2FCRA 5TPZA 2QRZA 1KA9H 4XASA 5BUZA 2H29A 3V46A 1RBYA 2J9XB 2EC5A 2A9KA 1GNVA 1J56A 4HDSB 3ZN2A 5FQNA 4F3YA 1IOLA 4RY8A 3AVOA 2PXXA 2GZDA 3PG5A 4URYR 2NU8A 4S1PA 1X7ZB 3Q5GA 1IJFA 1M1YA 3A4LA 4UMDA 2VNIA 5ALOA 3OZEA 3RSCA 3SKVA 3ZWDA 4WPGA 3W5BA 3SHFA 2AOUB 2JLQA 4YCMA 1X1BA 2KW5A 3F90A 3LOPA 3ACBA 1Z26A 3D2AA 1ADGA 1YONA 2JA2A 1YMUA 1QB7A 4ZU1X 1ZM4A 2G1JA 1CUXA 3HA5A 3V4OA 1I7NA 3WL3A 1IL0A 4AUMA 3GNTA 3W3AD 2F2TA 1UC8A 4Z9BA 1KDYA 2QZPA 2FN9A 3D8BA 3BMOB 1SVWA 2C54A 3K30A 1KS9A 2B3DA 2Y0DA 2N1MA 2O20A 2ASEA 2XZDA 5DBOA 3N87A 2PX6A 1Q3KA 3AFNA 1KQ3A 2ZAMA 2G0NA 3ASZA 4Y6SA 5ALDA 1QHSA 2QBYA 1NXPA 4B7ZA 1EDDA 1D5WA 4YUVA 4RJIA 5A03A 1V95A 2BMDA 2X7HA 4DJDC 1VSVA 4IUCS 1EEHA 4MIYA 5T41A 3U4GA 1FXWF 1KFCB 4AUEA 1UODA 1ABEA 3TLZA 4YROA 3VNSA 1A9TA 1LNZA 3VC2A 3VR5D 3VNUA 2FEKA 2VXCA 4YMHA 5KYTA 1UQTA 3G6KA 3KLMX 3PXBA 4I55A 1O6CA 3TFOA 5E6RB 3F3YA 3C3JA 3KJQA 3V4RA 2POCA 2WC1A 1KP3A 1XVIA 3NTLA 3VNVA 3E84A 1AXGA 3QITA 2VNAA 3IAUA 1UBEA 3QKTA 1MPXA 1VECA 2WYWA 3AV0B 3QFFA 1IY2A 2Q3HA 4MB2A 2E3JA 1QVAA 3ZE9A 3N8KA 1U1CA 2FMFA 3T15A 4D6XA 1E62A 1G6KA 4GC5A 3A9TA 4E1AA 3RUHA 2F3PA 5BVGB 1FP4A 5BN3A 3AR9A 3NVDA 1TCUA 3VU8A 2JLRA 5DM70 4BNMA 2P2GA 3LYAA 2IE0A 4JBXA 5CNIA 4I4IA 3VKWA 1P4JA 1A76A 4KAAA 2D5LA 4KTVE 1NURA 5ENZA 4BBPA 4CM9A 2J0EA 3QTTA 4NEQA 2JVIA 3GZNB 3O93A 4OBBA 4LPKA 5LQNA 5JSZA 3AHEA 4C3OB 2H7XA 2QHXA 3WYAA 4B6JA 2XZLA 3HJUA 3I1JA 4FR0A 1T43A 1E1MA 2R6FA 1BEZA 2Q9UA 5JANA 2YTZA 1G8GA 5CB4F 1RHUA 3C3KA 1ONOA 4WWHA 5G1PA 3RJMA 3HXQA 2RKBA 1KL7A 3WYEA 1JFFA 3DAGA 2V6JA 1CJVC 1G4AE 3FWYA 2VP9A 3QW2A 3GD5A 4M0EA 1YQQA 4Y30A 1E63A 2C9BA 5HWSA 2B8NA 4P54A 4PZCA 1WXGA 1K8YB 2YCLA 1EFAA 1DJQA 2QLBA 1C4XA 1NSYA 1OROA 3BHNA 2WPDA 1JQAA 1IHYA 3CCBA 4Y6PA 4D0NA 1SAYA 4HVLA 2JKVA 4YALA 1SVIA 2J3DA 3EUAA 2HFKA 1UOEA 4DB4A 1ZM7A 3TJZA 1CEYA 1GZUA 5ITZA 4EY3A 4PPGA 3C0KA 1J0AA 3WLMA 1G41A 3TVYA 1ZM9A 5SZKB 3X44A 5TGTA 2EW1A 4PSVA 2DR3A 4JUIA 3EBPA 4U9UA 1WPXA 1F17A 1PQPA 2HDNB 3L8MA 4Q7KA 4CKYA 3ZS9A 1XPJA 5FBVB 1T2AA 5HIAA 3WQHA 3N7AA 3NDRA 3LKDA 1XRNA 1PFWA 2KSQA 3HRKA 3M5PA 2JEOA 1EMDA 4P5DA 1LPSA 4PF1A 5ALTA 4EUEA 3UH0A 3BREA 1XVUA 3QOFA 4I1YA 4QUJA 2WTNA 2EDCA 2IT1A 4QGBA 1RADA 4XD7D 5ICEA 4GBMA 1N6LA 3OZXA 4CXMA 2OPHA 2BW0A 3ASUA 5TMDA 2SBTA 1DKPA 3UGTA 1Y63A 4O3FA 4H0FA 2GJ8A 5K8IA 1JXMA 1VI6A 3H1PA 3L7MA 2HR1A 2YOGA 1NMZA 1N0UA 2D2XA 5FWYB 3M2PA 3I2FA 4RCVA 2ZRGA 4N03A 4N6GA 1G1AA 2EF1A 9GPBA 2XXBA 1WO8A 4CKEB 2B20A 3NORA 4LSWA 4MVJH 2ECKA 1YQXA 4L4UA 2FEOA 4ESOA 2GLXA 2DHCA 1P77A 2FUNB 3NYRA 4K40A 4OP3A 4YQEA 4UQPA 5T8KA 5TQ2B 1PL0A 2WVAA 3D5QA 5FBLB 3RVDA 1E2BA 3GDHA 3H05A 4GM4A 4RJKA 4D9FA 1E3SA 3BQ9A 3BJZA 2NTNA 1PJCA 3L7NA 4DUGD 5KYWB 3R7FA 1W76A 4Y67A 4GX0A 2R1UA 2EF0A 1FMCA 1ZOLA 2D1FA 5JAQA 1RJ9B 2YN4A 1YUNA 3GWZA 3IUQA 4JLJA 4UAVA 3PUWA 4CU5A 1Y6RA 3HSSA 4J9VA 4ETWA 5KTRA 3C1OA 5CB6A 1KMNA 1QTIA 2XZTA 3HY3A 2OD9A 2W90A 1TJ3A 5HOQA 3GGSA 3JQ9C 3RGWS 4BPBA 1C7ZA 4PSAA 1MG5A 3MXTA 3ILHA 1PDOA 2RE8A 1T4CB 1F4PA 4W9MC 1O94A 1EVLA 3E4CA 3WWZA 1FS5A 3O4VA 1L7VC 1FDSA 5CIQA 1DKQA 2IUFA 4XVRA 3P94A 4HRYA 5J1SB 4GD3Q 1J0BA 3JQGB 1Z5UA 4H4EA 5DEIA 3ZY2A 4B4WA 3M6AA 1H2FA 2W6ZA 1RCFA 3PRHA 3E2PA 1G16A 4JXZA 1JVBA 1NOIA 3QP9A 2BIFA 1VJTA 3NS7A 3KXLA 3F8SA 4KXUA 2JKZA 1DI0A 1JEOA 1HYBA 1W2GA 2C92A 2QZ9A 3EBLA 3B1KA 4MCAA 1RWNA 4TWZA 1MB4A 1UM9B 2FFBA 3NTXA 4G0QA 4RJTA 3GW8A 4JJ8A 3OZUA 5CNJA 4E5DA 3PK0A 4O02B 5ALQA 5JS6A 3OX3A 3FSJX 5HQ3B 4DDUA 3IMKA 3QVSA 2MSEB 4G3XA 1CG6A 1SA0B 3KQUA 1PK7A 2YW2A 3QPVA 4TPKA 5JCJA 1HZZC 2J0QA 4I9NA 3EMBA 2FZCA 2R87A 1P0QA 1QHIA 3M6XA 2OXFA 2PTHA 3B3AA 4B7CA 2ISSD 3OJ0A 2ZUFA 3N59A 1DCTA 3GDFA 3THYA 3BXGA 1WBDA 3BQNB 3LT0A 2BTOA 1TLTA 4ER0A 1EFRD 3EDOA 3K6RA 4CMIB 1XX6A 2HPVA 3NEPX 1ZM3A 5IPFA 3HVUA 1HTTA 3PX7A 2Q6OA 3QEMA 4WXYB 3L1IA 2DYKA 4PZDA 4PHCA 4G86A 5U4XA 2X1VA 3FNIA 2R7LA 1B76A 4FZRA 2NUPB 4OGFA 3CNLA 2IP1A 4Z4EA 1GPBA 1XQVA 2I65A 1BKDR 4FDTA 4JJ4A 4PPQA 3ZHBA 1QIDA 4I55B 3TVDA 4M1SA 5IASA 2JGJA 2NXWA 3Q7IA 5JZMA 1XEXB 2VQ6A 1H66A 3O2JA 5AXDA 4QYSA 1R3UA 3AJ8A 5FA6A 1BOOA 2EJBA 5A06A 2PUWA 1GRQA 1C1HA 5FBHA 1UXKA 2Y2VA 1Z3CA 4F38A 1AV6A 4INZA 1KERA 1CUWA 1WEHA 3VC1A 5AKEA 4BV2A 4Y1RB 3P9SA 2JCXA 2QLMA 2W43A 5J4LA 1KRWA 3R0XA 1IQ0A 2JGLA 1LSJA 3L6RA 3O9VA 1KRHA 1VIVA 2AVDA 5BYBA 4RE5A 1GVHA 3BMOA 3VPAA 4DQKA 1IIBA 4CQMA 1KMIY 1ZJYA 2WUWE 4DBZA 2W7TA 3A6HA 3FIJA 4HTFA 4HXFB 3ZQ6A 1MR3F 1AVTA 1U80A 3M3DA 4EKIA 1ZMRA 1JKJA 2CNBA 3UYKA 4RHTA 4Y7DA 2X2OA 4L7QA 3GRVA 1Z06A 4J1QA 2P5TB 3L7BA 4QUAA 4MPRA 4WBNA 1NUSA 1ECGA 2AFIA 2DPMA 3AR6A 3RJ5A 4CKWB 1GAEO 3NEYA 3PYLA 3AF4A 1VPTA 1RRVA 3R9WA 2JH8A 4IQFA 2R11A 3N75A 1S02A 4YB8A 3W06A 3CWQA 2V58A 4WOKA 4HDSA 3ZD7A 3ZBQA 2PGDA 3DMTC 5DGIA 4BRZA 2IA5A 4CCSA 2WFMA 3IEVA 1C0PA 4TUYB 2CJYA 2GEBA 2VAPA 4D46A 1QC5B 4JC0A 5DF1A 3N05A 1KK1A 2PKWA 1OIXA 4KO1S 2JFWA 2F90A 3P32A 3SIXA 3ZW9A 2WG0A 4GU5A 1I5RA 2NLOA 4JLAA 3J81A 4XQ0A 4U9HS 3DWFA 2BN4A 5E1DA 3FKSA 5CUQA 2HA2A 3TTUA 4D4MA 1Z13A 3V1UA 3W4JA 1FFWA 2REOA 3NEAA 5GJVC 2AFHE 5C46F 4DA4A 2WKQA 4ITUA 4NBLA 4O08A 4D4JA 4ZO9A 2EIHA 5KYXB 4HEA1 4MULA 3TUZC 2QRLA 4YRMA 1S3GA 3TAUA 3QEBZ 1Z0DA 2FSGA 3ZNOA 1HC7A 5JSZB 4Y1GA 4BAGA 2JA1A 2RAPA 3E5RA 1MDFA 3LDUA 4I3FA 3ZW8A 2X2EA 1EUCB 3EUEA 4LXUA 2IUTA 1I7PA 1SO8A 3G82C 3DFKA 3OAAA 3QX9A 4Y1FA 5HJ2A 1HKUA 2A9FA 1C9YA 4Q00A 2LKCA 2X1MA 3DMNA 4L50A 5CH8A 1RIFA 4TT8A 2EJUA 3GJQA 3IUJA 3OZBA 4GDMA 4B48A 4DXHA 1MH1A 4DZRA 5HF5A 2FZEA 1COZA 1G6OA 3ILVA 3WHKA 4DHWA 2HIGA 1HRKA 1K4KA 4X62B 1QZZA 4A0QA 2ZDGA 2ZIVB 1JDZA 2AF3C 2X0IA 1VYTA 2HSZA 3PWZA 3O8QB 6CHYA 1ZH2A 4PEVA 1AK2A 5LPNA 5H80A 4F4HA 1KDZA 1JDBC 1O5TA 4JDPA 4KC0A 4RU1A 3A2KA 1BJKA 4Z5XA 3HG7A 1URPA 3H1AA 2CW5A 3LRPA 7REQB 3ZE6A 3TE7A 1T3GA 4DEYA 1NVEA 1VJ5A 2WT8A 1ZJ5A 2GCNA 1RABA 4HSGA 1KSHA 4MS3B 4GT1A 3REOA 3WWDA 1YRLA 3PRKE 4E7OA 4AURA 4W5RA 1J2EA 2Q3MA 1XCMA 1XXHE 2V3WA 4JK3A 4PLTA 3WQSB 1LDBA 3JVIA 4WBXC 1QKKA 4DC1A 1Z4NA 1MORA 3LBNA 3D7LA 1DKMA 3PQEA 4XDHA 5IM5A 2B5VA 2P77A 4B3BA 3HM9A 3M3PA 2CJXA 4RSRA 3MNFA 2EBWA 2R8PA 3L8HA 1L7MA 4Q37A 4Q4LA 5ALYA 2VAVA 3HZOA 4FHDA 1N77A 2VQEB 1YDWA 4JOBA 5FRDA 4NYMQ 1K97A 1QRAA 2B4YA 2ZJBA 821PA 3I9V1 4CUZA 1LXCA 5KYYA 4CM8B 2JFOA 4EYEA 2JK1A 3K73O 1KYTA 4HQ6A 4MRMB 4QELA 4CODB 2I55A 4C0KA 2HI0A 4ZIRA 2Q4TA 4F7DA 3P9KA 3C70A 3I2JA 3USCS 4YV2A 1T1JA 3TZBA 2QI9C 2XGOA 1AKQA 2G9QA 3P1JA 3HGMA 1U0RA 3HYRA 3RU9A 1NI3A 5IEJA 1AMOA 2P8JA 2VYQA 3KALA 3WKEA 3DXXA 1QYVA 1AK9A 1D0VA 4AZSA 1X2BA 3E5HA 4CT5A 2UXDB 1R3DA 2PAFA 2HA6A 4MAMA 3QFTA 4N5LA 1UC9A 4MMXB 3PHLA 3PP8A 1I5EA 1YQ9A 2DY1A 1MJFA 3EY4A 4IDDA 3DV2A 3H2BA 1X19A 2XQKA 1JLHA 4NEGA 4J3NA 5I8PA 1WUIS 4M54A 3B6KA 3CSUA 5CLIA 3DJYA 3G49A 4PR0A 2Z43A 2C4UA 2E2WA 3ZHXA 4EFLA 1WSWA 3ZHVA 2IC5A 2DBQA 1Y6ZA 2H4ZA 3X2EA 4EW3A 4G07A 2H8GA 2VHYA 1MO2A 3VX4A 1LBEA 4MUXA 5ECDA 1MOZA 2I7TA 2AMFA 2WPDD 4E3ZA 4BMPB 4XPIB 1USGA 3GFTA 2GPJA 1J4AA 1HA3A 2HDOA 3FIUA 2GFQA 3ESYA 1J2RA 3DCIA 4GMKA 4EFNA 5K7SA 2VRNA 1Q11A 1W6UA 2FPWA 4NCJA 3VI4B 1DDGA 1ZOOA 1KJIA 3FBGA 1HETA 1BA3A 3NI2A 4KKXB 2FWMX 1EBFA 2BONA 1BXKA 2WF7A 2WJ3A 4U2CA 5DPMA 3VBCA 3LPMA 1KC1A 2UZIR 2IUYA 3I6BA 3HLYA 3NASA 2J0UA 1GGFA 3O03A 5DTMA 3QQPA 1QANA 3ADOA 1H8HA 2VHTA 4ZHQB 3AEXA 4GI7A 1KKMA 4RAQA 3ZW7A 1GT91 1LLUA 1D6MA 2XMGA 2GKGA 1Z12A 1SXJA 1SC9A 3IXMA 1RI4A 4G0ZA 3PQFA 4YJKA 5TX7A 4KL8S 4RK1A 2ATEA 1ZR2A 3OFND 4OI2A 4N3BA 1WLYA 3H9GA 4LNHA 3F0TA 1JUDA 2VWPA 1KO5A 1DU4A 2FKNA 2YHIB 3CU5A 4Z8YA 3A32A 4WTOA 1NVWQ 2CYBA 4AJOA 1PDVA 3CVJA 2VJYA 3OT1A 4YAOA 2NX2A 1PJZA 2RB5A 3INYA 4AO7A 1L5HB 1NTRA 3GELA 1NYQA 2WWIA 4AJ1A 1CUEA 2C4WA 4UTVA 3D6NB 4BATA 3C43A 1MHTA 2IZZA 3R6GA 5C81A 3KQSA 4IDFA 5E6UA 5A2QA 3VR4A 3BFXA 3ONNA 3DEIA 2VDUE 3GJTA 4M3NA 2QVLA 4CMEA 2HU8A 1U1DA 2C4NA 3QUTA 4CMBA 3B3QA 1NQUA 1HBJA 2P9JA 2V97A 1DXHA 1LB1B 1D1QA 1SCKA 2R7AA 4QXPA 1NG9A 4IO1A 4BB9A 2IX9A 1YR1A 2FMIA 4JX9A 3F8WA 1OXKB 3OP4A 3D0OA 5DHAA 2BFEA 4BX2A 5TB5A 4NYMR 3EB9A 2WFLA 1TJ5A 1DP4A 2VT6A 3WMRA 4RVDA 3PHBE 4YRIA 3I73A 5AHXA 3FYDA 3HFGA 3AF3A 3CH7A 4V0NA 2A8YA 1Q7BA 3E7FA 2QAIA 1MBZA 2OC4A 3W3ZB 5TGDA 2MWMA 3OKCA 2YZGA 4GM1A 1S2GA 5DXJA 3GD7A 1GG2A 2V74B 3PE6A 1VA5A 3QHQA 4NFLA 3QNMA 3UHPA 3A1UA 5TR9A 2XRFA 5I5GA 4AZWA 2W98A 2JBHA 4N82A 3PQDA 1DFGA 3LHFA 4WUTA 4QC2A 1Y3BE 1GYPA 2RSLA 1C7IA 1RYEA 3HHEA 1QS0B 1IWPB 1CY4A 4PLWA 3DP9A 2QTTA 4YMTA 3VHXB 4R4JA 3VOBA 3LC1O 2WUVA 2R1TA 2XKKA 2VTDA 3UHFA 3E9DA 3GGPA 1N36B 2OK8A 5KC8A 4ITVA 4UMVA 2PKEA 2HJWA 1M10A 3AL0C 2R62A 2VF2A 2FSUA 1DHTA 1LVHA 1BHQ1 4OFBA 1PYGA 1U2DA 3Q98A 5JSQA 1MO4A 1ZL2A 1NBIA 3DCJA 3FHOA 1HDYA 1TVKA 1WMBA 4FFWA 1KWKA 3IIEA 2VUHB 2ZIZA 5DHSA 1BN6A 1R0RE 1MVLA 2P3QA 3G1UA 4C7KA 3S8YA 3C3XA 4CLDA 3ZGNA 2I62A 1SURA 1CUYA 5HP4A 1XTSA 3AL3A 1F5SA 3ZHUA 2OZLB 4JX8A 4ZEXA 4MRNA 3WOVA 1O9GA 4RY0A 3Q6MA 2H52A 2KE5A 1PSWA 4MKFA 3UUWA 5DIFA 1Z6YA 2IZ0A 3PR1A 3L40A 3W5DA 4HFMA 2ZTSA 1VHWA 1PZHA 2V9CA 1JG6A 1S3IA 3DG9A 4WI1A 2IWRA 1VSUA 3P0HA 1PLJA 4TMYA 4UNSA 3BRWA 4ZVTA 5CFRA 4WLOA 1RMQA 3JQ6A 5FOWA 4LBZA 1I94B 2DEUA 3K0HA 1USUA 2GPAA 2JS7A 5AVSA 4F93B 2GASA 1PQYA 3OTQA 3PKZA 2OV4A 4JFRA 1JQLB 1W59A 2ADFA 1QFSA 3QHAA 4LOJA 1U7HA 4OB8A 4QQNA 4A8JB 3AM4A 2B1JA 4FEEA 4CW7A 4RD1A 4PSDA 1EUCA 2AQKA 3H8SA 1DRUA 4HKTA 4V38A 1JR4A 2ZQ5A 2HF2A 4HAVA 3ROFA 5F21A 5JJKA 2UYYA 2VSOA 3A4TA 3WZLA 3K5HA 1OU4A 1XDSA 1VKRA 5EQFA 2RHGB 3NHZA 1E0JA 3FR8A 4IBOA 2I80A 2DGDA 4OXXA 1NLZA 5DVZA 4EQZA 1O3YA 3BZWA 4H7EA 4EI7A 3DE2X 1FQOA 2FG5A 4K6FA 1OOEA 2JIZD 3IQZA 4BJ3A 4XM2A 4ZYUA 3RQIA 5JWHA 5BURA 5LA6B 1H2EA 2XF2A 4DIEA 2GRJA 3FJYA 4WZ6A 5INTA 2GESA 4AKSA 3TZLA 1XWIA 4QREA 3E8MA 2O2SA 5M5BA 1GV1A 4MVJE 1PAUA 4LXHA 4LX0A 3N8NA 4PQYA 1JVSA 2PUCA 4IOMA 3ANNA 1W85A 4XVCA 5JASA 3N8DA 2VLBA 4UBJA 2JDID 2V0NA 3ZCUA 1SCUB 2O3QA 3OCZA 3ZZNA 4CIWA 5KQMA 2JGIA 1PJ8A 4NFSA 1TLFA 1V7PC 1K4MA 2BI7A 3IV9A 3OQPA 5DMHA 5HCUA 2RI1A 2VEOA 2P78A 3MLEA 1Z22A 3A25A 1U3DA 4JY7A 4M8KA 4Z0NA 4DA6A 4DDHA 5G4KB 2I3DA 4YV7A 1HY3A 1Z5VA 5BNFA 1ZCAA 1BCRB 4GS5A 2Y67A 3L4EA 4NZZA 4MVWA 4BVLA 4ZEVA 2FUEA 1E66A 2FUCA 2V4MA 3L2OB 4TVSA 2QTVB 2DFLA 2QQFA