3OLWA

Structural and functional effects of substitution at position t+1 in chey: cheya88t-bef3-mn complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
b'ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTTEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheY
publication title A Variable Active Site Residue Influences the Kinetics of Response Regulator Phosphorylation and Dephosphorylation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 45
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3olwA00
3KJXA 1DBWA 1Z15A 5IUJC 3FFXA 4G0ZA 2B1JA 3LFTA 1YMVA 3KYIB 1HEYA 4MGEA 2L2QA 1LK0A 4MQEA 4LDZA 4WXMA 3G85A 2FMHA 3Q9SA 2FEKA 1QO0A 1CYEA 4Z4IA 1TVMA 4RV5A 4RU1A 3MMNA 3SG0A 4CBVA 1QP0A 2FEPA 3LUGA 5T7BA 2QR3A 3CG0A 3MM4A 4G0PA 5TQJA 4EYQA 4MS1B 7ABPA 4Z0NA 3KLOA 4GPAA 3HM9A 3I09A 4MPTA 4EYKA 1S8NA 1SXGA 1AB5A 1DP4A 3D8UA 3ILHA 3KSMA 4EYOA 4N76A 3OQMA 4P1ZA 4MR8A 5I4CA 1RNLA 9ABPA 2FN8A 3OLYA 4OATA 4Z4FA 4Z9AA 4H60A 1BAPA 4RKQA 3MA0A 1KRXA 3T6KA 3N75A 2PUGA 3D02A 3NNDA 4KZKA 1K68A 8ABPA 4JP1A 1I3CA 2TMYA 2MYTA 2IOYA 3GYBA 2DRIA 3N8IA 5TQ0A 4MQEB 3E3MA 4IILA 2R47A 1XHFA 3H5LA 5IUNC 4F11A 1QP7A 2CHFA 1YTUA 2JCGA 3A0RB 4M88A 1BDJA 4RSMA 3HCWA 5DKFA 4Z4CA 3HDVA 1DC8A 3NNNA 4H3KB 2F8TA 3S99A 4YCSA 1JH9A 1C0EA 4TN5A 3MYYA 1L5ZA 4G0XA 1Z18A 2FN9A 2MSLA 3HV2A 3ILYA 4OBBA 1JF8A 5CNMA 5FWXB 4ZMRA 4QICA 1GUBA 2E4UA 3K4HA 3N6VA 1E6KA 4EYGA 4MR8B 3UKJA 2CWDA 5GQSA 1RZRD 3T38A 2X7XA 1JL3A 1M2EA 4PICA 2PUFA 1LBHA 3BREA 2QZJA 3F6CA 3M9WA 1EWVA 4JASB 4UHKA 4FB4A 3TMYA 5ABPA 4KNYA 5JS1A 5EWJA 1ZH2A 3I42A 4ZPJA 2ID7A 2B4AA 3K9CA 3OLWA 2IKSA 1U8TA 3LUFA 2OENG 1P6QA 3HSYA 3KKEA 1YS6A 1BA2A 4LE2A 1ABFA 3QX8A 4W5NA 4MLDA 4MAAA 1NXSA 3OLZA 2QXYA 4NQRA 1D4ZA 3VNAA 1JFTA 2M1ZA 4P98A 3OLXA 4KV7A 2JVIA 2J48A 5JNTA 2PLNA 2ZAYA 2P9HA 4MRMA 1D2AA 4PEVA 2IDMA 3GBVA 3H5TA 3O2JA 2JBAB 4RDCA 5CNIA 2NZUG 1DCKA 5EWJB 2E4YA 5IC5A 1W9HA 3CG4A 3N0WA 2N9UA 4D6XA 2HJ9A 4KREA 5TPZA 5EWMA 2R48A 3O2SB 3QELA 4O1HA 4RXUA 1ZGGA 1ZDMA 3EQ2A 3GT7A 3SNKA 3TX6A 2PAFA 4E7PA 4D74A 2FQWA 1LJUA 4WT7A 3IP7A 4H3HB 2PKXA 3W9SA 1F4VA 4QPJC 4Q7EA 4Z9BA 4HNQA 5JNVA 2V0NA 2FSPA 1YK0A 3KG2A 4L85A 3HO1A 3RVQA 4LZLA 4LDAA 4MRMB 5KQMA 2BGGA 2MSWA 3EULA 4MYRA 3CKMA 4XASA 3CZ5A 2PUCA 1Y1LA 2VYCA 1OXBB 1QP4A 3FFWA 5D2CA 1JYEA 2CHEA 3CFYA 3DLBA 3DGFC 4ETMA 5HQJA 1ZH4A 4YS6A 5EWMB 5JNWA 2HQBA 1CEYA 3DBIA 3Q7RA 1A2OA 1RPJA 2RDMA 4Q6BA 3H6HA 3QEMA 3T8YA 4RY9A 1FFWA 1TM2A 3RVMA 2L17A 3QLTA 4PE5B 2FKAA 3C6QA 3A0UA 1NY5A 3HUTA 3KS9A 4S05A 4W5TA 1FQWA 5BQ3A 2OQRA 3GBPA 2CD7A 1P8AA 5CNJA 4KK4A 3CRNA 3O2QB 2LIVA 1TJYA 1Z16A 3HZHA 2IPAB 6CHYA 2FQXA 4DADA 3C97A 4N03A 2A9QA 5CNKA 3LUHA 1NXPA 2WRZA 2RGYA 4LE0A 2FQYA 1NXVA 5KC9A 1KMIY 2VUHB 1SRRA 2RJNA 3N0RA 3QEMB 3FDFA 4XFKA 4NCBA 1P2FA 1JFVA 4B09A 3KCNA 5C5CA 3N0XA 3OLVA 4G0YA 3HDGA 5KC8A 4Z4EA 2KYRA 1QNLA 1A0OA 3LMKA 2PUAA 1MAVA 3F7NA 2E4VA 1VLZA 1USGA 2H0AA 2PL1A 3A3KA 1JLKA 3LUJA 4WUTA 1F51E 2JB9A 1USKA 3E61A 3H5IA 3Q41A 2WWVD 1QPZA 1NTRA 3I45A 3H1GA 1SXHA 4Y9TA 3IPAA 4Z99A 4EVSA 1TMYA 2E4XA 3O1HB 4NCAA 2O20A 4YR7A 3OM1A 3H1EA 3NHMA 3RVOA 2VUIB 2AYXA 2VK2A 4Z4GA 3ROTA 1EFAA 3L49A 4F06A 2E4ZA 3EJWA 1Z25A 3CTPA 4RY8A 3RVLA 2A9RA 2QU7A 3CLKA 3QX9A 1SD5A 2PUBA 1ZN2A 1DCMA 5TQ0B 3KTOA 3DZDA 4WXEA 1D1QA 1YK1A 3ROFA 5IX8A 1C4WA 1ZVVA 3RQIA 4YGXB 2MYUA 3TB6A 3IDOA 5JS2A 4S04A 3EQZA 1E6MA 3Q7TA 3OO0A 1NATA 5TQ2A 4N0PA 1MB3A 3NNSA 1U2PA 1LBIA 1Z13A 2Q5CA 2LP4Y 2QVGA 4JB0A 1J56A 4JB2A 1NXTA 3LOPA 4PZ0A 1XWWA 3JPYA 4LRQA 4MR7A 1DRKA 1ZHHA 3RVJA 1DZ3A 1TLFA 2WB4A 1IIBA 4G0QA 4L4UA 4WWHA 3RVKA 3LKBA 2PUDA 1ZESA 2ZWMA 3GV0A 4QYWA 5GOTA 4F12A 1M5UA 2M98A 1BVHA 3IPCA 3MQ4A 1L5YA 5ED4A 1BDIA 5HM6A 4Q6WA 4RY0A 5JNRA 2FW0A 3B2NA 2GWRA 2PJUA 4IRXA 3EAFA 4ML3A 3RVNA 3F6PA 3UK0A 6ABPA 1P6UA 3CNBA 1RZRA 1M2FA 1FFSA 1AB6A 1RXIA 1VKRA 1MVOA 3JVDA 4G86A 1PEYA 3LUKA 1OXKB 2QW1A 4MR9A 2IPMA 2NZVG 3O1IC 1DG9A 4QYMA 2JVJA 3HK2A 3KHTA 4EVQA 2A9PA 1JYFA 2WY2D 4MR7B 3URMA 1SXIA 3LUDA 1T34A 4IF4A 2WJWA 3HUUA 3BRSA 5C5EA 1PEAA 1QO0D 2JK1A 2YHAA 5DCLA 1MB0A 3EDCA 3C3WA 1CHNA 4KK3A 3FMVA 3O1JC 4HNRA 4RK0A 4EUKA 3HVRA 3QELB 4LX8A 2GBPA 4JOQA 2FMKA 4YV7A 3C3MA 3UUGA 2YHBA 4YO7A 4RWEA 4MR9B 4PYRA 5HKOA 4XAQA 2F8SA 1JFSA 5FBHA 5PNTA 4MS3A 5FBKA 5FWYA 3H75A 4MS1A 4F8JA 3H5OA 4RXMA 3P9YA 3IP9A 1GCGA 3G1WA 2HQOA 4XARA 4RK5A 3GWGA 2WMYA 4N41A 4O5AA 2QSJA 3C3KA 2FMFA 4MQFA 4Z4HA 5BRJA 1JDPA 3BRQA 3I5AA 4YLEA 5HSGA 3DLHA 2QVCA 4YP9A 2AYZA 3H5VA 3R0JA 3QEKA 1ABEA 3A10A 1DRJA 5F64A 1GLGA 3OM0A 4HNSA 3GL9A 1LJLA 2IPNA 1E6LA 3NBMA 3BBLA 4FE4A 3JVIA 3SQNA 1DJMA 3LUCA 5EWLA 3GRCA 1QMPA 3NHZA 1R8JA 2JVKA 2MSKA 3H5WA 4EVRA 4MS3B 4OTZA 4RS3A 5FWYB 3HXMA 5FWXA 4KMRA 3DGEC 4FE7A 4KVFA 3O75A 2PE5A 1ZAYA 4OG2A 1U04A 3RH0A 2PL9A 1GCAA 1KRWA 3SAJA 1DC7A 1Z2EA 1NXXA 1Z17A 2GX6A 4W5QA 4MQFB 1WETA 3O21A 2HQRA 1UDRA 5IUKC 2P4UA 3VNBA 5KQGA 1BDHA 1K66A 4XXHA 3N53A 1QQBA 1RXEA 2FMIA 2RJOA 2GKGA 4D6YA 5IEBA 1Z26A 2A9OA 4O1IA 5KWSA 4G0MA 1A04A 2R25B 2WJAA 4UHJA 4NV3A 3EGCA 3IP5A 1YMUA 1MIHA 3MF4A 1ISRA 4EY3A 1JX6A 4G97A 3OMWA 5EWLB 4OLAA 1URPA 2LPMA 3T95A 4ZYLA 3L6UA 1ZY2A 5B3JC 1U2QA 5KQPA 4WZZA 5KI6A 4RZSA 3OMXA 3SY8A 5TPWA 4KQCA 1D1PA 2MYPA 4RXTA 1YS7A 2IYNA 2LUOA 1XHEA 1JDNA 2R4QA 2FLWA 4JAVC 4RK1A 4RK6A 5TPZD 1PNRA 2FEWB 4IMJB 5B3JA 4TLLB 2ID9A 4GNRA 1DCFA 3CS3A 2JBAA 1ZITA 2FTKE 2FVYA 4DN6A 5IEJA 5E3JA 5DTEA 1W25A 2XDYA 5JNSA 4KQ9A 2PUEA 1USIA 2NT3A 3Q7SA 3RVPA 1QKKA 1APBA 4ETIA 1DBQA 4EGSA 4DQDA 1EAYA 3FGZA 4JA2A 2H3HA 4OLBA 5IBQA 2FXIA 4KPYA 4G0OA 3HJFA 1JHZA 1Z12A 5KQLA 3H6GA 4MS4A 1E2BA 1M5TA 4LE1A 5DLEA 5TPWB 5BR1A 4RK7A 3EODA 4TMYA 2L19A 4KFCA 3CU5A 3MIZA 1PHRA 3LKVA 1EHCA 1DBPA 3IP6A 1B00A 1FFGA 5TQ2B 4W5RA 3OQOA 3M6MD 3FFTA 3GA5A 4HYEA 1Z2DA 3QK7A 3Q15C 1H9CA 2HPHA 3JTEA 4RKRA 2FLKA 3HS3A 1EWKA 2JRLA 3JY6A 3TD9A 3LTEA 1PNTA 3RVRA 1U0SY 5BRAA 3OQNA 3SM9A 3QLVC 4N0QA 5TE9A 4N47A 3JS5A 5T3YA 4TLMB 2MYNA 4W5OA 4F3TA 4YWHA 2I6FA 4IGAA 4RK4A 1PUXA 2GI4A 1JBEA 2QV0A 3OO1A 4MLCA 4XLTA 3F73A 1QQAA 4MS4B 5IULC 1YIOA 3LUAA 1D5WA 3QLVA 1NXWA 3KYJB 5JNUA 4IMIB 5CHYA 3JPWA 1ISSA 3QLUC 4ETNA 2W42A 2L18A 2LBPA 4E7OA 3M9XA 4ZJPA 3HEBA 1YVUA 1KGSA 3CHYA 1GUDA 4YRZA 4ZMSA 1VRVA 1JWLA 2IPLA 3O74A 3CZCA 4NICA 1FSPA 2E4WA 3QLUA 1ZGZA 2PMCA 1VPWA 2NUBA 2HSGA 2NT4A 1EWTA 3TO5A 3KLNA 5DGCA 3RVSA 3H1FA 1NXOA 3BILA 4KRFA
chains in the Genus database with same CATH superfamily
2V4ZA 4TLDA 5DTJA 4AN1A 2A0FA 4ZVUA 2O8BB 5KNCA 4TMZA 4UZFA 4FUQA 1JWBB 1EJ2A 4JR0A 1GKLA 1UZNA 2AUMA 3EXG2 3OECA 4FC6A 4Q1FA 2LCIA 2X7HA 1JE1A 3PZBA 2P2LA 2FMHA 2NYUA 4GLFA 3ZDBA 2JGDB 2ZS7A 3A26A 3CGGA 3EC7A 2GAAA 4RV5A 2DFKB 4LJLA 4ZMBA 5CDGA 5KYYB 3TQFA 3K9NA 5JE8A 4AY6A 1C7EA 1RZ3A 3LS2A 3LSTA 4ENUA 3OTHA 3PGKA 3MM4A 5JUWA 1QBGA 1ZIYA 5IABA 5K0SA 1MO2A 3HJTA 4DV6B 4WLNA 1LX6A 2C98A 2WYOA 3D4NA 3I09A 1DV2A 2G4LA 4R0NA 1DG3A 1FQOA 1QGZA 2I1QA 3HBMA 2EFJA 3E22A 4MUIA 5DN9A 3E7WA 4MR8A 1CC1S 3OLYA 3PFKA 3E5NA 5FUVA 4GO1A 1CNMA 2VJYA 3MA0A 4HXYA 1IFXA 2CSUA 8ABPA 3ZY6A 2QUBA 3M6VA 2J5QA 4XVCA 4Y9DA 1WULS 1PU2A 2Y1LA 4NBLA 4YHBA 2J5RA 5EJGA 5K7SA 1R6BX 3TQSA 1KJZA 5B58T 4ZVMA 2BSXA 3EZXA 4JNCA 1BTOA 5DULA 3UMGA 4BX2A 1BDJA 4RSMA 4HGRA 3KT0A 2HEGA 1X70A 3OHMA 1D7OA 1POXA 4MDHA 1M83A 3NWEA 4M2LA 1S6YA 4MX8A 3ILYA 5C32A 2D7JA 1XTBA 4BV9A 2F6RA 4HL6A 4DQVA 4Q3EA 4GMHA 3C5EA 4E03A 5KJCA 4J7XA 4GH5A 4QICA 5H4GA 1FFCA 1GUBA 3TJZA 2HB6A 5EIAA 1ADYA 4KODA 1P1BA 3G2JA 3H4MA 5FT9A 3GT0A 4TQ9A 3K96A 4B79A 3Q5EA 4F2WA 1JMVA 1CIVA 1RI4A 1XVIA 1PKEA 3GGOA 1IHPA 4HWTA 1M2EA 1NC3A 3L41A 4AO6A 1WUJS 1FNSA 3KYCB 2OO3A 4AO7A 4ANFA 1KH3A 5F7XA 5LM3A 2BT4A 4NYIR 3V9PA 3WB2A 2ZULA 4FPXA 1ADCA 3HCBA 3WJ7A 1VYUA 2J3EA 3WRXC 1XZMA 2O06A 1V9LA 3CUTA 4L75A 4DXDA 1JKFA 1LCIA 1RWMA 1ZBDA 2YV5A 3DAHA 4QXQA 5B37A 3ZH9B 3WFZA 5IFKA 2QX9A 2IYPA 1NBOA 1YSCA 2XOKD 4OV6B 5AM5A 4RW0A 4MVJI 3WL6A 4X91A 3LT2A 3OLZA 3UMVA 3N7TA 3K5WA 1CZHA 3QKRA 4UUQA 3U7RA 3AM5A 2YOFA 3E48A 3DR5A 1U9IA 2P1ZA 2J48A 4MAMA 5EE9A 2NV0A 3L9WA 3OD5A 4A4DA 2GXAA 1I14A 3QA9A 3FLAA 4C2AA 1R3UA 4RDCA 4YMWA 3K6SB 3GFQA 4PYNA 1P60A 2WNHA 3T3IA 2W98A 4TSKA 1VCMA 2F67A 2ZYSA 5IC5A 1BGVA 1W9HA 4INOA 1W8IA 2HHCA 3R3XA 1NW9B 2FB9A 3GJ7A 5LZ5A 5HE8A 3RSFA 3HXTA 3PWKA 4KSYA 3II6X 1KJQA 1R8YA 4CHGA 3U9SA 1F0PA 2ZUBA 5TMPA 4IDHA 3TX6A 4HYYA 4EI9A 4UTRA 4RQAA 4I4NA 2ERYA 1LJUA 4J8PA 3LL4A 1O6FA 1JQEA 2GCIA 2OOKA 4UHEA 3U7IA 3K9FC 4CGZA 4W6ZA 3RYCB 4R5MA 1CP2A 1CJBA 1XDSA 5JAIA 1E2KA 3QTLA 2N1MA 1YT5A 2YOGA 2N46A 5EQJB 3A4NA 2P11A 5BN4B 1VLLA 2ZZKA 1TAGA 3UY4A 4KR3A 3HBLA 3PGLA 4KN5A 2SNIE 1U9YA 1X8JA 1UZLA 4K46A 1GNTA 4R1PA 3G5UA 1PT7A 2AX3A 2CYBA 4DEXA 3EULA 3UAOA 3CB4A 5ESDA 1DJLA 2EF0A 4DM4A 2R00A 5AKIA 1SEPA 1YFKA 5IKOA 1YI0A 3DLBA 3DGFC 1DKQA 4L9RA 3H65A 1WU8A 7MDHA 5DO9A 1C7QA 3AG6A 1M2KA 1SBNE 1ISHA 4PX2A 4DT1A 1HT2E 1ZI6A 4LWQA 1WKCA 3BMXA 5KDOA 1N3YA 3E05A 1YXMA 2C7QA 2WEKA 4NSNA 4JQYA 1P7YA 1EHYA 1F2UB 1RI3A 2MT9A 1AGRA 3G9ZA 3QVGA 3GCWA 2Z4RA 3EZ7A 2WABA 4HLUA 4WCFB 3EIUA 3HJAA 3JQ7B 4NCXA 4W5TA 1RKXA 3E9DA 2Q1YA 2OQRA 1ZXXA 4LV5B 3CO0S 4YIHA 1M3SA 1ODKA 2QVZX 1RQNA 3SJZA 2P2SA 3CRNA 3IDZA 3EGWA 3U9LA 1R0RE 4M3NA 1XVTA 1OH5A 2PUVA 3IYLW 4JMPA 2C0PA 5DOVA 1DQZA 3QNUA 4L3OA 4XVRA 1Q77A 2C78A 4MW7A 3RKSA 1PCXA 1Z8HA 3FYSA 5EIBD 2BW0A 3TNYA 3Q8LA 2BDUA 5L3SA 4DLXA 1KBQA 2CJXA 2OFOA 3CEHA 3EF1A 5JZSA 2HJWA 4CIDA 1VYVA 5G3YA 4FZVA 2AN1A 2I7VA 2OY0A 3HDGA 1RMTA 1IHXA 4HFNA 3E7PA 5LXTF 2B6NA 2KYRA 5KOYA 4EHDA 3OPNA 1N9ZA 2X0DA 3NTVA 3COPA 3QJGA 5CX1B 2O8VA 4L9WA 2WKRA 1L5HB 3BIFA 3Q7PA 3LUJA 1HZZA 5CDSA 1TM4E 3K0EA 4OHBA 2X0FA 1AZWA 3B1KA 1IJEA 2PKYX 5I7AA 1NDHA 1XQWA 3I3SR 2B1GA 5JASA 1CNFA 3D0KA 1GPWB 1SXHA 3HN2A 3O2NA 3T52A 1TMYA 2GEJA 4RCVA 2I2CA 1E6WA 4KGDA 2VC2B 5EXSA 4JS0A 2AYXA 4OOEA 1M8KA 2VK2A 3ZU5A 4CF4A 2SHKA 2JLYA 3U48A 3OTWA 3CTPA 1VI5A 4HHEA 3O91A 1XT6A 3JZFA 2AR9A 2J9FB 5IVPA 5ADWA 2VF2A 5JAOA 2QU7A 2EZ8A 1C0KA 3CLKA 1XZBA 4MQLA 3W4KA 4B4UA 1RWXA 4MVWA 4OAQA 2CB0A 1XJWA 2ZW9A 1S3SA 1X1QA 4IIJF 4HQKA 1AUOA 4WXEA 2Q6IA 1FTQA 1QGED 3UB3A 1D1QA 3CTMA 1UK6A 2KHZA 2YR0A 3PX2A 1QVZA 1EQAA 1ODJA 1N2CA 2HWKA 3EMBA 3GEHA 4RKFA 2FLVA 4JJ4A 1GGNA 3FCXA 4XWYA 2GPBA 2RGWA 5FQNA 2P6OA 1JNYA 2NO0A 3GFGA 2W6IA 2G70A 4HADA 4U9HS 4KU4A 2YVKA 5TT0A 3VC1A 1GKUB 4AMYA 4C7JA 4PLCA 3GO4A 4U2KA 3U4QA 1V3QE 4IQFA 2P78A 1XYGA 1XVAA 1VPVA 1ZCFA 3IERA 3BIWA 2DHCA 3I72A 4KXWA 1NJ2A 5K05A 1XTKA 3LK6A 1IPHA 1JQDA 2PBRA 2Z2IA 5J59A 1O4VA 3QJYA 1KJ8A 1NV8A 4M89A 5J40A 4BGEA 1RAAA 1DV1A 1J07A 3Q40A 1LPSA 5JCOA 1TUEA 2FPXA 2UXDB 3P0HA 6ABPA 3LTNC 3IQDB 2RBGA 1WUTA 5DM70 3JD2A 3VMFA 3ON5A 2A9VA 3RASA 1CZKA 3FSGA 4ZOQI 3EJ6A 3TSZA 1TJPB 2JI4A 3K6JA 1YVPA 1XTUA 4U7TB 4QUHA 4BFWA 4JLUA 4PZEA 1NN0A 1VXOA 4OQZA 4RHCA 3K72B 4AF7A 3NM4A 3P26A 4KBYA 4QDZA 5ERYA 3KLBA 3S55A 2XOXA 2YHSA 1YKSA 4LHVA 3P5BA 3AH8A 3GLFB 4KFTA 2CXXA 3G8BA 2C99A 4Z7NB 4UTZA 4LDJA 3MJHA 4QTUB 1T3HA 2WJWA 5KSYA 4YHHB 4GM1A 4DR3B 3EZLA 2EARA 2I4IA 1YU6A 2Y68A 2JK1A 4QYSA 4A6XA 4F71A 3EDCA 4BN5A 1CHNA 1BVUA 1MA3A 2ON6A 3I0MA 4RQBA 4CM9D 5AJZA 4DA8A 4EUKA 5E6SB 4Q9DA 3ILVA 1EINA 3R77A 3DCNA 3DTTA 5AI9A 5EQFA 2ETVA 2CL6X 1TFRA 2PGOA 3UAZA 1HDYA 4BV8A 2J3QA 4TKVA 2OHOA 4IX1A 1X1TA 2ZUTA 1DKNA 1OR8A 3AF0A 3BFXA 3B8EA 5ENVA 4LGVA 4IV8A 4ZV7A 4BP9A 3EGXB 5IAEA 1GPH1 3A1VA 3CZPA 4BVLA 4MQBA 3KZVA 1NLFA 2XUPA 1WSWA 3E1SA 4K6CA 2R6HA 4XGRA 1OYVA 4ZHQB 2RAPA 3MTJA 3ZDEA 1Z3CA 3ACBA 4DJTA 2IY7A 3N28A 2Q5JA 3D0OA 2EKPA 1Y5MA 4L5AA 1EFCA 3H5OA 4MQUA 1E1MA 3P9PA 4PC3A 3ZHOA 2H17A 1B3RA 2ZB2A 1K92A 2B2CA 1P5HA 3BMCB 2VXYA 1OZHA 4FDUA 4URFA 3QIVA 2R6GA 4C07A 4H31A 4TUYF 4K8OA 2NNLD 1RAFA 1Z2CA 2OBNA 2A84A 2F3TA 5CT9A 4AMUA 1J0CA 2AYZA 2Y6UA 2Q9CA 1DRJA 5T41A 2RH4A 2UDPA 5HTOA 3T5TA 4AO8A 3RARA 1FXWA 2MR6A 5GP1A 3FKSA 3GVHA 1LPBB 3F6RA 4TXHA 4L8LA 2J6IA 2VOEA 3JVIA 3KOMA 3L79A 3MWGA 4IUBS 4REMA 5K45A 1ZAKA 1GIAA 3V7WA 4DCVA 1N2CE 3G23A 2FF5A 1R8JA 2XR1A 3KHUA 4HLNA 2IE0A 5E6RA 5TARA 3ZWKA 4OHYA 2Y1EA 2QAGC 4HN9A 1EEHA 5EEHA 5T4HA 3R6DA 3JQCA 3DDZX 4IS2A 2O2HA 4PNPA 5SZIA 4L9SA 4F93B 2BFCB 2EBFX 2GS9A 4LPKA 3B6IA 1MHPA 1Y3CE 1O94A 3H9GA 3LP5A 4TV8A 1N6LA 4ZV9A 4MQFB 2BDEA 5ALKA 1GA1A 3QPBA 4EELA 2ZI3A 2WUEA 1BFKA 4KDCA 1JDBB 2R1TB 4XPIB 3RUFA 4BPRA 3OZRA 4FFBA 3IILA 2UUBB 3QKTA 1EE9A 3IP3A 3TEJA 3ZJYA 2O2GA 2CL0X 3AEZA 3BGDA 3R9WA 3WY9A 4LXIA 3HHPA 1PS9A 2B9EA 1TEXA 4JIGA 2ZVJA 4IJMA 4TXJA 1G5HA 1LS6A 3A9SA 1KZ7B 3AHJA 4B4VA 4EUHA 4OLAA 5K1ZA 1WWKA 3MTDA 4BFTA 5LOVA 2EU8A 4WZZA 1JEQA 3HCDA 4MA4A 5TPWA 4BFUA 5L3QB 4NJMB 1QYDA 3PC7A 1T3ZA 5EIFA 2INGX 2IYNA 4JUDX 4ESVA 4K0RA 3L4SO 4BVKA 3E9RA 2PVCA 2UVPA 4PW0A 4DR7B 2PKRA 3C7CB 4E5NA 2RGCA 3P9NA 1QOQB 4R8LA 4MKIA 4Q9KA 4WOPA 4AZ3B 4D9EA 2ODAA 1S02A 4L6CA 3SKXA 4I36A 4E88A 3ETEA 1TO6A 4DG9A 2UUCB 1Q5PA 5A03A 4DN6A 3AR2A 4GWLA 3A31A 4QNMA 3V55A 1ZUHA 2AFRA 4FK8A 4B45A 1RYEA 4NU5A 2AUTA 4M8IA 1E8NA 1KS9A 4RSRA 1R9GA 1V95A 4OL0A 4A8JB 2AN5A 5K0TA 5MFPA 4NESA 4KPYA 2XQVA 5KQLA 1WU7A 3DYVA 3H6GA 4MS4A 1II0A 3LC1O 4YASA 4M1SA 4ZOEA 1YR6A 2WBLC 3UCXA 3IA2A 3SFZA 2OESA 3NI2A 3VH3A 3PXDA 3ITEA 1DBPA 1MO6A 5ALIA 3PXGA 2XUHA 2KX7A 3FDXA 5LB4A 4M0EA 3EQ6A 1ID1A 1VMEA 3CZMA 3ENKA 1J9ZA 1XE3A 4UFNA 4ZI7B 4K2HA 1OFUA 3X2SA 2YL2A 3MSXA 1E3LA 1SC9A 4OXKA 1XOIA 1O3YA 2J3KA 3FYUC 4G85A 1ISIA 1KMNA 2AJLI 2IY8A 1U0SY 3NX4A 3AEUB 5BRAA 4FHDA 1RHMA 1GZ3A 1KU6A 2Z8ZA 3EFHA 1CD5A 3HG7A 4PCVA 4TLMB 4X62B 1TVEA 4F3TA 1KRHA 3RSOA 1C3EA 4G8JA 3V8BA 2ONYA 3O9VA 1FSZA 4KWCA 4W6QA 1QQAA 3IBGA 4RF5A 1FW8A 2FX5A 1HRKA 2WTMA 1QR6A 3F49S 2XIJA 2PXAA 1YJAA 3RK4A 3ADOA 1E62A 1OHHD 3F1LA 1VPDA 2LBPA 3K5IA 1D6SA 3HCAA 3C8ZA 1IWBB 3GJ3A 4AZ0B 1XAJA 2X5NA 2J30A 1HQKA 1WLSA 4PYIA 1X1BA 1DBSA 3JRNA 4WSOA 3I05A 4C0HA 1JJFA 3E4DA 2ISCA 5B1SA 1EGVB 2NUBA 2V6MA 4F38A 3NBUA 3DEKA 2BEUB 5DBHX 5KREA 1UIRA 1R12A 1NXOA 1MENA 3FHTA 2CVFA 4MGZR 1H6DA 3W8RA 3K31A 4Y1EA 3GGJA 4OQDA 2X3UA 1VKJA 3RTBA 2OXCA 5AVJA 1GPMA 2G3YA 2W22A 5FTKA 3T5PA 2ZBRA 3M4YA 1YQQA 4O2BF 5LQDA 1OLSA 1I32A 5F5XA 3A6JA 3I5MA 2RH8A 2YFKA 1DZIA 1ZD8A 1CS4C 3ABIA 1V96A 2FEKA 5TY0A 4WASA 4E08A 1JHPA 2BLNA 5JCPA 3V3KA 1CQJA 2ICAA 2NXCA 1I5OA 3SG0A 1EJ6A 2P90A 3E03A 4BE9A 3AVVA 3CG0A 3EZYA 3AF6A 5IT4A 3GPBA 2KW5A 4Y6GB 4D8XA 2W0SA 3CV3A 4XA8A 3QOXA 1ND6A 3AUJB 4UAGA 5KKAA 3SQOA 4YCLA 1E3WB 1P39A 1WHTA 5AVOA 2I71A 4LRUA 3PNLA 3BJMA 5L40A 1IRIA 1MJ5A 3GCDA 3JASA 3MJTA 5AOAA 2DWPA 3T6KA 2Q2QA 4I8IA 3UHPA 4E11A 3MRTA 4WPGA 2K2QB 1RTTA 2GJAA 3KQKA 4REQB 1FSSA 2AFHA 5T6BA 1YUBA 1I7LA 1MT0A 1VG1A 2QHXA 3HB4X 2EEZA 5TQ0A 1AKQA 4BMXA 3RYHB 4E4RA 5FUQA 4N6GA 1AKEA 3DO5A 5T57A 5LMZA 1TXGA 3GZNA 1IY2A 3FSRA 4TS1A 5CXXA 4U4AA 1DAIA 2NNWB 2ZJYA 1VSVA 4CMCA 2XUOA 2BLLA 4RH1A 2C4WA 2ZIGA 4KFRA 1ODFA 3GJYA 3L1VA 3WSTA 1BMQA 1Z18A 1VJTA 1T5TA 4XVQA 4CEJA 4P33A 3UJ9A 1E92A 4LQ4A 4TROA 5ADUS 1NZJA 4GGPA 5SZJA 5A6SA 2PTHA 3L1KA 4J0IA 4A5OA 2FPMA 2OUKA 3MLAA 1VGRA 2ES4A 2NXNA 2H85A 3PCTA 3M82A 2WVGA 3A25A 5DWVA 1K2VN 2O3RA 2V9CA 2WU1A 4OCZA 4Y18A 3NBAA 1NPTO 2HIHA 2P77A 4KV9A 2DHDA 2ZYTX 4WAUA 4PAMA 2ID7A 1GAWA 5KYVA 2W8BA 2QNRA 2XYQA 4KBFA 4Q3LA 5FYDA 1KTIA 2Y6VA 3T5DA 3BXFA 1U0RA 1MVNA 1ZGBA 2HUPA 2Z4SA 2Z1NA 4HDAA 5LSAA 1MAHA 1JBQA 4RTJA 1XRNA 1BJRE 5IAOA 3T5AA 5K8JB 5DCWA 2ZBPA 1OZAA 2I66A 3PTAA 3CPJB 2QXYA 4GR5A 2Q5OA 2B83A 1E3JA 2JAUA 2P4QA 4KLZA 5F78A 5IANA 2R6JA 1W49A 3DE3X 4JJKA 4PLHA 4UUNA 1ORIA 2JAOA 2Y8EA 3AERA 1OKKA 1ZUNA 4MRMA 3SC4A 4KEAA 2O0HA 4ZVOA 1D2AA 2YWDA 4L1KA 3QY0A 1F3LA 1GZ5A 3BPSA 3H5TA 1GCIA 1HG0A 2Y71A 3P2MA 4NS4A 5BXYA 3VR6H 4IHJB 1JQAA 5HZKA 2JCXA 2CJPA 2I67A 4OM8A 2J87A 4GKKB 4XR4A 1I36A 2R8ZA 4ZYUA 2QB5A 1UKAA 1LJ8A 2RBEA 2XB9A 3GJQA 3ZJ4A 5KJ1A 3HR7A 4O1HA 3NOQA 3PXUA 4NF2A 3L8ZA 3DWIA 1KQGA 1U0TA 5IM4A 3Q3CA 5FPQA 2IOFK 2QL5A 5CFOA 1N1MA 1NONA 5TF0A 2VJBA 3CZRA 1GEEA 3IR6A 4ZYTA 1X8KA 3ZOKA 1U8XX 1A69A 3G1UA 5IJ9B 4I4IA 4JY7A 2CXHA 4WI1A 4WOBA 2JDIA 5BVGA 5JY1A 4L85A 4N9QA 5CCXA 3HO1A 1SO8A 1AKYA 1GXSB 5JVDF 1M2OB 4XWKA 3GLRA 1UFVA 4R6XA 4C7MA 2BGGA 3A4VA 1U7UA 3WO1A 1H66A 3LW7A 1G4HA 4I55A 2R65A 4N0EA 3W2TA 4HDNA 3FYCA 2CHUA 3F46A 3P9KA 1J1UA 4NOMA 4CQLB 1GFIA 4CVNA 3FFWA 1FC0A 1JYEA 2D06A 2WSYB 4MYHA 1R4NB 1P2UA 1XJCA 3K73O 4C88A 4POOA 2VYVA 3FWZA 4YS6A 4ITUA 4X6XA 1X7YB 2XCOA 4ZZ2A 2C5BA 5DK6A 3CWZA 1VL6A 5K0NA 4HY3A 1WF6A 1QIGA 3G3EA 4UULA 5FUXA 3WAKA 1EFRA 2AFHE 1CQIB 1KYTA 4EW2A 1H0HA 5JDCC 1KO8A 3L05A 4JELA 1OASA 4WKOA 4TVOA 5C3UA 3O93A 3RIGA 2C95A 1KC3A 4PE5B 1T5SA 4BFXA 3WTBA 1J1ZA 2XZPA 4R81A 3ADDA 1YQDA 2VTDA 3ORHA 2WLTA 1PD0A 1ZPDA 3SHOA 3HVKA 4MKXA 3TTTA 1Z63A 5BQ3A 1YDFA 3KQQA 4YRCA 2G80A 1RP7A 2XIQA 1PDWA 2H11A 4LVOA 4ZT4A 1P8AA 2LRHA 4KK4A 3ZU6A 2C5SA 4DCGA 5AKEA 3VM6A 1VJ1A 4DIUA 4YRTA 3PDUA 2SKDA 2VBCA 3IHKA 2H0QA 4GX2A 4YYZA 3L0IB 6CHYA 4I2VA 1H94A 1E1DA 1M9NA 4P7BA 3DTNA 2C0CA 3NVAA 4Y6PA 2JIMA 3OBIA 1NNSA 4X1KB 3RU7A 3CX8A 1GRNA 2RJNA 4P5EA 2DM6A 2W6QA 4BX3A 4DCNA 2AGVA 4E09A 521PA 1P2FA 3TZEA 3ZDFA 5IXSA 2Q3MA 1GD1O 1EFLA 2OECA 2VDMB 2WNIA 3K8ZA 3NHKA 3M6WA 5THQA 1DQPA 2IYAA 3K5HA 1OLUA 2BP7B 3C2QA 5B1IA 1A4RA 1BKSB 3GGDA 2R8BA 3JAMA 4ECAA 4WERA 3PQ6A 1FRQA 1F0YA 3IDFA 4I1SA 5FBQB 2XQJA 2H0AA 3N74A 4JYBA 1C3XA 2XWBF 2O07A 4G01B 4OQEA 4PO3X 1SZDA 3O84A 3PF8A 3V7FA 4HCJA 2PTGA 4KQ1A 4LYHA 4CIBA 5LYJF 4DLLA 3HB1A 1HQCA 1NTRA 2BSQA 5LIPA 5HWSA 2WF9A 3DL4A 2QRJA 1PR9A 2ST1A 5A3QA 2E4XA 3H17A 5KTTA 1EP9A 4HXGA 2FSIA 3HYCA 3KOXA 5I5GA 3RVOA 3ZBTA 2VRCD 3LBNA 3SM3A 1GV1A 3ROTA 4HGNA 4EDFA 1IVSA 2C97A 2F9MA 4JJEA 1JXMA 1Z25A 2IH5A 1W75A 1GSOA 5HZMA 1G7CA 3I1JA 3C8UA 5KU7A 3AP1A 1P1IA 4TL9A 4Y1FA 3W9BA 1MJGM 4YAUA 2R0QC 1E61A 1C0IA 4CM4A 2NVBA 4K8RB 1EWQA 4J94A 3RD5A 3TKYA 5K6AC 3V32A 3WL8A 3V4SA 3PFHA 1BA3A 3PNOA 1YKFA 2GH1A 4PZCA 3D5QA 4H7EA 3N05A 1GTRA 3PV0A 2F9LA 1V6SA 4YJKA 4ZK6A 3EMVA 3E0XA 5BP7A 1OAOA 2DY0A 1EFUA 1U4SA 1S4MA 1VG9B 4Q5IA 1CR6A 5BPFA 5DGXA 5IDQA 4UVHA 1I51A 3IPLA 3GH1A 5JCJA 2KJQA 4XJXA 2YQZA 1BXRB 5HOQA 3ET5A 1H2XA 3P9XA 1QZTA 1QLWA 3CLTC 5E4YA 5E7MA 5JQGF 2ZFUA 1PFWA 1T1JA 2IEAA 2ZWMA 2A94A 2YFYA 3HC7A 3B13B 3LDAA 3M4ZA 1Q15A 3QOWA 1EK6A 4C29A 4DMGA 3K1ZA 1Z4NA 1ZOOA 3FPCA 1J5EB 1TZKA 5IH7A 3C3EA 4TOIA 3PKIA 3F3MA 2YRFA 3VTFA 4UUBA 4R83A 2I8CA 5FQOA 4G25A 3WGZA 3NDRA 2HZBA 1XTSA 3E0QA 3IVMA 4YRFA 2VVTA 2YMPA 3HE3A 1K0UA 1T2UA 5B7NA 3QE2A 4YXFA 1FTNA 1X6VA 5KHOC 2DG2A 2X2OA 4KSBA 4IXNA 3NB0A 2BMVA 2AXPA 2OAP1 2PRIA 1E63A 3OCCA 3ETHA 5EJFA 4OO3A 1F0KA 2ACKA 3GAMA 1G20B 4L4SA 1AOXA 2VZEA 1LK7A 3ST7A 3LUDA 1Q14A 4YP6A 3IURA 4EQZA 2JLSA 5DE3A 3STTA 4CLRA 2XOKA 4JCOA 2CL7X 3SE0A 1SBYA 4M0CA 3CA8A 3E35A 3BH0A 5IFLA 1Z4MA 2YHAA 5EJEA 4TMXA 4CTKA 4KZPA 3HU5A 5CLHA 1N2SA 2J3IA 3FMVA 3K2IA 2P7IA 1VDMA 4UQOA 1XKQA 3SKVA 3AHEA 4KTTE 3JWPA 2BI8A 3M5CA 2DUUA 1CB0A 4XFJA 1OV6A 1QZUA 1R27A 1Z83A 4JOQA 3FPKA 5EXTA 2VWQA 2IEZA 4LHYA 4YUXA 1D2MA 1EK5A 2PK3A 1XELA 1NJ8A 2PWYA 2IZ0A 4YO7A 3KUKA 4OHVA 2OFWA 4ENWA 3AR3A 1YNOA 2RCYA 1T10A 3OJ0A 3PENA 4EF4A 5BNIA 5DM4A 1NV9A 3S3TA 1XP5A 3I92A 4IXWA 2RG1A 4MWZA 2EZTA 2AJ8A 4PXAA 1GKIA 3S8YA 3IUJA 5DP2A 2A5LA 3KT6A 1EFPA 2J0VA 1TKBA 2PUJA 5ICGA 5L53A 1NFFA 3M2PA 3MJRA 4DLKA 5JS8A 3C5CA 1XC7A 2H4ZA 4RK5A 2JJ8A 3WLFA 1NI4B 4NABA 4JYAB 2O1WA 4TZKA 1VMAA 1SK9A 2WUDA 4GLLA 4R8RA 3DLHA 3EFBA 1T1SA 5CYFA 1VP3A 2O23A 2XNSA 2X5JO 4LNHA 2JIQA 1ENYA 2Q9UA 3H5VA 4XIFA 4OFBA 3B9QA 5LYYA 1ZD3A 3LOUA 4FC7A 4D56A 4I3FA 4HB2A 1Z0SA 3DKPA 2W6JD 3K9GA 3Q9LA 5ALOA 3KBBA 1IBRA 1CF2O 2BI4A 3BBLA 3H8WA 3U09A 3LHIA 2PD3A 4H7FA 4P3KA 3G5MA 4RS4A 1FX0A 4LJ7A 1H85A 1U2SA 3F3YA 1DTWB 2Q3CA 1L3BA 3N8DA 3PHIA 3PNBA 4FEEA 5DW3A 2HJVA 5AOVA 3S27A 2QL7A 3CPSA 4GOKA 3CNEA 4B8ZA 4WN9B 2XUGA 4D0NA 1IZYA 1VBMA 1OFTA 3DP7A 4R1QA 4FYVA 5JSUA 3WG9A 1CY6A 3VVCA 4EH1A 3SEZA 3VTKA 1GNSA 4I1IA 3TMKA 4OQXA 5K0FA 5KYNA 1NW5A 2ZJ3A 1IQ0A 4Y2HA 5HUQA 3TQOA 1NF8A 1PJ3A 2FWAA 2J3MA 5EN4A 1BRMA 1ESDA 4M60A 5AK0A 3QP9A 1KZ6A 2PN1A 3BGIA 3Q88A 3S1AB 2C7OA 5IT5A 5KNBD 2YMLA 5IKMA 4FSXA 4C1BA 3OIUA 5IKXA 3FNRA 4XX0B 1JLSA 5H3LA 5I7OA 5L7WA 1Z26A 4P82A 5D51S 4BCBA 5KWSA 4G0MA 2VK8A 2YN0A 4WZAA 3KJHA 5LNK6 2IY9A 5LP6F 4Y98A 1NMZA 2G0AA 1TMOA 4MW9A 4CUJA 3KYDB 2YHIB 2RHGB 4B2IA 3K8OE 3DEZA 3BMOB 2DAPA 2P65A 4IVNA 4JYMA 1XHLA 1RAHA 1SVKA 2ODEA 2GBFA 1M72A 3G02A 1HH4A 3KT3A 2GJKA 4KYIB 2ZM6B 1RLJA 3T54A 1EJBA 3EZ9A 4JC4A 4FZRA 1WDKA 2PZJA 5TPZD 1YA6A 3QGMA 1I80A 1PNRA 4IMJB 1FMCA 1CY0A 3EEYA 1RXYA 4I19A 3A3NA 5H82A 5KPJA 4KO1S 4UTOA 3GGGA 4QEKA 4FHGA 4H27A 4V38A 2I55A 1W2GA 1R0CA 1W5TA 4HLQB 3WYFA 3A2KA 1F9EA 5A5VA 5CD1A 2FVYA 4HWGA 3L7NA 1JHDA 2OBMA 3M70A 4I9UA 3L8FA 2VDVE 4B17A 1XROA 4ER7A 2IOHA 5KTNA 2XE6A 3ORSA 4N8EA 1APBA 3AOGA 1DBRA 2QZSA 1UWKA 1RLMA 2H3HA 2AD1A 1JIXA 1ECLA 1DAPA 1NMYA 4K2AA 1KEEB 1VJGA 3BCSA 3OURA 5M3BA 3RWBA 3ZUPA 3OQ1A 1OT3A 3HVHA 2JFBA 2QM7A 4A2QA 4WBNB 1CWUA 1X77A 5JMPA 5LA6F 1B0UA 2GOYA 1SCQA 3WIDA 1QIFA 1AKUA 2WAMA 1CJCA 1LPNA 3I39X 4AY5A 1RC0A 1P5RA 4MWTA 2CF6A 4E1AA 3M6MD 1EX9A 4LY6A 3TR0A 4DREA 5CDUA 5JTUA 2G8NA 2ZSAA 3EGOA 1BD4A 1H9CA 1WNTA 3TAXA 4UFPA 1WXGA 3B1FA 2V6GA 2GZMA 4MAFA 1CV2A 4NIMA 3Q3JB 3TJMA 4EMSA 4GBED 5JQGA 5CRIA 1XRJA 5FR2A 2WICA 5I7EA 1NKVA 2QDKA 4QBGB 1MTOA 2AB0A 1MDBA 4FM9A 2VZ8A 4C0XA 1UF9A 4IO1A 1T8YA 1LDYA 1ZUWA 3PC4A 4MLCA 1E79D 1D2NA 2X4DA 3F2IA 2QG6A 1ZS9A 1MABB 3OZAA 4FS3A 4O8CA 4QOIA 4D98A 2QN1A 5ILGA 3LUAA 4EUNA 2V6BA 2X0RA 2QRHA 3KXDA 3B38A 2GWHA 1AO3A 1DQSA 3BSFA 3GGPA 4FYJA 4L4XA 3B60A 2QLBA 1P0IA 2GFHA 3PPIA 3WZ2A 3GGCA 4GMXA 3KVVA 5EJ4A 3JCZA 4N5NA 1R5OA 3HYSA 3TLXA 3CF0A 5EMHA 2GPAA 1V5GA 3VH4A 3DMFA 1CULC 1H3NA 1RMYA 5KMGB 1GUDA 1NMSA 4LECA 4JT2A 3FZEA 4C7KA 3JRWA 5AKYA 5FLXA 3OOSA 4FN4A 5LP6C 1N9KA 2WP0A 4Y67A 4R2WA 5JDIC 2HV8A 3T7KA 1VPWA 1LSUA 1FYXA 2XMDA 4UEOA 2QNBA 5DGCA 2RHWA 5A62A 1DO2A 3TTUA 5KYGA 3I58A 2HX1A 2IYWA 3BILA 3DAYA 4O2AB 4PG4A 4RE5A 3T4XA 2FPIB 1Z06A 3ANTA 1KJNA 1IN1A 4UU1A 3FFXA 4Q1EA 4NBRA 5IYZF 2IYXA 2PCLA 3RTAA 4V0LA 5AK5A 3KYIB 4C4YA 5KEIA 4R3WA 4P3XA 3HPQA 4QTYA 1T8TA 1EFVA 2YX1A 1X1SA 4WZAE 4QVIA 2CNWD 2DX7A 2AL7A 4RMGA 2Q1SA 2IX3A 3B53X 3JR3A 4BWGA 2C9DA 5HE9A 4MV1A 2GTPA 3DG9A 1MTZA 4MZXA 1QS0B 4I1VA 4CM9A 2DQSA 1EGMB 1KFKB 4BNNA 1P1CA 1UZMA 4US2R 1BH2A 4CM6A 2W5UA 1LGYA 3ONNA 4J1NA 1MQ9A 4PGFA 4V0OA 4Q93A 7AT1A 5LQSA 4LDPA 1L2TA 1ZW1A 1EFKA 1ZICA 1JV2B 5G02A 3IO3A 1FDIA 2UZAA 2V5UA 1E69A 4Y6RA 3LI2A 4U6SA 3N7AA 5I4CA 3GNLA 5FI0B 5AUQA 5HJ7A 2ZBDA 3TIXB 4R16A 5D5HA 2EVWX 1USUA 3ISJA 4CGYA 1GTMA 2O2YA 4I1OA 2OCBA 2HLHA 3GYBA 5FTJA 3WYDA 5ALUA 3U6KA 2C29D 2FR0A 4IO0A 3SJUA 4WFJA 3W3AH 5C4MA 2DKOA 1LC3A 1BHQ1 1ZCBA 2F8LA 5AI8A 3E8SA 1GCUA 3ZJ5A 4KX3A 4XD2A 4CR8A 1T43A 4X6UA 2DWQA 3LQRA 2DWCA 1GDDA 4DRXB 4MHTA 2WZDA 2XB4A 3E4CA 3JV7A 3MYYA 5CNMA 1PTJA 1XZGA 2UUPA 3AEKA 2MSNA 3MCTA 5A1JA 5J2UA 3VNQA 1ONNA 3AFGA 1R0YA 3DE6X 4KKVA 4OVKA 3S2EA 5I7HA 1Z36A 1BSVA 3PHJA 3WLTA 3ANSA 2I2WA 3TRJA 1D5CA 1P31A 3V6LA 2CVHA 2C00A 1CUFA 4LY9A 4TTAA 1S9DA 4MWEA 2E3JA 3VJMA 4OREX 4YRNA 4W8HA 2OZVA 4EITA 1E6UA 1LA2A 2B6HA 3BHIA 4WKBA 1YOBA 2WJVA 5ABPA 2ZI9A 2FSVC 1HFJA 5J4VA 1X7GA 4FHCA 4V03A 2B4AA 1HTWA 3DOEA 1CUBA 5J5VA 3B78A 1YDMA 4L57A 3F5QA 3NC4A 5AVWA 3IOMA 2W9XA 5CBPB 3AKYA 1UXIA 5CJPA 1E2PA 3T3GA 3ZDYB 2WUVA 4Q1VA 4EEZA 1P6QA 3WOVA 3WYGA 2YVLA 3CRMA 1AUPA 1P2VA 3PWTA 1EUCB 5DI3B 2DTEA 2OXIA 5JH7A 1Z5GA 3IQWA 3IIKA 5ITVA 1XTPA 3ZXUB 1EXNA 2BL4A 3OT4A 3QVOA 4MKHA 1T8PA 2AFIB 2GNOA 3FPFA 1FDSA 2JGEA 3VO1A 2Q7XA 4NCHA 4E3WA 3H8JA 4DYHA 1J4AA 1JJIA 5ALNA 1TQ4A 4CODB 2C9CA 1TKAA 2O8EB 2EL7A 8MHTA 3RYTC 5AFSA 4R3UC 3DKRA 2JF0A 2YN4A 1GZUA 3SHVA 4X66B 1OVMA 1MH9A 2XMQA 4L8GA 2AKAB 4YJDA 1GA4A 3W7BA 1RYDA 1RJDA 1TEZA 2O54A 5ALYA 4ZJZA 1NP3A 5H7XA 2VHJA 1RYYA 5JXWA 2UZ1A 1HDRA 3DKVA 1T9HA 3DOIA 1V5WA 1FFYA 2W70A 2OCXA 4Q7EA 1FSFA 1KOGA 3PGMA 4HNQA 3ML1A 3RYFA 3ONWA 3V33A 5HIMA 5CFPA 4A0HA 3V5NA 1N4AA 5G4LA 5DYGA 1CFZA 2YV2A 4QT4A 5CA1B 4DHEA 3GFRA 2FN7A 1F6BA 5EJAA 4Z0PA 1NY6A 1AJEA 4GXQA 1JQ3A 2QVYX 3NWJA 3ZDQA 4BFVA 1JS1X 1MD9A 2PUCA 1NZDA 3ZBQA 2AMVA 4BMOB 1U0EA 1Y3BE 4BNZA 1MB4A 4YJ2A 5D2CA 1Z56C 4ND1A 4OQNA 2R5WA 3AILA 4AKSA 1I0ZA 2JRCA 1ICEA 2QRLA 2BMFA 4QXRA 2ZJBA 4JI4B 3AV0B 2NU7B 3A1EA 4DARA 3Q10A 4K6HA 4OUDB 4Z0TA 5JYEA 1N7IA 3TRHA 2GBLA 2XMSA 3DMDA 1Y3FE 3QKSB 1PVVA 1OH6A 1SXPA 2QSYA 3ZKWA 3FSEA 3QWIA 5EMJA 3VR3D 3BT7A 3QU4A 4PBRA 5A5GA 1EIWA 1XTVA 1AKWA 4DJJA 1EGQA 1UPBA 3QLTA 1NF9A 1YR3A 3DJFA 3TZCA 1EM8B 3ILSA 3KSBC 2B4RO 2YJ3A 4EJSB 3LO5A 2I29A 3ZVMA 1YI1A 3KS9A 1CG6A 1RJ9A 1EIZA 1XTZA 1O5IA 4HTFB 1P0FA 1L4EA 2LTAA 4KXQA 4RH0A 5F3RA 3ZWOA 3U56A 1A9TA 1KI6B 5GGYA 3EF3A 3KVYA 2RGXA 2ZYVX 4YV1A 1M7HA 5JSZB 5D84A 3H9QA 1MB2A 3KQHA 1ZCAA 2BHRA 2BEVA 5HK9A 2HGZA 3OIYA 5E9AA 1O5TA 2Y76A 1AQYA 3B9BA 2PMFA 5H0IA 3AW9A 2DMRA 3A6ZA 4LE0A 5D3ZA 5BUZA 3R6WA 3FX2A 5KC9A 3PXCX 2W2QA 3CUSA 2GEDA 2L82A 3FDFA 4RVFA 4X3OA 5HFNA 5CLFA 2R7LA 1YQTA 4N8SA 3KCNA 4DJEC 5SYAA 2D00A 3BCRA 4M37A 4NFYA 4M87A 4N39A 3R7DA 5KTKA 3PI7A 3BEDA 2ZCUA 4HEHA 3LZDA 4S12A 1I24A 1PGNA 3S28A 4PFJA 4JKIA 1YHNA 2Y0BA 4MA0A 4QUIA 2CNDA 3UG6A 4QDXA 1U7WA 3LJKA 4LNUA 2AA3A 4MVJH 5EZQA 3WJ2A 4GECA 5EJ7A 4TLBA 4NENB 2CJFA 1VJRA 4KQFA 5IDVA 1A97A 5HQ3A 5H83A 2GVNA 4CM8A 1F4LA 1M54A 1JYSA 5LKAA 3B3JA 1SQ0A 1T0JB 3QV2A 2H00A 2JARA 5ERXA 3UK2A 1WQ3A 4X20A 3ROMA 3GR6A 3EXHC 4GL4A 1J8DA 4LZWA 3NPMA 1DAFA 2J0UA 4OH1A 1LVUA 1P18A 3D6FA 4GLJA 4UASA 1OH8A 1GQOA 1CUSA 2VHQA 3U1TA 3CJQA 4C5CA 2DY1A 1O9BA 3RBVA 4MI9A 1MAAA 1LKZA 3GRFA 1PQWA 1TZCA 5FFMA 3B12A 4LRYA 5MGBA 1ZJJA 3AUKA 1CY2A 3ICVA 2ZR0A 5TGZA 5GVSA 1GAQA 1Z6AA 5AVQA 1E2HA 2I3ZA 3CLUC 1Y8RB 1L5VA 2QZ4A 3T35A 3P1JA 3NHSA 3W4IA 2Y1OA 4BO7A 3DOHA 3TPFA 4ITVA 1M1NA 3G8CA 4IDFA 5EMMA 5AXAA 4PG5A 5F2EA 3V8RA 1T1EA 4TMKA 2O8DA 4JXJA 1PDVA 1NATA 4GX0A 1TEVA 1HTBA 1Y4SA 2V7WA 1Q1EA 2C2KA 3SZRA 4MVCA 4HAIA 3P9IA 5GINE 3TLGB 2L42A 1L7NA 3ISTA 4LY0A 3V4ZA 3W2GA 4AB1A 4BMCA 5EUQB 3HPRA 4RTKA 1KAOA 2ZCVA 1A4XA 2J6HA 2P3SA 1I6LA 3E5MA 3USES 3GV0A 1VHQA 3AUSA 3WK9A 3FOAA 1ZP6A 3HFSA 2GK4A 4UPDA 4WZBA 1I6MA 4AX4A 4DPLA 2O59A 1RZUA 4IEEA 3KXLA 1TF7A 3AUFA 3BD6A 4GX1A 1T4CB 2GHIA 3CJRA 1G19A 1UBFA 1IK4A 4RTSA 3KB2A 4OYRA 3I28A 2DBZA 1SBTA 2LCQA 1DAGA 2YRXA 4LXHA 1JDJA 3HVJA 5A7GA 3EEIA 4IVPA 4WQMA 1ML3A 3REOA 4O3FA 3H4VA 2VJPA 3LUKA 4IIUA 2GLUA 4OQMA 3OIFA 4HRVA 4RANA 4WOJA 2QM8A 3RGGA 1UJ5A 3F0TA 4FSHA 4LI3X 5EHQA 2O50A 3DWFA 5DTIA 4RORA 5FLYA 1GFSA 4UEWA 1SUCA 1YB6A 3WLRA 3ICOA 5AI6A 5C4GB 4UFOA 5FADA 2Z56A 3ZY2A 1NQOA 3SR4A 4HDRA 4YT5A 4X0EA 5JO0A 3F7MA 4PLTA 2I7XA 5DSTA 4EI8A 3EHEA 3P7MA 5C5EA 8AT1A 4UCQA 3THYA 4HT3B 2P8SA 2O8CB 1AKTA 2ZJ5A 3BKWA 3T3HA 4YXWD 5SICE 4AXBA 4JQCA 4KN9S 2O8BA 2F43B 3NIGB 5J1TB 4D6PA 3HVRA 3OZDA 3QELB 2CVQA 1QK4A 1EDZA 3KFVA 3GN1A 1E1NA 2XY4A 3OG9A 3UAXA 2P0YA 3PUWA 3SJCA 2JGJA 3WSWA 4LTDA 2PJRA 4DB2A 4B6SA 3ZZMA 2EHJA 2FCRA 3K4QA 4I9NA 4M0PA 4ZGGA 4D8VA 3OIWA 4ZDJA 4MR9B 3EEFA 1C7FA 1ELOA 1SKBA 1NKSA 2QGFA 2O05A 3UC5A 4YJGB 1XZJA 2ZBGA 1O97C 4U7HA 3REQA 4F8JA 2QAJA 3M6FA 3OMLA 4RXMA 4B6PA 4CQMD 2JH3A 1SZCA 3D3EA 1GCGA 4IOMA 2NSJA 1GP2A 4MWOA 4ERNA 2ZKLA 4QTZA 1E59A 5L7TA 4B81A 4F84A 4Y6LA 5CA0F 1L5RA 4IGKA 5F4BA 4OJQA 4N5MA 4JJAA 2ZE5A 4R3NA 1U94A 3IXLA 4RPJA 2F55A 4UM8B 2ET6A 1MF7A 1YJCA 2RI6A 3RSLA 2WAAA 2XUJA 4XEUA 1ABEA 3L77A 3PDHA 2LKDA 2OLKA 2WIJA 3PNMA 3GL9A 4LBZA 4ENPA 3LBHA 2HO5A 3WRYC 1CUJA 3N70A 4BN0A 5G0WA 1R10A 2GEFA 4M1EA 3FVWA 4M53A 5CXQA 1SOMA 5EWLA 3SKYA 5K8CA 3S5JA 4EVRA 4GZMA 3VNVA 3X1MA 2GN1A 3G0BA 4RS3A 1U1EA 2RC5A 4LMPA 4E70A 5BV7A 3CNOA 5K4AA 3HYNA 4MQ4A 1NM5A 3T1VA 4E15A 3UENA 1IDN1 4UXIA 4ER0A 4ZTBA 3ZTYA 1XG5A 2DBVO 1ZR4A 4CI9A 1Y6RA 4OGWA 4UZSA 4BNVA 3A4LA 3SX0A 1DT5A 3I4FA 2OVFA 3EIQA 4GIBA 1E9VA 1D8AA 3A11A 2O1SA 1Y3AA 3L6BA 3EZNA 4YAIA 4CDGA 1L6RA 5A3RA 1O0CA 1KZ1A 3NW9A 1UDRA 1PGOA 4LDNA 1Y4ZA 4DCMA 5JD5A 1K66A 1I4WA 1P5FA 2BMAA 2QAIA 3DAGA 2OHVA 3GI1A 2PT7A 4NHEA 1RQ7A 1PZXA 3R7AA 3WA6A 2Q4BA 1F9AA 3HV0A 1QGAA 3BZBA 3IAAA 4ZAGA 1BEUB 4WZBE 3BERA 1EVJA 3ZD9A 1QU3A 3B85A 4GFDA 1MJNA 5DGDA 3RK1A 1T36A 4F4HA 4G63A 2DYKA 3OMWA 3FMOB 3HDQA 1V37A 2DT5A 3KKQA 4JLSA 4RL6A 3V7UA 2F3PA 1NQXA 1QYXA 1LUAA 5KI6A 1Y42X 4YAOA 3W1EA 4ZK2A 3OZSA 2QRKA 2Q7DA 4H7IA 3F9IA 1D1SA 2W6PA 1CVIA 3IAHA 2AIRA 4J4TA 1P3DA 1XHEA 2YCLA 4AJLA 3H2SA 1DXOA 1KU0A 3KQSA 1BWQA 1JN0A 4MNTA 2V1UA 4EKIA 4P31A 5CK5A 1D2RA 4E51A 3R7BA 1HL3A 5DNEA 4EA7A 1ZHFA 3JRXA 4BBZA 1Q2XA 1H1LA 3ROPA 4YCMA 3A9TA 3W8NA 1CDOA 4WESB 4H1VA 4P4GA 3FDIA 4FJ0A 4QVKA 5CAEA 1O5OA 3KLPX 3SIPA 3IMGA 3VDNB 4JV5B 1JAHA 2HMWA 3R4CA 5B6IA 4HNTA 3RVPA 4UAJA 3IELA 1AF4A 1XXHB 3U49A 1EWRA 3GFVA 4YRLA 3RLFA 1W34A 3GY0A 5DLYA 4YMHA 2FXIA 2R4UA 4CDNA 2VRCA 2V7PA 1T9ZA 1OXMA 2BV3A 2Z3WA 3H1BA 2GF0A 4FGWA 4ZO8A 2X0EA 1MJGA 1Z7BA 2I87A 2J3JA 3QMVA 4EG0A 3U3OA 2A3NA 1PVDA 5COQA 4EHBA 5FLKA 4BGDA 5K2OA 1CUXA 3L3BA 2P5YA 5IVHA 1G9TA 1VG8A 4W1RA 3PFWO 2ZATA 2BKVA 2CJWA 4HWPA 4FFNA 1E9BA 4OHXA 3AOEA 4OK3A 4A2CA 1Y8ZA 2C5AA 1ZJ4A 2FFAA 3VJLA 3ZOZA 3JSXA 4OI2A 3WWOA 1ORTA 1A8SA 1JT2A 2F64A 2WD9A 4WXPA 4AN4A 4XDZA 2ORED 3D5TA 3JY6A 3KQWA 1WDTA 2DPHA 2F48A 2QTZA 2GZ1A 5AWFC 2EKBA 3TZ6A 3LBFA 3SM9A 4N7MA 5AK6A 4D3ZA 3RS0A 1V1MA 2VCYA 5J63A 4LS3A 3ZH2A 5I7VA 1H3EA 4HB4A 1KERA 4AIIA 2W6CX 1QTIA 1XAGA 4IY1A 4LZZA 2DPYA 1RQPA 4D3DA 1Z08A 3KYJB 2PZGA 1WB6A 4Y1RA 4CPDA 3TSYA 4OGKA 3RS2A 3R40A 4E7OA 3HBFA 5EHIA 5HKLA 2VF8A 1BX3A 2XEXA 5JZOA 2RGAA 2AXNA 3F5SA 1XX6A 1Q7EA 3UFBA 4ESEA 5JWOA 1MEJA 2H4XA 4AY2A 4PXYA 1U99A 1E7MA 5C8YF 1YR2A 2GHTA 2G4VA 4NY1A 4N18A 3TL6A 5A2GA 4G1BA 5HIIA 3NRJA 1N8SA 5HKBA 3C8DA 1W36C 2Z6VA 4E14A 2X4LA 2OSBA 3BE4A 1YJ5A 3NXKA 1KYZA 4H0NA 1KI7A 3LFTA 3K0AB 3NBYC 3SEFA 4WLOA 1W7AA 4K28A 3KT8A 1DX9A 3VYTB 3ZQ6A 3O8CA 2D3WA 1TOAA 1ZIXA 2GUWA 1SC1A 4JQOA 3UVEA 4I8XA 1DG1G 5LNK1 1NE2A 1L4GA 1DADA 1TYBE 4RUKA 5DHTA 2QR3A 4PN3A 3CVJA 1Z2NX 3NDJA 4ARVA 1RQLA 4YRSA 4FINA 1Y82A 1B8NA 4H18A 4JVNA 1LW6E 1Z5OA 3DMTC 1WAMA 4TKLA 4ND8A 4YR9A 4FBLA 5BSTA 5JHGB 3M5DA 4C2BA 3DAOA 2D1FA 2QS9A 3DT6A 3IEUA 3K0BA 5KVVA 4QVGA 3QYFA 2GF9A 1KRXA 1Z6QA 3AB8A 4ON9A 3ZW7A 3NNDA 1ILWA 4ALMA 4RDXA 2PUGA 3R9XA 3KOYA 3WGTA 1Z4PX 3FHLA 1MAUA 4AMGA 2BUBA 2IOYA 1CY7A 3T3MB 3ZK7A 1JDVA 1KA9H 3IUYA 1VHDA 1IPEA 1E4OA 1Y5IA 4NZYA 4R7ZA 4WK6A 1XHFA 3ZIUA 2D8MA 1NFQA 2IU4A 1BCSA 1GRRA 3N2EA 3JU3A 2NUAA 4MZDA 3VV3A 1QX3A 4EY4A 5SY9A 2LGJA 4RESA 5F52A 4E4TA 3EDYA 1CDDA 1T2CA 1LF0A 4X65B 1Z6GA 5CIWA 1MXHA 3MAGA 3HJRA 3C6KA 4F56A 5AW6A 4R41A 2R7NA 3HYLA 4R8SA 3TUIC 5BN3A 4LKRA 2LXNA 5M2QA 2OO7A 1JE0A 2W6JA 4XCXA 3V8QA 4LHXA 3P2JA 3FCSB 2LW7A 7ADHA 2EBWA 3KXIA 2VDNB 3GPCA 5EP1A 3EGEA 2QYSA 5DXAA 3WLNA 3FTPA 3O8OA 1BN7A 5GZ6A 4D99A 3JVUA 3PQDA 1C3OB 1LBHA 3ZV6A 1TU4A 1EK0A 2FEAA 4L6IA 3AR7A 2VUTA 1A9YA 5FJJA 3RC2A 3CVYA 4ZPJA 1B1CA 2PX3A 3NHFA 4LYGA 4QDKA 2GD1O 2C03A 5KYUA 5LQUA 1QONA 1Z73A 2CFSA 1N7JA 2IKSA 2PKEA 5TX7A 3K9WA 4CTMA 5L7YA 3ER6A 3AUTA 5DJ5A 4LOKA 4JLWA 3JAWA 3OX1A 3C3YA 4M9XA 5BW6B 3VR0A 1U6KA 5DIFA 1VLHA 2YWXA 1YGPA 3QXCA 1Y6FA 1T9CA 3X3HA 2AG0A 4FWBA 4OQLA 2DSNA 5FUWA 5KNBA 4W5NA 1SWVA 5P21A 3JQBC 4N3AA 5AHWA 2COEA 1JFTA 5DN6D 3L0SA 4WE3A 2FWJA 1X87A 2YTZA 2FEOA 4HP8A 1CB7A 1W5SA 5SYMA 1IG3A 2II6A 3FPJA 1TK9A 1L7RA 3MWEA 5DRYA 5JV5A 4LV6A 5CNIA 3KEMA 2DQ4A 1N32B 3WWZA 2VDRB 3FNHA 1CR0A 1JZSA 2YW2A 4ZAVA 4MTLA 3OIGA 5ALEA 2IZ6A 1C9KA 1RI5A 5TPZA 2ORYA 1IZ7A 2BFFB 3FA2A 4RXUA 1DUIA 4YUZA 5JU6A 4W5JA 2FGJA 2VDQB 4YMSA 5AXBA 1CUYA 2NQ8A 5E3HA 5D00A 1PWYE 2PKXA 3QNMA 3EGXA 2C4UA 5D86A 4G5FA 3L0DA 3V42A 4CMHA 4CWAA 3OIVA 1XNQB 3FCEA 4GMKA 1P9NA 1KE1A 4ZHQA 4L07A 4P3OA 3UBMA 3X1JA 1OOEA 4EHNA 3QWHA 2JBHA 4NMMA 4LZLA 5ELMA 3OQHA 5KX5B 3JQEA 4Q00A 1F7VA 1RT9A 8GPBA 4BO6A 4DKJA 3DMYA 2R8PA 3I64A 3NAMA 2HBRA 4M9ZA 1V47A 1WG8A 4KBGA 1DDOA 3GDFA 3V80A 1GZ7A 1FQJA 2DWUA 2GEVA 2GAIA 3GIWA 4LOHA 3HJCA 1JQJC 1TM7E 2VT6A 1Q20A 3TI9A 4Q4HA 1A2OA 2H4YA 4QODA 3H6HA 1EDOA 1RC1A 1SUDA 2I3BA 4KH1A 4F4UA 3GLKA 3FCYA 1TYEB 4GBGA 2X0KA 2OM2A 3GVIA 4OXYA 3SI7A 4ZT7A 1WHSB 3E82A 4CFZA 1L4HA 3KQNA 2FRVA 1GILA 1O8CA 1T91A 4L28A 1JJVA 4BLTA 4RD2A 5DWDA 3V46A 4E2YA 3IAFA 2DPGA 1P72A 1T2DA 2JHCA 2OV4A 1E79A 3KE8A 1MGPA 2QENA 3GBPA 1OVGA 2IKQA 3A9RA 3P0IA 4IIYA 4LTMA 1T3TA 5DNAA 5LJIA 4CNQA 4EGJA 3MTGA 3I32A 1DC6A 3UK7A 3RLIA 3GJZA 4C4AA 5CNKA 2QRQA 5JHHB 3LUHA 5FA6A 3I9V6 1E0KA 5C51B 1TKRA 2RGYA 2H07A 3GH3A 1NXVA 1CEQA 4MP6A 5I8PA 2XA1A 1DAEA 5LOVF 2GN4A 3EXAA 4QGBA 4MQ5A 3BRWD 3VGJA 4O4JB 3V1TC 4KIGA 3TKAA 5D1HA 1W35A 4UEKA 2J08A 2FPKA 3FNQA 1TQ2A 3OOEA 3SDBA 1OROA 2VA9A 4F96A 4PQYA 3TUJC 2O3TA 3WB1A 2E4VA 2QRVA 5L3QA 1USGA 2X40A 4I3GA 4X8OA 4XDYA 5IG2A 4XWWA 3R6TA 4BRSA 4YRDA 1CRZA 2PBLA 2CNWA 1NLUA 4AZ3A 1MPXA 2GN8A 2VJNA 3AJRA 4X1IA 1KQFA 1JSXA 1NSTA 1MLDA 3Q85A 4RQTA 5D7BA 5PGMA 1GDHA 3TI7A 3TOVA 1PI3A 1C3JA 3OWXA 3UWKA 4AZSA 3ADCA 2J7KA 2J3DA 1UFQA 2E4ZA 3A1TA 4JL8A 2OZLA 4LNAA 4RY8A 2YV4A 5LLSA 1KH2A 3AVUA 1N2ZA 1XPUA 2WD8A 3PDWA 1D03A 4MDYA 3QX9A 2D5LA 2CEKA 3HJGA 4MRAA 2V8BA 3HB5X 4I4TA 3LPMA 5DGHA 3TIGA 2OCIA 4E1VA 4CG0A 3F90A 3GEEA 5J58A 5HG0A 3COSA 4P4LA 1FP2A 3MCVA 4MV3A 3UOAB 4BKPA 2XE7A 3JYOA 3QVKA 1U3GA 2KQUA 4DGSA 3MERA 4RIEA 4F5YA 3GXBA 2CLMB 3Q7TA 3AJ8A 1ZZGA 3RANA 1SQSA 2FDRA 4MOWA 1K8RA 5KPDA 2IHUA 5D85A 2W4MA 3U0BA 3QWBA 5JYDA 4HZUA 4UATA 5F1KA 2A1TS 1J56A 4M99A 1FIUA 1JHYA 4FKMA 1XWWA 2BMJA 2X7JA 1QAMA 4AURA 1KY3A 3RVJA 5I9TA 4MKZA 5DW0A 3GLTA 1FDRA 4WWHA 2OBFA 3ZU2A 5JWRA 4DR5B 3ASYA 3NHAA 3PLRA 4UHFA 1AGNA 4CQNA 3MOSA 2Q6TA 1ODTC 2P9EA 4F9GA 3PE3A 3G0GA 4IMPA 1YI8A 2PRSA 5JNRA 4A36A 4RH3A 1IBSA 1KFCB 1KK2A 2X3YA 2Q99A 3EAFA 3UG7A 4F5WA 5FIUA 4P4SA 4M0KA 2CDRA 3A6HA 4QXPA 3QG1A 3BUSA 1OA1A 4GR4A 1BWSA 2X9VA 4XQCA 5ADHA 1LTHR 1JIQA 1QSGA 2Y1DA 4ZO7A 1FEZA 1T24A 2QU8A 4I1RA 5BWMA 1VYTA 3GJXC 3AG5A 5IAAA 1BXGB 2GZSA 1HOXA 1XZIA 2ID8A 2Y05A 3JYHA 2C7VA 1AC5A 1P4AA 4HUTA 2QUIA 4MROA 1XGKA 4I4LA 2GD6A 2ZDQA 2PZ8A 4KIFA 1T5LA 4NMWA 2Y9PB 2RB5A 4IF4A 5DSZA 4C2TA 4WFIA 3ZHUA 4R31A 3V4VB 3BRSA 4A9AA 4GWGA 2GESA 3ZV3A 4KXLA 1FZQA 2ZYGA 1MN6A 1SEVA 3KXPA 3L7JA 3Q1LA 1UKEA 1UWVA 4ZEOA 3TVTA 1ACLA 1HDCA 3I62A 3IV9A 4H1TA 5P8WA 1PIWA 1P33A 2NLOA 3A4IA 1R0BA 2JFUA 4BFCA 1E8DA 3RRJA 1U6JA 2GZ2A 1DC4A 2GSDA 2KMLA 2CCKA 5I45A 1EXMA 2VJKA 4ZALA 1C3LA 3ZXIA 4EKNB 4DR1B 3JYPA 3VGPA 3FGPA 3VFDA 1QZXA 2QD5A 4WXYB 1UADA 3NMUF 2PYDA 5E9QA 4HGPA 4MS3A 4GW3A 1LLUA 1LD3A 1B76A 3IC5A 4MYSA 1OF1A 3WKCA 3AKCA 3KQVA 4YX9A 3ZE6A 3MTEA 2I22A 4D0SA 3RAGA 1E3WA 1KEZA 5DBIA 1KMCA 3EVDA 1E3EA 4FYXA 4OP1A 2BKXA 5HRCA 4TYWA 1U0JA 2FMFA 4YMGA 3THXA 1XDUA 1GITA 3I5AA 2PX0A 3AU8A 3OEYA 1AGXA 3I3OA 4PR0A 1IQRA 2M1XA 1PHPA 3QPAA 4Q0MA 5C1OA 3LC0A 2D2VA 4YP9A 4A16A 4UVEA 1IEQA 1M2HA 3R0JA 1X2BA 3WLOA 2FZEA 4M9QA 3WLQA 4BFLA 4IRUB 1Y6ZA 2XDAA 4W1SA 1GNPA 3CUWA 1LQ2A 3LECA 3G89A 3RROA 2C3PA 1CTQA 4CV3A 2E48A 3HI4A 1QJ4A 4IKEA 2XJ9A 1XD9A 3RT1A 5FHRA 1PEDA 1PP4A 3EDQA 2W90A 1UINA 3I83A 2XHEA 4A0SA 1KNXA 2EV9A 2REQB 3DSRA 3H5WA 4YJ3A 4CMJA 2BUAA 4R9UC 4MKFA 5FTMA 4GYJA 1QRRA 2OTCA 1Z0DA 2ZT7A 3T9AA 3ZGOA 1DAOA 3QH4A 1SA0B 3BHJA 1DQNA 3PQFA 4JJ7A 4RDHA 3ROZA 4ENRA 1UAAA 4ZC8A 3RC3A 2VPWA 1GQFA 1U98A 1XR3A 2BRUC 5JD3A 4CKEB 1NE7A 1KFJB 1PG5A 3SAJA 3VR3A 2XB2A 2VHEA 3V6MA 1RWOA 4KIJA 4D25A 3ZVNA 1C81A 1JIKA 1W5FA 2QEQA 4W7HA 4UMVA 3RS9A 4R98A 5E3IA 2XMZA 4OYYA 3N53A 2OO5C 1N75A 3HDJA 2GKGA 4D6YA 2H16A 5F2OA 1MZPA 3Q8WA 2ZJAA 3L8DA 4O08A 5E4TA 4OHZA 3TFQA 3R09A 4LJRA 3U80A 1VLVA 1VL8A 4X3CA 2WF8A 3QA3E 3G68A 3L7CA 4G97A 4C0WA 1WB4A 1YQGA 1G4UR 1V1RB 3NT5A 5ETJA 2BFAA 2EEPA 4YQEA 1GZHB 2FHPA 5K2MA 3K2BA 2WLSA 3LIPA 2C9YA 4BQRA 2DR2A 1W76A 1NVAA 1JDNA 3BWVA 3LQFA 4WVLA 2GA9A 5DNYB 1T0IA 3GU3A 3HJHA 3GEMA 3GMSA 1TT7A 3OIDA 4WGFA 5A3VA 3BBPA 3WXMA 4BE7B 2QX4A 4YNBA 4ZT3A 5SY4A 3VKFA 4EB3A 3R1IA 3CS3A 4EPRA 1Y7HA 3B1YA 4EA8A 2EBUA 1KP3A 3Q2OA 5J4LA 4D46A 2AT1A 3FYTA 2VJQA 3NYRA 4G5RA 1I2CA 4ZQHA 1K27A 1TU3A 1USIA 3IT2A 5C1IA 3OD1A 2JFHA 2ZS8A 2PUTA 1DBQA 4DQDA 1UJNA 1QHIA 3HMQA 1XTIA 3ANNA 3CWCA 1THTA 1JFRA 1HLFA 4DDHA 4J16A 1L1FA 3FKJA 1OILA 4BVGA 5A9SA 5CEJA 1LDGA 1Z12A 4E5PA 3A37A 1UBKS 2QZZA 5IJ9A 1IHDA 1S2GA 4G9GA 4RABA 4GBMA 1RXUA 2OYCA 1WCWA 2P4HX 2QG4A 1CY8A 2AQHA 1FFGA 3LX8A 1T29A 2GJSA 4HAOA 4WNAB 1UBOS 4YREA 3TKLA 2XXAB 4Q4AA 1N0WA 3GFSA 3N0TA 4DIOA 1KOJA 1V0JA 3ORYA 3CSDA 3NVMB 4PPFA 2QBYA 3QK7A 4FHEA 4U2EA 3H19A 1QPBA 4JXKA 2VDWB 4L27A 2JZNA 4I5GA 5HMMA 1L8QA 4O0LA 1BGWA 1QXSA 3ZLTA 3LTEA 1Q6YA 1FNDA 1OI7A 3IODA 1U3DA 5MN6A 1L5QA 1RKUA 2NV6A 5IH3A 5C8XA 2XA2A 2WE8A 3V8MA 5HF6A 1U1GA 4RK4A 4MUXA 2GI4A 3AVQA 4GZ5A 1O6GA 2GM4A 1UKVY 4EL5A 3OJLA 3OZ7A 5TJHA 3PQ8A 4CM1A 1YZLA 3SDZA 2PU5A 1P3Y1 3WFIA 5CHYA 4EEXA 2VEDA 4FEAA 2IYRA 1TUIA 4TN1A 3HABA 5G0SA 2V7UA 4JDUA 4YFYA 2FP4A 1G0NA 5FXMA 5EGNA 3TOZA 4DLVA 1G7SA 1ACMA 3CN7A 3CHYA 1N2BA 2BPOA 3M8KA 3TVYA 3W34A 3RHTA 1ZGZA 4GI3A 4AP9A 1PJLA 2NT4A 1KPHA 4LQDA 4BZWA 1JB9A 1ODIA 2I6QA 1RKBA 4F46A 3ENVA 1IH8A 3T41A 2IEBA 3KOZA 4NOKA 5G4KA 1UFRA 4C14A 4W5HA 3BB3A 1GUZA 2QYTA 4LVCA 3DB2A 4NH0A 2AMFA 1OJ7A 1L9KA 2WIAA 2WJGA 1DUSA 2GAFA 4L72A 4E5DA 4EQ6B 2L2QA 1TRKA 2Z6UA 2CW5A 2RKBA 2I4NA 3S1LA 2FZGA 5K99A 2YW9A 2YIDA 2IRWA 5AI0A 1M5RA 4ZO9A 4CCAA 2G63A 2M6KA 2H2GA 1US8B 2YJ4A 3AR9A 1IHUA 1L4YA 1QHNA 2ZAMA 2BTEA 3C3CA 1CYEA 1EDDA 2C4TA 4YXWA 4BQFA 1GZSA 4X24A 4X7BA 2BBWA 4QOJA 5E1MA 3VPAA 1QGOA 3F3SA 4WLUA 3ZE8A 2TSYB 1NW8A 4Z0NA 5C1BA 7ABPA 2J7PD 1MEOA 4MPTA 1QGUA 1S8NA 2BBSA 1AB5A 2PJDA 1YFZA 3MMXA 4HBGA 3SYRA 4BUCA 3FIJA 3OE7D 5FD8A 1EESA 4MTCA 1ODCA 3BXZA 4FGSA 2WHYA 4HWRA 4HH0A 1G8YA 5C2JB 3Q6IA 2AKYA 2OQIA 5I9NA 1L4KA 2QUZA 5IJ0A 5JEDA 2HT6A 3GQBB 2VSOA 1YAHA 3ZWPA 1E18A 4E6EA 3RS7A 1P7PA 1QG6A 3H5RA 3BL6A 2G9NA 2QUJA 4B3RB 1O7JA 2DRIA 4CQMA 4FDLA 3O4JA 4IOLA 3ZYCA 4CKBA 4ARCA 2ZIFA 4B46A 1DXHA 1A7KA 1P77A 4OQQA 2ZE6A 2UYHA 5ALTA 1MW8X 3H0EA 3ZBPA 1G4AE 1QGDA 1U90A 1X9GA 3KUUA 3OX2A 2Q8QA 3AESA 4P7JA 3SN6A 2HW8A 2Z5LA 3BB4A 2GRJA 4RA6A 3H04A 2WF7A 3EA5A 1V35A 4KVAA 2XWPA 1E3MA 2FNAA 3IT3A 4WFKA 1CXZA 4DV2B 1D0IA 1QCCA 2ZRBA 3EVTA 2WWGA 3CLTD 3E22B 2FFBA 2O0LA 3C16C 4MR8B 3ETGA 5CEEA 4QTTB 1SQGA 3JZIA 1J99A 3LF1A 3PUXA 1KPGA 2AG5A 2AMJA 4TMTA 1PO7A 2YZMA 3UUWA 4A73A 2JHPA 4KNYA 3CKYA 3SK0A 2VTKA 2AOVA 1YVRA 2FN4A 1HYQA 2C5LA 5AJTA 2WOJA 1RM3A 4UHCA 1LNZA 5EWJA 3EWNA 3KUXA 3O83A 2VEOA 2XOEA 3KYBA 1FU7A 1OD6A 2RHJA 3V8EA 4DV1B 1MQAA 1BJKA 1CP3A 3LUFA 5EFZA 4EFKA 5J3JA 2OENG 1FZTA 5JZMA 1OY1A 4IR7A 4RGBA 3U4DA 3WRXA 3A9CA 3M1IA 2WJYA 4CLEA 3JATB 3RI3A 3ZV7A 2QLJA 4OOFA 3ZWWA 1OZFA 4NQRA 1FVXA 4IV5A 5IKEA 1ZHOA 2EX4A 2RHHA 4AS3A 2PR7A 1VE7A 1G20A 4P3NA 3TW4A 3LYHA 5CVJA 4DILA 2ZAYA 2G6BA 1V8ZA 1NAHA 2R60A 4R05A 5AM1A 3TBKA 4MUKA 5DNWA 1EJ0A 2CLCX 4N7BA 5DHUA 1WZNA 5E0KB 4A27A 2BBOA 2C9ZA 2PT5A 5EKSA 5KNDH 5I51A 4RJ2A 6REQB 5KSZA 4YO8A 3P4UA 1ZC3A 4TGLA 3H42B 1AKRA 1QP8A 2HJRA 4ZU3A 1F1JA 4JLKA 3EGIA 1P81A 1ZDMA 3GT7A 5EMNA 4G56A 4BNXA 1VPTA 4JBXA 5BR4A 3GVPA 2OHGA 3FUVA 4KQ6A 3R7FA 2JH8A 3U4AA 2V59A 1HGXA 2M32A 2NM0A 3PPVA 1Q7TA 3QKRB 2LNDA 4P36A 1N5RA 1SNYA 3AL0C 1I7QB 3KX2A 2ZI7A 1E1RD 4G81A 3RIHA 4DUPA 3AL2A 3JQDA 1DRVA 1C2YA 4DEVA 5DYTA 1A82A 4QYXA 4QHTA 3TQCA 1USVA 4A6EA 4BZQA 3VPBA 2MMGA 2IW1A 4UPVA 2Q2VA 3HWWA 3REFA 4OK6A 3DZFA 2Y1WA 3KRTA 2VYCA 5F3WB 3CX6A 4Z2YA 3NHYA 4G36A 2VH1A 3IE1A 1XAIA 2J6CA 1UQTA 4HRXA 3DULA 1AE1A 1T13A 4HPXB 4AMVA 3STYA 2ZSBA 2ZUVA 5AHXA 3H9UA 4C43A 2LV8A 5K6TA 2O0KA 1QZ3A 3U31A 4DC9A 1U3VA 3BXOA 2FH5B 5DH9A 3UCEA 3WJ1A 2PS9A 3H86A 1TW3A 5KVQA 1L4BA 4DLBA 3UGTA 2WT4A 3AQ4A 4UBNA 1QC5A 2G77B 4ZAZA 4EG8A 1JGTA 2L17A 2AYYA 3T06B 1M8FA 3HY3A 3ZK9A 3ENQA 4WN9A 2I6UA 3H2KA 1CK4A 3H3XA 1UQRA 1VGVA 4H6PA 2ZE8A 1JB1A 1E2UA 1OPXA 2EWVA 2QTVA 4HVCA 3D6MA 4GUAA 1X1EA 4HNVA 4Q15A 4II2A 3HL0A 3H11B 4ZTUB 2FPRA 2BN4A 1P91A 4AJ9A 5NLLA 4B40A 3T1TA 3IUBA 2YV3A 3QSYA 3EIOA 1Z37A 2QN6A 2FR8A 2AOUA 1OWNA 3PJEA 4V24A 1U3CA 1YZNA 5CVUA 4GOOD 1UDXA 2VQSA 1KMIY 3K2EA 1SRRA 4OKNA 3INGA 2IU6A 4XFKA 4DT1B 1VIMA 4GRAA 1N5LA 1RACA 2RG7A 5E7JA 3IDQA 3PR1A 4J2HA 1VCHA 1SVMA 1J8MF 1QZZA 2BEJA 2J9RA 3IP1A 2YOHA 3LQ2A 3IE0A 4GQAA 4OMCA 1QH9A 3IBFA 2NZYA 1P2GA 4BU1A 2EW2A 1K4MA 1IY9A 1NR5A 5BMOA 1CT9A 2H59A 1JLKA 2E5FA 3T61A 4WUTA 4Y30A 1J9EA 4P80A 3HR8A 1K4YA 2WNSA 5JS7A 2R97A 4JEUA 1BD3A 1T0HB 2FSGA 3LQYA 4UD2A 4CN9A 2X4GA 3FZQA 4Y9TA 1ZUD1 3IPAA 3UWMA 3ERCA 4YRQA 1G20E 4MVJG 1UT8A 4OAOA 1KBOA 2ZTUA 1T8WA 4U8GA 4GLBA 1K8ZB 2ZOSA 2CXNA 2PRJA 4BP1A 2P4EA 3HU1A 2Q46A 2ZUWA 2Y4OA 1YJ8A 3HEMA 5UKDA 5BURA 5AVRA 5DSXA 2GN2A 3VO8A 2ZIWB 3AIKA 3WL4A 2AF4C 2EP8A 2DE0X 3NP7A 1Q1ZA 4XX1A 5A9TA 1G5PA 1JTVA 4TL6A 5EPEA 2Q3EA 2C2HA 1UL1X 3AB7A 4UVIA 1ZUIA 2JIPA 4FN5A 4IJUA 3QUQA 4CNBA 5HKAA 3O4HA 2OORC 5FO1A 4CIYA 1P2BA 4Q3NA 2VP9A 1USWA 3I2YX 4D26A 4F9TA 1STOA 1MPTA 2O7VA 4LFBB 1X19A 2H7YA 2HQSA 4DC0A 5KZMB 3ASUA 2GCNA 3BX1A 5LQJA 3RBAA 3L1HA 2HCFA 3RFUA 3ZZNA 4JB0A 1WTAA 1RHJA