4KLRA

E343q variant of human ferrochelatase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIQTLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ferrochelatase, mitochondrial
publication title E343Q variant of human ferrochelatase
rcsb
source organism Homo sapiens
total genus 134
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4klrA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4klrA01
2XWSA 2HREA 2QD1A 2QD2A 2Q3JA 3GOQA 3M4ZA 1N0IA 3HCNA 2H1WA 2Q2NA 1LD3A 2C8JA 2PO5A 4KLRA 2HRCA 2QD5A 1C9EA 3LYHA 4KLAA 4KMMA 4MK4A 3W1WA 3HCRA 1L8XA 2PO7A 2Q2OA 3AQIA 2H1VA 2XVYA 3HCPA 1LBQA 1C1HA 2XWQA 2XWPA 1TJNA 2AC2A 1AK1A 2JH3A 2QD4A 3HCOA 2HK6A 2QD3A 4F4DA 2PNJA 4CCSA 4KLCA 1QGOA 2DJ5A 2XVXA 1DOZA 2AC4A 2XVZA 1HRKA
chains in the Genus database with same CATH superfamily
3EGCA 4RGBA 3L1JA 1JXOA 4UE2A 1YQUA 1AN0A 3TMYA 5B5SA 4CEJA 3ED1A 5JAPA 3SYNA 4CGZA 3F97A 4I9GA 4Q02A 1KH2A 1RJDA 1ISRA 4W5JA 1ZI6A 4IVNA 1KQOA 2YMMA 3IR6A 3O4FA 1UKVY 2DPYA 2RHMA 1CQJA 5BRJA 4M0UA 1J8MF 1GN9A 4QXRA 1CVRA 3VOBA 3FSGD 4D0LB 5B3JC 3K1TA 3Q9SA 5EXDA 1PQUA 2ZPAA 3L9XA 3H9GA 1Z4NA 1N34B 2WFZA 1XRPA 4RULA 3KTFA 4XKJA 1D09A 2GK6A 3BJIC 3U49A 3B7WA 4D9FA 4EVSA 3KE8A 4KQFA 3U62A 3AI2A 2QRVA 3M34A 3LGSA 3OI7A 1QXSA 2ODPA 3CLSD 4YWJA 2WVHA 1IEXA 4YT8A 1J4AA 1EQAA 1U3WA 4LV8B 4PZYA 5AKYA 1TAUA 3KXKA 3UT5A 1TOAA 1YB2A 4WN9A 1Z37A 3N0VA 3SZGA 1KFBB 3IO5A 4XYGA 4EGCB 2QPOA 1UOOA 1M7GA 1HDGO 4URUR 1OH5A 1C30B 4LXXA 1MMFB 4JUAA 3RAPR 3EE6A 3IAEA 2YN2A 1DIGA 2HB6A 3LLVA 4GLBA 3WK4A 1ZXXA 4UM9D 1KQNA 2NZ8A 1PKXA 5E9AA 2JFFA 1QS0B 4YJDA 4WZ6A 2J9RA 4DQLA 3ORHA 5J47A 5BN4A 2L17A 3FUCA 4D9JA 4PWZA 1JEYA 3GDHA 1Q19A 2C7VA 2P0YA 2R84A 3FHTA 2DQ4A 4C08A 1XMOB 1C30A 2HQRA 1Q16A 1GL6A 1QZTA 1D6NA 2P6NA 3BMNA 3ENKA 4HGQA 3DZKA 4DYDA 1B6SA 1DVRA 4H27A 1XMQB 1QS0A 4TGLA 2ZRQA 2R47A 3SIXA 3UJAA 2RHRA 4B8ZA 1D9ZA 4R41A 4PQEA 2Q6LA 1D4OA 1WZ2A 1YA4A 2YV1A 3A4TA 3THXB 1AQIA 1X2BA 2EKPA 2F3QA 2EWMA 3EIHA 1I7LA 1G6Q1 1ZD9A 2YJNA 3KO8A 4TTIA 2OM2A 4DNOA 5A7FA 4CIYA 2FZEA 3E9YA 1JFRA 4E1AA 2JFWA 7ADHA 4WA8A 4CEJB 2VSYA 4J0FA 1OLSB 4I1UA 2AFRA 3C74A 1T9DA 1MEEA 2EZTA 4GMGA 3THXA 5K1ZA 4HTFB 3M83A 3PZRA 2PYIA 3M4XA 5GJVC 3AR9A 5B7NA 1KVQA 2DPGA 1UUFA 2ZJZA 3GRKA 2GJSA 2IV7A 3PXDA 1CFZA 4JLOA 2YIJA 1IOVA 3I0ZA 4MVCA 5DHQA 1OLSA 2BEJA 3S1AB 5I4CA 1IXYA 3C97A 3WV5A 4NICA 1W49A 5HSGA 5F35A 1N9GB 1D4AA 1VL0A 3B70A 1QORA 4JEHA 2EQ5A 4J75A 1JAZA 4Q4DA 4HTFA 4Q7EA 4UU1A 3KPVA 5CVVA 4GZ6A 4AX8A 5I7OA 1Z2PX 3M4NA 4P7BA 4F56A 2MSDB 1Y4SA 4UDOA 1MX9A 5EFOA 1E2BA 3NR2A 3PDUA 5CBPB 3NC0C 2GBCA 4JZYA 2DP4E 1PWYE 3JQAA 3K1AB 3P0JA 5CTAA 1TTTA 3K1ZA 1YC2A 1C2TA 2QYHA 3S1AA 3N8IA 4NPAA 5AP9A 4B3CA 4V1CI 2HI0A 1TMKA 5E4FA 4ZA2A 1ABBA 2OYCA 3K0CA 1JR6A 2CB0A 5C5IA 1O9BA 3WWCA 1A95A 2F9FA 2ACKA 1AOXA 2ZJAA 1KYXA 2WZBA 3DW1X 4B80A 4E4TA 1HNZB 2GS9A 5BSEA 1ENOA 3EZ2A 3CN7A 3MXOA 1Z16A 2FEWB 3II6X 3VZRA 2GYUA 2IHVA 5CBPA 1SWWA 3K1AA 1YDGA 1TKAA 2VLBA 2XTZA 3FYUC 4LYHA 1GUFA 3AF2A 4KAAA 2D2FA 4PPGA 5HE8A 4BTEA 2XZOA 1VG8A 4ERXA 2XUIA 2Y05A 1CEYA 3A25A 4XFKA 1M33A 1H4TA 4DPLA 5C18A 3L3BA 4J1SA 1D1PA 1Z0FA 3T34A 4ID3A 1HOTA 4FGKA 2XMDA 2FH5B 4ZVUA 3WGNA 1QSGA 5KO2A 2WMYA 1WUHS 1XT6A 3L2OB 5DK6A 4X7RA 5COQA 1NAHA 2OFFA 2EZ4A 5E4TA 4ENRA 4DC1A 2FUNB 5AM2A 3ID6C 3OEYA 3D1VA 2Z09A 3PR3A 4G0NA 1ZZEA 3HWX1 2GUWA 3EMDA 3TL6A 5IVKA 1NR1A 1AMUA 1NNLA 4BX9A 3HN2A 1HDEA 2FUKA 1PEYA 2GHRA 2QAGA 2CL5A 3IHLA 4FKZA 1KYTA 4CG0A 2UZ0A 3F5QA 3R0VA 1SIBE 4QKQA 1TUBA 1RR6A 3TW4A 1JBEA 1VPWA 4M98A 3A2MA 4JZKA 4OAOA 4FYKA 4EUKA 1TAHA 3GAFA 3ODGA 4UHBA 2MYUA 3V8MA 3W2EA 5ICEA 2ZYWX 4IGAA 5HRAA 3AY3A 4DBLE 2WWWA 5IBCA 2FKAA 1RCUA 3OX3A 3ZDXB 2WU1A 3BDAA 1G6HA 4IUCS 1P45A 4ESVA 4IH1A 3NVAA 2J9ZB 3KS9A 1QTIA 1U8FO 1Z8NA 1O77A 3WAKA 1OLUB 4CIWA 1ENZA 2A14A 3BEDA 3NTVA 3UBTA 2SICE 3G82C 1Y82A 4DZRA 1S2LA 1XZQA 4RZHA 1U8XX 3K0CC 3UMMA 1QP8A 1LI5A 5GQSA 1X1CA 1WA5A 2TMGA 1GA4A 4IUBS 2I2CA 1VJ5A 2HU2A 3IAFA 3FMIA 4IJVA 3KHTA 5AWFC 3NHRA 1XC7A 4U2FA 3HP1A 3HCDA 5DOZA 4XYMA 2BGRA 2NU6B 1V11B 1C7JA 2OFPA 3KJHA 2O5RA 1OIWA 1VCMA 3W4KA 1RWNA 2VOEA 5A04A 3H1EA 3QHQA 1R5JA 3RRMA 3HJTA 1CBUA 4IIDA 1ZW1A 1RFLA 3H0EA 2I6QA 5DHPA 2AA3A 1KC3A 1DMRA 1OIVA 3OBBA 1X86B 5JZVA 3FVRA 4HSEA 1E6MA 1RBQA 2O7QA 4Z8YA 5DOVA 2BOVA 2NU6A 4EA9A 3LC1O 5G02A 2ZIVB 4AZSA 2ZPTX 5ALFA 2EW2A 2VYND 2YVUA 4Z0PA 5FUVA 4A2CA 2H7CA 2JI7A 3JYLA 2PVSA 3DBLB 1RWKA 5ES4B 3MFYA 1ONOA 1UC4B 2A0UA 3E8XA 3W0LB 4XWOA 5CLLA 2HU5A 2CHGA 2FSSA 2HK8A 3OICA 4LYAA 2A78A 1QG2A 4WZAE 2QAGC 3BIJA 3JQEA 4DCGA 2YOGA 1F2UB 5IAAA 5TGTA 5T3UA 4BQQA 4OHCA 3VX3A 4DKXA 4U6QA 3C5WP 3H1GA 5A71A 1LJ8A 2MSKA 2INGX 1FMCA 5JRZA 3OECA 1MGOA 4AZTA 2VRCA 2W6QA 4KAXA 3FSEA 2VSNA 2AQKA 4FFPA 1G66A 5AKEA 2WUWE 3ELUA 4IIGA 2EYQA 3LRTA 4HDRB 4KLZA 2WF6A 1RAIA 3NEPX 4XA8A 5CW1A 3FROA 2NAPA 3RIYA 1D2EA 1ODKA 4CFYA 5BV1A 5AOVA 5EP4A 1SURA 4A16A 1ULAA 4ZEMA 2GLTA 4MS4A 5GONB 2MYNA 5KOHB 3ZLUA 5JQWA 1VHJA 3IDQA 5CJ2A 3Q88A 3I52A 2UVPA 3ONNA 3QG5A 1BXRA 4KIGA 4HDQB 3L7MA 3ZHBA 5FBKA 1OFGA 3H1BA 5HQTA 1E9VA 5JLJA 4ESOA 1XD8A 3SPXA 1XZBA 1MJFA 3HPQA 1ZSNA 1T34A 3FVVA 3G5AA 1BAPA 2ZS7A 3M82A 3PSAA 4C7XA 1TJ4A 1V35A 1B76A 2OGTA 2J5BA 1DQSA 2YRFA 3BL5A 3BRWA 4LF9B 2GCEA 3SQLA 1T0HB 3DNMA 1QQ7A 4M53A 2RH5A 4EG7A 3CJQA 4OY3A 1X15A 5E1BA 4DL9A 1MV5A 3INYA 3VGJA 4NJMA 1DFHA 3L40A 1N7JA 4YV0A 4ZT5A 1YF3A 1ZKDA 4RKQA 3H05A 1MNAA 1Z4LA 1WQ1R 1XAIA 2DVMA 2ZBPA 3BIFA 3CNLA 4HGYA 5T4EA 4D92A 1V4BA 3EH2A 4HXEB 4P35A 1K8RA 4YMTA 4DMGA 1JQ5A 1M8PA 3O91A 3LBFA 3Q7SA 5TGZA 2PXHA 3E9NA 3A4IA 3FIJA 3RAGA 1GZUA 4OIFA 7AT1A 1RAGA 3U80A 1PGPA 3VVBA 4COKA 3UJ7A 1BW9B 2QK4A 3H2IA 5IH7A 3LTNC 2Y3IA 2ATIA 4OM8A 4IJQA 3BWDD 5BWCA 5HW0A 1V5FA 4MUKA 2Q2OA 1GTG1 4DIFA 3DBVO 3FVQA 4YO7A 3GLIE 3ITEA 1E3MA 4GPIB 1PTJA 1T24A 3T5TA 4HGZA 4G0XA 1WZCA 4R5MA 5G4KB 2G1KA 1TI7A 1YR8A 5CA0B 1YTLA 3FCOA 4BZQA 4HR7A 1XTPA 5D87A 1RRMA 2QS9A 3LX5A 3KAJA 1GR1A 2FN8A 2BAGA 2VH1A 3QXXA 2XZPA 2CLKB 1J9EA 3RVJA 1MW8X 3AUAA 4JOCA 3O6VA 3VA7A 5LD2B 4TKUB 3I2YX 3MJHA 1XVTA 4UJ5A 3WOHA 4YLGA 5CA0A 3I28A 4AUEA 4E3WA 1RAFA 2X76A 3U7QA 3WL3A 5L40A 3NI2A 1T5OA 2GLUA 1VI6A 2D06A 2ZROA 3K0BA 4AK9A 3AW9A 3KJNA 2OV2A 3UM9A 3W8RA 2N47A 4R0MA 4I55B 2HF7A 2ZITA 3KP1A 2D2XA 4DQXA 2XCRB 2LW7A 3QV2A 1G9SA 4NAHA 3CH4B 5JZBA 1B8PA 1JJBA 4OHPA 1XOIA 3HVIA 5FNZA 1YS6A 4GZ5A 4PG8A 4IYRA 3ZWWA 1S2DA 3FMGA 3KT3A 3EPRA 3E9CA 4QDZA 5BWNA 3MWDA 4OL0A 2POQX 3ZWCA 5IK2A 4TLMB 3B1ZA 3KEFA 1VZ2A 5EE0A 2X86A 1AUVA 1FF9A 3PQ8A 2VP4A 3V1TC 3KUKA 5JHHB 2WLTA 4D1YA 2F1RA 2ZWOA 4F91B 4UMEA 4ZO7A 2DFTA 3BXGA 2PUWA 2Q5JA 3OJOA 4XEUA 3UMCA 3TR6A 2C20A 4ARCA 1TLFA 4MKRA 2KX7A 1KK0A 1NFQA 3MINB 4NWIA 3WYNA 3RADC 5H5JA 1GDHA 4L85A 3S2GA 2G80A 4RTKA 5CK4A 5M3BA 3AR7A 4L4YA 1ETHA 1A9QA 1GSHA 5SYMA 3AW8A 4J7UA 4FYXA 2NTYC 4BNMA 5HOEA 3LDUA 1JWBB 4DB2A 3DWEX 3W2HA 1I14A 3FMFA 2XXAA 2BELA 3H2JA 4LHEA 2ECQA 1QIEA 1VMKA 2H4JA 3WMEA 1X8JA 2GZSA 1NWHA 3C2QA 4JYMA 4AUMA 3REFA 4PS1A 3MINA 1PTJC 2CXSA 2OHJA 4M86A 3KLNA 4DLTA 4ZYWA 3H4VA 2YNMD 2FW7A 5JXWA 4RIIA 3HL0A 4PCAA 5I6DA 1OH6A 3MGGA 4C0KA 4GOKA 2GVNA 3S5UA 2XB6A 3BK1A 3NUQA 1A9OA 1W8DA 1K89A 3EVTA 1U63A 3FNRA 5BYAA 4AKSA 1SC4A 3BWBA 4BNDA 5CD9A 5ALPA 2XE6A 4BMPB 3CYFA 3H5OA 4ENTA 2A0XA 4Q1EA 1ND6A 1D3AA 1RKUA 3DE1X 5AW5A 4EKNB 4HRAA 4EKEA 5DWVA 3PWTA 3ADBA 3KQMA 1VMEA 1UFRA 4TYYA 1YVDA 1Q22A 2GOYA 3ICVA 3A9RA 4DLNA 2EDAA 3GCWA 5JMOA 4MP3A 2AEEA 2PQ6A 3SIRA 1C8BA 4M2LA 2EFEB 3O3MB 4YY3B 5IMBA 2F1OA 4J0GA 4JAVC 1RNLA 5BO5A 1BSVA 1KY2A 2QRZA 1NI3A 4MW6A 1U8YA 4WXEA 5AHWA 3U0VA 4C03A 2C9BA 1GD1O 1DCMA 3DDUA 3OTGA 4KQWA 4OHMA 5G0VA 1KEKA 4IQFA 2WQ7A 2WV7A 2WJIA 3HHEA 2YFQA 2GDZA 4J0KA 3IPRA 2C84A 2JLSA 4HFJA 1KETA 3OA0A 4JYCA 5LLTA 4IKOA 2XAUA 2YL2A 1MO5A 4GPTA 4FR0A 5BORA 3KG2A 1P6XA 4DNPA 3T4EA 1WTAA 1JU3A 3EIFA 5GV8A 5C34B 4LF5B 1LC0A 4OYRA 2PEZA 4F72A 4RTOA 2Y0DA 5F76A 4EWLA 4OQLA 4O2BB 2EATA 2Q0XA 4PYQA 5EIBD 1XCOA 3LT4A 4S04A 3B6KA 2D6FA 3TX6A 2R00A 1PDVA 3BB3A 4M8SA 3CX6A 3GUUA 4Z2YA 2HCRA 3WNCA 1BOOA 3V8PA 1AKYA 2FGKA 3KJIA 4PG6A 4C7OA 3LBNA 1W4CA 2FLVA 1E77A 3TZLA 4F8JA 4MWCA 4YDHB 4F3NA 4HJXA 1JT9A 4O2BA 3A6GA 1P6QA 2XODA 1E98A 3EBLA 3WFIA 4ODIA 4ZI3A 4UJ3A 3T7KA 1P1KA 4QODA 4OQYA 1L4NA 4CKWB 3VAZA 3ASYA 2IS1A 2HHJA 1X1SA 4XE5A 3RUPA 4DSAA 2QAIA 3M5PA 3MB8A 3GGJA 4ED9A 1FZQA 3QKSA 4TMTA 3EFHA 3ZWVA 5K09A 4V0OA 1P33A 4E0BA 3MTDA 3SYTA 2FX2A 1XF9A 1U3VA 2D2EA 2XHZA 1KK1A 4RK6A 2C2HA 1NGSA 3U9TA 2B98A 2PMEA 1WV1A 3Q3VA 3ZQ6A 1BX0A 2EU8A 2AN3A 2V9CA 1E3DA 1NYQA 1QIFA 3Q6MA 1XKTA 4ER7A 4QSMA 3RIEA 3AEZA 4MEAA 5GGYA 4MNTA 1FQWA 5D1NA 4HXFB 2HRZA 5AOBA 3V3TA 1FP4B 4Y9SA 2NMVA 3EPHA 3UFBA 1P4JA 3V1NA 4G63A 2VFAA 4GP6A 4RKWA 4E5MA 1R4AA 1B3RA 2RB4A 4BAZA 1RBZA 2IIQA 4C1BA 1RADA 4L15A 3RVSA 5EJ6A 2QD3A 4PLPA 2BM9A 2ZJ7A 1AE1A 4QO8A 8OHMA 1JHDA 1TK3A 3LX6A 4NMLA 5DGDA 1V7PC 2DCUA 1BDHA 2HT1A 4G67A 1JR2A 2Z2YA 4FMDF 3SS8A 4AWXA 1H2BA 2IYTA 3C5VA 2EX4A 3QBEA 4V2UA 4XM2A 4QIHA 3UJ8A 5M7EA 1G8KA 4NFLA 4JA2A 2ZVQX 5EHNA 1NF8A 4Q05A 4DCJA 4NX2A 3I9OA 1E5QA 4NAUA 4HLDA 3MCVA 4DRXB 3WP0A 4U00A 3ABIA 3QLJA 2J3JA 3D3WB 1P0FA 2P77A 2Z9DA 3CKKA 4TZTA 5KHAA 3T3DA 4AJKA 4CQLA 2R00C 2XOXA 4ER0A 4B3MB 4WBXC 4GDFA 1T2UA 4ZV9A 4CRWB 2W6ID 4PZ0A 2H92A 5J5AA 4UNRA 2QMUA 1B2LA 2QE7D 2PGAA 3VR5D 1DELA 4DIUA 1AQUA 1K1EA 2BY4A 1TFUA 3BH0A 4QDOA 2IYZA 1BDJA 5DHAA 1XYYA 4Y2JA 2ZVDA 4ENUA 3V2GA 4ZC8A 1JMVA 1W9MA 5FUWA 1VCHA 3QOFA 1GCOA 4QTZA 4I0WB 2PKXA 3DVLA 4RACA 5CURA 1G3IA 5JC8A 3UV6A 2NP6A 3LA8A 1SUAA 5CFNA 2VVTA 5BW8A 4HD8A 5REQA 1RS0A 3OWHA 4AICA 4DXDA 1YR1A 2IZ5A 3A9VA 5CM2Z 1FJ2A 1ZD1A 2JHFA 2Z1NA 3PNVA 5THKA 3RC9A 3SZLA 4CM9D 5CB8A 1SKMA 5B2FA 4EKYA 1Y7IA 3WQRA 3AEKA 4D3XA 4KQCA 4FR5A 3C41J 4Q18A 3QY9A 3RKSA 4F9EA 2H2WA 5LNK1 1E6LA 4O5OA 2KI5A 1UJ4A 2W6ZA 3NT2A 4Q93A 3DJYA 3SHTA 3VKVA 1YFLA 4DMHA 1Q15A 2BWJA 4NMXB 3V7UA 2REXB 3RG2A 4BHTA 1N5OX 1ZRSA 4LE2A 1VYTA 5JALA 1LCIA 2BMJA 4UM9B 1MC5A 1XDSA 3JZAA 4LY9A 5HM8A 3UXHA 3FR8A 5I4IA 2J0VA 2IUUA 1RYHA 4BX8A 1CERA 2ONCA 4HAVA 5E6SA 1B1CA 4IYJA 3EUWA 4KO1S 3WGIA 2DPMA 5DSXA 3A36A 1Z73A 4V3BA 1GGVA 3M1LA 2RGGA 4DWWA 2F9MA 4REOA 1WMSA 5CFQA 3WBJA 1Q0PA 3D8NA 2YQZA 3GJ4A 4EHAA 2JBHA 4NRDA 1E8DA 4HNVA 2XEXA 1AY0A 4LS3A 5FIUA 3C6QA 4KE6A 2A7QA 2RJNA 5EKUA 2A88A 4RPIA 2BM1A 2BW0A 2W6PA 3GDGA 5JQGF 4CLOB 2PAFA 1OBHA 1YGPA 3KEQA 1VDZA 2Q9BA 2QNRA 3F3SA 1U7WA 1H8EA 1YA8A 1YS4A 1NNUA 2ZCJA 1IM2A 5CVDA 4TKVB 5H68A 2LR0A 4U4AA 4E11A 3SWWA 2OSBA 5EIHA 3JVUA 4OP3A 2JS7A 2ZR0A 1IM8A 4LDAA 4DNQA 3JZMA 5CFRA 5TIIA 3DLBA 2RGUA 2C1EA 1JDJA 4CLOA 4BC1A 2H2DA 1SIUA 3DAYA 3GN1A 4L08A 4DR2B 3IEKA 4X41A 1A9RA 5JMWA 3B1VA 4G26A 4N0PA 4JUFA 5FQOA 3TLBA 1LZLA 1PLJA 5B6JA 3U40A 4DIKA 5DBHX 4TKVA 3JVIA 4RVDA 3INRA 1VLVA 2CCKA 3ICWA 5HJEA 3TGWA 1RDFA 1JTVA 3FWPA 5CBKA 3PLAE 4R8LA 4LRSB 4NHEA 1OFUX 3NIFB 3DULA 4B4DA 4N0EA 1EJ2A 4QTUB 3TRIA 4PWYA 3JWHA 5CVTA 3KT6A 1NBME 1N92A 3IODA 2PWBA 1O58A 3C3EA 4V38A 3EDOA 1EDDA 4KGVA 3D1JA 3RVBA 2IWHA 2BPOA 1HE4A 5TPZA 5ADUS 1XD2B 1L4FA 1L6IA 2ZTVA 3N39C 1JNYA 1GTZA 3IJPA 4LYYA 5E7IA 3RNOA 3TRKA 1RBMA 2QGNA 3P2MA 4DUPA 2R44A 1PR5A 3MWEA 4DHWA 5HJ7A 5EL0A 2Q9AA 3ZEIA 1X14A 1FQOA 1DNPA 2ZYDA 3WHPA 4CJXA 4WZAB 4R1NA 2VEOA 5HBGA 4LJKA 2CNBA 5AVSA 3T41A 3UCXA 3USES 3RC8A 2ZRNA 3OIFA 1HQYE 1UMCB 2H2FA 1XD2A 3PFKA 4IFEA 3R9KA 4W7HA 5CNIA 3DTYA 2ZUCA 4ZDKA 4DJDC 5IX8A 1FVHA 2PZFA 5AK3A 2I4OA 2QQGA 4YRFA 4ZPXA 3D6AA 1H1TA 1I4EB 2R96A 3L1KA 4JU9A 4LZOA 5AUQA 5BQXA 1GSIA 1C9JA 4WNAA 2O2CA 4DA8A 4MGHA 4O4IA 1YT5A 3CG0A 1FUYB 3GL9A 5T8KA 9ABPA 1Z5OA 1JXMA 3TQIA 1YHZA 3QK7A 4ZVNA 5BRAA 3AF4A 3I83A 3H5LA 2PKQP 1WD5A 4WDRA 2G7ZA 4P54A 1RRPA 3A2KA 2XQFA 4RJJA 1QFXA 2WZQA 3A7EA 3LT0A 2Y1CA 3O4JA 2IUSA 3OCZA 1RHRA 3E05A 4Q1AA 3PCTA 3PPXA 2OV1A 3P20A 3V4ZA 2RGCA 3JQRA 4LY3A 5AVZA 1ULBA 3OTQA 1CQWA 3Q3GE 2BDEA 1BH6A 2AX4A 4OQEA 4D2IA 1H2RS 1JPVA 4MJ3A 4ZMRA 2PGDA 1P3Y1 1HO3A 3VR4A 2NOAA 3H9EO 4FD2A 2C94A 2NO7A 3EUAA 3B9BA 1TYBE 4TUYF 1TF7A 4EZBA 4HRVA 4BNGA 2QX9A 5JEEA 3T4UA 2PSHA 3THWA 1K75A 3CF4A 1HZJA 3LOQA 2VO1A 3QLTA 1XO1A 3TXYA 3L79A 1KC1A 1T3HA 1ZCZA 3HQ4O 3IUMA 3R5FA 4DUGA 5ALGA 1MO4A 4TLCA 3PQ3A 3DQZA 1UWVA 1DEXA 2VDKB 3CRRA 5TVKA 3A1WA 4O3FA 2QV0A 4QSHA 4CVNA 3PEWA 2PZGA 4EEZA 3OE7D 4TTQA 3F8WA 4B1FA 2YVQA 4FI3C 4BV3A 1YVRA 3DT9A 5EG5A 2FOLA 2REQB 1HFKA 2FPIB 4CLRB 2D54A 4IIVA 2PD3A 3UMYA 1XP5A 5KNBH 1ODFA 5LDGA 4C78A 4WIAA 5DWDA 5CJPA 4AL4A 1Y3IA 3Q15C 3G1WA 4O0LA 4UULA 4ENSA 2FZKA 4HZIA 4YHBA 3P9RA 1AVTA 1KWKA 1CJVC 1XNHA 1YZNA 3PNBA 2ZJ0A 2PJZA 3DXXA 4I4NA 4IOMA 3SLKA 4COOA 1B6RA 4K9QA 4R3UC 2JFPA 2FR1A 2FPIA 2OBFA 4DCMA 1H5UA 3O1HB 1JZTA 4KN5A 1NM5A 3TIXB 1C0IA 4Q3OA 3AR3A 5K6AA 4JQCA 1MX5A 4OFBA 4EGQA 3CWCA 1IVNA 3U0BA 5H83A 4IOJA 1T5BA 3VU9B 3OOHA 3EB9A 4Z9XA 3WGHA 3ZDQA 3TOZA 3X1XA 4KE7A 1XDWA 4MDFA 4YJ3F 2YX1A 4JHLA 1UJNA 1DX6A 4K9OA 1Y9ZA 2CNKA 1ZA2A 3VZSA 1CUJA 2PQMA 4XIGS 1UWLA 1E59A 5CB4B 3V7YA 3ON5A 3L0SA 4CM1A 4IQ0A 3LY5A 4B74A 3HXLA 4ZAXA 3KWJA 4QBIA 5E3JA 1PU2A 5GJCA 1ONPA 3KR9A 3QPBA 4C7BA 1QVRA 2PY6A 3B6IA 5B3LA 3ME5A 3F7MA 2NQ2C 2WE7A 3RSCA 4EB6B 3WJ1A 1FX0A 2H65A 3OTOB 1SVSA 1UM8A 2A9VA 2ATVA 3STHA 1JEEA 3T1QA 5CB4A 2XUPA 3OWOA 4GECA 1IN1A 4B85A 1RXSA 4ALLA 3Q7QA 3E2MA 4PZDA 4UDYX 3MUEA 1E79D 4P93A 2XQVA 1CZUA 3UA4A 1WB5A 4D81A 1TU3A 3ENZA 1TX4B 5EY5B 4CCAA 1JMKC 1OV6A 4RE6A 3OJXA 4C2BA 2ZSJA 4CHGA 1Y6JA 2PT5A 4ID9A 4XX0A 3EWSA 3G8BA 3TE7A 2CYCA 3LUGA 3H75A 3ZCRA 2IHNA 4E5VA 3B2NA 1IEVA 1NTRA 2Y1EA 3OKAA 1DX4A 4L50A 2BR3A 5DRTA 3EG5A 3NTUA 5TMBA 4YUXA 5ENDA 2KJQA 1Y6GA 4CM4B 3ZHZA 2J09A 4NE7A 1P2SA 3R24A 1O96B 4RA6A 2GF2A 2J0UA 1YC5A 3FNFA 2PH7A 1WSBA 3BZBA 3EH1A 2EFDB 4PTYA 3HG7A 5JATA 3HVJA 1YAJA 1W75A 2EHDA 3KAPA 4ZJZA 3H2KA 4UTRA 3IRUA 2RD2A 3WZLA 1MENA 4IHAA 1QOZA 5EMJA 4IAOA 1Y81A 4CM4A 2ASEA 1QNLA 5IAKA 1F2DA 2GTHA 3G9QA 1JBKA 3K35A 4JK3A 2OV8A 4LBVA 4LHZA 2G88A 3FM9A 1NM5C 4P98A 4YP6A 4E03A 1H0HA 5BR7A 5K6AC 3QE9Y 2IHTA 2Q41A 3CV3A 1G5QA 3H4IA 4YRDA 1DJPA 5BQFA 3SF8B 1NPYA 1NOIA 1OCEA 2FP4B 2QL7A 1B00A 1SBCA 2YWEA 3IRVA 4Z4GA 3TCKA 4MVJI 1AK2A 4HXGA 1UBNA 3A1SA 4KGDA 1FJXA 1I24A 1I9CA 2C9YA 3Q3IA 2CMHA 3GMTA 2K4MA 1ZD2P 4DLZA 1KTIA 2B0JA 1P1HA 3D59A 3ZK9A 4X20B 1K4MA 2JEYA 3IILA 2GNAA 5AVVA 4MV5A 3STUA 4W5QA 5TLSA 3H9BA 3QJ5A 1NUAA 1NURA 2BKXA 5FPKA 3TI9A 1PFKA 4DNFA 1XZCA 2F1KA 1XALA 2I3GA 5HJ5A 1PJCA 1JG2A 2WKPA 2Q0QA 3A1FA 4Y0VA 3LFHA 1T1GA 4Q48A 3RT7A 1I80A 4LDRA 1AUPA 4P3KA 2O06A 1P61B 1S6YA 2BGMA 2FI1A 4YRBA 4JXKA 4X20A 3PE3A 4QGBA 2CNWA 3JTEA 3ZHUA 1Q1AA 1A69A 1Z62A 2ZRFA 3CZPA 3N2ZB 3ORSA 1L7NA 3P5SA 4LSGA 1OHHA 5ALJA 4X1YB 5L3RA 1HETA 1YK1A 1ZIDA 3W8FA 1HL7A 3ZE0B 1PD0A 4LJYA 1TM1E 1TYDE 4KXXA 4V0SA 1UJ5A 1YMUA 3GJQA 3ADKA 3KELA 4XZ3A 2EP5A 2CZCA 3PEVA 2YBEA 4J6EA 5IKOA 5BUCA 2H48A 3ZQUA 2KM1A 1N33B 2QVGA 1U94A 1RLJA 1X7HA 1M6EX 2EWWA 2A92A 2OSVA 3CIOA 1L4UA 3CEJA 4JSRA 4P9NA 4X1YA 3QPUA 4LQCA 3P9CA 2XQKA 3FYHA 4NBUA 4AMZA 3WGJA 3PFNA 4CKXA 4MMXB 1R9GA 2ZFUA 5GVRA 1SA0B 1IHOA 5LXTF 3I2JA 1CQXA 1ZJWA 1U8UA 2RAVA 4IJ5A 2X0DA 3RS7A 4Q6WA 3VU3A 1PZMA 2ORED 2WM8A 1C7EA 4MV7A 1EJ0A 3IXMA 2QT9A 1G59A 3F46A 3C45A 4FUQA 2ZUEA 4PAGA 2NM0A 2VJOA 1GTRA 1M10A 1FLAA 3P2OA 5FEMA 4HVCA 1IB0A 1KE1A 2FK8A 4XWTA 3GN2A 2QD1A 1R66A 2W8BB 2JLWA 3AJDA 1DOHA 5AI9A 5LIPA 1LPOA 1SGWA 2H7YA 2VZEA 4MUNA 1G8YA 2PD6A 2V4ZA 1E0SA 2V8OA 3O74A 4HQ6A 4BXOA 4CIXA 1O5OA 1PDOA 1OW3B 2HX1A 1UR5A 3V7WA 1H4SA 3O8BA 3PKZA 2A1UB 4FOTA 2I7TA 1C29B 1QO0A 1VIDA 1VL1A 1MJ5A 4BU1A 1D0SA 4F12A 2PX2A 1Q7RA 1TM4E 3QTLA 3V46A 3U1VA 2FWIA 3HU3A 3IKMB 1SWVA 1T0BA 2W8BA 3PXGA 3UK2A 1FDOA 4NAVA 1XXLA 3A2NA 1K2VN 4YJ2F 4B76A 3QYAA 2B4QA 5B1DA 3QEKA 4OV6B 4GPAA 3RRJA 3FHJA 4PXSA 1T2DA 3ZNQA 4BP8A 1WG8A 3MT7A 2HLDA 1H2HA 2QRMA 1NLFA 3ZXIA 4ITUA 4DMCA 5IVHA 5DYIA 1H0SA 4AN0A 2AXPA 3QLUA 3MS7A 4YRLA 1RHKA 2HPAA 3A1TA 1L4HA 1TGVA 1VL6A 5KQSA 1A2OA 2X41A 4RLSA 5GZ3A 3SF0A 1S9DA 4UEJA 1EPUA 2PN1A 2YNMA 2N3ZA 3M6MD 4EJ0A 1XEFA 4WSOA 4C0AC 1KSGA 3G8AA 1JIXA 1F0PA 3PNYA 1PUIA 1NF3A 2H3EA 2YZ7A 1HMPA 1RHMA 4UDNA 5IDYA 4EUSA 5FUBA 1U1GA 1L7EA 3N05A 4X1KA 3WIOA 4RC9A 3COSA 3EZ7A 4HYQA 1XXHE 1SXHA 4OA8A 2CDBA 3V9PA 1M0EA 4UCWA 2OM6A 4QASA 3RO7A 2Y1OA 3U3XA 5BVGB 2PZ8A 2XWSA 1P7ZA 1R6DA 3SEFA 3WLKX 2ETXA 4C5AA 1EAYA 1LW6E 5CT5A 4ZGBA 1IDN1 3NT5A 4G5XA 4AC9A 3GGSA 1G4UR 4S1NA 4J43A 1U0BB 3W2IA 2V0GA 2V9PA 1E2JA 4DBVO 4YRTA 2UZ1B 3L6BA 4NENB 4R01A 4YRJA 2DLDA 2GPSA 5EWJA 3UHFA 3HB0A 3TRDA 3IE1A 5AUNB 3AR2A 3BE6A 3GRPA 1IN7A 2JLBA 3UATA 1U7ZA 3WGUA 3BF7A 3WGQA 3L4JA 5A02A 3R23A 5JG7A 1H8HA 1XP8A 5IYZF 5B1SA 4ALNA 5M34A 5FI1B 2OBLA 2GNOA 2VDUE 4B6JA 1UPTA 2PZJA 4Z4CA 3I64A 3EBPA 1CR0A 3MRVA 1FU7A 3WYGA 1QCZA 2UZ1A 3EXHA 1SUWA 4Y2PA 5TQVA 4QM7A 4WESB 1VRWA 4Z0HO 3FNEA 2ZB8A 4M6WA 1K86A 5KYYB 3PA6A 5EMLA 5J5CA 5JD3A 3KSAC 2E37A 3KZVA 4MKFA 1K4KA 1M73E 2H7VA 3TMAA 2V5VA 1IZZA 3DE7X 3IE2A 5D3QA 1OH7A 2UZ3A 3BCUA 5FFMA 5TF4A 1JQLB 2BF7A 1Y8CA 2GX6A 1W52X 4K86A 3OIYA 4CT4B 1G5RA 1OE0A 2J32A 3PQEA 4M54A 3JXEA 1RYNA 3OPMA 2WRZA 2CW5A 5DTIA 5CG1A 2V98A 5A9SA 3UC9A 3UAVA 4TWBA 2A5FA 1XNQB 3AKEA 3G6KA 3GEHA 1WWKA 2I1WA 5AJYA 2X19A 2FPPA 5DSTA 3QI7A 3NOOA 2CVFA 2WJYA 3OZRA 3GK3A 3GLHB 3FPAA 3V80A 3W2TA 2JHPA 1PFGA 1PR1A 1M9NA 5AXAA 3BT7A 3A58B 4U2GA 4PAMA 4QDUA 3QUQA 1L3IA 1XDUA 2H5JA 1ZMRA 4PLTA 4RK5A 1CSEE 3E22A 3HRKA 2ZU0C 4BNKA 2J9FB 4M1YA 2V7WA 1LJUA 4P0TA 2V3VA 3EEOA 3GLHA 4NVRA 3KPJA 4N9QA 4D4LA 4FMPA 1EGVB 4OHXA 2I03A 1ULTA 2R6AA 3RIXA 1NI5A 2DQZA 2WSSD 3RVNA 4JIMA 4R68A 4TL8A 4B3DA 4BB9A 2G1AA 3NIBA 1N1GA 1PSZA 1U5BB 3ZH2A 2PZMA 5HK9A 1EXNA 2BFPA 4ZOCA 3ROZA 3SQNA 3OIUA 3UFXB 3FTEA 3KQYA 2QR2A 2YOHA 3LC7O 4IO0A 3OQJA 4DLRA 4OQPA 2VAMA 3WIEA 2VT6A 4J76A 4MRRA 4B48A 2Y66A 1V4NA 1X1BA 1KF0A 5FLYA 3I6MA 2IS4A 1E94E 1XEWX 3OQ1A 4NY1A 2QJRA 3KYCB 1V6AA 1L1QA 2WP8J 1U5BA 3EXHC 4BFVA 3SFTA 1F2TB 3GX1A 4AJEA 4JJ8A 4BQEA 3DGEC 3UFXA 1DKNA 5TJ9A 5IDQA 1T5HX 2Y0BA 4RQAA 1B8UA 1QGDA 2G1JA 1ZYUA 2XA1A 3DHNA 4PQRA 4Q7KA 4FEAA 2YW2A 2QE7A 5F51A 1Q2UA 4CHTA 4ZI5A 2P4HX 3RS2A 5DXAA 1O0CA 4KRXA 3KYCA 1T8RA 4RMNA 1GPDG 1VJ0A 4WTOA 2R1UA 3REQB 1SJ9A 5ALWA 4B33A 5JHGB 3GPBA 1DT3A 2QJOA 4HAOA 1ZVJA 3X1ZA 1UXHA 3RT9A 1TJYA 1M2KA 5D3MB 4OD0A 6REQA 1M5TA 1PKEA 4JQZA 5FWXB 3RRYA 4G6ZA 3UC5A 3F1LA 1YE8A 2GBLC 1M0TA 1HFJA 1OPRA 3OX4A 3EFEA 2PRIA 4OQMA 2EFYA 3RTAA 1GPKA 1H4VB 4LC0A 3VKFA 3REQA 3DTVA 2ISQA 4TRMA 4E2WA 2FR8C 1UIRA 2HK6A 3JVDA 1J70A 3AY7A 1EFVB 1JI0A 2C31A 3FGOA 4UZEA 4WV3A 5L6LB 3K96A 2JA1A 2DJ5A 1WR8A 4JEIA 1RXIA 4D0RA 3VUFA 1C81A 1GAJA 2CJPA 2X8WA 3GP3A 4B09A 4BN5A 4RY8A 1P2DA 1XRSB 5FWXA 4CQMD 4ERNA 1NBOA 4CT0A 4O4LB 5CDSA 3I62A 4LMPA 4NL4H 1K8QA 3IB6A 5CA1B 2JB9A 3GRAA 5JCJA 2QMZA 2WAAA 1TD9A 4X60A 2VRNA 1IQ0A 1XYGA 2BEUB 3PUYA 1UBFA 3LH5A 4WOJA 2GAFA 2W71A 4P4SA 4QDXA 4EB8A 2DE0X 4NYJQ 2I76A 5KYKA 4PZUA 1W5SA 4GFDA 4H6PA 5ITZA 3PT9A 3DHWC 3TJZA 1TCBA 3GP5A 3L7LA 4O4LA 3AFIA 1XELA 3K2QA 1E8MA 5J58A 2GN8A 1KY4A 3AYXB 4B8YA 5CA1A 1ICIA 2NTVA 2W6MA 3K8ZA 3LQ4A 4TTVA 1TLTA 2BEUA 1PX0A 5AO9A 4QGSA 1Y8ZA 2O14A 3DS8A 2EIHA 1JQAA 4Z1MD 3FDJA 1DP4A 2P69A 1DTEA 2ZAGA 5HKLA 2EZ8A 2J6CA 1HX7A 4OAQA 3NJ4A 4OKNA 4URZR 4AMBA 5BNTA 2B99A 5DPMA 3LDFA 4CTJA 1NT4A 5F9MA 3LT5A 3TWOA 3W6OA 3FPKA 4DTCA 5JECA 2X13A 2QW1A 2G1PA 4OK3A 2K7FA 3MMXA 4MYUA 2B94A 1Z9BA 4URYR 4Z7OB 1VSUA 1H1LA 2QL9A 3GRYA 3WXMA 4JEMA 1I4TD 1MO3A 1UT5A 2WOOA 3W4IA 2QN3A 1DKRA 2VJPA 4I6JA 4LEIA 4R5HA 1RBYA 1J2UA 5EWMA 1Q7BA 2PMCA 4PS0A 1VPTA 3LW7A 3URKA 3OJFA 4HG2A 3DWFA 2ZR7A 1Z7YA 4XQEA 4Q3CA 1L5NA 2RGEA 2OK7A 1ZONA 1QPBA 2G9VA 2YN4A 2POCA 4MX8A 1TKCA 4UTVA 5KMGB 5AVOA 5HJ2A 2BL4A 1E4EB 5AR1A 1P2GA 5K0ZA 5FYQA 2PJDA 1N9KA 5LIRA 1PWEA 4I5FA 5AI6A 1P91A 3F5SA 3ORRA 2NT4A 2AFHE 3PDCA 4RPHA 3ONWA 4ZAGA 3DW3X 3JR7A 3N8KA 2OGUA 5DVZA 1CUWA 2IHKA 1OT5A 2X5OA 2XGGA 3T06B 3M70A 2Q07A 3TN7A 3E3NA 3U26A 5KMGA 4PSUA 1E4EA 2IW3A 3AOGA 3OU6A 4YXWD 3MBIA 5CXQA 1U6JA 4ABYA 1G55A 4OEHA 3VR6H 3B7GA 4NCBA 3JPYA 1VYUA 1JV2B 2BHRA 2Q1SA 2XADA 1VL8A 4KDCA 4Y1RB 4DDMA 1U7PA 5JNSA 4MQLA 1R00A 1H94A 5D2CA 4LFCB 4BB0A 1WCV1 2HBQA 3Q1KA 4NK4A 4TV8B 1S8NA 4XUEA 2Z3ZA 1GTMA 2CK3D 4AYTA 3CH5A 3IVAA 3ZG6A 4BN4A 2E2WA 1AQ6A 4K6FA 1BNCA 4ZIRB 1ZJZA 1PFUA 3OEHD 4G0OA 2I99A 2UZIR 4J2TA 2G0TA 4N7JA 1FDVA 1PWZA 1S8AA 4P82A 3TCNA 5HWSA 1HDYA 3PX7A 1SK8A 2DH5A 3T8YA 2J4DA 2CJWB 3G2KA 1N3LA 3I53A 3E9RA 1IAVA 4FYWA 4JP1A 4Z86A 1NN0A 3CW9A 2P2NA 4B45A 4YAKA 1R0CA 2QVXX 5EE9A 4ZIRA 1RQPA 2X1MA 3CVJA 4PYMA 3MZ0A 4B6OA 4NFYA 3OZXA 3VV3A 3GR6A 4CKCB 2X5NA 1A7AA 1J8DA 2GI4A 4BFWA 2XNJA 2IEAA 3S7TA 5ARBA 1G18A 2RAPA 2C1XA 1M8FA 3HWWA 4PC2A 1ZVVA 3FFTA 2OXCA 4QA9A 5BW6B 1ONNA 2CJWA 4QUGA 1A4UA 3Q87B 2NYAA 3OC0A 4KUHA 2QN7A 1KBQA 2VJYA 4RF2A 4A7PA 3L0OA 5JNLA 3GJ6A 5A2QA 4ZRDA 5BSGA 1UWKA 3C4VA 3G5UA 4CR6A 4CKCA 1KYWA 2ZYGA 5AUOB 3TUZC 1WCIB 1H5NA 1GNTA 1T13A 4ND7A 1I5EA 5BSRA 8ABPA 4KXFB 5HDBB 1DO2A 4QL3A 4Q01A 1WZEA 4IIEA 3E5HA 1V2HE 4YREA 1NE2A 1UPXA 2NW6A 4RJKA 1T1RA 2XKJE 3DTNA 2EQAA 3MT8A 4YP1A 3TSAA 4DY6A 3TKAA 1J2RA 1J2JA 3BK2A 1Z5NA 2Y8EA 1WCIA 4R3NA 2XVMA 5JJCA 5ERYA 1HDOA 3NC1C 3T7SA 4DHEA 4NBWA 5ESWA 3AQIA 3FGPA 2O8EB 3C24A 1HR0B 5EXXA 4F11A 4MR8B 1MLDA 2RHHA 4YT5A 5DMHA 4H4CA 3AB8A 4NI5A 5A1JA 4V0RA 3U4MA 1OILA 3NNNA 2PT7A 2OVFA 4YCMA 2WD9A 4WKPA 1CUDA 3FDIA 2OV6A 1WM1A 1ZVQA 1MB2A 3LHSA 4P0QB 3NVDA 1SR8A 1Z6GA 4IDHA 3EGDA 3KB2A 2MYTA 5IEBA 2QMYA 4RIHA 4MR8A 1FW6A 3HYLA 2H5IA 3IVRA 1WD7A 3SR0A 1C9NA 1JKIA 2QP4A 3I9NA 3IDOA 1VB5A 1MCZA 1VB3A 4O0MA 2JATA 5DLPA 1R6AA 1X7YA 2WVGA 3M6UA 4FFNA 3AP2A 4OTZA 4R8VA 5FBRB 1ECPA 2PLFA 4AZ3A 5JCOA 5HUJA 5LJIA 1ZUNA 2X5XA 2WYWA 4ITVA 1PVDA 2PU7A 3ET4A 5EJFA 1JAYA 4JI5B 1MQ8B 1E0DA 4QYWA 1YOVB 3C1OA 2B8WA 3DM5A 5J2TB 4ECEA 2AF3C 3ZYZA 3B82A 4JXJA 2BTEA 3NCHA 4J7XA 3B89A 3M0EA 1U6KA 4IIUA 3IOMA 2DPLA 3EGVA 3WYDA 3ZK7A 3THYA 2IZ7A 4IIYA 5KTMA 3CF0A 3ZE1B 4F5EA 4UMVA 1WVIA 2SBTA 2FU5C 2AK3A 3UGTA 2NUAB 2HXYA 3DDOA 1SBHA 3DUFB 2GF0A 3I72A 3OPVA 4HDOB 4XPZA 3V2UA 4BKMA 4C4SA 2V45A 1X9GA 4C22A 1JDNA 4FFRA 2F90A 1Y6ZA 3AVYA 3E7DA 4LDPA 3MJSA 4XD2A 3VVLA 2GT1A 2IL1A 2YTZA 1PZXA 3L18A 3EYAA 1Q92A 5AM3A 5KOIA 5CVEA 1L5MA 4DN6A 4MIOA 2QG6A 4TV9F 5KWSA 5I51A 2YC4C 1EGQA 2NUAA 3DUFA 3GT3A 2DTDA 1EBUA 4UM8B 1M2VB 4Y30A 4PPYA 3QXSA 5EKTA 1PRYA 3D6MA 3SNHA 4B6SA 4OYHA 2QAJA 1Z75A 1C3XA 1S2MA 5EE5B 3SIWA 2WR8A 5LUAA 3CPJB 4HAIA 4OGLA 1KXJA 2WWXA 5FA6A 2BHNA 1AC5A 1G0OA 2HEGA 5IC5A 2J7KA 2QV7A 4GZLA 1GG9A 5DB4A 4AMVA 1MIOA 2H51A 1H05A 2HBRA 4YCLA 1KAMA 4E31A 3FJ1A 4NBKA 2PYDA 1M2VA 2FWMX 4MRPA 2WTBA 2H1SA 3F5MA 2OKCA 2JVKA 2PZKA 3L6DA 5JSKA 2H9AA 1C9DB 4GSKA 1ORHA 4QD3A 3TPFA 3PBKA 7MDHA 3PX3A 4HVLA 1BG6A 2A30A 2CD9A 1O5IA 1G6KA 3GJZA 3CO5A 3M8KA 4RABA 4NECA 1IJKA 1BJTA 1TCVA 2IDJA 2NSHA 1T6NA 2XUZA 3O8DA 2HSJA 2P30A 2Z5FA 2CY0A 1YS9A 4GXRA 1ZAKA 3DEKA 4H3VA 4A4DA 1T1JA 1PSWA 5E8JA 1WUKS 1C8VB 3W2FA 2QLLA 3GUHA 3IURA 1E3IA 1E92A 3WLMA 3JQFA 3FUWA 3ABSB 4HAWA 3WQBA 2R86A 2BT4A 1ZVKA 2JCXA 1K98A 5LWHA 1EEHA 3IBSA 1XQ9A 2R1TA 2PGJA 4G07A 2HMWA 4RVGA 1CUUA 1T4BA 3BILA 3EUEA 2YJZA 4KI0A 3KRTA 1PJLA 1CNMA 4LZPA 2FPGA 3CLRC 4MVYA 1YNSA 4IL5A 7REQB 1GOTA 2X3YA 3AUUA 1P2UA 4FZRA 1G20E 1Y1KE 1QYRA 1GZHB 2X5JO 4CF7A 5DIZA 2GAIA 1EFRD 4D3SA 1XTJA 3D2AA 2JANA 3JQ9A 3NBUA 3R5HA 4JI3B 2O0MA 4NJEA 3LIPA 3CHYA 5C4IA 4EO4A 1JYFA 5FV4A 1EFDN 3T1NA 4Q9LA 4CMJA 2R7KA 3PGMA 2PL3A 4KSCA 1YBVA 2G9ZA 2A3RA 1K3UB 3I8OA 1IXKA 1GGEA 3G5LA 5FOSA 3WK7A 3DNPA 5JI2E 5E1DA 4MCHA 4M0KA 2VDOB 1P0CA 4OX9Y 3FTFA 1N5DA 1M1YB 3ZBPA 3JD0A 4G23A 3R7BA 1PK8A 3MAGA 1IHXA 1VBKA 3GFPA 3I1FA 4ATNA 3G3EA 3Q8KA 3WRXA 2FEOA 3LY9A 4BLTA 3UPTA 2EBHX 5G53C 3P0HA 1GV0A 3VPCA 1K92A 2ZVJA 1JKFA 2ZT7A 4I5IA 2HDHA 4N0MA 5H1YA 5B2ZA 3LK6A 3VDQA 5LMCA 1T36A 3WRVA 1RVDA 1FLVA 1UH5A 3TSCA 4K0RA 3S2ZA 4BKOA 1FU4A 1N7IA 1M1YA 2WUEA 4JR1A 4MYRA 4TVOA 1W25A 4K46A 3GDOA 2FPOA 1NMXA 1I2AA 1U6IA 4IEFB 2PSEA 5IZCC 1NW7A 1DC7A 2V6FA 5AMXA 4E33A 4FHFA 2O50A 4G8JA 2OILA 5E6RB 1ITZA 4C4RA 2ADFA 2CLIB 1JFLA 4ZAZA 1D8TA 1LLQA 1NATA 1UP4A 2QUBA 1CR1A 4HNGA 4IIBA 2OB1A 3C3CA 5DT2A 1WCWA 4QFMA 1QZUA 1QOPB 5BV7A 1ZSVA 3JQFC 3TQOA 1Z68A 4ZO4A 3GZNB 4GEKA 1UFKA 3IT2A 4P33A 2PL9A 4FYMA 4D6XA 2VWGA 3WZMA 4GLJA 3ESAA 1VLMA 3QMPA 1IXSB 2P4SA 2JIZD 5E6RA 4ZANA 5SYNA 2V7PA 9GPBA 5K0GA 4IIJF 2QG9A 3EG9B 5JSZA 3CG4A 3F3KA 1HI9A 1R8JA 3DMRA 3IT0A 3GZNA 3M6IA 2BMVA 3RJMA 3NBYC 1DWOA 3UAOA 3WQQA 2GUGA 3JQ9C 4ALJA 2GHIA 3L0BA 1TTQB 2C0PA 3CZMA 3OOEA 2DHQA 5B4UA 3L6CA 3OCVA 2DLNA 2I65A 3PFCA 1RPZA 1AN9A 2DMRA 3BH6A 3WK8A 3GNQA 3EG9A 3RD5A 4LVOA 2W9XA 1ZH0A 2R6CA 2FSVA 4NZMA 3H11B 3I12A 2IY7A 4W5WA 3VNBA 1BRMA 3VU8A 4D4KA 4OHUA 4IG4A 3LKZA 1KRXA 1A5TA 1TL7C 2CNNA 3RM3A 1PT9A 4J0CA 1H6CA 5DSZA 3H87A 4JP2A 1BFDA 9LDTA 1R50A 4NYMQ 2O2IA 1QGED 2LDBA 4QYSA 3TB6A 1VBFA 3WRXC 2WPDA 2W0MA 3OUTA 1H9CA 2Q3DA 3MJ4A 2AS0A 3OQ6A 3H11A 2EAUA 4U7WA 5A4DA 4IGIA 3CB2A 1T5DX 2H1LA 4JLWA 1POXA 4L51A 4ZU3A 4B4UA 3L1IA 2Q49A 3T7AA 2JHGA 5H02A 4D80A 4IPTA 1SAYA 3TFOA 5IFLA 3GOHA 3TIVA 1MQ9A 3MC1A 4PTZA 3ZTTA 3HBMA 4BO9A 1LJLA 1QDUA 3TMKA 4LK2A 2O8FA 1M5UA 2WJGA 4A2QA 1GYPA 1COZA 4I1IA 1Z36A 2F3SA 2C8VA 1IN6A 4CF5A 2NXWA 4Z99A 2P67A 2Q3CA 2W2KA 4IDCA 2W7TA 3SQWA 3FMPB 4O3MA 3I01A 1YZHA 3KR0A 1FYEA 4QARA 3FLBA 3H5VA 4Q66C 1JR3E 2FEKA 2SNIE 1CS0A 3G0IA 1DTWB 1KIFA 4GVPA 4M76B 5DCWA 2OMKA 2QNIA 2XZTA 5EHGA 3TTSA 1XWWA 2ODNA 3GFRA 4H6XA 4AY3A 5CLIA 4CF3A 5IJ0A 2IUTA 4F06A 3S81A 3FTNA 4CQNA 4GSYA 1ISGA 1IZ7A 4RV4A 4UFPA 3MJFA 3AO0B 3AUJB 1A2KC 1GGHA 2YZGA 3GGGA 4Y2HA 1T3LA 2P2CA 3LYLA 2WIBA 1O94D 3N2IA 3U7JA 3LKVA 3U44A 3P9ZA 5E9QA 4LPSA 1U7HA 2RARA 3GLQA 4LRTB 5DBEX 3RPEA 2XA2A 4P1ZA 4UASA 3K94A 3M6WA 1FYXA 3GA5A 4UAGA 3AHJA 4V1CB 1XJWA 5EKXA 4YQFA 1ZK2A 4GM1A 2V4MA 4HN4B 1U7UA 3BGOS 3HR7A 2I4LA 4K2AA 3LDAA 3L7YA 2XJ4A 3WFZA 1E64A 2WT9A 4IDQA 2CLDX 3ENVA 3NEAA 1E5VA 2WZCA 1QB7A 2GA9A 2GMWA 3AERA 4GOMD 1L5HB 2JRCA 1LK7A 3WL8A 1KEUA 3D6FA 4P3PA 1FRNA 2JGAA 3QOWA 2C5AA 4C2AA 1HEYA 1U0HC 1RLUA 1CZKA 2JFBA 2L69A 2QU7A 3UK6A 4V1CA 1LNQA 2A57A 3BA6A 2I71A 3H65A 5DTEA 1UKCA 3CJTA 3PXAA 4UNNA 1GZVA 1MPXA 5D85A 1DKOA 1FUIA 4NLLA 1DIOB 1XZDA 3EY4A 1H6AA 2AD5A 3L8HA 5T3YA 1W0JA 4AULA 2FRDA 2JA2A 4O59O 1R0BA 3DLAA 5FTWA 2QRUA 3H2HA 4KV7A 1L5HA 2QTRA 1S7CA 1LQUA 3N87A 3I5XA 1WBDA 4I4TB 2QR3A 4G5QA 5C5DA 3DEYX 3GNLA 4CUKA 4P5DA 3H99A 3TW0A 3UG7A 1IY1A 1GNQA 1C8LA 1G5TA 4N39A 4OHZA 5F4ZA 4ZEWA 5KINB 3QFTA 2GD1O 4CKEA 3SU8A 1IQRA 2JJ1D 3O95A 5D7BA 4OI2A 2YFHA 3MEQA 4I4TA 4Q1DA 3T9DA 3U09A 2Z6AA 2ZB3A 4IQGA 3CLUD 2PX4A 4MI9A 2R8YA 2PCJA 3G8CA 3IE0A 4BVBA 4UEQA 3SR3A 1QIMA 4O8ZA 1C9YA 3AETA 2IXDA 4IVRA 3DO8A 2V65A 3HLKA 4JQOA 2W2QA 2BTOA 3EOBI 4IUYA 2QJTA 1SKUA 2IEYA 3OTIA 3VKUA 4ZD6A 1BWSA 5ALUA 4OX9B 2V7VA 4IHJF 3W5CA 4JL8A 1ORVA 4Q9KA 1P19A 4L8LA 5ERXA 5CX1A 3OT1B 5HIKA 2RI0A 1E3SA 5JLAA 2YJ4A 3U3ZA 2BZ1A 4KRGA 2J9XB 1ZNXA 1Z12A 2WABA 3OIGA 3V34A 1E1CA 4GI1A 4KN8A 4GMDA 4JA0A 3L0IB 4C9BA 4EQZA 1JDSA 1IB6A 1ML3A 2C4MA 2C4VA 1Y4ZA 3ROEA 3PNQA 3ZVMA 4YYEA 3OT1A 4CQMB 2GKOA 3NPMA 5JYDA 3IULA 3WB9A 4CXMA 1GUBA 4U3JA 4KG7A 4AZ0B 5C1OA 1KI8A 1TUEA 2XCUA 1S2NA 2EDCA 3E3MA 1IVYA 1CUVA 3F3YA 3HRIA 1YV9A 2NN3C 2XEDA 1U0SY 2O0JA 3ZQ4A 1NVWQ 4FC6A 3LNCA 1X0VA 4ZQCB 2FRDC 3RB8A 4BN0A 2GPAA 1ARZA 1JE1A 1O89A 4IMRA 3LG2A 3IQFA 3TBKA 1J9GA 2WQ6A 2D5LA 1AQNA 4LXYA 3TDNA 3GB9A 2Q5IA 4N54A 3HO6A 2BISA 4OMCA 3SMVA 2OA0A 3BXEA 4R9VA 3AB7A 1EXWA 2E0IA 4KXQA 5E6UA 2WTMA 4MCJA 1W5BA 2GCNA 2OOKA 3S3TA 3C70A 2Q2QA 1KBZA 1CP3A 2QJFA 3IIKA 3PG5A 4K7JA 4TM8A 5JSQA 5AVTA 4J2OA 1ID1A 4QXOA 1IY2A 1MC1A 4TSKA 4CCSA 3H97A 3CEAA 4UCFA 2SHKA 1ENYA 3H4MA 1IUOA 3L92A 1NMEA 4BRZA 4DLBA 5I4BA 4EUEA 1DKLA 3JARB 2X8JB 2AG6A 3GFTA 4LBYA 1AHIA 2K7ZA 4NF2A 5KHOC 1XRRA 5CR9A 1CUGA 3IP1A 4L8YA 2X4GA 5E0OA 2GXAA 1QHNA 1SHKA 1JHMA 2PGOA 3D4BA 3FWYA 1WY5A 1XZAA 5TEVA 4B7UA 4MV8A 1Z4OA 1P75A 3BICA 3GEDA 3O1IC 4M0MA 4FYIA 2G40A 1C9KA 2C2MA 2XTJA 4KTVE 1MB0A 5KJEA 3CRNA 3TBHA 4DZZA 5LU9A 2HNKA 3I9JA 5AH0A 2BLLA 2X8JA 1LBQA 3O8NA 4MHSA 4A2WA 3IMKA 5A4JA 3EWAA 4J0HA 1E2FA 2YOFA 3IAUA 3VTZA 3R7AA 2P2YA 1THGA 1XZNA 1L4EA 4IZIA 4ZGGA 1M0SA 1JDUA 1HYBA 2JJ2D 4NNJA 3ZUGA 1C4KA 1E9BA 2CDRA 3BQNB 3PYXA 1GG2A 1VL5A 2G4CA 4BRUA 8GPBA 3EPJA 5BWOA 2Z83A 3L84A 1UP6A 1LSUA 4A73A 4DB4A 1V16B 4ILEA 1IY0A 2AC7A 3RGWS 3BJZA 1E1DA 4WMLA 3CT4A 4HNAB 4ZOLA 1YCDA 3HKCB 4GICA 1DCTA 4YUYA 5DCYA 3JX9A 4EJMA 3JQBA 3Q5EA 3RIGA 4AAYA 2IP1A 2QUAA 5IUJC 3KQHA 3BSSA 1CQPA 1EGAA 1ZUD1 4UHFA 5IHPA 3N6RA 2NQ8A 4ZODA 2ZYRA 3EVBA 2OXIA 2QTLA 3L4SO 3LOUA 1TZBA 1W94A 3BWXA 3F7OA 4Q15A 4K3VA 5K3FA 4PGFA 2WB4A 2YBDA 4R16A 1WCYA 2HSZA 4HNAA 3V4LA 1T8SA 4CMHA 4I3FA 2Y6UA 2R48A 3Q5DA 4YXWA 2UAGA 3DXFA 1Y3CE 3G0HA 2YWJA 1OFUA 2B36A 5B4VA 2VDRB 4LYGA 1HDRA 1NXXA 4WUTA 5ALQA 1NDUA 3EFOA 4Z4QA 4L8FA 5HOQA 1E3JA 2H0QA 3FYCA 4O2RA 4PO8A 4U6SA 4OQ4A 4KE8A 2WHEA 1B42A 5FL3A 1ODLA 3WP1B 5I7SA 3KJGA 4HDCA 5ARCA 3IV6A 5JYCA 1WPGA 1GYRA 1ST3A 1ZI8A 2D1TA 2F1IA 4HWOA 2IIVA 2V8BA 4EL5A 5AUPB 1VLQA 5JSYA 2G67A 5KEIA 2ZQ5A 4ZMBA 2BCEA 3LCUA 5KQMA 1FJGB 3FI0A 3TLGB 3ORFA 1ZM9A 2BEWA 2QUZA 5GP1A 1Z74A 1EXMA 1CB0A 2YUTA 1L7OA 1YULA 3TQHA 3TR5A 4EF5A 1Q3KA 5EZYF 5IKEA 4LECA 1JSRA 3ASZA 2RHJA 1N6HA 3E7WA 3B12A 2QYSA 1J7KA 2O59A 3PDIA 1IK4A 2YUIA 3IVXA 4LVCA 1Z7EA 1ZC3A 5HKAA 1U02A 2ONZA 4MB6A 1IY8A 2XITA 5TC4A 2ILVA 2JAWA 3SYLA 3TJRA 3FPHA 3ZV6A 1SELA 4LZJA 1B0AA 2I4TA 3BK7A 2VDWB 2XJ9A 3OZ7A 4MYTA 2NSYA 3L7BA 4ND4A 2C3OA 5FKJA 2H1VA 3ISJA 3R44A 3UWDA 1V3VA 3GRCA 5BYBA 4BATA 2OFOA 5KPDA 1ZUWA 3F6YA 3VVCA 4MKIA 1FRFS 1FFEA 4C7KA 4CLHA 3IAM1 1DINA 1Z3CA 4P3XA 3OE4A 3T9AA 1ZESA 3PF9A 4GOJA 4NU5A 3AWDA 1KDZA 2HHAA 4NDAA 1W35A 4CV0A 3TTYA 3LSYA 4HRYA 1JVSA 1T1IA 2R7AA 3R6GA 3JWGA 3JZIA 4MHOA 4GXNA 1HOXA 4MKGA 5HDQA 3HC7A 4IS2A 1NQXA 1U7DA 3B51X 2G9UA 2J7PA 1RYFA 2QM0A 4B6GA 1A9YA 1I2ZA 2CKDA 1NMYA 3VM6A 1B1AA 3QNUA 4I1VA 4R84A 4C05A 5A3JA 5LFAA 4A0SA 5JAZA 1RLMA 1V9CA 1WS6A 2ZRHA 3QE4A 1KY3A 1ZCAA 2BRUA 3KEMA 3OT5A 4MYSA 4PLWA 4GWLA 1GXSB 2I3ZA 1FPMA 1OA0A 2L82A 3GJYA 4A0HA 2H17A 1KFKB 4PONA 4MPRA 3KEOA 1OSNA 1VE3A 1Z0AA 2QN2A 4MR7A 3ZIUA 3WLRA 4DRZA 3UF0A 1P9NA 3EQ7A 5FTJA 5IPFA 1WL8A 1YZFA 4JSYA 3WLTA 3S8YA 2Z9CA 1QIIA 1QH0A 2C2KA 5FPSA 5J1TB 1TQ6A 2C7BA 4BBAA 4AMYA 2UYHA 3M33A 5G1OA 1ZHOA 4L2IB 1WIWA 3A0UA 2WBLC 1M34B 2B34A 1W30A 2H00A 5JNRA 1WETA 3RQSA 2AHOA 4AIIA 1CHDA 1RP1A 5T4HA 2P9FA 1FOEB 3R3JA 5BN5B 2OG2A 2I2FA 1HE2A 4R6WA 4TMZA 3X1JA 2ZR9A 3RLFA 1L9KA 1MG5A 1KAQA 3JATB 2WHQA 1NI4B 5G40A 4AYXA 4F2HA 5AK6A 1RQXA 4L2IA 2B0CA 4A15A 1Q44A 1M34A 4F1WA 3QPDA 4XTRA 3KKOA 2HA0A 2XBLA 4CM5A 3OQHA 2L2QA 4YV1A 4S1OA 3PDHA 4Y9RA 3BAZA 1IY9A 2QG4A 4GE0A 3ZDFA 1NBWB 1WF3A 2ZCUA 2VLIA 2X4IA 1DQZA 1Q1EA 1NUQA 1ODSA 1ZK1A 3CKLA 3JATA 1N0UA 1GGMA 1MABA 1QIJA 3J81A 1PJ2A 1PX2A 1KZ7B 1Z7GA 3C3YA 3EZ6A 3GMDA 4G4SO 4WNIA 5IM4A 3MYYA 3QF4B 4GKKB 1UQTA 3QG1A 4HEHA 2EARA 1HT1E 1LLCA 3IESA 4G0VA 4DJTA 1DJMA 4FKBA 3IQGX 2HC9A 1WO8A 3N2NA 1T26A 1J39A 1TQ8A 4AJOA 1UFOA 4YB8A 1N6IA 1WABA 2FN7A 1UAYA 3EDMA 4INZA 2FVYA 4P7GA 3R5TA 5CUQA 2WWIA 4BO7A 4F04A 2FA9A 1R74A 1S5PA 3I9V1 4IDGA 1XZHA 3EXG2 4J4BA 3FPCA 1KU0A 1AU9A 3NYWA 3P9QA 3QF4A 4PZLA 2CXRA 3AB3A 3BVPA 4MQ4A 4POAA 4A6EA 2BH2A 2DB3A 2D1YA 5K03A 1S1MA 2WI8A 2I87A 5AI8A 4TS3A 4FDMA 3ZZTA 1JDBC 4QUEA 1R6TA 3G88A 2R11A 3QX7A 4GR5A 4W63A 4DABA 2VQDA 2OC4A 2AI3A 4L78A 4ZAWA 3GRFA 2NNLD 4FGZA 3MN1A 3NTRA 4L0QA 2C2OA 1E9SA 1U0OC 3CISA 4LDJA 1EGMB 5ALTA 4FDAA 1T29A 4IZ6A 3ILVA 1IAQA 1TJPB 2JGDB 3GOQA 5DYNA 3NBKA 1WAMA 2QM3A 2IITA 3CKMA 5BSKA 1LWNA 1V71A 4JBYA 2RGAA 3BFKA 5HPYB 2ZAIA 4G5HA 1AZTA 3BHIA 2ZSEA 3R7NA 4D97A 4RETA 4ZV4A 4JMLA 3UHJA 1ZGZA 1TYZA 1MVLA 1JYEA 2GQ0A 3IOEA 4LISA 4EHHA 1UOQA 3GUYA 4PSCA 1YH3A 3OM8A 5DHFA 5J5VA 1KYYA 1G5IA 3A10A 3X2FA 3EAGA 3N7AA 3U1BA 3RUCA 1OWNA 1E1RD 3AHDA 1U2DA 3E6AA 3HVHA 4CW7A 3N2GA 2PUJA 3KBBA 3S99A 5ED4A 2ZQYA 3H83A 4DIEA 4R8SA 4TOIA 2UXCB 5CEFA 2FPWA 1GFZA 1EFRA 2RI1A 5LBIA 3JYNA 3ZCTA 3DBHA 5JNWA 2CXTA 5EGNA 2XT9A 1AXGA 4RLFA 3JQ7B 5KQPA 2IHYA 2ZXEA 2EW1A 2OGSA 2UUOA 4RYDA 2HK9A 3JAWA 1M67A 2WF8A 4XCXA 1SCBA 2CVOA 1AQJA 4X84A 2AWOA 4JB2A 5HTKA 3LQRA 4D42A 4JP8A 4CEIB 2H08A 4K6CA 4I50B 5K0TA 4Z9YA 1DS6A 1RI5A 1Y8QA 3P7MA 1XEWY 3M9WA 5FOXA 3WLIA 2GO1A 3ML1A 4BNJA 5FUQA 1D1TA 1BROA 1QR2A 3UYLA 1I1QB 4C20A 4ARAA 4Z5XA 3JQ7A 4ER5A 2UDPA 3PS9A 4AXBA 3NOQA 1RZRD 9MHTA 5CH5A 2JASA 4HX5A 3DVAB 3HA5A 4Y67A 3UMBA 1A3CA 4KXUA 3MHTA 5C8XA 2Q99A 2QLMA 4G85A 1RI1A 1NVKA 3LLUA 5FL7D 3O4RA 4PC1A 4YWHA 1RKBA 3OQPA 3TNJA 1G8FA 1RZVA 2F2TA 2H1IA 2GCPA 3CUTA 3KX2A 2WKQA 3ZY2A 4DV7B 5IDVA 4EGAA 3VPSA 5JD5A 3UN1A 2G04A 3AWIA 4A2PA 3DKPA 3DVAA 3IBTA 1TIKA 5JBNA 5IN5A 2V5AA 5TPWB 1U0LA 3SC3A 5CDGA 2RK4A 4QPCA 4PYLA 1QK5A 1VSQA 5KSPA 4G5GA 5CEJA 4FLFA 1CUZA 5TQ0A 4Y6LA 4S1WA 5FXMA 3TW8A 1XCMA 1L7QA 2FOXA 4R69A 5F78A 2Q7OE 4E5SA 5EINA 3CW8X 4GUDA 3K2EA 4TLDA 4D4MA 1MW9X 5IXYA 3LUFA 3M5DA 5KAPA 1HLPA 4ZN6A 1L9XA 2V03A 4J8PA 2ZWMA 1SHZA 2I80A 3EEYA 3QKUA 3LQQA 3AZOA 4O6VA 1U2DC 2IYYA 1LTKA 2KLHA 1TLLA 2PMFA 2A84A 2QRHA 1ZCBA 4J1QA 4LDNA 5CLJA 2DQKA 4P7KA 1CG6A 3VNVA 1E1QD 2EJWA 4FD3A 1PNVA 1P4HA 1JLKA 1V7ZA 2X2PA 4KW7A 1W8IA 4BLRA 3D02A 4BCBA 4O2AF 2NSDA 3ONEA 4BMNA 5LJLA 3D7NA 2D3TA 4ZEXA 2VPTA 1OBVA 2JLCA 2QLTA 4IJUA 4FWTA 1DBSA 5IG2A 4ZP1A 3COZA 2PS9A 4OQQA 4DLXA 5J59A 5U1PA 3I2KA 4R7GA 4F45A 2LE0A 1K27A 2O3SA 1LBTA 2WTXA 2XNSA 1BQ4A 1GADO 2FSFA 2QTNA 2W00A 3A1VA 4I1YA 3ZNPA 4AWBA 2ZK7A 4BS9A 2D1SA 2EBFX 1ZKMA 1GGKA 2X22A 2VT7A 3ZV5A 2OG1A 1ZFNA 5DZSA 3O8CA 3CMCO 1KORA 2RHTA 3NOXA 1C3EA 2EJVA 4GOXA 4RD6A 5HQ3B 5KWVA 3HY3A 1V26A 1UT6A 1QM5A 4J9VA 4W82A 3WO1A 4EMBA 3QFCA 1WU8A 3P2YA 3MJEA 1E1LA 3EEQA 3GQBB 1WXGA 4OBWA 3Q85A 5DF1A 1HFEL 2QX7A 4DREA 1VE5A 1JB9A 3LOPA 1J9ZA 4N3CA 1X8LA 4ZYZA 3A11A 3R3HA 1JFFB 3VU1A 1L7RA 3VR2A 1SCUB 5KYUA 3VDMA 1CUYA 5KTTA 1U8CB 1A9XB 4P81A 3WGOA 1J0CA 5BMVF 2WG2A 3MSCA 4YALA 1IXRC 3WSTA 2WA2A 1IL0A 1UKBA 3SBDA 4B3RB 4PU0A 2CLMB 1S8OA 4M1ZA 4UCQA 2C8JA 3SQOA 1YFKA 3STYA 3GQBA 3TIFA 4DLVA 4I5DA 1KMQA 3L5KA 5KKCA 3W79A 2D1QA 3HZRA 1Z6QA 1R88A 2X5KO 2J3MA 3QVSA 5HEKA 5JXHA 1WMDA 2C7PA 1SCUA 1NJGA 1UODA 4OYLA 4OJMX 1GLNA 4Q3EA 5L51A 4X95A 2FW6A 3UUWA 2PSJA 5G4LA 4UHKA 3C4QA 4WDQA 3ONDA 3E1KA 1WW3A 1EDEA 5F1OA 5DBFA 4YPOA 4G9EA 1ID8A 4I14A 4YC7A 5HYVA 2GJ8A 5LZ8A 1FBTA 1DRUA 2R60A 3C15C 3TIIA 1ZRHA 3U37A 4KAJA 5E7MA 4AJHA 3GT7A 1EVEA 4FGSA 3TDMA 4EVRA 3CZ4A 2OL4A 3DOHA 3M6VA 1DCFA 1A9TA 5DX8A 5JFTA 2C04A 2QGZA 5KNCA 1OXKB 1NVBA 2BJWA 5ALDA 1U7TA 4IQ8A 1ZMBA 2Y93A 4XR4A 4BTLA 4JC5A 5EIFA 5HVNA 4DCUA 4PPFA 4GPD1 4K6OA 2B9EA 2FX3A 5EJGA 5EJ4A 1OU0A 3DM9B 4FJ1A 3QP9A 1IK6A 4H1HA 3VKHA 1CU1A 1UCFA 2OAGA 5B12A 2X0NA 3OJEA 2Q3HA 3Q40A 2M1ZA 4RZIA 3ZUPA 2O3RA 4XIIA 3RJ5A 3RS3A 3GRUA 2JD1A 3GFQA 1NYTA 5HMLA 4BNVA 4OMFG 3LWDA 4XXHA 4QYIB 1P1RA 1T9GS 4BB6A 2XGSA 1LVGA 1R0RE 3ICCA 4D44A 2PJRA 4BPRA 1LNSA 3WG9A 3BMCB 3N7UA 3GT4A 2R5WA 4W6ZA 4TYWA 4V0NA 1GUAA 2ETVA 2BZGA 2KWIA 3M4JA 2E4UA 1HA3A 1JS1X 1RCFA 3DBRB 4H1VA 4GL2A 2ZRBA 5BOSB 4JLPA 2L42A 2Q50A 2QVBA 3RC3A 4CMCA 1D7OA 3HYTA 4EHLA 1AV6A 3BZUA 1A7JA 1JXQA 2C4KA 3AOEC 2IIBA 1QRSA 1U8ZA 3TUIC 4CL0A 3IAXA 4R71A 4GUAA 4IX1A 3RFUA 1W6UA 1FTYA 1IBLB 3JCZA 2NTJA 3DBRA 2WJPA 3EGIA 4FUTA 4HZGA 4UNSA 3HDVA 1A2BA 5T6BA 4AYWA 4CZ2A 5BOSA 3BBLA 2J6BA 1OPXA 2O2SA 3LO5A 1Z0KA 1EFCA 1SHLA 3U6KA 4D5EA 2YZMA 4OLFA 1AO3A 4KLAA 3Q7RA 5EGSA 3HH8A 4IV0A 3X1DA 1BQ3A 3FKSD 2PUAA 1NONA 2GK7A 3HPRA 5DGIA 2W4IA 3RABA 5EHXA 2YV3A 1YK0A 1LC3A 2JAPA 1N8TA 4G0PA 3WIUA 1MC8A 1XU4A 2ZATA 1GT91 2REOA 2AK2A 2GJKA 3FKJA 4AU1A 1I6LA 4B44A 1TRKA 5C4GB 3ZVNA 4WXRA 3U9SA 1CDDA 1IWOA 4ALMA 5LDDC 4BLOA 1YBFA 5KYXB 1SU4A 4TXNA 3PLNA 3QTTA 3SBEA 1YR9A 3H3FA 4YI5A 3KNZA 4B6RA 2C98A 1JA9A 2VNJA 3G2QA 3F8TA 1EGHA 1ORIA 3R6TA 4JUCA 4PR3A 4WLVA 3S4YA 3TKLA 3W9SA 4D0GA 2PFSA 3BIWA 2PUFA 2BKEA 1NQOA 2N42A 1BWRA 1XR3A 4ZVPA 5AXDA 5T67A 1FB5A 3LTEA 2OUIA 2ZIWB 4TT3A 1H85A 1ABEA 2YJ5A 5EZSA 4RQTA 3IP9A 2IH4A 4HUQB 4OSEA 4RDXA 5KB3A 4UOZA 4X24A 4PF1A 5ITSA 2QTVB 5JMPA 5B6IA 4TLBA 1ZN9A 3MWGA 3H84A 1MO6A 1MKYA 1JLMA 1I13A 2WG0A 3RUFA 1Z4MA 3AEQB 3ZWPA 4R0VA 4U7DA 4MTCA 4ZHQA 1VDMA 1RYMA 4DSTA 4TROA 3WMGA 2P3SA 4DA4A 1MR3F 2D3WA 4BRWA 2NO1A 4TKLA 4KWCA 1LLFA 3VO2A 1RYYA 5EJ2A 4IDDA 2C42A 2QTVA 3NOVA 2PO5A 1DDGA 2PANA 2D2VA 3U13A 1BJRE 4DZTA 4LWPA 1JSLA 2DBVO 1A0OA 2Z43A 3AEQA 2XDQA 2M1XA 1YB6A 3IX7A 4RF3A 2HQSA 2NV2B 1EFPB 1V43A 1L5ZA 1GAQA 1Z5WA 2R25B 1R5OA 4XD7D 1AKWA 3CRQA 3QU2A 2RH4A 2NU7B 2UYYA 4NCNA 1RWVA 1H6BA 1J2YA 1T3TA 4OLJA 1JRLA 1K9VF 1XCLA 2A3NA 5AJWA 2OXEA 5BSHA 1QHIA 1KI3A 1UADA 4U2CA 1CC1S 4MCIA 1KKMA 1Q74A 2IU6A 2XV1A 3BB1A 4B6PA 4Y6SA 5AHKA 3CINA 1PLKA 3A70A 3JQGB 1NMZA 4PYIA 4OKSA 3UUFA 4A8JA 4EBBA 1L0BA 3A6FA 3SVLA 3GO4A 3PR1A 1HY3A 3LFTA 4LPKA 4UTPA 1U3UA 4AD8A 3R76A 4TWZA 3VVMA 4CETA 3TINA 1NX6A 4PFJA 4HC4A 4TQGA 1ZD3A 2B37A 3IUJA 3WAGA 2C61A 4MUJA 2QSJA 4N40A 1CQZA 3EARA 2XCIA 3PGJA 3U7HB 1E6CA 3CX7A 4I9UA 3PC6A 5C9ZA 2DFDA 1IN4A 4LE0A 1HRKA 2FLKA 3AK4A 4PSKA 1RIIA 5IC6A 3VNQA 2C1ZA 1HDIA 4JD5A 2FPXA 3CUUA 5CDFE 3A1CA 4MVJA 1T43A 2ZBGA 3ELBA 3AF0A 3SXPA 3OLXA 3KLOA 2F8MA 3OQIB 1OASA 4LTDA 3I30X 5IT4A 1LFDB 1RWPA 1SPXA 1QF7A 2I5PO 2R4TA 4NBVA 1DG3A 2GEDA 4XJSA 2YHAA 3V8EA 1FFXA 1I51A 5BSFA 5J2UA 3N2LA 2WD8A 3AJAA 4YRRA 4B7ZA 3UAWA 3H42B 4DCSA 4LC9A 2WTEA 4KI7A 4J7AA 3LD9A 4JP3A 2JGFA 2P40A 1KK2A 3D5EA 3H16A 3JQQA 4JI6B 2BEKA 1GDTA 3VR1A 1DT5A 1E89A 2BFCA 1I9GA 2RDMA 2Q27A 3D1LA 2RHDA 3DGFC 4G89A 4YMWA 1VG0B 4HB0A 5T64A 4TN1A 1WDKA 3ULKA 4DFDA 4KUGA 4N76A 3NKFA 4KVGA 2GZ3A 3OEED 2H8KA 3TSWA 5FCDA 3CIFA 2ONYA 2WHPB 1NQVA 3SM3A 2WF9A 3EJ6A 1CUEA 1YBHA 5EWLB 5FNVB 2Y2VA 3SJBA 1J00A 1GPAA 5HGXA 5KPJA 1EUQA 2VYCA 3ZPXA 4Z9AA 3GH1A 1U99A 1ZNZA 1QVAA 1U1IA 1WPXA 2LKCA 4S2EA 2JH9A 4D8VA 2Q3FA 5HRCA 5LNK6 4BFXA 1B26A 1H9AA 1QPGA 2B1QA 5H4HA 1YE3A 4OQDA 2A0YA 1XKLA 3GAZA 3RRXA 2XUJA 3OZGA 5IC4A 1KMCA 4FMDB 4X93A 2VDQB 5EUBA 4ZI7F 5AKLA 3T5DA 4L7VA 4YMSA 5FNVA 4A8JC 5EJEA 1HKHA 1TE2A 3CCBA 4RLHA 3UCEA 4D6YA 4X00A 3DO6A 3KOMA 5FQNA 3VPAA 1Z2OX 1PG2A 2CFTA 3OKCA 4W1RA 3KQQA 4B46A 3OPQA 4BWGA 3GQVA 1L2TA 2XKAA 1BXGA 1P60A 5IBQA 4G0QA 4MICA 4R98A 3HN6A 3PRJA 1Z4PX 3ABQB 2ZBRA 4YCDA 3SNKA 2P9TA 1SXJD 4X54A 5EIAA 3VR4H 3EAFA 2V6MA 3AM4A 3NBZC 3PUWA 1CPYA 5FTKA 4FGUA 1GPH1 2AI1A 3UJNA 1QWSA 3T0FA 1VP3A 3AUKA 4Q4HB 4BNXA 3QPWA 5LYJF 3WMXA 4HWTA 3W7VA 5DM1A 4MDYA 4RZQA 1GILA 4WECA 5HF6A 3HS3A 3T38A 4DGQA 1APBA 4NXNB 3ANXA 2UZAA 3F7TA 4IHQA 4MWZA 1XDZA 4OXQA 5LR6A 2X0JA 4NBNA 2O48X 4O63O 4GO1A 1NT2A 3B36A 4PRZA 1NPDA 4U5QA 3QKTA 5GADl 1Q7EA 3RS0A 1E2DA 1FU8A 1LLDA 1I5OA 1NVAA 1R0XA 3VR5A 5EPEA 3U5TA 5FT9A 1B43A 4WLNA 3F2VA 4HQRA 3QELA 3KHSA 1Q0RA 1LY1A 5FTLA 1EDBA 1QTNA 5ILGA 3EZGA 2FFRA 1P80A 4W9NC 1VE9A 4L9RA 4PQGA 2R2GA 2FKNA 1GZ4A 3LT1A 3V33A 4MI6A 2AMYA 2BGUA 1J07A 2QUJA 5CYFA 4TTAA 2IUYA 1FJHA 1RM3A 1FNCA 1L8OA 2X7HA 1NSTA 4EGFA 1VFPA 3OETA 1GP2A 1XN1A 2QYOA 4DDUA 5D00A 4B3HA 3R0JA 4AQ7A 4EYQA 3DZHA 1T9CA 2M98A 3ZHQA 1W36C 2A33A 2GXSA 3GG2A 1XZPA 3P97A 3G23A 4GF5A 1WB4A 3EUFA 1NV8A 1RQNA 821PA 1HE8B 1R9MA 3PXXA 4G37A 1OJ7A 4KFSA 4I2VA 5DISB 3ZE2B 1Z4QA 3EZNA 5JPDA 3FTDA 3GAMA 4TZ6A 3RS4A 4YQEA 3MTAA 4Q39A 2YHSA 3KL4A 1KHTA 3SXUB 2IPOA 4US2R 1EDZA 5CH8A 1CY7A 1F4VA 3WQSB 1Z6ZA 4KFRA 3S2SA 2GZDA 3ZU4A 1B8NA 2GILA 2VP0A 4H1WA 2ZYVX 1V39A 3ZOZA 1EA5A 3QIAA 3CLTC 2GFHA 2BP7B 2MJLA 2VJMB 1U2ZA 4G1BA 4YVFA 3WL4A 5KAMA 4C3ZA 4UMFA 3OZFA 3P4YA 5CB0A 1II0A 4ZJPA 5K8IA 1RTTA 1F9EA 1WSWA 2CVPA 2OCBA 4A1OA 4KBFA 1G60A 5K3SA 2ZGVA 2ZRDA 1KH3A 3H04A 1HZZA 5DX1A 1L5LA 5JASA 1UZLA 2EC5A 1J0XO 2O5CA 1OWMA 1CRLA 1UMBB 2BP7A 4BGUA 2PQ0A 1TZCA 4BFYA 4E6EA 4UQLA 4PHFA 3AHHA 4BIMA 4AKIA 1P74A 4I19A 3J81k 5B55A 3QLVA 4XWGA 1V9LA 3RR2A 4WL0A 3T5MA 3AF6A 4G4IA 3DB2A 2O4UX 3K8QA 2QHXA 3R5JA 4MPTA 3OH8A 3OZSA 4Q03A 2D0DA 1M8JA 1XSEA 4Z0TA 3OFKA 5F7JA 4GOLD 1L7XA 3FSRA 3PVSA 1KMIY 2PLRA 2EL9A 2IKQA 4FE7A 3FFXA 3JV7A 4QNNA 1RWQA 3DT6A 5CMLA 3TQTA 5BR1A 4IR7A 3Q8XB 1P39A 4I9NA 4WY8A 4E5PA 1A27A 3LHFA 1KJZA 1EDOA 5ALZA 3ZEAA 2FPUA 1WHSB 3N76A 4PO1A 1OXVA 2Y2UA 3GLUA 1GARA 3BL6A 4Q16A 4RHXA 4DR3B 3CUSA 4Y2VA 3TVDA 2IYXA 4B31A 5AW1A 1NY5A 4JLDA 1Z8DA 4BDSA 5AVQA 1RXVA 4TMWA 2Q2WA 4QUHA 3M4YA 1FSPA 3N75A 1J8FA 3EQ2A 2MTBA 3EVDA 4K9NA 4PAQA 4REMA 3LUAA 5ICFA 3WRYA 3WWZA 4ASUD 1H2FA 1VJGA 4E09A 3BHMA 3LZCA 3FN4A 2WW8A 4OOEA 5K0CA 4UFOA 2V1XA 1C1XA 1WCXA 5J4YA 5C53B 4GKJB 3EODA 4RM2A 1DRJA 1RKVA 3OQOA 1QFZA 2QSUA 2QLJA 2AVDA 4ZYVA 1KDTA 5B2EA 1J8VA 2NADA 1EAMA 2XYVA 3L8MA 3SJUA 1CWUA 2R68A 2Z1DA 4TZKA 2FMUA 4LYDA 1E1RA 2YS7A 4W5HA 5LA6A 2N75A 2YMLA 3WMWA 1QH8A 4RHEA 1F3LA 3D4NA 3FDXA 1JE0A 3Q0EA 4B82A 1U04A