4KLRA

E343q variant of human ferrochelatase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIQTLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase, mitochondrial
publication title E343Q variant of human ferrochelatase
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 134
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4klrA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4klrA01
2Q2OA 2QD2A 2H1VA 1LBQA 1LD3A 1L8XA 2JH3A 2AC2A 2DJ5A 2QD1A 2PNJA 1QGOA 3W1WA 2QD4A 2HRCA 2Q3JA 4KMMA 2XWSA 3HCOA 2HK6A 2XVYA 3GOQA 2XVZA 4MK4A 3HCPA 3LYHA 2Q2NA 1C9EA 2QD3A 1DOZA 2PO7A 1C1HA 2XVXA 4F4DA 1AK1A 4CCSA 4KLRA 2XWQA 3M4ZA 2H1WA 1HRKA 2QD5A 2XWPA 2PO5A 4KLAA 4KLCA 3HCNA 3HCRA 2AC4A 2C8JA 3AQIA 2HREA 1TJNA 1N0IA
chains in the Genus database with same CATH superfamily
4YT5A 3ASUA 4DR4B 5CVEA 5HUJA 3FPLA 3STHA 4B34A 4E30A 1I7QB 1HE3A 1PWYE 1LNSA 4KVZA 3WR5A 2ZRJA 3B6IA 4IIJF 3G7NA 4JROA 1GGVA 1GXSB 4FIZA 4DNFA 1PNVA 2ADFA 4RGVA 4RETA 3AUUA 4KZKA 3QMPA 3V2IA 3EG5A 5JR3A 2D8MA 2PX3A 1WP9A 5LB4A 4IHJB 4N8DA 1OTHA 4DTCA 3TRKA 4Y2XA 4YMWA 1NG9A 3L0ZA 4JB2A 5IUKC 2PMFA 3AG5A 2MSKA 4I5IA 4MQFA 2WD9A 3DNMA 3ZWNA 1OZFA 2RH4A 4B71A 4E5VA 3NDBB 2B8EA 2BFOA 1Z28A 4RFSB 1ZHOA 4B3GA 2ZK7A 1A9YA 3EB9A 2V5UA 4LF6B 3DMNA 2ST1A 2QNIA 4FWBA 2PRZA 4Z4GA 3E5MA 4H7FA 3LXMA 3VV3A 1UEJA 2NUPA 1MH1A 4IH9A 1DTWA 2J31A 3NH9A 2BHLA 5FR1A 1UOEA 2H06A 2I4TA 2YFKA 3OT5A 3RQIA 1Q1ZA 2VUSA 3ZH9B 1ORWA 2Y2UA 4MRAA 5HM6A 4RESA 3HEAA 1GUYA 5CU7A 4D4GA 1Z62A 3RU3A 4NRDA 1L4UA 4IUYA 1DKQA 2WT9A 3DMGA 4PQYA 3VDRA 1WZNA 2YJNA 3KLMX 4YLGA 1NYTA 1ORIA 1ADFA 5JSKA 3PHCA 2JHCA 1KDZA 3O90A 1UQRA 4OHUA 2WAOA 4UMFA 1A4UA 3WLQA 4HDSA 3GNSA 4JLMA 4CL8A 1KRXA 4LY0A 4KPYA 4I50A 4Q4JB 1RVDA 2G72A 4CZ2A 3P52A 1UBNA 3TL3A 1Q0SA 3PDCA 3KUCA 1XXHA 1U0BB 1RWXA 2Y3IA 3FJ1A 1EINA 1U0LA 2PX8A 5NLLA 1YCHA 5DOVA 2Q6KA 4RY0A 1CUJA 4G0ZA 5CT4A 4QEDA 1KC3A 1U9ZA 1QRUA 1GAXA 2LVBA 3R3HA 3IRVA 1QOPB 3SF8A 1NQOA 4I1SA 1SD5A 3U37A 1W49A 1PTJA 2FTKE 3ZPXA 4AS2A 3UMMA 4RH0A 4FE3A 4J0GA 1FDWA 4OQNA 1R5OA 2X2EA 1Q91A 2NYVA 4MCAA 2P8JA 1DX9A 3GGCA 4R8VA 2C9CA 3I42A 5AJYA 2HHAA 2C78A 3LUGA 5AVKA 1E4YA 5D5PA 4RDCA 1WCXA 3N6VA 1ZP6A 2GSDA 4K8RB 5JO9A 5LP1A 1Y6FA 2YMQA 5L3QA 4EG7A 2JJ2A 2YHBA 1V8PA 2BI4A 2REQB 3TOSA 2R6R1 2COEA 1MO3A 3U0BA 2E4AA 3IVRA 4V0MA 1G60A 1GTG1 4X8LA 3NALA 4ZCQA 3U4AA 1T4GA 2IY8A 4D4IA 2JLSA 1FLDA 3R9WA 1K5DA 3EMKA 1VPLA 2QRQA 3VQTA 1VPWA 2YUTA 2QENA 2XJ9A 3EX7C 5KQLA 1PJBA 3OPQA 4D98A 2R8OA 1YXMA 3N05A 5DMHA 1J0EA 1QOZA 4CU2A 4U2EA 1J39A 4JYBA 2G1PA 4CMBA 2F3SA 2UXBB 1ZUWA 2IVZA 3LWZA 1LTHR 3UEOA 1I80A 2Q2VA 2ZAYA 3CN9A 1QF7A 3LQRA 4ZN6A 1CD5A 2ODWA 2PZKA 5BV7A 2QTNA 4LOKA 4M0UA 4BIIA 1U2PA 3QFCA 1JE1A 2XNHA 1W36C 4GEGA 2J33A 4PRKA 1RMQA 2G9NA 3FVWA 2AOVA 4E07A 2IZZA 3H2KA 3MRTA 2G76A 1BZYA 2XUQA 1FMCA 4OQXA 1WAMA 2ES4A 1YNOA 3KOMA 5CJPA 5TY0A 1BX0A 2C4WA 1CULC 1BS1A 4JBNA 3SI7A 3PD1A 1F8YA 2QRVA 2M6RA 2QV0A 5K0ZA 4NYJQ 3TVYA 2OHGA 3KV1A 3EULA 2OAGA 4K2AA 2WUGA 5AUPB 1HDOA 2H59A 3CJQA 3L6BA 4MVJE 2B20A 3K20A 3SR4A 3VR3D 2A9PA 4H31A 1LBQA 2NXJA 2PGDA 4BO8A 1HV8A 4JUFA 2G07A 4ZJZA 3NC4A 5JNWA 5I4CA 1RRMA 1UJ2A 1CJBA 2PN1A 2J7KA 2P69A 3SE0A 1B15A 4I4CA 2K87A 3O4JA 4FXPA 2A33A 2B2XA 2QXUA 4FZVA 4WVLA 1Y5MA 4NXMB 4Q9DA 1SR8A 2PXCA 1W87A 3KAKA 2HT6A 3ESCA 4QYTA 3TI7A 3WHIA 3ZWAA 5BSGA 3HL4A 4X54A 4GVLA 1P19A 4MP3A 1TU3A 4RZHA 1CUFA 4F5EA 4Q4LA 2EFHB 4PYJA 1RBMA 1VMAA 5JQGF 1NPTO 3G89A 4OMUA 4EQ6B 1MB9A 4H0CA 1E1NA 3UWMA 1YE3A 2PS0A 5GONF 1XDBA 2XDYA 4XXHA 5CH8A 1RM4A 4RV5A 2KB0A 3V1UA 2EWMA 1L5VA 2G0NA 2GAJA 3EOZA 4GKVA 3SG0A 2XZDA 2ZSBA 4FI3C 1T91A 3GLHB 2JBWA 4I9GA 1YA6A 3FVQA 2C9MA 2BN4A 4JUDX 3F49S 3KYCB 2Z43A 4PQRA 5K3FA 2QUZA 1ZW1A 3A2KA 1Q21A 5CXSA 1GCIA 3PUVA 3ZCRA 2C1XA 2E6UX 3AGPA 3ILHA 3ANXA 4QGFA 2ZYWX 5BV1A 4B4OA 4GVXA 3Q3CA 1KHHA 2WTNA 1C29B 2GZ1A 2ABWA 1CJCA 4ESOA 4XJXA 3TGPA 3EC7A 1GR1A 4MV4A 4GOJA 4NONA 3IODA 1SCBA 4JJIA 2R5NA 1P60A 1YDEA 5GINE 3GRFA 4IM7A 2UZ1A 3ZW8A 1K8RA 2F8TA 1Z25A 3NHWA 4EL5A 3W5HA 4IMJB 4OG2A 2VWGA 7ADHA 2N42A 4BUZA 1KXJA 1A9XA 4OKNA 1EG7A 3K6KA 3S8YA 2O7RA 3W5CA 3RNLA 3B13B 4IXWA 5FAXA 4D8YA 3EZXA 4D56A 3HWWA 1E32A 3FLEA 3A3OA 1U02A 1B73A 3N2GA 5C8YA 2JJQA 1QZUA 4LUCA 1Q15A 1QP4A 1GKIA 3MVEA 4I9UA 4EVQA 3IPAA 2EIHA 2Y1CA 3QTBA 2EW2A 2QAGA 1KQPA 1PQWA 4RUKA 4Z2YA 3U9SA 1ESNA 1EWTA 5HJ7A 3DWIA 1YASA 5TS2A 3H6KA 2SCUA 1ZCFA 2A0KA 3SZOA 2P9YA 1C0PA 4OXRA 3F6YA 3SJ7A 3QSYA 2PUGA 3CRVA 3I9KA 1QGAA 3GJ6A 1F0YA 2ZUFA 2J85A 4XTCS 2NXEA 3R3WA 2H4WA 1TM4E 4FDTA 4U9HS 1Z5OA 2PNJA 4OA5A 3ZJ5A 1MHPA 3QYPA 4OHWA 1BTOA 3HVJA 5HOQA 1PQYA 3HA5A 2WJ4A 1L3BA 1N2OA 1E96A 4YDQA 3CC8A 1P7ZA 1RXSA 2P9JA 4KAAA 3PGLA 4W7HA 5LA6F 1K4MA 1C4XA 3USZA 3VR6A 4G0PA 3QVLA 5ARBA 4AJEA 1ZH6A 4RPLA 1CRLA 3VH1A 5SZJA 2AQKA 3CZRA 3OO1A 1GTL1 1WVIA 1DCFA 4OCZA 1YRQA 4NENA 1W0KD 1DIRA 3FNRA 3K92A 4E51A 1OLUB 1SZDA 4K88A 4XFDA 2NPOA 3KDSE 3PTLA 2IA5A 3F71A 3MERA 3MQFA 4QU9A 5J4LA 3T4EA 1C3XA 1X13A 4BP9A 5T7BA 1MAUA 3FOCA 3FCYA 3GJZA 4H15A 4OB7A 5FDFA 1OASA 5I7UA 2CXSA 2QTCA 1XWIA 3TTUA 1QAMA 3BREA 4N6GA 4GPEA 5ERXA 1M5UA 4TWZA 1JH9A 4CXMA 4BXOA 4IIJA 3ERCA 5JS8A 4C4SA 4UEOA 3ZBUA 4ZVMA 1WXXA 2IV7A 2W6JA 4IOKA 5CT8A 3DE3X 1Y7TA 3FR7A 4XB1A 3P94A 2FXIA 5IF3A 2FPGB 3D8UA 3E0XA 1KERA 3FNHA 1VLZA 2FSFA 1G0NA 2WYUA 3I28A 4ONEA 5FRDA 3RBXA 1KEEB 4CDNA 5NULA 3H9GA 4C1BA 1JFFA 3AQIA 3JVVA 2C5AA 3HO8A 3MYYA 4KODA 4MV6A 1J5EB 4M6WA 4L6CA 3C6KA 2R7NA 2WQZA 1EGVB 3EGWA 3AZPA 1RKBA 4H77A 3UXEA 4PBTA 1LX7A 2IUUA 1QFZA 3QEMA 5DYIA 3V8RA 2Q3JA 1EFPB 3MGKA 2FR8A 4BRUA 4ETWA 2LP4Y 1H0KA 2J9YB 4P4SA 3ZHBA 1DBSA 1JEDA 4D3XA 4W5RA 4UXHA 3LYHA 5GJCA 3JAWB 2NUTB 4ZXFA 2EIXA 4A4DA 5JBIA 3MTJA 1QHHB 4HN2A 4KIGA 2IGBA 2JFXA 3A4YA 4D1YA 1QS0B 3BXZA 4BX9A 5C3UA 1KZHA 3R77A 5F4ZA 2QTVB 4G1FA 1CUIA 1F06A 4Z7JA 3HFRA 2VT6A 1B8NA 4AJLA 3K8OE 1DAOA 4OTZA 5CYOA 1Z5VA 1WMAA 4S2EA 4WKPA 2NZ2A 4NBLA 4DLVA 4F1WA 2ODBA 2KJQA 4G65A 3UT6A 2ZVQX 5G1NA 2VP0A 1CUZA 3FIUA 1VM6A 4DCOA 2YWHA 1UEXC 1X7XA 3EEFA 4RKQA 1KOGA 2C29D 5C9ZA 1WXWA 3RSSA 3F5DA 3NP7A 4OSEA 4RX1A 4Q3KA 4TPKA 3RM3A 4HK4A 1UPFA 1I33A 1L7BA 2WZDA 3OEHD 3OTHA 3OJ0A 4WCDA 2AHOA 3KX2A 3O4HA 4HF7A 1AG9A 4MAMA 2WQ7A 2P27A 3WSVA 4AKIA 4MRMA 3Q4GA 1UBEA 5IJZA 1UFKA 4PVDA 4TYNA 4GRIA 2BZSA 4F4FA 1E5QA 1XDSA 4MEAA 1UBGA 1WM1A 1P44A 3HZRA 4IGIA 4UCQA 1QMPA 1AVTA 5C5EA 3LE8A 3BXEA 1TEXA 1TJ3A 1TAQA 3IQZA 2ZM6B 3NAGA 1MIOB 2MSWA 4QWWA 2EG9A 4QOIA 4XWKA 1NI3A 1SN7A 3A58B 4HY3A 3I0NA 2QR2A 1V11B 2WF7A 3ZTYA 1XD2A 2QI9C 4JQZA 1Q1BA 3DOJA 1X94A 4ARZB 4MINA 1OJ7A 2FK7A 3P2IA 3QKTA 3DZ8A 3L8EA 1S2OA 1BJTA 3FNGA 5HZHA 3NOOA 1Z06A 3MJDA 6CHYA 3DLPX 4RIEA 1J9GA 3OZSA 3GK3A 4WXEA 4YI5A 3D7RA 2O48X 4H6PA 3VPSA 2IEGA 4Z7NB 4ZDKA 1U2QA 1F17A 4A23A 2IZ5A 1JH8A 4PN7A 3GBVA 1T9GS 1V0JA 4UULA 3C5VA 3COVA 5DHSA 2G5CA 2RHHA 2YZ7A 3CPEA 4BFWA 4M9UA 1Z5ZA 2OCAA 1U7ZA 4G1EB 4D97A 2AZXA 5DCWA 4J2HA 4CM1A 3AR7A 2X4GA 4N9WA 3WGKA 3PEWA 1V43A 1G2PA 1B4DA 4KFTA 4RBNA 4WESA 1A4RA 3VZPA 4YRKA 1NVEA 1R27A 1SEPA 1D4AA 3GCWA 2F64A 4H6XA 2VPZA 2BRUC 1O9HA 4I4IA 3WIDA 4MA5A 3CF2A 2A9RA 5FOQA 5KSOA 3HHEA 2N0SA 2P9ZA 1T2AA 2NU7B 4RIFA 1W4AA 2BW0A 5EJGA 3EGOA 1QFYA 5F33A 1ZIXA 4QA9A 2DHQA 3TUJC 3ZGXA 4F97A 1AQJA 3BYZA 2CYBA 1ULAA 1DUIA 4HYEA 2D1RA 5TPZD 4WACA 3INYA 4DR5B 3K0BA 1NFRA 1XU4A 5KYTA 1IN4A 5EJIA 3AI3A 2YDXA 4HNUA 2ZSAA 3K31A 2FPIA 4Y2YA 4I4TF 2O8CA 1GVNB 3AVQA 5AP9A 4G8DA 1NKTA 2ZYVX 1NMXA 3GYGA 3M5CA 5J5AA 1KE1A 1ZN8A 4TXMA 4RH1A 4C7JA 1K0UA 1RR6A 3H0KA 3ST7A 3W9SA 3PEYA 4AB1A 2FG6C 1H1LB 4J0DA 1ISPA 1NURA 2C4VA 3K5WA 5CBKA 3AIMA 4P98A 4GRAA 4FN5A 2YZNA 5EHZA 5K7SA 3HVKA 5L4SA 4TMZA 1NPDA 1ZUHA 5FA5A 1U28C 2N46A 2AE2A 3PSHA 4LN1A 5CLFA 3TGLA 3IQIX 3PC3A 3E3LA 2OP0A 4U6NA 5CB4F 5BP7A 2AFHA 5A71A 3TLBA 1WPXA 1Y7PA 2FVXA 1B6TA 2PO5A 5I9SA 1C3LA 4DUYB 3IMGA 2V7PA 1TD9A 3ZI7A 3RUDA 3VTFA 1RYFA 4BMOB 2QTAA 4R3NA 5TMBA 3O1IC 5T8KA 4WY8A 4IWNA 4JP5A 3HKBA 1ND5A 1ZA1A 4KRYA 4DBVO 5JQGA 1UUFA 4KO1S 4J49A 1OAKA 4ROTA 3DAHA 5LOVB 5GONA 1EE1A 1M1NA 3MBIA 2XTMA 2PYIA 1S9DA 1UXOA 2VHEA 4FOPA 4YAOA 4LYEA 5IMBA 2IWHA 4DRZA 1DMRA 4FFDA 3JWHA 4JHXA 4NJEA 4DW8A 4YRZA 1SU7A 2EU8A 3BJRA 3ETHA 3KR0A 4NF2A 1C80A 1XLWA 1WL8A 5HHTA 1PZEA 4UU0A 3SSMA 3ABRB 4AF6A 1CUGA 3ECAA 4TTIA 2EGUA 2QROA 1GAJA 1TZBA 5A5VA 4KH0A 4V0LA 1JDVA 3DFUA 3GN1A 3MBKA 3FUCA 5TR9A 5I51A 3UHJA 1EFDN 2Q5QA 2BMJA 2VCYA 3BQ9A 3O0DA 5AK6A 1X80B 5JH7B 1G5TA 1BD4A 1IEVA 1C7IA 2PNFA 3NT5A 3NGXA 4M7WA 4Q05A 1RSZA 1IYZA 2BCJQ 1SUAA 1L1QA 1Z2CA 2XMDA 3TNJA 1KPGA 4EPWA 1N0UA 3FF4A 3GD5A 1A88A 3WICA 5K8JB 3K70D 2PAFA 4XWGA 4LKRA 1ZNYA 1GZHB 4JLUA 4RHXA 2IPXA 2LWIA 2JFFA 3C7CB 4JUAA 4MGEA 4RPGA 3OFVA 4UZFA 5CIWA 3SQWA 1OGYA 1YR2A 2IEYA 5AKXA 3K4QA 3IALA 1C1HA 4NOJA 4WZBE 2I1QA 1E2JA 3DCJA 2HTEA 3KXDA 3KZOA 1MJHA 3UJNA 4W5OA 1J90A 3VXKA 1I94B 3CNEA 2Y2VA 4F04A 5E95A 1RQ2A 3SLRA 5JZOA 1PJLA 1UBFA 5KPDA 1WOYA 5ED0A 1YFZA 1VKHA 4P84A 4MGZR 1VL2A 3P0RA 4ADSG 3PIRA 3ZBTA 5C80A 1PYDA 1DXYA 1VPEA 1VZ3A 2GPYA 2PS3A 1QQAA 4QJIA 2ZZNA 5F52A 3NTVA 4OXXA 1V7PC 1RYDA 1TTQB 1NW8A 1CJKC 1XMJA 2XGSA 3JQFC 1JEYB 1YS1X 3I73A 3RG2A 4AS1A 2RGAA 1OH8A 1YH3A 3GLKA 1SCDA 2GJ9A 3NNNA 2TECE 4II3A 2ZWVA 2QY9A 2FN7A 4OD0A 3LFUA 5IAGA 1Q1QA 3GCGA 2M6KA 3NWBA 3TX6A 3PC8C 3KIPA 5LA6A 2X41A 3OIGA 1ID1A 1GQOA 1RHMA 4CEJA 3ZS8A 2C20A 2AH5A 1I1QB 2I65A 4KR9A 4MWBA 1SQSA 2GASA 4AJ9A 4DR2B 4Q1EA 2O0HA 3ZZMA 2X2OA 3T5BA 4PYLA 1OROA 2OZKA 4DIOA 4RVOA 1NX9A 3QOWA 3WXMA 1T5TA 1QIJA 3KU1A 3S27A 5GY7A 1VE3A 2KQUA 4BIMA 5LU8A 4MV7A 1IN6A 4NEQA 5IW8A 1T3GA 5J1TB 3D7SA 5LDDC 3GG2A 4C5AA 2W7TA 1YS6A 3KLNA 2D5LA 2NQTA 3D3JA 3VZQA 4HRXA 2PZGA 3UAYA 1ZIOA 3CJRA 1MAWA 1MEOA 2VF5X 2C3PA 3MMNA 3U49A 1ZGZA 2XZLA 1JQEA 1NVVR 3EZ7A 3GZTB 1TKCA 4A8JA 1Q0TA 2C2YA 2R84A 1R12A 5KJ6A 1PN3A 2AMLA 5JSHA 3A11A 4MYDA 2VHXA 3OPVA 3H65A 1UC5B 7YASA 1GVHA 4JLVA 3RYCB 2HA5A 4DAEA 2DPYA 3FHJA 1ISGA 3TQIA 3KJIA 3JYLA 3R3UA 3WA6A 1W44A 1M8KA 2VNIA 3BRWD 3G9QA 5B7NA 3LY9A 3G6KA 4ZQHA 1C3OB 1QFXA 1U2GA 2HWKA 5A3VA 4BNTA 3K6JA 2Q9CA 3VR3A 4ER7A 3GDHA 3ICCA 3V3KA 2H63A 3QMMA 1XTKA 4JBLA 2X2PA 2IY9A 1DWQA 1DXQA 4R1PA 4JLWA 2X6TA 5IEJA 1G3QA 2P1ZA 4NULA 1HYBA 2VNJA 1BFUA 1IY9A 2HRZA 4QYSA 3R7SA 3RK1A 4WZAE 1TI7A 1QB8A 2C9OA 1P6UA 3OETA 1JAHA 1NP6A 4KKXB 4ASUD 3K96A 1CY4A 3MT8A 4GLJA 4LCJA 4E3WA 4YJ3F 1NGSA 2QTTA 3ISVA 3HCCA 2Q5FA 4QULA 1CY2A 5IUNC 4JWKA 4L15A 2GERA 3GF4A 1C2YA 2VYCA 3JSAA 3KYDB 2PHZA 4LBWA 3HP4A 2R4UA 2VRCA 1Q1GA 1QGDA 3ZKAA 1EX6A 1HQDA 4AMVA 2J0SA 5D86A 4RK6A 3L8MA 4TQ9A 4N54A 4HFNA 1TZJA 3K2EA 3W6ZA 3C14C 3RVQA 3B36A 1VLJA 3HJGA 1AQIA 4F0JA 1IPHA 1LRJA 2HWUA 3HUEA 1BH2A 1Z56C 4ID9A 4KRXA 4MO9A 1H8ED 4ZANA 4BJ6A 1JKFA 1QK3A 2WDZA 4O0LA 4B6FA 3WGZA 5JZMA 4URYR 2XYHA 1QRAA 16PKA 2AFIA 4KC0A 1MV8A 3DWEX 3ZU3A 2EEZA 2RDMA 3GCZA 3D7LA 2P6UA 2R6GA 4U6SA 5FOWA 4QJ4A 3UV6A 4FFVA 3C4JA 1E89A 2XUJA 3GVXA 4DLZA 2X9NA 2P9GA 4L85A 5E3HA 5DNCA 1OF1A 3TRIA 4IJMA 5F3DA 2ZPTX 5EQFA 1V41E 1EMDA 2F90A 2H07A 2XV1A 2QTHA 1PFKA 5BW6B 2YJ6A 4DUGD 4YFYA 3IYLW 5L7TA 2RARA 1A7UA 3I4CA 3WKDA 1W6RA 2AOUB 3TKAA 2WIFA 3IBYA 5JXIA 2FI1A 2DVMA 4B0OA 1P4RA 3W8NA 3VYVA 1J8VA 1HE8B 1CFJA 1ZK1A 5AI9A 1WULS 1XQYA 1TM2A 3LNCA 1ZR4A 4KXLA 1RLJA 1I9CA 2OZLA 2DUMA 3L7AA 3PK0A 4G8CA 5D3MA 3KQTA 1EUDB 5GJBA 2GTIA 1CHDA 3I72A 5LQKA 1XNHA 4DKXA 1M7BA 4Q37A 2DERA 4FI3F 2Y0BA 2IEDA 3DM9B 4NP6A 2AWNA 4O25A 2E1RA 3QXXA 4IXMA 3G79A 4QYIA 4RXTA 3RODA 4BNDB 4CHTA 2ORVA 1TQ4A 2BBTA 4PIVA 2WJGA 5LXTB 3N0RA 1IZ9A 4ENTA 1YACA 3LRPA 4II2A 3MRVA 2CJWB 2X15A 2I2AA 3AR2A 1YNSA 1D09A 3Q7TA 4BKPA 5SZHB 1VYUA 1ESCA 2CFCA 1V16A 2AUNA 3DCNA 2O4UX 2R6CA 2VK2A 1YB1A 3NW9A 5AWFC 4EH1A 3HJFA 1ZHFA 4OHBA 4BLSA 4CGZA 2C2BA 3FAZA 1QH9A 4MUEA 1J0XO 4INAA 3LLMA 5FOXA 5I47A 1R2QA 1NBME 1WX1A 3I83A 2H1LA 3IA7A 4CI0B 3GLGA 1CUCA 4DDUA 2J9RA 1AGNA 3I32A 3O3NB 1B8OA 3WRYC 4RZSA 1LH0A 1U0RA 4XGIA 4WIAA 1QX4A 2XWSA 3VKFA 4HNAB 5LXTF 3G5UA 1LLUA 2QP4A 3FBTA 2H2HA 1DFHA 1HM5A 4G41A 1JQAA 4I4TA 1XNJA 4MVJI 2Q29A 4W9MC 4MV5A 3Q3GE 3TJZA 2GBFA 3TOZA 4UUOA 1VXRA 2Z5VA 3OCJA 4QT0A 4AUEA 2QVBA 2EQBA 2OMKA 1IOWA 2J4CA 4MVCA 4Q48A 3M4JA 1DUSA 2IV2X 4CF3A 4X00A 2PEYA 3ZVMA 5ITZB 4V0QA 4FT2A 1N6RA 4MTLA 5CB4A 3P9YA 3W8EA 5AW8A 1BSVA 1BYUA 1LFAA 2BD0A 1W4CA 4XPIB 2ZW9A 3GVPA 1M73E 1WNTA 3AETB 3FLBA 1T24A 1YL6A 3AT1A 4QGGA 1P72A 4XCXA 1BG6A 3KKQA 3N1UA 4R1QA 5TGZA 5H70A 1CYEA 1TNDA 2F9MA 1N77A 1YKGA 2XMCA 3JQ8B 1WCIB 3L9WA 4L8YA 1LJ8A 4AQDA 1Q0RA 4K9MA 2V97A 3V3TA 3N75A 3BFPA 5B6JA 2IEBA 2JAUA 2QJTA 3UT5B 2OCBA 2JLBA 5CYPA 1GG5A 1SOWA 2VTVA 3NVAA 2CXUA 4WLEA 4O5AA 2YIDA 4ALIA 3Q11A 3DVRX 4JVMA 4ZYZA 1N3BA 1XCJA 1G5RA 3AVPA 3FJOA 1QX3A 5JDCC 5EKXA 4KLAA 2DQZA 4PC7A 2QRUA 3EFHA 4AWXA 3W05A 3K1AB 2Q0SA 1XEAA 3OJLA 5AKKA 2XCSB 1UFVA 1VB3A 3O82A 2VJMA 5AKJA 5GV7A 4PN3A 2XDQA 3DEHA 2C57A 2ATEA 2H7VA 5EXSA 3I8SA 1DBRA 5DNAA 4R9SA 5KTOA 1LWOA 3HGQA 4FR5A 3BFKA 3NCHA 3VPAA 2JLXA 4TT3D 1O0CA 4LHXA 1HH4A 2BDTA 1P7CA 2J3DA 1Q7BA 3J81k 4BLOA 3V34A 4PLZA 4UFOA 1QWOA 4EB3A 2BLLA 4OAQA 1ES9A 1O4VA 1VL0A 3DMDA 3Q7IA 2G7MC 3GJ7A 2JNWA 4V24A 1E64A 4HG2A 2RK4A 2VNHA 4CPDA 2VDWA 2ZAGA 1IHOA 3HVHA 4HGOA 1L6IA 4YJFA 1YR1A 3ZDAA 5CB8A 3F3KA 2KHZA 3TQQA 1M1YA 1UMBA 1SNYA 2RGYA 1AUQA 2MSNA 1OI2A 1Z5GA 2AYXA 3JATB 5A2GA 3U7FB 4WBXC 1I7NA 1XZIA 2HBQA 5DLDA 3BB4A 3WNQA 3C3JA 3IVMA 3CSSA 1P5HA 1XI2A 3LIIA 5EZSA 4OQMA 2N75A 3RREA 3RWBA 1T35A 2UUBB 4NMHA 3O6VA 1QE3A 4N5DA 5EPOA 4I55B 4QDKA 4TQUS 5FR2A 1H6DA 3QE4A 1D6NA 1JLKA 2P65A 4FMCF 4H1UA 4WFJA 2O8FB 4NBWA 4Q34A 4IFIA 1SIOA 4QQ8A 5JLAA 3PSAA 1JBQA 2G04A 5TGDA 3ZCSA 4RPIA 1OWPA 2ZJ1A 3GA5A 4FYWA 4HAZA 1OV4A 2VLIA 2R1TA 3H8WA 3LQ2A 4INJA 4S24A 2IOYA 4NMMA 2O6HA 5U1PA 2JGJA 3PJDA 2FN3A 4ON9A 3S7ZA 3TLGB 5K6TA 2FW8A 3HBNA 5EKTA 4B4VA 1K8XB 4J7UA 2QGZA 4BNNA 2Q45A 2QZJA 4WKCA 3TZQA 3JQAD 1TQHA 2DTDA 3L4BC 3PQEA 1WOMA 1PF7E 1H23A 2IE0A 2LGJA 3NHAA 1KI8A 3TNDA 4Z1OA 5LUAA 4YCDA 4YDRA 4D4LA 1E5LA 1GRCA 3UUWA 1KEZA 1COZA 4L5AA 1UDWA 1W1IA 3PQ3A 1OXXK 3OECA 2O8NA 4EFNA 1J7JA 4GMFA 1JVNA 4WBSA 2HY7A 3WRVA 1GAEO 1TMYA 2OBMA 1NBWB 1TEHA 3TEJA 4LHZA 3I5MA 4H27A 2FHPA 5HYVA 1P9RA 5I7VA 1R8JA 1QZTA 1D07A 4UJ5A 3ROEA 5JCOC 4Y98A 2NSJA 2Z2IA 3BGIA 1OAAA 4BGEA 1JQDA 3K2BA 2P11A 3HU5A 2HK6A 3QLJA 4BYGA 5JRJA 4DJJA 2UYHA 1YHYA 3OPXA 3BGWA 3L7DA 2QX8A 1QCDA 4AX8A 4EJFA 4A2QA 1A96A 1CEYA 1C3JA 1N6OA 5JXJA 2ORED 1Y81A 4MV0A 4OHOA 4KK3A 1EFVB 1GLNA 1V8OA 2VKTA 3ELBA 3EVBA 4YXWA 4IXDA 5FWYB 1GGMA 1P2SA 2B8TA 3ZV4A 3HN6A 4ARIA 3GGJA 4E2XA 1T3ZA 1URPA 3LY5A 2CJPA 3DAFA 3QU4A 1EX7A 4MR9B 1LY1A 4TMTA 5KTNA 3K6SA 1TVCA 3GFFA 3A6HA 1UP4A 4PTZA 4YJ3A 1TF2A 3DTVD 2W58A 4Z86A 3IKTA 2OSVA 2X40A 3O8NA 1ADJA 2C3UA 1W85B 5THQA 2ZYIA 1SKYE 4CRWB 2XUGA 3QG5A 4YRSA 4JJAA 1XVUA 1EWRA 2E7ZA 4Z4HA 2NU8B 1XK7A 4A0QA 1G7CA 1PBNA 5HUHA 3LF1A 5BUQA 2C2ZA 4WMLA 4M0DA 1LRLA 4DCMA 3SJZA 2IWRA 5T4FA 2WR8A 2CFOA 3UK1A 1TCCA 1BVYF 4UHCA 2GFHA 2PSEA 3FSGA 1AZWA 4GPIB 3WAKA 5KYYB 1ZM4A 3NDRA 1Q3TA 3A4LA 2YBDA 1BHQ1 2C5SA 4PG5A 3FWYA 3VC1A 2H5IA 3BFJA 1GRNA 4M55A 4I46A 3TLAA 1SIUA 4BMYA 3KZVA 3OQIB 3HCFA 4NC9A 4CT5A 4Z7OB 3UAVA 1Y1SA 1Q0UA 1T0JB 3TSCA 3SKVA 2W0MA 5CYFA 1FY2A 1LBTA 5KYNA 1Y7IA 1WY5A 2PKXA 2WV9A 3V7WA 2HK8A 3PPIA 4WZAB 2PKQO 2OCKA 3ONNA 3KELA 1GY8A 3DZJA 5J23A 4LNUA 2RHTA 3CINA 3PL1A 3NIDB 1AGPA 2GB4A 2MIIA 5JAOA 3OZXA 1TOAA 4G0VA 1XXHE 4TN1A 4DCNA 4AM8A 2X5NA 5G4KA 1NE2A 1T1IA 3D5EA 2HMWA 4CF7A 5GADl 3CH7A 4ND1A 2A5GA 1T4CB 1FK8A 2CNLA 4QM7A 5PGMA 1KEWA 2MSLA 5FBQB 1W88A 3H2IA 4F1JA 2BEWB 4OI2A 3P9CA 2B6HA 4KW7A 3O1JC 3REGA 3LT2A 4BGIA 2OENG 3RT7A 2X14A 2YFHA 1E2IA 3GB9A 4DJDC 3R0VA 1CNMA 4B74A 1TYAE 1T9CA 3OH8A 3JARB 2Q1WA 2C2GA 2Y1DA 3BMNA 3H11B 4DDTA 1NF9A 4ZVKA 1SG0A 5HRUA 2Z09A 3CKMA 5FI0B 1ZJWA 2D7CA 3QEOA 4YS6A 3ZBPA 3CLSC 4DMCA 1AV6A 5TLSA 2YIMA 3F7NA 1R6UA 3COJA 1G66A 4V0ME 1BN7A 2H2DA 5AVXA 4LF9B 2FA9A 2R7LA 4DA8A 3QEKA 3QU5A 2QGNA 1KEKA 1T43A 1SVMA 1V5WA 5LMCA 1TVKB 4AW9A 3AL0C 1A4IA 3ANMA 4JK3A 1TK3A 4PC3A 2VQ6A 1Q1NA 4TV8B 1YFJA 1WZCA 5DN9A 4ERXA 2Y05A 4WA8A 3SEAA 1Y48E 2H29A 2VCHA 3OQ1A 3M1AA 4JI1B 4JI4B 2SKDA 4MLCA 2VAXA 1E6WA 4BNXA 1C5KA 2ZQYA 4LF5B 4KXVA 3X2EA 1NVAA 2JFWA 4IUCS 2AR7A 1JU9A 2UVQA 2YCLA 3CGGA 4HDMB 5LXTA 2GCGA 2QRGA 4OMFG 2RB5A 4R0VA 2JBAB 1F3OA 3D0QA 3FPEA 3X43A 5ERGB 3ORFA 3WQBA 1WF6A 3AFHA 3IAS6 4QGAA 1ZWKA 4QG3A 4U7TB 3WYCA 4OU4A 3IT0A 5E9AA 1SU6A 2OILA 5AW0A 1LK0A 1YRBA 1ONBA 3B6MA 4TKLA 1K97A 2JD2A 4X1YA 3VTKA 3BFXA 3AJRA 3GEPA 3IT1A 3KWLA 3P2YA 3OMXA 2I7TA 4ILEA 3NPMA 2ZJFA 3S2YA 4R0NA 1OR8A 3R3ZA 3GQBB 3C87A 5I9BA 1FUUA 1M74A 2HJHA 2J0UA 1ZGCA 4RA9B 3U3DA 1OLSB 1WDLA 1Z7WA 4JHLA 1TLFA 1S8NA 3HV2A 4MYCA 5HCIA 4BMDA 5EZYF 4PHCA 1BDMA 3JQ7B 1OFUX 3I6ZA 4MPTA 2PD4A 4HDRA 4J76A 4DBZA 4PX2A 1Y3FE 3MGGA 2VHJA 3RTDA 1N5IA 1DTSA 1RPNA 1WXGA 3E18A 4G2NA 1CQZA 2FK8A 2NT4A 2OO7A 3H9EO 3COYA 2MYPA 3C6MA 1WCV1 3JWGA 3MFYA 3UAXA 1EBFA 3WAGA 4LZAA 4D9MA 3COSA 4EA6A 3H1FA 5JZBA 1VBMA 5CXQA 3I3SR 4IOJA 1YU6A 2PXAA 4XDZA 4CLDA 4OQFA 5F7JA 2GDZA 5LM3A 4LY6A 1PSDA 2WFZA 4LZJA 1SUWA 5LVAA 1BIFA 5FULA 1P1FA 1PKEA 3IEPA 2QKYA 5A04A 3SE7A 4EZIA 3JWPA 1TQ2A 1GYPA 5BSMA 1CEXA 3V4OA 1N0WA 4K87A 1AB6A 4NU6A 1JAYA 4WFIA 1LW7A 1QIFA 2P41A 4YCLA 1FP2A 4EPYA 2VQFB 3PC2A 3PRJA 3CT6A 3MTQA 3UCXA 3WGJA 1AE1A 3OFJA 3W5JA 4EY8A 2FG5A 4EGSA 2F48A 2Q4TA 2O9JA 3U4IA 4K6KA 1N3YA 3QVMA 3MJSA 1OXVA 4AFNA 7ABPA 5D6NA 2ZREA 2JCSA 2JFZA 4CYMA 3R1IA 3E4DA 4CVNA 1K3FA 4IINA 4R5MA 1FJGB 1TAUA 3Q2OA 4CIWA 2GZRA 2O59A 3REFA 4Y2QA 2OFWA 5IKMA 3U44B 3BGOS 4RYLA 4BFXA 2GEKA 1PL7A 3V9AA 3IIMA 1CE8B 2Q4BA 3OCZA 5EJ6A 4G25A 4MEJA 1E59A 5AIBA 2GN4A 3BDIA 1SXHA 3T1HB 2XQIA 3VKVA 3EXHB 4Y6QA 1SIWA 4KQ6A 4RTOA 2QQGA 1ILEA 1MMFB 5JNVA 2G28A 1PBTA 1JIVA 2CHGA 2D2FA 1K6JA 3DE4X 3PR3A 5IX8A 2GBGA 3QEBZ 1NXWA 3EGEA 4FIDA 3VRHA 4GXQA 4IV0A 1ULSA 2JFNA 3EDYA 5ED4A 1BXRB 3U17A 5ALSA 1EA7A 1N9KA 2RI0A 4QQNA 4HDNA 1NDQA 4KXFB 1DBVO 2H0RA 2Z1DA 2D6FA 1ZAKA 1ADCA 2RHGB 1FUKA 3D1VA 2MR6A 3AHJA 3V8NA 1V8FA 3FMVA 1L7MA 3FPKA 4JYPA 1D1TA 3C4VA 1CG6A 4JI6B 3OU7A 2W00A 4XWYA 1SHUX 2J3HA 3I64A 1NZJA 4DLYA 3BX1A 2MWMA 3L1KA 4AKTA 2B4KA 1IMOA 3DHWC 4A2PA 5A6VA 4HNQA 4P4UA 3WK5A 3ZXUB 3PQ8A 1HG1A 1CZNA 1DMSA 2FDXA 1YQWA 4HWPA 4R9NA 2J5BA 2A6PA 4YA6A 2REOA 4FFNA 4ZAWA 4PNHA 5BQ3A 2IYTA 1BS2A 1NF2A 1ZNWA 1RCFA 1ORTA 2X8BA 3FVRA 4FNOA 3DR5A 3RK0A 1DGQA 1PW7A 4F91B 3EF0A 3ZU4A 9MHTA 5HQ3B 2YHIB 4W9NA 4LGVA 1FSZA 5H3CA 3H2ZA 3KUDA 5AJTA 2H51A 2YNMD 4NY1A 1ZJ5A 1ORDA 2CXHA 2BT4A 3L84A 4C7XA 4KFRA 4H4CA 3MHPA 2BCEA 2QIOA 1JL3A 4DQVA 1R37A 3BWDD 4PCUA 2D59A 2C0QA 3ZIAD 2FWPA 3I04M 1FYWA 3K0FB 4R2HA 3ZUPA 2OY0A 5CD1A 3I04A 5DGHA 1RVV1 1RAIA 1F4LA 1DC7A 1SCUB 1K8YB 3O74A 3PJEA 1KYZA 3KHKA 3AVOA 3LLSA 1YVEI 1ESEA 4EHJA 4RPJA 3C3EA 4AZWA 1JHAA 5J5CA 1BW9B 5A5FA 3NBFA 4LJAA 2QX4A 1EB9A 2H52A 1J0CA 2PU5A 2F43B 1VBFA 1J24A 3GW8A 2EDAA 2XKJE 5HDBB 4CMIB 4MO2A 3SKXA 3IIKA 4DDHA 1UKZA 2NU6B 4R40A 4YRRA 1F5SA 1IQUA 3ZU2A 4BWYA 3QKSA 2P75A 4B2IA 2WJ6A 4C0QC 4COOA 1G7RA 2GLXA 2G4VA 4TWIA 2CMGA 1W5EA 3CTMA 4XGQA 4RCVA 1SHZA 1JHOA 1JLMA 2XY4A 3CISA 4BZXA 3DULA 2GKOA 2I4IA 2IHBA 1FNCA 2PGOA 2IIBA 2I2XB 1MUUA 4JP8A 4E5UA 4YROA 1JQLB 3OHPA 1KAOA 4HL6A 5GMOA 3BSSA 5IS2A 2BEUB 1SKYB 1QANA 4BKQA 1YIOA 2YHUA 2LXNA 3AR8A 4RKFA 3WGMA 4IKOA 5AM3A 1NRIA 3GNQA 4KIWA 1BYIA 4NFLA 3JQGB 2GCPA 1TD1A 1PJTA 2H4ZA 4Q7EA 3O8OA 5AM4A 4QFDA 2ZWPA 4JC4A 3RU7A 2P4UA 3QV2A 3S4YA 1I4TD 3EBLA 2R00A 3D7KA 1K06A 1Y5RA 2C0PA 2AC7A 1T8TA 1UP6A 1JWBB 1NJ1A 1NW9B 1XU9A 2GETA 2WSMA 3OBIA 3U1VA 4JSYA 3T7CA 3AF6A 1RCUA 2NNLD 4KBGA 1EUCA 5DK6A 3ZGNA 3X1DA 2ZPUA 4PPYA 5ALUA 4GM4A 4RELA 3PKIA 2GLUA 3CZQA 5JHHB 4UAVA 2HXSA 1DKLA 3MXOA 4IDAA 2C1EA 2JGFA 2QVGA 3H5IA 1J0DA 3H18A 4CTMA 1EGHA 3BIWA 3WJAA 3FHLA 4IIUA 2PFKA 2GRUA 2KX7A 4Q24A 1AH2A 2QY6A 1O3YA 1UM9A 1QNFA 2JFBA 2QQ0A 1AGYA 3HM2A 1O57A 3IV6A 4Y0AA 4LISA 4Z6KA 4ANFA 4GOOD 4XGNA 3BMCA 4WDQA 4OK3A 1K2WA 1BFKA 2P2DA 2RH9B 3DMFA 3QY0A 4LQ4A 3USES 4H7DA 4PX5A 5ALJA 5HTKA 5JZVA 4EPXA 2EC5A 1SKAA 1SUPA 3VR2A 4EZEA 1CZUA 5FO1A 3FKQA 3JYOA 3VTAA 4GBMA 2R68A 4JT4A 3UWPA 3ELWA 1X86B 2Z83A 3N7UA 3ZCXA 2GXAA 3DA8A 5DI3B 1WCWA 1R66A 1YQDA 4TZ0A 4PONA 1H22A 2YZGA 3CBQA 4HR7A 2A0XA 1P2DA 1GYQA 1R4ZA 2FV8A 2VYFA 1IN1A 3BEDA 1ABFA 3QF4A 1FS6A 3DOFA 4IS2A 2CT8A 2HSDA 1LDNA 3IAXA 1HDEA 3NI2A 1QIKA 2NN3C 3K9BA 4ZQGA 2HU5A 4PVCA 1UKBA 1T1GA 2C2KA 3CB2A 4FHCA 4ZVLA 2XD4A 2IXEA 4XE5A 5K8CA 3IJPA 2BGNA 4LE1A 4LNAA 4OYLA 3W1EA 2ZCJA 4QODA 3DVQX 3PDIA 2P4EA 1J9EA 3FA2A 4ENWA 1O2DA 3M0EA 1MQ9A 4PC2A 4ZYWA 3BPSA 1P29A 1ZGGA 4L8VA 4LY3A 1TC2A 3HZZA 3BRQA 3SSOA 5EZYA 2ZSKA 3EPKA 3VO2A 4HRVA 4MUJA 4PAWA 1I5RA 2ZXEA 2VAMA 3AILA 2HCBA 4QU5A 4OGWA 2QIPA 3P0HA 5EI5A 3ICEA 4HFJA 1RLIA 2W6OA 3QEJA 2Y99A 3L46A 4KQXA 5KX5B 3DE6X 1U3DA 5EPUA 2QZ9A 1KSJA 1U5AA 3WGUA 2CMKA 1DC4A 1RXUA 3QK7A 1L8XA 5F2OA 2IX9A 2AFHE 1TPYA 3O2JA 5JADA 3E1SA 2RGRA 2IYOA 4NU0A 3RSZA 1JVSA 2NVOA 3CEMA 2J5QA 4L73A 5BVGA 3DXZA 1PYGA 5EQDA 1JZTA 5EYPA 5FPYA 5ESXA 4Y2RA 1U6JA 3T4XA 5FOUA 1DX4A 5KINB 4CUJA 1PGPA 2HGZA 5BUSA 5F73A 3NCTA 2K6GA 4MCIA 3N2YA 3GAAA 3SC3A 2BFWA 2HJVA 2ZT8A 4CI9A 3RWMB 1UBSB 3L1VA 3WA7A 3F0TA 3LCMA 2O2YA 4LWPA 1R6BX 4P80A 1G8JA 4BBZA 1UOOA 2B83A 4PX9A 2PSHA 3DEAA 1XZMA 3FDIA 3QOXA 5ALNA 2CB0A 2X0RA 1RAEA 4MA4A 1LLCA 4RD6A 3VU9A 3VR5H 4M0CA 3FZYA 1JG3A 1ZQ9A 1LBHA 4N7JA 2CVFA 3U3OA 1NLMA 1FE8A 2F1HA 2VNAA 3QXJA 2BF4A 4Y9RA 5BQXA 4ZI2A 1P2FA 4DWWA 3KVVA 2H7CA 1VCOA 3F5SA 4QVGA 3N70A 3EWIA 2IODA 5JAQA 2H0AA 2RJNA 3R5KA 1SC6A 1RLOA 4D9BA 1FP6A 1Q12A 3A9RA 1RXWA 2E48A 2QSZA 2V45A 1KH3A 3HRIA 1HYQA 4G5QA 4O8CA 4X0EA 1MN6A 1CUDA 1TGVA 3IB3A 1WEKA 4FW9A 4RF3A 2QTRA 2WG2A 4JLKA 2OYRA 3UH0A 1SOUA 4TXNA 3UYLA 4GI5A 13PKA 1G5PA 2H1VA 5T4EA 1YRAA 3WLKX 1DIBA 3KSAC 4DKJA 4JOCA 5K6AA 3DL7A 4DR7B 1VDMA 2PIDA 2R97A 3W3AH 1ZD5A 1PFYA 2EFGA 5HKOA 5JC8A 4DCCA 1MD9A 4AUKA 2VJBA 2DRIA 1L7DA 3DVAA 2DWCA 1GT91 2CNDA 2ZETA 1KJ9A 1OWNA 2V7BA 3GMSA 3T0IA 1N57A 5TPWB 2P1DA 5LU9A 2IHJA 1UZNA 3UMYA 1H1DA 4RACA 1JEJA 4W1SA 1I10A 5U4QA 3U7GA 4HB4A 4YAIA 3KAJA 9ATCA 1Z63A 1YK1A 1J21A 3Q7EA 2AN4A 1K8ZB 2YC4C 2DKOA 4W7IA 4P3KA 1R0KA 4AZ0A 2EZ8A 3AJAA 1EX1A 5F5XA 5IN5A 5LWQA 1A1VA 5KSPA 2E5LB 4ARSA 4KO2S 1O6ZA 4KWIA 5AUOB 2WFAA 1THZA 4E6EA 5ITWA 3TLKA 4RCZA 1P61B 4W6QA 5AI0A 1ENOA 1PAUA 2PKYX 2B3DA 4I6JA 1XQXA 5JS1A 3IPYA 3DL0A 3BL6A 1FFGA 5L7YA 5IBCA 1LZLA 3K6RA 4OEHA 1DBIA 2HA2A 3LBHA 1SUEA 4B83A 2JRCA 5AKGA 5CW1A 1I3MA 4V1CB 2D1YA 3D59A 4NR0A 6ABPA 5CA0F 1QNLA 1WRBA 3WJ1A 1KFBB 2D3WA 5ALRA 5EPEA 3RFTA 1IG0A 2ZJAA 3FFXA 2VXYA 1HETA 5LP6C 1EJ6A 1PLKA 4P7FA 4ND2A 4HRYA 3F67A 3V2GA 4YY3B 4JJ8A 1Z07A 3R6TA 2Z3ZA 4MZDA 4WK4B 3WYGA 5TF4A 3TL2A 3NBXX 4KMOA 3CPJB 4P5DA 4JJ6A 4PRLA 4GG1A 1KH2A 4D3DA 3GFVA 3FHOA 4E2FA 3LGAA 1I24A 4RKEA 1EQAA 3OJFA 4J0IA 1SUDA 4G4JA 4AYTA 6REQA 1UT8A 5H59A 4LSGA 4GWLA 2CN1A 3DOIA 1E6LA 1DG3A 2WUEA 2B5OA 4ZZ2A 3TDMA 3X1ZA 1GTSA 3ENVA 3K70C 1TTHA 1ZEMA 4A8PA 4WSOA 3T5MA 1RBYA 4X1IB 2C7GA 5AVSA 5CIYA 2WTAA 4OKSA 3QVKA 4YEDA 3DMYA 4WLVA 3KQYA 3ZWYA 5KC9A 1N3IA 1KK2A 5EE0A 2OGWA 4MVJH 4BFYA 2OWDA 1N2JA 4LZWA 2BFDB 2XEDA 4BZPA 4DMUB 2GD2A 3ZUGA 2YXPX 3NYWA 4OJMX 5A7FA 1OX5A 2CYAA 3WNZA 4DCGA 4BWVA 4D4MA 3JD1A 2L17A 1SXJD 2EZ4A 1M8FA 1V9SA 4FLMA 4OF4A 3DE1X 3WHKA 3ETLA 4LC1A 5B7PA 4C7OA 4JLPA 2HDWA 1VLMA 4FC7A 4I0WB 3KQLA 1Z7EA 3GNTA 2GCOA 2IEZA 1RXYA 2WD7B 5EJ2A 4URZR 4MIKA 3MWYW 3CVUA 3UICA 1SEVA 2XXJA 1D6JA 2GVNA 3UJHA 4WWHA 5HF6A 1Z6ZA 4KWCA 1V37A 3PXUA 3B1JA 1KDPA 5CRIA 4WNAA 2IYEA 1T1JA 1PEKE 5IHXA 4B6JA 5JLJA 3DDWA 5LBIA 1RC1A 2QT9A 3BN3A 2WMNB 4FX2A 1IAVA 5F35A 2ZI7A 1TF5A 1NX6A 3OTOB 2AJLI 2GVDC 1YRWA 2YTZA 3DBVO 3E03A 4F9GA 2RBGA 3UMFA 2AFIE 2R8BA 4EMUA 3D6HA 2HDOA 1N5LA 4IIGA 4NV1A 4XPZA 3EZYA 1ECGA 4WN9A 3NRJA 4PLGA 4P4GA 3FGZA 1ZW6A 3AU8A 1IOZA 5DCUA 3R8XA 3S5JA 1NLUA 4C0BA 4RM2A 4N5IX 4JELA 5TRTA 4DCVA 5AI6A 2ZKLA 1CPYA 4HH4A 5K05A 1PR0A 1W5BA 4YRCA 1IULA 5TDHA 1U2DA 3DG9A 4Q7KA 1EVQA 1NW5A 1P8AA 1PYOA 2GRAA 2GPWA 5I8ZA 3KB1A 4C4OA 1RXVA 4CM4A 3OEEA 4PNEA 3A6GA 4S3MA 1HO3A 3HKDB 1JI0A 2PBFA 5IULC 2BM8A 5DWVA 3ZQ4A 4NE9A 3DOUA 4X20B 3TLYA 3D3WB 3OCYA 3PX2A 4NYIR 2WJHA 1WXDA 2X7XA 3NIFB 3QKUA 2Z2YA 5ALGA 2GI4A 5IDYA 4BNMA 2XE6A 4FVTA 2JGDB 3GFGA 4ZAVA 2H1IA 2FQXA 3KQWA 5KYKA 2NMVA 3UM9A 5KNCH 3HUTA 5AVVA 1MQSA 2AN5A 3DDOA 2WHPB 2IDJA 2G63A 2SHKA 1KDVA 4AX4A 1E6EA 4E12A 2WIDA 1NXSA 1OYWA 4TSRA 5EESA 1YF3A 5ECGC 1IM2A 1G8GA 2P3SA 2D1FA 2NSHA 3T3DA 2B36A 1NBHA 1TPZA 4QDUA 4LK2A 3FZNA 3IMEA 3QXHA 1Q44A 5EIBD 2HPZA 2FCRA 2ZI9A 4WCFB 1E7SA 2IE8A 4F85A 2AX3A 2JHGA 4LBZA 4PGMA 5DHPA 4E7PA 1U3CA 5C1OA 3H5VA 2Y1WA 2A1TR 2K5UA 2R8ZA 2WC1A 2WIGA 3EJ6A 3IKLA 4PYNA 3Q1KA 4U2CA 3R7NA 4CCAA 5H9WA 3R23A 4X3CA 5CCEA 5DM0A 3B1VA 1ZVVA 5H0IA 4P4LA 4A03A 3CE6A 4J7AA 1GU1A 1U94A 5AICA 4NH4A 1A97A 1ZCZA 1EESA 3BHNA 1YZHA 3PPWA 3RE1A 2D0IA 2O50A 4MS1B 4OKIA 3BZWA 2AJDA 4Z51A 2R62A 4LG1A 4CM9D 3GLGE 5LFAA 1I3CA 2P8SA 3CUEF 1Q57A 4GMDA 2R87A 4G9EA 1JR3E 2FP4A 3O0TA 4HAOA 4JA0A 1GKUB 2C95A 1VIDA 1IBCA 4MA0A 2A5JA 3C0KA 3FPGA 1Z6GA 2DQ4A 1DI0A 1U0HC 2CL5A 2P40A 3N2LA 2DFPA 1KMHA 2EFYA 5BW4A 4HEHA 5JSZA 3SZ3A 2HLDA 1BMTA 3WOHA 3KSBC 1ML3A 1P3Y1 4KYUA 2I54A 2XYGA 4IRMA 3QHAA 5D1HA 3UMJA 5IJ9B 2VPYA 3LF2A 4PPGA 4KXYA 4UCWA 2HR1A 1EEXB 3HYTA 1XTTA 1H65A 2ZB7A 4MKXA 1A2OA 1SBIA 4ZU3A 3PQ5A 1D4OA 1F2VA 3NIBA 3UT0A 1GRQA 4NPHA 4G81A 3P9NA 1T1SA 1UBHS 3HEBA 3AEUA 3BTUA 5MHTA 1PX2A 4XWTA 1DJMA 2XAUA 1FB5A 1JXAA 1UANA 1ONSA 3P27A 3D6NB 1E9VA 2IXGA 5E4JA 1RMYA 3PFFA 4ZGWA 1WTCA 1PR4A 3CB4A 3HI4A 1G8FA 4H1TA 1OBOA 1Z18A 5LYJA 1XWWA 4ENSA 5FL7A 3EW9A 4CM3A 4LRQA 1GPNA 2QX9A 3PXEA 3GD7A 1C9NA 4FMBB 4H59A 4OUKX 4RVDA 1CQPA 1RP1A 2P77A 2B4AA 3BKXA 4K9NA 5K03A 1W30A 3FTEA 4GX2A 3USCS 3TS1A 1Q11A 2H0QA 4ZGBA 5JAPA 1AO3A 2ZU0C 4C05A 1ZIYA 2XMGA 2HL6A 1NULA 2ZRHA 3VC2A 1ZLXA 1R4NB 4NFHA 5BSKA 1EVZA 2ZIGA 3EAGA 3EGXB 3MPUA 4BMZA 4YQFA 1GSIA 5HG0A 3VDXA 5DDIP 4RL6A 2WMYA 1GTMA 2QE7A 2AWOA 4UHKA 1BCRB 2HF7A 3IPXA 3O8QA 3PJRA 3VH2A 3FCAA 4WW0A 1C30B 2G17A 4X71A 5IEBA 3SEQA 2R4TA 3SJCA 2ACWA 3KKLA 4AG6A 5FADA 1DLIA 1EFKA 3WK6A 4A16A 5KSZA 2FEPA 2IF0A 2WU8A 1OJLA 5FWNA 1HTTA 3Q85A 4OVKA 3ZD6A 4G09A 1QGZA 3CRNA 1NBIA 2FWNA 1SVUA 2GBLC 4X1OA 1X2EA 3UH1A 5KOIA 2I91A 2QN7A 3AL3A 4FD2A 2BFEB 2MU1A 4KU4A 4OQYA 2DPXA 2CKMA 2W71A 3QMVA 2B94A 3TCXB 5CAEA 1KZ7B 5BSRA 1Z15A 1XLTA 2ZROA 3ZWPA 5IAEA 5T6BA 1K6EA 1PDWA 1FDOA 2W83A 4PGFA 1R8XA 3MJEA 1A9QA 4EGQA 2OTCA 1ZC3A 1I32A 5KQRA 2RGNA 2OQRA 4O4IF 3G17A 1RJDA 3NGLA 4D02A 2VBCA 1UK8A 5P8WA 1D2AA 2YQ4A 1AU9A 3OJEA 3AXTA 4G63A 4JBGA 3Q8XB 3TMAA 4D4HA 3R6LA 2DE0X 2J9FB 8ADHA 3MWKA 4PLCA 4OBEA 3WIUA 3M5DA 4RMIA 4JT9A 1H8HA 1EGAA 2BM0A 4ENRA 1M0SA 2JFUA 2M32A 3G0GA 4F3NA 2QG4A 5F78A 1QGUB 2YN0A 4H7EA 5GOTA 3RU2A 1JFLA 3KQQA 3OE7D 4PW0A 1B93A 3BQNB 3QU7A 1P75A 4LNHA 3C48A 5FLXA 2PQ6A 4KNWA 3PFBA 3CO5A 3T7SA 3WFZA 4YP0A 4NCIA 5K45A 3PEUA 3HSKA 2YUIA 2FFAA 1YHNA 3UAWA 2XUAA 3I39X 1TMOA 3L0BA 4KB5A 5F9MA 5B7GA 5JYCA 2J9ZB 2BGTA 5JVDB 1XN1A 1GZ3A 2PT5A 4UXIA 1ZJYA 2Z4TA 1UMDA 3AB3A 3MEQA 4PSAA 4F92B 4S05A 3DKIA 1FVOA 4H08A 4JNKA 4DT1A 4G1UC 4NL4H 3F78A 4QAJA 2GUGA 3D5TA 2C5FA 3MUEA 4ZI3A 3FKSA 3G0HA 1M2VA 3DP7A 4IPTA 1QDUA 4QUEA 1X7YA 4OY3A 4ZTBA 3HKCA 5KCMA 4KPUA 1XTVA 4CFSA 1JG2A 3PHIA 4DM7A 1X7WB 3A9CA 3LX5A 1VCHA 1YQ9A 3ZHUA 1MO6A 1TYCA 3DXFA 1G1MA 4XFKA 2Q5JA 4AY4A 1BNCA 1RXIA 3IDZA 4WXYB 1H6CA 2R8PA 3UNXA 1JR6A 2A78A 2IPOA 1IC6A 2XTNA 1II0A 3NS7A 1PKXA 1C9EA 1JQJC 4DIBA 5KREA 2F9FA 3KVNA 1MFPA 2I76A 3EA0A 4OUDA 3UUGA 3ZGVA 3SC4A 5KYUB 2AMYA 3BBPA 3ZDCA 1G4AE 3U4QA 2OFXA 2VDLB 3IQXA 5CJ2A 3SX2A 3R9KA 1HL3A 4A15A 5B58T 2O54A 1FUYB 2CL7X 1DINA 1G9XA 1II8A 4JN6B 4FFBB 3CCBA 3Q9SA 3IP5A 4M54A 3SC2B 4MLZA 2DG2A 2WSSD 4PZ9A 3EPRA 3FWZA 4MQEB 3ZEIA 5KHAA 3ZZ1A 4DEVA 4LYAA 5EWJA 1GA6A 3UFBA 4QQFA 1N7HA 4GVPA 2FEKA 2WTEA 1RWMA 1U1FA 3DLCA 4IP0A 2Q5HA 4RVUA 5A1TA 1BEZA 4DIUA 4EM6A 1RRCA 5C5CA 3L5OA 4O59O 3ND5A 4DQKA 4F84A 3CH5A 2IBTA 4CL0A 2IYSA 3CRW1 1FP4B 2A0WA 2W2NA 2NT3A 1GN8A 1VCMA 4GPAA 2ZIZA 1N4AA 2PGNA 3ESDA 4G0NA 4AKGA 4I9FA 5BR8B 3QKIA 1DKPA 2XA2A 2A67A 4AZ3A 3F5FA 5F4BA 3NNSA 3PUJA 1A8QA 1RIIA 1WPQA 1CVLA 2XE7A 5BN3A 3FOZA 2YFYA 2QK4A 2HRRA 2HW8A 1P73A 4NNOA 4XX1A 5E38A 3QWHA 2R44A 5GM2A 4PC1A 1OOEA 4ZO8A 3SYKA 5KWIA 2IVFA 3ENZA 1CW2B 1KH1A 3U48A 1U3FA 3KOUA 4S2UA 4FWTA 1NVXQ 1Q0LA 2NVUB 1CYDA 2PUVA 3RVOA 3EVFA 2R7MA 4KQHA 1W7AA 1JYFA 2AT1A 3BXOA 3K8QA 4DIKA 4XVUA 1CB0A 1FP7A 3AP3A 1BDHA 3IUEA 2ZT5A 4V39A 3AKYA 1BMFD 1P74A 1BKSB 1J8YF 3R5TA 4XJSA 1Y9JA 4J7XA 4D4JA 3LHSA 3M82A 1W48A 1H93A 1K63A 1OXSC 4MICA 3T15A 3U4GA 3CLHA 4ECAA 3RYIA 1YJAA 2ZYDA 3AYZB 5FT9A 2QTGA 1PEDA 4C89A 5CDHA 3PZRA 1HI9A 3VO1A 5GVSA 2CEAA 3VX4A 2ISSD 3KE8A 2YWRA 3BKWA 3L2OB 1Y89A 1NZFA 2IHYA 1D4ZA 2EX1A 2PA3A 3JALB 1H4SA 4HQKA 3TJMA 2P5YA 2NG1A 3RUFA 2FFRA 4PR0A 2PMEA 5ICMA 2YWCA 1JSCA 1KY3A 2D7DA 2IHTA 5IK2A 4G0OA 1G21A 3FOWA 4W4TA 4XDYA 4GXTA 4PAOA 4X1KA 4EG1A 5ELXA 4DB2A 2Q3LA 2HIAA 2Z1MA 2DPGA 3G2OA 4UTXA 4G07A 2AZ4A 4J3JA 3BD8A 4GP7A 1N4DA 4KDCA 4C3UA 2H3EA 2XB8A 1XEXA 1ZITA 1RKQA 2GUWA 2V5AA 3PT5A 4IFTA 5TV2A 1OREA 4KIFA 3T7IA 2ZCUA 3LXUX 4MKRA 3P0IA 3AHDA 4EI2A 1ZRHA 1T8YA 5AW4A 4EB8A 2C31A 2ZFUA 1KZGB 1TU0A 2FF5A 3RSGA 2UUAB 2YV3A 3IQWA 1LBSA 2VRNA 5HCUA 2AVDA 3KJGA 1X42A 2LNDA 1G19A 2YRXA 3CX6A 3Q98A 4MGIR 1ZM3A 1JX6A 1QHXA 1E5VA 1MOZA 1QHFA 3H8VA 3KLOA 1LJUA 1RRFA 4FN4A 4CTKA 4EFMA 3ICQB 2JDID 3NX4A 4AY2A 1N5MA 1BAPA 4FE4A 4QTTB 4XA8A 3WK7A 1PZMA 4ZQBA 3BCRA 1BMQA 1NW4A 4EY6A 3GDFA 4GP9A 2ZRAA 1Y1PA 3GFPA 4U39A 4EKDA 3VI4B 3W8DA 2CLDX 1MB3A 1Q50A 2C2WA 4L08A 3B9BA 4FSDA 5K8IA 3VHQA 1N34B 5G3YA 2OKGA 4DGSA 3EXIA 4IILA 5JI3E 2YVUA 1DO0A 1ZC4A 2HLPA 3C3PA 3JRWA 1V9LA 4FCVA 4GC5A 4LFBB 3SK0A 1S2LA 1VOTA 1EE9A 3CG4A 5FUXA 1EVJA 5CNMA 4ZRDA 2YWJA 4HRAA 3WLIA 5JATA 2AZMA 3JQEA 4ZOBA 2ZSFA 2X3FA 4MUXA 5ENZA 5KTPA 4DV1B 2Y93A 2F4VB 4TKVB 1WBDA 4IDCA 4OAOA 1NVTA 3QVGB 3ZZUA 2FWIA 1OIXA 2B37A 3FZEA 3AF4A 2CDAA 2QD3A 1RAHA 4TWRA 3HDVA 3I1YA 1U0OC 4MMXB 3RSFA 3PGA1 1FOEB 5JZ9A 2RG1A 4HUQB 3NHSA 4TYMA 3QIAA 5B53A 3STYA 4BP3A 4JU8A 2AZTA 4R84A 3PCTA 4PC6A 5CDUA 4M37A 3GLFA 4W5TA 3BXHA 1IQRA 3O21A 2JIRA 3TW4A 4A6XA 3IO5A 1FTSA 4AZSA 4C6TA 1M6YA 1R6VA 3KG2A 3DL4A 2Z8YM 1Q14A 1VE1A 1ZH8A 2EBFX 2O06A 2Z8YA 2CMHA 4D8XA 1S8OA 3OPYA 2NAPA 3KOYA 2WWRA 3LQYA 5DSZA 1L1EA 3PWSA 4DQUA 2XWBF 2I4MA 3OFSA 4GP6A 2FRXA 8LDHA 1W96A 1DP4A 3HDTA 2PTHA 1QZZA 2A84A 2FUCA 3HXQA 1YCGA 1IUOA 1GCUA 2GPSA 1WXFA 4CFZA 1RYHA 4REQB 2GWHA 3BRSA 3W8FA 3SHVA 2J5RA 1IFXA 4C4RA 4QEKA 4GKBA 3KWFA 1BHO1 1J7KA 1RQPA 1IY1A 3FWPA 4FQ7A 4PCAA 1BU5A 1U0GA 3C2QA 5JARA 1H2ZA 5DEIA 3KHUA 3RH0A 1JA1A 1H5NA 2G9QA 4CKYA 3WGIA 2ZWAA 3FYUC 4Q7JB 2IW3A 3NBYC 4ZVOA 3RIXA 2GJAA 4FHDA 4M1SA 3SQMA 3BH6A 3LKBA 3WS7A 3FMPB 1CT9A 2YV5A 1P7YA 2AG1A 1VG9B 1DEXA 4LJ8A 1FRQA 2IYRA 5FWXA 3U3KA 4FTWA 5LR6A 4KXNA 3MWLA 3IBTA 2OORC 2D0PB 1TADA 5DWQA 1Q2UA 1FJ2A 4S1NA 2AK2A 2P6NA 3E22B 1AQNA 4O4IA 5HMLA 1RE0A 5EIXA 4S1VA 1XGKA 3G8DA 3SSNA 3RC8A 2AYZA 1YJ8A 1AS0A 4UOEA 1K9SA 3WSWA 3O4RA 5EMLA 1ZM7A 4Q3LA 3L18A 1XSEA 1M6VB 1NW3A 1XD8A 3RUEA 4RTJA 2IS4A 2Q3DA 5DGTA 2PZMA 4CQLB 3BHJA 2ECFA 2R48A 3OM8A 1BWQA 1QG4A 5KVVA 1RWOA 3R5FA 5FB3A 4DVJA 4XD2A 10MHA 2O0LA 1RMTA 2I66A 2XXBA 4YJHB 1MAHA 3U6KA 1P2GA 5HIMA 3HA7A 1A2BA 2RI1A 5FBLB 4IXTA 4YI3A 2BEJA 4XVCA 5CA0A 2W5UA 2NIPA 3IP3A 4E1AA 3S5UA 3EQ9A 1A9PA 1ZGJA 2XWPA 3TD2A 3N9IA 1SXIA 4GI7A 3VX3A 2BP7B 5BURA 5J2TB 2NTVA 2C88A 2XUKA 4KRFA 3FUXA 1KBOA 3HQ4O 3EY9A 2X3YA 4E5MA 1Z8HA 5IKOA 3H4MA 2YX1A 1N2CB 4YJFB 3HB5X 3DT8A 3V5NA 2ODPA 3KYJB 2QR5A 2WJJA 3IIIA 5L3VA 3K53A 1JHVA 2RONA 4TLCA 1JHPA 4RKYA 4J90A 1JQBA 2HYIC 3X0DA 2D8AA 4RHCA 1Z83A 1KSFX 4IIXA 4UE2A 1Z4NA 1QLJA 2GDJA 1N2BA 1Q0PA 2RCNA 2IYPA 2FN4A 4IO0A 2XWQA 1C8KA 3KTAA 4OQPA 5D5QA 5JPCA 2D0DA 3IKJA 1LVUA 5FV7A 4E6PA 1HLFA 4EABA 1WUKS 2D7JA 4AJHA 2B9EA 1DT5A 1E7WA 2CC2A 2P9BA 2VYND 3R5XA 4JBXA 4IFEA 3MQ2A 1I1HA 2FB9A 3WTBA 3DVLA 3U5ZB 3G5MA 2JIDA 2WYOA 5LQSA 4H0FA 3ZD9A 1LLFA 4Y7CA 1BEEA 1VIYA 2XUDA 2ZRNA 3UTCA 3V8VA 3C7KA 2ZGVA 4CTOA 4Z4IA 1MQAA 2XGJA 3KSRA 3MJFA 4KQFA 5COQA 4AL4A 2G6TA 1L5RA 3ROFA 3I12A 3W3AD 3GRVA 4XYGA 3RLIA 1R0LA 3E9ZA 1SZJG 3BAZA 5JPDA 1LF5A 2ZYHA 4ID3A 4OIFA 4YLYA 3T6KA 1TLTA 3EG9A 4JQCA 4KUEA 1N8NA 3B85A 4NCXA 1NQUA 2BAGA 3IAS1 2DUJA 4L6AA 4PZUA 3ZWBA 4C4TA 1WKBA 2DYKA 2XGOA 1PLLA 2JI9A 1HMYA 1Z0ZA 2X22A 4JGGA 4LXYA 5A4MS 4KYIB 3UGJA 5FNZA 3S29A 1UKVY 1CY7A 1F3LA 1XRQA 4PSDA 2WU0A 4P08A 4MI6A 3VZBA 4NAUA 1CZRA 3HSYA 4J0QA 2XRZA 2ZTLA 1FS4A 1FLNA 3C70A 4JL6A 4L5JA 3NDIA 1GOTA 3NBQA 3WMRA 3NUZA 4FJ1A 2FX3A 1TW3A 2BFFA 4MARA 3F6PA 3CRMA 1JKIA 3VISA 2PVCA 4OL9A 3B78A 3TRJA 1S2MA 1C8VB 1EFTA 2YY6A 1IATA 4BNDA 2XNSA 2QZ4A 4EECA 2LD4A 2W9XA 4XYEA 1UZAA 1E4EA 3DJFA 1G41A 4MKHA 3SMQA 4BQPA 1OMOA 4HLCA 2F62A 3RRMA 1BQ3A 2RCYA 4IOLA 3ZTWA 3ON5A 1JDUA 1KVTA 5BWOA 1JAZA 3NASA 3L77A 4OM8A 3LS2A 1GXSA 2B34A 2WUVA 3LW7A 3QOFA 1KAEA 4BMCA 3S70A 5B6PA 2I3DA 1C9YA 1DG1G 4L4RA 3RIHA 1B2LA 2BGLA 3SX4A 3JV7A 3NHPA 1S89A 2DR3A 2WDPA 4LXQA 3VMMA 4B6RA 3BIFA 1A2KC 2EVWX 1I3OA 1LDGA 4HAVA 2JJ8A 5CMLA 4AVYA 1W36B 5JJLA 4I81A 3U9LA 4B3JA 4EJSC 4JL8A 2HMTA 2PQ0A 2A59A 3R7WB 3AVYA 3GP3A 3EUEA 4OHRA 4AO6A 1GHTA 4TZKA 1G63A 2Y77A 3IEIA 4QXPA 4CQMB 3AWDA 3DZIA 2GK6A 2O3RA 2GS9A 3IC5A 3Q1LA 1H2HA 2VH2A 4PYMA 2O05A 4CLHA 3IVXA 1JSRA 3CLKA 1R64A 1JSLA 3GA7A 4MVJD 2JW5A 2YNMC 3EIWA 5E1MA 3IAEA 4DWOA 4FCCA 1GEEA 3KDAA 3VNQA 1AV7A 2O8BB 3IDOA 5HUQA 3EVEA 1WUIS 2O8DB 3NOVA 1ZXBA 2ATIA 4IZHA 1KRWA 2OLEA 2VA8A 3CNHA 3E6AA 1OHHD 2QHXA 1GWNA 4UBLA 4ZYYA 3V00A 2GT1A 2P78A 4L8WB 5G4KB 4Z0TA 3EGVA 5KPJA 2D0OB 4Y1RB 1UKAA 4Q4JA 3TLCA 3JRXA 3PTAA 3AUYA 4DA0A 4UTZA 4YUXA 4KR6A 1GADO 1UC4B 4LZNA 4Z4CA 4AIRA 2GZAA 2F3RA 2JH3A 1MOPA 2LIVA 3T3PB 4IHKA 1PFQA 2P6OA 3E2PA 5LDGA 4GZ3A 1LSJA 1V2GA 4L3OA 1P91A 1QLWA 4OGKA 3RG8A 1EA5A 1Y6QA 1MB2A 1Z2OX 1W2WB 1J1UA 2GHQA 1P1KA 1RQNA 3COPA 3F97A 3A6DA 4C0SA 1YL7A 2FZLA 3FKJA 1CUEA 3D9QX 2WEKA 1U2ZA 2PR7A 3OZTA 5LPNA 2EHDA 1L5HB 4YRTA 5YASA 2B82A 3LSYA 2QMZA 1AO0A 4FXOA 3CGWA 3UCFA 1V35A 2VP9A 4L9WA 2REQA 1QLHA 4W82A 2HUNA 3I8XA 1PUJA 4BEVA 3K4HA 2OBYA 1E66A 4RGQA 1VXOA 3DNFA 3IX7A 4KFSA 4LQDA 4M1MA 4XD7A 5JPIA 1XTUA 3R0XA 4CR7A 1WP4A 3V48A 3EPJA 2FUEA 4IMRA 3HYNA 4XQ0A 4DJFC 1C0EA 2NTNA 4MHSA 1FNMA 1NUAA 1S2DA 4UCXA 4LVCA 1NVVQ 1KO7A 1CIPA 2C96A 3KJFA 3GN2A 2FKAA 2WJWA 1XVVA 1FA9A 5DTJA 2OCGA 2XDAA 1QIGA 3GPCA 4IS3A 4XDGA 3ETDA 4GGPA 4AP5A 2OZVA 1GEGA 4MX8A 5TT1A 2KSQA 1FU8A 3HYCA 5KYWB 5CM8B 4Z4FA 5JW6A 2BL4A 2P35A 4RJ2A 2VO1A 1GA1A 2FDRA 3EXEB 2YINC 1R00A 3DGFC 5KNCD 4QIHA 4J16A 1GL3A 4J2OA 1VPVA 1X7DA 2QPTA 4YO8A 2P5SA 1AKTA 1VCNA 2BMAA 4P4NA 3V7UA 4C7BA 3FRIA 2ZRMA 2ZYUX 5T67A 3HJAA 4RKWA 2QE6A 4YJ2B 1XNQB 3PIIA 2YQ5A 4OJTA 1NM5A 3H2BA 2ZYAA 2WRZA 1J25A 1FXUA 1JPUA 2D4AA 2EARA 3TPCA 5LLTA 4B6PA 3AVUA 4C4YA 4AJKA 3FDXA 3ADCA 1HXHA 3AX6A 4P81A 4C43A 3CVYA 1COWA 3D8NA 3PRKE 4ZRNA 5A6SB 3WLEA 3PVZA 4JUIA 2BR5A 1VMKA 1XAHA 3F8TA 4TYYA 3EIFA 4KLRA 2Q7OE 3UN1A 5KTRA 3IXQA 3QUBA 4MYTA 4IZOA 1SCIA 3FPBA 3LDFA 1NI5A 3W5BA 5CM2Z 3EYWA 3UHFA 3RHFA 5I4KA 5FTMA 1NRWA 1D4FA 2ZKIA 1DNPA 3A3KA 3LP8A 3PPYA 5HA5A 3VNRA 1C41A 3CFYA 4QNNA 1J0AA 1T5IA 3H9UA 3KT0A 1NW6A 3PNOA 5CNJA 5CFOA 2XZOA 1OI3A 2SECE 2ZRGA 2AC2A 2QTMA 4OOEA 5JRZA 4J43A 4D3FA 2AOXA 4LDAA 3BC1A 4HATA 4R8KA 3EASA 4QTXA 3JVEA 2C1ZA 2H6EA 3RYHB 3I5UA 1DJNA 3AF0A 3TINA 4AJPA 3BGDA 4L6IA 1P1RA 4MDFA 3A4TA 1PZXA 4EVIA 3ECCA 4F06A 4LQLA 1M1UA 2ECKA 3PNMA 2YYYA 5BOVA 4EQ6A 3IDFA 1ENZA 2CBXA 3B12A 4S1WA 2ICAA 5LOVF 3EXG2 2ZWOA 4K5QA 1SKMA 4CIYA 2W2PA 3JZIA 3V9PA 2BOVA 4M1YA 4O0MA 3WGLA 3G2JA 4ZICA 1UFRA 1ZGBA 3GLHA 3HBJA 4MKGA 4RLQA 4L75A 3R7FA 1JAIA 3DUWA 3VMFA 1VL8A 3KYCA 4EHIA 1AZLA 4NXNB 2IYZA 1YULA 2CSUA 3MT7A 3QJGA 3DCYA 2CL0X 1ODJA 4M1WA 4EB6B 2AXPA 1GPWB 1KI1A 1SUBA 3RT1A 4BYMA 1E60A 3IJ5A 1LVGA 1NDHA 1TK2A 5L3ZA 3LTNC 4Q9IA 4GX0A 4Q00A 3LT4A 1Z9BA 2D62A 2DGDA 4PGHA 4Q15A 4C6RA 3U3JA 3FPJA 3PENA 1KAMA 1O5OA 1RAGA 2FQWA 4BRWA 4JVLA 4YV7A 5ESDA 5ES4B 2BMWA 4EO7A 4L4SA 1DFGA 1JHMA 1EI9A 1QC5B 2HU8A 3LUKA 5FBKA 4FMCB 5K0LA 1PT9A 4G86A 3PYXA 1E8MA 2QRLA 3FAKA 4RLFA 5KTMA 1QF9A 4BCDA 2I2DA 1UJ6A 3GR6A 1GGHA 1P62B 3IIJA 2C9DA 4K03A 2XA1A 3A14A 1LTKA 1WG8A 2GA9A 3E15A 4V2UA 1QVWA 1P2VA 2I87A 5DKFA 1J33A 2BHTA 4X84A 4NYMR 1YQQA 1OXKB 2CLIB 1LDYA 5BRAA 1FDVA 3U7QB 4XIIA 3P5BA 3VJRA 3E23A 1XVTA 3B3JA 3COWA 3DDCA 1WZUA 3IUBA 1EAMA 2AQHA 3N2IA 5CTJA 4PTYA 1K6IA 4ZZ3A 4IV5A 3L4SO 2MDTA 5I9IA 2ETVA 3H9BA 2YOGA 1DG9A 2F8LA 4BLRA 3PUIA 1ZVQA 2PH5A 5KTYA 4Q16A 2ENUA 2GQ0A 3BWYA 1A7JA 3QFFA 4LTDA 3BICA 2IS2A 3DLHA 5SY4A 2OFFA 3KXPA 4B7UA 1GN9A 4C76A 3RIYA 5A4DA 4NTZA 1N0HA 3OZ7A 4WJZA 4GQIA 2PD6A 5EJ5A 4Y30A 1KOJA 2RC6A 3FDJA 1V45E 4PEVA 1XMSA 2A7XA 4ND7A 5C7OO 4N7RA 1KAHA 2GM5A 2VHTA 4IRUB 1OLUA 1IG3A 1U81A 3H4TA 4TMKA 5JSYA 1WBBA 3EFEA 5KNLA 3OFND 1MU0A 4ZVPA 1LUAA 1GM5A 4FGWA 5C1DA 1ISSA 4V2IA 3ZC3A 4KBYA 4MRPA 1ZSYA 3FDZA 4G6ZA 1AF4A 1T5BA 5CPBA 3Q3EA 3W79A 1CUWA 4DV0B 1QG2A 4TTAA 1MX3A 4QBFA 1J2UA 3FR8A 5LWHA 3P26A 1L8AA 3RTBA 3GUCA 5IAOA 3GRYA 4QRHA 3RVRA 4N47A 3TR6A 1E2QA 3ZXXA 3QTTA 3N3BC 1T10A 1JVBA 1LSSA 2DC1A 1K7XB 1M0TA 1YQTA 3OLWA 2FPGA 2UUPA 3ONFA 4P7GA 1JTFA 4TTPA 1KF0A 2K2QB 2ZPAA 4GZMA 4L0QA 3AF1A 4GSYA 4CIXA 1E1DA 1KEEA 1GAQA 4TSFA 1DRWA 2I7VA 3TBHA 1VJ0A 2GYVA 3LT0A 2CDRA 3QIVA 2XLBA 3UG6A 3I8OA 4D96A 4L27A 1USKA 1CDOA 1U7DA 3QUTA 3OSZA 1A95A 1U99A 3HI6A 3H97A 1KO1A 3MWDA 4NJMB 5B57C 1L4GA 4I1PA 1ZD2P 3MB5A 1WR8A 5LQUA 3EISA 4OOFA 1EM8A 1EFPA 4HNGA 2FYTA 1K6XA 2PPVA 4OHMA 2CWDA 1MEEA 2IHKA 1EP9A 5IN4A 4UNIA 2R4QA 3JAWA 3KZCA 2NUTA 3UXHA 1YQEA 4AXBA 2R751 5HQJA 1U65A 4KV9A 1KTIA 1QHHA 3CF6R 3LW8A 4GMKA 2C59A 5ALWA 2WABA 3R7DA 4MPPA 1QS0A 2VJKA 4I3FA 3UJ9A 3U4HA 1GAWA 3I2JA 1WDMA 1B23P 2FW6A 2YZ2A 2FE1A 2O2GA 2PZAA 2ISCA 1T8RA 1DQNA 2FUKA 2JASA 2Z9DA 4H18A 5FPHA 5FPPA 4XEHA 4EMTA 4OMCA 4TUYF 3IE2A 2I1WA 3D7NA 2V4UA 2G08A 3MTBA 3EQ2A 4RGBA 7REQB 4P93A 2BF7A 1EU1A 3HYLA 4YLEA 1IZZA 4Q1DA 1XUOA 2J7PA 4H4EA 1UMKA 3ESXA 1HQKA 3RUAA 3ECSA 3LH5A 4EUKA 3MUFA 4HXEB 4I7EA 4R6XA 3ZE8A 4U7GA 3O4GA 3V4LA 3C45A 4OQQA 4N5LA 4UVIA 2B2NA 4FFSA 5AOCA 2ZDHA 1FYDA 3DKPA 3O95A 4ICIA 4R81A 1D1PA 1SXJC 3OA0A 1RT9A 4CV3A 1EHIA 1ISMA 1YR3A 1T5LA 3VR5A 3WWYA 2C7PA 3HR4A 2I6TA 2O2XA 4PGAA 4BO9A 1ADBA 1X92A 2D06A 3BG5A 5COBA 3RFXA 2VR1A 3WL7A 3FPAA 4NPAA 3PD0A 3WYAA 2R3SA 1FRVA 1MIOA 2PGJA 2C4NA 2XVAA 1E9FA 2G77B 5JJIA 4BGUA 1P33A 1C7JA 3H0EA 1HFJA 5U9CA 5DM4A 1J49A 4O02B 1V11A 3T7RA 5HR5A 4ZEXA 5AI8A 1UM9B 3H13A 1E58A 1HTWA 3NMUF 4URWR 4ARZA 4YRMA 5KNBD 2AG0A 4R98A 2E4VA 1O95D 4I1RA 3X2FA 1Z4IA 2HBYA 1HT2E 1OD6A 1NJ5A 5BT8A 2FMFA 3H9QA 2PWAA 3J7TA 3MAAC 2PUWA 4Q3BA 2H9AA 2ZBEA 4QPJC 4XQGA 3GLTA 2FR0A 4PTLA 5A5DA 1ZINA 1HEIA 5SY9A 1MTZA 1EDZA 1TL7C 1WMSA 2JVKA 2W6PA 3OIYA 2PEZA 3W2FA 4C88A 3K0CA 3K0SA 2OO5C 1Q0HA 1WMBA 1Y9AA 2C61A 4UM8B 3RO7A 2X7HA 2DFTA 6PFKA 3AVVA 4BFCA 3KAPA 4HMPA 1RYZA 4X8OA 2OC9A 3JQCA 3HDYA 4L0DA 3U4DA 1I7DA 1QGED 2VPQA 3FOAA 4Z0HO 4F4IA 3FTQA 4A6PA 4ESVA 2DKNA 3UOWA 2B1IA 4B7ZA 1XDZA 2IDZA 2X5KO 4NCJA 5HQTA 3HXMA 1KQNA 1NVMB 2B4TO 1DDOA 1XQVA 4CLRA 4WV3A 1G291 5LUBA 1QOQB 4LDQA 4U00A 2NUAB 5HFNA 3PDIB 2SBTA 3NV7A 4UTRA 2NU7A 3IUMA 4YGYA 3M6VA 5MGBA 1E9BA 2H1WA 2V1XA 3GARA 4ZEOA 3W6OA 3U5TA 1KOLA 4CQNA 3FGPA 4DG5A 2HEGA 2Y67A 3PVSA 4AQYB 3EMBA 3NJ8A 1GO2A 1FFEA 1H2BA 3IOCA 1G42A 1BE0A 2HF2A 4R1OA 1D7AA 2XRMA 5EIBC 1X6VA 1H0RA 2O1SA 1H1LA 1QRDA 2ZAMA 4IWYA 1NQWA 1C7ZA 2AG8A 1UDCA 4J3FA 3AM4A 2AKAB 3PE3A 3SFVA 2XMQA 4CLOB 3OOYA 1BXZA 1Z17A 2DTXA 4GF5A 2OEPA 4AMBA 3ORRA 3PX7A 3M9XA 4WOBA 1OLOA 1WZEA 3LX6A 1SH7A 1YS7A 3LYUA 1KI3A 4O4JB 1IXKA 4B5LA 4B2LA 2ZUEA 3L82B 4NABA 1YVUA 1D6MA 2OG2A 1UZLA 3QUSA 5LOVA 2TMGA 3D6FA 3W5AA 2NV6A 3GZ4A 3OBBA 1M9NA 2FWRA 2VHVA 1X1QA 3LA6A 4HDKB 3WV5A 3ISJA 4DY4A 3DTTA 1BHSA 4KO4S 5EIEA 1E3TA 4M53A 3DT9A 5H81A 5TIIA 2NZXA 3SBEA 1BDIA 4IBOA 3K09C 4MUGA 3RVKA 4R2IA 1JDSA 3FJYA 3UATA 5IVPA 5AHKA 1HK7A 2C03A 5HJ5A 1O54A 3LUHA 4P4TA 2Q27A 1VHTA 5HIAA 4HEJA 1LDBA 3I9MA 4OFBA 1CS0B 3C3WA 1QH0A 2EDCA 3BD9A 4RHUA 4CKXA 4DHWA 1IE3A 3SQXA 3S2GA 4WKGA 1GUBA 3T4UA 3CR8A 5DSTA 3QVOA 1VMEA 1DT3A 4DZZA 4EEZA 1JHZA 3CUTA 4F60A 1X80A 4GM1A 5HCNA 1N1GA 5IARA 2C2HA 5IDXA 2JHFA 2VL7A 1WBJB 4PE5B 2FHSA 3P45A 5FOSA 2ZZMA 1K7EB 1Z36A 1K5GA 2O5VA 5DBIA 1PTKA 4KR0A 1PGQA 3C3DA 3L8GA 4BV2A 2IZOA 3OQMA 1M0EA 4F46A 1UOQA 2O2DA 1ZI8A 3WLRA 2BHNA 3LZDA 3Q8KA 1X38A 1F51E 4O2RA 5HWSA 5ICSA 3O26A 3H4VA 4OXIA 3WAJA 3DAGA 2FSUA 3TE6A 2O8EB 3JVIA 2WM8A 5HDQA 4BTLA 2J6BA 5JMPA 1KMQA 4HWKA 2Z4RA 3C3KA 2W37A 3GV0A