4NNOA

Crystal structure of manganese abc transporter substrate-binding protein mntc from staphylococcus aureus bound to a zinc ion
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
278
structure length
278
Chain Sequence
KLKVVTTNSILYDMAKNVGGDNVDIHSIVPVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSKDVKPIYLNGEEGNKDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQLEKLNNDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQMRQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTDSIGKEGTKGDSYYKMMKSNIETVHGSMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein
publication title CRYSTAL STRUCTURE OF MANGANESE ABC TRANSPORTER SUBSTRATE-BINDING PROTEIN MNTC FROM STAPHYLOCOCCUS AUREUS BOUND TO A ZINC ION
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transport protein
total genus 108
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2013-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4nnoA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4nnoA01
2AFHA 2YNMD 4CL2A 4TKUA 3TNYA 3ZTTA 4WN9A 4OXRA 3ZK7A 2X4LA 3AETB 2XQVA 2Q8PA 5JJ5A 4FNAA 3AERB 5BVGA 1MIOA 2O1EA 1M34B 2XDQB 3ZK8A 4MX8A 3AESA 3G9QA 5KOHA 2RG7A 4WNAB 5JOQA 2XH8A 3LHSA 1M1NB 5KHLB 1KAEA 4ND8B 2XV1A 4INOA 3AETA 5HX7A 5I4KA 4H0FA 3AERA 1M1YB 1G20B 3EIXA 1K7SN 4INPA 5KOJB 1M34A 2XDQA 2OGWA 2M6LA 4IRMA 5M29A 3PSHA 2ETVA 5CX1B 4DBLE 1KARA 3PDIB 2XY4A 4WNAA 1ESZA 3AEUB 1M1NA 4NNPA 5M34A 4ND8A 4UDNA 3UJPA 2R7AA 1M1YA 1G20A 5KOJA 2Q8QA 2OSVA 4OVKA 3CX3A 2AFIB 4N01A 5CX1A 3PDIA 1N2CB 4MLZA 4NNOA 5HDQA 3AEUA 3MD9A 3MINB 1QGUB 3MWFA 4MDYA 4G09A 4UDOA 4HMOA 5GGXA 4G07A 2PS0A 5B58T 3ZKAA 2XUZA 4UTOA 1XVLA 4PM4A 1QH8B 2AFIA 4XPIB 5CR9A 4FI3F 1K75A 1TOAA 1N2CA 2QI9F 4M7OA 3EIWA 1N2ZA 3MINA 1QGUA 3R5SA 1N4DA 3TEFA 3TLKA 2PRSA 4TKVB 4WZAB 3GI1A 5M3BA 1QH8A 3BE6A 4XPIA 4HMPA 4B8YA 4HMQA 3AEQB 4MO9A 5BVHB 3K1AB 2M6KA 5M2QA 4K3VA 4PAGA 2YNMC 1PSZA 4WZBB 4TKVA 1FP4B 3AEKB 4WZAA 1PQ4A 2OV1A 2PS9A 3ZK9A 3AEQA 5BVHA 3K1AA 4BBPA 2PHZA 3MFQA 5AFSA 2MINB 5GGYA 3HXPA 1N4AA 2PS3A 4WZBA 1KAHA 3LI2A 1G21B 1FP4A 1QH1B 2WI8A 1K0FA 3AEKA 4LJSA 4OXQA 1H1LB 3BE5A 3HH8A 4FILA 4WESB 3U7QB 1L5HB 1EFDN 4LS3A 5JPDA 5FLYA 5KOHB 2MINA 2AFHB 4GICA 3HJTA 4TKUB 4H59A 3MWGA 3PSAA 1G21A 1QH1A 2WHYA 4WN9B 1H1LA 2R79A 1K2VN 3NU1A 4WESA 3U7QA 2OV3A 5BVGB 1L5HA 1MIOB 4HN9A 4FKMA 5JG7A 4UTPA 3AESB 3R5TA
chains in the Genus database with same CATH superfamily
4HEA6 4DS3A 1TU0A 4KKXB 5CM8B 4EA9A 1W48A 3AF5A 1V4BA 3VNAA 3HN6A 1X1TA 5BQFA 4QHYA 2LPMA 4FK8A 5B1HA 4RKQA 2BOVA 4LFAB 3EX7C 4LOLA 1XTRA 4DAOA 4I4NA 5IYZF 1AZSC 1UMCB 2H59A 1YUBA 3ED5A 1WP4A 3MZ0A 1LWNA 1NIJA 3N0RA 1PNVA 4K9DA 5ENVA 3GFGA 5B3LA 3GXBA 4QBFA 4IM7A 2HDHA 4XIFA 1EEXB 3TR5A 4AX4A 1TT5B 2A8YA 1HFJA 2AE1A 1FL9A 1F1JA 2EZ4A 3L7KA 5ADHA 3RFXA 2DHCA 5KPJA 3U13A 2L69A 4I36A 1GZDA 5A4DA 3LPMA 5KCZA 5J1SB 1LV8A 4B83A 4KR7A 4ZO4A 4R4JA 3UN1A 4R1MA 4Q1FA 1DHRA 2ODWA 3HLKA 3OMLA 4M53A 3EZGA 1XL0A 3NCHA 3SC6A 2J3LA 1AO0A 3L4JA 1Q1NA 1CJCA 1A2BA 1RPNA 2DFKB 1OLUB 1OVGA 4JJEA 2AG0A 1EB8A 2J07A 2KSQA 4Q3BA 4RESA 2X8JA 1JQBA 3QG5A 2H1RA 2C88A 2VYND 4M1WA 2VLIA 1RRCA 1ZMTA 3DLBA 1MPTA 4R1TA 2XOXA 1NJSA 3ESRA 5E8JA 4PLGA 1JVNA 3V9PA 1WF3A 4G5RA 5J2TF 1M2FA 1ZYUA 2I2WA 2SKCA 1E1QD 3FG9A 5AMXA 3TLAA 3TTVA 1I1NA 5FUYA 4DA8A 4B4DA 3Q3IA 1SHLA 3DBLA 2REBA 3KD3A 5DN9A 5CDSA 1OJ7A 1R6TA 1V41E 3QNUA 3QX9A 4RK7A 4E33A 2P9FA 721PA 3KNZA 2JGLA 3QFRA 2AN1A 4GMDA 3W1VA 4MS1B 3NDJA 4WZAB 1ZJ5A 4YJ2A 4N40A 3U3XA 4QHSA 5BT9A 5BN3A 1VFNA 1YZVA 3IMCA 1QH9A 3REGA 3F9RA 1PW7A 1MAHA 3A32A 1V5GA 4N4AA 3RJTA 3O5AA 2DYKA 1SKQA 2JHCA 3JQFC 4DB2A 2YWFA 2VQ3A 5EJ2A 4EITA 2INGX 2Z5GA 2V8BA 2JZOA 2V9PA 3I9V1 5HJ2A 1IG3A 4FMDF 3UJHA 4EI7A 4QAJA 4F06A 1BX1A 1DRUA 1Y1SA 4LX0A 4R01A 1GSIA 3GR6A 1R6BX 2W2LD 3AVVA 2JLZA 3X1DA 1M1XB 3BA6A 4PSVA 5BVHA 3KHUA 1E5VA 1TZBA 1CC1S 3AHFA 4AWXA 2B9EA 4G2NA 2V03A 4JGIA 2COUA 2GKOA 2J0UB 1CJVC 3EPRA 5D3QA 3V2HA 5F23A 2XCTB 4B0OA 1ZD2P 4MGEA 3K70B 3B48A 4MW6A 3EPLA 1A2QA 4DEVA 2X9QA 4ZAGA 1QRUA 5FLYA 1EM8A 5EIBD 3FTNA 4AC9A 5L8VA 4L9WA 3MCAA 2JFOA 2R66A 3UTDA 1JHXA 3CUKA 3G7SA 3HCPA 4D74A 7AT1A 2FPWA 3RYTC 3DL4A 1C3LA 2D2IA 1TYZA 1YS1X 2IHTA 2CK3D 1UPTA 3E7PA 4UEQA 3VNUA 1P4RA 4ETIA 4GPD1 3EF3A 1UIMA 1C1DB 2C2XA 2OHGA 3H65A 1U3DA 2FOLA 4RADA 4GBED 5DSZA 2OCIA 4WNCA 1MW9X 4UBOA 5C81A 1UXKA 1QK5A 4CL2A 4QTYA 3PQ8A 4Z0HO 4BGDA 4I0WB 1RQ7A 2PSSA 1M6NA 1SC3A 4YC7A 4RCVA 1NV8A 3GGCA 5EE0A 4YPFA 3BMCB 4HPJB 4QPCA 2IOYA 3TH5A 5A6SA 3NBYC 4Q4DA 1GT6A 1RJGA 3N2LA 3GVHA 4LTNA 1S2LA 4YJHB 3OC6A 1DTEA 3R6GA 4QFBA 1K88A 3J81A 4CV3A 3RTAA 3V6MA 1TE2A 2F43B 2M98A 4Q02A 2N47A 1KA9H 2I4MA 1GT91 1RHQA 2XQJA 4LZAA 3S27A 4F4CA 3PFFA 4JXXA 3UGTA 4CI9A 1I5EA 4QNMA 1XTSA 4ER7A 2ZSJA 4JKOA 3ND6A 2DWOA 3FDIA 3I32A 1KVRA 2ZXEA 3ROTA 4HDAA 5FL7A 4FQ8A 4Z9FA 3AVWA 1I2MA 2R1VB 4CODB 4WLOA 4J1TA 1GPBA 3GIDA 1KFCB 4LOKA 5DHRA 3EUFA 4TTJA 4EVRA 5JZOA 4D4GA 2DLDA 5B5SA 1OGYA 1XRRA 2UZAA 2ZR7A 4WJLA 3CX3A 2GUWA 1Z5OA 2HLDA 1AD2A 2J41A 3BKXA 4QPZA 4U9HS 2BELA 3FPEA 3M9LA 4YDQA 2OCGA 1S01A 4MPTA 5EUQB 4B43A 3B3JA 1C8LA 3IUBA 3IDFA 4HMOA 3LQRA 2RGUA 4FFLA 1L4EA 1A8QA 3PQ3A 4MXDA 1CRQA 3K0AA 4JUIA 4HR7A 5HF6A 4B5KA 1T4DA 4YV1A 1NAHA 3QYFA 5AJZA 1YZNA 4DDVA 5SYMA 4CMGA 1MNAA 1R8SA 3S81A 1O6CA 2NTVA 4MPPA 2FQ1A 4JI7B 1FTWA 1Y1PA 1QGUA 2FPIB 3EIOA 3P9PA 1AQNA 2O8DB 2K5UA 4NBKA 1K5GA 3KHKA 3RRMA 4YCBA 3D54D 3GMTA 1ZGAA 4BXOA 3BWYA 5KTRA 2HREA 4P53A 4AZWA 2H06A 1ZW6A 1XTVA 2O05A 4L95C 1XKXA 3G5AA 4QLAA 5T41A 1B16A 4C7XA 1MA3A 5DSTA 1JWAB 3DE6X 2QMZA 1PP4A 1GDDA 1VG8A 2H5JA 3R7AA 1CJKC 3EGWA 4II3A 4YROA 4D9MA 4EUSA 2BEUB 1IZYA 2EWWA 1C1XA 1PZXA 2QBYB 3KQKA 2QS9A 1TJPB 1L5SA 3ZYZA 4R8KA 3PJEA 1LI7A 2BFMA 1FP4A 3FR8A 3PI7A 1CIJA 5P8WA 4CKEB 4JU9A 1J33A 2NVOA 3TQCA 3VHLB 4CM8A 3L5KA 2P7HA 5JCZA 2IXBA 4HWRA 4II2A 5ECYA 4WHMA 2XMQA 1D0SA 2JKYA 3RVPA 3SFZA 4DIFA 3LRPA 4YCSA 3LT4A 1N6LA 3G5MA 4BNZA 2EFGA 2JH8A 3NBZC 1LXCA 4PGGA 4NJEA 2EKQA 2NUTB 4U2GA 1L5HA 2CL5A 3SNKA 3HFGA 3VC3A 4QIHA 3K70C 2Z8XA 4MS4A 3ZHRA 1AQJA 3KT0A 2LWIA 1MJGM 3I6IA 3OZSA 3GCGA 5A7FA 4CFZA 3I76A 1V5WA 3G85A 4Y3UA 1ZRSA 3FIUA 1Q44A 1Y5IA 3ACCA 5AOAA 3RRJA 1FS5A 3AI3A 2F3PA 3IEIA 1I3CA 2IZ5A 4GQIA 3SOPA 3FKQA 4LRQA 4TYWA 2PQMA 2JIZD 2J3MA 1T36B 2BFWA 2NZ8A 3WKDA 4UNSA 5AW4A 2Q0SA 4JCCA 1JZQA 1E92A 1NVAA 1A9SA 4NV0A 5DBIA 5CA0A 2OQRA 3KPWA 2QRVA 3EFOB 3A6LA 1XMJA 2GASA 4F3CA 6Q21A 2X5KO 5I9MA 3R8FA 3N5KA 1ULHA 2V4ZA 5MGBA 3LPCA 1EZZA 4U2BA 4X64B 3WZMA 2HIGA 1B0ZA 2JEZA 2PT9A 3FH0A 3OWHA 1GTVA 4HG2A 3RGGA 4QPNA 3UWDA 2FETA 5GONA 3VTFA 4LHXA 4BQNA 1PI3A 4E7PA 1HL3A 2WSBA 5GJVC 3GJYA 2ES4A 4FMBB 4B6PA 3CT4A 3QMMA 1WSBA 1GU7A 3FN4A 4JLPA 1VE6A 4PF1A 2NQ2C 1SURA 3ZIAD 2BUCA 2GBGA 4LGMA 3WGUA 1JFRA 2C5AA 1U6IA 1ZRNA 3URKA 1OI3A 5H7XA 4IH4A 1DC5A 1F6DA 1Z9BA 3NORA 4LMPA 4E15A 5EHQA 1U2SA 4H6VA 4JLUA 3SAJA 2WZCA 3JAKA 3KVOA 2CUTA 2ACWA 3SQNA 2KQUA 2AW3A 1ZIOA 1O03A 4ICIA 1RXYA 3I1JA 4N8SA 2G1UA 5EP3A 3E5MA 5C3UA 4HAXA 4DRZA 5BPFA 2WFAA 2H7YA 1NN5A 5F21A 1EX7A 3IIEA 2I1WA 4Z3OA 2HRDA 3CX6A 2WHPB 1QX4A 2XUIA 2FZ4A 5EQTA 3IAS6 5SICE 5JBIA 2VUHB 3DLCA 3OZVA 4CKWB 1EVJA 5LXTA 1XRSB 1N5JA 4GXQA 2B0JA 4DC9A 5IASA 4YH1A 4X62B 3Q2IA 4RYDA 1XJ5A 5EJAA 1L4GA 1V0JA 1MH9A 3Q9NA 5CB6A 3DWGA 2CE2X 4BWGA 2FK7A 1U7PA 3NTQA 3UB3A 4ZJZA 4C01A 2FWBA 4LRXA 4QXMA 3DXFA 4E5UA 4OQQA 4A0GA 4ENSA 2VS1A 1GA1A 3D1LA 1IN4A 1UJ5A 1ECBA 3S4YA 2XTAA 4BO0A 2P90A 4UMDA 4ZI2A 4D57A 3NM5A 3IVGA 1ZJJA 5EIFA 1JSXA 2NZJA 5IC4A 2Z4SA 1ISFA 1JIUA 4POAA 5JBNA 1WHTB 4V1CA 3GEMA 4ZVVA 3VHXA 1OAAA 1H0SA 4CM9D 5CD9A 1GLGA 4BRSA 4EX6A 2QKYA 1UBSB 1XNHA 3NT4A 4XIJA 4ZPJA 1Q7TA 5GJCA 3WP0A 4C6TB 4ZC8A 2LTAA 1L5MA 5FUBA 2G71A 3P0HA 1EX1A 2Z30A 3R3XA 5K4GA 2ZB3A 1QVZA 2GWRA 2HRZA 4EGJA 3ESQA 5CVCA 4LDJA 1K9VF 2XB6A 1OFTA 1T3ZA 1PQUA 1U7DA 1XLTA 4IQGA 4JB8A 1KJZA 2X0FA 3VZPA 4UPVA 1DQRA 1BX0A 4G1MB 1VJTA 4NOKA 5IN5A 5EEHA 1IBKB 2RBKA 2H0RA 1AKUA 3GUCA 1NLYA 4BNDB 5JCXA 2VK1A 1ZUIA 4NQZA 2IIQA 1C4KA 2J6HA 3FXAA 3UMGA 3PUYA 2VTDA 4RX1A 4X44A 5IAGA 1KFKB 3LXRA 1NVKA 1E1LA 1RZRD 1D1PA 3NHJA 1FBNA 5JVDB 1T24A 2VP0A 2VEDA 3IPLA 1ZSVA 5DGXA 3VDQA 1ZK3A 2E4XA 2VWQA 4GBGA 4YMTA 3QYJA 7MHTA 1WD7A 1UP6A 3OO0A 5B2ZA 3ER9A 3ZNOA 1YQGA 1M83A 1Y98A 1EGVB 1Z56C 1V26A 2WABA 4FMCB 2FUG1 2D8AA 2PX6A 1JFVA 2G7MC 1O0CA 2VPZA 4Z4IA 4CZ2A 2J9GA 1GPYA 3K9LA 3WL5A 5AT1A 4O5OA 3SBXA 3U9LA 4JYBA 1JHMA 5H8WA 3GPIA 1JFTA 1K8ZB 1E89A 2IEAA 1HT1E 4KXXA 2VT2A 2AQHA 3PDIB 3BJRA 2C1EA 3MGAA 4FYPA 4RDHA 1QGOA 3QLJA 4I9GA 3TNDA 1CY7A 3SFTA 4DDKA 1IN6A 3VSAA 1J0XO 4P83A 1TT7A 2FFAA 3KT6A 3ON5A 1NQXA 2JHFA 4MV1A 3ZBTA 4BCBA 3MHPA 4PGAA 4F8JA 4N0QA 2CYCA 1UPCA 2OCYC 2Q5QA 4AZ0A 2F7SA 2R8BA 1JHUA 3G2KA 3ZHQA 3PXUA 2OV6A 1YK1A 1EMDA 4TMVA 1GG2A 4QDZA 2GUGA 3HRHA 1V8FA 1CLUA 4EA6A 4U5QA 5F98A 1L5FA 5BN1A 4ABTA 3AVTA 1QIEA 1RI3A 4YXWA 5JDCA 1YJXA 1XUOA 4H08A 4P81A 4CN9A 4LF9B 2QUBA 2DH6A 3EDMA 4RHFA 1KMHA 2QTRA 3P9XA 2NU8B 3WWZA 4CF5A 5A4KA 2R68A 2RD2A 1Y8QA 3OFND 5BSWA 5A3RA 4DR4B 2GRUA 1ZI8A 2WJZB 1GKYA 1GTZA 2XUDA 1V8PA 3LBNA 3KAKA 4JBXA 3RIGA 4HVLA 3K0FA 3R7FA 4NESA 3LM8A 4REOA 1AXGA 5TQVA 5KU1A 2FX2A 2YMLA 3A9VA 4G81A 2BSAA 2Q28A 3K1YA 2Q1WA 3K72B 4BBAA 1JZSA 3IT0A 4HPWA 4OHWA 3I62A 2UUBB 4IJKA 3W05A 1N5MA 3WGOA 2CBZA 1LDYA 3JQ7B 4I1IA 1MMFB 2ATCA 2R6CA 4WGFA 1C9DB 5E6UA 5DBFA 3OP4A 2FGKA 4NARA 4ZTUB 3ICEA 1TMKA 2AR0A 3MJVA 2V4MA 2LKDA 3V48A 1Q19A 3HGQA 4HRVA 1IOVA 1T6YA 1UDAA 2FX5A 4G5FA 1N1MA 4ARCA 3G0BA 2GXAA 2RH5A 2EP7A 3QUCA 1CZLA 3G9TA 1E9FA 4Y1GA 1NF2A 2WQ6A 2XVAA 2WI8A 1NMZA 4G8BA 2C9ZA 2YYAA 2JFVA 3QXJA 1Z0IA 1UFRA 2QLTA 1TEHA 3BYZA 4JL5A 2O5VA 3QX7A 2CY0A 2I8CA 3HJUA 1NLMA 2GQ0A 3II6X 4DBVO 5A4IS 1N3BA 3HO1A 3EYAA 1JG4A 3AKYA 1HG1A 4HWGA 3NFYA 3AHHA 2C84A 1U3VA 4FFBB 1KYVA 2QOEA 3PNPA 4PSCA 2DTXA 2ZBGA 2BISA 2CZCA 2Q46A 4Y9TA 2YZMA 1B23P 1X1EA 1XD8A 2CFOA 5KNDD 2B83A 1DX4A 1QS0B 3V1MA 1REQB 3OQMA 3W5AA 5BNFA 1C3OB 4MJ7A 3CRW1 4QOJA 4ZV4A 3GEEA 2FR0A 5DYTA 2PGIA 5JJIA 2OXCA 4X71A 5EJFA 3AHIA 1VM6A 4Q05A 3SYNA 2AHRA 4BNVA 5EOVA 2PLAA 3C6XA 4E4RA 1KHHA 3M6UA 3PGA1 4L07A 5A9SA 3ITKA 1W2GA 2EW1A 2QX9A 3VM6A 1SD1A 1VSUA 2WBLC 4RXTA 2J0QA 3WK7A 4I50A 2WYVA 4E5SA 2C5FA 4GVXA 4GKJB 5I48A 5SZHB 2ZREA 1USIA 5FPSA 2AXNA 5G53C 5JY1A 4M87A 5JD3A 3KQLA 3WGVA 3NAQA 3PHCA 4DCTA 3FA2A 2C9BA 4CTKA 4JT4A 4Z2YA 1OHHA 2ZU6A 2ZJ3A 3KR0A 5I51A 3T5PA 3F47A 4MUJA 2AN3A 3HJCA 5KYGA 5LNK1 3EEQA 1K27A 1DG3A 4BUZA 2ANBA 4NAHA 3QUAA 2Q8QA 4NPAA 3WTCA 1CIVA 1PR1A 1UJCA 3FPFA 3KYDB 1LDEA 4JLOA 4M0DA 3VHQA 1Y3FE 1EB9A 2YN4A 3I39X 3OIGA 1RI5A 4J4BA 3EY9A 2O20A 4TYMA 4UM8B 1XCJA 5JD5A 1KVSA 3HXLA 3CBGA 1WM1A 3C3XA 1QB7A 2ODBA 2ZSBA 3MTBA 1N1GA 4QTXA 4ASUA 1HK7A 4Y2PA 4BATA 3IUMA 5KJCA 1LDBA 1Y6GA 5KNCH 5CXUA 3PNOA 4NCNA 2BGJA 2QLFA 4Q4JA 1VGVA 2NU9B 1IN1A 4IJQA 4FI3F 3SJCA 1S8NA 1WXEA 3TQOA 2BLLA 1VJRA 4DLNA 3T34A 4KXYA 1FFAA 2GMWA 3V6LA 3ET4A 2QTVB 3FKJA 4TTPA 4U3JA 3MINA 4X5OA 4X6UA 4QGBA 5F2KA 5T3YA 2UZ4A 5EIWA 5JFTA 4BKOA 1WMFA 1E4YA 5EINA 3BF8A 3D6JA 4MUXA 4UFNA 3SG0A 3OZAA 3V2GA 3T95A 1RMYA 1Y5NA 2OG1A 3B78A 4RDIA 5CGZA 3JWPA 1Y5RA 2AJBA 4KYVA 4CM7A 4UXHA 5IS2A 1GDTA 2OORC 3AL0C 3W5DA 4G36A 2BEJA 3FYHA 4C3VA 1CNMA 2H9AA 2ZRHA 1W4AA 2DF8A 2EKDA 1E2GA 5JEEA 1DARA 3AR9A 2AZTA 2ADFA 1PVVA 2PS9A 4J3JA 4E2YA 1PKEA 4CUZA 1GPAA 1HZZC 4BLTA 4HEQA 4WV3A 1V1RB 3KCNA 4BLSA 3L1KA 4J07A 1NN0A 2AOXA 1BCRB 1N1EA 1S3SA 2BHNA 4M1QA 4CV1A 2QVGA 3WLEA 4F1WA 4GOND 1VP3A 1E66A 1NHGA 1G9TA 2FCRA 3IUSA 1IY0A 3B13B 4F2PA 4FN4A 5B6JA 1Y5MA 5TR9A 3IEXA 3DO5A 4BFCA 4S1TA 2Q1YA 3K1ZA 2BF7A 2XNJA 7YASA 5CJJA 3OPYB 3HWX1 3O3CA 1SK9A 4KE8A 5LQCA 1NVTA 2BUAA 4ZQHA 5FO1A 3W8EA 1NA5A 1XZKA 4ECAA 3VH3A 3MPOA 1OI2A 5EJEA 2VTBB 1R5NA 2VHYA 3T7RA 1IJFA 1G2IA 4D9JA 3OQIA 4NPCA 4PS0A 2RI6A 4NBLA 1YA6A 1KSHA 1W5AA 3FPKA 2G0AA 1EBBA 1YB7A 3ACDA 1O94C 3X2SA 4D41A 1FUIA 4H7FA 5KOHA 4Q9NA 5CDFE 2HIMA 3HO6A 2MSKA 4K6CA 4S1NA 3JQEA 1D5CA 1DDGA 3CCBA 4RD6A 2H5EA 2XODA 3LJKA 5TGDA 1M2NA 3M6VA 3B85A 2GJSA 3NM6B 4JX9A 4AY3A 2HM7A 3FI0A 5KWJA 3GP8A 2QG4A 1QHFA 4J7XA 4DG5A 1JAIA 1NN3A 3AR4A 2CLHB 1GZ3A 2JASA 1QHIA 3ZTWA 1A04A 5L4LA 1NHWA 1X74A 4IKEA 4MUKA 2HCFA 5DI3A 2XH8A 2WJGA 3S8YA 1KRWA 4N3NA 1GSHA 1M2OB 1QVRA 4C4RA 2ENUA 4DSOA 3MJFA 3RVNA 3ZH9B 2OO5C 3UJNA 1ZESA 2HA6A 3NAMA 5CEEA 1YVUA 4B85A 3ASUA 5IDVA 4XB2A 4U5XA 1GCGA 1YUNA 2AVNA 3S7TA 4RY9A 4ESHA 4TKLA 4TUYB 4RZIA 1UOQA 1WNFA 4IZ6A 3T5BA 3UJPA 4GM1A 3I8SA 1MOQA 4R1UA 3ZWOA 7MDHA 1P4SA 1Y1LA 5EFZA 5ED4A 4JLKA 1WD5A 1A50B 2R60A 1A9RA 4GYJA 2ENWA 3JQ9C 4RVDA 2TMDA 1Q17A 1U11A 2RIPA 2VJYA 4W9RA 3CJRA 4R3NA 4TWJA 1GTL1 5JISA 1OZGA 5JTTA 1AKNA 4CV2A 3QA9A 1PS9A 2QVCA 4EJ0A 4WBNF 1NUPA 5IWCA 5EHGA 2ZIWB 1U4SA 4TMZA 3IP7A 2P6NA 4LZWA 4LWQA 1EDBA 5JS2A 2WAXA 3LPLA 2FKNA 4NBTA 2GM5A 1Q0SA 4KZKA 3C98A 4NBWA 2C2ZA 2FQYA 2II6A 4IUYA 3KRTA 4MVJP 3PJRA 5BMVB 3GRZA 2BZGA 4H1UA 1S2IA 1DJLA 1DBSA 1Z2DA 2PMWB 4ZQEA 5E6RB 3QY9A 3D7NA 4XPIA 3G6KA 2BCEA 1GYPA 2PZKA 1MABB 1N2XA 3AEXA 3DPUA 1KI4A 3B3AA 3RIHA 2FU5C 4GECA 3SVZA 1ZOSA 2QX6A 3GPDG 1DAGA 4EPWA 2FWPA 4IVPA 2ERXA 2RH9B 1ZM2A 2GZ1A 2VTEA 5FTLA 3COYA 2DKNA 1BXRA 4A73A 2CLIB 2DR3A 1HE2A 1HE8B 3PGVA 5LQNA 5DP2A 5LWQA 2P2NA 2Q0XA 3AIKA 3H9GA 1KOGA 1LBTA 1GAEO 4ID3A 4D3FA 4P32A 3HXPA 1RCFA 1G8FA 2DOKA 4LWPA 3S2FA 4FJ0A 4Y1EA 2A1TS 1Q0UA 1QTIA 3MBIA 1EVLA 1DMSA 4WESB 4BU1A 4C5CA 3ETCA 2ZB2A 1R9GA 4O4IA 4F1JA 1CX9B 3VR4H 1ZJZA 4WKBA 4E2ZA 3CVYA 2FSPA 1Y6JA 2OV4A 4P3KA 4RPGA 2GEKA 3ZYCA 2Y6UA 5BSGA 2MSWA 2DZDA 3HJTA 5H68A 4EQ6A 1MR3F 5KHOC 4JQCA 4E1AA 5JO0A 1SCUB 3DOHA 3C5EA 3FMGA 3IUQA 4XUEA 2NVUB 3WLNA 2XMBA 4D9FA 4DMUB 2JG3A 5AR1A 4HLDA 3GC6A 3VVLA 1WDWB 5J43A 3U7RA 2PWZA 1IN8A 2VDWB 1EE9A 2FG7C 3L0IB 3PJDA 5CFRA 2GPSA 2VZ8A 3DVLA 3DDWA 5U9CA 2OC4A 1JLMA 1KI2A 4TMWA 1J70A 3WSWA 2GHIA 4ALNA 2FXIA 1W6UA 1B3RA 5HJEA 1F14A 3NBMA 3GELA 4AZSA 1XOIA 2E21A 3RYIB 4CMIB 3O83A 4PNZA 4LIPD 3IQHX 2E4WA 2CXSA 1U0GA 3ZBUA 4LHSA 3MLAA 4DUGA 4TMXA 1WXFA 2AMVA 3SXUA 4BYMA 3HUDA 1CTQA 3SYMA 1G7TA 3PF9A 2M2IA 2QM0A 3AMVA 4NJMB 1NN1A 3INRA 1VCMA 2EEPA 2V55B 4HDKB 1WZ2A 1HTBA 4QOGA 1CS0B 4RWZA 2Q9BA 1T29A 4XYBA 4D4JA 4HGYA 4F3TA 3IEUA 1OGIA 3I52A 4MKZA 1SXHA 3PFCA 5EMNA 3PC2A 2NUAB 1TVCA 1SELA 3KQQA 2YJGA 1ZRMA 3ETGA 3QPCA 2PGXA 4B7UA 2WIBA 1W19A 3FM9A 3V5NA 2GCNA 2XKKA 3MMXA 3VKHA 1YMQA 2VN8A 2IA5A 3SHFA 4EJ6A 3CVWA 4R1QA 1L5KA 1J7KA 1XXHA 4N47A 3N3BC 4P92A 2WKSA 1RIFA 1YI8A 3VR6H 4TLBA 4H7JA 1EA7A 2GLUA 1MJGA 1HH4A 1J23A 5GOZA 4P3PA 5CVJA 3TEJA 4BZWA 1Z62A 2ZVQX 3DWEX 3DZIA 1KMNA 2JEYA 3GYBA 2PKYX 3A1CA 2YJ4A 2V7UA 3AU8A 3B5IA 2RH4A 1IUOA 2Y1FA 3DJYA 3H3FA 3KFLA 4ITUA 4RMGA 3HB9A 1K06A 2O2IA 3OHSX 4BKPA 4C08A 3B6ZA 3FMVA 5HXAA 4RSMA 2XYGA 4ER5A 1X87A 4QUEA 1OAOA 2PT6A 3QFFA 3U0VA 1WV0A 1O7JA 2RH8A 4GF5A 4K9PA 2H3EA 3JAMA 3ADCA 4OQYA 1K7YA 3BD7A 3HXTA 1Z2AA 5EJIA 2BFDB 4LE1A 4D6XA 5DT2A 5HUHA 5G0TA 5DM0A 1OZFA 5M3BA 3A2KA 1GEGA 4Q1CA 1G64A 2EOAA 1Q6ZA 3CNBA 2WTNA 1ZAYA 1QC5B 3K31A 4I1PA 4FE4A 2RHWA 1L4UA 4QYSA 3GX1A 5IEJA 3ANNA 2IZ6A 4CNBA 5LJLA 1VPDA 2H1WA 5BN5A 1I3MA 3HP7A 3FRHA 3KTFA 2FK8A 2WNIA 2V9CA 3DBVO 3H4MA 1XN4A 3IAFA 3PUZA 3RNOA 3UB2A 4EKYA 3FUTA 1V3QE 5HYVA 5DK4A 5CD1A 1IBRA 1EUZA 3SF8B 1VKJA 1JH9A 1E2LA 5H5JA 4Z49A 3WLRA 4EMSA 1O6BA 2BEWA 1AXEA 3VHRA 5G1NA 3A3OA 2YZ7A 3I42A 3R40A 1Y9EA 4EO7A 4KOEC 5LQDA 5K0NA 1KJQA 2IUYA 3UOWA 1OJLA 5F3RA 4PG4A 2J9FB 3EXHB 1MC5A 3MFYA 4CIYA 1PUJA 3SQLA 1DEKA 2XOKA 2C00A 4PGMA 4YCAA 2JF0A 3HCBA 2F55A 1ST2A 2OOSA 3PPWA 3H17A 4OAPA 4Z4QA 121PA 4W6ZA 4NG5A 5FEMA 4RM3A 5B1YA 2MSEB 5GM1A 1R4AA 1SU6A 1SBZA 4PNPA 3KQWA 4P3OA 4G24A 1DRVA 4QBHA 4UHDA 1TZ2A 1R5JA 4X20A 1UBJS 1AGPA 2C61A 2YNMD 4W5QA 2C2YA 4PXYA 4PAQA 3TB4A 4EIWA 1XZPA 3BHJA 4IGAA 2A3RA 2QTZA 1U7HA 1DKOA 3DEYX 3W3AA 4PO1A 2ZTUA 5JO9A 1WV1A 1JQJC 4OHBA 2VRBA 4AY6A 1EVZA 1U3UA 2HA2A 2PMBA 2SKEA 1TM5E 3R0ZA 1PHPA 2GLTA 3EEYA 2W8ZA 4ONEA 5C80A 3UATA 4J7UA 4YA6A 5T8KC 2XCRB 1M8PA 2QTMA 3ODPA 4C7OB 4MLPA 3WGHA 1YR3A 4DCPA 1CB7A 2O8NA 2OZVA 3CUSA 1FNMA 3ONVA 5IVPA 3A58B 1CCWA 421PA 2O19A 1T3LA 1X9IA 1Z0ZA 3KQHA 3QF4B 1PSWA 4HDOB 2AQKA 4MROA 4NIMA 4UHKA 4NE2A 1NNUA 1T8PA 2IPXA 1GXSA 4QTTB 1Y8CA 2X5NA 4ZV7A 4ENTA 5B6IA 3H1TA 5AVZA 1A9ZA 4RTMA 5C1DA 3ZDYB 2BMAA 5LR6A 3AIMA 4E3WA 2FTKE 3L8CA 1ZO8A 4MKHA 1DBIA 4BNFA 4G5XA 1CY4A 3PDWA 1P73A 4IDNA 5BWBA 3C4VA 4NE7A 1RM0A 1ZITA 2ZE8A 3TW8A 2BZ1A 2VYCA 2NO0A 1AGYA 4BLRA 5EESA 2WWVD 2X2EA 4C0JA 4Y6SA 2ZT7A 1H6DA 1VL5A 4JLWA 1OILA 1A9YA 1E3JA 3EOAI 4KQFA 1TIPA 4MA0A 3RLFA 4PINA 3HC7A 2F4VB 2C3UA 3O8CA 4GPEA 3LVQE 2OZEA 4LZZA 4WY2A 4IILA 1XYGA 1ZXXA 3A14A 3GFTA 1HYEA 4EHHA 1EFAA 2JFGA 5JD4A 1XTJA 1J8YF 2YR0A 4EQ6B 1VKOA 4XASA 3M83A 2LGJA 2O5RA 4HRAA 1TZMA 4ZI7A 3H4VA 3D9QX 1QFMA 3TQRA 3GNSA 1NBEA 1LI4A 2PBLA 3ZY3A 1W7AA 4RV9A 3WHLA 4AJJA 4CTNA 4MUIA 2BEKA 3W2GA 2KBFA 3NPMA 4CMBA 4BNTA 2IYUA 2R1TB 4TM7A 5EA2A 1G4AE 2Q5FA 5DOVA 1HDXA 1UJNA 2C5SA 4AWBA 5DM60 1X3LA 1AS2A 1D9ZA 4C29A 2VUIB 2JBWA 2X5OA 4DWOA 3OH8A 1L8XA 2OCDA 4H0NA 1MZPA 3SZRA 4D9CA 1OY1A 1S2DA 4ZANA 2O9JA 3RRXA 3F4LA 4D3SA 1ITZA 1DKRA 2EG5A 3OA0A 3ITNA 3TAHA 4O4JA 5DTIA 1RXUA 4MWZA 1IDOA 1A76A 3VH4A 4FILA 1R0WA 2P9BA 2CLSA 2ZIXB 1L7QA 3Q9LA 3ZLUA 2P6PA 4DLVA 1Z0SA 3NYQA 4TS4A 2A0KA 1KZ9A 1C9KA 1PS0A 4UC0A 4E30A 4K3UA 1ZNXA 4XWYA 5JI3E 4FEEA 2PPVA 3FW1A 3E3LA 5AK3A 3GP3A 1MVLA 4LDAA 4MITA 4PRLA 2VRCD 3LYAA 2H31A 2QXTA 3AM4A 3HM2A 3SK0A 3FX2A 1W0CA 1CUDA 1E2IA 5AD1A 1TZJA 2GFHA 3EMKA 4D7AA 5JC1A 1OREA 4PIVA 4GUAA 2Y8EA 4LK3A 4XIYA 3BTVA 3E3MA 1G63A 2GYVA 3HHEA 3OCVA 4PLFA 5L3SA 2KYRA 1GQYA 1HFKA 2J09A 1NW3A 2OKCA 1RWXA 2WVGA 5AKGA 1E9BA 3ROGA 2X9NA 3L41A 4PZ0A 3CXRA 1MFPA 1V8OA 3IHLA 3PTZA 1KQGA 1UDWA 2HXYA 4M0MA 3WLIA 2QD1A 5AHKA 5EN4A 3LNCA 5ESWA 5IHPA 4FBMA 4QQRA 1PJAA 3LBFA 1MEOA 1J2JA 3TXXA 4IRMA 3ZGVA 2JJ1A 2YIJA 1LF5A 3K05A 1ADFA 4QXAA 5U4QA 1P7PA 3P9NA 1OA1A 4GOJA 1VZ3A 4JVNA 4UDNA 1G4UR 5BUZA 4QPJC 4BZQA 1A3CA 3PQEA 3LDGA 3BA1A 3NJ4A 4RKYA 4Q6BA 4P5DA 2Y1KA 3X43A 5AVVA 1QRRA 3LCVB 4CF3A 3UUFA 5MDHA 4YDRA 2ZSHA 1YIAA 4BDTA 1NE2A 2EJCA 4NY1A 4RJTA 3VO8A 3N2NA 2B30A 1YJBA 4DNXA 1IVYA 2ZSAA 1N25A 3L06A 3Q98A 3AI7A 1K97A 3DMHA 4YJ2F 3SP1A 1XELA 3L0YA 2JCSA 3GT4A 1N75A 4NNJA 4Y2HA 4I3HA 5BQ3A 1UFVA 3PZRA 1N6KA 4NXMB 4WJZA 2V54A 1TQ8A 3D6AA 4M8NE 1P2TA 1TYAE 2IRWA 3AILA 4JODA 2ZUTA 2IX9A 4M1OA 3RJ9A 1QQ5A 4Q7MB 4EG4A 4R71A 4M98A 5M2QA 3W9YA 1AJEA 1EFHA 1E20A 3NONA 1A82A 2VP3A 1Q3HA 5JE8A 1ECFA 3FZQA 3I53A 1C2TA 4ZZ1A 3JQBA 4ZO9A 3K6JA 3C3AA 1LLUA 2C0PA 2X86A 1RD4A 2NN3C 4GBMA 2NYUA 4NVRA 3FYTA 3K1AA 5EKXA 1LSSA 3N0TA 4LW8A 1YNOA 5EG5A 1GPDG 4AY4A 2AC7A 3RASA 1NDUA 2P2ZA 3V2UA 1C4OA 3T0GA 4N0DA 1X8XA 5D1NA 2RK3A 4P35A 4Z1OA 2J3IA 2C0CA 2ZR8A 4HEHA 3BE8A 4JYCA 3ZI7A 4EHAA 4ZZ0A 2Q7XA 4GZ3A 2HPVA 4LRUA 5A1JA 3MG9A 1XQXA 4IO1A 4HOYA 5DLDA 3RWMB 1GGNA 2AFHB 4O3FA 2I66A 1M2WA 2REQB 2WR8A 3CKLA 5DEOA 2EFYA 4M6WA 3UNXA 1VG0B 3K0EA 1NZFA 4WUTA 3ADPA 4TTQA 1SUIA 5DULA 1Z37A 1ZFNA 3ECCA 3N8GA 3C1TA 4E88A 3COJA 3PC3A 4TYNA 4JB2A 3ZXIA 2WT4A 3D0OA 3S5UA 4OMCA 3N59A 5E7IA 2YQ5A 4HGNA 1OLSA 1SUWA 4P3XA 2GK3A 4E94A 1KORA 1PZGA 4OXRA 2GAIA 2D4AA 5GADl 1MTZA 5T5QA 4CCWA 4BQFA 5DLEA 2EKZA 1NR1A 2WHEA 1V8DA 3A6ZA 4R8SA 4MX8A 5TVKA 3GXOA 3TFWA 5HM6A 4B8ZA 3D64A 1VIYA 4BMCA 3CR8A 2DLCX 1U2PA 4F72A 3GT7A 4P6VF 1KL7A 4N9QA 3SD7A 3AI2A 2Y9MB 3D3WB 1JDJA 2G70A 3QFHA 4BQEA 1ISGA 3ADDA 5CDFA 3KP1A 4FHEA 3V8BA 5I4CA 2MIIA 4C2BA 4TOIA 2ZJAA 3DHYA 4Q18A 2XB4A 4KXLA 5AVQA 1QIGA 2VJOA 2Y3IA 4R1LA 1O6GA 2Q2VA 3CMCO 3ORHA 1LRKA 3D5QA 3GLIE 3KTAB 5FBKA 3HR4A 2FN4A 1A98A 4MV9A 4H6WA 1O96B 5BYBA 3UK6A 4RGBA 3IOMA 1IHYA 1MX1A 2ZBUA 2UVPB 4ACBA 1IH8A 3E8MA 5BW6B 4E14A 5JI2E 5KOJA 2VHTA 3LFHA 3CEHA 4FDAA 2H07A 3E22A 5LQSA 2X0EA 3UPUA 3K9CA 2HY7A 2PR7A 2DE0X 4E5MA 3PWTA 1U2DC 4ZDWA 1UJ6A 5DM70 4BFZA 2JBAA 2O06A 1TZKA 3GZJA 2QM3A 4YRAA 3A36A 4MUFA 2C20A 2BFPA 4Z0TA 2D5BA 2VHQA 1MGPA 3AUSA 2BEVA 3FJ1A 4UHEA 4ZDIA 4BE9A 1UZAA 4GPZA 4R0NA 4M7PA 3TDNA 5T4EA 1VYHA 3M81A 1OKKA 1DC6A 1NLFA 2ZATA 3IT2A 4U0JA 5F1KA 3TSCA 3W5UA 1RW4A 3CVOA 3GRUA 5IKXA 2P9QA 3PIDA 1R4MB 3JQDA 4UBNA 4CIVA 2E4YA 3LLCA 2XHZA 4IQ0A 5C18A 3T61A 4PZPA 1QH8A 1PNRA 1KNQA 2C96A 3G2JA 3Q10A 1OROA 4MYRA 3RYFA 5DW0A 4EY5A 2ZSUA 3DAOA 2MYNA 4YTEA 2JAOA 2JFNA 1B7GO 1DHTA 4FN5A 3VOTA 4BFUA 1AKVA 1ORVA 2HSGA 1AGNA 2DVMA 3BBLA 4BO9A 4GLFA 3WIUA 3WA6A 2A14A 2C2WA 4NABA 2WWGA 3TN7A 5JS8A 5KDOA 2FFHA 1QK3A 1XMPA 3S68A 1I8TA 2XUKA 3DAGA 4TN5A 4MKGA 3M6AA 1O4VA 3ISVA 1N2EA 3LD9A 3WAGA 2FPXA 3H6HA 4Y9SA 2OPHA 2P8JA 1E9SA 1R0XA 1S2NA 1U1GA 1X7WB 2XCIA 3AFHA 2J8ZA 3ZS9A 4A0QA 2I03A 3NUGA 1Q50A 2GPBA 3LIIA 1X80A 2PO5A 5JPDA 5IK2D 1PGQA 1KE1A 2F8SA 1RBZA 4FI3C 1PQYA 3IJEB 1YVDA 2H16A 3K20A 1YRYE 3O03A 3PXDA 2P2GA 4Q93A 1QH1A 4DDHA 2RCNA 4K26A 1E64A 1OIVA 4L8LA 2PNJA 3OKCA 1DCKA 4OL0A 2VDOB 1TPYA 5IG2A 2Z58A 3AL3A 4I4TB 4JLVA 2DFDA 3FE2A 1DBPA 1SUAA 4PYMA 5GV7A 4J0QA 4A6DA 5AVYA 2VJNA 2BMDA 3M2TA 2OP1A 2EKBA 5CA0F 1H42A 1L7EA 1CBUA 3HB7A 5CDTA 2QJRA 3D6VA 1BE1A 5F7OA 1RT9A 1QVVA 3B5JA 2XNDA 4D8WA 1SOAA 1I6WA 3PKIA 5I8ZA 2ZIZA 4MUHA 5CP8A 3T15A 1EFPB 2C2OA 3TL2A 3U17A 5CNKA 5LMZA 4L8YA 3H8SA 5DNYB 4PLYA 5GONF 1G8MA 1GYRA 2ZJ2A 4P8RA 3AJ9A 3TL6A 3SM3A 3VR0A 2ZE5A 3CLTD 3PDJA 5IAEA 4E09A 4F11A 1N6NA 5F5LA 1IK6A 1P61B 2BSXA 3C43A 3FPBA 3LFUA 1SBNE 2GK4A 4WK2B 4KJXA 4ND4A 2V74B 3T41A 3GEBA 3OTWA 4JXJA 8ADHA 1XZMA 1JJAA 1DNPA 2JBHA 1ISIA 2WTEA 1T35A 2UYQA 1LBQA 2X3UA 2R1ZA 3NHRA 4LHWA 1M8GA 2C94A 5LKRA 3KYCA 4M9UA 4D3XA 1EK2A 3B1FA 2ZT5A 1B26A 3ISJA 4N01A 1G8JA 4N49A 3GRKA 2YVUA 3ZQJA 2GEBA 4HJXA 5C1OA 3G5LA 2BHTA 4KPEC 1JFFA 1W4CA 1ORWA 3E9ZA 5DGTA 5IVKA 9MHTA 2F64A 3KM0A 1P3DA 4I55B 1LK0A 4RTJA 5LJIA 1IEWA 1YNSA 3EPPA 5CR9A 3ZGYA 3N2GB 2HBQA 3DUFB 1V39A 4H4DA 3ZJVA 4HI0E 1E96A 3QMWA 1TM2A 1Y82A 5EWJB 2CLCX 4BE4A 1VE5A 5LXTF 1UEJA 1JEYB 1LC0A 2WSSD 5F4BA 2I76A 4D5GA 2F1IA 4NQRA 4EB3A 2P9CA 2O8CA 5J4KA 5JMWA 1C9NA 1Z38A 5D1HA 2AYXA 4PR0A 4B2PA 3LUPA 3WBFA 3EMBA 4FSDA 3B38A 3H4IA 4N0EA 2Q29A 4Q3EA 2IP2A 3TTSA 4B6FA 4F56A 5LD2B 1QO0A 2SNIE 2PUFA 1U9YA 1ZI9A 4ZODA 1A9PA 1NWCA 1YAJA 1RYBA 4OF4A 1G55A 4IAOA 4IVRA 4WK4B 3ZWAA 1IULA 2QQ5A 3NYWA 4CI0B 3MIIA 3ZV5A 4ZVSA 2TRSB 5HKOA 2HGZA 3IA7A 3OQPA 1Q84A 1UANA 2CXUA 3FB1A 4EW6A 3L8MA 1EPUA 1XDSA 2IXEA 2XCUA 3DKPA 5CNMA 1RI1A 1I2CA 1VPTA 1ZU4A 5KVQA 2HL6A 3X3HA 2PS3A 3RHZA 1ECLA 2Z2XA 4DIKA 4YUYA 3L7JA 5DO9A 3C6KA 4BP3A 1UEXC 1FCJA 1EE2A 3TOSA 1XNGA 4UEKA 2V6MA 2ZJ8A 4HWPA 4NCBA 4I4IA 3VSEA 2J4FA 4JJ6A 2FEKA 2BMEA 1I33A 1LPNA 4CEHA 1B6TA 2EP5A 3L49A 3O84A 4G9BA 5KCMA 4RCYA 2ETXA 1CUCA 3QQ5A 1ULUA 1SU8A 5H3HA 3LT0A 2Y27A 3BB1A 1NV9A 3K4HA 4NYMQ 3O2NA 2CZGA 2G06A 1BW9A 1AC5A 1TJ4A 2D2XA 2JB9A 2JZNA 3H0KA 5EKTA 1Z0AA 4AXXA 3EXFB 2WY2D 4PR3A 4EARA 5JCOA 5U1PA 1XPRA 2PV0A 5F9FA 3ZK7A 2ZI4A 3AI1A 3BL5A 3E4DA 4R40A 4KYUA 4UE2A 4YR9A 4YY3B 4RVSA 4ZVPA 3OZTA 3SBOA 1RHJA 3MWJA 4H7IA 2HB6A 3EWSA 3LFTA 3BJMA 5D5HA 1A97A 1FU4A 1P6UA 2G5CA 3FPSA 3H1AA 3OWOA 5AP9A 1K5PA 4WE3A 4HFMA 4IV0A 4UUMA 3UJ8A 5AUPB 4EAQA 3NX4A 2VAWA 4FBGA 4OGKA 4CYMA 3HXOA 3MWEB 2RFLA 4ZN6A 1V11A 3LA8A 4D45A 6LDHA 4G6ZA 2GCGA 4JBNA 2LUOA 2XDQA 1LSOA 3FPGA 2D06A 3OTOB 4BNUA 1M33A 1HG0A 2PX3A 3HFJA 4N7JA 3EGDA 3QE3A 2HMWA 4LJRA 1QFJA 3WRXA 3LU1A 4JC5A 1XF1A 3AEUB 4F0JA 5IJ0B 3TRFA 3U4QA 1T9CA 1KJJA 4IGEA 4YJGA 2EJWA 4NC9A 1FRNA 3DOOA 4G0OA 2CVHA 3K09A 1ZGJA 2J7PA 3LY7A 4H6XA 3TKAA 5JNUA 2QR5A 3IBGA 3UV6A 2PUBA 2Q5CA 1N2CE 1DINA 1WLSA 4XR4A 3E58A 1AH2A 4XLLA 2V3WA 2RAUA 2WTAA 3K73O 4MTLA 4ARSA 4QUKA 1QRSA 4GMGA 3QJ5A 5HDQA 2JGEA 2BSQA 2FN7A 2ONCA 5KQGA 5K0CA 5K6TA 2EVWX 3EVAA 3KV1A 3OG9A 1DIAA 1II8B 1OXXK 3T7KA 4GSKA 3J80A 2GPTA 5EYPB 8LDHA 1FQOA 4V0OA 1U2ZA 5E3HA 4BX8A 1LW7A 4HO1X 5CCXA 3ZXXA 3JASB 2ZETA 4HYEA 4BNYA 2H5IA 1LBHA 4W6QA 3IAM1 4LXQA 2O0HA 3KQNA 5F12A 3JZDA 5KU7A 1KY2A 2O7QA 3UYKA 5BQPA 4OQ4A 4DM4A 3ZV4A 1ZLXA 3KELA 3JU3A 3QXGA 3TQSA 4PAWA 4FFVA 3PPIA 3DEHA 5FNZA 3H1BA 4WZBE 5ALDA 4M3NA 3D8UA 1NFRA 1GQOA 1JMKC 4NWIA 4AMGA 5IP5A 4RUKA 3M3DA 2FB9A 3BWMA 4O4LA 4EBFA 2XQGA 3CLRC 1PQ4A 2HA3A 3VTZA 4CL3A 5F52A 5CFLA 3EXEB 1L8LA 3ZEIA 2CV1A 3DC2A 4UQLA 1EXMA 3IQXA 4JSYA 2FWMX 4Q9KA 4UAGA 1KR2A 5EE1A 5A3SA 4DDMA 1DKQA 2HHJA 1I30A 1QP8A 1S8FA 1RAHA 2BGUA 3LRXA 4I4LA 5LD2C 1EX6A 2XUQA 4PANA 2Z1NA 2FFRA 3AEKA 3OOWA 4KK4A 1ZBDA 4MQEA 4YAFA 3T99A 4AJLA 1VYUA 2DULA 2PXHA 1R6UA 2D2EA 1CRPA 1W35A 5LOVB 3DEJA 1Z08A 3FYUB 3UC5A 1NBHA 3CZQA 1Q0QA 3N76A 1SQGA 4LOJA 1ZD8A 1N57A 1XZDA 5JAIA 4GH5A 4LFBB 2R96A 3NALA 1ELOA 4KLRA 1PT9A 4L51A 4QWMA 1F4LA 2IIVA 4US0R 3TB6A 1T8SA 2VL7A 3P0RA 3GV0A 5EI5A 4P2GA 3K32A 4TROA 3ZCRA 2Q1TA 3KETA 2A5LA 5AOBA 2M32A 5THQA 3MQ4A 4OB7A 5C4GB 4DBLC 1WXIA 3J81k 3ZU5A 4GE0A 2FPLA 5EWMB 4OQEA 4N3GA 5F5NA 2IPAB 3WFJA 1S9HA 3CRMA 1WZEA 4C6RA 1HDCA 1N3IA 1F0PA 1V7CA 1VTKA 2EBFX 3NGMA 4I50F 4LV8B 4FNAA 5BVGA 1V1MA 2F8MA 3L0SA 1EFKA 3ME5A 3TRKA 1FK8A 2IDMA 4G0UA 2PBRA 4Q3DA 2I2CA 1E2QA 2OZLA 5EMKA 3DLTA 1IZ9A 3JXEA 4PG5A 2AXPA 2KLHA 3OJFA 4RW0A 1PEKE 1B4DA 1Y33E 3K94A 4C43A 4AKTA 4GU5A 4JHXA 2F2TA 3B1YA 1I3KA 1J9ZA 2BFFA 4KN9S 3T9CA 1FJGB 5KYYA 2GK6A 3PEYA 4A8JB 2PA0A 1PR0A 2BHRA 2IU6A 3N0WA 4F2GA 4FYJA 4IV5A 4HFRA 2EV9A 3UWKA 2G6BA 1R5BA 1QKIA 1FFCA 2AUNA 3P9ZA 1PKXA 5FPPA 5JV5A 2BBTA 2BZSA 1W46A 1WU7A 2H8GA 4TTIA 3MLBA 1VHDA 3FSJX 1Q21A 2UYOA 3H2BA 3W5SA 3LWDA 4PLZA 4K9LA 2AOTB 1YMVA 2YFQA 1V3VA 2YS6A 3P9RA 1YA4A 4HKTA 4TTAA 3LHFA 4FLMA 5AQEA 5CIYA 4MW2A 2X6RA 3BXEA 2COEA 1BEZA 2LR0A 4ZHQA 4X92A 4RHYA 3GLFE 4KXQA 2NW6A 4PFQA 5I7SA 2FHSA 1MB3A 4JHLA 4UUBA 4IYJA 4WBXC 2NP6A 3NWBA 2HJGA 2HSWA 4KSCA 1AB6A 1IRIA 1WQ1R 3FAKA 5G4KA 1UJ2A 1UDCA 2R00A 5I8PA 1IUNA 3S2YA 3D4OA 1JAZA 1G8HA 1QGAA 2J5RA 4HNAA 1W5EA 3MJCA 1FE8A 2VTVA 4INZA 5KSOA 3T1TA 1FFXB 2EZTA 2IEDA 1ULAA 3PYLA 1RWKA 1QLWA 4Q24A 3IV9A 4H60A 1KQ3A 2CWDA 4HNRA 2CXTA 1DXYA 2YL2A 4HMPA 1RLOA 3OM9A 1OV4A 1YJ8A 5K09A 5K45A 3MT9A 1L6IA 1B6RA 3WLMA 1TD9A 3RQSA 4D9HA 3MJEA 4JC4A 1DPFA 3MC1A 1IFXA 2L0XA 2HA4A 3DS8A 1JJVA 4C0AC 3BQ9A 3CVUA 3BZUA 1WUTA 2NZUG 4YONB 2CMGA 3GVCA 2GB4A 4Q7QA 2FSVC 2CXXA 3QKTA 2CV2A 2GPYA 3P26A 2IS6A 2R9VA 1UAGA 3N8HA 1XP5A 3D2BA 2A1IA 4MZDA 1KSGA 2P62A 3S3TA 3WJAA 3OZGA 1C80A 1JSCA 3V9AA 4C7KA 4E6EA 1KWGA 4FSXA 5ANRB 5ERYA 1WW8A 4DLBA 3W8FA 3H6KA 5M04A 2RK6A 3ROPA 1EU1A 1YJQA 1DAPA 1ZSYA 2XUOA 4KWTA 3PXXA 5JARA 4LUCA 1P5RA 4AK9A 1G98A 3U31A 3ZZNA 2ZRNA 1PEAA 1IC6A 4IJ6A 3WYEA 1LLCA 3NHYA 4TRJA 4RZ2A 1JWLA 2L82A 2UYGA 2NO6A 3R7DA 1RTKA 1NJ6A 2ADMA 1DIGA 2JGKA 2ZQYA 3Q0EA 3QPBA 3D1JA 5KNCA 3M4JA 3KLNA 1ZA2A 3NAGA 1NW4A 4Q03A 5KJEA 2KS6A 4BNMA 4BL5A 4V0SA 4CETA 2B4TO 2QL5A 2FOIA 2ZTSA 1TI7A 1RC8A 2CUZA 2FUKA 2I33A 3L04A 1UK9A 3SYLA 3X1MA 2YX1A 3QIVA 2Q8PA 4A6EA 5B7GA 2UXDB 2YMPA 4H3HB 4W82A 3QWHA 2H2GA 3PCRB 2HF9A 5J5AA 4EYOA 1S96A 4HB4A 8GPBA 4BKQA 3HA5A 2FZEA 2Q6KA 1JJIA 2I3ZA 2ZJYA 3O1IC 4MARA 4P1ZA 4CKXA 3ONWA 2J08A 1VRWA 1US8B 2VWHA 1TAQA 3DB1A 4ZCLA 2WP8J 2COKA 3TX6A 4INOA 1NVVQ 4PO3X 5EP1A 1QF7A 2J3KA 2W4QA 1J5EB 1KMCA 3ICOA 3BOSA 3EAGA 3QK7A 1WSDA 5AVTA 4CTJA 1IYZA 1K3TA 1CLEA 1KSJA 2JGDA 3NIFB 5CLFA 3DCIA 3BDIA 3PSHA 5IZCA 2XECA 3UFXB 3RC1A 3PF8A 5C8YA 4RY8A 4U7JA 1L2TA 5DX0A 2JEOA 1PSDA 2PGNA 2Q9AA 3D6MA 3DBRB 2C7PA 2QPTA 2AWNA 3QVGA 2W6JD 2NTJA 3P45A 2X4IA 3VOBA 1BEEA 4HAUA 1IM2A 1AQLA 4UDYX 4I66A 2XE7A 2DY1A 1MB4A 4BCCA 5J4HA 3U3OA 2W7TA 4D3DA 5KYWA 5DBGA 4RZUA 4Y2RA 1RWMA 3GLIA 3V4PB 3AY0A 3M1AA 4RK0A 2ZBPA 4ZYWA 1IBLB 4EB6A 1SR8A 1THZA 1XJWA 2EYQA 2ZIVB 3IJRA 4OSEA 2CHFA 1ZH4A 2ZB8A 1QHYA 3WR5A 5KYXA 3ZDDA 2YXBA 3KXDA 3ANLA 4HNHA 3WJ7A 1EUYA 1XEXB 4NBNA 5THXA 4BKUA 1IM5A 4CU5A 2QGFA 4JBLA 1KYZA 4FC7A 2XX3A 2CFCA 3DA8A 1A95A 3OCWA 1P17A 3PR3A 3CX4A 4YAGA 4YV7A 4ZI7B 2IHJA 1ST3A 3FOFC 1CUXA 1CUHA 4LYAA 2PIDA 4OAQA 5CLGA 2Z5LA 3KKZA 3ZKWB 4M8SA 1H6BA 4XD2A 2I65A 5B3KA 5REQA 5ITVA 2D3TA 3O2SB 1DJMA 3FSEA 2XMZA 4GMXA 2OHOA 4NHEA 2O0MA 3QVXA 1PJQA 3ELWA 2GF2A 3BHIA 1SAYA 3ETEA 3I6YA 1T9HA 3OOSA 3VVCA 2JGAA 3WQHA 2JRCA 3OMXA 1O8CA 3IO5A 4O2AB 1POWA 2DERA 2BHLA 1M5RA 1OYYA 3SZLA 4H16A 3CCFA 2PUTA 1EUCA 2WILA 4Q5IA 3NHKA 1JLHA 1JDUA 1S4QA 3IURA 4O4IF 3ZWKA 3NOVA 4F3NA 3IP9A 3LC1O 1NNEA 5CM9C 1ND6A 1U2EA 3MN1A 4O4HA 3HGMA 2O14A 3I1IA 4BFSA 2HT1A 1MNQA 1XBTA 4OYRA 3QV1A 4AD8A 5FUMA 3SS8A 2WDPA 3QXCA 1MDFA 5IDYA 3SC2A 5GIOE 2O8FB 4I1OA 1XDDA 4DJDC 2ZBRA 2J5XA 3AM5A 3QLEA 4V0ME 1MF7A 2HWYA 1PK7A 1XZEA 3S1AA 3ZWBA 4MIOA 2Q0QA 5KKAA 4K28A 1VG1A 1VSVA 3C3MA 3U7QA 5K05A 1I7PA 1OWPA 1MAUA 2I54A 2WZBA 2YRWA 1JHOA 1OXKB 1B00A 2C97A 3EVEA 3B82A 3KYBA 4A92A 5ALEA 3I5AA 3EGXA 2IQ5A 2WFLA 2Y1LA 3KKMA 4M60A 1BH6A 1ZN9A 2BD0A 3Q87B 4RVOA 4ZHQB 3TZLA 5A02A 5JXWA 4FNGA 2HCRA 3ZBQA 4FNMA 4DNOA 2X8LA 4ZWNA 1EX9A 2P5TB 3PRJA 2Y1OA 2Z09A 5C31A 3S8MA 1CJTC 4LC1A 2YYYA 1MIOA 1G6OA 3QVJA 3JWEA 4J94A 5GZ6A 4KSBA 2P6OA 5HQJA 5KHAA 5G4KB 4C2AA 3COZA 1KBZA 1LFAA 3OBIA 5EERA 3D2LA 4ZOLF 1NUQA 2PUHA 1CUAA 3G1WA 5L3RA 3SEZA 4N3AA 1KRXA 1F17A 1NJGA 3LZCA 5KYKA 1W4ZA 5FKJA 4HXYA 2JGJA 1UDRA 1GGFA 3MGGA 1XHLA 4BN5A 3DTYA 2D1SA 3BAZA 3NPAA 1YU9A 5TX7A 2XY4A 2VNKA 5I7HA 5K8VA 2YYZA 4UTRA 3ANYB 1U5BA 2HFJA 5THKA 2QG6A 4RA6A 1JG3A 1JKFA 3THRA 2XIQA 1JB1A 2BUBA 2B7CA 3G1TA 3GVIA 3QQPA 4HSGA 4J1QA 3HZZA 4RJKA 1VHWA 2HMAA 2OCKA 2RHGB 2FR8A 2GX6A 3RS9A 3BH7A 3JYQA 4GIBA 4WERA 1XIVA 4K6MA 4Q00A 3QFSA 1L5ZA 4RF5A 3FSGA 4NG4A 3L4EA 1KDOA 5BNWA 4GP6A 1T5DX 1L5NA 4Y1FA 5CNIA 2RC6A 1QYCA 5E1OA 5B58T 1QRDA 4MQLA 4YEDA 4AG3A 4IWYA 4BB9A 1AUQA 4QBIA 3RFFA 2QAGB 4MHSA 4E5VA 4PQYA 1UM9B 5KJFA 3ZVMA 4WCFB 4CWAA 1PJCA 3KEMA 4YRPA 1WPXA 2R8ZA 3QOYA 4H77A 2MSLA 2R6AA 2DB3A 1CZKA 1UPUA 2ZWAA 3SJ7A 1U28A 1ZMXA 3P20A 4LRTB 4OQZA 4ARVA 1IUKA 5CCEA 3TOCA 2IY8A 1YB6A 2OEPA 1KI7A 3GT3A 1E9DA 1CUJA 1R0YA 4J1TC 4ZAFA 3RVRA 5HIIA 3WDKA 4YMGA 1ZUWA 1ZY2A 2HQSA 5C5DA 1NUSA 4D25A 2IPLA 1MJNA 4QD3A 1I7SB 1IN7A 5A4MS 3VKGA 2VJMB 3FF1A 2AR9A 1QDEA 4C0SA 1TEXA 4NU5A 4QYMA 1TTPB 3BK7A 4PN7A 1FLNA 2FSFA 1CQWA 3NC4A 3I2HA 1C30B 1R18A 2VPTA 1JPJA 2ZRLA 3B6KA 3RIXA 1G16A 1KI1A 3WB2A 3WMGA 4BASA 2IIPA 3HUEA 1R66A 5CVEA 5HCIA 1KAQA 4YIHA 2BGIA 3G0IA 5D3ZA 3OEEA 3ZC3A 10MHA 1CUYA 3JQAB 1S89A 1O95A 2FZKA 2XYVA 4GRAA 1RPJA 1IHUA 2GO1A 3JQQA 4L15A 4YAUA 1EM6A 4C7BA 1E9VA 1BDJA 4ZVTA 1WX1A 3AY6A 4JJ7A 5C8VA 3AX6A 4Q82A 1BN7A 1J0AA 1XKTA 2ZIUB 1CWUA 1TK3A 2A5GA 3DFZA 3OX2A 3EBPA 4MCJA 4NDNE 3RWBA 5TF4A 2RAPA 2J3EA 1UT8A 1W6RA 2V4UA 1R50A 3LA6A 4K9MA 1XFAA 4YGXB 2A3NA 2O07A 4D9IA 4GI5A 3QE4A 2QMQA 1P2FA 4ME6A 2QRPA 5SYAA 4ZVLA 1C0KA 2YDYA 1W29A 3QW4B 2NLOA 4L4UA 3TLXA 1PFGA 3PEWA 2VBFA 3Q0IA 4TT3A 3ABSB 3TLBA 2C4WA 3T9DA 5C5IA 1GGKA 2IEZA 3H9UA 1MJHA 2F6RA 1LGYA 1D7OA 3CGGA 2QLNA 3LQ4A 4MV5A 4Q9LA 1YS2X 1NYQA 1KFBB 3DEIA 4FT4A 4KFSA 2HGSA 1ZKMA 4WXHA 4OP3A 4RD0A 1XFDA 1R0BA 5GAJA 3VH2A 1YJAA 3ZGXA 2D1RA 4N1AA 4CM6A 1PV4A 2AMFA 2NXEA 4KUGA 4UOQA 4QTUB 4HVCA 1T2DA 2A5YB 2JIOA 2PLRA 2ZI3A 3HA3A 1K3UB 2GTIA 5D8DA 5DWQA 1QG2A 3B70A 4A8TA 3ZHOA 3G2OA 4G1CA 4FU0A 1M2EA 1EINA 1HLDA 5GOTA 2VPQA 2WJJA 4XWOA 2YXPX 1YS4A 3DC7A 4FSHA 2BR4A 2PL5A 1JHZA 1GHTA 2C07A 4UZFA 3HRKA 3BQMB 2G9VA 4ARBA 1H4SA 2ZI6A 3DMRA 3PCXA 3AB8A 2JA1A 4R16A 2E55A 4RFSA 4XXHA 4Q9IA 3RAGA 5IVDA 1TVEA 2NAFA 1GJRA 4F38A 4FD3A 3W6OA 3U4HA 4DZRA 1NPTO 3THXB 1OAKA 2WM2A 4LI0A 3PUWA 3TLMA 2IHVA 3WHPA 3EVDA 3VVBA 5FWXA 4ADSG 1FVHA 2ZUEA 4PLPA 4IKOA 2LCFA 3UPTA 2PMFA 2ZUSA 3FWKA 4P5PA 2AFVA 1H9AA 2VI5A 1LH0A 2W4IA 4MDYA 1SCJA 3E61A 1NF9A 1QORA 3E4CA 4Y2SA 5AJYA 5A1TA 4ZI7F 1Z6ZA 4YMWA 1T1EA 2EF1A 1XWFA 4BEWA 3A6PC 3O8BA 3UXYA 2QE6A 5FPQA 2ORVA 1N2CA 2FZGA 2GGSA 5ALQA 5I6DA 3JRNA 4M0FA 1OFHA 2EKPA 1NMYA 4AO6A 5ICSA 3FVVA 5MHTA 1MGOA 4P7BA 4WEOA 1DL5A 5TT1A 3BL8A 2JI9A 3I58A 4X7PA 1NI3A 1GUDA 2RGWA 2PJRA 4KOAA 1XQ1A 3U7JA 3DTVA 4L2IB 1O77A 2G9RA 2FEXA 2NXJA 2WJ4A 3BM5A 3G0OA 1OGJA 2PFKA 3DVQX 2I6FA 2PPLA 1P77A 3TM4A 3PRYA 4OBXA 1PSZA 2HI0A 4YCCA 1A71A 1X86B 3W90A 3FCCA 5AK0A 3UYLA 2AG8A 4LX8A 1W5TA 2AEEA 4QG3A 4DV1B 1UKCA 4FWBA 1RAGA 4O4JF 4GKKB 5ULLA 1H0RA 1XKQA 1KI6A 4LKOA 5AO9A 3FCXA 1C0LA 3IXMA 2O48X 4EJSA 1ESEA 1SVMA 3M9XA 3DE2X 4RKRA 4YWJA 1GFIA 3H0EA 3WNVA 1ACLA 4LMAA 5B7PA 4RDXA 4WZBA 2MR5A 2GN0A 2P1ZA 4A2PA 3DOJA 1U1IA 1X1RA 3UKOA 2HU8A 4F91B 3ZZTA 3F73A 3V7UA 3EWNA 4LFCB 4K0RA 2V7XA 4NMHA 4HT3B 3RRBA 1LCIA 3IBFA 2D7JA 2GT1A 2JAXA 4P38A 4X0EA 4L0DA 3U9SA 2GJ8A 2EBWA 2P11A 3EZ6A 4OOEA 3T52A 2ECQA 4YNBA 5AK5A 4UMEA 2QTFA 4HUQA 2ONKA 2BE9A 2Q21A 2HMSA 2F3UA 2NZ2A 3BMQA 2RKWA 3DP7A 4R9SA 1X3SA 1YOVB 4Z6KA 4DLWA 3ZJ5A 3WP1B 5JY6A 4F12A 5KSZA 1QQAA 2PH7A 3MWYW 2NXNA 3NVAA 1PLLA 2QN1A 4G1VA 4MRNA 1T9ZA 1QH0A 3HBJA 3UAXA 2O59A 4FKMA 1Z5ZA 3AZOA 2X7JA 4IUBS 1MDBA 1IVSA 2H7CA 5KWEA 3N58A 3I37X 2Q49A 5K8TA 4TKUA 3WQBA 1HBJA 1QQ6A 1TCVA 3QMVA 3VPXA 5B4VA 3R3WA 4ISCA 1LNQA 4XAQA 3VU0A 1RBQA 2BTEA 2I1LA 1HXHA 4TZTA 1RXWA 2D74A 1ATIA 4Z4CA 5I9SA 1MV8A 1PZHA 1VL8A 2JJ2A 3FKSA 5CG2A 5A0TA 3VGJA 1KMQA 4QJBA 1QSGA 2Q3LA 3WSVA 4AN0A 4J03A 3CVJA 4DJAA 1QZ3A 2XEXA 4I9NA 3F8TA 3HCWA 4XCVA 3EC7A 2Q6LA 1ETUA 1XQ9A 3IAXA 1OWLA 3AERA 3DPSA 1E2EA 2H4HA 4NMWA 3H18A 3W77A 4XIGS 1T0IA 2CMKA 2VZLA 4L50A 3WL3A 1XLTC 1ZCZA 4NU0A 3VI4B 3HCOA 4CTMA 4QO7A 3P27A 4CDGA 2CWWA 4JYMA 5TDHA 1F5NA 4EI2A 4MR8A 1E60A 5TLSA 3D7SA 1RNLA 2DQSA 4TTSA 1C4XA 4LHZA 2B8WA 3HADA 4KHZA 5EE5B 3AFOA 2A7QA 1I2ZA 3DGFC 3GJQA 3KR9A 3MOGA 3Q15C 1MQSA 1ZM7A 3DKVA 4QRDA 3WKEA 4AZVA 3F90A 1YR2A 1U0NA 5ENDA 2ONYA 4H7EA 1DRKA 2Y0CA 4MLZA 4BKRA 5CM2Z 3JV7A 3DV0B 5AKLA 1TU3A 5ED0A 1VDZA 3R24A 5JATA 2GVNA 4MMZB 4NR0A 5DM2A 4BVHA 3AJAA 2J6CA 1KEUA 2O52A 3AVPA 5BMOA 2PH3A 5HP4A 4A6XA 3H5WA 3L6RA 1JKJB 4GLOA 1G21E 3QLVA 1OMOA 4FDLA 4BV9A 1KOLA 3SKYA 1EGMB 1KEEA 1T0HB 2XZLA 1ZU5A 1EVKA 4KG7A 5HTKA 1SKMA 4BZXA 3GLFA 1SZPA 4KUEA 3UWPA 2G1PA 3EH2A 1N8TA 1H3FA 2I29A 4KGXA 3S2SA 3JQAD 9LDTA 3GLUA 1IQ0A 1R15A 1Y42X 1EJ6A 4CKYA 3Q11A 2IV3A 5EXSA 3TD6A 1T8RA 1RYFA 5EFOA 3BFKA 3OI7A 2IQIA 4AQ7A 4YRCA 2ZIFA 1WMSA 1TF5A 5C7YA 2IS4A 4LWZA 4JJGA 4CT4B 2ZBVA 2BIFA 3K9NA 4IMJB 3IE2A 1N78A 2W11A 3G8YA 1TNDA 3U4DA 1E3TA 1XJQA 1C7ZA 2NU7B 3LLVA 3NWPA 3C7TA 3OOEA 2XUGA 5EVJA 5JDCC 3PWKA 1P7VA 2PWYA 4GVPA 5D00A 4OXQA 4ZYUA 2FLKA 1Q1EA 3RVQA 3UK0A 4M0KA 1UKYA 1QU3A 3MXTA 2CBGA 1DWPA 5EPOA 2O23A 1D2RA 1DVRA 5KREA 4GEGA 5JZSA 3EF0A 4LF8B 2X23A 1RQLA 4JLNA 5GPBA 2M6SA 3VR2A 1SXQA 2AUTA 3WGMA 1X6VA 1M0TA 4S0ZA 4AS1A 4KBFA 2PH1A 2Z8YA 2F59A 1MXFA 3CBQA 4OL9A 3RSLA 1XC7A 3P97A 4LE0A 3UJ3X 2KB0A 2PU5A 1PR9A 2NU6A 3JARB 5I9TA 3UGQA 1KYWA 1TA4A 3R0XA 4ND6A 2GBIA 2RGRA 3RC8A 5EEGA 2XWSA 2EKLA 1FU8A 2YFYA 2TECE 3C1AA 4AJNA 2H2AA 3GLKA 1T0UA 4F8EA 1QPBA 4KMRA 1H4QA 2G40A 4BMYA 2ORED 2RGNA 3EAFA 1AVTA 1K6JA 4I7EA 1P72A 3G9UA 4B4VA 5BQOA 4RPLA 3L7NA 2XVYA 2QW0X 5LL6P 1G8GA 5AJVB 2KW5A 4YQZA 3L01A 4QA9A 5DXAA 5TQ0A 3QPUA 3AYXB 3RAEC 4MB2A 2AEJA 3MILA 1PZMA 4GNKA 1V9CA 1X19A 2QXUA 1OPXA 3HA7A 4N5HX 4OKIA 5A5DA 4MQFB 4R84A 2IJGX 3C45A 4OJYA 1Q74A 2X13A 4PO8A 5KTMA 2XMGA 1JPNA 1MU0A 1NFQA 5JU6A 1ES9A 3HVJA 1ZG3A 2W8BB 3PUIA 1ONOA 1KI6B 4M55A 1I2BA 1QM5A 4N5MA 3RFVA 4KO2S 5FL3A 4DBZA 3IS3A 1U0OC 4UDOA 1T13A 2CLMB 2X5JO 4GGMX 2AZ4A 1W88B 2PXCA 1E3QA 4MIYA 3U7EB 4IR7A 3P0JA 5UKDA 3O9VA 4AQDA 5DJ5A 4BFWA 4KNVA 5CT4A 2E1PA 4XM2A 2JC3A 1OIWA 2Q1XA 4Q1VA 1U9IA 1JGTA 3D4IA 4PCAA 5HKKD 2R6GA 3M6XA 4ZI3A 1QQBA 1I4TD 6YASA 4S05A 2V0GA 2HTEA 2P2CA 2OHVA 3HDTA 2XWJI 1M0SA 3ZI4A 1D2EA 3BORA 1S02A 4KQWA 4TV8B 1U3GA 2PQ2A 1DC3A 4F4IA 3LHIA 3FGNA 1KJNA 5LLTA 3UJCA 2DBYA 3N05A 3M33A 1T5LA 1W85B 1PJ4A 3H9QA 4ZVNA 1I24A 1HI9A 4TX1A 5COQA 4L5CA 3W5HA 3I2YX 1WBJB 1LS6A 4B4KA 3DV9A 5IJZA 2HPHA 4X60A 3BD8A 3VJKA 4PYLA 4J8PA 4OUKX 3FWNA 4BMZA 2ONJA 4ZQCB 1SZDA 3V80A 1DGQA 1B8OA 3F2IA 3LBYA 3VJMA 1KPIA 2VHJA 1NVGA 2Z43A 4H18A 3F4BA 4GFDA 1EFTA 3ZNPA 2AE2A 5ICFA 1QR6A 1J6UA 5C3MA 1UZMA 3OJCA 3VR4D 3KZKA 3MJHA 5T57A 4OBWA 2HNBA 4ID9A 1GARA 1RRFA 3THYB 1I5RA 1OX6A 4DQDA 2OOKA 4FDTA 3O4IA 1Q3TA 4Q48A 1HE5A 3TNLA 1NVXQ 2YIDA 1TMYA 1B73A 4QSMA 1ZM3A 4R6XA 3QUBA 4QJ3A 3G82C 5G41A 1M2VB 1EESA 3HVUA 4JENA 3BXOA 4C0LA 3A4TA 1I7LA 2YV5A 2CVOA 1LLQA 1CUSA 1XAJA 2FMXA 2ZSDA 5AWFC 1U0SY 2CFIA 2YW9A 4NHOA 4YRNA 3DYIA 1GZ4A 1VFPA 2PZLA 1W87A 5J63A 3RTGA 4KR3A 1RHKA 4RO0A 5HKAA 4DRXA 1HNNA 4GMFA 1JQ3A 3DEAA 3GAFA 4FE7A 1DTWA 3HCFA 1A2OA 3I23A 1PJBA 1L8OA 2VUTA 3T12A 3WKAA 3F49S 2J4DA 3Q9UA 2RMKA 3P9SA 4NMMA 4QNRA 2DWCA 4V0MA 2N1BA 4X45A 5LUBA 4AS3A 2HADA 4PIMA 2OV2A 2WJHA 1ZCAA 4HWTA 2C2GA 2QD5A 1NY5A 2P0YA 2R7KA 2JI7A 2HMVA 3BIOA 3PJGA 4GSYA 4QOSA 1GGMA 3LUBA 5I9BA 2CVPA 2ZB7A 3PNYA 1ESMA 1XZQA 3ZBPA 3HB5X 1Q22A 4EUKA 1YCHA 1KFEB 3UCXA 5LP6A 1NRJB 4DCUA 1YR1A 3CLHA 3DOFA 3DONA 3OE7D 4GI2A 5F1PA 5G3ZA 3W5JA 1WCV1 3W2FA 2XJ9A 1ZUHA 5EPEA 4PRYA 3VV2A 2I6SA 3PHGA 5JWOA 3WYAA 3W9SA 5I3ZA 4QBKA 4O2RA 4OUDA 4CCYB 3MTGA 2F9MA 1R8JA 5K0TA 1PR2A 3VR6D 2JRLA 1DELA 1XVVA 1BXZA 2C5LA 4IOLA 4KDEA 4JFRA 2I9KA 1PIWA 3TZ6A 4J3FA 3EN0A 4X24A 2QMEA 3C5WP 3HKDA 1X2BA 3HBAA 3E9YA 3NXKA 3O8QA 4IVQA 4N39A 2HA0A 4QQNA 5B3JA 2R48A 5B1IA 4NPHA 4G0ZA 3A1VA 5T4FA 1ZUNB 4ZCPA 4Q4AB 1M9NA 2A94A 1M8JA 2G28A 1GWNA 2YHIB 3K2EA 1UL1X 1YC5A 2K2WA 4KMSA 4NENB 1T9BA 4PBRA 3ZKAA 4C3ZA 3Q40A 4D8VA 2WG2A 4M4SA 3RV4A 5HKBA 1JU4A 1NP3A 4LNAA 1EIWA 4WKGA 4TLLB 1AHNA 1FDUA 1UZLA 2FPGA 4CDMA 3ECAA 4FS8A 4XR9A 3G0DA 1T15A 2ZQ5A 1G5PA 1JKMA 4MR7A 2JIRA 1FF9A 3RT7A 3PK0A 4PTZA 3KEFA 4LOAA 1T4CA 2HJSA 4NONA 4EI9A 3RNLA 3EARA 4F93B 5I9NA 3LUCA 2E5LB 4GXNA 2BTOA 2GTPA 4HMQA 4ZT3A 1Q1AA 4R9RA 1XF9A 1E9CA 5ARBA 3FHCB 4RLQA 1JEQA 2IUSA 3ELYA 1KQFA 5AW3A 3GJ8A 5E1MA 4O1HA 1VL1A 2JDIA 1NBMD 3DL2A 4JI8B 3BXGA 1MX3A 2B9VA 2BJHA 3WDMA 3AVOA 5AOVA 3T3GA 3HE3A 2MINB 2HMUA 3GJ5A 4KYIB 4BMDA 3FR7A 3FTDA 4QEZA 5KNDH 2QZ9A 2OBNA 1EUQA 1XVIA 3MERA 4LJ9A 2YCLA 1BXGA 3H11A 1VBNA 3GJRA 3Q3JB 1C2YA 5IM5A 2XE6A 1JHAA 4IIYA 1RHRA 4B6GA 1Y3BE 2OM2A 5FOUA 4GKAA 4XX0B 2FWRA 2JJMA 5ALVA 1IJEA 3HNOA 1P18A 1DJOA 3IPCA 2C8KA 3QIAA 4JLAA 3BDVA 2CD7A 3GRAA 3P4XA 1I94B 3ZY2A 3F5QA 3O6VA 2WU3A 4UJ3A 3UXEA 2UVQA 1ULBA 1ZICA 2FFJA 3D02A 3L6EA 4NZ9A 1KZGB 1BRMA 5LM3A 1NJ1A 1E8MA 2OFPA 1HQKA 2EIHA 3NBFA 4GPAA 4EYQA 3KEQA 2D1QA 4IIFA 4WY5A 3VU9B 1ISJA 1FNCA 3EYWA 2HLNA 1CYEA 5DN6D 4YJ3A 2WPDA 4IFBA 1YB5A 4CLXA 1F9EA 2JFWA 1E1RD 2BDTA 3K6SA 4KWHA 3HVHA 3RUFA 3TPCA 3D8BA 4ZP1A 3WWEA 1B6GA 2QVBA 4FCWA 1QB8A 1O9HA 3JWHA 1WPGA 1L7NA 1KY4A 4AL4A 1JR3A 3A4MA 2OMEA 1KI3A 2G3YA 2C83A 2WF9A 4K0KB 1UM8A 5E4YA 3KZOA 1OASA 3H0CA 1QIHA 4JJZA 4TSKA 4KQXA 2ZE7A 5CVUA 2FPUA 4BLVA 4HNGA 1AS3A 1II0A 3L79A 2BCJQ 5DM1A 3QW2A 1TIBA 1F1BA 4IH9A 1L4YA 3BRWD 4U7WA 5CURA 2J5BA 3KT8A 3A9SA 1Y1KE 3N0VA 4R5HA 2CDCA 1GZ6A 2BM9A 2E4VA 4BHTA 4UTXA 2IUFA 2EL9A 5FI5A 5B7QA 1SXJA 3B7GA 4RJ2A 2AFIE 1RAFA 3ZWYA 4AJHA 2AB0A 3BUSA 4C4AA 4X63A 2JA2A 4B47A 2I2BA 4MV6A 4DJFC 3TXYA 2BDUA 5CAEA 4X7MA 1HSOA 1YL7A 4RKWA 3C8DA 3CZCA 5D87A 2V98A 4ZYLA 3DWFA 5HGJA 2ZJ1A 1B41A 4WSOA 4D9EA 4D46A 5I4BA 1XPJA 2F1RA 1EK1A 4M0LA 1H69A 2QV7A 5FV7A 1USUA 3QE2A 4POOA 1Q0LA 1OH5A 2OR3A 3A27A 1PN3A 3KSZO 1K98A 2JFXA 3O38A 3UXHA 4PSKA 1WMAA 2QU7A 3RM3A 4YAKA 1AG9A 1ZN8A 2XSZA 5D3MB 1RI2A 3S7ZA 4C20A 3OKAA 2JHAA 4RCZA 1GQRA 1EUDB 2IU4A 3LO5A 3ORSA 4OY3A 1G5RA 3LBAA 2EAUA 3P19A 4O4LF 4RPCA 1M67A 3D4BA 3KU4A 4ZRMA 1J8QA 3GLHA 2Y0EA 2AWOA 4UCFA 4DEYA 4Z7NB 2JAUA 3WKCA 1TIKA 4M88A 1FMLA 4MRAA 3GH3A 3Q8MA 1PT6A 1AN9A 1M54A 4LCEA 3DQPA 1E5LA 1OBCA 3C15C 1BCSA 1ZGCA 3DNFA 3QWIA 4L76A 4TKVA 1K6MA 1OWNA 1QIJA 1T1JA 1Z5PA 3DGEC 3G59A 4XDZA 1AMUA 4QOFA 4G0PA 2R8EA 1P1JA 1K9SA 2WAMA 3K2IA 3O9MA 4L4XA 3FBGA 1H2EA 1XEWX 5IBCA 1E3MA 1G17A 3T8YA 1XTIA 2H51A 3MUFA 4GDMA 1BWQA 3GFQA 1DG1G 1YWGO 1E7QA 4QT0A 4F46A 1ODJA 2FP4B 2Q5EA 1ND5A 3B1WA 1KH3A 2IPOA 4WVLA 2GZMA 5FD8A 3SXPA 4B3IA 8ABPA 2QA5A 4CKBA 1VLZA 1LPOA 2VK8A 1LRJA 1F12A 2C3OA 5FNVA 1XZNA 4IEIA 4G25A 2HW8A 4IOMA 2CXOA 3QBEA 3ZU4A 4IIJF 3OQJA 4CQNA 4QJIA 4Y6RA 2NO1A 4NCAA 1AA6A 1G6Q1 1NMXA 1J5PA 1W1WA 4KPUA 4DADA 2QL6A 5HIJA 4QXOA 2WTBA 3I0MA 4P7KA 3B7PA 1ULTA 3WAKA 1W36C 5CB0A 2O3JA 2X9VA 3AF0A 2YV3A 3BT7A 1RRMA 3L6CA 1Y1RA 4IEFB 5C46F 3J7AC 2R97A 1SKYE 3L40A 4ZKDA 3OUTA 4YREA 3OJWA 1DWQA 4P4TA 4QDTA 4FWIB 4X54A 1BE0A 1MC8A 3CNLA 3QI7A 3DF9A 3LXXA 4HDMB 4UBJA 1E99A 2RAFA 2F3TA 5ITWA 3GEGA 4LYDA 2CNKA 1H2HA 4N18A 3RDPA 5CA1B 1M0EA 3HFSA 5FA6A 1WNTA 1M1YE 2ZPUA 3ELDA 4OD0A 4RL4A 5DMHA 4B3TB 3P0EA 1EFVA 1F0YA 1N0UA 2QD3A 4RWEA 4OB8A 5FCDA 2X8AA 3A4LA 5K3FB 1SOVA 1AB5A 2ECFA 2WJ6A 2I1QA 5H81A 1L5GB 3RO7A 5BWCA 4E12A 3P5BA 3L1VA 3L93A 2NXCA 4ZOBA 4Z9XA 3RRNA 3NHSA 3PQDA 1KARA 3ZGOA 3WRYA 1RYMA 2I5PO 1TKAA 4EHDA 1E6KA 2BFCA 4DMRA 1U7XA 1FPMA 1FEZA 1RKUA 1D6NA 2F3QA 4IKPA 3IHTA 3W06A 2C54A 1SCNE 4MUGA 4PVDA 4OVKA 1N6HA 5IRCD 2C7BA 4CFSA 2PUGA 3R9XB 4C1NA 1M6VA 1CDEA 4QXRA 4X1KA 3FGZA 2GKSA 3LOUA 3T0FA 3UJ7A 3ZXUB 4LJ6A 2PTGA 1AHIA 1GR0A 1GPWB 4G0YA 4JWKA 5ELLA 3ZUGA 2XMPA 4ZJUA 1J1ZA 4B3SB 4UTOA 3U3DA 4KNYA 3UHFA 1BTOA 1W73A 2DFNA 3RQIA 1P7WA 3IRUA 1ENZA 2JVKA 3Q3VA 2E4ZA 2XVZA 4W5NA 2GZDA 1CB0A 1XTKA 2IOFK 3CY6A 5E7MA 3L7OA 2DT8A 3OT4A 2I2FA 1JPUA 3QJYA 4TMYA 3BH0A 4NU8X 2PRSA 2QUZA 1NSYA 3AYZB 5EY5B 1C3XA 5JSUA 4IFEA 3FGPA 3ZD8A 2O7NA 2REXB 4B9EA 1UQTA 5KVCA 3VR5H 5C8ZA 3BCUA 1KO5A 2AFRA 3GUYA 3SQXA 1NL3A 3UJAA 1OX4B 2JHPA 4KQ9A 4CM4A 3B1VA 1NUHA 4MWEA 1T6BY 2HWKA 4R9VA 1T2VA 4TPKA 4UXJA 4R2IA 5D5QA 4IUDS 2OV1A 3C5CA 3K0CA 4M83A 4KTVE 3EC1A