4NNOA

Crystal structure of manganese abc transporter substrate-binding protein mntc from staphylococcus aureus bound to a zinc ion
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
278
structure length
278
Chain Sequence
b'KLKVVTTNSILYDMAKNVGGDNVDIHSIVPVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSKDVKPIYLNGEEGNKDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQLEKLNNDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQMRQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTDSIGKEGTKGDSYYKMMKSNIETVHGSMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein
publication title CRYSTAL STRUCTURE OF MANGANESE ABC TRANSPORTER SUBSTRATE-BINDING PROTEIN MNTC FROM STAPHYLOCOCCUS AUREUS BOUND TO A ZINC ION
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transport protein
total genus 108
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2013-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4nnoA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4nnoA01
4HN9A 5M34A 4HMOA 3AEUA 1FP4B 4XPIB 3MINB 2MINB 4PAGA 4CL2A 1M1YA 1N2ZA 4OVKA 1M34A 4WZAA 4WNAB 2XDQA 3BE5A 4FNAA 5HDQA 1G21A 3ZK7A 5JOQA 2ETVA 3U7QB 4K3VA 2M6LA 1QH8A 3AETA 5KHLB 5KOHA 4WESA 5JPDA 3AEUB 3NU1A 2WHYA 3MD9A 5M29A 3ZK9A 1XVLA 1M1YB 2AFHA 3TEFA 1M34B 4WZAB 3TNYA 2XDQB 5CR9A 3AEKA 5BVGA 1G20A 1G21B 4WN9A 4IRMA 2YNMC 1MIOA 4NNOA 3CX3A 1EFDN 3TLKA 4FI3F 4HMPA 1QH8B 4MLZA 3AETB 5HX7A 5KOHB 2RG7A 4WESB 3ZK8A 3AESA 2XQVA 1L5HA 4TKUA 4BBPA 2AFHB 1PSZA 4OXQA 3PSHA 2OV3A 3AEKB 4G07A 1G20B 5BVGB 4WN9B 1MIOB 3AEQA 4H0FA 5AFSA 3R5TA 3LHSA 4M7OA 2X4LA 1N2CA 3AESB 1L5HB 4TKUB 2R7AA 2PRSA 3MWFA 4ND8A 4N01A 4FKMA 1M1NA 3AEQB 2Q8QA 3GI1A 2QI9F 4HMQA 1KARA 4WZBA 1K2VN 3MWGA 4FILA 3HJTA 2WI8A 1N2CB 5JJ5A 3EIXA 4MO9A 5KOJA 2XY4A 3HH8A 3ZTTA 4ND8B 1H1LA 4B8YA 4UDNA 4NNPA 1M1NB 3BE6A 2YNMD 5M3BA 4WZBB 2OSVA 3ZKAA 2O1EA 2OGWA 1K7SN 1ESZA 2R79A 2AFIA 4UDOA 5M2QA 2M6KA 1TOAA 5BVHA 5KOJB 4TKVA 3MFQA 1H1LB 5I4KA 1N4AA 4UTPA 3AERA 4UTOA 1QH1A 4LJSA 5GGYA 2PS3A 3LI2A 5GGXA 1PQ4A 4G09A 2XUZA 3R5SA 2AFIB 4GICA 4INOA 1K0FA 2PS9A 1K75A 3K1AA 1QGUA 2PS0A 3G9QA 5FLYA 1N4DA 5BVHB 1KAHA 4TKVB 2OV1A 3AERB 4DBLE 4H59A 5CX1A 5JG7A 3PDIA 1QH1B 1FP4A 4LS3A 2Q8PA 4XPIA 3MINA 2MINA 3PSAA 4MX8A 4PM4A 3HXPA 2XV1A 4WNAA 3EIWA 1KAEA 4OXRA 3UJPA 3K1AB 1QGUB 3U7QA 4MDYA 5B58T 2XH8A 2PHZA 4INPA 5CX1B 3PDIB
chains in the Genus database with same CATH superfamily
2WJAA 3TQIA 1N6HA 2HJVA 3HP1A 4JMLA 3DT6A 1T43A 3KSUA 3MINB 5HCIA 4QARA 2IPMA 4N03A 3NEJA 1FVFA 4R84A 3B85A 3HPQA 4YP9A 1VSUA 3KPVA 2GVNA 3GLGB 5JOQA 1H6AA 1P1FA 3IQDB 4XM2A 5DIZA 1DFHA 3OTQA 1JE0A 5FFMA 1Q0HA 1LF5A 1AQYA 1TL7C 2ZUCA 3NKFA 3NU1A 3OLXA 5E6RA 3TUJC 3UWDA 4D4IA 4MQ6A 5JWOA 5FBZA 5IPFA 1YIDA 4JP3A 4X7PA 4V0MA 1SD1A 1P39A 2XCOA 3FYCA 4A5OA 1V8OA 3GEBA 3S99A 2ZRGA 3H5LA 1KVSA 4JI1B 3U4AA 2ZB7A 2R62A 4IV0A 4MICA 3WXMA 4F3KA 1NVKA 4Y6RA 4X92A 5GY7A 2ISSD 4BFSA 3DVSX 4MUEA 1AV6A 4PGMA 3M1LA 5A3RA 4GI5A 5AK0A 2DULA 1JAYA 3LVBA 2OC9A 3OETA 4P4UA 4CL0A 2WKSA 4D26A 1HY3A 4P35A 4P7FA 2V58A 3HS3A 1J6UA 1M2KA 1TU4A 3AW9A 3OFNA 2FSVC 1QO9A 4MUGA 1JIKA 3PX2A 5FUYA 4AS2A 4GE3A 1BWRA 2R5NA 4B3BA 4F04A 4LF8B 4PANA 3H5VA 3E05A 3ZD6A 3AM5A 1ADCA 2V74B 4BVKA 4H27A 2FJUA 4IS2A 4ILEA 3CEJA 5EHNA 4N4AA 1C3OA 1IUOA 1HE8B 1HV8A 1M0WA 2Y9MB 3FTDA 3KB8A 4HVTA 4KXMA 3SOPA 2I6FA 5JJCA 3NBAA 2QI9F 4HMQA 1K2VN 3OQPA 2P2CA 2RD2A 2C3UA 4HDNB 3UT5B 3VJKA 3TLJA 2IEIA 4KR2A 1UF9A 3U7IA 5M04A 3IPYA 4UMDA 5ALZA 4XUEA 1O9BA 4EKIA 4M6WA 2CMGA 3W90A 2ALJA 2VNAA 3LYHA 4TSRA 2YDXA 4URHA 5TE9A 4YUAA 1CHNA 1TM1E 1E0AA 3H13A 2R5WA 1BJTA 3M6UA 3CX8A 3WB2A 2ST1A 4YROA 3PV0A 4Z0PA 2CFTA 4RZUA 5JISA 1E8NA 4CRWB 3L46A 3VR2D 3O9ZA 4YRSA 4J6FA 5LM3A 5IRCD 2ZAYA 5CLQA 3VNBA 5I4KA 2QBYB 4B85A 3OPMA 1FF9A 3SDBA 1P5JA 4HPJB 4OK5A 4RLFA 5EUMA 1CETA 5DXFA 3CVWA 3SHOA 3H19A 3ICQB 4OKNA 4RTKA 4GRIA 4H0CA 1Y7LA 4D8WA 5BR4A 4DIBA 3L1HA 2L18A 3K72B 1PNVA 4YCCA 2FB9A 1PCXA 3BWXA 1OH7A 4MKFA 3FH0A 4P54A 4D99A 4WINA 1QWOA 3DKVA 2PVCA 2RHCA 2Q62A 3MM4A 5A0TA 1G5RA 4MW7A 2WDZA 4M76B 1OXKB 3IKJA 4B6FA 2WVAA 4BZXA 3CRMA 2ENUA 1C0KA 3RUHA 1ZS9A 2FEKA 4OXRA 3HU3A 4PGHA 4LAFA 1QMPA 3HBAA 3PEVA 1I6WA 1U4NA 2ZTUA 1SHUX 1M7GA 1N0UA 4TT3A 821PA 3ZIAD 3FF1A 3MQFA 3Q7PA 2R8ZA 3A7EA 4KW7A 1O95A 2J3LA 4MWGA 3KL4A 4HNAA 1VBMA 2J9XB 4U1RA 1Z7EA 3O75A 3TRJA 3L1VA 1D3AA 4W9NC 3LNCA 2XUPA 4K0RA 3H5NA 4CM8B 1GT6A 2MMGA 3C0KA 5CDYA 5EIEA 2GZ2A 3A4NA 1VTKA 221PA 2D0PB 5HNKA 5L6LB 1AA6A 3DDZX 3OOJA 1TA0A 2XNDD 4BXOB 1G8SA 4IV5A 4OO3A 4Y18A 3TLGB 4QPNA 4ABYA 1OLXA 2UUOA 4GXQA 2CLHB 2C99A 4FDMA 1KJQA 5EPUA 1XNJA 5LBIA 2DUMA 4MQFB 4G26A 2OFXA 4KGXA 5FOSA 5LCXA 3WWPA 2ZIVB 2JLRA 2ZR0A 3F8TA 3WYFA 4DSTA 4ESOA 2JGRA 5K0CA 2BFNA 5MDHA 3OKAA 4ZOQI 3OICA 1X7ZB 5AUQA 2ODTX 2UZ4A 3G0GA 2OV3A 1G0NA 2R4TA 1RJ9B 3AM4A 3AEQA 1JDJA 4NSNA 4TV8A 1HKUA 3ANSA 3BT7A 2GCPA 2HUPA 3OZEA 2FLKA 4L50A 3RF6A 2ZGVA 1O6GA 5DHQA 4MV3A 3REGA 1D4AA 1Q1NA 1EP9A 3CSSA 4JLKA 2E21A 4FKMA 1M1NA 1GTVA 3KXLA 3MTEA 3OX3A 2J46A 3OG9A 4P1ZA 4KSCA 1C9JA 1EE2A 1F48A 5C5DA 4Q05A 3PNMA 5JSKA 2Q3LA 1X0VA 3AFOA 4UCWA 5BW6B 2VUIB 3I3SR 2EW1A 1MO6A 1H65A 1NOKA 4C2AA 3HJFA 1U65A 1FXSA 3S70A 5CVEA 4EUNA 1VG0B 4QJ3A 3KTDA 4J43A 4KVFA 3CH7A 3B6MA 5GIOE 1FFEA 3L41A 4J0DA 3WLEA 4QPZA 1UUFA 2NYAA 2QF7A 3LQQA 3N2GB 4DUYB 1YCDA 1M6VB 4ZHQF 4DMKA 4R31A 3BJEA 1E2QA 4BNXA 4PZ9A 5BN5B 1C41A 1E0SA 1E96A 1IHPA 1QH0A 3PC3A 1Q5PA 2QI9C 1B76A 2ECQA 3AB3A 4LSMA 1YD7A 2AE1A 4KKXB 1I7PA 3FOBA 4US1R 3SZUA 3ZQ6A 5TNXA 1W0KA 1LV8A 2HAEA 1AX9A 2ZBFA 4MJXA 1Z4MA 1RW4A 4GX5A 5CJJA 5I8WA 3TN7A 2A4MA 4R1OA 3I5YA 1TCAA 2ZJBA 4TV9F 1OWNA 2HWUA 3WLQA 1F14A 4HI0E 2P6NA 1E2IA 4HAUA 5K2OA 2PS0A 1SBYA 1Z2NX 4Q7MB 2IVFA 3UV7A 3QPDA 4HBZA 1JI0A 3V8NA 5AVSA 8LDHA 4TMKA 1JJAA 1EFVB 4H16A 2CJYA 2J4CA 3MTBA 2N75A 3COYA 1TRHA 5BYKA 1EAMA 2ZS7A 3LDGA 4UEQA 4AUKA 1FSPA 4AJ4A 5JSYA 1QM5A 1V41E 1YU9A 3AF2A 1V2HE 3FYDA 2OG2A 3GC6A 3HI6A 4OKSA 2FXVA 4NBLA 1P0QA 4BEJA 5JHHB 2F3UA 3IT3A 3TLZA 3NV7A 5BV0A 2WT8A 1A97A 1ISRA 1P2GA 4F60A 2XVAA 1HEYA 4B3RB 5DN6D 2E18A 4C4RA 1UDAA 3D6UA 4Q19A 4ZCSA 2UUPA 3K5IA 1XNGA 3OHSX 1F5SA 1H05A 4XLTA 4AZVA 3BD9A 3AU9A 1W5TA 2YIDA 4JK3A 3OQ1A 5BV1A 2PMDA 3R75A 1U99A 2REBA 1FS5A 3RSCA 2R47A 1MP0A 2PK3A 5CFRA 3TFOA 1C50A 4EHDA 3IQFA 3KR2A 3CF4A 3U19A 5HBRA 1IOZA 3RJTA 3C85A 4UUAA 4W8GA 6REQA 3EQZA 2Z2ZA 1D0IA 3PIRA 1KE2A 5BVGA 4QGBA 1D5WA 2FMXA 2V7UA 5B4TA 1PT7A 1VBKA 2IHUA 3ZCPA 4I3GA 1LLDA 4YFYA 4Z49A 2ACVA 3V7FA 5EHZA 4PX3A 3MT8A 4MK4A 2ZUTA 5A5DA 1EFHA 2G28A 2FUG1 3E0QA 3PE3A 3T5GA 1GQ2A 5HWSA 2WU8A 4UHHA 1F0PA 2SKCA 4HY3A 3SZRA 4BRSA 2Q6IA 1W2WB 3VQTA 4XVHA 2QN8A 1XIVA 4GFDA 1DRKA 1XD9A 3A37A 3NORA 2VA8A 2YJ5A 1NZJA 3D0KA 4G9EA 4R2JA 4ER0A 3EAGA 3ZDEA 5J2TB 1GTRA 2J6IA 1MVLA 1G8HA 2YL2A 1CZOA 1RI5A 2A30A 3FRIA 4QASA 4X6YA 3ONNA 1EWVA 2B8NA 2UXBB 3I2KA 3IJRA 1U1CA 3KOYA 5EMMA 3L7AA 1P72A 1R5NA 3QBJA 5DM70 2WJGA 3EOZA 2FG6C 3IE2A 1XYYA 2YJ6A 2EWVA 4IKEA 4OHRA 5FLKA 4OQDA 4E5PA 2VJBA 3QKRB 2VYCA 1MQ9A 2BZ1A 2WHQA 1CS0A 4HWOA 4JCOA 3SIRA 3LF1A 4O2RA 4UAUA 4WUTA 4YI3A 2JCSA 3KT0A 4FX5A 3DC7A 2B2XA 2B5VA 2KS6A 5FPTA 4KQWA 2JS7A 4RHFA 5JNUA 3U26A 2V8OA 3IMFA 1SUSA 4MIOA 4TRNA 5DGHA 2MDTA 5EERA 3BGWA 3L40A 3MMZA 2PMFA 2XYRA 1BVUA 4UDOA 5HUQA 1V8BA 1EMDA 3OQ6A 4BV8A 2A0FA 3JZAA 2QNIA 4G8BA 4XQ0A 2ZM5A 4UTOA 2HPHA 3OI7A 3L0OA 4ZAWA 4A23A 1YZGA 4Z1MD 1G1MA 3IV6A 4JEUA 1W4RA 5CTAA 5IM4F 3VV2A 3BN3A 3RQSA 2B4QA 1C3EA 3FBWA 3KUCA 4XX0A 5TIIA 2IUUA 4C4AA 1ZQ9A 5AI8A 1RWKA 2AZ4A 2WV9A 1KORA 3I6YA 4I14A 2OHHA 4W5OA 3WYAA 2WOJA 4CNQA 2PZJA 3RWMB 1ZONA 4X1IB 4I5EA 2F3QA 3UKJA 1FP4A 1SVUA 2V7WA 4I5DA 5DYWA 1Z63A 3A2KA 3T12A 5F3DA 1XE3A 1JBKA 1KOLA 3SXJA 1N36B 3RAEC 2QAIA 3KJFA 4XGIA 4EDFA 5JASA 1QQ7A 2IWRA 4HRVA 2WUGA 1P18A 1F7VA 1KJWA 3RUFA 4ZO8A 2IGTA 3H9GA 4DIFA 1A5BB 5C5IA 4HGRA 3ONDA 4A7PA 1NBHA 1OI4A 3IAXA 2M9MA 1SXIA 4TUYF 1QHHB 5DU2A 5SZKB 2DM6A 2OG1A 2R9VA 2ZTVA 2AZDA 3NNSA 2FF5A 1Q91A 2HC9A 3STVA 3T4XA 3BIXA 4GI3A 4NARA 2G0NA 2GN9A 5SV2A 3IMCA 1ZN7A 1O96A 1V43A 5HKLA 2K87A 4JYMA 4EJSA 3C8MA 4C3OB 4BEBA 4KV9A 2CB9A 1IWPB 2C1ZA 1AN0A 1AO0A 2HA0A 5LLTA 2QDXA 4D45A 4E5UA 4FDTA 3O8BA 2A35A 2D5BA 4L08A 2BHNA 3K6JA 1RC0A 1DX9A 1Y7PA 3FSGA 5EE5B 1ZL0A 5JLAA 5GP1A 1W4CA 1HQDA 1SBCA 4FI3F 4RH3A 1QVWA 4BO6A 4J1QA 9MHTA 3SFZA 5KOHB 2AJ8A 1ZISA 3NRCA 4O08A 4YR9A 1K0UA 5KPDA 2WA1A 4ERNA 5AI0A 2IBTA 1D03A 4ND1A 2NU6B 2WTNA 5JCJD 1TGYA 5HXAA 4YVFA 5D7NA 5JBIA 1C4OA 3GUYA 3WKEA 3EVNA 4N6NA 2EEPA 1E3IA 2H17A 1ADBA 2WMDA 3HDTA 3ON5A 5AUPB 1PJTA 4YALA 3SR0A 4P0PB 2EL7A 4PQYA 2HTFA 2WICA 2F48A 2LPMA 2HSZA 3EGDA 3TJRA 2QHXA 4RHUA 5REQA 3GGPA 4TKUB 2HJGA 4AJLA 3ZZ1A 1SU6A 1HLPA 3NANA 4DLSA 1AU9A 3AZOA 2WF8A 4UM7A 5LZ9A 4NZNA 2Z6QA 1WD5A 2WJ6A 5HKBA 2FZVA 2XKAA 3GWZA 1A5AB 2PLWA 2BKAA 1XZJA 4F3NA 2JARA 5EWMA 2B78A 4JUDX 5HF9A 3LAWA 4OHWA 5ADWA 3JD4A 4TQGA 3UK7A 4IDHA 4N7RA 2PL3A 2NZJA 2BT4A 4K2HA 4D4GA 2P9YA 2NXWA 2MHCA 3CZRA 3UWOA 4AKGA 4FEGA 1NUUA 3OKPA 4DGQA 2ABWA 3L0DA 3AF5A 2B3TA 2UXCB 1D9XA 1QQ5A 1QU3A 3IQXA 1RVV1 3KSDO 4UE6A 4UEOA 4ZV9A 3ER9A 4ZVMA 3BWVA 3K8ZA 4FZ3A 1ZA2A 2QZZA 2XYQA 2WWTA 3G2MA 4LZOA 4RPCA 3T7AA 1KAMA 1L3BA 3EOBI 4R1UA 4U02A 5K3BA 5EUBA 2G9NA 3A28A 4IX1A 3WIEA 2H2HA 4C89A 3DKRA 4LMBA 4Y1EA 3ADCA 3EZGA 7ADHA 4W8HA 1XQ6A 1Z06A 2QRVA 3OP4A 1NVEA 5E4FA 4M98A 2YHAA 3KDSE 2WA2A 1GKIA 1T2AA 5HKKD 2XCLA 2ZUFA 1E6EA 2CNNA 3F6RA 2DJ5A 2XUZA 4LRSB 3WK9A 1DCMA 2PS9A 3HE3A 3PNLA 2Q4EA 3QHQA 3Q3CA 4QD3A 4HVLA 1IM8A 1MC5A 1Z37A 2ZI3A 3AU8A 4ZXPA 1YB5A 4L22A 3SS8A 4HH1A 4B47A 4I8XA 1TIKA 4R9NA 4HSGA 5CPBA 5AM3A 3BDVA 5AVVA 1WUIS 2WY2D 3DVQX 4ZDJA 3WWEA 3U6KA 1GAWA 4QPJC 3OC0A 1A71A 4X97A 3G5TA 1CULC 1CSEE 1CNFA 1J33A 2ZRDA 3EDQA 4PAWA 1FYWA 1WV1A 5IAAA 3CTMA 1FYEA 1ZSVA 1AQLA 2I99A 4TOIA 3TRDA 4Q4DA 4IMJB 2E4AA 3F5DA 3P4XA 4BLWA 2IKQA 4IDOA 4EJ2A 3DWEX 3W1EA 4YRGA 1ODTC 2E85A 3EG5A 4Y6PA 3K31A 2HSDA 1EHIA 1CY0A 1O77A 3HUFA 4MB6A 3BDAA 5CCEA 4JP2A 4NXNB 4RD2A 1KDOA 1R0LA 2G06A 3JSXA 1TO6A 3PNOA 2MR6A 2AFRA 3TO5A 1K89A 4C7VA 4FFOA 3AEXA 2FQQA 4IJVA 3HWWA 3KEGA 4GPIB 4Z3DA 4QX6A 1GGEA 1OJ7A 1GR0A 2VHYA 3RD5A 4JT9A 2EJVA 4MJ3A 3M8KA 1UJNA 3NYQA 2QR5A 4OHOA 4U2GA 3S29A 3RVLA 3TUIC 1WPRA 4JQSA 3P9SA 1R12A 4FGUA 2JHFA 4OV6B 1JDSA 4M8SA 3U37A 5B2ZA 1VIMA 1EJ0A 4QHSA 1VBFA 3ITEA 3KKQA 1NYRA 1MG0A 1TZBA 5K8IA 2BZGA 2BUAA 1EUCB 1BE6A 1HE3A 2RONA 3ZXYA 1DJNA 4ZDWA 4LC1A 3AY3A 3OA2A 1L6IA 2Q07A 5C9ZA 4Q9NA 1AS2A 4LNHA 4YAGA 1YC2A 3T3HA 2NP7A 1I6LA 3W5HA 3CLSC 4A27A 4I3FA 1LI4A 1TAUA 4BEVA 5KAPA 4YV1A 3UPDA 1RYYA 2A5LA 3PF8A 2Q6OA 4W5TA 2WUDA 2Z3ZA 3ZE9A 2R7AA 3DBVO 3QYFA 2G63A 2VDPB 2YXPX 2VZ9A 4Q1FA 2I91A 3K0BA 4U6NA 2ZT6A 4EA8A 3PJFA 4U0KA 2QVGA 1V8PA 2M1ZA 2GAFA 4GRDA 3V4OA 1CYEA 2O7QA 1Y5MA 4QUAA 3EXFA 5KTOA 1QFJA 1TCUA 3RJZA 2YZ7A 3T7JA 3DZ8A 4RHEA 5I51A 4OREX 2JZCA 3EFHA 1NW6A 3F2VA 2R751 4YIHA 1U8TA 3JTMA 2YNMD 4C30A 1VKNA 3HKBB 4COKA 4NOKA 4CJXA 4TGLA 1KS9A 1U1EA 1PJQA 5J59A 4KE6A 1BQ3A 3K4QA 3KRTA 4URFA 2GD0A 4HTFB 4F21A 1B8OA 4N9WA 1XCJA 2EKDA 3BFJA 1PS0A 3W5UA 1VMAA 4NZZA 3IKLA 1VKOA 3ASUA 1DKQA 1KDRA 5JV5A 3KQLA 5GGYA 4MW6A 1POWA 4C4YA 2CL6X 1FVXA 2R7KA 3KJXA 2IH2A 2JKZA 3G6KA 4QL3A 3V55A 2QLNA 2ZJAA 3R5HA 5M5BA 4AQ7A 1WULS 3D3NA 4M89A 4C5AA 1Q0QA 5H9WA 3C45A 1XA3A 2V9ZA 3DH0A 2W6PA 4XTCS 1U9ZA 2C2WA 1F2VA 2AEJA 2QN1A 3H86A 5F1PA 2J0UB 3HRHA 3MEQA 1XT6A 3R7AA 3UAZA 1MHTA 2JIPA 2IXTA 3H7AA 4DWJA 2IZ1A 4L1KA 1L4LA 2PKEA 2YWRA 1H5QA 3K09C 2CWWA 4CKCA 5MFZA 3ZG6A 3SYLA 1JLKA 3UHPA 1AS3A 4RVNA 4LVUA 3NBUA 3OY2A 3ZW7A 4YAUA 2ZSBA 2VDLB 4AB1A 1C8VB 2P9HA 3JVVA 1JH8A 3A4YA 3RT1A 2CCJA 5IT4A 1PQUA 4Z4CA 5KTTA 4TYWA 2COUA 2ZRFA 2YV4A 1RMTA 1WCYA 5G0VA 2Z09A 2FGKA 2HF2A 2CYCA 5TVKA 2XMPA 2FNAA 4JITA 2Q7DA 2QTHA 2I78A 1JU9A 1QIEA 2ZVPX 4CM3A 2QPOA 4MYHA 2PPVA 3O4FA 3THSA 5C1OA 1P31A 1AHPA 1VB3A 4KI7A 2RI1A 1E7YA 1WHTB 3QXSA 2B7LA 4XD7D 3OQHA 4CLHA 3KEMA 1YVPA 3I0NA 4NCNA 1Y37A 2XOEA 1ZLXA 4K86A 3VNRA 4K6HA 5E6UB 1Q3TA 1EK6A 3FMFA 4LHSA 2HOQA 3DE7X 3P45A 2ISQA 4GHWA 3LRPA 4C7XA 1X74A 5A04A 5K05A 2NUAA 5ADHA 4NBRA 1A9TA 3KUUA 4DQXA 4ZQBA 2G83A 1QYWA 4KFSA 4RFVA 1AD2A 4WXEA 1ORVA 3MAAC 4LOJA 1SPBS 1MO2A 4W1PA 4F2GA 4IDCA 3W8RA 4IUYA 1UEIA 4GKAA 1RI3A 5DCYA 4DMRA 1LNQA 3UPUA 1L7RA 1PKXA 4KV7A 2R0QC 2HJRA 3BSYA 2QY9A 3KR1A 5DVZA 4ZVVA 4M7OA 3WYCA 3NT5A 2DHEA 3OC6A 4QSMA 1DPFA 3NHYA 3BCHA 4AJJA 5AHKA 4DCMA 5EQTA 1L8XA 1TU0A 3IB6A 3MPUA 1KEVA 1GFSA 1NJSA 3QVXA 4L4RA 3UICA 1EFCA 1G6Q1 3HL4A 3DOIA 3I5XA 4N01A 1A2KC 1O5TA 3D6VA 1WF6A 1P8AA 4GMKA 1HT0A 4RABA 3U3JA 1AURA 4X66B 3T3OA 6CHYA 5SYMA 1YQEA 3GJ7A 4S2UA 3R6GA 2Y4OA 1ADYA 4HNUA 5C81A 1OI7A 1AGNA 5MN5A 3EDMA 3PA8A 5HM6A 2DFTA 2GK7A 3DCIA 3GWGA 4LDAA 5GOTA 4PCUA 4AO7A 2WM8A 3LLMA 2JGFA 3THXB 4RGBA 3ZV5A 2IXFA 4N48A 1EB8A 1GAEO 1L4FA 2KM1A 3HB7A 4IKOA 4DLLA 1W6RA 3LXUX 2VNKA 3P2IA 4OP2A 4DC1A 5LQAA 1AUQA 1EQ2A 1M34E 2YWJA 4D79A 1OTYA 1E7QA 2BDEA 2Y66A 2ZS8A 4M7RA 4YEDA 3WC4A 3RRXA 4M8LA 1PN3A 4S2EA 2NVUB 2XUKA 3DZCA 1VL0A 4O4HA 3B1YA 3TAXA 3UZUA 1GTL1 4BLPA 4BKQA 3PQCA 4MR7B 2V6BA 3OCYA 3IULA 4FONA 5BWBA 3GP8A 1IN8A 1HWYA 5KWVA 2J3QA 2JLBA 2EJCA 2VHXA 5GV7A 4I9GA 2C9YA 5AOVA 1V48A 3RR2A 1A9XB 5A5GA 4X44A 3UT6A 4N0QA 1ZK1A 4Z3KA 2EX0A 1Q7BA 5EWLA 3Q7EA 4WD3A 3MA0A 4HSEA 3A1TA 3SC4A 2QMYA 1V5WA 2WSBA 2B82A 1FNDA 3QXGA 1ZHHA 4GU5A 3Q3HA 4MRVA 1ZVVA 2C59A 5JU6A 3WJAA 4A91A 3I30X 1Z17A 3DMYA 2ZATA 1IPFA 3EVTA 4EW1A 4M86A 2RBEA 3CRW1 2YRFA 1TQ8A 3CLKA 2R60A 4DSZA 5L53A 4KZKA 4DEXA 2P4EA 3MLAA 3OJLA 3GVCA 3DEYX 1O6ZA 1K68A 1NXQA 2QPTA 5CUQA 4BQOA 4HN9A 4BQQA 5JXGA 5K0FA 2WIAA 4RPJA 3U1BA 1JNYA 5AVYA 1GPKA 3HXKA 1DP4A 3T3PB 2BJHA 4XQ9A 3V4RA 4QU0A 3OTHA 4EFKA 1UK9A 4OVKA 1A4RA 1GG8A 1G7SA 1V96A 1Z82A 2B4YA 1JJIA 4R1TA 4TMTA 1XA4A 4FD2A 4M3NA 4M8KA 1BEEA 3ZHBA 4F4IA 3P9NA 2X77A 5IFKA 3PFKA 1QPBA 4N40A 2H4FA 2P9TA 2ODEA 3PKIA 3GMIA 3C3KA 2EGHA 4Q9HA 1A69A 1IY1A 2X9LA 3KYDB 4L5BA 5G4LA 4EMTA 1L4EA 1S3GA 4BWFB 2XEXA 3KZCA 4ER6A 2VH2A 4G4JA 4L76A 1Z6XA 3N39C 3C5CA 4OQMA 1TTQB 2YNMC 1KQPA 4OIMA 1JHDA 4BO0A 4D41A 4EF4A 1EDDA 4H3VA 1AS0A 4Y3UA 4B6SA 4MPRA 1NATA 2IBMA 2NLOA 1S3SA 3L4EA 4R9SA 4YAOA 3RUAA 3AL0C 5B4UA 5L7WA 2BGTA 3L4BC 1HT3A 3CMMA 2JCXA 4IOJA 4MO2A 4BMDA 2G40A 3PSHA 4YCBA 3H9BA 1UBLS 5EVJA 2ZTMA 5IAEA 2V4ZA 2Y1OA 2YFKA 2ZRNA 2Q7XA 3OEYA 4CMIB 9LDBA 3DMTC 3AINA 4AUNA 4CKEB 2QTNA 4AJIA 1FJGB 4KQJA 1TJPB 1PD1A 3SNKA 2BMWA 4OXKA 4ZT4A 1DIRA 1TRKA 2D4HA 2MU1A 3GYBA 3MGBA 3RB8A 3TPZA 4Q4AB 3UHOA 4D57A 5JY6A 5IJ0B 1R0WA 1LTKA 1WKCA 3AIOA 3KQSA 4OOFA 3TF5A 4O4IF 1DWPA 3L8DA 4Z4GA 4QNNA 2V7EA 2J09A 3AKEA 3AFNA 4BTLA 3H2IA 2BFEB 3AIKA 1C3JA 5KVAA 2HK6A 4LX0A 3EVCA 1NVAA 3IBTA 3GXBA 4XLLA 3RGGA 3PL5A 2PX0A 1U90A 1HE4A 3R24A 5DYIA 3IESA 1XJWA 3RVKA 3I9FA 4OU5A 3V4SA 5LN1A 4LSZA 5A9SA 4XWTA 3UMSA 3ACCA 3BE6A 1BGVA 2IV3A 4LF9B 3Q6MA 4OAQA 3DZDA 1MF7A 3W6OA 4JXZA 4DJJA 5EUCA 2I1LA 4QELA 2CT8A 3QUSA 2GBLA 3I6BA 2ZBEA 4Q5IA 2FZKA 4UJ3A 3FGOA 5AW9A 5BWCA 1E79D 1NVTA 3CG0A 5FUWA 4FBGA 1SHJA 1EH5A 1SUDA 1FBTA 4MS1B 1JA0A 1KI6B 3I01A 1TZKA 3IKMB 1UODA 2OAEA 3EVFA 2BEWA 3LGSA 4MV6A 3FYTA 4ZJUA 4X85A 1U8YA 3JR3A 5E0KB 5C5CA 3ESBA 4XW2A 1TQ4A 1E2HA 3HNPA 2E2WA 2PGNA 2V7PA 3ZNQA 1PE0A 5BT8A 3BD6A 4UARA 4UNSA 4PX5A 4FGSA 1ZNXA 3LOQA 1ORRA 3HDYA 3ISTA 5FWXA 4CQNA 2A86A 5DV9A 2AQHA 5DNUA 1OFVA 2LDXA 3TXAA 3VC7A 2HDWA 2OO5A 3VVLA 3SR4A 3IDZA 1UBMS 4NENA 1PNRA 4JXXA 1WUTA 2A6PA 5KX5F 4Z3OA 3QENA 4JLSA 2FPKA 3EXHB 5P21A 3EBLA 4NMMA 5BN3B 3LUDA 2Q5LA 3FTPA 4FFWA 3T6KA 3WMXA 1ACJA 1FS6A 2VUSA 1ZX1A 1U11A 2YYAA 5FI5A 2HDHA 3S3TA 1P0FA 4DIUA 2AOUB 4A9AA 1B26A 3C8UA 3V48A 1II8A 3MFYA 3NV9A 4IZOA 4NE2A 4BWVA 4KPUA 3WDSA 2NP6A 4ZGGA 1QB8A 3EY4A 2WDPA 3I83A 1EA7A 4IQ4A 1VIAA 4PWYA 1NN0A 4FJ1A 1RTTA 4RQBA 2CK3D 2ZR7A 3BWEA 1HT1E 4KXUA 4DM3A 1JHVA 1HDYA 4EW2A 5DX8A 2EX4A 3KOUA 3CNBA 4XI9A 3OOSA 1E2KA 3E2IA 3QLVC 4P2GA 5GJVC 4CLDA 3J81k 4YV7A 3T3NA 5CGQB 3FHCB 3Q11A 4FQ8A 2B21A 2KBEA 2XYHA 4FK8A 4LDJA 5KYVA 2RHHA 1B16A 4O0LA 4EFDA 5KYXB 3SYTA 3M6LA 2F9LA 4BO9A 2QEQA 3HBLA 5A4JA 5KMGA 2DFPA 3D31A 1USWA 3BIJA 3FNQA 1I4TD 2ZCVA 1XTRA 1Z08A 4D43A 1GZDA 3R3UA 3PPVA 4OHBA 5DEIA 2I2XB 3DYVA 3H17A 3CISA 1NE7A 3HJBA 4P8RA 1DUIA 2GD2A 4UM5A 2ETXA 4B79A 1ZUIA 3K2IA 4H0FA 3H05A 4N5HX 5JNLA 1SKMA 3IOYA 3PQ4A 2B1QA 3B9PA 3JQ8B 3TD6A 1II9A 2DOKA 1ZIOA 1H8EA 3OE1A 4WV3A 1Y8CA 4LTDA 1FFHA 2Y8EA 1KFKB 5DX1A 5IJ9A 5EHXA 4YWJA 2E3JA 3N07A 2YN2A 3FYUB 2DHRA 1NZDA 1SXJE 1Y7IA 3AHFA 3OJ0A 4I36A 5CAEA 2R48A 1YF3A 3WRXA 2Q1UA 2VF2A 1SZPA 2NU8B 1QGDA 2VPPA 3RSHA 5A6VA 1LKZA 4PO3X 2WIKA 1BVYF 4YA6A 3GLHB 3JALB 1MGPA 2CV2A 1GL9B 2Z9DA 2ZJYA 3L7DA 4DPLA 1I1NA 2D2VA 3KK0A 6GPBA 2H5IA 1C9KA 2A58A 4HQRA 1IZ9A 4HAOA 3HLTA 5CXUA 3IHLA 5H68A 2QQEA 5LDDC 4CUKA 5EP4A 4ZTZB 1JRLA 3PENA 4Q4HA 4UDNA 4DXAA 5GZ6A 4LRUA 4CNBA 2HY7A 4EECA 2FFBA 3P8ZA 5B7GA 1D6NA 2Y1WA 1JPUA 3VISA 4OH1A 1ZHOA 1PX2A 3L82B 1T2FA 5LQSA 3GCGA 5IVHA 1WUKS 2GA8A 2CFOA 3MELA 2IX3A 2R6DA 4IYRA 2QIPA 3TEMA 2IY8A 4ZI2A 4WY2A 1FSFA 4QUDA 5U9CA 1KGDA 5KWIA 3K70B 3DE6X 4ZYLA 1M72A 3CKMA 1M2WA 2BI8A 1LLCA 2ZB8A 4DW8A 3CCCA 4G1VA 3TSWA 3FFAA 4R8SA 3REOA 3VZCA 1RKXA 4BNUA 3BJIC 4MI1A 2BFOA 2XT9A 1OKKA 5LOVF 5HJ2A 3E58A 5A3VA 3SD7A 1VI5A 2VAWA 5K4AA 1S01A 2BGLA 3L0ZA 2VYNA 3ZCUA 4BZZA 4YJ3F 3FRJA 3MINA 4RCYA 4WJZA 5HGXA 1WX1A 4ENTA 4Q9IA 1YB7A 1P75A 5B1EA 2P78A 4QSHA 3KPJA 4DL9A 1MB4A 3W06A 2V65A 3P27A 4YONB 1MQSA 1ULBA 2IC5A 4G86A 4O4LB 1UIRA 4HAWA 2MOKA 4HZUB 3QV1A 5BN4B 3INTA 4Q3CA 3V7YA 1KETA 2F67A 2ZSKA 1ZOPA 3CPEA 3B8EA 3WTCA 3AF4A 3LPAA 2YCLA 1EXWA 3K8QA 1CIPA 1QHSA 2O0MA 2PH3A 2PSDA 2UUBB 4PYIA 2FW8A 1JSLA 4Y0AA 1J9GA 2JEOA 4U00A 4XRGA 4MYCA 4EUHA 1KYXA 3RC7A 5IBPA 1MRNA 4Z9YA 4X65B 4RM3A 4EOGA 1C1XB 3K2QA 2QG9A 4G67A 2Y1DA 2YMPA 1CTQA 4AWXA 4RU1A 3N0XA 5M29A 4RVCA 1WO8A 4GR4A 1M67A 1E6UA 2WJZB 4ZCLA 3I2JA 4BQNA 4TXNA 5D85A 4PYLA 3JPWA 3EVBA 3MJSA 1T0JB 4F5WA 2GXQA 5K8VA 1GGFA 3CX3A 3LGAA 1XCMA 4BB9A 3O3NB 1E2PA 1WEHA 2D7CA 2VT6A 3SMVA 2PUAA 5FTLA 3LLVA 3GRKA 3L07A 3PC6A 5LUBA 1IG3A 3UMFA 4EZIA 1C29B 3AUXA 3O90A 3I9KA 4O63O 3TLCA 1AK2A 2AFVA 5JSUA 2D8AA 5CBKA 1WB6A 4D80A 3GDGA 3CLUD 2BRUC 4PHTA 2CVOA 2E5WA 4RJJA 4AO6A 3EPJA 4HYTA 1ZU4A 2ATEA 4BKRA 2P65A 4HDNA 2XD4A 3GDFA 4GG1A 4PTLA 1P5HA 4KTVE 3UT5A 4B35A 1BKDR 4E08A 2BFMA 4R51A 1Z6AA 3I09A 3ZXUB 5HRCA 3OUZA 1OREA 1W25A 2IYSA 4OMCA 4KAXA 5F51A 2K7ZA 2A9QA 2J9FB 5CJPA 2NW6A 3CPSA 2Q3BA 2C82A 3V2HA 3ABQB 1DQNA 1UT8A 1UBKS 3FUCA 1CR6A 1OA1A 4ESEA 3IQGX 3OCZA 3NPAA 4L8VA 3IRUA 5I3ZA 4PU0A 3AYXB 5D1NA 1JJFA 4HGNA 3M6AA 5D3MB 1RRCA 2QBYA 2BGMA 1GNVA 1QUFA 1DCFA 2IXGA 3AL2A 2AYYA 1LWNA 1G17A 5DEOA 3STYA 3O7MA 1RPJA 1YO6A 2FTKE 1C4KA 4DA8A 3HYLA 4RJTA 3LUKA 4ZHSA 4UNPA 3UJ9A 3Q5DA 4GC9A 1FDIA 3PUIA 3ICPA 4LY3A 4W82A 4AUEA 3BREA 3LM8A 2XDAA 5DB4A 4F7DA 2ZIGA 2W42A 3S8MA 4F2HA 2IEGA 2RGUA 1WTAA 1Q1QA 1MT0A 2FN4A 2QSJA 4OD0A 4PQGA 1VFPA 4TROA 5CVDA 1JLRA 3W5SA 4F2PA 4CGZA 2OFOA 3WOVA 3F9CA 3OFJA 3VPAA 4YUXA 3T7IA 1GPNA 5GONB 5HBGA 2O52A 4HX9A 1FZQA 3FUWA 1ECBA 3A31A 4GPD1 4QRDA 1B6SA 5EXXA 1E1QA 5HQJA 1KYVA 1M2NA 3ONVA 4GUDA 4MQLA 1E4OA 2W4IA 1PTJC 3L84A 1LDNA 1DRUA 4UM9D 3G89A 1IYZA 2C5AA 3GBPA 5GM2A 1HEUA 4WZZA 1T2CA 4DF3A 5J4KA 2GPWA 4ZVRA 1CUSA 3LMKA 1KK1A 2FX2A 1L7VC 4CM8A 3UJPA 3HYNA 2VRBA 4M8IA 4PCVA 2V4MA 1SRQA 4GP9A 4U7HA 1NF3A 2XH8A 3A3OA 3U1VA 4C1BA 4EITA 5KPJA 4DQUA 5EJ9A 1K9VF 3M1IA 1NJ2A 4CTKA 4BXOA 2XGGA 3IT1A 3L7OA 3TLGA 2AI1A 3KXKA 3ZHQA 1FU8A 3MT0A 3F6EX 4HEJA 4TSKA 4K81B 1E9BA 1Y8AA 3GPIA 4RBNA 4BJ3A 4FQ5A 3DF9A 5G1OA 2PKYX 4E2FA 2YJGA 3L49A 2ZANA 5ABPA 2XECA 5AP9A 3O1HB 2AF3C 3QVUA 3ZWCA 4MQFA 1GZ5A 5C7LO 1MN6A 1H8HD 1JQDA 1KMQA 2YMMA 4FWBA 4FYMA 2QRHA 2QTLA 2LIVA 3H4VA 1C9YA 4B34A 1Z7WA 3MERA 3E3MA 4FTWA 4RKQA 3ZU6A 2HHHB 3SEZA 5TMBA 1X7ZA 1RPNA 5CW2A 4A5SA 4BYMA 3I2FA 3INRA 1E4VA 2RJ3A 4LK2A 1BXZA 3RNOA 1RJ9A 1QOZA 3V00A 4V1CI 3HBMA 2QPAA 1SCJA 4BFXA 1ONOA 3FNHA 1J70A 4KEAA 2I8AA 4IIUA 1CUHA 3WQRA 4QGAA 5TS3A 4ER5A 1EESA 2HA7A 2VEOA 1CZLA 3GJYA 4HCJA 4UHFA 4GXRA 4WESB 5CA0B 1EVLA 3ROKA 3IDOA 4LYGA 1JFFB 3MXTA 3RK4A 2R7MA 5CG2A 2QTCA 5FKJA 4HPWA 2WWVD 1FUIA 3T54A 4EI9A 2BM1A 3V6MA 3W3ZB 4HEA6 4Q1CA 3T38A 1DTSA 2PUWA 1WSDA 3IAUA 3PFNA 3LBAA 3Q40A 4XVQA 5CCDA 4AF7A 4LF4B 2XB2A 4DA9A 2G4CA 2XTNA 1L9KA 2FSSA 2PX2A 3RDPA 3WFJA 3IJEB 3QTLA 4C7MA 2AD5A 4DSOA 2ZJFA 3QVVA 1V39A 4J0GA 4TYMA 2Y0BA 4G01B 3ZTWA 4X9XA 4DG9A 2C95A 1I3NA 3WAGA 3DOJA 2CHFA 2OKGA 3N2GA 1KYQA 1YE8A 3HQ4O 2W0MA 1M6VA 4FOSA 4JL8A 4L9SA 5SZIA 1MW8X 4YRKA 3C4VA 3P71T 3GJ8A 4Q16A 5BN5A 1ZN9A 3EQ9A 4CPDA 2VHVA 3FPLA 1GUDA 3KIPA 3QJ5A 2OCBA 3GZNB 4IKPA 4E1VA 2OZLB 4DNPA 4EK9A 3BA1A 1SIBE 3FMGA 4MEBA 5FBKA 4BDTA 4D74A 3AGQA 3YASA 1IB6A 3KTFA 3VAZA 3TEJA 2OZKA 4WZ6A 3RTBA 2AG1A 4AKEA 1HPLA 1V6SA 4P80A 3EC7A 4RETA 1PFYA 2G36A 1KPIA 1Z25A 3ELUA 3NHKA 1EX7A 3KPWA 1MVNA 2YIJA 1LQTA 2CLDX 2C7RA 4AJ9A 2BKEA 1DDGA 3GR6A 3GCDA 4HDSB 1G55A 3H75A 3CMCO 2PT7A 1EFVA 4B44A 1NG9A 4LOKA 1AC5A 2X1VA 1CZKA 1BG6A 1WE2A 1N25A 3LY5A 3HFJA 4G3XA 5FTKA 4C20A 1DAEA 2C2HA 1U28C 3IBYA 4G5HA 3QEOA 1MO5A 3A4MA 4GC5A 2Y76A 2DFVA 3VDRA 3LOPA 2AHOA 5AW1A 4FGJA 2UYHA 1AQUA 1V6AA 6ABPA 3EEOA 3D2LA 4ZP1A 1RQLA 1HLDA 2OEPA 1CIVA 3FZNA 3ILYA 1Z4LA 4OMDA 5ICGA 1EX6A 1M8JA 3K9LA 1T36B 4E70A 3AHHA 4EMSA 4F1WA 1IY2A 4UREA 4UU8A 4TPKA 1FJXA 4IIJB 4JP1A 1I9GA 2PXAA 1HLFA 3B78A 4QJIA 4RVOA 5ALDA 2TRSB 3JQRA 3NASA 1N75A 1X9HA 1E2FA 1B2RA 4N0PA 4CQLB 5IAJA 4DUZB 1DXYA 2W98A 2YFQA 5JC8A 2D5CA 1BX3A 1O0BA 2PH7A 4ENQA 4P9NA 1VA5A 1X86B 5AJVB 2ZCJA 3EDCA 4X90A 1IAQA 1PK9A 1DBWA 1P4SA 1QF7A 4PIMA 1DOAA 4JLUA 4UHJA 5C8VA 3FOEC 1Y3AA 2P30A 2WLTA 4KFTA 5BSUA 2NTEA 4MUXA 4QPCA 2JHGA 2D6FA 2W11A 4MGHA 2DB3A 2KSQA 5EESA 5J4VA 3M70A 2CNLA 1VE7A 4BB0A 2VDQB 2P1RA 1S2DA 1ZVKA 1DUVG 4RJIA 5EZQA 2YWBA 3PKZA 4LYYA 3WGTA 4H7KA 2WR8A 3ZE7A 4C29A 4GGPA 5TDHA 1YUNA 2HHLA 4BMPB 2HRQA 3QW4B 2R11A 2JGKA 2XMDA 4DV1B 3TZKA 3TEFA 4MHTA 4AZTA 1DX4A 3GRYA 2YWHA 2O2ZA 4Y9RA 4D8UA 1J1UA 5EY5B 2FDRA 1MPXA 1SK8A 1U0OC 1BJKA 1JG3A 4BP9A 1QH8B 1U0SY 5J2TA 5BQPA 1A50B 4DR4B 2ZI7A 3PFFA 3VC3A 2J3HA 1A82A 1DBIA 4CQJA 1U2QA 5KZMB 1XXHE 4EJ6A 1A8HA 4EYGA 7GPBA 1KOGA 1M10A 1W2HA 3WK7A 2C4TA 3CSUA 4H18A 4WPGA 3O95A 3JAWB 3B2EA 2QPLA 1CRLA 3C4QA 3OZAA 3QKRA 3KXDA 5AI9A 2WG1A 5AFSA 1U7OA 3R5TA 1LU9A 3FVTA 4RCVA 3AP3A 1M8KA 2YXEA 3LHFA 2FGJA 3QHAA 1XTIA 3ETEA 1UZNA 1JFTA 2JD1A 2P6PA 4LV5B 4N12A 2G1UA 1HK7A 2C4UA 3AJ8A 4H77A 3LUFA 5IASA 1YB4A 3IIJA 2B2NA 3N7AA 4G23A 2B61A 3GG2A 3I1JA 3FIJA 2E48A 4LC0A 1K6MA 1UJBA 5CT6A 4AJ1A 5MFPA 2AUMA 1T0HB 2OKCA 1IOWA 4L8YA 3ENZA 3IUYA 4QUKA 4NDAA 2WE7A 2VOJA 2ZPTX 5DOZA 4F7WA 1J21A 4RDCA 1G6KA 1YRHA 3OCJA 4Y2RA 5FOVA 3ROEA 1Z5ZA 4M0UA 3EAFA 1JJBA 2Q1YA 2ZE6A 4IJ6A 4RPGA 4RKEA 3T7KA 3V2GA 4EPXA 4D25A 3HBFA 2C8VA 1NJFA 2R6ZA 3LH5A 1A5ZA 2IXAA 3TL2A 4QQNA 1E2MA 2WTXA 2FPOA 3C70A 3IQHX 4XB1A 1UPFA 1E1YA 1TC1A 2NOAA 3GAAA 1ZMTA 2ZAIA 2R2AA 3GFQA 3NTUA 4X1IA 4M4SA 1VLJA 5J9FA 4RK6A 5E4YA 2GZAA 1FDWA 1FUUA 4UDYX 4OYYA 4UOQA 2NZYA 4MV0A 1NPTO 5IVPA 1RXIA 2A0KA 4IFIA 3TZLA 2AL7A 3EGCA 5I6DA 3TFWA 3T4UA 3LJKA 3UOGA 1NSTA 1K0FA 1YHYA 2YZGA 3IVAA 4QE3A 1KJJA 5AXDA 5BUSA 2BCEA 4Z53A 2WU3A 1ZOSA 3EASA 1H3NA 1IIBA 3DMDA 4DYHA 5DSTA 4AG3A 2I2DA 1JQ5A 3LYAA 4HB0A 3BVPA 1MRSA 1QHHA 1GHTA 4L07A 3OZWA 4EG6A 4C5BA 3W3AH 1IJBA 4HLUA 4QODA 4N41A 1CUAA 3GVHA 1TIPA 1A04A 4G1EB 5TF0A 2DGDA 4V03A 4LCJA 3U3OA 2QZ9A 4HRAA 3JWIA 3CS3A 4B1FA 1KVTA 1T8TA 3RC2A 1W5FA 5DTMA 1DRWA 2GH1A 1U9JA 2NSJA 2FCRA 3U7GA 3QFFA 5FLXA 2Q3JA 3LT5A 3E2MA 1APBA 2JJ8A 1EWKA 3VSDA 2B30A 3G3EA 2JVKA 3KZXA 4BZQA 3JQ9A 3P19A 4D02A 3CKLA 1VP9A 4QDJA 1A2OA 1N2OA 3WNDA 4BJHB 3LBNA 1JILA 2AT1A 4HNSA 4NL4H 1KZ1A 4P82A 1J8MF 2I22A 1TXGA 4G8CA 4TKLA 5KOHA 3P0FA 4M1OA 1WDMA 2QU8A 2MYTA 4TTRA 3DDWA 2Q49A 2NU6A 2YWXA 4J0FA 2ZT8A 2OGZA 1KMIY 1UPXA 3ZWWA 3HVRA 1RADA 2Z4RA 2DPHA 3SIXA 1GZHB 1I5OA 1ODLA 2YWDA 3L7KA 1XLTA 4IY1A 4MV9A 4M55A 2MSEB 2R8XA 3KLOA 1KO4A 1NRXA 2RH4A 3MRXA 1UQTA 4TZTA 4ZWNA 2REOA 4KREA 4WASA 3EW9A 2Q0QA 2DXIA 2HSEA 3OZVA 5AM1A 1JHUA 3CVOA 4TKUA 5T41A 3SSMA 5BV8A 1PFQA 2P67A 2XZTA 1X3SA 3QU9A 4J2HA 3V1KA 3SSNA 3OIUA 2VKTA 5LB2A 2JAHA 4MVYA 4AVYA 2EJTA 1Q7GA 5CDUA 4S0ZA 1C3LA 1Z0KA 2R8EA 1R4MB 2C0QA 2GD1O 2X5OA 4PHGA 4BWYA 4CM4B 4DKJA 2C98A 2C7GA 3HV2A 3ONEA 1WBBA 1ISGA 3LKDA 1Y48E 4MRPA 1QKKA 1NW7A 3W1VA 4Y0NA 1KGSA 1HDCA 2IOFK 2IZZA 2OENG 4KQCA 3R5FA 3UW1A 3ESQA 3DFKA 2CNDA 3PQ2A 1HBJA 4F4CA 4QOGA 2AA3A 3KD3A 2P8JA 5DTIA 1WVGA 1Y5RA 3IAS1 4HH3C 5EEGA 1GNTA 2Q2VA 4YQYA 2LWIA 1L6RA 1HQYE 3O38A 3W6NA 4Y6GB 2XCRB 4EGJA 3M82A 4NPCA 2BELA 5I4CA 1SIOA 3E8MA 4IXNA 3MJCA 3DBRB 1Q17A 5E0OA 1EWYA 2C78A 1HXHA 4L72A 4C1NA 1KY3A 4WKNA 4DNFA 3SQOA 3KFXA 4XDZA 2AR0A 1G5PA 2EFCB 1HOTA 4MVJH 3ZKAA 4GQIA 2HHCA 2LKCA 2GS9A 1YK1A 3WLFA 3OZFA 4WXMA 1O94A 1QIDA 1WSWA 3FWKA 2RFLA 4OI4A 4HYEA 2Y1XA 5A5EA 4XR4A 5AMXA 1G38A 3N87A 5CM2Z 3NFYA 4B84A 1R8YA 4G0NA 1Z18A 3HHPA 4B33A 4DKXA 5EQJB 5FO0A 4I50F 4ARVA 3ZCXA 3MUOA 3BZWA 4CR8A 4Z4FA 5DM1A 1A4IA 4LZZA 4QHYA 1SHLA 1F4PA 3E3LA 4LK3A 4DS3A 4UAGA 4MAMA 1ISFA 1LA2A 5DNEA 3RV3A 3EGOA 3KB1A 4NX2A 4P7KA 4WWHA 1NG1A 3C7AA 4LX8A 3R3JA 4DBLE 1FIUA 1GAJA 4W5JA 4RCZA 3SHFA 1BWPA 1VXRA 2VWQA 3LDAA 5EOVA 5JS8A 1J23A 1H2HA 1E7WA 1T3TA 2QE7A 4ZT6A 4TZ0A 1KK0A 3LPNA 4WKPA 5DT9A 4AY4A 1AMNA 1NX6A 2VH1A 4QLAA 1YDMA 3BXPA 1WM1A 4ZN6A 1UH5A 4CF6A 5EN4A 3EUAA 2DBYA 3UAXA 3IRVA 4H35A 4XOIA 5IJXA 4AICA 5IXSA 4M88A 5KNBD 3CWZA 2KLBA 3ETDA 5K51A 3GJRA 1LC0A 5JH7B 2DHCA 1JW9B 1X94A 2DUNA 4UD2A 2OFFA 4LZPA 4ZK2A 1BWSA 1T1JA 3ZWPA 5E7IA 1GQQA 1BROA 1N6NA 4UHCA 3AUTA 1JYSA 2GBFA 1J0CA 3RSZA 5KJ1A 4BAZA 3MF4A 3IAAA 5IHPA 1EUCA 1GCOA 2B7BA 2EZUA 3EG9B 2V3CC 3JWGA 2KYRA 3DV9A 4RVUA 4C0BA 4KR6A 3B36A 4JJEA 5BWMA 4R40A 3H16A 4D0SA 1Z16A 1I4WA 4JI5B 1XPUA 5JYEA 1ZD1A 2P40A 3CF0A 3H1AA 3HZRA 3RVMA 5ICSA 3INYA 1JHRA 3NALA 1QTNA 3V8VA 3QITA 4K9PA 5HS4A 3HJNA 3N8HA 2G4VA 3BB3A 1C7FA 3E3NA 2G9VA 3ES9A 5E8RA 3VHLB 1KDVA 5ALMA 5EHIA 1NOIA 1KPGA 4E2YA 1BA3A 1W29A 4M0CA 3JVIA 4B2YA 3VU9B 4XOUA 5JADA 3KHKA 2A9FA 4Q66C 2QLFA 4TKMA 5AW2A 1TUGA 3DO6A 3OFND 1ZMRA 3PD7A 4JWKA 3LHSA 4QDZA 4GX1A 3WTBA 3FPAA 2IZOA 4X8MA 4CIYA 1L3CA 5F23A 3LNTA 5K5EA 1DLIA 3VA7A 4MWCA 1I30A 1PFWA 3U5ZB 2DX7A 4YJDA 5TVGA 4NEHB 3H42B 1B14A 5THKA 3TE7A 4F5YA 3LX8A 1JPJA 2MSDB 2PXXA 1SBQA 1KK3A 3GNTA 1PU2A 2HCJB 1GNQA 3CRQA 4BX3A 2Q4TA 1Z6QA 3FVRA 5GMOA 2HJWA 4PINA 3HKBA 3ZOKA 3HB1A 2YTZA 3H9JA 2J9RA 3L06A 5EIBD 4JGGA 3S2SA 1OASA 2FR1A 1DAPA 1OE0A 2AR9A 2CJXA 3T9FA 2VJQA 5BMVB 2BP7B 1NUTA 3NT2A 5A6SB 4HTFA 3DAGA 2ZWOA 4XA8A 3UJHA 4BNDB 4F3TA 1PW7A 4F45A 1OVMA 1KBOA 2CKMA 1P1KA 1CF4A 4N82A 3I28A 1U0NA 1P1RA 3WJ1A 5DNCA 4CT5A 2AMLA 1VCIA 2JBAB 1GPH1 3W5CA 1CC1S 1D2GA 3U60B 3V3TA 2O8CB 1LRKA 2QD3A 5BNFA 3S40A 3S2IA 4WGGA 3I72A 4OOEA 3U81A 3M3PA 4UNQA 4YMIA 3E9YA 5ULLA 4MVJG 3BMNB 1KDZA 3A1WA 4CF4A 2FRDA 3EOAI 2J0UA 4XQGA 1U94A 2JIQA 3JYHA 5COQA 5KEIA 1ORIA 3I8OA 1Z6YA 4MYSA 1QZ3A 4P58A 1GL3A 2ZU0C 4PWZA 4DIEA 1J4AA 1S6YA 1GG2A 1YZYA 1XDGA 3CNOA 2VS1A 4JB3A 2PZKA 3FR7A 3ST7A 2GBCA 1C0EA 4ZCMA 1CD5A 2HRDA 2QD5A 3O4IA 4PIPA 4GP6A 4B9AA 1KJZA 1DC5A 4IGFA 4XJXA 5KNDA 4PM4A 1MB0A 1XWWA 3L9XA 5CEJA 2C20A 1RYEA 2WK1A 1QRSA 3WB9A 1T8RA 2WB4A 1F12A 1P9WA 1W34A 2VPXA 3BKWA 4RTPA 1G3IA 1MC4A 1E2EA 3AI3A 3DDUA 4FMCF 3G68A 1V1RB 3TTXA 3ZCTA 3SBOA 4TT3D 5T57A 4F92B 1TMKA 1O95D 1WHTA 3FHTA 4CCAA 2Z8XA 4EYEA 1VI6A 3EXAA 3FDXA 1L5NA 4ARSA 3VTFA 4BQEA 1RRVA 1Z26A 3IA2A 4O5AA 5FULA 1LJLA 1Y4SA 1JPNA 2DEUA 5E6UA 2VPZA 3IA7A 5EFZA 4DILA 5FI1B 3FF4A 4Q1DA 1MA3A 1A96A 3Q3JB 4QC2A 3JQPA 2LDBA 4PLPA 3QKUA 1OXMA 2AE2A 3PFIA 2Q3DA 2QUAA 3U3KA 1ORDA 3AZPA 3L0SA 1BDMA 2JHPA 1GD1O 2C92A 3UOWA 1Z2PX 4NP6A 1BE0A 4AXBA 2YWFA 4JASB 1H93A 1SQSA 1U04A 2RSLA 2ZVQX 3UIEA 4MJ7A 1GU1A 1MXFA 4CCYB 3I62A 5FNVB 3DE2X 1O4WA 4PNZA 5ELXA 4UVHA 1WXFA 1G9SA 3NCHA 1ZC4A 1SNYA 4IIBA 3U9TA 4PPFA 3WLNA 1Z12A 3UBMA 4B6QA 3V80A 1R8QA 4CXMA 1FLVA 2LTAA 4Y2XA 4GDMA 3CUYA 4EX7A 1GV1A 1JQJC 2GLXA 1OC4A 1VOTA 3JCZA 4X84A 3SVZA 1SKAA 2YIVX 2ZIZA 2P6OA 1KY5A 4J1TC 3GAZA 3ISVA 1E9RA 1UC5B 2AI3A 1BFKA 1WDLA 3D1LA 4JAVC 4E5YA 4FYYA 5C7IO 2PRSA 2FSVA 5IYZB 3THXA 5BSEA 5E9JA 1ZRHA 1YRWA 5HPYB 1E1NA 3S1LA 5F98A 4G97A 3AUSA 3H8JA 2J5XA 3ANLA 5CRIA 1W88B 4FP9A 3NTVA 1HUQA 2JGLA 4EGFA 5KU7A 1XUOA 2VFAA 1IXZA 3I2IA 1UJ6A 5FF9A 1ZJ6A 4J75A 1GNPA 2KW5A 1QUEA 2NVUA 1QAQA 1NMZA 1FYFA 3O4GA 1U8FO 2VYVA 2SBTA 4L9WA 4HGQA 2QMZA 4G5SA 5U4XA 4MR7A 4QECA 5D86A 3RTAA 1SBNE 1E0KA 1FNMA 3W8EA 4ZARA 1AM4D 2JEZA 4LJ6A 1J2UA 3IPAA 3LD9A 1Y7TA 2AW5A 1QOPB 1NLUA 3CYFA 3TZQA 4D5GA 4E30A 2F7SA 1A9XA 1KU6A 3KLPX 4QNRA 5CIYA 5G02A 3T0GA 3OOEA 4PYJA 4MV1A 1JWBB 3PNVA 1IBKB 1X7HA 2BL4A 3OOHA 1NNUA 5E2IA 2CSXA 2PYZA 3OPQA 3CUEF 3HRKA 3WSWA 1W0KD 2DBZA 2P3LA 4GL2A 4D8YA 4TV8F 3NB0A 2W9XA 2DPXA 2YC2C 2ZR9A 4KJZA 4B09A 3L6OO 5K3FB 1WMEA 3K1JA 4TKVB 1DPGA 2WNSA 1Z29A 1NT2A 1UFQA 2H1CA 4P4TA 4JENA 4IHJB 1FY2A 2VQDA 4MUHA 1CQJB 4A8TA 3IS3A 2P27A 3DL2A 2GWHA 4ZO4A 3U7EB 1E66A 4KB5A 1G9TA 4H4EA 4CTOA 3F7NA 4RH0A 2VBCA 2B3DA 3HCFA 1J2TA 4P0TA 1GNRA 1U0BB 2GETA 2FPMA 3O2SB 3H9QA 1RWMA 3PVSA 1B73A 3IP8A 5ICCA 4P4LA 1PSWA 2PKRA 3ETGA 4A6DA 3KYDA 3FROA 3A2NA 3EZ2A 4CTMA 1KJNA 4PY2A 3KE8A 4H4CA 1GQSA 3BE5A 1TAHA 4GXNA 2P4SA 4AG5A 3MAGA 3IUBA 3H7IA 4FOPA 2GT1A 3FFTA 3HN7A 3GJTA 3GA0A 4BLTA 1N0IA 2IZ6A 2Q4OA 4XRRA 1WDKA 4QDTA 3TB6A 1WUYA 3ZDXB 4AX4A 2PH1A 2P5UA 1WV0A 3U39A 2HZBA 1GUBA 2OCLA 5ALKA 3V4PB 1HDXA 3ROTA 1CCWA 1N2SA 1S2IA 3OZIA 4NDZA 4OHKA 4YRQA 1CJVC 1S96A 4CMIA 3SY8A 2HQBA 4UCQA 1GV0A 4HQ0A 2Y27A 3OF5A 4NESA 4CKEA 5JHGB 1L7PA 5I7VA 3B1XA 1AVTA 3V8QA 3GCXA 3WI7A 1JDUA 2WNHA 4DCNA 3TRHA 1AHHA 4JB8A 3RTCA 3VSEA 2PJDA 4YASA 1YJAA 1UT5A 4G4SO 1G60A 1G8FA 1Y63A 3Q7IA 2RAVA 4Q4AA 5LD2C 3QUQA 4WCDA 5IJ0A 5IWAB 1OHHD 3DJFA 1M6HA 1Z88A 2RBKA 3B5IA 4JLOA 4JJGA 3L8CA 3RFXA 5BR7A 4BV2A 5LQNA 3GEGA 3UBTA 2CZCA 4D6PA 1FE8A 2BFEA 4ZC8A 1M1YE 3I6IA 2QVLA 5DHSA 4IJKA 1Z35A 3AHJA 2Q28A 1S8FA 2OBXA 3K2BA 4N5NA 3WBJA 4DPKA 4FD3A 4OB6A 5HE9A 1QJCA 4XIGS 4ZGWA 3K71B 1ISIA 3ISJA 1X9GA 3MBOA 3BRSA 1VP3A 2BUBA 1IEWA 3SDZA 3WGYA 3ZGXA 1HTBA 3WA7A 3B3FA 5CNJA 3VUFA 1UMKA 4GYJA 1JG6A 4Z2AA 3PEWA 4US0R 3T7EA 1AF7A 5CDFA 2NYUA 1QYCA 1QG2A 2L19A 3ECSA 1JAXA 1T1IA 2X3YA 1QAMA 1V8FA 3HH8A 1YI0A 1ADGA 3I92A 4MS1A 4W7HA 1KI6A 4F6CA 1S89A 1E63A 1KZHA 2GM9A 2HPVA 1MH9A 1CP2A 2VHZA 2XOXA 4GWGA 4OQLA 2K2QB 1G8PA 1XZGA 2A7XA 2AK3A 3IVCA 3QQ5A 3ABOB 1RYNA 2IIPA 2WYOA 3N0TA 1MJGA 4V3BA 2CMHA 1TEVA 4DABA 4XARA 3TQHA 3OJFA 4UTPA 3RS3A 3B2NA 3G8DA 2VZ8A 4OAPA 3CLRC 2J9YB 2ZRPA 4CG3A 4E31A 3VH4A 3WIOA 4JLDA 4A6PA 1T5TA 5JFTA 3IX7A 3EXHA 1KKLA 5FDFA 2DSNA 2P9EA 2VUTA 5DNDA 3JVUA 1YR7A 4LE0A 4QGHA 3C7CB 2VZLA 3PRYA 4V3CA 4N5IX 4OLFA 2OHVA 2AOUA 4LI3X 2EZ9A 3WRWA 5FEMA 3PNPA 1IOLA 2DQKA 1QV9A 5CITA 3A3YA 4NICA 4YCMA 5DMHA 4G65A 2CLCX 4JDUA 3FIUA 3L8MA 2R66A 3IIIA 3SHVA 1NAHA 1M83A 1QRDA 2D13A 3K8OE 3L02A 1P81A 3E18A 5GOZA 1Z36A 3EIWA 3I5AA 2CN1A 4LNUB 2P90A 4N5MA 4XDGA 4KP7A 5ENDA 3A9CA 4FFDA 4CIVA 3DR3A 1G4HA 2Y1FA 5B58T 5CB0A 1LUAA 1UP4A 1X77A 2AKAB 2IZ7A 1K97A 4J3JA 3M4ZA 1X19A 5IUJC 5EIAA 3K5WA 2OAP1 4CIBA 1Y5LA 2X40A 1T34A 4WXYB 3U9LA 1LBEA 4ZYWA 4QVIA 3RFTA 1PIWA 4HUJA 3R76A 3I4LA 1DIBA 2SKDA 4UXIA 3QFRA 2VBGA 1ZVMA 4CVNA 3VPGA 1N57A 1BDJA 1T6BY 2CLMB 3R5XA 5JCPA 2AG5A 3HGQA 5KYXA 1P6XA 3O8LA 5DWVA 2WHYA 4HKTA 2QXTA 1LPBB 1BU8A 2OM6A 3A1DA 4G5RA 4IYJA 4F6LA 1BEUB 1E6MA 3WGOA 2C88A 2W8ZA 4ZO9A 1GUZA 1FNBA 4P3OA 3I6QA 3NEYA 1NN3A 4ZAVA 1W9HA 3FSGD 4X45A 2REXB 3CINA 3HDQA 1EGMB 4WLEA 2FDCA 1RLUA 2C61A 3JQ8A 3N5KA 4OP1A 4JT4A 2V0GA 4MH0R 5MHTA 1PVDA 3NEPX 1WCV1 5JD3A 2VWGA 4I8DA 4AMUA 3BULA 2AIRA 4OJQA 2PWBA 1N6OA 3FYUA 4G41A 1D7OA 1XQYA 3BICA 4CIXA 4W5HA 4DM4A 1XCOA 1JG1A 2LP4Y 3L8EA 1DG1G 5EI5A 2NU8A 3VR6H 4AP9A 2B37A 2AUTA 4JB0A 3UAOA 3H2KA 3IR6A 4DR5B 4IW3B 3GLHA 3JALA 5LNK6 1O0SA 1XTUA 2ID7A 2GXSA 3EVAA 3KG2A 621PA 2PPLA 1P5FA 2Y99A 3GP3A 5IAGA 2P79A 2IHVA 4ENVA 3R3YA 1E18A 1TAQA 3O0DA 2AOWA 2D7DA 5M7EA 1JEQB 2QMOA 3VXKA 3ZQUA 4YCAA 4B6JA 5K3AA 5C5EA 1W5SA 3AFGA 2ZPUA 3FB4A 3OTWA 3TKYA 3NGXA 3V33A 2PX3A 2TSYB 1L8AA 4BX0A 1I2DA 5KVCA 1G0OA 1HRKA 3AVXA 2P69A 1FJ2A 1A2BA 3PGVA 1QE3A 1P2DA 1V8ZA 5BUCA 4MYUA 1E5VA 4QAJA 4WI1A 3L5KA 1PWHA 1A1SA 4I08A 3BL6A 2HX1A 1MEEA 2AJDA 2F62A 1T4GA 1S9HA 2FWAA 3VKHA 1AKNA 2B8WA 1ESNA 3VHQA 2IUEA 1RP1A 3S2UA 4YGXB 3L2OB 2YZ2A 2G5GX 1KRWA 2PTHA 3AQIA 1UJ5A 2IPAB 4HDMB 1UBJS 5AW7A 1QQAA 4RSMA 2CKDA 1XDWA 4B6EA 3TLYA 1K6EA 2IE0A 1PSDA 4UMVA 5EJ8A 1AUPA 2HWXA 5SYNA 1HDRA 1S02A 4FFBB 4S35A 4F3CA 4FOLA 1KMHB 1UKEA 3BERA 3G0DA 3IJPA 4HZUA 4O4LA 5BN4A 5JDCA 3I64A 1AH2A 2V5VA 1V25A 1W5EA 2BM0A 3ECCA 1WBJB 2P2LA 2QQFA 2C9MA 1AUXA 1O87A 4LYJA 4DUPA 5MN6A 1C81A 1OW3B 1WCIB 1NW4A 3A1VA 3HR7A 3LXMA 4LWQA 3NIWA 1YS4A 3PK0A 3TW8B 1M7BA 5B3LA 3LBFA 3PF9A 3RBXA 1GN8A 4ONEA 4N47A 4HS4A 4DNQA 4FU0A 1C1XA 3GLIE 1FTSA 1Z4PX 1L3IA 3GH1A 3HCWA 3MRTA 2GBIA 5E7QA 2GN8A 1TC2A 1A9RA 5K8TA 3TIIA 4BL5A 1FYXA 3N8GA 5IEJA 4BS9A 2C58A 1JA9A 3UHAA 1SC9A 2G07A 2K4MA 1G19A 2OOSA 2P7IA 1FRQA 2A5DA 3DFMA 4FEYA 1J49A 4LVOA 4MROA 3SZ3A 3NDPA 4BV3A 1W94A 2RIRA 2PD3A 3BXHA 3A3KA 3LUCA 4EHKA 2V0NA 1QV7A 2A14A 3A4VA 4QLOA 1Z0SA 4D92A 1QBGA 1RWBA 3R5KA 4YAEA 5ANRB 3RM3A 5K8CA 1IPEA 2GCEA 4KQ2A 2ZT5A 2Y1KA 3FMIA 3N2NA 4P3XA 4CG2A 2UKDA 2XUGA 3F9RA 4G2TA 4KJXA 1GZ7A 1ONPA 1WVIA 4JU8A 5CT5A 2OLJA 3M4YA 4RORA 1DXQA 1NXPA 3D1JA 1XZMA 1IONA 2EL9A 4LDNA 4RZSA 3MTAA 2PV7A 2UDPA 1FCJA 2Z83A 4UXHA 4YO7A 2BFPA 1E2JA 3ND8A 5CYOA 1T3SA 3HJGA 2VDRB 3RV4A 3OP1A 2NADA 8ATCA 2X8JB 4AI6A 1GM5A 1RMQA 2J9FA 1HTWA 4NOMA 3EQ7A 1U3GA 2BDTA 3RAPR 2ODAA 4PLGA 1NMXA 2CC2A 1G64A 1SCIA 1VXOA 1ZM7A 4B0OA 4JODA 3WHIA 2D3WA 4DLVA 2C29D 2IPNA 4ZU1X 2H29A 2ZRHA 1WOYA 1Z39A 4D5EA 3HV0A 4BMOB 2IOFA 3ML1A 3L7JA 5I3CA 3NWJA 2Q5OA 3C3DA 4PYNA 2GXUA 3IILA 2XWPA 4H17A 5AKXA 1E4EB 4C0HA 4WSOA 3I23A 4C4OA 4BQIA 4WVFA 5AESA 2ZS9A 2P75A 1KZ9A 3PI7A 4H3KB 1PJSA 2ZWPA 4G85A 3M4NA 3VKVA 4BZWA 1N2CB 2ORYA 4LRTB 4BLUA 1AQJA 4DA7A 4BPRA 4RD1A 1NN1A 3GIDA 1U63A 5I7FA 3G7NA 4PXYA 3EWNA 4G5YA 3ABSB 1S1MA 3KVOA 4UFOA 1TUIA 2BHTA 3FWHA 3GJ5A 5E9WA 3W8NA 1MFZA 4YCSA 3QLTA 5LJIA 3H5IA 3IV9A 4J76A 1YMQA 3MT7A 5GONA 4UTNA 2IBSA 2IV2X 3VYWA 1M7HA 2CLKB 4RUKA 1D2HA 2AXQA 3DZKA 3L92A 1X7GA 4HB2A 5AHWA 3TQOA 5F2KA 4B43A 3TH5A 4F4UA 4QOHA 4F8JA 2QUJA 5JJLA 1X92A 4CMGA 3BSWA 3ET4A 3MXOA 4LXHA 1P0PA 3DMHA 2ONYA 3COWA 2R00C 1XZFA 3GUVA 3OU7A 3GJ3A 1W1IA 4U39A 4B87A 3SLGA 1R6TA 5ILOA 1O0CA 4GPTA 1TKBA 2VDMB 4G2NA 1DXHA 5ITWA 1WB5A 1ZXLA 4DSNA 5L3VA 1CF2O 1LI5A 2YBDA 3HG7A 3T61A 3GLFE 2BKXA 3CW2A 4MHSA 3Q72A 5TT0A 2HRRA 2QVXX 4J9VA 2IU3A 3T1NA 5ALOA 2RGEA 4QDOA 4EWLA 4F5ZA 5FAKA 1JFSA 1PT5A 3OOYA 3IAM1 4B76A 1IHYA 1X1SA 2V5AA 2J85A 1I0IA 3C16C 3F3SA 4KACA 4JHLA 2H1IA 2V1XA 1A8UA 4RAQA 1RBQA 3P0EA 4XGQA 3BIOA 3CEAA 1Z4NA 4KKVA 4MA0A 1LFAA 1RMYA 1VRVA 4UUNA 3AKZA 3OCXA 2IDMA 3A6FA 3QLUA 4FXOA 1R6BX 4XJTA 4DIOA 1JIJA 1WA5A 1VIVA 2O0LA 3HU1A 2CB0A 3F71A 5AVTA 3M9LA 4LY0A 3STXA 2JLWA 4M0FA 4M99A 2E55A 5CA0A 4WESA 2QX7A 4PS0A 1OAAA 4XJSA 1JFFA 3MD9A 4MINA 2OORA 1MB9A 2Q3HA 3P2KA 1I33A 2IOQA 2QB5A 1LWOA 1XQVA 1T0IA 4D4JA 3DD5A 1KK2A 4ZYZA 2ZI9A 4ALLA 1DIAA 3AJEA 1DQZA 1H1TA 1YIAA 1ZK0A 4WK2B 5FV7A 1L7AA 1U8AA 3VR3D 3UWPA 2XDWA 3HJAA 3AEYA 4DCCA 1YZVA 2EP5A 1UFVA 5B1HA 4BX9A 4CDNA 1YA6A 2QTZA 3HLKA 3FYSA 2WSIA 3GLVA 3OZDA 4JLAA 3U56A 3RUPA 3GFTA 2C31A 4O2AB 4HB3A 3KVRA 3AIMA 3LHDA 4NPHA 1TA9A 4W1RA 5F3RA 4GWKA 4F9FA 6NULA 1H3EA 3TZEA 1GRVA 1K8XB 2VOEA 4BNHA 5IX8A 2X4LA 4KH1A 1AKTA 2M98A 1GO2A 3R6DA 3SJUA 3L4SO 1IXSB 2IPLA 4ZTBA 3GZNA 1A5TA 1D4FA 3P2OA 4OJYA 1S9DA 3OLZA 5GINE 2GM5A 2OZLA 3GU3A 5KHOC 1TAGA 2V5UA 2X2EA 1NV8A 1KI9A 3S2EA 5IJZA 2QZ4A 2NTJA 5AICA 4BP8A 2H3EA 1J9ZA 3BGSA 4PAOA 1G5TA 1FRNA 1MB2A 4UZSA 1J56A 4X62B 1Q6ZA 3W2GA 1HL3A 2O2CA 3R6TA 2FCAA 2O8EB 3I8XA 5AO9A 4CTJA 4S24A 5DW0A 5KNCH 4HDSA 2ZAGA 2VPTA 5EINA 4KDRA 3RANA 2H6EA 4E32A 2NZUG 1CUEA 1XRPA 3GJ4A 4MS3B 2WBLC 1KFJB 4XEUA 5ED0A 3DW3X 1M5TA 3VU3A 1ESZA 1KP3A 2R79A 1U7DA 3RTDA 2ZKLA 1QLWA 4UMFA 1T9KA 2ZSUA 3U62A 3ZHRA 4H4DA 3ZBQA 1RWVA 2EFGA 3DVRX 1G21E 2DTXA 1CNEA 3KFLA 4D4KA 1XD8A 3BXGA 2CUNA 4TL6A 3IUPA 1T36A 3RREA 1XZLA 4ZK6A 1AJEA 3EHEA 3EN0A 4EY3A 3OLVA 4IIJA 4R8VA 1XXLA 1Y6QA 2IYVA 2PS3A 3DA8A 4F8EA 1PP4A 4G81A 3AHGA 3KP1A 4KXQA 4EO9A 2NSYA 3KS9A 2WUEA 4YAFA 2B1RA 3NH9A 4CQLA 1QIGA 5H5JA 4EMBA 1M2OA 2ADFA 4EB3A 1E1KA 2HLDA 1DAHA 3M9XA 3G7SA 1RHMA 3OIFA 3R77A 3K73O 4XIYA 4PBTA 3CVJA 1Y8RB 2QW0X 5JZVA 1CW2B 2H48A 4ETWA 2RGRA 2YR0A 4I1SA 4JNCA 4ARBA 4MWBA 1WCWA 3DJYA 5JQGB 2OD9A 2GKGA 4IIHA 3I1YA 3TLXA 1C7JA 1OAOC 2NVBA 2WPDA 4Z0HO 1P2UA 4EHNA 2V03A 4AMGA 3H2SA 4DDMA 2B9EA 2O7VA 2RHGB 3V9AA 3X1YA 1LPOA 4EPRA 1YOBA 1MX1A 1SB9A 1CQIB 4DHWA 2LCFA 2GZSA 4FGWA 4UFNA 1TF7A 4E88A 5L3ZA 4EKGA 3T5MA 1DJOA 3MS7A 3DCYA 4EKEA 1OH8A 2CLFB 3EXG1 3K09A 3PQ7A 4E46A 1JAIA 4JA2A 4S1VA 5TPZA 5J1SB 2D1YA 2ZBRA 1Y6FA 1QH8A 2BF4A 4A10A 2BKLA 4L02A 4P7GA 4MLDA 2HK8A 3H5WA 421PA 4LMAA 3CLVA 2PSHA 1VMIA 1RZ3A 4O4HF 3K94A 3ZY2A 1WSAA 3VBEA 1M1YB 4FIDA 1GKKA 2P9GA 3DO8A 4P4SB 1P4GA 1JTEA 1LZKA 1UKCA 3S2ZA 3JAWA 4ECEA 2OOKA 3C3XA 1TZ2A 1QONA 2GJ9A 4YBRA 2N42A 4AYTA 2EFYA 4WN3A 2OECA 4DMHA 4CBVA 3H1EA 2NYRA 4LCEA 4H08A 4MMZB 5CK5A 4ATNA 3I05A 1U9CA 4Z7OB 1JALA 3O2JA 4IQGA 4EKYA 1OOEA 3DONA 3ZVRA 2ZWMA 4GVPA 3WX0A 1SCQA 3I37X 3KQOA 5FI0B 1HFKA 1NM5A 2J7PA 4QHTA 4QTXA 1G2QA 3SE0A 2P0AA 3AEKB 3MQ4A 4Y9SA 1PZXA 2B5WA 5CH3A 2B9VA 1NJ8A 2JJQA 1S3FA 5TGTA 3JS5A 3MPOA 1SHTX 1A5SB 3OPVA 2RKBA 2C5FA 4ZEOA 2YYZA 3RYIB 4N5DA 4B3GA 1B7GO 3QBDA 4P53A 4PG6A 3W5VA 2O19A 4PLFA 2QTMA 4PX9A 5IHXA 2WWGA 5JNWA 2NXCA 1PWEA 3TKLA 3DBHB 1TJ3A 3OPNA 4M9CA 3B13B 3BXXA 5NLLA 4E22A 1QHEA 1NVMB 4OBEA 5H70A 4KYTA 1MFPA 2BR4A 3RRBA 3QX9A 4R7GA 4M9RA 4FMDF 2JJ2D 3LUHA 2P2YA 3HU5A 2F3PA 2HLNA 4FILA 5BW8A 3PE6A 4O8CA 3L1UA 3W34A 1ZJ5A 5BSMA 2PMCA 1DBVO 3C5WP 5B2EA 2GBPA 2PD6A 5F1YA 5AVJA 3IE1A 1SG6A 1NXOA 3OEWA 4M1KA 4KXFB 4D81A 1JR4A 2JIRA 3PYXA 4ED9A 3ACBA 4FUQA 4LXTA 3TW8A 4YUZA 4G4GA 1PDOA 1NPYA 3M6MD 3S8EA 2ZWVA 2C42A 5DGCA 3ZD8A 1RAGA 1MH1A 2K5UA 4RKYA 3SJCA 1EFLA 3E3AA 3G2NA 4L0QA 4E51A 4PICA 5CFQA 3D0QA 1KQFA 4LWPA 2F1JA 2C2BA 4BCCA 3A0UA 1N6KA 4INJA 1LDYA 1I94B 1V47A 4XWKA 4DOMA 1VDMA 2FUNB 1V11B 2W6QA 4TVOA 2ZYWX 4WY5A 5JMTA 2NMVA 3P9RA 5E3IA 2ZLBA 1W7AA 1LGYA 1QP8A 2CXRA 4IDFA 4GQAA 1NKTA 5FWYB 3ZZUA 3UB3A 1ESDA 2PGIA 4LRYA 1V45E 4LXUA 1RU3A 4ZRNA 5KYTA 2Q5QA 1EX1A 3LPLA 1SC1A 2FEWB 3Q5EA 1TTHA 4X1YB 1G20E 3IUEA 4FEAA 1KIAA 4HS9A 2ZB4A 2ONJA 7ABPA 2X4IA 3EIFA 5JZ9A 1IIRA 1NBIA 1VHLA 3G82C 3NC4A 4ADSG 4MZDA 3H97A 1XZBA 4U7JA 5DBFA 3V8EA 3H9EO 1U8EA 3KKZA 3W4JA 1DIHA 1ZGZA 4E11A 4OX9Y 3HCRA 4C4ZA 4MOWA 3U49A 1XR3A 2IOYA 2R6GA 4R5HA 3I9NA 5KWSA 2PMKA 4HGZA 3W3AA 1QNLA 2Q2NA 3PNBA 3QVTA 1XL1A 2QAGB 3K9BA 4ETMA 1Y3IA 3FLBA 3HL0A 3AW8A 4PZUA 5M34A 2ZUBA 5T4HA 1HNWB 1CJKC 1UWKA 1BN7A 3BL5A 4OHPA 3HABA 5IH7A 4PAGA 4EEKA 3T34A 5ECWA 1VA4A 1N3BA 2X5KO 3UJAA 3ZWOA 3A6KA 3KQQA 2D1SA 4GGOA 5EXPA 1F4LA 3O4JA 1F3OA 1QH9A 4EI2A 4WZBE 4JBYA 4NWIA 5D1HA 4AY3A 4GI1A 1FRFS 2A57A 2HWYA 1HFEL 4K87A 3H1GA 4TXHA 1QVZA 4YN3A 1ZNYA 1Z4QA 2KWIA 2XE6A 3WLRA 1E7MA 3M89A 4H1WA 2LCQA 2XJ9A 1CS4C 3FDIA 1L2TA 5E6SB 2HBYA 1EK5A 2FQWA 2CNOA 3M6XA 1R4MA 4RV9A 5AOAA 4CM4A 1AKUA 3WVNA 3I4FA 3BRCA 5DLEA 1XJCA 2O5RA 1Z0ZA 4B7CA 4DLNA 2FE4A 1BMFA 1P2BA 3GUHA 3QU5A 3P0JA 3BAZA 4JLMA 4JQOA 4OH7A 4PQEA 4EJMA 4BBPA 4E4YA 1F0KA 3G49A 3P9ZA 1VCOA 2PMBA 4RTJA 1T0PA 2GEFA 2WJVA 1N1EA 3HCCA 5IKOA 2DLDA 1JI3A 2PXHA 3DM5A 3P9XA 5JO9A 3M4XA 4RJLA 5I4IA 2QOEA 1FNNA 1YJXA 4MUIA 4BLQA 3RC1A 1Q7EA 2DY1A 3AL3A 1F1BA 1HYQA 3L4BA 3FNBA 3EVZA 2VZEA 2C3YA 3DBOB 1OD6A 3MMXA 4G0XA 4PSDA 3DBRA 4UW9A 3SJZA 4IL5A 1H8ED 3LXXA 1F60A 1T1GA 2X7JA 3LY9A 4DSUA 1FSZA 3K9HA 1ZUD1 1R9MA 3PGJA 3GFRA 1FXWA 3MS2A 4A36A 3DMTA 4C6HA 1PNOA 1AB5A 1AK1A 1F20A 3A4TA 4TMZA 4XSGA 4ZU6X 4JOBA 3ZZNA 1N9ZA 2NV2B 3ZVNA 1CQZA 1JSCA 2IEAA 3UATA 4B6RA 4MO9A 4U8HA 3BF8A 1JNXX 1GZ3A 2ID9A 2O20A 3FWPA 1OB5A 3T99A 4MQ4A 1CY7A 4RAOA 4MW1A 2O9JA 1S2LA 3J80A 3JR7A 1CZUA 5DLDA 3T3EA 3GOHA 1Z0AA 2YHUA 2GAOA 1Y5NA 1FMLA 4Y2QA 3CX4A 4LFCB 4DLRA 4MVJA 1Q6YA 3N53A 4HNGA 4N3NA 1ORTA 1TUBB 3PR2B 3UJ7A 3ADDA 4OJMX 5A4AA 1R6DA 3C39A 1TEXA 4OQZA 4TM8A 4FFLA 3JVDA 3MSCA 2JRLA 2A88A 3LC2O 5J2UA 4H3HB 3B1FA 3OLWA 5HFNA 4O3MA 2JANA 4UQOA 2VJCA 1LH0A 4XFKA 2IUSA 3RIHA 1IBSA 4TQAA 3RKUA 3TD2A 2DPYA 4M1ZA 4QAQA 3IDAA 3JW8A 3W8DA 1UJ4A 3GNSA 4YDRA 3RUEA 5JS2A 3B51X 4X54A 2ZIFA 1Z45A 1OKKD 2PIAA 1XCGB 2PRZA 3M5DA 4CFSA 5FPYA 5CG1A 5FWNA 3ZE8A 4B4DA 4I4TB 4P5DA 1LQ2A 3SQNA 1SHKA 1U0HC 2VYND 3AR8A 3SQWA 3EA4A 2QSYA 5H16A 1XTKA 5IABA 2DBRA 3D6NB 3UK2A 5JH7A 1KZGB 1NLZA 3L04A 2O3TA 5TEVA 4BP1A 1LK0A 1E9SA 4GZ6A 4ROTA 1JSRA 3T95A 3RVPA 1JR2A 3B3AA 3EQ8A 3NWEA 4BYGA 1MAVA 1COWA 3HJHA 2YUTA 1EBUA 1ZJZA 4BMZA 3QVGB 1D4ZA 2ZE5A 3S44A 3EG9A 2SHKA 3F46A 5IXYA 2WWFA 3BXOA 4P34A 3VI4B 2D5AA 3RVSA 2CNBA 1YI8A 5L7TA 2Z5GA 3AO0B 3PLAE 5BQ5A 4Q7LA 1MAAA 3H0KA 3I61A 2DWOA 4HOYA 2Y3IA 1FDSA 2EG9A 3H2JA 3NM5A 1Q3HA 2XA1A 4RVFA 2CE2X 2R8YA 3K32A 4ZRDA 4KMMA 2NO7A 1Q0UA 2WINI 3HCAA 5JW6A 3ZDAA 2PL1A 4BNJA 3I01M 3VU9A 3ECAA 1LXCA 1FFBA 3BHIA 3N05A 4YFVA 2QJFA 1PEYA 5CD9A 2A78A