4NNOA

Crystal structure of manganese abc transporter substrate-binding protein mntc from staphylococcus aureus bound to a zinc ion
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
278
structure length
278
Chain Sequence
KLKVVTTNSILYDMAKNVGGDNVDIHSIVPVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSKDVKPIYLNGEEGNKDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQLEKLNNDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQMRQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTDSIGKEGTKGDSYYKMMKSNIETVHGSMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein
publication title CRYSTAL STRUCTURE OF MANGANESE ABC TRANSPORTER SUBSTRATE-BINDING PROTEIN MNTC FROM STAPHYLOCOCCUS AUREUS BOUND TO A ZINC ION
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transport protein
total genus 108
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2013-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4nnoA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4nnoA01
4WZAB 3ZK8A 5BVGB 4WESB 5BVHB 1QGUA 5JPDA 3MWFA 3AEUB 2OSVA 3HJTA 4MDYA 1QH1A 1MIOA 2OV1A 3AEKB 2AFHA 2PHZA 3MINB 1FP4A 5JOQA 5GGXA 1QGUB 1M1YA 3GI1A 1QH8A 2X4LA 3PDIA 3ZTTA 3AETA 1QH1B 1MIOB 4IRMA 2AFHB 5M34A 4GICA 1FP4B 5M3BA 2YNMC 4NNOA 4G09A 4OXQA 4DBLE 4UDOA 1M1YB 4HMPA 1N2ZA 5KOJA 2WI8A 3AERA 1QH8B 1N4AA 3CX3A 4M7OA 3LI2A 3AEKA 3PDIB 3AETB 1N2CA 1ESZA 5B58T 1K0FA 3G9QA 1TOAA 3K1AA 4TKVA 5CR9A 4H0FA 4WZBA 3R5TA 4MO9A 4XPIA 3AERB 5KOJB 2MINA 5KOHA 4B8YA 1N2CB 4OXRA 3PSHA 2O1EA 2PS3A 3NU1A 3K1AB 1PSZA 4TKVB 5GGYA 4WZBB 4XPIB 3TLKA 4K3VA 2R7AA 1L5HB 1G20A 4HMQA 4TKUA 2MINB 2AFIA 2XDQA 5KOHB 2YNMD 4ND8A 1K7SN 2XQVA 3HXPA 1K75A 3TEFA 4FNAA 3MD9A 4WNAA 1H1LA 2OV3A 3AEQA 1KAEA 4H59A 1G20B 2PRSA 4TKUB 3BE6A 2AFIB 2XDQB 2M6LA 4ND8B 2WHYA 4FILA 4LS3A 4WN9B 3EIXA 4WNAB 1H1LB 4LJSA 1L5HA 3UJPA 3AEQB 5FLYA 3ZK7A 4UTOA 3LHSA 4INOA 2XV1A 3BE5A 4N01A 2Q8PA 5JJ5A 5KHLB 4PM4A 4OVKA 1M1NA 2XUZA 1EFDN 4INPA 1KARA 4HN9A 3PSAA 1K2VN 2PS0A 3EIWA 3R5SA 2ETVA 1G21A 4WN9A 2M6KA 4FKMA 2XH8A 4MX8A 2Q8QA 1M1NB 5HX7A 5AFSA 4UTPA 5M29A 4NNPA 2QI9F 2XY4A 1G21B 4CL2A 4HMOA 2R79A 2OGWA 5M2QA 4G07A 3MFQA 2PS9A 5JG7A 4UDNA 5CX1A 1N4DA 4MLZA 3AESA 1XVLA 3U7QA 5HDQA 1M34A 4WZAA 5BVGA 4WESA 5BVHA 3HH8A 3TNYA 2RG7A 4PAGA 3AEUA 3ZKAA 5CX1B 4FI3F 1KAHA 3AESB 5I4KA 1PQ4A 3MWGA 3MINA 4BBPA 3U7QB 3ZK9A 1M34B
chains in the Genus database with same CATH superfamily
4Q7EA 4WFJA 1C8VB 3OEHA 4EFLA 1IBLB 4L5AA 1GSOA 4QL3A 2X9LA 4ETIA 2V7QD 3QBVA 1BS2A 1G4HA 1L7QA 2X0IA 2FR1A 4B2YA 4B3IA 1GLVA 1JAYA 4Q9LA 3AI3A 3OLQA 3CWQA 3BK2A 1G17A 2IZ6A 2YFQA 4OHKA 4IF6A 5CFZA 3WRYA 1Z8FA 1LVUA 2B4AA 3CTMA 3F8WA 1NVVR 3N8DA 2EG9A 4JR1A 4Q4JA 3EXEA 5DHAA 2J8ZA 2GF0A 5F1OA 3H9BA 2FE1A 1ZOLA 4TV9B 5EFOA 3L77A 3W3AH 5DHFA 3FBWA 3UJDA 4G09A 1GPKA 3C3BA 5BWOA 1QIDA 5BRAA 5D3ZA 3GLGB 2CEKA 4DCVA 2DTEA 1M6VA 3ETNA 1L5YA 3KSUA 1PR1A 1EI9A 2XB6A 2ZS7A 4B4WA 1PGOA 1N1GA 4RC9A 5B2FA 4F7WA 4O63O 4D8UA 2PYDA 1Z0IA 1DBQA 4J2HA 3IHTA 2ISSD 2XCIA 4RACA 5ESRA 4MUKA 1W6UA 3KWFA 3FLAA 1SBQA 3A1WA 3RKUA 4CMEA 2BMJA 2E1PA 1RR6A 5JXIA 3ACBA 1U0NA 3U4GA 3NHLA 5FCDA 3FYUA 4FN5A 4LN1A 4GOKA 3KXIA 3BXXA 5HGJA 4YCMA 3DFUA 2IXAA 2IPAB 2ZSKA 2IP4A 1CUUA 2QI9C 2P9BA 4NZNA 4FHFA 3QWHA 4FUQA 4NX2A 3M9LA 2G08A 5FX2A 3TN7A 4ZV4A 1ORRA 1J8QA 2NZWA 3TRJA 2VDMB 3JQRA 4KLRA 4ZYYA 2P62A 4EA7A 1XZIA 1AK2A 2GEFA 2RK3A 3GFGA 1U9ZA 4CL8A 3BMNA 4K9PA 4XDYA 4YP0A 1P73A 5BWMA 5JNLA 1EG7A 4RKQA 4GYYA 1Z73A 1Y9DA 3RJMA 1X1CA 3S55A 2NZJA 3ONNA 2VYVD 1CC1S 1UBTS 3QFFA 4ZANA 5EMKA 1ACLA 3GGJA 1VL6A 4TX1A 4Z3DA 2V7QA 2WA1A 1C7EA 4DSNA 1ICEA 3AKEA 1OB5A 1EFDN 2I55A 4QXMA 1BAPA 3MJDA 2XEDA 4UUAA 3P9RA 1RRVA 5FFMA 1IBRA 3OWHA 4Z4IA 1I30A 1LBTA 1YDHA 3CN9A 2QAGC 3EGVA 3H8WA 1VPVA 4GRAA 4QFCA 1MGPA 2Q2NA 4Y9RA 3ELUA 4IXWA 3V7YA 3CUUA 1NN1A 3H7AA 3GCDA 2DF8A 4U5QA 4D26A 1SVMA 5EKDA 3WYAA 4JI7B 1ZOIA 3TBKA 3HM9A 3OPYB 1RPTA 4PGGA 5D3QA 5SYMA 3GEMA 3QP9A 3G1UA 1A7AA 3RVJA 5BNIA 4BP9A 2WAXA 1BVUA 1NASA 1QFSA 4C6RA 2J3IA 3BSSA 1G8FA 2YQZA 4BNJA 1JL3A 3CY6A 2OQRA 1I7LA 4DT1B 4O4JB 1YS7A 3D3KA 4AMVA 3A04A 3TSWA 4OTZA 2VSXA 4S2EA 4F5EA 1T1RA 1PJCA 4YHHB 3QSYA 2CE7A 5I3CA 5B1EA 4Q66C 4IUYA 3QRWA 2X77A 3V42A 2C1XA 3HACA 4FHEA 1PS8A 3AB8A 1S8FA 4ZQBA 1Z4QA 3FHLA 3KKZA 4Q4LA 4DLKA 4N40A 1KK3A 2JLVA 2QT9A 4CBVA 2B83A 1N2CE 3N74A 4TOIA 3U1BA 4PTZA 4BMXA 1FMCA 4JEUA 2W0MA 3Q7PA 1LWNA 1NF3A 1SZCA 3LT1A 2XQKA 5EFZA 4TXLA 4UOEA 3PXBA 5INTA 1C9NA 3VYUB 3FN4A 1DWQA 2AI2A 3QJYA 1EXWA 1MO3A 1OHHD 1XU4A 1QHEA 2H0QA 2OTCA 1RKUA 2WD7A 1YVUA 1Y8RB 3HWWA 4M8IA 4PAQA 4RSMA 3KSRA 4CGYA 2MMGA 3HZZA 1DG1G 1UMBA 3KTDA 1E1DA 4UATA 5EJ5A 3TSAA 4IQGA 3PHIA 2NAPA 4JKIA 3TW8B 2BBWA 3NCTA 1LJUA 1VDZA 3GEGA 2YIMA 3HYCA 3QMVA 1BYIA 2D0OB 4QOFA 3MZ0A 2E4WA 2G9VA 3H5IA 3TLMA 1L5MA 3D4IA 2I65A 3JX9A 3ZN2A 2ZKIA 3AFMA 3B2QA 3BJMA 2JJ8A 2C82A 3OC0A 4FGJA 4BLRA 3T35A 3GQVA 1HKUA 2BM8A 4TKVA 2I7XA 4LMAA 4MGKR 2IP2A 2C1ZA 3LL4A 1CZNA 1T25A 2Q7OE 4BQSA 10MHA 5JSYA 2BBTA 4UASA 1BX0A 1N2CB 2HADA 3AW8A 4KL8S 3ZDYB 4BPRA 4IQ8A 4CETA 2PS3A 1PWHA 3A58B 3H2KA 3PITA 3OETA 3G2IA 1T2NA 5GGYA 3OG9A 3FTCA 5C37A 1L5HB 1XKTA 3PHHA 4KUGA 2JARA 2IW3A 5JROA 1E2NA 5L7TA 1VE7A 3TQFA 3L05A 4KXFB 3Q3CA 2KI5A 3THYA 4EKGA 1KZ1A 5JLAA 3Q2IA 1M8FA 2VWQA 1VSUA 2HEIA 1NSTA 3EAQA 4J6FA 1NXSA 1VHLA 4KXXA 4UVGA 3G0HA 5FKJA 1MO6A 5E9WA 4LHSA 1L7MA 3VHXB 3ZKAA 4BQOA 4EG7A 4WNAB 5B1YA 5D86A 5DNUA 3ZD8A 1DXHA 4MLDA 3K1TA 2J41A 4NK4A 4PYMA 2P9TA 1AMUA 3GD5A 4WK6A 1I5OA 1YCHA 1EH5A 3DLPX 3UWKA 3O94A 4BQFA 2D1YA 4YV7A 2CWDA 4WGGA 5I3ZA 4WWHA 3I62A 2JZNA 3QF4A 4C6HA 4J0IA 3AC0A 3B1KA 1FVHA 2L18A 6LDHA 1CUWA 2G88A 3VPHA 5IKXA 2AYZA 4ZI7F 3KQTA 1J8MF 3MNFA 3R4CA 4TLDA 3ND8A 4L72A 1E1RA 2HF8A 2VDQB 2WUGA 1H6AA 3UQYS 1Z4OA 2HH9A 5LUBA 1YKGA 3TLCA 1BFKA 1E9VA 2Q3EA 3GJSA 4RF3A 1YK1A 5JUWA 1TL7C 5FWAA 3U1TA 1IXYA 2QRVB 3NBQA 1AN0A 3MUEA 5F1PA 3PPYA 5IT0A 5CT9A 1S4MA 1U7TA 4O59O 3VPSA 2FZVA 4NPHA 5EP1A 3IEPA 1RKQA 1RQNA 4KB5A 4MGHA 1XD8A 4AMGA 1Q1BA 4IOLA 4DDKA 1A77A 1CR4A 2H2DA 1E2LA 2HQSA 5FTKA 2P1DA 4KLNA 1ZR4A 2QVLA 2ZPUA 1GA4A 3IX7A 5C8YF 2VVTA 1JHZA 3GDWA 2H4XA 2FEPA 3V1KA 5IDQA 1V43A 2GPTA 4MEBA 5H4HA 2X9GA 1JKJA 4RGVA 3OP4A 3SS8A 2OVBA 3ZW8A 1UF9A 3H5NA 3DDUA 3GFPA 4OQZA 4R2WA 4B2PA 4MVJF 2P9EA 3DWFA 3WA7A 3SIXA 4Y9UA 4RXUA 5M04A 2OFWA 2IYPA 2I5PO 3CE9A 2BZ0A 2JNWA 1KU6A 2D1FA 1XQVA 2ZQYA 1PJSA 3EJWA 3K0CC 3MAGA 3VH3A 1JIXA 4RD0A 3ND5A 1Z5NA 4FLMA 3NETA 5K8CA 5M5BA 3DD1A 4RDHA 5BOSB 3JWJA 1T0JB 1QRUA 1CQIA 2FHSA 2QX9A 2C4UA 2OESA 1G18A 1E9BA 1P2VA 1VIMA 4J1QA 1IRIA 1SO8A 1YZVA 1XMIA 4QJ5A 3VR4H 3K0FA 2YH2A 1J0CA 4EO4A 4NIMA 4HNHA 3O4HA 4CF7A 4CKWB 4JI4B 5FOSA 5CJ2A 5KPDA 1YOBA 1BTOA 3KWMA 3N7TA 3PT9A 3HEMA 3IEXA 4NRDA 3J80A 2Q6OA 2O8NA 3SWWA 3OO1A 4MPTA 3G89A 4PSAA 4HRVA 3TLGA 3ZLJA 4EDHA 3B38A 4WI1A 2WV7A 3N2YA 2HMYB 4PQRA 2H6EA 3CEHA 1W4CA 4B71A 1XRNA 1JN0A 4ODIA 5IANA 3EX7C 4AW9A 4DQUA 4JQCA 2D4AA 4WXEA 3WX0A 4BFTA 3CVWA 1P74A 1FX0B 1G20A 2Z56A 3DBRA 4UTRA 2VPZA 3TB6A 5E6RB 2O8CA 1H4SA 3VR5D 2BFDB 3LKZA 3DDHA 3ZHRA 3M6UA 5KKCA 2Y1FA 5HTOA 3PICA 1DAEA 3WOVA 1ZIYA 3WNBA 1R6AA 2OV3A 1BFUA 3ELBA 3VPDA 1JPJA 1NOIA 4WK2B 4XGIA 1A4IA 3CF4G 2XAUA 2C5HA 1MTZA 4MARA 4OG2A 2CF5A 3OQIA 2VZ8A 2J5QA 1I7SB 3FSRA 1JYFA 3GUHA 5CNJA 1E2IA 1CRLA 4HLNA 4AZWA 4V1CB 2JD0A 5FUQA 2J9XB 4W5RA 4JVNA 1BCRB 1EPUA 5DTQA 1IY0A 3UFBA 1DAHA 1TM2A 2AL7A 4FFVA 4O33A 4DC0A 4BBJA 4CF4A 4ZGGA 3GRAA 3C0KA 2H0RA 3LVRE 4TUYA 5J3JA 1YI1A 2NTVA 3M4JA 2IUTA 3O3CA 4TT8A 3T4XA 4BNIA 4EEZA 2PUTA 3U61B 4RLQA 3AFHA 3LCRA 3R7WB 5U9CA 5J59A 2X9VA 1TJYA 3B1FA 2IOFA 5HE9A 2PUAA 1NX6A 4OQLA 3UICA 2BHRA 4BIIA 1E4EB 1YBFA 1EA7A 3DKRA 5TMDA 1MORA 1NDQA 2IEAA 2ZTSA 1CUIA 1TNDA 1NTOA 4JUAA 4LHEA 2FR8A 2I2DA 2PXCA 4GRDA 4RSRA 1EWKA 4MRSA 1XZDA 1N75A 3KQWA 1C3JA 5H70A 3T4UA 4K9QA 1D0VA 1MU0A 3J81A 4RQBA 1E7MA 3A1UA 4GECA 4ENTA 3RNOA 1Z0SA 4LAFA 4ND2A 4C7JA 1QAMA 2VG8A 2P4QA 1E0AA 4GZLA 3PC7A 1Q1QA 3M9XA 1W29A 3O9ZA 5KI6A 1OIVA 4E6EA 3L8EA 4JD5A 3OTHA 3KLMX 2BELA 5B2ZA 2YCBA 3G82C 4QEZA 3Q7TA 1J24A 2YWXA 3UTCA 1G1MA 2QLBA 1KL7A 3V8MA 4MUBA 1UANA 4LCJA 2G8NA 1Z08A 1P6XA 1XZ8A 2NGRA 3K4QA 5TQ0A 2F8SA 4YUZA 1BXRB 1YRBA 2JH9A 1DCFA 4OFXA 4OLJA 4URUR 4ENSA 1WF6A 3CRW1 2BN4A 2ORWA 4HG2A 1AD2A 1CUGA 5KQMA 2APJA 2OV6A 2XQJA 3C8MA 2ZP1A 2FQQA 4H3HB 5G3YA 2HBRA 4CHGA 4ZCIA 2GKOA 1V4NA 3I01A 3Q2OA 4GPZA 1DBVO 1JH9A 1YIAA 2IVZA 2ZB4A 3OCUA 1NYRA 3MS7A 1SRRA 2X4LA 2VDJA 4PX5A 1EX6A 1II0A 4YCAA 3O03A 1CUZA 4CEIB 4KPUA 5JAZA 4HAXA 9ATCA 1OBOA 4C7KA 4AS1A 5JD3A 2Y8EA 3EHEA 3JTMA 1WZ2A 2JFXA 1CR2A 2DTXA 3QKSB 4J94A 4Q12A 3KXPA 2C3PA 4GOJA 4I5DA 4BO4A 1U2DA 3G9ZA 4ZV9A 3IVCA 1BVYF 4LXUA 1NMXA 2C4NA 1KTIA 4PZLA 2BHNA 3MGKA 1UXIA 3U7JA 4KV7A 4GM1A 2FN4A 5LMUB 3BZBA 4AZ3B 4U7WA 3AERB 5JZ9A 2FEKA 5K0JA 3TUZC 4FC6A 1EVIA 1D0SA 1VIVA 2BI7A 2D4HA 3QSGA 3L4BA 4PCVA 3ZXXA 4WFIA 4Q5IA 5IAAA 1C0LA 1TCUA 3R41A 1G16A 2AXNA 4EENA 3NWJA 2HCTA 2WD8A 3SVLA 5ALOA 2J30A 2FEAA 3OQPA 3TM4A 2ZCJA 4CNQA 5CMLA 1GSHA 4OP1A 4XM2A 3UB4A 4BNXA 1K7SN 4D6YA 2J48A 1D1PA 3E84A 5THKA 5J47A 1GVHA 1VM6A 3JAKA 1BKDR 2ZRDA 3BE4A 1SJ9A 3IBFA 3SXPA 5D8DA 1SG0A 2M6SA 4G1BA 1EGQA 3N0RA 2AGVA 2IDKA 5CRIA 1TKBA 3FNQA 5DYIA 5BMVA 3QVUA 3GVCA 3V4LA 4WTOA 1V47A 4YJ3B 2XGJA 3ZVKA 4C14A 1NOJA 2JGDA 5HMLA 3QYAA 1COWA 3BE5A 1Q22A 4RJLA 2FU5C 4Q4DA 1RVDA 3C24A 4YTEA 3TF5A 5IVIA 5MN6A 3CX7A 3K5WA 1Z35A 3H5LA 4ZAZA 3H4VA 4PR0A 1D6NA 3OQNA 4RMGA 1YB1A 2REBA 3NDIA 3DPIA 3L3BA 1KI1A 3K09C 1FRQA 3EGDB 1WDTA 3KB8A 4DVGA 1YU6A 3U37A 3N53A 2J9YB 5FFNA 4A82A 3W3AD 4C0XA 5KAMA 1RXUA 1NXVA 1A5AB 3CZQA 1TZMA 5EA2A 1ODSA 1NHGA 1XVUA 2ZWPA 3FLEA 5F5LA 1E79D 3N9IA 2XMZA 1NF2A 5GZ6A 4Y2SA 3A9TA 3UGKA 5CEFA 2A5DA 1UBLS 1U6IA 1IDN1 4Q3BA 1E6CA 1U7DA 1C9JA 4OK6A 1TF2A 4J4HA 1LPBB 3SBXA 3VV3A 2H06A 3BIOA 3E3LA 4OYLA 3ZY3A 5FADA 3U4HA 4JOSA 3L4JA 5FXMA 4XCQA 1F8XA 4WGFA 1U1DA 5REQB 1QBKC 4YT5A 3H99A 2B5VA 1CWUA 1RPNA 2GERA 2IY7A 1Q7BA 1GZUA 3AEUA 4F5WA 4RZIA 2PX8A 5J2TF 3WZLA 1DV2A 1NNUA 3ONVA 4OYRA 2PMEA 3D1VA 1IY8A 1J9EA 4NYJR 5GJCA 1VG9B 1NOKA 1UCFA 1WUHS 3ONDA 5DU2A 1M73E 3AM4A 5C0OE 1Z0JA 3SNKA 2UUCB 4X92A 1OGYA 2Y99A 1Z7GA 3SE7A 4TQAA 1BH6A 4PYNA 4DB2A 1NG1A 2WJJA 2ZUUA 4MUIA 2XZPA 3TIVA 3SSOA 3NTRA 4K6GA 3DMYA 3A6ZA 4EUSA 3BDVA 3PI7A 2G9UA 3KEMA 5DBGA 4YP6A 5A7HA 2OHOA 3RIXA 4DEYA 2GN6A 3BL6A 3E0QA 1ZN9A 5F7JA 4ZT2A 2VF7A 3G2HA 4LYGA 4HQLA 4A92A 1Z8NA 2BC9A 4LOLA 2HDWA 2YNMC 4HFRA 5DN6D 4DMHA 5K7SA 4B85A 1FFXB 2WTMA 3QI2A 2WP8J 5I4BA 4Z9FA 3E4CA 1AO3A 2JB9A 4YRDA 5FUMA 3A6HA 2CZQA 1NN0A 2DQSA 3DE5X 3SIWA 2A7QA 3CRNA 3L0SA 4G0QA 3UHFA 4IRXA 5G4KB 2IU6A 3FAKA 4B6RA 5F23A 4WXYB 4C6TA 3K9CA 4H35A 1PKXA 1G66A 3VSDA 3WIUA 4N7MA 4UJ5A 2BZSA 1A2KC 1PNVA 1XEXB 4OM7A 4E5PA 3RVRA 1GVNB 1FB5A 1ZJ5A 5IM4A 3PJDA 5H3LA 1J49A 3C6KA 4ENRA 3DE4X 1IWPB 4QEKA 1ZVVA 2VQSA 1E0DA 4Y3UA 3H1TA 1D03A 2OCBA 3UZUA 4AT1A 1E79A 1EAYA 1KMHA 1E3EA 2GAFA 2GBLC 3PHLA 3EBOA 1KEVA 4FE7A 4NEQA 2XTJA 1UODA 3H05A 4LRSB 4GXQA 4AF6A 4EFNA 1U9IA 3EB9A 1YZKA 1O9GA 4UNIA 5JE8A 4D74A 3GYGA 3P32A 1PDWA 3RC8A 1Y1TA 1CCWA 2RAVA 4GXTA 3A3KA 3C6ZA 1W35A 2CXHA 3T6KA 1QE3A 5ER6A 1DC6A 4KWCA 3WRXA 1K3FA 4PSDA 1SMKA 2VK1A 3LK7A 4P2GA 4B32A 3PNOA 1E0KA 3QNUA 4C78A 4BVKA 1PYGA 2ZJ0A 3KSDO 5CXQA 4CN8A 2VUUA 4BNGA 2QPAA 2ZSHA 4RJKA 1J0BA 1YU9A 2QVZX 4QM6A 5F5XA 3R74A 3PPIA 3UKJA 3L7LA 1E92A 5A9RA 2Q8PA 1BA2A 3CR3C 1P0PA 4TRNA 1VRVA 3NIBA 3QWIA 4PWYA 4K2HA 1EYZA 5CB8A 1AURA 1XKXA 3KOXA 4F3TA 1YBAA 2X4DA 4DMCA 3ZDBA 1LDNA 2GT1A 2PIDA 3E8XA 2RJ3A 1GZ3A 1HA3A 4G5GA 4FB4A 3OY2A 5AW4A 3KUKA 3BF8A 4QFDA 4RABA 1RYFA 3PB3A 3GCWA 2P9QA 2VPQA 5DN6A 3Q3VA 4PLHA 5DKFA 4FOLA 2QI9F 5I9SA 1J23A 1EK2A 5KTTA 4W7SA 2B6NA 4TMKA 5ALVA 4Q3NA 4YONB 4RYLA 4XR4A 3FYDA 4BJ1A 4NPCA 4UZSA 1E5VA 1VMAA 1LX6A 2BFCB 2ZTMA 3Q0TA 3LHDA 1TU3A 1XZCA 1KGDA 3N8IA 2SICE 5IJ0B 3F4KA 3Q7RA 4IIJB 1UP7A 4WZAA 3AX6A 3VU3A 3MA0A 3IB6A 1KP2A 3WGMA 5EJ7A 2DG2A 4UUMA 1EQUA 4JA2A 1SU8A 3SHTA 3IV6A 4ASUA 5ADWA 3AL2A 1OI3A 3PEFA 3U80A 1ADFA 4WBSA 4WESB 3UOAB 3WV5A 1UOPA 4U7DA 2LCFA 2QJTA 2DFLA 3DEYX 3A06A 1EE2A 4KH0A 3HCBA 2J9RA 2X8JA 1Y5RA 4LHVA 3TI9A 4KU4A 3OX1A 4I4LA 2AN5A 4H60A 5J4VA 1Y8ZA 3VAAA 4RK6A 4X85A 4ETWA 2H1OA 4WLFA 2UUOA 3H13A 1EFLA 1DCKA 1VSVA 2P2GA 4FS8A 4NPAA 3R2JA 4BZWA 1KQGA 3NTOA 3N3BC 4YK7A 5FF9A 4DA8A 1V3UA 4MLPA 1VKOA 2I67A 1ULBA 3D64A 3IEUA 1QF7A 1FVFA 2ZT6A 3AHEA 3PC4A 4LJ6A 4YJFA 1M1YB 5KTKA 2QIPA 1SA0B 2BE7A 4J0HA 3SFTA 3EFEA 3TIGA 1L4GA 3GMSA 4GP6A 3GJQA 1PT9A 3IO5A 4OHCA 4XDZA 2VRCD 4YMIA 3WMXA 4BDSA 1E2FA 2X1MA 1P62B 3ENNA 3RRNA 4R2JA 3PENA 3GMIA 4EKNB 5J58A 1RQPA 1U2GA 2IOFK 2XCTB 4LKRA 2ZIVB 2K87A 4HRYA 3GG9A 3GEIA 4BKOA 1F9AA 2WZQA 4ZVLA 1WCXA 3ZHXA 2J9ZB 2VPXA 3MTIA 2GM3A 2VDUE 5D85A 4BFXA 3ZDDA 3B12A 1QCYA 1CU1A 4AJ4A 2CVHA 1TVEA 4J16C 4CQNA 2WU3A 2ZBQA 3AJDA 1W0KD 1LS1A 4G9BA 3JYLA 4NCNA 5JCZA 4KDRA 2BCEA 1Z0AA 3OJLA 4LYDA 1QZUA 2IHKA 1GO2A 3W78A 2C54A 4PAMA 4DBVO 4NBUA 3OICA 2F59A 4EF5A 3AVTA 4DIDA 3ZZUA 3ITNA 1AX9A 1I3NA 2WMDA 4G67A 2JIZD 2MR5A 4B4VA 4J6EA 2JPDA 4NZPA 4IH9A 1OMOA 2Z3VA 4DGQA 5CCEA 3O74A 4YMGA 3AOGA 4QVIA 1II9A 2AZDA 5FWXA 4LXIA 3R09A 2VOJA 1TEHA 4YRSA 1X8LA 5FNVF 5H3HA 2EBHX 5LB2A 2BI4A 4U2FA 3QYFA 1F4VA 2HAEA 1V3QE 3GJ0A 5EE3A 5A5VA 1ZVJA 3CSUA 3SBEA 3UO8B 2PCLA 4MIYA 5K0BA 3WGHA 4PGMA 4LXYA 2I87A 1ZD9A 5P21A 4LF6B 1QLJA 2ENWA 4JLKA 1JHMA 3T5DA 3V32A 5M29A 1C7JA 1BX3A 1LI5A 5DULA 5H8WA 2ZRAA 3C3CA 2R5WA 2Q4RA 4Y6GB 2PRZA 1PW5A 3L0BA 5DIFA 3VR4D 3I2YX 4Z9YA 3ILYA 3LIPA 4N1AA 5IJWA 1N0UA 5DGIA 3GBPA 4HV4A 4JN6B 4CN9A 1TTQB 2VRCA 2OVFA 3EH1A 3OJEA 4FMDB 4M4SA 4MLZA 1QGZA 4I3HA 5IH7A 3UXEA 4YQYA 1I3MA 2DM6A 3MERA 2PV7A 3ST7A 1EDDA 3VO8A 1TU4A 1HNWB 4QU5A 3CXUA 1ZK2A 2PBFA 4MV8A 1NUAA 4EAQA 1IK6A 2CYBA 3CLSC 5KJCA 3T1VA 1FSZA 1Z7WA 3WSVA 1MP0A 4WLEA 3AK4A 4CZ2A 1WW3A 1HGXA 1W0KA 3QMPA 1MHPA 4WE3A 3S8MA 5BVHB 2VFAA 3CB2A 3FSEA 1KO8A 3HB0A 4IDDA 1IZ8A 1YR9A 4UNPA 3W04A 3QOXA 1D2MA 1RZRD 1MX5A 3ZOKA 3K2IA 2YMMA 5KYYA 4TV8F 4NENB 4CM4B 2JLWA 4EK9A 3ZWVA 5AI9A 1JHRA 1G8KA 2B0CA 5A7FA 2NVUB 3PGVA 3HZRA 4RD6A 2SKEA 3OZGA 5JMOA 1OU4A 1V6SA 4Q3AA 4JI6B 4BE4A 2Q5JA 1GG8A 1ZICA 3IP9A 4LE2A 1O57A 3SEZA 4EO9A 5B30A 3UPUA 4LF4B 1F5NA 4M7PA 1SBNE 1YT5A 3H2ZA 1P19A 3R9XA 1DIBA 4F21A 1R27A 2VUSA 3VZCA 2A1TR 3N2NA 2CUKA 1IM2A 4M22A 4R1LA 2DBRA 2ZI5A 4EHFA 3P0IA 2HXGA 2VUIB 2W2LD 1HXHA 2DQYA 1G60A 4NMHA 2ZTUA 3HMKA 4A8TA 4M8KA 5AOBA 3VRHA 1QQTA 5H83A 2CLCX 2O4CA 4NVRA 3QM1A 3E7DA 2AB0A 3HNRA 2W6MA 5ALWA 5KNCH 4NE9A 3VR4A 2YFKA 4ZYWA 1WCIB 2PH3A 3RVDA 4GPEA 2DVMA 4II7A 1PJ4A 2WWXA 2XDQA 4JI5B 2XAAA 1ZDMA 2H51A 2DLDA 3Q8XB 2ACWA 3FETA 4NBVA 3HXPA 4D2IA 2AC4A 1QX4A 1AKQA 1JHAA 1MEEA 1PBNA 3DQQA 3FTPA 1M8GA 4MPDA 3JWPA 4D3ZA 1U98A 1YAJA 3H5TA 2JIDA 4UU1A 1CYDA 1W44A 3E9YA 1ORWA 4LNUA 3R6GA 1YFKA 2V6MA 4QNMA 2JRCA 3JRXA 3L41A 4K3UA 4B43A 1C3XA 1GIAA 1M5TA 2BEVA 1ZOPA 3R1IA 2B34A 3BOSA 4W6QA 3F9RA 2OPHA 2REOA 3TJMA 1HE4A 5BYKA 2J33A 2Z0MA 1E1CB 1FK8A 2O5RA 3R3UA 1ZVMA 1SZDA 3EG9A 3KV1A 4G9GA 4O8ZA 2VF4X 2QTVA 3MFYA 4QX6A 3K0HA 1QYRA 1QHHB 1EFAA 4KGXA 3FIJA 3D6VA 4HGQA 1R8YA 2V7GA 1QVWA 1GSAA 1JQJC 1HETA 4IPTA 5AVXA 3AQ4A 5K8IA 1PP4A 4MRAA 1QZZA 4DXDA 3WNCA 1OC4A 1XWWA 3VSAA 2ZDGA 4W1RA 4MVJG 3T12A 2JK0A 1KTVA 4KQEA 3TBFA 1SXJE 2BGLA 2R4UA 1D3AA 2CZGA 3FYHA 4EF4A 3B8EA 2GEBA 4F72A 4QA9A 4HNTA 2CXPA 1KQOA 3NH6A 4G4SP 5EP4A 3T1NA 3AQIA 1XYGA 1PDVA 4MB6A 3FHCB 3L7AA 3ILVA 2W2LA 4JELA 2XGGA 5E2AA 4KE9A 1FQKA 1EM8B 4KX5A 2EX1A 2LCIA 2X42A 3QVMA 3ZV4A 2NAFA 2NTEA 4JBNA 1IYZA 4OMCA 2PJZA 4KMOA 4OUKX 5H7XA 1C9KA 4OHUA 4PGFA 2KBEA 2AN3A 1QO0A 3DE7X 4HX9A 4KQMA 5DYNA 4PNPA 5KUTA 4IHKA 2BTOA 2JANA 3PGA1 1NWCA 4FZ5A 1NN3A 4PCLA 5L53A 4HDRA 3PLAE 1JMVA 2XBUA 4GFDA 4BZQA 1N9GA 1YRHA 3NPMA 4LF5B 3SOZA 1YS6A 2O14A 1ZK0A 4UZFA 3H6KA 1U8EA 2H2FA 3IPRA 3EZ2A 4WSOA 2IGBA 3K6RA 1EVZA 2PD4A 3PC8A 4IJ5A 4R8LA 1MVLA 1MPXA 5JOQA 1DE0A 3V3KA 4FS3A 2O3QA 4AO7A 4H08A 2C5FA 3CG0A 1XNJA 3NAZA 2HJ9A 2VTVA 3O8OA 4AROA 1Q3TA 3BCHA 3CC8A 4RFLA 3ZZ0A 1C4OA 1SC6A 4I55F 1BN6A 3E5NA 4YH1A 3TIIA 2VHQA 1V26A 3B1WA 2QN9A 3FOAA 3SYRA 2JW5A 4IV5A 1P80A 1Z29A 2A1UB 1EUQA 1VJ1A 1KY2A 1YULA 4Q3EA 5LN1A 1NYLA 4BVLA 1NI4B 1RVV1 4KR3A 3I01M 5AKZA 3D0QA 3W8RA 4DMGA 4MQFA 5DM60 5JVDA 3S81A 3TQOA 4G65A 2QQ5A 3R7BA 3ZHTA 3QHAA 3ZJ5A 1VKRA 3ML1A 4P3KA 3EPHA 1C30A 4XR9A 2CF6A 2I4OA 2J67A 3IIJA 4RGBA 2GFQA 1QMGA 4EJSB 4FB5A 3ZDXB 3ELDA 1J7KA 1X80B 1X7WA 2PE5A 1I94B 2ZRCA 1YJ5A 3MQ2A 4Z4HA 3UJHA 5I9IA 4YS6A 4QJIA 2C96A 5K2MA 2PUFA 4UAVA 1GEEA 1XUOA 2JRLA 1ZGHA 4M38A 3WL6A 2QR2A 5HUJA 5AW2A 3NHUA 2QGZA 3UV6A 1TYAE 2HA6A 1G5RA 4EG5A 2PWAA 4B4OA 5F9HA 1ABFA 3NI2A 3G1WA 3MILA 3UV7A 3DE3X 4FHGA 1OC2A 4AMUA 2B0JA 2JFWA 3MEQA 5BNZA 1UKCA 5IMSA 4E32A 4RH1A 1RXSA 4RVGA 2BBSA 3O4IA 3HRIA 4LJSA 2BD0A 2FSPA 4FI3C 1NZDA 1N1MA 3IUBA 4I4TA 1JVBA 1F48A 1KEUA 2A1IA 4GI3A 4KNVA 2OAEA 1A7KA 4HZIA 1VJCA 2GBGA 3PXAA 4E4YA 4HUTA 7REQA 2GN9A 3ZVNA 4A0GA 4GE0A 4NJOA 4UBOA 1T29A 2IITA 2V7VA 4IL5A 4NCHA 1N7GA 4YJDA 2QZPA 1GRRA 3PTLA 1X2EA 1USVA 1IEWA 1RWNA 1OWLA 4M0DA 5B7NA 3A70A 1WSWA 5KTNA 4PG7A 3T4EA 5JASA 3HYRA 3ZQ4A 4RNCA 4B87A 1D9ZA 1PS9A 3OIGA 3SE0A 4BATA 1N78A 5K09A 1NQXA 1H0HA 5D7BA 1VLJA 2CL5A 2C3MA 2YZ2A 2ZJ6A 3NJ8A 3WKAA 3ZBPA 5CBKA 1UT5A 4YBRA 3LUPA 4NU5A 1NQTA 4U39A 3NAQA 1PQPA 4MUYA 2XE7A 1Y1KE 2EEZA 3MTAA 3PYMA 3ZYCA 1ISJA 3HR4A 1Z2CA 3AGQA 5H0IA 2ODBA 3ZU4A 1QV9A 3UG6A 2IIPA 1WDWB 2OWDA 1Y7TA 3U7QA 4JOQA 5FTLA 1N33B 4URHA 3ZLTA 3KKKA 1ZI8A 2KLHA 3OZ7A 4WLOA 3CLRD 3TNYA 4HYYA 3TZBA 4NFHA 1BE8A 1MT3A 1XN4A 4J3FA 3P7MA 2GPSA 4PNZA 5FOXA 4UTXA 2WE8A 3PKJA 5HSGA 1GN8A 5JYEA 5CA0A 3GJ3A 4X95A 2W42A 3IKMB 1UOOA 3VOBA 3Q0EA 1ZK4A 5JMWA 4OXIA 1C81A 1NKTA 5IJZA 1QK4A 4YRLA 1XELA 1RLOA 4GC5A 1M0EA 3RSSA 4AWXA 3GXBA 4CKBB 1NJFA 2WYVA 3UT5A 4UCWA 1TIBA 1QQ6A 2AFRA 2HMWA 4IWXA 4U9IS 2FWAA 3C6XA 2QG6A 4KLAA 2R8YA 4TZ6A 4BCDA 3G49A 4WINA 2NG1A 3KPVA 1EX1A 5CD9A 3LRXA 1JKXA 5F3RA 3NT2A 4FBMA 4JAVC 2BEKA 3QVGB 3G0IA 4UCXA 2AFHB 2IUFA 4ZVRA 4D9GA 4Y2UA 3DAFA 2IZ1A 1MB0A 1NLYA 1NW5A 2M1XA 2NZXA 2PG3A 2TMKA 4I9UA 2AXQA 1C7ZA 2HO5A 2RI0A 3W2TA 3Q7SA 1EG2A 2QZJA 4A0RA 2QRKA 1WTCA 2XWQA 1I4DD 3KBBA 1JZQA 3B5EA 2HMVA 3NWPA 5FTJA 4ZK2A 3PPWA 1GTZA 1CJMA 1GV0A 1K0FA 2CFSA 3IAS6 2I33A 1UIMA 2F17A 3IDAA 1BIFA 4FKBA 4KN8A 2ZAMA 4U2CA 4URYR 4FTWA 5ALJA 4YMHA 5DI9A 4BX0A 1KVSA 3KZXA 3FTEA 3A10A 3AVQA 3SJ7A 2QIOA 2QE7D 1BZYA 3MOSA 3WBJA 2NM0A 2NNLD 4X1IA 1A9XA 3SHVA 3NHKA 3KB6A 1E3WA 1O1YA 3GBSA 2P2NA 4JJZA 4M1EA 4Q1BA 4X1KA 5HM8A 1B1CA 1UZAA 2VRBA 1S1MA 1XAGA 2OL4A 4HDMB 4WZBB 3RIYA 2C9MA 1NDUA 5K8JB 5GONB 1R0RE 5LA6B 4F7DA 1MB4A 5CVTA 1RRCA 3O2JA 3HUEA 2WQ7A 3EVTA 2DWCA 2ZE5A 4BEJA 2I34A 1X3SA 1VCMA 2HMSA 4YV2A 1DXYA 4EOGA 1YVPA 1GDTA 3CF6R 4LHXA 3GGOA 3UH0A 3HB1A 2I4NA 4V3CA 3RVMA 4DWVA 1IPEA 3CWZA 5AK6A 1CUBA 1OYYA 1QB7A 4PYLA 1KC1A 2AJ8A 4LOKA 1ZC3A 3VC3A 1BVHA 4B4DA 1G4AE 4R8VA 3CW2A 2JCYA 4AIRA 3NYWA 4KDEA 3KELA 1L4LA 1DUVG 4DRXA 2EKZA 1M1NA 2R9VA 4RIEA 4GKKB 3PDCA 1KARA 3G7NA 4PC2A 3VU9A 5IT5A 1EXNA 2GNAA 5JBNA 3FSGD 2PSJA 3M82A 3F6CA 2O8FA 3WYNA 3RG2A 3JAMA 4OGGA 5BT9A 2CNKA 4XLZA 3RKSA 5IYZA 2AQHA 3LTNC 1F6DA 1P6QA 1K7YA 1ZD5A 2C4TA 3BSWA 1CYEA 2AG0A 1NRXA 2R6DA 3TVDA 2GB4A 2HGSA 3S2YA 1J0AA 1CS0B 2JGJA 2RONA 3QEKA 5JV5A 3ETLA 4EYQA 2PJUA 2V9ZA 3O2NA 3ZNQA 3U4MA 4ARAA 3PJEA 1NC1A 4MCAA 2JI7A 3LTEA 4OHYA 2HLHA 2GO7A 3GJ4A 4IDNA 3INNA 4Y0VA 4HKTA 1UP6A 1XZKA 2VP5A 3FJ1A 3UYLA 1XTVA 4AIIA 2DR0A 5KNDH 3ZWKA 4OLHA 3L6BA 2EJWA 4PPYA 3ZGYA 2QE7A 3BFPA 1B93A 5H3CA 2V58A 1XNHA 1AUXA 1Q0HA 3D0RA 4AJNA 4CIWA 4PY2A 1PTJC 2O2DA 5DHSA 1T5SA 1DFGA 4HHEA 3F7TA 3MWGA 1M0SA 2C0QA 4HMPA 4TGLA 4X91A 3U1VA 1U90A 6AT1A 3NFRA 2RKWA 3WO0A 3I09A 4O2RA 4YCNA 2AKYA 3RS7A 3B5JA 1L7XA 3IOYA 4CKCB 1UWCA 4HDCA 4TWAA 5I4IA 2PHZA 5BV8A 3VR3D 2Y1WA 1W36D 2XNCA 5GPBA 3PQDA 3BMCB 3WQBA 3RCBA 3FMFA 1E7YA 1X15A 4M8NE 1NG9A 2FDXA 3PWTA 4G23A 1YGPA 1Y42X 2AS0A 3W34A 4JSYA 3V6LA 3KX2A 4B83A 4AUMA 4K9MA 1FP4B 3W8DA 3R8XA 1YB2A 4H1UA 1CD5A 3ESQA 2HA5A 3VO2A 5EZ6B 1A9ZA 3E3MA 4MA4A 3VX3A 3C4VA 3KEGA 5KYWB 3BS4A 4L2IB 5F98A 3DBOB 4L5IA 4UBJA 1YIDA 4GXRA 3LYHA 3EXHC 3FSGA 1Q95A 2QTHA 3B5IA 5I7HA 2O1SA 1R00A 1GGVA 3UMYA 4C43A 2Q49A 3CB4A 1II8A 4IR7A 1DC7A 1W47A 2JHFA 4YO7A 4DQLA 5JFOA 5LP6B 4O4IB 3W1WA 2UXDB 3W79A 3C97A 2QZ9A 3W2EA 1JXAA 1Y5LA 1JHPA 3DAGA 1QTQA 1E7QA 5K3CA 2JGNA 1FTQA 3NV9A 4NMWA 4ZTZB 4FOPA 2RHLA 3TQTA 1W4AA 1TA4A 2YIDA 4ML3A 3DOFA 3TOVA 1TW2A 3FIUA 2PQMA 4LC1A 1TT5B 1HT2E 4K9KA 2XCSB 3ZDEA 2VXCA 3WRYC 5FUWA 1P1JA 5JFTA 3DNFA 2Y0BA 2VTBA 2Q28A 1J5XA 1YS4A 3VR2D 3F67A 2ZATA 3F71A 4ER0A 1B3BA 1J2RA 1PX0A 4BX3A 2R0QC 16PKA 2CK3D 2X4GA 3GARA 3Q5DA 3IUPA 4I3GA 3RB8A 4H6XA 8ABPA 2ZJZA 2ID7A 2YJGA 3GT0A 4R2HA 4X54A 4X5OA 2IWRA 4MYSA 5EMNA 4PG4A 4FR2A 1RAAA 5TGZA 1UKEA 1G6Q1 3E9RA 1P8JA 2M9MA 1YRWA 3VR3A 1KMCA 4BE7B 4LWPA 4MDFA 1J20A 2LCQA 4BQIA 5ADVA 1EGAA 5J1TB 3E7WA 3OF5A 1R2QA 5DLYA 2FPPA 1HFJA 4Y2JA 4B2IA 3GMDA 3JQGA 1UXGA 3OCZA 1L7VC 4YFVA 4RA9A 4CMEC 1XZHA 1GPH1 5DWVA 4I1RA 4EKDA 5JSZB 1ES9A 2N1BA 4Q93A 5FA5A 3FYUC 5HGXA 4TLMB 4FSDA 1EK6A 1XKQA 3FFXA 5H4GA 3AR4A 3WIDA 2VXOA 4H3SA 4YLEA 4WUTA 2PGOA 3M6WA 3VYTB 3LECA 4KBYA 3UH1A 3EFHA 1J0XO 4ON9A 1U3VA 4G0XA 1YO6A 4YFYA 3DFZA 5SZIA 2ZGVA 1JMKC 4TWIA 4BL5A 4EO7A 1TLTA 2C9YA 4UREA 1HTTA 2EGHA 2H2IA 2LTAA 3RS8A 4WLUA 5LZ8A 4J0FA 1EHYA 4GH5A 5DMHA 4CT5A 4DNPA 1Q16A 5KNCD 1Y3HA 1BDJA 2IEGA 3U48A 1XLTA 4GKJB 4IDGA 1PTKA 3NWOA 4KI0A 5EIBD 2AD5A 5TEWA 2EFDB 3OT4A 1TGVA 3RG8A 4EHBA 1YQ9A 3ZHZA 3SBDA 1ZOOA 2RK6A 4ZQEA 5ENZA 5GVSA 4R1MA 5JBIA 1GGJA 3FRHA 4H7PA 3ZCVA 1WY7A 1N5OX 2GSDA 1U0FA 3W90A 1C3OB 5LXTA 3UN1A 1QGAA 2AI1A 1MGOA 1C14A 3VR2A 4WCVA 3UK6A 5ALIA 2F3UA 4M9QA 1TYBE 4AXXA 4YRZA 3MCVA 2CK3A 5CLQA 1GG5A 1SQFA 1GRQA 2RSLA 2WKQA 1O87A 1UJ4A 2NV0A 3B6ZA 4PLTA 4C06A 1ETUA 1UZLA 1EE9A 1JSZA 4BPBA 4JWKA 5BR7A 1Z0ZA 1L4HA 1P1IA 3L46A 1TJ4A 4L51A 3OPXA 4R05A 3F5FA 4F96A 1G3UA 4ZVMA 2DH6A 2ZR7A 1TMKA 3MSCA 4K6HA 2W93A 5EE1A 2AG8A 2NU6A 1H85A 4BTEA 3CVUA 1TKRA 2XQFA 4L8FA 5JJBA 1SVNA 4KYIB 2VTDA 4J2OA 1SXPA 1DQPA 4CM6A 4XQ0A 3P0EA 2PUEA 3CZPA 3H1FA 3INGA 1N2EA 1ZO8A 3AF1A 3LCVB 2A57A 2PFKA 2ZXFA 3ZWNA 3ZOZA 3I5UA 3EGOA 4PZCA 3SYMA 4ZOCA 5EKSA 1OW3B 2QN7A 5ESWA 4ZP1A 3E1KA 5B7PA 1XJCA 3RQIA 3HCWA 1ZUWA 2YBEA 3IJEB 3GD7A 2FLVA 1NVKA 2BFFB 3NTQA 1E1QD 4EYOA 4TYWA 2GD6A 2G4VA 3A1CA 3LOUA 1K0UA 1D2GA 4P5EA 4ZDWA 5KNCA 3GWGA 5ALEA 3IP6A 3T5GA 3NHPA 5C7YA 1HLPA 1Q14A 1NJ1A 1PR3A 4AWBA 2WIBA 3PK0A 3IVXA 4IJMA 3AH8A 1U8CB 5SV2A 3PXEA 4R0VA 4KOAA 1PGJA 5GVRA 1OZAA 1F8FA 1XQYA 4YNBA 1Q1NA 3TLEA 5JPCA 2TRSB 4A6DA 2WJ3A 4AZTA 2FE4A 4PANA 1U4NA 4RE6A 5JY6A 4M0KA 3FUWA 1WIWA 2QVBA 1H5QA 1P18A 1JG6A 4MLCA 2YJ4A 4FPXA 3DP9A 2MSCB 3KHKA 4BGVA 5CLLA 1NW3A 3T8YA 2AJLI 4CG0A 3G0BA 4KFRA 5DP2A 2IYFA 1WX1A 1K8YB 4ZT6A 3WGUA 1KJQA 1X92A 2H8GA 4FFBA 5F1KA 4NBLA 3TCXB 4A9AA 2C5GA 4O2LA 1EFVB 3P0RA 5DEIA 4F4HA 3M3HA 5C5EA 5IJ9A 4YY3B 2P2SA 2UYHA 2UU9B 3F6BX 3TTUA 1PVVA 5M2QA 4EL0A 2B37A 2XZOA 1H4VB 1UC5B 1ZM3A 4ZT4A 3W5BA 2X1HA 1QKJA 1PZXA 3GB9A 4IX9A 4J1TA 4U6SA 3W1VA 2GX6A 1LVGA 1OFGA 2OOSA 4QJ4A 4MI3A 3PC2A 3GT7A 1T43A 1YHYA 3DEJA 4P3YA 2QL5A 4ZKEA 1CUFA 2ZUVA 4YUVA 1UWVA 1P9LA 2IUYA 3GIWA 5ALQA 1U7WA 1TEVA 2YFYA 1IN7A 4MMYB 4EGJA 1X86B 1M34B 3FPFA 3Q5GA 1H69A 3E2IA 3F7OA 4GLBA 4PLFA 5IC5A 3TBHA 3IXLA 1IBKB 1Z25A 3QY9A 3MJRA 5AW1A 5COAA 2EBUA 3D8TA 1KJ9A 3ENVA 3QUAA 3WLAA 2WG0A 1L3BA 1YTLA 2WDZA 4LGCA 4QBKA 4D97A 4N9QA 1Z6GA 1N34B 1BDHA 2B2CA 3QX3A 3RAJA 1E1QA 4KQCA 1LSJA 2VHVA 4J9UE 2IYSA 1JIVA 3F3KA 1H8HA 3WIOA 2O0KA 4IIEA 2G9QA 3K3PA 4OD0A 2P75A 3GEEA 3ISJA 4H7JA 2FN9A 3KVNA 4QQNA 1RABA 3K2BA 4N8SA 4D0LB 4I81A 2V03A 1IATA 1TGYA 1XC7A 3GFTA 2QL6A 4GICA 4UKDA 5TJHA 3U13A 3TCNA 4WN3A 1Q50A 2AC7A 3I23A 3BHNA 1T13A 2Q4EA 4UDYX 3UGQA 3GLHE 1PUJA 1TK9A 1C80A 3U7IA 1CT9A 4HGOA 1F2DA 3NC4A 3OMXA 2INGX 5ALRA 4XE5A 5AXDA 2RHDA 4RVCA 2TMGA 2PZ8A 1T36A 1CJKC 2G77B 3ZS8A 1U63A 5ELLA 1C9EA 4NZ9A 4EY8A 4YCDA 4TXNA 3AL0C 3PD7A 1SVKA 4I19A 1ZUD1 3H04A 4QGBA 4B7XA 4PCAA 2UZ4A 1ECGA 4B6JA 2VJBA 1ELOA 1JLRA 3HCAA 5TSDA 1ZR2A 4FJ2A 5LJLA 2YWRA 4MRMA 2VP3A 2I76A 3OC6A 5DW0A 1Z83A 5I7FA 2ECQA 1W94A 2VAPA 3JQPA 4XWTA 2JLAA 1CTQA 3ICVA 5DZSA 4FD3A 3UMJA 2WLSA 4FFSA 2IX9A 1FJXA 2E1RA 3C16C 1VYUA 1R4AA 1U2SA 4TSFD 2RG1A 1E99A 4LMBA 5KYGA 4LQLA 1P0IA 3QEMB 1V8DA 2AFIB 3BMQA 4ANFA 3KAPA 3T52A 2Q45A 4RHUA 3KVVA 1ZJ6A 4LS3A 2R11A 5EHNA 2IDMA 4BFWA 3FUCA 1YVRA 2H2WA 3RTBA 4ERXA 2F2TA 1FNBA 4BC1A 4V0OA 4RK0A 1RHQA 2MSKA 2O8VA 2XOKD 4EKEA 4YT8A 3E48A 1TKAA 2P91A 3LA6A 2XUZA 2G0AA 4IZHA 1U0GA 1V1RA 4ZI3A 1E89A 2MSDB 2QLNA 3DL4A 4P5DA 1GG9A 1KO4A 1Z5GA 1DDGA 1RTTA 4KK4A 3RVLA 2P2ZA 4H4DA 1C7RA 2DECA 2ILVA 3E70C 2JAQA 5E4TA 4TQGA 4G8CA 5HG0A 1NVFA 4GX5A 3O2QB 3WGIA 2QORA 4CM9A 2AYXA 2Z1MA 1R0SA 3IDZA 2W6OA 3O31A 3ES9A 3G2PA 4CV0A 1NJGA 2EARA 3E03A 2WVJA 1I7QB 4Z4CA 1K6XA 2PRJA 4IKOA 1K5HA 3BKXA 4ZCPA 4B17A 1X1QA 4R9RA 4KITB 5GOTA 2FPXA 1VFNA 4EHAA 4XWYA 1Q0SA 3FFBA 4IQFA 1MA0A 2J3MA 1FNMA 1JEQA 3TE6A 5JRZA 3T3PB 2C99A 3ZD9A 4JLWA 2WWWA 3MWLA 1OX5A 4KAAA 3UKOA 5AKJA 3D2AA 4QGAA 5CUQA 3MXOA 2DSTA 1Z3CA 3DZHA 4LY6A 1CZLA 4URFA 4BGIA 4FMBB 1R0YA 3C3DA 3IIIA 2F64A 3CF0A 3DZCA 4FI3F 1U2PA 1T91A 4KE6A 3V7UA 3ZLBA 4FYMA 4B45A 5A5DA 5BV7A 4BBPA 2PMFA 3UTDA 3IKVA 3X1ZA 5J4LA 4WJLA 3Q6IA 4IBOA 3JQ6A 1D5CA 1K8RA 3A3OA 3C3AA 3D5EA 3O5AA 4LDZA 421PA 2B7LA 3IC5A 5EQJB 2GJKA 3AEKB 4TSFA 3W5HA 1H2AS 3ZYZA 3ADCA 1CY0A 2BWJA 4U3JA 4EPVA 4IEFB 3P71T 4U5XA 4LF8B 1WXDA 4DG9A 2ZAYA 2OCGA 2YYAA 4NQZA 4PICA 2RJNA 3JTEA 4GXNA 5HQ3A 2BY4A 1PVDA 2OSBA 4ND4A 1CVLA 1YOVA 1UXJA 1KEEA 2ZXUA 1G3QA 4F71A 1A8UA 1MEJA 1IUOA 2Y68A 3LBNA 2FR8C 1TADA 4OYHA 1DJLA 3OEED 1PGQA 5LDHA 3H2YA 1HFKA 3WLMA 4F9GA 5KOJA 1TCAA 3MYYA 2OT3B 2X76A 3DV9A 1SD5A 1WSAA 4BNUA 3DLTA 4QFMA 5KREA 2GZHA 2B1QA 1KI3A 2PDAA 4LISA 4MV5A 4ZI7B 5LWHA 4C0QC 4N8EA 3AY6A 3OSZA 4ZJUA 2QPOA 4B5KA 1ZGAA 2CFRA 3P2OA 2VAXA 4HQFA 2GAIA 4MVJE 3NEYA 4CMKA 1P60A 4CG2A 2QTLA 1A1SA 1KEKA 1B26A 3W5DA 4DRYA 3L1VA 5I47A 4R3NA 3DO5A 4Z8YA 1KWKA 1VE5A 4DF3A 2PSFA 4YAFA 3GG2A 5CFLA 5HTKA 1QTIA 3W6ZA 3PP8A 2XPCA 4IXNA 4MJ3A 4R98A 4X60A 4A7PA 5T3UA 2D0PB 1ZHFA 1A5TA 4OOEA 4P7KA 2JD1A 4Y1FA 2QUBA 5ILOA 2CV0A 1RZUA 2LVBA 2BEWB 3TR6A 3BFJA 5KNDD 4P83A 2A35A 1P3JA 2Q3HA 2GQ0A 3DLCA 3IUMA 4RIFA 5DNDA 1MVOA 3S4YA 2XB4A 3KJQA 3E61A 3DBIA 1JT9A 2AYYA 3LM8A 3R0XA 4V38A 2B4YA 1FFWA 3A1FA 1NONA 3ANTA 4LDAA 4L50A 5K0EA 4TMWA 1G3IA 3P2EA 4N82A 3VR6A 5JYDA 1QHFA 3QLJA 4HAZA 1NAHA 1PDOA 2DFNA 2VSYA 3B2EA 3G5UA 3N2KA 5AK0A 5AW3A 4CKXA 3HVUA 3KQKA 2OXFA 3TQSA 4E4TA 4EGSA 3DTVD 3FZGA 3BMXA 4TN1A 5HEKA 1Q83A 1RQRA 5B4UA 1U2DC 1YZGA 2P9HA 4YRCA 3QMWA 1ZOSA 5FLXA 1ZRHA 3B89A 1BYUA 2P9JA 3UPDA 3H18A 2WU8A 3L7DA 2ORYA 4U7FA 5JZBA 1CV2A 5EWMB 3L4BC 3UJBA 7YASA 4JXXA 2XXAA 1TUBA 4YLGA 4D9NA 4R2IA 4LYJA 2ALJA 2V7EA 3NORA 4CJXA 3M2TA 4RDIA 1IAQA 4DNFA 4KXQA 1ULUA 3ECCA 5CPFA 4HFMA 5FR2A 1DDOA 2Z4TA 2QXYA 2ERCA 1YONA 1NBME 2W4IA 2WM3A 3I1YA 3PQ6A 2QAIA 3GF4A 4M1QA 2GUWA 5CYPA 3S2SA 4HNQA 1QE5A 4G36A 4IVRA 3IMCA 1L4FA 4GOND 1N2BA 5D5QA 5HK8A 1GRNA 3TX6A 5CVJA 2JAPA 3OEYA 3NPAA 1G42A 3WQSB 1Z45A 1EMDA 4LF9B 1QDEA 2GCEA 2W2TA 1T26A 4ZT3A 4TN5A 1A8PA 4DMRA 5J23A 2ZR9A 2DH5A 4J7XA 4I5GA 5FQNA 3H19A 5JQWA 1JAZA 4QTUB 2W2MA 2JAOA 2WNSA 4REQB 2C5EA 3I8XA 5E1MA 2HBYA 1ZC4A 3ND9A 1T0PA 4M9SA 4UBKA 5DRTA 2IV3A 2BFNA 5EZYB 3HKEB 4PEVA 3N05A 4TWRA 5IBCA 4PHTA 3LUAA 4TV9A 3PVZA 2Q5CA 2BDTA 2IEBA 1CIPA 4LJYA 1IQRA 2OGUA 3HV0A 4HVTA 4WHMA 4A15A 4F5DA 3ZWAA 3Q3IA 3GLGA 2QTZA 1J70A 3FVTA 1G59A 2IHNA 1SCIA 3ER9A 2RHTA 1IZ9A 2VYND 1HTWA 2V7XA 2VK4A 2I8AA 1NVWQ 2HD4A 1G7CA 5K51A 3H9GA 2QRGA 4XFJA 2ZUEA 4JLPA 1J2YA 1NBHA 1TE2A 2WE7A 5AKGA 4UEJA 5F64A 2Q3CA 1S4QA 4F85A 2ZYIA 4IGEA 1HDGO 3LI2A 1Q6YA 4GO1A 4WERA 3N7UA 2DPYA 4ZREA 1TF5A 4YP1A 1X77A 2H54A 3OJFA 3RABA 4EVRA 2WMYA 3MB5A 3BZWA 2D1TA 5FPKA 3A0UA 3UUGA 2C0CA 4P1ZA 4BV9A 2RGNA 5KYUB 3TZKA 1NDHA 2C9OA 4QYIB 3RTEA 3VNBA 5FI1B 5E8RA 3TLZA 1M33A 7GPBA 5GM1A 1KNXA 2UVPB 3GVHA 4O2AF 1XPRA 3GRZA 3P20A 4G1MB 3W05A 4GNRA 2P5UA 3TXAA 1PSZA 3BAZA 1POXA 2A33A 1LNZA 1N6NA 3DAOA 1RYEA 2A88A 3GELA 2O7VA 4LWQA 2GZSA 1Q21A 2ZRQA 3JW8A 2QTWB 4MV3A 5JCOA 4O4LF 3UBTA 1O6ZA 1R4NB 2P2DA 1ZIOA 5BV0A 1EVJA 4JL5A 3BF7A 4DARA 4AFNA 1FDRA 3QIVA 3ZI0A 1Y6GA 1IBSA 3USES 4DR7B 5DRYA 3OJOA 3TMAA 3DZKA 4IY1A 4D82A 3A8TA 4UAJA 2WYOA 3D5TA 2G1PA 4UHKA 4F91B 3SHFA 1A8IA 5K3EA 1XTRA 2FZWA 2CXXA 5IN5A 4JIMA 4ALKA 3ZC3A 1Z38A 4MTLA 3SMQA 2B25A 2FXVA 5EJGA 4KXNA 2BH9A 1XOIA 2B4KA 4BMOB 2ACVA 1Q1GA 4QM7A 3JWEA 4FWIB 1F6WA 1P4RA 5BPHA 1M6HA 3I1IA 3OCXA 1E2JA 2CLKB 4Z3OA 1VKNA 3PKZA 2DUJA 2FY8A 3OPYA 1DRWA 1I2CA 2AOTB 2UZAA 4FE3A 2J3KA 3AG6A 4L02A 3IBTA 1GKKA 3FUXA 1VGRA 3PNQA 2E4UA 3PNPA 2EP7A 3I3OA 3MD0A 3SXJA 4MUFA 1VE3A 4GMDA 4MXDA 2OZEA 4DT1A 2Z5LA 4O4JA 4P7JA 2OB2A 1U2ZA 1D0IA 2OFOA 2FH5B 2IPNA 5C80A 2SNIE 2O8BB 4CFZA 5BUSA 4EJFA 4UE6A 2H48A 4KFTA 4KPEC 3OQMA 3B3JA 1MRSA 4B7AA 3A28A 1GD1O 2FSHA 5CFMA 5LFAA 3KAKA 2H07A 1NU8A 4P86A 2OBXA 1Z6ZA 5AM1A 2YJ3A 1RAHA 4BX2A 4B35A 4YRNA 3B13B 4P4TA 3C7DB 3E1SA 3WRXC 3DDCA 4GEGA 2PWZA 3KWJA 2ZJ8A 4PZAA 1XZAA 4Q4JB 2RGYA 2ZIZA 3RJZA 3CZRA 1NJ6A 3IILA 4N0DA 1A2BA 3C4JA 4KLCA 5C5CA 3WDKA 2Y92A 4NFSA 3AVPA 3NM4A 3DQPA 2PYZA 1Y8RA 3QA9A 3JASB 1M6VB 2RHGB 4KZKA 2HCFA 2XMCA 1IN1A 4BB6A 2ZI3A 4QBFA 3TW8A 1UPUA 1X1DA 3OOJA 4KXLA 2XNSA 1Y4ZA 2HA0A 1ZN2A 4DWJA 2PH7A 2FXIA 2YVQA 3T9EA 4KFSA 3IP1A 3W9SA 5K4HA 1JNYA 5EGSA 4TM7A 4H7KA 1E62A 4CIVA 3T3GA 1VLVA 4LDQA 3O9VA 1VHWA 5AVKA 3HP4A 4C05A 2J6IA 3L6UA 1VHDA 3NG1A 2GPBA 4EY7A 4X65B 3SVTA 4EHNA 1N2CA 2GJSA 3EDQA 3CS3A 4OU5A 4LCBA 5EJ8A 2VHCA 2X41A 1UC4B 3BXHA 1UXKA 3GY0A 3KE9A 3PUHA 4RXMA 5AMXA 3ZEIA 2DU8A 4Y6OA 5HM6A 4MUMA 1OLXB 2VQ6A 3COZA 3HPQA 3OSUA 3X1JA 5C46F 4AQ7A 3VAYA 4AKIA 2PL9A 1CIVA 1RHJA 4TTVA 2Q3JA 3WKBA 4ETMA 2OCKA 4KUEA 1Y0BA 3TXXA 1WM1A 1HQYE 3HN7A 1NIJA 3FPCA 1PKEA 1L4EA 1MG5A 2H2HA 2PGIA 2LW7A 3ANSA 1EBUA 2C94A 5KOHB 2GUGA 3JALB 4YYZA 3G2KA 2ZW9A 3TVTA 2D8AA 4WNAA 1GQ2A 2BFPA 1SCAA 2QXTA 3EBPA 2Q1UA 4I8XA 3HUFA 1EK1A 1MHTA 2O8BA 2NPOA 3HB4X 4BUCA 5J2TB 3COSA 1MCZA 1PGPA 3FDIA 4M99A 2DFPA 5FULA 2Q99A 2JI8A 1U04A 3T1YB 4MUJA 1O9BA 2NP6A 1NW6A 5GP1A 5LOVB 3RFTA 3AXTA 1S6YA 2QOEA 3A1EA 4RTRA 1NLFA 5ALNA 2HXSA 2CYCA 3PWZA 5EUCA 3D9QX 4XJXA 1XG5A 3L0PA 5LR6A 2XXJA 4N47A 2WYIA 3AHDA 2GRAA 3T99A 5KQLA 2QRVA 2EOAA 1GKYA 3OIWA 2HIGA 2GS9A 4PW0A 3V1MA 3IQHX 1U2GC 2XWPA 2QN8A 1IEXA 5AKKA 4DA4A 1U3FA 2FR0A 1F51E 2XHEA 3L06A 2FQYA 2YXDA 4RU1A 3G5MA 3N5CA 1RHRA 1J0DA 2VQEB 4FYJA 4RQUA 4ZEMA 5HIAA 1O9HA 2WM9B 3HABA 3FKQA 1V95A 3PIDA 1IUNA 1MB3A 3L8MA 3QE2A 3RUPA 1UM8A 4LCEA 3TL2A 1QS0B 3KJHA 3Q5EA 3RBVA 2E0IA 2XWBF 3VZDA 1PAUA 3VO1A 1JF8A 1O6CA 1UKVY 1FP1D 1W25A 2ZIFA 1ODCA 5SZJA 1KE2A 2XOXA 4ROTA 1E1MA 1E96A 2Z3WA 4NJEB 4RUKA 4EZIA 5CBPB 4JEIA 2FZ4A 3DE0X 5EUMA 5I4KA 2XMQA 1Y3CE 3I8SA 1AK9A 2REQB 4E5UA 4FZRA 1XWIA 4UC0A 2Q29A 3IV7A 5LUAA 2B1JA 3QBJA 1RHKA 1TQ6A 2P9GA 1WV0A 1OJ7A 2CMHA 4I46A 5DE3A 4G8JA 5BOSA 3TTXA 1FF9A 3A7DA 5BV2P 4ND6A 1I5EA 5DHQA 4BTLA 4ATNA 5JDCA 4R8MA 4GMFA 3BFVA 4RWZA 1X13A 1J2UA 3LC0A 1ADYA 3AHJA 3Q9UA 1EU1A 1VL8A 2IHYA 2Q3FA 3DC2A 3FMVA 1XZBA 1OTYA 2IE8A 1RKBA 2ODTX 3FUTA 3QLTA 5IDVA 4AKHA 3IQIX 2XYGA 5BSKA 2WKSA 4U2KA 3VH1A 1TMYA 3UJCA 1N8KA 3FY4A 3HCDA 3OKCA 2R2AA 4HEQA 2QUKA 4W5WA 8LDHA 3ENZA 1RQXA 4HS9A 4PHGA 3INRA 4TL6A 5BSUA 3B1ZA 5FEMA 4YAGA 4XCVA 4RK1A 1FU4A 1VMKA 4H0FA 6ABPA 4J4BA 1DXQA 2OHVA 2PWPA 1ZH0A 4D8WA 3RIGA 1FX0A 2M2IA 1PZGA 2VP4A 2WINI 3DVRX 3EPRA 5E6RA 4OI1A 3EEFA 5G0VA 2BFDA 3LQ1A 4YCJA 4LVUA 1HOXA 2BGIA 3RYIB 3WIBA 4C3OB 4NYIQ 3K2QA 1WB6A 3EUAA 5FL7A 4DIFA 3GL9A 1HMPA 1WBJB 3ZTYA 3DDWA 3JU3A 2GVDC 3FB1A 2PAFA 2A9OA 5FOTA 1YE5A 1TAGA 2GCPA 3I9NA 2ZZKA 3CVJA 1ZXLA 3QW2A 5K3AA 3UA3A 4V1CA 4NOLA 3WDMA 1KSFX 5KX5F 1BCRA 2B1GA 1CBUA 2D1QA 3TAHA 1C7IA 1GN9A 4YDRA 4J29A 3D43A 3I92A 4TS3A 3PA8A 1F0NA 4EECA 1HE2A 3KJXA 1C2TA 1MOSA 1RAFA 2PT7A 2BMDA 4D3FA 2PBLA 4O0MA 4PNHA 4K26A 4G0WA 4IKPA 3R7WA 1KPGA 4ZHQB 1X7XB 4XLLA 1I51A 2VSNA 2Q7DA 5C4MA 1JEDA 1M2FA 2QAGB 3FNGA 4C03A 3FHTA 2WJ4A 1R16A 5T41A 3U26A 2ZAOA 4Q15A 5I7OA 4ER5A 1ZJYA 3K0EA 4OQQA 4A73A 1QHXA 3B60A 1PSDA 4B80A 4AM8A 1ZKMA 4BUJA 1J8FA 2FWBA 1M6YA 1IXKA 3LVBA 4G0OA 1HC7A 5B6JA 4X8MA 1I7NA 4ZRNA 4I3FA 4G0NA 5A4FS 2F6RA 3MRXA 1G1AA 1BO6A 2PL3A 3O2SB 1FNDA 4NV1A 4RVNA 1YFJA 3AVVA 1GZHB 3A2NA 3PRKE 3QVWA 3K5HA 5AESA 4D9KA 4WCFB 1PR5A 3C3PA 3FCYA 4JJKA 4QODA 4DQ0A 3PGKA 5I7AA 2RCNA 2ZBEA 3CU5A 4P33A 2QKYA 4LIPD 4YAJA 5ALGA 5AM3A 4TTSA 5C51B 1RQ2A 3LF2A 4LXQA 2QTAA 2VCEA 5KQRA 3SX0A 5LPNA 4I0WB 5CW2A 2QD5A 3NZEA 1BXRA 3U49A 1YE3A 2PPVA 1EHCA 3GEDA 1TQ4A 1F6BA 1IM5A 1N7HA 2P30A 4C04A 5FORA 1V96A 3IMGA 2P11A 1J8VA 1UC8A 4X6LA 2WZCA 4Z2AA 5IXYA 4JWTA 5HRUA 5BSMA 1U0SY 5HKAA 4MS1A 3IT1A 2FP3A 2W9XA 1HI9A 4LY9A 4LI3X 2Q5LA 1XN1A 5ALTA 5HHTA 3PR2B 1KC3A 5FUVA 3U60B 4JR0A 1H4QA 4IGIA 1ZIDA 4TSRA 4XX0B 1A4RA 4HQKA 3IQXA 1U3GA 1F3OA 4CEIA 1C0IA 1EEXB 2O7RA 2PZLA 5KTOA 3A2KA 4D25A 5TQJA 2A0WA 2XA2A 4U6NA 1E58A 1THMA 2Y71A 3CGWA 3QKSA 5EMLA 4HNAB 4IMRA 3VR0A 2P6RA 4RZXA 3DVLA 1AKNA 5CX4A 3DLIA 1I7PA 5ALUA 1XROA 1O0BA 1XALA 1D6MA 4ZT7A 3W9BA 3ZHQA 2HU7A 5C1BA 3M83A 2HF9A 2D7CA 5UKDA 2P3SA 5FNVB 4AZ3A 3AERA 1T9BA 4HPXB 4UPDA 3AZQA 3ISVA 2VBFA 5EOVA 1E8DA 3BRWD 1PS0A 1E6LA 3NOOA 3L0YA 2ATIA 3AV0B 1ZCBA 4L4SA 1QDLB 1ZXXA 4NJMB 5FAXA 5BN4B 4EPYA 1DX9A 4Q6WA 2YRWA 4MB0A 4QT0A 1S2OA 3K92A 2D62A 2AF3C 3VOAA 1WHTB 3URKA 2BM1A 3R6LA 5CDHA 1OIXA 4KXUA 4DR1B 2RHJA 2FMIA 3AM3A 1Y9ZA 2QYTA 3THXB 2VJNA 3OIYA 1S9DA 2PH1A 1N8NA 3T7DA 5CLJA 1Y7HA 1E1LA 5IZ4A 13PKA 4CMAA 4YAIA 1IRXA 3NNSA 3B6IA 1RI4A 4HCJA 2B61A 4D0GA 1GPMA 4TUYF 3UK2A 4FDLA 1G5IA 2VP2A 1ILWA 1YS1X 4HK4A 4A3SA 4M86A 4UUNA 2FSFA 5IJXA 1CUDA 3RVQA 3AHGA 4QRIA 4DV2B 3I9V6 2ZUTA 4MV6A 1G21E 1G3RA 1TRKA 4CF3A 3PC8C 4YJ3A 4ZICA 3UJ7A 3S8YA 4KHPB 2Q4DA 3W7AA 4QRHA 4GUDA 1XEFA 4YV0A 1SXHA 2IELA 1T0BA 5TF4A 5CH3A 3TFOA 1QIJA 1XEAA 3RWOA 4BMPB 1EQ2A 1HDYA 4RAOA 1ENZA 1OXSC 4JBWA 2P9YA 3WNVA 2Y2VA 2GXUA 3FCUB 2PUWA 1FCJA 1LV8A 4EHLA 1K1EA 3EGDA 4TV8B 1RJDA 2Z30A 3FMPB 3JPWA 1P1HA 3FI0A 4MGZR 1J7JA 4Q1VA 2GYVA 4F1KA 1AA6A 2NV6A 4WOJA 2CDAA 1P4SA 2WHRA 3K6JA 3SQMA 2J0UB 4V03A 2LDBA 1EP9A 4MIEA 8GPBA 3SHQA 4WN9A 1GA1A 2C07A 3GAMA 1ISHA 1USIA 4I66A 5CYFA 2VDOB 4TWJA 1Z6XA 1UH5A 2DOKA 4TZKA 4UUQA 1WMSA 1LCIA 5HIIA 4LX8A 2D7DA 3IBSA 2XJ4A 5DGHA 4PYRA 3GMTA 3F3SA 4IIGA 4P81A 2JFNA 4J0DA 3K53A 1G21B 2ZRKA 1S2MA 1XQWA 4I4IA 4UHHA 1EVYA 3BRWA 3QPWA 5REQA 4G07A 5B3LA 2VZ0A 4OGWA 4PBTA 4A2QA 2O4UX 2VR1A 1FDVA 2OO5A 4NDAA 1PFVA 4HWRA 5BW4A 4BWGA 2CVPA 2CSXA 1BQ3A 1IZZA 2H8KA 2O2XA 1LDYA 1BVRA 3EULA 2W0SA 3ZWOA 4MI1A 2KYRA 4X8LA 3KIPA 5EESA 5L45A 3QWBA 1APBA 3L84A 3N0VA 2R00A 4QG3A 3DJFA 4IF4A 4QXQA 4M2LA 1B6TA 3AIKA 1JR3E 2JBHA 3ZDAA 3D6TB 2IU4A 4YMSA 3DOHA 1M8JA 3RVKA 2FRXA 1ZCZA 2I1LA 4MWSA 5L40A 4C0LA 1RT9A 3UKDA 1T3HA 3SVZA 2I29A 3EW9A 4G5RA 2Y27A 2ZK7A 4TRJA 1CUJA 3EGIA 5T3YA 4AX8A 5KKNB 4RKFA 4RVSA 1Z22A 1EA5A 3P5SA 4PPFA 1FFXA 3I6IA 4QUKA 3RSOA 3T5CA 1M66A 4BX9A 2ZSUA 3IO3A 5DTJA 4IG9A 2OV2A 1L7AA 3LXXA 1ZN8A 1WCYA 2HK8A 3IQEA 5ALZA 3PXXA 4ER6A 4HNVA 5G4KA 2P65A 1DKUA 4NU6A 1MVNA 2WQ6A 4EI9A 1H1DA 2R7LA 5LQDA 4BQEA 1N92A 4C9BA 1WABA 4ZGBA 2Z6AA 3PDIB 1JMYA 1EM6A 2AOVA 1XEXA 2C42A 2W2OA 3LVFO 4MAMA 5CNIA 2PXAA 5IF9A 2QM0A 1DAPA 5ITSA 5BXQC 1KFJB 4LG1A 5HJ5A 1P8AA 5H59A 1ZINA 1IONA 1GT6A 3HMQA 4Y2GA 2WHQA 2XDYA 1QRDA 1HUQA 1XAIA 3G0OA 4ZQGA 1FSSA 2QQ0A 4Y2XA 4D5EA 3WE7A 2WILA 1WD5A 1JHVA 3G9XA 2SBTA 4BB0A 2O06A 3ETJA 3ZR4B 3FZYA 5EIEA 1RCFA 4OHWA 2NXNA 4NNJA 3P4XA 3R5JA 1J8YF 1KNQA 4MP8A 5IK2A 5J5CA 4UFOA 3WL7A 3TPCA 3QPVA 3N6RA 2EGGA 2JJYA 1L1QA 4B1FA 1TVMA 2XUIA 4RGYA 1KAEA 1HG0A 1CEQA 4EYEA 5JNUA 3F7MA 4P36A 1ONBA 4ZU6X 2GAAA 1WE2A 2CGEA 1T2AA 4Q9AA 3BIJA 1H2XA 3EY9A 3LZDA 721PA 1J6UA 5LB4A 5LVAA 3ZWXA 5JZMA 2Y0DA 1A9RA 1O96B 3VPXA 2GHRA 5DHPA 1OFTA 2Y0EA 5C8XA 4HH1A 5SICE 1PLJA 2N0SA 2QNIA 4WFKA 4Q16A 1PHPA 2GEDA 2P2YA 2O5VA 3O1JC 4U1RA 4HGYA 1KVQA 1TM1E 2ZU6A 4FW9A 3TNDA 3RJ5A 2NZVG 3ZY4A 2FW7A 4MV4A 3NCHA 5GTDA 3OZSA 4HI0E 3ZIDA 4EB8A 2HQOA 4Q7QA 2B5OA 3P9PA 2XUJA 4I55B 4IUDS 2XVXA 4KQWA 2OY0A 3A4TA 2BFCA 3HVIA 4K6OA 5ICMA 1UT8A 1Z6TA 5SZHB 1RYMA 2PL1A 3MMNA 1EP2B 5IJ0A 4IIJA 5YASA 3N6XA 3RYCA 4JC0A 4G1VA 4M9CA 1GCGA 1WDLA 5CHYA 3ZE8A 3TSZA 2ZQ5A 2W71A 5DBOA 2O3RA 3HFJA 4IYRA 4IZ6A 3K0KA 1EXMA 1SU4A 3ESXA 4E2ZA 1EINA 1WJGA 2PMKA 5ALYA 2HRZA 1H93A 3AUJB 4DMFA 3ZZNA 1LK5A 4ZZ2A 4PQFA 2RGGA 3K16A 5EP2A 4WESA 2W00A 1FYFA 2F62A 3AU8A 3I04A 3NOXA 4P7BA 1CE8B 1GQYA 3H4IA 4UVIA 3KYDB 1DCTA 1JFLA 5LQMA 1S9HA 2BKLA 4D8TA 3C45A 3CXRA 3LU1A 3ON5A 4AG3A 1ICIA 4Y9DA 4H7FA 2W90A 5D7NA 5BVGB 5EJ4A 4JJGA 4P34A 2V7PA 1R5BA 4EG8A 3OD1A 4Y67A 4P9NA 4GZ3A 1CNMA 1L1EA 4LA4A 4MDYA 3SC2B 4BJ3A 5DXFA 1ZM2A 5K2OA 2NXJA 2RAFA 5JI2E 2QBYB 1WF3A 3OE4A 3VJKA 4IHAA 1VMDA 2RH9B 2YN4A 4GQBA 3ABZA 3V1NA 4BGEA 5JQGF 2EYQA 1ECFA 1M1YA 1SA0A 2GASA 4CLXA 3ZNPA 4JYCA 3T9FA 5IM4F 3MJ4A 4EM6A 3NQ41 3NHFA 8ADHA 1NNSA 3FCOA 2QTNA 5HKKA 3U09A 1CPYA 3G8BA 4BFLA 5JNVA 1IVSA 2XVAA 3PZBA 3AJ9A 1VBMA 2HY7A 4L85A 3OU2A 3PBKA 3RHFA 1T6XA 4LJ5A 3GUYA 1YDWA 4WFQA 4COKA 3KFLA 3P52A 4PVCA 1XCBA 2Y1CA 3HEAA 4BMSA 1ZBQA 4L0QA 4ZEXA 4E11A 2W48A 2X7XA 2AK2A 3BD7A 2HRQA 4US0R 2J45A 3ITDA 1I5RA 4U2BA 1YC5A 3IQGX 4C3UA 5HJ7A 3ORSA 2YXLA 5IWAB 1KFCB 3UOWA 1OYWA 2BTQB 1RCTE 2G40A 1D2RA 1VG0B 2GO1A 4RL6A 3R9WA 4LFBB 3PLNA 3CX4A 3HPRA 1K9VF 2C7PA 1Y3AA 4C4ZA 4WX2B 3GA7A 3ESDA 4GVXA 3S40A 1ULZA 2VT2A 3JZIA 1NPDA 3G8CA 3OF2A 4KAXA 3ICPA 3VPBA 4DCTA 3L04A 5DBFA 2ZJ2A 1P0FA 3O83A 3M33A 4ZDKA 2YZGA 2FPIB 3C3EA 1KQ3A 2GTPA 2CDBA 3ESZA 1UDBA 1YFZA 4HB3A 4N54A 4RY0A 1MAVA 1P4HA 4QBIA 2C03A 2AT1A 2ZJOA 1ODKA 1ZMOA 5A03A 3PI6A 1G2PA 1PSWA 2ZYUX 3NVAA 3Q9LA 1Y8QB 2VAWA 1LLCA 2EXXA 4MO2A 5FUXA 3VC7A 3WXBA 5BR4A 2XUAA 2ZB7A 4Z51A 1BRTA 3UXHA 4DBLC 1W34A 1TJ5A 2X9NA 3N87A 2EATA 4XIJA 3TKYA 3P96A 2RC5A 3E9CA 1NLUA 1JS1X 1UIRA 2X4IA 3H86A 1GSIA 3CH4B 5JSQA 3H5OA 1KP3A 1CW2B 5DGCA 3HHEA 4TZTA 5KEIA 4BYGA 5EQTA 2X1LA 1TZBA 5FV4A 5ECYA 2SKCA 4HOYA 3NTVA 5ADUS 3DVAB 4WL0A 5BXYA 2IF2A 2I1WA 2QEQA 5AKXA 4DR3B 4I6EA 1PJBA 1QV7A 3A4IA 3PRYA 4OSOA 2PR2A 4QVGA 3WAKA 3IDSA 2LKCA 3PHCA 3RK1A 1NXPA 2OK7A 3GLUA 5EUQB 1MW9X 4JLAA 1CZKA 4BNTA 2AG1A 5D3MA 5JALA 1UMKA 1LPPA 3CE6A 1DRJA 3K9FC 1RI2A 3NRCA 5ES4B 3UWDA 4M36A 2X2EA 4XWWA 2A9FA 1TUGA 2ERYA 1JA1A 1E2QA 2F00A 1CP2A 3GAAA 1EJBA 3ZQUA 3ZHYA 4FGZA 5K0LA 3VSBA 1LTKA 4CVNA 5BVHA 1JEEA 3O92A 1N0VC 4BB9A 3EZFA 2EF1A 3DEKA 3R7LA 3ZV6A 3BXZA 3K1JA 3AR8A 4NENA 4CM4A 1L8AA 3I34X 4UTNA 3KQLA 5JS7A 1T8WA 2NVUA 3SLKA 4P4NA 1ZX1A 3SXUB 1K9SA 1VKHA 1RZVA 4M0EA 4HTFB 2EVWX 3QU2A 4OIFA 3BQNB 1Y7IA 1QRAA 4QFBA 4KIGA 4D4KA 1QQ7A 2IH4A 2PX0A 1W36C 2NTJA 1D4FA 2WTAA 3MLBA 2P7HA 1RPZA 1YMUA 1DKQA 4MZXA 4C4RA 3FCCA 1OV4A 1CUVA 4E51A 1HM5A 2ZM6B 1QGED 3LDUA 3DEFA 1E2MA 5AVZA 3GLFB 3IAXA 3IAAA 1CR0A 3KQVA 4JX8A 2NZUG 3E7XA 3DDNA 2J3EA 4MQEB 2D54A 3QKUA 1LGYA 5LZ7A 1K92A 3EEIA 3TKLA 1AKUA 1G19A 2B9VA 1U4OA 3C3YA 3SEQA 1JEYA 2O8DB 5AUQA 5ISMA 2HJWA 5FNZA 2JFPA 2VEDA 2V6BA 4YHBA 1WCIA 5EVCA 3V9AA 3HQ4O 2JLSA 2EFHB 2GTIA 2HO4A 1Z47A 2ZBGA 3UF0A 3B1VA 4C30A 5C81A 3TPZA 4P3OA 1GITA 1M2KA 4ID9A 4DJJA 3TEJA 1C8BA 4EG0A 3NS7A 2QLFA 4X7BA 1FUYB 5CEJA 1XLTC 3F5QA 1H2FA 1Y34E 5H82A 1K7FB 2FPWA 3LA8A 3NBXX 4M6WB 2MINB 4ARIA 1YCDA 3K0AB 3AMVA 4N7JA 1L5WA 3I0MA 4JI0B 1NJ8A 1IHOA 1KYZA 3BXFA 3R44A 5CDUA 1DAOA 2QSJA 2KMLA 3EZLA 4CQJA 4DRZA 1V6CA 3VSCA 2NVWA 3AR6A 1M6NA 4DKXA 1QH0A 4B82A 3NBZC 1E1CA 1GLNA 1F8YA 3LAWA 5CG1A 1VCOA 2G7MC 4GIBA 2RHOA 3S1LA 4OHMA 4RYDA 4EZEA 3HG7A 3PYLA 3O4JA 1QHHA 4TQ9A 3OFKA 1PNQA 3DEAA 1CUXA 1MT0A 3AEQB 4Q9KA 5KIAA 3BDAA 3QUSA 1L3IA 2H11A 5BN5B 1N1EA 1ORIA 4QGHA 2JZCA 1Q1ZA 3DHWC 3OFND 5CDFE 1FY2A 3W7VA 4M89A 4ND7A 2E6KA 3I5YA 1P17A 4RH0A 3X44A 3VTZA 4W5HA 1NI5A 1MQ9A 1JA9A 3LT2A 4JV5B 4L6AA 1MFZA 1KPIA 4OSPA 2VJOA 4NLLA 2FVYA 5BUZA 5AVVA 1Z74A 4MQ4A 1UMCB 1R3DA 3HBLA 1AUOA 1S02A 2LR0A 2Z5FA 3L1HA 3VVCA 4JSRA 4UM9B 4K5QA 4UTPA 4NCKA 5JRJA 4GAEA 1Z5ZA 3VHRA 1XSEA 1EM8A 3LC7O 3PEWA 1JSRA 2AKAB 2FLWA 2H57A 5K45A 2RD2A 3P97A 4CL2A 1LBHA 1LC0A 1O95D 3WDLA 3MS2A 5T7BA 1QGYA 1QCCA 3QX7A 4AJ9A 1H2EA 3OU7A 3FFAA 2AIRA 5LLSA 3NM5A 2PPLA 4O2BB 4U2DA 1JVNA 4D4HA 2GN0A 4D9JA 4PFSA 3T7CA 2CMGA 3WWCA 4AVYA 1MC1A 3MIIA 3B53X 3PJGA 4KMMA 3PEUA 2AZ4A 3FZNA 3HB5X 1XZNA 3QPDA 1V2HE 3GROA 4IZOA 4JXKA 1EX9A 3WK4A 4LV8B 3HXKA 1QQ5A 3IJPA 3DEIA 4QRDA 4ZODA 5EIBC 4Z0HO 2VZ9A 3VH2A 1G5FA 2RGAA 3L1JA 4P4SB 2JBWA 2JLRA 4Y7CA 5EINA 2OCIA 2HC9A 3QLVA 3KO8A 4HDNA 4K7JA 1AM4D 3MCUA 4BLVA 2IZOA 3WLHA 2CNWD 1IAVA 2GZAA 1T8RA 4MJ7A 4Q02A 2GBFA 3T3EA 5K5EA 2FMTA 2A1UA 2VJKA 4OHXA 3PD1A 5BN1A 5FL3A 3NOVA 1Y4UA 2ECFA 2WUEA 1J33A 3LXMA 3ZV5A 1NI4A 1V41E 1XFDA 2G5TA 4KK3A 1F4LA 1UBHS 4JQSA 5DWQA 2BGTA 5KWVA 3UIEA 5IAGA 5ICEA 1LLFA 2BGWA 1IY1A 4EPTA 1FYDA 1E6MA 2A0XA 3U3MA 3H8VA 1RLTA 1G6KA 1RNLA 2B1IA 1V8FA 4EJSA 3DOUA 2Q2OA 3F96A 1N6LA 3SX4A 1ANKA 3DXYA 2QRPA 3AJAA 1X80A 3D7SA 3OHSX 4F4FA 1OAAA 1XTZA 3VKUA 1GUFA 1DJQA 4CCAA 1E5QA 5LDDC 4K03A 4UE2A 1L7BA 2HX1A 4IMJB 3SY8A 4E2XA 5H1YA 1X7HA 3DD5A 4J75A 2QE6A 3AUUA 2P78A 3M0EA 1O95A 2A4KA