4NNOA

Crystal structure of manganese abc transporter substrate-binding protein mntc from staphylococcus aureus bound to a zinc ion
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
278
structure length
278
Chain Sequence
KLKVVTTNSILYDMAKNVGGDNVDIHSIVPVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSKDVKPIYLNGEEGNKDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQLEKLNNDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQMRQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTDSIGKEGTKGDSYYKMMKSNIETVHGSMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Lipoprotein
publication title CRYSTAL STRUCTURE OF MANGANESE ABC TRANSPORTER SUBSTRATE-BINDING PROTEIN MNTC FROM STAPHYLOCOCCUS AUREUS BOUND TO A ZINC ION
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 108
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2013-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4nnoA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4nnoA01
4UTPA 1QH8B 2WHYA 4WN9B 3ZKAA 2MINB 4XPIB 1N2ZA 4TKUA 5HX7A 5CR9A 2R7AA 1M34B 5B58T 3EIWA 5M2QA 2PHZA 3AEUB 5AFSA 1K2VN 3AEKB 1KAHA 1KAEA 5KOJB 4HMOA 3TNYA 5BVHB 3TEFA 3G9QA 1M1YB 4FILA 1N4DA 3AESA 2YNMC 3CX3A 3PDIB 4WNAB 3R5TA 3MWFA 3ZK8A 4IRMA 5CX1B 4HN9A 3BE6A 3AERB 3MD9A 4INOA 1QH8A 4WN9A 4BBPA 2MINA 1QH1B 1M1NB 3LI2A 3PSAA 3TLKA 4DBLE 1M34A 4UTOA 5GGXA 3PSHA 4NNOA 1N2CB 1EFDN 3AEUA 1H1LA 4INPA 4HMQA 1K0FA 3AEKA 1XVLA 3MFQA 2PS0A 1PSZA 3MINA 1FP4B 1G21A 5BVHA 1M1YA 4CL2A 1QGUB 4PAGA 4WZBB 4TKVB 3PDIA 4WNAA 4FNAA 3U7QB 4H0FA 3AEQB 5CX1A 3AERA 4MO9A 1M1NA 1QH1A 2OGWA 4UDNA 2QI9F 2RG7A 4OVKA 5KHLB 4MX8A 4OXRA 4N01A 4XPIA 5HDQA 2Q8PA 5BVGB 3GI1A 5JPDA 1FP4A 4M7OA 4WZBA 5KOHB 5I4KA 3K1AB 2M6KA 5KOJA 3U7QA 1MIOB 5GGYA 2M6LA 2XY4A 5M34A 2XDQB 4G09A 2WI8A 4K3VA 2PS3A 1KARA 1TOAA 1L5HB 2PS9A 4ND8B 5FLYA 2XQVA 2XUZA 5JJ5A 1K75A 2AFHB 2OV3A 1ESZA 5M3BA 4WESB 2XH8A 2XV1A 4PM4A 5JG7A 2O1EA 2AFIB 4GICA 2PRSA 3ZK7A 1N2CA 2Q8QA 2OSVA 4H59A 4FKMA 4OXQA 4WZAB 5KOHA 3MWGA 5M29A 3AETB 4LS3A 3K1AA 2ETVA 1G20B 1K7SN 1MIOA 2R79A 4HMPA 2XDQA 3UJPA 1QGUA 3BE5A 5JOQA 1H1LB 4TKVA 4ND8A 3R5SA 4TKUB 1L5HA 3HH8A 4MDYA 3ZTTA 2YNMD 3MINB 1G21B 3AEQA 2AFHA 2X4LA 4WESA 4MLZA 2AFIA 3HXPA 4UDOA 1PQ4A 3HJTA 1N4AA 3EIXA 4NNPA 4G07A 3AESB 4LJSA 3ZK9A 4B8YA 4WZAA 3NU1A 4FI3F 3LHSA 3AETA 2OV1A 5BVGA 1G20A
chains in the Genus database with same CATH superfamily
4D9CA 2E82A 1W35A 4X24A 1CS0B 3A6LA 1V9LA 3COPA 5EKXA 5HQTA 3GIWA 5E3JA 2ZYVX 5DB4A 1Q57A 4RJLA 1OWOA 2LRHA 2IXBA 4MKZA 3U7GA 4YCMA 2FQYA 1F5SA 5EKUA 3HBNA 1OT5A 4J76A 2OHHA 4YRGA 4XQCA 3OT4A 4EATA 5B30A 1G60A 2G7ZA 1H2AS 4RZ2A 3H8SA 4V1CA 3REFA 5KWIA 1MO6A 1SHTX 4FD2A 1PUXA 3WGGA 4AN4A 4QAQA 4D74A 5KOIA 5C2JB 1PJAA 2MJLA 2HPVA 2OBMA 1Z34A 1KFBB 2AHRA 2IIBA 2JLAA 2V3WA 3LYAA 3N59A 4P98A 4DCCA 1XTVA 1LI5A 5KB3A 4D9GA 5EXXA 1E3IA 1NQ5A 3C3KA 1XZCA 1WUJS 3LFTA 3HB1A 2XT9A 3HHPA 5ECYA 4D0RA 2UZ4A 2QN3A 3JQ7B 5KQMA 1SKBA 4KAJA 5FNZA 3PNQA 4RVGA 3N2GB 4X62B 4QGAA 1RI2A 3LRXA 4PC7A 1J00A 1QLWA 3H8VA 3D6AA 1MN6A 3MCWA 4UAJA 2BONA 1TZKA 4RV9A 8GPBA 2ZAGA 4Z3OA 4KO3S 4OIMA 4LXYA 5A7FA 1JIQA 1UAYA 3MRTA 2Q4EA 2QVLA 3V8QA 3BAFA 1P5HA 5K7SA 1L1RA 3CPJB 4NNJA 2B2CA 1BEZA 2KLBA 4WADA 4ARZB 3S2EA 3OX3A 1MT3A 1G17A 4RWZA 5DGCA 2XAUA 5EL0A 3K5IA 1AN0A 2RHHA 3MCUA 4ID9A 3W2EA 4EHDA 4HVLA 3P97A 5JNLA 2GN6A 4JKOA 5DN6D 4ZYXA 5E1DA 2OMEA 1Q50A 3WNBA 2PQ2A 2X22A 4LZAA 3DBRA 1NF3A 5DGTA 1XZFA 2P9EA 2CYBA 4D79A 3HCOA 3MNFA 2NXWA 1C9MA 3G2KA 3RC9A 5J4KA 4TTTS 5WRFA 1OJLA 3IFSA 3N58A 1AJEA 3GGJA 4E33A 1ABBA 1VLMA 1KI8A 4G8JA 2NVUB 4G65A 3WIOA 3GJZA 1CR4A 3L05A 4YJDA 1Q2XA 1XU4A 1KBQA 1OY1A 3GCZA 3QVXA 1U2GA 3SG0A 1VSTA 3TDKA 3HCCA 3U7JA 1SUWA 3UB4A 4B9AA 4ZKDA 5H5JA 1MD9A 1YCHA 2W6JA 3DMNA 4X6YA 5B2ZA 5SZIA 4DLNA 2QNBA 3BREA 4G01B 1IM8A 2FWRA 4MUIA 3BL5A 1HM5A 1WLYA 2Q8QA 2YTZA 5B4VA 4Z9XA 3UAGA 1JDBC 2HHJA 2XWQA 1Y7IA 3HM2A 4UBIA 4Q9HA 5JCPA 4OREX 3UJBA 4MYSA 3QHPA 3HADA 2J5XA 2XD9A 4ENUA 2QL7A 5AH0A 4AU1A 4PSCA 3CE9A 2I6SA 1CLUA 5LYJA 3A4YA 3IBYA 2ZBPA 2C77A 3N74A 3RRFA 1YOVA 4QPCA 3IIEA 4AKIA 3KLBA 5JJCA 1Y5LA 3DV2A 4N3GA 5TPZD 1HKUA 3P2KA 3DYBA 5FUBA 5JAQA 1EE1A 2BBTA 3EXIB 4KZPA 1TB4A 1OA0A 5IFKA 4G5RA 2A1TS 3JSXA 3QOXA 4HGPA 4OOEA 1MB3A 3DCNA 2I3ZA 3S6JA 1QX4A 3DNFA 4LVOA 4WCVA 3IUSA 4BLOA 5I7SA 2ERXA 2YJ6A 1N0UA 2O8VA 2PKXA 3OX1A 3VUEA 4GKJB 1X42A 2JGFA 4RK4A 4NK5A 1OGIA 1N3IA 4Q7MB 4UTPA 4PPFA 2F48A 2CFRA 3IXMA 2FI1A 3P20A 1TQ8A 3P9QA 4V2IA 4C20A 2W2LD 1LPOA 1NE7A 3NCHA 3GC6A 1V8ZA 4V02A 3K0SA 3GQBA 4QG7A 1JP7A 1ZM3A 2OD7A 1OXTA 2YWDA 4J9VA 1CYDA 4D1YA 2ZDGA 3IA2A 3CO5A 3E7WA 4WV3A 1BOFA 4RDHA 5LDGA 5I8PA 1NNLA 1SCNE 2BC9A 3E8MA 1UBFA 1FYXA 2J5QA 3PWKA 2R48A 4Q6WA 4PZCA 5JEEA 2EOAA 2PL3A 4QIHA 3GAMA 5LB2A 4AMVA 4EW6A 1XRQA 2ZJ1A 1BE1A 4XVHA 2BH2A 3BIXA 3GPBA 4P83A 3R7NA 2ZB7A 4LY0A 3IJ5A 4O6VA 4WA7A 3V4OA 3FWYA 3DC7A 3EIQA 2JFYA 4PO1A 3TUIC 4ZHSA 2OXRA 3BRWD 5CDFA 3HG7A 5EGSA 4C3OB 3P5BA 5JZOA 4TROA 1FP4B 2WTNA 4H4CA 4N48A 3D1LA 3PJEA 1P4GA 5F73A 3REQB 5GPBA 2C99A 4LE0A 1XL0A 1NASA 4BN4A 1SCDA 5IJ0A 4BMNA 1WE2A 1TM7E 4LNUA 3S4YA 5FI0B 2ZI7A 3JWGA 1AQIA 4KNVA 3OLZA 3U4CA 3THYB 2H11A 2V7XA 1VI2A 2O05A 3IO3A 4KW7A 4V39A 5F5NA 5FOVA 3TZEA 2HUPA 2IVZA 2B8TA 1ONNA 4TLAA 2ZYHA 1Z7EA 3AY0A 4IIHA 1ATIA 1C3OA 2XF2A 5B4TA 2PTHA 4WXYB 3ZWAA 1JJFA 1OLSA 1WQ3A 4EPYA 2BM8A 3BMQB 2H54A 3C3PA 3BB1A 2O2HA 3WIBA 4CN9A 3CSSA 1HE8B 1W4AA 3FNFA 4FXOA 3AHIA 3NVAA 3CF6R 3FOWA 1H5UA 4KQEA 4E5KA 1WQ4A 4ZDKA 4ND3A 4Q3NA 4NCKA 3U7QA 3KJXA 4AXBA 2Z8ZA 4S1TA 1GJRA 1UOEA 2YCBA 5E7IA 4ZKEA 1TYCA 3DOCA 1L3CA 3RIMA 3D7MA 1NJFA 4AZ3B 1BXKA 1BJRE 1QHHA 3I92A 4XSHA 1JFFA 1PR9A 3C7CB 3LKDA 4DM4A 1P17A 1R6BX 2GYYA 2PMBA 2QLLA 3RT1A 3ZXIA 1XO1A 3ODPA 2Q50A 3RU9A 3WGZA 1KH1A 1UZAA 4QHYA 2ZWIA 3FNRA 1Z07A 3U1TA 4LDZA 3QY0A 4XW2A 2B21A 4M4SA 2NXCA 1NBWB 3KWJA 1PJLA 3FBGA 1HFEL 2P9QA 5AW7A 2E55A 3HB0A 2PKRA 5AOBA 2VI5A 3IVMA 5BMVF 2WHQA 3FCOA 4MKHA 4OX9Y 2IYXA 1ZIPA 2ZIZA 4FINA 4KQGA 2Z8YA 2QR5A 5A4AA 3G79A 3PNLA 1JNYA 2II6A 4WXMA 1LBHA 2C7OA 3PLNA 2WIGA 2AYXA 4A1FA 3DTVA 4F9EA 1VLQA 1Q21A 4I1SA 4WCDA 4DRXA 5I9TA 5TEVA 3W4IA 4BVBA 1JTVA 4PZAA 3KQHA 4P4SB 3FVTA 2G5TA 5AT1A 1G1MA 3KUCA 2YFKA 3SGLA 4ZYLA 4K6MA 3HYLA 5LD2B 3D6FA 4RTSA 3MZ0A 3TW4A 5A6SA 3L6EA 4I0WB 2W2VA 2EDAA 3AKCA 2Q6TA 3WWYA 3ZWDA 2BM1A 3KHSA 3GEDA 5JDCC 4CIWA 4WGFA 1RRVA 4PC2A 2V6IA 5J5VA 1ECPA 4G1CA 3CB4A 4EGJA 3CZ9A 3IBSA 1I2BA 1JR3D 1W87A 3RROA 1P19A 3FWNA 3OLVA 3S2IA 5JD6A 2J08A 1THTA 3KJNA 2IH5A 3BD6A 2PUVA 2XGSA 3EA5A 3HXMA 1R3DA 1WB5A 2ARKA 2BELA 2SBTA 2V7TA 1WXFA 4PN7A 4BTVA 4Z4GA 1LI7A 1NF2A 4KQ6A 2VDJA 4N12A 3EGEA 2RAPA 4JDUA 2Z6VA 3FGNA 3K2QA 1SU8A 1S5PA 4PLZA 1UJBA 3AVWA 4GVXA 1GL7A 4IIFA 3N75A 4GR5A 1F9EA 3CUSA 3OCWA 3PUZA 3RODA 4UDXX 1FU8A 1YD7A 4D6YA 3T5GA 2JFHA 4AD8A 4Y18A 3CHYA 2JGRA 1R9JA 2N46A 2P0YA 1K88A 1I7LA 4XVCA 3KJQA 1KZ4A 2FPXA 3R3UA 4FBGA 5HS6A 5GJBA 2GDZA 4E21A 4C0HA 3UAYA 1GGVA 1XI2A 1BGXT 2DYKA 3AEQB 3FNQA 1RM4A 2ADFA 1LBTA 1CF2O 2QLJA 1NXOA 1B16A 1MRSA 1TFUA 2G1PA 4ZHQB 5AHXA 1K1EA 1UJ2A 1GPMA 2PSDA 3FY4A 4X20A 1VGRA 3VA7A 3M1IA 4YLEA 5EQFA 4XPIA 5SZHB 4UEJA 1PFGA 1TIKA 3NHWA 3OE7A 2BJWA 4LY9A 4CN8A 1E9AA 3TECE 3FPEA 3SDBA 4GI3A 1B8NA 2FMHA 1HMPA 2G9VA 5H4GA 1GDDA 2I6UA 4KO4S 5CFNA 1XKTA 1CR6A 2FEXA 1VSBA 2H2WA 4A0SA 4YV0A 5L3SA 2W2QA 2NUAA 2ZPTX 4MW9A 4BQIA 2IELA 4CKWB 5HRCA 1E6WA 3JYOA 1TTTA 3DPSA 4OP3A 2C57A 4QRIA 4AAYA 3O3NB 5LOVA 4C1NA 2QP9X 3C3MA 1FRZA 1NKSA 3V42A 5J9FA 3ZHQA 4L5BA 1U5AA 5IVKA 3MSCA 2PQ6A 3CINA 4LSGA 2ZAIA 3KQVA 3UMGA 4ODIA 2Q07A 4BB5A 3GLGA 3L82B 5E6UB 3C39A 1N2SA 2W6NA 1YS9A 3AM4A 5GOTA 2XUQA 1KMNA 1LWNA 1LH0A 3GT7A 4HN2A 4L0CA 4EARA 1CQJA 1U6IA 5LSAA 2RH8A 2ZR9A 1G55A 4QPDA 3U3RA 5KTYA 1Y1PA 4PFSA 2VDKB 3GVHA 3DM9B 3MHPA 4PYKA 1E8NA 3EGIA 3FUXA 3SJZA 2IU6A 3W5VA 1ZISA 4KR3A 3FI0A 3OY7A 1GEGA 5HKKA 3L4JA 3WGOA 4FQ5A 4FDLA 4LRTB 5FNVF 2ZS7A 4GMDA 1CZNA 1GGKA 2IXGA 3DE1X 3V1YA 4TTJA 1MV8A 4WOCA 2AOUB 3W5BA 1GNSA 1OU0A 3OZGA 4CMBA 1RPZA 2VWHA 3PI7A 1YBFA 1AUVA 4A15A 1D2AA 1OTXA 1SPBS 4Q6BA 1I10A 3PB3A 4LJAA 4KQKA 3VR0A 2PGIA 3RCBA 4EUEA 3FPSA 1QBGA 3CA8A 4DSTA 3RJTA 3DJYA 2NUBA 1QFJA 1ZR2A 3ZY5A 3A10A 1ZJ6A 2AI1A 2H3EA 4DUPA 4YONB 1NXPA 2NV6A 2A59A 2RDMA 1EDBA 4R2LA 4ZN6A 1UPCA 3QUSA 4M0PA 5K05A 5KNCD 2C2XA 3UWDA 4KOEC 3K6SB 4HEQA 4FHDA 2ZRQA 1J5EB 5FH9A 4MW6A 1JR3E 4FYWA 4LDAA 2WP8J 4FC6A 1BRMA 2VJPA 4CMHA 3OJOA 4K6CA 3QY9A 1OWPA 1UDAA 2GF9A 4YJ3A 1ZNWA 2PZEA 4EVRA 2JJ1A 3EIOA 3D8SA 4ZTBA 2WQ7A 4M99A 3IR7A 2NPFA 3A1FA 5LQAA 3ECAA 1AK2A 1XD8A 4QXOA 3WI7A 4E5VA 1QG0A 4JASB 4E5MA 3EZNA 2NO5A 4WDRA 5DM70 2V0CA 4DDUA 4CM8B 4RCYA 4G85A 1G21A 3GHYA 1JEEA 5IHXA 3A9SA 4XGQA 5DGDA 1L5GB 2O5CA 4OB7A 1SOMA 3VOSA 5CFOA 1XDBA 4TLMB 2R8BA 3W5AA 4NV0A 4CUJA 4NSNA 4K0KB 1RWPA 3ROQA 5B5SA 1X38A 2BYTA 3DAOA 3HB7A 2DH5A 4TSFD 2GJ4A 2IYTA 1NLUA 4GKAA 1XMSA 4M9XA 1FS4A 5I7FA 1U2DA 1VI5A 2JARA 4Q93A 3WQRA 2ZXEA 2NGRA 2E6UX 3HC7A 2VNKA 3LXUX 4M6WA 4RBNA 4CKEA 5JXHA 5HRUA 2H18A 2OXEA 3ZDCA 2RGRA 4G63A 3T4UA 3HBFA 2P7IA 5HDQA 1PS9A 3QNMA 5DYTA 1DI0A 2J33A 1UBCA 4R84A 2VYVA 4DKXA 4I4TA 1A04A 2R6DA 4TYQA 3VO1A 3DMHA 5ALHA 2ZT8A 1UZLA 5F7ZA 1FVFA 4EG5A 5JT1A 2AXNA 2ESRA 4GMHA 3OIUA 3IH5A 4HXYA 1BRTA 1LW6E 1MA0A 2M6LA 3SZ3A 4PRKA 1W29A 4EEXA 3DFIA 3WIEA 1QR2A 3WLHA 3BSFA 2CBZA 3ML1A 3UCXA 1RPTA 1JBQA 3BC1A 2WU1A 1TA0A 1QX3A 1DBSA 1Y34E 4WKPA 1KYWA 3HVUA 2XRZA 4L4RA 1E1RA 3THXA 2OOSA 5EHQA 4BN5A 1DKUA 1FLAA 2GKOA 2OCXA 2PGNA 2DR0A 1FL9A 2QX6A 2V45A 3LX8A 3SX4A 1QS0A 3H6GA 1Y5IA 4E70A 4RFVA 4IFIA 1TYAE 1AKTA 3B2EA 4TZTA 4YACA 3KQMA 3HY6A 3ZBUA 2M9MA 1SQGA 4IS3A 4YYEA 1TIBA 1T2CA 1K4YA 2DRIA 3MTQA 5F98A 4LC1A 2LDBA 4LZNA 1SG6A 2QAJA 2RHCA 3K9BA 3N2NA 1IXKA 4B81A 1TTHA 3COWA 3PEFA 3PUVA 1KVTA 2H5EA 3HU1A 1RI1A 5JZVA 4RVHA 3U37A 3SZLA 2BFDA 3ZWYA 1BMFD 2VPIA 3DHNA 4MKFA 1NGSA 3WYBA 2E1PA 3ZC3A 2V1UA 4LSZA 4YRCA 1QK3A 4CF5A 1QVWA 1L4YA 4DLSA 1T36A 1MRZA 2HX1A 2PKWA 5ESDA 4EG8A 3I2JA 2VZEA 1HGXA 1FU7A 2QRUA 4ZQFA 1G5IA 2BUCA 4KODA 5JECA 3IOEA 3OTQA 4QYIA 4A9AA 4WHMA 5I9BA 5G0SA 1JB9A 1E2IA 3AEUB 3NTVA 4MYHA 1SBQA 3PC4A 1J2JA 4L02A 5CBPB 1F2UB 6LDHA 1GNQA 3QF4B 1VBKA 3ELUA 4KUGA 5LQNA 1K89A 2YHIA 4IGFA 3EBLA 2JVKA 2O8DB 4JKYA 4IIEA 2O1SA 3TLYA 4C5CA 3PXUA 1NATA 4JMPA 1VG0B 4R05A 4ACBA 4Y6OA 4IDAA 3QBTA 5TX7A 1TUIA 2QRJA 4HB4A 2CSUA 3M7IA 3O4FA 2Y3IA 3U1BA 2AG8A 2PQMA 3M6FA 3OFND 5E8JA 5FCDA 2NUTB 4XLLA 2YW9A 3S70A 3KE9A 2XB2A 3D7SA 2PX5A 4BNXA 3SKVA 3SFVA 4M7PA 2WSIA 1AM4D 1Q0PA 1THZA 2ZE7A 1N2XA 3QUQA 9ATCA 4NYIQ 5IMSA 1R6UA 2QYTA 4QU9A 1EUCB 1W25A 1ZMTA 3VDNB 1DAFA 5IX8A 1DIHA 3H6KA 1H2RS 3AKDA 4NBTA 1I1HA 3N5KA 2TRSB 4JIMA 1IBKB 2OLJA 2AMVA 2B1RA 3KKMA 3INYA 2JFQA 1YDHA 4DIFA 4RKWA 3KSZO 5C7YA 2WJAA 3KP1A 3N6XA 4WVFA 3MJVA 4PC1A 3BJRA 4MR7B 5AR1A 1Z4IA 1N9GB 1SKYE 4J49A 2Z83A 2O3UA 3W2IA 2XYVA 3R6GA 5DN6A 4M9SA 4OVKA 3PGJA 4D0NA 1L5YA 4MKXA 4BFZA 4C76A 3QXJA 1W4ZA 2PX6A 3RAPR 2GPJA 4QRDA 2FU5C 3FVVA 2VZLA 3HVIA 3UCEA 1XCLA 1Z4KA 4OUDB 4UNIA 3OTIA 2CL6X 3GP3A 5E0OA 5KWEA 3KDSE 4YALA 3ZI4A 1J23A 3DLTA 1GPNA 4YPOA 2XYPA 1XLVA 1FQWA 3AWDA 3P0IA 2NV0A 4M76B 4KUEA 4ND5A 4ND8B 3TLGB 1P18A 2BFWA 4OYYA 4P3PA 1C9JA 5FQOA 5FUYA 4KGZA 4PNHA 4GOXA 3UCFA 5CYFA 3AZQA 3IC5A 4IH4A 2BMAA 3NALA 4DDTA 2JZCA 5KWVA 2XA9A 3RVBA 4G56A 1L3BA 1V8BA 1WCIA 3A0UA 3L41A 1XEXA 1XN4A 4RSMA 3ZEIA 4TVBA 4ABTA 5AW2A 2ZRNA 4R3WA 4IZIA 5ITSA 2C20A 1FYWA 3D0OA 4LZWA 2B8WA 2GK7A 1Z0ZA 5IPFA 3KKLA 3UB3A 3LDGA 3SQNA 2R6ZA 1KVQA 1O1YA 4UXJA 5TPZA 4F2WA 4FOTA 2QRZA 4AJ1A 4KZKA 1ENPA 3DLAA 5YASA 4EJSA 4YXWD 2OA0A 1DPFA 1R5OA 3R5HA 2XLBA 1XSEA 1JVSA 1XV5A 3LPDA 5F1PA 1CIVA 3UYLA 4LECA 3GZ4A 3R20A 1KIMA 3UWKA 3SIWA 5GTDA 5KQGA 5KNBH 1F8UA 3P2IA 1EB9A 3U3XA 1P2SA 3QLTA 5BPHA 1FX1A 1G291 1GUZA 4JN6B 4O59O 3TGWA 3WYNA 1NHGA 2W2LA 3F96A 4YP0A 2P11A 4ZRMA 3A6KA 4GYYA 4F5EA 4K05A 2JCYA 2NO9A 2ENWA 4M0KA 1GL6A 1JLRA 4CIXA 2NWQA 2EZ9A 1OASA 4HEJA 4KWTA 3PEYA 3FRHA 1GZ5A 1PEYA 2NUPB 4H6VA 4OHOA 4CU5A 3LHDA 2QXUA 1MAVA 1U5CA 4HF7A 4Q4HB 1SBZA 3MQ4A 3RSLA 3MJTA 3TW8B 3TTVA 4RTKA 3BM5A 2FQXA 2XOKD 3HA3A 5B1YA 4FZ5A 4J16A 1SIUA 1ZGCA 3S3TA 2WU0A 3B3JA 3QMWA 2V4UA 3G8YA 2KBEA 5HIJA 1LBSA 2JGEA 4FMDB 3LLSA 1WMDA 1JG3A 4I9NA 4LJ9A 4U7DA 2UXDB 1Z22A 4LK2A 2KYRA 1G8MA 2OYRA 2FR8A 2F7SA 3ZV6A 4DPMA 3BXHA 1TU3A 4YHBA 5DOZA 5DM0A 3U39A 3TMAA 1OGJA 1ENZA 1IY9A 2AMFA 5A9TA 2QX9A 3DKKA 1EFUA 3W6UA 3ITEA 3NP7A 3KAKA 1YK1A 1NJ2A 1K6MA 1NXSA 3A25A 4RQUA 3EAFA 4PZ0A 1KSFX 3MUFA 3VTAA 1M9NA 2ISSD 3HVKA 3HFJA 2Z2XA 1K8ZB 2G40A 3RIXA 4CMIA 4CQMB 4JT9A 5MGNA 1DCFA 4LHEA 4BX3A 1UK9A 1BGWA 2PZ8A 1NQVA 2XUJA 3SVLA 3K8YA 4FHZA 2D1RA 4RADA 1O2DA 3G02A 2HCFA 3N8HA 4H7KA 2Q4RA 1X1RA 4L4XA 3VNAA 4DLKA 3C43A 1E2QA 5DSXA 1QHXA 1DCMA 3ETJA 5KOYA 4OGWA 5KTTA 1SKAA 1VRWA 3PQ6A 5KMGB 1E3TA 2E1RA 2O8FB 2PWYA 1QF7A 3IAAA 4PR3A 1YWGO 2H1RA 3LA8A 4AJ2A 2CVQA 2ZE6A 2WZDA 4FFVA 5DXFA 2FWPA 4DLBA 1QVRA 2OFPA 1D8TA 1HNZB 5B37A 3VU3A 4B6FA 4C6TA 1G4UR 1RXYA 4MVJF 3S2FA 1SXJB 2ADMA 1CY2A 1RWQA 3FYTA 2Q2VA 3L4SO 3T41A 5IWAB 1E7QA 5BRJA 3HFSA 3JQ8A 3FHLA 4RQTA 4F71A 1CRLA 1YIDA 5U9CA 3TNDA 1C7QA 3ESDA 4OATA 3K2IA 1XK7A 3QEBZ 1JAHA 1L5OA 1GPUA 1GILA 2IFTA 4K28A 3FFBA 4LS3A 1W36B 1EB8A 3NM5A 4EMSA 4WDQA 3DHEA 1ILEA 4B4OA 4PQGA 1U2DC 1GKUB 3VR2D 3UKDA 3GVPA 3IBCA 1RJDA 3H1AA 4HX9A 5FT9A 4ZVKA 2CFOA 4CMAA 1DTWB 3JVVA 2IXFA 1JIXA 4R41A 3MCAA 3GD5A 2J30A 4BX2A 4PYJA 4MLCA 1YHZA 4D2IA 3FM9A 4OMUA 3OEWA 5DNVA 4IRXA 421PA 5KKNB 1QC5B 2GEDA 2Z98A 2P9GA 4RD6A 1PBTA 1Z74A 5E4TA 5AW1A 3I28A 4JXKA 1J8DA 2G82A 1I7DA 3QVJA 2BHLA 2X15A 2GS9A 5CM9C 1K97A 5FWXA 1UEIA 3OPXA 4YFVA 1NFRA 1SAYA 1OWLA 4L5AA 1YULA 4LSWA 2DPLA 4RQAA 3DO8A 5CDSA 4RMJA 5HE9A 3NFRA 2YQZA 2Y05A 1RAEA 4BECA 1WMSA 1U9ZA 1ISIA 4NG5A 4OI0A 4EF4A 1D8AA 3UT5B 2AN9A 1FDRA 4KEAA 2C54A 3CF2A 3ITNA 3A6DA 1M1YB 2HLPA 3T1OA 3VPAA 4ENRA 3Q15C 3DPUA 5BV1A 5A3RA 4G4SP 2W11A 3JWPA 3O7MA 4P35A 5EZYF 3QVGA 5HJ5A 5CM8B 1T0BA 1TZBA 3NYIA 3HGMA 2B8JA 3D6UA 5DNEA 4R01A 4BBPA 5HCNA 5L95A 1XGKA 2VPYA 3FIJA 3QJYA 3NBMA 3ZWXA 4N5MA 1YDEA 2Z2KA 6ABPA 4YTEA 2XNHA 4FSXA 3AJEA 2C3MA 3QQPA 3TEMA 3VUFA 5LP6B 1E9RA 1YI8A 3AHJA 3QENA 1NMEA 2I1VB 4R5MA 4AZWA 1XDGA 2UZAA 4CDRA 2G5GX 2GH1A 1H94A 1MC4A 4O4JA 3FFTA 3JQPA 1FQOA 2C97A 2I2WA 1S4MA 2RGNA 4GBED 4MS3A 3HNRA 4EGSA 3K0CC 3ONFA 5I7HA 1OX5A 3IEKA 1GTMA 1UMKA 2I8LA 3GN2A 1WDWB 3L8YA 3W06A 1CUAA 2CJWB 3P0RA 3LA6A 4IDBA 2HEIA 4X45A 1UM8A 2VPTA 3DBHA 4JLMA 1LEHA 2VUSA 1CFZA 1G3QA 2NYAA 4A8JA 2BFEB 3O93A 3VM6A 3L2OB 4RZQA 1WSDA 5H3LA 1I4OA 4ZO8A 4UTVA 2WM3A 2QM3A 2B2XA 1OI7A 4M1OA 4O33A 2P5YA 1OC4A 2Q6OA 4G1MB 3DULA 4PYQA 1H9BA 5EHNA 3W8RA 4EA7A 2Z6UA 1RFGE 1ISRA 5DYIA 3PR3A 3N8GA 1X6VA 3IOMA 3B1VA 1HXHA 1OF1A 1SQ5A 4DW8A 1T9GS 2GT1A 3H9JA 4FKZA 3LNTA 4KJXA 2G8LA 1SU6A 3DT6A 4P4GA 1K3UB 5T8KA 5EIWA 1OBOA 2OE2A 1X80B 3OPYB 4DIBA 4PONA 1ZESA 5EVJA 3F49S 1KARA 2CUKA 3IURA 3OQHA 5LZ2A 5LZ9A 3F6BX 1MUUA 4GLBA 4KN6A 4Y6PA 4LHZA 4RGYA 1WBJB 3GRAA 3ZOKA 1QPBA 4KB5A 1H65A 2IF2A 3STUA 3S2SA 3QU7A 1KQFA 4DLXA 3AJAA 1C4KA 4PICA 2FXVA 4QYSA 5EP2A 3VKFA 1OFIA 3FOBA 1M76A 4HKTA 4RS4A 1UINA 4JGBA 3EDCA 4A2QA 1CZUA 2PUWA 5DWQA 1X7ZB 3EPRA 3FNIA 2X19A 3NS7A 1C9YA 5TEWA 3TINA 5K8CA 3KB2A 2YZMA 2XA1A 4JYCA 4KC0A 4D6PA 5K4GA 3L7DA 3PF8A 4ITVA 2LKCA 1RW4A 2J85A 2XE7A 1W75A 4RPHA 3V4LA 1WUYA 3K6RA 2G1UA 3ZTTA 4YR7A 1ZG3A 3EDRA 2GPYA 1XELA 3NQ41 4FFDA 1ZBDA 3KKOA 3PHGA 1QDEA 3KZOA 1X87A 1C3LA 2QJRA 4F7WA 4ND1A 3A6EA 1J2EA 1YL6A 2JGKA 1CQPA 4JA2A 5H0IA 4Y1RB 5JAMA 4IINA 4LQ4A 3DP7A 1AQYA 3EJ6A 4ON9A 3HUFA 4LF9B 4OXIA 4D3YA 2WTMA 5AW8A 2F8LA 3G9UA 3OMXA 1LNSA 5KNCA 1AO0A 1SXGA 4KR7A 4MUAA 2SECE 3QIAA 5EJIA 4H6PA 3BICA 1POWA 1R0SA 5JZSA 1AMOA 1E3WB 2EV9A 4MGZR 3C6MA 3W79A 4J3JA 2I4RA 4KPGA 2QU8A 1H4VB 2XTNA 3TIVA 1HORA 5ALXA 4BKUA 1JG4A 2PV7A 3P96A 4HN9A 2ZUEA 2JAPA 1SOUA 4NU6A 2HDHA 4EJSC 4I5EA 4DC9A 3T94A 3I62A 5IT9A 4WFIA 4Z1OA 4NENA 5CNJA 1TF2A 1DJPA 1RMTA 5CG2A 1Y5NA 3F6RA 4PF1A 4Q1VA 4F6LA 3KU4A 1NW9B 1MB4A 1QPGA 3SM3A 2YBDA 2FPLA 2I54A 5CA0A 5TSDA 3D3QA 2G06A 3AWIA 3H5NA 4YAWA 3RWBA 3L7BA 3RAGA 1ACMA 4LAFA 1BMQA 4YAUA 2QVGA 3KKPA 4OHFA 3PNSA 1S3FA 1FRFS 3EYWA 1V9CA 3MT9A 4TL8A 4AF6A 6REQB 5JZMA 1G9TA 2WG2A 3BJMA 2A2ZA 4JWTA 1FFCA 5ER6A 1C3XA 4LSMA 4C08A 3NTQA 2WZQA 3L8CA 4Q4AB 4JI5B 3I1IA 1BNCA 1CS4C 4JMLA 1YSCA 4MV4A 1J90A 1ULAA 3Q7QA 3VFDA 4E13A 5AM0A 3VC2A 1ZH6A 4QM6A 2VJMB 1SK8A 2NM0A 4DXHA 4G1BA 5KTSA 1E3EA 3PD1A 4CDNA 3A05A 4MK4A 4FT4A 3HZZA 1A1SA 1DE0A 1J0CA 1KJJA 4YRSA 1X9GA 3MXTA 1HYHA 4MW4A 1NLFA 3FDZA 2FR8C 3LWNA 3H4IA 3RS0A 3QVKA 1L5HB 1EUDA 2QG6A 5GVSA 3PX2A 2H2HA 2OUKA 4H1HA 1KS9A 3S29A 2FUEA 5K4HA 2H00A 1TUEA 1YRAA 4P92A 4F56A 3VOAA 3KFXA 3L1KA 2ZRLA 4LXHA 5EJAA 1UKAA 2IYEA 3KXPA 4TTAA 4QQRA 3TB6A 4B5KA 3C48A 3FPHA 2VHXA 4F1JA 4TX1A 2RJNA 2PRSA 3TFQA 2VDMB 2PMKA 4R3UC 4EPRA 3NWJA 4WZAB 2OBNA 2ZRAA 3HWRA 3ZXUB 2JJQA 4U4AA 1PAUA 1Z5ZA 2ZWVA 3GG2A 2HK8A 3RVMA 4NJOA 1PF7E 4BZWA 1G5FA 1J1UA 4Z8YA 3LX5A 1AGXA 4NVRA 1NQTA 1ONBA 3ICWA 3OZTA 4TKVA 3S68A 3C6BA 4UATA 1VL8A 5JFOA 3K0FA 5CCXA 3WY9A 3QEAZ 1NQOA 3H4MA 1ZOLA 1D1SA 2MT9A 2X23A 3VNVA 2CCKA 2HIAA 3IUNA 2CLDX 1WETA 2P2GA 3IP7A 2MTBA 1MC1A 5DTIA 2HMTA 4BLQA 5HRAA 4ALNA 3FPKA 2HZBA 3U26A 5JSFA 4QBFA 3KJGA 3BMCB 3ANMA 3K1TA 1Z7YA 3KSAC 1E8DA 1RAFA 2JAWA 2M1XA 1SRRA 3O1HB 2YFQA 4NPHA 4EPXA 3AETA 3MRXA 5HKBA 1A8QA 1W2HA 1G8GA 5ALOA 4PYOA 1E5VA 2IX9A 2OESA 1MVNA 3RAJA 4RY9A 2IHKA 1ECBA 4Q9AA 1UBRS 2WE7A 1KFCB 4ZEVA 4XYBA 1E6LA 2WWFA 2R1TA 1N0IA 2HJRA 3TQRA 4OF4A 4IWYA 1NVMB 2PFKA 3B3QA 4EMTA 1VDZA 3CF0A 3HR7A 1ZNZA 5EINA 2GN0A 4R6WA 5FPQA 4KVGA 4F92B 4NK4A 1IH8A 4CG0A 1LSSA 4QBHA 2F1HA 3SC3A 1JR6A 2OFWA 2YICA 1I24A 5FPYA 1RZ3A 1GTVA 2CEAA 4N76A 1YR2A 1QMPA 3KXDA 2Q28A 4KQWA 4G5GA 1CQWA 1KYQA 3VVMA 1ICIA 3DE3X 4CKYA 4RTMA 3OZXA 4G6ZA 3JZMA 2ONJA 4GOLD 5KTKA 3OA0A 5FI1B 4RGBA 2BISA 2DTDA 2P0EA 3EXEA 4KX5A 5EIOA 3CVVA 2RIRA 4QOJA 4YNBA 2EIHA 1JZSA 1LU9A 2QLMA 2GZ3A 2X8JB 3M1LA 4TWRA 1SBNE 1YASA 4O1HA 4UPDA 3UBTA 3BORA 1TM4E 2P41A 1DQRA 1UPFA 4TYWA 4W7IA 3GR6A 1SC3A 2XCIA 1V37A 3TH5A 2ZAMA 1X7WB 1N5IA 2Q5IA 3TSCA 4GLLA 1AGPA 4LDRA 1D03A 1Q22A 4B71A 1I0IA 4EKEA 1T1JA 3BMOA 4PLGA 1TX4B 2Q1XA 4Z7NB 1AKRA 1E4EB 3ADKA 3BT7A 1VP3A 2HPAA 4K6OA 1U7XA 2GX6A 1GU0A 1IM2A 5DN9A 4F84A 1Y6FA 1UOQA 2C42A 3AP3A 3L6UA 3AF5A 1AUPA 2R4QA 3NPAA 4XQ9A 4YMSA 2Q5FA 1ZGHA 4O25A 5HTKA 2PO7A 2Z09A 5EP4A 4D92A 3ZBTA 2I62A 1G2OA 3JR3A 4NL4H 2VK1A 3QLEA 3TLAA 1BU5A 2NU9B 4X84A 1TXGA 3EZXA 3H2IA 2Y0EA 3IIMA 2N0SA 3MWKA 1ZONA 3IAFA 3OEYA 5KVQA 1LQUA 1GARA 1YFKA 3I6IA 4HB0A 2PA0A 1SUPA 2MCFA 3DE7X 5ELXA 2GWRA 4EPTA 2R47A 2OV3A 2QD3A 3D6TB 5H02A 3K1ZA 5I7OA 1RWWA 2IE0A 3GVIA 4IHAA 5EGNA 1UPXA 3BGIA 2POQX 4QODA 2QMUA 3AVQA 2C8KA 4L07A 5LZ5A 5BN1A 1B41A 1HEIA 2RJ3A 3I45A 2RHTA 3NNNA 1DNPA 3RSFA 1UEJA 1GFSA 5JDIA 2UU9B 5KC9A 2RGNC 3IHLA 1O9GA 4RLSA 2OO5A 4UHDA 2P75A 3GRPA 1USGA 1ND6A 4GIBA 1PT5A 2R8PA 3SXUB 5DHRA 3EXG1 4NBRA 1RZRA 4PHHA 4A8JC 1DC7A 2AYYA 4LX0A 3K92A 1M6HA 1H5NA 4L5IA 4B85A 2XITA 4E5UA 1BW9A 1UJ6A 3WAJA 4YMVA 1IOLA 5TMBA 5JROA 5EN4A 2LKDA 1C30B 3UMRA 3EC1A 5JANA 1U7DA 3WBKA 4OFXA 4D4JA 4YUYA 2QNRA 3HXPA 1RRKA 1V8PA 3OSZA 5DT2A 4D5EA 3PGLA 1XMVA 4U7HA 2C7VA 1QG4A 3DYVA 4NZ9A 2UKDA 2Z9CA 2LIVA 5IW8A 4O4IF 2O4UX 4QO7A 2O14A 1KMCA 3E22A 4ZEOA 3V2HA 1UCFA 2J07A 1MO2A 2BGTA 1HUQA 3G59A 1K6JA 2X2OA 3FIUA 2QY6A 1QTIA 5EMLA 4TKUA 1F8GA 4ECEA 1GZDA 5IABA 1ZXXA 1ESMA 2ZQ5A 2IZ0A 2OCYC 2BT4A 1U4OA 5FWAA 5I4IA 1NBOA 2D0PB 3CPEA 5HKOA 3WWPA 4KBGA 1NW6A 2OYSA 4FZ3A 3WGNA 1P45A 4D56A 1ZITA 3A14A 1D6NA 1CUXA 2BR5A 4TRJA 1PYDA 1N4DA 1CF9A 1PQYA 1R1DA 4MQBA 4UMDA 3HYSA 2DOKA 1CY0A 1GGHA 1XEWY 1JEAA 2VKTA 2A1UB 2H57A 2OP1A 3UAZA 3WR5A 2H2DA 4KREA 4M87A 1SXHA 3LUAA 1SFRA 5ALJA 5KNDA 4YDSA 1OAAA 5TF4A 2H5LA 3W6NA 4K2HA 2GVDC 3NUZA 1GCUA 4EFDA 3CLVA 4DAEA 2ZUWA 3RW9A 2FUG6 5BSTA 5TDHA 3SEQA 3BQMB 4AKEA 1WHTB 4N1AA 2C4VA 3GMIA 4EB6B 4FQ8A 1T8WA 2A5JA 2Y0CA 3SZMA 4IXNA 3GJ7A 1WQ1R 1M5TA 3OP4A 2WKSA 3B5EA 4PWZA 4CQMD 2FZLA 1C0KA 1MAUA 1CDEA 1W76A 2J8ZA 4KXYA 4LRUA 5KU1A 1IY8A 2GGSA 4CEHB 1EVKA 2GCEA 1ZXLA 1MA3A 5DK4A 5EIBD 2EWVA 1UFVA 5FFFA 1SG0A 4TRNA 4B3SB 1T3TA 2XAAA 2FPIB 3E7FA 2CXSA 3MMPA 4IDPA 4HS4A 5JSKA 3GLTA 1P0QA 3IRVA 2F55A 3I2HA 1Y3DE 4B4UA 1J09A 1FK8A 5F9FA 2FEWB 2RAUA 5LJIA 4W9MC 2ZTUA 2E4VA 4Y2XA 2FY8A 3VZBA 5FPHA 4YRQA 3GV0A 521PA 3WXBA 2VPWA 2F64A 3R6DA 2J5KA 2W6PA 1IN1A 2C8VA 3CKMA 1Z0IA 3OLXA 4I4CA 1BCSA 4AWBA 2DWUA 2PJZA 1IRXA 1EGQA 3FJOA 2ODWA 4HADA 2HCRA 3SJAA 1SWVA 3C1OA 4KIWA 4L4UA 4BWVA 2AUMA 3CGWA 3AFNA 1ODIA 3HXKA 1Z83A 1VZ3A 3OQMA 3OZ7A 2AJTA 2QW8A 1EFKA 1N6KA 2BFBA 4W6QA 1ULBA 1W94A 2J3QA 2O2IA 4WZBE 4WLFA 1M1UA 3Q8LA 3T9EA 3AONB 1EFTA 2GERA 3C5CA 1G7RA 5KPDA 3I5YA 2V55B 4LPKA 1B8UA 1ODTC 3QFFA 4UU8A 5FOWA 2E4WA 3WYGA 4CLOB 4Q1EA 3FETA 1W36D 2GHIA 2VNJA 4R7TA 1MW9X 2CHFA 1Y6RA 2DHCA 2XVMA 1Z38A 3BPSA 4LRYA 2Q9UA 5C8XA 4HH3C 2AMJA 4D99A 3CVUA 2JLQA 2VP4A 2I91A 4AYWA 4G81A 2XHEA 4E51A 2Z58A 1Z4QA 3O9ZA 1XZMA 2C7GA 2NQ8A 2QRVB 4LXUA 4RKEA 4ERNA 4QNMA 4NCXA 1NYQA 1N4AA 3VR5D 1UDCA 2FZ4A 4LYFA 2QZ9A 2Q7DA 3ZE7A 1D2CA 1A5ZA 4QZVA 2XCRB 2ONYA 2CWWA 3R3XA 3T34A 3OOSA 1M5RA 4MQMA 4BVKA 4EO7A 4BATA 1YFLA 4ZQBA 3CH4B 3D8RA 1U7TA 2RIPA 4CEJA 4TV8B 1TM2A 1ONOA 2GF2A 2EFEB 1FUKA 1MB9A 1AZLA 3H5AA 2F9LA 4P0TA 3GJ0A 1TZMA 5K3SA 3SFZA 1O9BA 1DLJA 3ZD7A 5EJ6A 2Y2UA 1EPUA 1WJGA 2XXJA 3GLQA 1WDMA 1RNLA 4CTMA 3PI6A 5A5FA 4AYTA 3KSBC 1PR6A 2V7GA 3WIUA 4AJ4A 2VOJA 4JP5A 1A2QA 2YOFA 2YWRA 2VKQA 3A28A 3IUBA 1S89A 3KFLA 3QYPA 4MQEA 4B76A 1FMJA 3BJEA 1QYRA 2MSNA 3V9AA 3ILHA 2WOJA 4ASUA 4A0RA 3I9V1 1YRHA 3HGTA 3R77A 3G8DA 2UVDA 3TAUA 1QH9A 3AQIA 2QD2A 5SY9A 5A1JA 2R84A 4QT4A 1GM5A 1RYZA 3IR6A 5LN1A 4C0KA 4HNAA 3AXSA 4JJIA 1R27A 2A4MA 1L5ZA 4PHCA 3U81A 4NZZA 3AVXA 4PFQA 1OKKA 4S04A 2DPYA 2FN9A 3IILA 1FNDA 1PSZA 1ZSVA 1G64A 2Q3HA 5EZQA 1T3LA 5DULA 2L18A 4GXTA 2CVPA 2QDKA 2HO4A 2D5IA 1CZKA 3ESQA 3ZHBA 1I32A 1UBUS 1DT3A 2JCVA 3KQTA 1HETA 4HDSB 4MPPA 4KSBA 2QQGA 1E2EA 3T4XA 1HK7A 3OF5A 2IH2A 2B1QA 2DKOA 1UXIA 4Y6RA 3H99A 5K3EA 1PG2A 2QVYX 2A88A 2DWQA 3OZFA 3CUWA 4KI0A 2A5LA 4KLZA 2JATA 4Z7OB 2J9GA 5JYBA 2IYUA 2KLHA 1Y89A 3FTCA 3K9WA 4YWHA 2B6NA 5GQSA 2IWRA 4HWOA 3A8TA 2QENA 2QPTA 4I50F 2AVNA 4MS4A 1U0LA 2G77B 1DKPA 4RA6A 4ZCRA 2O23A 4OLHA 1GWNA 1VKHA 3JASB 5TGDA 3OT5A 4UM8B 3GNLA 3WWCA 3QSGA 4JLVA 3RS8A 2EYUA 1OXBB 1JKFA 1SHLA 3O2JA 1DEKA 3PS9A 1TTQB 1P9WA 5FJIA 3ABSB 4DY4A 1XZLA 4L2IB 3TPZA 3JZDA 4ND6A 2HU5A 3TKLA 3ZY3A 2IPXA 3PK0A 4ZYYA 5EJEA 3CH6A 4WCFB 4ESHA 3MS7A 2JZNA 1BJTA 2DWOA 2OM6A 4RYDA 4LC0A 1Z2AA 3LC0A 4IXTA 4QFBA 2J9FA 1F6BA 3STXA 4EP1A 1UBTS 3DTTA 4CKZA 1PN3A 2HSJA 3C5HA 3W3AH 3KQUA 1X1EA 3FOCA 4K88A 1DAIA 2RHBA 4J1QA 4BGVA 4U02A 4B8WA 3N3BC 1AGYA 1P7YA 4G0PA 1Q44A 4WJLA 2PGJA 4UQPA 3SR0A 1FW6A 3BD8A 4MJ3A 1I0ZA 5CH5A 2QD1A 5L6MB 1T9DA 4ZMSA 1FVOA 4RD2A 3O21A 5FIUA 4UHFA 5LDDC 3LCUA 4I5DA 4PBRA 3RFFA 3DOFA 1HTWA 3A4TA 3EOZA 2F3PA 3NORA 3BRQA 5DVZA 3SPXA 4QFDA 2FB9A 1AE1A 4D4HA 1JQLB 4Z53A 5BSRA 4RNDB 3CXRA 4OBWA 1OX6A 3B1FA 2BKAA 2GBIA 2GPBA 5DBIA 2I7XA 4V0NA 3HEBA 3PRJA 4J6EA 4YI5A 1KAEA 4Q47A 1JBEA 2HTEA 4B3CA 4LZJA 1W46A 3MWEB 2OO5C 1XRPA 1QK5A 2C8JA 1MNQA 2Q1UA 3NV7A 3AVVA 4HDNB 4JFRA 5G02A 2VK2A 2LIPA 1EMDA 1YQWA 4KRGA 3INRA 4M0LA 4LCJA 4Q9NA 2LCFA 1YI0A 3QVUA 1W9MA 3EC2A 3VDRA 4WN9A 4IHJB 2L17A 4ME6A 3EPKA 2J7KA 1E64A 1P1KA 3KL2A 5HA5A 3TX6A 2VQDA 2XWJI 3RYFB 1PJTA 4XJXA 3VR4H 1PNOA 1P1CA 2O7VA 2X9LA 3AU8A 3NHUA 3NM6B 4INPA 4N7RA 4X1IB 2CY0A 1Y4SA 3CMCO 5BQFA 3IAEA 4M54A 3L6BA 5B3JA 3W5CA 4EG6A 2ZDHA 4I1PA 4G9EA 4DLVA 1VPVA 1EVLA 1A5SB 1K6XA 1J06A 4F1WA 2CB9A 4AJHA 1T26A 2B6HA 2C2ZA 2QTWB 1KRWA 1BN7A 1G3UA 3P8ZA 1E0JA 2IK8A 3KB6A 3UOGA 1XRLA 4KPUA 2I1LA 3IIKA 4D9FA 1DTSA 2ZUVA 2HGZA 3CCBA 4GXQA 1IN6A 2FP3A 1CHNA 2PS1A 3EWIA 4LOKA 4OM7A 3NNSA 2Z8XA 4OQMA 1C8VB 1OMOA 1S2NA 2IU0A 2A5FA 3QUTA 3PQCA 4L6AA 3DHVA 4ZGWA 1W73A 4YLGA 1GPBA 3OX4A 4JSYA 1Z6ZA 3H0KA 1CLEA 3KKZA 5I7AA 4JLJA 4N0QA 4Y30A 4CL3A 3L8FA 4JU9A 4HYQA 4C89A 1KO8A 3WO0A 3OT1A 4GC5A 3QWAA 4FOPA 1VJCA 2B7LA 1DBVO 2OHIA 3IE2A 5DWVA 1L5FA 5LB4A 3TD6A 3ZVMA 3GAFA 3Q3VA 4Y1EA 1V0JA 1Z8FA 2ZBQA 1MRNA 3CSUA 1ZQ9A 1T43A 2F67A 1ZK0A 1DQNA 3R3YA 1U1EA 1BKDR 2CKDA 4DWJA 2PXXA 3VJMA 2ZJ8A 5CTJA 1P1HA 2Q9CA 2G63A 4AL4A 2GAOA 2JGMA 3I9LA 1ADFA 5HF8A 2EKPA 4NCAA 3Q9NA 4FYYA 5CDGA 4KFRA 4LC9A 4XGIA 3VTFA 5KX5F 1U3GA 1FSZA 1HE3A 1V5FA 1CQIB 4BV9A 1CPYA 2P27A 1G7SA 1UP6A 4B6GA 5KTPA 2AA3A 3GLKA 1YZKA 1FDUA 4CM1A 3NT5A 3E58A 1KO5A 3S7TA 3WSVA 1B3BA 4LOIA 4JOBA 4F4HA 2FPKA 1M0WA 3MINB 1GV0A 3LP5A 3QM1A 1IBLB 1BO6A 3BHJA 2BEWB 3ZNQA 3TSZA 3GDOA 2NSYA 3PUKA 3CNOA 4RCZA 5A4DA 5LNK1 4NZMA 5HIAA 4OU4A 3GLIB 5FOQA 1PWEA 1ABFA 1CWUA 2VEDA 2X9QA 4EHIA 3LLVA 4WY5A 3R2JA 1KI6B 1VM6A 2VRWA 2BP7A 5AICA 4DC1A 3F73A 3P2YA 4O2AB 1E5DA 4CTKA 4P3YA 5DWDA 1YZUA 2BAGA 4WKGA 5CB4F 3O2QB 3JAMA 4ZDJA 3TCKA 1XQVA 3VAAA 4H0CA 2G9NA 4WVLA 4FK8A 1CK4A 4Q39A 3VDMA 1ADJA 3TXYA 5FLXA 1XU7A 4MKRA 1PCXA 1X1DA 4IEFB 2OHOA 1WXDA 2AYZA 2PLFA 3AESA 3F71A 3SS9X 4BLVA 2YWGA 5B1SA 3OECA 3F67A 3W77A 2EARA 4I46A 3TLMA 2BKEA 2ECPA 3ZX4A 1S9DA 1DEAA 2FMXA 2HF2A 2YC2C 3B5JA 2PBRA 3FYSA 1S8NA 2I34A 2ZJ0A 1QH1B 1MJGA 2AOTB 3EG5A 2CLLB 3NWPA 3T9AA 4EH1A 3KV1A 3FWHA 1SURA 5LD2C 3COJA 2ETXA 3ET5A 5JNWA 1Y4ZA 1CDZA 3T3PB 2YC4C 4O63O 4BGDA 1Z2PX 3AR7A 1E1YA 1Z4PX 2YR0A 3NTOA 4UVEA 2FTKE 3D3JA 3OFJA 4JT2A 2FQ1A 3W2TA 1I1QB 3Q8MA 4DCPA 3HDYA 3KOMA 3N70A 4RXMA 1DOZA 4BJ1A 3HY4A 3Q9LA 2WWVD 3FOZA 4LF7B 1JHXA 3BD7A 5J58A 1EJ2A 4DR5B 3RR2A 3ZGNA 4Q9DA 1QXSA 5KHLB 4N8EA 1BC5A 3RVKA 3OO1A 4HWKA 4TL7A 3T35A 1IN7A 3O95A 3JVDA 3F2VA 3N28A 4GFDA 1LLUA 1T5SA 3KCQA 4GZLA 3PXBA 3FNGA 4MZDA 4WZBA 4A26A 1HG1A 2ZATA 4KMOA 5IANA 1YDWA 2QWXA 2B4TO 3CMMA 2H16A 1TU4A 3FH0A 4EW2A 1DJMA 4CKCB 4UXIA 3DL4A 5LQCA 2Q3CA 5UKDA 2C4MA 3VSBA 2QPLA 4KTTE 1UT6A 3LQ2A 2WD7B 3GP8A 1S02A 1L7XA 4M8NE 5LMCA 2QZPA 5D84A 4MV9A 3GYBA 3OEHA 4N0EA 4PM4A 4TYMA 5KNLA 2HWKA 1PWZA 3TOZA 1WV1A 5F51A 4YRKA 3DMPA 1XZDA 3TOXA 3SBXA 5FDFA 1P7VA 5CDTA 4I14A 2L0XA 5AKLA 3ZD6A 3D8BA 3ROMA 3JU3A 3H9CA 1V48A 3PR1A 5CCEA 4TTIA 2NSDA 4NZPA 3LY7A 1X1TA 4QBIA 3CONA 1NUSA 4D3FA 4MAFA 3E3NA 1WKVA 1BXRA 1NXWA 4QPJC 1TYBE 2Z9BA 5C34B 3SJBA 1BQ4A 2IBMA 2UUOA 3GW8A 2HFKA 1RABA 4MQFA 4Q05A 2NVWA 1W8IA 3LV8A 1ZA2A 2VZ8A 3C7DB 2FLWA 3GPCA 1Q5PA 2W4QA 2ZULA 3ROZA 2XODA 3SMQA 3DE2X 3T7AA 3DQPA 2ZT5A 2EKBA 3I9FA 1B1CA 3PXCX 4NR0A 4N39A 4HXFB 1F14A 4KRYA 4U8HA 3RFUA 5HM6A 5CT5A 5BW8A 3L46A 1YO6A 1W2GA 5G1NA 1JHRA 3HB4X 1ZINA 3ADCA 2H1WA 1IBMB 3F6SA 4AQ7A 3QNWA 5IYZF 5TJ9A 1JT9A 3U9SA 3OQOA 2YIDA 2JG3A 2CNWD 4RSHA 3SZOA 1QE0A 2WHYA 3NH9A 5EI5A 1J9EA 1WCYA 3EIWA 2WHEA 4FI3C 2CUZA 1WO8A 3DOEA 3GBSA 3L9XA 1V95A 3ZVKA 2GEJA 2PGDA 4KYIB 1J20A 2ILVA 5K8IA 4CVNA 1STOA 2VQ6A 1JHYA 2OQ2A 1KOLA 5ED0A 3AINA 4LKRA 4OJNA 1RD4A 5DI3B 1SZPA 1RVV1 3FSJX 2XYRA 1GUFA 2RGBA 4J6FA 1E7WA 1XHEA 4OJMX 2Y1WA 1E5TA 1OLOA 4GBJA 3GO4A 3PIRA 3O7WA 2BIFA 3Q4GA 3GH1A 3WYEA 3PBKA 2HJGA 2ZIVB 1RRCA 2ZI9A 2ZRKA 4B3MB 3W6PA 3GA7A 1YQTA 1M8PA 1GKIA 3NO4A 4PTLA 5K0SA 3GFRA 2DECA 2ZYWX 4AZ0A 4CR6A 3VJRA 2YXLA 3FPJA 1GNRA 3UJ8A 5A3QA 5KS2A 2ZSUA 3GUVA 1DOAA 5J1TB 5BV0A 5AI6A 2QTLA 1N57A 2VIIA 5AKZA 3CE6A 3U31A 5G41A 5JS2A 2Q2NA 5F1YA 5ALKA 1Y6GA 5EE1A 4ZZ0A 1CE8A 2A57A 2EWMA 2GRAA 2JJ8A 2I2AA 1UBHS 1UODA 1YKFA 3HPQA 4GH5A 4H7HA 2IYOA 2DFNA 5HKLA 4EG4A 4PIMA 2QTNA 1XRSB 3CNBA 3D4NA 3RSHA 3IAS1 2FEMA 2VO1A 3K30A 2PAFA 1S4QA 3QE4A 4MRNA 1A95A 4KQIA 4BNYA 5I47A 1P77A 2DQKA 2Y1EA 3R23A 1UJ4A 2F90A 1MB0A 1P7WA 1U9YA 3E1SA 3EBPA 5F64A 3GPDG 2IQIA 5LQMA 1NU8A 3OAAA 3U44B 1O8CA 5CJPA 1H4SA 5HS4A 2QQ0A 1HC7A 4DG9A 5I4KA 3AUKA 2VDWA 4JX9A 3KUXA 1EFHA 4OGGA 2E85A 2I22A 1MX3A 2A9QA 2CHQA 2PTGA 1G8PA 2RKWA 5AMXA 2VQEB 1TYEB 2JFPA 2XMCA 3HR4A 3NAMA 3DWGA 3SQWA 1BE8A 2H2FA 4GLOA 4DV4B 3NGLA 1WG8A 3O90A 1KDOA 3A7EA 3I32A 1B14A 3K8ZA 3WK7A 3QX8A 4F4DA 1DX6A 1HDCA 1ZS9A 2JLXA 4DR3B 5CHEA 3WKDA 2RC5A 2QYOA 3BRCA 3Q3GE 4GMKA 2AG0A 4ZVPA 5B3JC 5I7VA 1GT6A 4XUDA 3U3JA 1PU2A 1AZWA 3I9JA 4OXQA 1KMMA 4WQMA 5IM5A 2Q3BA 1F38A 2FJPA 1YIAA 3PWZA 2HEGA 1J07A 1UBKS 5SYNA 1TAHA 1BDBA 2V5VA 2P4EA 3GFQA 4MW1A 5F3DA 4C06A 3PFFA 1GG2A 4OQXA 3RC2A 1R5NA 3HKCA 2P5TB 1KZ1A 4Q1DA 2G80A 2A4KA 1ZOPA 4ITUA 3BGWA 2GDJA 4PQRA 2BBOA 5FYQA 5J2TA 5IBRA 1NI3A 5CFPA 1GZHB 1QP7A 4HDKA 1GG5A 1PK7A 4DIKA 4NNPA 5IWCA 4JQYA 5DSZA 4W99A 4BO3A 4OHYA 2QD4A 3QW4B 3RBVA 3UFBA 3M82A 5BR8B 1WXQA 3DUWA 1MPTA 3BJZA 4QA9A 1SC9A 1DARA 1KJYA 2GLUA 2K87A 1YUBA 2PKQP 4WA8A 3FRIA 5DLEA 3UJ3X 3ZWQA 4IH9A 4CODB 2WSLA 2BMDA 2WD9A 3SVTA 3W9SA 5CR9A 1Y8QA 4GT1A 1HX7A 5TQ0A 4QOHA 2H59A 3NEYA 2Z3VA 1DG3A 4YDHB 5GVRA 1G8AA 3ZV5A 6YASA 1A3CA 1XPRA 4JLWA 1KC3A 4FMCB 4YBRA 1K2VN 2C9MA 1FFBA 1N75A 1S2DA 5AJHA 4LJRA 3R0XA 4XRGA 1SOVA 3THOA 5AW4A 5AVYA 2B1GA 3ZV4A 2PR7A 4MV7A 1KIAA 3K8OE 2BFCA 2C31A 3SIPA 3QPBA 2X3UA 3C7KA 3VYTB 1EHCA 1NUPA 1JMVA 3OFKA 2WB4A 1MV5A 3UWSA 2D06A 1U7ZA 3OOWA 1LRKA 4JLKA 4DXDA 1N2CB 4Q1AA 3B13B 3WBFA 4CTJA 4O1IA 4LHWA 1P7PA 4MGEA 5J2UB 3T3DA 2QMZA 4IZHA 2YQ5A 2ZYIA 3W9UA 4KITB 1QGUB 2VOEA 4I6JA 3M5PA 3BQNB 2Y0PA 5I7WA 4GYKA 4TRRA 4CKBA 4QVIA 3EZYA 3CWZA 4JBWA 3WHPA 1ZMRA 2FFHA 3G2PA 4P4LA 2NIPA 4LXTA 2ZJBA 4ZQCB 5EWLB 1XB2A 1NT2A 2AUNA 4RZSA 3ECSA 2ATCA 2HH9A 3EWSA 1VJ5A 3Q2OA 4M88A 5CLIA 4JI3B 3FB1A 1V47A 2R8ZA 2GN8A 1P2BA 2A6PA 3VZRA 2C82A 1E7RA 2Z6QA 4X5OA 1COWA 4UUOA 3MB5A 3NDRA 1FX0A 1KY2A 4UBMA 4RTRA 1Z8HA 1J6UA 1L9KA 4RK1A 3Q6MA 1E0DA 5CP8A 1ZK3A 4JV5B 3OBBA 2YJNA 3PZBA 4EX7A 6AT1A 2NXJA 1AB5A 1B6TA 3OJEA 2I78A 4R2IA 3WSTA 4TMTA 2W2OA 4J0JA 3E03A 4MRPA 2QTHA 3WMEA 4MVJI 3LUHA 3AH8A 1REQB 3I6QA 4UOQA 4ZVQA 1CZHA 3L7NA 4FZJA 3V8MA 2EBFX 4TXLA 2A1IA 3OPVA 3RUCA 2J09A 4HNQA 3QRWA 4XGRA 2R2GA 5IDYA 4JGGA 2R6FA 2AFIB 2I4NA 1JAZA 5CVCA 2R86A 1MX9A 4BNDB 3JQ6A 2BMEA 1JSCA 1V41E 4R1TA 4MYTA 2PH3A 3A1NA 3JXEA 3KM0A 3I1FA 5CG1A 5J23A 4Y1FA 1QG6A 1DHRA 3JS5A 3LUFA 3PA8A 5K2OA 4B6OA 2AE2A 1NUUA 2FYTA 3DAYA 3M6AA 1K7SN 2R66A 3AB8A 2PMFA 4G0MA 3UHPA 3CLUD 1FUYB 1OTHA 5D7NA 4CRWB 4WEOA 5KDDA 4MEAA 1HQDA 2SKDA 1GL9B 1I5OA 2G04A 4G37A 3Q7PA 1KY5A 5EFOA 5TVKA 1NVVR 1ODFA 3R0JA 4Y9TA 2R7LA 3C4QA 1JAIA 4MIKA 4UULA 2BJHA 2HBYA 3N2YA 3WV5A 3QF7A 1SUEA 1U02A 2YS7A 5FHQA 1K06A 1ZHFA 1UT8A 2G67A 1PNVA 1FDTA 1E94E 3LTEA 4JLSA 4URUR 3RYIB 4PPNA 4UCXA 1AT1A 4JJ7A 4PNEA 1T0UA 4YQFA 4OQZA 1YZNA 2GSWA 1H2HA 1Z6QA 3FMVA 3GD7A 3FPBA 3ELDA 4GMFA 3FLEA 4LGYA 1ZN2A 1MVLA 2I1QA 2WU8A 1HDOA 4TTVA 3I9OA 4KWIA 3TQHA 3F9CA 1GA4A 3DZIA 4KXXA 4OKSA 4X41A 4H7FA 3DLPX 3MGCA 1CX9B 1H23A 2HLNA 3FG9A 5EJ8A 1QUFA 1JQDA 1E2MA 2VWGA 4ZARA 5BVHB 4NFHA 3MGAA 4JC4A 2AWNA 2Q3JA 2HRQA 3U5ZB 4U5QA 4QGBA 5T6BA 3H1PA 5IBQA 3OPMA 2D5LA 4JCOA 4LTNA 4R8RA 3ROTA 4L15A 3SE7A 2G76A 2JKZA 1UK8A 2G5CA 4MQ5A 5CM2Z 4R16A 4HX2A 3FPFA 4DQDA 1EVJA 1Z62A 1FFDA 4C4XA 4G5OA 4D96A 1SOWA 2QYHA 3UK0A 5JUWA 1Y9JA 2BI4A 2XSZA 4S1VA 4IXDA 2XA2A 1I36A 1XNJA 2XMQA 1NI4B 1GAQA 4J43A 4HNVA 2O06A 2P1ZA 3CO0S 4BRUA 3P9NA 2G0NA 3IVGA 4C6SA 4IIDA 1DAGA 1OFUX 3VKUA 4REQB 4DNPA 1FEZA 4P6VF 1PT7A 4PYRA 2QMEA 4A82A 2DAPA 3SQXA 2WM8A 4C3ZA 2XZOA 3QPDA 1L8AA 4LJ5A 5E1MA 4CEIB 2ZTMA 3IAXA 4NG4A 5C8YA 3STWA 4Q3BA 1QCYA 4QTZA 5JNTA 3ZCVA 2OXIA 4GVLA 4XM2A 2WB2A 4BAUA 1WHSB 5TE9A 4DHWA 3WTCA 1SVMA 1RBZA 1SCQA 2Q45A 4YROA 1DAEA 4WASA 3GI1A 1X9IA 3MGGA 4WTOA 4QEZA 4YMIA 1KYTA 2WTEA 2C9DA 3ED5A 3S1AA 1XNGA 4GKBA 2JAHA 3PUJA 2RK4A 2F9MA 2W4IA 1B3RA 2F1JA 4X1YA 1VL1A 3QPVA 1EH5A 5IXYA 5K8JB 5REQA 1P7ZA 1Z0UA 1YMUA 1N3LA 3Q1LA 1VE1A 3LT5A 4K3VA 4OGLA 1ICEA 4ZU3A 1RPAA 1DFIA 1VLHA 3WK8A 5LQUA 1HEYA 2I87A 2G8NA 4FHEA 3PVCA 3IMGA 4R9VA 3HJBA 1UAGA 3HXTA 3BHIA 2XTJA 4JUAA 5G53C 1L1QA 2D4HA 3SC2B 3TSOA 4CU2A 1EKXA 1Z2CA 2YRWA 3V8EA 5ES4B 2I2BA 3FYUB 3V4PB 2P40A 3ZKWB 1EVYA 4DDWA 4TGLA 3KJFA 1Q14A 1R9MA 3EH1A 4UE2A 2OCDA 3OUTA 5EIBC 2CDRA 3E3LA 2W9XA 5AW6A 1EXVA 4RTOA 3K1AA 1I2MA 2VF5X 2PD3A 2ZCUA 3GH3A 2O2YA 4GI5A 3SF8B 4OX9B 4CCYA 1JWBB 2H1IA 1L4LA 1NW8A 4NIMA 3ZU3A 2ICAA 3HDTA 3MJ4A 3ANLA 1MGPA 4R2HA 3TIGA 2W42A 2B92A 2ODPA 3FCEA 2FPPA 3A11A 4I1VA 4GEKA 2J3KA 3EGOA 2ORVA 3KYBA 4O5AA 3SYRA 3OZRA 2ODQA 2QF7A 4JNKA 4M9QA 1EJ0A 1ZRMA 1PK8A 3RUPA 4YMLA 5JVDB 3JATA 3RFXA 2D8MA 4O2RA 4ZVMA 4E88A 3IAUA 1TVKB 3PFKA 1UR5A 3EMKA 3GFBA 1GUDA 4CT0A 6Q21A 3EN0A 4HPXB 4IWNA 4LYJA 3BAZA 1MO5A 1TJ5A 1HYQA 3PC8A 3GJYA 3NPMA 2OFOA 1QIDA 4A27A 2VBCA 2XT6A 4TMFA 4C6HA 5CB4A 4YCDA 5JISA 3DF9A 4IFEA 4Q48A 3P5SA 3SZUA 4GOJA 4AG5A 2ZTHA 3A4VA 3AOGA 5JWRA 4DMGA 4XTCS 3PKZA 5KTNA 1AMNA 5LNK6 4YRRA 2FEOA 1XQYA 4QXAA 2GJAA 3MILA 4UEWA 3MTDA 3L4BC 5AM3A 4AG6A 2WPNA 3ADDA 1LX7A 4JZKA 3D4OA 4JI2B 3R3JA 1V16A 2WA1A 5KJCA 5E7QA 2Y76A 1RHUA 3NC4A 2H1SA 4TPKA 3EIFA 10MHA 3K0HA 3T3GA 3OFVA 1LA2A 2OHVA 4MAMA 1VCNA 4WWHA 3ZE1B 4ZI2A 1JG7A 1A8PA 4KBYA 1SC6A 1SBCA 1RWNA 1V11A 1WNTA 4CV2A 3SEAA 3WLLA 3EY4A 3TG2A 1YMQA 2I6TA 1WP4A 1LB1B 1XVLA 2PD4A 2Q99A 4TQUS 4WECA 4XCQA 4FNGA 4IJ6A 4BMCA 5LUAA 3EVAA 1WV0A 1NAHA 3H3FA 1FP1D 4PHTA 3T0FA 3BWEA 1JA9A 4N5LA 3UV3A 4DDKA 5LQDA 5G4KB 3Q5GA 5K20A 3OOJA 3O83A 1BHJA 4NBSA 3G8AA 4MA4A 5JHHB 3OQIB 2JFFA 5FA6A 3ABIA 4E14A 4OJTA 1MIHA 1PZHA 2BCGY 1XVTA 1LSUA 4LRWA 2YWHA 1SHJA 4R8LA 1MENA 3V3TA 3ZZTA 2OQRA 2DLCX 3N7AA 4IKEA 5D86A 1KEVA 4E08A 3Q7IA 2B20A 2IHYA 2ZGVA 2HRDA 1G98A 3BILA 1P72A 3RYCB 2WYWA 2XTAA 3MIIA 3OJLA 2OQVA 1BG6A 5DASA 3WO1A 3IBTA 1MNAA 1ORRA 1QVVA 2ZBEA 4TLBA 4B3XA 3UJNA 4DAOA 4PLYA 1EZ4A 4B79A 3O8OA 3VO8A 2QN9A 4UVHA 3FZEA 2I8CA 4PINA 3STTA 4FYXA 3VYUB 4ROTA 3NOVA 2XUZA 3P0FA 5CH3A 5AHKA 4DR7B 2J7PD 4L4SA 2FX2A 4RU1A 3DMFA 4EUSA 1XTSA 3PC2A 4I3FA 4H15A 4KQ1A 5DRTA 1C1XA 1FS6A 3NOXA 5C4GB 3O92A 1FNMA 1NNUA 1YDFA 4GZMA 5I45A 2XUOA 4R83A 5CFMA 5DNDA 5FTMA 2JFBA 3HN2A 5IM4F 1KTVA 3LRPA 5LLDA 1WX1A 1D1TA 3NHSA 3TZHA 3GUCA 3DXXA 4EVSA 3B6ZA 4WBNA 3TGPA 5DX8A 4TUYB 1KEZA 2J59A 1QYWA 4B3FX 1B8VA 1WU8A 1QIEA 2QXTA 2OZKA 2REBA 2C5FA 3ABRB 3GEHA 1D1PA 4NATA 1ISFA 4XFKA 4EA8A 2B30A 3HH8A 3UXMA 3GLFE 3LDUA 5BWLA 3C1UA 4D3XA 2GAIA 1H1TA 4OCZA 1AS0A 2XUKA 3SEZA 2KHZA 4F2GA 4TXJA 1G5QA 2X0IA 3X0DA 3DS8A 3PHBE 3SXJA 1FE8A 2HSEA 4C3VA 3KB8A 1KAQA 4XD7A 4ZHQF 1IMOA 1MOPA 2ZSFA 5IYZA 4RELA 1E66A 3AYXB 4D4GA 3PXGA 4PTZA 3TR0A 4DNOA 3CH5A 2G4VA 1QHNA 2H52A 3BUSA 1YZ3A 3EPHA 4U2FA 1Z16A 2HJWA 3PQ5A 1L3IA 3TRFA 3K9LA 1TIPA 1U98A 4NDZA 1V5IA 3FTDA 1ORWA 2HU7A 2OUIA 1Q17A 4LQLA 1Q3KA 3OWHA 1RI5A 1W0JA 1U4SA 4D9IA 3IQEA 5CIYA 3FFAA 4Z3DA 1B43A 2W2PA 3QKSB 5GJWC 4RM2A 2FZGA 3L84A 2VAPA 5AKKA 4R1MA 1FDOA 1NY6A 4P3OA 4CETA 4JOQA 4HLCA 4KACA 4EBFA 1FRNA 1T0HB 1JHVA 2ADOA 2V8BA 3NP9A 4OMDA 2QEQA 4JU8A 4R7ZA 4Z0NA 3SU8A 2W8BB 5C8ZA 4P7FA 1JDBB 5AVWA 4DR4B 3SY8A 4NZYA 4U3JA 4HH0A 1XQ9A 3TZCA 3I0NA 3SOZA 2AWOA 3W5HA 1V3UA 4MVJH 2PX8A 4HQOA 4F6CA 1KE1A 1RKXA 4IXMA 4AUMA 3RARA 4DQXA 1QWSA 1DIAA 2FFBA 4NNOA 4PX5A 5H3CA 2DG2A 1LNZA 3IP1A 4JC0A 1NQWA 3C1AA 4HUQB 3RFTA 1UMBA 4DRZA 4N7MA 2XJ4A 4E94A 1WRBA 3OVMA 1ZCAA 2CK3D 1PG5A 1WW8A 2CVZA 3L7IA 3CYFA 4KWCA 4TKMA 3ZBQA 2E4YA 3RGWS 5FLEX 3ULKA 1MABA 3AUSA 1IEVA 5GADl 2OBLA 1M1NA 1IJFA 3NT4A 4LOLA 3RFCA 4AROA 2FMFA 2CZGA 5FORA 3M89A 1J39A 3J81A 4PC3A 1SA0B 1MJNA 2KE5A 4R1QA 5JW6A 4GZ6A 2Z1NA 1R8JA 3U49A 2GK6A 2RAVA 4P36A 4ZOAA 4F3CA 3ZY2A 1TI7A 5JCJD 5JNRA 5CIWA 1XP8A 1ENOA 4S12A 3LU1A 3M9WA 3WYDA 4Z9FA 1MP0A 3K1YA 5JRZA 1XP5A 4UQOA 1EA5A 5ALQA 1XU9A 3T9CA 2ZIXA 1Y4DE 1JQJC 4J90A 4P7GA 5KYUA 2HNKA 1ZVJA 1L1FA 2VDPB 2VHZA 4JY7A 1TYZA 2AC4A 2QUJA 3LY8A 2EZ4A 1GAEO 3OHMA 4TQ9A 5M3BA 1ZJJA 1YS4A 3OIDA 3LCJA 3W6OA 3GROA 3ILXA 1PKEA 3GVXA 4XLZA 4NULA 5FI3A 5FP0A 1T3ZA 2CYCA 3A4LA 1Y42X 4MWCA 4ZAXA 3M4ZA 1XNRB 1YMVA 4PZ9A 1TAQA 2A9VA 2WVHA 4NF2A 5E0KB 3RASA 1X2BA 4Z0PA 3OIFA 1QTQA 2WKRA 1C0LA 3T7JA 4N41A 1VYHA 1XRNA 1U0BB 2BTQB 3NB0A 2E18A 4XUEA 5JAPA 5EUCA 4PBTA 1OLUB 1P80A 2GBFA 2PZAA 4NYMQ 2JRLA 3R7WB 2AJBA 5TMEA 4B45A 1E5XA 1M8JA 1VBNA 3AW9A 4UD2A 5JTUA 2YJ5A 3A9TA 3RVOA 4PGFA 3CN9A 1PP4A 4K8RB 1LVGA 3QI7A 2LV8A 3DTNA 1JDPA 1V3QE 4WKBA 4MKIA 4ZXPA 3V7WA 1LS6A 2CL5A 3UHJA 3ZHSA 4LJSA 5GV7A 4AZSA 4XQGA 4EIWA 3CVWA 5AVKA 2Q4BA 1OC2A 4XX0A 3H2BA 3B9QA 3O82A 1JEYB 3DLHA 5KWJA 1USIA 4I9UA 3GNQA 3TLXA 3ZOZA 3KLMX 4HX5A 3RS4A 5CAEA 3RSGA 2DT5A 2AFHE 2WJ4A 3C5EA 1T29A 4GM4A 3K4PA 2HZ7A 5H8WA 1GQ2A 1RAGA 1WVIA 1ZH4A 4E46A 2ZBRA 3UO8B 3UMJA 4EPVA 3MVEA 5AFSA 4BY9E 2DY0A 4QNRA 2ZE8A 1T9ZA 4RTQA 3MWDB 2R6GA 3BCSA 5P8WA 5HF6A 3QELB 4FILA 1W0KA 2I4IA 2CXUA 2FJ0A 3IOBA 3NOQA 2O7NA 5IAKA 4JX8A 3CPSA 4ZVSA 1MQ8B 2IKQA 5PNTA 4P58A 4E5NA 2M6SA 3DXZA 3U3ZA 5I3CA 1EWQA 3LT2A 4KWEA 1OWMA 4GQAA 2C00A 4TWJA 2EZTA 1QNLA 1TCUA 5BUZA 3NC1C 4X65B 4JOSA 3MCTA 5BSGA 1ADYA 1N33B 2B5WA 3JQBC 2P9JA 1C7FA 2OWDA 5GIOE 4ZU1X 3L77A 4BE4A 2OCGA 3F7NA 3F90A 4YPFA 3RRYA 3RYFA 3A6HA 1RJ9A 3PNBA 4LYEA 4EGCB 3BOSA 1CEYA 3H42B 1GGMA 4GXNA 3NDPA 3PC8C 4M1WA 4LCEA 3HU2A 3A7DA 4RZHA 5B57C 2WDPA 4H0FA 2JC3A 4YJHA 5CHYA 1IHUA 4G1VA 4LJYA 3K0AA 4Q9LA 2ZJAA 3D3KA 1S96A 3FYDA 3G2LA 2P65A 4PAWA 1NQXA 2E5LB 2JBHA 4OXRA 2NPOA 3NG1A 1O97D 3LO8A 1CS0A 4OM8A 2FZCA 2GD2A 5DDIP 1X92A 2ID4A 1CNMA 2G36A 2NO7A 5JQGB 3PNKA 3AFHA 5ULLA 2WYVA 1NC3A 4X95A 5JH7A 5L4SA 2EQ5A 1GQQA 1GUAA 1E4YA 5H7XA 2WAOA 2F43A 5A3VA 2PL9A 1LDBA 2IOQA 1WXGA 1XC7A 1O3YA 3L5KA 2R00A 4M9ZA 4RL6A 1T8SA 2JI4A 4MI1A 4ZYZA 3G8BA 2PS3A 2JASA 1LRLA 2MU1A 3GEGA 1A72A 2GYVA 1ZEMA 3CJTA 4G4JA 5TGZA 2VCHA 2IZ1A 4NBVA 3JSAA 3TTXA 5KIAA 1OVGA 3BTVA 1ORTA 1EXNA 4FIZA 2ECFA 3P9RA 1D5CA 2JK1A 3ZK7A 4AMBA 4UD6A 2B69A 1ZGBA 3ZE8A 5ED4A 4IG4A 1Q7GA 4S35A 4TV9B 5MFPA 2XXAB 1LS1A 1DLIA 1RLJA 1JLSA 1T5DX 2XIQA 2YHAA 3C5WP 3IT2A 4ER0A 4CLHA 4PZDA 4EY8A 4PGMA 4HSGA 4XARA 4P7JA 3H2SA 1Z88A 1PL7A 3I4CA 4R2MA 2NU6A 1A8HA 1LJ8A 1NKVA 4RKQA 1NL3A 3A26A 2X0EA 4ALLA 3LC1O 3EMVA 4R2JA 4Y0NA 2I80A 1AN9A 1KJNA 3BIOA 4D8WA 5JBNA 1KI4A 4UHBA 1UC5B 3RVRA 3UJDA 4C7MA 3TL2A 1NA5A 1X7XB 3R4VA 1CY8A 1TPYA 3DCYA 4B4VA 7YASA 1IAVA 2H7VA 3AI2A 1P9LA 2I55A 4U7WA 5BWMA 4JL5A 4X7BA 1GNLA 5ENZA 4WY8A 4V1CB 2YN2A 4BXOA 2R8RA 2Q3MA 5GJVC 5LWHA 3JYNA 1CRWG 1DAKA 3O74A 5CVJA 5L3QA 1H3EA 5BW4A 1M2OA 3MOSA 2G09A 1GSIA 1VMKA 3BEOA 4N40A 3VGJA 2OCBA 1T5HX 2Y6VA 2I71A 1O6FA 3KO8A 4GECA 1Z7WA 4RPCA 1F48A 5JZ9A 2GEUA 5E3HA 3NW9A 5DTRA 4RTPA 4YMTA 2IBSA 1XJQA 4NQZA 4J0HA 4WUVA 3CCCA 3FCCA 3R8CA 5AK4A 4OXNA 4WPGA 3EG9A 1TK9A 3QBEA 4PYMA 4I8DA 1QGOA 2HWYA 2RB5A 3O1IC 4F4FA 1O08A 4POOA 1KMIY 3C4JA 2GBPA 1Z5WA 1ZGJA 1BFDA 3GEIA 5FOUA 4KMRA 2Y1GA 2FZ5A 2V9CA 1Z5OA 3MD9A 3ANYB 3PGXA 4LZPA 2EF1A 4H6WA 4MDHA 4N5IX 3VU8A 1KRHA 3STYA 3R7LA 1DP4A 1L5RA 1MVOA 2FWIA 1SU7A 2MSKA 3WLTA 2YUTA 1VCHA 5AHWA 3KL4A 3TZQA 1B26A 1FMCA 2I2XB 1NSYA 4Y2SA 2E49A 3GUUA 2IYWA 1IEWA 2AE1A 1FXWF 1WUTA 4Q4DA 3D02A 4CGYA 3DBRB 3F1KA 5F2NA 3AEYA 3EXIA 4EHJA 2DFKB 5D87A 3GFVA 1JE1A 3N8DA 1ML3A 4UUAA 3P0HA 4ZZIA 1T6NA 1DAMA 2PT5A 4KPYA 2OFFA 1XKLA 4Y2QA 2P2ZA 5ALIA 3RU7A 2JANA 5BN4A 5F3WB 1I51A 3C2QA 4V0LA 4A8PA 2VBIA 4OEHA 1SD1A 1VG1A 2ASEA 4C4PA 1UIRA 2W2TA 1MW8X 1XLTC 2C8LA 4DDVA 1RAIA 3EXHA 2HNBA 4IJMA 4KLRA 1U0NA 1IATA 2GFHA 4JENA 4N7BA 2GM5A 2P69A 5EQDA 3V2UA 2P6UA 1JHMA 1K4KA 5IUNC 4LN1A 5AOAA 3BJIC 2WYHA 3IMEA 1N0HA 2JCSA 4DJDC 1CJCA 3L8GA 4OFZA 4BEWA 1PNQA 2J32A 2F8SA 3EDQA 4L1KA 2O3QA 2XY4A 4MYCA 3Q87B 4U0JA 1WS6A 4TLCA 1CUHA 5K3AA 4B35A 1P0MA 5LYJB 3TMKA 1EK1A 3NUGA 4QBGB 5IBCA 1YOVB 3OZEA 3WAGA 1R0KA 1URPA 2F4NA 3AP2A 1K75A 3FWKA 3EC7A 4TKZA 3GLFA 2QPAA 2JGAA 1AQUA 4FMDF 3RRJA 1FP7A 2B83A 2V65A 3EXAA 2QQEA 4Z0HO 3PNMA 2LNDA 1G59A 1DEOA 4R9UC 3BH0A 4R1OA 1FSGA 4C2UA 3D8UA 1K8YB 2P3LA 4WLOA 3JRXA 4FKMA 4JQSA 2WF9A 1KP3A 3ST7A 3SVZA 3ZVRA 1RP1A 4NOKA 2R79A 4HQLA 1EFPA 4DA0A 4XWKA 3W2GA 4AMGA 3H84A 5IJWA 2GYUA 2HR1A 2H31A 2JL1A 1I4WA 1IHDA 1ST2A 2WPDD 5FO1A 2YJ4A 1FC0A 3IIIA 4MMXB 5A04A 5IVIA 4NEGA 1A9YA 3GQBB 5ALWA 2CYAA 3THYA 4DL9A 2DUWA 3A31A 1Z7BA 2XUDA 4BNWA 2ZW9A 1RHKA 1S1MA 4BJ5A 3CXUA 3IOYA 2FZEA 4CT4B 3DDSA 3P9PA 1PR0A 3ILVA 1O0BA 3U7FB 3NKVA 3F7MA 1H4TA 4DWOA 3R9IA 3HJFA 2HXYA 5T41A 4FWTA 1SVUA 1ZMOA 3HFRA 1KA9H 2BKXA 1Y80A 5B1IA 2W6IA 3W6ZA 5BP7A 2UUAB 3WLNA 3QKWA 3OC0A 2HLDD 3CUUA 4GP9A 4F72A 4JBIA 1JDUA 1NJ6A 3V1MA 3SBDA 1WULS 3QMPA 2C83A 4NH4A 3G13A 4PO8A 2EKLA 4IVRA 1P0PA 2LCQA 1JN0A 1HYGA 1XT6A 121PA 3ZHUA 3HN6A 2Y6UA 3K20A 3VBEA 3B9BA 4ATNA 2ZCJA 3FMIA 4XDYA 2YY5A 3BHNA 1K63A 4HEHA 5DCLA 1KI2A 3S28A 4XPZA 5DX0A 3EOBI 2G6BA 1ZXBA 4PLHA 5IJ0B 5DISB 4LNUB 1TLLA 3SD7A 2WWIA 5I48A 2QRLA 5F12A 4KHPB 2I4MA 2DHEA 1HLPA 5JO0A 3KYCB 1C3VA 3O0TA 5BR4A 1EHYA 1C3OB 4C29A 3PSHA 2TMYA 5SZJA 4NJMA 4UCWA 1OLSB 3JY6A 3FBTA 5HE8A 1V5WA 1U2EA 3ACBA 3ICVA 3TQCA 1G9XA 3WL5A 3Q2IA 3AQ4A 5GM1A 4MV1A 3ROEA 2IEZA 4AICA 1M7HA 5FLKA 3GT0A 4D3DA 4K7JA 1DBRA 1GYQA 4ZJZA 1ZIDA 2FW7A 3QU4A 3U7QB 2P2SA 4OXKA 1IY2A 5G0TA 3AUTA 1QHGA 3VNQA 1JSLA 2ZIUB 2X58A 3R0VA 4GPAA 3M6VA 3KQQA 2HIGA 2KWIA 2QG4A 4PS0A 3OO0A 4F96A 1JFFB 4M1EA 3THWB 4G0WA 7ABPA 5F9MA 1KSHA 1PHRA 2J9YB 2WHPA 2VHYA 2ATVA 4WXEA 3Q8XB 2WJJA 3CNHA 2UYYA 4F5ZA 1VKJA 1R64A 2D62A 2H3HA 3MJEA 3NI2A 2WEKA 1FTNA 3CZAA 4U9UA 3PUYA 1SXPA 4BZZA 1IEXA 3SEFA 4ED9A 4E1BA 1IN4A 1O94D 4U2BA 1SOAA 1L0BA 4KIUA 5IASA 2A35A 4X3CA 3UXYA 1Z2NX 5JNUA 2IIVA 1V7QA 5FOSA 2Q1YA 1J5PA 2VYFA 3N3AC 3VHXA 2PUGA 2XQVA 4KH0A 5J59A 3D6JA 2QAGA 3USZA 2QRNA 1DQYA 4GOOD 5EMMA