3GLRA

Crystal structure of human sirt3 with acetyl-lysine acecs2 peptide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
274
structure length
274
Chain Sequence
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Human SIRT3 Displaying Substrate-induced Conformational Changes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase regulator
molecule keywords NAD-dependent deacetylase sirtuin-3, mitochondrial
total genus 91
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 3glrA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3glrA01
4BN5A 2Q5OA 1PTJC 4JT8A 4K9OA 5EJ7A 3CLUD 3JR3A 4JD5A 4JUAA 2FN3A 4MZXA 3IAFA 4GP9A 3HWWA 1S5PA 1Q17A 4X3PA 1JSCA 3F6BX 2Q29A 5BWOA 1YHYA 4BV3A 4BV2A 2AG0A 1T9AA 1M2GA 4RMJA 4JUBA 4RMGA 2PGNA 5DEIA 4JUCA 4BVEA 2X7JA 1Z8NA 3PKJA 4QPZA 5BWLA 2VBGA 1OZHA 5DGTA 1DJLA 4R8MA 4C7BA 4MPRA 2H2FA 4IF6A 4GM4A 4UUBA 4V1CB 1YC5A 4FZ3A 4JU9A 3GLSA 1YHZA 3EYAA 2OD7A 4KXQA 5K3SA 4D5EA 4GPEA 1T9BA 1SZDA 3CLTD 5EJMA 1SZCA 1YBHA 2FWNA 1U2DC 4JUDX 4FVTA 4RMIA 4FEGA 5EJ9A 1MA3A 4FEEA 2DJIA 4BVFA 2Q5JA 1PNQA 2V3WA 2AG1A 5K6TA 1Q6ZA 1NM5C 4JUFA 4KPUA 2JI7A 3OE1A 1OZGA 4GG1A 1EFVA 2B4YA 1PYDA 4TWIA 1V5EA 1POXA 4JU8A 1PI3A 5MFZA 3ZGOA 1M2JA 2VBFA 2NXWA 5K2OA 2H2DA 3U3DA 2UZ1A 2A1TR 3CLSD 2BRUC 4Y6OA 1UPBA 2EZUA 3FSJX 2H4JA 4K9QA 1UPCA 4K9KA 4I5IA 4O8ZA 4V1CI 1XLTC 3K35A 1Y9DA 2VBIA 2H4HA 3D4BA 4UTVA 3PKIA 1ZPDA 1T9DA 2EZ4A 4TWJA 3EY9A 4QELA 3F6EX 1PT9A 4K9NA 5K6RA 5MGNA 2H59A 1ICIA 1N0HA 3CF4G 3LQ1A 5EJAA 2H2IA 1YI1A 1QPBA 1YNOA 2VJYA 3FLMA 5DGDA 3JWPA 1OVMA 3CLRD 3FZNA 1M2NA 1PO7A 1UPAA 1M2KA 3GLUA 2JLCA 4D5GA 4COKA 2JI9A 2FRDC 4Y6LA 5EJ4A 2IHUA 4ZZIA 3ZG6A 4J16C 2OD2A 2A1UA 2VK4A 3E9YA 1Q14A 2FSVC 3U31A 2JI6A 5BWNA 4RMHA 3ZGVA 4GM0A 4GM1A 2QQGA 1MCZA 1O96B 1V5GA 1YI0A 2OO5C 4Y6QA 2OORC 2PANA 1D4OA 2Q28A 2W93A 2H2GA 3EA4A 4K9PA 1E3TA 4KGDA 1Q1AA 4MPPA 1U31A 2JLAA 4F56A 4K9LA 4RJJA 5MFPA 4BVBA 4Q9DA 3IAEA 1PNOA 3PDHA 4UTRA 1PVDA 2EZ8A 2FR8C 2VK1A 4QQ8A 1M2HA 1S7GA 4JT9A 1BFDA 5IMSA 2WVHA 4C78A 4UUAA 2C31A 4UU8A 4IAOA 4HD8A 4HDAA 2PGOA 1U2GC 4F4UA 4RJKA 1POWA 1EFPA 3HWX1 3D81A 4J1TC 1T9CA 3GLRA 4UTZA 4L3OA 2OD9A 4G1CA 5D7NA 2HJHA 3GLTA 5AHKA 4ZP1A 4X3OA 2IHVA 1HZZC 1OZFA 5EJ8A 2Q27A 4BUZA 2IHTA 4V1CA 4IG9A 2JIBA 2NYRA 4UTNA 1V5FA 4MPJA 2H2HA 2VK8A 2WVAA 2QQFA 2Q5LA 3RIGA 2Q5QA 4L2IA 5FEMA 5EJ5A 2UZ1B 2WVGA 4BN4A 2EZ9A 1J8FA 4UU7A 4BVHA 3D7KA 5FYQA 5EJ6A 4JSRA 4BVGA 1YTLA 4UTXA 2H4FA 3RIYA 2JI8A 5MF6A 4MQ5A 1U28C 4K9MA 4RJIA 1YC2A 2EZTA 1O97D
chains in the Genus database with same CATH superfamily
2IJGX 3GBPA 1XQ6A 4KMRA 3RUDA 4CKBA 2J3HA 2C20A 3JR3A 2M1XA 1XCMA 2XMSA 3BXHA 3ETJA 3N6XA 3N6RA 4XSGA 1C2YA 1EM8B 4G1MB 4BKPA 1IJEA 3CX4A 2JGIA 1OLUA 4JR0A 4OXIA 5DBEX 4BBAA 5A0TA 1LI7A 2CJXA 1QYCA 3KK0A 5CH5A 3K9GA 3UVEA 1A88A 1T6BY 2P5TB 3GLQA 3QWAA 3DLHA 5F1YA 4Q34A 3UFBA 4B4UA 4DZTA 1XTVA 3PHLA 2C96A 2HSEA 1TYAE 1VJDA 2FFHA 3GEHA 1NI4A 4AY5A 1ZKDA 4JGBA 2OK7A 3SHTA 5CD1A 2OHJA 4XWYA 1DX6A 4HN2A 3D3JA 1NVGA 1GUDA 1RTKA 2REOA 4IIEA 1H2FA 3NKLA 4PLZA 4LHYA 1MC5A 2PS3A 1KS2A 3PQFA 4OQDA 3KPYA 3T7CA 3EBOA 4L22A 4WZ6A 3LW7A 1ZEMA 1IVSA 2IWHA 1EHYA 1YOVB 4WJLA 1MT0A 3TTXA 2BKUA 2GR9A 4EEZA 4YPFA 1SXGA 3F97A 4D8WA 5I4KA 1DBSA 3P26A 1JHMA 2EHJA 2DLDA 1C0EA 3SC6A 2AOUA 3GJYA 1TJ4A 5CDUA 4N5HX 1ZGAA 4AJLA 4S05A 3SMQA 3WWCA 2OBBA 3AX6A 5LMZA 3LZDA 1CUJA 2QGZA 5DE3A 4AL4A 1RCUA 4P4SA 1O2DA 2ZITA 4XXHA 3PX3A 2H51A 1VMAA 3E7DA 3Q9SA 5IDYA 1YASA 4ZEWA 4YV7A 3RKRA 1EVYA 5DYYA 4LFCB 5IDXA 4KFCA 2QP3A 3H11B 3BGOS 1YKGA 3DZDA 3COPA 4PZ9A 5E4TA 1IU9A 3A04A 2P9CA 4P80A 4GM0A 4RFSB 1FDWA 3UUFA 3L02A 2HU5A 2AN1A 1QZ3A 2W93A 3ITKA 3OFND 5HILA 4C6RA 1Z5UA 4U2FA 4LPSA 5DHTA 5DCYA 2QT9A 3HADA 3ABOB 2D5BA 1YRLA 1ZD4A 2V54A 1GR1A 4HO1X 4UW9A 4X7RA 1QC5A 3X43A 5CB4A 3R7BA 3AQIA 1J97A 4KO1S 3KQOA 3ZWWA 1M2HA 4G41A 3O75A 3W5SA 4YONB 2FUKA 4B4WA 1N0IA 2J9XB 1EUCA 4U2CA 1G55A 1XZBA 2OCGA 1YB6A 3A06A 1IEVA 4JJGA 2ZUSA 3B60A 4GWKA 3LKVA 2UXCB 1R37A 1XXHA 2P91A 3G2JA 1NW3A 1N4AA 4JI8B 1KFBB 4X1YB 1SQFA 1LY1A 3ZIAA 4XYBA 2CSUA 3MTAA 4MUBA 4ZALA 3UWOA 3MUNA 3HDQA 1FQWA 3I3OA 4CV2A 3V7WA 1UP7A 2FHPA 2H00A 2FMKA 1YVRA 1Z8DA 4DV6B 1FCJA 2RKBA 1C3OB 3F8TA 1KO1A 2Q5QA 3A0UA 6ABPA 2ZI4A 4AIIA 4LFAB 3PRYA 1LWOA 1EKXA 1HYQA 4YO7A 1B16A 3NBUA 5CEEA 5CCBA 5NLLA 4LYFA 1NI5A 4RTRA 2JCVA 5GPBA 3UOGA 4DR7B 3AJ8A 4OMCA 2O0LA 4KG7A 2GEKA 1I7PA 2X0KA 2RGDA 4UBKA 5EJ7A 4BO2A 3W79A 2BONA 2HRRA 4IJ6A 3NVMB 4ZYXA 4NMXB 5A4IS 1T1IA 1G3MA 1N3YA 1QZXA 3JZMA 1CBUA 3EODA 3KZNA 4NCIA 1XXHB 4QNMA 1XU4A 4IH1A 5D1NA 4ZC1A 2WD8A 2JCXA 1VCIA 2IQIA 1ST3A 5FL3A 1FZQA 4HSEA 5I7WA 4JJ8A 5DLQC 1UEJA 5C37A 1Y6RA 4BGDA 4V1CB 4FZ3A 1WHTA 3SM9A 2XZPA 3B3JA 2XUDA 4UBIA 1DXYA 4IDHA 1Z4KA 3IUBA 5E4YA 2R6ZA 2IRWA 3I2GA 4RULA 1SEVA 1KEWA 1K7SN 1R88A 3MAJA 3RVJA 4N8SA 2PPLA 2VPYA 2EKDA 2WJHA 2PNFA 2QYTA 2FF5A 5F2NA 4DIKA 2A59A 3GEIA 3EARA 2V7WA 4Y2UA 1C7IA 4CM9A 1LSUA 1TF5A 2A0YA 1ZSNA 4G5XA 4NTZA 4BFXA 2GOYA 1FXSA 4H77A 4NSNA 3CRW1 5IN4A 4P54A 1XNGA 2VJAA 2VSOA 4O3FA 1ZXXA 3MW8A 1SXJA 2PL1A 3D8NA 3HBMA 1M1XB 2QQ0A 2O3TA 5LQNA 3CUTA 1O6BA 3IAHA 5SICE 5KNBA 1EWVA 4UNSA 1AIPA 4XUCA 5C8YA 2A6PA 3OJXA 2FYTA 4K46A 2DETA 5JQGF 2SICE 2QY6A 1V37A 2PRJA 1GLVA 1WG8A 2E9SA 5DSZA 4DQLA 4BNFA 2H1SA 1Y7LA 2R8RA 3FMVA 5EFZA 3UO8B 2CJPA 4D3YA 4W8GA 1XJ5A 4HDCA 1SC9A 2JGMA 1NNI1 2YHUA 4NC9A 4DLZA 4F21A 3C4JA 1ADFA 1GA4A 5ALOA 2ZTLA 3E0XA 2WOOA 2FUEA 3F7TA 1GLGA 3FDXA 1K0UA 1NVDA 4FSXA 4HDNB 4BNDB 1NYTA 3IA7A 1UDWA 1MV8A 1SUFA 1FMJA 1UFQA 1ZGCA 3KL2A 3KZMA 3LCJA 4K9LA 4YP7A 3VGPA 9LDTA 2VDRB 2QD4A 4MVJF 1BH6A 2DLNA 1ZM9A 3EVTA 5CM2Z 3OE7D 4O4LB 1ZRMA 2MSEB 3B52X 3MGAA 4PR3A 5EEGA 1LKZA 2R87A 3TW4A 4DM7A 2QBYB 2W6ZA 3V4SA 4QWMA 4GMDA 1RYBA 3KXPA 4D41A 4TKVA 1XYGA 4BNYA 4K2HA 2PGOA 3IE2A 4UAUA 2GN8A 1XZCA 1E1LA 1KU0A 3RFCA 2PKYX 2KSQA 1Y4SA 2W2MA 2QLJA 3JSAA 4FOPA 4LBZA 3GLTA 2HHJA 4FFLA 1QIFA 2BZ1A 4YJ3A 5IAJA 3DDCA 3OUUA 3RTBA 4M1WA 3WLJA 2PXXA 1NUUA 4HEHA 2OZLB 2Q5LA 1GRCA 2GNOA 1VFNA 3STXA 1PJ8A 2D2EA 3QVLA 4F6LA 2R6R1 2VHQA 5ARCA 1Y7PA 3IXMA 1AQLA 2X0NA 2P5SA 4G5RA 3AFIA 4Y2PA 1YOBA 1I6KA 4ZHSA 1OI7A 4LZLA 5AM0A 1ZN7A 5T57A 1MUUA 1KKMA 1W85A 3L92A 4N5IX 1JR3E 2X77A 1UKAA 4FNOA 5BPHA 1TEZA 2J85A 1VE7A 1BDBA 3UXMA 4TPKA 1C3VA 1NXVA 1NVXQ 3TQFA 1KWGA 1O1YA 2YYSA 1RABA 2OYSA 3B6IA 3H5NA 2R62A 4MAAA 3U7IA 4G0YA 3G2PA 3NETA 2HB6A 1ZCJA 2WIJA 3KOWA 3FNQA 4KMSA 3N8HA 4GR5A 4QPPA 4WEOA 2YDXA 3OWXA 2Q6VA 3BXPA 3RRNA 2Z2KA 4L9WA 4ENVA 4JLAA 2X14A 1FPQA 3DFKA 5JNUA 2Z3VA 2CCGA 3N53A 5AR1A 3UMJA 2OWDA 4J2HA 3W7AA 1M1UA 1M76A 1QGZA 2VYVA 3NIGB 3LU1A 1CPYA 4DXAA 2BKEA 4PFSA 5AI8A 2GYUA 4LY6A 3DBLB 5G0SA 5JJLA 4OGFA 3UJ3X 3RV4A 2JFGA 4TX1A 1UT8A 2OZKA 2GPYA 4K6HA 4OA8A 2ZJ2A 4KMMA 4Q1EA 4DEYA 1XDSA 3VKVA 2ZYSA 1X42A 4DFDA 5JOQA 2CBZA 3UJ9A 2BOVA 2YZNA 4OP3A 3SWWA 1XF9A 3ZWAA 3RJTA 2Y1KA 5DYNA 5DTJA 4UBNA 3DHWC 4WKBA 2AI2A 2I6SA 4RZSA 4A3SA 3IP6A 4LK3A 5JEDA 3CLVA 4FMCB 2QN8A 2H59A 1JV2B 3WGMA 1VB5A 1ODLA 4TTRA 3BMNB 4FT4A 4S04A 2FZLA 1N2CA 3X1YA 3L6CA 1I2DA 3RHSA 4ASUD 5IDQA 1M1NB 2LNDA 3YASA 3DNPA 4JI0B 1Q2UA 2C4WA 5A3QA 1NV9A 1JSRA 5ALVA 1B8UA 4E4YA 4ZQBA 1GZ5A 4Q1BA 3KQWA 1E99A 5BSTA 3A2MA 3WS7A 2CEAA 1GG5A 2BKVA 4QGAA 2FEPA 2CYCA 3ENQA 1OXBB 3ZH2A 2VJMA 4OY3A 3D4LA 2J87A 3A28A 1ORWA 4S1NA 1C7RA 3ZU2A 4KNYA 4P0QB 1E7RA 2DFVA 2EJWA 1XZ8A 5MFPA 3G7SA 3CZAA 1J1UA 1NW8A 4X95A 1DQYA 3KOXA 2EL7A 3LLCA 2P27A 2X41A 2JEYA 5ALWA 1DC8A 3N87A 1L5LA 5BVHA 4DPKA 2ZVDA 3DP9A 1XRSB 3JQPA 4R8KA 3QFTA 3LC2O 3PD1A 3ZVRA 4BAGA 3ST7A 5DGXA 3W6NA 2XYRA 4PC1A 1X87A 2ZOSA 4HUJA 1PFVA 4RC9A 1KS9A 1E9AA 3EZLA 4HH4A 4EVSA 1KXJA 4LVUA 1T5SA 3ANYB 1OYYA 5IK2A 4MI3A 3HHPA 4RLQA 2VCYA 3A4LA 5IEJA 1KI7A 4TUYA 1IJKA 2XB6A 4PSUA 4F60A 1U94A 3IBSA 3BTOA 1U7XA 1W87A 3THYB 1JFTA 5IULC 1CUXA 1JEQA 4Z1OA 4ENTA 1WF6A 4QQFA 1Y8QA 1W94A 2FZEA 2P3LA 2AFHE 1OF1A 1O54A 2DPGA 3BL6A 5G40A 3T34A 2P6PA 4LDAA 4V02A 1FSZA 3LE8A 2GN2A 3N86A 5EUQB 3TTWA 1HLFA 3DVAA 5LWHA 1KVRA 3B2NA 4EY3A 3QX8A 5JXGA 4A6EA 1HT3A 2OKGA 5EKUA 4JV5B 5EHZA 1GR0A 3FFXA 2JFYA 2PX5A 3R1IA 1Z2NX 4IJVA 1WXDA 1XDUA 2GJ9A 4PZDA 1C4WA 2Q0QA 1X80A 1N34B 2IV2X 1UFVA 2TMKA 2HHLA 4D8UA 5C5CA 3GGDA 1ETUA 3MHPA 5AVWA 1KE2A 3FDZA 2E4VA 3F7MA 5AVVA 2YMMA 2A9FA 1DXOA 2PA3A 4J6FA 521PA 1NXXA 1IXKA 3HGQA 2VJQA 3UN1A 3ZD9A 4EUEA 2IZOA 1PUIA 2PPVA 1XTUA 2G1AA 4WI1A 3ZDEA 3RUEA 4DCNA 2XZDA 2IUTA 3VKGA 1NN0A 3PUJA 3G2OA 5FPQA 4KK3A 3QHAA 4N7MA 5LKAA 5HDBB 4KREA 3O2NA 4XD7D 2ADFA 5THQA 1O94D 3OP4A 3UGJA 5C53B 4UUPA 3SKYA 1NP3A 3F9IA 4KWEA 4LN1A 2AOUB 5IJWA 3DMHA 3R9XB 2XUJA 3KR2A 1TL7C 3D2CA 1MDFA 4ZVPA 2FPXA 3IDZA 3K1AB 3I58A 2FW6A 4IGAA 1FDSA 2JIQA 3ILVA 5H5JA 1LPBB 1QIDA 4D82A 2HDOA 1XUOA 1R8XA 3R7LA 1G8YA 3G9UA 3INTA 4R1TA 3QLVA 2FN7A 4JVOA 4UULA 4NEHB 5KVSA 3KLMX 4R6WA 1T0UA 1P17A 4S0XA 4JWKA 4K9KA 4WFJA 1NIPA 1XALA 2GBLA 5HKKD 5K9ZA 3MELA 3SVLA 1UZNA 1ULUA 4XSHA 4WLEA 3SEFA 4QUBA 1L5GB 1GFSA 2DBQA 1I2MA 2WIBA 2XQKA 4QO7A 1ZJ5A 3LUGA 4WNIA 3OESA 4PXSA 3WTBA 1QGAA 4XWOA 1NJSA 3KVRA 1TYEB 5M29A 4U3JB 1Z3IX 2X1HA 4GE3A 2Q3FA 1OX5A 3ESDA 2H5EA 1C8LA 2JGFA 3A05A 3RU9A 4Y6RA 3A3YA 4FNAA 4D57A 3A1VA 1AMNA 4CLOA 3PA6A 4EFDA 3IPCA 1W5AA 1DADA 3G5AA 3CN9A 2FRDC 3LSYA 1DAFA 4L9RA 1W46A 1SD2A 4UEQA 1JEOA 3EA5A 2ZRAA 1ZD2P 4ZO4A 3ZDYB 2HDHA 3JQ8A 3LLSA 3TECE 3WL8A 2NXEA 1NN1A 4PQYA 2BGGA 1ZGZA 1PQUA 1EFRA 1E4VA 1S1MA 3K0AB 1VG9B 1XN1A 2RAPA 1R3UA 3JQGB 3TH5A 1UAYA 1NXQA 2ONZA 3F5FA 4BVBA 1N2GA 2I2CA 2XWJI 3OOWA 1WVGA 3OJWA 4YJ3B 3TO5A 3WLPA 2OBXA 5I6DA 3VNUA 1WW8A 4IZ6A 1WMSA 2XMGA 2D5AA 2I2FA 2HGZA 2F17A 2X42A 4Y2HA 3W2IA 1H2BA 3CEHA 3ECSA 1U1IA 1V5IA 3HKCB 1PL0A 3R41A 5EI5A 4JSTA 4XQEA 4IXWA 1C4KA 3KYCA 4B3XA 3PR1A 4OFZA 3MTJA 4EEKA 5SZHB 2J3LA 5G1NA 5B36A 2OD9A 1JALA 4L5YA 5KJ6A 2GX6A 2NPOA 4DT1A 2WICA 3IIJA 4JEUA 4GLOA 4RVFA 5CTJA 3W9SA 2DPHA 3N75A 3HWRA 4IR7A 5CVUA 5ES4B 4G1EB 4IIUA 4OUDB 4ZGWA 1C4OA 4ZOQI 5K6AA 2YC4C 5J5VA 2QTHA 4JYMA 4U1RA 4BJ3A 1E61A 1X7YA 3HA5A 3BWBA 5JO0A 3TQTA 3K2EA 2VP4A 2HRCA 2YOFA 2BYTA 3DM9B 4I3FA 2XA1A 3PQDA 4YJGA 1QH8A 2PU7A 2EBHX 2P0YA 4F2HA 4ZAWA 1ID1A 3FNBA 4LGMA 4IVNA 1BEZA 2PEYA 4XQGA 1FA9A 5D3MA 4HGPA 1VDMA 3WMGA 3THWA 1UXHA 4RCVA 3SLRA 5B30A 1PQYA 3EQ8A 3NV9A 1THZA 1XD2A 3MAGA 3R5FA 3V6MA 2XBLA 2D1TA 2G17A 4IJUA 4OOFA 2ZZKA 4EK9A 5AESA 2DEUA 4D25A 3UK7A 4NNOA 5K8VA 3ZCTA 5HJ2A 1EK0A 4HGRA 1QDEA 4UU0A 1MVNA 1BGWA 3QMWA 4KN5A 4ENWA 4U7DA 1F1BA 4IS2A 4C4YA 1DFIA 3EDQA 1E6MA 4N49A 5AJXA 1HXHA 2IHNA 1GFWA 1YU9A 2HJVA 1YCHA 1VCHA 3RT9A 5E7QA 3G8DA 4P3NA 4XFDA 2SNIE 2V3WA 3GVPA 5DU2A 1CK4A 1V1MB 2C0PA 4PSAA 1VBMA 4B83A 2XI4A 4DQXA 2ERCA 3E7PA 3AGPA 3PNPA 1TM7E 2KI5A 1E66A 5ILGA 2VYND 4EB6B 3T1VA 1L8OA 2HA2A 2GEFA 1E2HA 1W2HA 1HORA 2F00A 1NX9A 1QCYA 1ZY2A 2C29D 2H63A 2OHFA 2PV0A 3C7AA 3H1FA 3OKCA 2OAEA 1H9BA 1QG4A 2UDPA 5EUBA 2ZDHA 1RADA 3BYZA 1LVUA 4TYNA 1M0TA 3EA0A 3OCCA 3QJGA 3L7KA 1JUDA 3A4VA 1ISPA 3O8RA 2AR0A 4HMOA 1M34E 4HX5A 3HPQA 5KAMA 1EEHA 4PN7A 4TTTS 3ITDA 3DE1X 4PPFA 3WZMA 1L8XA 2C95A 1DIRA 1BWPA 4BL5A 3W5AA 1BROA 3H97A 1FS6A 3FKSD 4RVHA 1H65A 3A1TA 3JV7A 4G5YA 5A7HA 3TAUA 4IDFA 3U17A 4UCFA 1YBMA 2WAXA 3DLPX 1LXCA 3EZ2A 3TIIA 4A6DA 1PR4A 2MSWA 5K3BA 9GPBA 4GQIA 4OSEA 1N5MA 4ZQCB 2ZRBA 4BNKA 1UBLS 5JLJA 3C6BA 2W9XA 2C42A 5MDHA 2G09A 4E70A 4OTZA 3OZWA 4CRWB 1PVDA 4Q9AA 1HT0A 5K8IA 3Q8WA 1RWQA 4AU1A 2B3TA 1HRDA 1OV4A 3GHHA 3T61A 1VIDA 2QN2A 2XRMA 4W5RA 2PQ2A 1SQSA 2QYOA 4M1MA 4F11A 5EE1A 1I14A 1W6RA 5KQSA 1TIBA 2AXNA 3EG5A 5ILQA 4GP6A 2W4MA 1U81A 1XZKA 3U1BA 2BCEA 1QHFA 2IYLD 4X1OA 3SX0A 4HWRA 2Z98A 4CUJA 1P62B 2W58A 3JWEA 4B6RA 3B51X 4C7VA 4CM4A 1NURA 3LZCA 3BXGA 1C3JA 5C32A 3BDIA 4ZHQA 1ADYA 3BMCA 1JAIA 1AQUA 1IQUA 4QBGB 1VI5A 4MAFA 3H8JA 2VDQB 3W4IA 1OLXA 3D7NA 4DA0A 5DLEA 2YJ5A 2XB4A 4L5CA 3G2MA 1OQAA 2XHZA 3A1EA 2VSFA 1ZI8A 4CV3A 4DN6A 2RHTA 5J5AA 2IPXA 2Q6IA 4MYTA 1U0RA 1SBHA 4HAYA 5GOTA 4N5LA 3KKMA 3OG9A 4CJXA 1W5SA 4QDOA 1JG3A 3ROFA 5KYKA 4O8CA 4MKRA 2FFAA 1Y1KE 3N28A 1IRIA 4R9NA 4N12A 4EFLA 3OC6A 4ZTUB 1WXIA 1P4JA 5IABA 4XIYA 1JB9A 1SD1A 1Y6QA 4JT2A 3VR6D 3FFAA 3A1SA 3LW8A 4URFA 4PXAA 1N1EA 4Z2AA 2HMWA 4RL6A 5DBIA 3E05A 3RK0A 1PL6A 3KQSA 1CKEA 1RKUA 2OK8A 3A3PA 1CSEE 4ZMBA 1VJRA 3LT4A 5BWLA 1LVGA 1RJGA 5BNFA 3TQOA 1QGUB 3QVSA 2YY7A 4RZQA 3WAJA 4GXTA 3N39C 1GZVA 5K0GA 4OAOA 1H2YA 2GVDC 3M6MD 2C5HA 4YMWA 5TGTA 5HQTA 2E5FA 1SHKA 1P33A 2YZ7A 1FNMA 1CRPA 1J09A 4I99A 2HA6A 5DM60 3KKZA 4REQA 3EQ2A 2OUKA 1E9CA 2VJLA 3L7DA 4W5HA 4DCSA 2Z8YM 3HXLA 4IIJA 1YFZA 1N9GB 3TN7A 2ODAA 5ADWA 5MFZA 4YP5A 2C78A 1ZM7A 2C2OA 5BQ5A 1MX1A 4WAUA 2A9QA 5F7ZA 1KE1A 3WB9A 4C1BA 3U4QA 2A0KA 2C88A 2PUJA 3KE8A 2MMGA 2PDAA 2F48A 2V9PA 2NVUB 1GWNA 5F5LA 3AKZA 3LT0A 2GPWA 2QAIA 1OBCA 3F6EX 1F0YA 4I1VA 1T5DX 1GP2A 3K0AA 2VPZA 4CMEA 1NBMA 4NECA 1M1YE 2GD1O 1GYPA 3V1LA 4ED9A 5JAUA 4IQ0A 5KC9A 3MCVA 1EE2A 1ZVJA 5DTRA 2E5WA 4C0KA 4R16A 1HH4A 1IQPA 2WAYA 4GR4A 4HEA6 1UPFA 5DHRA 4COKA 2ZJ0A 1K92A 4Z54A 4OKNA 5FI1B 1XMSA 4XRGA 5KSZA 5FBRB 1D1QA 1FSSA 5DIZA 4YIHA 1JQ5A 3IVXA 5CLLA 3AL3A 4RYLA 1KZ1A 1TO6A 3JW8A 1NFRA 4RTJA 2Q3BA 2C7QA 1F8FA 4UUNA 1MCZA 1E7SA 4K9PA 1LD3A 1TMYA 8ADHA 3NBXX 4FBLA 4PO1A 5K0FA 3NRCA 1LBIA 3GJ7A 4RY2A 1VMKA 5EMLA 4UTRA 5D5QA 3P9SA 1E2BA 4ZU6X 5IMSA 1CQJA 4KN8A 5K0TA 1Y6JA 1XD9A 3HXPA 4Y1RA 4P38A 2GRAA 1LEHA 5AVKA 3EPPA 2ZP1A 1UKCA 3ECAA 3L7NA 3ZZMA 1VSVA 1AY0A 4ZGGA 1NDUA 1P39A 5TEWA 3UATA 1AKWA 3B6EA 3WVNA 3U4MA 4CG0A 1XVVA 3KB2A 2PX2A 1V16B 2RHMA 2QA5A 3HNRA 4O1IA 1F7UA 1Y1RA 3T52A 3SJAA 5K01A 5A06A 1Z4PX 3OY2A 2IS6A 4C88A 5IWAB 5LZ2A 4BATA 4RSMA 2ZJYA 4RD6A 4TVSA 1G291 1G5TA 3R77A 4EFNA 1NP6A 1TO2E 3BXEA 2ZVQX 3CT6A 1XZJA 4HAIA 4XUGB 5I7RA 4AY2A 1DCFA 2O7RA 4U2EA 4S1OA 2YZGA 2VWPA 3Q7PA 4H31A 2QXYA 1JILA 3TX6A 4KPEC 2DUMA 3KCQA 1SHTX 3U3OA 1YVUA 1RI3A 2NUPA 2VRWA 3BERA 3IH5A 3K05A 3GNTA 2JI4A 4L07A 2IBSA 3RKSA 2X3UA 2FFRA 5ALIA 3FG9A 3JWJA 4OM8A 1J07A 4H4CA 4IIJF 5AHRA 4BJHB 2P2CA 1AJEA 1P4AA 5CK5A 4M1EA 3NKVA 4HH3C 3BMQB 3LDAA 2B1IA 2KLHA 6PFKA 3PGMA 2JZNA 1CEQA 1EE9A 4JU9A 3TTVA 4EKIA 3GAMA 3ZWNA 2RHOA 5M3BA 3FAZA 3BL8A 3M6WA 3FNIA 1DC7A 2JZCA 2ZFUA 2MSNA 2Q1YA 4G3XA 2AN9A 4JSYA 3Q12A 4MHOA 4D80A 2RIRA 2BP7B 4MR9B 5CYPA 3ZX4A 4YCBA 1WVMA 2R8ZA 2Y92A 2Z4RA 3QE4A 2C0CA 2VNSA 3IEPA 3E9RA 3AHEA 4HI0E 2LTAA 2PKWA 4L9SA 5HQJA 2BT4A 2BJWA 5ALTA 3BCRA 4W7IA 2OHGA 2ETXA 1SGWA 2J0UB 1ZW1A 4LSGA 1Z0SA 5KS2A 2PRKA 2XCRB 2EX0A 3JAWA 5D6NA 5DEIA 1K9SA 4GVXA 5CA1F 2MCFA 3EPKA 3C8HA 5DX8A 4HLUA 2AQIA 3GGPA 1BXGB 3BMQA 2CNLA 1QHIA 2G04A 3HBNA 5B1DA 4C0WA 4LPKA 4YPVA 1E1DA 1X2BA 4RHEA 1TYCA 5JR3A 1FFSA 4CMAA 1OLUB 5ALFA 1Z4MA 5JC1A 3WXMA 2JLCA 4DSNA 1VHQA 2FWBA 1YSCA 4X20B 5E1BA 5BW8A 1CR4A 1MJ5A 1GPAA 4OH1A 4Z1MA 5DIFA 2FPGB 4AWBA 3GC6A 2HCTA 2HNKA 4XJSA 1V5GA 4JWTA 2EIHA 5TR9A 1X1CA 3SE0A 1E4OA 1CIVA 1TMKA 1MO2A 1XBTA 3NIBA 4CR7A 3ZE1B 3PGXA 4YJ2F 2NLOA 4B7XA 2IYEA 2QENA 4WNAA 5H9VA 3U81A 4AF6A 5BUSA 2O8NA 1S2NA 1K63A 3GBSA 4MQMA 1ZO8A 4W5OA 2GF0A 2V6MA 3V5NA 3WQQA 1XAJA 4EGJA 3L0IB 1W5EA 3I2JA 4MKIA 2JHGA 4P7JA 4UUQA 3AYXB 4MGIR 5KJFA 5KYYB 1BAPA 3IQWA 1A9YA 3ROXA 4BIMA 3CO0S 3KKNA 2GD2A 1HMYA 1P45A 1U0OC 3QVUA 4NFLA 3RYCA 5LB2A 2H5IA 2PGDA 1EQ2A 1MO5A 4YCMA 1IAVA 3INYA 3AVOA 3ZHBA 3E4CA 2HTEA 3K6SB 2PKQO 1WD5A 3Q8XB 1A5TA 1L4EA 1ONNA 4ZT6A 1Q3TA 1R27A 2TMYA 1U0HC 1XVTA 2YN2A 4WKOA 3W5IA 2V8OA 4EUHA 5KREA 2ONJA 5FUXA 4CKYA 4MITA 1KQ3A 3EBLA 2CDRA 2CMFA 4MQ5A 1NVEA 2Q4RA 1KK2A 4IRMA 5LD2C 3ZYCA 1PWYE 3JQRA 1G3UA 2F3UA 4LUCA 3OQNA 1FFBA 1PBTA 2X19A 3CINA 4KHZA 4TKUB 3WWYA 4OHPA 4D8YA 3G8YA 5EE5B 2ZUTA 2EYUA 3BGDA 4AN1A 1IOLA 2BGLA 1YS6A 3H5VA 2C7VA 1CQPA 4URVR 1BHQ1 4NBKA 2VKQA 2X1VA 1BS1A 3HP1A 4KIUA 3KJGA 4GZLA 4L4SA 3R3HA 5ARBA 4KXWA 1ZC3A 3ELUA 1JU9A 4Y2VA 5FOXA 3TB6A 4M98A 4ALNA 4CLDA 4L5JA 3DUWA 1EFUA 1K5HA 3VR4A 1X15A 3I2YX 2G9ZA 1C9EA 2AC4A 2PSDA 4F5EA 5G53C 2W2LD 3ZIUA 1VI6A 1PJLA 4FEEA 2UAGA 4RGVA 4OSOA 1PJSA 5DBFA 3HJBA 1XB2A 1P5ZB 3OURA 5LYJF 3AF2A 3VTAA 3N70A 5FF9A 1J2TA 2F4VB 3S5JA 2PJZA 1BE1A 2ZRLA 4NFSA 1SQ6A 2F1OA 2VPPA 3KE9A 4FNMA 1PDOA 3K3PA 2RGXA 3CLSD 2ZUCA 4A2QA 2YKGA 3I6IA 1X1AA 1QIKA 3P27A 1XLTC 5HK8A 4F4DA 3FPFA 2MIIA 4ZANA 2FPPB 3OICA 4INOA 1AKVA 5FQOA 1E59A 2H31A 2BJHA 1T9KA 1T15A 1J0BA 4IRXA 3VKHA 4DR1B 4OQYA 3STVA 4Q3LA 5JCXA 3U1VA 1H4QA 5IT5A 5EE9A 2Y76A 3NEAA 2CBXA 4V0KA 2CVQA 3JD2A 4LMAA 2DM6A 4UQPA 2B94A 3KTFA 1C80A 3PD0A 3K1TA 3QLUA 4CF4A 1QIMA 5JI3E 2Z0MA 1BEUB 3NTOA 3UEOA 5LSAA 4MHTA 3CJTA 2Z08A 5EIXA 1LH0A 3LUBA 1Z6TA 1CZNA 1V9LA 3VQTA 5IZCA 2FQ1A 1D6JA 2I1LA 3AY7A 4YT8A 1NOJA 5K05A 1YUNA 1IEQA 3HS3A 3L5KA 4MLDA 2VNIA 1P9OA 2EGUA 1U31A 1G2QA 2NIPA 3CSUA 3KV3O 2FSUA 2GM9A 5BXQC 3HVRA 3BGIA 3ZQJA 2I8CA 3JXEA 4CIDA 3H2HA 5KDDA 5BQFA 2HK6A 2XSZD 5EJFA 3M1AA 3NCHA 1LPPA 1JKMA 3DWFA 3GVXA 5CHYA 3KKKA 5JMPA 2CE7A 3DMGA 4HXYA 4IUCS 1GNPA 3RUCA 5FUQA 3M1LA 3RLIA 3FWZA 3V32A 1NYQA 2B5OA 1P6UA 4KDFA 3MIIA 2RKWA 2FZ5A 1RHUA 1S6YA 1I0LA 1R6VA 1YR6A 1EHCA 3K30A 1GQFA 2IF2A 2OCLA 3MRSA 5A4KA 2WTUA 3R3WA 4DKJA 4W9RA 1LLDA 1SUAA 2IUFA 1V7QA 3D3WB 4KR2A 1HG1A 3CE9A 3PRKE 4NMMA 5AFSA 1L4HA 4X94A 1W0KA 1BN6A 3UYKA 1ZSVA 4GUAA 3WDLA 3LQKA 1R7RA 3AVWA 5BQOA 3GRFA 5F21A 3UENA 2BEVA 2E4ZA 3WMEA 3ZQKA 3LI2A 3AEKB 1YHNA 3OZTA 3UJCA 4FYMA 4S3MA 2WSIA 1J0EA 3N8KA 4WFQA 1DKUA 3QXSA 5CH3A 5HIJA 5LDGA 1TQ8A 2OAGA 2VDWB 4M9SA 4PNPA 2QTAA 3E61A 4KR9A 2O2XA 3V4OA 5DYTA 4ARAA 1EP1B 4Q93A 3KKOA 3L7AA 4L02A 1QH1A 3C98A 3UPUA 4PCLA 3BSYA 5DNWA 2PKXA 1X8LA 2JJ2D 3ZQ6A 3CZ9A 3MIZA 5AM5A 4D9FA 1S01A 1LLUA 5FD8A 4DG8A 4RGQA 5ALRA 2QTMA 5B2ZA 1KDVA 2FQXA 4CXMA 1F6BA 4IGKA 1CUWA 1I2ZA 4IIYA 3TUIC 3BD7A 3VVMA 3WNDA 1K3TA 1NJFA 3FUCA 2WV7A 3HGTA 3LYLA 4GH5A 2XRFA 3EISA 3W3AH 2F1KA 1KJJA 4KXQA 1EK1A 2ABWA 2V0NA 2Z8YA 1JJVA 2H3EA 1N2CE 3BG5A 3QW4B 4QU5A 1ODTC 4UEJA 1U2DC 5EERA 4V3CA 1DKQA 4AZ3A 4DLTA 3F7OA 5BSUA 1R4MB 4HH0A 2XKBA 1PNQA 4YH1A 2PX6A 2RI6A 2Z3ZA 4R1MA 4UNNA 1BIFA 1PEAA 1Z5VA 4KTVE 2O2CA 3NONA 2DU8A 4EW3A 2PA0A 1NUHA 3QEMA 4J0DA 4PAMA 3DBHA 1IBSA 3QYPA 1FMTA 3MCAA 5BSVA 3D64A 5DN6D 2ASVA 3RD5A 1UADA 1D2NA 3ZE0B 4MB2A 2A2ZA 3TSOA 3OZAA 3VPSA 4O4LA 1KPGA 1TXGA 2AMLA 3SDZA 3DFZA 5CX4A 5E2AA 2JRCA 3N2KB 4E3WA 3QELB 4I46A 2EBWA 4UFNA 1ZG3A 3M1IA 3HBFA 3G17A 1FQKA 3A3KA 1QHHB 4YCJA 2YMLA 2NSYA 3V8RA 2MTBA 2XWPA 5A4MS 1WP4A 4EHLA 3ZOZA 2HA3A 2HL6A 3ZYZA 1RQRA 4WDRA 3ZUGA 1HZJA 3T1YB 2Q3CA 1I6LA 1GYRA 5JMWA 1W1WA 2OP0A 3K92A 4AJJA 5HKAA 1YAJA 1PV4A 5GIOE 3ZEIA 2CMHA 1Z08A 2I8LA 3JRNA 4I9GA 4ILKA 3HXQA 2CMKA 1CEXA 2FCAA 1BS9A 1EI9A 4Q00A 3ZCSA 3EA4A 1Z0IA 3ZH9B 3BMNA 1L8LA 4UEKA 3U26A 3K8ZA 2AYXA 4C4ZA 1A4IA 3K8QA 2BI4A 4AYTA 3EH2A 2HF7A 5JJ5A 4KXUA 5SZIA 4QYTA 2W42A 2MJLA 3W4JA 4UDOA 2VHTA 3FVTA 3GJ0A 2GPBA 2P2ZA 2Q6LA 3ZTTA 4GYWA 1OROA 3LP5A 5BVHB 2OC9A 3HM2A 3QEJA 2H7XA 4D2IA 3U7RA 4ESEA 4XTRA 1F9EA 1QHYA 1W2GA 4DSAA 1Z38A 1G5FA 3E8SA 3C41J 2PD3A 2BKAA 1CB7A 4K28A 2A0WA 3PNVA 3VPHA 2RI1A 2IHTA 1AGNA 4EW1A 2ECQA 1MQ9A 3H2YA 5ESDA 2O20A 3M9XA 1SG0A 2CVZA 2GPSA 2Q9AA 1YD7A 3EASA 2RGEA 3V4RA 1N32B 3ITEA 2FKNA 1N8KA 3S68A 2PMWB 4JJEA 3CA8A 5FYQA 1UBTS 1W73A 2CFTA 4QU0A 1FRFS 2J30A 4CVNA 4EG4A 4GNKA 3DYIA 1U1FA 2H2WA 1XO1A 3E6AA 4G1VA 4ER7A 3HM9A 4A1FA 1ZVMA 2EFDB 2Z83A 4XDYA 5ALZA 5HFJA 5AM1A 2V58A 4PX9A 4RPCA 4ALMA 3HA2A 3IEIA 2C8JA 3TW0A 3ZHYA 2EGHA 3UTDA 4RENA 4JITA 1CF2O 4LHXA 3L9XA 5KTOA 3C4QA 2I9PA 4R9VA 1OXUA 1AT1A 1PR1A 2GCGA 4I1OA 5IJAA 4I66A 2YHIA 3FJ1A 2NNLD 3I01A 4LYYA 4MEJA 3OLYA 4MQLA 4CF7A 1YS7A 4ZMRA 1VHJA 3BMOB 1F2TB 1MXHA 4RKYA 1IATA 1KZYC 1EBFA 3EZ6A 5AOAA 3T1TA 4AWAA 3HR7A 3NDBB 1A8QA 1CJKC 1IONA 3TL6A 2Y67A 1KK3A 2OLKA 4TVOA 3VU1A 4A82A 4ZVNA 2VHUA 3CG4A 4ZO6A 4M9CA 4ZPXA 3HABA 4M7RA 3TUJC 2AG1A 1SMKA 2D59A 1E96A 2CHVA 2FE4A 4GVLA 3WV5A 1OKKD 1ZOPA 3IRUA 4M99A 3H4MA 2AC2A 3EVDA 1H4VB 1IBRA 1ND5A 2GJSA 3VZPA 4PYJA 2HGSA 3I1FA 3IUEA 3CX3A 5B3LA 1GAXA 3OD1A 2CMDA 2YS6A 1J9GA 3O3NB 3OQIB 4MO9A 5B58T 2XD9A 5DM1A 1HWYA 3QBEA 2XIJA 1DKLA 3AWIA 2XBMA 4MVXA 5C31A 3CVUA 3O21A 1FP7A 1R16A 1RXCA 2W8BB 3R5KA 2WAAA 1NC1A 3PF8A 1UKYA 2QE7D 5TVKA 3ZDBA 1BQEA 1OVMA 3IT1A 4DB2A 1NXSA 4JJKA 2FXIA 4Z4CA 2JIOA 5IJ9A 2RH5A 1WHSB 4BMOB 1HR0B 4PLVA 1F14A 5KOJB 4BECA 1M0SA 2ANCA 1E0AA 1PR9A 1V96A 1CQIB 1SC1A 2B7LA 2M98A 2XDQB 2M6SA 4CCSA 1QIHA 4GM1A 2J07A 3A0RB 4NZ9A 5CT8A 1K97A 3T12A 3A1WA 3N0RA 3VR4H 1ZD5A 4CKBB 4EKDA 1DQNA 1KMQA 3PQ8A 3SQWA 2I65A 4TRRA 2R44A 1VE1A 5L3QA 1CZHA 3K8YA 4EHAA 1XL1A 2XGSA 1RKBA 3KEOA 1CEEA 2OB1A 2H1WA 2J3QA 2R48A 3N7UA 2BBOA 2BGTA 4LDQA 5H83A 1OPRA 5ECWA 3B1ZA 4PONA 3PUYA 3CEJA 1L5QA 5F9FA 2BISA 1AQIA 3TI7A 5K09A 4Q7LA 3TJRA 3OJ0A 5KU7A 1GGVA 3GLHE 2IZ0A 1YS9A 1HE4A 3PNOA 3KHSA 4ETIA 2O7QA 1TCVA 1GTSA 1TYZA 5FNZA 2XVAA 1FNSA 4G26A 1RLTA 2B25A 1DBQA 2HRBA 3DL2A 1FPMA 4G0QA 4MW1A 4O25A 2O3RA 4WVFA 3AI7A 1M6VB 3DULA 4FN5A 5KTKA 3E82A 3O8NA 2F9FA 1YKFA 3I37X 3KLPX 5GVSA 3AVTA 4J7XA 2QG6A 4UFPA 2C58A 1SHUX 4QXAA 2EERA 4YCDA 5AHXA 1CUVA 3RFXA 2FDRA 2ZXEA 3EK2A 2D74A 3R23A 3UUWA 4CQMB 1AKMA 1B3BA 1ZM2A 2YTZA 4LXGA 3D8BA 4IJ5A 3H2JA 5LDDC 4WKNA 3VO2A 2J3EA 1G20A 3LG2A 4B75A 1QS0A 4GUDA 4AROA 1O9BA 4AZ3B 5IAOA 3PL5A 2FPLA 5JW6A 3L05A 3SBOA 4F72A 3O4IA 4WD3A 3RC1A 2C98A 3O38A 3WMFA 2YX1A 4W99A 3QFSA 2X2FA 4G0OA 5C7YA 2W2OA 1AUXA 5HUHA 1DEXA 2Y1OA 3MC1A 1NBAA 2J6HA 4D8XA 2IIBA 1PZFA 5LR6A 4QPZA 3I5UA 1UZUA 2FZ4A 3OT1A 1UJ2A 2QRHA 4HGYA 5IP5A 5J4LA 3OHPA 1GDTA 4E5PA 1MJGA 1P0FA 3INRA 4XYGA 5K3SA 1C1XB 2WHEA 3GFSA 4FFOA 3VBEA 1FXWF 4RK6A 2IXFA 2GXQA 2P9GA 2QI9F 1Q20A 4F2WA 1ACLA 4JBWA 2SCUA 1T1JA 1NRIA 4LHZA 4L8GA 2CHQA 4J9UE 4WGGA 4GOKA 3WLRA 1C1DA 3B3AA 5JMOA 4NU0A 3RVBA 1G2PA 5KVVA 3LRTA 5LNK1 1APBA 2C7BA 1S4QA 1CQJB 1JPVA 1W25A 2V5UA 3RK1A 1SUPA 5CW1A 1RAHA 5JH7B 2R6JA 1AXRA 3IFSA 3V2UA 5LU9A 4O3MA 3TNJA 1OFIA 1VLZA 1JDSA 1LUAA 1SUEA 3FYCA 4YRDA 4G9BA 5BQXA 3KQHA 4EZEA 2QU8A 2ZUWA 3HSSA 3VPDA 2FW1A 1F1JA 4I6EA 3HP4A 3L4JA 3H17A 4RTPA 4XLZA 2XQIA 3DE6X 3IDOA 1AB5A 4R9SA 3FYDA 1NLYA 3EFHA 1QO0A 2QYHA 3ZLTA 5JANA 2P2LA 3R8CA 1HBJA 2J9GA 2A5FA 4YACA 3SJUA 3TTUA 5DCLA 1NVBA 3OZXA 4KLAA 2WHQA 1TU0A 4X3CA 1UM8A 1VKRA 2AJ8A 1US8B 1MJFA 2HSWA 2B78A 2VA8A 3UHJA 4BQIA 5K03A 4RQAA 1MOSA 3RIEA 1ISRA 4TTIA 2Z6UA 3MJRA 3O8QA 1QTRA 1V7CA 2F90A 3PDHA 2JGAA 5UKDA 3QYAA 1LK5A 4EH1A 4XM1A 4MI1A 3OLWA 4CIBA 1H8HA 2YXDA 1TUBB 3DDZX 1PP4A 2PAFA 1SBYA 3ZDZB 2AKAB 1JJBA 3NAMA 3ONVA 5IJZA 3EEIA 2QHXA 3T0IA 2QRGA 1USUA 1OHHD 1T0HB 2EW1A 1HZZA 1WHSA 4WPGA 4ACAA 4OBXA 1H23A 1PHPA 3OTGA 2HYIC 4I1IA 5K0SA 3CGGA 1D2EA 5FTKA 2F2TA 2YY6A 1N2JA 4DBVO 2P9TA 2BSXA 2UVPB 1Y3AA 3Q9LA 4HATA 4P82A 3J7TA 1US8A 2PRSA 2W2PA 2W6IA 3RF7A 1LF5A 1QZZA 5HM8A 1DUSA 1A8SA 4UM5A 4F4JA 1TKAA 2CN1A 3CZQA 3C8ZA 4M1TA 5DTEA 4BKUA 5A6SA 3VA7A 2MR6A 2Q9BA 3FCEA 2AX4A 5CA0A 5L3VA 2FN8A 2IXBA 8ATCA 1J2EA 1U28C 1MQSA 1Z2EA 2ZW9A 3B3GA 4QJ5A 5GQSA 3RAPR 3OLXA 1YGYA 2WY2D 4JB3A 3V1MA 2GVZC 2RHLA 4P32A 1DHRA 1J25A 4P0PB 3O3CA 4GWGA 2WSSD 3H9BA 3RRJA 3JVIA 1LPAB 3WRYC 5FOUA 4TV9B 3LOQA 2NU7B 3LQ2A 5AHOA 3S1LA 2A4KA 1FRVA 4C7MA 2QRVB 2R3SA 1F5NA 3F98A 1ECGA 2O8DA 2E55A 1N8TA 3A6JA 2GN6A 5SY9A 4LF8B 3MQ4A 3N2YA 2IH2A 4TSFD 2ES4A 2WIFA 1NJGA 3BWVA 2HIHA 1DIAA 4KQ1A 2I33A 3ZWXA 1M1YA 1XMXA 2RHRA 2V6FA 3IHWA 4RIHA 1ODFA 1XQWA 3GJSA 2NX2A 2X5NA 1T2FA 3C7DB 3R0VA 1MJGM 2NN3C 1P8JA 1SHZA 3OY7A 4KPUA 3KXIA 3UM9A 3I2FA 3OMLA 4FJ1A 5EHNA 3IKLA 1YJCA 4J0FA 4KQKA 5BW5A 1H3EA 1Z0UA 4IHKA 4B31A 2O5CA 3HVIA 1KARA 2FR8A 3U5ZB 5TGDA 4C07A 4EQZA 4M21A 1Y42X 3KQMA 5AM2A 4ZVSA 4H1HA 1K89A 2PZJA 4LMRA 3EY9A 3SJBA 2ECOA 4EDHA 4QJ4A 4F96A 3G9ZA 3I9OA 2JCYA 2QTNA 2CVPA 3ZBPA 4OJKA 4C3ZA 2AHRA 3DE5X 3E2MA 5JO9A 3NZEA 2UUPA 4OQEA 2RH8A 4WDQA 4BX0A 1PWEA 3RYCB 4ZK6A 1SU8A 1KEKA 3OZCA 1D1SA 4QDKA 2PK3A 3LTNC 3QKWA 5E9JA 4DHEA 1EZ1A 1MU0A 4ZZIA 2NACA 4X6UA 5CLQA 3CMMA 5K3AA 2LZ0A 5A4AA 1EXWA 2AS0A 1PT5A 3HK2A 5DYWA 5GV8A 1NR5A 1P1FA 3IHKA 3UKDA 1Y3DE 2FGJA 2PANA 3KSMA 5BO5A 1J9ZA 4AI6A 3UT6A 3MA0A 4HXGA 4Y0VA 1HNNA 5FEUA 1VJ5A 3UXYA 1RQ7A 1L5OA 2BMAA 2FFQA 2C2YA 3NHRA 4F9TA 3DC7A 4ADSG 3GLGA 2P35A 4QL3A 2XE7A 1EJ6A 4EW2A 1F12A 1J06A 1L9XA 2B4QA 3PDWA 3OP1A 4BHTA 3S6JA 3QE2A 4HS4A 3IILA 1HQDA 2ZVJA 4NOKA 2AJDA 3ETLA 3KVYA 1GTG1 2FPUA 1ZZGA 5HIIA 3TOCA 4Z9AA 3NHKA 1G9XA 3TLMA 1Z28A 5JIBA 4QDTA 4KP7A 4LMBA 4XE5A 1IDOA 2QVGA 3L0OA 1QKJA 1XJQA 4LZPA 3P4XA 1EG2A 1PFGA 3OX1A 5HNKA 2QLMA 4Q6WA 3C48A 3AF6A 5HMMA 2AF3C 5EJ8A 1R8QA 4HUTA 3EEOA 3ORRA 1MNAA 3MINA 3S4YA 4HF7A 3B1KA 3O31A 1A4UA 1U0SY 4CQMD 4GRDA 3ZVLA 2IXDA 2BMJA 4E30A 1SJ9A 4KL8S 1VP3A 2PIDA 5IANA 3D54D 3AEZA 4DYHA 3SEZA 1SUBA 3ZJ5A 1RC1A 1OBOA 3GT0A 3SSAA 1C41A 1F4LA 1P9WA 2FSPA 2OQIA 3DOEA 3IURA 4WQMA 3R7DA 2D7DA 1FSPA 2D2VA 1IN4A 4HN9A 4WIAA 1KK0A 2C8KA 1A9ZA 4P9NA 5HRCA 2DY1A 1PVOA 1XZEA 4UDYX 2FWJA 1G64A 5AXAA 4CL0A 3D7SA 3RE1A 4I9NA 5HQ3A 3Q3JB 1EDBA 3KT6A 3CNQS 5EIBC 1ZK2A 3Q2OA 4B4OA 2VS1A 2AH5A 1L3BA 3D7RA 2C00A 4AURA 1EVKA 5HRAA 221PA 5EKXA 5AVJA 2EBFX 1VKZA 4WESA 1K6EA 1N0WA 3Q3IA 4KAXA 2VJMB 4KCGA 1FU4A 2M6LA 1CUHA 5LP1A 1YHZA 4ZAVA 4UUMA 1Z39A 4F6CA 4JXXA 4AX8A 1YBHA 2CL6X 2P40A 1CNFA 1VL2A 3AJAA 3D8UA 2NUPB 1XROA 4DIDA 1J1ZA 4EJMA 2WSMA 5G41A 7MDHA 1MOPA 1Y8RA 3RVPA 4Y2TA 5JJIA 3ZHVA 2DECA 4ND2A 4Q15A 4RTQA 3C15C 3TTTA 1PW5A 1TX4B 2VCEA 1F7VA 4JYZA 5FOWA 2WB2A 1R0XA 5K2OA 2ZWAA 4CR8A 1M6WA 4EABA 1OFUX 4OFBA 4C7XA 2AMFA 3R3XA 4R6XA 2V6IA 3JATB 1E1QA 1NF8A 1MIOA 2CCKA 2R00C 2RARA 3EWIA 3NIFB 2Z30A 5MHTA 2CHGA 3KAJA 1AX9A 3PTLA 5LQSA 5L3QB 3AVVA 4UASA 4LXXA 4B7UA 5IJ0B 3EXFB 4GGOA 4RHCA 1H0KA 4Q03A 3EYWA 1PR2A 1I3LA 3PHBE 2BTQA 4PLTA 2XB9A 1N3LA 2H6EA 3F3YA 3HWSA 4MJ3A 1DAEA 2P75A 4PYOA 4XI9A 5IH7A 1DI0A 1T9HA 1L7BA 1YQQA 2ACVA 2I4IA 2V8BA 2WPNA 3FYTA 4H7HA 2WG2A 4MUXA 4OEHA 3R7SA 1X1SA 1B8OA 3ZU5A 4BEWA 4U9UA 4ZCLA 2H0RA 3H16A 4D9GA 3RAFC 1Z8HA 1XTZA 1UK6A 1O96B 1NNEA 5DKFA 1OCEA 3DW3X 4NYIQ 1RJ9A 2YRWA 3ELDA 1T5OA 3A10A 4O63O 1UCFA 4I1SA 5K3EA 2FR8C 1STOA 4B3HA 4DM4A 4QOHA 4Y3UA 3ER9A 2XY4A 4GOLD 3V7NA 3CKKA 2X8JB 3EEQA 4FHDA 4NX2A 4NAVA 1XXHE 5EZSA 3ZZNA 4BNTA 1QR6A 3T1OA 2PUFA 1L5HB 1FF9A 1GZSA 1PUXA 1ZMXA 4W63A 4MSUA 2VZ0A 2GD0A 1D2MA 2AOWA 2XF2A 4DLWA 2BTQB 4ZIRB 1VLQA 5T41A 1CY1A 2WYIA 4HDRA 2Q0XA 3WHPA 2HLPA 3GL9A 2JKYA 1E77A 2EL9A 2QGFA 4KN9S 1WQ3A 3GR6A 1FRQA 1PWXA 1N8SA 2D3TA 3B5JA 4CODB 3D1VA 4AJ4A 3ZBUA 3AVUA 1N33B 1TGVA 2TRSB 1YQ9A 2WEKA 3M6VA 2EZ9A 2NO9A 4NFHA 3PXAA 2H1RA 1W75A 1D1PA 4ARUA 3KLBA 3RRFA 1RPAA 1EBUA 2LBPA 1V11B 3TAHA 1E58A 3VH1A 4DIFA 3EMDA 1RYFA 2ATVA 4L95C 1W4CA 3PNMA 3UGKA 1XG5A 3BORA 1FUUA 1XVAA 2R1VA 3L9WA 2I6QA 3NV7A 1PR0A 2OV6A 3HB1A 4MVYA 4QDXA 3RRXA 2XXAB 1LVHA 2ZCUA 3N2KA 3BZBA 2RC6A 2WJ3A 4FWBA 2NXCA 1A8HA 2JGDB 4OLBA 4X1KA 5IT9A 1QDLB 3HJNA 3PQ5A 5A5FA 1SH7A 3ZC3A 3WV4A 1ESMA 1TLTA 3F71A 2KQUA 1BD3A 5EP3A 2ZI9A 2ACKA 3TRHA 3LRPA 1E3WB 2OOSA 1LF0A 2VXOA 2ZTVA 3HFGA 3R5TA 5EWLB 2WPDA 1N4DA 4OL9A 4IJQA 4A2PA 2YFYA 2J5RA 2Q21A 1RJDA 3ZGNA 4AUEA 1X38A 4OHKA 1JYSA 2PH1A 1HEUA 4F9FA 4AG5A 3NDJA 4ZI7B 1O5TA 3HCDA 3R3JA 4G4SP 1Y1LA 1RWWA 1JLSA 5K6AC 2XWBF 3QI2A 1TC1A 2A78A 2VXBA 3ANLA 1WUKS 3B7WA 1QV7A 3WA7A 2H92A 2QX9A 2ZI3A 3E5RA 4L57A 4JBHA 4J8PA 2WW8A 3RVDA 1RWOA 1Y3CE 2H4HA 4Y0AA 2P30A 2Q1XA 3LY8A 2OYRA 3O3MB 3W34A 4AYXA 2I6UA 2WNSA 2EKPA 2XKJE 3TEJA 1A7AA 3LQ1A 3OPMA 3JQQA 4RZXA 4CBVA 4MGEA 5HA5A 3HFRA 2BMEA 3I23A 2QX4A 1DC6A 1BTOA 1NDHA 3VV2A 2E6KA 5JNSA 4HAUA 3N07A 4BRUA 3GLUA 1YBVA 1U6JA 3AM4A 3WGOA 2HQBA 3A6GA 2DPXA 1QH0A 1JFVA 1KF0A 1FW8A 1SC4A 2NO5A 1J2RA 1YOVA 4G5SA 4QNNA 4CL3A 4D0SA 3JRXA 4D4LA 2VHEA 5AI0A 1CP3A 2GFHA 2WMOB 3RC3A 2B4RO 2ZIVB 4IIJB 4DLSA 5CUQA 4CNBA 4L73A 1I10A 3MBIA 2EJCA 4NU5A 3S44A 5FWAA 4M8IA 3NR2A 1NY6A 3T1NA 3AFHA 3ES9A 1C0IA 4IJMA 4B76A 3ZDDA 1L7VC 5U9CA 1D7OA 4K9RA 5B3JA 1OH6A 2H1IA 1VGVA 2EDAA 4CT4B 1YZQA 1SULA 3WGTA 3OI7A 4KWCA 5IVDA 1U0BB 1T6NA 2MSLA 3OC0A 1EWTA 1XMJA 3VZRA 4C0AC 2GM3A 2O19A 3ZR4B 3FCSB 2Z5LA 1GSAA 2Q7DA 4QLOA 2I7XA 1OLOA 3LKDA 1JP7A 3L0ZA 2NMVA 4B2LA 1GQRA 3BQNB 3AJRA 1BDMA 2WSYB 3DAHA 4YRPA 2WSLA 4LXHA 3HVUA 1DV2A 2INGX 2W6QA 4MO2A 4YUZA 5B4UA 3DMRA 1U8AA 4UMVA 2JANA 4JJIA 4OYHA 2CMGA 1A2QA 2WV9A 3KRTA 3TNYA 3PE4A 4BRZA 2DQSA 2CK3D 2XLCA 3TFOA 4F2PA 5KVCA 2AEMA 4L8FA 5GONA 3ICEA 4IIXA 1VPVA 2BR3A 4PHCA 3R5HA 1DL5A 2ZS9A 3MGGA 2VTVA 2P4QA 1K4YA 2P8SA 4Z6KA 9ABPA 3KQYA 3MWLA 3IUPA 2GEBA 1P4RA 4KQFA 4TGLA 5H7XA 2Z2IA 3V2GA 2G25A 3L40A 5B1HA 1TZKA 2HRDA 4AYWA 3I5YA 4BNVA 3MPUA 1LGYA 1UAGA 3PE3A 1MD9A 1RMYA 3SZLA 1THMA 1E2FA 4ZRDA 3H8SA 4Q9KA 1YQDA 3OKAA 2W6CX 1EXNA 2CD7A 4IDEA 4IYRA 3RTAA 2CXPA 1PNVA 2MHCA 1FEZA 1II9A 4RORA 1X7WB 1ZU5A 4O2AF 2CDCA 3I04A 1VG1A 5E1DA 3NP7A 5B3AA 1IAQA 5I9BA 1XU7A 2AZ4A 1C9DB 1PQWA 1MF7A 1WP9A 3AHJA 1LDYA 3EMKA 2ATEA 2FJPA 3C74A 4FIZA 1GL7A 3DEJA 3SMVA 3WYCA 2I2WA 1RM5A 2Z09A 1VBNA 4UPEA 1TMGE 4MVJD 3EFEA 1F0KA 1R6BX 1SZDA 2F59A 4O29A 2DBVO 3O3OB 1RACA 1CDEA 2ZS7A 3GG9A 3I83A 4U8GA 2NTYC 4GI3A 1E2QA 3ILSA 2JCSA 4XAQA 4B47A 3K0KA 1YQTA 4MHSA 5KMGA 3QPBA 4H6VA 4EA7A 2BUBA 4X6LA 1R0SA 1ITZA 3T9CA 4B7AA 5GZ1A 4MVJI 4L3VA 1X8JA 2ZSFA 3OEHA 5AKXA 4BAZA 3A6FA 3REGA 4AKEA 5JZOA 5ALHA 3FWNA 4MYHA 4BNHA 1J5EB 5JAIA 2H4JA 2HMYB 2NAPA 1GSOA 2XNCA 2ZSBA 3ESAA 3MCUA 4H7FA 1X1EA 4HMPA 1H6DA 2G07A 2P6MA 5DLYA 4Z0TA 2EWVA 3DMTC 4N18A 3FPCA 4DNFA 4EA8A 4G5FA 1NKVA 2DAPA 2Y0BA 4QO8A 2X9LA 3OZIA 1QH1B 3TR0A 3K5WA 4JIGA 4HK4A 4NQRA 4HWPA 2CFRA 2DTXA 2JBWA 2OP1A 2CJWB 5BQ3A 2EOAA 2M2IA 3DTVB 4R51A 1VL1A 3SR0A 3OQVA 1OUMA 2J3MA 3PC6A 3HKCA 4EB8A 1G7SA 3QI7A 4N0EA 4RXUA 4Z2YA 1F06A 4RY0A 5TQVA 1E5TA 2LXNA 4AN4A 3A9VA 5A1JA 3JQAB 5I51A 5K45A 4I5DA 5JBQA 4IDAA 3RTCA 2DCUA 1UXKA 5KWVA 5MGNA 1WV1A 4LGVA 4JP2A 2P78A 2JAXA 5BN5A 3ZV6A 4D45A 3R0JA 5KYUB 3ZY6A 1KO7A 1NVVR 1IVYA 1DRKA 4RLSA 1MX5A 1ZLYA 3JQCA 3M2TA 1GJRA 4XOUA 4ZEXA 5KNCH 1Z0FA 3JD3A 5C3MA 2BTOA 2MSCB 2R85A 4E14A 3UJNA 1S2GA 3KEMA 2JAHA 4URWR 3LX8A 1NQTA 2NVWA 4EUFA 4PZAA 5AJVB 3AVYA 4PZPA 1A5BB 4MLCA 5CIYA 4NZZA 4Z3KA 3O4HA 3O1IC 3OM1A 1NAIA 1YBFA 4YRGA 3H9UA 3AR5A 3I0NA 5B7PA 4EPRA 1G2IA 3TZKA 1CRLA 3MTDA 4KXXA 4RU1A 1Z13A 2BMDA 2YHSA 3KDSE 3OA0A 3TYXA 2Q62A 4M87A 3RIMA 3WLFA 2ZPUA 2O8BA 4KXLA 3GLFB 5DV9A 3BHJA 3KR0A 1DKRA 3R0ZA 2NYRA 3F6SA 1OAOC 3PUHA 4KXVA 1KZ7B 3T0FA 5CA1B 5CD9A 2YJ4A 1IPFA 5DNUA 3SVTA 1I1OA 1VCOA 4ERNA 1EUCB 2BY4A 2R65A 5AOBA 1D0IA 1ZITA 3L1VA 3TMYA 3WDSA 2JLYA 1RZUA 4MICA 2TYSB 4PTLA 5H70A 1N6RA 1R10A 3W7VA 1CUFA 1KETA 4BGVA 2DUNA 5DHUA 3KWJA 1X7ZA 2V65A 1OU4A 3PG5A 4M8NE 4FS8A 1YBAA 2OFOA 3MMXA 5DB4A 4DUYB 2YXLA 2A33A 3L41A 3W5BA 3IMGA 4MIEA 1EX1A 1UEXC 2WM8A 1UK7A 3PEFA 2GMWA 4MTCA 3HU3A 4CF5A 1E9VA 1GSHA 2EXXA 2PBLA 2XUZA 3MTIA 5AW8A 2E4UA 4IZHA 3KV1A 1KC3A 2Q3HA 5I7OA 3FY4A 2G9RA 4FE3A 2G5CA 1OT3A 4BYGA 2WHRA 3F78A 3ANMA 5JADA 3WNVA 2FEMA 4B79A 3TE7A 2MINA 2ZYHA 3RVQA 3EUAA 1V35A 2OV1A 3PDIB 3OJFA 1MB9A 4DTCA 4BNUA 1ZMRA 2FX2A 1VBFA 3LO5A 3K0FA 4QLAA 4MWTA 1F6DA 1II8A 4LVCA 1XRLA 4E1VA 1NMZA 4K0RA 1S7CA 1HFWA 1YJAA 1NJ6A 3MWGA 2PZGA 2GEUA 1Z6QA 2V74B 2K5UA 4OJMX 3T3PB 4WCFB 5K99A 1N2BA 2DJ5A 1DJMA 5DNYB 1USVA 1Z5ZA 1MQAA 2EU8A 1D03A 4X7PA 1FX0B 4OIMA 4BCBA 5CAEA 1O5OA 4RF4A 3O4RA 4R71A 4LW8A 1P4GA 4KRYA 4YMUA 4IIDA 3DZHA 3NYRA 3MOSA 5HE9A 4S12A 3ASUA 1TT5B 1QYRA 1MFZA 3MWEA 1KDRA 4S2EA 2LIPA 3L0YA 4GI1A 2M1ZA 4NNJA 1TJNA 1Y8AA 3PFKA 3WFIA 4OQQA 5JFGA 3JWHA 3AERA 5AQEA 5HFNA 1FFXA 4NCJA 4XWAA 3G1TA 3NHPA 1B1CA 3UQYS 3DZFA 3KYDB 4DTIA 1YI0A 5EAIA 1P9LA 3H2KA 5EFOA 1JKFA 1GRNA 3P20A 4YC7A 1ZWKA 3UWDA 2VI5A 1KBOA 2XWQA 3EIOA 3FAKA 1N3IA 3FLAA 3G88A 1O4WA 3EC1A 1U02A 3K09C 3SC2A 1KI9A 3HU1A 1NUTA 2IBMA 4EGSA 4A8JA 5KDOA 4LV5B 3DLCA 3IIKA 2NU8B 1A1VA 2H1LA 4DL9A 2V7XA 3AHFA 1DBPA 1X9HA 2X2EA 3KUXA 1I9GA 5AJUA 1Q7CA 4LJ4A 3OZSA 3H7AA 3RS7A 3G9XA 1MABA 1Q7RA 1QHNA 3A6LA 3HKBA 4LDRA 5EG5A 3TQRA 1GPBA 3T35A 2VRBA 4GX5A 5CCXA 1EVQA 2ZYWX 2BKLA 2GZSA 1R66A 1U8XX 3NDIA 3Q7QA 2EFCB 4I50B 4QDZA 4TWZA 4HRAA 2AK3A 4MUIA 4C5BA 2ILVA 3RDPA 2C5EA 2HRQA 4H7PA 4E32A 4BQNA 3THXA 1NNSA 1T2EA 2FMXA 3O2JA 4J0HA 4KTTE 3R7NA 4A0RA 5J2TA 1J0AA 5JSQA 1R5JA 1M72A 4MKGA 3T54A 2OGTA 3D0QA 2ZR0A 4TMVA 3CH7A 4K9MA 2JHAA 1EDZA 3SC3A 3K70B 1W49A 5KX5A 2E0IA 4N6OA 1Z07A 3ZDRA 1F2DA 4MZXA 1REQB 2J3JA 4H2DA 4PWYA 2ZZMA 2FETA 1AD2A 1L5HA 4D4KA 1YHYA 2IIVA 4K1XA 3IPAA 1MABB 4UCQA 1LW6E 3NKFA 2MWMA 5IZCC 1BXZA 5B2EA 4M8LA 3W8DA 1E98A 4PGAA 4YREA 1YZUA 5G0TA 2V0GA 1C1HA 4LJSA 1A8UA 3A11A 4J7CA 5LMUB 2WKWA 3BMCB 1VTKA 3C3JA 5GMOA 1W4RA 2RGUA 2A5JA 3FJOA 4BNZA 1H69A 3ENVA 4MGZR 2V3VA 5B1IA 1C14A 2ZR9A 1PVVA 1SBZA 1WWKA 1HDGO 3LCCA 4DV2B 3NBYC 2LW7A 4QOFA 4JI6B 2H7CA 2YICA 2CVHA 1PKXA 1YR8A 3AUFA 4TLAA 2JJYA 1Y48E 2PY6A 5AVQA 5HJ7A 4EMTA 4IP0A 2V7BA 1RZRD 2XCQA 4EKEA 2QVZX 1H2XA 4KKVA 3WGYA 3B53X 2P8JA 2N3ZA 2JW5A 2XRZA 4LKOA 4GZMA 3WKEA 2X3YA 3BOSA 3VXKA 3DFUA 3UJ8A 4BX8A 8GPBA 5KYYA 3IOCA 1KDZA 1EFTA 3AIOA 4C14A 3A2NA 3E9MA 4RAQA 2X9GA 5J59A 1EFCA 3TSWA 3HV2A 4JYAB 1ZUHA 4Y98A 5K3FB 1M34A 2O7VA 1SVUA 2HSJA 3LBYA 4WY8A 3FWPA 1ZXLA 5JCOC 2XZOA 4KAJA 4DV4B 3D6NB 3OPXA 5LP6B 1ENOA 3DOJA 1DSSG 1J4AA 1DJOA 1TADA 4BWFB 2DHEA 3ZEAA 2CHEA 4QUHA 5KOIA 4ZOBA 3VH2A 1E3IA 1XVLA 3PDIA 4ZT4A 4AJIA 4XPIB 4HQ6A 3NTXA 4K86A 3IB6A 5FWDA 2H85A 2VP3A 1U7UA 4TQUS 4UHEA 1Y4DE 4Q4LA 5EHQA 4YAOA 2H16A 2IBTA 1WZEA 4HADA 2QW8A 4BMDA 5C8ZA 4CM5A 3DUFB 3TVDA 1PSDA 3UMMA 1LDEA 3PEUA 5FLEX 5JQWA 2WP8J 3TLCA 3FYUC 4MUFA 4ZYTA 4K8RB 5C51B 3MT8A 4D81A 1H2AS 1EJBA 2ZRPA 4Z9FA 1O9GA 2UZ4A 1GY8A 3FPBA 4LBWA 1F5SA 1T4MA 4KIJA 4OLJA 4P3OA 4YWHA 5KNLA 3OPYA 2NVUA 4BJ5A 4POOA 5JS6A 2ZTUA 3OF2A 1OU0A 2ZSIA 1G8HA 1TVKA 1OC2A 1Q3KA 1TTQB 2HN9A 4AMBA 2JG3A 3SYKA 1G5IA 3LVRE 2VHWA 2VP6A 2VCHA 3WGIA 4UTZA 2MSDB 4ANFA 1O7JA 1C0LA 2XYQA 3GCZA 4NU6A 4OQMA 1U3VA 3GMSA 3QM1A 3S2FA 4DR4B 2XQJA 4X3OA 4DRXB 3DEYX 3U7HB 4IWYA 4ND1A 1NUQA 1OH5A 5IKXA 3MLBA 1ABBA 1ID8A 5E2IA 4QUJA 3KC2A 5JRZA 4WCDA 3AY0A 3AETA 3UUEA 1N5JA 5FTMA 3FTQA 5FUBA 2RCYA 1FNNA 1FFAA 2PQ0A 3AI3A 3NEPX 2A5DA 2JASA 5CDTA 4DIEA 2RAFA 3BK1A 5LYJB 4LY9A 4UM9D 2WF9A 3S2GA 2XT6A 4Q4CA 4CIAA 3E0QA 5GONB 1CW2B 1WMAA 1XEWY 3PCRB 1ESCA 1RCTE 3JRWA 1SCUB 4M89A 3KLOA 1RI1A 1RP7A 2G7ZA 4LIPD 3K4QA 1NYLA 4LRUA 4MRSA 4NR0A 3WFJA 5HR5A 2CV2A 1S96A 1TK2A 2Z2YA 5FR1A 3HKEB 4TMXA 1P5RA 1Z7WA 4O2AA 4W7HA 4M36A 3EXAA 3IUQA 4B6GA 3EF1A 4CLRA 5KMGB 2O7SA 1QFSA 1OYOA 3U80A 3LMKA 4GKVA 5EJIA 5EYPB 1RRKA 3H8WA 5CLHA 2BBSA 1R0CA 4DLRA 3LVFO 5DXJA 5GONF 2NYVA 1Z68A 1FOEB 1TPYA 3C7TA 3GNQA 2X4GA 4YT5A 1Z56C 1K5GA 3DKRA 4PGHA 4UJ3A 4NVRA 4EVRA 5F7OA 3M34A 2GCNA 4H18A 4V0QA 3UPTA 5KHLB 2ZATA 4Z3DA 4C0LA 1T9ZA 3WI7A 3PWKA 2BMVA 4G4SO 2OD7A 1QFZA 4PRYA 4RDIA 1RYNA 1E3DA 1TB4A 5D86A 4EHDA 3SLKA 1KJ9A 3QXXA 3ZLJA 3ELWA 4QM6A 4FYJA 4P93A 5CFOA 1NF2A 4CGZA 1K8QA 1VHLA 1JR6A 1ZFNA 2XUPA 4KDRA 4FD3A 3M6AA 1JDNA 4Y8VA 1PTJA 4CT5A 4F12A 2Q45A 4HNAA 3AEQB 1A5SB 1ES9A 2ADMA 3MTBA 2OR3A 4KR0A 5FBLB 5K4HA 1BMDA 2REQB 3K5PA 2P69A 2WJZB 3M33A 4QSMA 4MPDA 5KKAA 2J9FB 1VYTA 3ZLVA 4OXYA 5DSXA 4UE6A 3CFYA 4JBGA 4KEAA 4RCYA 2O6HA 5HOEA 2AXPA 3QGMA 4ZVQA 2QV7A 4UXHA 2QROA 4M1KA 4EHBA 4ZEVA 1NKSA 3CBGA 3D3WA 3HN7A 1KJZA 5FX2A 1YI1A 1J2UA 4BQFA 5JTTA 1ZR2A 1RIFA 4UZFA 3HCNA 2YBDA 1CFJA 3PYXA 1KAHA 1OIVA 1P8AA 5HHTA 4OYYA 3AFNA 3CS3A 3PPVA 2QX8A 4J29A 4P4LA 4TUYB 3WX0A 2ZIXA 4CEIB 1HF3A 5IJXA 5IWCA 3LC1O 3E9YA 4M53A 2WR8A 4NENA 5BWCA 4IMRA 1Y98A 1IHUA 2OESA 4CMIA 1X86B 2C99A 2PYIA 3QBVA 4HLUC 1C81A 4Q3EA 2I3DA 1RI5A 6ADHA 4C4TA 1VJ1A 2AG8A 5E7MA 5I45A 1C4XA 3HKDA 3WHLA 2QJOA 2PKRA 5L7WA 3OQMA 2PS9A 1YQXA 1KHHA 4AKIA 1JG1A 4PQRA 4BMXA 1YRWA 1QLJA 3PHJA 4ZCMA 1IQ0A 1COWD 3I62A 4FGJA 2HBQA 2KJQA 5BSFA 3BB4A 3W8FA 4MR7B 1G0NA 4RJ2A 3HYSA 4BZQA 1I4DD 2CZQA 1SVOA 3GRCA 3PNKA 1L7NA 1AO3A 1NVTA 4N3CA 4R9RA 5AK4A 3T41A 4XX0B 3TBKA 3V80A 2ZZNA 1BQ3A 1NMXA 2HZBA 2ZTHA 4FCVA 3F5MA 2OHHA 4YS6A 1F6WA 1HLPA 1N6NA 1ZOLA 1XDZA 2QX6A 3LHSA 4ZQIA 3RYFA 5KTMA 3AINA 4QJBA 2XAAA 5D7NA 5I4CA 4X66B 1ISGA 3L0CA 3SZMA 1OZFA 3IP8A 3NGMA 1WXXA 4TL8A 4HFRA 1JLMA 1K7CA 1N2XA 7AT1A 1UPTA 3FB4A 5G3YA 1XCBA 2YXPX 5F3DA 3BQ9A 2WMNB 3SZUA 3UKJA 1YVPA 1I3CA 2RGCA 2V6BA 3U4CA 3VVLA 3LNCA 3DEIA 3OTIA 4BN4A 3D1LA 1B26A 2GKGA 4R2LA 2FQYA 1VIAA 4GPTA 1ML3A 2XLBA 3ORSA 4MUHA 1L9KA 5IVHA 4I8XA 3WGHA 5LIRA 1R00A 4HQ0A 5KJEA 3VDMA 1YC2A 1NL3A 2DTDA 3NCTA 4JMLA 4RJTA 3K1ZA 5FBVB 3BFPA 3CH5A 1X1QA 5AOVA 1G17A 2BZGA 2ZJOA 4B6QA 4DCOA 1D1TA 4M0FA 5B7QA 5K5EA 1E4EB 2WYVA 4RZUA 2O8EB 3L8HA 4CTNA 1IWPB 4J7UA 5C4IA 5EWLA 4TLCA 5FWYB 4QEKA 4BB5A 1MB0A 3T6KA 1I30A 4DJEC 1QOPB 3WSWA 4OO3A 1EWQA 1OZHA 4GMHA 2HSDA 2SKDA 4YBZA 5KNDA 4C7BA 1JA9A 1ZHFA 1E6EA 4QJIA 4U3JA 5EQDA 1WNFA 3ADKA 1SAYA 1O95A 1DU4A 1XEWX 3ANTA 4GZ5A 3RSSA 4IEFB 4YR7A 3GGSA 4A73A 1UPUA 4BFTA 2WWXA 4WASA 4LJKA 3K0HA 1NVWQ 2CYBA 3NYWA 1ZSYA 1MV5A 3F3KA 2Y2VA 2FR1A 1SVKA 1ZI9A 4MW4A 1P19A 3ESBA 3O8OB 5HBRA 1I5OA 4GG1A 1EFVA 1QHEA 2YUTA 4D02A 4DPLA 1CLEA 5B6IA 4MQUA 4INPA 2CWDA 1Q1QA 1NGSA 1SUIA 3K73O 4ZOAA 2I4NA 3FSJX 3QPAA 1R2QA 1NRXA 2OBYA 4EJSB 5FNVB 4F6RB 3IDQA 5C4GB 5TQ0A 3TTSA 1GSIA 1YQUA 2YNMA 2ZT7A 3IPRA 3KJQA 1T3GA 1JHYA 1W0JA 3AC0A 2GZDA 4ID3A 4RY9A 3MCZA 3FUUA 2OHIA 4NWIA 1DVRA 1HE8B 1IL0A 1HDZA 2ZYGA 3LY9A 5H8WA 3L1UA 3ORQA 5BR7A 1H2EA 4KNVA 3HJCA 4JX8A 2IOYA 3CUSA 3R4CA 1X3LA 4M46A 3P2IA 3V4FA 3FRIA 1S3FA 1QRSA 1M2KA 3KVOA 2B21A 4TVBA 3FWYA 1D2CA 2BFEA 4F92B 1V2GA 4IX9A 1E7QA 1RYYA 3T3DA 2BE7A 2C9BA 2BHSA 1FY2A 1JB1A 2SCUB 3N2ZB 3UA4A 1GXSB 3VZCA 4CTJA 4XVUA 1EQAA 2GDZA 3K5IA 1E8DA 1HI9A 2WQZA 4WA7A 4EIWA 3TZQA 1D4OA 3QKUA 1AK9A 1GL3A 1IFXA 3MRVA 3DM5A 3VU8A 3EDCA 2ZUEA 5DLDA 2ZSEA 5LQDA 1FU7A 3ZWYA 1WY5A 1KAQA 2VRNA 3CR3C 4YFYA 5LZ8A 1V95A 4JLBA 4N03A 1DCMA 4LJYA 1YJQA 4Z7QB 1YFLA 2OY0A 5BN4A 2NUAB 3DEAA 4Q3AA 1KC1A 1MRNA 3PC4A 1E1RD 1WMDA 4PYLA 2OPHA 4B7ZA 3UMRA 2WNHA 5EWJB 3OQPA 4ZRNA 2Q0HA 2MYPA 3UGQA 2PVSA 3U37A 3QK7A 4YJ2B 2BBTA 4K3VA 3O82A 4F06A 3U4IA 1U2TA 3PC7A 4ZODA 1Q0UA 3M6FA 4BBJA 1N2OA 3BGWA 3IPYA 3KJFA 3M3PA 3PI7A 4N3AA 1KEUA 1EA7A 4CQJA 2HREA 2I55A 1YDGA 1C2TA 3CLSC 4H08A 5CP8A 1YL7A 3VYRB 4CI9A 2DOKA 3AF5A 4NYJQ 3GFQA 1AGXA 4MI9A 4NOMA 3PJFA 1KQNA 3TKAA 1VE3A 1WU7A 3M5CA 3DHEA 3QUTA 5A9TA 6NULA 4MKHA 3HDGA 4XX1A 4QYXA 1A7JA 4L85A 4X90A 1BVRA 4FS3A 3FMFA 3GWZA 1JQKA 4YCCA 3TBHA 4QG3A 1M74A 1NG1A 1HQCA 4HYYA 1EAMA 3MMNA 1ENPA 2P9HA 2ONYA 4HVAA 5TJHA 3ERCA 1UOPA 3NATA 4M6WB 4IHJA 1TJYA 1QP0A 1MDBA 1XWWA 2IC5A 1QB8A 2R8XA 2BI8A 5I9IA 4ISBA 4DDKA 1Q7GA 3DE0X 1MW8X 1XTIA 4DDVA 1AZTA 4MQFA 1Z45A 2XYHA 3HCBA 4CKWA 4FFRA 1P7YA 3JD4A 4B8ZA 1EA5A 2B4KA 1CF9A 4K05A 5AVOA 4LRWA 2CXTA 3IODA 4QM7A 2WAOA 3WO0A 4L08A 3UJDA 3DW1X 3MN1A 4TRMA 1VGQA 3NGLA 2FLVA 4RS4A 3TINA 4CFYA 3KU1A 1KRXA 1TZJA 4IGFA 1F3LA 4JUFA 5F7JA 2Y0CA 1NPTO 1C9JA 1OZGA 3GFRA 4YQZA 1F20A 1D3AA 2AF4C 4TYWA 4MS4A 1TM4E 4YRLA 4MV3A 1T6YA 4XR9A 3UAWA 5FORA 5JS7A 2ZUFA 4ON9A 5EPUA 3T4EA 1EFRD 4X93A 1XCJA 3K9LA 4HPJB 2FF7A 4D3XA 4Z4GA 1ZAKA 2H1VA 2H7YA 2GTHA 3BTSA 5DI3A 4FDMA 2IGTA 5JVDB 4EYEA 4ODIA 2Y1FA 5GJVC 2AZDA 4ZJUA 3B20A 2PR7A 1ULZA 3JWPA 1I33A 2G88A 2SHKA 1JQLB 4BTEA 4O59O 3W90A 4CEJA 3JQAA 1E2JA 1JFFB 1EQUA 2OCPA 1IY9A 3MEQA 4E1AA 1SB8A 4RK5A 4HBZA 2XGJA 4XX0A 2BVNA 3HXOA 2A1TS 2GPNA 3EB9A 4NBTA 4EJ0A 4EMSA 2XD4A 5JNWA 3IKVA 2C03A 4WA8A 1XX6A 2OORC 3FVWA 4HT3B 3N0VA 3HXTA 3BPSA 2X5XA 3B6ZA 2BIFA 2CLHB 3MQ2A 4NDAA 5U4QA 3VPXA 4X62B 2DFNA 1ECPA 3BE5A 3AOEA 3PWTA 5DTMA 4RSRA 5EWMA 3VJMA 3GT4A 2EZ8A 4JK3A 2Y68A 3IT0A 1PG2A 1P0CA 2BFCA 4RXMA 5EC8A 5ITZA 2A94A 3QJYA 3NS7A 1OGJA 1LX7A 2RB5A 4HNGA 3RC7A 5HOQA 4E03A 1ILEA 5KWEA 2ZRKA 3MWDA 1T6XA 3TD2A 3FOBA 3NTVA 1V6AA 2XAUA 1U2GC 1IWBB 1MEJA 3NWPA 3A7EA 3OZBA 2YCLA 3UHAA 1QVAA 1N2SA 2F9MA 2VSNA 3N05A 4G23A 4G97A 1KNQA 2OV3A 3M89A 4G9EA 4JROA 4Y1GA 1JSLA 1N6PA 1E9EA 1E0DA 2WE7A 2RH4A 3HCCA 4C0XA 2GCIA 4GD3Q 4UNRA 2P2GA 1X39A 3JTEA 3N2EA 4N6GA 5F9MA 3C5WP 3C6MA 3L1HA 4D26A 5A6VA 1TAGA 4FC6A 2QTTA 1E3WA 4U8HA 4ACBA 3BMXA 4DWOA 1R0LA 5JDCA 1QLHA 3LQRA 1ZONA 2V1XA 4YRAA 1ECCA 3ZNOA 4I5FA 1GAJA 1M5TA 2PJRA 5FOTA 3INGA 4FEAA 5LP6F 3GJ5A 3FIUA 3KQVA 3ZU4A 4ZOLB 2VQ3A 4HQRA 1EH5A 4PAOA 3UAZA 4PAQA 2C7RA 4H0FA 2IFTA 4XQ9A 5BYJA 4DIMA 5ICFA 1WUHS 5CA0F 4N1AA 4NMWA 3ML1A 3IC5A 3L0BA 3GVIA 3OZRA 2YIVX 2VYNA 3RV3A 4WZAA 3ZZTA 4D44A 1HE1C 2FPPA 4MRPA 2PZAA 4O0LA 1E2IA 1E3EA 1CUAA 1DTWA 1UXGA 2HHAA 2XUKA 2B8EA 2IOFA 4UHHA 3KSBC 4LF6B 4J6EA 3PLAE 3M6LA 3ET4A 3OZEA 1LWNA 4CFSA 3IV7A 3IB3A 3JZDA 4HOYA 1UUFA 4JP8A 4PICA 3OQJA 3BA1A 1CYEA 5LXTA 2ECPA 2HKIA 4IUYA 1IULA 2VOEA 4KFSA 4KVZA 5JPIA 1JA1A 2HY7A 4WJKB 2HQSA 4YCLA 4LY0A 4PYRA 2JIPA 4ZAZA 1TZMA 5CG1A 4CKCA 5L40A 4KRXA 3P9RA 2AW5A 2I78A 2PWPA 3V1UA 3WOVA 3R6LA 5JH7F 1QAQA 4DJTA 2G70A 1ECBA 4QRIA 1Q1EA 1JDTA 1SOVA 2X6TA 2XQFA 1F2VA 2ZJ8A 1KIAA 2Q8PA 4KQHA 3QHPA 1OXXK 4EYOA 4EYSA 3EHEA 5C8VA 3OZDA 2IUEA 5HIAA 2D6FA 4UTVA 3P0FA 4V0OA 1BNCA 2Q7XA 4QELA 4YASA 5I7EA 4CN9A 1ZK0A 2RGAA 3F5SA 1F3OA 3HKDB 3I09A 4Q4HB 3G3EA 2I7VA 1SXJC 4QATA