3GLRA

Crystal structure of human sirt3 with acetyl-lysine acecs2 peptide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
274
structure length
274
Chain Sequence
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Human SIRT3 Displaying Substrate-induced Conformational Changes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase regulator
molecule keywords NAD-dependent deacetylase sirtuin-3, mitochondrial
total genus 91
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 3glrA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3glrA01
1M2GA 2NYRA 4RMHA 3IAFA 4JUBA 2JLAA 4K9LA 4Y6QA 4K9NA 2WVHA 1U31A 4G1CA 1UPCA 1V5EA 1SZCA 1M2JA 1YHZA 4K9QA 2UZ1A 2H2HA 5K6RA 1YC2A 4V1CI 2PANA 1U2GC 4V1CB 1YI0A 1Q17A 3PKIA 1OZFA 2UZ1B 1Q1AA 2OO5C 3LQ1A 2H59A 2QQGA 1MCZA 4BV2A 4K9OA 5FEMA 1UPBA 2VJYA 4J16C 3FZNA 2EZUA 4C7BA 1JSCA 1YC5A 2VBFA 2VBIA 1XLTC 2W93A 3FLMA 4MQ5A 2JI8A 4BN4A 3CF4G 4C78A 3RIGA 1PVDA 3JWPA 1PO7A 5K6TA 1PTJC 4ZP1A 4V1CA 4K9PA 2OORC 2FWNA 4L3OA 1E3TA 5EJ7A 1U28C 3EYAA 1S5PA 5EJ5A 4I5IA 4FEEA 3D4BA 2JI7A 2BRUC 2WVGA 2VK4A 4IF6A 4JU9A 1HZZC 4IG9A 1O97D 2C31A 3D81A 2VBGA 1PT9A 1YTLA 5EJ6A 4BN5A 4RMIA 4MPPA 1J8FA 4Q9DA 2IHUA 1PI3A 5BWOA 4QPZA 5K2OA 2QQFA 1V5FA 2H4HA 4GM1A 3U31A 4TWJA 1OVMA 4J1TC 3CLUD 2NXWA 4Y6LA 1D4OA 4BVHA 2IHTA 4QQ8A 2H4JA 4TWIA 2WVAA 1YNOA 4JUFA 1N0HA 4X3PA 5D7NA 4ZZIA 1UPAA 1YBHA 3CLTD 5IMSA 5DGDA 5EJ4A 2JLCA 2H2FA 3PKJA 4GP9A 3GLTA 2Q5JA 4UUAA 4MPJA 2DJIA 4D5GA 5EJ8A 4UTVA 4JUDX 5MFPA 5FYQA 4RJKA 1DJLA 2H4FA 1PYDA 4UTRA 3RIYA 4JU8A 4UU7A 4RJJA 4GG1A 1T9CA 1T9DA 2Q5QA 1ICIA 4IAOA 4FEGA 4HDAA 4BVBA 1EFVA 1Q6ZA 4GPEA 2PGNA 2FSVC 4F56A 4F4UA 1POXA 1V5GA 1EFPA 4JUCA 2B4YA 5AHKA 5MF6A 2Q5OA 2H2IA 2FRDC 4JSRA 1MA3A 3PDHA 4HD8A 1OZHA 4JUAA 4UU8A 2Q5LA 1BFDA 4Y6OA 3ZGVA 1M2NA 1T9AA 1M2KA 3EY9A 4KXQA 1NM5C 1SZDA 2EZ8A 1YI1A 1PNOA 2Q27A 4K9MA 4KGDA 4JD5A 3E9YA 2OD2A 5EJ9A 3HWWA 3ZG6A 4UTZA 4FZ3A 4JT9A 1PNQA 2IHVA 3GLSA 4RMGA 2OD9A 4BV3A 2V3WA 1ZPDA 2OD7A 2VK8A 1Y9DA 2PGOA 5DGTA 1OZGA 4BVEA 2Q29A 3JR3A 2A1TR 2FN3A 2Q28A 4GM4A 4L2IA 4RJIA 5BWLA 3CLSD 4FVTA 5MFZA 5MGNA 2VK1A 4UTXA 4UTNA 3GLUA 1QPBA 1U2DC 3CLRD 4BVGA 4JT8A 3ZGOA 4BUZA 3GLRA 3F6BX 2JI9A 4RMJA 1M2HA 1S7GA 4X3OA 2EZ9A 5BWNA 4BVFA 3D7KA 4MPRA 3FSJX 3HWX1 1POWA 2JIBA 2X7JA 2JI6A 4R8MA 4O8ZA 2HJHA 3IAEA 3EA4A 1T9BA 3F6EX 4MZXA 5DEIA 5K3SA 2H2GA 1Q14A 2FR8C 4KPUA 1Z8NA 3OE1A 4QELA 5EJMA 4K9KA 2A1UA 1YHYA 2EZ4A 2H2DA 4UUBA 2AG1A 5EJAA 2AG0A 3K35A 4D5EA 4COKA 1O96B 2EZTA 4GM0A 3U3DA
chains in the Genus database with same CATH superfamily
3LHDA 2GLTA 4FFDA 1JPNA 4TXLA 4YX9A 1I94B 4J0QA 1VE1A 2XYVA 1JAYA 2O2YA 4CF4A 1B0AA 4DS3A 1E9RA 1SQ6A 3HS3A 1XEWY 2FUG1 4X9XA 1PJ8A 1MOSA 2Q1SA 5TT0A 2UXCB 4J16A 4WESA 2VDOB 4X0EA 1IZ8A 4AJ4A 5DIZA 1MX3A 1ZRMA 3K0BA 4Q1AA 1O94C 3AXSA 1UMBB 3OI7A 4QQKA 4D79A 4GW3A 3A6HA 4DLAA 1RCUA 2J3HA 1OASA 3EQ6A 5TX7A 2QNIA 2GN0A 3FLMA 3KEQA 1YQWA 2FRXA 2XQGA 5DM2A 1XTQA 1XQXA 2QKYA 2HSWA 3U44B 2YUIA 4PYMA 5CA1A 1D04A 3IKJA 1KE2A 5IAOA 2ZI3A 3DULA 2B99A 1BE1A 2FPPA 2GBGA 4XYMA 3VR5A 1SMKA 4X7RA 4H7HA 4CMEA 3ENVA 4C7VA 1MEOA 1DTWA 4Z86A 5BR1A 2WJ4A 2WYUA 3JZAA 3W8EA 4KR2A 3T06B 2ECPA 1JIIA 2WNHA 2ZYUX 1U3DA 3O92A 2FLKA 3OBIA 3NWOA 3N86A 4O8CA 2NADA 2MINB 4PINA 4PZUA 2V3VA 4P5EA 1FUUA 1TIBA 2NXWA 3IBFA 3O8LA 4GMFA 4M0EA 4PGGA 1DU4A 5FLYA 2H07A 1JSXA 2IVFA 1RR6A 1T9HA 1OCEA 2GHQA 3N2ZB 5MN4A 4L08A 5LQJA 1MEEA 1HTBA 2C0CA 3A1DA 5BYJA 2EQBA 2QPAA 3H1AA 3P9ZA 1JHPA 5F2EA 1K9SA 3FTDA 5CHYA 3JVUA 2WWTA 5BQPA 1B6SA 4ZT2A 2H9YA 4RWEA 1OI3A 4BN0A 4BLWA 1XMPA 4K03A 3MJDA 2GAIA 2JASA 3F78A 4NXNB 2R1ZA 4LV5B 4TZKA 2JCYA 3GNTA 3HZZA 1Z6YA 1YUBA 3NTQA 4QQFA 5AM4A 1ZWLA 3GT4A 1GZDA 3SDZA 4IHAA 5LMUB 5AWFC 3L7AA 3IBSA 4WI1A 2WUEA 1Y4SA 4PZ0A 1WCWA 1U8YA 4P86A 4WBNF 4AMYA 1KEWA 1QHXA 2BM0A 2CUZA 1UK7A 4D0NA 3EAGA 1EMDA 3WGUA 5FUBA 4TZTA 2VYVA 1QO0A 2OQIA 2HWWA 3BJEA 3HNRA 2GEFA 5M34A 3EQ8A 2O14A 2GBLA 2BM8A 1GPBA 3E53A 4YNBA 3O26A 1KH2A 2IHVA 4FFSA 4FDAA 4ML3A 2YWXA 3ZCPA 4Z3KA 2RH8A 3JQ8A 1KQPA 1Q0SA 3R3UA 4PYIA 5E7IA 3K71B 3QVKA 6GPBA 1K0FA 5DWDA 4ALJA 3CKKA 3CCFA 3LRXA 3L82B 3ZHTA 4DIEA 2M32A 1OWOA 4BUCA 1ULHA 5LC1A 1W4AA 3MS2A 2ZRKA 2X1VA 3UWDA 1V3VA 3M70A 1GT91 1WCYA 1TK3A 4JJKA 1Y9AA 2D5BA 1X2BA 4WACA 3ZJ4A 1PF7E 2L17A 3FUVA 1R4MB 2EIHA 4TTSA 4XWTA 1EVLA 1ZZGA 2G5TA 4EPVA 2PUCA 4MXDA 4R6XA 3S2EA 2CF5A 721PA 3W90A 3L7DA 4G23A 3LVFO 3TGWA 3U3KA 5CDGA 2BMFA 3AY3A 3I1FA 3SMVA 1KI7A 4L50A 1H2YA 1KO7A 1U8UA 2AG0A 2HC9A 4NZMA 4UM5A 3WQSB 1X1RA 4M7OA 3KDSE 5DULA 4XM0A 5CFQA 5CDSA 4KNVA 4XUCA 2I65A 1ZQ1A 1EGVB 3MUEA 2WWVD 3H0EA 2OFPA 4KX5A 4GYKA 4ZZ3A 4HZUB 3IRUA 4Q02A 5HW0A 1C9NA 3OIGA 1QHYA 1RYBA 9MHTA 1DQRA 4FMPA 4FOPA 3FH0A 4GZLA 3VXKA 1XJ0A 2R8BA 1TLTA 1VJ5A 4EPYA 1EHYA 1NQUA 1TF7A 2H1SA 2Z57A 3JQ7A 4KXYA 2B92A 3N5KA 4RQUA 4BUJA 1WKVA 1O4WA 2W2KA 4RLFA 5A4FS 1T1JA 1JIUA 3V34A 3NAZA 1JKXA 2IW1A 2WQ7A 2IYEA 4WRRA 3P9NA 1RLTA 3I6IA 4NENB 1TXGA 3WNQA 5DTRA 5ABPA 2PR7A 3WGLA 4Q4AB 1LBQA 3CTPA 5D6NA 1WP4A 5FWYB 1E4OA 2A58A 3PPWA 2CFRA 1MH9A 4M86A 2UXBB 1G20B 2HH9A 3OQIA 2IS2A 2QY6A 4ZO8A 4AMVA 2NO0A 5AUPB 1ZMBA 3G2MA 2Z6QA 4OSOA 4QQ8A 2HA7A 2VP2A 3EUEA 4RVOA 3LC1O 5AKHA 2WU8A 3ECCA 3JQDA 1ATIA 1Z16A 1VRWA 2QL7A 1EM8A 1CUFA 1K7XB 4JMPA 2AE1A 3AH8A 5DBOA 3ADOA 1MP0A 2JZNA 2O4UX 2XLBA 3D7MA 3BFVA 2RONA 1UM9B 5JTTA 2LBPA 3J81k 1VLHA 3HHPA 1WXDA 3UXYA 4FE7A 5BURA 1PWYE 1SR8A 2PCJA 2BHSA 1QHHA 3GQVA 2GNAA 1UBSB 2ENWA 4H9GA 4QGBA 1NBWB 2CBZA 1D7AA 3LPCA 2V7VA 4G9GA 1SWVA 5E3HA 1KH3A 3D8RA 4X20A 4UFOA 1QB7A 3OTQA 3W6ZA 2BMEA 2D2FA 1TU0A 5JC1A 3ACBA 4RKRA 5EE9A 2VQSA 1CW2B 1Z0JA 2FEMA 2J3JA 3ML1A 2ZUEA 4EW2A 2VT2A 2JVJA 2P78A 2IXEA 4WCFC 5AK0A 5AVOA 3X1DA 2P2GA 4UPEA 5JS1A 2D1TA 1I2ZA 3FSEA 1M6WA 5EKDA 4JJIA 3AB3A 3G0IA 4FGKA 2ZS8A 3IAS6 1R10A 3NLLA 4J49A 5T8KC 3KEMA 1QO9A 3J80A 4YQZA 3WGVA 3WIBA 2W6JD 4A82A 4H7IA 3LHIA 3T1HB 1EFRD 3G2QA 4TLCA 2HA3A 4IW3B 4BLOA 2ZWPA 5AKIA 1PEYA 4U2DA 4HLUA 3RIMA 1MJ5A 1DCFA 1M5TA 1I3MA 3QU2A 2CMGA 1Z3IX 5EEHA 5LZ2A 1DEAA 2YIDA 4H1HA 4OJKA 1TYAE 3A6EA 1NP7A 3P94A 3PEVA 4KLAA 1IEVA 4Q4LA 3T5TA 2IY8A 1L4LA 5E6SB 3L49A 4YP1A 3SAJA 1KEZA 1GNPA 3ZD7A 3H86A 5CAEB 3PXGA 1PDVA 4RKFA 3KTAB 3HBLA 3CRMA 1WY7A 4EJFA 4JN6B 1NW4A 2C00A 4RGQA 3QVGA 4EEZA 1CY1A 1TA9A 4QOGA 4CXMA 2VL7A 1F8YA 4LV8B 3ZV4A 2V5VA 3KSRA 4MA0A 1KH1A 1NXWA 1V43A 4KIGA 1NY5A 3PNPA 4YPOA 1O0SA 2HOQA 2ZROA 4OUKX 4RCVA 1XFDA 2WJYA 3NEYA 1UWKA 4B7ZA 1FU7A 7AT1A 1OIVA 4UJ5A 4WXHA 5DYGA 2DKFA 3ST7A 2DBRA 1KOLA 3RUPA 5HRCA 5TMBA 2O6HA 4BGDA 5ENDA 4J2HA 2VYCA 4RDHA 3U09A 1GRQA 1O4VA 2VUUA 4AN1A 1Z2EA 3DE1X 1VKNA 4MKXA 3BMQB 4DM4A 2O0LA 2OM6A 1X14A 1S1CA 1W5AA 3CLTC 2BZGA 2VWQA 3SN6A 4TVOA 5EKUA 1G3RA 4Q4DA 4GMDA 1NXPA 4OIFA 2JLUA 2PQ0A 5FTWA 4F3TA 1BH6A 3KJHA 1B7GO 2ZK7A 4S2EA 4Q9HA 3BCUA 4HGOA 4JJZA 2QQFA 2PFGA 5FNVA 4Y2HA 5IK2A 5KCZA 2OC4A 3IQFA 1I9CA 3EPPA 5HCUA 4XJTA 2B25A 3I62A 3F2IA 2P4EA 3QEJA 3M4XA 4R7ZA 1E64A 1GRRA 2BGJA 2H4JA 5E7QA 2YTZA 3QW2A 2XDAA 5KTKA 1Z75A 2XRFA 13PKA 3VNQA 4YV0A 1MQ8B 3NC1C 1ZBQA 1Z7BA 3Q4GA 2G1KA 3IUEA 3HPRA 1OY1A 2YWEA 2CNWD 3BSYA 4KQMA 3DPIA 1GKUB 1IQ0A 4LRUA 2Q41A 4MKZA 1GGNA 2ZRHA 4LE2A 5E38A 2HUPA 3DZ8A 4AFNA 4B84A 3S2UA 1ZK2A 2YY7A 4RJJA 3Q98A 5AP9A 5K09A 1DX4A 5ESRA 5IHXA 4P33A 4TXNA 1Q6ZA 2BKXA 3ZGLA 3C7KA 3FB1A 1ZD5A 2ZR9A 4H2DA 4IMJB 3P4XA 4AG3A 2GRUA 5EIFA 2BDUA 4JSRA 5K8LA 2Q3BA 1R15A 5CVUA 1TZ2A 2I2WA 5FA8A 3TXYA 2B1IA 3OQVA 4FIZA 4YXWA 3AUAA 4URXR 4QJBA 2DERA 1S9HA 2P40A 4KJZA 4BMZA 5J43A 2W8ZA 1WDLA 2R97A 3U26A 4E5VA 2A9JA 4EGCB 2ID8A 1U3WA 1CUSA 3G2PA 4LJKA 2YV1A 1EK2A 2AVNA 3LY8A 3DR3A 5T4EA 2PUBA 5JU6A 3LSTA 4RZ2A 1OJLA 2M6LA 2EF1A 3EC1A 2PSFA 4WZAA 3VAAA 4R68A 1FW6A 1UXJA 4Y0NA 3TLCA 3PPXA 1YIOA 1OXTA 4PICA 3BUSA 3I52A 5T4FA 4IIEA 1XAGA 2C2WA 3TTTA 3L7LA 1Q1ZA 2BJWA 2ZJAA 1QC5A 2GM5A 3E9QA 1BCSB 1O6GA 3RHSA 5EIEA 4EVSA 2I6FA 3EGDB 2AUMA 4HDNA 1CUWA 2HZ7A 3AIKA 2NAFA 4AJNA 1Q1NA 1CF9A 3KD3A 1JW9B 4IHKA 3RGWS 3DEIA 3GUCA 2ZBUA 4LJYA 3FFTA 1Y6GA 1SHJA 5K0LA 3RSZA 2DLDA 2IDZA 4HNVA 1GQFA 4E31A 3SIXA 4F8YA 5CCBA 1EBUA 4DDUA 3L06A 2W42A 4INOA 1JKFA 3RRFA 1ZVJA 1CVLA 4IKEA 2QUIA 3CY6A 5JRDS 2J4FA 1C3EA 1E6EA 1OMOA 1Q7TA 4OQDA 3OA0A 3U7QA 3VPDA 2OAEA 3TR5A 3ZWAA 4PZAA 1N6HA 5K3FB 4LZJA 1CE8B 1EP9A 3QENA 4B1FA 2DQ4A 4B3FX 4I4NA 4D3FA 5A03A 1Z0UA 5LD2B 4YAFA 3E4CA 2RB5A 4RLHA 3JQCA 3KR9A 3WLTA 2JL1A 3AI2A 1QHHB 2WTBA 1KFEB 3QMMA 2WQZA 3MPOA 1XJ5A 1XXLA 1F2VA 1K89A 1L7XA 2JW5A 2IZZA 4G0PA 3REQA 2P7HA 2ZOSA 2FVXA 4KYUA 4DABA 5E2IA 3WA6A 1M8JA 3B52X 3WBJA 4CR7A 3BS4A 1X6VA 1R9GA 3E27A 2H3HA 2WC1A 4YWJA 2C4UA 2J59A 5KMGB 1T5SA 5ALLA 2CMDA 2H1OA 4PZYA 3KOWA 1DO8A 1RWWA 3WLQA 1FLDA 4XGQA 3ZHRA 4P32A 2IXAA 3AZPA 4GGOA 3T3DA 3GPBA 2XQVA 2B4AA 3NOQA 3PWSA 1E8MA 1BDBA 1WXQA 1XDUA 2XEXA 2WUDA 3ETHA 2A9VA 3EVZA 4L9SA 3TUJC 4EGAA 5I9IA 3GPIA 4KHZA 4NWIA 4JI0B 1O9BA 2CFSA 3Q6MA 3TX2A 1OX6A 1Z25A 2YOHA 5I7RA 3OKAA 2YNMA 3A36A 3INYA 1NI5A 3VV3A 5AKEA 1O1YA 2F3UA 3PUZA 4G84A 5JXJA 1ODFA 5A5VA 2PKYX 2VH5R 5HKLA 1TVKA 2EWVA 3NI2A 3P2OA 2G9RA 1NRJB 2YFKA 4RD2A 1U28A 4LE1A 4UFPA 1E5QA 2XTAA 1QLWA 2P5UA 4UHJA 3K6SA 1UK6A 2K2QB 5GOTA 5EWLB 3RV3A 3V8MA 4J1SA 4C1BA 4TT3A 4RJKA 4AKEA 2OHFA 5ILOA 2Y67A 1H9CA 3OWOA 4PLZA 4D8TA 1L4EA 5JBNA 3KJNA 1ZGJA 4ZVNA 2OVFA 2P9YA 5JWRA 1XWFA 1ZOSA 3ZQJA 1G55A 3L7MA 2I3BA 4WINA 4N8DA 4CFSA 4JLAA 3HCAA 4RNCA 3V4ZA 5A04A 1Z5ZA 3C97A 3IHWA 1PWXA 4CNQA 4R2JA 4TS4A 3TNLA 4DIDA 1LBHA 3ND9A 5JQGA 1T2UA 3LTNC 1ZITA 5FHRA 4CF3A 4DMRA 3I3SR 3PHBE 1U4OA 3ETGA 4GXNA 4LZPA 1B0PA 1YB1A 4II3A 5FJJA 1RHJA 3SC3A 1M0WA 1QP4A 1ZHFA 2P2ZA 2RGNA 3EW7A 1ADBA 3B3AA 1Y8CA 2OQVA 5A3JA 1US8B 2CUKA 1RIFA 3NTOA 2PRKA 3GLGA 1ZPDA 1R0WA 1WZIA 3R5FA 4IH1A 1BO6A 4IJUA 2PBLA 1CEQA 2JGAA 2O4CA 2Y76A 5LNK1 2XE4A 1ZM4A 5ENZA 1UR5A 1MT3A 2RHRA 3EXG1 1P7CA 1KFKB 2QX8A 3K2EA 3AZQA 3CE6A 1ZH6A 2X0RA 4LSGA 1VA5A 4C9BA 2ZSIA 4NI5A 2JI6A 2ZJ7A 1XYGA 4LSWA 5IJAA 3MJTA 1P29A 1X39A 3EF0A 3A3YA 3ORRA 5I7AA 3S8MA 4AUMA 2O3QA 5KOHB 3GN2A 2AF3C 2XXBA 3DMFA 4L3WA 5EJMA 1L8QA 1NJ2A 4PYJA 3ZVKA 3PKZA 3CZRA 1OLSA 4TVBA 4BBPA 3VR5D 5E2AA 2UUBB 3TECE 2FFAA 4OTZA 2WU4A 4WXEA 3ZJ5A 3KFLA 1CU1A 1DC7A 3CH6A 1Z5VA 1OFGA 4I4TA 4AECA 2Q4RA 1AGPA 5JZMA 1UXGA 2D2IA 4CLOA 4FYKA 1IC6A 2BP7A 1O3YA 3AR8A 4A26A 3HBJA 4CTKA 1B42A 1ZI9A 4QQRA 1Z73A 4G36A 3DP7A 3E3MA 2RG1A 5HF9A 4RAQA 1SKQA 3FRIA 2JAXA 2QWXA 3FVRA 3FZNA 3Q7TA 3VPAA 1KWKA 4PR3A 1KMHB 3GT3A 4P81A 3RVRA 1SKUA 4W5NA 3HA2A 1Z6QA 1NLUA 3NH9A 4H59A 5KX5F 5JZBA 3RJ9A 1X1SA 1OUMA 4YR7A 4B3GA 3VM6A 1I32A 1DG1G 4X71A 3UV6A 4MYDA 1O95A 2A9QA 2VK4A 4L0CA 4R0NA 4U7DA 2GK6A 3L84A 4C6RA 4S35A 5FUXA 3D8HA 5DGIA 4UOEA 3NBAA 2GCOB 5AOVA 3T3OA 3WXMA 1PL0A 3FYHA 2Q2NA 3B1ZA 3O8BA 3L3BA 3PC7A 4UD2A 5EJ2A 1CYEA 3TIXB 4HV4A 1SOAA 1JBQA 5TGZA 1CUYA 4Y1GA 1PR4A 1GGMA 2A5JA 3B7PA 3AWDA 1YRYE 1DB3A 2GD0A 3NJ4A 1FS5A 1HA3A 4IJWA 2IYRA 4MWBA 3Q3VA 4IP0A 2W6QA 4TYWA 2WM9B 4TYNA 3OMLA 3KQWA 1PS0A 3KOOA 1T9ZA 2CJWB 2EG9A 3AL3A 1UXKA 4HMPA 4DDTA 4RTOA 1UAAA 2G9NA 3W6NA 1DAFA 2BMWA 1K3UB 2YUTA 2Q5JA 4KQWA 3WZLA 2Q5CA 4MUYA 1EX7A 1RJ9A 4B3BA 1LH0A 2XCIA 3ESBA 1DLJA 1M34A 1EE2A 1PL7A 4C5BA 1PYDA 1FFXB 4KR7A 1H05A 1NMEA 3K0AB 2WJAA 4LYDA 4AJEA 5F1PA 5AKJA 3A4YA 3QBEA 2ZWOA 4MINA 2QTMA 2Y8EA 5M04A 2FSVC 4IICA 4LWOA 1CR4A 3LYUA 3V32A 3WYCA 4M9QA 2CHUA 1QIKA 3C6YA 4H7DA 2NSDA 4TRJA 2FZGA 3VSAA 1QUEA 3MD0A 3VR1A 1TQ8A 4G81A 1EXMA 4FHGA 1WPGA 1KEUA 4CLXA 5TIIA 1TLFA 1AQJA 1ULSA 4P3OA 5LWHA 2ZPAA 4LF6B 4PYQA 2CXTA 3LD9A 4XARA 3EHEA 1RKQA 1LY1A 2BFDA 1BGWA 3HWWA 4KUHA 4LXHA 2J7KA 4FZ3A 1ZMRA 5E9WA 4KODA 4DNPA 3P0JA 2OD7A 4ND1A 4ZREA 3DEZA 3RFFA 1UAYA 2XKBA 4JHLA 2P3LA 3OKFA 4UTNA 3G0GA 4YMLA 1B23P 3X1MA 5D51S 3CLRD 1ND6A 4UAJA 3ETLA 5L4NA 1VBKA 3PSAA 2AIRA 4LGMA 4F8EA 3MYRA 2G09A 3U3ZA 1YKSA 3QKRA 5JSUA 5BWNA 3DLBA 3R9IA 4ARCA 4RY0A 2EEPA 1TPYA 4EKGA 1F6WA 3F98A 2FU5C 4AJIA 3IJ5A 3W3AD 4AULA 3OP1A 4GRIA 1J9EA 1JJVA 1V35A 2R4TA 2XUOA 5DXJA 2XITA 5G0SA 1AS0A 1J2RA 1YB4A 4ZT4A 4UXHA 4DR1B 1XTKA 3FUUA 2IVZA 3OLZA 5BN5A 3K35A 4HFMA 5DX0A 4WLEA 5IF9A 1AN0A 3JTEA 4YONB 1WCIA 5DP1A 3C5HA 2KSQA 3QOXA 4DLKA 3G5LA 3VYVA 2PCLA 2V1UA 4FDMA 1J20A 3CIFA 2EL9A 1DBSA 3CUEF 4H7PA 1ZVKA 4TQGA 1XQYA 4IDNA 1IM8A 2OOKA 2RGEA 2YHIA 2OO5C 3E0XA 1GEEA 4GLBA 4PPYA 3K0EA 3LFTA 3B1KA 1YQUA 1SC4A 3FHJA 3O31A 4L74A 3UUGA 1E1QA 3RRNA 3ZHSA 3U44A 1P0IA 3N2YA 1DJNA 3G2KA 3P8ZA 4D9FA 1M6YA 1VKHA 1TO2E 4IQ4A 3PITA 3C3KA 2F59A 1C9JA 1E8NA 4WN9A 3WKDA 3E9CA 4Q39A 3FHCB 2IXGA 4RADA 3T5CA 1PX0A 3S1AA 4YQEA 2B1JA 2HCRA 2XMCA 4MARA 4XH9B 4B3HA 1B00A 2HXGA 3QI7A 1H4TA 4GT1A 1VHLA 3UJ6A 5AVZA 3I42A 5SZHB 5F1KA 4OL0A 4C2UA 2NTYC 4Y7DA 5IXYA 4U5XA 1NBAA 4B3SB 5C7IO 3TKYA 5HIAA 1LI4A 2KYRA 1RM4A 3KLOA 3SQLA 2Q4DA 4KPEC 3W8FA 4DGQA 1GKKA 3QSYA 1NUTA 3TZLA 4X62B 3ZZ0A 1GDTA 1HDCA 5LOVB 3DWFA 1GCIA 3IB3A 1D8AA 4BFVA 4D98A 3MWYW 5FUWA 3IE2A 3CBGA 3CKMA 3K8OE 1PZGA 1XVUA 4OFWA 2RAPA 4X45A 3DQQA 1HE4A 4YQYA 3U7GA 2BOVA 2E21A 2JC3A 1ACMA 3ADPA 3ZD9A 2FWMX 1W36B 1G8HA 1O57A 1B2LA 1SB9A 1L3BA 5MFPA 3DFZA 1L0BA 1VXRA 5AI6A 4CTJA 1EGAA 1GCUA 3PYLA 1JMVA 2FDXA 5EY5B 4QPDA 5DBIA 2GASA 5T8KA 4XDHA 2WJ3A 1KZHA 4EJSB 3ADCA 1O08A 1HTWA 1PR6A 4RU1A 4AL4A 1RLJA 2H18A 2F1RA 2I7TA 1PJCA 3EGXA 5JSHA 4PRZA 2NPOA 1XRRA 1JF8A 3ZBPA 1T4DA 3OM8A 4ZDJA 4A0QA 4A0SA 2VPTA 2R1VB 1JDJA 5AM2A 5ITZB 4BU1A 3OX1A 5H9VA 3MTQA 2O0MA 1X7WA 4NFLA 4IHQA 3OA2A 3EWIA 1YR9A 4EUKA 5CYOA 3AQIA 3GUYA 3I2HA 1TCBA 3M4ZA 1B43A 1Y98A 4KZKA 5IJ0A 1RP1A 3K31A 3RM3A 4FI3F 2WHYA 4ZVLA 2CXSA 1UDAA 5MFZA 3GDFA 2P2CA 2PU7A 3TBFA 2FFRA 3ZD8A 3COWA 3ZDYB 3ZWNA 2GPTA 4CG2A 4B7AA 5F4ZA 5BV0A 4I9NA 4U7JA 3N0WA 2YHBA 1CEXA 3HMKA 4H08A 3OFKA 3ZCSA 4YUZA 1X1CA 3U80A 1IBMB 1W0KA 2H6EA 2YOGA 2IOHA 3L93A 3PFHA 2X2PA 4UNPA 3WQQA 4MQBA 4UNRA 1KO1A 5AOCA 3ZVMA 4KKVA 3UH0A 3HJCA 4R2KA 1A9QA 3SCZA 5B12A 1YOVB 2J6HA 1V0JA 3FE2A 4YYZA 2PX8A 2OMEA 5AW6A 4BNMA 3OOEA 1JN0A 4XX0B 1N2OA 3S70A 4XVRA 5IVHA 5JJLA 3TCXB 1O96B 2BEWB 2PWBA 3DHYA 3GRKA 4LJAA 1I4LD 1V4NA 2GBIA 3GPCA 4YDRA 2YXDA 1XMSA 4V0SA 4M37A 1RWPA 1UPCA 3PX3A 4UVEA 3ZU4A 3GNQA 3D43A 1VPTA 5K6RA 3RUCA 4Q3KA 3R7SA 3WL8A 2C78A 2WFZA 3C0KA 1VGRA 3AL0C 1N32B 2AL7A 4U7PB 3S81A 2AMLA 3ES9A 2QQGA 1ISFA 1FFXA 1ZKMA 3BGIA 3H19A 1NJ6A 3DBRB 4GQAA 4N0MA 4EY6A 2HPHA 2ZM6B 3K4PA 1TIKA 4C78A 2YFHA 4TN5A 4X7BA 4EHKA 5BR8B 2VXBA 4BQEA 4YALA 3RRYA 2JBAB 4D8YA 1HM5A 3MWDA 1JHZA 2B9EA 4IDEA 4W1QA 1B76A 2KE5A 4IZ6A 4XWGA 5DM4A 1UJ4A 2AR0A 4TN1A 3UA3A 2V6JA 4WDRA 2Y6VA 1E2QA 3BWEA 4H0NA 4JB3A 5CLGA 4M9UA 3H2ZA 4GVLA 4D4LA 2HU7A 2ZBFA 3KB6A 1AKQA 2MCFA 4BMXA 2B1QA 5IM5A 3B7GA 4RM3A 2QRVA 5FV7A 5DHAA 4Q9DA 2J9ZB 3MRXA 4IM7A 5ED0A 2A6PA 3EGOA 3PGLA 3DR5A 5J2TF 4E30A 1QQAA 1XMOB 1X0XA 4OHYA 3IOCA 4JLDA 5IJZA 1T15A 3DEAA 4J2TA 4UEOA 1C0EA 1F0YA 1MB4A 1ZUHA 1T5LA 2XMZA 3AI7A 3FOBA 4WY2A 1JDVA 1RE0A 3U4GA 3X1WA 4IXDA 1L5VA 2VWHA 4TWIA 1RACA 1JLMA 1VHQA 3GBSA 5A71A 1H69A 1KS2A 1N0HA 1Z08A 4W1SA 3ZGYA 2QZJA 2INGX 3L8MA 1QRDA 3QU5A 3WKAA 3NOOA 4N3GA 4Y9RA 3A31A 3ZNPA 1YMQA 3MGGA 3ZCQA 1CQZA 3T7TA 4PC7A 4BV9A 4JENA 1AK2A 1AZTA 4YRLA 2MJLA 3EG5A 1K3FA 1KSJA 1OX4A 1H8ED 3IB6A 2JH9A 4D26A 1RWOA 3KL4A 2RGGA 4E3ZA 1IWOA 3S2YA 3UW3A 5AW7A 1B8UA 3ESCA 1UM8A 3LO5A 4EEXA 2X22A 1MAAA 4QYWA 4BL5A 3PXDA 2NW6A 2QX4A 3TLZA 3QXGA 1H5NA 1T6BY 3ITNA 5D3MB 3ZWOA 4N5LA 4BO0A 4DV1B 1EDOA 1II0A 3KVYA 1DWUA 4K6OA 1GNTA 3SSMA 3C15C 2WYOA 3F2VA 1E60A 2P75A 3ACDA 4G65A 4IMPA 4FGSA 4B3IA 4C3OB 4F1WA 3SVTA 1CRPA 4DYVA 1DEOA 3GAAA 3LC7O 4S1NA 4GD3Q 1U2RA 2ZJ0A 2HMUA 2V65A 2BFCB 1EJ6A 5C34B 2BFEA 1WHTB 3FWYA 3U7QB 1NHWA 2DZDA 2ISCA 3SD7A 2UVPA 1P4HA 3IBCA 3RODA 3ETNA 2VPYA 3BFPA 4KDRA 1W94A 5BVGA 4G4SO 3THWB 5LMCA 1Z34A 3LUFA 5BVHB 3AXTA 1ULBA 5CCXA 1FXWA 3KM0A 4Q7KA 3LP6A 3X0DA 2EOAA 2Q7DA 2V7WA 1JNYA 2IF0A 1NMZA 2JGLA 4B46A 4Z4FA 4HQOA 4EIWA 1E61A 5E2BA 3O1HB 2UYHA 5L3SB 2CMFA 3ET5A 1FDIA 4AURA 2MWMA 4UDNA 4EBBA 4RMHA 3L7IA 4D6PA 4P22A 1Q7BA 4CODB 3O93A 3I53A 3BCSA 2WF9A 3MFYA 3H1EA 5HJ7A 2IF2A 1KU0A 1R0BA 4Z3DA 3U5ZB 5C4IA 2R68A 1G63A 3ELWA 5THXA 4WJZA 4I1PA 1JEOA 2DRIA 3SQWA 1XDZA 3RK0A 1N2CE 1O9HA 1MO5A 1TMYA 1UP6A 1ZOOA 3R40A 2DECA 1CYDA 2DPYA 2L82A 4W6ZA 1AH2A 4FHEA 3BTOA 5FO1A 1SXGA 3K9BA 2Y1KA 1E4YA 4DLLA 4ERNA 1YQDA 3JAKB 4DN6A 1AUOA 1BRMA 4BQIA 1YR3A 3Q88A 5KU1A 4JU9A 5KJCA 3GLFB 1HZZC 3KZXA 1YQTA 3G0BA 5K7SA 1L5YA 4LK3A 1WDWB 4B76A 3MCWA 3VH1A 1EHIA 1COWD 3NHAA 4UHHA 1Y3BE 2X3YA 3Q0EA 1SFRA 3EJ6A 1VE5A 3HRKA 1WBDA 3H5TA 2JFNA 1P1FA 5BOVA 1B73A 3WAKA 5DNCA 2CDBA 4YI5A 4RJTA 1F2DA 4OQFA 4HYEA 4L4RA 3E3LA 4AMBA 4LQCA 4RFVA 4BMNA 5IVPA 1FP4A 1X94A 3E8SA 1MEJA 2BBSA 1HE1C 5IXJA 1KRWA 1YKFA 2CVFA 3CURA 5EFZA 2CJYA 1TZCA 2NO5A 3C4JA 3AJAA 4ABYA 3WLAA 3O4FA 1T10A 4EZEA 4GKVA 1U7HA 3QE9Y 1M6NA 2XTNA 3RUIA 3WSWA 1IZZA 1DV1A 1NT2A 2I8CA 3Q5DA 4ZGGA 2K2WA 1XLTA 2I67A 1R5JA 4QDOA 3I2GA 2OB2A 3IVMA 5FWXA 2XNCA 4LJ8A 1U0NA 3AFNA 1S2NA 2JCGA 3E9EA 3IUQA 5EPOA 3UJ8A 2QRKA 5A6SA 3VYRB 4JYAB 4CEJB 4P3YA 5EUBA 3SSAA 5KDLA 1PD1A 3ED5A 2XWJI 3IKVA 3C3CA 4PAWA 4KN9S 2ZAYA 2QPOA 4FJ0A 4OPMA 1ZG3A 2Z8XA 1F5NA 4EK9A 2JAPA 2X6RA 4X1YA 1L4HA 1YZYA 2JDID 3M0EA 3WGQA 4Z7QB 4Y2PA 4HYQA 4KXUA 4LXYA 1OZGA 3BKWA 4ZMSA 2VR1A 1DQNA 2NXJA 1CUBA 3OEHD 1ISJA 3EGDA 4HDNB 4JGIA 4ER7A 3LCMA 5EERA 1M7HA 1E92A 3QBJA 4TTQA 3ZE7A 3JZMA 2GYVA 3IEUA 4KNWA 1E9VA 2GF0A 4Q1EA 3B1YA 2ZAOA 5I01A 3LQYA 1A2BA 3HXPA 3PXEA 5AHXA 4R9RA 2PY6A 3A4LA 3QWBA 3QVOA 4GWKA 3UQYS 1Q0QA 1H0HA 3IKMB 3ONEA 5KJ1A 1T13A 5FEUA 4C0XA 2GVZC 2XZTA 1H8HA 2X42A 5D85A 1B93A 4FT2A 5ECDA 2OUKA 3DDUA 3DCNA 4N3BA 5EN4A 2ZVPX 4WKPA 4P92A 3UJPA 3I01M 2IBSA 4XFKA 2NV0A 2PAAA 4GI1A 4NBSA 3RVSA 4EUFA 4RVNA 1NT4A 3HI6A 4MUHA 3UMMA 3W3AH 4IG4A 1B8VA 2J9FB 4XB2A 2NU7A 4BWYA 3KQUA 3HFRA 3LRPA 4FGWA 4GZ6A 2CKMA 2HBZA 3U7FB 1GADO 1E1MA 1KO4A 1DBQA 3U4QA 1I4EB 2V9CA 4KH1A 4EHNA 3KXLA 1G8GA 2R4QA 2I4TA 5JCOC 4FBMA 5JXWA 2ZU6A 4TQUS 4B82A 3SOZA 1I2MA 2PX2A 1XPJA 1YZHA 4IQ0A 2I54A 1XCOA 3BREA 4DT1A 5L51A 2SHKA 1J8DA 4NHEA 5AXAA 3SHFA 1I0ZA 4ZEMA 4F86A 1BVYF 5BNWA 1J8YF 1MOQA 1Z83A 5KCMA 3U1VA 2V1XA 1X70A 2BI8A 2FTKE 2WAYA 1U0JA 3A9SA 3FDFA 2QD5A 2JFUA 4HB3A 5I9LA 4ZXFA 3E6AA 1KOFA 1Q44A 3TQFA 3W5HA 2H17A 5EIWA 4URUR 3AVOA 4H3SA 1QBGA 3BXHA 4U2CA 1D03A 4D6YA 3CLKA 4J75A 3OZAA 4ZU1X 1GNQA 4OQZA 1AHPA 4ABTA 1PFKA 5DHPA 3H2YA 4F5EA 1EEHA 3N87A 2GSWA 1UJ5A 4Q9IA 1R9MA 2CMHA 2Y1GA 2IL1A 3LY7A 2ZRAA 3AK4A 3F9IA 4GR9A 4ZO9A 5EJFA 2MSLA 3ZI0A 4V03A 5THQA 1XRLA 1IFXA 4M88A 4QJ3A 4YP0A 1C3OB 4WZBB 3DF7A 1GRVA 4KTVE 1P1CA 4XX1A 4KN8A 2Q50A 3ESZA 4TL7A 3RLIA 5EIBD 2RD2A 2I7DA 4LZWA 3PDCA 2PJRA 3GLTA 4TMTA 3STTA 4BPRA 1BKYA 4YAIA 2AC4A 1FU4A 4OMCA 5KZMB 1OFHA 2EAUA 5K0GA 4U9IS 3AC0A 3DE7X 8OHMA 2AZXA 1KZ9A 2V7BA 4QYIB 5C3UA 3EN0A 2FPKA 2O1WA 3MT7A 3WAJA 5LL6P 1ZUD1 2WSBA 5ALIA 4HAOA 4WBSA 1FXWF 1N1EA 1RFGE 2DPHA 5CK4A 4BV8A 4JY7A 1P3JA 4R84A 5IKEA 1HDRA 1XMXA 4BHTA 2XUDA 1T4BA 4FNAA 4RPGA 2RKWA 1MVNA 2H63A 3DOIA 1MIOB 1LS1A 1BW9B 1RYFA 1CQXA 3I4FA 2EZ8A 3S7TA 4X5OA 1VIVA 5KKAA 1IZYA 1DKPA 1AA9A 2QL6A 4DBLC 3D8BA 4A6PA 2VJCA 2IYNA 3PG5A 4PZPA 1ZVMA 4XCVA 2BV3A 1RXCA 4PN7A 4DM3A 2UZAA 1JV2B 3BMXA 4CIYA 4KUEA 5AVWA 1KETA 3IMEA 4JQOA 3P9YA 3CLHA 5CG1A 5LDDC 3VPBA 5IYZA 4BUZA 1V9SA 3UXMA 1Q11A 2WPNA 1ZVQA 3MHPA 1Y3FE 3NM6B 3RUAA 1JHUA 2ECKA 3ZZMA 4C6HA 2H1VA 3U1BA 3QG5A 4RD3A 2QTBA 1OLSB 5KQSA 2Z3WA 3EX7C 5LUAA 1DHRA 3V97A 3IQZA 1EINA 3Q15C 5DGCA 1P9RA 1QZTA 3EXEA 4CYMA 4E21A 1DJMA 2X5NA 3O8OB 2NVUA 3N7TA 2FQWA 2P2YA 1OIWA 2BZ1A 1W52X 1VL6A 2UUOA 3NQ41 3VJMA 4DTCA 3ELBA 4YRDA 3UUEA 4AYWA 3E7DA 1O9GA 1ECJA 3D5QA 1R0KA 2YWBA 1XB2A 2WG1A 3SVZA 3EDYA 1QV9A 2A88A 3MSCA 1N3YA 4RANA 2C1ZA 2PUWA 4IILA 4MLPA 3T5MA 4D44A 4JT2A 3OF5A 4IDHA 2JFWA 3OJEA 3PXXA 3RWBA 3DDHA 5C52B 3ICPA 1O6BA 2FDRA 3GWGA 1SC6A 4REMA 3LRTA 3M6UA 3U3OA 2ZETA 4CQMD 4CMKA 4X64B 3PZRA 1BXKA 1OLUA 1SUCA 1WVIA 4RO0A 4ZZ1A 1S89A 5JYEA 5CRIA 1PNRA 5ICFA 2HIAA 3N2EA 1Q57A 3AKCA 5DV9A 5LZ5A 4BO5A 3EIOA 4HDKB 1G42A 3KU1A 3SLKA 4AMGA 2EX4A 2A5LA 3V4VB 1E3TA 1PG0A 1QO7A 5KYWA 4LHVA 3ORFA 4L4SA 4V3CA 5DTEA 3JR7A 4OFBA 3RC7A 5B57C 3E8MA 1I14A 5FI1B 3GG2A 1I6LA 2O2GA 5EE1A 5THKA 1SXJC 3W6OA 3D4OA 4ME6A 3ETDA 3R4VA 3A1NA 3EPRA 4QC2A 2EVWX 4F3KA 2X6QA 5IANA 1KAGA 2XMGA 1UJMA 4PTLA 5EMNA 3YASA 3V8VA 1WXGA 2QN9A 3I8SA 3BGSA 4OH7A 3EZXA 2AYZA 4LEIA 3H2BA 2QQEA 4TLAA 3Q11A 4MOWA 1NW7A 3BA1A 2BJHA 1YBHA 1YVEI 3PD1A 4Z4HA 4WY5A 2ZS7A 1R12A 1MDFA 1X87A 1Q21A 2G1AA 3D1JA 3FNFA 3H4IA 3JZDA 3P9RA 5CEFA 1MO6A 1VIMA 2HA5A 2QGFA 3DWEX 3V4LA 4QVIA 1DFHA 1U7OA 2W6OA 5FT9A 2AMFA 4J7AA 3LDAA 3SK0A 2WTXA 1KJYA 4X54A 4PX2A 5BRNA 2HMYB 3N3BC 1EWVA 4YFYA 5C37A 1ZAYA 1LVHA 3IVGA 2O5EA 3GJ0A 2J3IA 2QIPA 1SKYB 1T9GS 2HDNB 2I78A 2WJJA 2XDQA 4Y1EA 5U1PA 3KAQA 4ZU3A 1OAOA 3SC6A 2II6A 1DBPA 2QTHA 2PV7A 2C7RA 4DV6B 2B9VA 3GV0A 4LQ4A 2J5RA 5AJZA 4F38A 2IX9A 4X6UA 4B75A 3I1JA 4TQ9A 2Q27A 5DX1A 3SU8A 2AH5A 3N0TA 3SFZA 3TMKA 1VLVA 4K3VA 2C2XA 3RIXA 1L6IA 2IYAA 1E3EA 2K5UA 5KWSA 1DXHA 1Q74A 3CEPB 4QDTA 3R7LA 4AU1A 2KI5A 5LPNA 1BAPA 1N7JA 1W19A 3AGPA 3PICA 3HN6A 1ZUNA 4PSVA 5E6RA 3WBFA 1J49A 3VPFA 5ICEA 1YK0A 2HSGA 3TZBA 1DX6A 4BJ6A 2O3RA 1J1IA 2JANA 1FTNA 1KMIY 1U8TA 3B70A 3F5QA 1YU6A 3O2SB 2VXCA 3PX2A 3O91A 2VTBA 4EG6A 1EGHA 2EF0A 2VK2A 1NR7A 4HDQB 4INJA 4Q6BA 2GM3A 4TKMA 3W6UA 1XFAA 1XUOA 1Z39A 3NTUA 4D97A 4O4HB 1OXXK 3O8NA 3DMNA 2KS6A 3WZ2A 1OFTA 4OUDA 4D81A 4E03A 1X8JA 4KGXA 4BO2A 3WDMA 1N9KA 5HILA 4E5SA 2ADFA 4CM9A 1ZJYA 1G16A 4MVYA 3ZS8A 1ZX1A 3RVKA 2P6MA 3K9HA 4ZHQB 2JEYA 3KOUA 4ISCA 4XAQA 4B6RA 2RJOA 5FWDA 3EA0A 2IYSA 4ZOBA 1E1YA 4IS2A 3JCZA 1QQ7A 4IX1A 4LZZA 4H4CA 1SIOA 3A6KA 2WB2A 3TIIA 1JS1X 3M4YA 4FCWA 1U8XX 1AURA 1C81A 5BYKA 2WPDA 3R3VA 2Y9PB 1U04A 5LYYA 3FWNA 3N6RA 3I39X 1JDTA 1Q3KA 5AJHA 2X40A 3EXHB 3STVA 3ZN2A 1GPMA 1P62B 1V47A 2KPOA 5ETJA 3TW4A 4DCOA 5EMLA 3ZHBA 4ENRA 3SJAA 2NTJA 4ZGBA 2IPLA 4MRAA 4NYIQ 1YQ9A 1ZH2A 2XF2A 1MHTA 2NQ8A 3L5KA 2ASVA 3DBVO 3WE7A 3TFWA 3WRYC 1OZ0A 3KTOA 2I4IA 1FJ2A 1CUDA 3KYBA 4MQUA 2GYWA 4BN5A 5BSGA 4JYZA 1DG3A 1RRFA 1VI6A 2ECFA 4XWAA 3FPHA 1WNTA 5DSZA 3ME5A 2VDPB 1QGED 3MJRA 3MXOA 2VCYA 4MA4A 4PCUA 3K70D 3DXXA 4P3NA 5AM5A 1OC4A 1DEXA 1T6YA 1WAMA 2AFHE 4ZHQF 3EDOA 1GDDA 1PTJA 2TMKA 4E5PA 5L4LA 3QYPA 4BVHA 3Q1KA 1UDBA 4MYCA 2QN3A 1MRSA 4NQRA 2ODWA 3IULA 4HLQB 4NZYA 4EFLA 2FN4A 4A2QA 1N77A 1J0DA 1DBWA 2FWBA 3Q3GE 4WECA 3MSXA 1EQAA 1FSSA 1SQGA 4X61A 5TEVA 4ZIRB 3G5UA 5LA6B 2DTDA 4Z7NB 2VJAA 5ELLA 2J3DA 1K66A 4I55B 3OZWA 2HL6A 1AUVA 2C58A 4M0UA 4N18A 4EENA 3NIWA 3OX2A 4KRYA 5FPHA 4JMLA 4EUHA 1JYFA 1R18A 2W11A 3F97A 4LHSA 1UZMA 5KSZA 4JLKA 4YUWA 5KNDA 5C31A 3WQRA 5HE9A 4YHBA 4A3SA 4EHJA 4NG5A 1TYBE 1YZQA 3AFOA 4L5JA 4HX2A 1X8LA 3LGXA 3HO1A 3RG2A 1M2NA 1ZUNB 2PL1A 4DIFA 1I7QB 1K4KA 1U11A 2XQKA 2R8RA 3I3OA 3Q8MA 1RQLA 3K5IA 2QG6A 3PPYA 1AZWA 2DWCA 3GLSA 4MDYA 1J2EA 2CJXA 1J0EA 3JAKA 3BWMA 5C8DA 3N53A 3QE2A 2YN4A 3PNMA 4HPJB 1ZMXA 3WGJA 2VJMB 4FKZA 5LZ9A 3IPRA 3BL5A 1HTTA 1Y81A 2HK7A 5T3YA 1Q3TA 2YR0A 3PI7A 1MC4A 3V46A 3PGXA 1RVDA 5JXGA 3HJUA 4RY8A 1K8RA 3QVJA 2PGJA 3DBHB 3SDBA 5CLHA 5MN5A 1AZSC 3IILA 3UYLA 3EWNA 4QUAA 1DIGA 4J3FA 1T24A 4Y18A 3TLGB 3NO4A 3TF5A 3KQTA 1ZNYA 3DQZA 4XQ9A 2Z6AA 2OK7A 3BF8A 3DV0A 1MABB 3O74A 1XZBA 5FUMA 1VPWA 3MGKA 1GNRA 1YS9A 2OSBA 2VAXA 4JK3A 2ZRCA 1QU2A 3NFRA 1G2QA 2WIGA 1VCIA 1GNVA 2DHDA 1L5FA 1XEAA 1LDYA 2E87A 2OXCA 4TMVA 4V02A 3DC2A 2BUBA 5TJ9A 1RPAA 2IHUA 3U4IA 4Q3EA 4QGAA 4B48A 1BZYA 3SYKA 3PL1A 3QTBA 3T7IA 4OCZA 5DT9A 1U31A 2FGKA 4AICA 1E2UA 3AUKA 3F3MA 3NNSA 3OSUA 5IT9A 1FPQA 3PUVA 3FOFC 5EXTA 1PYOA 3ZLVA 2XBLA 3OJWA 4RL4A 2GETA 5J1TB 4B6QA 4C0KA 3DZKA 1FJXA 2O8BB 3NPMA 2CLKB 3S2GA 5JY6A 4I99A 4M1QA 1HDGO 2JJ1D 3KOYA 1PVDA 4K87A 5AXBA 4EB3A 2AEMA 1VG0B 4XCXA 2OAQ1 2BIFA 1SQFA 3GFOA 3R0VA 4YMWA 4BQFA 1LTHR 2ZR0A 5BSWA 4WZZA 4F2WA 1GG2A 5BNFA 3ZH9B 1A9PA 1KDZA 1WZEA 1GR1A 1I80A 2BRUC 2WABA 1C1HA 3MAAC 5EVCA 5DXAA 2IHBA 3R6TA 2R79A 4HKTA 5JALA 4QHTA 5A0VA 2GARA 3EXIA 4NYIR 1IXKA 1R9JA 1PK7A 3F90A 4H6WA 4MRMB 3ZQ6A 4FKMA 3RC1A 1W0KD 2R44A 1C1DA 4PFSA 2V7GA 4LYHA 3USZA 4MS4A 3KJXA 1DSSG 4I4LA 3C7DB 1D9XA 3H4VA 3WBKA 3GDGA 3BRWD 2Q4EA 4ZCQA 4A2WA 1XL1A 2GTHA 3BPSA 4ZCIA 1IL0A 4C04A 3FN4A 5KNCH 2CSXA 4YVFA 3WRYA 1E2DA 2FSUA 1DI0A 1J97A 1S2IA 2J0UB 2QDKA 3AOGA 2EYUA 3AMVA 3DEJA 3FYUA 3QVLA 1CSEE 2YQZA 5JCJD 5JBIA 1JI0A 3PC6A 3DUWA 5DT2A 1FL9A 1TLLA 3HKCA 2EHDA 4MO9A 4NJMB 4JEUA 5PGMA 3WL3A 4DQKA 3ZDBA 2JFQA 2Q0HA 1BCRB 3MTJA 3UGQA 3JARA 5LBIA 4CDGA 1WB6A 3OJOA 1T9CA 1Y89A 2XEDA 4PIPA 4K3UA 3UHOA 2R8XA 2CDRA 3UMVA 4EYKA 3K6SB 1K8YB 1DNPA 4FYVA 1MW9X 2ZAGA 3DSRA 3BHIA 1MT0A 2GI4A 1SQ5A 1SXJB 5DYWA 1YBVA 2YINC 4QG3A 1NTOA 3S4YA 2C2MA 3LXUX 4ZZ0A 3AJEA 3AV3A 5K8IA 1KJZA 4LMRA 1PR3A 2IUFA 1THGA 1KVRA 3P26A 5LQCA 3OD1A 1CNMA 2D3WA 3GRZA 4H7JA 4PTZA 2PLRA 3AB8A 1NVVQ 1CIPA 2VK8A 4DIKA 2PWZA 5DI3A 3I5YA 1KIMA 1PR5A 3IUJA 4DPMA 1ECGA 2NP7A 5EXDA 2FETA 1I0IA 1C8BA 3H3XA 3GVIA 3MBIA 1B4DA 2VT6A 2PZLA 4B3RB 3MS7A 1LNZA 4ZU6X 2HA0A 5FV4A 2PEYA 5JJKA 2VHEA 3FTQA 1UQRA 1P2FA 1XEWX 2LW7A 1U7TA 3I76A 1PVVA 4UPVA 1VE3A 4P7FA 4P54A 4X1IA 4D4IA 2NZVG 3I4LA 1V1JA 1WDKA 2IPMA 1Z2NX 1JTFA 3CF2A 2JLRA 1Z9BA 5F3DA 4QYTA 1MO3A 3H8SA 4UTOA 4BFLA 2PUTA 4ES6A 2H4ZA 3GZTB 1HETA 2BFWA 3WO1A 3B9PA 4Q93A 1ODCA 1RSZA 5LQAA 1GO2A 2ZIVB 3LBYA 4WV3A 1MJGA 3RVPA 3NGXA 4ZEXA 1CUJA 1PFUA 1VG9B 3OLCX 4B35A 2BONA 1P6XA 2ZUTA 2C3YA 3SC4A 1U2GC 4V1CB 3EISA 3GIWA 1C1YA 3K5HA 3ASVA 4Q9AA 2H5LA 3T9FA 1SKBA 2AK3A 2C2KA 2D7JA 3WK9A 4E11A 5HZMA 5CJPA 5ISMA 3KSMA 3PF8A 3TLXA 3IT3A 2C61A 2GXAA 2OFOA 3FX2A 4JC0A 3C3MA 1ODSA 1K06A 3RKUA 3LDFA 1XXHB 3RGGA 5C1OA 3IRVA 4RD1A 5JAHA 1F3OA 3W4KA 3IO3A 1O87A 4WESB 4L3OA 3EYWA 3EODA 3ICOA 5GV7A 4Y2GA 1CQJB 4EFKA 3LCJA 4R9NA 3LCVB 4UJ3A 1Y7PA 5AI9A 3GDOA 1GRCA 1WZCA 1ZEJA 3BZBA 4GOKA 5E3JA 3PNYA 2PQMA 4KB5A 2MYUA 1A2QA 3COZA 2CKDA 1E5VA 3KLBA 2SICE 4LOJA 1R6DA 1BSVA 2QLLA 1J1UA 2F90A 3IR7A 3Q9SA 4WCFB 2H4YA 3D1LA 2VUSA 2P0YA 3MGCA 4Y6LA 3PQ7A 2H7VA 1ZCZA 2JGRA 1RXSA 4YI3A 2XKKA 3U7JA 4C08A 1QAOA 1HDXA 2VF2A 4C0WA 2OHOA 1M2VA 4IV0A 5G0VA 2W00A 2ZUDA 1LCIA 1ONNA 2IE8A 2D1QA 4FC7A 4YECA 3JQAB 4FUTA 4KQJA 4D7AA 2PX0A 3EIQA 3VGPA 1NVWQ 1UJCA 4NBUA 3OU7A 2DWUA 5REQA 5FI5A 3WTCA 2WAOA 4FQ8A 4DLYA 4EYOA 4CGZA 1QYWA 4F4UA 3CQ9A 4YQFA 1OFUA 4BPBA 3OH8A 4EQ6A 4K6KA 3WB1A 1IWPB 2C29D 1O6CA 3EB9A 1K98A 2XGJA 3EEBA 4ZRDA 2V58A 2YHUA 1HSOA 5BV2P 4MI9A 3WIUA 1TW2A 3HPQA 1E1NA 2CVZA 4BE7B 3F5MA 4TXJA 3REFA 2OZLA 4KBYA 4LOLA 1QVRA 1IN8A 4IUDS 1SA0B 4BJHB 3ZBUA 5F51A 2V3WA 4O3FA 5JOQA 1NI4B 1F6BA 1QZZA 2HXSA 3GGSA 3JALB 1K6IA 2RGBA 4H35A 4M2LA 5BRJA 1NJGA 2HRDA 1H0RA 5KTPA 5JMOA 3DZFA 1P9OA 2FK8A 1PJAA 4GP7A 2AOXA 4RVHA 2EKZA 4LIPD 3IEVA 5EAIA 2L42A 4LQLA 1IK4A 2YDYA 5EHGA 3JRNA 2OHXA 2BPOA 2BLNA 2N42A 3QQ5A 5ALQA 2DH6A 3L0YA 3RVBA 3RSSA 3VTZA 4PXYA 1X1BA 3HSKA 1SBNE 4J0IA 3IJPA 4F9EA 3N2KA 3L40A 5CX1B 4DBVO 2JKYA 1PZEA 4M9SA 3EGXB 3LBIA 1UKAA 4GLFA 3A6PC 5CNKA 3EIUA 4MRVA 3DE5X 4MHOA 5EHXA 5B5SA 3OPNA 4OXKA 3ZCTA 1OPRA 3EDRA 1RHQA 2HZBA 3ZJTA 3UWKA 3I5UA 4ZEWA 2Q6IA 3UJBA 1W4LA 1RJWA 1HC7A 3T3NA 3IBGA 1PGPA 1ZXBA 3KB2A 3DFIA 3AVUA 2IZ6A 1NF8A 9GPBA 2Y0DA 1OVGA 3U17A 2VO1A 1AQLA 2WWGA 3OQ6A 1CUEA 2J7PD 1UK8A 3WJAA 2QL5A 4B2LA 3FWPA 4CMIB 1BYIA 4DM7A 5IDWA 1PT5A 1DV2A 1M67A 1N78A 2ZBQA 2NSHA 3WNVA 4A6DA 4M1OA 1T9KA 4F72A 3EPHA 2ROQA 2EJWA 3JYNA 4FE4A 4K81B 5TR9A 1VL2A 4ALNA 3TH5A 4NCKA 1ZD9A 1WMSA 3L6RA 5AHRA 2O59A 1DPFA 1NVUQ 2XMQA 3PBKA 4HQRA 4MP6A 3BWYA 1BHSA 1WXHA 2C94A 2C3OA 1U8EA 3B1WA 1NR5A 1GTL1 3R3SA 3E5NA 1NNSA 2I1VB 4G0NA 4JQZA 4KYVA 4NECA 5B7PA 4TM7A 5GM1A 2E82A 2C8KA 3ZCRA 1TX4B 2G6BA 4GICA 3AVPA 3G9XA 4ZVVA 3KYDB 3VNVA 1D4OA 2AN4A 2OZKA 2VKTA 3EFBA 3LL7A 4WEOA 4C4PA 3K16A 5HA5A 5NLLA 1H8HD 4EWLA 2GQ0A 3PFIA 3UV7A 4DILA 3P0FA 3ZHUA 1AKEA 6REQB 4ZO4A 4P31A 3EVCA 4ZCSA 2JFZA 3ELDA 1DOZA 1ADYA 3LHSA 3RADC 3IIJA 1COZA 2QVGA 3L7NA 1R37A 2FHPA 4F6RA 2YFYA 1YAJA 3UAXA 4D80A 5L4SA 2Y1EA 2B34A 3QLUC 4A0RA 4XRGA 4AKIA 5CD9A 3DVLA 2BFPA 3FG9A 3NBFA 4HSGA 3UHFA 3EMKA 3L6EA 3QWHA 3WB0A 3HXQA 5A6VA 2P9EA 3IE1A 3K9NA 4Y2SA 2RGUA 3C85A 3IIIA 1DUVG 2FSFA 4L4YA 1U1CA 3PFCA 4IDQA 3EEFA 1HE2A 4FSHA 3B9QA 5ALKA 1LRJA 1P7YA 1BKDR 3KUDA 1G5RA 5H16A 5TV2A 3SYMA 3TLJA 5CB4B 5JQGF 2XB4A 3ZWVA 1EX9A 1XQWA 4DNOA 1MZVA 4KGDA 2OUIA 3H5VA 4LYGA 1GZ6A 3VUFA 1QAMA 1QH1A 3ETCA 4MP3A 3L5OA 1TEZA 3LZDA 3ZG6A 1PNQA 4GVPA 1E79D 2AEFA 1YBFA 3GHHA 5ARDA 3NHLA 3D6NB 1M2OB 1UJ2A 3E18A 3MPUA 2GZMA 4L1KA 2B1RA 3CVXA 1P4SA 2AKEA 1MTZA 1XTPA 1P1RA 3VHRA 5FL7D 4DHWA 5GQSA 5J63A 2GZHA 2RHHA 1B15A 1U6IA 1EFUA 3OHMA 2GNPA 4UAGA 4OXIA 2QXYA 4ZOQI 1D5CA 4WOPA 1K68A 4YMTA 1KI1A 2G9UA 2LUOA 5DE3A 2NYUA 4U3JA 3CVUA 1XI2A 2YQ4A 1NHGA 1TADA 3TCKA 1J2YA 2C5AA 5DHQA 3W4JA 4GL2A 1QMPA 4RXMA 5H70A 1GM5A 3PRYA 3DPSA 3OPXA 1XPUA 1P4JA 1BMTA 3AR7A 1A5TA 1ADCA 2X41A 3PE4A 1TM5E 3Q3JB 3DVRX 1ZJ6A 4PTYA 3C48A 1KO8A 5A05A 5COBA 1A7UA 3SNHA 5TJHA 3VOSA 2W2XA 1T4CB 3EA4A 2E9SA 4F04A 4A91A 3GLQA 1UBNA 3A1VA 4DLPA 1Z5NA 3CLUC 4FLMA 5CB4F 1SK8A 3MT9A 4N6OA 3T7JA 1C9YA 4KX3A 3ZK7A 5DHFA 4BO9A 1NKTA 2WTMA 3S7ZA 4C43A 3EMBA 4OHMA 4JUBA 3PUXA 4OK6A 3BGOS 2WVHA 3QKIA 1P8JA 3LCCA 1AB5A 4M0DA 5FULA 2XMDA 5IDYA 1ILWA 4EMSA 4DR2B 1NVDA 4IPTA 1G8KA 5SYNA 2DQSA 5C7OO 3R44A 4C4XA 1U5AA 2VKQA 1EE9A 4FNOA 4O08A 3QJGA 4U1RA 3DLTA 3T8YA 2DY1A 2PJZA 3TQRA 2QT9A 4XQEA 3HWSA 3QFCA 1R0SA 4ND3A 3ANYB 1P5FA 1UKVY 4ZVRA 4OHFA 1G5FA 2QRVB 4GO1A 1K2WA 4OQMA 2HF8A 5KDDA 4NH0A 4GE0A 5DM0A 3E23A 1A76A 3O2QB 3QFSA 2ZWAA 2AFHB 5KC8A 1EIZA 4DW8A 1LF0A 1RPJA 4H1UA 1JLLA 5JAZA 2JG3A 3DCYA 3PDUA 2JJ2D 1UT5A 3V55A 1Y3DE 2NZXA 3D6VA 4U5QA 4IVNA 2C4TA 1H23A 4PE5B 4HVCA 4M0FA 5A9SA 5HJEA 4WJLA 1AK9A 2H4HA 2XIQA 1RQRA 1X7ZA 2K6GA 2ZT8A 3A1WA 3HR7A 4AZSA 2QZPA 5BUSA 4CHGA 1YE5A 2Q7XA 3HKEA 2GYUA 3I2JA 3PFWO 2OORA 3WK5A 2QW1A 1FUIA 5DBEX 2OBLA 3HFJA 1KVSA 1ZHHA 3A6FA 2I2AA 4A23A 3RNLA 2PWYA 1IJKA 2CXRA 2Y27A 4JUFA 3NC0C 2GEBA 4QBTA 5IVDA 1Z2OX 2ADMA 2C8LA 2Q2OA 2Q9UA 3JX9A 4URZR 2JCBA 1GSAA 3G8AA 3CRRA 3LPLA 4EW3A 3TEMA 4UUAA 3H2JA 3UUWA 5J23A 5GV8A 5KVCA 2DHEA 5IDXA 4FFNA 3T52A 5LMZA 2YV5A 4LX8A 1FCJA 1K6MA 2CXUA 4QPNA 2N47A 5L40A 3O47A 3AKEA 1POXA 1WL8A 3UC9A 1YCFA 1NUSA 2BWJA 2ARKA 4JASB 1XTRA 2AOWA 3AEKB 1JA0A 3CSDA 2ETVA 1KFCB 3O2JA 4MWTA 4CQLB 1RHKA 3H5OA 1H3NA 2GPNA 1LJUA 3UHJA 3EFHA 3GEGA 2CHQA 3VKWA 3KR0A 4Y2QA 1I6MA 1I3OA 1E9CA 1NDQA 1CUXA 4D0GA 1LK7A 1XCGB 3PNSA 3CM0A 3B6IA 2BHLA 3CG0A 3WQBA 3DB2A 4CBVA 2ZATA 4IDAA 3C1UA 1JKIA 5SY6A 4BVGA 4IYRA 4IV5A 1RI4A 5LXTB 3MN1A 2OWDA 3QMPA 2QOEA 2VNKA 1T4GA 4O1IA 3AWIA 1US8A 4J03A 1XZLA 3LX4A 2Z58A 3ZU3A 3R7BA 3R76A 4WT7A 1EVIA 1JIQA 3C16C 4NIMA 1C2TA 2JIBA 3EAQA 3HEMA 3KWMA 1YF3A 4FDUA 4P58A 1XZGA 4NONA 1F60A 1UC9A 3DVAA 3QK7A 3AV0B 5E95A 4B7CA 2OCDA 2QE7D 2ZJ8A 3GAMA 3MNFA 4LYJA 4BKRA 3B53X 3WMFA 2Z6UA 1I4OA 1PZFA 5D1HA 4IJ5A 1OI4A 3DBIA 2Z30A 4FDVA 5B1HA 2AN1A 4WWHA 1QHEA 1V5EA 4RJ2A 3LUGA 1L8XA 3FLBA 3NKFA 5FP0A 4UVGA 2QZ4A 2H2HA 4TM8A 1N5IA 3W2IA 1YC2A 1W0CA 2E85A 2QTRA 4D82A 1WUIS 2H7YA 3VO2A 1ORIA 1EBBA 3PK0A 4N82A 2WSIA 2P3SA 2QRQA 4WLVA 5F2OA 3U3XA 1PWHA 4INAA 4WOJA 1ZSVA 3W4IA 4XASA 2FWJA 3BRWA 1MV5A 1ZZEA 1PLLA 3O8DA 5JS2A 5DNDA 2BMAA 4EABA 3AUJB 1HNZB 2Q3HA 1HDYA 1OX5A 2NU6B 1B16A 2CDCA 3GDHA 4FSXA 2CNDA 4I5EA 5HF8A 3DYIA 4L9WA 3OQOA 3ADDA 1UBLS 5ECYA 1CY0A 2G5GX 4BEBA 1CZKA 4RTJA 2YWJA 3MJ4A 4NCXA 3S8YA 1L7QA 3R0XA 4PC3A 1PT9A 4FWBA 4JEIA 2IH2A 1JKJB 2QLTA 4MMXB 5B3JC 2WR8A 3R0JA 4HAVA 1NI3A 3N6XA 2LE0A 4BQOA 3JQ9C 3HRIA 5BMVF 2IK8A 3DZJA 1T2EA 3S55A 3R5SA 2HR1A 2CMKA 2R7MA 4LJSA 1EFAA 5H02A 3OLWA 1NMXA 3MUOA 4MVWA 5P21A 1AA6A 1YVRA 9LDBA 4MVJH 2IIVA 2X5KO 2Z2ZA 3FZEA 1UMDB 3HL4A 4RCZA 1QF6A 1FNMA 1IMJA 1Z0FA 2ZSHA 3LT1A 4P3XA 4DBZA 4UQPA 5AW4A 1QR2A 2ZJ6A 3MWFA 4P7KA 2J0UA 4L6AA 1TUBA 3ZNNA 5I5GA 1JWLA 1E2BA 1SXJD 2W8BA 1BWPA 3L6CA 3K53A 3SC2B 1U3TA 4CLRA 4UTRA 1R0LA 2X5OA 3DNFA 4JT4A 1ZA2A 2CJPA 3WADA 3QTTA 1VG8A 4XIFA 4FPXA 4EO9A 3K3PA 2HDOA 1JH9A 2O2JA 2HLPA 3LLMA 5ADUS 4I36A 5BT8A 5IUJC 3NTRA 1PFVA 5LB4A 2Q5OA 1PZMA 1SHLA 1MA0A 4O4JA 4BO6A 4MV0A 1F5SA 3KKMA 2CVHA 3K5PA 5IVKA 1WEHA 4UCFA 5K9ZA 3VOTA 3QU4A 3WRVA 3E3AA 4K40A 4ZHSA 1X7DA 1HDEA 1ZN8A 1RYNA 4OD0A 1TUGA 4N0EA 4TMWA 2DOKA 4ENTA 1YDHA 3BMOB 1QQBA 4IEFB 2IDJA 3G8DA 3JWHA 4IJ6A 1WPXA 2CNBA 3EXFB 4OQQA 6CHYA 1ONPA 1J42A 1QGZA 1NW9B 2PGIA 2O9JA 5A9TA 3RVJA 1E58A 2OAP1 1TQDA 4DQLA 4XGNA 1AM4D 3ZW9A 4EMBA 1SUEA 4YRTA 3BEDA 5I7VA 3CUKA 3TXXA 4ADSG 1BQ4A 2VZ9A 3ZHXA 5CHEA 3L07A 5FOSA 1MAVA 4F3CA 3W1VA 3HWX1 4BNHA 1OLOA 1OWMA 3UPTA 2ZLBA 1GTMA 1BQ3A 4DAOA 4Q4AA 1I1HA 3MINB 3X1YA 3FZYA 2I4LA 2J5BA 2ZAMA 3OWXA 4Q4CA 3WC4A 4AJOA 4V0NA 3TM4A 1H9BA 2D5CA 3CC8A 1J99A 3F0TA 3PNVA 1TA0A 4PFKA 4YH1A 2ZUFA 3GU3A 4MGEA 1YRLA 3PLAE 4RHFA 2FMUA 1I5RA 2OGZA 1GG8A 1WZNA 2PU5A 1GVNB 2JGEA 3IAFA 4MGHA 2CEAA 2DTEA 4HDRA 3IBYA 4C4SA 4EW1A 5FH9A 2RIPA 5JLJA 4HRAA 2G28A 4BLUA 5IHPA 3WGZA 4MRNA 4MW6A 3WGTA 1M0EA 3C8ZA 2ZSDA 3RRXA 5K4HA 3D8TA 1I9GA 2G0TA 4O3MA 3W5AA 1ZK0A 2YOFA 1YZVA 4KE7A 3CZQA 1OH6A 3TZKA 1GTZA 2REOA 4URWR 1R0XA 4G41A 4MYHA 4OU4A 3K0FA 1T0UA 4D9GA 4R01A 7ABPA 2PH3A 4AY6A 4MR7A 2VHUA 1DTEA 2C04A 1NSYA 2BY4A 5I48A 4MTLA 1A98A 1Y3CE 3C3AA 4KXLA 3WICA 1USVA 1PGQA 4NCJA 1DUSA 1WMEA 2Y71A 4RD6A 3EUFA 1VLLA 1DQSA 3BBPA 2BFBA 4H18A 4TL6A 2VJKA 3OZGA 4E7OA 5F98A 4C3ZA 4RQBA 1WHSB 2P1DA 2AC2A 4E5YA 5AW3A 2ZJ1A 2I6GA 3STUA 2HF9A 2IEIA 2B20A 4MYTA 1QE5A 5K2OA 2JD0A 5SZKB 4ALIA 3LJKA 3P5SA 1V7CA 5IWCA 1TT5B 4O5AA 2VRCA 2PZ8A 1KTVA 1OZAA 5LP6F 3L77A 1TEHA 2B2XA 3SJ7A 5G3ZA 4N0PA 1EQ2A 4Q1DA 2IS4A 4C1NA 1INLA 1F8UA 1FRFS 3BMCA 2R6ZA 2WQ6A 4UE6A 2ZITA 5B3KA 2OA0A 5HJ5A 5HKOA 1I30A 3QFHA 2EBWA 2OSVA 1KVUA 4YS6A 2CBGA 2GPJA 3EEYA 2J9XB 4GQBA 2QY9A 2HDWA 3FTPA 1BS1A 4K9RA 3JPWA 4URHA 4UDOA 1K7YA 4MPDA 1MJFA 4YRFA 4BJ1A 1T3TA 4A03A 7ADHA 3R5XA 3RYCA 4WEQA 4HNRA 4L0MA 1P0QA 3PV0A 1ZA1A 2VDQB 1KJQA 4GMKA 2I62A 5F9FA 1RAHA 1QOQB 2WA2A 2VTDA 1L7OA 4RA6A 4NE2A 3G79A 4RE5A 2VAWA 1F7VA 1IN1A 3IR6A 3RUEA 1VB3A 2JJ1A 8GPBA 5FOXA 4N40A 4TSKA 1V7ZA 4FMDB 3BXFA 5GZ6A 3ZGVA 3GNSA 4BFXA 3VI4B 4ZQFA 3GGGA 1XVVA 1X92A 1L4MA 1Z4OA 3MB8A 4QFCA 2X8BA 5IW8A 3LGSA 1CZNA 4X66B 3G5TA 2O2XA 3OZRA 3P2YA 4B4WA 1HMYA 4OIMA 3OWHA 3PQ8A 1KJ9A 4X90A 2A9OA 1IOZA 1AXRA 3OC6A 2FQYA 4GUAA 1CR6A 3VR6A 4BLSA 2ZUSA 2J5XA 1E32A 2B8JA 3R3XA 1JIJA 2IU4A 3C5EA 3H2HA 1HV8A 3Q3HA 2ZCJA 2OXTA 4GXRA 3IP7A 2G0NA 4XPIA 5DBGA 3UAGA 2NXCA 2PZJA 5FTJA 3AW8A 1DFGA 4LY6A 4C4OA 2Y1CA 5C5EA 5GZ3A 4BMVA 1ZJJA 2Q2VA 3AHEA 4I50B 4E09A 3NCHA 1S6YA 2HRBA 3A1FA 3MJCA 1RNLA 4RDCA 5ULLA 3WLHA 2OTCA 5I8PA 1YDEA 4E46A 1J0XO 4JSYA 4KHPB 1E59A 2A86A 3UHAA 3DBLA 5TY0A 2PD4A 5BR4A 3LQRA 2GCIA 1ZM7A 5A0TA 4NSNA 3SLRA 1FYFA 1FA9A 5IMBA 2GHRA 1RBMA 2ORYA 4LZAA 3ZY6A 5IK2D 2IC5A 4FYXA 3VH2A 3O7MA 3NKVA 3RFVA 1ZESA 2I1WA 1JHXA 1A27A 5F23A 4P6VF 5E9AA 1YO6A 2QT0A 2ONYA 5SV2A 3ZVNA 4MI6A 3DWGA 1MOPA 3E70C 3ZOKA 4JB0A 3ZU6A 1O96A 2BEWA 3PR1A 5T4HA 4XLZA 3UT5A 4IIHA 4OO3A 3UJNA 3LBFA 4TRNA 4MJLA 4UUPA 1VSVA 4AY5A 3A9CA 2WTUA 3JWPA 4YCBA 4ASUA 4BFTA 3ENKA 2FK7A 3N7AA 5EYPA 4CM4B 1SH7A 3AM4A 3ZWYA 3QUTA 2YY6A 5ICMA 3EYAA 1QHNA 4MWDA 1FFYA 4I5IA 3RC2A 4F6RB 1AKWA 4PZZA 5KHAA 4IWYA 5IN5A 1G21A 2VYVD 3AERB 2DHQA 1S2OA 1U3UA 1L8OA 2WW8A 3O8QA 3Q7SA 5DBHX 2EJUA 2OPBA 3X44A 4JQCA 4ZVTA 2Z0MA 4DG5A 4EX7A 2QR2A 4IRUB 1CJKC 5L3SA 1KDOA 1S8NA 3I9FA 4E2YA 2JLQA 3L1KA 4UMDA 1ZJWA 1IMOA 1HORA 1TZKA 1ULTA 9ABPA 1ICEA 2B4TO 3ERCA 3VQTA 4DHEA 4KO8A 3S1AB 1WLYA 3WLNA 1ZIOA 2GFQA 3C8HA 1CRLA 5CM2Z 1SOMA 4Y2UA 4YUXA 3FJ1A 1SURA 1CPYA 3FPGA 2XMBA 3SZLA 4OLAA 4KFRA 5C1DA 1DC3A 1N5MA 1UZLA 3OZDA 3L0SA 5EZ6B 1FMCA 3BHMA 1E77A 2P0AA 2A0WA 4K5QA 3WIEA 3FCSB 1EUCA 4PBTA 4J0GA 1YA4A 2QTTA 1V1RB 3EWSA 1E1QD 2OXIA 3NG1A 3TW8A 1O6ZA 1NY6A 2BDEA 4DC1A 3HJNA 4US0R 4R9SA 4J2OA 2VPIA 4N5HX 2VDMB 3GMTA 4KGZA 4YTEA 2LCFA 2ZB3A 1B8NA 3ZTYA 4KI0A 1IIBA 3A1CA 4DIUA 3RK4A 2W0SA 3EULA 1DEHA 5LZ7A 1DZIA 2GHTA 1I6WA 3AUTA 4WADA 1NFQA 5GIOE 3TUIC 1ILEA 4P4TA 2CL6X 3FYUB 3L0ZA 2FOLA 5AQEA 3T9EA 1T4CA 3SE7A 1DTWB 4FGLA 3OTOB 1AMOA 4AAYA 1DWQA 1AY0A 3JATB 1JB9A 1M66A 3S1LA 2G07A 1W8DA 2TS1A 5SYMA 4CM7A 1Q19A 1BXZA 2WIAA 3VH4A 2V7UA 2RBGA 3VV2A 1CHNA 3KQYA 1IK6A 4F9FA 1YA8A 1ENZA 3I6YA 1TF2A 1KQFA 5F21A 5EWMB 1R74A 1G8MA 4LWQA 2EJTA 4O4HA 1L5LA 3OPYI 3FETA 2C88A 2P9BA 3W5SA 3CA8A 1GU7A 2P65A 4L8GA 3EZFA 3V8BA 3ZXXA 5JNLA 2QTWB 3OTIA 4NS4A 4NZ9A 2YJ4A 4LOHA 5H1YA 1JXMA 5LJIA 4I66A 2XE7A 3WS7A 1KP2A 3ISTA 3PGA1 3QV2A 2V7TA 3UF0A 2QBYA 1ZCFA 2BTQA 1N25A 3FKJA 2NVOA 3ANTA 3A9TA 4OI0A 3GH3A 4U7FA 3EZGA 3JQGA 2B37A 3STXA 1KMMA 1NJFA 1VYTA 2MSEB 1L7BA 3E8XA 5EIHA 4C89A 1E2FA 5CLFA 4HAYA 2BSAA 1U90A 3KXIA 3PCRB 2HTFA 4DUZB 3ROKA 3O9VA 4HYYA 3I05A 2G25A 1VECA 2IKSA 4AJLA 1T2DA 2MSCB 2NXNA 5CGQB 2Q9BA 1QLHA 3H8VA 4R5HA 2XLCA 5D7BA 3MGAA 1H6DA 3PFGA 1ORRA 8ADHA 1I13A 3L8CA 5JSQA 1PCXA 2FZ4A 1XXHE 1BOOA 1SVLA 2QYTA 2VJYA 5GJWC 1LQ2A 2P27A 1ZGCA 2P9HA 3SSOA 3M6MD 3UFBA 4ECAA 1JB1A 1N75A 3LUHA 3PQDA 4FR0A 4PVDA 3MAJA 4PRLA 3KB1A 1E2NA 5FHQA 1RWXA 1N3BA 2O8CB 3ABQB 2PNFA 1JLRA 1E6CA 2C8JA 4FE3A 4P5DA 4Y3UA 5TMPA 4NOMA 4PYNA 3G0DA 4QPPA 4PYRA 3K1AA 1AB6A 1K88A 3TKAA 3ADBA 3TI7A 1KEEB 2YN0A 4PV7A 4PHTA 2DPLA 2PD3A 2DWOA 2PUEA 2PE5A 1FDSA 2V6IA 3EDCA 4KO2S 1YCHA 2AI2A 3CH5A 5BQ5A 1FRZA 1TA4A 3FY4A 4RF5A 4DCGA 3KC2A 4ZC8A 1O0BA 2WA1A 4EL0A 3U4QB 2MSDB 1L4YA 5HXAA 2G83A 2O7QA 2JS7A 3FM9A 2AHOA 1TCCA 3ITDA 1JFFB 2FOXA 1QMGA 2AOTB 1ZD2P 2NXEA 3MM4A 3NH6A 4NNOA 4OKNA 3BRSA 3SQDA 5B4UA 4HVLA 1Y6ZA 4F71A 1SIUA 3OZCA 2DVMA 2QJTA 1Y8AA 2VTVA 3WLJA 2LNDA 3PHJA 4KWEA 3MBOA 4EA6A 1DAMA 4F5WA 2OGWA 2ZPTX 1UK9A 3CEAA 3KQKA 1LWOA 3H4TA 2BR3A 9LDTA 2EFHB 2IHKA 1O8CA 1WOMA 1PJBA 4GZ5A 4E14A 4EX6A 3KU4A 2GTIA 2XMPA 4DJTA 2WEKA 1PWZA 4A15A 3MILA 2FJPA 4MWGA 4REQB 4R4JA 2FMIA 1H0SA 1G2OA 1RYMA 2GN9A 3GUVA 3E7PA 3WWCA 1SZDA 1BE8A 1UKEA 2DR0A 1MJHA 2B4RO 3DP9A 4YEDA 2DULA 5L7YA 3QXCA 3TCNA 2QMYA 3HU3A 4ZKDA 4MCHA 3CF0A 2BZ0A 2OO5A 2IA5A 4OGKA 4UTPA 1JEYA 4XZ3A 4DMFA 4OP3A 4EF6A 4BDSA 1QGUA 4M3NA 3IUYA 1U0OC 2GZRA 4MWOA 4P1ZA 3R7AA 3RRMA 2PSSA 4FWTA 2F62A 1U2DC 1MC5A 2P77A 4X1YB 4RHUA 1CDZA 3E7WA 2IH4A 3BJRA 3QLVC 5AI0A 1RRGA 4BCBA 1AS2A 1CK4A 4L5CA 5EVJA 3QGMA 1E5LA 3GFGA 3GX1A 1FPMA 4Q24A 2FR8A 3O4GA 4FK8A 3QVGB 1H2XA 1U5BA 1EK5A 3V3KA 3HU5A 1KZ1A 4OATA 2NUTB 4KREA 1DC5A 2UKDA 5A5DA 4KAJA 2J87A 5SZIA 3W2TA 1N6NA 4JB8A 4MDHA 3VHQA 3VZDA 2ZCVA 3WLOA 3DLHA 4LDRA 2ZQ5A 3LOPA 5J5VA 3WI7A 2O19A 3RROA 821PA 1KKMA 5DRYA 1Z37A 2OLEA 1HQDA 2W2OA 4CV1A 5A06A 1WUJS 1BTOA 4BNDB 4DZTA 3GCDA 1S8OA 3MOIA 4OV6B 5GWXA 3HA7A 5LB2A 6AT1A 2XMSA 2Q7OE 3G8YA 3UIEA 1YBMA 4R1TA 1HNNA 1ONOA 2K7FA 2VF5X 2E48A 3S8EA 3KWJA 4GPTA 3H05A 4DRXB 2FPIB 2PIAA 2PRJA 3HLYA 4MO2A 4U2EA 3WYDA 2XXAA 2ZYDA 3R24A 1VMDA 2YV2A 4NCHA 2HRZA 2NUBA 3NVAA 1RM5A 1YZTA 1KR2A 4I4TB 2XX3A 1JDZA 2RI6A 1EGQA 1MNQA 1YI8A 4DA7A 1TFRA 2VAVA 1XTSA 2VN8A 5I7EA 1E1CA 1MHPA 2W2NA 5AH0A 1JR4A 2BEUB 1EVJA 3T95A 3ZVLA 5C8VA 3BZUA 1THMA 3VX4A 4HNGA 4NNJA 4DA9A 1A50B 1XD2A 2Y68A 3PUYA 1VZ2A 1G7RA 2H00A 3PI6A 3VMMA 3U81A 4BX0A 4CRWB 2BRUA 4AY4A 2VCHA 2QAJA 1KEEA 3H9GA 3K9CA 4FR5A 4Z9BA 1TUBB 3B82A 3PC3A 2OMKA 4KMSA 1KJ8A 4FIDA 1P5RA 3TJRA 5HBRA 4BNLA 5ICCA 3WLIA 3ABZA 4MP8A 2WD7A 1BJRE 4FYIA 5H0IA 2QENA 4GP6A 4RYDA 3RAEC 4IIFA 4NU5A 4BQQA 1FFSA 5D7NA 2Q0XA 3CW2A 3D6MA 3IQIX 3LNTA 3SIWA 3V1TC 3VU0A 1P5JA 1KBOA 5K0JA 5CEJA 1T0IA 3HKDB 4HNSA 5K8UA 2AFIA 4JLUA 1T1GA 1FY2A 1WCV1 2HJGA 2KW5A 2PLWA 1RHMA 2VDWB 2VSOA 3GGJA 3W5DA 3GD5A 3GLIA 1GQQA 2VF8A 4FFBA 4RH1A 4XIIA 3ODGA 3EUWA 2A94A 1DCMA 1R8YA 5EFOA 3N05A 2EJVA 3OESA 4ZICA 1QP0A 3DMTA 5J9FA 4IEIA 4KR0A 3D6JA 3SBEA 4F56A 1WKCA 5ALXA 3KOZA 3UOWA 2WFMA 5CXUA 2QW0X 5DMHA 5KHOC 2W70A 3F6PA 1KFJB 1PK8A 2W4MA 3Q7PA 4MGKR 4D42A 2FWRA 3OD5A 1OYYA 2P30A 2R751 1Q2UA 2CSUA 2G70A 3GFQA 3ZE9A 1NAIA 1PAUA 1QQ6A 5J47A 3N8GA 3LUKA 2O2SA 1YI1A 2AQKA 2AXPA 3LX6A 3RHFA 2ACWA 3FYTA 1TM1E 3IPLA 3JQQA 5IT0A 3IE0A 4G24A 4EKDA 4RMGA 4GBMA 2AW3A 1A82A 3GD7A 4TTJA 3IP3A 1U4NA 5EA2A 1Y5LA 1BMQA 2NACA 1WWKA 2ZUCA 2PL5A 4ZTUB 1J8MF 3ND8A 1NVXQ 5TB5A 5FTLA 4LKOA 2L69A 3G88A 2WF6A 4GRAA 2A67A 5AVJA 3IDZA 2GF9A 2I2BA 1HKHA 5FLKA 2OEPA 3MCZA 4B9AA 2ZIWB 4DCSA 4C30A 1L7RA 1BN7A 5DI3B 3S29A 3FOEC 4KRFA 3G17A 4D4KA 5KSWB 4UD6A 1N7IA 1FJHA 4EKNB 1QIEA 1Y7LA 3CPJB 1OTHA 2Q46A 3BIFA 2UYQA 2GCPA 2JNWA 1XP5A 3OPYB 1DC6A 2HHCA 3CMCO 1Z8NA 1OREA 4L5AA 1ISMA 2JGDB 5H3CA 1R5OA 5JSZA 1UXHA 3SF8A 4N41A 4NX2A 1CETA 5CPFA 3OEHA 1KHHA 3I92A 2O57A 1C1XB 2W43A 1MB0A 2Z95A 2UYYA 1QP7A 2XBMA 3H9CA 3BJZA 5K3FA 1RM3A 5AKXA 1WSDA 2JDIA 3PJEA 4GMHA 4A5SA 4QEDA 1A71A 1QS0A 3OETA 4W99A 2IYTA 3RTCA 4GKJB 4KQCA 3OO0A 4CU5A 5A2QA 3RREA 4G4IA 4U8GA 4C7BA 1W8IA 1Y1RA 4QXQA 1JU3A 1NFFA 5EUQB 3DTVB 1TCVA 2F1KA 4QNMA 1PTJC 4W7HA 1EU1A 3K1YA 4M9RA 2X13A 2QUJA 3HCPA 3K8QA 4O25A