3GLRA

Crystal structure of human sirt3 with acetyl-lysine acecs2 peptide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
274
structure length
274
Chain Sequence
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent deacetylase sirtuin-3, mitochondrial
publication title Crystal Structures of Human SIRT3 Displaying Substrate-induced Conformational Changes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase regulator
total genus 91
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 3glrA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3glrA01
3LQ1A 4UTXA 5MF6A 3GLUA 3CLTD 4RMHA 4BVGA 1J8FA 4UUAA 3HWWA 2IHVA 2QQGA 4ZP1A 4GG1A 2FR8C 4K9NA 4BN4A 3EA4A 4JUFA 4JUBA 2OD7A 2WVAA 1BFDA 2AG1A 1DJLA 4L2IA 1PO7A 3FZNA 3EYAA 1T9CA 2Q29A 3U3DA 4I5IA 4X3OA 2JI7A 2Q28A 4O8ZA 2VBFA 1T9DA 2FWNA 5EJ4A 2BRUC 4G1CA 5FEMA 3GLTA 1YI0A 2OO5C 1EFPA 1SZCA 1T9BA 5BWOA 5K2OA 4V1CA 1T9AA 3U31A 1YHYA 2Q5QA 4V1CI 1Q14A 2PGNA 4K9LA 2NXWA 4RMIA 2C31A 4HD8A 4GPEA 3F6EX 4GM4A 4D5EA 3JR3A 1YNOA 2UZ1A 2H2IA 1QPBA 4IAOA 4RMJA 2EZUA 4JSRA 1ZPDA 4BVEA 2EZ4A 2Q27A 1U2GC 3GLRA 1PT9A 4MPJA 2VBIA 2H4FA 1NM5C 1V5FA 2A1UA 3E9YA 4F56A 1POWA 1O96B 2VK8A 2OD9A 2VBGA 4COKA 4D5GA 4KPUA 4K9MA 4UTNA 4JUAA 3ZG6A 1YBHA 1Z8NA 1UPAA 5EJ9A 4MPRA 4UTZA 1PNOA 2Q5OA 3IAFA 1U28C 4KXQA 2V3WA 4UU8A 1MCZA 1M2HA 3ZGOA 4MZXA 2X7JA 2WVGA 4RJIA 5BWNA 4QELA 5BWLA 4V1CB 1S5PA 2H59A 1Y9DA 4QPZA 2EZTA 4J16C 2QQFA 3RIGA 4MPPA 2JI8A 1M2KA 3D81A 4K9PA 4F4UA 4RJJA 4Y6LA 4R8MA 4TWIA 4QQ8A 1PI3A 3EY9A 3IAEA 1E3TA 4X3PA 1YC5A 2AG0A 2OORC 2UZ1B 5K6TA 2H2GA 1V5GA 2B4YA 3D4BA 4UU7A 4C7BA 1Q1AA 4BVBA 4C78A 4JUDX 3F6BX 2Q5JA 4BVHA 2Q5LA 4FEEA 4FZ3A 1D4OA 1M2JA 4UTRA 1OVMA 5MGNA 5IMSA 2IHTA 4HDAA 3OE1A 3CLSD 4K9KA 4JU9A 4GP9A 2H4HA 2JIBA 4GM0A 4Y6QA 3JWPA 5K6RA 2JI6A 1UPCA 1YC2A 4BV3A 4Y6OA 1Q6ZA 1XLTC 1OZFA 1N0HA 2H4JA 5D7NA 4IF6A 5K3SA 4JD5A 4JUCA 4ZZIA 4BUZA 2JLCA 2W93A 1OZHA 4K9QA 4JU8A 3CLRD 3FSJX 1M2NA 1S7GA 2H2FA 2FSVC 4L3OA 1MA3A 4MQ5A 1YHZA 3D7KA 1EFVA 2JI9A 5EJMA 1SZDA 5MFPA 3ZGVA 5DGTA 2HJHA 2FN3A 1OZGA 1O97D 2JLAA 4IG9A 2PANA 4BN5A 4FVTA 4J1TC 2FRDC 3PDHA 1PTJC 1M2GA 2VK1A 2PGOA 4BVFA 2A1TR 1U2DC 1HZZC 1YI1A 1JSCA 4FEGA 1PVDA 1ICIA 5EJAA 4RJKA 5EJ7A 3GLSA 2NYRA 2H2DA 5FYQA 3HWX1 3PKIA 4TWJA 2VK4A 2VJYA 2DJIA 1POXA 3CF4G 4Q9DA 2WVHA 2H2HA 5EJ8A 4JT8A 1U31A 5DEIA 4UUBA 5EJ5A 4K9OA 1Q17A 2IHUA 3FLMA 5AHKA 5EJ6A 3K35A 2OD2A 4BV2A 1YTLA 1PNQA 4RMGA 4GM1A 1UPBA 4KGDA 3RIYA 3CLUD 3PKJA 4UTVA 5DGDA 1PYDA 4JT9A 1V5EA 5MFZA 2EZ8A 2EZ9A
chains in the Genus database with same CATH superfamily
1BKDR 4D98A 4MUXA 4OQXA 1JR3A 4LF9B 2AJ8A 3WVNA 2IBMA 1AGYA 1N1GA 4RHEA 4IUDS 1E4EB 1I30A 5KJEA 4MVCA 5TLSA 4BVGA 2L2QA 2LIVA 3FPGA 4JK3A 3V33A 3SWWA 3L7JA 1I9GA 2IHVA 3UAGA 4CTNA 3DDHA 3EQ9A 3UYLA 2VP2A 2P91A 3W6NA 3Q11A 1FJGB 1XJWA 4UBNA 4B33A 4DDMA 2PH7A 5CRIA 2R60A 2ZVPX 3GEEA 2PJZA 1XA0A 4JUIA 5TRTA 2IS6A 3KQOA 1SOMA 3AJRA 3E18A 3SQOA 2DRIA 3H16A 1X38A 3N9IA 3N75A 3CJTA 3DFFA 1GSOA 3AIIA 4Y98A 1DQRA 4U00A 1Y6QA 4JELA 5LDGA 1ZX1A 4PG8A 2ET6A 3M6IA 2IPMA 2FW9A 3P9ZA 2XX3A 3AR3A 3ZK9A 4NDZA 1XU4A 2GZDA 3H5VA 4G24A 4K05A 4PPGA 3U80A 4BQFA 1RBZA 2NPIA 4AICA 3AEQB 5B1SA 3BFVA 4CKYA 1DBWA 2FP4B 4WZ6A 4H1VA 3R9XB 4TKVB 4ZYYA 4HWSA 1SXIA 3O3OB 4EKDA 1ND6A 4YAIA 2HU8A 4TS3A 1WBDA 4D80A 5EJ4A 4O1MA 1U4NA 2XCRB 1Z6XA 2A92A 1QYRA 2HU2A 4Z8YA 1MG0A 4QZVA 3ZI4A 5JE8A 2JB9A 3DAYA 4G5RA 1KZGB 5F23A 1OLSB 3ZN2A 1DARA 4Y2GA 3GVPA 1GRVA 2I29A 5FUWA 3FPBA 2G4CA 1X7ZA 2FMXA 1VDZA 2Y1KA 1JNYA 5BORA 4RQAA 5A7HA 1DG1G 5EQDA 4DLZA 1N2SA 1V96A 1XZHA 2VOEA 3PNPA 5FOVA 2E4AA 3DA8A 4L7VA 4E4RA 4GP6A 2PX5A 1H1LA 4HXGA 4O29A 4TTAA 5IKPA 1J9ZA 3WA7A 4HQKA 2PBRA 1EDOA 2W2XA 3NRCA 1GADO 2WD8A 3O83A 2GZSA 3ONWA 5JD6A 1G8SA 2VNIA 2FPWA 3PUJA 5K09A 3GGDA 1PIWA 1YUMA 3KWMA 2HHCA 4W63A 1J00A 3BYZA 3T1NA 5L8VA 3GP8A 2VDJA 4FFOA 2WLSA 4GF5A 1ZNYA 5DT2A 1AKQA 1EVIA 3D2CA 2RDMA 3GFFA 5GAJA 2CLCX 5GVRA 1CS4C 2PCJA 2FU5C 3GRZA 4MV6A 3RVJA 3ZDRA 1YZLA 2AV6A 3TB6A 1IAVA 1CHNA 3OX2A 4QLAA 1TFRA 1WV0A 5AJXA 2AMLA 3BQMB 3HV0A 4WOPA 1OBVA 5HKLA 2VYNA 1FXSA 1GCGA 1SELA 1CDDA 4QXQA 3MJHA 1XE3A 3WJ1A 4DJDC 2GAJA 2MSEB 4TOIA 2QAGA 5A4FS 4RADA 2HHHB 3RKRA 3KRTA 1QIDA 4I6EA 1Q5PA 1A77A 2FMHA 4EMBA 1DTWB 3EVBA 3LSTA 2W2QA 1C7RA 4XCQA 2RHCA 3QV1A 4HNSA 4NEHB 3DD5A 4LAFA 2P41A 3SOZA 4GE3A 5SYNA 5JC8A 2DZDA 3MOIA 1SU8A 1SBIA 4X20A 1KEPA 1ONBA 2VLBA 4K8OA 5FKJA 1WZ2A 1NLMA 1Y81A 3IYLW 4HUQB 5AOAA 4JXJA 1XTKA 1YD7A 5CHYA 4F2HA 1UKCA 1I94B 2RONA 3KVRA 1R8YA 2JAPA 2Y77A 5FWAA 4KODA 4Z1OA 4YAUA 3THXB 4EPYA 3A32A 1G4UR 2JD2A 4P3YA 1RLOA 4RH0A 4MQ6A 4BVEA 2BMDA 4UNSA 4YAJA 3VPSA 2FSVA 3L6BA 4PG6A 1B76A 3PV0A 4ND5A 1BRMA 2D54A 3DTTA 4QVGA 4B73A 3ZDBA 2IOFA 3F96A 1UT6A 3GUZA 5C8VA 3LW8A 3ON5A 2NT4A 1R9JA 1GPKA 2QP9X 5DBEX 2O7QA 2QL9A 3QFRA 4YAOA 4TZKA 4ZVMA 3ZY2A 3WIVA 4DV5B 2JH8A 3MS7A 3G0BA 2IP2A 1I3MA 5EWLA 1V5FA 3PHLA 1U1GA 4GAEA 4OVKA 5DWQA 4MB2A 5FNVA 2OFPA 4ER3A 1TCCA 1PGJA 2FWJA 1LPSA 1WKBA 1C81A 5LB4A 1G18A 3VSEA 5JDIC 3ZHRA 1HE2A 2HMWA 2OD9A 3GEHA 2FLVA 3T0IA 2QL7A 2WFLA 4IXMA 2VJQA 3VR2A 3VSAA 5EFOA 1Y4ZA 2PYZA 1KR5A 1EGQA 4KFUA 4M87A 3SZMA 1ZONA 4KN9S 4CM9A 3K3PA 3JQDA 2FTKE 2JFOA 2HA7A 4QATA 3DEYX 1NASA 1JTFA 2WT4A 4YFVA 1E5DA 2R751 2R8OA 3A2NA 3DHEA 1QIGA 1YA4A 1K3TA 2AKAB 3F90A 2BEJA 2GS9A 2A78A 4HMPA 3UJCA 2C00A 3TRKA 1R37A 4MWZA 5KYXB 3ZJTA 4TTRA 4BHTA 3H65A 3RUPA 3ISJA 1JBKA 1A7JA 1PR0A 1VHTA 2FLKA 4MGHA 4O0MA 2CF6A 3KAQA 1OBOA 4LF7B 2GPSA 1Y1SA 2Q4EA 3NIDB 1SOUA 3TD9A 1KKMA 5K4HA 2D6FA 3LFUA 4NCAA 2QMUA 4P08A 2NOAA 2CLLB 4UEOA 3TW8A 4TV8F 2D0DA 3OPYB 3OQ1A 2AEMA 1BDHA 2FZ5A 2J0UB 5AVUA 1Z2NX 2PGDA 3D59A 4RANA 4EHDA 3MERA 2QP3A 2XRMA 2WWYA 1XMOB 1FFSA 3WB2A 5BWLA 1DUIA 1RQNA 4ZICA 3RU2A 4Q93A 3BGDA 3P0HA 1N4DA 1GPYA 1D0SA 3JATA 2QRGA 2Z98A 3WLOA 2JRLA 3NFYA 4TM7A 4M1TA 3WGQA 3IBGA 3HCNA 1UBKS 1XZJA 1GU7A 4UPDA 5E1OA 4CM7A 4G07A 4GMHA 3UWMA 2P79A 5T8KA 4JJ8A 4JXKA 4L0QA 3IIJA 4ARVA 5LOVA 5DGIA 1QRRA 4RJJA 3CNLA 5CFRA 4LVUA 1QHHA 1N36B 3NETA 5F5XA 3UY4A 4BZXA 5AVYA 1HI9A 1BHJA 3E2PA 2XNKA 3DT6A 4PRKA 3VGJA 3DM9B 3O0DA 1CIVA 2ZYRA 1TZKA 2GPNA 3RVPA 3AXSA 3EF0A 4CF3A 4PWYA 3LLVA 2C9YA 4FB4A 1NNEA 2R1TA 2BKXA 4ZTZB 1NV8A 3FUWA 4OJQA 4IEEA 3C5VA 3D4BA 1VL0A 3Q3HA 3U6KA 3P2EA 4Q9KA 4BO4A 1QGAA 3IV9A 5JALA 3M82A 1Q15A 1N8KA 1YS2X 5FI5A 1EE1A 4UOQA 4R01A 1USKA 2WTUA 4DA6A 1IJBA 1R18A 5A6VA 4OX9B 1OXTA 4G6ZA 1YJBA 2QD2A 4ZYTA 1PF7E 3FZGA 4C21A 4HRVA 1A5AB 4D8VA 1NVUQ 4GMDA 3GLFE 1ACJA 1E96A 1LDNA 2H9IA 3TIFA 5FUVA 3SXUB 3C97A 4Q3CA 3RH0A 3WISA 4X24A 5A03A 5BT9A 1DRWA 3NGXA 1OAOC 1J06A 3MSXA 2AOVA 2CSXA 3S27A 3ASUA 4FW9A 3IEUA 1XTZA 2B8EA 3BE6A 3DE6X 1K75A 3NONA 4FYXA 1PVOA 4XSHA 2YRXA 1XL0A 2GPTA 2QXUA 3I01A 5IVDA 4U2KA 5A7FA 3K0KA 3ND7A 1FJ2A 4FU0A 5DTQA 5L4NA 2RE8A 3CSSA 1SCJA 3M4NA 1IOZA 1S2NA 5T4EA 1G9XA 2VNAA 4B7XA 1THMA 1GRCA 2XODA 4QXAA 4U2DA 3GHYA 1ZM7A 4E2WA 1NFQA 2Z5LA 3N2KB 4LZLA 1B8UA 5B3JC 4J76A 5TY0A 3AGPA 4M9SA 1CFZA 2HA6A 2PRJA 3V4SA 4DJEC 2VJDA 3D3WB 1B8OA 4X1YA 3TL2A 4U9HS 3ZWBA 1B3RA 1J0DA 1ZM9A 5AKIA 3BXXA 1IBKB 2VRWA 4M21A 2ZM6B 1R16A 2OKCA 1UPUA 4Q34A 3C3EA 2XTMA 4YRSA 1HO3A 5H81A 3O4GA 4L74A 4HX5A 1IXZA 4X1IA 3ZLVA 4BNVA 3SF8B 3WZ2A 3LC7O 1EDDA 3ENWA 1COWA 2QN8A 4YP7A 3TNFA 4TUYB 1NQVA 3JAKA 4OLFA 1D3AA 3EUWA 4ZI5A 3BJRA 3L7DA 1HK7A 1Y1KE 3ES9A 1QCZA 1V6CA 1ODFA 4FYYA 3PFNA 4D43A 2HXSA 2Z4SA 1MIOB 3VBEA 3NTOA 1L5YA 3TH5A 1RWBA 3P8ZA 3S99A 5K3SA 8ADHA 3LQKA 3VKWA 1UZMA 4IYJA 4W9NA 3HU3A 4CLRB 4HFMA 4XIGS 5EWJB 2XQKA 6LDHA 1WTCA 3Q72A 5COQA 2V5AA 4ZZIA 1VKZA 1V7QA 2R1VB 3ETCA 4ZMSA 1NXWA 3MTBA 3O8QA 5E4TA 1Y4DE 2JL1A 2FRDA 1L1QA 2QGZA 5D3MB 4AJ9A 2ZI6A 3H13A 5E7QA 1FFCA 5FDFA 1YQXA 4JP3A 3TVTA 1FQKA 2WKSA 4EKGA 2DQKA 4X6YA 1OZHA 5ENZA 2IH5A 1HORA 1GJRA 4NYMR 1ENYA 1JYSA 1ZITA 2JAUA 5CT5A 3WOHA 1AM4D 1NI4A 4CL2A 2X9NA 3A6PC 4FYVA 2XZLA 2PVCA 1I4EB 3ZD8A 2GHIA 3KQNA 1QVWA 2H31A 1MZVA 3AC0A 4D3SA 3JARB 2G72A 5CURA 2RGAA 3VR6H 3SJZA 1TGYA 1IHXA 1BU5A 1NVBA 1X8LA 2PH1A 1PSWA 4YQYA 1JG1A 5BRJA 1XZCA 4I6JA 7AT1A 4QOIA 5ALJA 4H7DA 1WB9A 3IBCA 3A7DA 1B73A 2CN1A 5AW1A 3VPAA 2HNKA 3C16C 2J6HA 3TDKA 4EYSA 5FR2A 3SIWA 4F96A 3ILSA 3NP9A 4KVAA 4JI1B 2D1RA 3MTGA 2RGXA 1GAJA 3OIDA 5TR9A 2G9QA 1RABA 2WYUA 2VTVA 3DFMA 4JLUA 2ZJ7A 3KC2A 1IULA 1FNMA 2QTZA 3CHYA 2OXRA 4KWEA 3GXBA 1R6BX 4KXXA 3L4BA 4PC3A 2RKWA 4AG6A 1ZOSA 3SU8A 2WZQA 2V7EA 4KZPA 1SQ5A 3TUJC 2RGCA 2VQ3A 1WDMA 4FBLA 1YVDA 4N3BA 1H1TA 1VSQA 1KY2A 2PUJA 3HQ4O 3O8DA 3FSEA 2IE8A 2RAVA 3ANNA 1DPFA 4A23A 1DEHA 2JAQA 3R3JA 2C3UA 3QNWA 3DCNA 3N3BC 3P2MA 2HYDA 2VKTA 4OQNA 3PNOA 2B1IA 1YJCA 2MR6A 2RJ3A 3SLKA 4PZZA 2F43B 2PZKA 3AONB 4PN7A 3MMZA 2OZLB 3LWDA 5F3RA 1LKZA 2CFSA 3QVJA 3P9NA 4RJKA 3A7EA 4RKYA 4RWEA 1E2NA 3C6ZA 3I52A 1X7WB 1YRYE 3VV3A 3MINB 3ZIAA 3ROGA 5JVDA 3MEQA 4P5DA 4P5EA 4B8WA 1IONA 1LPBB 3V1KA 4F9TA 4YV0A 1H5QA 2FQXA 2DETA 1E2LA 4IDBA 4XB1A 1D2EA 2HLPA 2GXUA 4Q24A 2OY0A 2Z8XA 1D5WA 1FJHA 4ND8A 4YUVA 4HVLA 5IXSA 2C3OA 1GPDG 3K4PA 4LJ4A 1PLJA 3T7IA 4CV3A 4D9MA 2R7NA 1L5ZA 2UUOA 5FLKA 1VHDA 5I6DA 2ECKA 3L8HA 4OSPA 3PLRA 2L82A 3I6BA 1W9HA 2ZCJA 2PLRA 1FRZA 1C5KA 4JLAA 5CIYA 3QKTA 4EF4A 1MRSA 3DW3X 3LHFA 2VJAA 5LYJB 4H3HB 1Z88A 2WDPA 4FFDA 3PUHA 2DQ4A 1XQWA 3JZFA 4QGHA 3DL2A 3I28A 3CCBA 3IILA 5EWMA 3WSWA 1J2JA 2AHOA 4N7BA 5A5GA 2E89A 2VDNB 1YFZA 3QMVA 1O94A 2O6HA 3KHTA 3EHDA 4DUGA 3DLCA 4I8DA 4WNYA 1EZZA 1T2VA 5AHOA 1UQUA 4JS0A 3THYA 4BNIA 2O1XA 4L95C 2L42A 2HCFA 4MV7A 2VHJA 3K0FA 1XA3A 1JMYA 1I6KA 1YTLA 2XDYA 2WY2D 4RNCA 1LSOA 4DM7A 1I7SB 1WTAA 5DN9A 3IDSA 4P6VF 5KIAA 1GG2A 2X7HA 4MEBA 2RHGB 3HPRA 4UZSA 2VP9A 3PE4A 4G8JA 5F1YA 1QIKA 3HUUA 3Q0IA 4R5HA 2C42A 3LCMA 4QUGA 4R8LA 5SY9A 1AT1A 4RDHA 1CZHA 2FZEA 4DG8A 2YNMC 3HSYA 3QZUA 4BLUA 2PL9A 1VG9B 1ZY2A 4UCFA 5J4LA 1VQ1A 4BNTA 2BGJA 4Q9IA 2EKDA 3RFTA 4FOSA 3UQYS 3K6SB 1VPTA 5JS6A 4ZIRB 3AI7A 3ZZUA 3UEOA 1FUUA 1U1EA 2D4AA 4NCBA 3AVTA 5DXFA 3BGVA 2I4MA 4RVGA 1W9MA 4N40A 1R64A 3TLBA 1RPTA 3CXUA 3AG5A 2E6UX 3TRIA 1Q83A 1E94E 1H2XA 2ZTUA 4RVCA 1ZJZA 5AVKA 2OCLA 1J1ZA 1YACA 3DAHA 3GNTA 3C8MA 4FDVA 4AP6A 1XRMA 1GNLA 2XAAA 2VHWA 4RZ2A 3LHIA 2O7VA 2WZCA 1TA0A 3WYBA 4CKCA 4F8YA 4PYJA 1FP7A 1P33A 1U2EA 3ASYA 5JHHB 4GBED 3V8MA 2WIAA 3WMRA 1FQWA 1Z4MA 4KJXA 2VF7A 1NX6A 4L5AA 4X66B 2JAOA 4DB2A 3KUUA 4JP5A 3AINA 3PFCA 4PGFA 5LN1A 4Y3UA 1C9EA 3HRHA 4NPCA 3S2GA 1YCFA 2WWHA 2BR4A 2DE0X 3DAFA 3GJ4A 3U3MA 3N2EA 4CM8B 1BXRA 3NFRA 5BNWA 2ZOSA 4L02A 1T9CA 1ULHA 3IEIA 1FLDA 4GSKA 1EFUA 4X3OA 1WUTA 2Q28A 2FR1A 4YA6A 2E5FA 4QRHA 3LI2A 1P3JA 1USWA 4BC1A 2FUNB 3QVSA 4ZT5A 2FWNA 2W9XA 4EUFA 5IUJC 2Y3IA 3FVTA 3CRVA 2Y1LA 4JP2A 4MQFB 1A9XA 4A82A 3LNCA 1T5OA 3AP3A 2XH8A 1LRJA 1RE0A 2D7CA 1Y7HA 1YGPA 2W2OA 4IXDA 4U7JA 4CKXA 1Z9BA 3E6AA 5CJ2A 3G0HA 1JI0A 5JSZA 3W2TA 1CNEA 1KDTA 4W6ZA 3UN1A 1Z13A 4XQEA 3O1LA 2HREA 5IKOA 3EC7A 5IM4F 1XXHE 3HUFA 3B1JA 4IIJF 2EATA 5CYGA 2FNAA 4I4TB 1H23A 4RD0A 4RD1A 2B7BA 1WMDA 3JSAA 3AH8A 4C0BA 3AEKA 4AJPA 1U3DA 1VKOA 1CR1A 1OTHA 4K86A 1JDSA 5IKEA 1BHQ1 3GEDA 4EYEA 5IZCA 3K0BA 2GZ2A 2IUEA 1U0SY 1TFUA 1P4GA 1YHYA 2EWMA 4QAQA 3SEFA 1Z5WA 4JWTA 2AT1A 5JTUA 1MOPA 3HDHA 5ALSA 4BGDA 3S1LA 1P1KA 1U2GA 4GKAA 4WLEA 4HDNA 6GPBA 1NKTA 1M9NA 2HRCA 2OFWA 1YNSA 1NN1A 2HA0A 1DWUA 2ZB3A 4ZOEA 1P2TA 2ZTSA 3T0GA 3T61A 1YH3A 4ENRA 2QNRA 4UVHA 3WIEA 1UBLS 1R7RA 2JLSA 2OK7A 4H6VA 1Z34A 1QIJA 1BEZA 2JZNA 4TRMA 4LJ8A 3TQIA 3DO5A 4FOTA 5HQ3B 1F2DA 1C3XA 2G04A 4S1VA 3L4JA 1LLUA 4RK6A 2VNHA 3AQ4A 2XQGA 1GUYA 2UZ1A 1KAEA 1E79D 2FRXA 4YJFA 4LZJA 1Q1EA 5EMLA 4K6KA 1QFYA 3EW7A 4IXWA 5ES3A 4KQCA 4Q9LA 3DF7A 1N7JA 4XD2A 1G5PA 1Q0ZA 4IV5A 5ICEA 2GKOA 3C2QA 1AE1A 5F1OA 4BBJA 1Y8QA 4IO0A 2AN5A 2VPWA 2WJ4A 4GSLA 2AEJA 3EFHA 3KQTA 4H7EA 3CVUA 3HO8A 3JASA 3U4AA 4TT3D 2G6TA 1MQSA 1N2HA 2ZAMA 2NQ8A 4J7UA 5KDOA 5KNCA 4WHMA 2AI2A 2YVUA 1PDOA 2GXAA 4IJUA 4O4JA 4PM4A 3DEHA 4PS0A 4RXMA 3BFKA 1R12A 2OP1A 1WOMA 3BL5A 2C59A 2J9RA 2JIZD 1LI4A 3GRVA 4HYTA 2CGEA 3TIVA 3OZFA 1HYBA 4J7AA 2DHCA 2QE7D 5FORA 3DMFA 1E18A 3LJKA 3I9LA 3DBVO 1X14A 1ECFA 4PAQA 3F71A 5KWIA 2O5CA 3PC7A 4ZMBA 4HYYA 1VG8A 4G89A 5CNIA 1I6WA 4IL5A 1MNAA 3FZEA 1U2SA 1VE9A 4R5MA 4YLEA 4YQZA 2AX3A 1JG3A 3IJ5A 1DIOB 1JZSA 2NO7A 1NHWA 3EGDB 4CYMA 2AMFA 3G5AA 1O96B 1QDUA 4B0OA 1CULC 3L0OA 3JD0A 1M73E 4R9NA 3Q3JB 2NTYC 4R2JA 2ZRLA 3V42A 4F3KA 2DPMA 1UKYA 4RKQA 4ZI7A 4ENTA 1KJ9A 3AIKA 3EZNA 5K99A 2OZKA 2O5EA 2R8BA 3JRXA 4K46A 5HWSA 2PSHA 3C87A 1K8YB 2GI4A 2HADA 4FD2A 3U40A 2QTVB 3GRAA 4GC5A 4UHCA 3U3OA 3IMFA 4Q9NA 3RT1A 3GF4A 4KR7A 3MQFA 2P9ZA 1U8TA 4ENWA 3KETA 3IVMA 3PI6A 5FA5A 1NBEA 3NHSA 3PIRA 3C74A 1SG9A 1X74A 5EGNA 3BB3A 2REQB 3HP4A 3PC2A 1L5FA 3VPFA 2OGZA 3GZJA 3GYGA 5E9WA 2OUIA 4KFCA 1A5SB 3QE9Y 2FWMX 2B1RA 3GAAA 5C80A 3D7SA 2GN8A 1Y6GA 3GDHA 4CTKA 5K45A 3PT9A 3OPVA 3B1YA 2FSGA 3RGWS 2AMVA 1YZYA 2A0UA 2QN9A 4FFVA 4U9UA 4EGAA 5B1YA 5KYKA 4WKNA 3W05A 3BIJA 4B3TB 1RWMA 2XYPA 3K6KA 4L15A 3EVDA 3HR4A 1E7RA 1UMKA 2QX6A 3BTOA 1I2CA 3I2HA 4LYDA 4XDZA 3L7AA 5TX7A 2XRFA 1TECE 4ZV9A 2V6BA 3OZIA 3K09A 5DNAA 1RD4A 5HDBB 4ZCRA 2ZR0A 4MUBA 4YRDA 4V24A 3R0QA 1IU9A 3UKDA 4JBGA 3OCUA 1P61B 2HK9A 2IEYA 3AVVA 3O4FA 1D6JA 2IH2A 1KXJA 3L3BA 5J2TF 2G36A 1CZRA 3KSRA 5TQJA 3QKRA 2GBFA 5JISA 1H5NA 3R3HA 4G0NA 3TW0A 4FUTA 5AVTA 5JV5A 4R2HA 3AVQA 1MH9A 2GRAA 1X0XA 5KOHB 4XM0A 3ABZA 3LO5A 1S7CA 3QXSA 4IIVA 1KZHA 4NFLA 4LMRA 1P31A 1GL3A 1YIAA 2BDUA 3T4UA 3UQZA 4CMBA 2WJYA 2RB4A 5F5NA 3RYTC 3ZCXA 1F6BA 4IMJB 1MORA 4DA8A 3W77A 4IV8A 1Y3IA 4MWDA 4I7EA 1XTSA 4KSCA 1PZXA 3QF4B 1E1NA 1NMQA 5A5FA 2UZIR 1NBMA 2NQ2C 4AY6A 4R16A 3EGWA 1VHWA 3ZVLA 4J3JA 2TMGA 3N2YA 4MVJM 3DBRB 4UXJA 2G8NA 1HPLA 3EXIA 4DGSA 2IY9A 3PRJA 1J9EA 1TQHA 2XZTA 3ESQA 3PF8A 4KBYA 4LF4B 2HN9A 4H18A 4OJMX 2MJLA 2UYCA 1SVKA 4XSVA 4YCSA 1NKSA 5AM5A 4I1RA 2CC2A 4Z4EA 1CC1S 5FNVF 2H9YA 2CE2X 4LXHA 2ZUBA 4ND7A 1P9OA 2CMKA 4KE6A 5G3ZA 1XR3A 3VNBA 4NJEB 1NG9A 2Q5LA 2XSZA 2Z1NA 3IQHX 2SNIE 4LJLA 2ZUEA 4JL5A 5GIOE 4QAJA 1OVMA 3F7NA 4KE7A 2YJZA 3H0KA 4CL8A 1WP9A 4Z9YA 1VTKA 3GRKA 2TMKA 3CKKA 3PJEA 3CMMA 4ON9A 3TNLA 4Q00A 1YZNA 1KP3A 821PA 2JHFA 4YMHA 2SICE 3IMGA 4LYJA 4UM5A 3ANMA 2OHFA 3DTNA 3EJWA 1LC3A 1CQPA 3NT4A 3ILHA 3OZVA 1BW9A 3TRJA 1YL7A 4PC7A 1NVDA 2VRNA 3EUAA 4M46A 3BMNB 4NZMA 3DW1X 3I9KA 3UPUA 4Q6WA 3B6EA 1NXTA 4EBBA 4RAOA 3JWPA 1KMNA 3HCFA 3LBIA 3P2JA 2QLBA 3UJ3X 2EARA 4GMFA 2FCAA 2RH4A 4HWPA 4F60A 2DY1A 4DCMA 1N9GB 3K53A 1VECA 3LW7A 4LISA 4MUYA 5KYVA 4YDQA 1T6NA 4G8CA 3M5WA 5F2NA 1Q6ZA 3HR7A 4P7KA 5DI9A 3MCVA 3D3EA 4G9BA 4Z53A 4X9XA 3K2BA 4WXYB 4Z3KA 3FR8A 2YHAA 4KACA 2C92A 1BCSB 1UWLA 4R51A 5HF9A 1M67A 4LNAA 1JIJA 1P7YA 1V1JA 3OIYA 2JATA 2GPYA 4OLJA 4OI4A 1Z7GA 1OFIA 5E2BA 1RXWA 3HBLA 1L4MA 2ZUVA 3B6ZA 3BX1A 3HO1A 3E0XA 1TF2A 1EVKA 1WKCA 2G17A 3G8BA 3KHUA 4TZTA 2AW5A 2Q1WA 2UVPA 1ZBQA 2XA9A 1MQ8B 5TDHA 5LOVF 5HRCA 2PXXA 9LDBA 4YJ2A 3B6JA 1D8AA 2PD4A 4FMPA 4IIXA 3AGQA 2C2ZA 5JPDA 2XVAA 3ENVA 2R7LA 2H17A 1NSYA 3MJSA 1UBMS 4LBWA 1H8HA 1IQRA 1AUXA 1YQWA 2P2SA 1HTWA 2HTEA 2AG8A 5L53A 3DTVB 2C3MA 1ZL2A 2J9FA 5GP1A 1JHZA 1CY8A 3STTA 1Q1BA 3N5KA 4DNOA 5BYKA 5M29A 1DC7A 2GLUA 2WHYA 4DIDA 4ZT4A 4BO1A 4IKPA 1T8YA 3QJYA 4F45A 1XZLA 3GCXA 4Y7CA 2XRYA 5ELLA 4YUAA 1YL6A 3TJRA 2GDZA 4D74A 2H11A 4OTZA 1OT3A 2FPPB 2WW8A 2G70A 3DLAA 1GLVA 2CCJA 4XQ0A 5AW2A 1SCBA 3EOBI 3MS2A 4M1YA 1LJLA 2BKVA 1Z8FA 1E3WA 2UYGA 1C3VA 1L7AA 1ZJ6A 4YP9A 2IXAA 2OBBA 1WMBA 3H5RA 2ZVDA 4DAEA 1ZC3A 3T5CA 2BUBA 3UK0A 3THRA 3KLBA 3OOHA 1WRBA 4RPHA 5DTRA 4BGUA 4YPOA 2J1LA 2XDAA 1T2FA 1T0UA 3ZV5A 1FNBA 3L1HA 1YWGO 3M6UA 1TZMA 2O2IA 3E05A 3M6WA 1ZKMA 4QYSA 4MUKA 4DBLC 3DLBA 4W5NA 2HJHA 1Q1NA 4AYTA 1KDRA 4URXR 3W5AA 1OZGA 4WVLA 1DADA 4LHZA 4J1SA 4WERA 5A4KA 9LDTA 5KBYA 2VT6A 3AR8A 3KKQA 1FRVA 2C4VA 5HF5A 5KQLA 1JIXA 1SXJA 3VHXB 3GLHB 1JIIA 3Q87B 2D13A 2H0QA 2XADA 4TKZA 3AEUA 1ZMRA 2NO1A 1U1CA 4J4BA 4JQYA 1G291 3CEJA 2WT8A 3CO5A 4KRXA 1NXQA 3CUVA 4RY0A 4EQ6B 2MCFA 5CITA 2WAXA 3HSSA 3LXUX 4HQLA 1QYXA 2HM7A 3QEBZ 4QDOA 1N77A 1OX6A 4FFRA 3RR2A 2QMQA 4BQQA 1Z06A 1NL3A 2P6PA 2F1KA 3FWNA 5EZ5A 3KX2A 2YWXA 4ZQCB 4KI0A 5BSHA 4IIYA 1RRMA 1TMKA 2REBA 5AKHA 3GFVA 3JZIA 1YI1A 1QP7A 2RGEA 3D7NA 1SJ9A 2IP1A 4MH0R 3KEMA 3ZWKA 2XUDA 2K4MA 5DTMA 3ZZTA 3V32A 2P2DA 4QBFA 3BF8A 3EPJA 4TZ0A 2FPXA 3KOWA 5G1PA 2GJKA 2DMRA 4O5AA 4P7GA 3AVYA 1ZN7A 4XYLA 4D57A 2V7XA 4CT0A 3F2VA 2PWAA 4L51A 3RK1A 1QIEA 5LQJA 3TI9A 1RIFA 3K4HA 2PEYA 2FUKA 1OFUA 3V46A 1IN8A 2PKCA 4RA6A 3Q8KA 2Y1EA 1R88A 1IM2A 4FWIB 4IQ0A 4N0MA 4OXXA 1YQDA 1GCIA 1PWYE 2WT9A 3FCUB 2V8BA 3ICWA 1W34A 3QEOA 4Q82A 4ANFA 3EPLA 1VPWA 1T0BA 1KRWA 1YUNA 3RYIB 5JD4A 3HPQA 3S2SA 4EKIA 2IYUA 1NPDA 4KMOA 3CZ5A 4Q19A 1FFXB 4Q9DA 4EJMA 5A0TA 3QTTA 1ZISA 3OLVA 4KNWA 2PUHA 1LK7A 1ML4A 2E1RA 3CY6A 4Q4JB 3ABIA 2B35A 4XSGA 5E6UB 3T3NA 5IBQA 1ZMBA 4HDSB 4NXMB 2C88A 3DBHB 1JEDA 1ZM4A 2VDOB 3FF1A 1WZUA 4FZ5A 3LD9A 1UJCA 1NZDA 2HTFA 3UT0A 3VVLA 1SKMA 5AP9A 2V6JA 3KPYA 2DQYA 3HUDA 4OIFA 3M3HA 4GXQA 1C4WA 3PR2B 4I3FA 2I65A 3S44A 3TM4A 1PGPA 2QR3A 1L0BA 1U7WA 2IXDA 3MT9A 5DNWA 1R3DA 4R9RA 4CMHA 4BV2A 2C7QA 2IGTA 2XF8A 5I51A 3Q98A 3CV3A 4TN1A 4C3UA 3HV2A 4R2LA 1QVVA 4LS3A 5K8TA 3A4VA 2QPAA 3GJ5A 4I46A 1ZOPA 1XDZA 3EMBA 2X5KO 4A16A 2NU9A 2C4UA 5FX2A 2ZS9A 2FSFA 4X41A 2CHGA 3I39X 1ISIA 5EOVA 3WDMA 4F5ZA 1BN6A 4N3AA 4B6RA 1DMRA 1D0VA 3LBNA 1Z5ZA 3BRWA 2GSWA 2LW7A 2P1ZA 3OX3A 2KBFA 2FMFA 3L49A 5FO1A 1GPNA 4CFYA 3BL8A 1LPPA 3GJRA 4G5FA 4UEJA 1HNWB 3ESYA 3P9IA 3F6CA 4LJRA 3ACBA 2M1XA 4HF7A 4M0PA 4DR4B 4UEWA 2WG2A 2E5WA 4UTXA 2CDBA 3HCDA 4G0OA 4TYMA 4I9GA 1DXHA 1WWKA 4ADSG 1CVLA 2VDKB 5H0IA 1E99A 3ZY5A 4QUDA 1HM5A 5BUZA 5FOWA 3ORRA 4MK4A 1T5SA 1RBQA 5F51A 3B7PA 1GGHA 4ZP1A 3R0IA 5AW5A 1XJ0A 1R4NB 1MIHA 3SQXA 3BD9A 1SVIA 5KKCA 4MVWA 2C2XA 3DEJA 1UK9A 1V1RB 4QGAA 4QREA 3W9YA 3CLKA 1J9GA 2Y6UA 4NSNA 5BUCA 3GJ3A 4MYUA 2WU8A 3EA4A 1V43A 2CW5A 4G1FA 1ZVQA 4P0TA 4Y1RA 4D0NA 1WF3A 3KPVA 2GFHA 5IRCD 2GXQA 4FGWA 2DEUA 4IX9A 3HKDA 1G3IA 3W2EA 2W2NA 1EJ6A 2YY5A 3DP9A 3JVVA 2QOEA 3QFTA 4OEHA 2PT5A 4AUKA 2WFAA 1QC5B 3I9OA 3CE6A 1JDTA 3N0RA 3QVXA 4ECEA 2F2TA 3GZ4A 3VC2A 2CXPA 5AHWA 1U9IA 3RRYA 1U5BA 2LD4A 5EXPA 1UM9B 1DJQA 1EFRD 2WYHA 3ZKWB 3ZZ1A 2IYNA 4PGHA 2W2VA 4L4RA 4EW3A 4H0NA 3MWEA 3U7FB 2CWDA 1OZAA 2Q5HA 2BEVA 3SZGA 5CCXA 5E1MA 1E9CA 4BLQA 3R0JA 1E59A 2IW3A 4K9SA 2VS1A 2HX1A 1AO0A 2O14A 4UW9A 1T9ZA 3WL6A 1MLDA 1UJ6A 3L8EA 3RQIA 1VCOA 5IARA 5JG7A 4XYMA 2RK4A 4E70A 5F76A 3QH4A 4MIYA 4R1UA 4MV5A 3CNEA 4H4EA 3ZNQA 2NP6A 5EKTA 2W7TA 3CZCA 1BH6A 2XJ9A 4HGOA 1C1DA 3OD5A 1K3UB 3A36A 3AKYA 1M6VA 3VNAA 2JEOA 4U2GA 5JCZA 3R7AA 2OO5C 3JV7A 2PAAA 5BQOA 2G1UA 1V7PC 1XKXA 3N2IA 4BNDA 3GRCA 1PFUA 3D0OA 2VHVA 4C6SA 4GMGA 4FDUA 4LNHA 4E03A 3QPCA 4KN8A 2IYEA 3TNJA 3W04A 1OLOA 2AOUB 1OX5A 1YR3A 1T9AA 4A0RA 3LVBA 4C2BA 2PFGA 1SU4A 3F8TA 5ER9A 2YCBA 4P9NA 1C7EA 3DFIA 3L84A 1IMJA 2YR0A 4CU2A 4QO8A 4WT7A 2R68A 5FR1A 4QPNA 2I91A 3EFOA 4Q4AB 1C29B 5MGBA 2BM1A 4EYKA 1AY0A 4QBKA 3KSUA 4BMPB 4OQEA 4P38A 1V8PA 2IY7A 3A6GA 1FPMA 4NP6A 2VPZA 3CUWA 2CLOB 3DOCA 1KO5A 4DDTA 5EXXA 5ADHA 2VQ6A 4F92B 2DHDA 2PMEA 2CV1A 4YCAA 4MR9A 5GM1A 4HDOB 1A8HA 1V3TA 2EFEB 2GARA 1UAYA 2EF0A 3UMBA 3FVRA 2H3EA 4G0MA 4RVNA 3BICA 3NUZA 1K92A 4X7RA 2W2MA 1PNRA 2G5TA 1RPAA 1G3UA 1SHZA 1ZOOA 3H5OA 3CA8A 1JHOA 1MRZA 2BTQA 3AF0A 3JQAB 4I9HA 1Z4OA 1PEDA 2X3FA 5E1DA 2EGUA 1VJTA 2OHOA 3X1XA 1MXHA 3O1IC 1Z5NA 1H69A 2JLQA 2QMHA 3PWKA 4QIHA 4TMWA 3R6LA 3IP1A 2GN4A 4JKOA 1RIIA 3KQVA 3H0CA 3QFHA 4RMJA 2BFPA 1YDWA 4QEKA 1L1RA 3ZVRA 2I6TA 3ROTA 3RODA 3AJEA 1QGOA 3L1IA 2LKDA 1Q7CA 3O7MA 3RLIA 2ORWA 3E03A 3KKOA 2ACEA 3FN4A 3OKFA 1LU9A 3ONVA 4Q9AA 5DASA 1OH6A 3NKLA 4OHBA 4IZIA 3A1VA 1FUIA 3OEYA 2ECOA 4Q03A 3BH7A 2TECE 4ZDJA 4GMKA 1ULSA 2EU8A 2XUZA 3KQHA 1XMXA 1GUBA 1GN9A 2Q27A 2V7GA 4CXMA 3PVSA 3NJ4A 2DHEA 4AK9A 1E69A 2X5OA 3LPLA 2VHXA 3MMPA 4F5DA 2Q5FA 5K0EA 1TTTA 4YECA 5KYUB 1JFTA 3IESA 2ZIEA 4PC2A 2WHPA 1M74A 1EUDA 1E4YA 3QQPA 4HRXA 1YZVA 2Q6LA 3U39A 5K3AA 1RI4A 4D42A 4Y9SA 3P2KA 4REQA 4BFCA 3TCKA 5GZ3A 4ROTA 1I1HA 2I34A 4O02B 3IBFA 5DYTA 1FW6A 3ZPXA 4D79A 3EXG2 2NU8B 3VJKA 1DQNA 4QJBA 2RHTA 1UK6A 3K5PA 3RSFA 3NJ8A 1I2BA 1QLHA 2AWNA 4BFLA 2F59A 5E6RB 7YASA 1U1IA 1DKUA 1GPWB 4BB9A 1Z63A 2QSUA 3Q5GA 4YYZA 3QX9A 3X3HA 1Z8NA 2H1HA 3HJTA 3MA0A 2OP0A 3ZU5A 3G9UA 4C3ZA 3GFPA 4RTSA 2VZ8A 5J43A 3T5PA 4KRFA 1RHQA 2FRVA 2WTAA 1SHKA 3HXTA 4A8HA 2Q5OA 3IAFA 1R3UA 4HAYA 5EXSA 5L7YA 4PO3X 5M3BA 3TLEA 4PLZA 4YJHA 2H1OA 2WUFA 2BH9A 4DIFA 1JHXA 2XWQA 3I72A 2GB4A 3COVA 4DLBA 4ZOLB 3EWSA 4NU8X 1JQ5A 2FPMA 2RC5A 2VR1A 4YMLA 5HM8A 4UUOA 2IU4A 2ON6A 3IT3A 4YCLA 2VTBA 4RM2A 1Q1GA 4MV8A 3AOEA 2VATA 4X97A 3EX7C 2XIQA 1R8QA 3CQ9A 3O3NB 4RJIA 2OGWA 3EXFB 4WBXC 1EK5A 4FXPA 1XMJA 4GPIB 3UT5B 4DDKA 2J0QA 1U98A 2Z5FA 3CB2A 2HLHA 3JZAA 1V9CA 1WEKA 2ZVJA 1X3SA 1FC0A 2ACVA 2QRVB 1JPJA 1TYAE 3FMGA 3HKCB 1G2OA 3IAM6 4GOJA 2HJGA 4X8LA 4A26A 3HE3A 4G01B 4UNQA 3PCTA 2HCJB 1QOQB 1L7PA 2AQKA 3HVJA 5CTAA 1SQSA 2ADFA 3HZRA 4J0JA 5HG0A 3HU1A 1P19A 2QLMA 2XZDA 3KEQA 4Y67A 4DRXA 1TPYA 5FPSA 1S2DA 2NYAA 2QUJA 3SZOA 3B60A 3V2HA 2IK8A 2CMDA 3VC7A 2B5OA 4TYWA 4H27A 4B8YA 4HVCA 3K5HA 5JXGA 8ATCA 1W44A 1KVTA 2DPLA 2FSUA 1KI6A 2R7AA 3OHMA 3FYSA 4W9RA 1Q3HA 3M4YA 4JASB 1C80A 3C5CA 4F4UA 5DISB 4B3MB 1XZGA 1JKJA 1IHDA 3E3LA 2DOKA 1NDHA 1WG8A 3MUOA 4UHDA 1B41A 4NJMB 3VTAA 4BVLA 3GLFA 4IOMA 1IPEA 2FFQA 1RJ9B 2OYSA 3CW8X 3H2GA 2G28A 4O4JF 5FL7D 4TX1A 1PI3A 2OV4A 2HSJA 3N6RA 4M0FA 4IH9A 1QPGA 1K6EA 3O21A 2E4VA 2VUHB 4X3PA 1YC5A 1N2ZA 2C82A 3CR8A 3KXIA 3N05A 4HAXA 1YHNA 3MQ2A 2PE5A 1DNPA 5CVCA 4AJHA 4F3YA 4F85A 2WJAA 2IHJA 1RLMA 5TARA 2BH2A 5F9FA 2IOFK 2GAOA 1LLCA 2PBZA 3AHDA 1AJEA 4LJYA 4PLPA 4EX7A 2RK6A 5C4MA 5HR5A 1V48A 4HGRA 1AMOA 2Y67A 4OP2A 4MIKA 4PCUA 3OPQA 4L50A 1I32A 2E7ZA 2WMOB 4ZZ3A 1Y0BA 1HYQA 4IHJF 4BVHA 2ENWA 1LD3A 3G1TA 3PG5A 3FWKA 4EVIA 1U6IA 5DYWA 4HB0A 2O8BA 2R8PA 2ZXFA 3G2KA 4P1ZA 4J0HA 1G66A 3VR6D 4ZDKA 4TKUB 2DY0A 1T3TA 2AE1A 4U7DA 3IUQA 2BBWA 3DWEX 1Z25A 3W6OA 5HRAA 4HEHA 4HZUA 4D9CA 3ZZMA 2HO4A 16PKA 4DEXA 1YZUA 4I8XA 3R23A 1U8CB 2GD2A 5LQDA 1C2TA 4OD0A 4FN5A 5JWHA 2BFBB 2RI6A 1MENA 2C99A 2Z04A 3KOUA 3WV5A 1K2VN 3RIXA 4C2TA 3L7MA 3CLSC 5DF1A 5EP3A 2JFBA 3V4VB 4GWLA 3BL6A 3L0IB 3VO1A 3WG9A 3B6MA 3SKYA 3JQEA 5EE3A 2Q6IA 2JIBA 4GXTA 4XFJA 3K0CC 4NBWA 1GO2A 3SZRA 1B0PA 3GJ0A 4WOKA 4LBYA 2I2DA 1ODCA 1AKNA 1L2TA 1SBNE 2QYHA 5HRUA 1SCUA 4C08A 1HFEL 1QWOA 1R6UA 3M3PA 3TPCA 1W4CA 5FBHA 4Y2RA 4MR8B 1L5LA 3H2ZA 5DLPA 1EFAA 5IH7A 4N48A 4BFUA 2PZGA 4BP3A 1UJNA 4BLWA 1PDVA 2QTLA 1BQEA 2DHRA 2GPAA 4J0KA 4JBWA 1N7IA 1SO8A 3DLIA 3OJXA 4UUQA 3VUFA 3ILYA 1O3YA 1X8XA 4L5JA 1REQB 3K8ZA 4P53A 3V1NA 4PNPA 5B12A 2VKQA 2WJPA 2YINC 3EUFA 4JSYA 4LOJA 4M83A 1KSGA 2FFAA 1BNCA 1QF7A 4YEDA 5M04A 2C9BA 5IABA 5D7NA 3BAFA 1G1MA 4YGYA 2JVKA 2NZ8A 3DOHA 4XEUA 2HT1A 1LBIA 4RTQA 5I7SA 1ATZA 4O4IF 3V8QA 1NUQA 2QRLA 1EESA 3UUGA 1KMIY 2Q7XA 1IJEA 3UTCA 3H5LA 4BP8A 5ALVA 4CQNA 3E7PA 3QUAA 3A6EA 4CL3A 1IYZA 4CODB 4D9BA 4TYQA 1CS0A 1TZBA 1O6BA 5FP0A 1P0IA 3AUJB 5HF8A 3IOCA 2PHZA 5ADVA 1MX5A 5L40A 4OFBA 1VG1A 2JLCA 4RZSA 2XWSA 4FJ2A 1QGED 1OX4A 1LDEA 2PG3A 2P1DA 3NEPX 4F93B 3EK2A 2QL6A 3IP8A 4WV3A 2OCDA 3TQOA 5A4AA 5LPNA 4NOMA 5HJEA 1SY7A 4JI5B 3CLTC 1BROA 3CSDA 4FGUA 4HBGA 5KOIA 3A9UA 5FQOA 3GQVA 1Y4AE 3LL4A 3GLIB 1A8SA 2EYUA 1J56A 1Y8CA 1YDFA 4U2CA 2Q07A 4UTPA 1CUEA 1JA9A 1O89A 1TIBA 2W71A 3I04M 4WNAB 5NLLA 3UFXB 1E2PA 2C54A 5C4GB 4MQ5A 1YHZA 4K2HA 4QFDA 2JI9A 2R5WA 2HJRA 2SCUA 5FTWA 1E9RA 3A4LA 4F3NA 2M1ZA 3O75A 1I36A 4UBJA 1TO1E 3Q41A 3B48A 4DLSA 2HNAA 4II7A 3U19A 1RZRA 3PI7A 2BCEA 4IG4A 4ERXA 1EP2B 3D64A 3M1LA 3MXTA 4D41A 2GBCA 2BW0A 1UBRS 4XWGA 4F6RB 3M6FA 1Y7LA 1R27A 1H2RS 1AX9A 4C9BA 3QKSA 1YQTA 2JK0A 3KR0A 4JC4A 1PR4A 2AVNA 4KRYA 2NLOA 2JLAA 2ZCUA 3FBWA 3MTJA 3T9BA 4ZO9A 2CLEB 2WUGA 1G2QA 2MSNA 1JV2B 2KHZA 3DVAB 5IMBA 2GVDC 1HT3A 2INGX 4EG7A 4E5NA 4P4NA 3VKVA 1R0ZA 3BK2A 2O2CA 3WRVA 1FZTA 3WTCA 1Y1LA 2QVXX 3B2QA 5FTKA 3W1WA 1GQOA 4D4LA 1XWWA 2QHXA 4R1MA 1Z39A 5AKGA 4ZVUA 3HM9A 3IAS1 1XAJA 2YMPA 1FRNA 3HHEA 4HNHA 5JXWA 1ISFA 4N6NA 4YI5A 1FSPA 1HZZC 5F1KA 3ZOKA 3T38A 1QG4A 4PY2A 2EIHA 2QM8A 1RXVA 5FI3A 1ZUD1 4KL8S 4ZCPA 3T0FA 2X2OA 2XCSB 4ASUA 2C3PA 3GZNB 4OOEA 2CXXA 2X0JA 3D3NA 3UW1A 1TT7A 4A6XA 4FCVA 5GQSA 2JGJA 3NBQA 4LMAA 2QMOA 3ZNPA 1NIJA 2QSZA 4R2WA 1WXEA 1EXWA 1SU6A 1BD4A 1RWVA 3DG9A 3LV8A 2VJYA 2WWFA 2HF7A 1F8UA 4HPXB 5LA6A 2YZMA 4QXRA 5CYOA 1N2CB 4C7JA 5A02A 2BI4A 2EG9A 2PMFA 3AHFA 2HRQA 3P0JA 1O0BA 4JI7B 4YJ2F 2I6QA 2UYQA 4EB6B 4K6OA 4RF4A 3LYLA 3HB9A 4GGMX 4U63A 2ZPUA 4PXAA 2HSDA 5IVHA 3C39A 2DFLA 4JLMA 3FDZA 1VL6A 4LK2A 2G4LA 4HH3C 3G7NA 1FFDA 3VDRA 2ISCA 2YWJA 4AXBA 3UK6A 3UXYA 5ICCA 3FH0A 1VLJA 4L3WA 1TEZA 3FPHA 5CMLA 3QXXA 3UXEA 3OZRA 4Q3LA 4KITB 2RGGA 3ZQUA 4PQRA 1E63A 1OILA 4DA4A 5DNCA 5CA1B 5JASA 2PJUA 4JHXA 5JRZA 4RHCA 4HV4A 3Q1KA 1X7YB 3RS2A 3MMXA 2QVLA 3RS9A 3TMYA 4L8LA 5IAGA 1L7NA 3U0VA 3UUWA 1M75A 5EJ6A 4YWHA 2VDPB 1RACA 2FPGB 1SUFA 4H7PA 4PFQA 1RC8A 4XQCA 5FBZA 1ZP6A 2FQYA 3NDPA 2DM6A 1U28A 3GJZA 3KKZA 3NPAA 4UDNA 5K51A 2Z3ZA 3IEKA 1V8OA 4U5XA 3HDTA 3OEHD 4PICA 4BC0A 3F3YA 1QCCA 2DPXA 3B20A 1LTKA 3D43A 3VQTA 4D25A 3PPIA 3TUIC 3HY3A 4I1IA 5KJFA 2OGSA 3X43A 1JHVA 1ESEA 1KYYA 4G4IA 3VUEA 2XA1A 1IMOA 4NV1A 4X1KB 4F21A 1Z17A 4IS3A 3MCWA 1UC5B 1Y37A 2YNMD 4LY9A 3D8SA 5E4FA 3ZVMA 1MRNA 1LBSA 2YXDA 3ADPA 1XNJA 4PIPA 1FNCA 3HB5X 2VHUA 1SBZA 3V7NA 3B9PA 3A9SA 3VR4D 3B5JA 3DSRA 4INOA 5AHXA 5CLIA 5FCDA 1ZQ9A 1VRVA 1K7FB 4C20A 1UMDB 4QNRA 5H82A 2BONA 1W47A 3M6LA 2VXOA 3OY2A 5B2FA 1E7QA 3LQ1A 1AKVA 1U7DA 3ZJUA 4E15A 4U3JB 3BN3A 4FDMA 4LECA 1HTTA 5CYPA 1ZH8A 2EVWX 2ID9A 4J2OA 1ZL0A 4M0KA 5THQA 5B64A 2H07A 2ASEA 1ZGGA 2ENUA 3ETJA 5AI8A 1WO8A 2D59A 2XGMA 3D6HA 4D0GA 2HWYA 4ARIA 2VDWB 4RVOA 3VR1A 1CP2A 1PCXA 4BS9A 1GQRA 4M8NE 5KINB 5FJJA 4HC4A 3PEYA 4QVIA 3ZJVA 5B58T 3D0RA 4BN4A 3CF2A 2QL5A 3KUXA 2OD7A 3N2NA 2LE0A 4URYR 2B1QA 2UYHA 1S8AA 2FEPA 2JBAB 2WOOA 3EMKA 1M6YA 5H4HA 5DGCA 2B82A 2X0KA 3RU7A 1PJ2A 5AVSA 2WIDA 3PGMA 1TJNA 1FP4B 1UQTA 3I9FA 3N2GB 3NJRA 4Y1EA 4MV9A 4A36A 1ONNA 4LV5B 5JZ9A 1DKLA 2QTWB 4A2PA 1OFGA 2P8SA 1XXHA 1ORVA 4IIFA 1A4XA 2C9CA 4L76A 1XC7A 5HQJA 2X0DA 4RVHA 3HDVA 3RKUA 4BX3A 4DPLA 3VYVA 4Z4FA 1JILA 2IEAA 5AR1A 1P1BA 2VSYA 4L9RA 5LZ4A 3JD1A 2AI3A 4NE7A 1UXHA 5FEUA 4GKKB 2WF7A 5JQGB 3AR4A 1QANA 2C2OA 1RZ3A 1NRWA 1XVTA 3M5PA 5A4IS 4OU4A 3PCRB 4GDMA 4AS3A 5LD2B 5KC8A 4JSTA 3A9TA 1E79A 3MCAA 1VJ5A 4A6DA 4Q0MA 3QVUA 4PPQA 1U65A 1NQUA 3HN2A 3OY7A 2EX4A 3ZS9A 1TKBA 3ANXA 4ND1A 1YOBA 3H7IA 2CNDA 3H9JA 2HIHA 4QYTA 3GLTA 4POAA 4Y0VA 1H6CA 1AURA 1ZU5A 3TOXA 1L7DA 2WJ6A 4QYIB 3CRW1 3OTGA 1QGUA 1RADA 3Q8LA 2O0KA 3DZHA 1RZVA 2JGFA 5AVZA 1MB4A 3TAXA 3P97A 4EX6A 1NW9B 4TT3A 4QGGA 1Z6YA 5SZJA 3PGA1 2IHNA 2GZRA 1U1FA 1M7GA 4ICIA 2PL5A 2AVDA 3K15A 1CR2A 5K2OA 4UNIA 1UDRA 2JLUA 1TM1E 2JIZA 4ER6A 1V8FA 3X1KA 1HOTA 2W8BB 2PZMA 2ZB2A 1LDGA 3BILA 4FCTA 4OB8A 3C7DB 2PNJA 3MWDB 1U0FA 4HXYA 4IFIA 5EKDA 2FPLA 4R7ZA 1XEWX 1L7OA 1Y9EA 5AJTA 4OMFG 5T4FA 1IG0A 2VDRB 3KKMA 4LDZA 3UUFA 4AG5A 9GPBA 2J3JA 2ODWA 4PZEA 4FI3C 1DAMA 2RB5A 3LX4A 4XCXA 5IK2D 1TNDA 3JQFC 4U6QA 1N2JA 1SGWA 5EE1A 5DNDA 5EPUA 1XEXB 3IPAA 3RSGA 2C5EA 5IDXA 1T6YA 4EZEA 2I87A 4FN4A 3IP6A 2IU3A 3PENA 4EIWA 4MQMA 5KX5A 4WGFA 2E0IA 1KZ6A 4LYYA 3C7AA 4D3DA 1CZNA 3AFIA 3S2UA 3M1IA 2DKOA 4MEJA 4RH1A 5GOZA 1XK7A 4K3VA 3EWIA 3AZQA 1PD0A 2WIFA 3UV6A 1L7EA 4E11A 1R5OA 3REGA 1NTRA 4CR7A 1E3JA 4J1NA 3GGJA 1E1CB 4UEQA 3AILA 5GONB 3V8VA 3ZDZB 1ZR2A 1O4WA 3L8DA 3NC1C 4N01A 4QUAA 4FNMA 2FG7C 3U7IA 2RBKA 1SG6A 2UUCB 3B8HA 5L3VA 2VRCD 3H1PA 4L9WA 4F06A 5A4JA 1HRKA 2DT8A 4UNNA 4YRJA 1JE1A 4RS4A 4KGVA 4B8ZA 1RTKA 1N6PA 3AETB 3H2SA 3WR5A 4X71A 2R44A 4DEYA 1W36B 2Y05A 3OT1A 5ILOA 1BJRE 1OPRA 4WZAB 2BE7A 1X1QA 2QT1A 3ZBPA 2EZ4A 4JMLA 5LD2C 1A98A 1DVRA 4MB6A 4DQUA 3AMVA 2QF7A 3PC3A 3UBMA 3KOYA 5IEBA 3DMGA 4DREA 5KJ6A 2QTAA 3EZ7A 2B1GA 5A6SB 2HHJA 4NBLA 1BCRA 2H5LA 3UBTA 5AJZA 2Y1XA 1TQ4A 5BURA 1KOLA 3D5TA 2JRCA 3LOPA 1Y6JA 3DBLB 1I2MA 2CBXA 3LKVA 2WAMA 3RWMB 2ZBVA 3E9YA 5IP5A 2ZSBA 2LWIA 3BULA 3OQNA 5G0SA 4I1OA 3CZRA 3HNOA 4WH0A 1Z29A 1E1LA 4XUGB 4UUMA 3RRJA 4HH4A 5C7YA 5ELXA 4MAFA 1ZESA 2BEUB 4TTVA 2NZ2A 2R7MA 4DJJA 5AW4A 2Q6VA 5HZMA 1G64A 4P3OA 4DMCA 3B1KA 2N46A 2NW6A 1TLLA 1D1TA 3PR1A 1IN1A 1E0KA 3EGIA 1QRDA 4C89A 4FGJA 2WQZA 4MQ4A 3O8NA 2Y4NA 4RZ3A 4E5MA 3LX5A 4ZU6X 1XMIA 2EJUA 3WMGA 3U7HB 3KE8A 1C4OA 1XZBA 3FFAA 1VE7A 1Z15A 3SHFA 1SHUX 2JJYA 3LK7A 4GYWA 1G19A 1TADA 1GA1A 1L4GA 4BZQA 5HS4A 5I9TA 1IIRA 2VDVE 4ZHQA 2NVUB 4D3ZA 2PFKA 1N78A 4V0KA 4DR5B 1NX9A 3A58B 5JANA 1F6DA 4YIHA 3UWPA 4EK9A 3ZGOA 4DMGA 4N7MA 3F9CA 3U48A 1X87A 3W7AA 3WLFA 2UXBB 1A7KA 2XW6A 3AHJA 1MN6A 3DNFA 3E8MA 3CRMA 3EGOA 1H0KA 1UZAA 3AYXB 1QAMA 4NULA 1JECA 3BMOA 4B6SA 3WWPA 5CEJA 1CFJA 3NYWA 3PT5A 3JXEA 1E9FA 3HKBA 3L7IA 5AK4A 4B44A 2YTZA 3BWVA 1C8LA 1BG6A 5HOEA 1WW8A 4BCDA 4GVXA 3RK0A 3RIEA 1IL0A 4UVDA 2P3QA 3G2MA 3RHZA 2RCYA 3CCFA 3O95A 4K5QA 1C1XB 3AFOA 4NKRA 3ZC3A 3EPHA 1XL1A 4Z7QB 5E95A 5KYWA 3ZCTA 4PRLA 2AYZA 4QDUA 1M8FA 3UK7A 4MPPA 2GCEA 1P77A 1XZ8A 2D7DA 2FPIB 5JUWA 1LSJA 1XCGB 2GCOA 4IDAA 2H57A 4LXGA 3WHPA 2J46A 1BMDA 5BVHA 1EDZA 2EFHB 2BLNA 1XAIA 2D5IA 2ZULA 1QS0B 2QZSA 4UEKA 4K1LA 4P4TA 2P7IA 2XMGA 4AMYA 5ALMA 3B7GA 1NQAO 2C4HA 1L5OA 4L28A 3P20A 4G5OA 5ERGB 1JUDA 1XF1A 4CKBB 1GTZA 2H2GA 4G36A 3LMKA 2FOLA 3SYRA 4BAZA 5CCEA 1M72A 2WYWA 2GEVA 4ALIA 4EZBA 1RQGA 1F0PA 2G40A 2JIRA 2X42A 3OVMA 1ONSA 1Q57A 1IK6A 4JUDX 3KVVA 1D04A 2RGWA 4KO2S 3OOSA 4MMYB 4LG1A 2Q5JA 4M1WA 3ZEAA 2I8LA 3DKRA 4YXFA 1OU0A 2JCGA 3ZCQA 2ZT7A 4GI3A 3CVXA 5TPWA 5D5HA 1TT5B 2IEIA 1KI8A 2YVQA 4IDQA 4YP1A 1JHQA 1T0IA 3LXMA 5AQEA 3Q0EA 3VU9A 1WU7A 4BE4A 1Q0TA 4NENA 2C96A 2I76A 4XM1A 2NP7A 1XPOA 4BO7A 3BZWA 2IV7A 5JAHA 3IQZA 4EKEA 1PE0A 3DHYA 4KQXA 1ZG3A 1PKEA 2MYPA 2P9CA 2ZJBA 3JWIA 1KWGA 3E22A 4ZT3A 1JNXX 4EY6A 1FP2A 1U94A 3KJNA 1FYVA 4OFXA 5TQ0B 1Z5GA 3UAZA 3OAAA 1DV1A 5CNMA 3M81A 3MJVA 3ZGXA 2NZUG 5HKKD 1CIJA 1QCDA 4Z54A 2CL6X 1Z6QA 1E6LA 4OGWA 1FDVA 1GL7A 1EP3B 1GXSB 3EZLA 3RUCA 2MDTA 1NQXA 3BE8A 3EOAI 4KDRA 4GP9A 5KB3A 4NCXA 3L6RA 4EFDA 2QY6A 3GN2A 5DHUA 5LMZA 5FBKA 1L5KA 4DDHA 1PGNA 5AJWA 2JHPA 5F2OA 4KXVA 1H9BA 5KPDA 2QVCA 1J20A 2Q2VA 3STHA 4WLOA 4AKIA 1G42A 1M34A 4V02A 5DMXA 1DO0A 1DO2A 1LTQA 1UPXA 4X63A 1S96A 1KFCB 2COEA 1BA3A 3LDGA 4YAEA 5IT0A 2Q4OA 4K2AA 2HMTA 5EMNA 5D00A 1L1FA 4BV3A 1W5BA 2YMQA 3I0ZA 1DBQA 3T54A 3T7JA 2MWMA 2IF0A 4TXHA 3U4HA 2NO0A 1HV8A 2D2VA 4S24A 5AVVA 6YASA 3L7KA 4PYOA 3NC0C 1WA5A 3ELUA 1SD2A 1ZN2A 2E4UA 2OCKA 2UVDA 2ZSDA 3G13A 1EM6A 2XLCA 3LUCA 4S0XA 3RC9A 5A3QA 2W6ID 1EWVA 5JIBA 4N76A 3G6WA 4JYMA 4FHFA 1I6MA 4YONB 5LZ9A 1JFLA 2DFPA 1GPMA 4CMIB 3DGEC 5E3HA 2X7XA 4LZWA 3T7EA 3EODA 4CN9A 3S1SA 1J0BA 1M2VA 1Z0SA 3FVVA 5L3QA 1RPJA 1C9KA 2OCBA 1YFLA 3M89A 2B20A 5DYGA 2X2FA 4H7IA 5LLTA 4QPPA 3A1DA 1BHO1 3WLLA 1LWNA 3KQPA 2GRUA 2P40A 2R8ZA 3T7AA 5F1PA 1W46A 2B7LA 4MIEA 4FXOA 2GNPA 1VA4A 1ZGCA 1WULS 3STUA 2P9TA 4DBLE 5CBPA 1J7KA 3U49A 1DAIA 3PU6A 3QI2A 4KTTE 4YHHB 1IM5A 2FEXA 1ZYUA 3JALA 3OFND 5HILA 1OLXA 1O95C 3I1FA 4U7FA 5EIAA 2E5LB 1X7XB 2IVZA 1R6VA 1ZI9A 2I2BA 3ER8A 2BV3A 5C8DA 1JEQA 2X6TA 3RLFA 2WILA 4RGBA 4G0VA 2YZNA 4IIGA 5EE5B 1WABA 3QYAA 4JC8A 3ITNA 3MJRA 5DE3A 1WNTA 4A0SA 3DC2A 5D87A 1GDTA 4L3VA 3I01M 4BMNA 3CZ4A 1V2HE 3JD3A 1QF9A 4EYOA 2RK3A 3DZIA 3ZGVA 4NTZA 5LUBA 4ACAA 4NARA 1I4DD 1P7WA 4YR7A 2ATEA 1WDWB 3PEVA 1NW3A 4CVNA 1XQ9A 2IYRA 3M33A 4Q1FA 3W8RA 3DB1A 3ZYCA 5IJ0B 1E6KA 1ZSNA 1FYEA 2B3TA 2VNSA 3AERA 2VJPA 2XQIA 3COSA 3GJYA 3L7OA 1QHXA 4FFSA 2IEDA 5LNK6 1TF5A 1TKCA 1FVXA 1JFVA 4B2PA 3GRUA 1MC1A 2B9VA 4AUMA 2W22A 1E7WA 1JJVA 2FUG6 2PUVA 4BN5A 3OT4A 4ZVOA 4AMBA 4PN3A 4M1EA 1CY1A 1EXNA 1WLYA 1ZD9A 3JX9A 4RKFA 5EE0A 3S68A 3SK0A 4WCFA 5CPFA 4DBVO 3G5UA 5EHZA 4Z4QA 3DXXA 1A5BB 4LWQA 4EY8A 5G3YA 3GELA 2ZBDA 3EXEB 1U8ZA 4RELA 1EM8B 1MKYA 2Z56A 3M5CA 2I4LA 4NFSA 1T2NA 2AD1A 1FX1A 3R9IA 3BD8A 3T1YB 2Y99A 3ZHZA 3LA8A 3PHJA 3JQGB 1W5EA 4LY0A 3UMJA 2XMCA 2O1EA 3OIUA 3PA6A 2J85A 4F2GA 3PJFA 3B1ZA 2AJLI 4UQPA 1W5SA 2X1MA 4CKZA 4GS5A 4OLBA 4LZNA 4L6IA 1U6JA 5LXTA 2NYRA 4UULA 4BV9A 4LTMA 1EINA 3HNRA 3DTVD 1ZIDA 2Y68A 1ESCA 4YP0A 3M83A 2O2JA 4M6WB 5CT9A 5IT4A 2E2WA 3VHQA 2H1IA 3DEFA 3PVZA 2A1IA 4OHWA 3SHOA 5A9RA 5C81A 2XE8A 3B3QA 3K70C 4MI9A 1N5RA 2ZU6A 3EG9B 5K6AC 1Z35A 4XR4A 3K0SA 4XARA 1T8WA 2JDIA 2VI5A 3GLHE 4M89A 3RAGA 3E4CA 2D0PB 2DWOA 3VZPA 5TMPA 5H83A 1W0KD 3I0NA 1DIAA 2G88A 2H2HA 2ZR9A 4PLGA 3TQTA 5CJPA 1JLMA 3SBXA 1ADBA 4E3WA 1WZNA 1KH1A 4D92A 2GF0A 1LVUA 3AUYA 2PSJA 3WKAA 1JPVA 4MGIR 2IYAA 2JJ2D 2QJWA 2VNJA 5F5LA 5TEWA 3I9NA 4I5EA 2GEBA 4V0QA 2RH8A 2WR8A 4RHUA 3OM0A 4KFRA 2AOTB 3QM1A 2QWXA 4YUWA 1MO4A 3WGYA 4DR2B 4F8EA 4UVIA 2V7QA 4HQ6A 1E3EA 2PKXA 3AY7A 1GQSA 5FPYA 5BO5A 4QPCA 4L5YA 4CCYA 1Z4IA 2Q9BA 4KH1A 2C0CA 3EDQA 4J91A 5LJLA 4H4CA 5F2KA 4OYHA 3RVKA 4EA6A 2H5EA 4P80A 4PONA 5A71A 3LSYA 2ZBPA 2IYWA 1U3FA 3RO7A 5ESDA 4TV9B 4WJLA 5CG2A 1Q11A 2Y1DA 1VIAA 3VU0A 5HKAA 4C3VA 4F1KA 1EX7A 4QVKA 5IZ4A 1EFRA 5FFMA 3T1VA 4AAYA 3C3JA 5FD8A 4IQ4A 1ZEJA 3A2KA 1K5HA 2OZPA 2AUMA 5IUKC 4F9FA 2VPYA 2RSLA 4DB4A 1UKBA 1EAYA 2Z8YA 4FR5A 2G1PA 4UCXA 4UHHA 4ZALA 4N8DA 1NDUA 3SN6A 1AQYA 3S55A 1UC4B 1DOAA 1VCMA 3FI9A 2HAEA 1KJJA 2H9AA 4NBUA 3NTVA 5T64A 3TSAA 1MNQA 3BDIA 4QJIA 1CUZA 4UARA 2A0XA 1U8AA 4WTOA 5AOBA 4YGXB 1CJMA 3SNKA 4EVSA 2QN2A 4HDMB 4B4DA 3CZPA 5L51A 2ADOA 2NO4A 1LSUA 2JA1A 2JGLA 4Q3KA 5FWNA 3OETA 2X1HA 3I6YA 2J07A 3MELA 1CEQA 2C97A 3WL8A 2PD6A 2C4KA 1ZM3A 4MYCA 5DM1A 2NO6A 2RHBA 3BB4A 3WGKA 1WEHA 3FWHA 4FDAA 4Q7LA 5AKXA 4ZV4A 5KQSA 3KZOA 1ZVKA 1NPYA 1BXGB 4MKRA 1KO7A 1N9ZA 2QLTA 4DYDA 5TMBA 2AN1A 3LL7A 3OBIA 1CR6A 1G5FA 1Q6YA 2AS0A 3C70A 3NBMA 4I50B 3DMDA 1EFCA 3D5EA 4NCHA 4P32A 1DC8A 3KTDA 2Z1DA 4X54A 3SC2A 4I9UA 4UM8B 1T34A 1ZSYA 5LA6F 1MZPA 1FFAA 3P4XA 2Q99A 4EA9A 3PJRA 4B82A 5CM8B 2AFIA 1K3FA 2E85A 3FZNA 2QVGA 3EYAA 4P3KA 4ZOAA 5K7SA 3GJ7A 1XTUA 3A1CA 2VWHA 4WWHA 2QIPA 3DZGA 1PAUA 2UVQA 4GPD1 4J29A 2IXGA 4TKMA 5FULA 3A3OA 1KEEA 2QD4A 3QEJA 3H83A 4N0DA 3LY7A 4PYRA 3WLMA 1J0CA 2BRUC 3FIUA 3JYHA 1VBNA 1Z0UA 2GK3A 5ED0A 1SWVA 5FEMA 4BDTA 4ZXFA 3L8MA 2C0QA 1YS1X 4HWOA 4JLDA 4RA9B 4J4TA 1AUVA 1DAFA 2I66A 4YBZA 1N3BA 3Q5EA 4DLAA 2H1LA 2E49A 1A27A 1YI0A 1E77A 2FE4A 2AWOA 2RHMA 3KAJA 2GR9A 2FP4A 3JQBA 1ADFA 4ZEVA 1YB4A 3R9XA 1C8VB 3G49A 3QHAA 1Z2DA 1T5BA 4YJGB 5EHIA 4UDYX 4L0DA 1T9BA 3WKBA 4BLSA 4D8XA 4MV1A 3I32A 1P80A 4IOJA 3U1VA 1FU8A 3HN6A 5HP4A 5GINE 1LVHA 4ONEA 4CLHA 5DLYA 3BMQA 3DEIA 1B00A 4RTLA 1UEJA 2OBNA 2VVTA 3G2JA 1O8BA 4XA8A 1OLSA 1G8PA 4OAPA 4GZLA 4ZAFA 3MLBA 2LXNA 2IT1A 1RYFA 3OIGA 1EWKA 3HL4A 1QUFA 3EDOA 3TGWA 4C6HA 5COBA 4FS3A 2FZ4A 3GYBA 3PJDA 1UPFA 1XTRA 4OY3A 1GV0A 4FHZA 4RIEA 5JY6A 3EQ2A 4RMIA 4WK4B 2ZVQX 5KYNA 4X3CA 5HNKA 1PWHA 3CBGA 4ER5A 3JAMA 3QE3A 3GMSA 1EHIA 5JDIA 3JR3A 3JQ9C 2V7VA 3RVOA 3SZLA 2J6IA 1A04A 2QJRA 1ISSA 5J4HA 1JHUA 1UL1X 4IOKA 3SJ7A 3KQQA 1R4ZA 5FQNA 1CQIB 3FETA 3FPLA 3FZYA 3O47A 1NJGA 1RYNA 5B30A 3PXUA 1B6TA 4RY9A 3V7YA 2DBZA 1KOJA 3HJNA 1EK0A 3HYTA 5A4DA 5G40A 2X8AA 3A10A 1QZUA 1EJBA 1KKUA 4KAAA 1N57A 2P69A 4TL6A 5DBHX 4Q48A 1N3LA 3LP5A 4ZA2A 4V38A 3SFZA 1GGFA 5FA6A 5A9SB 4DR7B 2DH6A 1LPNA 3R09A 5EP4A 4EG4A 2JPDA 1YUBA 3F3KA 1N75A 4OQQA 1WOYA 4YH1A 3NW9A 3GR6A 3BTVA 4OB6A 4NRDA 3RYHB 4HS4A 2AGVA 2WUDA 1ZIOA 4GI2A 4AN0A 5IHXA 5JZVA 3PDUA 4RK5A 4CMEC 5CA0A 3FOBA 3B70A 1ECJA 4FHEA 1A2BA 1G55A 4DLVA 3OKAA 3ROQA 2I54A 4OMDA 4Q3NA 2A7XA 4C2UA 3BA6A 1SPXA 5F7OA 1NURA 4PINA 1AF4A 3ENZA 1QH9A 1NJFA 3OU7A 2OESA 4YMGA 3L6DA 3L8GA 3U4QB 3KL2A 2G8LA 3UFBA 1JEJA 2FDXA 4OLAA 1M8PA 4F56A 1EJ2A 2CXUA 2JFPA 1CYDA 2N42A 2Q4RA 4PANA 1HYHA 1VKNA 1XQ6A 4L9SA 1J5EB 3GEMA 3C3YA 4L4UA 1AC5A 2N75A 4B40A 2A30A 1O8CA 5I9SA 3ZUPA 3VTZA 3DO6A 2BEWB 4NICA 1DRJA 3A8TA 4R6XA 1U9CA 4B3BA 3FNEA 4P31A 5K9ZA 1JDZA 1FX0B 3CX8A 5K05A 5A05A 1XNHA 3NAQA 4BMSA 3AIMA 1VSBA 4RWZA 1BMFD 4H3KB 2C5FA 4QXMA 1PSDA 1S9HA 1VB3A 1W6RA 5FL7A 5SZHB 4DAOA 2TS1A 4BQIA 3EEBA 5ITZA 4MVXA 4OK5A 1R6TA 1J0XO 2EP5A 3CZMA 3LPCA 5H02A 2QTTA 3HZHA 3RGGA 2P2ZA 3WXBA 1LJ8A 3DAGA 4ZAXA 1TO2E 2OOKA 3JZDA 4BNMA 1KYVA 4EFKA 5KJCA 3ZDYB 2H00A 2WIJA 4UMEA 4OUKX 2XUFA 2O2XA 2J48A 3JQ8B 3TTVA 5CG1A 3WGGA 1HC7A 1LW7A 3JQAD 3QG1A 4ETIA 5AUPB 3LUAA 3FJOA 2O8CA 1KFBB 1Z0AA 2AB0A 1KI4A 3K9LA 1QIHA 3ABRB 3LDHA 1YR7A 2BI8A 4QULA 3DR5A 4A73A 3KQWA 1C7IA 5LJIA 4BB6A 4CGYA 2GCGA 5A1TA 4I5DA 2FWBA 3PA8A 5SICE 5ED4A 4V1CB 1UPTA 1NR1A 2FETA 3CLHA 4ZC8A 3VR6A 1N2BA 1RQPA 2GHRA 5KX5F 3ANYB 2A9FA 1OAOA 3AKDA 3L79A 3ND5A 4QUEA 1R66A 1RBMA 1V25A 3TFOA 4HGNA 4CQLA 4QPZA 1PGQA 1J99A 4RKRA 5DTEA 4J16C 2JJ8A 1DMSA 2BY4A 3GRRA 4DQXA 2VWQA 1L5WA 1T36B 3QJGA 4LXYA 3FVQA 2I2FA 3U16A 1IJKA 1SQFA 3AV0B 4TV8B 4JR2A 3IT1A 3A04A 1K86A 1FNNA 1Z5OA 4QWMA 4U8HA 3MUNA 4WY5A 2WV7A 4EHIA 1Z4KA 3MGGA 2VSNA 3P0FA 4MDFA 5B3JA 1XRJA 1K7CA 2QTBA 2YFKA 3KYBA 4BZZA 1CTQA 1RRGA 1S2LA 1WHSB 3KYDB 3D2AA 4NHEA 1GDDA 3REOA 1JLLB 2W98A 3THWB 721PA 1VJDA 1SD1A 3ZTYA 2D74A 1VPVA 1ISMA 3NRBA 2LNDA 4PBTA 1ULZA 3GGGA 2BDEA 2CDAA 3QVMA 4PGAA 2TYSB 2X8LA 3KSMA 2Q5CA 4UE2A 4ARZA 3R3VA 3E70C 5FNZA 1DHTA 1YOVA 4WNCA 2M98A 1QRAA 2ZAYA 3W06A 2HGSA 1CW2B 1B1CA 4MKGA 1ZA2A 3N53A 4OBEA 4AUEA 4EJFA 3PHGA 1RW4A 1QTNA 3BE5A 1ILWA 2ZAIA 3GGOA 3OPMA 4MS1B 2MIIA 2OZVA 5HXAA 1SNYA 2WJ3A 1IEQA 2A7QA 2NXCA 3DMYA 2IWHA 3RIHA 3RIMA 4D9IA 1D4OA 4BXOA 5H59A 1WSDA 4OQYA 3EXHC 4BNJA 4M9XA 4HADA 2XXBA 1KDOA 3KBOA 4H1TA 4N5HX 3OFVA 3BQNB 2CYCA 2P1RA 3RVNA 3DMHA 1O08A 2R85A 3ITDA 3DGFC 5FOXA 1NHGA 5KQGA 1ESMA 1YE8A 2BSAA 3ONEA 4FX5A 3J80A 3AESA 1VA5A 1DELA 3CLSD 4M1QA 3TDMA 2BYTA 3PSHA 1IEWA 1DFIA 1C41A 1RAGA 1P0QA 4TROA 1H05A 1E2KA 1TXGA 4Y2SA 3DNMA 3VH4A 4ZHQF 3COJA 4YCJA 2DUUA 4IVPA 4NMXB 1OWOA 3F5SA 3JVDA 1OXVA 4OYLA 5CP8A 5UKDA 1DG9A 3EQZA 1SVNA 4LFAB 3NM4A 2NX2A 3BF7A 3V7UA 2MSCB 4CG1A 1WXWA 1DBRA 4YMWA 4HDKB 2CXTA 2QUAA 1EA7A 3SI7A 5BR4A 1F0YA 5KZMB 2GSDA 1UFVA 4NU6A 1YC2A 3BMXA 1E3LA 1G4AE 3ZGLA 3AK4A 5M7EA 3ELDA 4TRJA 1XTIA 3DXZA 4IMIB 4IVQA 4RLHA 1Z0FA 3DV0A 1KK1A 3I09A 3PXBA 4RETA 2IU6A 4M7PA 1IDOA 5LQSA 1R50A 3I37X 4NI5A 3MMNA 1GLGA 2JBHA 1KJWA 4XWWA 1HE8B 1X1CA 1DBPA 3EQ6A 3WIUA 1N0VC 5FOQA 1E8DA 1XWIA 1ZO8A 3KPWA 4GRAA 4RKWA 5ITWA 2OM6A 5L6LB 5H9VA 1RMYA 3WAJA 3ONNA 4MRRA 2FPRA 2VXYA 5FRDA 3RUHA 1TMGE 3K9QO 3CWQA 1VL2A 2P6MA 1WHTB 3E9QA 5KSWB 3SVLA 1DWOA 3D4NA 3KOOA 1P0CA 2O8EB 4BQOA 2HJSA 4JU8A 2BCGY 3I61A 3NASA 2WWXA 1XP8A 1LBQA 5H4GA 1NFRA 2YIMA 4ZOCA 2D00A 5DCLA 4PG4A 1AMUA 5IT9A 5DX8A 3LECA 1L8QA 2ERYA 3EGXA 4CLRA 3NS7A 1MA3A 1BE0A 1JTEA 2GCIA 4WN9B 2I3ZA 4QLBA 3G9TA 4RH3A 1II8B 1T8TA 1CXZA 2C04A 2DFNA 1ANKA 5E6SB 1XVIA 1QZZA 3U9TA 1Z4LA 1KIFA 1S01A 3A6ZA 3VV2A 1BE8A 1P91A 2ETVA 2ZITA 3BSFA 1YSCA 4LY3A 1XDDA 4L73A 4R83A 4BY9E 5BSVA 3E9NA 3A4IA 1T0JB 4YRLA 4DLNA 2JARA 1F4LA 2QLLA 1MW8X 1JB1A 3ELBA 2HSGA 3PHHA 4PX2A 2D5CA 2ZG6A 4AFNA 5JRDS 2WM3A 3QWHA 4FQ8A 1D0IA 1FFHA 4FSHA 4QOSA 4A91A 2Z83A 2CNBA 5E7MA 1FYFA 3WLNA 1IY0A 4ZGWA 2KI5A 1VIMA 2MTBA 4DZZA 1PS0A 4PG7A 1GGVA 2BFCA 2VT2A 4XWKA 3M9WA 3CG0A 3RU9A 4C7VA 4P0PB 1MQ9A 1JIUA 2HMSA 1C0LA 4UMVA 3B85A 4ZO6A 1W1UA 2I55A 4CFZA 3T9CA 4E5DA 3QEAZ 1J33A 3BTSA 5TV2A 3T3HA 3V6MA 2CT8A 3BT7A 2FLWA 4K9RA 2OFXA 4XGRA 3G68A 2VNKA 3JQRA 2B9EA 2X23A 3T12A 3IERA 4DSZA 2DR2A 2V7TA 3UGQA 4HNAB 1M66A 4X85A 4M55A 4EPRA 1UKVY 1T4CB 1V71A 2CFCA 3CG4A 4HEA6 3UG7A 3GLIE 3IR5A 4TTIA 4B2IA 3LY9A 3IUSA 3WJ2A 4EP1A 4CMCA 4BBPA 3R7BA 3X44A 1SIOA 1ZD3A 3TAUA 4TL8A 3FYHA 1YCDA 3W8NA 3HGMA 3MW8A 1P72A 2ZB4A 3V55A 1UKZA 3WYCA 4RFSA 3BEOA 3R6DA 2WD9A 1GA4A 4BMZA 5HDQA 4AN4A 2EHDA 2G9ZA 1NMSA 2MU1A 5FYQA 2P11A 3EGEA 3Q7PA 4TRRA 3WGUA 1RWKA 3DKPA 3ELWA 4QU8A 1Y6RA 4TWJA 2VOJA 3BFPA 4M3NA 3HI6A 4FDLA 5B1EA 1KQPA 4ZD6A 1FNDA 4EAQA 2P5YA 1KYTA 1ECLA 2SKEA 1RT9A 2YNMA 3WLRA 2VTEA 3ECAA 1I7NA 2FN8A 1R8JA 1G4HA 1V8DA 2QG9A 3KYCA 5U4QA 4OBWA 3TLAA 2QRJA 2MMGA 3ZX5A 4J9VA 3QFCA 4NPAA 3RAEC 3I6MA 2OZLA 2YL2A 3DBIA 1LLQA 1XTPA 1SAYA 2EBWA 2ZJ6A 3KELA 1IN5A 1TYCA 1SVLA 2VUTA 1XVUA 3OSZA 4MGKR 2ZSHA 2XUQA 1NQ5A 3PPXA 3VH1A 3MINA 1EZ1A 1P4RA 2IEBA 4GLFA 2R7KA 1BFUA 4UASA 2OT3B 5DEIA 5B58C 1JVSA 1VIYA 2WSIA 4A9AA 4TVSA 1QE3A 2ZZNA 3NAGA 1OUMA 1Q92A 4Q4HA 4BX9A 4KLZA 1IVYA 3FJYA 4FDTA 4MWOA 3R5KA 4A1OA 4CM3A 4LYAA 1USVA 4UOEA 4DUPA 3I9MA 2NT3A 4XTRA 1E6UA 5JNTA 3OTQA 1EP1B 3G59A 2N1MA 1Y8RB 3FUTA 3T4PA 5EIEA 3RYCB 1L4BA 2ILTA 3I1IA 1U90A 3SMVA 4CLEA 4R9UC 3X1JA 4XWTA 2EKQA 3VFDA 1V11A 4PX9A 5LYJA 2X9QA 2O4UX 3HUTA 1C3OB 2Y0CA 1N25A 2EG5A 2RGDA 3OTWA 1RCUA 4JENA 5DGXA 2C07A 3HY4A 2C8JA 1I0ZA 5EGSA 1UFKA 5HBRA 3RRMA 4CEHB 1R0KA 3ODPA 1QK5A 4L08A 1TA9A 5ALTA 2QZZA 3AU8A 2W6JA 5EQTA 2W37A 4UTVA 1SM4A 3EEIA 1RWQA 3RJ9A 2PO7A 3DMRA 3OOEA 4Z51A 2DJ5A 2C0PA 3LU1A 4YO7A 3SQMA 3G2LA 2BFEA 3VJRA 3JVEA 4LCEA 3K72B 1GR0A 3B7WA 1SQ0A 4RPLA 4WI1A 4WA7A 1WY7A 2REOA 4YJDA 1SOVA 2QZ4A 1ZCAA