3GLRA

Crystal structure of human sirt3 with acetyl-lysine acecs2 peptide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
274
structure length
274
Chain Sequence
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent deacetylase sirtuin-3, mitochondrial
publication title Crystal Structures of Human SIRT3 Displaying Substrate-induced Conformational Changes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase regulator
total genus 91
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 3glrA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3glrA01
5EJ9A 4RJIA 2OO5C 4JT9A 4JT8A 4X3OA 4FEGA 3GLUA 2A1TR 2PGOA 5K2OA 2H2FA 1OZFA 4D5EA 2EZTA 3D4BA 4L2IA 3RIGA 3JWPA 5BWLA 4J1TC 4MPJA 4UTVA 4K9QA 2Q27A 2OD7A 4V1CA 1JSCA 2UZ1B 4GM0A 4BV3A 1EFVA 4K9LA 1M2HA 3FZNA 4FZ3A 1NM5C 2EZUA 5MF6A 1YI1A 2JI6A 4GG1A 5BWOA 4TWIA 4UUAA 4JD5A 2AG1A 5K3SA 3FSJX 5EJ5A 2BRUC 4FVTA 4C78A 4UTRA 4MZXA 4BN5A 1UPAA 1M2NA 2VK4A 1BFDA 1YNOA 5DGDA 1POWA 3FLMA 5EJMA 1Z8NA 2C31A 3EY9A 4BVGA 5K6TA 5EJ8A 2VBFA 1UPCA 2WVGA 2EZ9A 4JUAA 4RMHA 4ZZIA 3CLSD 1ZPDA 2IHUA 4BVFA 3EA4A 2B4YA 1T9AA 1U28C 4MPRA 4F56A 1UPBA 2Q5QA 2OORC 4Y6QA 3PDHA 1DJLA 4BVEA 1PTJC 2EZ8A 2IHVA 5FYQA 5K6RA 2A1UA 5DGTA 2DJIA 2FSVC 1PT9A 2H59A 4V1CI 1M2GA 4GPEA 1M2JA 2JLAA 4K9NA 3ZGOA 1YTLA 2VJYA 4X3PA 1O97D 2FWNA 4IF6A 1J8FA 4JSRA 3F6EX 4K9OA 1YBHA 2JIBA 4FEEA 5EJAA 4GP9A 5EJ6A 3E9YA 1N0HA 4K9MA 4Y6LA 1OZGA 4JUBA 2AG0A 1ICIA 3RIYA 4I5IA 2H2HA 5EJ7A 1PI3A 4QPZA 4QELA 2Q5OA 3PKJA 1V5EA 3HWX1 4KGDA 4L3OA 4RJJA 1E3TA 5IMSA 2PANA 2X7JA 1Q17A 3EYAA 1D4OA 4RMJA 2VBGA 2Q28A 2IHTA 3U31A 2JI7A 1YC5A 3CLUD 1YHYA 4RJKA 4TWJA 4JUDX 4MQ5A 2PGNA 4BV2A 1U2GC 4G1CA 2Q29A 3JR3A 1MA3A 4BUZA 4D5GA 2H4HA 1S7GA 5DEIA 2HJHA 2VBIA 4UUBA 1T9DA 4MPPA 1SZDA 1PYDA 1T9BA 1PO7A 5MFPA 2JI9A 1Q1AA 1Y9DA 2NYRA 3HWWA 2H2DA 3D81A 4V1CB 4JU8A 1SZCA 4UU8A 4GM1A 3CLTD 3CF4G 2VK8A 4KXQA 5MFZA 5MGNA 5D7NA 1XLTC 4JUCA 4QQ8A 1MCZA 2VK1A 3GLTA 1PNOA 4BN4A 4Q9DA 4JU9A 3CLRD 3OE1A 4ZP1A 2FN3A 4BVHA 3GLSA 2OD2A 4IG9A 1OVMA 3IAEA 4F4UA 1T9CA 2W93A 1PNQA 2FR8C 5AHKA 4COKA 4UTXA 1V5FA 2EZ4A 5FEMA 1EFPA 1Q6ZA 2H4FA 4UTZA 4JUFA 1HZZC 3D7KA 4Y6OA 3LQ1A 3ZG6A 1YI0A 3K35A 4C7BA 4UU7A 3IAFA 4GM4A 2H2IA 3F6BX 4J16C 2UZ1A 2QQFA 4KPUA 4O8ZA 5EJ4A 2Q5LA 1YC2A 4BVBA 1U2DC 4UTNA 2NXWA 2Q5JA 2WVHA 1V5GA 1M2KA 1U31A 2JI8A 2QQGA 4IAOA 1QPBA 4HD8A 2OD9A 2H4JA 2WVAA 2FRDC 4R8MA 4HDAA 3PKIA 2H2GA 3ZGVA 4K9PA 5BWNA 1OZHA 1PVDA 1Q14A 3GLRA 4RMIA 1YHZA 2V3WA 1POXA 2JLCA 1O96B 1S5PA 4RMGA 3U3DA 4K9KA
chains in the Genus database with same CATH superfamily
2AOUB 5JZ9A 4P3YA 1QUFA 1SC3A 3H6GA 1CFZA 1EP2B 1ST2A 1U5BA 2ZRMA 5FEUA 2EJCA 1V8PA 4P3PA 3DZ8A 4NG5A 4KPEC 4W4TA 1DEOA 1QJCA 3N75A 1E2IA 3SG0A 2YBEA 2ZETA 4OK3A 4R8KA 1SD1A 2I6SA 1Z0DA 3Q41A 4WACA 1U98A 2HNAA 1EWTA 5G3YA 3I6YA 1ULHA 3LKBA 4XD7A 2D0PB 2Q4RA 1DCKA 3W90A 1O6ZA 5LA6B 5L3VA 3SIPA 4WBNA 5LR6A 4KYTA 4G65A 2LWIA 3D4BA 1KQNA 1IPFA 2LV8A 4J0CA 4UHFA 4EVQA 1ADGA 2HFJA 5LOVB 1V9CA 3L8ZA 3TLMA 3W0LB 2RGRA 5DSXA 5UKDA 1YUMA 3A7EA 4Q01A 4TM8A 1F20A 4A91A 2VHUA 1MVLA 3Q85A 1NXQA 2OV3A 2PX8A 5SY9A 4LBWA 1KIAA 3N74A 4KWHA 2AJ8A 3AM3A 3LC7O 4LYAA 4GP7A 1FSZA 3VSAA 4NAUA 2XAUA 4MAMA 2ZIUB 4NEHB 1X92A 3E9NA 1BS1A 3CS3A 1MOPA 1EDEA 2DRIA 2IUTA 2C8KA 2BFCB 5ALVA 1AKMA 3HBJA 4A2CA 3QX7A 3GJSA 4IO1A 1N6HA 4OGKA 5AWFC 1U0BB 1N32B 1WDMA 1LA2A 5JZMA 1M2HA 1UJCA 3FWKA 4AY4A 4EUKA 2GXAA 1XTVA 3MGCA 2VUIB 3U13A 2AOXA 4YHBA 3CF0A 3PUIA 3T4EA 2DEUA 1F1JA 5ER6A 6LDHA 5HW0A 2R1ZA 3MLAA 2J09A 1QHEA 1ZUHA 3O8OA 1FEZA 2DUWA 4FUQA 1NXWA 3T3IA 2ZBRA 4A26A 1SQGA 4MJXA 4HY3A 3RK1A 3UV6A 3DEYX 3ZCSA 1TADA 5ADHA 2RE8A 4E70A 1U2QA 1GNVA 2Q0HA 4FVTA 1KVRA 3BJMA 4LWZA 3W5BA 2CJPA 3AR7A 4M55A 4PHFA 1UAAA 1PJ8A 1XDWA 2DHDA 2Z4TA 5CFPA 4DPMA 3IR6A 3U44B 2H1FA 1Y8AA 2VK4A 3EMDA 5DVZA 1A9TA 3DLCA 3X2EA 4AW9A 3GUHA 1XELA 4JGIA 3WGGA 1XCPA 1Z4QA 2G1AA 4PYNA 4GECA 1T8PA 1XEFA 3KFLA 4QOSA 1JIQA 1V7CA 1XJCA 2RAFA 2VHWA 2Z9CA 4RK5A 2XE8A 4D46A 5L7YA 4ZHQF 5ALRA 4EPXA 5EJ8A 5HHTA 3KOWA 3DE3X 5LQSA 2F64A 3LOPA 3QZUA 4DCVA 3TMKA 5LQUA 1NNUA 3GEGA 4XYGA 5LJLA 2NOAA 4UD6A 1SOVA 5EMKA 4E11A 3U3JA 1R6VA 5BUZA 4KGZA 3VBCA 3KLNA 2R4TA 3ON5A 3K09A 3CNBA 3KV3O 4HYQA 3JQ9A 4QA9A 1ZD2P 1JJFA 2GO7A 3WWCA 3ZLTA 4Y2QA 1L6IA 5CYFA 4INPA 1LCIA 4H7IA 4OI4A 4RH1A 2ZBUA 5NLLA 5JAUA 3MS4A 3GJ8A 4BKRA 3UHPA 1DQYA 3SC6A 2J33A 2AQ8A 3MT8A 1DBRA 3CUUA 3NS7A 3MWJA 4Z1MD 3S7ZA 4S1WA 4BX9A 4YXFA 2ZR7A 2VP3A 4PPFA 5EL0A 4DA4A 1ZRNA 3MZ0A 4QDJA 4PV7A 1ZIDA 4OQMA 2R5WA 4HRYA 4EQ6A 2F62A 1GZ3A 5A04A 2IV3A 3ILSA 4PSUA 2FVXA 2RB5A 2BGKA 4EW2A 3EH1A 3WLMA 4Y6QA 2PKWA 3L0CA 4O5AA 2B4AA 5IC5A 3WB2A 1OH7A 2P1RA 4MMXB 1T3HA 2ZJ8A 1NW8A 3DMRA 4HKTA 4KSYA 4CUKA 1KI8A 1MFPA 2E4XA 4LHXA 5GGYA 4I8DA 3R3HA 4R1SA 1ZK2A 2IE8A 5FOTA 4ZGGA 2IYRA 3TJZA 1Z0ZA 2XWSA 3GPCA 3RG2A 3ZYCA 1QIEA 3NHPA 5FULA 3IOCA 4BO8A 4FGJA 3GV0A 1J2TA 1JQLB 3HA3A 3FAZA 1BH6A 3U5ZB 4WD3A 4X0EA 2N47A 3OIYA 4WNCA 2EW8A 4TS9A 1U7PA 1FJHA 2W4IA 4GOND 4O1HA 4F06A 4LV6A 1H2BA 1RQPA 2R6ZA 4CF3A 4IH4A 3KV1A 5F7JA 2P3QA 3RAFC 4YRIA 2ZREA 4QUKA 4DS3A 3L0PA 1ISIA 4IUCS 3DKVA 4ARZB 2MSWA 2JFHA 3LG2A 4HVLA 3D3KA 4JSRA 5JD5A 1VXRA 3BH0A 4BQSA 3GJYA 1Q7TA 3F0TA 3CVJA 1ZGZA 3UJNA 1F0YA 4Z86A 3QEOA 3EA5A 4KQWA 5EJFA 1TRKA 5ICFA 3GLKA 1KZ1A 3NJRA 3JQPA 1M6EX 3L18A 4G0VA 5I3CA 2BMJA 1PE0A 2PGAA 5LXTF 3RVKA 3LC2O 2YIJA 5AM3A 3CWZA 1DQPA 1XMSA 1JU9A 1ZH4A 4FYIA 3TFWA 1AN9A 3BILA 3QVTA 2D8AA 2O19A 4PAMA 1E79A 3DJYA 2G1PA 1EVZA 1JWBB 4EY6A 5KJ1A 1TVEA 1PK7A 2VC2B 4RD1A 5HP4A 5ILOA 3ORHA 4TUYB 3A1SA 2HGSA 2BPOA 4QXPA 1SXHA 3PC4A 1W4BA 1XN4A 2OBFA 1L5ZA 3EGDB 3N2GA 1MB9A 4PF1A 5DGHA 3K0CC 3FVWA 4YAOA 3K15A 1KYYA 2A57A 2R6HA 4OXRA 4CTKA 4F4FA 3L2OB 3O8QB 1DX9A 4ZEOA 1USVA 3HCPA 2Y6VA 4R2LA 1GQRA 4MVJA 3IUNA 4X1KB 4D44A 4J0GA 1GUZA 2QIOA 5DHPA 4R2IA 2Y4NA 3HNRA 2VH5R 4OMCA 1YB7A 1U04A 3RVRA 5LP6A 3ORSA 3GZNB 3LDFA 3F5DA 3GFRA 4RY9A 2DR0A 3ELWA 5B37A 2C97A 1N3IA 2QD3A 1VL0A 3BRQA 4WLEA 2QV7A 1QP4A 1NRWA 3MUNA 5DMHA 4K88A 3V42A 1YA6A 2G5CA 1CSEE 2GLUA 3KQWA 5DBEX 2WE7A 4DIOA 2HRRA 2ERXA 3VJLA 4DLZA 3RRFA 4J7XA 3PTZA 4L16A 3G3EA 1JEQB 3LQRA 3FNQA 1N57A 1IZ0A 1I80A 1I5EA 2CBGA 2GR9A 2RIRA 4GBED 3GLHE 4H0CA 3SS9X 1C2TA 5I4BA 2QX4A 3E53A 1T8TA 4JI4B 1I7QB 3IJPA 3GT3A 4W5TA 2OBYA 4QD3A 5HJ5A 3DAYA 3GY0A 3A36A 3KHUA 5ALKA 4CDNA 1KETA 1PR2A 1G55A 2Y2UA 4ZVQA 4TZ0A 4AD8A 4LFAB 1U2GC 2C03A 2WF9A 4G1UC 1AHNA 3AO0B 2I3BA 2JJMA 2VSOA 3L5OA 4RF5A 5CIQA 3GJRA 5TGDA 4BNYA 4ZZ0A 2ZUTA 3DVRX 1BQEA 1HORA 1NQUA 4BV8A 1V71A 2AN9A 5K03A 1ZCAA 2BZGA 4M8IA 5A6VA 2QN8A 4GYJA 4BNIA 1G8JA 4D5GA 4EYKA 4YMLA 3TGPA 4OJTA 3JTEA 3QPWA 3T3HA 3OF5A 4M7RA 3VDMA 4GOOD 2Z2JA 1CUCA 2QAGB 2Y0CA 1G3MA 3WGLA 1EWVA 5ARCA 2VT6A 1Z7YA 1GDTA 4IQ4A 1E1MA 2BP7B 3H87A 3PNKA 1H6DA 4Q3KA 4RKWA 2D5LA 2ORVA 1L5LA 2VJAA 5AHRA 3TB4A 1Q0TA 3W6OA 5JPCA 5IH3A 2WIFA 4G0PA 5THQA 3KR1A 4EBBA 3N0VA 4NK5A 5AVXA 1J09A 5ALZA 2HUNA 4AYWA 3IQIX 4B3CA 4CIDA 4QULA 2XVZA 4AJIA 3AVWA 4FC7A 5T41A 3HR8A 5J43A 1E59A 1EIZA 5ULLA 2ZXEA 2UZ0A 3OETA 4CM5A 4FWBA 5CB4A 2IITA 2JI9A 5BN1A 1AN0A 3OOHA 3TQIA 5JCPA 4G0UA 2D1SA 1DV1A 2H8GA 1Y9DA 3LBYA 3Q6NA 1U1EA 2LNDA 4MS3A 3CURA 1TDJA 3VU9B 2AI2A 2H2DA 1ZMRA 4AJPA 4R2MA 4WK4B 5DNCA 4O4JF 1VRWA 4FHGA 1ZX1A 4D92A 2C5BA 3CUWA 3WDLA 3NKLA 3WGZA 4EP1A 3EIXA 1RU3A 1XZGA 2PUAA 2AMLA 5I9TA 2GJAA 3VR5A 1E1NA 2XUPA 3LDHA 4RYLA 4QARA 6REQB 4B45A 2W22A 3DUFB 4OHUA 2W2MA 4FNGA 1Q83A 4ZDIA 1PSWA 4OYRA 1YDGA 3Q2KA 4NE9A 3TRFA 3CNNA 3IAHA 4WZBE 1K5HA 3QOYA 3G6KA 3IODA 2VF4X 3I9V1 3MMSA 5JNTA 5IT9A 3NOOA 1U0HC 1MQ9A 1HF3A 4BBAA 3OEWA 4Q9AA 1PTJA 4AKTA 3GLTA 2QM0A 1CB0A 2YWFA 4IZOA 2V0NA 1SXJC 3UA3A 4EYGA 5CDFE 2WM9B 3DJFA 1JR3D 1P1CA 4ZAYA 3OZUA 1PL8A 3IKMB 3CZ5A 1CUBA 4AJNA 2FN3A 4B7CA 1LFDB 1U7UA 2BMWA 3CLRC 3PSHA 2PSJA 4R5HA 2IK8A 3GLSA 3E7FA 1RBMA 4TMVA 4DY4A 4CMBA 2OCBA 1SOAA 2VUTA 2HDNB 1TA0A 2I1WA 4XASA 3AUYA 4U7TB 5EZYB 2YL2A 1WVIA 2GFHA 2QPTA 1H4SA 3RFFA 4B33A 3DEJA 1PZGA 3JYHA 5DP2A 5FTJA 2WY2D 4E15A 2HA4A 1PNQA 3B1ZA 1CVIA 4ZT2A 4BDTA 5IHXA 2GFQA 4H31A 2XWPA 1XF9A 2POQX 4AO6A 3WWDA 1AV7A 1YVUA 2HV8A 2VK2A 4M46A 3B5EA 4MHTA 2O3TA 3L8FA 1HYEA 1DJOA 3LHSA 3HJTA 3RTDA 5JISA 3QOXA 2F3SA 4RLSA 4II3A 4DBVO 1NT2A 3EGOA 4KKXB 4RELA 1XZFA 5LQRA 2HIHA 4TQAA 4KNYA 1A5SB 1Y1SA 4D3YA 2QKYA 3HBAA 4ARVA 4S05A 4F60A 4P2BA 1JSRA 4Q4HA 3SDZA 3UOWA 2QSZA 1V39A 4N54A 4XE5A 1CF2O 1VZ2A 1Y9ZA 1ZQ1A 2X5XA 4C4AA 4JYZA 1AH2A 1MP0A 1QNLA 5EIBD 4MWGA 4PQRA 4RVUA 1TO2E 3CCCA 4CXMA 4PGHA 2X2OA 4Q7QA 4KYIB 3UB2A 3V55A 4DR3B 2NQTA 3O1JC 3OZCA 3GEHA 5IWCA 421PA 4JLNA 1CNFA 2HSGA 2D0IA 4DMLA 3B38A 3MF4A 4OK6A 5HA5A 4UTNA 5LC1A 1VE9A 1Y3DE 1FNCA 2A9FA 3RSZA 3P4YA 4QBGB 5JALA 4KSCA 2DBVO 1C3XA 1WQ1R 3B60A 2EHDA 2YFQA 3QKSA 4IXTA 1Z4JA 4P7BA 5TEWA 3JASB 2VJNA 2FPUA 1BGVA 4G5SA 2FRXA 1RLOA 2FP3A 2QQGA 2VS1A 5JQGF 2AMJA 2OTCA 1NTRA 4CEIA 1Y1LA 1NW3A 4BWYA 4RKFA 1RZRA 5DHSA 3C6MA 4D74A 4TKUB 1NVKA 1EHIA 1CV2A 1OBOA 3P9IA 1VMEA 1G5HA 1OPRA 2QGNA 3AUJB 2WJGA 3OCUA 1P4GA 1ZUIA 5BR8B 4MTCA 2M9MA 1VSVA 1DCMA 1U0LA 1Y3IA 2PDAA 3AW9A 3DVQX 3PKIA 3WA7A 1PDOA 2WHEA 2FKAA 3IDFA 4OLHA 1BHO1 2QA5A 4EB6A 1TQ8A 3T7SA 1ADJA 1K86A 1L7VC 2IE0A 1OZHA 1XVLA 3C6XA 4MA5A 2EFJA 4YACA 3PDCA 3IQZA 1ZU4A 5ALFA 1PVDA 9LDBA 3O9ZA 1TW3A 3GGJA 5DHRA 4OHYA 2PMCA 3QHPA 1A8IA 1RADA 2H4XA 5BV0A 4X00A 4DSNA 2V58A 2J0QA 3DMTA 1GNPA 2V3WA 2W71A 5TQ0B 5TT1A 3L0DA 2FB9A 2XWQA 2Z2XA 1P9OA 2H1IA 1ENOA 1UWKA 5FBZA 4ETNA 4KW7A 1MX5A 4EMBA 1REQA 5K6AC 2WJZB 4WK6A 5K8UA 2JRCA 4L5AA 5JAPA 1CY0A 2G71A 2ZIEA 3NHSA 3TWOA 4DPLA 2VNIA 4O4IB 3NLLA 2B82A 4XYBA 3B5JA 4U6NA 3BTSA 3GGOA 1ZGBA 2UUBB 2WI8A 3RYHB 3SVLA 1BRTA 2IXBA 4I6EA 1NF2A 1KY4A 3I6MA 3FYCA 3MPUA 3LM8A 4MKHA 4M9ZA 5KYYB 2DH5A 3VR5H 4P3OA 1MJ5A 1MXHA 2PUDA 3DBRB 3DDOA 3IJ5A 4P4SA 1QYVA 1MJHA 1QAMA 1QJ4A 4EPWA 1CHDA 1H2ZA 4R6WA 5F64A 2QJWA 1LF5A 3ITDA 3K5WA 4GUAA 1DKRA 2HXGA 3TW0A 3USCS 3EPRA 4F9FA 1YACA 1B0PA 2YTZA 3MJSA 2P0YA 2R66A 4WESA 1YBMA 4I50F 4Q1CA 4E6EA 4F1WA 5HCNA 2V7PA 3IPRA 4BO5A 1FSPA 1ISRA 2EP8A 4Q3NA 2K7ZA 4QBTA 3WB0A 2WWVD 5F7XA 2R00C 4KWIA 4BRUA 3EIFA 3ORFA 2GPBA 3I3OA 4WN3A 5ITSA 4BNJA 1ZUNA 3DO6A 3UH0A 1FZQA 4XM0A 1DV2A 1MC8A 2CLDX 1YFLA 1NP3A 2WR8A 4QPNA 1F1BA 3DOEA 5C5IA 3UENA 1DIHA 1GRCA 1UXHA 1UDCA 3HKCA 2JGNA 4CKBA 1HE5A 2O8DA 1F4VA 4BKOA 1FJ2A 2PKRA 4UBJA 5IFLA 2Z8ZA 5HBGA 5ALDA 4MYSA 5THXA 1FP4B 2UAGA 4XX0B 2AXPA 5IZCC 3MD0A 4R40A 4NZYA 4A27A 5JBNA 5F77A 1EP1B 3D6FA 4HX9A 3QPAA 1ZKMA 1P0CA 3G7SA 2OZVA 1EVLA 4TLBA 4DVGA 2EWWA 2WUVA 3IIMA 1SIWA 3D3NA 1EFVA 2VDNB 1IK6A 3PWKA 4Q3DA 3KKLA 3PXCX 4R84A 4CQMA 3IFSA 1ZKDA 1Y7HA 3GQVA 1AA6A 2YQ5A 3VR4H 4LWPA 2I4TA 3U80A 3MIZA 4HS9A 4LGVA 1QQ7A 2F90A 4G1FA 1M2VB 2MHCA 1XZBA 4GG1A 3RTBA 3EGXB 3G5AA 3Q3VA 1TAUA 4UUAA 3Q3HA 1YCFA 4HVAA 5GGXA 2DBYA 3KQQA 3U09A 3QYFA 1FQKA 2OXTA 2FQQA 3AUSA 1I01A 4LGYA 5J9FA 1LK7A 2QRJA 3ONDA 3MSCA 5J4VA 1ZYUA 4AYTA 2JH8A 3TSOA 3RRNA 3KZ1E 3PQ4A 4I1SA 2C95A 1FYFA 2AF3C 2NSLA 1F3OA 4R6XA 2QD5A 4OEHA 3DKIA 3FPFA 5FHQA 1O7JA 1YQQA 4B3IA 5IANA 3PDJA 4RHCA 3AX6A 1HLFA 1GV1A 5FH9A 2IUSA 5E8RA 4U7HA 4RPHA 5DYYA 3LWBA 3TQOA 3FLMA 3BFKA 3MOGA 3MT7A 4YJHB 3QFSA 3S27A 4BKPA 4FDLA 1D4ZA 4KSBA 4C0XA 1CY2A 5AXBA 4HQRA 1WMBA 1W1WA 2H06A 2NSJA 1NG1A 4MUJA 4AN4A 1J07A 3ZQ4A 1M6VB 2ID4A 3HLTA 3MINB 1GZ5A 2FF7A 4J3JA 1SC9A 5CH8A 2CMGA 2R6FA 2ISQA 2VYFA 3ICPA 4JA0A 4K9RA 2VOJA 4UVEA 3AHHA 3AIMA 4UFPA 3KSMA 2BLNA 1QFSA 2YNMC 2V7QA 1EVYA 4JL6A 4EKIA 1TL7C 4NYIR 1Y8RB 2PLWA 1PT5A 2RKBA 2XH8A 1R6AA 1L4UA 4MJ7A 5CLIA 3DTNA 4TMWA 4BMNA 1KVQA 2QQ5A 3Q1LA 1G5IA 1OLUA 4HGOA 5FL7A 1L7PA 1VSTA 2Z3ZA 1AS3A 3CLSD 2YHIA 2WHQA 4GWLA 5CLFA 3I12A 5BOVA 2M6RA 5AO9A 2R8OA 3UXMA 1T3LA 1NURA 3HJRA 3GFVA 2PN1A 1HE3A 3QVKA 5I4IA 1ZVQA 3KYCB 1IXSB 5KDOA 3CUKA 2VDOB 1G17A 4OXNA 1II0A 4U3JB 1NQWA 2ISSD 2P91A 1L8QA 2O3JA 4RIFA 1NWHA 5AXDA 4MWEA 3WWPA 2CVHA 4XUGB 1GDHA 3EXFB 5LM3A 5KO2A 4IUBS 1L5RA 1SXIA 2E6UX 2DUNA 4EAAA 3S4YA 2PJZA 3ZN2A 2XMBA 3QE3A 4RSGA 1YS1X 2WFLB 3NC0C 4P98A 4QQFA 4B81A 5IDYA 2Q9BA 4FIZA 2FPPA 4ND3A 5A5EA 4PIPA 3PITA 4I5FA 3V2UA 1C9KA 2PH5A 1MDBA 2Y1XA 4YRTA 1PR1A 2A1UA 3FCCA 5TJ9A 3W2EA 4Z4EA 1O6GA 2HADA 1WCIB 2GH1A 4FXPA 4KIFA 5F35A 3VH3A 4BXOA 1OHHA 3UB4A 5DYGA 1YWGO 5AH0A 4DQ0A 1THGA 1IMOA 3AF0A 3TPZA 1KQPA 5ALHA 1VI6A 3AFMA 4KMRA 2QP4A 3FROA 2XEXA 3I23A 3QOWA 4ROSA 3K9QO 4AZ3A 4AURA 4FGZA 2OGZA 4AX4A 4EMSA 4NS4A 2ZRAA 2CLHB 2YJZA 3GEMA 3HCNA 5LBIA 1Q77A 2RI0A 2PA0A 3LFUA 3HWSA 2EF0A 1BMTA 3FY4A 4X3PA 1XPJA 4GT1A 2LGJA 1QE3A 5K8IA 2FMTA 2OM2A 2P9CA 3KKMA 3IESA 3VUFA 1C3OB 2IU4A 2NYVA 4NG4A 1YVEI 3CE6A 3MJFA 1CRZA 2JIBA 5CT8A 4G97A 1ZAKA 1QVWA 2V7TA 3DDWA 1UQTA 3O3CA 3A4TA 4KQFA 5BSGA 2DKNA 5EJAA 2Z56A 2WWWA 3AEUB 4XEHA 4BB0A 1CQWA 1BOFA 2O2YA 2GNOA 4B09A 4GPIB 5JD6A 3PR1A 2JBHA 1H42A 3CWCA 3B48A 4EGAA 4MX8A 3I62A 3IXQA 1EZZA 5B2ZA 3CCFA 3WL4A 2O0JA 1ZW1A 3KR2A 1Q0HA 3W5VA 2OXFA 1T2CA 3FNFA 5KNLA 4MV7A 1GQSA 3PWTA 4DBZA 1Z29A 2DPYA 5K3DA 2ZJ7A 5IDQA 1RE0A 3HRKA 3TBHA 1RR6A 4DJJA 3K20A 4UKDA 1G3RA 4XIGS 3TNDA 1M72A 1Z4LA 3U26A 4OHFA 3BMCA 3BJIC 1FDOA 4PNPA 1S2DA 2B4KA 2IHBA 1UK6A 2SKDA 3TSYA 1F60A 2Q6VA 3N2YA 3EF3A 1HC7A 4UUNA 3PR2B 1Y6ZA 4KAAA 3LD9A 2PV0A 2FCAA 3N5CA 1QQ6A 4U2KA 1OYWA 1QO0A 3FDIA 3H97A 3PKJA 1NUUA 1QGOA 1HQCA 3N2LA 2YXDA 2Q9AA 1Y98A 1UC5B 3ESBA 4YJ3F 4B6GA 3ZUGA 1KR5A 5IT0A 4WCDA 5A3RA 3EEFA 1O0SA 1YRBA 1DQRA 1JMKC 4B6JA 2HPHA 1KQFA 2PZBA 1VE5A 1GPNA 1F7VA 2DKOA 5HUJA 2QTLA 2XB4A 1F4PA 2XUFA 5KQPA 2JFNA 1E5TA 3DMFA 1VKRA 2PZMA 3O74A 4IYRA 3HBFA 5BYKA 2O8FB 1X74A 4X5OA 2AC4A 1Z8HA 2GBCA 2FQWA 5FHRA 4LHWA 1ECCA 4W5RA 3EFBA 4LYYA 3JALA 4FR5A 3K9HA 3RU9A 1CQPA 1GTMA 3OO1A 2VXOA 1EESA 4FFLA 1XCOA 3LYUA 2ZIAA 2RIPA 1H1TA 2VF5X 1RKUA 2JLZA 1TX4B 1AK9A 1C30A 5EQDA 5LBTA 4YJ2A 2SHKA 4JXKA 3SEZA 3ZNNA 3ZGYA 5CFRA 3U16A 2HOQA 2IYVA 2V9CA 3PXBA 3P45A 5BWBA 5JADA 1Z4IA 3QVLA 5BOSB 1U0NA 3PC6A 3OOJA 5DZSA 3ZHBA 3D4IA 2PPVA 4EABA 1WXEA 3JARA 4ARCA 2VPYA 1FK8A 3EQ6A 3TTTA 821PA 2OBNA 1E1LA 3IR5A 4CN9A 3V4LA 5BUCA 3B1JA 1G8FA 3UWOA 5ARDA 4JOBA 4F9EA 1XQWA 3EH2A 3JQBC 4B4WA 1GKKA 4C29A 5AW1A 2X40A 4WWHA 3C3KA 3LZ6A 4YMVA 3QUCA 3E81A 3NHAA 3TJMA 3HDGA 2OAP1 3BPSA 5FOXA 1TYBE 3R9IA 3B36A 3F3MA 3T7CA 2SCUB 3TNFA 3SR0A 5KYWA 3J81A 1KJIA 4I1PA 3WK8A 4YFYA 2GVNA 2PX5A 3KTAA 4DYDA 1S2LA 4MDYA 3IEIA 5FTNA 1UBMS 1CZHA 4YDSA 3PG5A 1NW5A 3B1KA 4Z6KA 1YB1A 3HB1A 3HDTA 3OE7A 1DUVG 4G01B 2O5EA 2JH9A 1S4QA 2ZPTX 4E1BA 1L8OA 2R11A 4TQUS 3JTMA 3S8EA 2XXAA 3KCQA 4NR0A 2Q7OE 8ABPA 1T9DA 4JVNA 3Q7EA 3WL7A 2UUCB 4IHAA 1OKKA 1XUOA 1O5OA 4RFLA 1QU2A 1CLUA 3Q87B 3L6BA 4YCSA 2VCYA 1LEHA 2I3DA 2WTEA 3ER6A 1SCQA 3JQDA 3OHMA 4FE3A 4TT3D 1TC1A 4I3GA 1NPTO 1B8NA 4Z5XA 4QSHA 4Q9HA 2DTDA 4QPCA 1XDUA 5EVCA 4IV5A 4P4UA 2YCLA 3V1YA 4BLQA 4B46A 4DCUA 1Y7IA 5DI9A 1VG8A 1ZNYA 1K3TA 2G9UA 3U1BA 1KC3A 1UT8A 1KEPA 3HWWA 3UA4A 1GGHA 2ESRA 2IYLD 1U0FA 5HQ3B 3E9EA 1RRGA 5G0VA 3VUEA 1AKQA 4U00A 2IOFA 2X6QA 1CUYA 1MABA 7YASA 3FAKA 3HBLA 5CA0F 5G0SA 4G25A 3W8FA 3L9WA 1FQWA 1TYAE 2G4LA 4M36A 1K7SN 1B3BA 1N7IA 1P1BA 5E0KB 4D3FA 3G2LA 1JDUA 3ZI4A 1P6UA 4Q4DA 3RC3A 1NW7A 2P6MA 3LX6A 3SLKA 3ZIUA 1SC4A 1E4OA 1M7GA 4MKZA 3GYBA 1KGDA 1O96A 2YJ6A 5BW6B 3SXUB 3FCAA 5HIMA 3WXBA 1G3QA 4B8WA 1V1RA 1JLHA 1IC6A 3CEHA 4KVAA 1GNQA 4CQNA 1XC7A 2P79A 1KBOA 3DSRA 4KJXA 5JD3A 3MQ2A 4NP6A 3ZY3A 2QD1A 1RZVA 1YZYA 3MUEA 3NHKA 4MCJA 1NVVQ 1Y33E 4QUAA 4LXYA 1R0CA 2GHTA 1U7OA 4K26A 4R2XA 5D2CA 1Y7PA 5JJ5A 4HRVA 1V43A 4Q3EA 1UKBA 1MR3F 3INTA 5CT5A 1ECPA 5H8WA 4GZ3A 3UKOA 2FOIA 2V6GA 3F90A 1ZOSA 4GGOA 4EG7A 3EWAA 3KT3A 4HNVA 5HIAA 5C32A 5KWEA 3QVVA 1LBEA 3PL1A 1QRTA 2I65A 3CZCA 4K6FA 4ND2A 3QPBA 3QY0A 1Z8DA 2O1WA 2CMHA 4HB4A 4TKZA 2PZKA 1WPRA 2XRYA 3ROZA 3VMFA 3FPEA 3WQHA 3GQBB 5LA6A 6PFKA 5IULC 1U3VA 4O5OA 1Z38A 3GJ4A 5TDHA 3RUCA 1JYSA 3NASA 1EK5A 2X9NA 3OFJA 4D7AA 1Z0IA 5LOVA 1RBZA 1I7PA 4A7PA 1YRAA 2LDXA 3OOSA 4B9EA 5T6BA 4PBTA 3PEUA 3CO5A 5C9ZA 4UQOA 4B3HA 1DQSA 2LDBA 1Q6ZA 2X14A 1NJFA 4XLLA 3HDHA 4RIEA 3GRYA 1JI0A 2XUOA 3HUUA 3WL8A 1A1SA 3U3ZA 2HT1A 4EJSC 4TV9F 2PBRA 1XHEA 3DYIA 4RZSA 5KKAA 4K40A 1B16A 4D8UA 1JLMA 2YS6A 2AMYA 4MKIA 2KQUA 1TCAA 2BFCA 3CX8A 4JODA 4UNIA 2C5EA 4XR4A 5AKLA 1M6YA 2WLSA 3BE5A 3P9CA 4ER3A 4BNFA 3MYYA 1OXKB 4O8ZA 3EDQA 4JC8A 4X20B 5DRTA 3GAMA 2EIHA 4KFRA 3PNSA 4OO3A 5CW1A 1HL3A 4PGFA 2D5BA 2CB9A 3ENVA 2R47A 5DGCA 1RVDA 1AKTA 5DOZA 5FNVB 1M0WA 2WVJA 3AKCA 4PN3A 2XD4A 2XR1A 3PT5A 4XYEA 1CJCA 2VDLB 4WK0B 1U31A 3GLQA 4Q9IA 4XOIA 5HE9A 1SAYA 3NWBA 1BKSB 1NF3A 1P75A 2GEKA 3NATA 1NBOA 1Z35A 1L1QA 3FTPA 3BXPA 2POCA 4DADA 2CMFA 1NXSA 2ZE8A 5F78A 5HGXA 4G23A 4MIEA 4U39A 3UW3A 4BYMA 1AA9A 5J58A 2PLFA 1XN1A 4XX1A 3A2NA 4QO7A 5KMGB 4FHZA 4O25A 4U7PB 4EB8A 5IDXA 3NBYC 1R4MB 3MJDA 5DHUA 1LBTA 2ZI5A 6ABPA 2MSLA 2OHHA 1QG4A 3ONNA 2NU8B 4GICA 1Z7WA 3C3MA 3AF5A 3ABSB 3GH1A 3W4KA 2GPAA 1M9NA 1NZFA 2YZGA 4X85A 3Q9SA 1RJEA 1W2WB 3OJLA 3QSGA 4XLZA 1HNZB 2XBUA 4D4GA 2AE2A 3HM9A 1K7YA 3R76A 4ZEXA 2H4ZA 2KLHA 3AZOA 3ZLVA 2B21A 1P7YA 1KFCB 4CT5A 2BOVA 1C50A 4DNQA 1XMXA 1JW9B 2DKFA 2Q1TA 1HETA 3PQFA 5MN4A 1KRHA 3IUMA 3TR5A 3KB6A 4D25A 4FD2A 2F7SA 1T5IA 3DMDA 3K1YA 4GSYA 1NXVA 2DFKB 3U3DA 2G04A 3QMPA 4CFZA 3KEGA 5JJIA 4OL0A 3IPYA 1SBIA 4LY3A 2FN7A 2OB1A 4Y7DA 4CEJB 4RKEA 4NV1A 5DIZA 1NFFA 5HRAA 3PHJA 1NFRA 2Z43A 3MRXA 5KI6A 4EECA 9ATCA 2E82A 5F2KA 5F1YA 3TMYA 5HWSA 4QVGA 3TQTA 3T9FA 3STWA 3LP6A 1PEKE 3KFVA 4G5HA 3SKYA 4E33A 3I01M 2Z08A 3RIMA 4W9NA 1XLVA 3L49A 1G64A 3W2HA 2J3KA 1Y1RA 2EBFX 2AEMA 2V5AA 4ZV9A 3PRJA 5FUMA 4ZVUA 5KKCA 2CB0A 2X23A 5D8DA 3OQMA 1WO8A 1B93A 2CLCX 2M1ZA 1GTVA 2EHJA 2C4NA 3WQQA 1GNTA 4D5EA 2DZDA 4FFDA 4W5WA 2CFIA 2J9FB 3TEJA 5KHOC 2IW1A 3C14C 4HTFB 3QKWA 7REQB 1MJFA 5BR4A 1C4WA 2NQ8A 4PLGA 4W8GA 1DX4A 4RVDA 4D3XA 1IJEA 3AV3A 3DFZA 4PNHA 3G9QA 3DEFA 5H83A 1AKNA 1TO6A 4LF8B 4FCWA 4TKVB 5BWLA 3LQ4A 2FZGA 2ZITA 5ABPA 3OLVA 3EHEA 1LLFA 1Z2DA 2EFCB 4GQBA 1I2CA 4OJYA 5B2FA 3G6WA 3KZNA 1R8QA 3WISA 1KO7A 2IHYA 5BNWA 5L7WA 4NJMB 3FZEA 5JRJA 2O54A 1IHYA 4PCUA 5JXGA 3ISTA 2YVUA 4NCAA 1UC4B 3C74A 2RHWA 1YSCA 4ND8B 4COOA 5YASA 2FP4B 4BVKA 3FHJA 1JR2A 2NXNA 1E1QA 4Q3LA 2Q62A 4NQZA 3V2GA 5LMUB 2VNSA 2OHIA 2NU9B 1CQIB 2IRWA 4QOIA 3WX0A 2I4RA 4FDMA 5EQFA 4ARZA 3PGXA 3HR4A 5HTKA 4L7VA 4F96A 2EZUA 2GETA 2WD9A 4CZ2A 3MCUA 4AP9A 4IZIA 1NV9A 5DBIA 2H2WA 2ZBQA 3LSYA 1K7CA 1SUSA 3U0BA 1G8KA 3RS8A 1IQ0A 1VYTA 4M9SA 1RJDA 1A9OA 1CUAA 2YN2A 4JD5A 4NF2A 3TTVA 4CIBA 1UKYA 4R9VA 2NT4A 4F8JA 2HJVA 3MM4A 1EFTA 4WFIA 3M6MD 3IV6A 5FTLA 4D2IA 2MSKA 4NBNA 2QVXX 1M1XB 4W1PA 3A4VA 2CVZA 3SIWA 3TYXA 2CWDA 3OIDA 4YJFB 1JNXX 4G4JA 5E4TA 2VRNA 3VKUA 2OZLB 4UDNA 2C9MA 4R71A 3TGLA 4TUYA 2NACA 3IJRA 2X15A 4O2AF 5M34A 4TS3A 2WSSA 2HQOA 2RB4A 2WSIA 3OLQA 1YR6A 1KSHA 2QTWB 3K9WA 4M2LA 5LL6P 4G09A 4D99A 1ZK4A 2YASA 4KO4S 2BGWA 5EJMA 3MTIA 4BP9A 1EFCA 2JGAA 3W4JA 4IZ6A 3WKCA 3O8QA 5TIIA 4HDKA 3WKBA 3PXDA 3L40A 4X1KA 4DJFC 1FFGA 2WP0A 3V1LA 1TECE 3I39X 4ILEA 4YP1A 3SZOA 1EP9A 1T5DX 3HADA 1EEXB 1NC1A 3ZEIA 5JYCA 3K94A 1G2OA 4EWLA 1YS4A 1Z0KA 3GZNA 3O4RA 1MB3A 4M3NA 1A72A 1T9GR 3HDVA 5EGSA 4ZZIA 4BJHB 1SURA 3SYNA 2CZCA 3NWEA 2CLEB 3WDKA 5J40A 5JAIA 1DPFA 1L5MA 3LBNA 3IKJA 2BMAA 3PHCA 3WBJA 4WNIA 4YLGA 1RRVA 3QEBZ 3K0BA 3A3NA 2L2QA 4CN8A 4GOJA 3L4EA 1YS9A 2W48A 1BS9A 3H13A 1JEQA 3HM2A 4CTMA 3L8DA 8GPBA 1PWYE 3I83A 5JH7F 1T9AA 3U17A 3QXXA 1P72A 3E70C 5I47A 4XW2A 5FOWA 3BH6A 4V39A 5BN4B 2ODWA 1Y5LA 3T5MA 2PSFA 4KLNA 4JI5B 3G8BA 1FJXA 1TJ3A 1Z4KA 3RIXA 2FZKA 2I1VB 5AKGA 2WRZA 3SHOA 4K3UA 4Z3OA 4BQNA 5AJTA 3EIUA 1GGKA 3PDHA 2FPIB 2WJ4A 1QDEA 2FUKA 5IC6A 4C6RA 2QBYB 1L7XA 3UAYA 4EATA 2CUZA 4LE0A 2QTNA 3IEMA 2MR6A 4IIEA 3DAOA 1Y9EA 2EKDA 4I9NA 4OQXA 3GLGB 1J9GA 3BERA 4OAQA 3ZTYA 4ZKEA 4P0TA 1UXKA 3W79A 2QI9F 3FYSA 5T4FA 4PYQA 3R9XB 4N7JA 4UREA 1PHRA 5BQ3A 1WZCA 3CG4A 3RS2A 4ACBA 4I3FA 6CHYA 3EZ2A 4FMDF 2ZVQX 3O4GA 3AOEA 3QVUA 3ZHRA 2QAGA 4ZYVA 2VJPA 4EJFA 1L1EA 2UYHA 2ZRPA 3FB1A 5CD1A 3G8CA 1XV5A 2WYIA 3HY6A 1ZJWA 2YWDA 2F3TA 2YJTD 4EJ2A 5IEJA 2LVBA 4AYXA 1PW5A 4ICIA 5JLJA 1XYGA 1JIKA 2BP7A 5HUQA 3KKZA 1EXDA 2AXEA 3OPQA 4DA0A 4L0MA 1Z0AA 3SJAA 4DCSA 4DUGD 1AS2A 1T4BA 3KOXA 3TOXA 2P11A 3HYTA 3NCTA 5AM4A 2ZS8A 1EBBA 4EHHA 2GZMA 3AF6A 3EFOB 4KUHA 3R3VA 3M34A 2QL7A 2EBUA 2HSJA 3U4CA 2VKTA 1YB4A 4UOEA 1QIKA 1R9NA 1JQ5A 3EMVA 5H02A 3KG2A 1U7XA 3D6VA 3ROGA 1A27A 1ZL0A 1IEWA 1IIBA 4LYFA 3IP5A 1G21E 2GHIA 1XMPA 1DRKA 1SHUX 4GVXA 4NESA 3RS4A 3VU9A 3WRXC 5JAOA 3FIUA 4XGQA 4QJ3A 4EZBA 2B1QA 4EHIA 2HKIA 5F5LA 1X80B 4G9EA 5U9CA 1M8KA 3FMOB 1PN3A 2JCYA 3CTPA 2BFEB 5G02A 1GP2A 1IZYA 4ASUD 1DAIA 1WRBA 2RGWA 1K1EA 2AUNA 2OCLA 4GXTA 4R4JA 6REQA 1OB2A 3ZDDA 3RIYA 3DUFA 4OUDB 3LWNA 4DABA 1P5RA 3OZBA 3CJQA 2W6IA 4I5IA 2DLDA 5JC1A 3MRTA 3SAJA 3JWHA 3JQ6A 4KU4A 4RD6A 3SOPA 2ST1A 3VH4A 2IYOA 2VNAA 4KR9A 4ARBA 4XM1A 3U4DA 3ZW9A 1H1LA 1XTIA 1FTYA 4RSRA 1Y5IA 4J9VA 2PX0A 4IKEA 4RK1A 1KNXA 3ZWXA 4B8YA 1K6IA 2F55A 3ELDA 3OQ6A 4ZTBA 1KU0A 2V9ZA 4BBZA 5IMSA 3IMEA 5SY6A 1JPVA 4PAWA 2BF4A 1ATIA 2NZ8A 3QPUA 3V8VA 1V3VA 3CHYA 2VJBA 4KCGA 4EI7A 2ZRDA 4EJSB 1HGXA 4YAJA 2X8AA 3FG9A 3LGXA 4WOCA 5EZYA 1UBCA 1L3BA 3DF7A 1FC0A 4B35A 2G06A 1LLDA 4LDJA 2QG4A 2EATA 4XRRA 1D5WA 5I4CA 3MGAA 2I6FA 2WZQA 3HY4A 3UJ7A 1RS0A 3AJAA 4M0MA 4FLEA 2RC6A 1UJMA 4RKQA 2IYZA 4I9UA 4WKPA 1N5RA 5KTPA 3EWSA 3RRJA 1YTUA 3HHPA 1EU1A 5AVSA 5IXSA 1GGMA 2MDTA 3BMNB 3GEIA 4G1CA 4MRMB 1DKPA 4WLFA 2B25A 4ZAZA 1O89A 4DA7A 2VA8A 4UCQA 4X1IB 1IM5A 1SHTX 2CXHA 1EE9A 1W0KD 1T0PA 3D0KA 1DB3A 4ZTZB 5ADWA 2QT0A 4JYBA 1CR0A 1B2RA 2HMYB 4ARUA 2HPAA 2MT9A 2A88A 4HHEA 4D56A 4N48A 3I9V6 3RSHA 3FSEA 2MTBA 3DEZA 3SOZA 4KMMA 2GNPA 3I2FA 3D3WB 3FYHA 4NHOA 1RBYA 2IYNA 1FOEB 3H1AA 4NZZA 1NF8A 2ZE5A 3K0AB 1GL3A 5AJZA 4WAUA 4QHTA 4KXXA 3QFRA 4JGGA 4KK4A 3WLLA 1B8VA 3TI7A 4DLSA 5F3RA 4UNQA 2CFCA 1J06A 4L8VA 3MWKA 1M75A 1ZFNA 1KDOA 5DK6A 5DH9A 4NONA 1O3YA 3CVVA 1YU6A 2V7GA 3VVMA 1KZ4A 4CR6A 2FEMA 3JASA 3TZQA 4J6FA 3VNSA 1X39A 1TRHA 3FJOA 4S1NA 5DBOA 1JEEA 4AP6A 3NTRA 2D0DA 2I66A 3VNRA 1C7QA 3C6KA 4FHEA 3VZDA 5JDIC 1FP2A 2VNJA 1SUWA 4LDRA 2G5TA 2XECA 1CX9B 3NHMA 3SQOA 3ZWKA 3EPJA 4MRSA 4TKUA 3BH7A 1Z88A 3FHLA 5CVTA 5MFPA 4JI8B 2DBQA 1OTYA 2BCJQ 1GAQA 2D1YA 4CQLA 1MJNA 3H1EA 2C0QA 3E7PA 5E8JA 4KXFB 3IT0A 4LE1A 5MDHA 4DJ5X 2AB0A 1GTG1 2AF4C 4V1CB 3O94A 2HK8A 2XMZA 4NYJQ 5CJJA 2OK8A 5BQPA 2DQ4A 3OP1A 3H2BA 4H6XA 2J4CA 1Z6TA 5A5VA 5JY1A 1XT6A 2PQ2A 1X70A 2DU8A 2ZXFA 4QLOA 2AEJA 4AG6A 4WBNF 3VVCA 1CCWA 2B8EA 1KK2A 3IBCA 1T35A 1E3MA 3IERA 4ERXA 1XQXA 4JZKA 5TS3A 1GYRA 2C3OA 4WQMA 4FE4A 2HA2A 3D0QA 1QYRA 1U8AA 3I09A 3MJEA 2GZSA 1EJBA 3PQCA 3SGLA 3U7EB 4B31A 4N39A 4IP0A 1OAAA 2AKYA 5KSPA 3UHJA 5IX8A 3U19A 3F9RA 3HU3A 1GUBA 1RXCA 3ORRA 4JWKA 4QHSA 3PNLA 1U2EA 1GXSB 1N0UA 3KQSA 4O4IA 5JS8A 4DB4A 3NHFA 2CLMB 4RABA 4W8OA 3E9MA 2OUKA 3K96A 4NPCA 3W9BA 3RYHA 2WWIA 3I2HA 3P4XA 4WMLA 3ZKAA 3MWLA 4WXEA 5HRUA 3S6JA 3O3NB 4FQ7A 3KDAA 2JD1A 3KB2A 5IBQA 3RPEA 5KYYA 1NMQA 3M5PA 1JG7A 3TTSA 1ZVJA 1Q2UA 1R74A 3DBRA 3UN1A 1G4AE 3RJZA 2IS2A 3BWXA 5D84A 2VZEA 3N2EA 4LXTA 2Y8EA 3KL2A 3VRHA 3BE4A 5LP6F 2VTKA 4OU5A 1JMVA 3S70A 3WP0A 5FX2A 3ZI7A 3GBPA 3VPBA 1QPZA 1AKUA 2OMEA 2W6JD 1EFRD 3CO0S 6ADHA 5I9IA 3HV0A 1W4CA 2NADA 2ZS9A 1RFLA 3KSRA 4OFBA 1FNNA 2W93A 5TF0A 3UC5A 3CJRA 1MAHA 1MVOA 3JD0A 2FZWA 3P0JA 2HZBA 2D62A 1O77A 4MYHA 2NYAA 5ILGA 1SUDA 1XAGA 1YBAA 2FOLA 2JCVA 5IAJA 3TTYA 5ALIA 4PHCA 2Z3VA 4UHDA 1FYVA 1R8XA 4UULA 2LXNA 3MTEA 1CEXA 4LRXA 4LZOA 2PSDA 1V2HE 2NT3A 5T5QA 1KP2A 3HHEA 5FA6A 1H4TA 1OFTA 2A4KA 5DHQA 3H3JA 1XVUA 5TT0A 4CM6A 3A6JA 2ONCA 1XF1A 1J8MF 1ZXBA 2I6UA 5CXSA 2P4QA 1K75A 4WXHA 1FP4A 4XX0A 3D6HA 4P92A 5K4AA 5DSZA 4Q00A 2G08A 2PXCA 3AIIA 3R3SA 4J91A 5F98A 1CY1A 1FLDA 4OQFA 4FSHA 4F97A 1IDOA 3BTUA 5JR3A 2FDRA 2Q4BA 3F6RA 1ZHOA 1BZYA 1NYLA 1S3GA 2AI1A 1G8AA 1QH1B 2ECQA 3SYKA 5EIBC 1PV2A 2C2WA 4HAXA 4DQKA 3H17A 2ID8A 4RE5A 3EVEA 3DEAA 3ZE8A 4A10A 2J3IA 4MQEA 3UK0A 3VQTA 4LJ4A 2O2IA 3EAFA 3K0CA 1ZR4A 2J1LA 1DDIA 2RHJA 3EGXA 2II6A 4M0KA 3DHWC 4RENA 1J00A 5JDCC 4KKVA 4YIKA 2XA2A 2AZ4A 3RWOA 3BF7A 1SQ6A 2CVPA 5IS2A 2FX5A 2XMSA 2VG8A 4A0RA 1G9TA 4B6OA 4KNVA 4TZKA 1DEAA 1I5RA 2L82A 3VU1A 4AWAA 1YZNA 2FF5A 5CIWA 1ZC3A 3SWWA 1J99A 1USGA 2V4MA 4ALJA 4EF4A 2HUPA 2QMYA 4UJ5A 4JYPA 3G79A 1Z63A 3OZXA 3PQ7A 3KU4A 4L72A 1ZW6A 4NYMQ 2XMDA 3WHLA 1ESZA 2BZ1A 1F9AA 4K9PA 4BNTA 4YV1A 3IJEB 2BR5A 4WJZA 5DIFA 2OC9A 2NZVG 2XEDA 1MIHA 3GN2A 3MHPA 4YJHA 2G3YA 4GX1A 4QG7A 3H1BA 3RAPR 1IJKA 3RWMB 3VR6A 4UD2A 3RT1A 1XMVA 3ICEA 3DH0A 4R68A 1K89A 1D1QA 4UPDA 1M6VA 2PUGA 3E5MA 3MINA 1DE0A 3FOEC 4AK9A 1RCFA 2P5UA 3U6BA 5K8VA 3H42B 2QVYX 4ZEVA 1PQYA 3DQQA 5G4KA 3OLZA 5GP1A 4DANA 3CH4B 4BFCA 5GZ1A 4LJ7A 5LQAA 1Q7RA 3QY9A 4UXIA 3NEAA 2E7ZA 3L79A 4HOYA 3IVMA 3EIQA 2ID7A 1ZN7A 4HGRA 1Y8RA 1FSSA 4ND7A 4ERNA 1OMOA 3ZIAD 2OCPA 2WICA 3K4HA 5TC4A 5IAOA 1O8BA 4B3JA 2ZTMA 2D7DA 5H59A 2HCFA 4LF5B 2IEGA 1XALA 1U2GA 4EPVA 1PU2A 3LCVB 3G2HA 2QIPA 3WADA 5A4IS 2R6GA 2QN3A 3I9MA 3G1WA 4M8KA 5EJ9A 1PWHA 1SN7A 2I3GA 4MA0A 2BN4A 4Z7OB 5L51A 1Z82A 3RFVA 2EKZA 1WMDA 3FGNA 4EY3A 2DHRA 1MXFA 2IT1A 3LPAA 3KYCA 3PJEA 4RZHA 4AKEA 2CHUA 2EJBA 3E5NA 1MB2A 2V45A 1NRXA 5ENZA 4U3JA 3L8CA 1CYDA 4YT8A 3S0JA 2JFYA 1QGAA 1WCWA 1XTRA 4DY6A 2PGOA 3EXFA 1DBIA 3LF1A 3OM1A 4KHZA 4UPVA 1WPXA 2DULA 3H1FA 4DNXA 1F8GA 3B1XA 2CHVA 2W2TA 2WJYA 3CNEA 3KETA 4KITB 1DT5A 4TYYA 2G83A 2O7SA 2REQB 3CUTA 2WFLA 1Z2OX 1MC5A 4J1SA 2A0KA 2XVYA 3O2NA 1CJUC 1RKXA 5B3AA 2G1JA 2IEZA 1GHTA 1YZHA 3EUFA 3GLFA 1LPMA 4QUEA 3UH1A 1QVAA 1ODIA 1OZ0A 1WCIA 1KH2A 3CT4A 1TM1E 5EXSA 2O14A 5FPYA 5A9SB 2F8SA 1CP2A 1RWPA 1P2GA 1C3EA 1AIPA 3NRCA 1IPHA 4DJEC 2G1UA 4MUYA 3EFEA 4RMNA 2L0XA 4G2NA 4H0NA 2O2HA 1J1IA 2J32A 4N5IX 3AUKA 1M34E 4NNOA 4OOFA 4PSVA 3O1HB 3V8PA 2WWYA 3IT3A 2GCIA 3GP5A 4MVJF 2X7XA 4TV8F 1MGPA 4GM0A 5TMBA 721PA 5LYJF 1PKXA 4UM8B 1S4MA 1WVGA 5HDQA 5DW0A 4POAA 1NM5C 3WSWA 5BV8A 2D74A 4JELA 1TI7A 4KXYA 1GOTA 1C3OA 1KO5A 3FI0A 4K6MA 4PSAA 1QDLB 4HNGA 4B7ZA 4ZCIA 4JBGA 4Q4JB 5DXJA 2N75A 1U6JA 1ZA2A 5DWVA 1O9GA 4P5EA 1SCKA 2PY6A 3AEUA 4ER0A 5TSDA 4N49A 4RTPA 3DMNA 2Q3BA 3TIVA 1QIGA 1E6CA 2VYVA 3DG9A 1KIFA 4EB0A 5HUHA 2I8LA 2QNBA 2VAMA 2REXB 4IMRA 5CFLA 2OY0A 5INTA 1YONA 3M89A 4MZXA 3PF8A 1SXJA 2ZRNA 1P1HA 4HATA 2MOKA 2W2VA 1C7RA 3AR6A 4PVCA 1UPAA 2A9RA 1UPXA 4WVFA 1NLYA 1YJCA 2FX2A 3LT0A 1I3KA 1U8YA 2ZUWA 1YNOA 1QYIA 3E9DA 4HQLA 2EJTA 4M1TA 4M89A 5F5NA 5JCJA 3KD3A 2W2QA 4KXMA 1VJGA 3ZGNA 2Q3LA 1M5UA 3I53A 3BK1A 3WNQA 3CVOA 2AEEA 2WF8A 3BC1A 3U7JA 4AQ7A 5AJHA 4AUNA 2I8CA 4Q7JB 1UEIA 2ZU0C 3DOHA 1WBBA 1QANA 3UCEA 1UBTS 1RI5A 2XRFA 1JWAB 4G5QA 2QRPA 2VBFA 1NBHA 3MNFA 4DRYA 4TN5A 4GPD1 3P0FA 1KOLA 4ONEA 3TQFA 4NAHA 3FDFA 1Y8CA 4B48A 2A35A 4S2UA 5LZ8A 2EZ9A 3EXG1 3PENA 4R0NA 4CKEB 3L7OA 1VPTA 1TKBA 3UHOA 3UGJA 4FYXA 5K3BA 3W2FA 4PC6A 3VR6H 1XNJA 1IOVA 3GHHA 1BJRE 4Q1BA 3GEDA 5EWLB 3AHJA 4S12A 1P18A 1V6AA 3NALA 4BTLA 3LBHA 1FDWA 3OKFA 4DN6A 1AUVA 3AHFA 4JC0A 4J0EA 4QXMA 4B43A 3OZVA 4RY0A 3CLSC 3I0MA 3ZC3A 3SHWA 2C83A 4NMMA 2FMKA 3HQ4O 4W5HA 1HYBA 1TKRA 3O93A 1U28C 3DHEA 4AZWA 2H7XA 4ESVA 5DXFA 1V9LA 2D2EA 1CLEA 3LVFO 3Q98A 3JY6A 4OHXA 2CGEA 2IUFA 4DC9A 2MMCA 1N6OA 2FG6C 3JR7A 4GYKA 4NBTA 1OB5A 1XU9A 2PUTA 3NONA 2O7NA 4IXWA 4DHEA 5IPFA 1WD7A 5BOSA 1XQVA 2OORC 2HRQA 5CB4F 5K45A 1Z2AA 2P9GA 2WBLC 3I04A 4EHNA 4DXAA 1ODFA 2GPWA 4D41A 4AX8A 1IDN1 3AESB 3D8BA 2X7HA 4FMCB 3VO1A 4C4ZA 3Q8KA 3AT1A 4M21A 1LWNA 3HBNA 2O3UA 3DZHA 3SC2B 4BZZA 3ZQ6A 1X7GA 5JPIA 5EJEA 5DHTA 1E89A 4EY5A 2EOAA 3OX1A 2I6GA 4OSEA 3FMIA 3WGHA 2PKQP 3IMGA 3ETEA 1DXHA 4LV8B 4KVGA 1AF7A 1ZESA 4BEJA 3C4JA 3SKXA 3OPMA 3M9LA 1WY5A 3G17A 4L6AA 2SCUA 3RHFA 2NTVA 3SJBA 3PUWA 1USIA 3ETHA 4PCVA 3Q8XB 1M83A 1QP0A 4OFZA 1TZ2A 4OBWA 1I7DA 1XJQA 1JJAA 1UBLS 4MEJA 3ZGOA 2JGDB 1PJSA 2NUPB 3C3YA 4CG2A 2IS1A 4PQEA 4EJ6A 2P1DA 2CW5A 1R0BA 3I1YA 3HSYA 3MUOA 2QLJA 3A6PC 1GPUA 1NJ8A 1TCCA 1XVAA 2HQ1A 1DPGA 1FNBA 2GLTA 2RHGB 1KMCA 2WMOB 2Y1KA 2JEOA 2Z04A 4NCIA 5GONF 3VO9A 4YHHB 2H2AA 3GFGA 3LK6A 2C4TA 5BQ5A 3K6SA 3R24A 1Y6RA 2YWBA 4IDQA 4WADA 4U7JA 4DREA 4D43A 5K6AA 1L3IA 3G9UA 1N0HA 4U2GA 2BFFB 2PXXA 3IQEA 3W04A 3L6UA 4WEQA 1ZCFA 2QLBA 4NU8X 4U7WA 2Z30A 5C51B 5HOEA 1K0FA 1W2GA 1R5JA 1CUUA 3FOAA 3BVPA 3NFRA 3ONVA 4U8HA 4ALKA 4H77A 5KHAA 1SVWA 5HQ3A 2YV4A 1V0JA 3TL2A 4S1TA 4HB2A 3TZKA 4EHDA 1YKSA 4TWRA 3UPUA 1E9CA 2ZWPA 1DI0A 1ICIA 1SKYE 3AR2A 3BSSA 3PUHA 4XKJA 1OWMA 4P3NA 1BA2A 1WEKA 2R6JA 3DGFC 3FVTA 3C8ZA 1QMPA 2VAVA 3CPEA 3G9TA 3H2HA 5CPFA 2XQVA 3DD5A 4Z7NB 2V03A 4FTWA 4LF7B 3V32A 1KMIY 2BIFA 1U8TA 1J97A 1SKMA 1SR8A 1Q95A 2ATCA 2EBWA 3WYBA 2XYRA 2C7BA 3CZ9A 1RP7A 2QLTA 4NZ9A 3SXUA 3NNSA 1EB8A 1E58A 2P4SA 4MUGA 3SR3A 4RTJA 2VQ3A 3AZQA 1SBQA 3PD7A 4RTSA 2GILA 4RACA 2C96A 4GPAA 1RFGE 2WMNB 3A1DA 4BUCA 2GZRA 2BKXA 2R00A 3A9UA 2G25A 2VTBB 2KBFA 2MSDB 3P71T 3CRNA 1E2FA 3LX5A 3QF4B 3SFVA 2ID9A 1KMHB 5GY7A 4DLPA 3N6XA 1JAZA 4ZGWA 2HJSA 5AVVA 2W83A 3E1KA 2B2NA 1ZONA 2KYRA 3AC0A 4OQQA 1NBWB 4CCWA 2C20A 3TLEA 4LNAA 1VHTA 1HDCA 2GDZA 2R7NA 2R86A 2VBGA 2B1JA 3UXYA 3DR3A 1MDFA 3UJ8A 5IZCA 2HWWA 2ODBA 2Q1XA 4HNUA 5BXYA 1FSGA 2YV1A 4HUQB 3DAHA 1RHKA 3H9JA 3GQBA 4JBNA 4YJDA 5FWNA 4QOHA 5C8VA 1XPRA 2ODAA 1PGPA 3IT1A 4BDSA 2DWPA 1ZN9A 2CBZA 1BXRA 3MGBA 3EZLA 4JUDX 4R2WA 1YZLA 3LCJA 1X7ZA 2P9BA 4MJ3A 3ZXXA 1JYEA 3WXMA 3B13B 3K7EA 2FWRA 3Q7QA 3GUYA 2TMKA 5KC8A 4FFVA 1UFVA 3K71B 3IX7A 2GWHA 1J0EA 1TXGA 4QX6A 1WUKS 5T6MA 2GK4A 4X63A 3N6RA 1OHHD 1Z2NX 4H7DA 1FUKA 2QPOA 3CWQA 3PHHA 2IY7A 1V3QE 4MP6A 3U3XA 3ZXYA 3NHRA 1M33A 3V7NA 4BKMA 3OJWA 3I32A 1UMDB 5BSFA 3VJKA 1ZI9A 1P33A 1QM5A 3ZPXA 1OYVA 3GNLA 4UU0A 3PNOA 2P2NA 4TWZA 1A8QA 1XA0A 2XMPA 1P29A 4X20A 2WZCA 4B2YA 1ZSNA 4IDEA 4XVRA 1F8YA 3QM1A 3FMFA 3S1AA 4MIYA 3O2QB 3KEQA 1P7VA 1RQRA 4XWAA 5F5XA 4F3TA 1XCGB 2XUAA 3S44A 5D3QA 3M9XA 3PZRA 3TCKA 3I8OA 3QRWA 4IGAA 1AZLA 1UXJA 1Z6AA 3X1DA 4EW1A 1PSZA 4LTMA 1KI1A 1QIHA 1T2FA 4G8DA 4QT0A 5E6SB 2Q8NA 1L5NA 3MAAC 2MSCB 3Q9UA 3S2IA 1QGED 3SZMA 2YNMA 5E2BA 3T3DA 3S5UA 1NYRA 3K0KA 1NP7A 1CRLA 5HCIA 4B74A 4MKXA 4F92B 1MORA 3SZUA 3T06B 5ITZB 2XTZA 1LI4A 3NT4A 4B76A 5U4QA 5C81A 4J0KA 1WMEA 2ZAGA 3OCJA 2OG2A 5I7HA 1R0KA 2FCRA 5KMGA 1QQAA 4JJEA 4WTOA 1T8YA 1R4MA 2FR1A 3D6NB 1QIFA 4LXXA 4IIDA 2JHGA 5L45A 3P5SA 2VWHA 1CE8B 5C8YB 2VPIA 2NU8A 1D2EA 1PWXA 3VFDA 4BMDA 1LBIA 4ARIA 3AKZA 5CDSA 4OXYA 1DKOA 5CUQA 3MERA 3QKRB 3L0YA 1QGZA 1UBOS 1D0VA 1MJGA 2VWGA 1OX5A 1IHPA 4IVRA 4MVJI 1GNLA 1PJZA 5K0ZA 2ZZNA 4QUBA 4RC9A 1XU7A 4ATNA 1FVOA 5A4DA 1BWPA 2J3MA 3IIKA 1K4MA 2ZIVB 2ZLBA 3BWVA 3CUVA 4O02B 2DC1A 1BX1A 5TX7A 5LQNA 3HCCA 1MKYA 3B3GA 2R79A 1Y3CE 2F9LA 3PE3A 4R2KA 5F1OA 3WMEA 4L27A 4L0DA 4DIUA 2RK4A 3HFRA 3TQRA 1HDOA 4QQ8A 4G67A 1QU3A 2GS9A 4NAVA 2WKWA 3I76A 1BEUB 4E3WA 1NSTA 4UHHA 2IWHA 3ZE7A 4BAUA 4CEJA 3N0RA 3OD1A 4H16A 2J87A 3GN1A 2GUGA 2D5IA 2LP4Y 4LSMA 3SFTA 1SUEA 2Z6VA 1YQTA 2IP2A 2FR0A 3WI7A 5FDFA 3E9QA 5D01A 5F9FA 2G72A 4IIGA 2VAPA 1H65A 4ZO6A 3I9KA 4ZOCA 1RWMA 5CR9A 5HF8A 4BVHA 4E4TA 2WK1A 1PL0A 4M60A 1D4AA 4MLDA 2O7RA 5FKJA 1NVVR 1RQLA 5JNWA 2AS0A 2YN4A 1YVDA 1U65A 1U0JA 3PD1A 1KZ6A 3A3KA 2KI5A 3HYRA 3WK6A 2QTFA 3W8EA 1RQXA 3FGZA 4LEIA 3D7MA 4A2PA 3AB7A 1W49A 4XPZA 3OJFA 2J9FA 3P96A 4GC5A 4UTXA 4L4SA 4TVKA 1JIVA 1GLNA 1V5FA 2EZ4A 2DFPA 3ECSA 4HTFA 7REQA 3B6IA 1TA9A 2BLLA 1HK7A 3MBOA 1BO6A 4L5JA 5DASA 5LLDA 4GOKA 2BGGA 2ZR8A 3VNBA 1E9SA 1KEVA 4IILA 1JJBA 1LV7A 2XTAA 5IVDA 1LQTA 2RBGA 4MI6A 4WECA 4TKVA 5C4MA 5KUTA 1HZZC 2BMEA 3EEIA 1EGMB 2OOKA 5DV9A 1E1RD 1GRRA 1DMSA 1QVZA 1SG0A 2NLOA 3L82B 1E1CB 4DIEA 5K8LA 4NJMA 3QA3E 4Q15A 3MVEA 1YK0A 2QTZA 2XDWA 3G9ZA 4IDDA 4QRDA 3WGMA 1R0RE 2X0IA 4ND8A 4TLEA 4PC2A 5A3VA 2FP4A 3C5CA 5DYTA 3LUGA 4MITA 3L1JA 4DLUA 4LRUA 1RLJA 1RYNA 2NU9A 4QTZA 1JTVA 2YH2A 3ADKA 4CMEC 3T9DA 3U5TA 2GERA 5K9ZA 2YZ2A 4B2IA 4HWSA 1NPDA 5B55A 2E55A 4GAEA 4NV3A 4ER5A 2N1BA 3M6UA 5IJ0B 2AG8A 3LXXA 2MMGA 4BMVA 1GRNA 3KQMA 1OKKD 3V1KA 1YCHA 4N65A 3H9GA 5K0EA 5DISB 2EJVA 4LDZA 4F4IA 1QTNA 4OFXA 2OGWA 4QVKA 4D4MA 4LA4A 5DBGA 2PEZA 1GTZA 1J1ZA 4DKXA 3SDSA 1QO7A 3MILA 1YR1A 3MCVA 1X77A 3WWYA 1YU9A 3NKFA 3JRXA 3UMGA 4RF2A 3X1XA 5JS2A 2GZ3A 2M1XA 3NV7A 4L02A 2DUJA 5KYVA 3V7UA 1ZCJA 1ONSA 3M6IA 1L4KA 1NMYA 2X3FA 3GGDA 5BN5B 1N1MA 4YJFA 3TSZA 3ZU5A 1V35A 1W19A 4ZIRA 3HC7A 2OZLA 3U9TA 1PUXA 3N1UA 2C77A 2C98A 2IU6A 3TINA 4BO4A 1CZRA 5AI6A 3NQ41 3KC2A 2YJ4A 2ZJ5A 5IASA 3TK1A 1OWNA 4IZHA 1B41A 1M0SA 3KKNA 4TX1A 3DBLB 4B6RA 2G0TA 2KMLA 2WKPA 3NTXA 1GA1A 2FN8A 4G5XA 5ESWA 3VI3B 1TVCA 2A30A 4ECEA 3AEXA 2O8VA 3VHLB 2P2LA 1SVKA 3FUUA 3GR6A 3NXKA 1FUUA 3O7MA 5GOZA 2WMYA 3T3EA 1QC5B 4BFTA 2Y1OA 5BWMA 1A8PA 2JLCA 4R8RA 4CV1A 5KU1A 4BNGA 2AEFA 2C3MA 2PKCA 4QOFA 3SJCA 1VP3A 3FFBA 1W85B 2VDQB 4DDKA 1D09A 4RFSB 3I2GA 1RPTA 1TTHA 2BGMA 2R7LA 4XCQA 2PLRA 4CM9D 4AZ0B 1KGSA 3DL0A 4DDMA 3LXMA 4G8CA 1UEXC 4GBGA 4XJTA 3ZCRA 2VATA 4WA7A 1EXWA 2M98A 3GAAA 5CNIA 5SYNA 4DT1A 1WAMA 4E7PA 3HZOA 4K9KA 3SY8A 4POOA 3R8FA 4G0OA 3O82A 1RRMA 5TQ2B 3VPSA 1DJNA 2CE7A 5DBHX 4AWXA 4C4SA 1MB0A 3RF7A 1QXSA 2FPLA 2L19A 4MYCA 3N70A 2JKYA 2C5SA 3JQBA 4N0EA 1T0JB 4P38A 3HDJA 4Q66C 2Q1YA 4MKFA 3UVEA 1AMUA 2HIGA 3T1HB 1E5LA 1U0TA 1IG3A 1SXJE 1TU3A 1WUJS 1DC4A 2J7PD 3H05A 3O92A 1GCUA 3PNVA 3MAJA 4IIJB 4MA4A 4DCCA 2GCEA 3R41A 4C03A 3FLEA 4R7GA 3DMYA 3IOBA 1RRPA 2P0EA 3FPCA 3N39C 5K2OA 4KBGA 2IF0A 2ZJYA 1YASA 2JPDA 3D6TB 2GXUA 3JWJA 5FBQB 5B5SA 3UUWA 5F9HA 2FNAA 4RZIA 5FUBA 1JQ3A 3KRTA 5TJHA 4X71A 2FPIA 4KV7A 3THOA 2Z58A 3I0ZA 3L7KA 2FHSA 4FI3F 3JWPA 3EEBA 4IIBA 5ALJA 4AJ1A 4ECAA 4ZVMA 4NIMA 1GNRA 2IVZA 2XNCA 4JOSA 5U1PA 1XROA 3TNLA 3WKAA 4ZCLA 2JIOA 4TYNA 2VSXA 4WBXC 2QXYA 1Z2EA 1C0EA 2Q7XA 5HIIA 4US0R 2LCFA 5AHWA 2Z5FA 2R6DA 5A05A 1JWLA 4IFEA 2JC3A 1R18A 1NJ6A 1Z6GA 4C5AA 4CCSA 5JZSA 1CEEA 1HDEA 5CLQA 1S9DA 1TJPB 1R15A 3UAGA 2OESA 4B6FA 4HN2A 1XAHA 3BXOA 3OY2A 1CR6A 2OB2A 3ED5A 1CJVC 2X77A 2EFYA 5B53A 4J7UA 3LT4A 3PPWA 2GN6A 3T7TA 1DBVO 4JV5B 2YMQA 1JXOA 3EFOA 1ZBDA 2ZYRA 2X0KA 4JLDA 1YZFA 5T4BA 3HCRA 4NBUA 4NCNA 1ZP6A 4IJ5A 3W3AH 2PFSA 5AVRA 4QE3A 3KUKA 3ILYA 4UAJA 5I48A 5JV5A 2BFWA 3KYJB 4LJAA 4KQEA 4G41A 4P1ZA 2AZDA 3O73A 3QLVC 4BQOA 3NUZA 5ESDA 1TF5A 3SQLA 1YJQA 4GZMA 2GCOB 1OU0A 3SHFA 4K05A 4S0ZA 5TGZA 2XADA 4LRTB 2C7QA 2BKVA 4G0MA 1X80A 1HSOA 5EN4A 5EP2A 2LE0A 4OYHA 3RADC 2ZDHA 2VJQA 4YXWA 4PZAA 3PA8A 2BFEA 4YJ2F 2CSUA 3NDJA 3A6EA 3T0IA 4KP7A 3WK7A 2WTUA 1XR3A 3K9FC 1KDZA 2X5KO 2O57A 1K2VN 2GRJA 3NB0A 4F7WA 3VKGA 4BAZA 1IQPA 1OI3A 1UINA 1UANA 2X4DA 3I6BA 4TTVA 4XAQA 3UJ9A 3WLHA 4BVGA 2XQJA 4B71A 1PX0A 1U99A 5L8VA 2B36A 4KRFA 2XV1A 3OQNA 2ZBVA 5DHAA 1E8MA 5AOVA 4V3BA 5AJWA 3R7DA 2DH6A 1JKFA 4HNHA 3NBUA 2ZM6B 3OCVA 4PZPA 5FWXB 3IR7A 3CZMA 3I28A 1IXZA 2WU1A 1A4UA 4QXAA 1T9ZA 3DW3X 5MHTA 1KH3A 4BBJA 2FI1A 2RGEA 1HDRA 2DSNA 1N6RA 2E1PA 2ZWIA 4C88A 2Q0XA 1H66A 3PIRA 1U8XX 4QUDA 3GJ5A 4CCYB 2W42A 3RNOA 4J76A 2XYVA 4GRIA 1GDDA 3H1GA 5FWAA 3FNBA 2C07A 4F2HA 2J07A 4EJSA 4DDVA 1XKLA 1P1KA 1YI8A 3FM9A 3F9IA 2VJDA 1E1KA 3PX3A 1WETA 1HMPA 1E2PA 2FE1A 2JHFA 2NTEA 2X1LA 2YV2A 3A4LA 1KWKA 4JI0B 1DT3A 4PG4A 2Y1GA 4LYGA 1KPGA 2VL7A 5T8KC 5DE3A 5IC4A 2BHRA 4MUEA 2J6IA 2I2DA 2IZOA 2Z6QA 3P7MA 1QYCA 4XGRA 1JL3A 1JIIA 1QRRA 3IEXA 3ZY4A 5DRYA 2EGUA 2WFMA 4BNMA 4O4HB 2WM2A 2WW8A 5C5DA 1AKWA 1B0UA 2ECKA 3BMNA 4Y6RA 2ZATA 1JLLB 3DLBA 2OXIA 1UJ6A 4JB2A 4HI0E 2ZGVA 4AN1A 1AS0A 1GPAA 3D6MA 4KLAA 3QNWA 2YJ5A 4X1IA 4WX2B 5EAIA 1Z26A 3KB8A 5FYQA 4IDAA 3NIWA 4N8EA 3UWPA 3I9JA 4ZQIA 4Y2VA 4E4RA 3KJNA 4RW0A 1J9ZA 2GN9A 5AVOA 1N8NA 3ZZTA 3K32A 4DJTA 1RMTA 4HAOA 1C5KA 2ZRGA 5BYJA 1JPNA 4EFNA 2FGKA 5H4GA 1Z33A 5DM0A 1EP3B 1DC3A 4HGZA 2DWQA 2O23A 3WNCA 1E1QD 2R87A 1OH6A 2IKSA 4GE3A 1N2CE 4GX5A 3E4CA 2R60A 1EGVB 3D0OA 2QN1A 2GBLA 3ADPA 3K0AA 2H3HA 3R4VA 4RORA 5EUMA 3R6WA 2C2ZA 3RE1A 1FJGB 4I8XA 4BN0A 2MINB 1L6RA 4X6YA 1YTLA 4GVPA 4F3NA 1O97D 2XIJA 4K3VA 2HYDA 4PZDA 4U2DA 1AUPA 1P5JA 3T3OA 1T6ZA 1SBYA 1YOVB 4PWYA 3QX3A 1TK9A 3N6VA 1CQXA 2WA2A 4TTIA 2F8MA 2WB4A 5A1TA 3DA8A 1C0KA 5C5EA 1HKHA 1ZLXA 4ZODA 4JLUA 2K4MA 1S8FA 5BYAA 3BL8A 3QHQA 4RK7A 4UM9D 1UBHS 2H5LA 1LX7A 4BATA 4E6PA 1EH5A 5DYNA 2AQIA 4HF7A 4I36A 4DFDA 2Y67A 3KVVA 1YH3A 3BUSA 3DULA 3PFNA 2QRVB 3ABIA 3EULA 1Y1TA 2WWGA 4IDCA 1KAOA 4RH3A 2E4AA 1QR2A 1WV0A 2PM8A 2FQ1A 3G2JA 3OE5A 1DMRA 1KDVA 3U62A 4AS2A 4BVLA 1K2WA 2I0FA 4JA2A 3A2MA 3LF2A 2TRSB 4Q7EA 1S01A 5AKJA 3TUIC 1EFUA 2H31A 2WIDA 1OF1A 2A5GA 1Y4ZA 3EG5A 3L01A 5FO0A 1M54A 5ETJA 3CW8X 1V96A 3TO5A 1Q3KA 4QU9A 4B5KA 1GXSA 4EARA 8ADHA 3U60B 3KE9A 1JXQA 1YE5A 3M3HA 3OZ7A 1B00A 4Q19A 1K6MA 2Q6OA 2DR2A 1G1AA 2Y3IA 3BREA 3IP3A 1KA9H 2YW9A 3A6FA 4ACAA 3UAVA 4BNDB 5CEFA 1SHJA 1GRQA 3HJGA 4MV4A 1DAPA 2I5PO 2BEJA 3THYB 2QM3A 1TUBA 3DXYA 4L0QA 3EXHC 1EZ1A 5AXAA 4X7MA 2O4UX 1IN7A 3KOUA 3RF6A 4DILA 2V7UA 4EZEA 4Q47A 3BDVA 1HOXA 1SEPA 1JZQA 5EWMA 2NVUB 3UAWA 3NX4A 1DWOA 5FLXA 4JXZA 2R3SA 3DBIA 1JT2A 3KALA 2NUTB 3K2BA 2C92A 5JE8A 4ABYA 4UQPA 4AU1A 1KI4A 3IOEA 2BFDB 1DAKA 3GJQA 5GADl 1ZG3A 4A1OA 1SUIA 1EUDB 1QFJA 1JYFA 2WIKA 1U9JA 1PEAA 2EX1A 2Q1SA 4K0RA 4RETA 3L46A 4ZOQI 5FBLB 4YAKA 4LCBA 2QUIA 1KF0A 4HLNA 3ADBA 1I1OA 5I8PA 2PR2A 3KLMX 3KVYA 5GJWC 3W77A 4NCBA 2TYSB 1KZ7B 5K4GA 1FTGA 1XRPA 4RQUA 5FI1B 3JR3A 3JZMA 3TUZC 1B4DA 4Q39A 2UXBB 3JCZA 1QWOA 1WLYA 3K0FA 4X8MA 4N5NA 1W1IA 4C0QC 3WO1A 5K99A 3TLGB 1ECGA 3ZK7A 5EMNA 4WLVA 1LWOA 2ZP1A 4ZAVA 3M6VA 5DF1A 1TD9A 4JX8A 5IJAA 1QH1A 4UAGA 3FOFC 4FHDA 1ZO8A 2AE1A 2ZUUA 4JIGA 4FB5A 2Q4DA 3QE9Y 4DIMA 1G9SA 1WHSA 1Z18A 2BY4A 3GUVA 4X64B 3ZCXA 4LKOA 1Q0SA 2Z1NA 4AB1A 5B6JA 1YULA 2XQGA 2PFGA 1GZ4A 1PQ4A 1KYWA 2GLXA 2Q1WA 4LVOA 2VF8A 2DX7A 1XCLA 3ZCQA 4CR7A 4D42A 4JEMA 2CVFA 1D2CA 4NFHA 5AQ1A 5FWDA 1H05A 2FPWA 3DOOA 3KEOA 3RYTC 4YMGA 1HFJA 1SKUA 1T9BA 2Q3HA 4Y9RA 4KZPA 1DU4A 2GN0A 3FKJA 4D57A 1NVDA 3KWLA 1YZUA 1L4LA 5A7HA 3X1MA 5HKOA 5KKNB 1ULTA 3RUPA 5KNBH 1Q1AA 2RARA 2DTXA 2QW8A 3U1TA 1JP7A 2CL6X 1CVLA 1Z8FA 5CMLA 3GYGA 1VMAA 5B7GA 3LUHA 4RAOA 1FTWA 1IRXA 1P0IA 1IL0A 1WP4A 2GAOA 1FRZA 1GKLA 3KU1A 1X0VA 4GVLA 3CISA 4IHJF 4W1RA 2A78A 4RVSA 2C7OA 3QVMA 3H1TA 3ER8A 2C8LA 3FOBA 4RIHA 1E64A 2G09A 4AP5A 4B7XA 3M81A 4FPXA 3P94A 1E3IA 3VTZA 4NYJR 4KFUA 2XZTA 2PS1A 4EG0A 3NGMA 1KKLA 3RC7A 3UHAA 3BAFA 4Z1MA 1MRNA 3NVMB 2RGAA 2I2BA 1UEJA 4NCJA 4WN9B 1B8PA 4WINA 2JFFA 3ZBPA 1XLTC 4GMFA 4RZ3A 2OFFA 3SYRA 5EHNA 4J90A 1EVEA 1L2TA 1G18A 1L7BA 3WGOA 3A2KA 1PT6A 2AKEA 1WMAA 4KX5A 2F3RA 2WHPB 3N7AA 1O87A 3PCXA 4OU4A 4ZA2A 4KRGA 5I8ZA 2H1HA 2R751 1RXVA 4BUJA 3V4OA 3T7RA 4DKJA 3DXFA 3TLBA 1RT9A 1YBFA 2PU7A 5T3YA 2FMHA 2J46A 5DLQC 4A16A 5HK9A 1BXGB 4ZKDA 5AIAA 5F52A 1CBUA 4TTTS 1ZIYA 1Y82A 1DKQA 2ZS7A 3ZJTA 2Z9BA 3L7LA 3QMMA 3A26A 5REQB 4HZUB 4OMUA 2HJWA 9MHTA 4KPGA 2GVDC 3QVXA 3FNGA 2REQA 3UT6A 5FEMA 4ITUA 3HRHA 2D8MA 1X1EA 5J4HA 4FEAA 1P7CA 3E0XA 3RT9A 1VIDA 2ZI7A 4G4GA 1GGFA 4C06A 1YVRA 4F5DA 3KJGA 4N8SA 4UTZA 5COAA 1R66A 1XZIA 2WJHA 3LZDA 5DWDA 1OFUA 2BMFA 3U37A 4TUYF 1V45E 4OHCA 4PTLA 4WZAE 4Z2YA 4YIHA 1TEVA 5B7QA 3MRSA 4IV0A 4F91B 1GCIA 4JYCA 4INZA 4KUEA 3S2EA 1NHWA 2OLJA 2RHCA 3LLSA 4B6QA 2G82A 2XUKA 3WRXA 1L4YA 2VSYA 4AECA 3ZHQA 3ZGZA 1S2OA 3CM0A 4BWGA 1E92A 5C4IA 1WSBA 1M1YB 4KO2S 5EMMA 3NWJA 1MTZA 1YAHA 3KCNA 1JG1A 1VG1A 4L0CA 3VDXA 5CIYA 3SI7A 3FPJA 4NECA 2Y0EA 3RYFB 4FHFA 4UTOA 2QLLA 1XXLA 4NENB 4Q4JA 1BCSB 2XXJA 4R7ZA 2IV2X 5A5FA 1LRJA 3B82A 2HK9A 3PHLA 4JLBA 4LN1A 3DBHB 4BFWA 4YPFA 2DQZA 1JHOA 1HXHA 4KBYA 5SZIA 4YT4A 4ZREA 4IAOA 2OXEA 3H4MA 1TPZA 2OAQ1 4PTYA 5BRJA 5LBUA 1QPBA 2GXSA 1HH4A 4FX5A 4I55B 5BY2A 5FJIA 3JQ7B 5JHGB 2GJ8A 4BIMA 5H3HA 3DGEC 1D8TA 4M7WA 5BV1A 2X0JA 1QDUA 1C81A 4MLCA 3PLRA 2OA0A 4ZI7B 3MS7A 1II9A 2OLEA 1PTKA 1D04A 3DFMA 3UYLA 5LQMA 3FTEA 1DC8A 1E77A 2AUMA 5DW3A 2IXGA 2D5AA 2NSHA 3I5XA 1PCXA 2O3RA 3TRIA 4BFYA 3A9TA 1QH8A 3AUAA 1L4MA 4HWTA 4J4TA 2ONJA 3W9UA 3A32A 1GRVA 4QQRA 1T25A 1E0AA 4HN4B 4JGBA 2JHPA 4NCHA 4NBSA 3AFIA 2GEDA 2EG9A 3WZMA 1UUFA 4M1KA 1MAAA 1WOMA 5KYXA 2IDMA 1XJ5A 1FFAA 2PD4A 2QUBA 3IVXA 4X24A 5EMHA 4HDSB 2IH4A 3VH2A 1X7XB 1WTAA 2XOEA 3P0HA 2O6LA 1S8OA 1FRQA 3F5QA 1WY7A 2OQRA 1QS0B 2J5BA 3AXTA 2C99A 3KKOA 3EAGA 2F9MA 5GMOA 1A5BB 1DXOA 3OTWA 4PX3A 1C8BA 2FA9A 4NX2A 4V3CA 2O0LA 5EWLA 1R6UA 4WVLA 2GM9A 3T9CA 3UIEA 5CFOA 5CT6A 3FMPB 5FIUA 2ONYA 2DPXA 4KDCA 5SY4A 3ES9A 2W98A 2GD2A 2G17A 2BBTA 4YP0A 1Y4AE 1LGYA 2C1EA 4RD4A 1ZXXA 4ZVRA 3R3WA 4CMGA 1TQ6A 2PXHA 3ENZA 4YRAA 2EU8A 3AK4A 4GL2A 2PRZA 4FEGA 5AUNB 4JR0A 5H0IA 4G8JA 1AK1A 4MR8B 4QYIB 2HYIC 3TPFA 3LI2A 2WNIA 1OZFA 3DWGA 2QMQA 2RHOA 2P2SA 2XUHA 1U8FO 2WIJA 2XE7A 4G1MB 4MP8A 3R7FA 5IT4A 4F5ZA 1BYIA 3BMOB 2ZI3A 2PTGA 4GNRA 1IAVA 2C84A 3AESA 4QWMA 3UJDA 2Z95A 5IW8A 2E89A 1DHTA 2ETVA 1Z0JA 3SC2A 5K0FA 2P6RA 4F45A 3BBPA 2XNJA 1XTPA 4M76B 1F3LA 1L0BA 3SEQA 4GC9A 1SB9A 3R5KA 3R6TA 4K81B 3D43A 4BGEA 4JDUA 2FK7A 3ECAA 3OD5A 2JFQA 1BDIA 1J2RA 5CYPA 1QH9A 3WYAA 4B2PA 2WKSA 3GWZA 4IFTA 1CUVA 4R2HA 1LLUA 2JATA 3U7RA 5E3HA 4Q12A