3GLRA

Crystal structure of human sirt3 with acetyl-lysine acecs2 peptide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
274
structure length
274
Chain Sequence
b'GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent deacetylase sirtuin-3, mitochondrial
publication title Crystal Structures of Human SIRT3 Displaying Substrate-induced Conformational Changes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase regulator
total genus 91
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 3glrA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3glrA01
1T9DA 4UTNA 4V1CI 3GLRA 1SZDA 3CF4G 2Q5OA 2JI7A 5EJ4A 5K2OA 3HWX1 1SZCA 4UUAA 3RIGA 2WVAA 3PDHA 5EJ8A 3CLTD 2NYRA 3JWPA 4GP9A 3GLUA 5DEIA 4D5EA 4BVGA 2EZUA 1N0HA 2JLAA 4GM0A 1POXA 1M2GA 1M2JA 4KPUA 4ZZIA 2Q5QA 1Z8NA 4UU7A 1YTLA 4RJIA 4Q9DA 1Q17A 4Y6QA 4BUZA 2BRUC 1T9AA 4FZ3A 3D7KA 4C78A 4JSRA 3OE1A 1S5PA 1Y9DA 4Y6LA 5MFPA 4G1CA 2EZ4A 4K9NA 2Q5LA 1OZGA 4F56A 1YI0A 2JI6A 4K9MA 2A1UA 3ZGOA 5EJ7A 1DJLA 2OD9A 3JR3A 2PGOA 4K9PA 5MF6A 1YHYA 5BWOA 3E9YA 3EYAA 1D4OA 4JD5A 3U3DA 1OVMA 4JU8A 4UU8A 1HZZC 1QPBA 1M2KA 4JUBA 3CLRD 5K6RA 4X3OA 3HWWA 2QQGA 3IAFA 4COKA 3CLSD 4D5GA 1YHZA 2Q5JA 5BWLA 2VK8A 1OZFA 2JIBA 2X7JA 2B4YA 1EFPA 1PVDA 4FEGA 4UTVA 2H59A 1PT9A 5EJ6A 1ICIA 4RMJA 4K9QA 5IMSA 2H2HA 4JUDX 4V1CB 2VBIA 1S7GA 2NXWA 4MZXA 4TWIA 5D7NA 1O96B 2OD7A 2UZ1A 1PO7A 1PNQA 1U2GC 4UTZA 2H2GA 1T9BA 3F6BX 4Y6OA 2Q28A 2OD2A 1YNOA 3D81A 1YBHA 3K35A 4QELA 2FN3A 4BVHA 2WVGA 2FSVC 4BN5A 4JUCA 4QPZA 5AHKA 1U28C 1UPAA 1UPCA 4IAOA 2OORC 4RJKA 4HD8A 1Q6ZA 4RMIA 2VK1A 3EA4A 4TWJA 4GG1A 5EJMA 4UUBA 2Q27A 1XLTC 4KGDA 4BV3A 4HDAA 1J8FA 4BVFA 1BFDA 2V3WA 4GM1A 2IHVA 2FWNA 1PTJC 2EZ8A 2Q29A 2W93A 3ZG6A 3RIYA 2DJIA 4GM4A 2EZTA 4L3OA 1POWA 4K9KA 2H2DA 1YC2A 1PNOA 1PYDA 2H2FA 2H4HA 4K9OA 2WVHA 5DGDA 4FEEA 4F4UA 4UTRA 2HJHA 1PI3A 5BWNA 4RMHA 2JI8A 4BVEA 3U31A 5K3SA 4JUFA 3ZGVA 4IF6A 5MFZA 1UPBA 4O8ZA 4KXQA 2FRDC 1Q14A 4BVBA 4J16C 3FSJX 4RMGA 4JUAA 4L2IA 1V5FA 2EZ9A 1EFVA 4MPRA 5FEMA 3GLSA 2AG0A 5MGNA 2PGNA 3IAEA 4IG9A 1M2NA 2FR8C 2VBFA 1V5EA 3FZNA 3LQ1A 4RJJA 2JLCA 4FVTA 4BN4A 3EY9A 2H4JA 4BV2A 3PKIA 1U31A 5DGTA 1E3TA 1OZHA 2JI9A 3CLUD 2AG1A 3F6EX 1T9CA 4MQ5A 4GPEA 3D4BA 2H4FA 4J1TC 1M2HA 5FYQA 4I5IA 4X3PA 4K9LA 1O97D 3GLTA 2QQFA 2IHUA 1YI1A 3PKJA 4ZP1A 4JU9A 2PANA 1JSCA 1V5GA 2IHTA 4R8MA 5EJ5A 1YC5A 5EJ9A 4V1CA 2VBGA 5EJAA 4JT9A 4C7BA 2UZ1B 4MPJA 2H2IA 1U2DC 2VJYA 1ZPDA 2OO5C 4JT8A 4MPPA 4QQ8A 2VK4A 1MA3A 1Q1AA 1MCZA 3FLMA 2C31A 5K6TA 4UTXA 2A1TR 1NM5C
chains in the Genus database with same CATH superfamily
1VSQA 5SV2A 4ZWNA 2I54A 1Y3HA 4RA9B 5GINE 2HWWA 1W1WA 4JN6B 1SBIA 3CX7A 4Q21A 2CBZA 3HV2A 4A6EA 1TYBE 5EUMA 3QWHA 5CLHA 4V03A 1K0UA 3HXKA 3PHJA 4U7PB 5LP6F 3VKHA 4IVQA 4XUEA 2OLJA 2X5JO 3IMFA 3R4VA 1EVKA 3FMOB 4TVOA 4ZRNA 5JZBA 3O92A 5LQUA 1Z5WA 2DCMA 3PS9A 2PZEA 4BGIA 2I29A 2NU9B 1E5VA 3QPDA 1W29A 1TADA 2IOHA 1MNQA 2WD7B 1R0LA 3QK7A 4DCVA 4YUYA 3FSGA 3KALA 3LT2A 1E3JA 1X7YA 5AK5A 4EGAA 5BT8A 4S2UA 2ZWVA 3KR9A 4I9FA 5K8CA 1U7PA 4ROSA 1ORTA 3TTSA 1NF8A 1GEEA 5HIJA 2YWBA 3IUJA 4PO8A 5BVGB 4FLMA 1NUUA 2PSJA 3D8HA 3SFVA 4BMXA 3HP1A 1CJKC 4FCVA 1B6TA 4MVJF 1K1EA 1LW7A 4KMOA 4E2XA 3RV3A 4J1SA 4UAUA 5CNMA 2AX4A 1QQTA 5B37A 4DR1B 2XTZA 2YVQA 5F98A 1FEZA 3ROGA 3JATA 2TS1A 1NVMB 2XX3A 4HZGA 4YAKA 4P33A 4L5YA 1RQLA 2WM3A 4TKUB 4YX9A 5F76A 4B3JA 2NM0A 2K2QB 3WK7A 3P0HA 4YP0A 1EZ1A 1WB6A 2PLWA 2HRRA 1Y6QA 2X42A 4JI4B 1ZQ1A 3KHUA 1ZWLA 4WNAA 1BCRA 2WG2A 2YXNA 2Q45A 1AN0A 2QNRA 3NORA 3F7OA 4UAGA 4AF8A 2C88A 4E3ZA 4MYDA 4Q9DA 5A5EA 3W5CA 3PTAA 4RXUA 2E9SA 4JOCA 1CUUA 1HM5A 4E5SA 4FC7A 4YWHA 3KLPX 4I3HA 2YZGA 1T4DA 3M1YA 4QYIA 1IK4A 1AJEA 3KLOA 3R0QA 1QMGA 5CITA 2JH9A 1F2TA 2R6R1 3AP2A 5FBWB 5KZMB 1IZ7A 4A4DA 4E4YA 1JIJA 2X14A 3HCEA 3SYLA 1VJDA 4D4KA 1WHSA 2HFKA 4C01A 5B58C 5I48A 2OLKA 5IDWA 1N2SA 1UKVY 2WV7A 4XB1A 1SY7A 3RIMA 4MKXA 2P4HX 4QO8A 4MR8A 4U7TB 4GF5A 4ARCA 2ZZKA 3PX7A 1QGAA 2XOEA 3OIDA 1Z39A 2A0UA 3VR4H 2WMNB 3LX6A 3O21A 5JO9A 2HW8A 3TVYA 2MT9A 1WXHA 3O4GA 2XQIA 4Q93A 3RGWS 4H7FA 1UP6A 4AMVA 1WPRA 3NZEA 5JQGB 1D2GA 2HY7A 3V4PB 2O0JA 3NVAA 4N5LA 4LCJA 3TZQA 3U40A 4B7CA 3IALA 4GX2A 1YAHA 1SEPA 2NU6B 4HAWA 4Q4AA 2CMHA 2O2IA 3F96A 4ER3A 1B23P 2Z8YM 1F12A 2QTWB 2PWZA 3KHSA 3RTGA 4K9MA 3M34A 3MWFA 2F3RA 2A1UA 3KCNA 3DVQX 3DZJA 3L41A 3DV0B 4QUDA 5FT9A 1XRLA 5F5XA 2IZOA 3FDXA 1C30B 3GFVA 4PTLA 4WKBA 1GFSA 1J9GA 4Z0TA 4NMMA 1L7MA 4MUYA 1N1MA 1J22A 3EPRA 2GYWA 1DQSA 2RGXA 2VXYA 4WY2A 4TYNA 3AHGA 2W6PA 4I99A 4B82A 5DFAA 2WKRA 2YIMA 5H4HA 4TZ6A 4OBXA 2P6MA 5CT5A 2IS4A 4YRMA 4MICA 3RT1A 1XZIA 1ZONA 1F14A 1AS3A 3ESYA 4OKIA 4V39A 3G3EA 3MWEA 1WBBA 2XT0A 4B6SA 3R9KA 5IXJA 3E2MA 3OY2A 4CM8B 1XPUA 4GXQA 3MLEA 4WXMA 3MWLA 2WC1A 3BICA 4CNBA 1V37A 2XCSB 1NJ6A 2F62A 3KTOA 1OWOA 3BIXA 2O1EA 1D4OA 2GHRA 1SG9A 3WB2A 2YWFA 4LECA 2IQIA 4MIKA 1T5SA 5C7IO 4PLPA 3EUAA 5DP2A 4EVIA 4Y2SA 3UG6A 3NKFA 4KMMA 3ZWDA 4D02A 1EFRD 4YT8A 3K8OE 2K5UA 1EWQA 3HLYA 1R16A 2QROA 3MJDA 1G3RA 2Q9AA 1SUPA 2XMSA 3DVLA 1EEHA 3E58A 1RAAA 4FQ8A 3T1NA 4C04A 3M6WA 1ENPA 4LX0A 4NDZA 1HYEA 3NHBA 1FTYA 3T7RA 3BQMB 5EHGA 4BRWA 1QHNA 2BEJA 3HWWA 2CFOA 4COKA 3RDPA 4IIJB 5EWJA 1OC2A 3V32A 4DR3B 1CUXA 1OFVA 1ZA2A 2YFKA 3QVLA 4AD8A 3CLSD 4F6CA 1ZMBA 4WA7A 3ER9A 3AGQA 1OH5A 3OJXA 2Q5JA 3FE2A 5GMOA 5IDXA 2ZT6A 5SYMA 2HWKA 2ZE7A 4I14A 4NE9A 1N5MA 5CX1B 4R1SA 2C95A 3BWMA 5IFLA 5CYPA 3GK3A 4WX2B 3JWHA 3MWDB 1PYOA 2KM1A 1PVDA 2JIPA 1MB3A 3QTBA 4K6GA 1V8BA 1XEWX 2C5GA 2A6PA 4GGMX 4KX5A 3HV0A 4OVKA 5LIPA 3F1KA 1RQ2A 4WV3A 1GNRA 3MGBA 4RJTA 5BW6B 5EMNA 2C20A 1YR8A 3BRQA 1WKVA 1GUZA 1XJWA 4G1FA 4FYIA 3JZDA 4WPGA 2D4AA 3F5MA 4ZJZA 3KQNA 2QJFA 4PE5B 1Z0KA 2JBHA 1O9BA 4MA5A 2E5LB 1T3SA 4CFZA 1P31A 1CRZA 1VFPA 4BECA 1GNPA 1NUSA 3BHNA 4RHXA 3EA0A 3V4SA 2W6ZA 1FFGA 4QQNA 1XZFA 5IDVA 2FCRA 1Q91A 1V8FA 4ZALA 2OD7A 5IC6A 2CLEB 1BIFA 2HRQA 2XD9A 1PNQA 1JHUA 3CUKA 3EXHB 4Z51A 4EJ2A 5TIIA 5E6SB 1DHRA 3U4MA 4RZ3A 3K31A 1JHOA 1LBSA 1QDUA 1A8IA 1JDVA 3VH3A 3FGZA 4XCVA 3NEJA 4C21A 1E1LA 3KU4A 1CIVA 4YBZA 3DZGA 3QP9A 4MQEB 4UBKA 3D81A 4L78A 5KHAA 1H8HA 4M8IA 1P60A 4C7XA 4CKCA 2ZXEA 2ZU0C 1DU4A 1V3QE 4TV9A 2H4XA 2ET6A 1ZN9A 1VM6A 2FMXA 5GQSA 4I1OA 1KYZA 1PLJA 1X0VA 2OBBA 3ZVMA 3EC2A 1AKTA 3K0EA 1NYLA 1T2UA 3G2HA 3V8RA 4GU5A 3ECAA 4TTQA 3K2EA 4DR7B 4PN3A 3BZUA 3H11B 4MKIA 1NBIA 2OSBA 4WACA 2WT9A 4XA8A 2XOKA 4YYZA 1B26A 4OYYA 1JNYA 3FOZA 1CE8A 3K94A 4QC2A 4JWTA 4J4BA 4LQCA 5ETJA 4UOEA 1YZTA 3NRJA 1NVFA 2I03A 2VQ6A 2PVPA 5LUAA 2OBNA 1UWLA 1BEZA 2VJOA 4EGSA 3QG1A 3MWYW 1FY2A 3AIKA 3H2SA 2B61A 4OL0A 4MW6A 4Y2UA 4OQFA 4AP9A 4YAWA 4DS3A 2H08A 2CWWA 3DOUA 5ELMA 4D8UA 4ASUD 4W4TA 2KLHA 1FYWA 1FU4A 1A9YA 2ZAMA 1P18A 1Z7EA 4ZYXA 4QYWA 4NX2A 2Z6AA 1KR5A 3OE7A 5EVJA 4EI2A 2ASVA 4OHVA 1HZZA 1VMIA 4TTVA 5K4AA 3UWSA 5BY2A 5JH7B 1X6VA 4R5MA 4LFCB 5AKLA 2OA0A 4BZPA 3DAOA 2CD7A 1O77A 4QRHA 3ZX5A 3A6KA 4KNVA 4DILA 1MB0A 1XXHB 2CXHA 3E18A 1WHTA 5D6OA 2F6RA 5AXCA 3EZ6A 1L1QA 1ESMA 4RW0A 3AR2A 5D1NA 3U17A 5C32A 4M0KA 3L9XA 1T9ZA 1XAJA 3ZHZA 2O54A 1CXZA 4MVJM 1U8XX 2WHPB 3I5MA 4OQLA 4PQFA 3GWZA 3EXIB 4L3OA 4P08A 5LXTF 1V48A 3G8BA 3RYIA 3I9JA 5F78A 4R2LA 4JODA 3WV4A 4MUFA 2VQEB 2XRYA 1UQTA 2BWJA 3TD2A 3A7DA 1XTIA 5BSEA 1L8XA 2IUTA 2VTVA 1ZHFA 2J3QA 3GB9A 2QGNA 3WBFA 4PQEA 2Q3MA 3SIPA 1F1JA 2YCLA 1PIWA 2ZJ3A 3NYRA 4MRMB 1BWPA 1N9GB 4GBJA 1CP3A 1WTAA 4R05A 1UH5A 3V97A 2VTBB 4Z1MA 3MB5A 2GLTA 3A4TA 3GN2A 2XYRA 3ZIDA 3C3XA 3PNLA 2V3VA 1N4DA 2WYHA 3U48A 3WFJA 3KL2A 1E6UA 3ID6C 4K7JA 1CB7A 1YVPA 5K3SA 3DAHA 2QI9C 3H9BA 1DAIA 3CLUC 2C8LA 1KJJA 2FZWA 2RC5A 2WG1A 4M86A 5E3IA 1JTFA 3NVDA 3RODA 3W6ZA 1Z06A 1QZXA 3I23A 2FZVA 1YD7A 4ZOAA 4NAHA 521PA 4B87A 4H3KB 4PBRA 3LUJA 2IIPA 5DN9A 3HEAA 1J0EA 1PG2A 4BVBA 1TT7A 2HQBA 5EIWA 1AA6A 1T24A 2W2XA 4BB5A 2Q2WA 3UEOA 3X1JA 3ROTA 1O95A 1NOJA 4J16C 3ICEA 2QD2A 4XXHA 4J7AA 2B2CA 5CDFE 1T8TA 3EF3A 3RKRA 5TEVA 2X13A 1D6NA 1YONA 5L7WA 1WLYA 2H2WA 2YN4A 3AERA 4LNUB 5EUCA 3B36A 2IWRA 3VI4B 3WBKA 3ZNQA 4BLWA 4LMRA 3KJZA 2FSVA 4HP8A 3BCHA 3KKOA 1M54A 1J9EA 2WTAA 4XEUA 4HN2A 2YTZA 2FSHA 2IYUA 5G1NA 3FHTA 3HLTA 3GJ5A 1RQ7A 3O4IA 1U94A 2C2KA 2YZNA 1U3FA 3D64A 2ZQ5A 4NNPA 2H9YA 2G4LA 2PGNA 5KCMA 1G0OA 2C1XA 2A14A 2VZ9A 1ZK1A 3VC2A 2GCNA 4EDHA 2B35A 4QAQA 3V3TA 1ND5A 1V3VA 3DT9A 3A1TA 4Q3KA 2EQBA 3DZFA 3PFGA 5HZMA 3DMPA 4FMCB 3LQ1A 4QFDA 2QG6A 3NCHA 3ZK9A 1ZGJA 1KAHA 2UZ4A 5DBIA 2PVCA 5F2KA 3A32A 1U7WA 3V6MA 3NAZA 3Q7RA 3LAWA 4UNQA 3BH0A 5HBRA 5AXDA 1Y1RA 3H2ZA 1BJRE 1E0JA 1UT6A 3ONDA 2Y6VA 2AHOA 3DDUA 3TSZA 3V48A 5AQ1A 1HOXA 5A0FA 2ESRA 4NIMA 4CDNA 4B2YA 1T9CA 3HB9A 3AHCA 3EVFA 3KOYA 2V74B 3BHMA 1HH4A 1PRYA 3FSEA 3NANA 4RSMA 3IE1A 3JQBA 3JZFA 1WKCA 3WRXC 4MYHA 4ZMRA 3ZZTA 4CIAA 2QLTA 5DM60 5KWEA 2JLVA 1RM0A 3KXKA 3IHWA 4YV0A 2XYGA 3OU6A 2YFYA 2ONKA 1VKOA 1GAQA 1YZUA 2ETVA 1DCMA 3STYA 2MSNA 4ZCRA 3TRFA 1XQXA 2E18A 3GX1A 3DOJA 4HVAA 1I6KA 1QH9A 3UK2A 5J4KA 3OWHA 2G36A 1KTVA 3PKJA 1FNDA 2H2AA 2O2ZA 2OCGA 2Q7XA 3HCOA 4GECA 5IARA 4C87A 3NDBB 1HX7A 3KXLA 3P5BA 3WNVA 4U3JB 3TTVA 2FEKA 3O73A 4EEKA 1A9XA 3TBKA 4YMUA 1ODIA 3Q7PA 2ODQA 2ZQYA 3D02A 4TS4A 1OPRA 2DBRA 3D2LA 4K6HA 2BGGA 1Z4QA 2LCFA 2MSWA 3A8TA 2VSNA 1B2RA 5EZ5A 1DMRA 4E94A 3U37A 2QUAA 1W5EA 4U7HA 1LUAA 1INLA 2J7PD 2HMVA 4RH3A 3D6VA 1NHWA 5AHXA 1H85A 1EFKA 2DUWA 2AG6A 2EJCA 2NTYC 2RH4A 3BL6A 3IUQA 5EJ9A 4JVNA 4X62B 1ZR2A 4ZI3A 1KAMA 3WBJA 5CBPB 3BCRA 4XFJA 2PLAA 3O3MB 1NATA 3PSAA 4I5EA 4K40A 2PM8A 4K0RA 4HQOA 4LZOA 4ZOLB 1E2EA 1YS7A 3HBFA 4HVTA 1SUWA 5EWMA 5TGTA 5C8ZA 3PLNA 1NJ2A 3OOYA 2I55A 3SD7A 4ND8B 1RBQA 3DSRA 4ERXA 2QJRA 4LYJA 1OU0A 4TLLB 4JOBA 3BAFA 4C0AC 2QTVB 3LC2O 1E7QA 1DFHA 3FCXA 5ALFA 5IHPA 5KEIA 1JHDA 3HA2A 3IB6A 1K5HA 4LOHA 4Y6PA 2OO5C 3PDJA 3VPXA 1TVCA 5CB4F 8LDHA 1L7AA 5IUJC 1FDUA 3JVVA 1V6SA 1L5QA 1CJBA 5B1HA 2QWXA 3ENKA 4R8LA 4JOSA 4X9XA 3WA7A 2PDAA 3ACDA 1O6FA 4BNGA 3PF8A 3U0BA 2O8VA 3DBRA 1WQ1R 3GEHA 1OFIA 1YJCA 2W2QA 4KQXA 3SWWA 4NNJA 3WRVA 3AIMA 4ZOCA 5B3JC 3I30X 5CVCA 5ED4A 2A9QA 2BTEA 3IRUA 2WR8A 4PPFA 1TT5B 1Y63A 3KXPA 4XJTA 2PXXA 2FXIA 4NAUA 3SJCA 1NW5A 1X9IA 3BQNB 2LNDA 4LBYA 4Q03A 4WOJA 1M1YA 1KEUA 2W83A 3U4GA 3UWPA 3X2FA 3O8NA 2LDBA 3LA8A 3ABIA 4V0SA 4I55B 3ZJVA 1L5YA 4JFRA 4UOQA 4BFTA 4WEOA 5K2OA 1WDKA 2EQ5A 3JV7A 4AP6A 2Z4SA 1N2EA 1XVUA 1V4BA 3TIFA 5ITZA 1TCAA 2HM7A 3IBYA 3B1VA 1QCDA 4XWYA 3KFVA 1U7TA 4BASA 4MVJP 5BO5A 4YRNA 3NM4A 4X7RA 3M9WA 2NTVA 3RC3A 5A2QA 4EJSA 2JL1A 5BVHB 2GVNA 3NALA 4AZTA 3VO1A 1BE6A 4KN5A 5CA1B 3PNVA 5F64A 3SC6A 3WJ7A 1I33A 3TZHA 1DIOB 4RIGA 4UASA 4TM8A 3RUIA 3V80A 1D8TA 3WYDA 2NSYA 3NNDA 4XUGB 2FWRA 4MS3B 4LBVA 4O2BF 3NFYA 3AETA 3ZE8A 2QDXA 3CEHA 3PHGA 3COZA 1U7XA 4PAQA 4S0XA 4WKNA 4KXLA 3ROXA 3FTNA 1X38A 4V0MA 4M37A 3N76A 5IP5A 3W2EA 1WVGA 3OD1A 1ZOOA 1K68A 2SBTA 3OE5A 4GM0A 2OHHA 5E0KB 5T5QA 4J2HA 4P32A 2X58A 3O83A 1FSGA 4KQIA 5DGXA 2X1HA 3P9SA 3OCXA 2BMWA 2Q5QA 5LN1A 1GPBA 1G1AA 2EBWA 4KDEA 3WDLA 1NJGA 3TRHA 1QV9A 5K6AC 5C2JB 1A5AB 5KYVA 4QASA 5KAMA 5JECA 3F90A 4S0ZA 4DKXA 3GJ4A 4PLHA 2OP1A 1IUNA 1DZIA 1T9AA 2JPDA 2P62A 4U0JA 4L5IA 2PS1A 3AUAA 1J0XO 3HDHA 4JSRA 1MJFA 3WMRA 3KOWA 4H60A 4AP5A 1P5HA 5DW0A 3EOZA 4B6GA 5JU6A 1XZ8A 3WQRA 3PGKA 1UEXC 5GONF 4E3WA 4X64B 4G4SO 2GEKA 4F4HA 1VE1A 4XM0A 1X9GA 5MFPA 2VTBA 1IHDA 3V4VB 1T9GS 1XXLA 1I4WA 5BMOA 4YRBA 4HDNA 4IQGA 5DHSA 2AW3A 1AKNA 3B5EA 3RJMA 1OZGA 3L18A 3WGZA 1EP1B 1XKXA 2ORYA 1JWBB 3A9VA 2CCKA 3AKYA 4BKOA 2P9QA 1GU0A 3I58A 2Q9UA 4DLNA 4QM7A 4R8RA 2VP4A 4JJAA 1R4NA 2OGTA 4RA6B 3OIYA 1W7AA 3OPYB 3AHEA 3KOUA 3M5WA 1TF5A 4Q9NA 1F8XA 2IYQA 4AICA 5KMGA 2Q3FA 1NT4A 5CCDA 3NUGA 1UJ2A 3PJFA 4KUGA 2HIMA 3REQB 1WCYA 4D42A 4GPAA 2VPTA 5I4KA 3EVDA 2Q07A 4MWCA 4AQ7A 4R3NA 4UUNA 2GASA 4L76A 1IE3A 4OB6A 5HCUA 1DJLA 2WICA 1YDHA 1CUBA 2YQZA 5CRIA 2ENWA 4N8SA 1LV7A 4F92B 5L7TA 1T6BY 2AC2A 3GFPA 4MO2A 1C3OA 3ZDFA 5C7LO 1ZAYA 3A1SA 4JC8A 3EPKA 2P9ZA 4IIHA 3WL5A 3JVUA 6PFKA 1H5UA 4YRLA 3MXTA 3I2KA 1SVUA 2HU5A 2J31A 5HEKA 2GCEA 4DMHA 2VATA 1FFDA 4LY6A 3UT5B 1W88B 4BP8A 1NURA 1K7XB 2CHFA 3R75A 3ER8A 1YQDA 4F5ZA 1YKSA 5DTEA 3A1NA 3UANA 1YK1A 1O94D 3QXJA 4M1YA 3HKCA 3BXEA 2CEKA 4WNIA 4NJEB 4AIIA 4HWTA 2AN3A 4DUYB 1OX4A 2Q0QA 1O7JA 5ILGA 2VDRB 3GLIB 2H9AA 1N6IA 2QMYA 4KN6A 3T7SA 3ZZNA 2UYOA 4B48A 1AU9A 4B44A 4M49A 1JQ5A 1TZMA 4LY9A 1SNYA 4MROA 1DT3A 1ADYA 1H23A 4HRAA 3N6VA 4MV5A 5G3ZA 1L4BA 1X7ZB 2HDOA 1GILA 3DMHA 3ZIUA 1N77A 2K7ZA 1KDOA 3UFBA 4WKOA 2QL6A 4INAA 5IF3A 2F9MA 1U0BB 3PIDA 4PRZA 5JRJA 2QQGA 4Q01A 5G40A 4CKYA 3LKZA 4BLVA 4XYMA 1KSFX 2NZ2A 4LSWA 1PW7A 3C41J 3GG9A 3LXRA 3LVRE 3RVSA 1NVVQ 1F0PA 4MW4A 5AKYA 2ID8A 2DFNA 3EDYA 4NCAA 2BEVA 1L5FA 5FOVA 3LG2A 3T1TA 1YMUA 2DHRA 4AXBA 3WSTA 4ZI7B 5C1DA 1XL0A 3GEBA 3HK2A 1GARA 4GLFA 1DC6A 3K9NA 3F3MA 1WXIA 1BOOA 4C89A 4Z4GA 1G9XA 3OH8A 5KOHA 1N2BA 3M6XA 2E4AA 4MVJI 3FFTA 4U7GA 1BKDR 3AM4A 4OQEA 1BN6A 2Y71A 4CN8A 1N3IA 2QRJA 1FLAA 3BD6A 3OKFA 3D6HA 4CTOA 1ESNA 4EUHA 4H6PA 4J2TA 2DB3A 1KK2A 4F7DA 2JFXA 2AJBA 3B8EA 2HYDA 3FZQA 3O9VA 4F6LA 2P9FA 1WMEA 2HHAA 3LOQA 4JUDX 1G8MA 3GT3A 1F6BA 1UK8A 2VBIA 2ZIUB 1U0SY 1GLGA 2IITA 3MTJA 3R3SA 4HDMA 1X15A 4TMKA 4GLBA 2ZR7A 3THYA 2Q1WA 1ACLA 1N32B 3QLTA 4NAVA 5D7NA 1O96B 1IY9A 4O4HF 1V8PA 1OLXB 3OLQA 3CX8A 4YONB 3HCPA 1YSCA 4D96A 4E1AA 3OSZA 4JB8A 4CR6A 1NVWQ 5K0ZA 2CVFA 3GUZA 4QT4A 2BMDA 1Q7RA 4OU5A 3GAFA 3IO3A 2ZSIA 2B78A 4DYVA 4CLXA 1NUAA 3QSGA 4FE3A 1E3WB 3D7LA 3LDAA 5FAXA 5AM2A 1OHHD 4PZZA 2PUAA 5F3WB 1P2BA 2YICA 3B1YA 1ZD9A 3DBLB 4MO9A 1WNTA 2E5FA 4R7GA 1G4HA 2W71A 2FPMA 4UCQA 2AUTA 2CXTA 4EHIA 2P8SA 5I6DA 1FW8A 1DWUA 2WV9A 1AHNA 2GYYA 2LE0A 2QN3A 3IUEA 3FLBA 5IVIA 2UUOA 1BA3A 2I91A 1A9SA 2GAFA 3QU5A 2HA2A 5AVTA 3EPPA 2WIJA 3W8RA 1U0NA 5ILOA 1P9NA 4JK3A 4O4IB 4QOSA 3DXZA 2ZDHA 4ERNA 4R1MA 1A5BB 5BN1A 4ETWA 1PX2A 1RCUA 1G3IA 4L95C 2KBFA 2OV1A 2XGOA 4RMIA 1S2IA 1QHHB 3IUBA 1WV0A 2QENA 3G8CA 1PDVA 1L6RA 1FQWA 1NJ5A 1Q5PA 2JFQA 1SXGA 1MD9A 1JILA 4LI3X 4LXQA 1C9NA 4B81A 4ODIA 1AB5A 3GPIA 5JWOA 2L82A 3LY7A 2GDZA 2WTXA 4PLZA 3MM4A 4RVUA 3VAZA 1IQRA 1D7OA 2R6FA 4L07A 4IO1A 1N6HA 3P71T 1OTHA 4WCFB 4Y9DA 1XLTC 4RTQA 5JMTA 3B3FA 1DUVG 1H3NA 1CNFA 4LTMA 3NXKA 5EFZA 4KREA 4IRUB 3IPLA 3KAJA 3O2SB 4Y6SA 2O2XA 3O91A 4ZVNA 4JP8A 4C0QC 2PZKA 1IN7A 1EYZA 5CDGA 2C5FA 2RK6A 4EUFA 4ENVA 1EKXA 1BFDA 3DMFA 1T1GA 3A6HA 1ZNZA 3KJQA 4N54A 1QSGA 2VVTA 3DZCA 4RELA 5ESDA 5IANA 4F38A 4KQHA 5GWXA 3KRTA 4AKEA 1SXQA 2CXRA 2NTEA 4G2TA 3A27A 4QDZA 5BV0A 1SA0B 3FUCA 3EIHA 4NEQA 1QZ3A 1MT3A 1EK6A 2DSNA 1JLRA 2F1HA 3KZNA 4G0QA 1MQ9A 3J81A 5HQJA 3HO8A 3WGQA 1BQ3A 3Q5EA 2W93A 3Q0EA 2FPUA 2CK3D 1WU8A 1RAHA 1Y81A 3O47A 5LWQA 4C4PA 3A2NA 4UDOA 5CDSA 3ZHQA 1KMQA 3NBQA 4MDHA 5F3RA 3VU3A 3DMYA 3GZJA 4LTDA 1WXDA 3PRJA 4LRSB 1Q3TA 5D51S 4FOTA 4BIIA 5BOSB 1YC2A 3TPCA 2FPKA 3HVUA 1KYWA 1LRKA 5IT5A 1G6KA 3ZWBA 2XMPA 3DQPA 3UUWA 3JALA 2LCIA 4CMAA 1AF4A 1NQWA 3QXCA 1YRLA 4XWOA 4ZDKA 4PLFA 3GGGA 4Y9UA 1WBDA 2NV6A 2PSFA 1Y5NA 4PYRA 3C85A 2NW6A 1KY2A 3O7MA 2EBHX 1UBHS 3Q11A 3DF7A 1L5RA 5J4YA 1K06A 4BLQA 4IOLA 3T35A 3OO1A 3BPSA 3IHTA 4OY3A 2PBFA 2CE2X 3IUPA 2ZI4A 4OJTA 2EW2A 1O08A 1I14A 1MRZA 4Y0VA 4BEWA 1OLSB 4J43A 5DBOA 5G1OA 2FN4A 1JH8A 4EELA 3ZLTA 1BXZA 1UJ4A 2O8NA 3BZWA 1PBTA 1RHQA 4KBGA 4NTZA 4DG8A 1GTG1 3AFOA 3TFWA 5ALUA 1DZ3A 2HA4A 3OZDA 5B5SA 1QG2A 1YIAA 4Y3UA 4Q18A 2GZHA 4IH4A 2F59A 4RQTA 4G4JA 4IWXA 2J07A 3HUUA 3M3HA 2Z6VA 2QU8A 1N2HA 2B34A 2DWCA 4XD2A 3KL4A 4BBZA 4ESEA 5AK0A 5F3DA 4IFBA 4OAQA 2WLTA 1ECLA 1I2MA 1JDSA 2PH7A 3L02A 4C2AA 3G0DA 4X7MA 3PR3A 2VG8A 1RM5A 3CC8A 1PJCA 1Z7YA 1RXIA 4RKYA 3QLVA 4YBRA 3SP1A 4DPLA 2XDQB 3FPKA 5DHRA 1NBME 5M3BA 3AVPA 3IV7A 1NQVA 1U28A 2I0FA 1RJ9B 1RMQA 2BBOA 3EWSA 5LNK1 1GNQA 2II6A 1C7RA 2HDHA 1JW9B 2QZSA 3B3JA 2F8LA 4R1PA 4YLYA 4ZQGA 3FVTA 2XUGA 5CPBA 3ADKA 3H6GA 5FFFA 4EMUA 1I2CA 5KSWB 1IUPA 1Q95A 1GVNB 2BZSA 2CZCA 1G8PA 1Q0RA 2FR8C 4IXTA 3OZXA 2PH5A 3ZU5A 1RW4A 3OC6A 3PUVA 5AIAA 2RKWA 1YB7A 3KBOA 1EM8A 1V71A 2V5UA 3T38A 4JT4A 2AQKA 2JAWA 2VHEA 3I62A 1O8BA 4O0LA 4MS1B 2WF6A 3VAYA 4ZIRA 1QRTA 2C94A 4DDVA 4M1EA 5JNLA 3EEBA 2IHYA 1I7PA 2BKAA 1ISMA 1GDHA 1ZM7A 3FYDA 3I9MA 4HDKA 5E7IA 3U4QA 2CVQA 1E3SA 1W96A 1U81A 2X1VA 2FZKA 1LCIA 3LM8A 3AEUA 3O84A 3T7IA 4X61A 1Z2PX 3EG9B 4WLFA 4R98A 5AWFC 3P2EA 1CW2B 3DC2A 1ZIOA 5TQ0B 1XQ1A 3CLUD 4G26A 2BM1A 4IIYA 5DM0A 4PO9A 3A11A 3OLXA 4JB0A 4KAAA 5K0LA 1MKYA 4ZQEA 3D0KA 2ACVA 2WWIA 1QKJA 4IJ5A 1UWCA 3H7AA 4YJFB 1U2RA 4BWFB 3QXSA 4C5BA 1EPUA 3C7AA 3H5WA 1S2NA 3BMQA 3QVTA 4MI9A 4X85A 3OEHA 3H18A 1Q15A 3SI7A 1M8PA 1NMEA 4BEVA 5IX8A 3MVEA 3CVOA 1DIRA 2RC6A 4B4DA 2WU8A 4I8XA 2M6KA 2OQIA 3V1LA 4J6EA 1U3DA 2FMTA 3EDQA 1SVOA 3U1VA 1RM4A 3KB6A 1J1UA 1IEXA 4GZ5A 1YBVA 5JY6A 4ZP1A 3TFQA 1G5IA 4LY3A 2Z0MA 2CKMA 2OWDA 5BVGA 1ZD5A 2Y0PA 1IUKA 4I4LA 1TRKA 1V1RB 3DWFA 5B2EA 3LGAA 2GK6A 3SEZA 1VJ5A 1QDLB 4U5QA 4MRRA 3S8MA 2PANA 4BMZA 2F4VB 1GPAA 1JSCA 1OBCA 3CBQA 5DZSA 1M83A 4JGGA 1RYYA 4QTUB 4AL4A 4CTJA 4EY3A 2EU8A 2JJMA 2WILA 5KNCH 5ABPA 5PGMA 3WWEA 1M3SA 3TOCA 3FZGA 1NOKA 1T15A 3SF8A 2JGRA 2QU7A 4K1LA 4AWXA 4LBZA 4AJKA 5AUNB 2GT1A 5JCOC 5K0JA 3L8DA 2IY7A 5MGBA 1JYSA 4A03A 1L5WA 1Q0SA 4Q1EA 2DE0X 3TWOA 1X70A 2UUCB 4AZ0A 2GK7A 1Q7GA 1YT5A 2I71A 4N65A 1JMKC 4INPA 2FQWA 3HBNA 3OKAA 4CEIB 4TWRA 3KTAB 2PIAA 2RARA 3OJCA 4Q48A 3NHWA 5FA6A 2DEUA 2RI1A 4NMLA 2PZMA 4LYHA 5I5EA 4PO3X 2NYUA 2PKWA 5IASA 3QUAA 4C43A 2BLNA 2JJ2A 1Q1AA 5BUCA 1U5BA 4FFSA 3GCXA 3N75A 2BFWA 3ZWPA 4ALJA 3I6QA 1TMKA 3WGIA 5GM2A 5BN3B 1TO6A 4HQNA 5J2UB 5D3MA 3T9FA 4DBLE 2J9ZB 1NM5C 1AGXA 1M1YE 1QUEA 2A5GA 2QX8A 2F1JA 4FOLA 4KQ1A 1LLFA 4MB6A 4YT5A 5AO9A 2PAFA 3QQPA 2ZJBA 3H75A 3JD2A 4YP1A 3O26A 2VDWA 4DIFA 3ELYA 4EECA 2ZWOA 4OTZA 2OV3A 4GIBA 3SN6A 4CFSA 5ECWA 9ATCA 3SQXA 1FRFS 1SZDA 2FSPA 4TLEA 2XKBA 1SHZA 1VPDA 5E3HA 3UB3A 2AFVA 3ZQUA 4X1KB 3E7WA 4MVYA 1PWHA 4X92A 1A8HA 3C39A 3OQJA 2DX7A 2QM7A 3MTEA 1XRRA 4EPRA 1NF3A 1KMNA 5KYXB 4LOAA 4EX7A 4KRGA 1Q7EA 3A6PC 5DCYA 1G6Q1 3RIGA 2G4VA 4IMJB 4UXHA 1GCUA 4Z9BA 4JXXA 3ZHOA 3H86A 3TI7A 2JZNA 2DPMA 4OI2A 4M87A 4DZRA 1HR0B 2P30A 1GUYA 4GC9A 5ARBA 2OBLA 3I4LA 4TRNA 3U16A 4BGVA 4V0ME 1MC4A 3OD5A 1KMMA 3SPXA 2R68A 5FWDA 4A6PA 3QWIA 1UT8A 2R62A 4EK9A 3GLUA 4L8LA 2QSUA 4BN0A 5CVJA 4R40A 4YJHA 3F47A 2J3IA 4WJZA 1DXQA 1DE0A 1SCNE 3FPEA 3INTA 4B4OA 3COYA 3B9RA 3LCUA 5CIYA 2A33A 3PVSA 1YZYA 1M1NB 1XG5A 2ZRJA 3GOQA 2JLAA 1EIWA 1DEXA 2VS1A 1CUHA 4TKMA 4CM8A 3KG2A 3K2QA 1MAVA 4GEKA 4UHEA 2PS9A 4JI6B 3UWDA 3CG4A 3KUUA 5A1JA 1BX1A 2VOEA 4YRRA 3H9QA 4KPUA 1OFGA 1V1JA 3A31A 4OB8A 3MUOA 5A3JA 3KPVA 1TYEB 1CZLA 1I2ZA 4BJHB 4QXPA 3IT2A 4GBMA 1YTLA 4TMZA 1HEYA 2Q5IA 4MRNA 2ZVPX 5B53A 4BNIA 5IF9A 2PG3A 3AF6A 5A3SA 5LJIA 1Q17A 4YRPA 3DV2A 1KI8A 4OFXA 4HNHA 5HTOA 1XP5A 4AB1A 1JIKA 3O31A 3E2PA 1UOEA 2A0WA 3LUDA 4DJEC 3OE1A 3PD1A 4K8RB 4MIOA 3VJKA 5SY6A 4F7WA 5I47A 1P1IA 1M8FA 2J59A 4OP1A 4PFSA 1RWPA 1VGVA 1W5FA 3P8ZA 4JEHA 2IXFA 3DE3X 3IQHX 2JDIA 4O8CA 4ZCLA 4K28A 2WT8A 2JFPA 2O20A 5DGHA 3C4QA 3K9QO 2QE7D 5ULLA 1I80A 1VCNA 3JQ6A 3AVTA 1OF1A 2OHIA 3PX3A 4GQBA 2WIDA 1O57A 1P1JA 2YZKA 3LC1O 4XB2A 1T6NA 3BRWA 1W5SA 5ALQA 1EDBA 4ZGBA 3LPLA 4EF5A 1EM6A 2O07A 2QVCA 5CX1A 1GPUA 2LVBA 2W2TA 4O25A 2X22A 3G7NA 7MHTA 4MW2A 4U2BA 4XX0A 3BIFA 1RLMA 2I3DA 2Q6IA 2W6QA 3AR8A 3DDOA 3N8HA 4OYHA 4PXSA 3ZZ1A 2UKDA 1IMOA 1JJFA 1NNLA 4IDBA 4RGVA 3O38A 2NADA 4OD0A 2IGTA 2ZTVA 3PVZA 1L1RA 3CW8X 2CNLA 2TECE 3EZ9A 3VJLA 2NXNA 3PCTA 4Y0AA 2IEGA 3IAHA 3WGYA 4LV6A 1TJ4A 5JDCA 4PM4A 5BYJA 2C2HA 2VN8A 3QUQA 3PQ7A 1SVSA 1TTPB 3D1VA 4KK4A 1MXHA 1GZ5A 2JGDA 2YMMA 1IB0A 3JS5A 4NZMA 2QB5A 5F52A 1I7NA 2W00A 3N6RA 4HYYA 2VT7A 5EI5A 4F86A 4ZK2A 1J09A 2CV1A 3ERCA 3ANXA 1KI1A 1YQ9A 1BOFA 5AM1A 2DU8A 1C0IA 2ZB2A 2Z57A 3RS2A 1DRUA 4FYVA 1JAYA 1OYOA 3V46A 4UCXA 2AC4A 4YAOA 2G0NA 3PL1A 1QRAA 1GZ3A 4EUNA 3Q15C 1Z6QA 1VL5A 3MUNA 3IVXA 4CKBA 3HG7A 1Z5GA 5BWOA 3E9YA 4R2JA 3ZBUA 4QGAA 2GEJA 5JZMA 1BRMA 3EUWA 5KX5B 1UK6A 1F8FA 1R5OA 1ZBDA 2CKDA 3TRKA 5J2TB 1TA4A 1OFUA 1BNCA 1Y7TA 1QYXA 2N75A 2ZIWB 2Q7OE 1TM2A 3UGQA 4FP9A 4ZMBA 3UOGA 4FS3A 4ZI5A 4WOPA 1E98A 1P5FA 2I1QA 4MQBA 4XGNA 1FDVA 5ED0A 4Z4EA 3ZX4A 1KK1A 4WZBA 4KVAA 3AW8A 5TT0A 5HGXA 3QU7A 3JQCA 2J9XB 4UARA 1R6DA 1SVMA 2UUBB 1VE6A 3H11A 3DHWC 1R5NA 4IMPA 4TUYB 3WKDA 1XD2A 2QVGA 3GRKA 4MV7A 1YRHA 4NZOA 1E1CB 1I13A 1I3KA 3DTVD 2RGYA 5ALXA 3WGOA 1L6IA 4TTSA 5A05A 5K6RA 4QM6A 1Z3IX 2B8WA 2I7VA 1THMA 1LFDB 2H52A 2OGSA 5JCXA 2NSJA 2YHAA 5JZOA 2ZB4A 5AXAA 4JBYA 5BQXA 2FG5A 2F48A 4TT8A 3UAOA 2IE8A 4DA8A 2Q4EA 4PBSA 2P1DA 2W43A 2JAOA 2Q0SA 2VK8A 3ZNPA 3VM6A 1W4AA 2AEJA 3OZCA 1GAXA 1XWFA 2OFOA 3HRIA 3CHYA 1PL6A 3AUTA 4BO9A 2B4YA 1F0NA 1H2BA 3DMTA 3F3SA 1D1QA 2JCXA 4YAGA 4URZR 3S2EA 1E1MA 4YJKA 1MGOA 1EXWA 1YR3A 4CBVA 1TKCA 3N0XA 1D9ZA 1AE1A 3F6RA 5NULA 1H4SA 2AMVA 3AR9A 5JH7A 1GR1A 3DV9A 3F2IA 1W59A 4ENSA 3AY7A 3E7PA 5TR9A 3PGMA 1LPBB 1IZ0A 4NCHA 7REQA 1MZPA 4RMJA 3QTLA 4UBOA 2PT6A 1XXHA 3A2MA 4OHCA 1Z2CA 4QARA 4HLDA 3BRCA 3ZLUA 4BB0A 1UF9A 4L74A 3KQOA 5FOQA 4V1CB 1VYVA 3QKRB 4MMZB 1PFWA 2OZKA 4BU0A 5HJ5A 2A35A 3M6MD 4BLOA 4PAWA 5KTSA 2WU0A 4J0EA 5FPTA 1JG3A 1T4CB 4D4IA 3ESBA 1IYZA 3GGDA 2VHUA 2P6RA 3OWOA 4KWCA 4WEQA 3EXIA 1KS2A 1U0HC 2D2IA 2HCTA 2J4DA 3K1AA 3RC7A 3VTFA 1BD4A 2ZXUA 1XALA 2FX3A 2WYVA 3PQFA 4ZI2A 1Y3FE 4ILKA 4DSNA 3WJAA 2VPPA 4YQZA 1YHNA 2RGCA 5FBKA 4DEYA 3TLAA 4X65B 1P0MA 1R3UA 3ILHA 3OZ7A 2LIPA 4F8EA 1XZDA 1XTQA 1XCGB 2HPAA 1JF8A 2F9LA 3OFJA 4MW1A 3K35A 4QX6A 3OJ0A 3RSGA 1YZVA 4LDRA 1QAQA 3OHPA 1Y0BA 3BQ9A 4GUAA 1T2FA 4MRMA 1AV6A 4XLLA 3OECA 1T2DA 2YH2A 4FR2A 4AJ4A 4OH1A 4F3CA 3QEBZ 2OB2A 2PX8A 1OYWA 5E7JA 3K0CA 1Z7BA 3BE4A 3F4KA 1DQRA 1XA0A 3AOEA 4FGUA 5KVQA 1E8MA 3DW1X 4F5WA 1OKKD 3KPJA 4Q7KA 1M5UA 4EHHA 3S68A 1UPAA 2VSOA 4GUDA 3ZI4A 3DNPA 1JKFA 3P5SA 5DOZA 1U1FA 2ZPAA 4PHHA 5B4TA 2MR6A 3N8DA 2Z5GA 1MHTA 1YGYA 2FU5C 2FP4B 1L5OA 2CXUA 5KS2A 3H5VA 4PX5A 3CMMA 5BP7A 2Q99A 5AM5A 2RGEA 3A1VA 2JASA 3HR4A 2HKIA 4GG1A 4MWGA 1EWKA 4OATA 1N0IA 4UE6A 4UUBA 3I9FA 3Q7IA 2ZKLA 2YUTA 4ND5A 5GIPE 3H87A 1BDBA 4CXMA 3WYGA 1OXUA 4CKWA 1KEEB 5AVXA 2ZRCA 2VZLA 1XEXB 2YIDA 2OCPA 1GQQA 2C78A 3FMFA 3HACA 1RXYA 2SKDA 4O2AA 1DL5A 1EG7A 2P5YA 4FBLA 5CEFA 3IDOA 4G67A 4TXMA 3T3EA 5FHQA 3UAYA 3OJEA 4N7BA 3DHNA 1T6ZA 2Q5EA 2UZ3A 1Z0SA 2MJLA 5I7HA 3R74A 1RS0A 3ETDA 5JMPA 3H65A 3OCVA 4YACA 1TVMA 3OFVA 4H7KA 3IT3A 3W78A 5CAEA 5AJYA 3THSA 1YR6A 3P4UA 3BL8A 1CJMA 3P0EA 3Q8WA 1LVGA 1KIMA 5DHUA 3AEQB 4L08A 3A6EA 1DKLA 1MT0A 1TTHA 4S1WA 3B1FA 4OHWA 1E7MA 4H59A 5WRFA 3ZVLA 4B3BA 5ITWA 4DB2A 3T9AA 2P79A 3BWXA 5JXGA 3LWBA 3X44A 3QHQA 4NZNA 2Q3DA 1QK4A 3BN3A 2HSEA 4XIYA 1ZU4A 4JQYA 1RAGA 3EBOA 1Q0QA 1G42A 4LN1A 1SBHA 1UODA 3TDMA 1R18A 2JBAA 2O9JA 3AB3A 2GNPA 4TN5A 3JQ9A 3UJPA 1L9XA 3DFUA 3DO6A 3K6KA 2C3MA 2C9YA 3OBBA 4HMOA 5DTRA 3DB2A 3H2GA 4QJBA 1E9DA 1S1MA 3IQZA 4DCMA 5ALZA 2QTGA 3AKEA 2HJHA 3DR3A 2HREA 1PFKA 4CM9D 2HX1A 5JYCA 1RC0A 4FGZA 3KOOA 5CYFA 4J4TA 2G28A 1UK9A 4B5LA 2NT3A 2F3PA 4C1NA 3UFXB 1NBWB 3IBFA 2VUIB 1NU6A 1SUDA 1RXEA 2CHGA 2FP3A 3C8HA 3W3AA 4UC0A 3B7PA 3W2GA 4WIAA 4O8ZA 1DWOA 2VRCA 5ALTA 2QSJA 1UC9A 5KTPA 1EU1A 1A9PA 5ERYA 2IT1A 3IDZA 5HJ7A 1H8EA 4N18A 4PQRA 2H07A 3BGOS 2QS9A 5C35A 3I39X 4J0JA 1YI8A 2YQ5A 1P44A 1HTWA 5IAKA 1Y4SA 3VNAA 4PFJA 3ZHRA 3FSJX 4GP6A 2BEUB 4PSVA 2YIJA 1CRWG 1D5CA 4CGZA 1KGSA 4J9VA 3EZ7A 1P80A 4CI9A 3ITNA 5EGNA 2VUUA 1YV9A 3UKOA 4BFVA 4CQNA 3BTUA 3LYHA 1EFRA 1K7CA 1VC2A 4IIXA 4NHEA 1RMTA 3CU5A 1L0BA 3W77A 1WXEA 2LCQA 1JE1A 4CKEA 4IG4A 4C7OA 5EKDA 2OCLA 4JQSA 3I3OA 1ANKA 1OMOA 2XBUA 2AG0A 4Y9TA 1Q84A 4GMXA 4ZOLA 4N5HX 1K89A 3L5OA 5D2CA 2QTFA 4CT4B 5F35A 2OXIA 3QKSB 4DADA 3P9KA 4G63A 5KKCA 4YUXA 5MGNA 1P6QA 3J7AC 1CVRA 3IAEA 3RRMA 3PXAA 3QXGA 1FZTA 3BWEA 3F7MA 5BSVA 3RAPR 1X92A 4KGVA 1EGAA 2EWVA 4BPRA 3TGPA 3D5TA 2H1HA 1NXPA 2X4LA 3OCZA 2VZEA 3ZD9A 2NZUG 2R1VA 3DQQA 4Y1EA 1E4EB 3CZ5A 2JW5A 3KD2A 3LRPA 1TO2E 5JNSA 1SQGA 2VKTA 3AG6A 3QYAA 4EENA 4C7JA 2IC5A 1CT9A 3V1UA 3LVBA 3HZOA 4MEJA 2OXCA 3WLOA 2XUOA 3LUPA 1XKTA 4FE4A 1FJ2A 1ML4A 5F5NA 4BO1A 1E3LA 3GCGA 4EPVA 4ZZ1A 4BNTA 2OHOA 1QK5A 2W2VA 1UMDA 4OBBA 4HXYA 3HB5X 3JD3A 3C1OA 4MX8A 2QP9X 1GZVA 5ESRA 3SKVA 3KKNA 1JWLA 2WT4A 1K63A 2JHFA 5C80A 1TYZA 4XQ9A 3U39A 5HOEA 5FYQA 2F3QA 3CRMA 1N5DA 1T2CA 1U6KA 2ZT8A 5ESWA 3AHHA 2ONJA 1R6UA 4TVSA 2BMVA 2M6SA 2Q62A 3C1TA 3L0ZA 4ZO7A 4B09A 2R84A 4N6GA 3A0RB 5AW8A 3ROKA 2I4OA 5K05A 5T8KA 3R6DA 1E2KA 1O89A 1I4DD 1YJ8A 5BVHA 5IRCD 2I3GA 3ZY6A 1DLJA 3UA4A 3CKLA 4OSOA 4RVNA 5C8YB 2DWQA 3MWKA 1FP4B 1UMCB 1AUXA 5JUWA 1BXKA 4N6OA 1T25A 3VDXA 2H9IA 3VSBA 4AMZA 1MX3A 2KSQA 4F60A 2YXLA 2PRJA 1L5ZA 2C83A 2P4EA 2VA9A 4D82A 4MVJD 5U1PA 1A7UA 1P74A 2JFNA 1OAOC 3F3YA 3HNPA 1SHUX 1IEQA 2IDMA 3MINB 4G0OA 5ICMA 2FWJA 2IHTA 2WUWE 1F0YA 2BR5A 2IU0A 3JQFC 4EFNA 3CLTC 1ZD8A 4DW8A 1M0EA 3ZDAA 3QE2A 1E8DA 4A8PA 3T3HA 3PFIA 3THXB 4I4TF 4I66A 1DKRA 3A9CA 2HU8A 1N2IA 3QJYA 4L5JA 1S8OA 2VYVD 3VR6A 4EI9A 2RBEA 4KQ9A 4RPCA 4QATA 4J7XA 1XRQA 4E5YA 1IEVA 4CEJA 1CHDA 2VF4X 3CVUA 2R11A 1NYRA 3VHXA 3BSSA 3DTVB 4LZNA 2OGWA 3F6SA 3NEYA 3T4UA 4C14A 1WP4A 4Q7EA 9GPBA 1DEKA 1JYFA 1K27A 1UC5B 3HTXA 3OFSA 3AM5A 2EKZA 3QF4A 1AO3A 1TF2A 3IJEB 4WW0A 4YCJA 1IWOA 5FOSA 1K66A 3C8DA 1H69A 2VRWA 2XMBA 2ZITA 4JT8A 3L7NA 4F5DA 1NRXA 2N1BA 1XHLA 3M4ZA 4Q1VA 4MTLA 4TQUS 1C7EA 5H5JA 1N33B 4LHXA 1ATZA 1QGYA 3KJIA 1JFFB 4DYHA 3GN1A 3GQBA 1QLJA 1QS0B 4O1IA 4UATA 3EZGA 5T3YA 3ANTA 3UXYA 1J2UA 5FI5A 2ZRKA 4ASUA 4JDPA 4UULA 1ABEA 1GOTA 5HA5A 5A5VA 3OX1A 4PAGA 4DIOA 1XKQA 1Y5MA 5H8WA 1JEYA 1S4QA 1G8AA 3UKJA 2B7CA 3D0RA 1BHO1 3AI7A 4DCJA 2G17A 4A8HA 1XJCA 3I61A 2PLNA 5EMHA 2AG8A 2PA0A 4HB4A 3WXBA 5AOVA 3LX4A 1LDGA 5KQSA 3CNHA 5FOUA 4K6CA 1BWSA 1Z5NA 1GXSB 3G88A 3HQ4O 5ERXA 3FPCA 3PFWO 3REQA 3TZLA 5EXTA 4E2YA 2VP9A 1CUZA 3DE2X 4EL5A 1N5RA 4HB3A 3OTIA 3BL5A 5HTKA 2C4VA 3PFCA 3MF4A 4FXPA 4G24A 2HXYA 2WDZA 2G0AA 4K05A 4K6OA 4RJLA 5AI6A 1ZH4A 4E88A 3W6PA 1IXRC 1RVDA 3Q9UA 2J7KA 3OQVA 4IDOA 3IJRA 3UT6A 3WGMA 4E1BA 4ZOQI 1ENYA 2EJTA 4GS5A 4BNNA 1KA9H 1LPSA 3RHTA 3T12A 4C2UA 5TVGA 4NULA 5JWHA 3RNOA 3T7DA 3QJ5A 4O1MA 1XB2A 3BS4A 4PLYA 3SX2A 3PT5A 4LJAA 3OQIB 1XJ5A 2VP6A 4CHTA 2JLXA 3ND6A 1CK4A 1MHPA 1N7GA 4KRFA 4XLZA 1OZ0A 2DPYA 3KKLA 2PNFA 3RTCA 1M2JA 2I6TA 5TLSA 3BULA 5ES3A 5MN4A 2OZLA 3PGVA 3KSZO 3IDSA 4NJEA 1RJFA 3R7SA 1Z3CA 1KYTA 1PR1A 2AN5A 3VPAA 1T36A 1G2PA 3Q3HA 3U4CA 3GLIA 1SURA 2PCJA 4NICA 3V1TC 2C8KA 1WPXA 2WUEA 3FNFA 3BMNB 5CK5A 1KYVA 1W0JD 1X7XA 2HNAA 2QZ4A 1GYPA 5J43A 3L2OB 3N2NA 1ZH0A 4ARUA 1G8JA 1T2VA 5CUQA 3TM5A 1YTUA 1TLLA 1FRVA 1XVLA 1PJQA 1ZM2A 2PXAA 3F9IA 2G1JA 2OCBA 4XGKA 3O5AA 1S5PA 3NV9A 2R66A 4JBNA 4OO3A 3R8FA 1XE3A 1JVSA 3D7MA 1E6KA 2GWHA 3D3JA 3DGEC 4BX0A 4CQJA 4HFRA 2IYAA 3G8DA 3MTDA 4B6JA 3FYCA 3NHJA 3ORFA 2BH2A 1ISGA 1A4IA 1Z38A 1R0BA 2CXXA 5G0UA 4ABTA 1WL8A 1ILWA 3T3GA 5KNBD 3KB1A 1U9YA 4RE5A 5LD2C 1I7DA 1SIWA 1TD9A 2FPLA 2ZU6A 4F4FA 2GPSA 4F9FA 2F55A 3QY9A 2WNIA 4K3UA 1UMKA 1NPYA 3LWNA 1N8SA 3D8SA 4K6KA 2Z3WA 3F8SA 3C97A 4AF6A 4F11A 1CF4A 1G3QA 4GQIA 3F9RA 2AXEA 4Q24A 3ZGOA 4KAFA 3M6VA 4W9RA 1GL9B 3MAAC 4DCPA 5L45A 4R9UC 2HZ7A 4E6PA 2QMUA 1REQB 3AJ9A 3AFHA 4RD3A 4ZCIA 1PYGA 4ZA2A 1PJZA 1LPPA 2BT4A 1T91A 3B82A 3D5EA 4JYMA 1N25A 4FCWA 2P8JA 2YS7A 2BP7B 3HBJA 3WO1A 4BP1A 4L28A 4CLHA 3GXBA 3Q40A 2WNSA 1DJPA 1BHSA 1JAZA 2C9BA 5ALGA 3SEAA 3BMOA 3CZAA 3KLNA 2WD8A 3UWKA 3ZXSA 2P3OA 2IX9A 2NT4A 3H1PA 4ZYYA 1RI2A 1NUHA 2E82A 2VQDA 2XCQA 1PHPA 2W4MA 3A6ZA 3VXKA 4DE5A 5FWYA 1Y6FA 2JLZA 1BWQA 4O3MA 3U0VA 4YHHB 3N7TA 5BT9A 2KW5A 3A4NA 1U8AA 1E3WA 3A04A 4U7JA 4WZBE 1HNXB 3EFBA 3LBAA 2F90A 2WVJA 1CUAA 4H15A 2EC5A 3J81k 5AJXA 3SR4A 3L7KA 5G1PA 4ZAYA 3U9LA 3WTBA 3FOEC 1T8RA 2EFYA 5BPHA 1JU9A 1TUBA 2AF3C 1HG0A 2WJJA 4ZAGA 3VV2A 2D6FA 4JYBA 2Q4TA 3UHOA 2R6ZA 2WKQA 4UFNA 5KKAA 4KSCA 2HLNA 1NW4A 1KNQA 2XUFA 1MXFA 3HJUA 3DVSX 3DZBA 3MS2A 3EDRA 3VR5H 1IN4A 4Z54A 4N4AA 1XNRB 5IJ9B 1U90A 2QBYA 2IYFA 4JUBA 5BSTA 1N6NA 3HB7A 4KQKA 2QZZA 2RDMA 4DSAA 3K3PA 3T4XA 1FVOA 3H9EO 4UNSA 5KDDA 5LQDA 1K4YA 2J7PA 1VECA 4JJZA 2QUZA 4ENRA 2VTKA 3OWXA 3B1KA 4WBNF 2BGRA 1U1DA 1ZN8A 1DX4A 1G64A 1DBPA 2BGJA 3HR7A 3PQ6A 4QBIA 4UE3S 2V6BA 4CF3A 3R7NA 3MRSA 3EWNA 5IJAA 2VKQA 2Z43A 1I30A 3NB0A 4YQYA 2IBTA 1H3EA 3SYRA 5GOZA 4HUQA 2F8SA 1P3Y1 2UVPA 4DLVA 1E0AA 4Y1RA 4GZ3A 5JRDS 2QRLA 2RHJA 3HXTA 3L05A 4FD2A 4D9MA 3TI9A 1M75A 2PYIA 3GLKA 4BMYA 1XXHE 4M8KA 4U9IS 3AQIA 1PK8A 3FI9A 2QM8A 5YASA 1U5AA 5B3KA 4YP5A 1OH8A 1L5HA 3JQDA 1M1UA 5A2GA 1US8B 3G82C 4RD4A 5CVEA 4ES6A 1EDDA 5IMSA 3VMFA 3K5WA 1LFAA 1NP3A 1BDIA 3QH4A 2QAGA 2VHJA 3AC0A 2B3TA 4PHCA 2NXWA 4QBKA 4AY2A 2VHYA 2VSQA 1Q1NA 3DBHB 3ETCA 4LZWA 3ILSA 4XSVA 5CTJA 3RASA 3HDQA 4BJ1A 2M1XA 4YPOA 3JPYA 4EH1A 2OKGA 4CNQA 1WE2A 2D4HA 3CB4A 4Q9JA 2ECOA 1G6OA 1ZITA 4CPDA 4L15A 2E49A 4C6TA 1X1AA 3M49A 5LP6B 1FYFA 4HB2A 3CN9A 4ZXPA 3Q8KA 3FNGA 2WAAA 2ON6A 3HL4A 4QNMA 1KE2A 1A76A 2JJ8A 1YIOA 1OBOA 2O06A 4H1VA 5TQJA 5GJCA 1IN6A 2RMKA 1X7GA 3PFHA 3QHAA 1VG8A 1ZI8A 1EUCA 3EVGA 3HR8A 4JVSB 2SNIE 5E9WA 4NEGA 3V7YA 4GYWA 4M7RA 1ZVVA 4S1TA 3BHIA 5HOQA 2AZTA 2OKCA 1SUSA 3IMCA 4WGFA 3AF5A 1CQZA 1Z28A 2O57A 5DXFA 5U4XA 1DC3A 4LA4A 4LJ4A 2GZMA 3QOFA 1E8NA 4JB2A 4PZCA 4L4YA 4ZT3A 1UPCA 1XMXA 1YL6A 3D8RA 4D9BA 1I3NA 4FMPA 1MRNA 4B4UA 4F4DA 5FD8A 1Q6ZA 1NONA 5GADl 4TL9A 2EBFX 2I62A 3QV1A 4RDXA 3TH5A 3ZBTA 4FK8A 4JKIA 4NSNA 2CFSA 4RORA 4QPDA 2XTAA 3HS3A 2XRFA 1CKEA 1CPYA 2OO7A 2JGAA 2GA9A 1E9EA 3H9UA 3JAKA 5E6UA 4GL2A 4DZTA 2YXPX 4YROA 3CTMA 1D9XA 1ABFA 3QLEA 1XDGA 3M89A 2JJ1A 3BD8A 1I0ZA 4QDTA 1FJHA 1C3LA 5I4IA 1Y7LA 3I5YA 2NXJA 3WL6A 2H6EA 3AJDA 4HFNA 2GFHA 4DMKA 5L40A 3PZBA 3KT6A 5HQTA 1RJ9A 1GL6A 3WAJA 3KSAC 6ADHA 1Y3DE 2PSHA 2WRZA 1BGXT 3TSAA 2XDAA 5LVAA 1P0FA 1RWNA 2Q41A 3MQ2A 1CQXA 3HLKA 4IIJF 5JASA 3JCZA 5FQOA 4BX2A 5B64A 1J2TA 1XQVA 2CJXA 3SF0A 3IEVA 4G36A 3BKWA 2EZ8A 1NT2A 5A5GA 3U44B 3C1AA 3BIOA 4QGSA 5DX8A 4BMNA 1QAMA 1GTMA 2C96A 3LFHA 4OREX 4P7BA 3QIAA 1PR5A 3V34A 3PUYA 1KH3A 1W36C 1ZGAA 2DFKB 2BMJA 2G71A 2JANA 3R3WA 4RVDA 4RACA 1J1ZA 3RVBA 1POWA 3TOSA 3LA6A 1N5OX 4MGYR 4YIHA 5H59A 4P2GA 3O8OA 16PKA 5TQ0A 4KIWA 1R0KA 3FCAA 5KQGA 1M67A 1SCJA 1Z4JA 4PZEA 4HUTA 5KOYA 1ZRHA 2IVZA 3PYXA 4YRZA 3EAFA 1XWWA 3TIGA 1J4AA 2G8LA 4F4UA 3DEFA 2X76A 3IO5A 3E81A 4ZT2A 4QEZA 4YJFA 1H0KA 3GEEA 2YYAA 2HJVA 2FSGA 1ONPA 4GL4A 5JHGB 1X8JA 2AK3A 5BWNA 2XF8A 4RM2A 5JEEA 1T6XA 1T9GR 1X8KA 3WGJA 2VPYA 2R8EA 5DN6D 1HO3A 1JEOA 3KLBA 1DHTA 4XQGA 4DPMA 3DCIA 3I6IA 5BRAA 3RADC 2P7HA 3KSDO 3EODA 1H0RA 3IERA 5CLLA 3BYZA 4M1KA 2PUEA 4WK4B 2RGAA 1ADJA 1RM3A 1IFXA 5DTQA 3TJMA 2VEDA 1D8AA 2P75A 2GEUA 2R1TA 2F17A 2REBA 3RK0A 1CQIA 1IHYA 1TUEA 2I6FA 2EYUA 1O94A 2D5CA 2RB5A 1BJTA 2VR1A 4ZD6A 4PY2A 5AT1A 5M34A 1YR9A 4C7OB 2OG2A 5GGYA 4Q7MB 2X0JA 1O1YA 2H3HA 3HCCA 4NESA 2QD3A 3H8JA 4RHTA 3B6JA 1RIIA 2BDEA 4MLPA 4UBMA 3SMQA 2YUIA 2H16A 3QVGB 5KVCA 4UAVA 4D9IA 3LY5A 1OSNA 2B30A 2E7ZA 2EZ9A 2QTCA 3B3QA 3QNWA 2DSTA 3OM0A 3TLYA 3STXA 4ZPXA 2GLXA 1T0JB 2G83A 3OZVA 2BC9A 4GKJB 4M7OA 4PIMA 1CS0B 5C53B 4ID9A 1AOXA 4DQXA 5IKPA 3ETEA 5AW6A 4LG1A 2BFAA 3AH8A 1UBGA 3JQGA 4AMBA 1C4WA 1LJ8A 1TKRA 4QWWA 4A8JC 3KTAA 3RAJA 3FDZB 4X8HA 4F1JA 4LJYA 1GKIA 3ZW9A 1DBSA 2F3TA 2V7GA 2QT1A 4N5MA 3VVBA 3LWZA 5CA0F 3P27A 4IIVA 2CGEA 3DFMA 3IUMA 2MINB 4OXXA 3L8YA 3OCWA 5AKHA 3SHWA 3VU9B 2X2PA 2YVAA 3ZDDA 3CUYA 1WCV1 1JFSA 3VU8A 3ZWAA 4EF6A 2E6KA 2X9LA 3PDIB 1ZMTA 5J2UA 3KDPA 2XLCA 2FFJA 4RHEA 5I8WA 2A86A 2R60A 4FGKA 3KKMA 3VDNB 1H66A 3LY8A 5DGTA 4DGQA 5CEJA 5LL6P 3CZMA 4OHOA 2YMPA 5I9NA 3NGXA 1GSOA 2OP0A 5A6VA 2WWTA 4BBJA 1JXAA 3FG9A 2P5TB 5LDDC 2HBYA 2DECA 4M46A 3VHLB 5GM1A 1LK5A 4F2WA 4GPEA 1Z5VA 3KAPA 1XDBA 1RVV1 2FOXA 1Y5RA 4RNDB 1EVYA 5LBIA 4FUQA 1XROA 2XLBA 4UZFA 1NAIA 1N9ZA 4BV8A 2VP0A 3HSSA 3SLRA 2HGSA 5K45A 2PL3A 3N2EA 4QUBA 1L8OA 4I5FA 4ARAA 2EW1A 2Y77A 3RS4A 5A06A 4KSBA 1PVVA 1N2CB 3SXJA 2BHRA 4BMSA 3UUFA 1DWQA 3EDOA 5L3VA 1F8UA 3ASVA 3P4YA 3IMEA 3FA2A 1Y80A 2FFHA 1JKIA 3KZ1E 4JYCA 4CKXA 2JG3A 1TA0A 2ID4A 5CG1A 4YK7A 4D81A 5JJCA 2MMGA 3ULKA 4CDRA 5I3CA 1MH1A 1JFTA 1EUYA 2VJCA 4OB7A 5FPKA 2QD5A 3EXEB 1OWPA 2QT9A 3HY4A 1ILEA 1Y8RB 2I2AA 1AS2A 2Q4OA 3CF6R 5HMLA 3SIXA 5HZKA 4WLNA 3TSCA 1R2QA 3QMPA 4HKTA 4F3YA 4ZO4A 1M0TA 2O2SA 4JY7A 3MT7A 1QB7A 4H18A 1G5FA 1PWZA 4PX2A 4TV8F 4EHKA 1EA7A 1VYUA 3HM2A 1KVRA 4F4JA 3I83A 3NETA 4TMXA 1P5ZB 4PZLA 1UEIA 5EMLA 4KR7A 3O93A 1YC5A 1JEAA 1COWD 1YCGA 2VDMB 3PXCX 4IM7A 4Y2JA 1NPTO 2PZ8A 2AUNA 2J67A 3SX0A 3DLTA 5DMXA 5FIUA 4Z53A 2OFFA 2UZ1B 1O9GA 2OVFA 2W2MA 4E5PA 2YJTD 4KPEC 1H0SA 1KK3A 1O4VA 3ET5A 4R1NA 1DTEA 1R64A 2X19A 1UBCA 4LI0A 5HFJA 3TOZA 3VOAA 5T3UA 1TZJA 5EZQA 1L1FA 1T0IA 2PX6A 2C2WA 3UUGA 2CZQA 2VJYA 2X0RA 3MPUA 3P4XA 5K01A 4M54A 3NYWA 2Z1MA 4PLWA 4QQ8A 5DNWA 4HH1A 1NN5A 4PZDA 1MCZA 3A9RA 3IFSA 4XWGA 3E23A 1YRBA 1P8AA 1SG0A 3EWIA 4TKVB 3V8BA 4EGJA 1FNCA 3SKYA 1PZNA 2EJVA 1RBYA 3DDZX 3BIJA 3PQCA 3IBSA 1SVWA 4CTMA 1SK9A 2XGGA 4PQYA 1XZJA 5AW7A 4YH1A 3OT4A 2ZRGA 3PYLA 4M2LA 1H4QA 4TRJA 1Q7CA 2H4YA 4B3IA 1JDPA 3M4JA 1EK5A 3U3KA 4URVR 1GDDA 2EGGA 3FZEA 1YE3A 1JV2B 1QNFA 2Q5OA 3IGFA 4P82A 4QJ5A 1YH3A 5LR6A 4FR5A 3G9XA 4HYQA 2CF5A 5EHQA 1B6GA 1T1IA 3K70D 3BZBA 3NONA 4QGFA 3LOPA 3LFUA 1IATA 3AG5A 3E3AA 4RZIA 3NTUA 4G1BA 3WNBA 2CDRA 2G1KA 1SZCA 2VT2A 3AOGA 2J48A 2ZIZA 4FMCF 4QNNA 4XB6B 4YMIA 1XD9A 3F5FA 2XA1A 2QKYA 1Q92A 3LL4A 3CLTD 2CK3A 2AJ8A 1AKVA 1UPXA 3LPDA 4DGSA 2HA6A 2OM2A 3DD5A 4UQOA 5AK3A 1II8B 4DY4A 1NVKA 4RK7A 1MORA 1K3UB 2IW3A 1HEIA 1R6AA 3P19A 5EN4A 5LXTB 5EE0A 5JDIC 2C5AA 2IYRA 4RADA 4L6AA 4S1NA 3SGLA 2CLOB 4KPGA 2A92A 3RYFB 2XMZA 4MA0A 3C16C 1QJ4A 3Q8XB 1JDZA 3VPFA 1DC4A 4XIGS 1EHIA 1DO8A 2GDJA 5JVDA 3CRZA 1W25A 4YY3B 2X77A 1ZOPA 1KFKB 2ZT5A 2ISCA 4PS1A 4U39A 4WXPA 1B16A 1HF3A 1RQRA 2Q2QA 3CE9A 4MOWA 3GLIE 2OC4A 3JQEA 1F17A 2QYHA 4CLOB 4I50A 4LRQA 4HLUC 3VO2A 4B17A 4F96A 4Z6KA 1OIWA 5D3QA 3O1LA 4BL5A 1Y9JA 4QNRA 1XQWA 1CEEA 3TEFA 2GBLA 1CRLA 2X1MA 2RI0A 3O4RA 3IP3A 1ADGA 3NHLA 3NEAA 3SZUA 4UKDA 3TQIA 3FXAA 1U04A 4J2OA 5F7JA 4P36A 1PQUA 1DVRA 2XADA 3U4IA 5JQWA 4FMBB 5EZ6B 2UXCB 2W6JD 3LE8A 3R5HA 5DH9A 3QU2A 2MYTA 3JPWA 4MZDA 5BR4A 2NQTA 1VI5A 4FZVA 2GK3A 3MSXA 3DHVA 1FX0B 2HF7A 3R6WA 4RS4A 1DKQA 4UUPA 4DV1B 4Z2YA 2DKFA 4R1UA 4FI3F 2K6GA 3LGSA 2GCGA 2R25B 1DRVA 1NF9A 2OBYA 2YMQA 1B0UA 1XX6A 2PRSA 3OAAD 1Y9DA 1YAJA 1SOMA 4WERA 3WL4A 1JLLA 4Q0MA 4Y9RA 5F1PA 3NTQA 4EMBA 2A4MA 2RKOA 1QTIA 3OFND 5DWVA 5FV7A 4PTYA 1IBSA 2AMFA 3RV4A 3T7CA 1RYDA 1QO0D 4R1OA 2IZ1A 4BZQA 1WF6A 3H2KA 5AKJA 3KVRA 4TLBA 1HT3A 2ZUVA 1ZUNA 4X1IA 5C31A 3CXRA 4N5NA 3WYCA 5KTOA 4ZT4A 2ZUFA 4IOKA 3A05A 5LC1A 1THTA 3WK9A 1SELA 4M60A 1W85B 3SICE 4UEOA 2BVNA 4D4JA 5HS4A 3NNNA 1I8TA 5CB0A 4NRDA 4HGQA 4I08A 5F2EA 2B1QA 4DXDA 1L4KA 5K9ZA 2Q5CA 4B3SB 3QNMA 5IK2D 3K1ZA 1KH1A 4ZHQB 1UXKA 1YS4A 2BMAA 5SY9A 1UOQA 2B1IA 3ASYA 3ABSB 3LZCA 3S2UA 1HTTA 3AF0A 1IRIA 3ETNA 4F1WA 1MR3F 1XVVA 5JI2E 3E7XA 3PNMA 4YAEA 3DEIA 4G0UA 1TM4E 3GPDG 4NH4A 4A2QA 3GHHA 1N78A 2VNAA 4G0YA 4X5OA 3C6ZA 3KFLA 1T4CA 1IC6A 3QKUA 1ZSYA 6CHYA 1SBNE 3C8UA 1FC0A 1KYQA 1PP4A 1YMVA 3GPCA 5DYIA 3U7FB 4I55F 2J3JA 3M4YA 3LO8A 1L7RA 5D3ZA 3UB4A 3KOXA 1QX3A 5K51A 3TN7A 3ZEAA 1PQPA 4KXNA 4RTJA 5FADA 3EZ2A 3VR4D 3TQSA 4XDGA 3HKBA 2ASEA 2AJLI 4S3MA 1ZW6A 2UUPA 3VPGA 1FMFA 1L1EA 4ONEA 4RUKA 3WYBA 4YCDA 3BF8A 2DPGA 4EJ6A 1RLIA 3N2YA 1IDN1 1Q1QA 1E59A 3KKKA 4A16A 3A0UA 4M89A 1P1KA 4OHFA 4REQB 2Z3ZA 5A7GA 3GFRA 4IFIA 3RR2A 1RYHA 5IEJA 2Y1WA 1PBNA 4C3VA 1OXVA 3TNYA 3QVJA 2WWXA 1HDRA 1Q57A 1VZ2A 1I1NA 1N1DA 3RC9A 3V7FA 3H5OA 1CQWA 3FCEA 4X94A 4ZQBA 5TS3A 4QZVA 2ZBVA 2NXEA 4RTNA 2QHXA 1ZCAA 4TYWA 4I2VA 1H9AA 1O0SA 3KHKA 3A1DA 1PZHA 3MCWA 3RSLA 3FX2A 2ZETA 1WUYA 2FP4A 2XZOA 4WADA 1R37A 2NUPB 5FULA 4CU5A 2FKAA 4OJKA 5IZCC 2LTAA 5IH7A 3N2GA 3ZN2A 4I4NA 5BWLA 1IQ0A 1KFEB 3B5JA 4BJ5A 4E70A 2PUCA 3HDJA 3K6SB 3MEQA 1JR3A 1X9HA 3C3DA 4H27A 1ULUA 2ES4A 2PUTA 2R8PA 4NNOA 1EFPA 4BKRA 1KEEA 4RFSB 1PZFA 4TS1A 2ZS8A 3ZU3A 4CETA 5JC8A 2ZKIA 5EZYB 2QPTA 5H16A 1G66A 1KORA 4Y7CA 5JAHA 1YJAA 1UADA 4IO0A 4JLJA 4MP8A 3GZNA 2IE0A 4KGZA 4UD6A 3THRA 5LKAA 4DV6B 1ISIA 2N0SA 2NO4A 4MQ4A 2OCIA 3SVTA 5KDLA 1YK0A 4EFKA 2DBYA 4Z8YA 3JRWA 4KWIA 4QUKA 2LRHA 4DT1B 1ZIPA 2I67A 1YZQA 2WJAA 1OREA 1UKZA 3PD0A 4PHFA 4R2KA 4DVGA 3DFZA 3ZGXA 4A9AA 3KUKA 2B7BA 1YA6A 1SBZA 2BFOA 1DOHA 3KSUA 4HRVA 3K1YA 4IDDA 4M1SA 3EBLA 5AKKA 2OPHA 4PFQA 4DQKA 1S7GA 3VU0A 5JNUA 3EXAA 4ZQIA 3B8HA 3R41A 1PG0A 2IFTA 3DPUA 2ZIXA 4IQ0A 3RARA 3AVWA 2ALJA 4E0BA 2HSZA 1SM4A 1G21A 4R8VA 3HXQA 1FVHA 3SOPA 1DBRA 4MWSA 4GKVA 2Q4DA 3EGOA 4MV8A 4FDMA 1C8VB 3Q0IA 4TS9A 3ZTTA 4CMKA 3BKXA 3HO1A 1YNOA 2NTJA 1GSAA 2TRSB 5ICEA 1FUKA 5K3FB 3I04M 4EW1A 1GITA 2BISA 3IQDB 5L95A 2FN3A 1VLQA 3R7WB 3KQLA 2G9ZA 2HDNB 2VWPA 3NATA 3WLKX 5CYGA 1DCKA 4L8GA 2CCJA 2IUFA 4D9KA 4A73A 4TRMA 1M5RA 2IOFK 3A26A 3HP7A 3TNLA 2M2IA 4RK4A 1JTEA 1H1DA 3IHLA 4DUGA 5L53A 2A7QA 1Y33E 4J6FA 3S5UA 2VPWA 5H81A 1VKHA 1DFGA 2JRLA 1E79D 5GPBA 3GLFA 1RZRA 3NHRA 1UOPA 1M34B 5TJHA 3W8FA 2O7QA 2OZVA 3WKEA 4YI3A 4MGHA 3TW8A 1KQGA 1DQYA 1JKJB 1XVAA 2OORC 3C6QA 4BZWA 3FY4A 4QIHA 2O8BB 1FYXA 3FCOA 2ID9A 1CB0A 1XZGA 1XTKA 2CEAA 2J5XA 3M70A 2VSXA 4J07A 4DIDA 3ZHTA 3TCNA 1XNHA 4WBSA 2LDXA 3K73O 1QIMA 2GFIA 1SU8A 3QMVA 4ZAWA 4PYKA 5HS6A 1L5GB 3OFKA 1AUQA 1KJNA 2CMGA 1OU4A 2QRUA 3FJ1A 3PFBA 3IESA 1B42A 2V7WA 3B12A 4PPYA 1LA2A 2GD6A 1JHMA 1GGMA 1ZIXA 2RJ3A 3O7WA 4IVRA 4B74A 4K86A 2L42A 3EW7A 2ZJZA 1R74A 4KKXB 4WA8A 5CGQB 3PENA 4MH0R 5K0NA 4RX1A 3COVA 4IX9A 3VX3A 4M88A 3RSQA 3EARA 1YF3A 2SKEA 3X1DA 5BSKA 4MKFA 4MGIR 5D00A 3A4IA 1T5OA 2V3WA 3AW9A 4F2PA 1XYVA 2C2GA 3BFJA 5GONB 1KDTA 1NI4A 3IURA 4Z4CA 3EB9A 5BV7A 2QE7A 2YWEA 4MUEA 6REQB 1CZOA 3P20A 4FDVA 5B4UA 4IWNA 5BQ3A 4KXYA 1NTRA 3E9ZA 4S1OA 3RIYA 3DWEX 5BMVA 3RS9A 4ZI7F 5I7EA 3RYCB 1ESDA 4FTWA 2VNJA 1JLHA 3FNQA 4M53A 3COJA 1WO8A 4WN9A 4TGLA 5CCEA 3X3HA 3K70B 1MVOA 1RRFA 3IAUA 4CF5A 2QRPA 2BM9A 3DEKA 1IY1A 3RRBA 5J1SB 2PT9A 4EARA 4E21A 4DNOA 5ADHA 2I4MA 3CO5A 3QSYA 5DGDA 3OCCA 1LVHA 3OP1A 1Z2DA 1E9RA 2CB9A 1CS4C 2J08A 4RKEA 5KYWA 5TPZA 4MKRA 1XPJA 3HXPA 3LHDA 1P9LA 1WZUA 2V55B 4DOMA 5IKXA 1Z0DA 4GZ6A 2YHUA 1JECA 1URPA 4U00A 2GERA 2BI7A 1BTOA 2FPPA 2MSKA 2NV0A 5EPUA 2BL4A 4R6WA 1GP2A 3PUZA 5D5QA 5ALNA 3RRJA 4KR2A 4JMLA 3DZIA 1W44A 4KW7A 4ZVTA 2BR3A 2QIOA 2IDJA 4KFRA 2PKQO 2WJYA 3G6KA 2ODEA 3DVAB 2R4UA 2JK0A 3UAXA 2IJGX 4DIBA 3EXFB 5FUXA 5BN5A 5MFZA 1RWBA 1O0BA 3R2JA 4HRYA 1NMZA 1E89A 4HL6A 2E21A 4JA0A 1KZHA 3KUXA 1YRWA 4XDHA 5L4LA 3G9UA 1G63A 1JPUA 1YZNA 3GJXC 1X13A 3U7QA 1VMKA 4HLNA 3U56A 1O4WA 4FZJA 2Q3HA 5DSXA 4EY7A 3R40A 2D1FA 4WZAA 5DI3B 4RMGA 3K32A 4C07A 2JGIA 1VPLA 2WJPA 3O6VA 4B46A 3B1JA 4J0CA 1NBOA 2NO0A 2TMDA 1U8UA 4I9UA 1E9VA 4Z9YA 1QR6A 4ESHA 1TYAE 3H6KA 3WRYA 1VSVA 3EEOA 2BBWA 1SHLA 3K4PA 4GPD1 2M6LA 3THXA 3O9ZA 1I1QB 3ICQB 1XA3A 2XE4A 4ID3A 2VJMA 5DT9A 2ZRNA 5BW4A 1K4MA 1TU4A 3ADCA 1W36D 2GFQA 2WOOA 2QN1A 2VCEA 4W5JA 3Q8LA 1XDSA 2Z5LA 1V1MB 3D43A 3EUFA 3QWFA 1LBEA 1Y1QA 4JKOA 1IRXA 4LMBA 4O4IF 5HM8A 4E5KA 3DTVA 1L7PA 3ES9A 3PNYA 5J5CA 2IU3A 2CUKA 5TQ2B 2I2CA 5KYYA 4AQYB 1E0KA 1P1RA 2IYXA 1PFUA 4D43A 4A5OA 4BWVA 2Q49A 4KQ6A 1XRPA 1AD2A 3UOWA 1JEEA 2P5UA 2X23A 3VA7A 4A23A 3L8HA 3GD5A 4RPKA 1BYIA 1R6XA 1HSZA 2R65A 2Y9MB 4Q12A 3CVVA 1ISJA 2MSEB 1UZUA 3ZCXA 1QS0A 1HG1A 4EHFA 4BN4A 2O8EB 1HLDA 2BFNA 3V4OA 4BV2A 1E0DA 2LBPA 2D0PB 4P7GA 3OX3A 3DEYX 2VNIA 4XGIA 3VH1A 4IIFA 3VZBA 1CUSA 1V8ZA 2DPHA 3D54D 4GOXA 4XH9B 4LHVA 4C4ZA 5IUKC 3IVMA 4UBLA 4WJLA 1YDGA 2YC2C 3ONFA 5BPFA 3EGCA 1EGQA 2ZYHA 4IXDA 2IPNA 2VSFA 1E5LA 3D59A 1NV9A 1GV1A 1MQSA 2QN2A 1KHTA 2WU3A 2XNJA 3EGIA 1JBKA 5JD4A 2RG1A 3ELUA 3A6LA 3E53A 5DPMA 3W0LB 1CZHA 1T8YA 1DKMA 4FN5A 3LYUA 4FGJA 5HKAA 2FSUA 2PZAA 3SMVA 3U3MA 1XRNA 1MJNA 4ZARA 2I66A 4QHSA 3FNBA 3FHCB 1E3DA 3L7CA 4OJQA 3A2LA 4QDUA 5JJBA 1E9CA 1ND6A 2RGRA 1BMFD 5K3EA 4JXKA 2DC1A 1GPWB 3TLZA 1CY4A 4E12A 2P2ZA 3ROQA 1DB3A 2B0JA 1PV4A 2ZBFA 5GJBA 3ESZA 5CXUA 2HI0A 5CLFA 1MO5A 2BLLA 2ONCA 3JARB 4H0CA 2QM3A 4CV1A 3AXTA 2R7AA 1A27A 2JGEA 2Q50A 2H7YA 3B1XA 3E2IA 4CMEC 1ZOLA 5LZ8A 3ZWOA 4Z3KA 4PZ9A 2QQ0A 4UHDA 4W6ZA 4TS3A 3WBBA 1XOIA 2GEBA 5E4YA 3LNTA 3P7MA 2IL1A 2BTQB 2IPOA 2WYUA 3NBFA 3Q88A 4KWTA 4LJ9A 3A25A 3QQ5A 2OV6A 4HGNA 1HFKA 5DGIA 1AUOA 2H7XA 1H6AA 4BFUA 2ACWA 5F9MA 1L5KA 4V3BA 3ABZA 3AIIA 3ZCUA 5LD2B 1QH8A 5NLLA 2FF7A 3MJVA 2QTMA 2RI6A 4B3CA 3RAFC 2XHZA 3L4SO 4BQSA 2DUNA 2IA5A 3TFOA 3HGQA 4WL0A 5PNTA 4C20A 3L04A 4ZAXA 1W75A 821PA 1IK6A 1VMAA 2FRDA 2DR3A 3PGA1 4NOJA 2ANBA 5DTJA 4YUZA 2XCRB 2BDUA 3TZBA 1DJOA 1G4AE 2OTCA 3MJFA 1XV5A 4MPPA 4KP7A 4EW3A 2UUAB 4FOSA 1SUAA 4LCEA 4EG8A 2PPVA 5FPHA 1G19A 3OF5A 4TMWA 1KQFA 3DLBA 2XCLA 3ETJA 1P7PA 2CB0A 4EKIA 3R09A 1PS9A 1HYGA 1S96A 1HV8A 1VLHA 1Z33A 2HK8A 1HZJA 3GDFA 5DKFA 1N8NA 1FL9A 1S6YA 4LYAA 4XM1A 3BFXA 3PQDA 4CMIA 3B7GA 1G60A 5FB3A 3VHRA 3W90A 1MPXA 1A95A 1R50A 2W6CX 3M6UA 3LGXA 3I12A 1JPJA 2H8GA 4CT0A 2XDWA 4QQKA 1DO0A 1H6CA 3M82A 4R2IA 4HTFB 1PVOA