3GLRA

Crystal structure of human sirt3 with acetyl-lysine acecs2 peptide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
274
structure length
274
Chain Sequence
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase regulator
molecule keywords NAD-dependent deacetylase sirtuin-3, mitochondrial
publication title Crystal Structures of Human SIRT3 Displaying Substrate-induced Conformational Changes.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 3glrA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3glrA01
5DEIA 2JI9A 4MPPA 1EFVA 3CLUD 1M2NA 3EYAA 2FR8C 3ZGVA 1BFDA 2H2GA 5DGDA 4IAOA 3K35A 2QQFA 2PGNA 1PTJC 4JUCA 4GG1A 4TWIA 2HJHA 5K2OA 3FZNA 4ZP1A 4JUDX 2IHTA 4FEEA 2EZ4A 5AHKA 3CLRD 2Q29A 4RJJA 2NXWA 5BWLA 1ZPDA 1N0HA 4BV2A 4BN4A 1V5EA 3FSJX 5EJ5A 1MA3A 2VK8A 1YI1A 4KGDA 4V1CA 4RJKA 1PT9A 4K9PA 3U31A 4K9QA 4C78A 1DJLA 3FLMA 1YBHA 4RMJA 4Q9DA 2JI6A 5MGNA 4UU7A 1U28C 4X3OA 2Q5QA 4UUBA 5EJ4A 2VK4A 2PANA 4UUAA 1OZFA 4BV3A 4L3OA 2Q5OA 2WVAA 4V1CI 2FN3A 4HD8A 5K6RA 5MFZA 2VBIA 2W93A 1SZDA 4BVGA 4UTRA 2Q5JA 1M2KA 2NYRA 3LQ1A 4C7BA 1POXA 4FVTA 1T9BA 1T9AA 3CF4G 5FYQA 1Y9DA 3IAFA 2V3WA 2H4HA 4JU9A 2JLCA 2OD9A 2FWNA 4QPZA 4F56A 1J8FA 2H2FA 1JSCA 2Q28A 4JUBA 5K6TA 1SZCA 4IF6A 1M2GA 4Y6LA 1MCZA 3ZG6A 1YI0A 2OD2A 2IHVA 1U31A 4K9MA 2EZ8A 4Y6OA 2UZ1B 4RMGA 2BRUC 2VK1A 4UTZA 1UPAA 2Q27A 3HWWA 1T9CA 4UTNA 4J16C 4GM1A 1XLTC 1PYDA 1U2GC 5EJ6A 3GLUA 5EJ8A 2EZUA 5IMSA 2OO5C 4GP9A 2JI8A 4BUZA 4KPUA 2H2DA 5D7NA 5MFPA 5DGTA 1YTLA 1UPCA 1PVDA 3OE1A 2FRDC 2FSVC 4GM0A 1YC5A 1ICIA 3GLTA 1YHZA 1PI3A 1OVMA 4COKA 1T9DA 1UPBA 1YNOA 1S7GA 3EA4A 4R8MA 4HDAA 4F4UA 2EZ9A 1EFPA 3CLSD 2H2IA 1OZGA 1POWA 4QELA 5K3SA 3U3DA 3JR3A 4ZZIA 2WVGA 1Q14A 4K9LA 4BVFA 3RIGA 1V5FA 2WVHA 2AG0A 5BWOA 5EJMA 3GLSA 4X3PA 4G1CA 4I5IA 4QQ8A 3EY9A 1O96B 4FEGA 4D5EA 4JUAA 3RIYA 2UZ1A 4RMHA 2B4YA 4JD5A 2A1UA 4J1TC 2DJIA 3PDHA 2JI7A 3JWPA 3ZGOA 3D4BA 2Q5LA 5EJ9A 4K9NA 2H4FA 1NM5C 2OD7A 1YC2A 4JT9A 2JLAA 3PKJA 3PKIA 1D4OA 1HZZC 4GPEA 4FZ3A 2A1TR 4BVHA 2AG1A 4JSRA 4RMIA 3E9YA 1Q17A 4L2IA 4KXQA 1M2JA 2JIBA 5EJAA 2PGOA 1PO7A 4K9KA 1M2HA 5FEMA 5MF6A 1Q1AA 2OORC 4UTVA 3D7KA 3GLRA 4MPRA 4JU8A 4GM4A 4JUFA 1QPBA 1PNOA 2IHUA 2EZTA 1YHYA 2H2HA 5BWNA 3CLTD 1O97D 4K9OA 4UU8A 4BN5A 1Z8NA 2VBFA 5EJ7A 4JT8A 4UTXA 2H4JA 1S5PA 4TWJA 3D81A 4V1CB 4MZXA 3IAEA 4MQ5A 4O8ZA 4Y6QA 3F6BX 2VBGA 4BVEA 1OZHA 3F6EX 1U2DC 2C31A 2VJYA 4MPJA 1E3TA 4D5GA 4BVBA 2QQGA 4IG9A 1Q6ZA 3HWX1 1PNQA 2H59A 2X7JA 4RJIA 1V5GA
chains in the Genus database with same CATH superfamily
4LX8A 2R7LA 3FCEA 2G5CA 3KZCA 1JALA 2G36A 3U39A 2HIMA 1I4TD 3OC6A 1UMBA 1LK0A 5KU7A 2ZWAA 2VSXA 2P41A 4XH9B 1T1IA 1TECE 1KOFA 2OFWA 2QUAA 4HMPA 2C84A 3KZKA 1R88A 1YFKA 2FHPA 1Y4ZA 4IUYA 3F7NA 5I4KA 3H1AA 3HR7A 4IPTA 3ZHCA 3TLXA 5KREA 1BFDA 1KI7A 5CDSA 1RDFA 3UWMA 1A2QA 3LQYA 4WN9B 4X1YA 1J7KA 3K2IA 4KCGA 2H7XA 3PXEA 2EXXA 2IPAB 2DBZA 4EGFA 1RQPA 5LD2B 1GCAA 3FI0A 4CMAA 2Z57A 4IXDA 5HPYB 5FCDA 1NAHA 4FYXA 1CUIA 3FWZA 4OQYA 3PZRA 2QL6A 2O0JA 4GX2A 1TIBA 3RG8A 4GC5A 1V6SA 4ZCMA 1SPXA 2PMKA 2WHEA 3B1ZA 3H9JA 1FQOA 2BDEA 3L4BC 4QHSA 4QRIA 3V8BA 2GFQA 4DR1B 1RYEA 4QNMA 1XZHA 3DE2X 1U0FA 4ZO7A 5HKBA 3TN7A 1QK3A 4OXNA 1Z07A 2TMKA 1MO3A 3MQ4A 4X95A 1EVEA 4JBIA 5B7QA 1XZNA 3ITNA 4GSKA 1Z25A 3A6KA 3TM4A 5F5LA 2BZ1A 4BBAA 1AHHA 4IQFA 1DG3A 1L7NA 4JLSA 5D8DA 3SHTA 1VBMA 3USCS 4CEIB 4TXLA 5GONA 2VTVA 3IAUA 3HCFA 3K6JA 4XYLA 1HSOA 4MA4A 3QM1A 5LLTA 4HDMA 2FV8A 2OGUA 3QBDA 3OEYA 3TL3A 4PX5A 1J49A 1VSQA 3TRHA 5AVJA 4EL5A 3G79A 3ED1A 3U1BA 3P0FA 2VNHA 3OQ1A 3PC3A 5CLLA 1SIUA 2GERA 1LLFA 1PR6A 4Y2QA 5ERYA 1P0CA 2FKNA 4W8HA 2IODA 4KWEA 1GG5A 1KZ1A 1RI5A 1N57A 2PQ6A 1UKYA 3JSAA 3W2HA 4O02B 5K0SA 1FNMA 4ISCA 5ICSA 4L15A 1CRWG 3EGDB 1WXQA 2YBDA 2ODEA 1DDIA 3DDHA 4PSDA 5IXSA 4QO8A 3PJFA 3D5EA 4Y30A 4ZJZA 3C85A 5HF5A 2V3CC 1W5EA 2V6JA 2XQVA 3V55A 1JAIA 2J0SA 1LPPA 1HTBA 3RB8A 5DM4A 3FD8A 4HG2A 1F9AA 2WSBA 1YOVA 3OIFA 4LOAA 4C2BA 1RP7A 5L8VA 4DT1A 2XVYA 4UUAA 1TMYA 1Y8AA 2H18A 4DWJA 3REQA 3VPGA 4WE3A 2AUNA 7MDHA 2RGBA 1HNZB 4LGVA 4LHWA 4NATA 2QRMA 2DERA 3DOEA 2WHYA 1U9ZA 2JGLA 1BRTA 1IHPA 2OL4A 3HZHA 4GU5A 1Z0IA 4KSCA 2AR9A 1DO2A 4UUPA 5JD5A 4O4IA 2E2WA 3SIRA 3I52A 3O2JA 2OHVA 4GZLA 2PIDA 2J4CA 4LKOA 4Q4JA 5BVGB 3MBKA 4AX8A 1TRHA 5NLLA 4R31A 5K3BA 3OTQA 1EVKA 1FMCA 3SSMA 5HF8A 4TVSA 2IS1A 1ZYUA 4F7WA 5LNK6 4BVGA 3G2HA 2HV8A 2DWUA 5E0KB 1FFEA 2B1QA 1EINA 1C4OA 1TZCA 1SQ0A 4IVRA 2PEYA 1O0CA 4OBWA 4HWSA 2B8NA 1CFJA 1SRRA 2K7FA 1U2TA 4K2HA 4EATA 2VPXA 4PLYA 1NQWA 4BAGA 1E2FA 3P2IA 3LLUA 3BC1A 4IEEA 4YAFA 4ZARA 3RC1A 1A72A 1UKBA 1QH1B 1KJNA 4WZBA 3UV7A 1PZHA 1Y9DA 5K0NA 4CIAA 5I9LA 4UDOA 4BNUA 1G7TA 1AUPA 3VJMA 4YB8A 2PWYA 2FA9A 3DOCA 3U62A 1E1MA 3I45A 5JY6A 4E2YA 5IH3A 2H4HA 2I3DA 4QE3A 1PP4A 3N0WA 2VHZA 3HSYA 3D2LA 1J90A 1MO4A 4GVLA 3QXGA 4FILA 1SB9A 4LNUB 4I9FA 5E8JA 2AN9A 3VZQA 1KOGA 2PX0A 3RIXA 3B2QA 1E3IA 4G5SA 2ZYTX 4H18A 1GRCA 4HH0A 4OHFA 4BQPA 3O8RA 2X8AA 1OBFO 4ABTA 2LE0A 2OV1A 4MIYA 3N0VA 1E1RD 3NALA 1HOXA 2OWEA 3KOYA 5EIBD 1YTUA 4QM6A 1UXIA 3SC2A 4CMIB 5LB2A 2F3RA 2RCNA 2UUCB 4ARVA 3ZCPA 1G3RA 1PQPA 3OA2A 1ONOA 1NZFA 4QOGA 1V4VA 2WD9A 1BDJA 3KSRA 3N6VA 3O3MB 3WTCA 1SR8A 7REQB 3EEOA 3DVSX 1YIOA 2WUEA 1BQ3A 4H17A 1W9MA 1EFRA 1DCMA 3MRSA 3AR2A 3CE9A 1VJTA 3LLMA 3HNRA 1WMDA 2R1VA 4Z51A 1MX9A 4G0MA 3R20A 3P27A 1BD3A 1HKUA 2IWRA 3TIVA 2CB0A 3C7CB 3RYIA 1L3BA 2FZEA 4WUVA 4UTZA 5AJWA 1PLLA 3AFIA 1K6EA 1GL6A 1W52X 4LKRA 2PJDA 2G25A 4R2KA 2GJSA 1QCCA 2P1DA 4I1SA 4YRMA 1QR2A 1LRKA 1PKXA 3I83A 4L9WA 4RJTA 4D56A 3MPOA 1SXQA 1WAMA 3HYTA 1NBWB 3NJRA 3L8CA 4QXQA 2E1PA 2PXCA 5AKIA 5HS4A 3K70D 1G8HA 4C7VA 2EZUA 2ENUA 1YT5A 2FSIA 2O3QA 3IBSA 3NM4A 3UC5A 3HHPA 1PBTA 3B1FA 4PZLA 1D09A 3SK0A 1FFWA 1TTHA 3HVKA 4RKWA 3RD5A 2G1AA 5C1DA 2RHWA 1WMEA 4R1TA 1CJBA 1UJNA 3ZE2B 3IAAA 4F8JA 1RXIA 1KI8A 2J0EA 3P8ZA 3TIFA 5GM1A 3PR3A 5EZ6B 1N5KA 3A27A 5K8UA 2HPVA 4QFDA 4KTTE 1O6FA 1O5OA 1RFLA 4ROSA 2RHGB 3HCCA 4LDZA 1K98A 2B34A 3C15C 1QGZA 1K66A 4EUHA 1XZMA 2IZ0A 3JQGA 2QDXA 3P97A 5DI3B 4R9UC 3FSRA 5AHWA 4DDTA 3I8XA 3MG9A 3N0TA 4JLUA 1HR0B 5LLSA 4F93B 1T0UA 3WP1B 2C8KA 1G8MA 3GEBA 3RYFB 4M46A 1J25A 4ETWA 4MYDA 1LDBA 1FLNA 1G5IA 1WNTA 3ME5A 5ABPA 3DVQX 4IYRA 4EO4A 3PFBA 4TTIA 4V0NA 2CCJA 4YTEA 3EA4A 3T4UA 4R8MA 16PKA 4II3A 3D02A 3LDAA 2PCLA 1DC6A 3KU1A 4XJTA 4OHUA 2VNKA 3H8SA 1C1XB 3L7YA 2IUSA 5HP4A 3U4DA 4DM4A 4F5YA 2O4CA 3E81A 2B2XA 2WAYA 4BWGA 3DQZA 1TVCA 5AUPB 5BUSA 1Z39A 2PK3A 4U2KA 4YY3B 1RFGE 2IK8A 3KPVA 5JSFA 2ESRA 3NEPX 1GNSA 2D00A 3AGPA 4JLVA 4JL5A 1YS9A 3B6JA 3LBAA 4LNAA 1RQNA 3O8OA 4UM7A 2NIPA 2C5FA 1FRFS 4JIMA 1JLMA 1LSSA 4MO9A 4O2RA 3ZWQA 1KZYC 4J7CA 1IB6A 3PA8A 5ICMA 4X65B 3R3XA 4IDEA 1B1AA 3N2KA 3CZCA 4P7KA 2JFZA 1ORIA 3CSDA 4Q7EA 3VR2D 1L3IA 3F6RA 4MWOA 4UEQA 4YCJA 4B3BA 4CKWB 2C8LA 4U7WA 4EA7A 3WL4A 5C5EA 5JRJA 2G83A 4F3CA 1ZBQA 2Y9PB 3A6HA 3N75A 4GOOD 5TV2A 1OWPA 5A3JA 5GJVC 1N8SA 4C4OA 4E2FA 5J2UA 1WS6A 1M6VA 1XLVA 4I5IA 1FXSA 5ALUA 1AKYA 5GZ3A 5JXGA 2UZAA 4PE5B 4RVCA 3VTKA 3G6WA 4MYCA 2CNLA 3F90A 1MC5A 1S2OA 5LZ7A 4O4JA 1IEXA 3ITDA 3PNKA 2W8BB 3HFSA 1UWCA 2P77A 3H1PA 4M0LA 4ACBA 1EJ0A 1EBBA 4LXIA 4ENUA 3HDJA 3P2EA 3OSUA 1JRLA 1T1SA 3I6ZA 5IAJA 4A2WA 4TRRA 1L5OA 3LD9A 4WOCA 2ODTX 3B13B 3HUDA 4MQFA 2QRUA 4XR4A 2OHXA 3KR1A 3VNQA 1X19A 2BN4A 1GR0A 3GZJA 1E3SA 2VPWA 4MYHA 1G20B 5TSDA 2V1UA 1CEEA 3DNPA 1C0KA 4KN5A 3PDHA 3BSYA 3KL4A 1KFKB 1NI4A 1ISHA 1OH5A 2RBEA 1RBMA 3BF8A 4II7A 4EY7A 3R2JA 3UO8B 1VCOA 3JWPA 1XU7A 1YRLA 2JI7A 3P96A 4XGNA 4ZICA 1V8PA 1F4LA 2F3SA 4GIBA 1JDUA 5HKOA 3JVIA 3E9CA 4TZ0A 4EKDA 3CUKA 2B2CA 1DIHA 1JHXA 5JHGB 1FTSA 1NJGA 1ZICA 2IOHA 3BHJA 3QE9Y 3A4LA 1RWQA 1M7GA 4BO1A 2AZXA 5EJ9A 1HSZA 5AKXA 1F0YA 3G0HA 1M6HA 3TQRA 1YRBA 3LUGA 2OAP1 3K72B 4PRYA 4K46A 3KR9A 4NV0A 1AB5A 1JQ5A 4KDRA 5C7IO 1D9ZA 3EZFA 3HP7A 3C4JA 1AKRA 2QP9X 3D8BA 1I36A 2DHDA 4NJMB 4LFBB 4QJ5A 3FHTA 2QAGA 2Q9UA 3RS9A 1A76A 3ECAA 5AQEA 4GR4A 4CFZA 1XD8A 2I03A 2VUSA 4O2AB 5BURA 4CL3A 1DXYA 1D4OA 3LFUA 4GPEA 4AS3A 1U90A 3HCNA 2ECKA 2MTBA 4LPSA 1P1FA 2WV7A 4V2UA 2A1TR 2B61A 2CCKA 4EVIA 5CFZA 5A5EA 4FC6A 4Y2HA 1FX0B 1HT0A 1WETA 1BTOA 1O7JA 1IONA 1RJGA 2CZCA 3IOMA 3QVTA 3SIPA 4BJ1A 5GTDA 1DCFA 1DXHA 3VU8A 4LSZA 3QEMB 1LH0A 2BGIA 3KSDO 1NW3A 4P7JA 3U19A 3SDBA 2PEZA 2R2AA 4IM7A 4OQLA 4QYIB 1JHUA 2ZUVA 3PC2A 4QSHA 1EFVB 1GQSA 2ZTVA 2PL5A 3AHHA 1OB5A 2FJ0A 3OLYA 4Y9UA 2FX2A 4K9KA 3WLLA 1M2HA 5IVPA 1E1QA 3B70A 1HL3A 3AL2A 2HA6A 5FBWB 1WBDA 4RPIA 4FGJA 4HMQA 3C8ZA 1O5IA 1UK7A 4Q6BA 5A9SA 4LZNA 4PBTA 3A4TA 5JJCA 1RHKA 1JEAA 1QZ3A 3KKMA 2EX1A 1VE6A 3IIJA 1CUCA 4Q19A 3MD9A 5JNUA 3AB7A 1IPEA 1Q12A 1H3NA 1W4BA 5FWXB 4RPJA 4ZVLA 5IYZF 4GPAA 2FQYA 3WB0A 2JGMA 3OI7A 3RARA 3GRYA 3CZ4A 4WMLA 2CVFA 3MJTA 1WX1A 4BBPA 2FSPA 2PT6A 3OOWA 3R3SA 1L4EA 3ZJVA 3G8BA 5M5BA 1DJMA 1RZ3A 4WCFC 1FPMA 2Z08A 4MW9A 2FLKA 5G4KB 2G67A 4BMYA 1QFZA 3Q7PA 5IC6A 1IOVA 3RO7A 1SOAA 5DM0A 3DW1X 4RFSB 4EJ2A 1YD7A 1EG7A 1Q83A 2JEZA 1C3JA 4K9OA 3WYEA 2WJWA 4GLFA 4JB0A 1MNQA 5F12A 3WNZA 3FTQA 1J0DA 2EC5A 3D5TA 2PMBA 3HBAA 3LPLA 4OAPA 4EFMA 4XQEA 2JJQA 5I9SA 3R5FA 5JAQA 1M1YE 1MC1A 4C29A 1JH9A 1F2VA 1SVWA 3W8RA 1RRMA 2Q6OA 4BMDA 3OJCA 4HBZA 1CERA 1V1RA 1KEEB 1YR8A 2QMOA 1ZKDA 2GYUA 5C4MA 3WA6A 3QJGA 3GBVA 1E3WA 2WDZA 3CZRA 4G4SO 2I6SA 1L4UA 2IW3A 1SK8A 1EE1A 2P0AA 3KM0A 4ZK6A 2Y0CA 1OB2A 2VHEA 1WVIA 3E4CA 3MBIA 3RANA 3ROGA 4DJ5X 1QNFA 2QG9A 1NVFA 2Q4BA 4OXXA 3E6AA 1RKUA 1BS2A 1CRPA 4DV7B 1F7UA 4P38A 4U0JA 3LDUA 1B16A 1T5TA 1VJGA 1Y4SA 2CLEB 2RH4A 1VI5A 3F6BX 3O83A 4G2NA 4ZU6X 4B3TB 3B7WA 4KC0A 2R8YA 4WLVA 1IQPA 6CHYA 4HN9A 4PR3A 1CB7A 3MWYW 2CKDA 3E7DA 3F7MA 2RHCA 2CF6A 4CMCA 1RPAA 2P6OA 3BB1A 2I3ZA 1C50A 4ENVA 2VJYA 3D9QX 1TMKA 3LCJA 2GLTA 1D2RA 3UZUA 4RLFA 4YRFA 3VC1A 1N6RA 5A7FA 1N2HA 5B12A 3JQBA 1HRKA 2HNKA 4ZVQA 3HSSA 1IHYA 1CETA 4UNQA 1UUFA 3CNQS 4HVAA 2I6XA 3R3ZA 1XTQA 2FDRA 5FI3A 3RODA 1PQWA 3E9ZA 4GKKB 2W98A 1DZIA 3MIIA 1TW3A 2YWHA 2PRSA 4GGPA 3O84A 4NBRA 4DZRA 1XYVA 2VAPA 4B31A 2IYLD 2JK0A 5I3CA 3RKUA 1WV1A 2NZ8A 3C5CA 3IV6A 2OBBA 3P9CA 5GIPE 4DW8A 4Y6RA 3IQZA 1SVOA 1JG1A 4YRZA 1VKHA 1GRRA 1XDUA 2HBRA 1BNCA 1UMDB 1YJBA 2CL7X 4CM4A 2ZKIA 4GDMA 3LX6A 4I9GA 3AY3A 3EODA 1P1BA 2DR0A 2YDYA 3O4HA 3QOYA 2PT5A 2C99A 5FNVA 3H11A 3SNKA 2XVZA 5EP1A 2JLUA 5HQJA 1OBVA 3CPHA 4RXUA 5L45A 4ENTA 3AIIA 5DLYA 1OGJA 1GQYA 1VL1A 2FW7A 3K35A 3QY9A 2X0IA 3B89A 1EP1B 1K5PA 1LSUA 4RZSA 4Z0PA 3FFWA 1ZA2A 4M87A 5DHPA 4CKYA 4X1IA 4KIWA 1NONA 4IIYA 2XR1A 4ILEA 2NNWB 3BKXA 2NUTA 4H3KB 3RRNA 4UATA 3INTA 2HJHA 1MQAA 3HN7A 4HQKA 2ONZA 2B5OA 3WGHA 5LPNA 3HHEA 1K3FA 2IXTA 1NYTA 1V3QE 2CLOB 1BVUA 3MEQA 2R2GA 1XMVA 3HM9A 3FCXA 1MF7A 3IP6A 2RHRA 1UL1X 2OMEA 3EUEA 3NW9A 3OFSA 3T0FA 4UFNA 3FRJA 3LMKA 3MJHA 1RS0A 5CDFA 3T0GA 4ER6A 5A06A 5BSVA 5LKRA 4N7RA 1R00A 5A3QA 3MWLA 1Q84A 2N0SA 4CVNA 4EENA 1HYGA 3DLHA 3EQZA 2O48X 4XIJA 3RRYA 4FMPA 1ZPDA 3ABSB 1J24A 3CO5A 3ML1A 4NXMB 1DJOA 3BX1A 4A2PA 3PFGA 3KKPA 1NURA 1BO6A 3NHYA 3QKRB 4I9UA 1H4VB 5K0ZA 1O95D 3JASA 1B42A 5ECGC 3DQPA 4ZVPA 2YYZA 2W58A 4LF8B 3KCQA 1S1CA 3V1TC 4NE7A 2QZPA 1KOLA 3GUUA 4RVDA 1QDEA 1EGQA 4HQFA 3UOAB 5KYTA 1CXZA 4MV3A 1JQDA 2C2XA 1TC2A 2RGCA 4JBXA 1ZAKA 4RE6A 5J2TF 2IHYA 4OA5A 4DLWA 3NUZA 5DFAA 4JELA 4H4EA 1C1DA 1IB0A 2I6QA 2ZDQA 3DV9A 4FFPA 2IUUA 4DREA 3FYHA 4N1AA 4KVAA 2C2ZA 3K0HA 4DIBA 2FPMA 2OWDA 3I9V6 1R37A 1VE5A 5A71A 1Z7EA 5IKPA 1P45A 2H16A 2JFFA 2XPCA 2QLJA 2PKQP 1Z7BA 2CWWA 4C0LA 4KG7A 4EZBA 1IH8A 1ZI6A 1OOEA 4KAJA 3QVXA 1BS9A 1Z08A 2C7GA 5BNZA 4P4LA 4HVTA 3UUEA 3ZDZB 3KYIB 5DNAA 4BU1A 3Q3IA 3N3BC 4EGQA 2DC1A 4E70A 4EQ6B 2F1OA 1NFFA 3GUHA 2HT6A 1DGQA 1TKRA 3SD7A 4AYWA 2Q5QA 3FCOA 4NI5A 1NW4A 3IMEA 1H66A 2GRJA 1ZLYA 1YS6A 3FVVA 4XDHA 5DHAA 2W2OA 3M6VA 2AFRA 3H65A 3KG2A 3SKYA 3NVDA 4JLJA 1EVYA 3WBJA 2GEUA 1G4AE 3UMMA 5JDCA 1A4UA 1LBIA 2X1VA 2Z1DA 1R8YA 2NVWA 2RK4A 3IHKA 1ZFNA 1C9JA 2JJ1A 1DG9A 1DTSA 3C1AA 3PFWO 3QXXA 1P0MA 2AK3A 2Z3ZA 4RIIA 3W5HA 1KVRA 1G5QA 4RIEA 1VYUA 1NKSA 2EDCA 3F0TA 4CCYA 4I2VA 1M0TA 4D4JA 1MXFA 2YMPA 3DXFA 2JNWA 1JQKA 4BGVA 1U0HC 1U8UA 1HDEA 2X5NA 3AKEA 3RUFA 5ADWA 5I9MA 5LCXA 4DV3B 2IS2A 2HA3A 5B1SA 3I1IA 4G8CA 2OZEA 4XX1A 3WLKX 1FSFA 2PFSA 5EA2A 1E59A 2XUFA 1VG9B 4OL9A 3DYIA 3EMDA 1KDVA 1Q77A 1V0JA 3EC2A 3M4YA 3NHPA 1KFBB 2ZCJA 2JLVA 1LS6A 1M8JA 2R4QA 1GTVA 1GAEO 5A7GA 1R27A 3CF4G 4NNJA 1A71A 4JBWA 3UMBA 3ULKA 1BU8A 3SYRA 4C4SA 1KVSA 4DLKA 5BPHA 3QGMA 2QNIA 3N0XA 4OOEA 1TUIA 4X9XA 2YN4A 3BFVA 1VCMA 5THXA 3RWMB 3TOSA 3NTLA 4LOLA 5CDTA 4BL5A 3NYWA 4EYEA 1IM5A 3EVTA 2ZT6A 1K2WA 3V3KA 3ZQKA 1CB0A 3VJKA 1CP3A 1VFNA 2WOJA 4Q7KA 4F56A 1GQ2A 1JG4A 1SBYA 4TWAA 1ML4A 5KNCH 3IMFA 4YFYA 1SQSA 4NSNA 5CA0A 4ETMA 3KPJA 5DM1A 3TKAA 2JIZA 4PINA 4UVIA 4DLTA 4OXIA 4MJXA 4EB6B 4LJLA 3LUCA 3A2LA 4RDCA 4BEWA 4XJSA 4YO7A 3TAHA 3CH7A 1PNTA 3NPAA 2FE4A 2PPLA 1XF1A 2RC6A 3NJ4A 4DABA 1P7ZA 3RSGA 5BN3B 4Y6LA 5JVDB 4CUZA 5C3MA 4IHKA 5CT5A 5IABA 2ENWA 3BMCB 5E1BA 4KXVA 5I9IA 1JAZA 4NICA 4R2MA 4Q1BA 1C3LA 1YACA 2IKQA 2PXAA 3ANSA 1P1KA 3JQDA 1JJBA 3SVZA 3ZZUA 3KFXA 3SLKA 2G0NA 2PVSA 4RD2A 4N3AA 2A0XA 1HH4A 2ZETA 3WLNA 4HX2A 2YJGA 1ECCA 3NWEA 5CVDA 4GDFA 1BCRB 2GEJA 4RA9A 1NPYA 4TYQA 3N9IA 4A8JA 2DUMA 4CLRA 3OQVA 3DB2A 3NHKA 2P78A 2PRKA 1EFKA 1QQ5A 1CC1S 3OJLA 2W37A 3O4GA 3R0QA 4QU0A 5B3KA 1LWNA 3GUZA 4K3UA 4OQMA 2Q6VA 1QZTA 2QY9A 3FDZA 3HWWA 2IU3A 3GEMA 3HYLA 3IOBA 4JP5A 1PUJA 1P6QA 2J30A 2JAQA 5CLHA 1NC1A 5AJYA 4U8GA 3MWDB 2HF8A 1YK1A 4TLDA 3SS9X 4DY4A 3OZFA 2NT4A 3WQSB 1PV4A 3OETA 4F2HA 1YVPA 4UFOA 5CVTA 2IELA 3VKHA 3WIOA 1UPUA 5F2KA 3T9EA 2CLCX 3BA1A 5CH3A 4O4HF 1K7CA 1CUUA 3WHIA 1PJ2A 5D3MA 4C4RA 1NL3A 4DVGA 3WG9A 5C8YF 1I4LD 2I4RA 1I94B 4UBLA 3VPBA 2XTZA 1JQLB 1PFUA 4K9DA 4F3RA 1VB5A 3NVMB 4LDPA 3L7AA 4J75A 1W44A 4BLSA 3VSEA 2ZRCA 1E8DA 1Y3IA 3IUPA 3DBHA 4WZ6A 4CCAA 2DH5A 4IRXA 5FLXA 4TLLB 5DM60 3H9CA 4C0QC 4LY0A 5A5DA 1NJ6A 5B55A 3TOXA 1X0VA 5LYJB 2H07A 1MHTA 1V1MB 1A77A 2QXTA 1XZDA 1YZQA 3W5BA 2J0UA 4QT4A 1KR2A 3C6BA 2EVWX 1KFCB 5HX7A 3UJHA 2V6FA 1FTYA 5F1PA 3TK1A 5GJBA 5CBPA 2YY5A 4F4CA 2YY6A 1HLFA 1FFXA 3E8XA 3QLVC 4RTNA 1EZZA 5LMCA 4WXEA 5KYYA 3DT6A 1EU1A 2B35A 2VSQA 3PUWA 4GX5A 4UMFA 4C06A 1L1EA 4CXMA 5L3QB 4G23A 1XCOA 1L1RA 3K8YA 2HIHA 4QBFA 4ICIA 2CFTA 2Y6UA 2BDUA 2ZJOA 4ND3A 4AXXA 2WYUA 3AOGA 5L7WA 1N2GA 4RIFA 1BXRA 2BBSA 1EWTA 1NVBA 1R0BA 1SBQA 4DJAA 4J0DA 3OOJA 3T1VA 3DAYA 3K1AA 2HFKA 1CS0B 1ODFA 3A6FA 3WX0A 1M1YB 2WFMA 4MSUA 1T2VA 1AQUA 2KJQA 1HETA 4XGIA 2GN2A 1S02A 2V98A 2ZJ6A 1YK0A 3IDAA 4JQYA 4B5LA 2ISQA 1VOTA 2F8TA 4M9UA 1CY6A 1WZIA 3C3MA 2QTVA 1WM1A 3LKDA 2PT7A 4MS3A 3B9QA 2H1WA 2OENG 1KL7A 2TRSB 3LQ4A 4Q4HB 4EECA 2V4ZA 3RVLA 1EXMA 3DNMA 4JI4B 2GT1A 3T1YB 4PZCA 3IVGA 2BELA 5CA1F 3BAFA 1PDWA 1YDGA 3WNCA 1E1RA 1ZCBA 2ZJ0A 4B76A 5JIBA 4F4HA 4CEHA 3OKFA 4NONA 2FUNB 4JMPA 1PEYA 1Q1QA 3EGWA 1XN1A 3NP9A 4GMKA 4XRRA 5A03A 4YMLA 5FX2A 1GZVA 2XUJA 3DZKA 1VGQA 4B3GA 1EM6A 4OGLA 3V46A 1OASA 1SCUB 1CLUA 4HFNA 2VDPB 3IAXA 4ZJPA 3K9BA 4NCAA 4N9WA 3R3YA 4IXWA 1PR1A 2ADOA 5IM4A 3VKUA 4NZPA 4CKBA 1QXSA 1BGXT 3AKDA 5JADA 1M5TA 4TYWA 3QNMA 4X1OA 1AS2A 3FHOA 5CDHA 2PUDA 4KEAA 4NJEB 3OBBA 3S2IA 1Z38A 2PDAA 2B94A 3A9VA 4OXRA 3QMPA 2HXGA 3R23A 2DECA 3R76A 5JMOA 1B6TA 4MVJF 4RF3A 4U00A 3U60B 4I50B 4C2UA 4KFRA 1WUKS 4X71A 1E2IA 3KQWA 4KPEC 1CUHA 5L4LA 2SHKA 1OZAA 4IDHA 2PXXA 4KQJA 1W7AA 3FF4A 1KNQA 4GI1A 5CXXA 3I5YA 2OZKA 1SO8A 2IYZA 2RGNC 5HDQA 2QRHA 4J0HA 2A5FA 4I55A 3VOBA 1AHPA 1YCFA 3HDTA 1XVVA 1LU9A 4B4WA 4K0RA 4RGBA 1M8KA 1S0UA 4O4LB 3L7MA 2JGNA 1VCHA 2G4CA 3M34A 2HV9A 2QN9A 4OBXA 3WK4A 4EK9A 4EJSB 4Z4HA 1REQB 1NMZA 1QO7A 3W9UA 4JBLA 1LW6E 1FB5A 2J7PD 1STOA 1NBHA 3U44A 1XKTA 3DE6X 4W1QA 4CL8A 2XCQA 2PWPA 3ZCTA 4FZ3A 1NP7A 3ZHUA 1ZNXA 2WZQA 1M0SA 4UM9B 3NS7A 4ZA2A 1DMRA 1MJHA 4XI9A 3Q0EA 4CTKA 2DFPA 3KWLA 5F7OA 3UMRA 1AZLA 2BLNA 1CZHA 4JGGA 1KJ9A 4QREA 3B6IA 5G0TA 3TH5A 4PU0A 4PLGA 4BMCA 1PL0A 4S3MA 5K0JA 4YHBA 4XWKA 2E21A 1P1HA 1RI4A 2D3TA 2PMFA 2QK4A 3EZGA 3FGNA 3MBOA 5BN1A 5A0FA 4HHEA 3OZTA 4TYNA 3I42A 1II8A 2OCBA 1WJGA 2IZ7A 1X3LA 1Z56C 1ZMTA 3AY6A 3I2IA 2PPVA 2CDRA 2MSCB 2ERXA 5LFAA 2I71A 2D1SA 5FEMA 2OUIA 1HF3A 2J9FA 1RLJA 4RKFA 1YKFA 3CEMA 4BFVA 4XD7D 1ZEJA 3C5EA 3RT7A 5JS7A 1HE8B 1MB4A 1SXPA 5HQ3A 1ZH8A 2H4YA 3AXTA 4YRPA 4C04A 4I6EA 3BQ9A 5FDFA 3ZPXA 3KT6A 2H3EA 3IQXA 1II0A 1S3IA 3LY7A 4FKBA 2PZGA 3VNSA 5LXTA 2W6JA 3A3PA 3H2SA 3IQWA 4LYDA 3DEFA 3ABOB 5BUQA 4OI2A 2DCUA 4KUHA 1ZGAA 3FDIA 4HFMA 4DR5B 1P9RA 1JYSA 1QIJA 1XVUA 4P3OA 3KQUA 3OM9A 1ZX1A 4UTOA 3FPBA 2E4UA 1D2MA 1QE0A 3GLHE 3N8GA 3T5AA 4B5KA 3DL2A 4Z4GA 3EDYA 2Z9BA 5HZGA 1JKIA 3KEGA 4RETA 1R8QA 3VZSA 3EF0A 4WK6A 3SQWA 2JVJA 1H0HA 1Y7PA 2C2KA 3AJ9A 4JDUA 4L76A 4MRVA 4XA8A 1IBSA 2QLMA 1F60A 1ICEA 2NV0A 3M6LA 1CUWA 2O1EA 4FMDB 4J1NA 1PEAA 4O2BB 5FIUA 3R75A 3IXQA 3L5KA 3VBEA 2KPOA 2JEOA 4OFBA 1QHHA 3O1IC 4D1YA 3WQBA 1SVSA 2LCIA 1XTTA 3UJPA 4LISA 4PG8A 2YZMA 4M49A 3L43A 3TFQA 3A1EA 1VC2A 3L93A 1OFHA 5FNZA 1WLYA 2GD6A 3HBNA 2EU8A 4JI2B 3B20A 1JXMA 2EATA 2FR1A 4IDAA 1YQ9A 3NTOA 4KXMA 1E79D 1W8DA 1RHRA 2J3QA 2BEUB 2XGSA 1KP2A 2O9JA 2ZI5A 2B20A 3G88A 4P5DA 1IQRA 3OQIB 2OYRA 1SXJD 3CYFA 1DZ3A 1DJPA 2HHLA 3LVBA 1KZ9A 4PLHA 3P20A 3I9V1 1KJZA 3F7OA 1EVZA 2OTCA 4NZ9A 4TVOA 2I54A 3TGWA 1JPNA 3CZAA 4RW0A 2WQ6A 1IYZA 4QU5A 1UAAA 3PHGA 4JLKA 1YQWA 2VBGA 2X7XA 2IDJA 3QKIA 1RWBA 5DGIA 2UV8A 1L4MA 3M9LA 1KS9A 2OCXA 5FTKA 2GM3A 3FFXA 1KHTA 4ENQA 1FMTA 3SP1A 2RGAA 2P0YA 2G17A 3K05A 1RWPA 2WUVA 2X42A 1G16A 3FFTA 3NKVA 4LC1A 4S1NA 5AK3A 3VR6D 3WLIA 2AXPA 5BUCA 1YL5A 2O2ZA 2HSGA 1Y1QA 3W7VA 3RBXA 3TPCA 2XCOA 5CT4A 2G77B 3NTXA 2DTEA 2VUHB 3GXBA 1S96A 3NFRA 3P0IA 4R4JA 1FC0A 3O95A 4EB8A 1UMCA 3IKLA 4PG4A 3DZDA 1Z36A 4FD2A 1RADA 3I64A 1O94A 5AK0A 4IG9A 3V8PA 1D2AA 1DHRA 3D1JA 3DBLA 3HWX1 1PNQA 4LYJA 3ZVRA 5BN5A 1Q74A 2YOFA 3A70A 1KZHA 4EA9A 4K03A 4BP9A 2R6CA 4ZAZA 1UBTS 3R8CA 2VQEB 1DXQA 5IJXA 4UARA 1E0AA 2Q6KA 2F1HA 2X9LA 1NBEA 1NF9A 4PNEA 1AK1A 4EEZA 3CF6R 1I4DD 4B47A 4JJ7A 3VH3A 5C1PA 1M2NA 3O8NA 3GEGA 4CR6A 3PL1A 4MW7A 4MUMA 1DKQA 1NNLA 3AF1A 1IBRA 3Q8WA 1C7JA 5EJFA 1ULAA 1U9CA 3BMQA 2P35A 3OKCA 1W5TA 2DX7A 2EGHA 4PZAA 2GNPA 3I3SR 4WASA 5LBTA 4URHA 3A3NA 3BJIC 3SQMA 4UHBA 3UJ9A 2R6ZA 3CPEA 3JALB 3EOAI 5EIOA 2BGJA 1ARZA 1XXHE 4JUCA 4LE0A 2HXSA 1XTPA 5ALWA 1ZGJA 4CRWB 4OI4A 3RS4A 4ND1A 4G1MB 4PLVA 3RBVA 4BO9A 4ZMSA 5SZIA 3PPWA 4BNDB 3U4MA 2DWOA 4OXYA 1V6CA 2BRUA 1O4WA 5DULA 3UN1A 1DAHA 1APBA 3OY7A 1DX6A 1U7XA 1ELOA 4PC2A 3ZDAA 1T26A 3B6KA 5JU6A 1FTQA 1N8NA 1W73A 4Q18A 4MV5A 4UXIA 4YPFA 5JARA 4DIOA 5KBYA 3RHTA 2GYYA 3LBYA 3VR3A 5HUQA 2XADA 1KA9H 4L7VA 4BTLA 3WLSA 1WA5A 1TAQA 2ETVA 1KYQA 3UKOA 4H59A 1T1RA 3B8HA 1H05A 3H5VA 4TKUA 1ZZGA 3LNCA 2XMDA 2OO5A 4GL4A 4L08A 4Q9LA 4XDZA 3VX3A 2BJVA 3C3AA 5EN4A 5LQCA 2ZXUA 1KQOA 1H2ZA 1KC1A 3JVDA 1YU6A 3AKYA 2P9GA 5HUHA 4LXXA 1ZSNA 1L4NA 2DBYA 1SU4A 2H51A 2K4MA 4FUQA 4XVCA 3EUWA 3QVGA 1FW8A 3RCBA 4F1KA 2PQ2A 1UT5A 3GD5A 4RJKA 3EGXB 3VYRB 2P6MA 3ZIDA 3SEAA 3L7IA 4MH0R 1GZ6A 1PW5A 5KYYB 5F33A 1W49A 2FQXA 2N46A 2WU1A 3OHPA 3ZCUA 5ITSA 3QX3A 4CODB 1U7HA 4LHVA 3OTHA 4BCCA 1X1RA 4WXYB 5TMPA 1AJEA 3DR5A 4YGXB 3S2GA 1JBEA 1MORA 3P9QA 3A04A 4G84A 1P1RA 2O1XA 2GXSA 2P9TA 2Z0MA 4DNOA 1BFUA 2IKSA 2IZ1A 2PFGA 3EH2A 2F4NA 5JAOA 4URVR 2WJ4A 1BCSA 2C7VA 1NVGA 4HDNB 4IOJA 4OJMX 4V0ME 1Q2XA 3DP9A 2FNAA 3E2IA 3EAFA 4HZIA 3KO8A 4K81B 3U7EB 4KPUB 1C3VA 4UUBA 1V5WA 5KTKA 3PQ8A 2JZCA 3PFFA 4L02A 3C3BA 3Q3EA 1N6KA 1ORRA 2W90A 1K8YB 1OZFA 2CHGA 1OI4A 1ZU5A 4HPXB 2NU8B 4F6RB 1ABFA 3SBEA 2ZEJA 1SCDA 1C3OA 5DOVA 2D2EA 4CDRA 2VXYA 2Z6UA 4ARIA 4G5OA 3NBZC 1U3TA 3RSQA 2WKSA 3BGOS 4DG8A 5DN6D 5HK9A 3QI2A 4G0XA 4QXRA 3O8QA 4BIIA 2OXEA 1I5OA 3OOSA 4HNTA 1HE4A 4LF6B 1GPMA 3Q3VA 2FH5B 1MB9A 1T5OA 4YH1A 1V16B 2GCOB 2O2GA 1JTVA 3AU8A 1NXTA 4I9HA 1RYMA 4L16A 1M8GA 3KHSA 5GWXA 3PQCA 1AQNA 3KQKA 5JS2A 1U8FO 3NWOA 1FRQA 4P4NA 3PYXA 4CF4A 3IHTA 1G0NA 5JDIA 5CIQA 4KDCA 3G0BA 4NTZA 3W3AA 4CMEA 2PZLA 4G5XA 4BRSA 5KNLA 4C7BA 2AN3A 3DOFA 4YXFA 5JSZB 5WRFA 2O8DA 3ZU6A 2WC1A 4BKPA 4I4TF 4RQTA 4CNQA 4R2HA 4U6NA 5D87A 3KQHA 3PKZA 3O5AA 5HRAA 3E1SA 5BQ3A 3FJ1A 2GS9A 1EGHA 3MXTA 1GAWA 3V80A 4FYVA 4YP1A 1XZPA 5KJFA 3TQSA 3B82A 4CTOA 4Z53A 4FFVA 3N7UA 1IPFA 4HNUA 3PZBA 1QQBA 2X8JB 2H2FA 4CKEA 1Z5UA 2JLSA 3RVPA 1U7ZA 1RAAA 1R50A 4TKLA 1KH2A 3QE4A 3ZJTA 1ZOPA 2DTDA 2OOSA 1TIKA 2WJ6A 4WQMA 1SHKA 3V1NA 4BLTA 3FNHA 3UANA 5DF1A 3OTGA 2PUGA 1DUSA 2QBYA 2P2YA 3SZLA 3EAGA 1FJXA 3KB2A 2H9IA 4JC8A 4IJ5A 3ZCXA 2OD2A 1NX6A 4YMSA 2KX7A 4AS1A 1SVIA 1VZ2A 3MERA 2Q3HA 4IBOA 3OQOA 3N1UA 1Y9JA 2VJOA 2YJ3A 4P98A 4P8RA 4B46A 4X7RA 1QIDA 3IE1A 4OHYA 3L0SA 1KAMA 5J4KA 3O8LA 2O57A 2WIJA 3KYBA 4XYEA 4DSAA 4HQLA 3NHZA 4C6HA 1T6YA 4KUEA 3GJ8A 3WSWA 3ERCA 3KTDA 2Y27A 1PZNA 2J1LA 2R8OA 3GDWA 1P91A 4L5YA 2HYDA 2VN8A 1Z7WA 2ZIAA 4EY6A 3L3BA 4HQOA 2JCBA 3N87A 1ZG3A 1RWNA 1WCWA 2DP4E 2X1MA 1M5UA 1R0ZA 4XWYA 4U7TB 3OESA 3T06B 4ETNA 5K03A 2HLNA 2Z56A 2EKDA 3OUZA 4YRNA 2IS6A 2Y77A 3BIOA 3CJTA 5CHYA 2I6UA 5F2NA 7ABPA 5FT9A 5EJ6A 1R0LA 3TLCA 3PYMA 1B74A 3DMPA 3Q8LA 1LC3A 3R3UA 1T2DA 1TZ2A 1UKVY 3B12A 4NAUA 2JI8A 2DQZA 3KKKA 3MN1A 4M83A 5D7NA 3WFIA 4Y2PA 3NGXA 5L7YA 3JW8A 1AURA 1CNEA 3DAOA 2R6DA 4O29A 4QYXA 4RC9A 3UMYA 3K4PA 1JSXA 1EVIA 4WCVA 3TW8B 2ZITA 1ESMA 3GFRA 4WNAA 5EINA 4DRYA 2H1CA 3D1LA 2WU4A 3CE6A 3H2GA 4QOEA 4BYGA 3IUEA 1YKSA 1QZZA 2FEKA 2AG6A 1Z0ZA 1ZN9A 1ZUHA 4YDSA 4B74A 4EA8A 4RTOA 1NLUA 4N3BA 4AJ4A 4YMGA 1YC5A 4ESOA 2X4IA 1OF1A 3DBVO 5FL7A 3E8MA 2CZGA 4JYMA 4AJKA 1OSNA 3LYAA 1DKNA 2LPMA 4KO3S 1E9FA 1OFTA 4E5UA 2CCGA 3IJPA 1T1EA 4JVOA 2JH9A 3KNZA 2HGSA 2EARA 3DL4A 1QRTA 4P4GA 1U4NA 1V2HE 1VXOA 2Q45A 1FPQA 1UZMA 3E22A 1HKHA 3LUHA 3NI2A 4E21A 3MMXA 1YNOA 3GLHB 5CYOA 4HRXA 1IBMB 4CL2A 1N7IA 3W5JA 4PRLA 5CB4B 3MUEA 3ZDCA 3IKMB 3LFTA 4HGNA 4MWZA 1GILA 3K9CA 1ZEMA 2XMRA 4R8RA 2DG2A 5AXAA 2XRYA 3OT4A 2ECFA 1P0QA 4L2IB 4NZYA 3PUKA 2Q7OE 2XI4A 2L17A 2R6JA 1SQ5A 3WSTA 1LBTA 1X9HA 1KEUA 2AE2A 1GPWB 1O0SA 5FOVA 5D7BA 4HPJB 5K3SA 2XCTB 3F9RA 4CIWA 2C57A 4CQLA 2ODNA 5ARCA 3H3FA 1IXKA 4KQEA 4EYKA 3U56A 4QTUB 3L8DA 1E7YA 1N1MA 5BMOA 2OPHA 3ESDA 1R4NB 5ALQA 3ANTA 1V5FA 3B1WA 2YH2A 4DCSA 4LRXA 3GLFA 4OHOA 3V6LA 2PD6A 4YNBA 1U63A 2FYTA 4U2EA 3RC7A 2AG0A 3AO0B 4AN0A 3TRFA 2PQ0A 1XBTA 5KNBA 3KD2A 3OQHA 1Z5NA 2HDWA 2IDZA 3C3CA 3U80A 4URUR 2XQJA 3L6UA 2TSYB 2I55A 3CH5A 3FA2A 2OV3A 4OYRA 1KIMA 5AK4A 4M1SA 4JB2A 1QMGA 1X7XB 1U2QA 3HXQA 3D6JA 5DZSA 2I2DA 4LOIA 4YCSA 3G2QA 4D5EA 3EPLA 1S9HA 5JG7A 3NO4A 1QGUA 1P2GA 1JXOA 4DWVA 1OXXK 4DM7A 1UWKA 1VGVA 1YBMA 1DKUA 1WXWA 2V74B 3H19A 1C0LA 3M82A 1RQRA 4NMLA 2WP8J 3S6JA 4BMXA 2QIOA 4IP0A 2BM8A 1KKUA 2SKCA 4LDRA 3WLQA 1I7NA 3EWAA 2QT0A 2ZUTA 5IZCA 1P3Y1 4AQDA 1S2GA 2ASEA 3PICA 3T54A 1GUYA 3GI1A 1YI8A 2V6BA 1NVMB 3NBYC 2WT4A 4E3ZA 1DC8A 2JJMA 4R0VA 4XRGA 3KXLA 3KZNA 4AF6A 3IPCA 1Z37A 2O5VA 4CMGA 1YR6A 2I6GA 4KNWA 4YP6A 4B3XA 1MD9A 1ECGA 1FYXA 1HBJA 4Q16A 4YMTA 1EEXB 3TDMA 2Q8QA 4CKCA 2Q5LA 1QLWA 5CFQA 4F6LA 2FMTA 2JZNA 2G6BA 3N8NA 1J0EA 4FCVA 2G5GX 3GN1A 3M6UA 4OQPA 1XCJA 1YKGA 3VISA 3MAAC 3AY0A 3RRXA 5L3SB 4TV8F 5ALFA 3GFPA 3KAPA 4L8WB 3ZLVA 2XGMA 3SQOA 4KV9A 4Q1FA 2W70A 3S7TA 1D1SA 2OBLA 1R12A 1SNYA 1CG6A 3EZXA 3M3PA 5JNVA 3LFHA 4BLRA 1OREA 4CTMA 2WQZA 2GRUA 4EPRA 1WIWA 1D3AA 1P75A 1XKQA 4C87A 3NVKI 2A5GA 3KJZA 5ESXA 2PX2A 4BNLA 1GG2A 1X1CA 3G7NA 5FWYB 4URXR 1DAIA 2P3OA 4IDDA 4MR7A 2ES4A 2OC9A 3RYCA 2VJPA 3DTVD 3USES 3HGMA 3HI6A 3NIFB 1F17A 3Q2KA 3A28A 3A6GA 4ZQBA 4D6YA 1QIGA 3DLPX 4DG9A 2RGYA 1T5DX 1DCTA 2QTTA 3MOIA 1ZNZA 1XU9A 3ORSA 1L3CA 4IQ4A 4P0QB 2M1ZA 2XNKA 1S1MA 4DV1B 4KL8S 4XWTA 4KREA 1TF7A 3G9ZA 4S35A 1XJ5A 3AFMA 4MYTA 5FBQB 2LP4Y 4R3UC 4ZI5A 2VDUE 1OLUB 5DTMA 4C0XA 3SX4A 1V8BA 1J0CA 1VMAA 1K08A 4QOJA 4FEYA 4WNYA 1LLDA 2DHEA 4UDXX 3LLVA 4W6ZA 2VTEA 4RGVA 3FPSA 3DOUA 4N7MA 5J47A 2WF9A 3GR6A 1PJ8A 3F3MA 1JDBB 3QX9A 3IBTA 3AFOA 3GLGB 5JSKA 1Z3CA 5C0OE 3FYCA 1ADYA 2UUPA 1XG5A 3SJ7A 4D9MA 3UW1A 5M2QA 1TAUA 3HY6A 4TMFA 4TLBA 3MTEA 2OORC 1T9HA 2OB2A 1QAMA 2GOYA 3FHJA 5CT6A 1ECBA 2Q0HA 1OIXA 1WKVA 4Z9BA 2ZBPA 1KEZA 2Q3EA 4JT2A 2ZUBA 3H99A 4GM4A 5EEGA 3SC3A 2CYCA 2RI6A 4BQOA 5LWHA 3I6YA 2G9UA 3FHLA 2WA1A 4Q9KA 4BN0A 1MJGM 1Y1LA 3H6GA 3WKEA 3BM5A 1PNOA 3QNWA 3ZLBA 2REXB 1CKEA 5EWJB 4RPLA 3S2EA 4AO7A 4RHYA 3GFFA 3EE6A 2YHAA 1K4MA 4JP2A 2VT3A 2GWRA 5B3AA 3CLTD 1TVEA 3G8YA 4UCXA 1M6WA 3A4NA 3CC8A 3A2NA 4ZYXA 3QELB 5A9TA 1VCNA 4OQEA 1W0KD 5JMWA 4ZI3A 4RIHA 2QM7A 1E4OA 5B6PA 2VEDA 2ON6A 4L85A 3JARB 4ZTBA 3VJRA 5CVVA 5FD8A 3TIGA 4TTQA 2FGJA 1UCFA 4CIDA 1KWKA 1XSEA 2GCNA 3BMNB 1DAFA 5T4FA 1MIOB 3OC0A 6YASA 5FR1A 1DLJA 3TLMA 2ODAA 4KHZA 4RGYA 4JB8A 4D9NA 1S5PA 4X84A 1SKMA 1WDKA 2P9FA 2DPXA 3TQOA 3D81A 1NI3A 5ERGB 5EMNA 3L8FA 4YAUA 1IATA 2R97A 3EAQA 4IHJB 5T3UA 3AF5A 1C0EA 3JQ7B 3W2IA 5HFNA 1M1NA 3KBOA 4Y6QA 3KQVA 1HLDA 4KE6A 4Y0NA 3CVUA 4KH1A 4R01A 3HKDA 1OZHA 3KPYA 1UK9A 1K6XA 3TVDA 4RJLA 4W5QA 3FNIA 1H23A 4MYRA 4S1TA 4ZXFA 4MP3A 2WZDA 2ZWMA 3Q5GA 4K05A 2M32A 4TKMA 3WK6A 2BR5A 4C0HA 4DA4A 4MIEA 3S1LA 2G0TA 5IAGA 4RZQA 2Q3FA 2W6PA 1CDZA 2UVPA 2VUIB 2Z5FA 3HC7A 2C7OA 3AF0A 3HCEA 4YLEA 5BOSB 2OG2A 2VP4A 3JAKB 3RUCA 3A1WA 4XIYA 1WZUA 2GVNA 2PH3A 3H5WA 1YA8A 1AUXA 4UC0A 2ZKLA 1AKTA 2VZ0A 4C4YA 2C98A 2PZKA 3HG7A 4HADA 4URZR 4UZSA 5J63A 3VPFA 3WDMA 4RACA 2WA2A 4TKZA 4WK0B 5DEIA 3PU6A 4HQ6A 4HTFA 4UJ3A 1OMOA 4FW9A 2EWMA 2JCGA 3IDSA 2AK2A 3R0ZA 3PGKA 4N0MA 2GPBA 4MRNA 4P4SA 4PC3A 2VPIA 4MULA 4H7HA 1HE1C 2P6UA 3OT1B 4KN6A 5A5GA 3U09A 3L05A 4L4UA 2JKZA 3GHHA 4MUFA 5IHPA 1EQAA 1ML3A 2J85A 4YP9A 2GO1A 1VSUA 2PGLA 4AXBA 2QAIA 5C7LO 2QAGC 4KR6A 5DGDA 4BVAA 1ZIDA 5BWCA 2IS4A 3WMFA 5I4BA 4HB2A 2GEVA 1FSPA 2RCYA 2YZGA 4JJAA 2OM2A 1CY4A 2RGEA 4ZRMA 1A8HA 1O0BA 2P30A 4FZJA 4IDQA 1RJ9B 4GOMD 3EXIB 2F48A 1LVGA 4XD7A 2JLYA 2ZZNA 1X80A 2HU2A 2C7BA 1YJAA 2CJWB 4K1LA 2WU8A 2OFOA 2MSNA 2SICE 3HO1A 1QVAA 1XC7A 3FOAA 3TBKA 3LC0A 4EO9A 2GPJA 3DAGA 4CWAA 4XZ3A 3FPEA 4J9UE 4S24A 1UFKA 4YJ2A 3OURA 1UEJA 1B41A 3CSSA 4PEVA 1I2AA 1Y82A 2E4ZA 3Q9LA 2O0KA 4K9RA 3T7IA 1CR6A 2ZBGA 5E2AA 1V3VA 1A0OA 1GTZA 4DJTA 4UMDA 2KI5A 2D0IA 4ZU3A 3WXMA 5BVHB 3A37A 4DNQA 2HU8A 1CQIB 2J9ZB 3P2MA 4TT3D 4EOGA 4DDKA 4TMVA 1ORDA 3FFAA 3KSAC 2G09A 3KZMA 2QLTA 2Z6QA 5C5IA 1RRKA 3HO8A 4IWYA 2ZR9A 2GEFA 3F2VA 4WCDA 5ELXA 1DBRA 1XTIA 2XUQA 1OE0A 2PMWB 2Z5GA 4M98A 4DQKA 5LOVB 3ROXA 1YQUA 5BT8A 1E92A 1OIVA 4M1WA 1ULHA 1T4CA 1Y0BA 2PJRA 3G59A 1TT5B 1W1WA 5AICA 3U4AA 3WGJA 3QXCA 3QIAA 4K9PA 5ED0A 4DIKA 1KVQA 3S68A 1ZD2P 2NSYA 3F5DA 4FFDA 3SZOA 1EM8B 1QO9A 4HDRA 1ETHA 3S1AA 3VAYA 4DXDA 4ERNA 4PZZA 2HHCA 5KTOA 1ADCA 1KZ6A 3A10A 5JC1A 4WPGA 3E4DA 3E70C 3TECE 4L8GA 3GPLA 4WXMA 4EKIA 2DFLA 5E4FA 1Y1SA 3WLTA 5AW2A 1H9AA 4WXPA 4TMYA 3ESAA 2Y4OA 1HUQA 1XB2A 3ZJ5A 5AI6A 2DT5A 2X6RA 2XDQA 1M74A 1QH9A 4JJGA 2H4WA 4UVHA 3I01A 1XYGA 2YZKA 5AHOA 3V5NA 4KV7A 4DMLA 5EYPB 5LQMA 2BJWA 1IY0A 3MAGA 4RNCA 3N6RA 3V4LA 3VR6A 3PEWA 5K0GA 4LMBA 3RVOA 4FE7A 4B3IA 2IYOA 1VA5A 2Q2WA 2ROQA 2XMGA 3ADPA 3JX9A 3JZDA 4FJ0A 4O25A 5DX1A 2D0OB 3SEZA 3U9LA 4AX4A 4XVRA 4DEXA 2PUBA 3GCGA 4MQUA 5EP3A 4X20A 5E4YA 1AUQA 1UBUS 4REQB 1TF5A 2BEWA 1DQNA 4ESVA 1GVNB 1RLMA 1OPXA 4B17A 1L9XA 4AP9A 1KXJA 2CLKB 2ZBRA 3FPFA 4PZEA 1WHTB 4X93A 1JDTA 1SWWA 2JD2A 2J48A 1R16A 1W34A 1HGXA 3LX4A 3F98A 3LPAA 3OJEA 1VG1A 1K6JA 5DYWA 3SR0A 1U81A 4P5EA 2F1RA 5BV2P 3PEFA 2IDKA 4TSFD 4ZIRB 3JQBC 3D3QA 1JV2B 2GRAA 3F8TA 3MK31 4HEQA 4MIOA 4P2GA 5I6DA 1R4ZA 3OU6A 1NXOA 3KVVA 3H9EO 5ALLA 5K3FA 4ZYYA 1Y9EA 4ASUD 1Y89A 1FU8A 1QTNA 4IIXA 4W9NA 3RE1A 1EP2B 1JFVA 1I13A 2ECOA 2QRJA 3OE5A 2JBWA 2AX4A 2XRFA 3MF4A 1H2RS 2CE7A 3CLKA 1I6KA 2HCFA 4G5GA 4IIJB 2YKGA 1VPDA 3KJEA 3PI7A 5FO0A 1XNHA 4XXHA 1QQ7A 1EX9A 3H04A 4JFRA 5EOVA 2A0FA 5CGZA 4YBZA 2XUHA 4P5PA 1QNLA 2JA2A 4PSAA 5FHRA 3WGLA 3ZWDA 3UWKA 3A6EA 3IA2A 4WGGA 2NZYA 2PNJA 3VI3B 2P2DA 3BIFA 4GXRA 1Z2CA 1RWMA 1PQYA 4TS9A 2PSDA 5B1HA 1RXWA 1R0YA 2CHFA 5TS2A 5H7XA 5JH7F 2COUA 2SCUB 4GVXA 3TZHA 2OQIA 4M0UA 1T8SA 2Q0SA 2VXBA 1QU3A 2XA9A 4EZIA 3LRTA 1E3MA 1USKA 3JQFA 1G60A 2WF5A 4ZV4A 3TAUA 2R8EA 3U3JA 1XROA 1OV6A 1F4VA 1TPZA 221PA 1V2GA 2BBWA 2V96A 2NZ2A 4UXJA 1VKJA 2J5RA 3RRFA 1KZ7B 4B7CA 1IIBA 1UINA 4AQYB 4UDNA 4CT5A 1JKJA 2WMYA 3TSAA 3VPCA 4CM8B 1Z0JA 1R5NA 4YV1A 4GKBA 2OLJA 1VSVA 2BI4A 4K86A 3TJRA 4QEDA 1CUVA 4V0RA 5CLIA 4A1OA 1H9CA 1VPWA 1P18A 5AOBA 1KFEB 2LUOA 3P9RA 1QQ6A 3N28A 5BV7A 2GM9A 3L0OA 3Q5DA 3ZDFA 2A84A 2F6RA 4PO3X 4Y1RA 3UHFA 4FDUA 5KVCA 1Y4DE 4P31A 1OIWA 3KLNA 4S1VA 4BNTA 5ITZB 4ITVA 3FSGA 4FMBB 1OWLA 3SBDA 3QTBA 4OGFA 1QC5B 1IG0A 5TGZA 3TEMA 1QGYA 1GKYA 2DLNA 2Q49A 4NENA 4RJ2A 3RT1A 3L8MA 3TTXA 2EW2A 4BE9A 5JQGF 1SHLA 2GJAA 2LV8A 5DDIP 2H2DA 1AS0A 3MWEB 2IEGA 4YUWA 5MFPA 3BE5A 5KKNB 1JJIA 5DGTA 7AT1A 3DHYA 5AJHA 4B32A 1LX6A 4OOFA 1I14A 4AECA 3CNLA 5ALGA 3IELA 1PVDA 3OE7A 2MCFA 2PJUA 1JHMA 1RLOA 1HEYA 1X1BA 2PX3A 3AZPA 3L2OB 4J29A 2FPXA 3ELYA 3TZKA 1IM8A 5JJLA 1N0VC 1YR2A 1MV8A 1IC6A 3IAS6 2NGRA 4ZU1X 2G9NA 2R0QC 1N5OX 1XR3A 2OT3B 1Q7EA 3QMVA 3OHSX 5E9WA 3M2TA 3TX6A 1TJ3A 1KSHA 2VOJA 5LDDC 3B1KA 1SU6A 1L7XA 2FSHA 1E0DA 1NFRA 3LM8A 1I10A 4YMIA 3V97A 1CNFA 1RXEA 3VR4A 2LBPA 1T6NA 5AVOA 3AVYA 4HTAA 3UB2A 3BMOA 2NO9A 2WAXA 4KN9S 5BR8B 5CX4A 1F1BA 4OGWA 2BFDA 1TT7A 3WZMA 1ZJZA 3PF9A 3EG9B 1B7GO 2Q62A 3NDRA 4BO7A 1QO0A 2Q7XA 2F00A 2B36A 4BDTA 2WJPA 1Y8ZA 2C92A 1WTCA 3GB9A 1SEVA 2ZE6A 3QQPA 4M7OA 5TARA 1XEWY 1JGTA 5KYVA 2X2FA 1TTTA 3PA6A 1JR6A 5JDCC 1EFPA 3FTPA 4OV6B 5LA6B 2N47A 2PX6A 5IEJA 3FTEA 1OTYA 4FLMA 4IGAA 3EFBA 2XIJA 4FOLA 2Q1SA 3AR8A 3KJNA 3VI4B 4C5AA 5KTTA 3PGJA 1I7LA 1A9OA 2B3DA 1HWYA 1DB3A 3IPLA 1VFPA 3UA4A 1QVWA 4K9LA 1L7MA 1YQEA 2ZIEA 2LWIA 3M81A 2P2CA 3PD7A 3DCYA 4UD6A 5DCWA 3TXXA 5IYZA 4C6TB 2G1PA 3I9LA 3THRA 4GKAA 4LV5B 4XAQA 5BOVA 3SKXA 2XBMA 1AH2A 4WSOA 1X7YA 1P39A 4Y9SA 2R7NA 3DWGA 3OZGA 4O1MA 2V9CA 2W0SA 3W5CA 1PCXA 3QSYA 4R8VA 5ICEA 2ZG6A 5AI0A 4NOKA 1ZWLA 2WABA 2O3RA 4UEOA 3O93A 6ADHA 4QUDA 3RV3A 2HJWA 1HFWA 2Q21A 4FNGA 3NOOA 1YZYA 4DR7B 1BX0A 3E5RA 2B4TO 3PRKE 2YZ7A 1ZOLA 3QVLA 2FFQA 4YRDA 3DMYA 1TEXA 5B4UA 3F9IA 4IFBA 5GOZA 1H5UA 1BW9B 2R65A 4M1MA 4CU2A 4EGSA 4W1SA 1BXGA 2Q4RA 1ENZA 3PLRA 3ZHXA 3OEED 1NVEA 2WILA 2HMAA 4ZODA 4QG3A 4O63O 5EJGA 4MUEA 3GDGA 4LYHA 4Q4CA 8GPBA 3L40A 1ZD3A 4UASA 4D8WA 5EC8A 2HO5A 5FA8A 3UV6A 2LCQA 2C59A 1ZISA 3R5JA 1NP3A 3TLEA 5IJ0B 4MRMB 3WWPA 3U61B 2XT6A 1C4XA 1E9BA 2Q41A 2ZUSA 5FTNA 3VDRA 4AJEA 4ALKA 4DCTA 4XJVA 5C81A 2JGDA 4F1WA 1MPXA 2WT8A 3AM3A 5DX8A 3AW9A 1DV1A 3HXOA 1H8HD 4MR8B 3U7HB 5ALOA 2J5XA 3WHKA 1P2TA 4MP8A 4KQCA 5ERXA 1FYEA 3T1HB 5DI9A 1TMGE 3D4BA 3UWPA 3WIEA 5KOJB 2BFWA 3UICA 5BYAA 3ITEA 2FEWB 3ENWA 1ODJA 2A9FA 1P2UA 2GEDA 3QEJA 3S8YA 2O5CA 4ZC1A 1FX1A 1VBFA 2BMEA 4MOWA 3CHYA 2RK6A 4Y67A 1FDSA 1P29A 3F6YA 3HKCA 4A8JC 1I8TA 2KBEA 1N6IA 1F0KA 3DE3X 1RYHA 1ZZEA 2QTHA 3TGLA 1GV0A 1TJ4A 4KQFA 4DADA 4LYEA 4YRQA 2QMHA 4BATA 1U6IA 4RENA 3L6RA 2OD7A 4B3DA 3K9WA 4B9AA 3VAAA 1ES9A 1J6UA 1PFYA 4BKOA 3PFNA 3PENA 1NUTA 4Q0MA 1L5MA 4FFBB 1CRQA 4KMOA 5KS2A 3HRKA 3COJA 2V7XA 4M55A 4EA6A 1JXAA 2P69A 2D2VA 2XE6A 3MSCA 3UUFA 1DG1G 1BOOA 3T41A 5CAEA 2YHSA 1YE5A 1V11A 3MCWA 1MJNA 1PT6A 1K5GA 5EWMB 5C7YA 3KFLA 2WSSD 1XCBA 2PS9A 1GR1A 2O2XA 5FBHA 3ZGZA 4OH1A 2IYUA 2AFHA 4V03A 2C9MA 4ZZ1A 5JYEA 3CW2A 3DFIA 3LW7A 5B30A 5CFMA 5B2ZA 1XDSA 2VAWA 5CXUA 1CULC 1NGSA 4MRRA 5DLPA 1OH8A 2V4MA 3OAAD 5E7JA 3AJAA 4GRIA 1A9ZA 4RADA 1QM5A 2HL6A 1QX3A 1SH7A 3PC6A 2FU5C 5DTIA 2FFHA 4HRYA 5HKKA 1S8FA 5C1IA 4DMHA 3NHBA 2BGNA 3PHBE 1H93A 4ZXPA 3ONNA 4TKVB 4AM8A 4RQBA 4ATNA 2FJPA 2H0AA 4LRQA 5EZQA 2ET6A 4NMXB 3PUXA 5J59A 5JCJD 1VL5A 1YZTA 4RK5A 2Q3BA 4X7MA 4N5DA 1FE8A 4E0BA 2ZAMA 3GLRA 3K2BA 2WYOA 2VF7A 3FB1A 2IVZA 5ALEA 5TEWA 3OIGA 4CDNA 4LMRA 4I19A 2DUWA 6REQB 1Z7GA 5FBVB 1G6KA 3DV0A 3JZAA 5CVJA 2CUNA 3MWGA 5BMVF 1NVUQ 3ILXA 4AD8A 5GADl 5LUAA 1HA3A 2AOTB 3MLEA 1YHYA 2NLOA 1HXHA 2R85A 2YASA 4IIUA 4YDHB 5E6RA 1BWSA 1X94A 2FP4B 4I3HA 5JT1A 2H2HA 3NMUF 5TEVA 1VMDA 1RAHA 3L01A 4PRKA 3X43A 1GFIA 4LS3A 5JNTA 1CE8B 1YJ5A 1GAQA 3TOCA 1DEKA 1SQFA 1Z47A 4LG1A 3WK9A 2YZNA 3O90A 2ZRLA 2W83A 4LWZA 1D1PA 4QUEA 3GP5A 1D6NA 1U8TA 4BMPB 4RTQA 4N03A 2I33A 2GF2A 3TINA 4D97A 2VBFA 5C32A 4A6PA 3ZHQA 1GRQA 5JWHA 4F38A 3LTNC 1ZESA 1E2GA 3SVTA 2XTMA 5TR9A 5EIBC 2AMFA 3W90A 2NYUA 4YRRA 4JCCA 3KDSE 4TWJA 2AIRA 1TVMA 2OG1A 3OPNA 4IUBS 1LBQA 5JY1A 4KXFB 4P0PB 3K9NA 3LY8A 4H0CA 1UZLA 1U1EA 4F6CA 2DLCX 1Q91A 1YR3A 2O8FB 4O8ZA 1B0UA 2NUPA 3FR7A 5T41A 4RCYA 1MAHA 1M2OA 4NZZA 4U7PB 3ZIAA 1TQHA 4R71A 4YCDA 3RIHA 1AKEA 1W47A 1CLEA 1E2MA 3H05A 2ZTLA 4FUTA 4LF7B 2J4DA 5HZKA 4PIVA 1Q0PA 1QHXA 1P73A 2I3BA 3GG9A 4ZT7A 1Z0KA 3PGMA 3ZEAA 4QJIA 3RKSA 1VIMA 2EJUA 2XOKA 1ABEA 4QPCA 4TQGA 4U39A 4TLMB 4QXOA 3CLRC 5IK2A 1O08A 4KMSA 4UMEA 1NOKA 3ZNNA 1JEOA 3LQKA 4Q4AB 2QQGA 1KC3A 4QWMA 1ZMOA 4GOLD 4I3FA 1TJYA 2Y1CA 2CE2X 1JUDA 1NXWA 2BMJA 1D8TA 3I28A 4QXAA 5TGTA 2O8BB 1I5RA 1V5GA 2LXNA 2W6MA 3ICEA 2TMDA 3W8NA 4JI1B 2MMGA 5MGBA 2JI9A 1TLFA 3OEHA 3SF8A 1N3LA 3FCSB 4QUHA 2DPGA 1JG6A 3DC2A 4FBMA 4Z9YA 2BFPA 3D6AA 5ENDA 3M5WA 4IDGA 2CNKA 1KY5A 1XRMA 4WOBA 4XYBA 3HDHA 4URFA 4E5NA 1Z6XA 1RRVA 2H2GA 3AP1A 4CIYA 3HU2A 4Y18A 5BR7A 4X3CA 2IYAA 3EXAA 4IO1A 1KS2A 3ELBA 3TWOA 5AKEA 10MHA 1RLUA 2P4QA 2WYHA 1P2VA 1FP1D 2F9FA 2OP0A 3AC0A 4I4NA 3REFA 5JTUA 4FR5A 4UHJA 1NBAA 1BC5A 5JRZA 3TUZC 3BZBA 4RWZA 4W99A 1DTWA 3SBXA 2JFYA 4JC0A 4C89A 1XOIA 3ILSA 1T8RA 5TQJA 4JUDX 3WLEA 3H18A 1NJ2A 5LZ9A 2I1VB 3DOIA 2FR0A 1PFWA 5GONF 4ZDIA 2DR3A 3L7CA 2EQAA 3EISA 1Q57A 1W4LA 2C83A 3NHAA 5G40A 2H1OA 3FOWA 4M88A 1UMBB 2BMWA 4RJJA 5DBFA 5U1PA 3GDHA 1GPJA 3W78A 2ZJFA 2YXDA 3GJ4A 1RZRA 4IXTA 2FZ4A 1F1JA 5EXXA 1N0HA 3DA8A 5E0OA 3UNXA 2DY1A 1XQ9A 2GZAA 3VM6A 1USUA 1TF2A 3UK6A 3GGDA 3JR7A 3ROKA 5EJ5A 1JKMA 2IIQA 1SK9A 3BXFA 1TTPB 1OROA 5DTEA 2FUG6 1EXWA 2OMKA 13PKA 3I9KA 4G63A 4HGQA 2ZIXA 1YB4A 1KJIA 2YWBA 1W6UA 4G56A 3DBIA 1A5ZA 4G25A 2QL9A 1IXRC 1EIWA 3UHPA 3THXA 2BH2A 3EZ2A 3SJZA 4HVLA 3AETA 3NBQA 4DIDA 1R0KA 1AB6A 2QPLA 1PUIA 1AT1A 1C7ZA 4E2WA 4C76A 5EKUA 5JCOC 1EEHA 2VT6A 3ILHA 4OSEA 2AZTA 1E2KA 2FSVA 2RKBA 3D6HA 4LYYA 4O4HA 3UQYS 1YSCA 4ZD6A 3UFXA 3BSWA 5KKAA 4AF8A 3AL3A 3ESZA 3IBCA 3OY2A 1YRAA 3I72A 3P9XA 2GKGA 2XV1A 4M2LA 4PSKA 1E5QA 1DIAA 1C7RA 4EFDA 5CFRA 1YBHA 1CR2A 2R60A 1HORA 4O4IF 4DWOA 4GYYA 5KVVA 1FU4A 1YZLA 4WERA 2VDWB 5MGNA 2VF4X 1ZJ5A 3CWQA 2I9KA 3SAJA 4C0SA 1FDOA 3GGOA 2WU0A 3K9HA 3NHUA 1DJQA 4OM7A 2W5UA 2B9VA 1NRIA 4IF4A 3INRA 1NLMA 4R8SA 1Q1GA 2W6ID 1ISFA 4Z7OB 4FI3C 5EJ4A 1PNVA 2HQOA 2BKXA 3KOMA 4CBVA 4HAXA 4M0DA 5TPZD 3ZY6A 1QVVA 1QYWA 2QTAA 1F0PA 1RYFA 2Q5OA 2ZIWB 2YMMA 3B6ZA 2WVAA 1P4AA 1YR9A 1OH7A 1C5KA 1J8VA 4E4RA 4EHHA 2Z6AA 3FKSA 3EXFA 1I5EA 3PE6A 2Q5CA 4HDSA 3ZLJA 2MSKA 2Z83A 2Q4OA 2GSWA 3BB4A 3H5OA 5MFZA 4JL8A 2ST1A 3SFZA 2VCEA 4IIEA 1CWUA 1QQTA 1JDNA 1SUCA 2PY6A 3HDQA 1W85A 3ENQA 1SZDA 1HG0A 3T38A 3ZBUA 4BO8A 1Z75A 5KSZA 2F4VB 1OJLA 1GZ5A 4QUIA 3UWDA 2FPIB 4L8LA 3L1UA 2IUEA 3VHLB 4DLRA 1VZ3A 1VM6A 1GFSA 1XHFA 3GGPA 1G5TA 4XOIA 5JMPA 5GZ1A 3AKZA 4EKEA 2R44A 3DHNA 5JJ5A 1JFFB 4PVDA 3HK2A 2FCRA 4UDYX 4QODA 5DXFA 2GX6A 3HA7A 4X00A 1M33A 1JN0A 3UAVA 4C1BA 1O94C 3O9MA 1AO0A 1VPEA 1G21B 2Y99A 3FUCA 3HV2A 5EL0A 1J1UA 1DADA 2G5PA 3HCWA 3BRCA 5DYGA 1ZRMA 1UFOA 3VR6H 4EHKA 3RI3A 1J2RA 4L5AA 3LC1O 4YRAA 2RGGA 1ZXLA 3LXXA 1OJ7A 2VJLA 4KN8A 3RK1A 2C78A 2V65A 2P40A 4JP1A 4KXLA 2IYRA 4Y2RA 3MJ4A 5BQXA 5I7FA 1B23P 4CIBA 1VDMA 4M9ZA 1EA7A 1J8FA 1FLDA 3N2LA 1OWNA 5DBHX 2BFEB 1ZONA 1CK4A 4UJ5A 2G9QA 3W6NA 3W6PA 3CJRA 2G1UA 5TRTA 3LUAA 3SFVA 5K6TA 3GYBA 1UZNA 3SXPA 5KYNA 3PX2A 3KSBC 5GV8A 4JI5B 1ZAYA 4Y2SA 2CEAA 1VIAA 2OKGA 3DCJA 4I4CA 1N1DA 4I08A 4ZHSA 5AKZA 4ZKEA 3TZ6A 2EEPA 4DN6A 3TLZA 5J43A 3K15A 2Q2QA 3RSSA 3C3KA 1MW9X 4N49A 2VWQA 5CNKA 1T0JB 1V26A 3A7DA 3ONEA 4P4UA 1ATZA 4N5LA 3VR5D 3Q7RA 1F14A 1JHZA 3S44A 2PUTA 2GF9A 4XDYA 3CVWA 1WD5A 3WB1A 5ESWA 2M6KA 4OGKA 3AMVA 3OF5A 2M6LA 2BRUC 2GUGA 3K5PA 4MVJA 5KJ1A 1G3MA 3EDOA 3T1TA 1NRWA 5JNRA 2PV0A 3QI7A 1O2DA 1N2EA 2IZ5A 4IX9A 4UTNA 3KPWA 4RZIA 3SE0A 1H69A 5B5SA 5AVVA 4E6EA 4PZPA 2R751 4AMZA 5CD1A 2XMQA 1WMFA 1IWPB 1G2PA 2C9CA 3PL5A 2HBQA 2B25A 4MJ7A 1VIVA 1ENYA 4D0GA 4OUDA 4DIMA 4WBNB 5JZBA 2F43A 2J3KA 1VJ5A 1R6AA 2OO5C 3MT9A 1U0NA 1FQWA 4G24A 5AKGA 3LBHA 4GKJB 4ALMA 3PQEA 4B3SB 4MKZA 3J80A 3U2QA 1XFDA 5BV8A 5TGDA 4B43A 1W29A 5HJEA 3ET4A 3QJ5A 4YACA 1OA1A 3RUEA 1R6TA 3KQNA 2IF2A 4KKVA 2R1VB 3EK2A 1Z12A 2FZKA 2VTKA 3L9XA 4GWKA 1EFAA 1TKBA 3Q0TA 4DHWA 3DDUA 4MXDA 2QROA 2X6TA 5BR4A 4FWIB 3EF1A 2UZIR 3LZ6A 1U3UA 3IDQA 3BEDA 4DA6A 2W4MA 1FRZA 1QIHA 3GLTA 2X8LA 1TCBA 1XMIA 4Z1MA 3RVJA 3CTMA 3IP9A 2FZCA 3JYPA 1CQJA 1D0IA 4R1NA 2VRBA 4JUIA 4S0ZA 3L9WA 2GBGA 1SKAA 2ZRFA 3JZFA 4NAHA 1IJKA 1ZOOA 2ACWA 4KFSA 4ENPA 2X8WA 4D9EA 3CS3A 1PL8A 3A14A 1VL2A 4D0LB 4DMRA 4ZN6A 1NWCA 5CDFE 1FA9A 1NT4A 5AW3A 1UANA 1KAHA 2ZJ7A 3JD4A 2G9VA 2EQ5A 2UDPA 2VYVA 4XASA 4NMWA 1KK1A 1WQ3A 1XA3A 4HJRA 3LQ2A 5IDWA 5CBKA 3H5TA 4FPXA 4Q5IA 1UP7A 2ZUDA 4L7QA 3D54D 2DKFA 3VH2A 4QELA 4C7OB 1DU4A 5DASA 4B87A 1ZJ6A 3D6VA 1WUJS 2HQBA 1A5AB 3KKZA 3KD3A 1G9XA 5A2GA 3ISTA 4EBBA 2D8MA 4ER3A 3OBIA 2CXHA 5K4GA 3C7TA 3FAZA 4Q7MB 4KBFA 3JQGB 3ZLTA 4E07A 1C7FA 1JHYA 2BV3A 5KDDA 2H9AA 2QRNA 3QU2A 5BT9A 4LOJA 3N8IA 2WVHA 3K53A 4N3NA 4EJ6A 1MO2A 1VHLA 3K20A 1GNLA 2I1WA 1U0OC 2VTBA 3IO5A 4R5MA 2HOQA 1TXGA 3T9AA 3NBKA 4IJ6A 4CMEC 4DCVA 3V8NA 1E5DA 3C39A 1DKPA 4M8NE 4YIKA 5FOXA 2BW0A 2ZS8A 4EG1A 5JISA 1XVLA 2DU8A 2Q0XA 1NI5A 3O9VA 3GFQA 2P2ZA 4JJ4A 4AQ7A 3Q41A 4FEGA 5HS6A 5HVNA 3DMGA 1K4YA 1E3JA 1RI3A 4WY5A 4KXWA 5JCZA 4Y2TA 4QUKA 3B8EA 4JX9A 1RLTA 3VPSA 1IHOA 2BCGY 1Q0RA 1JEJA 3OTWA 4PV7A 3DDNA 3I9FA 1C3XA 5TNXA 3BJZA 4B6QA 3HA5A 1WUIS 1ULSA 1X38A 1QYCA 2AVDA 2NO4A 4ALNA 3DKKA 3CO0S 3EY4A 3HACA 4FS3A 3X1JA 3U5TA 2PSFA 1K88A 2FE1A 3OJOA 5JNWA 3SHQA 1A9YA 3PGLA 2C96A 1J39A 3F1KA 1GADO 1AKVA 1TIPA 3ANYB 4J4BA 4V0KA 5AO9A 4D4IA 5FJIA 1YZVA 4FNMA 3LC7O 3EXHA 4RTJA 1LDGA 1N6NA 1WSAA 3JQAD 1YRWA 3IXMA 1ZCJA 5LU8A 3DCIA 5IM5A 4OX9Y 3UK0A 2C4TA 1Q0HA 3CWZA 3WWCA 4R2JA 4M0PA 1WXXA 3NT4A 3NJ8A 2QMQA 3TSYA 5J2UB 3B1XA 3KZOA 3VKVA 4X85A 2CFRA 2ZPUA 5ALIA 3FWHA 3OTOB 1GDTA 3NBMA 2FK7A 1UBJS 3AYZB 5AQ1A 3LL4A 4F5EA 2P3LA 3LRPA 4XEUA 5KNDD 2P9QA 1JAYA 2WF8A 3RU9A 1PV2A 2WQ7A 1O6BA 1UKZA 3P0EA 3GF4A 1Z74A 3AX6A 5JOQA 3OKPA 2ILTA 1RPZA 3ZTWA 3I4FA 4YCNA 5BWBA 4UEWA 1EFLA 4X7PA 4HFJA 4V0SA 1U99A 4AVYA 3PWSA 3GPCA 4YAJA 4MQFB 4BNWA 4DPKA 1X39A 3SG0A 2E37A 2J4FA 4D80A 4R7TA 1B76A 3QIVA 3EFEA 2A78A 3OE4A 4J8PA 4RY2A 1WMSA 5DMHA 3X1XA 3S2UA 2F9MA 5GJCA 1XZ8A 2WIAA 2NQ2C 3SN6A 2DHQA 4F5DA 2A14A 3OWXA 4RV5A 1DSSG 3PGVA 1ST2A 1BEUB 2EEZA 4R1SA 5L51A 1NVTA 4KQWA 1KDTA 5HIMA 4R8LA 1Q44A 1U98A 1OKKD 1X8KA 4G07A 4MQBA 4J7XA 1RACA 4AFNA 2O52A 4BX0A 4JSRA 2YVLA 3A6ZA 1XUOA 1R7RA 3IDZA 3EF3A 4HXEB 2NU6B 1QHEA 2MIIA 5DKFA 1DJNA 2P8JA 3SCZA 3IE2A 1M2JA 3TRDA 1RMQA 3HJNA 4L4ZA 3ZWCA 4LVNA 3H2JA 4DNPA 2PUFA 4HN2A 3WJ7A 1YUMA 1LLCA 1P2FA 4NG5A 3TZQA 5ECWA 4FYIA 2EX0A 3C5VA 4IGKA 3QLUA 5L6MB 4WFJA 5C18A 1G6OA 2QPOA 1NLZA 2Y1XA 4OHVA 3W7AA 3KQMA 5CX1B 4QQKA 1X7GA 1LW7A 3KAQA 1GTSA 4X1KB 1YFJA 2YXNA 3ZJUA 3KOUA 1JI3A 2X3YA 5J5AA 4F84A 1N92A 1LLUA 3D6MA 3H2KA 4LIPD 1D2EA 1FDRA 1GL7A 2FUKA 4PHHA 1QPBA 4RS4A 3OQNA 5G2OA 3U49A 4LRYA 5FI5A 2ZRKA 2XECA 1V4NA 3U37A 1EZ4A 1PX0A 1VJRA 1W4CA 2WMOB 4BNZA 1U2PA 2FUCA 1B8UA 2JFGA 3OJ0A 4UPEA 4BQRA 2WJHA 4OO3A 3UMSA 3MGKA 4C43A 2RI1A 3QBVA 4GPIB 4F11A 2FLWA 3RTAA 4A6DA 3HJGA 3ANNA 2WWFA 3DYBA 4TLAA 3WKBA 2F7SA 4LQCA 1N6PA 1NVDA 3HL0A 4IGIA 3K9QO 3RTEA 2NWQA 4EZEA 1D07A 1Z8NA 3NHMA 1Z13A 1R0SA 1X7WB 3OZUA 4C1NA 3EVNA 3CLUC 2QW0X 5A9SB 4Q21A 2XGJA 1ZH6A 4IS3A 1M2VA 4LEIA 4DCPA 2QRVA 3ON5A 3AZQA 1N3YA 1QG0A 1W0CA 2G8NA 4PNHA 4DB4A 3HU1A 1NYQA 4HV4A 5I9NA 4G67A 2VDOB 4LXTA 1OFVA 2YWGA 3SX0A 3U6KA 4WESB 2GLUA 1J4AA 2YV4A 1CDOA 1DIGA 1CUYA 3IAEA 3WMEA 1YO6A 1MIHA 3FDXA 3MB8A 3MJCA 4YO8A 4NC9A 4U6QA 4CG2A 2Q07A 3GVIA 1J07A 5JNLA 3G1TA 3PYLA 3O21A 2FQWA 2BTEA 4KIGA 2UYHA 3ZCVA 3CWCA 2DKNA 1JJVA 1HTTA 3U0BA 5IZCC 1C9DB 3HNOA 4R9SA 4GBGA 2ZJYA 4FK8A 2VBCA 5SYAA 1LRLA 3WXBA 3HR4A 2B1RA 3ER9A 3ILVA 2R8PA 1E9AA 3Q3CA 3VXKA 1K8QA 1E3TA 3KTOA 4K6OA 4PQFA 5CGQB 3ZDEA 4PGFA 2AOWA 2DHCA 1OHHD 4YRTA 4YCCA 4FYKA 1CY7A 1B93A 1MR3F 2PZEA 4W6QA 1LPSA 4CLRB 5FNVF 1Q6ZA 1XTVA 3EMKA 4ZRDA 4ZGWA 2AC4A 2H59A 3EIHA 3ORQA 2HSJA 3UTDA 2HSWA 5DW0A 4EHBA 1A50B 3OLQA 3A05A 5SZKB 1BHO1 5D5HA 2Y8EA 1FJ2A 4B7AA 3DTTA 2A67A 2H00A 3W0LB 2PR7A 1GPLA 4WK4B 3DDSA 2D5CA 2YXPX 5ALJA 4XB6B 2OA0A 1JEYA 2WZBA 1XQVA 5LQUA 1A69A 3IGFA 1GT6A 1F3LA 5DMXA 4DA0A 5E1MA 3X1KA 4AZ3A 3PG5A 2H31A 3WNDA 4GO1A 1P1JA 4WTOA 5FBLB 3PE4A 1I7DA 3LP8A 3LCVB 2C03A 3ZHRA 1NJ8A 3E0XA 2VJNA 5CVCA 4EI8A 2QXUA 3PVZA 2PLNA 3TMKA 3OZXA 3GA7A 3ND7A 4FNOA 4XTCS 2CHVA 4YI3A 1VPTA 2IX3A 1H6BA 2EYUA 4WOKA 2FZWA 3K16A 4H1UA 3BAZA 1N2CB 4R1OA 3KLOA 5AI4A 4G0QA 2QX4A 1W9HA 2DGDA