3B6MA

Wrba from escherichia coli, second crystal form
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
197
structure length
188
Chain Sequence
b'AKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavoprotein wrbA
molecule tags Oxidoreductase
publication title Crystal structure of the NADH:quinone oxidoreductase WrbA from Escherichia coli.
pubmed doi rcsb
total genus 67
structure length 188
sequence length 197
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3b6mA00
1AKRA 2FZ5A 4U7FA 3F6SA 1T0IA 3R6WA 4U7GA 3HR4A 3KAPA 3F6RA 5B3LA 2Z9DA 2OHJA 1RLIA 2OYSA 3W78A 3W79A 4YAUA 2QX8A 2XODA 3N3AC 1AKUA 1D04A 3OVMA 4FGKA 4QOHA 5NULA 2HNAA 1AZLA 4DY4A 3UXEA 1FUEA 1J8QA 1ZWLA 1I1OA 2HNBA 1FLVA 2Z9BA 3GFSA 3O2NA 5F12A 1ZX1A 4PTYA 2HPVA 1J9EA 3GFRA 2XOEA 3GFQA 3KEGA 4FGLA 3U7RA 1X77A 2QMYA 3JSXA 4QOFA 4DIKA 3NFRA 2FLVA 1YCHA 3FJOA 3KAQA 3OWXA 4ICIA 2Q62A 5LVAA 1AMOA 2Z9CA 1CZOA 2V9CA 4CF6A 3N3BC 5FA6A 3UXHA 3ZHOA 3B6MA 2OHIA 3W77A 1FTGA 3FVWA 4CETA 4N9QA 2BMVA 1DXOA 4YAFA 3RPEA 1C7FA 3B6IA 2M6RA 4QOIA 1YCGA 4N82A 1JA0A 4BMPB 1RLJA 4M0CA 2MWMA 1XT6A 4Y9UA 1QR2A 4DILA 1CZRA 1SG0A 4LTMA 5LMCA 1AHNA 5LJLA 1C7EA 1FX1A 1YRHA 2M6SA 2QR2A 3QE2A 5EA2A 4C0WA 1DXQA 4YALA 1OBOA 5TGZA 1AKVA 2N1MA 6NULA 3OJWA 2X2OA 2BN4A 3K20A 1FLAA 1YCFA 1VMEA 3NHYA 3O73A 5LBUA 1OBVA 2KQUA 5F51A 5LBTA 5ULLA 1QRDA 1KBQA 2MT9A 4ESEA 1B1CA 3L9WA 4LTNA 4C0XA 4D02A 1BVYF 1XI2A 3KLBA 5B3KA 2V5UA 4LA4A 5LLDA 1TIKA 2RG1A 1GG5A 1AKWA 1J9ZA 3LT5A 5FX2A 3OJXA 2F1OA 3NHJA 1AG9A 1DX9A 2B3DA 2Q9UA 4LAFA 4XDGA 1F4PA 2FDXA 1TLLA 2FZVA 3B6KA 3N39C 2FAXA 4N65A 2V5VA 4H6PA 2KLBA 4PTZA 4YAWA 1FLDA 4QOJA 1CZKA 3U7IA 2R97A 4NULA 4FGJA 2R96A 2QX4A 4Y7CA 3NHFA 5JROA 2ZKIA 1D03A 3B6JA 4C76A 1YKGA 3OX1A 2FX2A 3NLLA 4QOEA 4OXXA 2ARKA 4S24A 4YAOA 2QMZA 1CZHA 1XYYA 3F2VA 3FNIA 3ESXA 3FW1A 2D5IA 3OX2A 5FUQA 2QX9A 1J9GA 3HA2A 1KBOA 1AKTA 4R81A 2FVXA 4GQIA 4J8PA 1CZNA 1QHEA 3G5MA 3D7NA 3QFRA 5EMNA 5A4KA 5LJIA 1NNI1 4NLLA 1T5BA 2QX6A 1AKQA 1D4AA 2WC1A 3NHPA 4ZVLA 1FLNA 4ZVKA 4H2DA 2BZSA 3NHWA 3OWHA 3QFCA 3TE7A 3NHRA 1SQSA 4U7HA 4LTDA 3ES9A 1QBGA 3F90A 4XDHA 2FCRA 3P0RA 1XYVA 4ZVNA 3TZBA 4GR9A 1CZLA 2A5LA 1WSWA 3W7AA 5F4BA 2MOKA 1RCFA 4ZVMA 3NHLA 2W5UA 2X2PA 4GI5A 2FOXA 1RTTA 1WSBA 4YQEA 3SVLA 5EAIA 4HEQA 1OFVA 2AMJA 3FX2A 2Z98A 3HLYA 2OHHA 1JA1A 1YOBA 1FVXA 1E5DA 3NHUA 3ESYA 4F8YA 2MTBA 2GSWA 1CZUA 3ESZA 3EYWA 2BPOA 4Y9RA 1BU5A 4PU0A 3TEMA 1H66A 2BF4A 3LCMA 3NHSA 1ZWKA 3NHKA 4QOGA 1YDGA 1V4BA 4C14A 2QWXA 3K1YA 4BMOB 4QODA 3OX3A 4FX2A 5BUCA 3EDOA 3GAMA 3L9XA 4HS4A 5NLLA 1H69A 3S2YA
chains in the Genus database with same CATH superfamily
4IHJA 2G4VA 3R6WA 4GSYA 3FPSA 5DXJA 5E2BA 1AQLA 1UJNA 4X8HA 1T3ZA 4MYDA 1RRCA 5KNDD 2WZBA 1LS1A 1E3DA 2HJVA 3BS4A 3JCZA 2D5BA 4PR0A 2I34A 2BGJA 3LLMA 4RYDA 3EXHB 4CIDA 4DY4A 3D8TA 3ONEA 2XQKA 4ZYZA 2VP3A 3U4IA 2O8FA 1E8NA 2NO9A 2ZRDA 1X77A 2OQVA 2OV3A 1OH5A 1UXJA 3AJRA 1LJUA 2IEIA 4K8OA 3UEOA 3SHQA 4JLNA 2YWFA 4JNCA 2WNHA 3UW3A 3DEJA 2VEDA 4GPBA 3BGIA 2H63A 1E1NA 4JKYA 1B1AA 2FQXA 2GN4A 3T12A 3GIDA 3MSCA 2YHIB 4NQZA 5E0OA 5FKJA 4UXHA 3QF7A 4MPPA 5E7IA 2C77A 1JSCA 3P32A 2XJ9A 1GTJ1 2NUPB 3BFVA 1XD2A 3G2QA 3PPVA 4Q3EA 3VGJA 3D3WB 1SG9A 3P9IA 2O8NA 2M1XA 3KX2A 1IHYA 2D1QA 3INTA 4QT0A 4UBKA 1R4MB 3RHFA 5DNDA 3OFVA 1E69A 1LTKA 4TMTA 3V2UA 3WB2A 3A3PA 1NMSA 1NW8A 4LQLA 4P7KA 3O1HB 3OLQA 4GLJA 4P4NA 4B6SA 4PRYA 3HRKA 5EOVA 1JECA 2R25B 3RVJA 3TI9A 1GT91 3UAWA 2FKNA 1V8FA 1ZIYA 2WUEA 4DHEA 3BMQA 4XYEA 1VYTA 2YFQA 4MQEB 3OF2A 1ORIA 4NAVA 4BNIA 4CM9A 3R5TA 1GUDA 2PLRA 4HH1A 3A3KA 4FHZA 4PGGA 1KE1A 2GCPA 4G86A 4ND3A 1CY6A 1EE2A 1L5VA 1QH0A 2VPIA 3CNEA 4DCOA 1JYFA 2C8LA 1GGNA 2F90A 3BULA 3U80A 1AD2A 2WSBA 1N6KA 2CBZA 1UBLS 1Q1BA 4TPKA 1UP7A 4II7A 2GSDA 2V4ZA 1LRLA 1ETUA 3OU6A 3WHPA 4RABA 1YFLA 1PTJA 5DYNA 3EXIB 4RIEA 4UNSA 3NKVA 2Q3MA 2Z1DA 5HGXA 1VLHA 4PPFA 421PA 3CJRA 3TB4A 1RYNA 1APBA 4UVIA 1LX6A 3N8IA 4ALNA 4V38A 5TPZA 3EH2A 3PLRA 4L51A 3S81A 5K0GA 1QBKC 2A0YA 2ZW9A 3NAMA 4GBED 4R2KA 1YFZA 3HP7A 2Y2VA 4LHVA 4PO3X 2G1AA 5JPDA 1CR2A 1UBKS 3EZNA 3GJ7A 3DVRX 4L76A 4O33A 4OKIA 3VKWA 4X62B 4RDHA 1VL5A 1YE8A 2R4QA 3ET5A 4J1QA 3TD6A 1WSWA 4LK2A 2IIPA 2AN3A 2Q2OA 4JV5B 2MOKA 3UMYA 3O3MB 1P4GA 2DFNA 3N8HA 3GP3A 3FPLA 1BOFA 1NOIA 3PFHA 1P73A 1TQHA 2C3PA 3R09A 3QBJA 2YJ5A 2OB2A 3JQ8B 3L8YA 3NIGB 2NU8A 1XTPA 3FKJA 1NE2A 2GUWA 2BCEA 2GSWA 3OZEA 4TMWA 2X0DA 2ZRQA 3OHSX 4PU0A 4E1AA 2FH5B 4CWAA 4C7XA 2H2HA 3OCXA 1P60A 2D4AA 1W2GA 4QELA 5AW3A 1OGJA 3RT1A 3EGDB 4CR6A 3CLKA 3DDZX 3KAKA 4AXXA 3GR6A 1ZVVA 3BJMA 1D0VA 3C74A 2FZKA 4DV0B 4GL2A 3I9OA 4JLDA 3CC8A 1XMQB 3O03A 4L5CA 4GFDA 1NYRA 5H02A 4YUAA 1FUEA 1Z5ZA 5FOUA 3C3WA 1Z6AA 2IF0A 1H4TA 1SQ5A 4GPAA 1Z63A 4PAGA 4BQSA 5L3ZA 2PUFA 2GASA 2QMYA 3EWSA 1QH1B 3DBIA 1MRNA 2HY7A 3LO8A 3NHBA 3OETA 4CKWA 1PSWA 4D3SA 3PNSA 3IIMA 3OZXA 4TRNA 4PS1A 1SBHA 1LLUA 1R66A 4RZHA 3SU8A 3HJNA 3LVFO 2D59A 5JBQA 1NQXA 3VI4B 1HEIA 1I51A 3IR5A 4WNAA 1XMJA 2C97A 2E82A 2I9PA 2WWWA 3AERB 4XRRA 1RABA 2XDYA 3BQNB 5KMGA 2ZSDA 4K6GA 4MI1A 3DT6A 2YZNA 3NOQA 2VOJA 4IGFA 4L9RA 4AZWA 3U3DA 3PWZA 3QE2A 3A6KA 1G8YA 1I4TD 1A8SA 1A98A 1V7QA 1Y8QB 2FSVC 9ABPA 2NVOA 2AI3A 2BFFB 1M6WA 4HI0E 5JZSA 2NUPA 4N6OA 1NMEA 1E7WA 1RQNA 2J67A 5TMPA 4ENRA 1KQGA 1B1CA 1EZZA 4US2R 1U7HA 4X7PA 2G7ZA 2XBUA 4ZPJA 3UGKA 5IT0A 4PLCA 1T2VA 2DJIA 2BAGA 3KJFA 4YUXA 1CERA 2GEFA 3DQZA 3GD7A 3GLKA 3PA8A 1CVIA 4LHEA 2ORWA 3HUDA 4NPHA 3ZEIA 5J3JA 1NW9B 2OO5A 4D02A 4K6FA 3FMGA 3U7HB 1PJ3A 4GWKA 4HKTA 3R5JA 4LISA 1ZNQO 4WZ6A 4DR2B 2H92A 3TYXA 1UPUA 4C3ZA 2V03A 2WAXA 4BXOB 3OUTA 4HG2A 2PRSA 2AN9A 5EQJB 2CY0A 3OIVA 3U5ZB 1RMTA 2FZCA 3CYFA 1R9JA 2ZKIA 1M66A 2ODPA 5ALFA 1F4LA 3DE2X 1KIFA 1JG3A 2CZCA 3T3GA 2PUAA 4NEQA 1QK3A 4PO1A 5K0NA 2OSBA 1QAMA 4MGEA 3ZDQA 4EG4A 4FMDB 2Y66A 3R44A 5ELLA 4E0BA 2ZYAA 4HXYA 1VE1A 2ZTLA 4Q7MB 3WTBA 2DR3A 1WPQA 3ESQA 1ZUHA 4DCUA 5KEIA 1JDPA 2EW8A 2GK7A 3OEYA 2VJPA 3ANNA 2C4HA 4R4JA 3WMWA 3LW7A 4RTKA 1SCUB 4NAHA 4O3MA 3UFXA 5JADA 4DIEA 3QXSA 1YONA 3KPYA 4JASB 3LBAA 1I7LA 3E5MA 1MRSA 3LCCA 4JLAA 2O52A 3RU2A 3UMFA 1PL6A 1VLZA 1ZRNA 4HB0A 1P8JA 2VHZA 1T5OA 4AN4A 1L5RA 1OB5A 4QIHA 1JHDA 4O4HA 4G26A 4B3HA 2CXHA 4TRMA 5JBIA 3HGTA 4LNHA 5BUQA 4I7EA 3E9ZA 3WSWA 3SVLA 3WJAA 2XMBA 4HTFA 3DZDA 4IIUA 2OFXA 2WHEA 5ALZA 1WP9A 1V3VA 1TVKA 1ZR2A 4HMQA 2B8WA 4HWRA 1JIQA 5D8DA 3DL7A 4G41A 1NJ2A 3NDRA 5A4AA 1X7WA 3AVXA 1ZRSA 3RIMA 2OFWA 2WNIA 2Z2KA 3TD9A 5HKBA 2R8RA 4MVWA 2AXPA 4K3UA 2GCEA 1KEZA 5CU7A 3R41A 1BNCA 2O14A 4NARA 2Q6TA 1TJYA 3DDCA 3R7NA 1FPMA 3RS3A 5JDIA 3AR3A 1HTBA 1XD2B 5DULA 1KI2A 3VDRA 2HLNA 2D3TA 3TKYA 4FN5A 2ID9A 3IDQA 1FX0B 2GEUA 3S27A 4DCMA 2EEPA 4HQ6A 3WO1A 3SZMA 2DKFA 4A5SA 3G2OA 4YRDA 5EXXA 4WADA 1ORDA 4FJ0A 4XUEA 1DFIA 1LK0A 1Z45A 4EENA 2OHGA 4AY5A 4F84A 4JUBA 3THYA 4IL5A 3TJRA 2P69A 1BEEA 3OQHA 3ZNPA 4P7GA 1BWPA 2Q5HA 4DV1B 2ZSHA 2I3DA 4URYR 4BE9A 1N1DA 1ADGA 1IOWA 3U39A 1V5EA 1MAAA 1KFBB 1XLUA 2X8LA 2YWDA 1A8UA 1O96B 1HY3A 3ECAA 3ITDA 1ZAYA 5AVXA 2E89A 2C0CA 2Y67A 1NU8A 3L4KA 4ZEOA 2IS1A 2WILA 3W5SA 4KKVA 2DBVO 2J5BA 4H3KB 4H3HB 2ZIGA 1GQ2A 3LKDA 5DNEA 4YN3A 5GZ6A 3VKHA 4J6EA 6LDHA 1U8YA 1Z5WA 2P6NA 4G8BA 4GR5A 4KPEC 9GPBA 4UD6A 2V0NA 4NE7A 1U02A 3OZDA 3SWWA 4EEXA 1XNGA 1YR2A 4IUBS 4CIWA 2OK8A 2ZJ2A 1BVRA 4H0NA 4C4SA 2PNJA 4RQBA 4AJPA 3TTSA 4QWWA 2NU6A 2ZUVA 3OZCA 4WZZA 3MS2A 1S8OA 4G2NA 4TSRA 5DBFA 1PD0A 4Y1RB 2C7VA 1KJWA 2XGSA 4JZYA 1O1YA 3J7AC 4WZAE 2E55A 2B8TA 1H9AA 1UFKA 3A1DA 2F9FA 2ZPTX 4REQB 4UDNA 4WZAA 1RXCA 5B4TA 1R16A 4N39A 3EW9A 4TMZA 2J0SA 1IZ0A 4LYGA 1L9KA 3RKRA 3WHKA 2UXDB 1Q0QA 3F6CA 2WI8A 1MN6A 2OL4A 2QMZA 4NBWA 4P8RA 3MJ4A 3G23A 4UHFA 4YAOA 2HSEA 4WN3A 5D5PA 1KDVA 3VPBA 2AI2A 1SBYA 4EUNA 1D0SA 4W9NC 3OAAD 1ML3A 2BJHA 4I8DA 2GPNA 2IVFA 2ADOA 1ES9A 3I1FA 3FTFA 4BMYA 2IKQA 2IV3A 5BWMA 4YRMA 3VSCA 1KAHA 3NATA 1IXZA 4B6FA 1CEQA 3ZV3A 2VWHA 4EQ6B 1VCHA 1DTEA 2AI1A 2XTZA 3E15A 2CV0A 1ATZA 3R77A 5E1MA 3RC8A 2E6UX 2Q3BA 1QRUA 3TZBA 1CPYA 3LY9A 1R00A 3MAAC 4NBTA 1D4OA 3TW0A 4BCBA 2OSVA 3W3AA 3ZWVA 3CXUA 3EF3A 4F3CA 1ZHHA 5C5EA 4HMPA 3IOMA 3G1WA 3SP1A 1NZFA 2OV1A 3RUIA 3I6BA 2H2DA 2HJHA 2PR2A 2Y1GA 3ANSA 3E81A 3IP3A 1ISPA 4ZT3A 1FFXA 4MVJF 1CY8A 1Z2OX 1EG2A 1MO2A 4FDMA 2OFPA 2XMRA 3H8WA 4IFEA 1G18A 3DKKA 1I6WA 3A9UA 4JIMA 4IIEA 2JD1A 4IKEA 4WK2B 4BAZA 5DTEA 4BVLA 4JT9A 2BWJA 2PLFA 1KIMA 5EE3A 4DJ5X 4B2LA 4ZEWA 4X41A 3U9TA 4YV7A 4OSEA 4M0EA 3T94A 1PGPA 2BR3A 2VF5X 4IHJF 3HR4A 2EX0A 4MUGA 2F8LA 4MS4B 4TMFA 1IG0A 4DXAA 1WW2A 3FYUA 2C2HA 1Z4MA 2XXJA 4PIMA 1EI9A 2WG1A 3V4PB 2HNAA 2OXCA 4FGWA 3OTOB 2XNJA 1RNLA 2H54A 2XTJA 1RKBA 1N9GA 2UVDA 4MQBA 1PQUA 5H9VA 4QX6A 3VPXA 4EB0A 3KQQA 1NT2A 1Y8CA 2FN3A 2VHXA 3F6BX 2B92A 1AKEA 1CZOA 1FZQA 3JZMA 1TFRA 4QYXA 1CJMA 2O0JA 1E63A 2XYQA 3KZOA 1USVA 1JHPA 3AJ9A 2FEKA 4S1VA 3SDZA 3V7YA 4BLSA 2G71A 3WGGA 4LZPA 2HLHA 4LHXA 2AMFA 1QUFA 1JHQA 4MRVA 1YJ8A 1TMKA 2W8BA 3H4TA 2GFQA 3IMGA 1HQCA 1N75A 3VC7A 1UANA 1IIRA 3IELA 4OH7A 4Q4CA 1OH7A 2GVDC 2R66A 3DWGA 3TPCA 4E2ZA 1GQQA 1FF9A 4EMBA 4TS4A 3TRKA 2C07A 1PJLA 4LY3A 4YRJA 1JAIA 1QKIA 3VH3A 1OSNA 4K1LA 4LPKA 2G8LA 4M8LA 3WXMA 3DKVA 3CO0S 3A1NA 3BUSA 2GJ4A 2J09A 5J5VA 2VRBA 3PR3A 4E5KA 3C85A 3T1QA 3N2KB 3PFKA 3H2SA 4QBGB 5JO0A 4EJMA 4B3RB 4S1WA 4RIGA 4NY1A 2A4KA 3CCBA 3FCCA 4YONB 4DV2B 3VSDA 3H18A 2FAXA 3NGMA 3KZXA 2NWQA 4BECA 1EHIA 1VSUA 2HIGA 1SUAA 2EKPA 2Q21A 2VNIA 1UH5A 4MV5A 4RD0A 4C0SA 1F8GA 2YC4C 4WXEA 4B09A 1M8GA 4MWCA 1TEVA 2RGGA 5AM2A 2AVNA 1FDTA 1OX4A 3SK0A 3TXAA 3U3KA 2NQTA 2XD9A 3AHGA 3I8XA 5LN1A 1KBOA 5F2KA 3QPBA 1MFPA 3LD9A 5ALRA 3KUDA 5LDHA 1JTFA 4A36A 4WZBA 1BTOA 4Q21A 5E7QA 2BEJA 3PQ7A 1YI0A 1U9ZA 4F9GA 3STWA 1Y37A 1M7HA 2VJCA 1WMSA 2VNJA 3SBOA 2D00A 1J99A 1DBIA 2O1SA 3I01M 4OK3A 5K8CA 4DSZA 4JC8A 4JYPA 1P2FA 4ARIA 1PWHA 4ZT7A 1XK6A 1E5XA 4GGPA 5LXTF 1XSEA 4A91A 2Z3VA 3P0EA 3U4GA 3R5HA 2VT3A 4EY3A 5HKLA 3I2KA 4MYCA 1VECA 5JJKA 1DJOA 3CR3C 1NW6A 3K7EA 3QXJA 3UUEA 4BTVA 1YZFA 1SBCA 3H0CA 4ZN6A 2MINB 3JVEA 3TJMA 3DMTC 2C4UA 2X8JA 3LP8A 1NDUA 1PT8A 4RPJA 4WUTA 5DT9A 5JD5A 3U44A 3HKBA 3ZV6A 5AMXA 2CLCX 5FQOA 4ZI7B 3K1YA 3ZD7A 3FSRA 2GBPA 1S0UA 5GGXA 1N92A 4IEFB 1EGAA 4BV3A 2R1UA 5LYJB 3K6SA 1IAVA 2B61A 4MCAA 1R0XA 1K6JA 5JSYA 4CI0B 2BMDA 3H9CA 5FTMA 5FWYA 3THYB 1X6VA 6CHYA 3DE4X 4KXXA 3S7ZA 5JCOC 3QI2A 5B3LA 3IDZA 3NS7A 1NJ6A 4QYIB 5AQ1A 1SK9A 2ZQYA 6REQB 4G5RA 4Z3DA 2X14A 2OAQ1 1USKA 1SKAA 3ZLTA 1A96A 4PO8A 1XDSA 4HFJA 1FJXA 1RWBA 2J3MA 4J0DA 2Z56A 3DCNA 3QX7A 2GZ1A 4OO3A 4PPQA 3PL1A 1ONPA 1C9DB 4UEWA 4FWTA 4TSFD 4GC5A 5L3RA 4DJTA 1YUNA 1R6XA 4D9JA 5D3ZA 1F38A 2BTOA 4FLMA 1PEYA 1SBQA 2B69A 3E3OA 4MMXB 5D3KA 2X0KA 2OHFA 2OM6A 1ULBA 3TLAA 3BREA 3EIFA 2ZRKA 4LF9B 4MUYA 4JJ4A 5K3OA 1T10A 4GX2A 1TUBB 2QM3A 1SXGA 1RM5A 3ED5A 2GXUA 2ZB4A 4I0WB 4Q1VA 3KETA 1A77A 3FBTA 4ILEA 4LYDA 4EPXA 3CRZA 1U2GC 1U8UA 3KYIB 2I62A 3KKPA 2BM0A 3AU9A 3R0JA 4HYTA 3TW8A 3ZVRA 5HUHA 3O4VA 3TAHA 3HDYA 1PT6A 4H4DA 3IB3A 5AVQA 1Y3FE 3HBMA 2VAPA 2HGZA 2I3BA 4ITUA 4Q6WA 4PXSA 1O2DA 3HKDB 3E3MA 1MG0A 2NNWB 2FP4B 1TFUA 1J9ZA 3B7WA 1G5RA 1RADA 1YRYE 1KARA 4G4SO 4I4NA 4Q7KA 3ONVA 1KC1A 2VJYA 4RZ2A 3EVEA 4B8ZA 4MUMA 3T9AA 1W36D 1ZK1A 3MGBA 1V7ZA 4GW3A 3OEED 1VGQA 2GZDA 2V7XA 2NYVA 5EZYB 5CVDA 5JZ9A 4FJ1A 4ZQCB 1GUFA 3ROKA 3RT7A 3QVUA 3IYLW 2AVDA 3FPJA 1NX9A 3RU7A 2VYVA 3VU9B 5JBNA 3KYJB 3H1FA 3C8MA 4PN3A 1NU6A 3ICOA 1FFDA 1LLCA 2H5IA 2HF8A 1W9MA 2HQ1A 4HT3B 2H3EA 1XUOA 2LW7A 4N7RA 2C98A 2O2CA 4JVSB 3I2GA 4PGAA 3RBVA 1FYDA 3O8QB 2JFXA 4KE9A 3SCZA 2PCLA 1AKQA 3DAYA 1A9QA 3T3DA 4EMUA 4FTWA 4LDQA 2WE7A 1NKTA 4B75A 1GILA 5JZVA 4JS0A 5HS4A 3O21A 3AUFA 4M8IA 1LB1B 1CX9B 3I72A 2RK4A 5LQCA 4Q3AA 1TKCA 3VKUA 1GEEA 3PR1A 2R00A 1Z7WA 3PUZA 3UCXA 4R98A 4B2YA 1JLSA 1UMDA 4MB6A 1MOSA 2PSDA 3EQ8A 3QYJA 4K87A 4NRDA 4E5MA 1O94A 1X2BA 4UTZA 1ZC4A 3ORHA 2C5AA 4IWXA 3LWZA 3NBQA 3TW6A 4DA6A 1SOUA 4WA7A 2BEUA 2N46A 3TLGB 2J7PA 5I9LA 2ZSBA 1CQWA 3RUDA 2XTAA 1AGRA 3HHPA 3JVUA 3LWDA 2JFBA 1EIZA 2ZS8A 2GCOB 2NV6A 3FKQA 4X8MA 5AW5A 1J0EA 5EJGA 4I6JA 4QYMA 1XJQA 3LDHA 4AFNA 3O8CA 4QM6A 3I8OA 3B9PA 4L4ZA 4YVFA 5A6VA 4IIHA 4YV2A 2YV1A 5ALUA 3V1MA 3DF7A 4KVAA 4MYRA 3AFNA 3I61A 2VLBA 5HTOA 1XMPA 2GZ2A 1QQ7A 1HF3A 1ESMA 1HI9A 1IXKA 1RAEA 4ZC8A 3ZH2A 1LD3A 3GH1A 2OBLA 3DFKA 1W2HA 1E9RA 1RRFA 3TEFA 1R8SA 5AFSA 3OD5A 2TYSB 1DNPA 2E3JA 1W4AA 1EE1A 1R0WA 3GFQA 3VR4A 4Z7QB 2TS1A 1BX0A 3TQCA 3TDMA 1NE7A 2NIPA 2DHDA 3KKZA 4ITRC 1BEUB 3H2HA 2OECA 4G9GA 1Y33E 3CF6R 3K8ZA 4DLUA 1YK1A 2Z8YM 4YAFA 1L7MA 3HQ4O 3HH8A 2V6IA 2ZRPA 5HDQA 4II3A 3KQSA 2GBCA 1M5TA 1SUIA 1KI7A 4G1FA 4O2BB 8ATCA 1E61A 1T5IA 2P30A 2VO1A 3K0FB 4PFJA 2FUKA 2W93A 3BTOA 1RTKA 1N9KA 2NOAA 5LA6F 3H87A 1QPZA 1HE5A 1J90A 3LU1A 3VGPA 3HY6A 4Y2VA 4ZV9A 1M72A 1UADA 3GG9A 3CUUA 3O73A 1Y7HA 2ACKA 3QU2A 3W8NA 4CZ2A 4DPLA 1W96A 5K8LA 1P1IA 1XTKA 2ORIA 2R2GA 4Z54A 3DO5A 4MJLA 4ZOBA 2DZDA 2F3RA 1I5RA 3K70B 1G5HA 1YS4A 2C59A 5AYVA 3MTIA 2Q1TA 3PYMA 3EPPA 2QSJA 1XOIA 2RI1A 4YUZA 1TLLA 4KNVA 4XFJA 4URWR 3ZE9A 5HUQA 2BTQB 3PZBA 1NI5A 3WADA 1DARA 1HLGA 5HE9A 3ND6A 3SR4A 2R2AA 1X7GA 5AWFC 3VPFA 4J6FA 1JDVA 4W99A 1SMKA 3WLJA 3M49A 4GICA 2YWHA 3LC7O 1R4NA 4IDAA 1XALA 4FNOA 4UUMA 3RS7A 2GKGA 4II2A 2K2QB 3FDZA 4AS1A 3DVSX 3EUFA 5CBPA 2WU1A 1HDOA 2J9ZB 3CWZA 4N0PA 5F2OA 1XJ0A 3AIIA 4U6SA 2OLJA 3DM5A 1I9CA 3QTTA 4KJZA 1NBMD 3SR3A 5K3CA 4N5IX 4LXUA 1JLMA 3ZDXB 3CO5A 3M83A 4BKQA 3VFDA 4P4GA 4QQRA 4R6XA 4BNLA 3RRNA 4LTDA 4ACAA 1ZGCA 2QV7A 3DAPA 3AVUA 4XDHA 2PYIA 4AMGA 2IHYA 3LRPA 4O4JF 2IELA 3UJAA 1KVSA 3MXOA 3SM3A 3A32A 1W94A 1AQ6A 2O8CA 1NLFA 4Z4CA 2EYUA 1AGPA 4RCVA 3SFZA 2JAHA 2R6HA 3R3JA 1RQGA 4TV8F 2PXCA 3H5OA 1NJSA 1T8TA 1KBZA 4YWJA 3FCOA 3ROEA 2C2GA 4IGAA 3TZ6A 4YXFA 2QJWA 1T0UA 3MK31 3O82A 4YJDA 2CEKA 4PAWA 5UKDA 3U3JA 3UCFA 4I3GA 3OEHD 2YXNA 3EXFB 4TMYA 3WDKA 1RPNA 4GWGA 1E0DA 4C20A 3V8EA 5HHTA 3UWDA 3BTSA 3EDOA 5TLSA 1ESNA 1Q19A 4WW0A 5LUBA 4D4JA 2BBSA 3JPWA 1O9GA 1KNXA 1W2WB 2ZIFA 1DVRA 1JQKA 5AOCA 3UJHA 3X1YA 2CXOA 5BRJA 5JAMA 5EEGA 5CM8B 2MU1A 3RQIA 1C0LA 1AKUA 2ZK7A 3I42A 1F51E 1O6BA 2HC9A 1NA5A 2QENA 1EPUA 3MM4A 2REQA 3WK6A 2PAAA 2NYRA 3PEVA 3CVUA 1JMYA 4PTYA 1W88A 3RASA 2O2EA 4ZZ1A 1ZM9A 4KTTE 4CF7A 4E31A 2FP4A 1IHPA 5CTJA 1N36B 3GLGE 4NCAA 3SHWA 2J3QA 1F0YA 4HDCA 4BV9A 1MDBA 1Y8RA 3UXMA 2JCSA 5L51A 1O0CA 3DWEX 3IV9A 2ZRIA 1SUFA 1I2CA 3H5WA 5DN6A 1I3OA 4YAGA 1R0KA 3K16A 1Q1QA 2H4XA 1RWOA 4R2XA 4A2QA 1PTKA 1PLKA 2IXBA 2Y1KA 2RC5A 3RC9A 3KO8A 3GO4A 2O2GA 3QWHA 1T9ZA 2D13A 3WWEA 2BFPA 5CHEA 3PQ2A 4NYIR 5C3MA 5KMGB 4BCCA 5C1OA 4NJEB 3STHA 4KLZA 1JLHA 4LCEA 3AHIA 7MHTA 4PCUA 3IT2A 1TCBA 2OLEA 2X0NA 3TNJA 4EHKA 1DOZA 3ZOZA 5FUBA 4JIGA 1E2QA 3R3SA 3ELDA 5LXTB 4K2AA 3E8SA 4W8GA 3F5DA 2YMMA 2Y0DA 5ESXA 1M9NA 3BK1A 1SCJA 4FFNA 2VRWA 1VE6A 1L4NA 2Q2QA 5EIEA 1B6SA 4JYCA 1JB1A 2XDQB 2AE1A 2P41A 3AVOA 1GAEO 5F3DA 3D4OA 3T7JA 1WABA 1O77A 4J4TA 4WOKA 3OIWA 1JS1X 5FLEX 1D03A 1SK8A 3NDJA 4U2FA 5IMBA 4FFLA 2UZ1B 1PFQA 4YB8A 2RGDA 3HKCB 2BW0A 2ZUTA 1YZGA 4IS2A 4QXRA 3RWOA 3VAZA 3WNCA 3ZCQA 4BJHB 2WSSA 2IGTA 3VPCA 2DM6A 5TT1A 3ZVMA 1NYQA 1MW9X 4KYIB 4EB6A 1GDHA 1NY6A 3COSA 3DEFA 4JYMA 4QU0A 1H22A 4E2FA 2NVWA 4I1SA 3W6UA 1JR3D 4GPIB 1P5FA 3QWBA 4OEHA 4YJKA 5JSHA 1TC2A 4EA9A 3I5AA 2ZR9A 2UV8A 2P6OA 4TVOA 4AP9A 3ZE7A 5HMMA 1QANA 1G3UA 1SUCA 2UYOA 3B51X 1TM7E 4RA6A 4DNXA 1U2GA 3IDFA 4Z4GA 2IYUA 1ETHA 2BLLA 2EJUA 1Q0SA 1OBFO 2Q46A 2XUKA 2I87A 4GF5A 4KVZA 4M1WA 2FZ4A 2B7LA 4EG8A 4MYHA 4YLEA 3IEMA 4XB2A 4FCVA 3ZE0B 5BY2A 3GDFA 4GX1A 4JFAA 1QCZA 4M99A 2EZTA 4WOJA 4EY7A 4AJOA 1OMOA 1WUTA 3KL2A 1VJ1A 2VS1A 1T2AA 3CJQA 3D43A 1MBZA 2B7CA 1N6RA 3D4BA 1RQLA 2GWRA 2Z3ZA 3H97A 3NHUA 3GX1A 5CBKA 1YNSA 1ZJJA 3QU9A 1V45E 721PA 4JXXA 1QU3A 1LK7A 4CMGA 1A2OA 5JRJA 3VQTA 3T5CA 4EKGA 2VH1A 3FPAA 1UF9A 4ZRDA 1S4MA 1PFUA 4Q39A 3D02A 2H16A 1EB9A 5AJZA 4U1RA 4GOKA 3AR9A 2I7VA 5I9SA 5TJ9A 5TS2A 3W78A 4DTCA 3N74A 4X6XA 3ZI4A 3N07A 1V5GA 5JXHA 4Y2YA 4ABYA 2BMJA 1K9VF 5HF9A 3K1ZA 1C0PA 1T5HX 2RONA 3EMDA 4RTOA 5HGJA 1WNTA 1N77A 5BR8B 3GLVA 3TECE 4CKCA 1C4XA 2Q3LA 3W8FA 4X1IA 1MC1A 3VU0A 3H4IA 2Z6AA 1NW3A 5M2QA 2PFSA 2QR3A 4CG1A 2VJNA 4QLBA 1ZN9A 5IBPA 2WSSD 2EF0A 3M82A 2F43B 3I3SR 2HA7A 5LUAA 4B80A 1VRCA 1F20A 2UVQA 4MV3A 4NCNA 4RVNA 3MD9A 4M7PA 1BGVA 4Q3LA 2R4UA 4B3DA 1A4RA 3RIEA 3CQ9A 1CUYA 1ODFA 3GRRA 3QBEA 4N5MA 3HCAA 2DPLA 1UK6A 4QFDA 4R05A 3DOEA 5KJ6A 3RAJA 5IDQA 4QE3A 1A82A 4EDFA 5HDBB 2IL1A 1YZ3A 4PRZA 5HFNA 4LQCA 1MZVA 1WCWA 4ECEA 2LIVA 1JDTA 1GG9A 5F23A 3IRUA 1CC1S 2MT9A 2PX6A 3KQMA 3RVRA 1OLXB 4DQ0A 2WWTA 1UC5B 5LZ4A 2OG2A 2YVLA 1TVEA 2V3VA 3W2IA 5U4QA 1TJPB 2HV9A 3K2EA 3RCBA 4IJKA 1QGOA 1YRQA 4NJEA 3QGMA 3TRDA 2W6NA 4MOWA 1FU8A 1L4LA 1NP7A 5E6UB 4A3SA 4MGIR 1ZDMA 3E5HA 2GLUA 3TLCA 2OBYA 4NK5A 4YT2A 3Q3HA 3RF7A 4EYOA 2W6ID 1SCIA 2C3MA 1CS0B 2CHEA 4DCGA 3U7QA 3AEXA 4Z1OA 2HYDA 1LWOA 1X13A 2KI5A 2X15A 2VH2A 2J41A 3RFUA 1BWRA 2FVYA 3ETGA 3GJRA 4IW3B 4BTEA 3ETHA 5EUCA 1J0DA 1FU7A 2IEGA 2R4TA 2Y76A 1DINA 4GZ3A 4LRUA 2Z43A 2AJBA 2GPBA 4Y18A 1OLUB 4AQYB 3ZJVA 1I2AA 3CLHA 5BN3A 5JAIA 1I1NA 3MWKA 1N2XA 1R15A 3K9GA 3VNRA 2I76A 3RSGA 3B3JA 4IDEA 5T3UA 3TQFA 3OPMA 4OOFA 1RVDA 3MINA 1ND6A 4UQLA 1VB5A 4MRNA 5F35A 5FOTA 5K3EA 4AKIA 4NHOA 2FCRA 1BAPA 2NX2A 1XTIA 2Q5FA 1PF7E 2RH8A 5JCXA 5BW6B 2BGWA 3NWEA 5T67A 2ZJFA 2OPHA 2JVJA 2JFWA 2Q1UA 3K9CA 2UU9B 3N8DA 5DHAA 2YBEA 4M3NA 1Q0ZA 2ZJ5A 4EFKA 5DM1A 4R2HA 2V7QA 1RU3A 1JQLB 4I1VA 1RHMA 3IEUA 5CXQA 5AI4A 4ZU6X 5CCXA 1TK9A 4BFWA 1D8TA 4LOKA 1GHTA 4PC2A 1RI2A 3GGGA 3EN0A 4MVJH 5FAKA 4X93A 2RBKA 1UKZA 1J0XO 3RYIA 3TH5A 3LWNA 4C01A 2WTEA 1TT5A 4CEIA 2W83A 4NDZA 4KRYA 4MV8A 2BGGA 4CR8A 1V41E 2AJCA 1L7EA 1ZJ6A 4H1TA 2QVYX 3ZXUB 2OUIA 3WO0A 2IPNA 1UJCA 1TRHA 4PZ0A 3AHFA 5JCPA 4D74A 3C5VA 3E9YA 4G09A 3CPHA 3MQ4A 4H7PA 2FMIA 2PO7A 3KAJA 4H59A 3G0OA 4NAUA 3HB7A 5HS6A 4XAQA 1FJ2A 1EVQA 4S2UA 1SB9A 1OLSB 3PP8A 4QOFA 3VMMA 4AYXA 3C7KA 5LWHA 1O95C 1VXOA 1Z9BA 5DX0A 2IHJA 1Y1SA 3N5CA 4LWOA 1OBCA 2QSZA 3PLNA 4ME6A 2O3TA 1I94B 1U04A 1CB0A 4FYPA 1EX6A 2HWUA 1R6TA 2ZYSA 3IUPA 2GLTA 3K6RA 3GDOA 6GPBA 2O8DB 1NLMA 1A76A 3RGWS 2Y0EA 3UA3A 3OZFA 4DLBA 5GZ3A 2HCJB 2O3SA 2GHRA 2NP6A 3PNQA 1YL7A 1E5LA 1XLWA 1IHXA 3O38A 3MLBA 3V2GA 4HVTA 4TTAA 5BNFA 1Y4DE 3NWOA 3VKGA 5J1TB 2O2SA 1NXXA 3B2NA 2X2OA 1NN3A 3L7YA 2R1ZA 2XVZA 2P9ZA 4B7UA 4HQFA 3HHEA 1VLMA 2XUPA 5I5EA 2CEAA 1R4ZA 2OCXA 3JQFA 5KUTA 5K8TA 3U4HA 3LBHA 4LWQA 5I47A 3NX4A 4HBZA 4MI3A 3S6JA 1GL9B 4REMA 3D0QA 2VAVA 2Z3WA 5ALSA 2J1LA 4J4BA 4JWTA 1CQIA 1RJWA 1CQJB 3RC7A 1GAWA 1RAAA 5KVCA 1X38A 4NX2A 4DS3A 3EF1A 1FXUA 2HWWA 3W8DA 4BNUA 2JI6A 4NULA 5MFPA 1SXJD 1S8FA 3O1LA 3GVPA 4NZNA 4I1RA 1Q14A 1V9LA 2IGBA 3W5DA 4FZ3A 4XYLA 3D7LA 4LJ6A 5JNVA 3C43A 4R2MA 3UJDA 3EXG1 3MQFA 2NQ2C 1EJ0A 1KJQA 3MWDA 4HY3A 4NS4A 4KEAA 1DQZA 2BONA 4ND5A 1HMPA 2D5IA 3W1VA 3MJHA 3MJTA 3WTCA 3K0KA 1U0BB 1XVVA 1MIOA 2NVUA 3REGA 1YS2X 3IIKA 4O2AA 3WWDA 1ZU4A 3RTGA 2WIBA 3RVKA 3PVCA 1X7XB 1WDTA 1Y5LA 3TCKA 3VJMA 5D3MB 3GARA 5KNDA 3DOHA 2FLWA 4JR0A 2QUJA 4AJIA 2Y3IA 3A9WA 3BPSA 4AWBA 3FVVA 1QRAA 3KFXA 3WGQA 1NY5A 3QX9A 4HUQB 1JQBA 4J7AA 2VF8A 2QRJA 4MIEA 2RJNA 5BW5A 4IFTA 1NUHA 1ZIOA 2NT3A 3F3SA 1CJUC 4BJ5A 2D2XA 3KT3A 1LFAA 1SUBA 1GDTA 4OAQA 3PX7A 1Y8AA 1XL1A 2I8AA 4E51A 1FNSA 4LJSA 1NXPA 4M7RA 4QVKA 5K6AC 1O6GA 4DYHA 4PICA 8AT1A 4Z9YA 2JLRA 5GOTA 3IVXA 1Y6FA 5K7SA 5ADWA 4LGVA 1RQ7A 1JWAB 1XQXA 4EM6A 5BWLA 2XCLA 5J1SB 4W1PA 3MA0A 2ROQA 4LGMA 4Q9LA 2HFJA 4ZO7A 2ZFUA 5EWLB 5ESRA 5K8JB 1Y81A 2IEBA 1R50A 1YQDA 4DJFC 5JSKA 2GM5A 3HI4A 2W2OA 4M0PA 1H2YA 1H2RS 3GJ8A 3WK4A 4AF7A 3A4YA 3I39X 2Z57A 2RGCA 4UCXA 3OLYA 5J47A 3U40A 2Y1EA 4XEHA 5CDUA 1AQIA 4KXLA 5DYWA 2XBMA 3T61A 2YXBA 1QVWA 4GE0A 2ZWVA 1ZI9A 2OWEA 4KPUA 4YAUA 4YCAA 1K86A 5DVZA 2PZAA 4QUAA 3JQGA 3KC2A 3PHLA 3N5KA 1HSOA 4DLAA 3V6LA 3WLQA 1PS9A 4P3YA 4L3WA 2JLBA 3PIDA 5CJJA 3UMVA 4LYYA 2BIFA 1E3IA 4E70A 2O1XA 2OLKA 2YQ5A 4HQKA 3S70A 2ES4A 4M8NE 3ZDYB 2CUZA 3AKEA 1DXOA 1H2ZA 3DYVA 2EX1A 2Y9PB 1UPXA 1W0KA 1I3MA 4AU1A 2FMUA 2JK1A 2R8PA 2B4AA 4QASA 1E77A 4FZVA 4YNBA 3ZV7A 3KKEA 1KMHA 3GLHA 1KQNA 5JHHB 2O6HA 4ER5A 3BMOA 2JJ8A 2PGXA 3GT4A 2XZPA 4FYYA 4K9RA 2CVQA 4L4UA 4KQWA 4KPGA 1XD9A 2ZVJA 3R5KA 4MVXA 1EXVA 1NXWA 4PYNA 5H7XA 1QG6A 2ZYIA 3MHTA 1QGED 1VCNA 2ZXFA 3QLVC 3QUBA 3QVWA 5LL6P 2DPMA 4IHKA 3I9KA 4X85A 5E6RA 4QM7A 1R0CA 1SHUX 1UBSB 4HDOB 1L1QA 3BOSA 3EY9A 4M6WA 2XF8A 3GK3A 1E5VA 3A06A 3PC2A 4HRVA 2YR0A 2Y1XA 4EHHA 1TQ2A 5AKZA 3QFTA 1CCWA 1EJBA 1AG9A 4G37A 2Q5JA 3I12A 3RJTA 3C6BA 4M87A 3AW8A 1T8SA 4KLNA 4ZAGA 4F04A 2HCBA 2WLTA 1QAOA 3BXEA 3OJOA 5JCJA 4EUHA 1K5GA 4M9QA 4GBGA 4RDIA 1DXYA 2H7VA 1XZDA 1ZI8A 3NHFA 4IX1A 3CUVA 3GAZA 3UG7A 1ZJ4A 2BELA 4LXIA 4IIDA 1U9YA 1UZAA 4DA8A 3C3AA 1SIWA 5DPMA 5EIOA 4DJAA 3Q10A 4EJFA 2L82A 4FXOA 1P5RA 4P3PA 4ZJZA 2AQKA 4D0GA 2WFAA 3ZWDA 2WVGA 1K63A 1P9OA 1LEHA 1QHGA 2VDKB 3A6GA 3SMVA 1EUDB 3BIXA 1U0EA 2X9LA 1X7DA 3AP1A 4V0RA 5B2ZA 5T6BA 5JZMA 3RJ5A 3KSZO 3UANA 2Z6VA 5DHSA 1R18A 1X1TA 3L8ZA 3WLFA 2AFVA 3BAFA 1I10A 4A27A 4XIIA 1ONNA 2A9OA 4YECA 5H4GA 4MKXA 3QLVA 4BB6A 2X42A 1D2MA 1JDZA 4GUDA 1OHHA 1ZUNA 2GS9A 5JH7F 4I4LA 4XI9A 1CQPA 1M83A 5H3HA 4BX2A 2GXAA 1NSTA 3PJRA 5KHLB 4N6NA 1XEXA 4LRWA 4FCTA 3DMPA 3EVCA 1Z29A 4OFZA 4DUGA 2CXSA 2BRUA 1ISMA 3QLEA 4GXTA 5ALJA 3UAOA 2HHCA 4ZCIA 1J4AA 2RHMA 1DAGA 2HJSA 5C3UA 4ZI7A 2NO4A 4S1OA 4X3CA 1W59A 1GUZA 4QFMA 1EBFA 4LRSB 1OE0A 1XJ5A 2YJZA 4PLTA 2XD4A 4FKMA 5GM1A 5AOBA 1JGTA 1M3SA 4QAQA 1IPFA 4P98A 3P2IA 4FQ5A 1WLYA 3EFHA 3Q3JB 5AJXA 5FPKA 4ASUA 3WNVA 3QOXA 1ST3A 1KAEA 5HRAA 3DSRA 3U9LA 2AEEA 4Q05A 3E58A 5C4MA 1MF7A 3LY5A 3DJYA 2VPZA 3GDWA 3ND8A 3PZRA 1JE0A 1TLTA 3R5SA 2VTBB 2AFIA 4G3XA 3UUFA 2AF3C 5F1KA 1GN9A 3MEQA 3GPCA 2CFTA 3DYBA 1POWA 3Q15C 4G07A 4F85A 3OQIA 3QVSA 3R2JA 7REQB 2D1YA 4L95C 2O8BB 1V3QE 2IY9A 1T36B 5KYGA 1EM8A 4MMYB 2FE1A 1Q2XA 1DE0A 4CKEB 5JS8A 2KX7A 4KSBA 3OWXA 4RY2A 3F5SA 621PA 4G0MA 3NALA 2FJPA 4OMDA 5F78A 5D3QA 3RK1A 1OFHA 3DW3X 1ULUA 4JU9A 5E1DA 2DR2A 4OX9Y 3LX5A 2HU5A 1NFQA 4HLUC 2G9UA 1BOOA 1M2HA 1ORVA 2G0NA 4IDGA 2OESA 3TD2A 4UFPA 5EXPA 5BYAA 1CUJA 1Z0KA 3BWBA 1IHUA 3Q0TA 4MW4A 1VHTA 2ZZMA 2GCOA 2AN5A 2PZJA 4NIMA 2RGXA 3CLVA 3FIJA 3QBDA 1E64A 4FW8A 4JVOA 4Y0AA 2JFNA 3S5UA 5M7EA 2C7QA 3GCWA 4G5YA 1NVAA 3CU5A 2Q3CA 2ZBVA 1D1SA 3ETEA 4KBFA 4N03A 4UUOA 2AR0A 5CH8A 1FLAA 3LXXA 4EBFA 3PNVA 3LBNA 5IULC 3OG9A 5K3FB 2ERYA 1KS9A 4I81A 1E3JA 2WHQA 2X58A 5D3MA 5C8XA 1AY0A 3UKOA 3HJTA 2V6FA 3GNSA 1ZLYA 1I5OA 2I1VB 2QPOA 4QXOA 1E1CB 2E85A 2EWMA 3KVRA 2NVUB 1LLDA 2FPWA 3GDHA 3DP9A 1KL7A 4A03A 1O3YA 2VJMB 1J5PA 1XAHA 3B1FA 5E2IA 4C06A 4E7OA 2QLMA 4QTXA 3WAJA 3B1KA 3E9MA 1C7IA 2O57A 4D6YA 4DWJA 2XNCA 5HKAA 4Y6LA 3GN1A 6Q21A 2X1VA 3UV7A 1II0A 1WV1A 4QEDA 5DWQA 4H4CA 2EL9A 4EKNB 4AULA 3R3WA 3ZTWA 2BR5A 4AXBA 1J2TA 2CL7X 3A31A 4WN9B 2YYYA 5CT8A 3NEJA 2QX9A 4NYJR 2BUAA 2WIFA 3DDSA 1GZHB 5ICGA 2MSCB 3QMMA 4LRQA 4WKPA 5FWNA 1AQUA 3WIVA 5DGCA 3CEMA 5EC8A 3GRZA 1ZINA 1CQXA 4GP7A 2PHZA 3JQFC 5ARDA 5J5CA 2ZIZA 3S2IA 2GYUA 2WMDA 3WNQA 3BFKA 3JTEA 2FSFA 2AOWA 3D7KA 3IR6A 1KJIA 1QQAA 3NHRA 1S3GA 5CVVA 1YIDA 4OYHA 2P1RA 3FSGA 4N76A 5K0LA 2NT4A 4B8WA 1XXHB 3EHDA 2P2LA 3NQ41 4PHFA 4TYWA 3SQDA 2QUBA 3IVAA 1POXA 2QRUA 1QB7A 3DOJA 4JOSA 3O92A 4L7VA 3GUVA 2N75A 4MR7B 3CX7A 4XUCA 5EPUA 3K4QA 3C4JA 4TV8B 4UHJA 3ZXIA 5IAJA 1JKJB 3IE1A 4HH3C 2H1OA 2BFBB 4CM8B 1HFWA 1CU1A 5T3YA 2OZLA 4AROA 3NTUA 9MHTA 5TVGA 1CF2O 4MPTA 4MX8A 5C46F 2WJGA 1SHJA 1VHQA 2Z95A 5DXAA 2BF4A 3B1XA 3OC6A 1NT4A 1QGAA 3QW4B 5B1DA 3PDHA 3I04A 2FV8A 3QE0A 5DP1A 1DJMA 1AGXA 6NULA 4HLQB 3K70C 3BHNA 3IP5A 1UZNA 2G9RA 2IPAB 3AUKA 4X6LA 2I4OA 1TU4A 4PRKA 2FZ5A 1MVOA 5ALIA 1YZVA 5C4GB 1A8HA 3EA5A 3I53A 1RPTA 4FGZA 2CMFA 4N48A 5AJVB 5DO9A 3RNOA 1G8HA 2F67A 2XB2A 1X87A 1ECCA 1R2QA 3CRRA 1V5WA 3QKRB 3QA3E 1YDMA 1NV8A 3PRJA 4FFBA 1A9XB 3HR7A 1XEAA 3DNPA 3VH1A 4IFIA 1GQSA 1NP6A 2GBIA 3IOCA 2CUNA 4NJMA 2Z9CA 4QGFA 3CCFA 1TU3A 3CMCO 3RS2A 1MO6A 3WIDA 1YS7A 3IBTA 1Z8NA 1EXNA 4Q3DA 3HNRA 1Z22A 1PNTA 3LTEA 5B7QA 2JJ1D 3NT4A 2QD4A 2EQBA 3K31A 1UPAA 2OV2A 1OZFA 1XRMA 2FPPA 3GGOA 1V2HE 1ZITA 3KTDA 4PTLA 1G66A 3WRVA 2VYNA 3C3JA 4DIUA 3I58A 3IPXA 3VZBA 1DCFA 4GX0A 1XIVA 4I50A 4MWBA 5EXEA 1O6FA 2BEVB 4BNZA 2ASVA 4FVTA 5BNWA 3NH6A 3HVJA 4NENB 3IKMB 4YFVA 1GLVA 1HORA 3GV0A 1J1ZA 4YREA 3W6NA 4M86A 3SQWA 1N5JA 4QDKA 3LPLA 4JUDX 5CCDA 3K1AB 1DWPA 3JASA 5H8WA 4M9XA 4BQRA 4QWMA 3F98A 1U3VA 1GYPA 4M0LA 5MF6A 3NBAA 4F5WA 3ILXA 4U2KA 1RXIA 2M98A 1I01A 3AV0B 2CHGA 3ISJA 3JXEA 4LY0A 3RV4A 3JD2A 1LFDB 4OQXA 2HCFA 1KU0A 3QW2A 1KS2A 4RVGA 1NUPA 2YN2A 3BICA 4BDSA 3IEKA 5HIAA 2I91A 3H5VA 2P0EA 4NICA 2PD4A 2WYVA 2EZ4A 5LQKA 2D7JA 4ZRNA 1WMAA 2J32A 4S05A 4HDMB 1HOXA 4KR3A 1JTEA 2CKMA 3AF1A 3W1EA 1X92A 3D3JA 1KDPA 4P3KA 4CQLA 1WL8A 4KBGA 3JWEA 4OFBA 4QJ3A 3J81k 2RSLA 3PKJA 4UNPA 3L84A 4XSHA 1Z08A 2J9GA 5A4KA 1HGXA 2QY6A 2JBAA 1UXHA 4RQUA 4UHCA 4NI5A 3RJ9A 2PKRA 5EMHA 3SX2A 1EK1A 1JJFA 4B3GA 2X6TA 3V1NA 2V9ZA 3ESRA 2GR9A 5JISA 2BBTA 5BWNA 5CFRA 5C1IA 4XKJA 1XZMA 3DTVA 1OROA 3V2HA 2QYSA 4OKSA 1KAOA 2OEPA 3OZBA 4PX3A 4KK3A 5K3AA 5KYNA 2GBLA 4I3FA 5KYUB 2RAUA 2CJWB 4DVGA 4F9TA 2GK4A 4WBNA 1QVVA 1QP0A 4WCDA 4XGIA 2M32A 3ZQJA 4ZV7A 3VSBA 5K2MA 3CUYA 3L01A 1LW6E 3L4JA 2NMVA 1D6JA 1E4OA 2ZI3A 2D1RA 1AUXA 3HSYA 1PUJA 4PPYA 3VUFA 3LSTA 3PUHA 1B0AA 3ECCA 2P68A 1BCSB 1VGVA 2WT8A 2QL5A 3LSYA 1IN8A 5EWMA 2G1PA 5H16A 4KI7A 3AVVA 3O31A 2Q9BA 3CE6A 1H1LB 5KCZA 4Z8YA 4BP3A 4ZK2A 4PFKA 4LHYA 3QUTA 2NO0A 4MKIA 5DBOA 3VV3A 4ZYYA 1V5FA 1CF4A 4L3OA 2ACWA 2RHJA 2VJBA 4PGHA 1UDRA 4RK5A 5CT6A 4NVRA 2DERA 4FMCB 2ZE6A 4EI2A 4NABA 4FGKA 1PFVA 2IYNA 3W2FA 4DMKA 1V2GA 2XYGA 5EXDA 3R24A 1CUAA 1FLVA 2B2CA 4MH0R 4DBLE 4ZYLA 2HCRA 1W9HA 4JMLA 2DPXA 3HB5X 5KVAA 2F4NA 1P74A 3AFIA 3G5UA 3OTHA 4LJ8A 5AD1A 1C4KA 3GFBA 4HB2A 4RM2A 3S8EA 5H3LA 1YVUA 2J3EA 2Y0BA 3EEYA 3ZPXA 4B32A 5A1JA 3I6QA 3F49S 5JS1A 5JY1A 1BX1A 3EDCA 1XDBA 1E9VA 2HSDA 4EW2A 4D80A 2HK9A 4MS1A 3ZOKA 2IWHA 2M2IA 1SR8A 5JDIC 4EHAA 2V54A 5ILQA 1QG0A 1E98A 3WG9A 1NG9A 5DJ5A 1DC8A 4I55F 2VSFA 2TMDA 4TM8A 3W04A 4DOMA 3AFHA 4PG5A 2C54A 3ZX4A 1VPLA 5A5DA 1GQRA 1VLJA 2J46A 1I32A 2WHYA 2I2AA 3A05A 3KOZA 4TXLA 4WASA 2Q3JA 2E5LB 4MQFA 1X1SA 4PF1A 4D81A 1IPEA 1QHFA 1WCV1 2O2HA 2UVPA 4LN1A 3VR5A 1WU7A 3K35A 3T41A 3P9KA 4WFJA 1YFKA 2QS9A 4D1YA 1I7SB 1LSJA 1NI4A 4O4LB 3P9QA 1YOVB 1N0UA 1RWMA 2XOXA 3PEWA 2EKZA 2ZROA 4NMXB 4RGVA 4TT8A 4FGJA 2XE8A 4FDUA 4R16A 1NVUQ 5B3JA 4OQLA 2F43A 3ABRB 1LY1A 3LLSA 3WYDA 4S24A 2VZLA 5AM4A 1XYYA 2WD7A 4ZI2A 2VDNB 1ZQ9A 4HZGA 1FS5A 3KU4A 5JS7A 2JLAA 2Q1WA 2YCBA 2HUPA 4M88A 2QTTA 3DE6X 4O25A 2GF0A 3GUHA 3R6DA 1KDYA 4RKRA 2FEAA 1OKKD 2WVAA 3G5MA 3JWIA 1QUEA 1SRRA 4Y30A 4Q3KA 4YAKA 1DPGA 5AW0A 4IJUA 1AUPA 1E79A 4K9DA 5DRYA 5J2TB 3KFVA 3PQFA 4J29A 4PG6A 3R5XA 4XWGA 2WUFA 1HH4A 5CNKA 1O94D 4UVHA 4D3FA 5F5XA 5C7LO 3C5HA 1QQTA 2PLAA 2DCUA 1LPBB 1YS9A 1UDWA 4NCKA 4AF8A 3MOIA 5FA5A 1X0VA 3N6VA 1FDVA 4A5OA 1E9SA 3B52X 1NVGA 4WSOA 5IWAB 5T4BA 4XUDA 1NUSA 3NEPX 1N0WA 4UARA 4C4RA 5ITZB 1BDMA 1SVNA 2BFFA 2FPMA 4UTPA 3EXFA 5SYAA 1W4LA 5FI3A 4XTRA 2Q9CA 4NZOA 4R7GA 4BWVA 2BH9A 2IZ7A 2JLVA 1SEPA 3TUIC 2ZUWA 3CF0A 2QDXA 2KBEA 5CFMA 3WGMA 5LQJA 1XVTA 3ND7A 4D4MA 2DEUA 4M1ZA 4MQ4A 4KHPB 5CTAA 4B3JA 1NZJA 1CLEA 2ZOSA 2PL3A 2XRMA 4HWGA 1EFRD 2OMEA 2Z04A 5DFAA 1O97C 4D0SA 3AM1A 1MX1A 2PMCA 3M3PA 3E3LA 5SYMA 4MVYA 1F7UA 2JIPA 2DQ4A 2HFKA 3OCYA 3N2GA 1HE2A 3ZV5A 4AUKA 5C18A 2R6GA 4ZRMA 1JBEA 1SU7A 1EDOA 2HPVA 4EVQA 2Y4NA 3FDZB 5T57A 4DDUA 1TTTA 3ICVA 3AR7A 3ZUPA 3TN7A 2DWQA 3L40A 4K6OA 4O2AB 1XZKA 1YB7A 4ZQFA 3A4VA 5JDCA 3AR2A 2V6GA 3AZPA 4QDZA 5KNCA 1H8ED 2OCYC 2G70A 2WTMA 3P2MA 4Q9JA 3W77A 5BR4A 4OTZA 3RYHA 4Z1MA 4TXHA 3TE6A 5IKXA 4WCFB 5LD2C 2PPLA 5EMMA 2VG8A 4XJSA 1PCXA 2EEZA 4BO5A 1ZUIA 3LCVB 4YDRA 1ZD5A 2Q6LA 5E1OA 2H8GA 1UM9A 5IW8A 3SS9X 3UT6A 5BUZA 2H65A 2UZ0A 3P2JA 5DW0A 1VSTA 2G25A 4C4AA 5JANA 1ZMOA 2HDNB 2ATXA 2ONZA 2QHXA 3E6AA 1MR3F 2Q41A 1VZ2A 3I2JA 2XVMA 4GBMA 5BMOA 1LBTA 5C80A 3EXEB 1AKVA 2C8JA 3P9XA 3B12A 1P7WA 4E08A 1VG8A 3PD0A 3ZYCA 4AK9A 1KMQA 2H00A 3UH0A 4D9HA 2ODWA 2HA2A 3ESDA 2CFOA 3TAXA 4OHWA 1QFSA 1M0SA 1QZUA 2WMNB 3H7IA 4OVKA 1RYBA 1U2TA 2JW5A 1QHYA 2QTFA 3MFQA 3VAYA 2BFCB 4MZXA 4DUPA 4LECA 1GNSA 1QLHA 1PJ4A 2WJ6A 2C78A 1M6YA 4DLRA 2ZQZA 4E6PA 3R76A 2RHBA 4DT1B 4GRIA 4YT4A 5LU9A 4Q02A 2F62A 1T15A 1NN1A 4MR8A 1FFWA 5JPIA 1JIJA 2GNAA 2R7AA 5AQEA 5FD8A 5KYUA 1BIFA 2Q3DA 2R97A 2V6MA 3INNA 1G5TA 1MA3A 3K9HA 4JBWA 4RM3A 2CXTA 1TQ4A 4GKJB 3AJ8A 2Q50A 3UICA 4CMBA 2R7LA 2FRDC 4OM8A 1GCIA 2P0YA 3HCCA 3MMNA 3W8EA 3KCQA 4DREA 3RFXA 4K3VA 1COWD 1SXIA 1R12A 3CEJA 2J5KA 3SKVA 3IAEA 2HF2A 5CYPA 1SZJG 4CG3A 4QYSA 2IXFA 1HDRA 3ENQA 1IJFA 1ZA1A 4IG9A 3D4LA 1E18A 5ED4A 5J63A 2R1TA 4QO8A 5HR5A 3IO5A 3K1AA 4P1ZA 3KE8A 5BQOA 4C9BA 1DG1G 2HV8A 1MG5A 1XEWY 2Y6VA 5FNVA 2M1ZA 1W8DA 3JVVA 3LUBA 2JJ1A 3QVOA 1G0OA 1M33A 1RIIA 4AY6A 1B14A 2H2IA 4NNJA 2I3AA 2I4IA 3BMCA 2VBGA 3C5WP 1YTLA 2E21A 1EAYA 1FRNA 1JR3E 3PQ3A 4UTXA 1WXQA 1AHPA 5I7VA 3R8XA 4P7JA 2B78A 1KJZA 4BFUA 4NSNA 4YBRA 3W2GA 2IU6A 2H29A 1GSOA 1C3OB 4YUWA 2OD9A 2I8LA 4TLLB 5EAIA 1WA5A 1YTUA 2EOAA 2PUVA 2R8YA 3FWKA 5J2TF 5L3QA 4HADA 1QV9A 1QVZA 1OWPA 4QSMA 1JDNA 2YVQA 3WA6A 3QVTA 2OXRA 3PENA 1Z7EA 3KFLA 5HJ7A 2V0GA 3V3TA 1JJAA 2C9OA 4FEYA 2RHGB 1HC7A 1S2DA 1CDZA 4RK1A 1UWLA 4FINA 4QU9A 2G36A 5A7GA 4GP6A 3CB4A 5FBZA 2DBRA 2Q8QA 2Q5CA 1CY4A 3IBGA 4FZJA 1JLRA 1UEXC 3H04A 2Q3HA 1G2QA 1DUIA 1T25A 1EFPB 1YJBA 1ZGAA 4NOMA 4C4OA 3L46A 5A4FS 3A3NA 2DG2A 1A69A 2CNKA 2ZTMA 4OYYA 2DUNA 1F0PA 2A5YB 3NVDA 3NTLA 2RCNA 2P35A 2Q1YA 2E4XA 2JH3A 3OIDA 4HDNA 4QAJA 2OA0A 1SKUA 5EJFA 4ECAA 3L0DA 3AQ4A 1RP1A 5IK2A 1OU0A 4RK4A 3O3OB 2V45A 2VUUA 2BGTA 1TYEB 1KNQA 4WGFA 5FUVA 1PZXA 4EL0A 1HYBA 1ZJZA 5DSTA 3HA7A 3FWZA 4BXOA 1OAKA 2NPFA 5FL7A 2A0KA 1N5LA 1JXAA 1Q1AA 3QU4A 4WJKB 5I7AA 3T34A 3C7AA 4ENUA 1GPH1 1X7ZB 2JAUA 1TPYA 3HUUA 3ZNOA 1LVUA 3SIXA 2XWBF 5CLFA 1IEVA 1YMVA 1FX1A 4F3TA 1I1HA 2O0LA 1RXUA 2R5WA 3DFUA 1P6UA 1OTXA 3EEIA 2C2OA 3KDAA 2XTNA 4QGBA 1KQFA 1F2TB 1Z5PA 2H07A 2J85A 3R7WB 3U4QB 4LDAA 1WTCA 4RAOA 1KK3A 2XA1A 3AFMA 2AEFA 1BXGA 2W2XA 5IAEA 4B3SB 1QX3A 4TUYB 3RLFA 3D0RA 4DIDA 3EDMA 4OREX 3AHCA 4J91A 2V5UA 3IQGX 4LC1A 3M7IA 4JVMA 1NBEA 2BFEB 2F7SA 3G02A 3SYKA 1MUUA 1CBUA 3EA4A 3VSEA 3AVTA 5H80A 2ILTA 4Z7OB 3QLUA 1ODIA 3BB4A 5ENZA 5GY7A 3DOFA 2J3IA 2GMWA 3DB1A 3I2FA 2FZLA 3O0DA 4JHXA 4QOJA 1N1MA 3DJFA 5I5GA 4CT4B 3T7DA 4LJRA 3H1BA 2XUHA 1VCIA 1ZN2A 5IJ0B 1KEVA 1BDBA 4LFCB 1H85A 1SIUA 4Y0VA 3HYLA 3OU2A 4LZLA 2IPOA 3CF4G 3EWIA 3D0KA 1PN3A 1VHDA 4LW8A 1II8A 1P18A 4MSUA 1XZIA 2L2QA 2SNIE 1P4SA 1ODTC 4M21A 3ZZNA 1GPDG 1M2KA 1RXSA 1O03A 3D64A 1HEUA 4RD3A 4Q9KA 4OQDA 4Z0HO 5G3ZA 1Q7CA 1G98A 1WEHA 1C9MA 1X7YA 1NMZA 2BVNA 2WTXA 3LM8A 3DDUA 5HOEA 5KTMA 5LP6A 4JQCA 1TD1A 2Q99A 5ALNA 4EHBA 3KSAC 1PQ4A 2Y1WA 2YJNA 2WMOB 3PWKA 4DLVA 4OLBA 1CR0A 1TCUA 1T5SA 2HHLA 3GEMA 2DY0A 3H2GA 1PNRA 4B5LA 1BCSA 1SWVA 3K1TA 3KEOA 4NU6A 5EWMB 1GCOA 1VRWA 3ORFA 5HUJA 3T3NA 1U1DA 3UWKA 4Q18A 3W6OA 3G7UA 3G0BA 5C8YA 1Q57A 3IVGA 4S1NA 4DN6A 5AI5A 1E2EA 4DNOA 4NFSA 4V2IA 2PX4A 3HKBB 4DCJA 1AA6A 5SY4A 3COVA 4O4JB 1Y9AA 3RS4A 3T4PA 4Q37A 1TZKA 3C6KA 4I5DA 5FPYA 4I55B 1RWWA 3BM5A 1ZWKA 2MYNA 3CVJA 2WF5A 4M1SA 1UR5A 4HDKA 2FG6C 2EJBA 1W47A 3G89A 4F4HA 1QDUA 4UQPA 3B8HA 3BXFA 5IM4A 2I33A 1H3EA 4OFWA 5C1BA 3TIIA 3TLBA 1MCZA 1M2WA 1QMGA 3EGVA 3O2JA 1XTTA 1T0IA 4D3ZA 3GFVA 3OCZA 5K3BA 5K6AA 3HL0A 2OYSA 1MQSA 5D87A 5K8VA 3SHVA 1XCLA 1YS6A 5P8WA 4YRFA 3PL5A 5DHPA 3DR3A 3DWIA 1QWOA 2FWRA 1G8PA 1P0CA 5CCBA 3JAMA 2YNMD 4BX9A 1GG2A 4PC6A 4HK4A 4OL9A 2XOEA 2ATEA 4P93A 2QRVB 4YK7A 5ER9A 2HWXA 3CR8A 3VV2A 5EZQA 3ZHXA 4AKHA 1TA9A 2Z6UA 1P5ZB 3EASA 4FMCF 2XNSA 5FBRB 1FFEA 1PQYA 5LPNA 4MPRA 4Y6RA 1WDMA 3I9LA 3EULA 3U3MA 4IXNA 1JA0A 3EDYA 2AZDA 2CNOA 2AUNA 4D9BA 1LS6A 2FUEA 2QMHA 3A1TA 1XT6A 3DVAB 4GD3Q 4KYUA 1QR2A 4G63A 4WH0A 4Y2XA 4PZCA 2EIHA 4ZAXA 1BN6A 1WSDA 1ZOLA 4L5YA 2VHCA 4WESB 5I48A 3LQRA 3CT6A 5AKXA 3V7NA 4J3FA 3M1LA 1BMFD 4FZRA 4F6LA 3ZE8A 3RRBA 1R5NA 2OBBA 3GG2A 1U1IA 3F3YA 1I36A 1XMSA 4AZ0A 2VT7A 1M6NA 3E5NA 4TQGA 3TKLA 3X1DA 4P2GA 5CDHA 1IIBA 1T5LA 2OBFA 2OAP1 2V1UA 2YFKA 4C21A 5JVDF 1V1RA 2C3YA 4HGYA 4CI9A 2DU8A 2JDIA 1P1HA 3FCUB 4RA9B 2FMHA 3T5DA 2C7GA 4F2HA 2FG5A 4OJTA 3ELYA 1EFHA 4B3CA 1HLPA 1I30A 1YWGO 2ZYDA 2N0SA 1JFLA 3VUEA 1KH2A 1SNYA 1VCMA 4M1KA 2QLBA 3VOAA 1FRVA 3KEFA 2PE5A 5EMLA 1V1JA 4UMFA 1J09A 4HRYA 4R0NA 4KNWA 1W6UA 1RRGA 4DIBA 4DANA 1DBVO 3WL8A 3N75A 3EC2A 1KZ4A 2WKWA 2E4ZA 1NF2A 3B6JA 4UZSA 1FMJA 1K92A 4KXQA 5EP3A 1GFWA 3EZLA 3I8SA 3OO1A 1FDRA 2R6AA 4O1HA 3AJDA 5IAAA 1E3TA 3AUXA 1Q0HA 1VCOA 3E7DA 1A9XA 1P1BA 1KIAA 4Q1CA 2XJ4A 4R2WA 1J23A 3JQ7A 4Q0MA 5B1YA 1ZC3A 3D5QA 4B44A 2PVCA 4JX8A 2JGDB 2Z8XA 2A0XA 2OG1A 1KETA 1CZNA 1GPLA 1UOOA 4AY4A 4FBGA 4CL2A 4E14A 3DS8A 1H8HD 3M6FA 1VI2A 3KYBA 1NNI1 2VH5R 5KREA 1N8KA 1PJAA 3L7JA 4FFDA 4QQKA 3HWX1 1T2NA 2J3HA 1WB4A 2PUCA 3KJIA 5JT1A 3E70C 3GPIA 4ZANA 3TWOA 1U4SA 3O8BA 4GQBA 5GZ1A 1ZZEA 4W5JA 1GWNA 2FETA 5ENDA 5B2FA 4Z86A 3W5BA 2YHAA 3DCJA 3EEQA 4ML3A 2IDMA 3MQ2A 4B0PA 4XDYA 4N18A 3ZHVA 4CMIA 1FP1D 1UKCA 2PQ2A 2EVWX 2YRWA 1JIKA 3AWDA 4X1OA 2DQSA 3F3KA 2L19A 2YY7A 2HGSA 2ZUDA 2P9QA 2AR9A 5CB4F 3PJGA 5F9FA 2C9CA 1UMDB 1R27A 3M81A 1P4AA 4MR7A 2P6RA 4QLOA 4ZV4A 1E5DA 2RHTA 4LQDA 4J1NA 3ZD9A 5KOJA 1I4WA 4JVLA 5IDVA 3D8RA 3AW9A 1QGUB 5REQB 3A1FA 2Y05A 1ORRA 3I9MA 5HZKA 1SUSA 4MEJA 1J97A 5I4CA 1COWA 1D2NA 1T6NA 2QP4A 3L9XA 1MJGA 1QJCA 2ZSUA 3EJ6A 1ZL0A 3GHHA 4DY6A 1DRJA 5EYPB 1P0PA 2QVBA 5EJMA 2QG6A 1ND5A 3QMWA 4WIAA 4HAVA 1MQAA 2YL2A 1JJBA 4NZMA 1JQ5A 5ETJA 1Q17A 5CA1F 2R5NA 1Y8ZA 1W4BA 3IAUA 4QUBA 4WK0B 2J6IA 2JIZA 3CG0A 4BWGA 2FFAA 2OXIA 4PVCA 4YGYA 1PZEA 4CM3A 2GJAA 3MUNA 1ZO8A 2FR1A 5ARCA 2AFHE 3OFKA 1ACMA 2H0RA 3EISA 1R8XA 5BW4A 4AWXA 3OE7A 1E1RA 4YT5A 3EAQA 1LLFA 4R1NA 1ZKDA 1OREA 2HK7A 3ZCRA 4DCVA 3FYDA 1NVWQ 5LOVA 2JJ2D 5E9AA 3NT2A 1XQ1A 5KSYA 4IX9A 3UOAB 3HBJA 4REQA 5LP6F 2QX7A 4JWKA 5A4JA 3SEZA 3LGXA 4K26A 3TL2A 3T3HA 2A2ZA 3TSYA 2R68A 1G7SA 3FXAA 1UJBA 2BFCA 3E18A 4JNKA 3WK7A 5B58C 2QRZA 1RHRA 2AS0A 2WYWA 5FA8A 3P9CA 3I52A 3KQTA 2WK1A 3PF9A 3OJWA 4MWZA 3WR5A 4D6XA 4O5OA 1C2YA 3ZUGA 1YCFA 2C7BA 4L5JA 5B2EA 4DGSA 2R47A 3R3XA 1U9CA 2HNKA 3A6PC 3A2LA 4S12A 4Q01A 2SBTA 3GLUA 1JR2A 1YB6A 2C58A 1X8XA 1BC5A 1X39A 4O8ZA 4WESA 4JYBA 5TMBA 4O4IA 2W6JD 3F74A 2JLUA 2IF2A 1PR2A 3AXSA 3C3BA 2ZJZA 4B4DA 1A2BA 1E9EA 3S8YA 3QJYA 3QYAA 2B3DA 1NL3A 5AVKA 3SF8B 1F2DA 4N0QA 1YHZA 1OVMA 1P2SA 3IMEA 4GI7A 2NXEA 4NV0A 3RYHB 3VYVA 5G40A 3ADBA 1ULHA 3JQAD 4FT2A 1FTYA 1RI4A 3R3VA 2A3NA 1GRRA 1UK9A 2ODAA 3I2YX 2G77B 5ALHA 4QUHA 5KX5B 1T36A 2FUNB 3CM0A 5KTKA 4JELA 1BH6A 1EVYA 2HBYA 2PMBA 1ENPA 1FNCA 1IOLA 4J1TA 1TZMA 3L4SO 3KT8A 2PZGA 1KYVA 3HDTA 5BR1A 1S2LA 2EFJA 4IV0A 3SZOA 4ARBA 5BV1A 1QZ3A 2WYUA 3LY7A 3KQYA 4O4JA 1XLTC 4JBYA 5DM70 3HM2A 4CHTA 2HWYA 3ZBTA 2JHAA 2FSPA 2DUMA 2VCHA 2PRYA 4BFZA 2VHWA 3DKPA 1FB5A 2NUAA 4M36A 2R7MA 4QUIA 4JI8B 3EVFA 1J0BA 1QKJA 4ZVNA 2WHPB 3D8SA 1GXSB 1V6SA 1Q22A 3ME5A 3CPJB 1SCAA 3G1UA 1WQ1R 2X2PA 4NMWA 3F3MA 3JQDA 2AHOA 4QG7A 2JJ2A 2QL7A 4HUQA 3ROPA 1NIPA 4DGQA 3HADA 1IM8A 2XBLA 4UTOA 3C39A 3ZWPA 3WL6A 1YOBA 1FDIA 2AG8A 2VSYA 5AJWA 4XGKA 3ZR4B 1SPBS 3KNZA 4DLYA 2HADA 2VDQB 3ADKA 2QTBA 1INLA 3HBFA 4Q03A 2E4YA 4ZOAA 4QPDA 5F5NA 4CKXA 3DUFB 1ZIPA 8ADHA 4O3FA 1D8AA 2XUDA 1TB4A 3K5HA 5KNBA 1SHTX 1DO0A 3T1OA 1T1SA 3UAGA 3L7IA 4BASA 3BX1A 4BFTA 4EI9A 5IJAA 3E9QA 2CLMB 2E7ZA 4ZT4A 3RFFA 3F7NA 1H69A 4PX2A 1LQTA 1HDGO 5BSMA 1RXWA 1GNVA 1HDZA 1D6NA 1TADA 3WB0A 4BU0A 1NAHA 2XAUA 4EG0A 1QNLA 3E03A 1SHZA 2BEWB 1CT9A 1V39A 3P27A 2ZRJA 3WVNA 2X5JO 1W0KD 2CYBA 2GNOA 4G81A 5IN4A 4AQDA 4GBJA 4QXMA 4LCBA 4CV1A 3GRPA 3U16A 2PYDA 2HA0A 3LYLA 5EE1A 3TNYA 1QQBA 4XM2A 3MBIA 4OJMX 4B43A 1TA4A 4K46A 3C1AA 4ARZA 1AKNA 1NVXQ 2VRCA 4RTQA 4DR4B 3OH8A 4LJAA 4ZVVA 1ML4A 1ZVQA 4GVPA 3T3EA 4RVDA 4K9SA 4DR1B 3FWNA 1TTPB 3ANYB 1NW7A 1DC5A 2G1UA 4TQ9A 4BNTA 4DZRA 2F6RA 1UJMA 5TJHA 2FWAA 4KGVA 1DT5A 4E5PA 3MOGA 1ZMTA 4DYDA 5JFGA 4C43A 2XB4A 1T0HB 4CG2A 3JYNA 3QVGB 1QFZA 1EFVA 2PMKA 1Z75A 4E07A 3LIPA 2AOTB 1XZPA 3EODA 1KBQA 3GC6A 3PQ6A 4JENA 3CT4A 4Q66C 4RVOA 3OUZA 1ONSA 2DFTA 5A0VA 1C7RA 1L4KA 5LDDC 3KR1A 1JSRA 4G5SA 4ZHSA 4EUFA 5ALEA 2I1LA 1NLUA 4AZSA 1SQFA 3KTFA 3QFSA 4CIVA 1V3UA 4ALIA 1D2RA 4CQJA 1TI7A 3QPWA 1VSVA 2V5VA 5ALMA 1PI3A 3T99A 2EP5A 1QWSA 4CGYA 3NM5A 4D7AA 2OOKA 1XTVA 2FQWA 2YVAA 3ROFA 1O08A 4HSEA 2IUEA 3BXPA 3OIYA 4XGQA 4D9MA 3E61A 1W581 2ZCUA 4RS3A 4ZQGA 3ZGLA 1UAGA 3F6YA 4Z7NB 3ND9A 4ZGGA 4YDSA 3LCRA 2REQB 2NU6B 1K7XB 4LZAA 3AXTA 3WNZA 3CLSD 2ZUSA 1FTNA 3FTQA 1YJCA 5REQA 2WMYA 3TTYA 3WL5A 2GO7A 4RDXA 2YKGA 1Z6TA 3GEIA 3PV0A 5LA6A 1GPYA 4NOKA 5EPEA 5LWQA 3N2EA 4OLFA 2CLSA 1BX3A 3ISTA 3V1TC 2WAMA 1ENYA 4CFZA 2OHVA 5KX5A 3E9EA 2PX3A 3QMPA 3EGDA 3QG5A 4LOHA 4BOYA 2RK6A 2WIKA 3UPUA 3FY4A 4X45A 4QYIA 5DNCA 2AZTA 4C5CA 4O2LA 4KE7A 1L5HA 5DNVA 4XVUA 3LECA 2VA8A 2IIVA 2SKDA 4OGGA 2OZLB 4E2YA 3UMSA 2AUTA 3W1WA 1M6HA 3G2KA 2PTGA 4YQZA 5GWXA 4DV5B 4YJGB 3ZS8A 2JIDA 3GUCA 4K86A 3LTNC 3ZWMA 4B35A 1KXJA 1RAIA 4B6GA 1Y4SA 1K7EB 3AOEC 4TVBA 1GA1A 2H48A 3AETB 3TNDA 4NYMQ 1CNMA 3NVMB 4QJBA 3PWTA 4UE6A 5KTNA 4GGOA 3U6KA 3Q9LA 1RYYA 4MEAA 4OHPA 4BO9A 1OLOA 3ABZA 2QN6A 4YMUA 3PNOA 4CV3A 2IQIA 4FFWA 4Q7JB 4IJMA 3X1ZA 5K2OA 1ECBA 3ZE2B 4RSHA 3K0AB 3FBGA 4AMBA 4F5EA 4CM7A 1GKIA 3VM6A 3KXPA 3V32A 4OI0A 4I1PA 3QEBZ 3P2EA 5ADVA 1K3TA 2WT4A 2XT9A 2OP1A 1C4OA 3GJ4A 2FFHA 4DLLA 4HNUA 2J5QA 5DIFA 1XCBA 3U49A 1SKQA 4HEJA 4LX0A 4P5EA 3PUXA 4XCQA 5IVIA 1AH2A 1RAFA 1S3IA 4CTNA 1Q21A 4QU8A 1AXRA 1X15A 2ZREA 1N3LA 5C2JB 1TO6A 3FMFA 3LIIA 2HA5A 1VKNA 2XYPA 3FPHA 3L7DA 4PZUA 1DL5A 1EM8B 5DI9A 1DWUA 1E79D 3TSAA 4B0OA 1ZG3A 3CTMA 3PC4A 4DMGA 1U0RA 3VYWA 4F4IA 5AVYA 4BMPB 1QFMA 2QG9A 5KINB 4BUZA 2JAOA 3DEHA 4PYKA 3ZGNA 3DXFA 3SEFA 5DCUA 1UC8A 1X3LA 3ANMA 2A57A 1ZK0A 2GHIA 3AI7A 4X9XA 3T15A 2ISCA 1A04A 1QGDA 3MCZA 1N9ZA 2R79A 2IU4A 2GAFA 5KI6A 1LSUA 2KLHA 3G2PA 4FBMA 3U9SA 5AKEA 3TDKA 2ADFA 4P32A 4LJKA 3U4CA 2FFJA 1H6AA 3CBQA 3UA4A 1A5ZA 1SXJE 1AM4D 1BGXT 2A1TR 3E22B 4ALLA 3KPJA 4TKUB 3WC4A 4RMNA 4UW9A 1SZCA 4WNIA 1CUXA 5EZ5A 1E3WB 1Z35A 1BYUA 2PRKA 4J0KA 4PNHA 1G20E 3HVHA 4DLSA 1CY0A 1RPJA 4V2UA 2VDOB 3LDUA 3QQPA 4XQGA 3O8QA 3UK1A 4AUMA 1U7ZA 4MYSA 1QHIA 4OXQA 5IS2A 3P9YA 1AXEA 2W00A 1T4CB 3ZCTA 1B2LA 1UBUS 1WDLA 2CVPA 2YXPX 3HWRA 3KR2A 1VHWA 2HRDA 3LUPA 5LNK6 2FHSA 1N6OA 1TCVA 2LVBA 4OBBA 1H4VB 1FQWA 2W2MA 4MKFA 5ECGC 1Z4PX 5THXA 5IKOA 3RWBA 2GEDA 2IEAA 4AICA 2PJUA 3I23A 4UD2A 2AQHA 4INJA 4ZGBA 1J06A 1RMQA 2HIHA 4O8CA 3W0LB 4LMRA 2PUJA 2VZEA 4AS2A 1PX0A 2RJ3A 1H1TA 2VZ9A 5IJ9B 3REQA 1FVOA 2H3HA 5JDCC 1KEEB 4Z9AA 4QRIA 4ZVUA 3TSCA 3NHPA 3R3ZA 1T91A 1M1NB 3I9JA 1QIMA 4TL9A 5F2NA 3O75A 4NATA 3GGDA 1JPUA 5ITZA 3VX3A 1E6WA 3RBXA 4IFBA 2W11A 4MR9B 3ZI0A 5P21A 4GG1A 1TMOA 1JEAA 3KZMA 2HU2A 5FYQA 1LDNA 3NT5A 5L53A 1T9GR 3ORSA 4HSGA 4NESA 3QK7A 2XVYA 2FOXA 3IBYA 1Q7RA 4JZKA 4Y9SA 4CCYA 4KXFB 1OYYA 2H31A 4CMIB 1WUJS 3OI7A 3TFQA 4PZ9A 2P3OA 3FGOA 1KJYA 4J03A 4L28A 5IF9A 4IJQA 3DZGA 4KOEC 3RGGA 1W34A 1BW9B 1E8DA 4AJEA 3CUWA 4UZEA 4CKWB 3P4XA 3PSAA 4TRRA 5BOVA 4EAQA 1A7KA 1HDEA 2HPZA 4WE3A 2YZGA 5L7TA 4PLFA 3B38A 4HRXA 1Q6ZA 2PMWB 4ZIRB 3G6KA 1K2WA 5EJ7A 1TECE 4D8WA 3SIWA 3G8DA 4XJVA 3N1UA 1FP4B 3UJPA 1QH8A 3BJEA 2PPVA 3F7OA 1T6BY 5HJ2A 2QUIA 3UC5A 4WKCA 1TK3A 4UU1A 5LZ9A 3IURA 1J9EA 3WK8A 2XMCA 5G0TA 1O87A 4LPSA 3WIBA 1CF9A 5EZYA 6YASA 4H7DA 1V11A 1Z12A 3ZWAA 1IN6A 3HKEB 1WXDA 4A4DA 1YDHA 3WYFA 1J24A 4A6EA 2BFEA 3L6UA 4JL6A 4N6GA 1HPLA 3WJ2A 3CUKA 4HDNB 1MFZA 4J4HA 4PCAA 3UHFA 1W29A 1X8JA 4LDRA 2IYWA 4MPDA 1FFSA 3EMKA 1VTKA 1J56A 1AMUA 2FPLA 1PLLA 2DPYA 4OGWA 3RB8A 1KKLA 1KOLA 1MDFA 1SUDA 4RHEA 1RAHA 4KWEA 3GFFA 4DJEC 2ADMA 2IYOA 3HZHA 1QOZA 2BV3A 4U7DA 2DWUA 2EU8A 2ZU0C 3AM5A 2C5BA 1MEEA 2Z2ZA 3TLXA 3UZUA 1U94A 2WUVA 4EW6A 2O1EA 1HG0A 1PFGA 2PR7A 1GVNB 2Z4RA 3KOMA 3UAVA 4BO7A 3FB4A 4I08A 1MJFA 3DAOA 1R5OA 5GP1A 4BNNA 5D85A 2ZRGA 1G64A 3VAAA 5GINE 4RSGA 2VT2A 1OAOC 1VG1A 1AF4A 3OF5A 4QULA 2ATCA 5I7WA 3SQMA 1U2QA 3N0RA 3E82A 4IILA 1EJ6A 4JJ6A 5AIAA 4L4SA 2OZKA 5EUMA 2ENUA 4OAPA 4W7HA 1M2VA 2D0DA 1Y98A 3W5JA 4XDGA 3ZN2A 3HJCA 1CUEA 2W6CX 3BWDD 1BEZA 4OUDB 3RNLA 3DLTA 2XGOA 3GPDG 1YE5A 2XYHA 4JL8A 3V80A 4M55A 1XKTA 1OJLA 4OYRA 2CLFB 5IP5A 4B7ZA 1X1AA 2WDPA 5ITVA 3AESA 2DBYA 3FUTA 4JJEA 2ACEA 4BX3A 3QX8A 1N6HA 3KQVA 2GJKA 1W0JA 3BH6A 1XZFA 1XELA 1QC5A 2ZR7A 4GC9A 4NDAA 2FN8A 1E8MA 2GNPA 2XIJA 4W5TA 3AU8A 1SD5A 3U6BA 3CINA 5EL0A 3PJEA 3ZBQA 1AZTA 3G0HA 1N6PA 1USGA 1VJ5A 3AI2A 4YPFA 1O97D 3WLHA 3K15A 2AJLI 2UYYA 3OE5A 4ISBA 3VHRA 1G2OA 1MIHA 3GMDA 4TL6A 2PWPA 1W1WA 4V0MA 1E89A 3QLJA 4NHEA 4MP6A 1X7WB 4MW0A 4FQ7A 1QOPB 1GU1A 1ZNZA 4A26A 4F3RA 5CM2Z 1GTRA 1T9BA 3DDOA 4JLJA 5A9SB 1GKLA 1TDJA 2EFCB 1XNHA 5DXFA 3BZWA