3B6MA

Wrba from escherichia coli, second crystal form
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
197
structure length
188
Chain Sequence
AKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Flavoprotein wrbA
publication title Crystal structure of the NADH:quinone oxidoreductase WrbA from Escherichia coli.
pubmed doi rcsb
total genus 67
structure length 188
sequence length 197
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3b6mA00
3N3BC 5BUCA 4N9QA 1FVXA 2R96A 3TEMA 4ICIA 5FX2A 3NHFA 2Z9CA 1I1OA 3OWHA 4N65A 3W7AA 1SQSA 4HEQA 1ZWLA 1QBGA 3OX2A 4DIKA 1X77A 4PTYA 4ZVLA 3W78A 5EMNA 5LMCA 2QX8A 2FVXA 2FZ5A 1CZHA 1BU5A 3NFRA 4F8YA 3OX1A 5LBTA 4LTDA 3QE2A 2OYSA 2BMVA 3GFQA 3FX2A 4CF6A 3JSXA 1J8QA 4Y9UA 1ZX1A 3NHPA 3HLYA 2A5LA 5EA2A 3NHJA 3KEGA 3ESXA 3QFRA 2QR2A 2Q62A 2MT9A 3F6RA 4LTMA 4Y9RA 4NLLA 5LJIA 3R6WA 3F2VA 1CZUA 1FLAA 1T5BA 1XYVA 2FLVA 1DX9A 5LJLA 3GFRA 5NLLA 1FLVA 1YDGA 1RTTA 4PTZA 3W79A 4YQEA 4Y7CA 3OJWA 4YAFA 3NHYA 4LA4A 5NULA 3NHRA 2ARKA 2Z9BA 2BN4A 2Z98A 4CETA 3NHWA 1AKUA 5JROA 1SG0A 3LT5A 2MOKA 4FGKA 3B6JA 3FVWA 3NHLA 1QHEA 1AKWA 2GSWA 1NNI1 3L9XA 2F1OA 3N3AC 2FCRA 2FOXA 5LLDA 1XYYA 3S2YA 5LVAA 1YCGA 2MWMA 1AKTA 3W77A 1AKRA 2B3DA 4ZVKA 3NHKA 5FUQA 5TGZA 3TZBA 1XI2A 3FW1A 4DILA 3G5MA 4QODA 3OJXA 1D04A 1AZLA 2QMZA 1FX1A 1RLIA 3KLBA 5FA6A 1QR2A 1AHNA 2KLBA 1AKQA 3HA2A 2Q9UA 2BZSA 3NHSA 5B3LA 4QOHA 4M0CA 2FAXA 4H6PA 1H66A 3ZHOA 2MTBA 4LAFA 1GG5A 1CZRA 1TLLA 4ZVMA 3ESZA 3B6IA 2V9CA 2M6SA 1DXQA 3NHUA 3GFSA 4HS4A 1WSWA 2OHIA 3UXHA 2V5VA 4C76A 1KBOA 1YRHA 1QRDA 4C0WA 6NULA 3FNIA 4D02A 3KAPA 1T0IA 1CZOA 3NLLA 2X2OA 4YAUA 2QX4A 4QOFA 3EYWA 1FUEA 4ESEA 2BPOA 1DXOA 2QMYA 5F51A 1YCFA 1JA1A 3L9WA 1YCHA 3OVMA 5F4BA 1B1CA 2W5UA 4J8PA 3EDOA 4N82A 3ESYA 1CZNA 3B6KA 4QOJA 2QX9A 2XODA 4GR9A 4YAOA 1J9EA 2N1MA 4XDHA 3F90A 3N39C 3HR4A 4GI5A 2Z9DA 1C7FA 4YAWA 3U7IA 2M6RA 1YOBA 2RG1A 1YKGA 2ZKIA 2WC1A 1FLNA 4BMOB 1F4PA 3D7NA 3K20A 3P0RA 2OHHA 4QOEA 3F6SA 4U7GA 1CZLA 2OHJA 1J9GA 1D4AA 1FTGA 2KQUA 3QFCA 4OXXA 3B6MA 1WSBA 2QWXA 4NULA 1AMOA 1XT6A 4PU0A 5LBUA 1OBOA 3RPEA 3SVLA 4YALA 1OFVA 4FGJA 5B3KA 1V4BA 1H69A 2R97A 3U7RA 1CZKA 1KBQA 2QX6A 5EAIA 1BVYF 2XOEA 4BMPB 1D03A 3KAQA 4LTNA 3LCMA 1JA0A 1ZWKA 2BF4A 4GQIA 1FLDA 4C14A 4FX2A 4QOGA 4QOIA 5ULLA 3O2NA 2FZVA 2FDXA 1RLJA 5A4KA 4XDGA 3FJOA 3UXEA 1J9ZA 3K1YA 2AMJA 3OX3A 1TIKA 3ES9A 3TE7A 2D5IA 2FX2A 3OWXA 1AKVA 4R81A 4U7FA 2HNAA 4S24A 4DY4A 1OBVA 3GAMA 3O73A 2HNBA 1VMEA 4FGLA 1RCFA 4H2DA 5F12A 4ZVNA 1AG9A 4U7HA 1E5DA 2V5UA 1C7EA 4C0XA 2HPVA 2X2PA
chains in the Genus database with same CATH superfamily
3VSAA 1YZKA 4BRSA 5BUCA 3QXSA 5EMKA 4BO3A 2QVYX 3G1TA 3S29A 3DG9A 3QELB 5CVUA 3BMOB 4IQ0A 4A0QA 4FJ1A 4MQFB 1U5AA 4JR2A 2BGTA 1D6SA 3BXZA 1SQSA 2QSZA 3CRQA 4GW3A 1NW4A 2NX2A 3LBFA 3LQRA 4XPIB 3CLSD 4Y8VA 1SM4A 4O1HA 4B34A 4BVJA 4N7RA 1ZJ4A 2FMIA 1SXHA 4DEVA 3KXIA 4UDYX 1LW7A 1PDOA 3DE7X 3PDIB 3L6DA 1E0JA 1F2DA 4KXNA 1QYDA 1YB4A 2HGZA 4PW0A 2JAOA 1XQ1A 4OMDA 4X62B 5KO2A 2XWQA 4HT3B 1CBUA 4U5QA 2JRLA 3MSCA 3KELA 4B3SB 1QIFA 3G6KA 3WSTA 2YS6A 1M1NB 4PQEA 3ZD9A 2R9VA 4NZYA 4O5AA 2MJLA 4Q1VA 4YIHA 2QTHA 4LYDA 2NVUA 3LC2O 5EIWA 2PXXA 3E9RA 1R5JA 3C1AA 3SBDA 3WRXA 2R8OA 5DIZA 1ML4A 1I13A 4RS4A 1EZ4A 2GVZC 3DAPA 3O4RA 4GC5A 4GM1A 4XSHA 2BFFB 2XE6A 3PLNA 2W4MA 3ZX4A 2GNPA 4PICA 4PYLA 1PJLA 1UPTA 2DTDA 3CS3A 2E6KA 3EXEA 4OMCA 4EG7A 1ZJWA 3W2TA 3T1HB 5SY9A 3C2QA 1JECA 2AH5A 1T2FA 3PC8A 5A0FA 3ZV6A 2HHHB 1OXUA 5A5EA 1YI0A 2VH1A 1G21A 2FQYA 2ZRGA 3SXUB 5IT4A 1HDRA 2C07A 2CL7X 3CH4B 5I7AA 1G5IA 3GLIB 4DA4A 1GM5A 2ATEA 5FH9A 4XQ9A 5E9JA 1M66A 4AYXA 5JARA 4RF2A 4L5JA 1PT9A 2GZRA 4BFLA 3EJ6A 3FYHA 4KYTA 2NQ2C 1GUDA 3DEZA 4P0PB 3DB2A 4N4AA 2QN1A 1QDLB 1GGEA 3ONWA 1RWNA 3NJ4A 4MRAA 3UB2A 1E2FA 1FJXA 1W73A 2PBRA 3VNRA 4AN4A 2YV3A 4FC7A 3MTQA 2YXBA 3W04A 4IJKA 1G9XA 4L6AA 3Q6IA 2F64A 1X7YA 3OZVA 5LZ8A 1ZGCA 4J1SA 3OF3A 2PGAA 1XZEA 3B5EA 4BKQA 1L8LA 3QVUA 1XCJA 4AP5A 4G1CA 2NO5A 1E92A 2G9VA 3NMUF 1BXZA 1ZQ9A 5EWMB 1UKVY 1TT5A 2JK0A 2CXUA 3ILHA 4Q34A 1GCOA 1TVMA 1XCMA 5AOBA 3TLGB 3UC9A 2VCYA 4WKBA 1T9HA 4K1LA 4B7CA 1M5TA 1UKCA 5G0SA 1XD9A 4P08A 4BFVA 4UCXA 1N33B 1QANA 1NF2A 1ZC4A 5EJ5A 1G7RA 3AVYA 2ZBUA 5G4KB 2HIGA 1JBQA 2PKXA 2QTFA 1YDGA 3AETA 3R3VA 4UU7A 4H7PA 5DTMA 4E21A 2C7BA 3WHLA 4NBSA 2FE1A 2YYZA 2C0QA 3E48A 3JWJA 4IIJF 4PTZA 3JX9A 3VV3A 4FMDF 4DABA 1ISJA 3HGQA 1A7UA 1J2EA 4DLZA 1T8TA 1ZGAA 4FN4A 4GYKA 1A7KA 3NHYA 2PMEA 1HOTA 2NU8B 1C0KA 5KNBD 3WNZA 3KPVA 4C0QC 2A92A 2VT7A 4JQCA 4K03A 5DHAA 4F60A 3MCTA 4HPWA 2I6SA 1U0LA 2AOUA 2IWHA 4GDFA 4P4TA 1OE0A 1ZO8A 2FWBA 2XR1A 1E9SA 2W90A 3AJEA 3OQJA 5LPNA 2E1PA 1DC5A 2XH8A 3GEGA 3ASUA 3W9SA 1CTQA 2G80A 3KWFA 4GFDA 3BIXA 4OQ4A 3H11A 1Z4KA 3ZE0B 3ZWBA 6PFKA 5C1IA 4IHJA 1HI9A 5HYVA 4AURA 3ITKA 4RHFA 4QDKA 1UQTA 4Q4AA 3ZTWA 2A0FA 4S2EA 3UY4A 3NHLA 3UMCA 5IZCA 2MYTA 3DE2X 1V5IA 3ORRA 2PKQP 4JQZA 4TLCA 1M34B 3BS4A 1BWQA 3RU9A 4BFWA 2XVYA 2GSWA 3L6UA 4BFZA 1RAIA 3Q1KA 1H0HA 4TWIA 3DNFA 3JQ9A 2VUHB 1IHDA 2XE4A 4IXWA 5ALOA 5GADl 3BKXA 1SXGA 2BY4A 2D2EA 4I2VA 5A9RA 2XMCA 2Y1CA 2IEGA 1AZWA 1JT9A 1XZIA 4O33A 4TQGA 5CVDA 4M60A 1T0BA 1U0NA 2M32A 5BT9A 4Q4JA 5IP5A 1LLDA 3C1UA 3W5VA 2BSXA 3GD5A 2ZUTA 3VJRA 4M37A 3DL0A 4CM3A 2PKCA 2MU1A 3S81A 3LIPA 4JIMA 4GSYA 1KZ6A 2YXLA 5CW2A 5SZJA 5EMMA 1OLXB 3QYPA 2FHSA 3TUIC 3U13A 1GJRA 1Q50A 1WULS 2GZDA 4I9GA 4A0HA 2GJ9A 1EFPB 2QU8A 1WTCA 3VYRB 2AQIA 3WWZA 1SEPA 4L5IA 1O95C 4FBMA 4HPXB 3UZUA 3COJA 4BNZA 1D04A 1JHXA 5HIMA 4K9PA 1RLTA 4XCVA 4V0SA 1LPPA 3BYZA 4RPIA 2HWUA 2AFHB 2AZDA 2KX7A 3I53A 5COBA 3U3ZA 3FLBA 4NMXB 1JILA 1LKZA 4TXMA 3NHSA 1GU0A 2J1LA 4Z7JA 1GTRA 2FUEA 1XE3A 3EGEA 2ZIGA 3N6XA 3BK2A 4P2GA 3REFA 1JDTA 2Y1EA 4KQHA 1HH4A 2I6QA 4OXIA 3V46A 5JMWA 4ZVRA 4E32A 4YR9A 4HXFB 5BRJA 4Y2HA 4FB5A 1J6UA 1DTWB 1T2VA 2FZLA 2QTBA 1OREA 1SK8A 2VXCA 2B25A 5CJ2A 5EHZA 2NXWA 1GG5A 3C6ZA 3L02A 1SBHA 1OZ0A 3EXIB 3KHTA 1DQPA 3ZCQA 4D3YA 2B6HA 2NT4A 1GFIA 2H4JA 4IDOA 2G4CA 5IYZB 1N6OA 2CSUA 4AUEA 1FP7A 3RH0A 1QGUA 4C4RA 1E7MA 4OYRA 4RORA 4BWVA 5IF9A 5BN5B 4LJYA 1QH9A 3OY2A 3FCXA 1XAJA 2WM2A 4YR7A 1KZ1A 4RWEA 1AZTA 3ILYA 3QKSA 1NJ6A 2YY7A 4JI0B 1T4CB 3KXLA 1DAEA 3LHKA 2GCNA 1ID1A 1LK7A 1YVRA 4TTRA 2ZQYA 5HZHA 4I2NA 2WD9A 3ETNA 1N32B 5K3DA 4RK4A 4MR7B 4OP2A 4Q3NA 2OHIA 2O2SA 2QDXA 3VBCA 2Q9AA 4RF3A 5A0VA 2B92A 3KU4A 3EDQA 2ODQA 3IT2A 4FWIB 4KSYA 5B58T 5BWMA 1X7DA 1Z68A 1YS1X 1NI5A 2HBZA 1SPXA 4H0CA 1K27A 1SXJB 4RCYA 1QRUA 3IXLA 3WBFA 2IKSA 4TTVA 3SSNA 3NG1A 3RC1A 4IJ5A 4OY3A 1WW8A 2E2WA 2Q8QA 2FWNA 1K3UB 3RC7A 4B4VA 3BRQA 4BZPA 2ZCJA 5BOVA 1NWHA 2Y27A 1NKTA 2QN7A 2WHQA 1WDWB 3QJYA 2DKFA 4WOBA 3H5LA 5T67A 3OECA 3VH1A 4MP6A 3OIFA 1AHPA 3KQSA 3KUDA 4KIWA 3DUFB 1GR1A 1L5ZA 2FWMX 1CB7A 2HQ1A 2VEDA 3G6WA 3WYEA 4EVRA 4TKVA 1HMPA 5C1DA 5J2UF 4AQDA 4GKAA 1UMBA 3L9WA 1TTQB 2HYIC 5GOTA 4B6FA 3MPUA 2IIQA 1X1EA 1DIOB 4XUEA 5A9TA 5FOWA 1QBKC 1QAOA 1Y33E 2Y9MB 4TXJA 4HWKA 4Q1DA 3R9XB 2OQVA 5IMBA 4DUPA 1KI8A 1PO7A 2N75A 1PQWA 2ZR8A 3MD9A 1EK6A 1G5RA 3W2FA 2CL5A 1M74A 3IAM6 1X7HA 5DBGA 1V37A 2D5LA 4MTLA 4MA4A 3QHQA 4BNYA 1RJEA 5BQXA 1H6DA 4WK0B 5FPHA 4DMLA 3H3JA 2A59A 3U60B 1QFYA 2B30A 2DHQA 2AMLA 4N5HX 3K9FC 2W2LD 3BAZA 2VDOB 2BBWA 3ENZA 4HGPA 4ZV7A 1H23A 3O7WA 1OXMA 1Y9AA 3LPNA 4G84A 1KBZA 4K6GA 4Z9XA 2ZSJA 1J20A 4LWPA 2JEZA 4NPCA 3W4KA 3NWJA 1XAHA 2OBFA 3BXFA 3TB4A 4EVSA 4DCVA 5KAMA 2CNDA 2XVMA 5ADHA 2QL7A 3BDIA 4V0KA 4J1NA 4WQMA 1A2QA 4CPDA 4RTMA 1R1DA 2W2LA 4KLNA 2ON6A 4XIGS 3SXUA 3NPMA 4QU5A 1G42A 1YC5A 2DUUA 1V41E 4YWHA 3T4XA 3V4ZA 3ITEA 4HDMA 1A9YA 4RKEA 2WAOA 3D7NA 3K96A 3U7GA 2C5AA 4YRNA 3ZD6A 2XUAA 1VLJA 4G9EA 4RCZA 1LEHA 1Q83A 4KKXB 3KZVA 3VZRA 1PDVA 2A7QA 2JAUA 3KL2A 4GECA 4ECAA 4HZUA 1UDCA 1W2WB 3OAAD 1CZLA 3PXBA 4YP1A 3TWOA 2BEWA 3EARA 2YY5A 3IPRA 4MLPA 3MWDA 2WA1A 4H15A 4NP6A 1U31A 2Q5FA 3H4VA 2CLCX 3RF6A 2ID8A 2E49A 4BFYA 1AA9A 2PGLA 4EW3A 2LCIA 3S4YA 1IATA 4MUEA 4TLMB 3CX4A 2HLHA 1GVNB 4KE6A 4MB0A 1HG1A 3D8SA 1VSTA 4GE0A 4RHCA 5ESDA 2H65A 3ZYCA 5B6IA 4DLUA 1S02A 2ZJ2A 1DC6A 4DXAA 3OAAA 2IEAA 2DUMA 5JC1A 3ROMA 3B48A 4QBHA 3IP9A 4PLCA 5KQMA 5T5QA 2QRPA 3FF4A 3GGJA 1C1DA 1DC7A 1QVVA 4AUNA 4G8CA 2CYBA 2AXNA 3LUFA 3WBJA 4DUYB 1Q6ZA 2NV2B 2PG3A 3AQIA 2FN3A 3PLRA 5EEGA 4CZ2A 2VEOA 1A9XB 3QYAA 3WLKX 2Q29A 4Y1EA 5AHRA 3O3OB 4YJKA 1OWMA 1QOPB 1WOYA 2NXCA 3HCRA 4G1MB 3RSLA 2PD4A 2Z58A 2I7TA 3LGXA 1DLJA 1Y89A 2P69A 2YRFA 3BEDA 3CSUA 3D6HA 3QEOA 4V0MA 1QP8A 5GGXA 2ZTVA 2GERA 4MQ5A 1H2RS 2I4TA 1SVMA 4MEAA 4P36A 1C4XA 2PAFA 2YV1A 3ZNOA 3MQ4A 2FFHA 4LDJA 3PT5A 2GM5A 2WSSD 4FIDA 2ZJFA 2QX6A 3C3EA 4M88A 3VYSB 5FF9A 3TDMA 3U4HA 4Q7LA 2V97A 1DBSA 3UYLA 1SQGA 2UV8A 4QECA 2PFGA 3BWBA 3E3MA 5HA5A 3FRIA 3G2NA 2C2KA 1SHJA 2NNWB 2JJ2A 2ZU6A 4FMPA 1RBYA 3TLMA 1JHAA 1RR6A 3KAJA 2IYLD 2WSSA 3ZWXA 5I7RA 3GLHA 4Y67A 3TEFA 3K0KA 5AUPB 3ICCA 5JFGA 4TT3D 2QZJA 4MJ7A 2H5EA 4YI5A 3LCMA 4TXHA 3GEEA 2G9NA 1Y3DE 3CUEF 2CNKA 1IN4A 3OHPA 2R00C 2D7JA 2YRWA 4JT4A 4K9OA 3KALA 3ZBUA 5J9FA 4RD0A 5DGDA 5AI4A 1KQNA 4EJ0A 1E9DA 4GL4A 3PX3A 3HR7A 2WF9A 3CEAA 3LNCA 1I30A 4LVCA 3ZIAD 5BSHA 1PAUA 4IIJB 4CUJA 1EEXB 5KYXB 1PG2A 1AD2A 4FMDB 1IIBA 1Q7GA 2OHOA 1PZNA 1JA9A 1V6SA 3RTBA 4J9VA 5AK0A 5K0ZA 1XCLA 1BGWA 4V0OA 3AHFA 4YDSA 4CN8A 2XUKA 1XZDA 4X8HA 5H7XA 5AW9A 2BSQA 1N6IA 3T0FA 2QN9A 2Y4NA 4QQFA 3E58A 5AW4A 3HDJA 3P2EA 3BG5A 3DYVA 4RIGA 2CLDX 4UTVA 1CRWG 3FY4A 2WVAA 3WLFA 2GF2A 2IU6A 2ZYRA 3ZIAA 4PFKA 1G6HA 5T7BA 2FX2A 3RADC 2I3BA 4JLKA 3WHKA 4P6VF 1NUAA 2PSHA 3QI2A 4MICA 5KX5A 1TQ4A 4OQQA 3S8MA 4BWFB 4R81A 1IJFA 4CR8A 2BR4A 3B1YA 1DKQA 1JGTA 3GVIA 3RQSA 4QJ3A 1PS9A 4JJEA 2XJ9A 2FY8A 4GVLA 4MITA 2SCUA 5EWJA 4BNTA 3VTZA 1MW8X 1N8KA 2EFHB 2E1RA 4NCBA 3O73A 1JFRA 3TDNA 2O4UX 1A9ZA 4AKGA 2L82A 3GVCA 3TNFA 5JAPA 1HUQA 2B4QA 1HDZA 2GMWA 3Q2OA 1SCDA 1W30A 4YXWD 4J07A 3T52A 4NL4H 1NQWA 1ZS9A 3AO0B 1IULA 1JMKC 5EPEA 2R1TA 4BO1A 2OGTA 2Z08A 3SP1A 1NJFA 1RYZA 2OXCA 3LPCA 3CBGA 1LPAB 3QIVA 1PWEA 3QFHA 3S2ZA 4MYCA 2MIIA 5I7HA 4PO3X 2FQXA 2AG5A 3E18A 5AESA 5HKLA 4CT0A 5JSZA 4XUDA 1RCTE 5CM2Z 5DM1A 5H81A 1QQ7A 3VGPA 3H3XA 3TOSA 4AJ2A 4WKPA 2HU5A 5JNRA 4YXWA 2VF5X 3KSAC 3ZDXB 2HK6A 4LOLA 3EY4A 3CMCO 3OSUA 1Q44A 1EH5A 4N65A 3ZXYA 5JDIC 4QLBA 4YB8A 1RADA 4YMVA 3ILXA 1AK9A 2BGRA 2GKOA 1E9BA 3LX6A 2CXPA 1R0LA 3NFYA 1ZM3A 2X9VA 3DWGA 5AVXA 1KEKA 2VBGA 3O0TA 3E9DA 1C1HA 2F90A 5EMNA 3DSRA 1XG5A 1UWVA 2GD1O 4UXIA 3L7DA 2XNHA 4DIMA 3AVQA 3RC8A 1P4HA 3SYLA 4P32A 4MHTA 2VDQB 2BFNA 2XCLA 2GA8A 1P44A 3P4XA 4CM4A 4CQLA 1ZXLA 3AR2A 4MB6A 1QE0A 2X1VA 4HAZA 3NFRA 1NL3A 2IHBA 5FD8A 4R1LA 1KH3A 4HNTA 3AF5A 6LDHA 1MX1A 4L50A 1AUOA 2J8ZA 4NCIA 2C2MA 2J30A 2I7XA 3TVTA 3EFHA 4W1SA 1CUXA 3H2GA 1WHSA 1LDYA 3KDSE 4S3MA 1LJLA 4JR1A 4DPKA 4F46A 3NM4A 5DASA 5JO0A 4JR0A 2B7LA 1SU6A 4QDZA 3GMSA 3JALB 4UZEA 2B83A 4G4IA 4QUDA 4YHBA 1KFBB 4A8HA 1ZLYA 5LQDA 1N7JA 2PD6A 2WAMA 1VIVA 4KBYA 2QTGA 4Z51A 1MX5A 2W37A 3HKCA 4E88A 4GQAA 2ZIAA 3H1GA 1KWGA 1Q16A 4WY5A 1XIVA 4UNQA 3MG9A 1W47A 4KNVA 5LYJA 4DZZA 3KX2A 2R6JA 4IEEA 4HDAA 1QORA 3KEGA 4XOUA 1B00A 3QA3E 5G53C 3T1VA 4C3UA 1JAYA 3ESXA 4G56A 3UPDA 2GS9A 4EPXA 4ZIRA 4TL7A 3VU9A 4TYNA 2JIZD 3KLNA 5ARBA 4MZXA 5F9HA 1M5RA 1GAQA 3KPUA 1Z4IA 1P1BA 3PEFA 2G71A 2YHIA 4R1QA 4TTTS 2IY8A 2VC2B 1DCTA 2GI4A 3F5FA 3V3TA 4XVHA 3WL3A 5H4HA 1WPRA 1OPRA 3DL7A 3GH1A 4LF4B 2DFDA 2JIZA 2PX2A 4ZCQA 1JLRA 5DNWA 2OXIA 1VC2A 5KWSA 5KTTA 4DM3A 3HB5X 4XEHA 4W82A 5CYPA 3ICOA 1IHUA 1Q6YA 4DCPA 1MOZA 3A1TA 3H0KA 4B9AA 4WK6A 1YU6A 3KB8A 3L8FA 4L72A 2PA3A 5I6DA 2HMYB 3NTRA 3JAWB 3MOGA 1BE1A 1ZAYA 1TT7A 3QQPA 1CJTC 4HRYA 1T6ZA 1R64A 4KQCA 3DDNA 2HWYA 5JYBA 1XPRA 1Y3CE 1A1SA 3LX8A 4MRMB 5FI3A 4TXLA 5D51S 5G1PA 5IXJA 3AG6A 3D2AA 3UJ7A 2EARA 4GSLA 4MP3A 4PO1A 2XMZA 1EUDB 4R1SA 2O8FA 1QXSA 2VA9A 4LJ4A 1FQOA 3QENA 3OICA 4AG5A 2VYND 2LRHA 3N0RA 4QGHA 2O8VA 5J2UB 3TI7A 3PPWA 4IP0A 2CZQA 2FN8A 4C7JA 1O6ZA 3L46A 3ISTA 1SQ6A 5HQ3A 2Q7DA 1ADJA 2RB4A 3A9UA 3V34A 3WA6A 1GSAA 4BE7B 4D6YA 2XB2A 2FQQA 2R7KA 1EX6A 2DBZA 1Z2AA 1U28C 3GFOA 4OI2A 1WXWA 4OXQA 2WTXA 5CA1F 5IC6A 2VYNA 1XNHA 2H52A 3IESA 4Q39A 4XX0A 4ENWA 5JROA 2OFPA 2OQIA 3A7EA 4LQDA 5HRUA 3K1TA 3P32A 3B7WA 3PHGA 1XA4A 2GPAA 4OHUA 4NZZA 1L5KA 3L1KA 4PY2A 5CB0A 4PHGA 3GELA 4EGSA 4TVBA 1C9DB 3M81A 4IXNA 3I5YA 1KO4A 1KMHB 1Q1QA 2YMPA 5HQTA 4PNPA 1T8PA 3DLIA 1WB6A 5AVZA 4GC9A 4L4UA 1H8HD 2WUEA 1WPXA 4JITA 4B6PA 1RJGA 2VLIA 1AKWA 2VJNA 2J0EA 5EIOA 1Q1BA 2O4CA 4BN4A 4Z4GA 5F7JA 5JTTA 1WF3A 2NPIA 4O4JA 1YQXA 4DANA 1XJ5A 1G3MA 1WY7A 1O58A 4MW7A 2YV5A 1XQ6A 4G0OA 1QHHA 2DWUA 1ZR4A 1XTIA 2OMKA 3K1AA 3BMCA 2AL7A 4UM7A 3U3KA 5LLDA 3V4PB 1E5QA 3R7BA 3WQSB 2UUAB 1H8HA 5CPBA 2J3QA 2CHEA 1YCGA 4OHPA 1OY1A 3S0JA 4HFRA 3ZVNA 3MLAA 5I3ZA 1VECA 1M10A 1NN3A 2A9RA 3KJXA 2R6GA 5CFOA 2WT9A 1B93A 1ZVMA 2B3DA 2RAFA 3LBAA 4U3JB 4GS5A 5JO9A 3ZWYA 4G24A 1OFGA 1PR5A 4FZRA 1GAEO 2J3IA 4UOZA 1E58A 1KVRA 4LK3A 1U2EA 3CKYA 3LQYA 1D2MA 4BJ1A 1E79D 2ZRLA 3LHSA 2VPPA 3QLVA 4CLOB 3DL2A 2NUAB 1DXHA 5FP0A 3SS7X 4JC4A 1NXVA 3NBXX 1Z4PX 2BJHA 2WICA 3TQHA 1EWYA 2I3GA 4NQRA 3IAUA 1GPBA 2GN4A 2QW0X 4H18A 2MINB 3T12A 1XPUA 3WIUA 2GN6A 4YDHB 1JYSA 4JLPA 1KXJA 2VAPA 4US1R 1E79A 3O31A 3EGDB 5F7OA 3UHAA 3G89A 1TKAA 2G82A 3OLXA 2DKNA 3DVQX 4C7OA 4YRLA 4N6NA 1SCBA 1LNZA 2OCPA 4YCMA 5LNK6 4AWXA 4E4YA 3ZVKA 1RRCA 3A4MA 1WMEA 3DOOA 1WQ3A 2Z09A 3B70A 5KYUA 3WGHA 1LJUA 2NTYC 4EO9A 3IX7A 1FFHA 2IXAA 2H0RA 1WP9A 3UPUA 4OFZA 5EN4A 3MUEA 1CUIA 4WNYA 1P6XA 1GV1A 1R6XA 2VQDA 3CZ5A 5DBOA 4A82A 4B09A 2VHVA 1MV8A 1G7TA 4EDFA 4S1OA 1VMAA 4OP1A 4W5HA 3I09A 3BZUA 1JW9B 3EDMA 5CH8A 4BOYA 2XTMA 3BMNB 3HY3A 3U1TA 4OEHA 3SQXA 1ZZEA 4CR7A 2CGEA 2BOVA 3ENQA 3NUGA 2A5GA 4DWOA 4XYLA 1JB9A 4PYNA 4HNVA 3PQEA 3SN6A 1IPHA 4GD3Q 1RPZA 4YS6A 2CUKA 2CUNA 2HI0A 3WLEA 2Q5EA 4N03A 3SZMA 4AMGA 4BTLA 3FWYA 4BFCA 5C7IO 3PE3A 2K87A 3G8AA 3H5AA 4YLEA 1ETUA 4KIUA 4TSRA 4Z4HA 1ABBA 1AN9A 1D1SA 1NV8A 2QTZA 4Y6RA 5TRTA 4L22A 4BZZA 1QKJA 2COKA 3M6MD 3UAVA 3FAKA 3GGPA 3B82A 4ZVUA 4HN4B 5HK9A 3CA8A 1ZH6A 1ZMRA 1KNXA 2VBIA 2I2BA 3BDVA 5ITWA 2CSXA 4NBKA 2O8EB 2BYTA 4FC6A 3GD7A 3PQ7A 1T1RA 1N6HA 1LUAA 3CKKA 3DE1X 5TY0A 5JAIA 2NGRA 2HLDA 2WW8A 2SKCA 3EEYA 4N7BA 3ZEAA 3DEJA 2QRMA 5EIBC 3N86A 3VUEA 4D0LB 1HKHA 2PJRA 2O52A 1W8DA 2VRWA 3A37A 3I2IA 4LRQA 4EKGA 1B23P 1DIGA 1ESMA 3OUTA 4MKHA 4V0NA 4F93B 1ZNQO 2WBLC 3QW2A 1L5HB 4QPPA 1VJGA 5I9TA 2R6HA 5EYPB 3CVYA 1AUQA 4URHA 4A6EA 2HQBA 3EYWA 2EW2A 3FD8A 3SYTA 3EPLA 3DMTA 3HU3A 1SUIA 1RMQA 1XWFA 2AF3C 3LS2A 3WRWA 4L02A 4E0BA 1SH7A 2B0JA 4ILKA 4WW0A 2LDXA 1UODA 3PZBA 1A76A 1GFWA 1GGMA 4B2IA 5IFKA 1U11A 2D00A 3BFPA 3C98A 3R8CA 2PSFA 4YEDA 3VU8A 4AMVA 2HF9A 3LUGA 2EOAA 2CCJA 3AR6A 2BF7A 4NQZA 4IDNA 3TZCA 1KF0A 2OO7A 2VBFA 4G5YA 3FDXA 4UVDA 4L15A 4ARCA 3A6EA 4V3CA 3DBHB 1CZNA 1HSZA 4J0CA 1ENZA 3OTWA 1JN0A 2ZULA 1APBA 4EW2A 1NZFA 3UW1A 4CG1A 5LUBA 5JXGA 3NVMB 5KTSA 3CMMA 3MBOA 3HU1A 4BB9A 1PGNA 2R86A 2H59A 1T5LA 3SPXA 3UWSA 4Z9YA 1TUIA 3KEFA 3QV2A 1U5CA 1UUFA 2CFRA 4Q47A 1X9IA 2QF7A 2YQ4A 5IDQA 2JAXA 2ZSAA 2JD1A 4YRSA 2QAGA 3CKLA 3DEIA 1PRYA 1KY3A 4RSRA 4CM1A 2E6UX 5HOQA 2IC5A 1RRPA 3I9NA 5DX8A 1D3AA 1QG6A 3Q8XB 5AM1A 5AO9A 3QTLA 2QJTA 3UF0A 3WSWA 2QD2A 3I2FA 4F71A 1W0JD 1SXJC 1XZHA 2UU9B 3AESB 3HKBB 3ZGLA 4JUDX 2IOHA 1IY8A 1U81A 3C7DB 3KOXA 4YNBA 5JJLA 3A31A 1QGAA 5CD9A 3NUQA 5ECYA 4EY4A 3PDJA 3F73A 3EIFA 4G3XA 1T35A 3G3EA 4YIKA 4QU0A 3HJFA 5FPQA 2IL1A 2DQYA 4ZYTA 2ZJ7A 2X4LA 1W0JA 3OPYA 5REQB 4Z49A 3CNLA 3DAOA 1PJQA 1JSZA 3R3WA 2CHFA 1YZYA 3QI7A 1JYFA 4E5UA 1J9GA 1O94D 3IVXA 4HLQB 3K6JA 3QXGA 4I81A 4JVMA 2ZLBA 4Q9JA 1CQJB 5GONA 3F1LA 4CIBA 5ALNA 2D2VA 1JH8A 5CLFA 3B12A 1GWNA 3RS9A 1RFGE 4D3SA 3NBFA 2ZR0A 4NCHA 2OT3B 4ZGBA 2ZW9A 1KR2A 3E8XA 2O3RA 4FTWA 4AJ9A 4CEHB 1PHPA 2W2OA 2IXTA 3VNBA 1MNAA 3C3JA 1O94A 4X1YA 5TE9A 5T4BA 3KE9A 2V4MA 4UHFA 3V1KA 4D9JA 3L43A 4BVFA 1YVUA 5IABA 3BXGA 4WN9A 3L3BA 1OV4A 1VPDA 2UYQA 4WBSA 1AK2A 2EATA 2V6MA 4KMSA 5DWQA 3WRYC 3GCDA 5C51B 1RZRD 3OZSA 4OGWA 4UTXA 3KM0A 4CMKA 2XCOA 1VE7A 2Z4TA 4UBOA 2NNLD 3FFBA 3I05A 3L01A 3RAPR 1V4BA 3MCZA 3CZQA 4FE3A 3RB8A 2FWJA 3ZQJA 2YWGA 4B8YA 3A4YA 5HXAA 2J9ZB 1IAVA 1RWVA 4X61A 3KUKA 1TX4B 2AK3A 3HDTA 2C2ZA 2GB4A 4Q1FA 1I8TA 3HQ4O 4MDEA 2OMEA 4YRRA 1RZRA 3JVIA 4HV4A 1XVUA 3KB2A 3SKXA 4OQFA 1ST3A 3GU3A 1BX1A 2JZNA 4GOND 2D3WA 2K2WA 5A3JA 3VVMA 3USCS 3I73A 3OIGA 3JQ8B 1W2GA 3A26A 1X2EA 8ADHA 2VDRB 1QZUA 4HATA 2RH4A 1DBRA 4MUKA 5GZ3A 4K28A 3PFGA 2FH5B 4UASA 5CT4A 2JZCA 2LGJA 2G7ZA 2Z04A 1UM8A 4WT7A 5AKJA 2BFEA 2G88A 3U17A 4DMGA 3EXHA 3OEWA 4LS3A 3H1FA 4P92A 4RGQA 4KDCA 4N54A 3EPKA 2BH9A 4XIFA 2I76A 4P7BA 1ZA1A 5EI5A 4FSHA 4DSNA 2Z4RA 2AVDA 1BIFA 4PZ9A 2JAQA 3IDFA 3KL4A 1THZA 4LSGA 2B4AA 3DKRA 4TUYA 3C3XA 1KE1A 1ZK0A 3JQAA 3A58B 3VR0A 3DONA 1H2AS 3L7MA 5KWIA 3IKVA 2GSDA 3DBRA 5KOJB 2NU9B 1Y81A 1Z5WA 4FHCA 2WKRA 4C01A 3LK7A 4N7JA 1JX6A 2OO3A 3A70A 3HL0A 3ZNNA 3W8EA 3UHOA 1V45E 1B43A 3EOZA 4RVHA 1MXHA 1VLQA 1LS1A 4AX8A 3ZLVA 1UAYA 4BO6A 1Z8DA 1T43A 3PGKA 1IN6A 7REQB 5JFTA 1JG7A 5JSQA 5L8VA 1XMOB 5CFQA 3COPA 4EKDA 4JASB 4LZJA 5E1OA 5KPDA 1SU8A 4YQYA 1ZCJA 4JT8A 4OYYA 3CZMA 4CG0A 1NONA 1H1TA 6REQA 5I7FA 4DCGA 4PCAA 5BR7A 4L8WB 3GLGE 3DDUA 4Q4LA 4LF5B 3OH8A 2W58A 2A35A 5PNTA 5JW6A 2XQKA 1K89A 4HLUA 4IINA 2IE8A 4MV1A 1Q0HA 2DULA 3AUYA 4KC0A 2YL2A 4RDIA 3I8XA 4LOIA 2YMQA 3WRVA 3UJCA 3AUAA 5ALKA 1O6CA 1V8BA 2B78A 4YJGB 4A2WA 2JGJA 4Q9HA 2IS6A 1JVSA 1R0BA 3OJCA 4DV4B 4FGLA 4PCVA 2I6XA 4A9AA 1INLA 4UULA 3ZIUA 1SC9A 1X70A 3FPKA 3H5VA 3KJHA 1F12A 1GPDG 2G8LA 3W5UA 1GU1A 1AOXA 1VLMA 3UMBA 5K3BA 4PE5B 3L0PA 2ZSIA 4A91A 4JDPA 2Z1DA 3GF4A 4C0XA 2QTVB 3PLAE 1LPOA 2I2AA 2TRSB 5HIIA 2XDQA 5C8YA 4UNRA 3ME5A 3E0XA 2O57A 4TOIA 4Y2PA 2Y0CA 2O2IA 3PEVA 4G5GA 4EGAA 1V47A 3BJIC 1YR6A 1DWOA 1GUFA 3NTQA 4GLFA 1DBIA 2QLNA 3KWLA 1FVXA 3VZBA 3WY9A 1PZMA 2A1UB 3N7TA 5CXQA 2ZRAA 1JBKA 2BZ0A 3LE8A 4BKMA 3P5BA 4PPGA 5EY5B 1YQUA 3HZRA 2B9VA 4N5MA 2DT8A 4JBLA 3A3PA 3WFIA 5JAHA 1S0UA 2PLRA 5DP1A 1FDVA 2NM0A 4R8SA 2B99A 4R69A 1W9HA 4YDRA 2VP6A 2DHCA 3CJQA 4IF4A 5EE9A 1OFTA 4WVLA 3WLIA 3I8SA 4XUGB 4UAUA 1WO8A 3VR5D 1ZI9A 3UOWA 2W2PA 2VLBA 4R2IA 2WWFA 1JAXA 2GJAA 3FDZA 5BSUA 3WDMA 4BEVA 4S1NA 1IH8A 2NYAA 3CISA 3K0BA 1R5OA 1TQHA 1WCV1 3BGWA 1QCYA 4H1VA 5ISMA 4BJ3A 3VR5A 2ESRA 2FPRA 4JB0A 1TM5E 4ZGGA 4KACA 5IJ9B 3SE0A 3KO8A 1Q1EA 1P80A 3S1LA 3ZNQA 5HP4A 1QVZA 1T0UA 1ML3A 4HC4A 4HGOA 4N48A 4EI9A 5L53A 1NN5A 2G70A 4OK3A 1Y8QB 3P7MA 3QFTA 1KE2A 3TLZA 5C46F 2J0UA 2XYHA 1XEXA 2QAJA 3A04A 4GPBA 2JATA 4Z9AA 1AIPA 3L2OB 1LWOA 1N6PA 3PXDA 1PJ3A 4GNRA 4ZK2A 1HL7A 2ZITA 2QMEA 4X8OA 2FMKA 3S1AB 5G41A 4ZYXA 2OGUA 1RC1A 5BQ5A 1MEEA 1NRWA 2ZRIA 3GLRA 1V4VA 5M5BA 1BHO1 1GZ4A 3H5WA 2Q1UA 1O6FA 3TNDA 4CF5A 2EBFX 3CRMA 2ZSUA 2UXCB 4J91A 4Z7OB 3NORA 3KB6A 5BQFA 2HDWA 1TRKA 3GP5A 1V3TA 5A3QA 3MBIA 4ZYVA 3W2GA 1U2DC 4F11A 5K45A 4X94A 3ZU2A 4E13A 3BCSA 4CQJA 3WYNA 3HCEA 1XQYA 2FN7A 5KAPA 4ADSG 2P6UA 5A9SB 4EA9A 2P5TB 4HXEB 5AUNB 2QZ9A 2QL6A 4JOCA 2ODPA 4RV5A 1GG9A 2OUIA 4IEIA 3ESAA 4HDKA 3L79A 2LKCA 3A1SA 2HY7A 3AF2A 1CF9A 3U44A 1SG9A 2OBYA 4RZ2A 1YVPA 2ADMA 4LNAA 3DJFA 3UH0A 2Q21A 4H16A 1MH9A 3LBHA 2I4MA 5SZHB 5LKRA 4TL8A 1Q14A 4BNKA 4G5QA 5JC8A 1GCIA 1P7PA 4F2HA 1C4WA 1LDEA 1CUCA 1MO2A 4LYYA 4YREA 3RKRA 1T1JA 1CV2A 1H65A 4JVSB 4R2JA 4R2HA 4OI0A 3L4BC 3UT5B 3ZWVA 2F9FA 5DN6D 3RG2A 2XRZA 4N76A 4K87A 5AKYA 1BGXT 3W8FA 3QEAZ 1WQ1R 1IJBA 4CLRA 3KKOA 2JFZA 1T0PA 1KSJA 4R4JA 4OMUA 3CN7A 4RSGA 3EC1A 4AXXA 4B31A 3DMFA 1OOEA 4EHAA 2ACEA 4MPPA 4WOPA 2GBIA 2V98A 3WZ2A 5DN6A 1QTNA 3EN0A 4IIYA 1E2EA 3LPDA 4E33A 2QZ4A 5J58A 1VA5A 4JZKA 1C30A 1JWBB 1R8JA 1DFGA 2ANCA 4KWEA 5TB5A 221PA 3GFGA 2AE2A 4F72A 2F2TA 3VNVA 1ZHFA 3VJLA 2YJGA 2C5BA 3HB9A 1R37A 3KPWA 3RU2A 4LOJA 4G97A 5K7SA 3CYFA 4F38A 5A05A 1SG0A 1QWSA 1XP8A 1TEXA 1ZIOA 2CJWB 3ETLA 3RV3A 1IBKB 2XXAB 5E7MA 3LX5A 4DMFA 1J97A 1QQTA 2ZT6A 4BLTA 3G9UA 4GMHA 4QTYA 3MB5A 4LNUB 5A4MS 1TZKA 5KSPA 3B6JA 5DB4A 4MWSA 3MRSA 2FNAA 1QGOA 2H5LA 1I7LA 1YB1A 2BONA 3TZ6A 1UPAA 2X9QA 1QHEA 1Z88A 2W6NA 3PZRA 3ZE7A 3VX4A 3VR6D 3E22A 2JBWA 4P54A 3OLVA 4KO8A 4QXRA 4F7DA 4GZ6A 1R8YA 1YZHA 3HM2A 5F3RA 3Q7IA 3G2OA 4OI4A 4PNHA 3URKA 4DNOA 5IVPA 3NT4A 4LE0A 2IODA 3KOZA 2DKOA 2FOXA 2XECA 1UPXA 4CE6A 3T5AA 3B60A 5F2OA 4PYQA 3HYSA 1DKNA 4ZHQF 2B7CA 4XWAA 1W36C 2HUNA 4OX9Y 1I6WA 4UUBA 4KGDA 1Y98A 3LW7A 3VR6A 2W9XA 4G41A 3NOQA 4YMTA 1NPYA 1NTOA 3KTFA 4IR7A 3M4JA 3ADOA 3D0QA 4OQDA 4XSGA 3SDSA 3IFSA 3PFIA 4FILA 4DJAA 3ER8A 3TW8A 2Z6VA 1HYHA 1UMCA 2EKQA 3PE6A 1ZKDA 5L6LB 4UE6A 2ZANA 4PSCA 3D6UA 2VDMB 1EXNA 4A2QA 1U2RA 1C9JA 1MR3F 5CCBA 3FPFA 1ID8A 3SHTA 4RLSA 3IJPA 2HX1A 1JHMA 2QMZA 4EUNA 4QREA 3GI1A 4UMEA 1Z37A 2BFDB 3B7GA 2OVFA 2W2XA 4RFSA 2Y1LA 4Q93A 2NO7A 3L4KA 2PS1A 4F5ZA 3UMYA 4BVEA 5ICFA 4AS3A 5AVWA 4DVGA 3L0CA 1LRLA 1KSHA 4D82A 3NB0A 1P4AA 1XZGA 3JCZA 4ON9A 4R2WA 4AZSA 2QY9A 2D13A 4URUR 2ZI7A 2UYGA 3RVSA 2DPHA 2DEUA 1KK3A 5E4JA 1XC7A 1NT2A 4YDQA 2VHXA 3WK9A 4CXMA 2Y9PB 5EKUA 3RVDA 4BLRA 1WUIS 2GPSA 2JZOA 5IK2D 1GKYA 2JLWA 1I01A 2ZB8A 2OECA 2WZCA 3LXMA 1ZHOA 4U7TB 2Q28A 1LJ8A 1RYBA 1XQXA 3WBKA 3ZHXA 3FNGA 3ANTA 3MLBA 1GUBA 4TROA 1U0OC 2D1SA 3IERA 1NQOA 2VT6A 2X13A 3KIPA 1YOVA 4KP7A 3R3ZA 1ATZA 2GNAA 5K5EA 2KSQA 3R6GA 1DLIA 1EFTA 1O77A 2IZ7A 3FA2A 1E3QA 2JFQA 3N76A 4IQ8A 2DLNA 3OUUA 2YN2A 3DS8A 4J3FA 4MHOA 3BH6A 5IK2A 4YRGA 4EY7A 4XAQA 2GM4A 4DCTA 2A4MA 2OOKA 2CXQA 1NP3A 4M8SA 4YRFA 5H5JA 2HDOA 2WTNA 1WZCA 4F91B 4QFCA 1HO3A 3LOQA 3G9XA 3P4UA 4PLYA 4KVZA 4OBEA 3RFXA 5BSWA 4RVGA 4JAVC 1XFDA 3QLEA 4X54A 3KDPA 1PKEA 3VAZA 3RVQA 5LA6A 1SWVA 1RM5A 1ZIYA 1KBOA 4HWSA 2BLNA 3KHKA 5J1SB 5BVHB 2OZKA 2A58A 3C6QA 1L7AA 4FFDA 4LWQA 1ZH2A 2W8ZA 4M1QA 2YWCA 5HG0A 3UWKA 1SUBA 3ZHCA 4EEKA 1E7RA 4M36A 1QX3A 5HEKA 1E5XA 4K5QA 5A03A 1ENOA 4WXPA 3T9CA 2PWZA 1GPH1 1MPTA 1CU1A 3E23A 3HO6A 4ZT4A 3EQ7A 2H4ZA 1X19A 3Q5EA 3QPVA 4JD5A 4AN1A 3MTGA 3ZI4A 2JANA 2IE0A 2PXHA 2YFYA 2GWRA 3OURA 3Q7SA 3RRMA 1QO9A 4IHQA 1PR2A 3BQMB 2YNMC 2JASA 5KKCA 2AGVA 2ZWOA 3COVA 2A1TR 2ZTHA 3WJ1A 4WKGA 4HH3C 2CDNA 1E0KA 2DLDA 5JTUA 3IKJA 1CWUA 1NBAA 1IHOA 5AI9A 3TN7A 3KQOA 1H8ED 4NYJQ 5F4BA 4WE3A 5TPWB 1YUBA 2EL9A 4ZC1A 3HYTA 4O3MA 5FFFA 2BKAA 2GPBA 3RYHB 4W7IA 4KQJA 2XDAA 4JI2B 4D4LA 2KS6A 4QNMA 3C7KA 4FNOA 2FPIB 4Z86A 1LFAA 3M83A 4DQDA 3GGSA 4QM6A 2GDZA 4KN9S 4W9MC 4B44A 3TPZA 4C7BA 1PR1A 2P4QA 5FBHA 4G86A 4V1CA 4AJHA 3NTLA 1H8EA 3GJ6A 4LJ8A 1Z22A 4Z0HO 4ISBA 5IN5A 3RFTA 3IE1A 4M9ZA 2ZRFA 1KS2A 4U02A 2PL3A 1FQWA 3KXPA 3MINB 5AJVB 4Z4EA 3F90A 2O2ZA 1C80A 2IY7A 4HQOA 4ND7A 3EW7A 3SC6A 3BIFA 5IAAA 3EASA 4L3VA 5CVCA 1TMGE 1XDZA 2G3YA 2R84A 3RVKA 1BEEA 4OXKA 4ZDIA 1T1EA 3ICPA 4ETMA 3OCXA 4G37A 4DQXA 3RJZA 3GRFA 2OAP1 3K9BA 2I7DA 1K06A 1ZG3A 1DIBA 5JANA 4H35A 2ZXUA 2QENA 1VBNA 4BO8A 1YJBA 2JAWA 2BMEA 4ND4A 1K68A 4KXVA 3BH0A 5I01A 3N75A 3SVTA 1L4FA 1PJSA 2YHAA 3EVEA 3M8KA 3ZWAA 1ZD9A 2J7KA 3QWAA 3P27A 1MJGA 2P4SA 4FHDA 1ODJA 2ZP1A 3AB8A 2XXJA 2HK9A 3KR2A 1PW7A 2G5CA 3NDRA 1KGSA 1UT8A 1VKHA 2VTBB 2HLPA 3TXYA 2NWQA 2ZCVA 3ORSA 4EB0A 1EQUA 3A3NA 1I2MA 4NYIQ 1H9CA 4RJTA 1C1YA 2JCVA 1UDRA 2OCIA 3Q3GE 2PZMA 1MOQA 3C6KA 4PZZA 4B4OA 4S0ZA 1U8CB 2XGSA 2CNWD 1ESZA 2FKNA 4PC2A 2O2EA 2ST1A 3CSDA 1X7ZB 1XT6A 1Q92A 2ZIXB 4JY7A 5ED0A 1E9CA 3OC6A 1BDMA 4C4YA 3OEHD 1ZM4A 2VSNA 2ZTMA 1P2SA 3G59A 4RJ2A 3Q3IA 1TXGA 3H8SA 4YO8A 1EG7A 2AN3A 4OA5A 3U5ZB 3AIMA 3G7SA 4HRAA 2V3CC 3CX3A 2XSZD 1OHHA 2XW6A 2VCEA 3VKVA 4TRNA 2QTNA 1N8SA 2VRNA 2NSYA 3IAXA 1QLJA 4FYXA 4LKRA 4X8MA 2G5PA 3MJEA 4X90A 5DXJA 2OY0A 3Q7RA 2O2CA 1NUPA 2Z8ZA 3TKAA 3O8CA 1J2TA 1FFEA 2DECA 3MA0A 4MR8A 3OEHA 4FNGA 4EGJA 3PTAA 2O59A 4O2LA 2GCOA 2PJUA 3DOEA 3GXBA 4Q02A 2Q4TA 3IVMA 1PNVA 5KB3A 4KRGA 2QNBA 4B32A 3NV7A 8MHTA 3F7TA 1CY4A 3I6QA 1OWNA 1RHRA 3KCQA 4IJMA 5SY6A 3QA9A 1WMAA 3I2JA 4LK2A 3O94A 4JBHA 1KAMA 3MN1A 4FYIA 1IXKA 1O97C 1L1FA 2VJOA 3I4LA 4BMPB 3BJZA 1MFZA 3Q0IA 4MUFA 2JF0A 2IPNA 4MKGA 4DNQA 1PNQA 1WZIA 1K6IA 3EYAA 5FULA 1KJ9A 1HEIA 3K9WA 3PVZA 3MXOA 4UU8A 2E4YA 1W4RA 3WGZA 4PSUA 5DMXA 1I6LA 1V11B 3FPBA 1E3SA 1XL1A 1V6AA 1X1DA 5F35A 3T3NA 3W1WA 1T5IA 1MRNA 4C0SA 5ITZB 1E7WA 3TG2A 4BE9A 1WB5A 1W48A 1R8XA 5DLQC 5FFMA 3KKEA 4BUZA 2PUGA 1MAAA 3FWPA 1U2PA 4D3ZA 4PRYA 4E6PA 1FS6A 3NJ8A 2C7GA 1JU3A 3CXRA 2AQKA 2AW5A 3GFPA 4HMPA 3ZY5A 5KBYA 3KJIA 1WDLA 4G4SP 4YP5A 4ATNA 4KO4S 5JYCA 4BB0A 2GXQA 4INAA 1DAHA 2FDXA 1RLJA 2ZPUA 4U6QA 4LRXA 1OWOA 5LQKA 2PGJA 3NNSA 3D2CA 1H4VB 5A3VA 4YCNA 3N2LA 3TQCA 4B35A 5IAOA 1BW9A 1I7NA 1K63A 1UFRA 4E15A 1EE1A 3D4OA 3FUXA 5ALLA 1NVVQ 1USKA 2PBLA 2TMKA 4M21A 3OFJA 4TTIA 4PN3A 3JWPA 4NKRA 3SYMA 2QI9C 1YRBA 1Q7CA 1Z5VA 1IZ8A 2ZBPA 3TE7A 2GD0A 1E2UA 1O2DA 3I3OA 4DLAA 5DSTA 2BFPA 1P77A 1N9GB 2GPTA 3NNNA 3RAGA 5LQRA 3I1FA 1JR2A 1RWXA 1H6BA 2WHYA 5JVDB 4UUNA 4S24A 1KZ9A 3ROGA 5KWVA 2P5SA 2OP0A 1ITZA 2XVXA 2V4ZA 2VJYA 1QHSA 2OEPA 2OV2A 4M22A 4OVKA 4CR6A 4EA8A 3DTNA 4RZ3A 3LKZA 1M67A 2HIMA 3EMBA 3FLMA 1Z28A 3MEQA 5TT1A 3RNLA 3EH1A 3B38A 3N0TA 4R2XA 5FBRB 2HHCA 3L41A 3MWEA 3VTFA 3I0MA 4DL9A 5C4IA 3CCCA 1NAHA 4I4TA 1NXWA 3OC0A 4C0JA 1XXHB 1UK6A 2RC5A 2YQ5A 4E5MA 5K8IA 3M6WA 1SK9A 2OFOA 4L6IA 4LXXA 4M87A 1M2OA 2QYHA 1NQUA 2FZGA 3O8LA 1K5HA 1AJEA 1Q0PA 1XCGB 4FPXA 5KYYB 1BXKA 1U8YA 2CNNA 3PL1A 1PGPA 4N9QA 2HA0A 1GZSA 3HACA 3L8HA 3PUYA 4TTPA 4ZT5A 1G0OA 1QFXA 2ORED 3RVNA 3PSAA 4A0GA 4L74A 5FUXA 1SBZA 4F9EA 4EHKA 5H02A 2FV8A 1M8KA 3FN4A 4GPEA 1KARA 1NN0A 2JFVA 3L7CA 4LZAA 4CMIB 4DJEC 1KQGA 2IP1A 4K6OA 3N2KA 4Z4FA 1FDRA 1SKYB 3W78A 5FWYA 5LMCA 1DZIA 1E1RD 1JWLA 1HQCA 2BM9A 2O23A 5A2GA 5J40A 3NTVA 1TJNA 1L5VA 4PGGA 1XZNA 4N3CA 1O95D 2VHZA 1NKVA 4KQ9A 1XHEA 5T64A 2CW5A 4MYDA 3D8HA 3KZCA 3H9QA 1QYXA 1H2FA 1C29B 3GPCA 1T2CA 2G9QA 1EK0A 4FSXA 1SCUA 2VSQA 5TQ0A 5LBTA 1JJ7A 2Z2KA 4I50F 2YWDA 2Z8XA 5H3CA 4Y98A 3ZJ4A 1VIDA 2WWYA 3OWOA 4QRHA 5HF5A 4HWPA 3RYTC 4CEJB 1AF4A 1PYGA 4RAQA 1A9RA 3WMRA 3ZS9A 1Z6YA 1O95A 1R10A 1T4BA 1ZJ6A 3JYNA 4IHKA 4LHSA 2ECPA 2OCKA 4KSCA 4ZWNA 3VZSA 1S8OA 2FW7A 5BPFA 4JROA 4DR5B 2BEUA 3LT1A 5E0OA 4AUMA 4CF6A 3VMFA 3ZGVA 2XQGA 3JSXA 2O0HA 4LYAA 4N8DA 2Z2ZA 1PS0A 4OGKA 3NHPA 4XARA 3K73O 4QYIB 1ZGZA 4PFJA 4TYPA 4J90A 4R0MA 3V4RA 4GL2A 2RC6A 4OQMA 4C7MA 2OV3A 2X7JA 4BXOB 1RHJA 1W4AA 3MAJA 4RETA 4IGAA 1KY2A 4Y2UA 3OU2A 3BEOA 3Q9UA 1TVEA 2C04A 1X3SA 2XE7A 3BWDD 5DI3B 5ALZA 4D81A 2RKWA 1GPWB 1FFGA 2MMCA 1P33A 5LDHA 3EX7C 3ODGA 2E7ZA 3O1JC 3O5AA 5C34B 4L9AA 3JTEA 4R0NA 1MN6A 2R6CA 2ZBGA 2I2WA 4JT2A 5CCXA 3GLFB 1CZUA 3K70D 3W5IA 4GXTA 1Z0FA 3KD3A 4L8GA 1NW7A 4UM9B 5FUMA 1ZZGA 1SB8A 1UEIA 1UWCA 1Z6PA 3KQTA 3GJXC 1U3FA 5ELMA 3WB9A 2WE7A 4HHEA 4OA8A 1NN1A 1W35A 4FQ8A 1PFQA 1SBIA 3OT1B 5MGBA 1VGQA 1VLHA 1K8XB 3JATB 1VLLA 3DV0A 1USWA 2QPTA 2UXBB 2QR5A 2WFAA 3FHTA 4MIKA 2NN3C 5ERGB 4GX0A 5EERA 4QPZA 3WLHA 3ZHQA 1MIHA 3CNQS 3OZAA 4NOKA 3W3AD 4U00A 2Q2VA 5AWFC 5NLLA 4AVYA 3C5VA 2VHUA 4DLWA 5BWNA 1P0IA 3R6LA 1GGHA 1DKOA 1NFRA 1GCGA 1LVGA 1RWWA 4IMIB 1KYWA 1AGXA 2PWPA 3DHWC 4OPMA 4YQEA 1UJ6A 1Z63A 3MNFA 4YAFA 3T5CA 2PRSA 3D8UA 3ISJA 4HYYA 1AGPA 4J0QA 4S1PA 1PTJC 3NEPX 3W3AA 1Y5MA 1O96A 4HN2A 3EOAI 4A8JB 5KVCA 4CFYA 5A1JA 1LVUA 1Q0QA 3ZCVA 3PITA 2QRVA 5IBCA 3IRVA 1OX5A 1RFLA 3KR9A 3SFZA 1IN7A 1RWMA 2J9FA 2P9GA 4WH0A 5B7NA 1Z4NA 1FW8A 1GPKA 1GKUB 1G4HA 3P8ZA 3Q15C 5EPOA 1NDUA 3UMGA 3VHLB 1H4QA 2F00A 4ZMBA 1NLUA 2V7TA 3LT5A 1YMUA 2RGNA 2ZR9A 4FK8A 3PYLA 3NEYA 4HB2A 4IDBA 4O0LA 2WK1A 2G5TA 3D8BA 2O20A 2P6MA 4GVXA 1SHZA 2YVKA 3UJ9A 4BJ6A 4ZOLF 4J1TC 2HJ9A 1MG0A 1Z6AA 5EKXA 3P9RA 3WYDA 2WINI 2IEIA 4PLPA 4BKRA 3V9AA 3JAMA 1O08A 2VJAA 4LJ5A 2FP4B 1W4BA 1H5NA 2HD4A 2PZEA 3SIWA 1BE6A 3P9QA 1QTQA 1LS6A 2R4QA 4Q3CA 2AFIE 3I92A 2J7PD 4OB6A 2QW1A 1UEJA 3PT9A 3GMTA 3L7LA 1L7DA 2FWAA 1HZJA 1AGYA 4D8UA 1WCWA 3L8DA 2VXYA 1PUXA 1VIYA 2JVJA 3B8HA 5LVAA 1W6UA 1JHOA 3M33A 4F12A 4M1YA 1W1IA 1M2VA 1THGA 2FOIA 2NIPA 3FHCB 4U6SA 4AJ4A 3CGGA 2V9ZA 2FFBA 1C8BA 1P2UA 1J4AA 1Y6JA 2PQ2A 1O9HA 2OGWA 2J7PA 1XLVA 2QRNA 3PNKA 2ZE6A 1U7XA 2H5JA 1M6WA 3FVTA 1U2QA 3PXGA 3IBSA 4X44A 2WG2A 2XCQA 5G3ZA 4KR2A 4COKA 4BV3A 4YT2A 3K0HA 1T4MA 4XD7D 3WL7A 5H9WA 3RGWS 3T41A 3WL4A 1UBCA 5DW3A 1YDFA 5M34A 5JEDA 3G0GA 2FPMA 3GP8A 5EZQA 2ZZMA 3UPTA 1LPSA 1AZLA 2ZDGA 2X5XA 1NBOA 1II9A 4O2RA 4PX9A 1GKKA 1M6VA 4RV9A 3EPRA 2PQMA 5JXIA 1QR2A 3NAGA 4LV5B 2WKQA 3GT3A 4EB6A 1AKQA 3GRZA 2ZPTX 2LIPA 3UKOA 4M9RA 4C3VA 1YZLA 4XD7A 4E6EA 3G49A 3EQZA 1R0SA 3FSEA 4NONA 2X0FA 3CNEA 2ETXA 4K9LA 4M7WA 4A26A 3IIKA 1D2CA 1UDBA 3PUVA 1TW2A 4WESA 2VWQA 3KR0A 3ZK7A 1B8OA 3H65A 3ZWCA 4RY8A 2PT7A 3OCVA 4U2GA 3LG2A 1K92A 4G81A 4UUAA 4ZO7A 3GMDA 4HNHA 5HF6A 5JCOC 1RJ9A 4JLDA 1E4EA 3E3OA 3R7DA 2C7PA 3O75A 2LE0A 1KEZA 2RH9B 1YVEI 4ZQEA 5DW0A 1FP4B 2C3PA 1G3RA 4IGKA 5P21A 5T4HA 4DFDA 4CL2A 3LTNC 2GEKA 3Q8MA 5JH7F 4IUDS 1Z7YA 2YWFA 2YRXA 2Z3ZA 2IX9A 3L07A 3OO0A 3PFKA 1TLLA 4IJQA 3IOBA 2H06A 5TMDA 1B7GO 1IJEA 1M1XB 1VL0A 2AJTA 3X1WA 4CIAA 5ICGA 3IUYA 2I80A 5KQGA 3DKIA 1Z82A 3Q98A 2DY1A 2YZGA 1M76A 4RMJA 3IT0A 5ALQA 5FNVA 3VC1A 1XKQA 4GOXA 2X1HA 2VPIA 5I7EA 4J43A 1AKYA 4OU4A 3I4CA 5AW3A 5IFLA 1VI5A 3C1TA 4BO7A 4DWVA 5JAZA 2C2YA 4QYSA 4I5GA 5AJZA 3CGWA 1KU6A 3WZLA 1XA0A 4RA6B 1DBPA 2AZXA 4B80A 1H3NA 2BJVA 1UXJA 3ZQUA 4FYMA 3I72A 3T3GA 4FEGA 5HJ2A 2H1SA 1H9BA 2IHJA 2Q3MA 3VI3B 3T6KA 5D00A 2WJWA 4G2TA 3L6BA 4REQA 1Q19A 2CE7A 5CT6A 3EDYA 2WU3A 3BA1A 5JAUA 2DPXA 2JFUA 3IBGA 1ZUHA 3OX4A 5T57A 1NLFA 5JRZA 2R00A 3DQQA 4AP9A 3T35A 1PE0A 1QKKA 3PA6A 1M6NA 1GPMA 4ACBA 5F51A 2F9MA 4KNWA 5ALVA 1F6DA 4R41A 1JA1A 2EJBA 4DVJA 4AICA 5JZVA 2AT1A 1NF3A 4M98A 1RRMA 4NCJA 2UYHA 3ONFA 5DCYA 4EJSB 3SYRA 1VIAA 3NDPA 3ANYB 1NMYA 2QSYA 3ZGZA 1JMVA 5IM5A 4M38A 4KLCA 2P2NA 4JSTA 5B6PA 5CB4A 4JT9A 1D1PA 4JODA 3F7MA 4B6OA 2C8JA 2QLFA 3QG5A 3ISVA 2E21A 2QX9A 2R11A 3BWYA 3HYCA 5DHRA 1R9MA 5JNVA 4ERXA 2I3AA 2I66A 4LRSB 2ZDHA 3U5TA 3EBOA 4M7OA 4RF5A 1CDZA 2J3KA 4L0CA 1X92A 1U6JA 3AV3A 4NBTA 3V8QA 3FTQA 4H59A 3RRBA 1GYRA 1KEEA 4ZJZA 3ZI7A 3BGSA 1M6YA 4EUEA 4YRQA 3ER6A 5BVGA 1O57A 2AMFA 1S3SA 4A16A 1U2TA 1RJFA 3X1JA 3W0LB 1JHPA 2DJ5A 2ZKIA 2HHLA 4EATA 4JJAA 3K8OE 3CUWA 5DVZA 5ED4A 1GGFA 4FYJA 3DVRX 4Q7MB 1RYHA 3ENWA 3N7UA 5FOQA 1XVVA 4WEOA 2YYYA 3FNEA 1ZOOA 2FSHA 3NNDA 1GZHB 1SUEA 3EODA 2P9YA 2FPSA 1DBQA 2G9RA 2D0IA 3WK6A 5I51A 3IP1A 1P9NA 1BVUA 3F6SA 4TMKA 1UK7A 4CTMA 2E9SA 2HRQA 3RIMA 4AC9A 4GP7A 1UKZA 4LHYA 1BCSA 1V7PC 4II3A 2KQUA 3IHTA 5TQ2A 3JZFA 4P82A 5JDIA 4MVWA 3X0DA 1V4NA 2JI6A 3UW3A 1ZGHA 4FE7A 4PRLA 3M3HA 4I50B 4JC5A 4U9HS 5EJ9A 4HQRA 3C8UA 2BR3A 2Z5LA 3C45A 4L0MA 1HRKA 4IIXA 4G9BA 3LSTA 1NIPA 1KZHA 5K8LA 3P9NA 2GO7A 1Z15A 1FFWA 3PHHA 3CO5A 5CAEB 2F1JA 3UV3A 3BMQA 4K9NA 1EHYA 4DHEA 5IM4A 4M1ZA 4FE4A 1YSCA 4YMLA 1Y8AA 4W7SA 4OLHA 2YWHA 2RBGA 1ULTA 2VK4A 4ESHA 1J09A 2YICA 4L0QA 1O54A 2BEVA 1YC2A 2E4UA 1FXWA 1IN5A 4H3HB 4GQBA 4K6MA 1E69A 3O95A 3UJNA 3SJZA 2IOFK 4ZEXA 1VP3A 1NR5A 5L40A 1D4ZA 3SD7A 1XLTA 2Q4RA 4IWXA 2HB6A 3G85A 3SVLA 3SWWA 4KAAA 3D6VA 4B9EA 4MS4A 2BWJA 3GROA 3KUCA 3RUEA 1ZW1A 1Z2PX 4IVQA 1FJHA 3N9IA 5HJEA 3L7BA 3LJKA 4YPVA 5CXSA 2BL4A 4BNMA 4KL8S 5CD1A 2GLXA 2OE2A 1J7KA 1SKAA 3GJQA 1TI7A 3L7OA 4GICA 1IVNA 1JEYB 1EUYA 2AZTA 1EGHA 1JIJA 2JKVA 3BPSA 1YASA 1BC5A 1ILEA 2I0FA 3W5DA 1CDDA 3GA0A 1KI9A 4HOYA 1YS4A 1V3UA 4PYOA 4RZSA 1QP4A 5DWDA 2RHBA 2FTKE 4KPGA 4TZTA 4MO9A 1L4MA 1OXKB 4DNXA 1W49A 1Z5UA 4R8RA 1SUDA 5E38A 3I37X 3FPSA 3IAS1 2QOEA 1DO0A 1UT6A 3BMOA 3QELA 4KUEA 1V43A 2GZ2A 2HK7A 3EULA 4MQFA 1FL9A 1NY5A 3IODA 5CEFA 4LTNA 2IF2A 4PC7A 4K2AA 2H2GA 1S2DA 1XTKA 3BL5A 4XPIA 5GJWC 5LMZA 2OCDA 2IT1A 2JL1A 2CBZA 4LRWA 4LWOA 4EYKA 2OLJA 4D44A 5FR2A 3IAEA 1UKYA 2I62A 3PDIA 4Q7JB 3FROA 1JLLB 4YRDA 1R0CA 5F77A 4J2HA 3WLTA 3T1YB 1ZM9A 3O2NA 4RM3A 5LDDC 1YVDA 1GZ5A 1PV1A 1LPMA 2G08A 2Y0BA 4L78A 5CK4A 2C96A 3FUVA 2HJSA 1M1NA 3EUFA 3H1TA 3GJ4A 3PRYA 2BI7A 4AJPA 3DZ8A 2JGRA 3V8PA 3WJ7A 2BGGA 1DVRA 2Q9BA 1QWOA 1R4NB 4S04A 2A94A 1JDUA 3K1YA 3NIDB 2OZPA 1YR2A 1F48A 3C3BA 3OX3A 4IQ4A 4KXXA 5BUQA 3T61A 1AX9A 4RVUA 4G5OA 3BXHA 3MS2A 2W00A 1XRLA 4PHFA 1X0VA 2VNJA 2FUNB 3EUAA 3QJ5A 3WC4A 4BPBA 4WGFA 2X0EA 1OYYA 3FG9A 3JVDA 4QGBA 1V9LA 2HADA 2HLNA 1DKUA 2XHZA 3DTVB 1EUCB 4KPYA 2D2FA 3WIDA 1HETA 4QTZA 1GPYA 3UJHA 3RS0A 5GINE 1CRPA 3VC7A 1CFJA 3GLIA 2TSYB 1OI2A 1M8JA 1R3DA 3S28A 1E2GA 5IC4A 3GAMA 3LAWA 2F1HA 4ZOLB 3SSOA 4IL5A 4TQUS 4HB3A 4Z53A 3VR2D 1ISMA 3IMKA 2Q3DA 4HYQA 4R1UA 4WBNF 4H3KB 3S8EA 1MB4A 5I4KA 1NQVA 4KLZA 5HE8A 1L4UA 4J7XA 4F1KA 3D3EA 3MJFA 5DCWA 3SSAA 3M82A 2XNJA 3BD7A 4JDUA 3X2SA 5KTKA 2G40A 4MCHA 1SZPA 4GYYA 2O2YA 2O3UA 3M9WA 2AKYA 3HCDA 1V39A 1ZIPA 1NBEA 2PVPA 1P62B 4J16C 2DU8A 5AXDA 1XDUA 3DC7A 1HORA 1XTZA 2FW9A 2ZBQA 1H6AA 2O5RA 4LN1A 4OM7A 3SF8B 1S1CA 1Z6QA 2BBTA 2Q1TA 3JV7A 4X8LA 3FTFA 3K30A 1BS2A 1QYCA 3G0DA 3H1EA 3LLCA 3GPIA 2VHQA 4P3YA 3FOWA 3PHBE 2XGJA 4G0ZA 1GGNA 2JJQA 4DTIA 5C31A 4KQKA 3O0DA 1ZN2A 1MT0A 1YZNA 3LUKA 3UUFA 1UJBA 1GQYA 3CRVA 3TLGA 1I9GA 2GRJA 2JEOA 2X5OA 4G0WA 1Q1ZA 3FKJA 2IHTA 3ESBA 1QBGA 1X77A 1IY0A 1TKRA 3QX9A 2ADFA 3GGCA 4F6RA 1GUYA 3L92A 3PQCA 3UUEA 3TX2A 1N6KA 3CLSC 4NNPA 1PQ4A 5KC9A 2NO6A 2J41A 1RKUA 1MAHA 2L2QA 4EY5A 1VI6A 3N6VA 4W5WA 4HSEA 4BAUA 4C4PA 4CTKA 4G0UA 2F9LA 5F7ZA 3A32A 5FCDA 1JVNA 2FGKA 2M1ZA 4NZ9A 1DCKA 1WIWA 2GKGA 5LQJA 1DIRA 1DDIA 1W4ZA 2XMGA 4DQLA 3BIWA 1LPNA 3O4VA 3PC6A 2G4LA 4D3DA 3VPDA 3EZYA 3NX4A 1YZTA 2REXB 2NVBA 5CBPA 2QORA 5IWAB 1ORWA 3V32A 1E1MA 4KB5A 3L4JA 4MKXA 3WQHA 1BRTA 5DI9A 3AM3A 2NOAA 3SIXA 3U1VA 5ALIA 4AZTA 5TQVA 4EMSA 3PYMA 3ET4A 2A30A 3IRUA 2ISSD 4UU1A 5GWXA 2PSEA 2O2GA 4DXDA 1WKVA 4Q6BA 5E1DA 3C3AA 4AD8A 4DV1B 5JH7B 3F6PA 5CVEA 4XYMA 1M83A 2IIPA 1CP2A 1IBCA 1U0GA 5BV0A 1E1CB 3CVXA 1QPZA 3R76A 1K3FA 1XLWA 3F6CA 4F84A 4B4WA 4IV5A 1C3EA 3PUWA 4NEHB 1RAGA 3MAGA 2YASA 4MVJE 1M34A 2V7GA 5HDBB 5F9FA 2EF0A 2IITA 5TF0A 4GMXA 2FPWA 4MCIA 4QDUA 4UDXX 4ZRDA 4OIFA 5E6SA 3TRHA 3EY9A 1YK0A 2FWPA 5DSZA 2J3EA 4EAAA 4QGSA 2WE8A 1C3XA 4BQRA 4ENSA 3TCXB 4RTKA 1DQNA 4JYZA 4MYSA 4BFSA 3MJHA 1SU7A 1R0WA 2FLVA 2L19A 2WSMA 1JDJA 2WWWA 5BMOA 2OWEA 5CYOA 3MILA 3RTAA 3CWQA 4D74A 3CR3C 1VHLA 2AJDA 4RK0A 4MYHA 4CNQA 1GG2A 4DCSA 4BS9A 3H9GA 3JQCA 3P0EA 1BO6A 4K6HA 4Y6QA 1OLXA 2WM3A 5DO9A 5L3ZA 3W9YA 4E12A 3SHFA 4E70A 4JBYA 3SIRA 5JEEA 1N4AA 3V1MA 4PIMA 1EFPA 5EHQA 4A73A 3I2HA 4EZIA 5HK8A 3UENA 4MAAA 3UHPA 5I4BA 1D2AA 2KBFA 3KT0A 1XVTA 1YIOA 2PUHA 1JQKA 3ZDYB 4JLOA 1XRSB 3OJWA 1Q12A 3PRJA 3V4VB 4C3OB 1EDEA 1QQAA 2HL6A 5CURA 3A3KA 4EHIA 5LWHA 3GA7A 4P3PA 3SK0A 3DVLA 4HYEA 1FDWA 3T3EA 2GCGA 3FHLA 4PLFA 5F78A 4CW7A 1OC4A 4QVGA 2JFPA 1U1FA 2IUSA 5BSKA 2AVNA 3KJFA 3I9V1 3D5QA 5JQWA 1OYOA 1T9GR 4ND6A 1YR3A 3PNSA 3CRW1 1RRKA 1UBHS 3UG6A 2P2ZA 1WMSA 3GDOA 1I7QB 3BBPA 3BKWA 3R3HA 3KPJA 3RQIA 1VPWA 2CVZA 1RXIA 3OETA 3P2JA 1QYWA 4C7OB 3ND5A 2DY0A 1R0KA 2VHTA 3TTSA 1D4FA 3T3DA 4V39A 3VNUA 4FN5A 2IYVA 1DI0A 1R6TA 2PVSA 3EW9A 3DHYA 4PSKA 5FLXA 2EJVA 3GPDG 1K7FB 4X3OA 5ERXA 3WLPA 3G9QA 3R3SA 4ZARA 2O54A 3FVWA 3K09C 4G1UC 1NJ8A 3ACDA 3IV9A 4YJFB 1C2TA 1GZ6A 3RWOA 1VSVA 2DT5A 1ND5A 1VL1A 2OBLA 2Q3HA 2R2GA 3IKLA 4AG3A 5BN5A 2QPAA 3PK0A 2FXVA 3U3OA 1FW6A 2A8YA 1KZ4A 4EFLA 1OXBB 2G76A 4IGIA 2WLTA 1NXSA 1IHPA 1UM9B 1RE0A 1C81A 4LBWA 1M8FA 2FKAA 2XX3A 1OZGA 1T4CA 2Z5FA 3O2JA 1FFAA 4MWDA 1Y1SA 1SXJD 3BXEA 5D5PA 3VSDA 3O8QB 4G89A 4MMZB 3I1JA 4MINA 1IBRA 2X8LA 3FHOA 2B35A 3GPBA 4ZVPA 1C14A 1K8ZB 1ISSA 2CYAA 3TSWA 4BLVA 1ZCZA 2I9PA 1OB5A 2MWMA 3I5UA 3INNA 2F59A 2CXSA 1XQVA 1CVLA 2KW5A 4LDPA 1V1MB 4AKEA 4MPTA 4DDKA 4P7FA 2ZGVA 4CMEA 2GAFA 1SXJA 5FB3A 2BGKA 2WSLA 1FPMA 5AI8A 5JJIA 3C39A 5IHXA 2FF5A 4A8JC 2P5UA 3G5MA 4G1FA 1EWKA 3OJXA 3W5AA 2EKBA 2GEBA 3WNVA 2X8JB 3Q3HA 3T9AA 1VIMA 4O4HF 3RJTA 1KK2A 2CMKA 3DR5A 1ZR2A 4OLBA 4RDCA 4QAQA 4K6CA 2QDKA 4EYEA 3KLBA 3FB4A 2A84A 3BCUA 3GB9A 1SIOA 3QKTA 4P81A 2Z8YA 3DUFA 1I2BA 1YJQA 3UJPA 3G2KA 4YCCA 3RRZA 4YTEA 2X40A 3QOFA 4QOHA 4FEEA 3BD9A 3R0JA 3CZAA 5FWAA 3ZCPA 2BR5A 4A0RA 2GBCA 2JA1A 3T5TA 2WMDA 3S40A 2FN9A 2H7YA 2D7CA 1K4MA 4M0UA 3U19A 4DIDA 4ER0A 1Y6ZA 1F3OA 3UJ8A 2NO4A 3R9XA 2ZKLA 5GAJA 4TKUB 1XZMA 2JS7A 2LVBA 5DRTA 2ZVDA 4HAIA 4TRJA 3TGWA 4ZHSA 4EG0A 4LE1A 4XXHA 4AP6A 3T8YA 3RD5A 1Y9JA 4CL0A 4MROA 5IUKC 2CMHA 2ZDQA 2ZJBA 5L45A 2ZJ0A 4KGVA 3PIIA 3G0BA 3KKMA 4ZVMA 3NATA 2YR0A 4QPJC 5K2OA 2GESA 2XQFA 3IMGA 5DULA 1XZLA 2JIMA 1K9SA 1L5WA 3DVAB 4FINA 1O9GA 4RJIA 5MGNA 3B89A 1CF4A 4Y30A 4JP3A 3QOYA 1OD6A 1LQTA 2C92A 2R7AA 2Q5HA 5IBQA 4HDSA 2ODAA 5AHKA 2LXNA 4IQFA 2FZWA 3LKVA 3ZK9A 4PEVA 4GX2A 4DA8A 3PJRA 3C4VA 1YS7A 2SNIE 4GNKA 4OJTA 5F1OA 3OHMA 1PJBA 3DAYA 4RTLA 2D4HA 2HJHA 4ND1A 1SQ0A 3H8JA 1M2HA 1Q3TA 1G2QA 1JTVA 2IUEA 4PR3A 4DIEA 5CX4A 4H1UA 2LR0A 3FNBA 4HQ6A 1XTUA 1OIWA 4R16A 4ZEMA 4R1MA 3CF6R 1JKJB 1WSAA 4XWOA 5EVJA 3AGQA 1R4AA 3PGMA 1EX9A 3REOA 3I5AA 4IIHA 3RIYA 5BWBA 1GTJ1 3FBWA 1K4YA 2IYWA 3NLLA 3WIBA 3EG9B 3Q10A 1E18A 2VUSA 1KY5A 3URMA 2V7QD 3H18A 1VE6A 2UXDB 4EDHA 4BUCA 1N3BA 3CTPA 4FFWA 2WHXA 5KNDD 3KQYA 2PWYA 1DXOA 4UOQA 4DBLC 3ACCA 1JKIA 3VNAA 3VXKA 2OPHA 5TS3A 2OV8A 3WHIA 4INOA 1L8XA 3ZV5A 1D2NA 3KSRA 3GLKA 4ZT3A 1XUOA 2EZ8A 1QB8A 1A4XA 2P78A 4JLSA 1PD1A 3IR5A 1FDIA 1G8JA 2FSGA 4J8PA 1RPJA 1Y1QA 2R7LA 3DEHA 1QVRA 1RHKA 4NU8X 1BYIA 3V2IA 4EF5A 5KNDA 2G5GX 3E8SA 4BQEA 7MHTA 2XOXA 3PB3A 3A3OA 2WYUA 5D6NA 5B1HA 4HBZA 4EYGA 5K3OA 2QU7A 1N1MA 1NIJA 2OV6A 3GBSA 3KXKA 5CB6A 1V2GA 1AUXA 2ZJ8A 1N2ZA 2ZRBA 4PHTA 4WBNB 4AULA 5L3QB 1ONPA 4ZDJA 3NHAA 4TM8A 3FCYA 3QMPA 5TPZD 2PUFA 4M1WA 4CM7A 3ECSA 2FG7C 3FUCA 4P53A 3SOPA 5I7OA 3SLRA 5J4HA 5LLSA 4V1CI 1MX3A 3QZUA 3H42B 1DEOA 2AEJA 3CU5A 2F48A 1ZSVA 2Z9DA 1SZJG 5DM70 3LTEA 1N5LA 2XT0A 3NIGB 5G0UA 1C7FA 4XVCA 4DV0B 3EISA 4K05A 4Q4HB 1YQWA 2Y05A 4B3MB 2C9CA 2VAWA 2ZATA 3A4IA 2KHZA 1EJ0A 5EGNA 1JDZA 4PG5A 1GSOA 2QVGA 3OPMA 1JF8A 4EX7A 2B36A 1C3OB 5LB4A 3U3RA 3UGKA 3IUSA 1T36B 4X60A 1EVQA 2ZE8A 1CIVA 2IYFA 4QVKA 1U3CA 4M2LA 2HT1A 2PLNA 3I39X 2P9TA 3C6XA 1MPXA 1KKUA 3FNRA 4ZO8A 5LZ9A 3UBMA 3DO8A 3H2ZA 4ZICA 5DZSA 3VM6A 4D56A 1XALA 2GYYA 4A2PA 1EFLA 2G72A 1GDHA 1JDBB 3VKHA 1SOMA 2YS7A 2C77A 2QL5A 5KYXA 4IIJA 3Q3JB 1W5BA 5LZ4A 3THSA 1L0BA 2R751 4UMFA 1AQYA 3K6RA 4OHWA 4C2UA 2IW3A 3KG2A 3P1JA 5AVOA 1JZQA 5KNLA 3NEJA 4NZNA 3MS7A 1PR9A 1J70A 4QT0A 5FBWB 1S2GA 4AWAA 1FYWA 3SJ7A 2R5WA 2Q4DA 3X3HA 1CY2A 3AR8A 4WXRA 3HO1A 2BDUA 4UARA 1OXVA 2FQWA 4NNOA 4A1OA 1DSSG 3I6IA 4GPIB 5DGHA 3AI3A 1F38A 1QM5A 3QYFA 4FFBB 4HNAB 4S1VA 1WX1A 1XX6A 3H2YA 3HRKA 5AXBA 4CCYB 3SJBA 4DJTA 3ENNA 2I6UA 2E48A 3JQDA 4MGHA 3O9ZA 3T94A 4UCFA 3ZU5A 4GM4A 4N6OA 4KO2S 3LWNA 1H69A 4TM7A 4ZZ2A 3QVTA 1QZZA 2G63A 1UCFA 5EQJB 5FBKA 3P9ZA 5AXAA 2VDVE 3U7RA 4MLCA 1KQFA 3ED1A 3WMFA 1Z0SA 4DLLA 1E2LA 1FMTA 2QS9A 2XT6A 4ENTA 4DDUA 3MLEA 2NUBA 2D2IA 3COSA 3IEIA 4L1KA 1WS6A 3LRTA 4HTFB 5KHAA 3FR7A 4I3GA 1IB0A 4YT5A 4D2IA 1QS0B 3PI7A 1CIJA 4I1IA 5IH3A 3X1YA 4HEA1 3HPRA 4IMPA 5LU8A 1HEUA 4O2BB 1EGVB 2ZIZA 2B4KA 5TVGA 4S35A 4MO2A 3D4PA 1U2DA 2YFQA 1TYZA 3NAQA 4MX8A 3W6NA 2N9UA 3GYGA 3T9EA 1JA0A 4K2HA 1I7DA 2PO7A 3ZXUB 5D87A 4DJJA 3RRFA 3SX4A 1A8UA 2B7BA 4F4HA 1V16B 2ECQA 3Q41A 3TDKA 2Q3LA 2VK1A 3BD6A 4QIHA 1VZ2A 3L18A 1CB0A 1CK4A 1LW6E 3BD8A 4WV3A 5E7QA 5FOVA 2NYRA 3ZI0A 3CZCA 1QIJA 4JB3A 4RACA 3ANXA 5ELLA 5I7UA 1Y8RA 5M3BA 1V8DA 4OBBA 1A96A 5TNXA 2H54A 4BDTA 5C8XA 2BGJA 4F3TA 1QCZA 4JV5B 5AW6A 4PAGA 1R18A 3PE4A 2IZ0A 1EB8A 2PDAA 1HDCA 1WAMA 1RT9A 1Y5LA 2OSVA 1A8QA 2RAUA 3EXFB 3QY9A 4RPLA 5CT8A 5EZ6B 2OV4A 1IB6A 4Q48A 3U7FB 1WZUA 3L4BA 3L7AA 2CL0X 3V8VA 1E7QA 3DQZA 4UFOA 4LJ7A 2J9YB 3OQIB 3ZLBA 3ZZ0A 4DWJA 1E89A 2Z83A 4ZYLA 1W88B 2QHXA 2ZBDA 3JALA 4RHEA 1V2HE 4C6RA 2J9GA 5CT9A 4QJ5A 2NU6B 3ROTA 4QPNA 1JQJC 3W2IA 4JXZA 1E6UA 4D4KA 1AKVA 2PE5A 2CE2X 2WUFA 3VZCA 2GBLC 4CODB 3MTEA 1SELA 2H4XA 3CLTC 4WY8A 3Q9NA 1E20A 4KWCA 3E35A 5E8JA 4EYQA 4Z2YA 3M1AA 5FORA 1E6MA 2QUHA 2B9EA 4XWYA 2A5YB 4FD3A 4H2DA 2H3HA 5F12A 1H4SA 2EQBA 1IN8A 1RYDA 3D64A 2PSDA 1CR1A 2P90A 1MABA 2IYAA 1KI1A 4YAEA 2EX4A 3TNLA 2FMTA 1G7SA 1EBFA 1VE5A 1Z35A 2CEAA 2COUA 3QMVA 3GAZA 4NATA 1N75A 3TPCA 5AOVA 2GILA 2J5QA 5BP7A 2LIVA 2YKGA 3HJUA 3B1FA 5K3FB 2EERA 3GK3A 3IOYA 1EIZA 3TYXA 5HMLA 3W6PA 2OO5A 3HV0A 621PA 3FOEC 1CS4C 4FEYA 1C50A 2SKEA 1S01A 2WJYA 1EBUA 3HY4A 4ICIA 5BR8B 3JYQA 3HP4A 4QNNA 4BP9A 4YYEA 3HI6A 4CKZA 2CFTA 1YTLA 1JDSA 3TM4A 5KQLA 5DX1A 5HVNA 3IMCA 3R5HA 4JU9A 4RY9A 4UTOA 5AKLA 1UXHA 4HEQA 1JTFA 4GR5A 2BFWA 3T34A 4JA2A 4EG8A 1X15A 3TQFA 5ADUS 2IP2A 4LC1A 3JAWA 1G19A 3AHJA 1RQGA 3G2HA 4YGYA 3W5HA 4BKUA 1GAWA 4ARVA 4B73A 4D80A 4EARA 4M53A 1P0PA 4BY9E 1GTL1 4MRMA 2CJPA 4O4HB 5TMBA 1OIXA 1KRXA 4N0DA 5D01A 4NNJA 1OFUA 1QZ3A 2PWBA 1XTBA 3PIRA 2GHRA 5KWEA 1QRRA 1EUDA 3AUUA 4QBIA 4KFUA 4JNKA 1WXQA 3GUYA 4WTOA 5C7LO 2R87A 3MSXA 3L1VA 4IH1A 4L5YA 4RK5A 5CH3A 3NALA 3VJMA 3OIDA 2P3LA 3ADPA 2BM1A 2X9GA 3OESA 2VA8A 4GOLD 1YCDA 4OOFA 4P7JA 1A82A 5ESXA 4V0ME 5HCIA 3WXBA 2ETVA 3T1QA 5TARA 3T7KA 4INJA 2A9KA 2QE7D 3JQFA 2CLOB 1Q7BA 3RK1A