3B6MA

Wrba from escherichia coli, second crystal form
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
197
structure length
188
Chain Sequence
AKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavoprotein wrbA
publication title Crystal structure of the NADH:quinone oxidoreductase WrbA from Escherichia coli.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 67
structure length 188
sequence length 197
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3b6mA00
3F6SA 1ZWKA 4HS4A 3HR4A 1AZLA 3OX3A 2XODA 3FVWA 3FW1A 2WC1A 5FA6A 1GG5A 4J8PA 4C76A 1FUEA 2Z9CA 1V4BA 2RG1A 3NFRA 3ES9A 4Y9UA 1AG9A 1RTTA 2BPOA 1AMOA 3O2NA 5F12A 2ZKIA 3NHWA 3NHLA 4QOHA 2FDXA 4D02A 4FGLA 3TZBA 2BF4A 1CZUA 3LCMA 1J8QA 5EMNA 1WSBA 1ZWLA 2OHIA 3W77A 1X77A 1I1OA 3N3BC 4BMPB 4F8YA 4U7HA 4QOJA 3NHFA 4QOFA 1FLDA 2M6SA 4GR9A 1ZX1A 1SG0A 1YCHA 2FOXA 1OFVA 4LTDA 2FAXA 5LVAA 5LJIA 1RLIA 2X2PA 2OHHA 2KQUA 2A5LA 3ESZA 4R81A 4XDGA 5B3LA 1T0IA 1AHNA 2GSWA 3FX2A 1CZOA 1DX9A 4YALA 4QOGA 1AKRA 3HLYA 1AKVA 3S2YA 2FCRA 2MT9A 3OJWA 3W79A 1T5BA 1YOBA 1CZRA 6NULA 4U7GA 5F4BA 1XYYA 3K1YA 5FUQA 4CETA 1JA0A 4YAFA 3QFRA 3EDOA 1C7FA 2Q9UA 5A4KA 4U7FA 1WSWA 2MOKA 4DIKA 4QODA 3FNIA 3EYWA 3GFRA 1AKTA 3FJOA 1YDGA 4H6PA 5LBTA 5LMCA 1QBGA 4BMOB 5F51A 3ZHOA 3W78A 2BN4A 3GFSA 2QR2A 2ARKA 4ESEA 4CF6A 1FLNA 2Z9DA 5FX2A 2B3DA 1SQSA 1RCFA 4N65A 2QX6A 2FX2A 2FVXA 4PU0A 2MTBA 4QOIA 1J9ZA 1AKQA 1QR2A 4YAUA 1H66A 3KAPA 2D5IA 1D4AA 3ESYA 3NHRA 2W5UA 1CZNA 3NLLA 2V5UA 2BZSA 4YAWA 4LA4A 1FX1A 3NHYA 2Z9BA 4ZVMA 4N82A 3F2VA 5NULA 2QX9A 4PTYA 4M0CA 3R6WA 4C14A 3O73A 3LT5A 3N39C 3NHJA 1OBVA 5TGZA 1XI2A 1AKUA 1E5DA 1D03A 2KLBA 3F6RA 2HPVA 4ICIA 3RPEA 4LTMA 5BUCA 2FLVA 1YCGA 3UXHA 5LLDA 1CZHA 4OXXA 1FTGA 5LBUA 2N1MA 1DXOA 1J9GA 3K20A 2HNBA 4LAFA 4XDHA 1D04A 1JA1A 5EA2A 2V5VA 5EAIA 3QFCA 1RLJA 2R97A 1F4PA 2QMYA 4LTNA 3U7RA 1TIKA 3OX1A 1KBQA 3HA2A 3GAMA 2MWMA 5JROA 3KAQA 1QRDA 3F90A 2OYSA 1BU5A 1YKGA 3N3AC 2V9CA 3KEGA 2HNAA 4Y9RA 2X2OA 1XYVA 1AKWA 1VMEA 3SVLA 3NHPA 1C7EA 4DILA 4H2DA 3NHUA 4YAOA 3B6JA 3P0RA 1FVXA 4N9QA 3TE7A 3OVMA 1FLVA 1NNI1 1YRHA 2Q62A 3L9WA 2Z98A 1CZKA 4YQEA 3L9XA 2F1OA 4DY4A 2QMZA 3B6MA 4ZVLA 3NHKA 3QE2A 4ZVNA 4QOEA 4NLLA 1DXQA 5LJLA 1OBOA 4FX2A 2QX8A 3D7NA 2OHJA 4PTZA 2FZVA 2BMVA 1KBOA 4NULA 2M6RA 5B3KA 1QHEA 3GFQA 2R96A 4ZVKA 3OX2A 3OWXA 3TEMA 3B6IA 1YCFA 2QX4A 2AMJA 4GQIA 4FGKA 3G5MA 4C0XA 3U7IA 4C0WA 3B6KA 3JSXA 3ESXA 3NHSA 5NLLA 3KLBA 5ULLA 2QWXA 1J9EA 4Y7CA 3UXEA 1CZLA 1B1CA 4FGJA 3OJXA 1FLAA 1H69A 1XT6A 2XOEA 1TLLA 4S24A 4GI5A 2FZ5A 1BVYF 3OWHA 4HEQA 3W7AA
chains in the Genus database with same CATH superfamily
3EXHC 1YR3A 1GKKA 3JVUA 3HVIA 5LUBA 3WGYA 1NVAA 1GG9A 3M1AA 4WKGA 3NKFA 3ZC3A 2A4MA 3LBHA 3PDIA 3PKZA 1L8OA 4JJKA 3SYTA 3PTAA 1DAKA 2GD2A 1SKUA 5JNVA 1Y6FA 4JJIA 1Z4JA 4M0EA 2XMCA 4XIJA 5ECYA 3USZA 4WBNF 3IHLA 3HRIA 2ZIUB 2ZJ4A 4TS3A 4JL6A 3PZRA 2JAPA 5BOVA 1I30A 3B51X 1VBKA 3JATB 4G84A 4BE4A 5LKRA 1X1BA 2BLLA 1PR5A 3ZCVA 1JEJA 5KNBA 3R3YA 4EKIA 3EBPA 4LBWA 5EKTA 1V71A 2WTNA 3SEQA 1DG3A 1P1FA 4F5WA 3LO8A 5EE5B 1ODFA 3RANA 2C2BA 3AW8A 3PFGA 1UK8A 1AMOA 3T15A 1FTNA 4J76A 2PANA 3IQZA 1HQCA 4CHGA 2PZAA 4JR1A 1PJZA 4KPUA 4OAPA 1KZHA 4MWGA 4OHUA 1CU1A 1DDIA 3W5HA 3VTAA 1DC3A 1QO0D 4FGLA 1I7NA 2C4TA 3GYGA 4K2AA 4Q3BA 4EA6A 1J49A 3JQRA 3F0TA 3C7DB 2IP4A 3L77A 4IGAA 2Q7OE 1ODLA 1XQ9A 4HG2A 4WBSA 1C0EA 3D31A 2MSLA 3L6DA 2VXBA 1DEAA 3JQQA 4JT9A 4TPKA 3H8JA 3CY6A 3L8MA 3UN1A 3W2TA 4I8DA 5ABPA 2GHRA 3QBTA 1L2TA 5JBIA 3BD7A 4TGLA 4PINA 1Q11A 4BB5A 3AOEC 1DQZA 3E82A 1Z5ZA 1LWNA 2FPRA 2PXXA 3IUQA 5DHPA 1YO6A 3UOGA 3WK5A 3R40A 5JS7A 5JJIA 4U7HA 5CTAA 1M8PA 2IYRA 2Z2YA 3HFJA 1B8UA 1YVPA 1Z6YA 2Q4EA 3GJZA 3GUVA 2NTVA 2X76A 3WL7A 3EIXA 4D9JA 1E59A 1XZKA 3A32A 2JFFA 3FFAA 3T12A 4DA6A 1W2HA 4LUCA 4BO9A 3QLUC 5K6AA 5JATA 4EI7A 4ZYWA 1ZVVA 1X1CA 3TPZA 3HI6A 3U1BA 5DNDA 1I2BA 4AJJA 2Q5OA 2E5WA 3C5VA 5CH3A 1MJGA 1Y80A 2OM6A 3NT4A 3O8OA 4QOSA 1UDBA 4KPEC 1XRJA 4CKBA 4H3HB 3RYCA 3WI7A 2PWYA 4LNAA 3PNYA 3OTHA 3NHBA 4FFVA 2JKYA 4E5PA 4XZ3A 1KJZA 4HNRA 1DZ3A 3L2OB 2CHUA 3QU2A 2Y66A 2IEBA 1CIPA 5ILOA 3T95A 1PLJA 2V5AA 3Q7TA 4RCYA 4BB0A 4NBNA 4LISA 2IIPA 1L1FA 3W34A 4M1KA 5CUQA 4DR2B 5ELXA 3CRW1 1I0LA 3LM8A 1C9JA 1XMVA 5FNVF 1L5NA 1HWYA 2ZI9A 5KTMA 3CSSA 4B76A 1ZR4A 2CVFA 3B5EA 1QONA 4L5AA 1EFRA 5KVSA 3FCXA 3LF1A 4US0R 3L40A 4GNRA 4DM4A 4ZJUA 2ANCA 4MUIA 2NAPA 4X90A 3CLVA 3C5EA 2X77A 1SOUA 3KR2A 4QAJA 5BW8A 3O47A 4X65B 3D0QA 2QZSA 2SICE 1YRQA 1AVTA 2QYTA 1OC2A 1QIGA 2W37A 2NGRA 1BJKA 2O23A 3CB2A 3HVJA 5HIMA 4ZJYA 2O1WA 4JT2A 1A4RA 1EKXA 1FFXA 1NXTA 1XL0A 1XDBA 4ARBA 1I3CA 4NMMA 2NMVA 1I36A 1H4VB 4G37A 1C50A 2X7HA 4M1WA 1W0JD 4QECA 5EN4A 4HB0A 3EC7A 3WHLA 1ZUNB 3VU9A 3HKDB 3ZV4A 1QPBA 4KCGA 3BCSA 1SNYA 2B1GA 4E88A 5AVZA 5HK9A 2FR8A 4EJMA 2HGSA 4P3OA 1U0RA 1OSNA 3IB3A 5B6PA 3CLUD 4PG7A 5C7OO 3W9BA 3KKPA 3E7PA 4FFNA 3Q1LA 4KOAA 3GJQA 1Z35A 3HG7A 3A2LA 2J7PA 5LZ9A 4ZGWA 2HF9A 1PVDA 4GWKA 4N54A 2QI9C 3SLGA 5K6TA 2F1JA 3DMTA 5CCXA 2ZWPA 4XJSA 5DYWA 3W1EA 1GQOA 3IMEA 4KXNA 5F3DA 5J40A 2YHIB 1CUSA 3CEMA 2FA9A 3PYLA 1IY9A 1QV6A 1EX6A 1QMPA 1SXJE 2YXLA 3MVEA 2I22A 5FWYA 4LYJA 1J8MF 3KKKA 4LSGA 1PFUA 4R83A 4E7PA 2BFBA 1SM4A 3IO5A 2B1IA 3M4XA 5DBGA 1X7ZB 1TZCA 1WB5A 2QXTA 3WK7A 1MXFA 2CLHB 2IYNA 1Q2XA 4G8BA 3KYIB 1AF7A 2ZSHA 1E20A 5EJGA 4KMOA 2G04A 2Y0BA 2OBNA 1Z47A 4YYZA 4CM4A 4WPGA 1PQPA 4YP6A 1PJAA 3FJOA 1LDNA 4YLEA 4F84A 1C3JA 3C45A 4J75A 3WB0A 3HBLA 5IJ0A 3RFUA 4BCDA 3V34A 4ESOA 2FDCA 2G4LA 5JYBA 4H7FA 4B71A 4FE7A 4ZP1A 3SYNA 4RTRA 1JPUA 1A5BB 1DKLA 3LP8A 1CEEA 1KOLA 4LFBB 4PSAA 1QLJA 3KBBA 5JXWA 4HTAA 4KI0A 4P3YA 1GL3A 4PLGA 5AH0A 4BVAA 4E46A 5J63A 3GARA 1JB9A 4F97A 1T0HB 1C0KA 2WPDA 1W75A 1WQ1R 4BASA 5IEJA 1EXDA 2QIPA 2JAOA 1B2RA 4AJEA 1JR4A 2Z9DA 2H2GA 2BHSA 4CMGA 5I8PA 4FQ7A 1GSAA 1KI6B 1OXBB 3THYB 4LJ6A 3SKVA 3FYHA 5J2UB 2PJRA 2XYRA 1XG5A 2CEAA 2E4YA 2QQFA 4EYSA 5K0EA 3N8NA 4BLPA 3FUTA 3NBMA 1T5TA 5B58C 2J45A 4WOJA 3K9NA 2QLFA 1I6MA 3VYRB 1S8AA 2O05A 5BT8A 2CF6A 3QFSA 4C4SA 2XUOA 4AQDA 5DJ5A 3DPIA 2VHWA 4OKNA 5LP6F 2VJCA 4IAOA 4UE2A 2YNMD 3H1EA 2DQZA 2WWXA 2ZBGA 2VHTA 1P9WA 4FI3C 2APJA 4G0QA 4HPJB 5F1OA 2WT9A 1VPTA 1BQ4A 3FB4A 5IJWA 5JZBA 2YQZA 2I8CA 1FY2A 2PLAA 2PHZA 3T3DA 4Z2AA 2ZIXA 1RJEA 1R6UA 5EZSA 1GHTA 1GNVA 1CG6A 2DBVO 1T5IA 2H48A 2IXTA 1DKMA 4TZKA 3WV5A 4AKEA 3MAJA 3LJKA 3VKFA 5IM4A 3C6MA 5FFNA 1YZLA 1T9HA 2VKQA 1U31A 3RRFA 2CLLB 1J2RA 2D3TA 4AY3A 2TRSB 1WXWA 4H27A 5KOHB 3QPUA 3QKSB 4LJSA 2PS0A 3AZPA 2ERXA 4LJ8A 1VCMA 3TQHA 1OLSA 2L0XA 3Q6IA 5EXEA 2XYVA 4YMLA 2IPLA 3E9NA 4B35A 2K87A 4LHWA 1P39A 2HBZA 5AM0A 4Y0NA 1II0A 3QNWA 3ZDAA 1E9VA 4O0LA 1EE2A 3C43A 4P32A 1JDVA 2JJ8A 2WAOA 3TQTA 2X7XA 5F1YA 1LDYA 4RHTA 2H8KA 4X0EA 3OAAA 3WL4A 2C8JA 5C9ZA 6ABPA 1WKBA 1ZGAA 1Y3IA 1OPRA 3VYSB 1CEYA 1AGYA 3BE4A 3BXHA 4MQFB 1HUQA 1YE3A 3F1KA 10MHA 5DU2A 4BPRA 4BL5A 4K9NA 2NVBA 2Q6VA 1ZI9A 3OBBA 1DO0A 4LC0A 1MVNA 5EJAA 1G7SA 3MBIA 5BMVB 3WL6A 2WKWA 4M7PA 1ZC3A 3EEQA 1AGRA 3QHAA 2OD2A 1JBEA 3OE7D 4WUTA 5KU7A 3PB3A 1NTRA 1RHMA 1A2BA 2R0QC 1D2MA 1P33A 2WAAA 4FHZA 4RHYA 3PR1A 1RXYA 1T9AA 2BONA 2QE7A 2ZJ3A 3AJ8A 4G07A 3C16C 4KI7A 4MWEA 2XZTA 5M7EA 1WEHA 4X9XA 5LP1A 3UPTA 4CEIB 3H5WA 3VMMA 4E03A 2X3UA 4MYRA 5HK8A 2PPVA 1N8SA 2E4WA 2OV4A 2C0CA 3B2NA 3I8SA 3NHAA 3Q7PA 5B7PA 1VSQA 1Y63A 3A6HA 1T2AA 2Y1WA 1L7MA 3B7WA 1H3NA 2HNBA 2EFDB 2QRPA 3H11B 3AC0A 4JKIA 1NU6A 4H4EA 3D6UA 4JIGA 4U2BA 1LS6A 1KK3A 4Z5XA 1L6IA 1XA0A 3FHJA 5G3ZA 3RJ5A 3HKCB 1XCMA 4JX9A 4PIPA 3ZBPA 5IXSA 1PEKE 3OE7A 3QYJA 1I4WA 3NFYA 4CXMA 4P80A 5T41A 3U3MA 5T5QA 5BW6B 2BI4A 3LLUA 4MO2A 4MI6A 1XR3A 1U0LA 3NTXA 4BP1A 5BR8B 2UUAB 1QVVA 4JXXA 1QP0A 1BTOA 3REGA 1MEJA 4HWOA 1SUWA 4IG9A 2BGWA 1P61B 3GRKA 4DIOA 1H23A 3UXYA 1LFAA 1ODKA 3KT8A 4Q1FA 3DLTA 5K20A 2WUFA 3AVYA 1SK8A 2BH9A 3GRPA 3O5AA 4G0PA 5TIIA 2RGBA 1JVNA 3GHHA 4D9BA 2R00C 5BSVA 3T4XA 3UG7A 4MVXA 2EX1A 1HA3A 3HA2A 4HH1A 4RABA 5IARA 4TLBA 1EE9A 5E7MA 1IFXA 2FP3A 1QRDA 4YUYA 1UQTA 4AQ7A 2O50A 3JQBA 2Y2VA 3ZNQA 3CPSA 1N0UA 4A92A 5A4MS 2UZAA 1QM5A 3RUPA 3BK1A 1Q0RA 4LY3A 1EGAA 2J9XB 1PFQA 1RWPA 1RXIA 3MWLA 4IDEA 2QUBA 1KP2A 3OT1B 4FC7A 2ZJ1A 4I55A 4KQJA 3D1VA 4MYTA 4QREA 4NEQA 5ALJA 4JA0A 5FBLB 4IINA 3TAUA 4R4JA 3TR6A 3ZHRA 4NICA 1WUKS 4XGRA 1NU8A 1T36A 4NBLA 4YVFA 3RG8A 5HRCA 1V2GA 1KDPA 1VG0B 2HEIA 3F5MA 3PC8A 4ZOLA 4GOJA 4K9DA 5HTKA 3W2HA 3SXJA 1ZVKA 4IX1A 4RV5A 3VGJA 1E3QA 1MX3A 2ZBUA 3QLVC 2R751 3KO8A 1SBNE 3NXKA 5C8YB 1CB0A 2AUMA 1H8EA 2FSVC 3F3MA 2J5XA 1D2NA 4F46A 3CLHA 5B4UA 2QBYA 1GILA 2DULA 3A28A 3BGVA 3NM5A 4QYWA 4RYDA 4BQEA 5I7RA 3TDMA 3L6RA 5ADVA 1DBRA 2FCAA 3OCVA 2HLHA 4RV9A 2X8BA 4LVNA 3SR4A 3WLEA 4BNWA 2P6RA 4PNEA 3EIUA 3GCDA 3H9BA 5K9ZA 1VGVA 1CZKA 5LXTF 4EGJA 2VA8A 3ELDA 4II2A 5HDQA 3ZTYA 3W2GA 1ADGA 1FNNA 3ORYA 3UCXA 3V7FA 4KXUA 2B20A 4MJ3A 4PZ0A 5GV7A 4QQ8A 4B84A 4D4HA 4FMCB 1Z8NA 1FS4A 4I14A 1YU9A 4FWBA 4E15A 3O8QA 2GARA 2JCSA 3FSJX 1K6MA 5LPNA 4ZPXA 3OY2A 4PGFA 5AVVA 1SEPA 4F0JA 2F3UA 4K9MA 4R0VA 2Q3BA 3CKKA 1V5EA 2JF0A 4UDYX 4D3FA 3M3PA 5LJLA 4L4RA 2PSDA 4IILA 2FFHA 4L5YA 1VM6A 4EJ0A 1VECA 4D9NA 1QNFA 1JB1A 1P62B 1UEJA 4OXNA 1W5EA 1UKBA 3U17A 3D6VA 4D82A 1TEXA 2WYUA 3ANMA 3OQJA 2PGDA 5HS4A 5GJWC 3PC2A 4JV5B 3AKCA 4FMDB 4JIMA 3P96A 4UD2A 4ERNA 3KSBC 2E6KA 1J5EB 1F06A 2GVNA 4JP5A 3AIMA 5TGTA 3GPBA 1WCXA 4NULA 4BMSA 1ENPA 2IYLD 1ULHA 1OYVA 3BMOA 3BIXA 1UJMA 4I8IA 1XRNA 2MSWA 1HI9A 1WG8A 3LI2A 3LUPA 3Q1KA 2GZMA 3IPAA 2ZSFA 4G1VA 4H16A 4Z99A 1JLMA 3LUHA 3A1TA 4QJ3A 1MRNA 2WMDA 3EFHA 1KZ1A 4BE9A 2BZ0A 3OWXA 7REQB 1XKXA 3HTXA 4TLDA 2VXOA 2H5EA 5FUBA 2R1TA 1MFZA 3UQZA 621PA 2Q4TA 2LBPA 3CF0A 1K98A 1I5OA 5FI1B 5AUOB 3IP3A 1AS0A 3WYDA 5K6RA 4DV6B 4E1BA 2IT1A 1KVRA 3KD2A 1DMSA 2W2PA 5F9FA 2P6OA 5KNCD 1XMPA 4KGZA 5JAIA 1N6LA 3G5MA 1M6VB 4V2UA 4O2BA 1YSCA 1H1LB 2QYOA 5TPWB 5FR2A 2WD8A 3L7YA 3I0MA 2B61A 3B6EA 3C6YA 3C8HA 4WA7A 2X9QA 3LCRA 1E3TA 1PZEA 2Q0QA 5CXQA 2ZTVA 1MOSA 1XD2A 4OHPA 2CDNA 1ACLA 1IM5A 2HHHB 1UUFA 4UOZA 2BR5A 2YJGA 4L9WA 4ZI7B 2NOAA 1JIVA 3IQEA 1KJJA 1OE0A 1A2KC 2J3LA 4HCJA 2YZ7A 3RYIB 1K86A 4YJ2A 3ZHYA 2EQAA 5JYCA 3U3RA 4ZEMA 5KNCA 4L8LA 4PLVA 3X1XA 3E2MA 3MXOA 1UJ5A 2PX4A 5H9WA 5JPDA 3HXPA 3LOQA 3UQYS 1U2DA 1KKUA 5LM3A 4C22A 5M29A 3DYVA 3G23A 2VYQA 3AI1A 4PY2A 3OD5A 4L8GA 4XYMA 3RK0A 3OJCA 3SF8A 1BW9B 3Q41A 2WSSD 3F98A 1G21A 3TJMA 1WEKA 5G0SA 3IPRA 5DX8A 1JQDA 2J9FA 2IY8A 4RWZA 3TBKA 3MQ4A 2IRWA 2VHVA 4BO0A 1G9SA 4OAQA 1APBA 4JQYA 1GKUB 3Q7EA 2OORC 3P4XA 2ID4A 4KQIA 4PS0A 1X87A 2PMKA 2GILA 3L8DA 3O4JA 4K3VA 1IBLB 3E9ZA 3CM0A 5DGIA 3NKVA 2IZ0A 3JD2A 3WQBA 2FSFA 1MW9X 4P3XA 2BI7A 1EWVA 4C20A 2VRNA 2Y27A 3WB2A 2ECKA 4HN2A 3MTJA 3KQLA 3GMDA 5AM3A 2GHQA 1UBLS 4XWKA 2YV1A 2OHOA 3DDSA 4YUAA 4MUAA 5JJKA 1D1SA 1SUFA 1IB0A 1JJVA 2AQIA 4R1LA 3MD9A 1I7DA 3OE1A 4GXRA 4HX2A 2NQ2C 2KW5A 2AG1A 5H0IA 5A7GA 1OFIA 5KAPA 4WCVA 5K3SA 4NFSA 4EKDA 1A9OA 4FZ3A 3UJAA 4HADA 2XMPA 3EDMA 1CTQA 3N59A 3MMNA 4KGXA 1S1MA 3G13A 5EWMA 3H4MA 3P0EA 3JQAD 3HJFA 1M2WA 3R3SA 1ELOA 3QY0A 4HEA6 821PA 2RAVA 1P8AA 2VJQA 2FH5B 1NT2A 4FR5A 4RC9A 4CQMD 3R8FA 4BXOB 2ZWVA 4MPJA 3RU9A 2LVBA 3AH8A 5F5NA 1CUJA 1V8ZA 3R7SA 4O8ZA 2W2VA 4IQGA 1NW9B 2YJNA 3B78A 2QUKA 1PJRA 2GZ1A 4DXHA 3U16A 1BCSA 3H83A 1KEPA 2AR9A 2CLSA 3C7AA 4O4HF 5D3MB 1E0AA 5EMNA 3VO8A 5JYEA 1XZJA 2QQGA 3JYLA 1W49A 2GR9A 1WA5A 1ZWLA 2H4YA 2ZAYA 1KAGA 3FAKA 4WNCA 4B74A 2WHEA 3EUFA 3KWLA 4X95A 2CXOA 4PLPA 3KQPA 3RC2A 4B79A 5JISA 3W6ZA 4A82A 5BVGB 3RVRA 3TLGB 3W8FA 4MW9A 1PNOA 3IALA 1XQVA 3JASB 4JSTA 4Y98A 5JU6A 3LNCA 1XMQB 4FVTA 1SHKA 2E55A 1I6LA 3DW1X 1Q1NA 2RJOA 3KM0A 4B3JA 2OXIA 3CH7A 1SG0A 3N76A 2DZDA 2OZPA 3TZCA 3U3XA 3ZEIA 3IXMA 3CTMA 2VQ6A 2FJPA 3GN2A 2GPSA 3GOHA 4PZLA 1R8SA 2C95A 2J87A 1ZH6A 1DUVG 1KFJB 2J09A 3MTGA 3QG5A 3T8YA 2Z43A 4RUKA 3T3EA 5DIFA 2EW2A 2QJTA 3R9KA 4COOA 3SHVA 4FHCA 3GG9A 1J0EA 4FP9A 1TGVA 4TKVA 4PNPA 4GS5A 1ISHA 1SBCA 2Q9AA 4U0JA 4V38A 1TMOA 3VNSA 1I33A 4OTZA 4XQCA 3EXIB 4PBRA 4Y1RB 1Y1RA 4H7JA 3NRBA 1Z06A 2PSJA 4N7JA 1DG9A 2FEMA 4Y9SA 1QIKA 3S2UA 1ORTA 3OQIA 1JG3A 4A8PA 4ITVA 4PFQA 5AFSA 3FPSA 4S3MA 4K9QA 2H65A 1TYCA 4R1UA 3G85A 4HDRB 1TF7A 2OAQ1 4X1YB 1O3YA 2NU7A 4P5EA 2GERA 3VBCA 2OCGA 4CZ2A 2QYSA 3EOZA 1G8SA 4UVIA 2GF9A 5TEWA 1ULZA 4UXHA 5EPEA 5K8JB 2E87A 2MT9A 1ZOIA 2JLWA 4FFSA 3MPUA 3AF2A 3W5BA 2FPPB 4B31A 1ESMA 1ZNZA 4RVCA 3L5OA 5HFNA 1OMOA 1COWD 1JHMA 2A30A 1V11A 4GPAA 4NEHB 3FZNA 4OUDB 3VR4H 3Q3JB 1Z0SA 1Z5UA 4RVFA 4CTKA 5L9AA 3IDSA 4RF3A 1T1SA 1H6DA 5JLJA 4CLRA 1LRJA 3IOEA 4U6NA 1BJRE 2DE0X 3OEYA 1ZIDA 5INTA 1SBQA 2B1QA 1P7CA 3SM3A 2BEKA 2ZAGA 4XPIB 4ZAVA 3REOA 2XCSB 2C9YA 4QASA 2YQ5A 3DE4X 2GK3A 1JA0A 2O2CA 1IUPA 3A3KA 3VSEA 4C0KA 2CYAA 2GO7A 3FTNA 3PGA1 4UUBA 1GOTA 2VCHA 4JLWA 2JLYA 3PFWO 1YAHA 2A0WA 4M8IA 1COWA 4RGQA 1NJ5A 3C85A 4JITA 1KO5A 2O2GA 1NJGA 1L6RA 4KAFA 3JQ8B 1F8GA 1GGJA 2NZ8A 2P8JA 2W6NA 3CZMA 4QTUB 2RC6A 3EGOA 1X92A 2WJYA 3T5GA 1ECCA 3B3GA 1WB6A 3UAXA 2XW6A 3JTMA 3WGLA 4DABA 1FDRA 3RFCA 2FPSA 3ZDCA 2B1RA 1SZCA 2MYPA 4TMVA 2WICA 3HMQA 3QE0A 1KAMA 3ZXUB 1Y89A 1K3UB 3SDZA 3PR3A 2C1ZA 2JFOA 2BKVA 2FHSA 1R5JA 2WVAA 3ZWWA 4DLYA 2ODAA 4MW0A 1N34B 1JEYB 5CT4A 5KQLA 2F62A 1SQFA 2ZSDA 3BGSA 4HNAA 4MTLA 4OP1A 4B6SA 3G1WA 3U31A 2H3EA 5FBQB 1VYVA 2EAUA 1EBUA 3DS8A 4FNAA 3X1ZA 4Z0HO 2OXFA 2XIQA 1QQ7A 2XWBF 4YJ3A 4CCYA 4ENWA 4PCUA 1ENYA 3AEQB 4BKUA 2V7EA 3M6MD 5CLLA 2PSHA 4IHKA 2RHHA 3EWSA 5CFMA 1U94A 2H31A 2NNLD 4RH0A 2J3DA 2W71A 4MRNA 4FBGA 3V33A 1L1QA 2B83A 2HSWA 3V8MA 2I99A 2BFCA 1TK9A 2ZBQA 3A26A 5JASA 1LS1A 2ZS8A 1L5QA 5HHTA 1SUDA 2ECFA 5L6MB 1PYOA 3IQWA 1SCDA 1G5IA 1OGIA 2CFSA 1E8MA 2GBGA 3D2CA 4AM8A 2P35A 4P2GA 4TTTS 4N65A 4ENUA 1QRRA 1BFDA 3KZVA 4A73A 5TMBA 1UP7A 5J2TA 2CV1A 5KAMA 3BGOS 4ZOEA 2VQFB 4IHJA 1U6IA 3ML1A 4MAMA 1FSPA 1E0DA 2CMGA 1GIAA 1Y33E 2IYXA 4PN3A 5KCZA 3KALA 4YMGA 3H1PA 2AC2A 5D5QA 3UHAA 5C8VA 4DLKA 1JG1A 4DIMA 2PVCA 3A3YA 3K4PA 1JFFB 2VJAA 1KU0A 4RMNA 1S3GA 2X0RA 3BJRA 1VPLA 3K05A 2C5LA 1ISSA 5DI3B 5E9WA 5JE8A 1GKYA 3A2MA 4HPXB 4NIMA 4QJIA 2YWCA 1M1ZA 3W8DA 3ZU6A 1WPQA 4E13A 3DMTC 1DTWA 4WBNA 4F2HA 3EPKA 3GLHE 4FEAA 5CA1B 1N5KA 3LVBA 4FOLA 3DUFA 4GVLA 1DADA 1Q3TA 1TADA 3FTCA 3NHYA 4HDSA 1O6GA 1SXQA 3TQQA 2FN8A 2C83A 2J6HA 4MLPA 4ARSA 1AOXA 2LCQA 3UT5B 1RRPA 4MQ4A 2QRQA 1T9ZA 4OIFA 2D3WA 3MMZA 2ZU0C 1XNQB 1E7RA 3G2IA 3ET5A 2O3UA 4BFYA 2W4QA 1GA1A 3CLUC 4D3XA 1LVUA 4D46A 1C8LA 3P9IA 3W8NA 1TOAA 5AICA 2A3RA 5GONB 5HMMA 4BU0A 1RI2A 3HHEA 3OLZA 3GUZA 3EGIA 4PEVA 5DGXA 1M7BA 1XVUA 1Q0SA 3DOOA 3ZU3A 6REQA 5LMNB 3ZY2A 3L18A 1RQ7A 3BWMA 1IZ8A 3TCNA 1L7DA 2FWAA 2NVUB 2PMEA 3PGMA 3VPAA 3NONA 4AO6A 1G55A 3G6KA 3N8DA 2N9UA 5CEJA 1F48A 1GAJA 4YREA 3PUWA 2WFZA 5EIXA 5CK5A 1MCZA 3P1JA 5LMUB 4IEIA 2GPAA 4B3CA 3ZUGA 3W5DA 3UIEA 3DFMA 5FQNA 3F71A 1YR6A 3SJ7A 4EUHA 3A9CA 4F60A 3RJMA 4A2QA 2O54A 1GQSA 1H6AA 2HLDD 2VHCA 1A82A 1CLUA 2IEDA 3GBSA 4LTMA 1FMLA 2JJ1D 3UCFA 4MCJA 4RK6A 4IGIA 1ZG3A 3UAOA 5F76A 4NJOA 4RD3A 4HBGA 5LZ5A 3ABIA 3AV3A 5TPZA 1HYBA 4B34A 3IAS1 1BYUA 1MT3A 1G5HA 1NMSA 2B8EA 2XNDD 3NJRA 5IZCA 3WAJA 5F2OA 3QM1A 3WO0A 1E0KA 1H1TA 1RRKA 2O0HA 3FSEA 4LYDA 1IRXA 2RGEA 3L6OO 1BWPA 1G6Q1 1TZKA 2J32A 3HP4A 4KJXA 4V1CA 3ZWAA 5EAIA 2JLZA 1FSZA 1DX6A 2ZYSA 3F4LA 4TVBA 3Q8MA 3ONDA 2CJYA 3R20A 1QS0B 4MWTA 2NU9A 3WLRA 3HXOA 1XRMA 4CCSA 2FSHA 4DEYA 3JRXA 3LL7A 4OXKA 5SICE 1BU8A 1Q91A 1PUJA 2QR3A 5KYXA 5A02A 1PK7A 4R2KA 3HJRA 2PUJA 2YW9A 1R00A 3IBFA 3M8KA 4ND3A 3NIGB 4X5OA 4BNMA 5L4SA 16PKA 2AZDA 4IQ0A 1OVGA 3A9VA 5B58T 3QEMB 2ZQYA 3HJCA 5FNVA 5KSWB 4TLCA 2WU1A 1KYZA 5TMPA 4BFVA 3W04A 2HV9A 2JAWA 1TVCA 2OYSA 1I3MA 4KR7A 1BU5A 2W83A 1R0RE 3G2HA 4KBYA 4ES6A 3PGKA 4LF6B 4IIJF 4Q4AB 4RLFA 2O14A 2YV5A 2PEYA 4AC9A 2QKYA 4TL8A 4OBWA 4ZKEA 3ONNA 2YNMC 1QQAA 1VE1A 5AQEA 2Z3WA 2AIRA 1RYEA 3K9BA 1UP6A 2DH5A 5KQPA 1HDXA 1ZJ5A 1QGED 5JNUA 1A8IA 1M2VA 5ITSA 2C7QA 3BERA 1RXEA 3FFXA 5K0FA 3DOIA 4B6EA 1H3EA 3LSYA 5CBPB 4FB4A 3DP7A 2ZUFA 1X14A 1OZHA 4X1KB 2RDMA 4B9EA 1A8HA 1IQRA 3PX7A 1WXFA 3D0OA 4KGVA 3PDIB 4PX5A 5HSGA 1AB5A 1N7JA 4M9QA 4BJ1A 1E7YA 4LDRA 4YJKA 4CVNA 5K0ZA 1YUBA 2YYZA 3BMQA 3QZUA 1WB9A 2WTUA 5K4GA 1TU0A 3BZWA 1EJBA 3UNXA 3AEKB 1Y7IA 2JI8A 1OWPA 3CW2A 4E07A 1VIMA 2O2DA 4MJ7A 1ESNA 2TMDA 5I7OA 2L18A 2BAGA 1YZYA 3L9XA 1Q0HA 3GCXA 1TVKA 3F5SA 5I7HA 3LA8A 1NUTA 4U7TB 2YJTD 3GVIA 3RRNA 1NVVQ 2N46A 4HYYA 2X0JA 3V4VB 2W4IA 4D3ZA 1A5SB 5T57A 1R8YA 3LX8A 4GH5A 1V8OA 3V1UA 4U2CA 2HL6A 5KNLA 5F3WB 5ALZA 4BATA 5BSKA 3TECE 3KD3A 1FFBA 1JZTA 2PH1A 4RANA 3PXBA 5BWBA 5JSUA 2WG0A 4R3UC 4E6PA 2BZGA 1DINA 1UC4B 3IC5A 1TCVA 3G0DA 1XXLA 5D85A 1XQWA 1J90A 5IULC 1FUYB 2NX2A 1YJCA 2ORIA 4H3VA 1VJDA 3P27A 1K8XB 2JH3A 3HSKA 3PUVA 3SY8A 1X1QA 4EGQA 1KY2A 1XAJA 4RFVA 3MCUA 3RTDA 1E2PA 3W90A 3ILXA 4BEJA 4ZHQB 2W42A 4DIDA 5FBKA 3CT6A 1NBEA 1KP3A 3JTEA 2BUCA 4YJHB 5I9LA 2CV0A 3U49A 1EGMB 2ZVDA 2WTMA 5P21A 2A84A 1F6BA 4D5EA 3IJPA 3GRCA 3WNCA 4GMGA 3BIFA 1EX1A 3FNHA 3GLFA 1VXOA 1KWKA 3CUUA 2AR7A 4ZMSA 4OGLA 4H31A 4UPVA 2I2CA 4PQFA 4DCGA 5CDUA 2JGDA 4UUAA 2C3PA 4URZR 2IV2X 3UUWA 1GFIA 4FCVA 5AOCA 3UUGA 3MNFA 2FW7A 3O8OB 5EP4A 3LD9A 3P2YA 4NWIA 3AHHA 1OXKB 1Z18A 2FW0A 3QVMA 4GECA 4EPRA 1E5XA 2K6GA 3I2IA 4XFDA 2OCAA 4KVGA 1NJ6A 2W6CX 1GADO 1IVSA 1MT0A 2HMSA 2DWCA 1ZISA 4QD3A 3UMGA 3ZE6A 5LP6A 1DRJA 2PRJA 4N5LA 4LGMA 2J41A 2CLCX 3BBPA 2QY6A 5FD8A 3W5VA 1NC3A 2EQ5A 3CWZA 3I4FA 1D6NA 2VF7A 4M9UA 2A5FA 2FOLA 3VJMA 4LHEA 2V0GA 1K5PA 1L1RA 2PYZA 3IA2A 5ULLA 3KKZA 1CDEA 1Y9DA 2WIAA 1NPDA 2FMIA 4F06A 3OJ0A 1WUYA 3KT0A 1UBSB 1UP4A 5BR4A 3S2ZA 4W5OA 3M6UA 3MGCA 1WBJB 5I9NA 2Q3MA 5BSRA 5A4AA 1CNFA 1WPGA 2B1JA 4I9GA 5GQSA 2CZQA 3F47A 5EPOA 3PP8A 4AF7A 3P26A 1SCNE 1LF0A 4D8YA 1VG1A 3W6NA 4XB2A 4CGZA 2BEUA 3FBGA 2W6OA 1O03A 1VL5A 3QXXA 3UW3A 4C3UA 2YJ5A 4CR6A 1WS6A 2XOEA 2RK4A 4DKXA 2IU3A 5HR5A 4JYBA 1NN1A 4CMKA 4Q0MA 4GDFA 1T3GA 2D13A 2ZI7A 5BUQA 3MJDA 1A69A 2P6NA 2QRNA 2VH5R 3TXXA 1YIOA 2BSXA 2G1UA 3DCIA 5C35A 2X2EA 2ZXEA 3H6GA 4OXIA 3VU9B 2HWUA 4UBMA 5BORA 2H2DA 1T2FA 1R10A 2JJ2A 4X3OA 1JF8A 4IXWA 4B4VA 3E3LA 3O6VA 2ERCA 2P6MA 1XEWY 4DA8A 2GJ8A 2CXRA 3N0VA 2YMQA 3RAPR 4ENRA 2IHTA 4MVJF 5JEEA 1E5QA 4XR9A 1A7AA 4MIYA 2FUG1 3PDHA 2G8NA 3HDTA 1JU4A 4PVDA 1QAMA 1PFWA 3CH5A 1KE2A 4RSHA 1S2GA 3B9PA 4EUEA 3G9TA 3IQIX 4ZIRB 2D0IA 4L02A 3A7EA 3OY7A 3CEJA 4U00A 3VR2D 2PSFA 1PR3A 5EJ7A 4TSFD 4MITA 2XOKD 4DCSA 2P4SA 4AY2A 3FVWA 5BSWA 3H65A 1IN5A 2YRWA 2BKXA 3JWIA 1Y4SA 4J8PA 4NI5A 4JUIA 2Z04A 5MN5A 2V0CA 1WVIA 2WMOB 4RENA 2BMWA 5SY6A 5J4YA 3WQSB 3L46A 4AK9A 3LBFA 3MB8A 2ES4A 3AKEA 4KXLA 1SXHA 3H9CA 5E3JA 2XMGA 2V7QA 1J2YA 3GNLA 4IL5A 3G0IA 3L0ZA 2FW6A 1VLQA 4NONA 4CM4B 2CW5A 3E58A 5IPFA 3NATA 3IILA 4L16A 4UUMA 1C9YA 1PT8A 1ZA1A 2P4UA 4GD3Q 4BNDA 5MFZA 1PU2A 4JA2A 4P4SA 1GZ3A 4AX8A 2FWJA 1VKNA 1LPMA 4QDJA 2FFRA 2O7SA 4J0GA 2PG3A 4EY7A 4M60A 3P71T 3C3EA 3LW7A 4MRPA 5TC4A 4AN0A 2HXSA 4ZYUA 3SEFA 3V8RA 4B3GA 1H2FA 1BMFD 4KGDA 4I5EA 1CZUA 5F73A 2WIGA 3GGDA 4Y2PA 2Q41A 1BKDR 4P1ZA 4HLDA 2DKOA 2YN0A 4JSYA 1BSVA 1L7OA 3U7EB 2RKWA 4R8KA 4DWVA 2GZAA 2QMQA 1WSBA 1DTSA 1LV7A 1ZXXA 4DCOA 2ZJFA 4TZTA 3RV4A 1TFUA 4RJ2A 3PNBA 3RH0A 1RIFA 2P9BA 3N3BC 5F98A 4RH3A 1YCDA 1ECLA 2FB9A 2C3OA 2QJOA 4Y1FA 4F8YA 1E79A 4BUZA 3LYHA 3N7UA 4Q12A 1AK9A 3ZV7A 2ATVA 3I58A 1X7HA 3VPCA 3T5PA 4XGKA 1B8VA 1JJ7A 1GUBA 2PKRA 4GZ5A 5AM1A 2ZUEA 1IXZA 2CJWA 3VUEA 2EFHB 5CM8B 4IDFA 1R74A 2IYUA 2XTZA 5AKJA 2VXYA 1U9JA 1PFVA 4ARZB 1E2FA 1GL9B 1ECBA 4IJVA 4UFOA 2W6JD 3HN6A 5DB4A 2EKZA 4DLNA 1SXPA 2QMHA 4FN5A 3VYVA 5KOJA 2OHHA 1E1LA 1E9EA 3C1TA 4WKCA 2A5LA 3ESZA 2I1WA 1XD8A 4LI3X 3NMUF 1XUOA 4BO5A 2A4KA 4PAQA 1Z39A 2A78A 5D1HA 4OHBA 5CT6A 2GBPA 3M5DA 3WJAA 1JI0A 4QJBA 5K4AA 3PJFA 2BTQA 3AHDA 2XECA 1YE8A 1EZ1A 2CXSA 4FCTA 1U2GA 3VAAA 3VYTB 3LRTA 4Y2RA 4PWZA 4BQOA 2I9KA 2GN6A 1OT3A 5CPBA 4PC6A 4OYLA 3AB7A 5A5FA 1QWSA 2ENWA 3S1AA 3TQOA 5H81A 1B6TA 3AETA 4YV2A 2GSDA 5B6IA 1TDJA 3PQCA 5LXTA 4JFAA 1QRUA 1QE5A 3DFIA 3NVAA 4WZAE 1AKRA 3R75A 3V97A 2W8BB 3DONA 1E2IA 3P9NA 3HYSA 4ZRNA 3RSQA 3RUDA 3WGNA 5K7SA 1S96A 2Q45A 3EGVA 4HXGA 4UAGA 5FQOA 1LNZA 1XRRA 3S2YA 3V6MA 2IUSA 1JIIA 1EX9A 1HYEA 2OP0A 2FUCA 1KMQA 4P81A 1ZCAA 5JHGB 2DT5A 5DTQA 5C81A 1ZJJA 2HA5A 4XWTA 5B5SA 3LTNC 3GROA 3STWA 2NSLA 4QU9A 4F4IA 4UPEA 2ZWIA 1C9MA 1HRKA 3DV0A 3AY7A 3HP1A 1GZUA 2H4HA 3HU1A 3ILSA 3LYAA 4N8SA 4DPKA 1C0LA 3I9V6 5ENDA 1D09A 1FMTA 3R7WA 3T7CA 1U2SA 3T5TA 4FIZA 3H0CA 1KH3A 1TJPB 1Y42X 2X0NA 3JQFA 5AI9A 3GJXC 5DXFA 1YWGO 3DV2A 4BE7B 1MMFB 2Q5FA 4F1KA 5FUQA 5BOSA 5DP1A 1NXOA 3UWMA 2Q8PA 4PTLA 3WY9A 3R0VA 2I33A 3PSAA 4AJ9A 2Q46A 5H4HA 4ZN6A 5BRAA 2E5FA 1V5GA 2VYNA 1JWLA 3QVWA 4ID9A 2GEKA 3A4IA 4I08A 2WG1A 4G67A 4FYXA 3OKPA 4DXDA 4ZQCB 1RHQA 2QVYX 3GDGA 4JI5B 1FXSA 1ZRNA 5GY7A 1C7FA 5AJHA 2TMGA 3ZKWA 4H35A 4TT3A 5D1NA 3X1KA 3TDKA 5I5EA 2PKWA 4RZHA 4X7RA 2ZTLA 4PG6A 3LX6A 2MOKA 2B0CA 2WJWA 4RY9A 3GG2A 5EXTA 4CMJA 2JFZA 2O0LA 2ZRCA 2H59A 3AI2A 3PQ4A 4PS1A 1O8BA 3ZW9A 4DQ0A 4ECEA 1KDVA 1T8PA 3E35A 3PJGA 1NM5C 5JD3A 1XX6A 5G3YA 3ICPA 5LBTA 4BKPA 1RZRD 1PGOA 1RI1A 5ARCA 1HGXA 1Q0LA 3EHEA 4GOXA 3TGLA 3U4AA 3PJRA 2G83A 3HLTA 2CHQA 3ETJA 4GX1A 3NM6B 2AT1A 3DHEA 4Y2TA 1E63A 1KA9H 4BTVA 5IC5A 1WZUA 2B94A 2E82A 3BEOA 3LXXA 4QT4A 5HIKA 1S2MA 1GKLA 1RM0A 1S2NA 5A3QA 4QZVA 5JG7A 2DUNA 5KNDA 4RCVA 4JVLA 4JD5A 2DQKA 4ZZ2A 3WB1A 3X44A 1ZMBA 3ZY6A 1K4KA 4F9EA 4CTNA 3UA3A 3W1VA 1P0MA 2XEXA 3F8SA 4DPLA 1WE2A 1RZRA 4WDRA 3COVA 5ER6A 1M2FA 1A98A 4IZ6A 3FA2A 4L9SA 2Q3HA 3H9JA 4C4YA 1FX0A 4BFXA 2ZRQA 2HMAA 1T36B 2B3DA 4X3PA 4CIAA 2NP7A 2WMYA 2C84A 1JHRA 5HIJA 4JWTA 1XVLA 2OGTA 4C6TA 1X8KA 3ANYB 3R5XA 4ENPA 2D4HA 3VH2A 3GWZA 3RSLA 3FD8A 3FJ1A 2QN7A 4OHRA 2JASA 1V1MA 4AL4A 3FZQA 1OTHA 1K6JA 2CL5A 2X5XA 4QOIA 5DGHA 1P5HA 4OIMA 2FHPA 2GBLA 3K0AB 3RQSA 3EPHA 5AKLA 5JQGB 1XMIA 2CZGA 1AM4D 1EGVB 521PA 3KQVA 1TKAA 1KH1A 1P7WA 2ZXFA 4UQPA 4URFA 1D4AA 2RKBA 3I4LA 5IWAB 4WMLA 4NZ9A 5IDVA 8AT1A 1ISPA 3ZIAD 1VL8A 2WFAA 1P75A 3UK7A 4JZKA 4LCJA 1DHRA 3ELBA 5FPYA 4D2IA 3TR0A 3G0BA 1HDZA 5EQDA 3FR7A 3GMIA 4BMCA 4FIDA 4YXFA 5KUTA 2GN9A 3IE1A 3EVGA 2R8YA 3MMPA 1G8JA 3MWFA 4G6ZA 3FBTA 4K2HA 2KBFA 4JZYA 4B5KA 1SBYA 2NXEA 1JP7A 5J5CA 1A96A 4D0NA 4N82A 5BYKA 1JHOA 1F12A 3DCJA 1L7PA 3KCNA 4YJDA 4HNQA 4MZXA 2G0TA 2XF2A 3G5LA 1CQXA 4YRRA 5DLYA 4EQ6A 3P5BA 4DB2A 5CLQA 1UXHA 5JSQA 4BB6A 1GEGA 4RDIA 1M1UA 4MV1A 1UT5A 3WHIA 1PDOA 4MEAA 2YX1A 4BC0A 2O5VA 5HJ5A 2Y1LA 3BMCB 3WBBA 4V0MA 4ENSA 4Z2YA 1DEHA 1JMVA 1U7DA 4YTEA 4RVNA 4BRZA 4ER5A 5ICMA 3VVLA 1EUYA 2IBSA 3C3XA 2WLSA 2XV1A 4BAZA 4Q4CA 1UMCB 4K6MA 5UKDA 3FYUA 5FFFA 4O4HA 3BMOB 2NUTA 2Z3ZA 3R0XA 4RZ2A 4XIFA 1ZEMA 3DAPA 4FYIA 3IULA 3M5CA 4MTCA 2HPVA 3AM4A 4I1UA 4LPSA 2BDTA 2Y1CA 3ZYZA 3SWWA 3FPEA 4GWLA 2R1TB 4BLRA 3SQLA 4QBKA 1F2DA 1SK9A 2CVPA 1NQ5A 4QSHA 4LJLA 2WFLB 1V3UA 1VL1A 2VRWA 4RD6A 2GO1A 3JARA 2C5EA 3U9SA 4PGAA 3EZ6A 4O08A 1XTIA 2YTZA 3OA0A 3AL3A 4R8LA 3ZX4A 5HGXA 1O0SA 5KEIA 4QU5A 3HV0A 3OEHA 3K2QA 1KBZA 1XL1A 2XB8A 4LWZA 1BXRA 1XCLA 2BGMA 1MVLA 3RS9A 1CNMA 1I1NA 4LS3A 2X0EA 2YIDA 4CKZA 1SQGA 3A6FA 3ITNA 4XI9A 2EJUA 4AJ1A 4UJ3A 3VYWA 1XD2B 3HJUA 4J1SA 4ZZ3A 4REQA 1QIJA 3ETHA 4ME6A 1F4PA 4HWSA 1NSTA 3TZLA 2HZ7A 4YJ2B 1J1UA 3KQYA 1BVUA 1N2CA 1NBME 2XA2A 3NYQA 3OEED 3Q12A 4NU0A 3HO6A 1CF9A 2J8ZA 3NZEA 5BMOA 4LV5B 3VTKA 1R4ZA 4WEQA 4XLLA 5DTRA 4BNNA 1YQGA 5A0VA 5DHUA 1IOWA 1XWFA 1SOAA 3OZGA 2BM8A 5K51A 5EMLA 4INAA 4NV0A 4QPZA 1PS8A 3G9UA 1H94A 2J9FB 4TTRA 4D8XA 1JG7A 8MHTA 1RQXA 3VDMA 4I36A 5EIWA 1GUFA 1JAHA 1K7FB 4Q7JB 4C0AC 2Q5HA 5HVNA 1BKYA 2J0UA 3D4IA 2FWNA 2RK3A 3LZ6A 1X8LA 3LLVA 1HG0A 5FJIA 2WPNA 1PWHA 2OYRA 1P3JA 5U9CA 2AYXA 4RVGA 3X1DA 2OYCA 4QNNA 5KHLB 3PQ3A 3QXSA 3WJ1A 3T1QA 2IYYA 3EPPA 4FOSA 4JUDX 5CCDA 5IYZB 4QTXA 1Z4IA 2H07A 2QAGB 4W5JA 1GGKA 3VDNB 4F2PA 1O4WA 3FTDA 3FUXA 3L7NA 5ERGB 1P17A 3MW8A 1L5ZA 4GT1A 3NRCA 4IHAA 2ID7A 3P4YA 2P2SA 1O54A 5ALQA 4EGAA 1NNI1 4EKYA 2BR4A 4MDFA 4XYGA 3CLSD 3D6JA 1BRTA 4LCEA 1OJLA 4AG5A 1C1DA 1GZHB 2W0MA 3CNBA 1DO8A 3SSAA 2PNFA 2Q50A 3G68A 2EL7A 4YQEA 4LOLA 3MJVA 3PEUA 1U99A 1RXSA 3D8HA 4LGCA 5LC1A 4ALKA 2QMZA 4J3NA 2YH2A 5I45A 1I0ZA 3CUWA 4F8JA 3QV1A 2XIJA 2P69A 4ZEOA 3FHOA 1SZDA 2JLCA 3KRTA 2GJ9A 3KV1A 4JEUA 1E9SA 4G2TA 5DLDA 3A14A 3D6NB 4YO8A 5IZCC 4B0PA 1DXQA 1DKOA 2IS6A 3LQRA 1QV9A 2Q1XA 3K1AA 4LOAA 4V24A 3MN1A 4X71A 3U40A 4DLBA 1I4DD 5BV2P 1X13A 1GPBA 1HLDA 1DUIA 3ANNA 4INPA 1NVFA 1BCSB 2AYZA 4WI1A 5ICFA 5H4GA 1LY1A 1UJBA 4HX5A 4BVFA 4E94A 5A3JA 3L4JA 2NSJA 3CVYA 5JS2A 4RM3A 1A3CA 4EI8A 2OBBA 3WLFA 4A2WA 4FKBA 1B14A 2G9QA 3FWPA 4CL2A 3GLTA 1KO7A 3OPYA 5CT9A 4LBZA 4N5NA 2BMVA 2OV3A 2WJ4A 4GBGA 5F7XA 3MJFA 3UATA 5BY2A 1FRZA 4WNIA 5LQJA 1HDRA 2REBA 1I4TD 1W85B 2ZIWB 3MQFA 1Z0UA 3FPLA 1WCV1 4X6XA 5KVCA 1QF6A 4HAXA 1P19A 3EC2A 3TRFA 2XPCA 4EDHA 4ZAWA 3P94A 3WGOA 4EHAA 5KJCA 1JWAB 2IYPA 4G09A 3E8SA 4MVWA 3VR6A 1BOFA 1G5QA 2F7SA 3EAQA 3BMNB 1VKRA 1Y8CA 2V03A 4G65A 5TX7A 5KINB 2AG8A 1PKXA 4M6WB 1FB5A 5FIUA 1J99A 1T43A 3G6WA 3T54A 3MINB 1GAXA 1B00A 5L3QA 3QOWA 5B57C 2AMJA 5JCXA 2IU4A 3PA8A 3PITA 4FGKA 3EF3A 2JAUA 4RA6B 2JGIA 3KWFA 3FIUA 2Y0EA 3OFND 4GI1A 4HB2A 1ENOA 3U7IA 3T9AA 4A16A 1TU4A 4P5PA 4E30A 3JSXA 1QHHA 2FZGA 2QB5A 1BGWA 2MINB 1D1QA 2RCYA 2YFQA 3DZFA 3ELUA 4JSRA 1F38A 4Y6RA 5AT1A 2D5CA 5REQA 4B46A 3QUQA 3LGAA 2GK6A 3NHSA 1ONOA 3DF7A 3OTWA 3WLSA 3N6VA 1MB9A 2CHEA 4HSGA 2I6XA 3R7FA 2J9ZB 1O97D 1J9EA 2J59A 1KOJA 4DCCA 2C0PA 4RA9A 1KTVA 2AN3A 2NU8A 4S1OA 3C6KA 2HJRA 1QHFA 1X86B 1RZ3A 3C4VA 1L4EA 2NU7B 2YYSA 3LHSA 1IQPA 4LXGA 4KYIB 2I2BA 2PUTA 3OFNA 1LW6E 3V8QA 1VCNA 3EUEA 1PVOA 3ZLJA 4RY0A 1QP8A 1YQXA 4YH1A 3L84A 3QF7A 3C4JA 2JIQA 3GLVA 4GBED 4UFNA 4TWIA 3IIEA 5A6SA 1TQHA 5DK4A 2FZEA 1E2QA 1OIXA 1CJBA 1CHDA 2H7CA 4KOEC 1O87A 4I4CA 4TRJA 1KJNA 1CQIB 4MPPA 5CIWA 3ZWPA 4CMEA 4DDHA 3PQ5A 3OWHA 2VSNA 3FDXA 3MTDA 4IDOA 3VAZA 4ABYA 1DBSA 3IQXA 4JJAA 5FBZA 4HJXA 3KOXA 4IEEA 2VT3A 4K6GA 5C8ZA 1C4KA 3DE0X 4QUGA 4MS4A 3RIYA 5CFLA 3RVBA 3GNSA 4A1OA 1C81A 2DECA 4XOUA 4OXYA 4OGGA 3N9IA 1D0SA 2GAJA 2GMWA 2QORA 3H6KA 5I8ZA 4B3HA 4MRRA 4TXNA 3PQFA 2PZEA 2POCA 3VVCA 3B5IA 1NXSA 3O38A 2EOAA 3LUKA 4K6HA 1MO5A 4WHMA 4BYGA 2IHBA 2I78A 2PZBA 2Z8ZA 3FDZA 4B5LA 2XODA 3EEBA 3QI2A 1UM8A 2QG9A 1NUAA 4QDZA 4XE5A 5KI6A 1RRFA 1E1MA 1F3LA 4RA6A 5KHAA 3QE3A 4B4OA 3ZQ4A 3B36A 3LH5A 2I3AA 3Q3VA 3S1SA 3WADA 4UFPA 1RRMA 1SHLA 1IOVA 1YBHA 3OIDA 3D3WA 1XKLA 1E2HA 3SJAA 1GYQA 1QTNA 4IKEA 3O8LA 4R71A 5CYGA 1FTYA 1PKEA 2ORVA 1MEOA 4MI1A 4LV6A 1UJ2A 4DQUA 2VJKA 3SNKA 2VPIA 3EIQA 4WT7A 3TW4A 3M9LA 3ORFA 3VPSA 2HRDA 4MXDA 1UQUA 2XDYA 4L0MA 3R76A 1A95A 4M87A 5BN5A 2BHTA 2HU8A 3O4IA 2W4MA 4HNAB 3ETGA 2OLEA 3EZLA 5LQUA 3NHLA 4ZV4A 1GDTA 2UUPA 3IUSA 1GL6A 1W6RA 1YA8A 3PRJA 4W8HA 3T5CA 1X7XA 4L0DA 2BWJA 1JX6A 3CLRD 2W6QA 2AX3A 4OA5A 3RDPA 4DAOA 4EYQA 3U61B 2X1VA 2FZWA 1VBNA 4G9EA 3FB1A 1HNWB 5BYBA 3Q3EA 3UWPA 5DT2A 1RJFA 2CUZA 1GR0A 2QL9A 1ODTC 2QK4A 3LQ1A 4ND8B 5G4KA 5KCMA 1A0OA 2BFCB 4WNAB 5EZQA 3U3OA 2HBYA 3GT3A 1E6EA 1Y7HA 3NDJA 5BWMA 2FPIA 1AXEA 3IBTA 1TAQA 4DEXA 3T0IA 4DV1B 2HWYA 3H0KA 2IP2A 5CK4A 2IL1A 5TB5A 1UWKA 4XTRA 4MYCA 4ZXFA 3SKXA 3HXQA 2OQVA 2AA3A 4J1TA 1U9IA 4IIJA 5CDFE 2RGDA 2M6SA 4BLQA 5J2TB 2TS1A 3V9AA 2Q6KA 1EK5A 1ZX1A 2C77A 3WIVA 2VQDA 4XKJA 1E77A 4IHJB 4CN8A 3CXRA 1GGVA 2XCTB 4HNUA 5LLTA 3EXHB 1UXIA 2FOXA 3WIDA 4CYMA 1USWA 3BMXA 1CETA 5EVJA 4DM3A 2BCJQ 3L4BC 2O8EA 2V55B 5LJIA 2XY4A 4U7WA 3TQSA 1NMQA 3KTAA 1G0OA 2HK6A 2UKDA 3TUJC 5HKOA 3DLCA 5A4FS 1V6CA 1GY8A 3UKDA 2B37A 3N8IA 2B21A 1FQJA 2VNSA 2IVFA 2GN8A 1YB7A 1RPNA 4TKLA 1AHNA 1E9BA 4NV1A 5EMKA 2IZZA 1ILEA 1GDDA 4JLJA 1CZOA 4YAEA 3GEEA 1BOOA 2BMEA 3K53A 3MT7A 1IBCA 4RK7A 4ZAYA 3CISA 3FFBA 3T4EA 3ZR4B 5IF3A 3DUFB 2I87A 2YMPA 3KP1A 3KLNA 4HDSB 2ZROA 3F3SA 4C0SA 3BWBA 4CMIA 3T61A 1UAAA 3VNBA 2HD4A 4ZZ0A 4PXYA 2BGTA 4L5CA 4E09A 3HLYA 2ZTHA 3W8EA 1J22A 1WXDA 2PD6A 1EFHA 4TV9F 5IKPA 5LCXA 1IQ0A 1M34E 3CVWA 1X7YA 1GUAA 2BUAA 4ALMA 4YONB 1FFAA 5EHGA 1BEEA 3RWOA 1I4EB 5FTNA 4UAJA 3W79A 4EPTA 1YS2X 3FWNA 4GPEA 4U5QA 4P86A 5AJWA 2IH2A 3RC9A 4V3BA 4P7FA 1M74A 3PGVA 1JYSA 2HF8A 4FU0A 1CR2A 1TCBA 3AKZA 2H4JA 2QG6A 4LE0A 2C88A 2WILA 4UTZA 1U3FA 2CJXA 1T3TA 1HE3A 1G2QA 2QUZA 3YASA 2JFXA 2XB2A 3AVWA 4XAQA 3QHQA 2OXTA 3I5YA 3GYBA 4HXYA 1KAHA 2ZYUX 3AVPA 2VFAA 2ZI4A 3DLIA 2SKCA 4LQCA 1QOZA 3QIAA 4OP2A 4CETA 1KQFA 2PA3A 1KO4A 5ENVA 2WWTA 3DE1X 2NSYA 3H8SA 2Z6QA 5KYUA 2QL7A 3KXDA 3S2EA 3AL0C 2BFAA 1H1DA 3IAM6 1GYPA 2A94A 1VLVA 2BFEB 2OFPA 4RACA 5PGMA 1MC5A 2LNDA 4KFSA 5CAEA 1KDZA 4Q1DA 3O3OB 2Q9UA 3D4PA 4FGSA 1NBHA 1DIBA 1LBTA 2C5SA 3A27A 4KL8S 4Q03A 1EZ4A 5BWLA 2J7KA 3PQ7A 4BGDA 4V1CB 1EAMA 2PFGA 5JTTA 1MXHA 4DIKA 3ED1A 1ATZA 4K0KB 3E9CA 1DT5A 1R3UA 3RYHA 3DDZX 1CUCA 3DVSX 4JMLA 1CWUA 5EXPA 1Z9BA 3EGEA 1V43A 1QBGA 3R5TA 2ZWAA 3HZZA 1E2GA 2RC5A 3IQHX 3K9CA 3QE4A 3HCBA 1TT5B 2XYGA 4QXRA 2F9LA 1PG0A 4FBMA 3HH8A 1CUEA 3HUEA 1J33A 4RORA 1GZDA 4L78A 3DQPA 3UJ6A 3UMVA 3EQ2A 3W78A 1LSSA 4H0FA 5A06A 5FNVB 3NC1C 4B4KA 1VMAA 2AVNA 4GI2A 4L22A 4FSDA 4S1WA 2V6MA 3ZGXA 2UXCB 1GG2A 1O8CA 5K03A 4IVPA 1U04A 2RHJA 1W4AA 5DEOA 3C5HA 5K3AA 4QGGA 2C7RA 3JX9A 1Z75A 2KLHA 3V2HA 2EVWX 4P92A 2P91A 1AF4A 3L7KA 3E4DA 1KI3A 2J3IA 2JFYA 2ZJYA 2ZYHA 3CCFA 3JVDA 3LDUA 3PG5A 2HU7A 4HYTA 5FLEX 2X6RA 2GETA 1MEEA 1VFPA 2ODEA 2HGZA 3MJ4A 2NV0A 4RF4A 4JNCA 3ZK7A 3D1JA 4AJKA 4IM7A 2CL6X 4OGKA 1AK2A 2ZE7A 4C78A 2CXXA 1B76A 4YCAA 1XXHE 1JXAA 1RQGA 1IHXA 2C94A 2VCYA 3BF8A 5SY9A 2XQGA 5JS6A 1RYMA 3G2MA 1XN4A 5JSZA 1QR2A 3ETCA 4NBTA 1W6UA 4MVJA 3N0WA 3H97A 5CG1A 4WASA 3U37A 3THWA 4D7AA 1KDTA 3BMQB 3WKCA 2GN1A 4LZOA 3ME5A 3MXTA 3L01A 1XCJA 5G41A 1PEYA 3KZMA 2ZIAA 4BMDA 3HB1A 4NATA 1P77A 4N47A 1HSOA 4OHMA 4FONA 5K0SA 2IK8A 3O93A 3GF4A 2WD9A 3ZZUA 1CZNA 1L4YA 2C9MA 3NIBA 3ODPA 3AWIA 2R1VA 2YVUA 1U81A 4YROA 4MROA 2PCJA 1NI4A 3HSYA 4A91A 5LU8A 1N5DA 2HPAA 3ROMA 4RKQA 1J00A 1KJ9A 1Q22A 2XSZD 5C34B 1UOQA 4AG3A 3E0XA 1ZRMA 1EE1A 1VKJA 3TRKA 1JHYA 3W2EA 3TLXA 5FP0A 2DBQA 1ZGHA 3FLBA 2YWHA 1CUGA 4YDSA 3NCHA 2VT7A 4C21A 4RD2A 3AVVA 3FOAA 1PSWA 2WWVD 1UBEA 3I30X 3A06A 2AOTB 3CUYA 1C2YA 4LXHA 3WZ2A 3KPWA 5HFJA 2CWDA 2G67A 3LIPA 4URVR 4ZKDA 2EZ4A 4FHGA 1AQUA 2VXCA 4NCIA 4RE5A 1JECA 1ZITA 1IOZA 2I2AA 3ND9A 4RZSA 4W6ZA 3BA1A 2P7IA 1Z3CA 3DC7A 5FNZA 4YDRA 4AF6A 4QUEA 4IFBA 4BX9A 1V47A 4UM9B 5AVWA 5KWEA 1U11A 2OL4A 2QUAA 3RV3A 721PA 1HE4A 2Q4DA 3NAGA 5BO5A 3DOJA 3MAAC 4NECA 5DXAA 3OLWA 1XRQA 3EPJA 3C15C 1WUTA 1U2EA 1HTTA 1EA5A 1ZD8A 1Y7PA 4PAWA 3ACCA 4XM0A 2OGZA 4MGZR 5FAXA 5HQ3B 2ZT6A 2HU5A 2ZYAA 3FNFA 4CL0A 1KERA 3X0DA 4UASA 1FYEA 2WAMA 1BE0A 1CZHA 2G9RA 4JNKA 5THXA 2YKGA 1FTGA 3E48A 1IC6A 2R65A 4JY7A 4LC1A 4FOPA 5T3YA 3IQFA 1AO0A 3MTIA 3BH6A 1YZGA 3L3BA 1E4EB 3PVCA 3VV3A 1GVHA 1QV7A 3EW9A 4YAGA 4G23A 3A36A 1DRKA 4KIGA 2EWVA 1EVZA 2C8LA 4NK5A 3ZW7A 3T1OA 4TLAA 1P1KA 2A9JA 2O4CA 1XQYA 3IEVA 3PRKE 5F33A 3EISA 5EMJA 5FL3A 2ISQA 3ZJ4A 5K99A 1MJFA 3GHYA 5I9SA 4UXIA 1ODCA 1FDOA 1HPLA 4M9SA 4ZTUB 3T9FA 3U0BA 1GSHA 1IXSB 1X1DA 3KQOA 4HLCA 4HLQB 2YMMA 2F4NA 2ANBA 4J0CA 1ZIXA 1M2GA 2I6GA 3ISVA 3BBLA 3GAMA 2JAQA 1B0UA 1OFTA 1TE2A 4B33A 3HNPA 4G1MB 3VR5H 4E7OA 3ZNPA 2CVQA 1NNEA 1I3KA 1WIWA 4ZFNA 2D7CA 2RI1A 2REOA 5ALYA 4JUFA 1N77A 2Z58A 1CJTC 2PGAA 4GQAA 1PQYA 4Q7LA 4UJ5A 4Z1OA 2NWQA 3WWYA 3X1WA 4EG6A 3FUWA 4C3VA 2ZB4A 4DFDA 3BDVA 1RFLA 1C4WA 4ANFA 3JZFA 4IP0A 1J5XA 5LA6F 3DF9A 4NZPA 3UC5A 1TQ2A 2QG4A 3AKYA 3DBLB 1HYHA 1ZINA 2X13A 4TMKA 2EBHX 4EGCB 1FMFA 1OAOA 1RD4A 1UIRA 1IY8A 3H8WA 1PT9A 1TTTA 5LQRA 4U3JA 2WINI 1ZFNA 3HBFA 5TY0A 3RAFC 2GPJA 4ZA2A 3HO1A 1GAWA 2JGMA 2POQX 4WUVA 1XU4A 3AVXA 5P8WA 1ZSVA 2HMYB 3ESQA 4E0BA 3SQWA 3NTUA 2JLQA 4KP7A 4F5YA 5CFPA 4UTNA 1IOLA 1ACJA 3D4BA 4S1VA 3ZGVA 4Q66C 4KWTA 2R7MA 3K0CA 3K6JA 1FLVA 4CPDA 3OZWA 3U44B 4ZQEA 4C7OB 4A7PA 2DHEA 2QLTA 4DPMA 3HBAA 4C04A 4N6GA 5L3RA 1PTJA 3BM5A 1QJ4A 4LBYA 5DWDA 3SC3A 4L2IA 2WJHA 3RRXA 4AYWA 1UH5A 3TNFA 1TVEA 1HBJA 1BXGA 1PI3A 2EFEB 1NJ2A 4EKNB 4ZXPA 4R01A 1L9KA 4M9ZA 2IE8A 1VZ2A 1NZJA 3EAFA 3HA7A 3NVMB 5E6RA 1IJBA 1JQBA 4P4SB 4UU0A 3KTOA 5I01A 3JQ9A 2VYVA 1GNTA 2BDEA 2OCXA 4HWPA 4MW7A 4Y18A 3D3KA 4TYQA 1EDBA 3TPCA 1PBTA 1YB4A 3EH2A 5JI3E 4KR6A 1XZQA 5FYDA 1ECFA 1RT9A 2VPXA 4TRNA 4PYKA 3MERA 1IHOA 1UBFA 3UUEA 1V35A 4ZT2A 4JOQA 1C7QA 3HXMA 3AI3A 1S2LA 1ZHOA 3ZU4A 4GOLD 1A9SA 3SE0A 3BAFA 3K6RA 5ARBA 2QP9X 3JQCA 1DC6A 4XIGS 3I52A 4D4LA 2VQ3A 5IKEA 3DHWC 4IDQA 3KQWA 1I10A 2IHUA 3FGPA 4ML3A 3Q5EA 3IAM1 2QNRA 4Q3CA 1PJ4A 1BS1A 1P80A 4HF7A 4JYCA 4RJLA 4WESA 5B3KA 4C2UA 4AU1A 1DPGA 1JR6A 2JLAA 5IAGA 1YDEA 1AS2A 1C7IA 2JB9A 1ECJA 1UWLA 2MDTA 3IQGX 4ETMA 1IBMB 3GWGA 3SHTA 2QL6A 1C3OA 1RMYA 1Y6RA 2CJWB 3TEMA 3EWIA 3FOBA 3NR2A 4KQ2A 2D7DA 4MNTA 1QGOA 5D5PA 2Z56A 1SHTX 5DRTA 4IFEA 1K3TA 3UFBA 3ND6A 5EJEA 4DLXA 2QN3A 3BSYA 2C3YA 1JG2A 4I5FA 3TLKA 5KOJB 3SFVA 1ZN2A 4OHYA 2BP7A 5KYVA 4BKMA 2EKLA 2PY6A 3DTVA 4Q93A 2FRDC 4AWAA 4NBRA 2FQ1A 2PK3A 4F72A 2BTQB 4DV7B 3N70A 5ELLA 5BP7A 4BVKA 1EUDA 1KEVA 3P20A 4OFWA 4NMXB 4ZV7A 1DWQA 5NLLA 5B1EA 4DSNA 1ZBDA 1T25A 2IS4A 4NG5A 4DIEA 1A7UA 2LXNA 4ZANA 4P7BA 1N6OA 3KXIA 3UZUA 3KJFA 2P4HX 1A5TA 4E08A 1SU7A 1ZD2P 1XU9A 4J6EA 5ICEA 2QTLA 1ZN8A 2HQSA 4FS3A 3RROA 1HZJA 5HS6A 4HKTA 4CEHA 1XF1A 3Q3GE 4HT3B 1E6WA 4LE2A 1RS0A 2A7XA 4QO7A 4N6OA 4GUDA 2ONCA 1NVEA 3AR6A 4WJLA 1OZ0A 2GZSA 3N8KA 4ZAGA 3QX3A 2OKCA 1CR6A 3V1LA 4F8EA 3MSCA 3MTBA 4E12A 4S24A 4AP9A 3CZ4A 1H2HA 1UC8A 2FZ5A 3JWPA 4MGKR 2R4TA 4QT0A 5ALPA 3FMPB 4BLVA 5BUSA 2P9EA 4NNOA 3LT1A 4O33A 2NXCA 4D9IA 5AVOA 2ZSAA 4IQ8A 5JSFA 1MAHA 2JI6A 3LBAA 3O91A 3CLSC 221PA 1P9NA 3VH4A 7MDHA 3WNDA 1KEWA 3WGUA 5B3JA 1GZ7A 2XUDA 5CRIA 2L2QA 4MV7A 1UXKA 4YRGA 5BOSB 1O9BA 2P77A 5JSKA 4YHHB 1EM6A 3ZK8A 4XVQA 5BNFA 4FCCA 3UCEA 1OI4A 2WHQA 3SDBA 1JKXA 1ECGA 3O1HB 4PVCA 4AZWA 2CDRA 2PFKA 3WMXA 3NCTA 1OB2A 3RJTA 4A15A 4AMBA 1NL3A 5DH9A 1JRLA 2D2EA 2IY9A 3T1HB 4QULA 1MENA 4IIYA 2C78A 4MKZA 2NO7A 1W8IA 4C76A 2Z9CA 5JDIC 2DYKA 2CHGA 5ADUS 5AW6A 5J3JA 1F8FA 5E7QA 3O8BA 2VZEA 1Y1KE 4LG1A 1ZZGA 1BS9A 3CBGA 3W5CA 1AV6A 2XUQA 4GLFA 4QSMA 2QZ9A 1XZ8A 2QZ4A 3F97A 3PPVA 4KQWA 4Y9UA 3QUAA 3N6XA 3I2KA 3TIFA 3E7WA 3COJA 1JNXX 3PNPA 2EBUA 2NPFA 3QJGA 1U3CA 2MR6A 4JKOA 5BMVF 5JBNA 3OFKA 1HEYA 5I3CA 3HKBA 2PUWA 4DC0A 1KTIA 5EKXA 4M55A 4LHVA 1UJ6A 3OZTA 1T6YA 4EL0A 1KKLA 3GFFA 5EE3A 5CFOA 2AC7A 3BWEA 3X3HA 3FWHA 4D02A 5F3RA 3PFHA 3GFTA 4FSHA 5JO0A 2HDOA 1JS1X 1UC5B 1FFCA 2C96A 1W5TA 1QTRA 3L5KA 2ZDHA 1NN0A 3EW7A 1VSBA 8LDHA 4Z4IA 1QX4A 5FUWA 4KR9A 1F1BA 4F4FA 1M76A 4WFJA 1GTZA 1K9VF 5FPHA 1QFJA 9ATCA 4I1RA 5F5LA 1FX0B 3SBDA 1L7EA 2UUOA 4J0HA 1UKZA 5L40A 5E38A 3VKWA 5IDYA 3NI2A 4YCDA 5HCNA 1OLUB 5I6DA 1EJ2A 5KNBH 3C3MA 4RIIA 1J1ZA 2WDZA 3OPXA 1NVTA 1YE5A 3CZPA 3HCNA 1OTXA 1B3RA 1SKYE 2AW3A 3PPIA 3M6LA 4URWR 1V1MB 3IAAA 3K8QA 6ADHA 3QU7A 3K9LA 3ZY4A 1R4MA 5AJYA 1GKIA 1KO8A 1Z2AA 1QH8A 1X80A 2X6TA 3A10A 3M9XA 4JEMA 4B80A 1T9CA 1LDGA 2ZTUA 3BZUA 4EP1A 5KTNA 2DR3A 1NNUA 1HYQA 1O97C 1X0XA 2OZVA 3I9FA 3TGPA 1MVOA 4AS3A 1L5RA 1KSJA 4ZQIA 2KQUA 5BR7A 1BS2A 1NY6A 3TEFA 3AVUA 4HVAA 2X9GA 4FE4A 1FBTA 4Z4EA 1I80A 5B3LA 1J4AA 1IM2A 4IGFA 4MKXA 5B1SA 2KX7A 3INRA 5KTKA 1HKHA 3BPSA 5BN1A 1AO3A 2EJBA 1N8NA 4K0RA 4KHZA 5TJHA 3WMFA 3ESBA 3VOAA 3KG2A 2A8YA 4D5GA 5HOEA 4BO1A 1YL6A 2VHXA 5GGYA 4L8FA 1REQA 3AERA 2BMFA 5GP1A 3N0XA 3L7DA 4R0NA 3U80A 3WAKA 3H5OA 3ZZNA 3ZJ5A 1G21E 1NI5A 2H51A 2OLJA 1OGYA 1ZYUA 4QG3A 1BN7A 3UJHA 3QA9A 4Q18A 2ORWA 2ZSEA 4EQ6B 3DAGA 3MJEA 4QVKA 5D51S 4YEDA 2DLCX 3LQ2A 5AJVB 3HFSA 1GXSA 2VSOA 2XUAA 5AJXA 4KNWA 2O3QA 2GLUA 3E3NA 5DW3A 5G1NA 5JAQA 2V97A 4ARAA 2JRCA 3X2FA 1IBKB 2V0NA 2O1EA 4N9WA 2OENG 1SJ9A 1IEXA 2FRXA 1C9DB 4IOJA 4JLBA 4LNHA 2IDJA 2H16A 1P2SA 2Y1OA 3UJDA 3RVDA 3NJ4A 1NI3A 2ZB3A 1I4LD 1XTBA 2VAXA 3ICQB 3IR6A 3RGWS 3FYUB 4EBBA 1YUMA 3KYDA 3INNA 1NQUA 5JFTA 2F17A 5T6BA 3QI7A 2GYVA 5BN4B 1SBZA 2NUTB 4A8JC 5GADl 3KQKA 2XQVA 1INLA 1KPIA 1U7XA 1XYYA 3DMNA 2NXJA 1E92A 4KJZA 4M99A 2AB0A 3MG9A 3HUUA 4FMCF 3ZWNA 5THKA 2RGCA 3ZH2A 4DT1A 2ZEJA 3GA5A 3ROEA 4AMVA 4ZI2A 4RF5A 3UOAB 1XN1A 4PN7A 1OWNA 1O6BA 2XB6A 5CITA 4UVGA 1OHHA 2DR2A 4R2WA 4NAHA 3B1YA 1ZNYA 3WNVA 1FRQA 3RIEA 3ESAA 5GPBA 3DZHA 2R7LA 5EMHA 3SJCA 1IK6A 2G5GX 3JARB 4FTWA 2A9RA 2EDAA 3UT6A 4HGYA 2X14A 1AGNA 1P5ZB 4L57A 1NYLA 1L8AA 1OQAA 1UPUA 2PIDA 2PS3A 1YMQA 4DLSA 3U5TA 4LSWA 3B3AA 3ZHTA 3LYUA 2R5WA 2X8LA 4KZKA 3TMAA 1TYZA 4KIWA 4P4TA 5DDIP 5DHTA 3U39A 1JDBC 1EGHA 4MS3A 3WGHA 2QPLA 3CLRC 4K6OA 1LBEA 2YFKA 4N5DA 4FMDF 3ZD9A 2BGGA 2B5WA 1T8UA 1WAMA 3BD6A 3E2IA 3PXXA 4RLQA 1TM2A 3NEPX 3DNFA 3NKLA 4YIKA 5JIBA 3ADBA 2CB0A 3R09A 4AD8A 3RC8A 3BAZA 1VP3A 5G1OA 1X9IA 1N2CB 4JMPA 3U09A 3ORSA 4U2DA 5F51A 3ZHOA 2I71A 4EX7A 1E1QD 3ZCPA 4ZEVA 1Y8QB 1E6MA 2BN4A 2GVZC 1SA0B 3GEBA 3IERA 2FXVA 1CY4A 4YRFA 3IPLA 4J16C 2GT1A 2RHTA 3DEZA 1NE2A 1IBRA 1TEHA 4BX2A 2VN8A 3AIKA 1K0FA 3ITEA 1Z0ZA 2J4CA 1S2OA 4RZQA 2ATXA 2ORED 5A2QA 2R8BA 3GJ6A 3I34X 1BZYA 2G1KA 3LDAA 2VJBA 1ZGJA 4KN5A 5FEMA 5IVDA 1DBIA 1HMPA 4YRBA 1AKYA 3K70D 2AFHA 9GPBA 4DV2B 2AKEA 4NHEA 3ZQKA 1PJ3A 1KAEA 4ZQGA 4B7XA 4MWCA 4DWWA 3DOFA 1FNBA 4H15A 1SU4A 3PLAE 2R6GA 3KXKA 5FXMA 1KYQA 4BBJA 4HX9A 2BZ1A 3LOPA 5HKKA 1XHEA 5IUKC 3IEIA 4RJIA 3F5QA 4GBMA 1NZDA 1T2VA 2AZXA 5SZHB 4CWAA 4U8HA 3IP9A 4KYTA 3ZPXA 2OBMA 4ETIA 3IOCA 2VUTA 4FZJA 4UQLA 3B3FA 1T2NA 4X62B 4DR6B 4B6JA 5AIBA 2VTEA 5ESDA 5FTWA 5JZVA 1BE1A 3ZDBA 4YV0A 2A92A 1LPAB 1VIDA 2MJLA 2QX7A 2ZR8A 3PHJA 3PWTA 4GAEA 4KV7A 5C8XA 1UMBB 2QLLA 4WXHA 4LMRA 4X20A 1HDEA 1PZMA 2QMEA 2OG2A 2CYBA 3AJ9A 2Y0PA 3C7TA 5CVEA 5HZGA 2GJKA 2EXXA 4E2ZA 3PL1A 1XJWA 3Q9SA 3SFTA 2G25A 1EFPA 3TYXA 5THQA 3DKKA 4EPWA 1KZGB 1DVRA 1F51E 3QFFA 4N0EA 2CCJA 1WULS 2XGGA 4CN9A 1BC5A 4M8SA 4GMHA 2QPAA 2WNIA 3IR7A 1MRSA 3CVVA 5F1PA 1P45A 3RLIA 4YXWD 4DUGD 4BWVA 2DHQA 6YASA 5AO9A 4OVKA 2VSFA 3TCKA 1C7ZA 3EFOB 1XJQA 3HWRA 1EUQA 3F2VA 3E18A 3L05A 3STYA 2G08A 2DQ4A 2BM0A 3EA4A 3PSHA 3A4NA 4HQNA 5TF0A 4QYMA 3SK0A 1NX6A 2R86A 1TM3E 3R3JA 2JIPA 3C24A 3ER8A 5CVCA 2F3QA 5JARA 1ETUA 3UV3A 4G85A 4XW2A 4DRXB 3D6MA 3L1VA 4EF4A 5AOBA 5JJ5A 5JR3A 3DTTA 1V5IA 2Q1YA 3ZS9A 4GW3A 2ZB7A 4YJFB 1OBVA 4D6YA 3CRQA 4NXNB 2X4IA 2I62A 1E5DA 3QW2A 3H9EO 4DUGA 3PS9A 2K7FA 3PD7A 1T0BA 4IZHA 3F5FA 4G5OA 4Q9AA 1NRJB 4E2WA 2BW0A 3G89A 4ITRC 5IKOA 3LXRA 2AN5A 5HJ7A 1II9A 3EJWA 4RVHA 2EJWA 2PX0A 3ZOZA 2GH1A 1CRLA 1Z83A 3S29A 2KHZA 4MKFA 5E6UB 1HO3A 2IYEA 3QLEA 4JI6B 2I4OA 1BN6A 1A27A 1G41A 2IEAA 2VDKB 3GB9A 1N75A 1ID8A 5LBUA 4UEOA 1P2VA 2PZKA 3VC2A 3LQFA 2O8BB 1B1AA 3ZBUA 2Z2JA 1KJYA 3HO8A 3Q15C 5K01A 3FNQA 1F8YA 3C0KA 4BNZA 4KVFA 5C5IA 3QG1A 1TU3A 1U8YA 1L4BA 4PZDA 1JDUA 2C03A 3JW8A 2AMYA 4OLHA 4ED9A 1PGQA 3ULKA 3KL4A 5E9JA 3T0FA 3PPXA 4NABA 1Q0TA 2Y1XA 3QKRB 3B1ZA 5AMXA 5EKDA 1WWKA 3EUWA 4TZ0A 4B7ZA 2HQBA 1MHPA 1U0FA 1VHDA 2FSSA 3A1CA 3LFTA 4GX0A 4MJXA 1JHPA 3RGGA 5EJ5A 2HRCA 5K3FB 3ZDZB 3IMKA 1AT1A 3TBHA 1FU7A 3NOQA 4OL9A 3W2FA 4RA9B 2Y68A 5EEHA 5G0TA 2ATCA 4NMWA 1OA0A 3TSWA 4JXJA 5DX1A 3UAVA 3GRZA 1CYEA 5A4IS 2VDLB 1IMJA 4FLFA 1TXGA 1SQ5A 3AR4A 4DZTA 4B3SB 2G5TA 3A1NA 4HXEB 4BFTA 5FAKA 1F2UA 1ZM9A 2QM3A 2CCGA 1Z7GA 3FMOB 1YKGA 3HUFA 1OXTA 2B7CA 1MX1A 4JS0A 1M33A 2REQA 2X41A 4N48A 3ESRA 3FMGA 1XLTA 3JQGA 1DKPA 1T15A 2HCFA 3FZYA 3L92A 4LNUA 4TV9A 5TQ2A 4C07A 4RNDB 4M1YA 4FMBB 2BFOA 1N9ZA 1SXGA 1NX9A 2X2OA 4JBGA 4L07A 3PPYA 4OJYA 4PM4A 5DHRA 4RAQA 4QPNA 4TKZA 1V48A 1ZUIA 4G0VA 4EHJA 2CXQA 2LKCA 3B3JA 3KFLA 4LYFA 5HRAA 1JR3A 2D62A 1DQPA 1TEVA 4FHEA 4RDHA 4X60A 1K9SA 4GPBA 5ALHA 1I7LA 4RGBA 2OQ2A 1V26A 4QXQA 1R50A 1M67A 2J9GA 4WY2A 5HDBB 2CDCA 2J6BA 2EP5A 3VSCA 5JEDA 4GKJB 4Q3OA 2HMTA 3I6MA 3VFDA 3HJTA 4D9MA 1PT5A 2JBHA 4N6NA 2RHWA 1KQPA 3KX2A 4QGHA 3BFJA 1XZNA 2OZKA 3FDZB 4KEAA 2IV7A 2BGNA 3MIZA 1PW5A 1Z2CA 3AL2A 1O94A 3PXEA 3EXEA 3G49A 3PTLA 5HEKA 2MSEB 3KPVA 3CF2A 1E1RA 4J4HA 3BSWA 3N2YA 3WV4A 3ZLVA 4GKKB 3Q4GA 4TROA 5EHQA 1Z45A 3PYMA 3D3EA 4C5BA 1BO6A 2CY0A 4G0OA 5DCUA 2C4MA 3KB1A 4E14A 1JEQB 2V6JA 4MPTA 4ASUA 4IV0A 3KEOA 1JAZA 1NWCA 4IWNA 1RYNA 5J1TB 4YFYA 4BNDB 1IRIA 3NT2A 1PN3A 1U7WA 5DWQA 2VDRB 3EZXA 3GP3A 1RRCA 3UY4A 3FPJA 4KDFA 5IC6A 4K7JA 3UV6A 3F8TA 2HEGA 5ES4B 5G40A 1WDKA 2ZRIA 5J4VA 2R60A 3A6ZA 4UDNA 4F4CA 1MP0A 2EERA 3TFWA 5C4MA 5IRCD 1NP3A 4R0MA 3H5RA 1XTQA 3TE7A 5ILGA 1VL2A 2V7WA 2HUNA 4ND1A 4NG4A 1C1HA 4F6RB 1KK2A 4FNOA 1W93A 3KVVA 4O5OA 4RS3A 4EG7A 4FEGA 2A9QA 2DEUA 2PS1A 3B7GA 5HGJA 2AR0A 2HSJA 1PD0A 5A7FA 2H00A 3TRDA 4LBVA 1RC8A 2GBCA 2DTXA 1FNMA 3C7CB 4DB4A 1ISIA 2BEJA 2QTFA 3IPCA 2AEMA 4R40A 5TQ0A 4ZARA 3OLCX 3DEFA 3QTTA 4OMCA 4IQ4A 3UUFA 1B41A 8ADHA 1QU3A 3TD9A 6Q21A 2M1ZA 2YIVX 1LLCA 2ZS9A 2X1MA 3DZIA 2Q9CA 3OJEA 4IKPA 3UANA 4EHBA 5JNSA 5DCWA 2C7OA 1PE0A 1X2EA 3IAHA 2O8EB 4C87A 3I64A 4BGEA 1SCUA 4ZRDA 5CEFA 3Q87B 3GJ0A 4WZBA 2VAVA 1E9FA 3SSOA 3KTAB 4OYHA 1PL8A 4C4ZA 1RSZA 1YFLA 5A05A 4S1TA 1G8MA 3ZJVA 4C0WA 4RHXA 3HCOA 5EIBD 5L51A 1X74A 3ZCSA 1DLIA 4EYOA 5LOVA