3B6MA

Wrba from escherichia coli, second crystal form
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
197
structure length
188
Chain Sequence
AKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavoprotein wrbA
publication title Crystal structure of the NADH:quinone oxidoreductase WrbA from Escherichia coli.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 67
structure length 188
sequence length 197
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3b6mA00
2M6SA 3NHRA 5BUCA 4LTMA 3EYWA 4PU0A 3L9XA 1YOBA 4LTDA 1YCGA 2V5VA 4QOJA 4U7FA 1T5BA 2FX2A 1DX9A 1AKRA 1X77A 4N65A 2OHIA 1ZX1A 2MTBA 2QX6A 4H2DA 4U7GA 2Z9CA 1VMEA 4YAFA 3OX2A 4D02A 5LBUA 1AKVA 1YDGA 5EAIA 3OVMA 3HR4A 2B3DA 2BMVA 3FJOA 4QOIA 4DILA 5B3LA 2FAXA 3UXEA 3KLBA 3QFCA 1OFVA 1D03A 3TZBA 2BF4A 3P0RA 3OWHA 2MWMA 3W77A 3G5MA 5EMNA 1ZWKA 1SG0A 3B6MA 3ES9A 2X2OA 4Y9UA 4LA4A 2OHHA 2W5UA 1NNI1 3FW1A 2RG1A 4BMOB 2R97A 1C7FA 5LJLA 4H6PA 1OBOA 2HPVA 2Z9DA 3F2VA 1FLVA 1BU5A 3K1YA 3OJWA 4YAWA 4NULA 4ZVLA 4S24A 4GI5A 1T0IA 4YAOA 2AMJA 1AG9A 3HLYA 5TGZA 2Q62A 4N82A 1CZNA 3HA2A 3U7RA 4FGLA 2BZSA 1DXOA 3B6JA 3QE2A 3NHUA 3R6WA 3UXHA 3NHKA 1FTGA 2M6RA 1CZUA 3F6SA 1RLJA 2V5UA 1QR2A 3FX2A 2FLVA 4CF6A 1FX1A 4C76A 2OHJA 4J8PA 3NHYA 1XT6A 1J9EA 5A4KA 5LBTA 1YRHA 3LCMA 3S2YA 3OWXA 1AKWA 1AHNA 1D04A 3TEMA 4F8YA 2D5IA 1YCHA 1CZHA 1QRDA 3ZHOA 2QWXA 2GSWA 4Y9RA 1TLLA 2Z98A 2QMYA 4BMPB 4U7HA 1YKGA 2XODA 4FGKA 3NHJA 1AKUA 3NHPA 4OXXA 2ZKIA 4HS4A 1FVXA 4HEQA 1XYYA 2QMZA 3KEGA 4QOFA 4CETA 2FZ5A 2XOEA 1CZRA 4YQEA 5LMCA 3KAPA 2KLBA 1BVYF 1FUEA 2HNBA 3W79A 2Q9UA 1CZOA 4NLLA 1QHEA 4C0WA 1H66A 4GQIA 2KQUA 3TE7A 3NHWA 3RPEA 4C14A 3FVWA 3OJXA 1AKTA 1AKQA 2FDXA 3GFRA 3B6IA 3ESXA 4DIKA 5EA2A 2MT9A 2BN4A 2FCRA 1B1CA 3N3BC 3O73A 5FUQA 1WSWA 3U7IA 2F1OA 4XDGA 1JA0A 1F4PA 4ZVKA 3K20A 5LVAA 5JROA 4GR9A 3F6RA 1XI2A 3F90A 3NHFA 3W78A 3D7NA 2V9CA 1KBQA 1FLDA 3B6KA 1J8QA 2FOXA 2QX4A 2X2PA 4LTNA 1OBVA 3N39C 1WSBA 4DY4A 4Y7CA 1SQSA 2FVXA 1CZLA 3LT5A 2R96A 5FA6A 4C0XA 1FLNA 4ESEA 1JA1A 1AZLA 3KAQA 3NFRA 5LJIA 1E5DA 4YAUA 5F12A 1V4BA 4PTYA 4QOHA 1D4AA 1YCFA 2FZVA 3GAMA 3NLLA 4FX2A 1FLAA 2HNAA 3FNIA 4PTZA 4LAFA 4N9QA 5LLDA 4XDHA 4QOGA 2QX9A 3GFSA 1I1OA 5FX2A 2A5LA 1GG5A 4R81A 2QR2A 4QOEA 1AMOA 4ICIA 5B3KA 1J9ZA 5F4BA 1C7EA 3SVLA 2ARKA 3EDOA 4ZVNA 3ESZA 2Z9BA 5ULLA 3JSXA 4QODA 1RTTA 5NULA 3N3AC 1KBOA 1DXQA 1TIKA 3OX3A 4FGJA 6NULA 5F51A 1CZKA 3QFRA 2WC1A 2MOKA 1XYVA 3NHSA 5NLLA 2N1MA 2OYSA 1QBGA 2QX8A 1J9GA 4ZVMA 1ZWLA 3OX1A 3W7AA 3GFQA 1RCFA 3O2NA 2BPOA 1H69A 3NHLA 1RLIA 4M0CA 3ESYA 3L9WA 4YALA
chains in the Genus database with same CATH superfamily
3ICPA 2QMHA 4EG7A 1XMXA 1YZYA 5GIOE 1ZICA 2BH9A 2IBMA 1ZJZA 4RPKA 5FWYB 5A7FA 3IT0A 2D0DA 5K3EA 3EXG2 2J3EA 3GGGA 4H7JA 3HP1A 1YDWA 4I66A 4XKJA 1QYCA 4HYTA 5JQGA 4X41A 3RSQA 3E3NA 2XZDA 1T26A 4R51A 4CM7A 3I2JA 3E1SA 4QDUA 2AG1A 2EG9A 2Q5LA 2IWHA 3ID6C 5D3MB 1HE1C 4A2PA 1WSAA 1CUZA 2I4IA 3HXKA 3T1TA 3D6VA 4OPMA 3O9ZA 3U0BA 5ERGB 1O95D 2WJVA 4O4JF 5A3QA 4NBKA 3D7RA 1KL7A 1PJ8A 1ESMA 1VMKA 2ATEA 4NSNA 2XMRA 4I55F 4BGIA 2CN1A 1QOZA 2SKCA 3UB4A 3W8DA 1ZXLA 4ARCA 3IQIX 3X3HA 1CSEE 1VE5A 2GASA 2O1XA 2V7UA 4HDKA 5DU2A 1JHZA 2DWOA 4YJDA 2UVQA 2I1LA 4BLRA 2VQ3A 5G0VA 3E81A 3A04A 2C0QA 3WXMA 1ZI8A 2M1ZA 3DBHB 1CUXA 3IHTA 5BYAA 3DXZA 5KQPA 3UOAB 4RULA 1FSGA 2Z2JA 3THOA 4DCPA 4WRRA 2WDZA 1KEVA 2H9YA 3JYPA 5ALGA 2ZUTA 3MCUA 3RVSA 5B1YA 4R2KA 4UMFA 2O8EA 1X94A 2FAXA 1C0KA 5GJBA 3NASA 2PQ6A 2QY9A 1H2HA 1BS2A 3OLVA 3BM5A 3UOGA 3I5MA 3NX4A 5IG2A 1R6BX 3A31A 4XQEA 1KMNA 1OFVA 2ISSD 3HVKA 1TVKB 5LP6A 1VZ2A 4P58A 2SKDA 4L5YA 4QPNA 1CRWG 2QZ4A 1ORTA 5EXEA 5I7WA 1P80A 4F4UA 1ZJWA 3TFOA 5DBHX 1GCAA 3WK7A 4ZO6A 5D8DA 3M6FA 1YIOA 1MB9A 2V3WA 4U9IS 5EMNA 3C6KA 2ID8A 1X1TA 1QNFA 4GPZA 4RUKA 1Q74A 1WF6A 4MUXA 2WIBA 4BN0A 1V1RA 1Z5OA 3PUKA 3WFIA 1UXJA 3DE1X 4A16A 3SGLA 1PJZA 3ZHSA 5LFAA 4TSFD 1OB2A 2O50A 3GEPA 3L84A 2WW8A 4EJSA 2EBUA 1J22A 3HZHA 3VAZA 4DYDA 2HD4A 3C6BA 3FOCA 2IHUA 1COWA 4RHTA 1P60A 3W8EA 1C1XB 2Y1EA 1JECA 4RPHA 2VVTA 4N4AA 5DISB 3RIEA 5L3VA 1Q0LA 1EWRA 3G8CA 3L0CA 1GG9A 2X86A 2HA0A 4IGAA 4OJTA 4JYMA 4LJKA 4XSGA 4AFNA 5INTA 3FF4A 3RSHA 3FYCA 3OCJA 4F6RB 3PVCA 2GJAA 3K9WA 4HPXB 4K2AA 1CE8A 2LDBA 3AXTA 2EX4A 1DPGA 3SMQA 1CDEA 1RWNA 3Q1LA 5LP6C 5C9ZA 3P2EA 4OGFA 3AEYA 3T3HA 2WPDA 2OYCA 2ZB4A 3VYWA 2JIPA 1A5TA 3V32A 4UZFA 1A4IA 3DE5X 4EY3A 1J2JA 1F2TA 3AM5A 2NUAB 2PX5A 2WD7B 1RYBA 1VJDA 4OG2A 4ZVLA 4S24A 4GWLA 4IJUA 6ADHA 4TV8F 4CUZA 2VOEA 4IQ8A 3A06A 5FUXA 1R8QA 4JOBA 4ZYLA 2CEKA 2FPRA 1T0IA 2E82A 1JAZA 1CDZA 4EJSC 4YRZA 4OMCA 3LSTA 4NYJQ 3CCBA 2JH8A 5EP2A 5GZ1A 5JJ5A 1KDVA 4JLVA 1N6NA 3TL6A 5E7QA 1W76A 2JD2A 4JBXA 3RAGA 1U2PA 3F97A 5AVKA 3RNOA 3OQIA 3U7RA 1QVAA 4AMBA 4F7DA 1YL6A 1G55A 1N2CE 4QJ5A 4IM7A 2BZSA 3HKBA 4ZOCA 4DA7A 5A0VA 3R6DA 5GP1A 3L4JA 1N2ZA 2JL1A 4RELA 3NT5A 3V9AA 3VGJA 2OB1A 3CG4A 5LYYA 8ABPA 2XIJA 1OWLA 1KVRA 3DM5A 1A71A 4X7RA 1WS6A 3WZMA 4CQNA 2D5CA 4EY6A 2A4KA 1ZQ9A 4RTPA 3G23A 3O8QB 1V4NA 2V7XA 1AXGA 4ERXA 1T2CA 2C94A 1O5TA 5T4FA 5B4UA 1PNQA 2HPHA 4BEJA 4M1EA 4UNRA 1GQ2A 3NPMA 2TSYB 4R7TA 4WNAA 1KI9A 2QN7A 3PUHA 3V2GA 1LC3A 2CHGA 4J3NA 4KXQA 1UR5A 3H2YA 4LY9A 1LBTA 2VDWB 3V8VA 2RH4A 1RLJA 3D4NA 1Q0TA 1O6CA 1ZM4A 5MHTA 3EGXA 2J85A 3G68A 2QLNA 5FFNA 1NWHA 3MEQA 4E5SA 3G3EA 3PDCA 1FX1A 1OREA 3U7EB 3UPUA 1CJMA 5G3YA 3GIDA 4QM7A 4IJVA 3QXGA 3PSAA 3EZ7A 4YLGA 4MJ3A 4AWAA 2VQFB 2JBHA 4RHEA 3JAWB 3D3KA 2P0EA 1RACA 5D5HA 1NUAA 1SD2A 2VP3A 1ECCA 4ZI2A 4S04A 3QFFA 3HM9A 4I19A 3P96A 4AF8A 4L02A 2J6CA 2GK4A 4CM3A 2I91A 1TQ4A 4TKUA 4ZDIA 4XZ3A 4IRMA 1EH5A 3R3YA 4R41A 1RYEA 4NR0A 2MSDB 2A94A 2R8EA 4JLBA 5CPFA 1L8OA 1US8A 2AQ8A 4LDZA 4BQIA 1MNQA 5JSZA 2CCGA 4BC0A 3OJOA 5FPKA 5IJ0A 4R83A 2VAPA 4EF5A 3NH6A 4K9OA 4BECA 3ZDFA 3QWAA 2Y99A 3H0CA 2HHLA 1VJ5A 3JYLA 2IXTA 3EOAI 3PEFA 5CJ2A 4ZOLF 1KPHA 2QRZA 3P2YA 4B75A 1RAGA 1RM5A 2QD5A 4HQKA 4WT7A 3VJRA 1M6VB 3L7LA 4N7BA 4A8TA 4A92A 4J7UA 2PUAA 2FG5A 2PX2A 4MB0A 5JFGA 2O3UA 1NY5A 1Q1NA 2FJ0A 4NY1A 1Q17A 4NF2A 5JAZA 5GVRA 2GVZC 3RKSA 1EPUA 1EIWA 2BTOA 3NNDA 3AFNA 2ZIWB 1FUYB 4KRXA 4RS3A 2PUEA 2PBLA 1JS1X 4UHBA 1L4MA 2O2ZA 2PRIA 3ND5A 3HJHA 2WTXA 4E22A 5G4LA 2OCDA 3ZY2A 2PMBA 2A0XA 3WKDA 1DG3A 4ADSG 1K3FA 4YQYA 1DIRA 5B6JA 1Z29A 3PXUA 2IHKA 3E7FA 4TTRA 2XDWA 1YMQA 3PPYA 2RD2A 1TT7A 2B8JA 1IMJA 2O0JA 3AL0C 2D3TA 1RQ7A 2GA9A 2W6IA 2NYUA 2ZUCA 1D6MA 4N7MA 4M55A 2CE7A 2O05A 1H4QA 5BNTA 4MW6A 1YZ3A 4I8DA 3T3MB 5DBGA 1J39A 4FN4A 1WO8A 1E9SA 2AUNA 2REQA 3AI2A 4INOA 4QREA 2DH6A 4EY4A 2VYCA 3E9EA 3AH8A 1MB2A 4IAOA 1J97A 4EYEA 2QQEA 4PFJA 3UH0A 4JWKA 4RQUA 4B7UA 1DX4A 4B8WA 3L8CA 2JHPA 3TX2A 2A5FA 2P9ZA 1H2ZA 4C22A 2QBYA 3NBMA 2AOTB 3IAXA 4MDYA 4HX2A 1A0OA 1TCBA 4HNTA 4DDMA 4XEHA 1DEXA 4EF4A 4FQ5A 3I3SR 5E6SB 1BW9A 2DECA 4YAIA 1MPTA 1WW3A 4K9KA 3SIXA 4K6GA 3WV4A 1C1HA 4LRWA 3HBNA 1H6DA 4JT2A 3SF8B 5FOQA 4NWIA 1AGPA 4FSXA 2HFKA 3OICA 4OTZA 3LHDA 2WUGA 3TXAA 4ER0A 1QHGA 2DQSA 2NSLA 4P92A 2X4DA 4RD2A 1WABA 2HIMA 2NOAA 3JZAA 4YYZA 4BNIA 4ZHSA 1Z0SA 3BPSA 1NXSA 4IINA 1F4PA 4D0NA 1B41A 3KEFA 1CB0A 1RWPA 2ZWAA 5I9LA 1ANKA 1ILWA 1Z0DA 4X00A 3IRVA 1Q22A 3VR5D 1EBUA 1A9TA 3AY6A 4DBZA 3RVPA 3BGOS 2PUBA 4TLEA 3QUSA 1UKYA 2WSYB 4P6VF 4NG5A 2JGDA 3ZWDA 5KQGA 4M1QA 1NPTO 4KODA 4IZ6A 4C3UA 2V7VA 3OQHA 4BU1A 2ZW9A 3IVXA 2F1JA 2V9CA 2Q3FA 4J1NA 2BUAA 3T7TA 1STOA 1YBAA 4RWEA 3BMQA 3OOJA 3QTBA 5CJPA 2CXNA 1I80A 3GT7A 5JSYA 4N5DA 5HBGA 2QQ5A 1RD4A 4HWGA 4XSHA 1GYPA 5SV2A 3A05A 5EE9A 2R5FA 1XDBA 2BH2A 4TZ0A 1E0SA 2NPIA 4ZC1A 3DQPA 2JHAA 1VHTA 2QORA 3LWZA 4IXNA 5TARA 5IUJC 2NUPB 3SY8A 4XTCS 3PGKA 3K5HA 5AKHA 4L0DA 1HXHA 1TZMA 3I2GA 3LT5A 4C20A 2IFTA 3MJDA 3QP9A 3M6WA 3SZ3A 5IZ4A 4W7SA 2JIMA 3FYHA 2WPNA 2P9GA 1A5AB 3K0FB 3HXOA 4N3NA 5J5CA 2HWUA 1BCRA 1ES9A 2VUIB 3LA8A 1E6UA 3H42B 3A6PC 5IVDA 4F5YA 3ML1A 3EZGA 3BIWA 3GUZA 4KE9A 3ZNPA 1H65A 4GMKA 3GY0A 2D5LA 3OZWA 3F8SA 4B0OA 1CVRA 1Q21A 2RHWA 1BXGA 1N6OA 1CUEA 3I2HA 1HK7A 1TT5A 1XMSA 2HQBA 2X2EA 4M6WA 3F6YA 2IPNA 5AM4A 1RZRA 1ZL2A 4G9BA 1O58A 3T38A 1DKMA 4ZDJA 3CLVA 5KKNB 1T9KA 4IEIA 5KSYA 4FVTA 2O8CB 1DRJA 4QFCA 1T91A 3DMPA 1JSCA 3IAFA 3MJHA 1V4BA 2BKUA 2B35A 4GGMX 4PTYA 4MUMA 4B3MB 1UBFA 2H4JA 1V1MB 4V0KA 4YJ3B 1EDDA 1NRIA 1Z6PA 2EFHB 3N87A 3HUFA 3OHSX 4DQUA 4EHNA 2R4UA 2VHQA 4XWTA 2GM3A 3TLGA 2Z8XA 1W49A 3IBCA 4L08A 1YA6A 2EJBA 1WPRA 2HNAA 1VE1A 2VJOA 4EW2A 1SB9A 3OSZA 3KX2A 4O8CA 1UZUA 2O7RA 3UUEA 4CM9D 1DJQA 1ZY2A 4N0QA 3RUDA 5IASA 3C5VA 3WQSB 4B17A 1ZN8A 3I01A 5J5VA 1VHLA 1UM9B 2QN2A 4LHSA 3M2PA 5CXQA 4NCBA 3UNXA 3TSZA 1JQKA 4BMDA 5FX2A 4XGIA 3KQWA 3DWFA 2BE9A 3LF1A 3MJCA 3G2IA 4M7OA 3AO0B 2PBFA 1U0BB 3FVVA 4URUR 2HZ7A 3ZZUA 3R6TA 4QZVA 1E7MA 1T2DA 4FW9A 1K7YA 4MVJA 1JG4A 2EC5A 4UM7A 1U0HC 1YRLA 1KETA 2B2CA 3SVLA 2J0VA 3OZCA 4LF7B 3CGWA 3KETA 4IX1A 1SUFA 3EDOA 4HCJA 5H59A 5K0ZA 1NMXA 1E6MA 3PX2A 4MKGA 4KV9A 4W5NA 1G60A 4JZYA 4P7JA 5AKGA 1O2DA 3TWOA 1RFGE 3V34A 5NULA 5KNBH 3DGEC 4RX1A 1P73A 4N1AA 2Y92A 5JJBA 3O9MA 3R3WA 4RJ2A 2FW9A 1KPIA 3RJMA 3C3WA 3F5FA 4HN2A 3GLKA 3QA9A 2W48A 2XSZA 4II3A 5EIEA 1G20A 4N5NA 5HM6A 1ISPA 1UQRA 1NONA 3ROPA 1V5WA 3F74A 3WIOA 4QUGA 1FP4B 3G2NA 3HA7A 1NJ8A 2XKAA 3MUNA 1W0JA 4WMLA 1LX7A 2DWQA 1NVMB 5I5GA 2WTMA 5A4JA 1Q7CA 3D6HA 3ETLA 3MAGA 4OHCA 3IBGA 4OSPA 4YH1A 3ZKWA 4BDSA 4EJ0A 3KXKA 3GLUA 3L49A 1L4EA 4CL8A 2BFEB 4BBJA 1VTKA 1TGYA 1D0VA 1FS5A 5BSEA 3Q0IA 3MUOA 4OP2A 3WGZA 4C0BA 2HTFA 3F4LA 3ANSA 3CR7A 5EMMA 1O0CA 3KKQA 3RYIB 2DBVO 1JDPA 3GMIA 3TNLA 1R8XA 3VI4B 2E7ZA 1U3VA 5KTOA 1SCKA 3VRHA 5BN4B 5TEVA 1TQ8A 2JATA 1DJNA 3AKZA 4JHXA 2KW5A 4NESA 5KZMB 2GVNA 4JVNA 1JHPA 1DAFA 2W2LA 5G0UA 1DC6A 1CR1A 1QGOA 2V54A 2CXTA 1EFVB 3UJ8A 1E59A 4RQTA 2NZUG 3VTKA 3P71T 2FK8A 4UTXA 1AHPA 1AUVA 4A03A 4IV0A 1RWMA 2WLSA 2QRLA 2VDRB 5PGMA 5HZKA 5I51A 3HP7A 3U49A 1IWOA 1WQ1R 3M4ZA 3I2YX 4IJ5A 3V7WA 4ZYWA 5C4MA 1S2IA 2ZIXB 1A82A 1PVDA 1QIJA 2I55A 3ELUA 3WVNA 3TLXA 5JSUA 4L85A 2Y27A 2WMDA 2E4YA 4ZRDA 3NHRA 2OK8A 3NTLA 3OCCA 1UK8A 1E9AA 1XDDA 2A84A 4XCVA 4EGCB 4EUEA 2H1CA 4J4HA 1XXHB 1JL3A 2QT1A 3WKEA 4QU8A 2QUZA 2YJGA 4D44A 3DD5A 3CUEF 1CP2A 4JLOA 4L6CA 5HQTA 4OAOA 5JS6A 1NKVA 3VQTA 1Y8AA 1JHXA 1JIVA 1CDDA 1Z16A 4CG2A 1XELA 8ATCA 4U7FA 1TJNA 4C5BA 5AVUA 4TYYA 1E66A 4RYDA 2H07A 3IP1A 1TLFA 3CF4A 2CSUA 3OIUA 4OHKA 5DMXA 5HRCA 3U3KA 5LQCA 1KZ7B 3N0XA 3ZDZB 4DIUA 3HPQA 3IAM6 1Z6GA 2MDTA 1KH2A 1MEOA 5AP9A 4F93B 1P1BA 4YMLA 3KWFA 4QDTA 2EOAA 4FOPA 5TVKA 1Z13A 4IGKA 5K0TA 2IPMA 3FFTA 5EZQA 4ECAA 3I58A 4DGSA 2QX6A 4OJMX 1HT1E 1S01A 4YAFA 1OHHD 2W6CX 1CFJA 2D00A 1QQ7A 3NVAA 3HXLA 2J7PD 3FDFA 4QBHA 4RPLA 2IC5A 3OETA 4JXZA 2WFZA 3G85A 4X1KB 2IEZA 5MDHA 4NE2A 3PKZA 4WZBE 3IUJA 2NZWA 4Y6GB 5AIBA 4UVHA 4QXMA 5DBOA 1J1UA 2ESRA 4FNOA 3PEEA 4QOIA 2JLWA 1MIOA 3PFKA 4JENA 1B2LA 2PY6A 3VFDA 4DLVA 3OQPA 3PLRA 2JIOA 2XR1A 3GLIB 2ORIA 5L6MB 1Y9ZA 1DTWA 1L7NA 3ORYA 3FMFA 3II6X 5L7WA 5I6DA 4F4CA 1R3UA 1RR6A 2MWMA 2Q3HA 4ZFNA 1XVIA 1T4BA 3WO1A 3GNLA 2HJRA 4GM4A 4NBUA 2YWJA 3MJEA 4FHEA 4L50A 5FPTA 2QPAA 2IUSA 3A9CA 3QE3A 2WKRA 4P2GA 1T9GS 4LECA 1JTEA 4U3JA 4FW8A 4WK0B 3QU7A 3N59A 3CONA 5A9TA 3BBPA 1F8FA 4R01A 3R7BA 1IBRA 2P68A 3TVYA 5CFZA 5LCXA 1A7UA 2H57A 3KFXA 3NDPA 4PM4A 5I9TA 1UP4A 2AS0A 2NTNA 1YF3A 3EEQA 1NZFA 1E3LA 1T9GR 1NMYA 5J40A 1G18A 1IK6A 1C7FA 1P0PA 3CNLA 1D4OA 1H2EA 4N5IX 2ASEA 4IHAA 3CYFA 5KBYA 3MCWA 3FZNA 3NTRA 1DHRA 1E2LA 4P81A 4BJ5A 2QP9X 5A1TA 1GYRA 2A9KA 3F2VA 4HTFA 3WGYA 4KXYA 1IAVA 2PGNA 4A0QA 1R0RE 1KIAA 2IUTA 1OZ0A 4WJLA 5M34A 3QBEA 4UBNA 1U2GA 3ODPA 2FWMX 1C3JA 1AVTA 4ER3A 1JH8A 1UDBA 4DA6A 4DA8A 1EVZA 1JMVA 13PKA 1VIMA 3F3KA 4X93A 3TR0A 3W6PA 4URZR 3F0TA 2DSNA 4UUMA 2OCKA 2N3ZA 1CIJA 4XM2A 1XRRA 2QSYA 4B3IA 5ILGA 4H60A 2OY0A 3N53A 2CLSA 4R4JA 3OU7A 1KZ1A 8GPBA 1S9HA 1X86B 3QF4B 4GWGA 3L7OA 1V2GA 3KXLA 4PNHA 4G4GA 3WQQA 3BF7A 1NJFA 1NJ1A 3SJCA 3Q72A 2OLJA 3P2MA 1SXPA 1KAQA 1Y6FA 3T95A 1V25A 2J09A 2ZUSA 3JQDA 5TGZA 1NBMA 3WGHA 1OW3B 2W9XA 4NH0A 5AK4A 2H7VA 1RHMA 2Q4OA 2Y71A 2WUVA 4PQYA 5BWOA 5IX8A 2XE7A 5FUBA 4D0SA 3WO0A 1FXWF 3FVQA 4YEDA 1P39A 1CUGA 1CZNA 3HA2A 3R24A 3N8HA 4X95A 5EESA 2HRZA 5TSDA 4AN4A 4DCGA 2VSFA 4UUNA 5SZJA 1OFUA 2QPLA 3DKKA 2I67A 3BXFA 3KFLA 3KSRA 5ALNA 1CJKC 4P4TA 1LPNA 4UQPA 3ZXUB 4D5GA 1L5HB 1B16A 1U2GC 2C57A 2HWKA 2WJGA 3D4PA 1FSSA 1NQXA 2OG2A 1WWKA 2GVDC 3C7KA 3P9XA 5HGJA 3IBSA 4HDNB 4RA9B 5CB4F 1Y9DA 5CT9A 2Q1UA 3OLCX 5SICE 3RTGA 3UBMA 1U3FA 2D2IA 3KZMA 1FFHA 3HP4A 3VH4A 5DM70 4K03A 3VH3A 2EFCB 1SCQA 1ZSNA 3F3SA 4Q3KA 1L7QA 1NJ5A 3C8ZA 4R9NA 3WX0A 1ZVVA 3WLLA 3IOBA 3D6TB 1G64A 2YHAA 1M7HA 3BHMA 3ZOZA 2BBSA 4GX1A 4ZEMA 4FFMA 5JLJA 4V3BA 4B83A 1LTHR 3IP5A 4EB6A 3U3ZA 1E2FA 2FLVA 3B2NA 2QP3A 3HFGA 1LSJA 5E7JA 5H16A 5HJEA 1Z6XA 3DE6X 3ELWA 4QUHA 5K0CA 2IS1A 3UJHA 3V8MA 3EGOA 1LV8A 1JDZA 3PD1A 2YVLA 4RSRA 4D3ZA 2YVAA 2I3ZA 2R8BA 4NJMA 2VP5A 3BGIA 3N2KB 4URYR 3DNFA 1W8IA 5IFLA 5BW8A 2R85A 2CNWD 3PG5A 4U7DA 3EGDB 4WA7A 1QANA 3L6CA 4W1SA 1XEXA 2C9ZA 3GDOA 4ID9A 4XWWA 421PA 5IKEA 3FOAA 2ZE8A 3S2YA 3WE7A 3UC5A 1AHNA 2D8AA 3B20A 1ND5A 1FFXA 4KJZA 1RJ9A 4D3YA 1H5NA 4GUDA 3A3YA 1WY5A 4CLRA 4IMRA 4S05A 5FPSA 1DI0A 3Q7PA 4PGHA 2DQYA 4BVGA 1DQSA 4FYHA 2PIDA 3O4JA 3RS4A 3TSCA 1FBTA 3PBKA 4FCTA 4Q34A 3VVLA 4BMYA 4DM7A 1XPJA 1K8QA 2DPYA 2X1MA 4TXJA 5EQTA 1Z5ZA 5A5EA 3IE1A 1VG9B 1LX6A 3PGJA 3QLVA 4G0NA 3V3KA 4MS1B 5JMWA 2X23A 3JVDA 1D2EA 3PD7A 2QE7A 1EE9A 2GEJA 3D5EA 3S2ZA 3S5JA 4W5OA 4URXR 2OLKA 2KPOA 1L8XA 3AOGA 3FPFA 1I9GA 2NUTB 1TCVA 4U7HA 4HQOA 4XIJA 3SIRA 3TNJA 4AP5A 1CG6A 5PNTA 1JQJC 3ROTA 1EVLA 1S2LA 2ZBVA 3FGPA 4U5XA 3RRYA 1RKQA 5JMOA 1JHUA 3EIEA 1C9KA 1GGMA 4KQIA 3ZGZA 2R7MA 1YRAA 5LLTA 1IN1A 3DOIA 3GRYA 2FVYA 4EJFA 3B8EA 4WKNA 2QDKA 3TVTA 4LXGA 4HS4A 3OUTA 5I8PA 1O77A 1EFPA 5CDGA 3SF0A 4JI0B 2A4MA 2FX5A 3H8JA 1UKAA 1ZNZA 1NT4A 1PV1A 2FPIB 1PFYA 2F3PA 3DVQX 3QJYA 3KAPA 2GH1A 3P0IA 4GD3Q 1YUBA 4NIMA 4X6XA 3HB1A 4HAIA 4J91A 3SFTA 5AICA 4RTLA 3LPCA 5LIRA 1A9ZA 3A9UA 1WKBA 4TWBA 3GVPA 4NBNA 2GPTA 5EPEA 4FFOA 4P4UA 4LYGA 5AW9A 1QHEA 3DFKA 4CHGA 4ZICA 3LVRE 4ZALA 3DC2A 3T5MA 3C3XA 3C15C 1MUUA 5C0OE 2WWTA 2X3UA 1LH0A 2YWFA 3BCHA 4R8LA 3RT9A 5G0SA 3CUVA 1M67A 4EABA 2E1PA 4QU5A 1R6VA 3OJXA 1AN9A 4J2HA 4TLAA 5DASA 4HYYA 2J0SA 3ZJUA 1GUZA 2FXVA 4JSYA 3PGVA 3QW2A 2YICA 3ZX4A 4DQ0A 3PWKA 4WIAA 1ULSA 3RJ9A 2QRQA 5JC1A 2OAQ1 1W4CA 2B9EA 4YK7A 3L0IB 5TQ0B 2CLIB 3ZY6A 2VP0A 3MS2A 1XZKA 2X8JA 4AF7A 3GELA 3FCOA 3H5TA 3N7AA 1BEEA 2G0TA 4FEAA 2BE7A 5ITVA 2OO3A 2VR1A 3G9UA 4D74A 4KAAA 1FNNA 2JAHA 5D5QA 1K66A 2GXUA 4RCVA 4WERA 3VMMA 1LZKA 4PZLA 3OF3A 3Q5GA 4OK3A 2ZPUA 4F0JA 3W6OA 3NEYA 2Y1OA 4HXFB 3J81k 1WIWA 2V98A 1XAIA 2O3TA 1ZXXA 1YMUA 1UKEA 2EWMA 3IBFA 4Q4JB 4BKUA 4A23A 2HBZA 4KQHA 1S8AA 1JBEA 5CLJA 2TECE 4KYTA 1JSXA 1X1RA 4EA8A 2JCBA 4DWVA 5KTSA 3EA5A 1W4AA 3QVWA 4IIEA 1OAAA 1PGPA 1T2AA 3DMNA 2RBKA 3W78A 1M7BA 2G9ZA 1CJTC 2ZCVA 3NUGA 4HDMB 3L1HA 3TBKA 2BFMA 2Q5IA 3GCZA 5F2KA 1YE8A 4MUKA 2PT5A 4C6HA 1KOJA 3COWA 1T4GA 3DTTA 2W83A 3IEUA 4K9NA 3LA6A 5AKZA 4H3SA 4KHZA 3AEKB 1UDAA 1GSHA 1JX6A 2VJYA 2ZTMA 4N5MA 4ZVUA 1QHIA 4G56A 4DY4A 1G6KA 4GH5A 1L7DA 1S2DA 1G59A 2FPLA 4UNSA 1GARA 2DKOA 1XD9A 3OJLA 4NNPA 2F6RA 3EA4A 1JDVA 5KTNA 5HZHA 2P9EA 1QDUA 4L51A 5JBIA 4HZGA 4TGLA 5K3CA 1P7ZA 3NEJA 2G70A 1PSWA 4JC0A 1B73A 2PK3A 1L4GA 2D06A 4HO1X 3PA8A 4TMXA 3DTVD 2MINB 2VK8A 1D8TA 1KYQA 3E2PA 4D6XA 1N4AA 1HWYA 3DQZA 3BTUA 5T67A 1UMKA 1Z28A 4IIXA 4ZGWA 3HUEA 2GPAA 1KQPA 2H8GA 3ZS9A 1XZBA 4BE4A 2NVWA 2B4AA 2QK4A 3ZD8A 1BDIA 3GPCA 1KDRA 3ELYA 5IK2D 2YFYA 1XDUA 4ZT4A 1RI2A 3EVGA 2R4TA 5TNXA 4Q1BA 5JZSA 2GD2A 2QN3A 2VXCA 3H9CA 2BKXA 1UJ6A 2XYVA 3IKVA 2YIDA 2PG3A 5EN4A 2HA5A 3LCRA 4HDSA 4YO8A 2EP5A 1FY2A 5KTKA 1CB7A 4INJA 4X7BA 3Q8WA 1P29A 3ZU4A 2P62A 3FKSA 1OC4A 2C82A 3SQOA 2ZTVA 4PX5A 2E21A 1GQOA 5K0GA 3FTEA 1YAJA 4F2PA 1S3SA 2JKVA 4NBWA 4BLUA 2ERCA 2XMCA 3C8MA 2RAVA 1DS6A 3I37X 1IBCA 3LT0A 2RKWA 4YRQA 4B74A 1VLQA 3K6KA 3VNUA 5ARBA 4TX1A 1EXWA 3AM3A 4BQOA 1ECFA 4QEKA 1SIWA 3AUKA 4IWNA 4PRYA 4EI9A 4IFIA 4MQEA 2FH5B 3U7JA 4LK2A 1K86A 2QAGC 2QX9A 3SM3A 4MVJG 4TWZA 4EEKA 5FKJA 2O0MA 3R7SA 4LXYA 2IYXA 5K0BA 1F0KA 1RHJA 1RLMA 2JRCA 1G2PA 1E1MA 4FDUA 5FWXB 2J3DA 1SCNE 3KAJA 4HSEA 3ZOKA 4D8WA 2PSFA 1W35A 2Z04A 3UG7A 4GVLA 3CX6A 1XCMA 1MENA 5TVGA 4MO2A 3QUCA 2FPMA 2VYFA 2VTBA 3D4OA 1M1ZA 1W9HA 4ZOBA 1OZFA 4D92A 1VL8A 1XU9A 3ESZA 1ETUA 1V8BA 4YDQA 2R4QA 1KP3A 2ZK7A 3EVCA 1NI5A 2RIPA 3FDIA 1YI0A 3G6KA 3HSKA 1P5HA 4YECA 5LYJA 5BN5A 1U6KA 1CY7A 1EHCA 1LDNA 3MWEA 1M8GA 3KTFA 3VSAA 3TNYA 2QZ9A 4ALKA 3L06A 5DM2A 1MR3F 1V11B 1C3OA 4H7DA 1Z07A 2DC1A 3DOJA 2EKPA 2RGWA 1JLRA 3FN4A 1K3UB 1L5SA 3IVCA 5F35A 3E22B 3DDZX 4CRWB 1NBEA 3LBIA 5I4KA 1T36A 3JQ8B 1O97C 5LQKA 1JKIA 1P5FA 1DBIA 3DDNA 3P9SA 4GL4A 2ZP1A 3BH7A 4TV8B 2I7CA 3P4XA 2VP4A 2WNSA 5HCNA 6NULA 3T7JA 1CZKA 3JQCA 3OIWA 2F3RA 4I4TF 4QTTB 5FPYA 4XLLA 1X1CA 3NHSA 4YQFA 2IPOA 4AXBA 4CM4B 4GOND 3AESB 4Q7LA 1E2IA 2JGAA 1CVIA 5EE0A 5HFNA 5COBA 3TL3A 5D5PA 4CKCB 4UUAA 1MJFA 3OZ7A 1GPYA 2PS9A 4WOPA 1Z4NA 4B6RA 1MB4A 4F97A 4FWTA 4E4RA 3MB8A 3CXRA 4MULA 4MARA 4UNPA 3M33A 5E3JA 3VTAA 1JEQB 3C5EA 1YNSA 2E18A 3TSWA 1Y3CE 5L6LB 4GL2A 3NM5A 4F9TA 1EA7A 2W4MA 4HRAA 2GZMA 2J9RA 2H52A 1XAHA 1C41A 2HU5A 1CD5A 2NQTA 3ZY5A 1LJ8A 3VR2D 4A6XA 3CTPA 5J1SB 5ALJA 3ZGOA 2GNPA 3IA2A 3B7GA 4BFXA 5FAXA 1XCOA 3V2HA 1SZPA 3DDHA 3GLRA 4XUCA 4QHSA 3A32A 1I01A 1GNTA 3GGPA 4GSYA 1MXHA 2ODEA 3HCRA 3IV6A 3GD5A 4K9SA 2CDNA 2ACVA 4IFTA 1I6LA 3UGQA 1RJGA 5FD8A 3QHAA 1JILA 1XBTA 1RQXA 2JS7A 2VF4X 2ZQYA 3ESYA 1WZEA 4FEYA 1AUPA 2C4WA 1U7WA 3Q12A 4FYJA 1N8KA 1A2KC 1ZZGA 4KLZA 4QXPA 3QLUA 2P2NA 3BFVA 3ZK7A 1V7QA 5DVZA 2IW1A 4R1SA 1G19A 2VYNA 2IHJA 1WXEA 3UXYA 2P11A 3DEFA 3Q4GA 4LTMA 2NU7A 5SYAA 3AI1A 2BSXA 4GE3A 4P5DA 5DNDA 5FHRA 1QU2A 2J3HA 5E4JA 3VOAA 3ZDXB 1YCGA 3M2TA 4NOKA 1O95C 4IDBA 4OXRA 3SR0A 3FWPA 3CV3A 5CX1A 3W2GA 2FUNB 2GNOA 4DADA 3OKPA 4Y2RA 2FX2A 2X0EA 4BXOA 3JPYA 3M4JA 1N2XA 1TIBA 3PQ7A 1UODA 3FSGD 1QH8A 4GGPA 1DQYA 2JANA 3HY3A 3U4IA 2VHTA 2NPFA 2CSXA 3GRUA 4TVBA 4CODB 1U63A 1QHSA 3MAJA 4QUAA 3V42A 2UZ4A 4N39A 1E0AA 3P27A 4UDYX 1D2NA 1HYHA 1UPAA 2ZWVA 4RKWA 2P41A 2W2XA 3D81A 2P5YA 3AKEA 3F6BX 5L7YA 2Z6UA 4UPDA 3D59A 4KNWA 5L3SB 4TKVB 3A4TA 1PBTA 3HR4A 5JG7A 4D4MA 1W87A 4PBSA 3B1YA 3QLUC 3DLPX 5BR7A 1K8YB 1R5JA 1X7XA 2JASA 2JB9A 4ZU1X 5HKOA 1OV6A 2RB5A 5L8VA 1DVRA 4KQEA 3T5CA 4N8EA 3G0GA 1N0UA 3O4HA 5J2TA 1H23A 1O96A 2ZWOA 1K75A 3OWHA 2D0PB 4EUKA 1L6IA 1FTQA 1ZK2A 1IVNA 2R1VB 5L3ZA 2X0RA 2ZRLA 3H19A 1HSZA 3IP7A 3N58A 2RGRA 1TF5A 3R7WB 3Q3HA 4JB3A 4A5SA 3TZKA 1IUKA 1IH8A 1IY2A 1JE1A 2F3SA 1I4WA 4MR7B 4OK5A 2QM0A 4QL3A 1GO2A 5JNSA 1H2RS 1T3TA 4Q4AA 3IUPA 1KKMA 3HJGA 1AD2A 1P4GA 2Y6VA 1HE5A 4WBNA 4FWBA 1CLUA 2DBRA 3H5LA 3ILYA 2P2SA 3IAAA 2VP6A 4R7GA 3RR2A 4IUBS 4CT5A 1PJLA 5TPWB 2CLKB 3UJNA 3OD1A 3LPDA 1JTFA 2NNLD 1JG3A 2HIGA 3BJZA 3BMOB 4H6PA 1EXVA 5DK6A 4Y2UA 3E5RA 3ELDA 4IKEA 4N41A 4L7VA 5FL7D 3QUBA 1PYOA 3GRZA 3VR5H 4AIIA 1ZCFA 4O2AA 3QKSA 4MPPA 5DBFA 3DJFA 4J49A 1JU9A 4MSUA 2YYAA 3VR1A 4OHMA 5ICFA 5FPQA 3DMYA 3H84A 1VFNA 2VLBA 4FC7A 4YAWA 4WESB 1NHGA 1RPNA 4DA9A 3K70C 1W36B 4Z1MA 2GM4A 1CK4A 1VPTA 1IOVA 4N8SA 4JI5B 3WWOA 4ZTZB 4BEVA 1ND6A 2NZ8A 2GK3A 5JD3A 1YR6A 2P5TB 3OCWA 3EW9A 4MIEA 1GTJ1 1SCJA 1PEAA 4DTIA 2IF0A 3L1VA 3SXUB 4OHBA 2MU1A 1K92A 2JI7A 2FQ1A 2AIRA 4Z4GA 1EFTA 4Z0TA 3USES 4IDEA 1RQPA 2O6HA 1R8SA 3ZNOA 4BFVA 3EBPA 1JAIA 1RXIA 5ITZA 1VGVA 3LK6A 4I36A 2WFAA 4YRAA 1XCPA 1RRKA 1EP1B 5JXIA 4R2MA 3CHYA 1G21E 1G5RA 1ZJYA 1UPBA 3HBAA 3PT9A 4Z4CA 2ADFA 1DGQA 2WWVD 1C5KA 2I2DA 5D7BA 5EJ6A 2GJ8A 2R68A 4D3SA 1M2VA 3RANA 3T1NA 1T5DX 2IOFK 3ITEA 1BN6A 3OFND 2Z6QA 2GPWA 2NYAA 3RU9A 5IKOA 3W6ZA 1Z8NA 3U60B 1W19A 2BP7B 3CLUD 2EQ5A 1W36D 1JZSA 2ONKA 3L7MA 1M10A 4HUQB 4JN6B 2ZSAA 4ZEWA 5KB3A 1OX4B 2ZJBA 1JIKA 4IXMA 1KVQA 3ABQB 4NZPA 4U7WA 3KELA 1CUUA 1R0KA 2KX7A 2ORYA 3FYTA 3O95A 1BWQA 5AKLA 4BASA 5JVDF 2O7VA 2RHTA 3M6AA 6REQA 4P34A 2Z1DA 1UEIA 2AJLI 2UUPA 2IS4A 4HRYA 5EZYF 4A6DA 3TAXA 3LGXA 5GOZA 5H3LA 5DBIA 3U80A 1GNVA 4XARA 2E3JA 2PV7A 3F2IA 4GMXA 2H0AA 2D13A 5DLYA 4B8YA 1TJYA 1U94A 4B3XA 4C76A 3FNEA 3KQMA 3A3KA 1SKAA 2QGFA 3OLXA 1XT6A 3UPDA 3LX4A 3GJZA 5CPBA 3QELB 1CUJA 2PYZA 3K1AA 4JJAA 4L3OA 2IVFA 4YJGA 3U4QB 1LSOA 3LX6A 2FZWA 3GQBB 3TLBA 3MM4A 1I8TA 2CF6A 3IP3A 4PS1A 3S2GA 3SHFA 1UBJS 2XUPA 1RHRA 5M29A 3WV5A 3TEMA 3GCWA 1C4KA 2OBMA 4HC4A 3ST7A 4GMDA 3QNWA 4JLKA 5C3MA 4J0HA 4QLOA 2WF7A 3EJWA 1ONPA 3FUUA 4RF2A 4G0UA 2CL7X 1DJOA 1JR3A 1CQPA 3OJEA 4UHFA 5D2CA 2GZ1A 2WMOB 1FFSA 5CT6A 4BO0A 4E3ZA 5ALEA 5CXUA 2J48A 1F8GA 2B25A 1L5FA 1SEPA 1ZD4A 3IH5A 4EHAA 4PLYA 4RCZA 2ZDGA 4GXTA 3UYLA 4FR5A 2AJCA 4M0MA 1NATA 1O4WA 2ODAA 4KFUA 1AGYA 3EXIB 1EE1A 4CVNA 5KYYA 3NYWA 2GN0A 4LOKA 2QMYA 3LXXA 3ZDAA 4DLZA 1JHOA 4CKEB 5EE1A 5FWYA 4KI7A 1MOZA 5A5DA 2VPWA 2O8DA 4B4VA 1F6DA 2I80A 4XRGA 2EZ8A 5C5DA 5CDYA 5IRCD 3ICQB 2Q2VA 1RABA 4BTEA 2DLNA 2H4ZA 1U2DA 3MTIA 3QMMA 4H7EA 2EKBA 2HCTA 5DZSA 3RAPR 3FYDA 4X6YA 5B2ZA 3EX7C 3MVEA 1WZIA 3K5IA 3PDIB 5D3MA 4N76A 2BD0A 3HVUA 4DSNA 3HEBA 1I4OA 2B4RO 1GEEA 3HU5A 2ZRCA 4Z2AA 1FSFA 1I3LA 4LSWA 4YJKA 1OV4A 5D1NA 1ZITA 3CWCA 3QG1A 4AM8A 4C0KA 5K8CA 4JQOA 4K5QA 3DCIA 4M8NE 3AR6A 4QAJA 1HETA 2PDAA 1BVYF 5LD2C 1PUJA 3IERA 3ZV3A 1P9WA 2DT8A 1DO8A 2K2WA 1E0JA 3GOQA 2PJDA 3DBHA 3TCKA 4XYBA 1FP1D 1PL0A 2CMDA 2CLDX 1TM7E 1NVBA 1ULTA 1YL7A 2BKEA 5DNWA 3VR3D 1MVNA 1ZD3A 4N03A 2LPMA 4DLSA 4QLBA 1RKVA 1XKXA 3G0DA 4JI3B 4E88A 5BVGB 2JLZA 3C45A 3A4YA 3EXHB 1H2WA 4TS1A 3NHWA 4U02A 3WB2A 5H9VA 4ANFA 2RBGA 1MF7A 3FCSB 4BV9A 4RH3A 4KPFC 3KO8A 1GR1A 1I9CA 1E2DA 1T24A 4ZCSA 4YXFA 1ZJ4A 2H5IA 1U11A 3FPLA 1GADO 4NOJA 4NZYA 3GZNB 1I7NA 3UHJA 5A06A 5HDQA 5A5FA 1HT2E 2BWJA 3ZYCA 1OXMA 3Q8KA 1TVKA 4FYMA 4YP6A 2B92A 3GLGE 1BHJA 3QTLA 3SHTA 1U2DC 2WG2A 2ZRQA 2IYWA 4RFLA 1EJ6A 2HV9A 4XIFA 1FYFA 1HPLA 3MIIA 4LYDA 3CRVA 5CK4A 3R7FA 4E5UA 1S3FA 1J5XA 2QL7A 1Y9EA 1YR2A 2ZYTX 3MT9A 1H4VB 1S89A 4U9UA 4QWMA 3UMFA 5KSPA 1JB9A 2P9CA 3GAFA 3O0DA 1AU9A 3O1IC 4J7XA 4IDPA 4K3UA 5LA6F 2X8WA 1TO1E 3SQNA 3WYGA 4EQZA 4M1YA 2JLXA 3WKCA 4M46A 4NECA 5C32A 5HZMA 4OGLA 2CXQA 2OESA 1MO4A 1ZH6A 2DTXA 4LJ9A 3ZE0B 5AW3A 3DOOA 2GPBA 4TMWA 1C1XA 3T3NA 1XD8A 1PWHA 3CLHA 3LPLA 4C4RA 1JW9B 2FK7A 2PO5A 3BMCB 3F90A 1LJLA 1VBMA 1A97A 4QPJC 2RK6A 1XZHA 3FTCA 4QQNA 4RPCA 3H65A 4B45A 2LKDA 1O6GA 3NUZA 4GQBA 5C7LO 4I99A 2G7MC 1KBQA 1R88A 1VLLA 3O3NB 1ONOA 4X3PA 4F6RA 4DLLA 1RRFA 1Z68A 2HWYA 2ORED 4GKKB 3S8EA 1EFRA 1VZ3A 3S55A 5A2GA 3L1JA 3N7TA 1T6YA 1W52X 2FUKA 3TW8B 5F3RA 1R5OA 4CLEA 3O94A 4QAQA 4V0ME 1TQDA 3IJEB 5KHLB 3CPSA 1CUWA 1EI9A 1MX9A 2NUAA 1UFKA 1Y9AA 4KGZA 4MYHA 2WD7A 3RM3A 5HQ3B 3GZ4A 4TUYB 2CXXA 5T5QA 3W5VA 1V5IA 2DJ5A 1ACJA 1J0AA 3L7KA 2QVLA 2QM8A 2CCJA 5FA6A 4DV5B 4RVDA 4ESEA 1GZ7A 1IHOA 4P0PB 2C0PA 2G83A 3U4GA 4DA4A 1BA3A 1JA1A 3CJRA 1RQ2A 3P32A 4I9GA 1W1IA 2AE1A 5J9FA 1IWBB 2FGKA 1LRJA 1C3XA 2NXWA 2YHIB 3BTSA 4JITA 4Z9BA 1N4DA 2PYIA 5I3ZA 4XX1A 1IHDA 2PR7A 4MPTA 5EWLB 4GI3A 4Q00A 4RVUA 2C2ZA 3EFHA 1E5DA 4P4SB 3LWBA 4AZ0B 2V0CA 5GIPE 2IZ0A 2XXAB 1CVLA 1GPAA 1NVWQ 3O75A 1OT5A 2CE2X 1Z6YA 5CFRA 1EEXB 2H2AA 1YJAA 2GAJA 2PXHA 5IC5A 4Q0MA 5CDSA 4I8XA 4QOHA 3VTFA 1J0BA 4V0OA 3W5UA 5KOIA 5AJTA 2OC4A 2NU9B 2O59A 3HCOA 1EEHA 2B5VA 4UASA 3O8QA 2G17A 4FZ5A 4QUIA 1I51A 4PLGA 1XN1A 2EG5A 3BD9A 1Z0UA 3GVHA 4REQB 3JVIA 4KXLA 5ENDA 3PU6A 5KKAA 4TRMA 5E2AA 1KU0A 2C97A 1NXVA 1ZVQA 3D5QA 3VPFA 2LGJA 4EATA 1JG1A 1Z5WA 3GDWA 2VDWA 3HLKA 4HBGA 3WGMA 3GA7A 2JVIA 1O6FA 4ZV7A 1VPWA 2RE8A 4ARSA 3R5HA 5EQFA 2Q6OA 1XTPA 4TWAA 1K6IA 1DE0A 3L4KA 3DDOA 4KVZA 1MMFB 2KHZA 2IU4A 1FFDA 1YBMA 2CLOB 3DR5A 1II9A 1COZA 4AWXA 4KFTA 4NXMB 4EUHA 5IVKA 4FUQA 1BCSB 1N2OA 1TMKA 1T5TA 3KYCB 4L4RA 3TIFA 3UAVA 3OBBA 1E5TA 2PZBA 4DSAA 3EPPA 2EKZA 3G0BA 4MICA 1N8NA 3JAWA 4WJKB 3RTCA 2G1UA 2QNIA 2ZDHA 2B1RA 1A9XB 3O4GA 5JECA 1E5LA 5ILQA 4AD8A 5D1HA 1P45A 4G81A 2WWFA 4MA4A 2Z9BA 1SO8A 1SXJE 3EZFA 2VDOB 3KE9A 2P0AA 5JCOA 1E79D 5IH7A 2ATXA 1I3KA 4EI2A 3JSXA 4BBPA 1MJGM 1WUHS 4YPFA 3N3AC 1XLVA 2C5FA 1EUQA 5ALKA 1DQZA 3AUXA 1CETA 2DT5A 4CN9A 221PA 1N6IA 3AUUA 4J0QA 4XE5A 1IPFA 1ZIYA 2BISA 3GFGA 3E8MA 1NW7A 1QX4A 1Z26A 1VPVA 4LJ6A 4R54A 4JVLA 2ZRNA 1PG2A 3SHQA 3OOSA 1M6VA 3C3JA 4IRXA 4NCIA 4DV7B 2FHSA 3NHZA 1KE1A 2DSTA 3ZE8A 4LJ4A 4MQMA 1OGYA 1SQ6A 5TS2A 3TTUA 5LPNA 3QM1A 2ET6A 3NI2A 1K4MA 1MIHA 5AHKA 5B57C 2I29A 1EINA 4G89A 3VDRA 3A28A 4BQNA 2I65A 1SU8A 4RE6A 1QCZA 2WZCA 3C3DA 5A9SB 2C61A 3JZMA 4OGKA 4L9WA 3ACCA 1U1DA 4OP3A 2ODWA 4AZ3B 1NSFA 4IXTA 4ND2A 4DV6B 2O2IA 1FFGA 2FWNA 3GNSA 3OM1A 2QJRA 1KK3A 3DPIA 4E1VA 2XGJA 4GLJA 3GH3A 4FFLA 1I3MA 1QDEA 2BJVA 3OX1A 4IX9A 4JGIA 3PSHA 3RWOA 2BJWA 3HJUA 3MN1A 5JCOC 1M2NA 5ALXA 1W0CA 1V2HE 1Y98A 2NO1A 2IZ6A 2OQIA 1OWOA 2YV2A 3KQVA 4ZYTA 1YIDA 4TT8A 3X2EA 3CQ9A 2NZXA 5J3JA 2H1IA 2E4AA 2ZIGA 1E9VA 2GRJA 3SOZA 2WIFA 4NAVA 4IJKA 4Q19A 5IUNC 6CHYA 1UAGA 1E1CB 4C9BA 1W5TA 2ZGVA 1TKBA 1NGSA 2ZSDA 4F71A 1HQKA 3G9ZA 3LUKA 1XQVA 1UMCB 3RC2A 4DQLA 1PI3A 1Q1EA 5IN4A 3D8NA 3V8PA 1U5CA 5BQXA 5D6NA 5LLSA 1H6AA 5FP0A 3G7UA 3UJ7A 2AOTA 2R8XA 4J7CA 4MGEA 1T0BA 2YRFA 4CDNA 4KH1A 2WF5A 1I7DA 4QM6A 2ISQA 1LKZA 3DKIA 1NBWB 5ALVA 4KEAA 2ZYDA 3MWFA 5E6SA 5FUMA 2EJWA 3QV1A 1EB8A 3V8QA 4C0HA 1MVLA 2BR4A 2P1DA 1ZINA 3SF8A 3EYWA 1RC1A 5IHXA 3DE3X 4E08A 4QTYA 1YOBA 4DIDA 4C05A 1DT3A 4HH0A 1Z56C 3NWBA 4WVFA 2HMWA 4OH7A 2AR9A 4Q3NA 1HC7A 2A9PA 3G1UA 3WHLA 5GTDA 1VA5A 3EA0A 2J7KA 2XB6A 5AW4A 3WB1A 2BKVA 2GHIA 2PS3A 1Z38A 1U2EA 3JYNA 4FCCA 3RJZA 1RE0A 3ICVA 3UJPA 1F14A 3E2IA 3N8IA 4L6AA 2GCEA 1LXCA 2OHIA 1I4TD 1PWYE 2C92A 2LTAA 3CF4G 2VBGA 1MQ8B 4KAXA 2E1RA 4BVFA 1E9BA 1LLUA 2ZB8A 2BEWB 4L9RA 3IEMA 1GCGA 2HK6A 1W2HA 4U7GA 3B1KA 3H1AA 1LK5A 4KKXB 5DYNA 3BF8A 3WNVA 3DOEA 3ZHQA 3HLTA 2IH5A 3OX2A 1KJNA 3NFYA 4UEWA 3FOWA 3ZBTA 2W42A 2YJ4A 1JEDA 4HD8A 1SJ9A 1VFPA 4I3HA 4M1WA 4ZQFA 4KPUB 3TMYA 4YY3B 3U5ZB 2AMLA 2B3DA 1I6MA 4E5MA 3PJFA 1QRSA 3MRSA 2WILA 3BORA 4HEA1 4R9VA 1R10A 3DE7X 4LY3A 4Q82A 5EIWA 3KPWA 4Q6WA 3OO1A 1XYGA 2NUPA 5IH3A 2YQ5A 3P0RA 1KI3A 2AZTA 4YC7A 5BY2A 5EJ7A 3GCGA 3UMYA 1T2NA 2IJGX 4NMLA 4D6PA 3IT1A 4DJJA 4EHKA 3CLRD 4KYIB 3I12A 3VSBA 3MOIA 3K0FA 1Z4PX 2Q3MA 4WASA 1MV5A 5E4TA 2P1ZA 3B6MA 4ZEXA 4DARA 2PUJA 1PJBA 1TI7A 3PEVA 1Z2NX 1VDZA 5C8DA 3V4SA 2FR1A 3KPVA 2X2OA 3JQFA 1J4AA 2WT8A 3KIPA 4RKYA 4IH4A 4UNIA 2ZT7A 5JDCA 1GA6A 1I4EB 2BGKA 1S4MA 2RJ3A 3BL5A 3QU9A 4KO4S 1JNXX 3I5UA 5L95A 1U7DA 4JJ7A 5BW4A 2FMTA 1BTOA 1UPUA 1NNI1 3WFZA 1J2UA 1X7GA 2B6NA 2VJAA 4B3CA 4EFMA 3KTAB 5H83A 2A0WA 4KLRA 5AOBA 2I62A 5LDDC 2VYVD 3IPCA 1GCOA 1KZGB 4OB7A 2O8CA 3BAFA 1QP8A 3AIMA 3PDJA 3CR3C 2FZCA 1DG9A 3DAFA 4NFHA 1E8MA 1L5LA 1XFDA 3WMRA 1ISSA 1RYFA 1V1MA 3F9IA 1S5PA 3MMZA 4JLAA 2OZEA 3NBAA 4NATA 4YJ3A 4RWZA 5E1DA 2F67A 3SS7X 3WS7A 3LSYA 1YC5A 4BC1A 4F6LA 2BIFA 1G2OA 1H8HD 1NMQA 1E99A 2ZZMA 1XA3A 3BFPA 2OFPA 3NC4A 2HSZA 1ZSVA 4Q4HB 2YBEA 4AY3A 1LW6E 1OX6A 3CJQA 5H0IA 1VBNA 2ZG6A 4OBBA 3ZQUA 3OQNA 4OJQA 2WSBA 5I8WA 3Q98A 4BVLA 3W5AA 4TS3A 1NE2A 3HHEA 1TK9A 1UM9A 4NDZA 2PQ2A 1C7RA 4UUQA 1J09A 3N5CA 4DNQA 1W9MA 1UBRS 5EP3A 3S2SA 1IE3A 3U6KA 1F4LA 1UPCA 4F5DA 5ICEA 2HA3A 4CU2A 3FUCA 4EFDA 3K8YA 2IZOA 4OQFA 5M2QA 4P82A 1YASA 1O0SA 2D2VA 3AL3A 1TC2A 3U3XA 5KPDA 1PJ3A 4TMTA 4Y1FA 4E2FA 5BV2P 3BD7A 3E48A 5KOJB 2XI4A 4WLFA 3KZ1E 5C1DA 2XV1A 4KTVE 2PXAA 3IQGX 5DEIA 1W4BA 4V0LA 1DBRA 4HG2A 4BV8A 2LKCA 2ZJ7A 4ZRMA 1NC1A 1PW7A 2VUSA 3P5SA 3R5SA 2G0NA 3U3OA 2NLOA 1Y8CA 4HOYA 1VCNA 4LXQA 1ISRA 3T7KA 4BNNA 1NXPA 2C8LA 1QORA 4C07A 2GD1O 3DMGA 4QGBA 2Q5CA 3S2IA 1XMVA 5DYWA 4XJXA 1Z0ZA 4C3OB 1FP4A 1SB8A 5BWNA 1OF1A 3F8WA 5JNLA 3H75A 1JLLB 1SBCA 4MZXA 5KINB 2C5BA 4FNMA 4H4DA 4MKFA 3S81A 3FFBA 1X1BA 2CXUA 1UBTS 5G0WA 2FP4B 3K15A 4LRXA 3WRYA 2DJIA 4CKYA 2BFEA 2A1UB 2P4SA 2PANA 2X1HA 1GFWA 1IHPA 1ZQ1A 3BMNB 3DYIA 1U80A 2O20A 3IAUA 3QMPA 2C4NA 2FG6C 1U8AA 2AWOA 5KTTA 3CINA 5EERA 4N18A 3RYIA 2QKYA 2HCJB 4NS4A 5I4IA 5BN4A 2BCGY 2HXYA 2IPXA 3DBIA 1RWWA 5K0EA 4HLNA 4YPOA 1NR5A 4G5XA 1U0GA 1X3LA 4JFRA 1D04A 4UTZA 4EMBA 3ZJ5A 4D9MA 4Z7NB 1HQDA 4F4DA 3PHLA 2EZUA 4O4LA 3L01A 5CXSA 1MO5A 5JASA 2QXUA 3AR3A 1A9QA 5CEEA 3CO5A 4HATA 1EFVA 1NAHA 1NBHA 2X0IA 5KDLA 5U4QA 3TQIA 3ZHOA 1E20A 1YUMA 1KRHA 1X9IA 2V4MA 2WTBA 2F48A 2RDMA 4X94A 1BJTA 2OXFA 2YV3A 1PK9A 1PNOA 3ESRA 4PSDA 5HX7A 3LOQA 5HIKA 3PE3A 5LQNA 2YN4A 1Y5LA 5THKA 3ZW9A 5I9BA 3NTXA 5KS2A 2J87A 3MMNA 3FMVA 4YASA 2ZIXA 2D1QA 3E53A 4Z4IA 2YNMD 3OCUA 2VJNA 2OWDA 4D57A 2TMKA 1T6BY 1FIUA 5BMVB 3PWZA 1E1KA 3TLYA 4EMTA 2FNAA 3MINB 3WRYC 1P7CA 2GJSA 2VCHA 3AR2A 4B5KA 1XXHA 2IOHA 3MJFA 4WKCA 1ODSA 1R64A 3QQ5A 4JLPA 4PCLA 3RB8A 4E2YA 3TM4A 3VOSA 1R5BA 1P0MA 4ZI7B 2JF0A 3TZCA 5HK8A 4GX5A 2XKKA 3GPIA 4JT9A 3I62A 3OPNA 1HDZA 1F2DA 2G5GX 2QMZA 2RHOA 3BWYA 3NB0A 3HMQA 4MV7A 2J5KA 2D1TA 2H9IA 3CW2A 1M73E 3ON5A 3QPVA 1WKCA 4WNYA 4E1AA 1N75A 2WR8A 1CY6A 5SYMA 1KYXA 1Q95A 3L4BA 4HMQA 3WK9A 3ROZA 2C5EA 5HW0A 1OFGA 1PAUA 5IU6A 1B8UA 5GJVC 5BSGA 3OBIA 2GXAA 1C9NA 4IUDS 3OOYA 2Y1XA 4BKQA 1MG5A 2DHDA 2HHJA 2BM9A 3QXJA 1C4WA 5JPIA 3WQRA 2K7FA 10MHA 3MTQA 4X1KA 4ZCPA 1S96A 5KJEA 2ZAYA 5IAGA 3THWB 3RS9A 5FBKA 3DXXA 3TRIA 5JHGB 1EDBA 2DY0A 3IUQA 4D5EA 1QYIA 3DYVA 1T3HA 1P4JA 1P7WA 1ST2A 2IVZA 2JIRA 2OHFA 1DFIA 4I08A 2PGDA 3MGGA 4MQ6A 3VU8A 3DO5A 1Z88A 4R2XA 4KR2A 4X9XA 3K72B 4ZGBA 1WCIB 4ZU6X 4G2NA 4EEZA 3O1LA 1EFHA 2A9JA 4DLPA 4DG8A 2FI1A 4YRNA 3D7MA 4CTNA 4MDEA 1M6EX 2OO5C 2GCGA 4IIDA 1UOQA 4DSUA 2IX9A 1UUFA 3E3OA 3DWIA 3IVMA 3L4EA 2DPHA 2C2KA 1AQUA 2CW5A 3E3MA 2IUFA 4PYLA 3DULA 2NU8B 1UIRA 4TTJA 4LZOA 4UM5A 4DCNA 4DDKA 3L4BC 1I7LA 1WXDA 1ORIA 3ND7A 2AFIB 3GFVA 2YY5A 2CLCX 4RVGA 5C7OO 4XVQA 3VHXB 4AJJA 1PNVA 1GGVA 1DCMA 1OBHA 5DHAA 2I8AA 5A02A 4YA6A 3WLSA 3TG2A 3I1JA 3GA0A 3F6RA 2P79A 5HCUA 3VNBA 1FZTA 1XI2A 4RZQA 3X1YA 3FI9A 1KAMA 1VRCA 3NHFA 4DDWA 1JHQA 1DC3A 2QRVB 4RS4A 5AM3A 5BN1A 4XWKA 3NHAA 4PC7A 5DGTA 1FTSA 4CQMD 2HF2A 4J3FA 2GETA 1J8QA 3H9JA 2J0EA 5J2UB 3H6HA 3HCCA 3LUHA 1XDSA 2PX6A 3LWNA 1HORA 5JZVA 1VSTA 3PIIA 3PZBA 3RI3A 1J5EB 1POWA 2HOQA 3BZUA 1GY8A 1V48A 3PXBA 4OLJA 1EG7A 5SYNA 1ML3A 4OATA 3SLGA 3PFBA 4RJIA 4S1WA 4LC1A 4TV9B 5I9SA 2IU0A 3LUCA 5H3HA 1HM5A 3WGOA 2ILVA 3A27A 3A1NA 1E8DA 4MW1A 4NICA 5AQ1A 2VDLB 1WAMA 2FMKA 2J31A 2ACWA 4X45A 3AJRA 3DCJA 3QF4A 3ZIUA 2QTBA 4JYBA 1NWCA 2OL4A 3E5HA 3IJ5A 1HYQA 4BGDA 4F1WA 2AZMA 3NEPX 4RIIA 5I4CA 4AY5A 1KYTA 1TTHA 3NGMA 2J59A 3ZI4A 1G8YA 1AF7A 1E8NA 3K2BA 3A4NA 4ZT3A 5JAQA 3R8FA 3IILA 4BRUA 1XKTA 3QKWA 3HTXA 1TU4A 5H4GA 5K8JB 5AW0A 3EQ9A 1XQYA 3PIDA 2DY1A 2QTMA 3DAOA 3GP5A 2VZLA 4KDCA 1XJCA 2ZQZA 4YAUA 2CJXA 3AVTA 3ETCA 2DUNA 2I4OA 2WJAA 1CR0A 4ENPA 3L1IA 4O4IB 2ZXUA 3O90A 1J21A 1FQJA 1L5HA 3QU5A 3QX7A 5DRYA 2HR1A 2ODTX 4R05A 2YXNA 3DONA 1IOWA 2E5FA 1NXTA 1OX5A 4HDNA 4RA9A 3ZWMA 1E98A 1BHO1 2AB0A 2WK1A 3GDFA 3L1KA 4J07A 4MUEA 4RA6B 3OOEA 4CXMA 2ZT5A 3E15A 1UT6A 3GB9A 3PRHA 4K6OA 2FEMA 5DN9A 2ZEJA 2Z2ZA 3D3JA 3DUFB 2LNDA 3D6UA 1HY3A 2ID7A 4GOOD 1TZKA 3WOVA 4BO8A 5HHTA 4DJFC 3UCFA 1NQOA 4JJGA 4LAFA 4RZSA 4F3NA 3TQTA 1H0HA 3G02A 3AIIA 1ONSA 4RHXA 5EQJB 3IMFA 1C81A 3X1ZA 5AJYA 4G0YA 1QX3A 2BF7A 4IJMA 4EI8A 4LJSA 3CCCA 4LNUB 2HHAA 2YDXA 4ISCA 4R8SA 9ABPA 5C53B 3GFSA 1TIPA 5DCYA 5C4IA 2ICAA 5F1YA 1JDBB 3ZZ1A 2HU2A 3RFUA 2ADOA 1V8DA 2Z56A 3KUCA 1WEHA 3PUIA 1X74A 1L4NA 1NQTA 2GM5A 2GN2A 3N2KA 3WMEA 4KWTA 4ZMBA 1A27A 4OK6A 2ZPAA 4IUYA 1V9CA 3EGDA 5I45A 3ZXYA 3RVKA 3JZDA 1QGED 4FYYA 4Y2PA 2DLDA 2VCYA 1CEEA 1MNAA 3ETGA 3GLVA 2QUKA 2QRHA 1TQ6A 3L7AA 4H59A 5B3JA 1YFLA 3EPRA 1O6ZA 1Z2EA 3G8AA 2AXNA 2LUOA 2GMWA 5HEKA 1AA6A 4JJ8A 1XGKA 2PL9A 3Q88A 2BI4A 2WHRA 3VR2A 4AT1A 3W7VA 1ZR2A 2GEDA 3M6XA 4Y2SA 4LF9B 1AKYA 2FSFA 4MVJE 4DSTA 1UOEA 4YUAA 3MIZA 3HGQA 2Y1WA 5EHXA 5K99A 3OPYI 1TIKA 3I3OA 4ZK2A 4MS1A 2IL1A 1LTKA 4RPIA 4ALLA 1JFTA 4IWXA 1KJYA 1SU4A 3RRFA 1W5SA 2Z0MA 4DNOA 5DGXA 1G1AA 4I5EA 3EPKA 2G63A 2VSYA 1TX4B 3IUMA 2E49A 3EMDA 2NUTA 4WKGA 3IXMA 3ZI7A 1NN3A 1JZQA 3BFJA 3L6RA 2PPLA 4OJKA 3AI7A 1K6MA 1AK2A 4QBFA 4U0KA 2XRYA 4EQ6B 1N6KA 2LZ0A 5A3JA 1DP4A 1C9JA 1ODTC 2A78A 1CUHA 1VG8A 4J6EA 4RPJA 2PVPA 5HE8A 5JAHA 5JUWA 1G20E 2IOYA 2G9QA 4BX0A 4D8UA 2ODPA 3BQNB 1YOVB 4EF6A 2BT4A 2QL5A 1NLUA 1J9GA 2QY6A 3PL5A 2AN4A 4J76A 1B6SA 4QQ8A 5KC8A 3FF1A 3H2SA 1NQWA 1ONNA 2ROQA 2QGZA 4U7JA 3SOPA 1A1VA 1K27A 5KNCA 1L7PA 1PVOA 4HUTA 4YDHB 3IP8A 2JEOA 3NJRA 5DBEX 4Z8YA 4LC9A 3WK5A 3QE9Y 2VDPB 1WKVA 3JYOA 1I10A 2W6MA 2IK8A 3K9GA 5C5IA 1NOKA 3I05A 2TYSB 4GYJA 1DBPA 1FUKA 1N7GA 1XZNA 2FFAA 1IG0A 3L0YA 3RIYA 4BO2A 3JTEA 2WTUA 4AQ7A 1PUIA 3TI7A 5AI9A 4C2UA 4UBLA 2OV2A 2FF7A 4RENA 4MWSA 4Y9TA 2J0QA 2C4TA 3V7UA 3V4VB 3W5CA 4J0IA 3EVEA 3B9PA 4FEGA 1HZZA 1BG6A 5IBRA 2AJDA 5LNK6 1WZCA 1QB8A 2CLEB 5JISA 2XE4A 1QZ3A 2NAPA 5F2NA 1U2RA 4PC1A 3R76A 4PG5A 5I7OA 5DP2A 2E2WA 2VRCD 3PQ2A 3BCRA 4KIWA 4Z9XA 5IDQA 3KQLA 4CGZA 2BLNA 1RYDA 3U44B 1B4DA 1UDRA 3W6NA 4AKGA 4GBED 4YGYA 3FPJA 3QXHA 1BMFA 5FJJA 4IYJA 2WU8A 4LBVA 4ETIA 2D6FA 1KYYA 3A1WA 4E5DA 4PG8A 2X13A 2ZIUB 2J07A 3KKKA 2AR0A 1FB5A 4DBVO 3JQEA 2HFJA 4ER6A 3VR4D 4QOJA 1KE2A 1NTRA 5FADA 1JHVA 5T3YA 2JC3A 1U1CA 4Q37A 1NP6A 3L8DA 2R47A 4UEJA 4Y67A 2AGVA 4OYYA 2A88A 5H81A 4B34A 4IMJB 3KJIA 1NF3A 5EHNA 4DYVA 4CIAA 5JRJA 3NC0C 5JZOA 4B3FX 1N3BA 5AI8A 1P75A 3JQAB 3Q3CA 4Q4JA 1W0KD 1MHPA 1AO3A 1Y8QB 4GIBA 4PS0A 3ZC3A 3A4VA 3M1YA 3W5SA 1CIVA 1NULA 4OOFA 1KKUA 1GU0A 1VIDA 2HT6A 4P3XA 2FXIA 5C4GB 4ZCIA 1HZZC 1VMDA 4I6GA 1AH2A 4QKQA 4XOUA 3WNQA 1Z0KA 5DM1A 4K87A 3EYAA 3T5PA 5TPZA 4FIDA 4LMRA 1P1FA 3HXMA 5I9IA 3I61A 4K8OA 3F7MA 3PPWA 5E2BA 1R9GA 2FOLA 2I99A 2VWGA 4IMIB 3RVJA 3SSAA 1SWVA 4MX8A 4QWWA 2WHQA 4UAGA 2FSHA 3V00A 2O14A 2VJPA 3AEKA 3DWEX 1FRZA 4YJ2F 2IYLD 5DF1A 1Z0AA 1W59A 4MHSA 4XQCA 1K0FA 4BJ1A 1N2BA 4W5QA 2MSNA 1JJ7A 3UUGA 1E1DA 4C7VA 1D03A 3CO0S 1PT8A 2NQ8A 3RK4A 3Q0TA 2FPGB 4RNCA 2GTIA 1YS2X 4HUJA 1GGKA 5ARDA 5LOVF 2KE5A 4FHGA 5EIOA 5EFZA 1GXSB 1GKKA 4NDAA 4I1YA 4N48A 4R0VA 2CVPA 3NIWA 3B5JA 3U40A 1W581 1P91A 1J7KA 2MINA 4EECA 2NO6A 4RTSA 2BFDB 4J2OA 1K7SN 1W25A 1N5JA 4PLZA 4XAQA 3LP8A 5GONF 3W05A 5LP1A 2ZJ4A 2D74A 2EBHX 2UZAA 3AF6A 4JP1A 3OA2A 3IX7A 5J4LA 2Y0PA 3WRXA 4Q15A 3QEOA 4LYHA 1Y8ZA 4IHJB 4KGDA 3K9QO 3M7IA 4HDRB 3RAJA 1U7UA 4LRQA 3BIJA 4MDHA 3B5EA 5CFOA 6YASA 3A26A 3DMRA 2ASVA 4HN9A 1WVGA 1UMDB 3JQ7B 4B82A 2Q7XA 1D2CA 2CXSA 3RYFB 1IMOA 1G98A 4JUFA 5HGXA 4LFBB 1IYZA 3ZU6A 4DF3A 2CMFA 3TLEA 1HYGA 3T1OA 1SZDA 2HKIA 1ID1A 4V1CA 4OYHA 1C0LA 3I04M 1ZK1A 4Z8XA 3DO6A 4PPGA 2W2PA 2GZAA 4PVDA 4FINA 1NF9A 4G0XA 5LUBA 5T57A 3AVYA 4QUDA 4NULA 2JFNA 1IZ7A 1NIJA 2GFQA 3OEHA 3PTLA 4Q12A 3CTMA 3WIVA 4YGXB 3NV7A 3FCYA 2IYPA 1HLPA 2J3MA 3LBFA 1NMZA 3A2KA 2DHRA 1J33A 2HIAA 2IYAA 4ZAVA 2D62A 1SVNA 2B61A 1R9NA 5TB5A 2YMMA 2ODQA 4TM7A 1XXLA 2CJWB 5FWXA 3UHFA 4EHBA 2J9FB 1RQGA 1FC0A 2GLUA 4Z9FA 3I9V6 4JU8A 1D1QA 1RLOA 2AXPA 3HYSA 4FYWA 5DXFA 4WY8A 1TD1A 5F9MA 5GJCA 2OORA 2D4HA 5JI2E 3IKTA 1DTSA 4ZVSA 4YT4A 1KXJA 4Q9AA 4ZPXA 5C5CA 2JFFA 3CLUC 2QM7A 1ELOA 3OZRA 4AN0A 1WV0A 2RI0A 2RAUA 2HK7A 2QENA 3B6JA 1U0EA 1I2AA 3VZSA 3HK2A 2O19A 3T1QA 1P2BA 1QE0A 1VXRA 1D2AA 3DFMA 4QBIA 1V11A 3DZFA 2QPOA 4R16A 3B3JA 1NBME 3H9QA 3INRA 4MW9A 3EIWA 3EWIA 3FYUB 2WG1A 3JQQA 1IM8A 2Z58A 2AV6A 1Q77A 2C84A 3GFPA 4IG9A 1XRMA 3E22A 4OXYA 3GCDA 3C8DA 2PT9A 4LX0A 2BI8A 1BQ4A 3A9RA 3JQ8A 3MW8A 4CKZA 2ZYIA 4LZLA 2LBPA 2AUTA 2HLPA 3R5FA 2R65A 4TV8A 1XRPA 1U31A 3M8KA 1LS6A 4ALMA 4JNCA 3ZK9A 1WPGA 5EGSA 2VNSA 1JJVA 4JGBA 2WKQA 4DZTA 1V5FA 3P4UA 3FNGA 4G97A 3WLKX 1I24A 2WM2A 4WA8A 2GAOA 1L8AA 1LNSA 1R4MB 1SAYA 3DQQA 4KB5A 4CM4A 1HFEL 1H9AA 1R4NA 3HI6A 3AESA 4G09A 2C2BA 2PUGA 2ZFUA 3I2FA 3IYLW 4J8PA 4KR0A 1P8JA 4CKCA 1ZUIA 3W3AA 1O0BA 1WF3A 3BC1A 1L5NA 3ECAA 1CULC 2OORC 4P3PA 5AK0A 3IBYA 5EINA 1CYDA 1JLSA 3E9ZA 2EF0A 5IM5A 4BCCA 1JEQA 5CIQA 3RUPA 3REFA 4ETMA 1F1JA 3EUFA 3P5BA 4MO9A 1HEUA 5KYGA 5JAMA 1GNPA 5BSHA 1EM8B 1J2EA 1CQIB 4QELA 1WSDA 4NENB 5C1BA 1J6UA 5KVAA 4Y0NA 1QQAA 3L8GA 4J9VA 1DARA 5JY6A 2ZS7A 1CP3A 2FPUA 5K6AA 4ASUA 4WECA 1Y7TA 3VR3A 4U00A 3U2QA 4UJ5A 4B6QA 1XLTC 4B6EA 1IDN1 1BGWA 1KMQA 2G72A 2XQVA 1HDOA 4B6PA 1DBSA 2HJGA 1PKEA 2GDJA 2WP0A 3QQPA 3X43A 4D9JA 1YJXA 3ACBA 4MEAA 3SM9A 2D0OB 4I4NA 1FTYA 3KHTA 1UXOA 1GL9B 2XCUA 4F3CA 3E9MA 2V03A 3UJ6A 1HRDA 1C8LA 1DJPA 2R6FA 2IY9A 3ECCA 3IQXA 1BE1A 3G2PA 1TAQA 3R3SA 4N0DA 2Y0CA 4E32A 3BSFA 2IH2A 2G0AA 5DV9A 1AT1A 1YZGA 5BORA 2VAVA 4DMCA 1Y1LA 2EYUA 2QJOA 2RB4A 3LFHA 2VPTA 3AEXA 5AKIA 2D1SA 3OC0A 2UDPA 4XGQA 5FYDA 1J99A 3MCTA 1Z47A 3AVUA 4C88A 5BV0A 2PU7A 2ZBEA 2YC4C 1LBSA 1E94E 4NPHA 1AS3A 1K2VN 2PRYA 1MP0A 1JHRA 4W1QA 1VIYA 4K86A 4FOLA 2OBBA 4AULA 1XZ8A 1CZRA 3B1WA 3R23A 4ER5A 5C37A 3KQNA 1SHLA 1GGFA 2PTGA 1DAGA 3WIUA 1XDGA 4ER7A 3JARB 1GG8A 5IULC 5K6AC 4UARA 4RPGA 2N0SA 4LHZA 4NYIR 2L82A 3W79A 5T7BA 4X3CA 4JLJA 1KERA 4DNFA 1F5SA 1YQUA 3VO9A 4J90A 5BSRA 5BUQA 1NX6A 4OLBA 2HSEA 1A8SA 2OHVA 5L3SA 3ENVA 1NP3A 3HSYA 4TKVA 4GU5A 3OCZA 1NJGA 3I9OA 1DRKA 3S27A 1ADFA 3W3ZB 3NBFA 3HMKA 4NQRA 3V8NA 4LHEA 4QT4A 1UQTA 2HCBA 1G5TA 1QG2A 4CFSA 3AG5A 2BSAA 1M2FA 4AIRA 1FQKA 1C80A 3A9TA 3T3EA 2IKQA 2P3SA 3ZLJA 3GJ4A 3T7DA 5EUQB 1QRTA 1Z4JA 2P6MA 1K1EA 2BN4A 3H7AA 2BR5A 4FGWA 3WYAA 2R1VA 1QAQA 3OPVA 3LX8A 2ZWMA 1QG0A 3JTMA 4HPWA 3R7WA 5LIPA 2P67A 5FUQA 2NTJA 2RC6A 4IIJF 4GBJA 3FBWA 4PSAA 3G5TA 4GECA 5DXJA 3D0QA 3ZV4A 3WISA 4HK4A 2KS6A 4LBWA 4MR7A 5IZCA 2EATA 3D0RA 1SXJD 3IURA 4B9AA 3UGTA 1NXQA 2YYZA 4UDNA 5CA1F 5HQJA 4LRSB 3FUVA 4RM2A 2OQ2A 3GLTA 2A6PA 2I3AA 2BFFB 2C2YA 4ZVKA 3CUSA 4R71A 1FJXA 4AK9A 4P8RA 3FZQA 1ZUHA 4GR9A 1DLIA 4XIIA 2B4TO 4NZOA 2QMEA 5TPWA 4B0PA 2VK4A 1JR6A 4JB8A 4J3JA 3BMOA 2O8FB 1D2MA 2IHZA 3ZS8A 1FW8A 1IXKA 1OU0A 1U3GA 4H1UA 3ET5A 2JGKA 4WOBA 4CNQA 2I7TA 1TPYA 3E7WA 4QIHA 4TVKA 3I9FA 1G42A 1P6XA 3DPUA 3ROQA 1RP7A 3AJAA 4MW2A 2AR7A 2LCQA 3AFOA 1GNQA 3U13A 4AC9A 2X0DA 1WSBA 3CNOA 2VTEA 3B12A 1QYWA 1US8B 3OKFA 3LUGA 3OU6A 5AI6A 1R00A 1ZMXA 4AAYA 2QTRA 1IN7A 2CL0X 1Q20A 2VUTA 3PQ4A 3QTTA 1PV2A 2IELA 4JL8A 1JHYA 4MV0A 4TTPA 4XX0B 2VH2A 1SN7A 4AO8A 1S8OA 4L76A 2ZULA 1NZJA 3CMCO 2V55B 4RACA 4EENA 2ZAGA 2XHZA 3HWSA 1GDDA 3M3DA 1MTOA 2GLTA 2E55A 2J6BA 5IZCC 5EKTA 3SXUA 1QLHA 2WIAA 2YZNA 3D0KA 4ZAGA 3LQ1A 3THXB 4BLOA 1XU4A 1R0YA 4WCDA 1NBAA 2PPVA 3GJSA 3K5WA 4ZZ3A 2QU8A 2WU0A 7ABPA 2ZUVA 1Q11A 2GF9A 1FBNA 1NUTA 3LY5A 3N8NA 3R7DA 3TKLA 4E6EA 1G3UA 3MYRA 3UAYA 2XMBA 2OB2A 2XUOA 5LJIA 5B30A 4X0EA 1BDMA 5GJWC 4CU5A 1E6LA 5ESDA 3AHCA 1JJBA 3AKCA 5DX8A 1XWFA 2ZSIA 1G2QA 3PUYA 3HM2A 1KWKA 3RWBA 3UB2A 2NP7A 5TDHA 2Y0EA 3B60A 2BP7A 2AUMA 2P40A 4X1YB 2OR3A 1RIIA 3QY0A 3FJYA 1IAQA 4G5HA 4HUQA 2IS2A 5HF8A 1XPUA 4OI2A 1OX4A 2FZVA 1A9SA 2HDWA 2QZPA 2J4DA 2XOXA 3GAMA 3VDXA 1G3RA 5B7NA 3EISA 4FX2A 3ZHCA 2RGBA 3TF5A 1W36C 2F1HA 1NVTA 4H7IA 1JFFB 3H6KA 1N5MA 4B4WA 2VTVA 1ICIA 1Y4SA 3GEDA 5E3HA 4XFKA 3CSDA 2Z4SA 4AI6A 5JR3A 3S7ZA 3F78A 3GNTA 4PTZA 2XADA 4DMFA 4F12A 2W2OA 1ADGA 5ICGA 1FJHA 1VYHA 1UDCA 4HQRA 4HWRA 5AIAA 1N2SA 1OTYA 2Q3CA 2VDJA 4TSRA 2HA6A 3WWEA 3M49A 3R3UA 1PNTA 1LQUA 4K9QA 1F0PA 4LGCA 1Q0ZA 1FVHA 4HZIA 1SRQA 4IJWA 5DTQA 3ADBA 5F77A 1TL7C 2XCRB 2NGRA 4MP8A 3KDPA 1JUDA 4KJXA 5LXTF 5K8IA 1VJ1A 2M9MA 1C0EA 3QELA 2IGTA 2XQIA 1R6AA 1VE3A 2NPOA 4P3KA 3RFVA 5K2MA 4BKMA 4GZ3A 3I72A 2HUPA 4BKPA 4LGYA 3GQBA 5KSWB 1EP9A 2O2HA 4NABA 2VT2A 4HGZA 1C2TA 4KIGA 4OHFA 3Q85A 4U2FA 3ZK8A 2FPPB 5D3QA 4AY2A 1K5HA 2X2FA 3EBLA 1KIFA 4HWSA 3JSAA 4UE2A 1KDPA 3ZY4A 1M7GA 1E7RA 2B98A 3H16A 1B6RA 3EC2A 3K0CA 4QODA 5CDFA 3H7IA 2Z6AA 2C9DA 3H8WA 3PHIA 1ILEA 1EP2B 4RTOA 1KJIA 5DIFA 5HVNA 4ZVTA 4C89A 4E2WA 1BX0A 1K5GA 1M1NB 1WD5A 2FZGA 3ZD9A 1G63A 1GKYA 1ORVA 3R0JA 4N3GA 1BQ3A 1K97A 2XTMA 3EXIA 1JJFA 3FMOB 2VP9A 3WP0A 4BYMA 1RQNA 4EO4A 4P3OA 2EYQA 1M2HA 4CKEA 3B82A 3CNNA 3GMSA 5FBLB 5DSXA 3ICCA 3AHHA 1VKZA 4I1PA 3UGJA 1V6AA 3ZU2A 1RI4A 3GGDA 4KR7A 3CVXA 2O3QA 3SJ7A 2AFHB 4GVXA 2CUNA 4D9IA 821PA 2VF2A 1E64A 2VSQA 3WFJA 5JATA 2OD9A 3N0RA 1GTL1 5HA5A 1WZ2A 1OTXA 4QA9A 1E2BA 4PZAA 1KI8A 4XYEA 4OHWA 4A27A 4KLCA 4EGJA 4ZGGA 3PDIA 5DCWA 2JI8A 4FLMA 3DZBA 1QBGA 5JH7B 2QMQA 4MQUA 1C7QA 3CH7A 4RVOA 1VOTA 4XQ0A 1Q2XA 3JQRA 1IZYA 3IALA 3TZHA 3UENA 2ZBFA 5AUPB 2Y67A 1A04A 2DOKA 3BA1A 3ZGNA 1EXDA 4I1SA 3IS3A 2FPXA 1V3VA 1DKRA 1Z34A 4HVTA 4Q18A 2NQ2C 3QXCA 2XAUA 4AKTA 1V96A 4BAUA 4OSEA 1KNQA 1P2UA 2XNDA 2Q2NA 1EQAA 3F98A 1LF0A 4EVSA 1AK9A 2AF3C 1F6WA 3JZIA 1BXGB 1Z8DA 4C1BA 1B74A 3UAZA 4MV9A 3WL4A 4A82A 5DP1A 5BVGA 1DIHA 4PXSA 5A0TA 4B80A 1WMSA 3EXHA 4IVPA 2X3YA 1YJQA 3G2OA 5C18A 2G8NA 4KO2S 3WL3A 5KYXB 2J45A 4XCXA 1C8BA 2VWHA 4MRMB 1E1NA 2CFIA 3GZNA 3JRXA 1GA4A 3L9WA 4Q7MB 4PLCA 3HDQA 3U19A 3L0SA 1LPMA 2QYSA 3VPXA 2HQOA 3KUXA 4AKEA 3WYBA 4H4EA 4YMWA 3TE6A 1YI8A 5JI3E 4MGYR 4OFXA 3HRHA 2ZSUA 5E6RB 4CCAA 2WPDD 2UUBB 1IDOA 4EAAA 3T5AA 4Q1DA 2C3MA 2G9VA 4POOA 1FNMA 2NSYA 3RRNA 5TT1A 1RPZA 5F78A 4G0PA 2Z8ZA 4P5PA 4LI3X 2J46A