4B8ZA

Crystal structure of human gdp-l-fucose synthase with bound nadp and gdp, rhombohedral crystal form
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
308
structure length
308
Chain Sequence
b'MRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-L-FUCOSE SYNTHASE
publication title Crystal Structure of Human Gdp-L-Fucose Synthase with Bound Nadp and Gdp, Rhombohedral Crystal Form
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 99
structure length 308
sequence length 308
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b8zA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4b8zA02
1S6YA 4FD3A 3GN2A 2G0TA 5MGBA 2FR1A 3FN4A 4FCCA 1BG6A 2NACA 1T4DA 5KJEA 4CMHA 1PS8A 5BQFA 2X86A 1DFHA 2E37A 1JDJA 4HADA 5IN5A 2J3KA 4KOAA 4TWRA 1TT5A 2Q50A 3UW3A 5KOIA 4BKOA 3JQAA 5IZCC 3GPDG 4NFSA 1KERA 3KEQA 3FPCA 4A0SA 2ZB3A 4TVBA 2CMDA 5ENVA 4CL3A 1BDBA 1ZEMA 3MTJA 1ZSVA 2VNAA 4PLTA 1N1EA 3HHPA 2VT3A 1A27A 3LYLA 1EEHA 3SLKA 2JCYA 3C7AA 1PIWA 4Z0TA 3L4BC 5K9ZA 4L8VA 1I2ZA 4MP8A 3VH3A 3UKOA 1IPEA 3GEGA 2Y0DA 3C7DB 4FJ2A 4ILKA 3IP1A 4KWIA 4EUHA 1TLTA 1BGVA 4N7RA 2Q2WA 4PZCA 4KMSA 1QYWA 3JD1A 3DBVO 3Q6IA 3H9GA 4CMKA 3JQAB 3PEFA 5DCUA 2WWRA 5EJ2A 3PFWO 3DHNA 3TFQA 5EINA 4E5YA 2Q2QA 3ZWBA 3C1TA 4M87A 4AJPA 4CM4A 3ONEA 1XKQA 4W9NA 1XYGA 4OSOA 1O95A 1XCBA 2BI8A 3KOUA 1GTMA 1HE2A 4XWYA 4BKPA 3MWEB 4PG4A 1R0SA 3GVIA 2A9FA 2AEJA 4TKLA 1CERA 3DQPA 3OJEA 1I3LA 1BVUA 1U2DA 1VC2A 3GHHA 4HUJA 4LVUA 4OAQA 4E2XA 5GZ3A 3EVNA 4XRRA 1I5RA 4MIOA 2X7HA 1YVEI 1JQBA 4D3FA 1HWYA 1GR0A 4AL4A 2G82A 4WPGA 1T26A 1T2EA 3WJAA 1ID1A 3NTQA 1XIVA 1HTBA 4JK3A 4WE3A 4QO8A 1NFQA 1K89A 4YACA 3WDSA 4CM4B 3PHLA 1E1MA 4OL9A 3ZWAA 2UYYA 2Y1FA 3RD5A 2JKVA 4YT2A 1RWBA 3OMLA 4GVLA 2I6TA 2PLAA 4BQRA 2VHZA 1VJTA 2E49A 4HX5A 2CVZA 4OXYA 2JFGA 2GERA 2VRBA 2RBEA 2EGGA 2TMDA 1AUPA 1E3SA 3BTSA 4KDEA 1VRWA 4W7HA 5I9MA 3UHAA 5COBA 4Z9YA 3PYMA 3HFSA 4IZHA 2OP0A 3LK7A 1HE5A 1VL8A 2PGJA 3HJAA 2EW2A 3E03A 1AN9A 1GYPA 2YQ4A 4BO8A 1KVQA 1OZAA 4A10A 1H0KA 1UZMA 3PYLA 3RUCA 4CMAA 4CUKA 4E3ZA 3TFOA 1SB9A 3BMOA 3VPHA 1YB5A 1EBFA 3VZRA 1YDWA 1OBFO 4IUYA 1H94A 3I5MA 3BMQA 5DOZA 3WQSB 3K92A 2EEZA 3IJPA 4JIGA 4IGFA 3FNHA 3JQGA 4L73A 5AQ1A 4Z6KA 2XOXA 4MVJG 2EP7A 4FDAA 3PQDA 2G5CA 3GA0A 1IUKA 3JYPA 2DPGA 5AXDA 2UV8A 4KTTE 3SX2A 1AE1A 4CLXA 3AUTA 4BVAA 3OEYA 1VJ0A 3ZHBA 2PTGA 4NIMA 1I3KA 3VAZA 5JDCA 1PL8A 5A3VA 3P19A 5EPOA 2I66A 3GH3A 3OHSX 4NG5A 2DPHA 1WMBA 1F0YA 3JD4A 3RAJA 3BMQB 5ICMA 3QVTA 4XYBA 1P1JA 3JQGB 2O2SA 3PI7A 4WUVA 3SJ7A 4CQMB 2C54A 5K6AC 2YHIA 1DIAA 2O48X 1W0CA 3JYQA 4K26A 4G5HA 1UXIA 5DULA 1NQTA 2P91A 4UEJA 4NU6A 4JJIA 4ESOA 4XQEA 1M6WA 5DF1A 3AI2A 5JNLA 4I5DA 4PZEA 4WOKA 2IZ0A 2PZLA 1RYEA 1CQIA 4J43A 1E1LA 3OA0A 4U5QA 1ENYA 2AE2A 3H5NA 4QFDA 5HWSA 2C59A 2R6JA 4LN1A 1LSOA 5COAA 1HYHA 2D3TA 1MFZA 1DLJA 4FGSA 5TS3A 3DWFA 1RM0A 4FOOA 3RUHA 3I6QA 4XIJA 1EUDA 1LLCA 3ZV6A 2ZTMA 5JPIA 3RUDA 4RQUA 1QG6A 1N5DA 2B5VA 2DM6A 4PGFA 1CETA 4ALNA 1ISHA 3CZMA 5DN9A 1NAIA 2CFCA 2BHLA 4BKRA 2Q46A 1ZK4A 4YJGA 5FI3A 2CDAA 2E6UX 3WFIA 5A9TA 3WX0A 1QKIA 1X15A 4F46A 4LSMA 3DZBA 4DVJA 2O3TA 4M49A 1Q1NA 2V6MA 3AUUA 3GVPA 3IC5A 4WLNA 3TN7A 1YWGO 1K0UA 1E3EA 4NK5A 2GR9A 2FRDA 3ROQA 3WS7A 2IDZA 3GEMA 1P1KA 3B1FA 1PX0A 3DZJA 5T64A 1DBVO 4WNCA 2IE0A 4F6CA 3VKUA 2IEBA 3H9QA 4Q9NA 3WNQA 2QZ9A 3ANLA 1LRLA 3JQ6A 2DTEA 2VCYA 1EFLA 1JWBB 1JWAB 1KVUA 1LX6A 2WYWA 4HNGA 2DBRA 4XYEA 4KQWA 1YB4A 3VDQA 3ADPA 4YJGB 4AJIA 4AJLA 1E7RA 1EVZA 3ZCXA 5JXWA 1VE9A 1IPFA 1XHLA 1GUYA 1V35A 3DOJA 2YZ7A 4IQGA 5DNAA 4XCVA 4EDFA 3B20A 3O03A 1FF9A 2Q1WA 1A5ZA 1H2HA 4O63O 1PJLA 3DC2A 3LF1A 4GI2A 2PY6A 3KZVA 3HN2A 2PZMA 4BGIA 4BMNA 4W4TA 2CNBA 5L95A 1AXGA 3IKVA 1LRKA 1XEAA 1LDBA 1J5PA 4PLZA 4XYLA 1LTHR 4LW8A 2Y93A 4LISA 1ORRA 4YCAA 1PL6A 2R00C 1O5IA 2OZPA 3OETA 3M1LA 2A35A 4LCJA 1TT7A 4NU5A 1K6JA 4PG6A 4Y9DA 4DWVA 1B2LA 5ER6A 2YW9A 4FB5A 3QV1A 5CPBA 5AOVA 5JAIA 1ADFA 1MA0A 4MPDA 4UVEA 4B4OA 3ZH2A 1BXGA 2NSDA 2RHRA 4K28A 1BSVA 3WICA 1N7HA 3KXDA 1CRWG 5JSFA 4RV9A 3K2EA 4R3NA 1BVRA 3QW2A 4WKGA 2GGSA 4XYMA 1K6IA 3VTFA 3VTZA 3ZZNA 1PZHA 3GDGA 1LJ8A 3RC9A 2J8ZA 2ZTLA 4W99A 3KHUA 4ZVVA 2ILTA 5B37A 2BMAA 3LT1A 4IXTA 5DCYA 1HT0A 1NASA 4CR6A 2LDBA 4BV9A 1SEPA 2W90A 4YYZA 3KLPX 4H3VA 1JAYA 4PFJA 3AM3A 1EFKA 1BXGB 3ZWPA 1M75A 2UAGA 1JAXA 4P22A 2ZKLA 1FDVA 1NYTA 5F5NA 1TB4A 4NHEA 3VZPA 1WWKA 4RVSA 1Z73A 4CV2A 1DIRA 1OFGA 2CD9A 1B3RA 4XZ3A 1MP0A 2V6FA 1X1EA 4CV1A 3RBXA 5B4TA 3LT2A 4MJLA 3A28A 1NQOA 2BELA 2AHRA 2NQ8A 3AM5A 1DC4A 1YQGA 5TT1A 3MJVA 3W8EA 1PGNA 3QVWA 5IFLA 2WJPA 4KTVE 4UUMA 3SC6A 2JD1A 1D1TA 2UUPA 3G49A 4JX8A 4TRJA 1KVRA 1PR3A 4FPXA 3S2IA 3HN7A 3Q0EA 4R69A 1V6AA 5L7YA 4IPTA 4O5OA 1PWXA 4PRKA 5DBIA 5TC4A 3UCEA 2IODA 5L40A 5L7WA 1Y8QA 5A5FA 1R0LA 3OBBA 4BNIA 4CM3A 2OUIA 5I7SA 1VJ1A 2EGHA 2H63A 1CQJA 1MG0A 3T4XA 3F3SA 3BIOA 3C1OA 4RVGA 5BNIA 5IAAA 4D46A 4NBTA 1QRRA 1E6UA 3BHMA 5KIAA 4NMHA 3A14A 1PGJA 1LC3A 4ND5A 4R41A 4NBUA 4GMFA 4FQ8A 5TJ9A 3PDJA 3D0OA 4U6QA 4IJUA 4XR4A 4LSWA 2X8LA 4EJMA 1NHGA 3AU9A 2FP4A 1NP3A 2P9EA 3DONA 3PIDA 5B4UA 3WR5A 4L74A 1DB3A 3AU8A 1U3WA 4WLOA 3K8ZA 2QQ5A 3TOZA 1LLUA 1CJCA 1GDHA 3JQBA 1TXGA 1UXGA 4L76A 3EVTA 2D2IA 3PDUA 3PJFA 3VC7A 1J49A 2VOEA 4NR0A 3PLNA 3UCFA 3HB4X 4CMEC 2HMWA 4JXKA 5BSEA 5JY1A 1YL6A 3I9NA 4WNIA 1HETA 2IYOA 2G76A 2VYVA 2VYND 4CR7A 4L4XA 1EVJA 2I76A 2EHDA 2Y1CA 2Q45A 5F5LA 3IKTA 2DBQA 4W6ZA 1J6UA 3RKUA 4U0KA 3DOOA 4J9VA 4R3WA 4WLVA 4XQCA 4BO6A 5AYVA 3ZHXA 3ZWWA 1HYEA 4BNWA 4FS3A 3PIIA 3ASVA 1R0KA 3IIEA 1PJBA 1A9ZA 1MX3A 4PVCA 1E7YA 4WOJA 1VI2A 3CINA 4CL8A 5ICSA 5EESA 4AJ4A 1S7CA 1C1XA 1KETA 2J6IA 4RQTA 5MDHA 2HU2A 5I7VA 1YGYA 1PL7A 1NAHA 1EE9A 1UUFA 5GZ6A 1NBOA 4EJ0A 2VHWA 4C7KA 3ETDA 5TSDA 3D3EA 3AWDA 2O7SA 4MKXA 1DRVA 3N58A 3SLGA 5JC1A 1ZBQA 2P9CA 3ZW8A 4I9NA 1Q7BA 1X1TA 1ZMTA 1KBZA 2X0IA 5ES3A 3DHYA 5B1YA 3VPGA 1P45A 3QSGA 2Q4EA 5JCXA 5AXBA 1JVBA 1PJ4A 4I8XA 1LDYA 4ZD6A 2I67A 3D5QA 2TMGA 2F1KA 3B70A 1YOVA 4HNHA 4TSKA 1MGOA 1M66A 3C24A 3NAQA 4OYRA 5L4NA 2EJVA 4ZQFA 4DYDA 3AK4A 1LNQA 2VUTA 4J7UA 3DFZA 3UUWA 1PJQA 2WD8A 1C1XB 3NGXA 5BNTA 3D7LA 4GMGA 4J90A 4R54A 4B7XA 3AFNA 4A26A 1SZJG 9LDBA 1K2WA 1C0PA 3PK0A 4IBOA 4FW8A 2B5WA 3NKLA 3GVCA 3QP9A 3UFXA 4M89A 1U3VA 4HXYA 1HZZA 2AQ8A 2GYYA 2JCVA 4D43A 3GY0A 3F1KA 2ZB8A 3WYEA 1JLLA 4RDHA 1YOVB 1YBMA 5G0SA 4NPCA 3BTUA 3V1UA 1E7SA 3F5QA 3H5RA 1KC3A 1E3WA 2O7QA 3ON5A 3ZGYA 1E5LA 1GU7A 2OMEA 3H9JA 5G4LA 4BO4A 3DZIA 4YAIA 3VOSA 3G79A 3P7MA 2X5JO 1C3VA 4YA6A 3WYCA 4KZPA 1NVMB 3GFBA 1EZ4A 5CPFA 2ZYDA 3PHJA 1D8AA 5BSFA 3FI9A 3GNTA 3BYZA 3GFGA 3OIDA 2VN8A 4G2NA 1LDGA 1V3TA 1EE2A 2D4AA 2VUUA 4GQAA 4QX6A 4B4WA 1A4IA 4BGVA 4OSPA 4YAGA 4WCFA 1ENZA 2Y67A 4I5FA 5G2OA 1PSDA 1Q7CA 2E4AA 4BL5A 3HUDA 4B8ZA 3KBOA 1GCOA 5C7IO 1F12A 3DBLA 5JW6A 1BRMA 4MOWA 4QFCA 4R16A 3CMMA 3O26A 4IMRA 3T7CA 3OIFA 4E30A 1E3WB 2HMTA 2QYTA 5C5IA 4Z3KA 5KNLA 4ROSA 4XJSA 4BNVA 3NJ8A 2CVOA 3GN1A 3QVSA 3RC2A 3RQSA 2C7VA 2C0CA 2OOSA 1BMDA 2BF7A 4NZ9A 4DQXA 4BNKA 2VOJA 1OC2A 3G1UA 2PV7A 1PJSA 2OFPA 2NVWA 2JJYA 4D41A 2O3UA 2I99A 2PA3A 4YJFA 2X4GA 4JJFA 4MVJD 1F14A 1U8FO 1U5AA 3L07A 4BNYA 3OJFA 1HDXA 3OH8A 1GPJA 2FR0A 1QLJA 1OAAA 1EVIA 2JCXA 3RROA 1B8VA 5KJ6A 1P3DA 4DXHA 3BHJA 2O3RA 4J9UE 1P1FA 4RVFA 3C7CB 4JBIA 3ZW9A 1PWZA 3QLJA 2J3HA 4UVDA 4BO7A 1B16A 2Q1TA 1GZ4A 5BSGA 1V9LA 4D3SA 5A9SA 1YQXA 2DU8A 1KOLA 1AGNA 1VL6A 3MJ4A 1KVSA 3TL2A 2FPGA 3OQ6A 3QWAA 4ZHSA 4R1NA 3UXYA 4YJFB 3WGHA 2BH9A 3RU7A 1UAGA 2BGLA 1LI4A 2B0JA 3H6KA 4LMPA 1G6KA 2HUNA 1ZK1A 3Q3CA 3KYCA 3CTMA 3B1KA 3CUKA 4R68A 4DMMA 1RM3A 3DZKA 4K1LA 2X5KO 2X9NA 3LT0A 3U09A 1UXJA 1X0VA 3PXXA 1HZJA 2Q1UA 2VWHA 2BD0A 3QWIA 1EQ2A 3DAPA 1K5HA 4TRRA 3Q1LA 1XU7A 2O3QA 4WASA 5C37A 4F3YA 4BNJA 2OO5A 4NFHA 4CMGA 2EJWA 2W98A 3JV7A 5A9SB 2PKRA 3R1IA 2HK9A 3BZUA 4WEOA 2W2LD 3PWKA 4ITUA 1HYGA 5AXAA 3R6DA 4WECA 2C7GA 5AXCA 1Z7EA 2RH4A 3WNVA 5B4VA 5BR7A 1NXQA 1WZEA 3BXXA 5HBRA 1TT5B 2O23A 1NR7A 3LC7O 3NUGA 3ZHYA 1IYZA 4DPKA 3DZFA 1TVEA 4R9RA 1ZK3A 2PGDA 4AJOA 4I1IA 4RVHA 4Q3BA 2FPIA 3NEPX 1B14A 3TZKA 4YT5A 3UH1A 1EUZA 1V3UA 1ZFNA 4E5NA 4Z9XA 2HJSA 2I9PA 2NTJA 4BS9A 2Q1SA 2UUOA 3PHIA 1A4UA 1QYXA 1W73A 2UVDA 1NFFA 3ADOA 2NU8A 4E5MA 3OQ1A 2Q3EA 3UCXA 3HZZA 4EGFA 2CVQA 2AXQA 2Z5LA 3H2ZA 5EQDA 1GL3A 1H93A 2Q4BA 1Q0HA 3EK2A 3ZU3A 2Y0CA 3K73O 5JDIC 3D1LA 3OJLA 1JA9A 4AJKA 4BQPA 3H9EO 3FNEA 3V1YA 1I2CA 4ID9A 2NTNA 4J7CA 5CP8A 2WYUA 1C1DA 3GNQA 4M54A 4JGBA 4D0SA 2H9IA 3PHGA 2YDYA 4ND1A 1NQ5A 4Y6RA 5L9AA 1G0NA 2D5AA 3DEYX 4HBGA 3OICA 4BO2A 3HE3A 4FOSA 3F47A 4Y8VA 3WTCA 4U7WA 2DLDA 3M2PA 3I83A 5KJCA 2QX7A 2WYVA 7ADHA 5A04A 4M1QA 3TJRA 4GH5A 5KVCA 5T67A 1M76A 3MWDB 3R0IA 3JQ9C 4MDHA 2RCYA 4C7JA 1UDBA 4B3JA 1YS4A 4FFPA 1R4NA 4BB6A 5DCWA 3AOEA 2VYNA 1B8PA 1LSUA 2AQHA 1O9BA 3PQEA 5KKAA 3ROPA 3NT4A 1C1DB 3BAZA 3WFJA 3R3SA 2P4HX 3PQFA 2GZ2A 2X0RA 4Q3NA 2GLXA 4Z0HO 3VH2A 2IEDA 4JBGA 1RM4A 3GMDA 1NVTA 5ILOA 1HDOA 3OP4A 5I7FA 5F1OA 1NPYA 2BFAA 4H7PA 5I9NA 2PZKA 1U4SA 5ITVA 1DO8A 5CDSA 4EITA 3QJ5A 1NM5A 4U0JA 2PD6A 4XJTA 1E77A 1ZW1A 3KM0A 3CMCO 2DTXA 1UR5A 1ZXBA 4PLYA 1R4NB 4YXFA 1P1RA 3ROKA 4J1NA 4D44A 4TVOA 2C07A 2QYSA 3V2HA 2I65A 4II3A 3KSUA 4XGIA 1L1FA 3LC1O 5THQA 3GGOA 4CQLA 3WSVA 4O1MA 3BMOB 3IJRA 3N74A 5IXYA 1EBUA 4GSLA 4XQGA 4DBZA 4GGPA 4K6FA 3W8DA 5A4DA 5FF9A 1GV0A 4A73A 1IZ0A 1ZSYA 2VZ0A 4CMBA 3E1KA 4RPJA 2FSVA 2BLLA 3H7AA 4L0QA 3GMSA 5LDHA 3A06A 5KVVA 2NU6A 4YRBA 2YQ5A 4CLOA 4WEQA 4J49A 2HO5A 3PJEA 5G0TA 2FMUA 5T8KC 4D45A 3FD8A 3L6DA 1Y7TA 1H6CA 2VNSA 2YV2A 1GAEO 1UP7A 4TQGA 3IOYA 1BTOA 3DHEA 3ZU4A 2C20A 2P9GA 1JKIA 3KYBA 3FRJA 3NYWA 1ONNA 4RORA 4BNZA 5HS6A 1NPTO 1PGPA 4IDGA 3RKRA 1U4OA 4R1UA 2GCGA 3I9LA 1FXSA 1I01A 1E3IA 4MP3A 4E5PA 1P1IA 4FFNA 3NDIA 4MP6A 5CG2A 3OEWA 1OC4A 4PIVA 4RPHA 2WMDA 4YT4A 4BNGA 1W6UA 2YHIB 1I24A 1U1IA 4PLWA 1HL3A 3W6ZA 1ISJA 4BO1A 3GLQA 1PZFA 4Q3CA 2EERA 3DMTC 1U3TA 4CLOB 3DXFA 2VHXA 3CH6A 3ICCA 4CM9D 4FJ0A 1E1KA 4OM8A 4DIBA 2W4QA 3U49A 3UOGA 1LSJA 3VH4A 3T4EA 3M1AA 2POQX 4MVJH 4DC0A 5L45A 4JBHA 1KIFA 4P38A 4E13A 4JROA 4CM8A 4BNFA 2AA3A 4QECA 4CJXA 2Y1OA 2YV3A 3AY3A 4KQXA 1YQDA 5JCJD 2GUGA 4OKNA 4DIFA 3O9ZA 5JAZA 1Z74A 1YJQA 1N8KA 2WSBA 3KEOA 4P4GA 1VKNA 3ULKA 4PG5A 4O0LA 4MVJF 1GEEA 3JQ8A 2CF6A 2J3JA 1P74A 1FDTA 1ZSNA 5TT0A 4FJ1A 3JQFC 2FR8A 2HSDA 2ZB4A 3ZWVA 4RPLA 1XQ6A 4ZA2A 1PZGA 1LUAA 3A1NA 4J4HA 3FTPA 1SCUA 4CM1A 1Y5RA 1H6AA 3M2TA 4RL6A 3ROMA 3SXPA 1P31A 3KTDA 4CMJA 1WPQA 2PH5A 5TX7A 2D5CA 1Z82A 4E6PA 2X1HA 1A72A 1NTOA 1FDSA 5JS6A 2Z95A 4YTEA 4PLGA 1YL7A 4NNJA 4ZQEA 2EP5A 3H5AA 1Q2XA 2GF2A 2GPTA 4HP8A 4MVJA 5CDGA 3GC6A 3L6OO 1R4MA 1SBYA 1SAYA 1HRDA 3JQ8B 3HQ4O 2RIRA 4GLLA 4D79A 4DPLA 1ZZEA 3RBVA 1Z7BA 3DFUA 4WJZA 6ADHA 1QV6A 1HSZA 4NFYA 2FOIA 4IY1A 1WDLA 3GHYA 1X0XA 3D5TA 4RCVA 4ZICA 1ZKMA 3W8FA 4ALJA 3EUWA 3WXBA 1VSVA 3RJ5A 3NRCA 1EDZA 4CM5A 4Q3DA 1L7EA 1LDNA 4R4JA 3NDJA 5H83A 3I9KA 4PLFA 5HM8A 5CG1A 5A02A 1YB1A 3KSZO 4XQ9A 2DKNA 1EQUA 3H8VA 4N5LA 1NR1A 4FIZA 5KCZA 1B8UA 1R4MB 2B69A 4EZBA 4GX0A 2XXJA 3JCZA 3WSWA 3RC7A 3KSDO 5L4LA 1UJMA 3I6IA 4GX5A 4KUGA 4NBRA 4X54A 5IZCA 3GRPA 1KEVA 5IDXA 3K2BA 4XGKA 3PWSA 4GKBA 1Y6JA 3TQHA 5DBFA 1T1RA 1VLLA 3CE6A 1LQUA 1B15A 1WXDA 3TNLA 1PQUA 4GWGA 3OIGA 3ZV4A 1DLIA 3RFVA 4BNNA 3HSKA 4GSKA 4JP2A 4XB1A 2EWMA 3L4BA 3QE3A 4HKTA 4UVIA 2QG4A 4DRYA 1GD1O 4RF4A 3Q9UA 3K5PA 1DHRA 1CF2O 1EDOA 4J7XA 1GQYA 1ULSA 1YL5A 3QHAA 5TNXA 3MOGA 4YQYA 2V7PA 2FHSA 5BT9A 3OA2A 4CLRA 4LMRA 1XA0A 4LCEA 3JQAD 1IZ9A 3COSA 3TZ6A 4WCDA 1KY5A 2XXBA 2I5PO 3UICA 1HE4A 3HG7A 2VTDA 3INTA 4CLEA 3ZV3A 3RSHA 2P68A 5DBGA 2P5UA 4II2A 4L9RA 3F1LA 1WP4A 3NT2A 4S3MA 5U4QA 1PGQA 3ETGA 4OXNA 1I2BA 3PGJA 3IAHA 3RUIA 4YJHA 4BO0A 3JD2A 2A4KA 4BV8A 5F3RA 1JW9B 1MB4A 1O8CA 1PEDA 5A05A 1P1HA 3AFMA 1MXFA 2VWQA 3C1AA 4CLRB 3P5SA 2ZYAA 2PKQP 2NLOA 3FHLA 3K31A 5JE8A 5IXSA 2X23A 3VHRA 1B26A 2A94A 3VPSA 4W9NC 3EAGA 1DFIA 4DQUA 4CM6A 1DRWA 1NX6A 3WGYA 4PLCA 1QV7A 3BMCA 2I3GA 3HWRA 3AI3A 4YAEA 2GD1O 1G1AA 4MINA 4FFLA 5KJFA 4MVJP 5JAQA 3RWBA 4YJHB 3GG2A 4OOFA 1IULA 4BHTA 4XRGA 2NU9A 1Y8QB 3TF5A 1P9LA 3S1LA 2DBVO 1DPGA 4G65A 2GRAA 1EUCA 1U9JA 4EEXA 3CXRA 1Y8RA 3LU1A 2JHGA 5I8WA 1LXCA 4M86A 1WNTA 1WDKA 3FCOA 3FWZA 5GY7A 4LVCA 4B3HA 3V2UA 1N1GA 4INAA 3RIHA 2EF1A 1JU9A 1UXKA 3MJSA 1MFPA 2EKLA 2BKAA 3BMCB 4BNMA 4L75A 3KLMX 4L4RA 1GYRA 1HDGO 4Q39A 2PD4A 1HSOA 1XSEA 5IDWA 2AG8A 2AW5A 1ISGA 1C0IA 3M6IA 4OXKA 4RPGA 2JFFA 2G1UA 5DT9A 4BNXA 1Q0QA 2FZWA 3WIEA 5JO9A 2QHXA 4ONEA 4D0RA 2YJZA 1HDRA 1I3MA 2AEMA 4B8WA 2V6BA 3BA1A 3VH1A 4Q3AA 4A2CA 2H5LA 2AG5A 3LLVA 3LVFO 3T7EA 1FJHA 1Y8RB 2OXIA 4BMSA 3AM4A 1I3NA 1GY8A 4QSMA 1E92A 2Y0EA 4BO3A 3DAGA 1IY8A 3D3WA 3WTBA 4H15A 4ALMA 1RPNA 3WQRA 2YHUA 4NK4A 4MIYA 1E5QA 1DJNA 4AJEA 4MO2A 1ADCA 1K6XA 1PJCA 2GN9A 5TRTA 5K6AA 1ADBA 3PVZA 4CQMD 1U7TA 2FSSA 3K96A 3LLSA 1SEVA 3I9JA 4CODB 5HA5A 4RVUA 4UVGA 2VWPA 1DRUA 3ETEA 1LC0A 5JYEA 4GBJA 3BTVA 1LU9A 3GNSA 3QVXA 4PG7A 1XQ1A 2W2KA 2C5AA 2GNAA 1QMGA 2ZJ1A 4PCVA 4E2YA 4E12A 1SC6A 2OORA 1DC6A 3LT4A 1V3VA 5JDCC 4AJHA 3NT5A 3V8BA 1A9YA 4TZTA 4JQCA 2GSDA 4YRDA 1SPXA 3HDQA 4PLHA 4BNUA 1ISFA 1LRJA 3AY6A 2V65A 2NV6A 2X6TA 3UF0A 4B7UA 4EUEA 1X13A 2QRLA 3VDRA 5G0WA 3NTOA 3G1TA 3B6ZA 4YT8A 4HFNA 5JAMA 3H4VA 1ZK2A 4MKZA 4OO3A 1G0OA 4B7CA 4CM9A 2WEKA 2C82A 3CZRA 4DA9A 1HF3A 4RLSA 1M67A 3EGOA 3ST7A 1Z75A 3P2YA 5CAEA 4GX1A 5EN4A 2W2KB 4XX0A 4TROA 4RZHA 4IDEA 3VZQA 4M8SA 1BW9A 3I1JA 1UAYA 1GYQA 5U9CA 2ZJ0A 1WLYA 4MVJM 3RU9A 3AJRA 1D1SA 3IDSA 4E4YA 3LDHA 4YVFA 3SVTA 1ZNQO 1LDEA 1GV1A 4D7AA 3TL3A 1XGKA 2WE8A 3DTYA 1KEWA 1IE3A 1R12A 1SB8A 5A1TA 1R66A 2X0NA 3JQCA 1SO8A 3TOXA 3OECA 3ZWCA 2HMVA 3S2EA 5HRUA 4XA8A 3B1JA 1EK5A 2NU7A 1JVSA 2YFHA 1VSUA 4TKMA 1DOHA 1HLDA 3E18A 1YJ8A 3ORFA 3WGTA 4EUFA 2CY0A 1P33A 3ONDA 4F6LA 4RDIA 4J2OA 3AUSA 3GZNA 3MOIA 5L3ZA 4DMLA 1RM5A 1BW9B 4FGWA 3EDMA 2HAEA 2OBYA 3TWOA 5DOVA 3V5NA 4NBVA 4M55A 4UUNA 1F06A 3CEAA 4NI5A 1QXSA 4RPKA 4DUPA 3PTZA 2O3JA 3EZYA 4F45A 3I23A 3WMWA 1MXHA 1EMDA 3PP8A 4J91A 1LLDA 3DO5A 1I32A 4J0EA 4YQZA 3OJOA 4AJ2A 2BI7A 4WCFB 2VRCD 1QYDA 1E6EA 1PGOA 4JCOA 3UAGA 4AVYA 1YO6A 3QY9A 3W4IA 2R00A 3SBOA 3W4KA 1VPDA 3U62A 2WE7A 3DBLB 3INGA 3UN1A 5COQA 4BKQA 3U4DA 2BRUA 4HFRA 1C0LA 4LRTB 3CIFA 1MUUA 4BO9A 1FDUA 2IYPA 3X2FA 5B12A 1B7GO 5LCXA 4KWHA 2FPPA 2FWMX 4R1SA 2O3SA 2Y66A 3P2OA 3WWZA 4J4TA 1N2SA 1ZK0A 4IDFA 2Y1GA 4N5NA 5I9LA 3H2SA 3D4NA 3NTRA 6LDHA 1GFSA 3C85A 4FBGA 5ER9A 5LDGA 4BNHA 4HFMA 3NV9A 1J4AA 5GMOA 2IZ1A 2QRKA 3NJ4A 3UGKA 1TI7A 2CUKA 2XF8A 5FEUA 2ZB7A 5L7TA 1AXEA 1D7OA 3EMKA 1E7WA 5L53A 1Q0LA 4RF5A 1U8XX 3I9OA 3E5RA 4JNKA 1YKFA 2HQ1A 3EZLA 5DP1A 5EQFA 3F4BA 2X0JA 4XR9A 5A3JA 1NWHA 3ICPA 4BO5A 1GUFA 8ADHA 3DOCA 1IHXA 3RFXA 3I4FA 3AUAA 2J5KA 3O8QA 3L9WA 2PGLA 3Q2IA 4J1QA 3GDOA 4IDAA 1Y5MA 1OOEA 4O59O 3U4HA 4AICA 1JN0A 4IIVA 3HADA 2C29D 2OHXA 4BOYA 1DIGA 3ZNPA 2PWZA 4MVJI 1A71A 2GZ3A 3KYDA 3I4CA 2OL4A 4HWKA 3K6JA 2Y68A 3WLEA 1CEQA 3GOHA 1W8DA 4NJMA 4IS3A 4I9UA 1WDMA 2Q99A 3JSAA 3KYCB 4NBWA 1DC5A 4MKRA 5FI5A 5JMWA 1GPDG 4RVDA 2DBZA 3ZWOA 2BFOA 3QIVA 3MJTA 3MCVA 2QRJA 3QVOA 4PN3A 4YR9A 3GR6A 2CDBA 2VT2A 1LA2A 1LQTA 1YBVA 3JD3A 3IUSA 3O8QB 4FN4A 2YY7A 3ITDA 3R3JA 4ZQHA 2X9GA 2ZTVA 1D4FA 1I10A 1W4ZA 3GF4A 3LC2O 4QEDA 4R01A 2FN7A 2W8ZA 3INRA 1Y9EA 3KV3O 1NWCA 4ND2A 4UEKA 3DL2A 3KYDB 3O38A 1X14A 1GCUA 1KEUA 3MJCA 3ZN2A 4NJMB 1M6HA 3PJDA 1SNYA 3VPXA 4RF3A 1XG5A 3IQDB 3Q2KA 1LDMA 3VVCA 3V2GA 1X7DA 3FNGA 3E9QA 3PPIA 3RFTA 1O89A 3L0DA 1IHYA 1L7DA 4XB2A 5TQVA 3ZV5A 4DQVA 5ADHA 3TDKA 1N9GA 1HLPA 3GUYA 2Z1NA 2JL1A 1EVYA 4IJVA 3IP3A 4WLUA 2NTVA 3F4LA 3E8XA 3OFSA 2A92A 1JKFA 2PFGA 3U5TA 4FR5A 3IUPA 1H2BA 3SC4A 5CHEA 1KC1A 1ZIDA 1D3AA 3GVXA 1ISMA 4GGOA 1NQAO 2E82A 4OOEA 2C2YA 5J23A 3GGPA 1DHTA 4J1TA 2IXAA 5LC1A 2WM3A 1MV8A 5T5QA 3EY4A 4CMEA 1XWFA 2JAHA 4TZKA 3DBRA 4BIIA 1T4BA 3S2GA 5HTOA 2YDXA 3WGIA 1RJWA 3E9MA 5I8ZA 1RKXA 4QQRA 5KWEA 3G0OA 4BB5A 1R6DA 1N9GB 4DGSA 5CDTA 1XLTA 1ZEJA 2DT5A 1QR6A 4Y6PA 3FTNA 2P2SA 3U4IA 2R2GA 4TRMA 4U6SA 4PG8A 2XPCA 3LQFA 1KVTA 1MG5A 2AQKA 4I5EA 4C4OA 3JQBC 4WLEA 4AG3A 1KEPA 5CDYA 4OJNA 1WMAA 4KUHA 1I30A 1XELA 1Y81A 4I9HA 1U3UA 2HK7A 3AI1A 1BHSA 3VKVA 3D4PA 4QT0A 5CEJA 5THKA 2ZCVA 3FPLA 3S55A 3DBRB 2ZIZA 3GUCA 5F21A 4IGEA 4J1SA 4NH4A 2NVBA 2VYVD 4KP7A 4I5GA 4ZN6A 4E21A 4E32A 3KB6A 4CQMA 4R5HA 4YJDA 2PZJA 1K3TA 4EW6A 3DMYA 4ND3A 3HFGA 4ND4A 1FDWA 3FSRA 1V0JA 1H5QA 1I8TA 2VUSA 1DFGA 2NWQA 5KKCA 3ANNA 3S8MA 4R9SA 3S2FA 2HLPA 4UREA 4A5OA 5IDYA 1PTJA 4P8RA 3PJGA 4BKUA 5BSHA 1OMOA 4B4VA 2Y1DA 2HJRA 3DZGA 4DLAA 4OMUA 3CKYA 3H9UA 1SOVA 3RUEA 1VM6A 1ZCJA 2JFHA 4UULA 5TGDA 1C0KA 3OM9A 2ET6A 4CLDA 1A7AA 4ZJUA 4NQZA 5FFFA 1ENPA 5F1KA 4CQLB 4RJTA 5IZ4A 5KVSA 4FC6A 2NM0A 5EIOA 2ZQYA 4FFOA 5TIIA 3TSCA 1PZEA 1HKUA 2QZZA 1IB6A 2Y05A 3E5MA 3I3OA 1UZLA 1XDWA 1C14A 4TRNA 3WB9A 5TJHA 4URFA 2GZ1A 2CSUA 3CPSA 3EC7A 1NFRA 3GAFA 3DZHA 1I0ZA 1TA4A 5A03A 4DL9A 1H9AA 3ZNOA 1P0FA 2VTEA 4QO7A 3RVDA 1CWUA 2EKPA 3WBBA 2WTBA 3G17A 3DAFA 2WD7A 2P4QA 3OSUA 2NADA 4YBZA 2AMFA 5IJZA 3WGGA 3PHHA 3W1VA 1H9BA 3EW7A 1KS9A 1DEHA 3OQBA 4E33A 3I9MA 2X5OA 3GT0A 1U7HA 4YAKA 5IF3A 3JQ7A 3ZWMA 1FMCA 3OJ0A 1ISIA 4IDCA 3PZBA 3PLRA 4J6FA 3VPFA 4CM7A 2NNLD 2EKQA 1IOLA 4YEDA 3EHEA 3PGXA 3WJ7A 1O6ZA 3IS3A 4IQ0A 3WGZA 4CPDA 3H3FA 4LRSB 5T57A 3FWNA 5JBIA 4B3IA 1PU2A 1DC3A 1E3JA 1F17A 3DR3A 4IS2A 1YXMA 3GPIA 2VZ9A 2WD7B 3I52A 4DC1A 1NNUA 1B0AA 1MLDA 3JYNA 4LK3A 2NUAA 1PJ3A 5DP2A 4BGEA 2VHVA 1HXHA 1T2FA 4AJ1A 3WYBA 3GZ4A 3WGOA 4CM8B 4IJWA 5A5EA 2VRCA 3JQ7B 4WCFC 1LEHA 3ZHZA 3KRTA 1T2CA 2B4QA 1LSSA 4LGVA 5T6BA 3RBZA 1UZNA 4J2HA 4RZIA 3KUXA 1DDOA 3PYXA 2YUTA 2AEFA 4I08A 2F00A 1ULUA 2GN4A 1PJTA 4NJOA 4H16A 4Y6SA 3F5SA 3ZNQA 1E0DA 2EW8A 1A7KA 1KYQA 3QWBA 1SMKA 3H65A 3RI3A 3VZSA 5A9RA 4GAEA 3ZU5A 3U3XA 3Q9NA 2O4UX 3IMFA 5JFOA 1HDZA 1SOWA 1GZ3A 4L4SA 5TF4A 2BGKA 4A27A 5ILGA 2B36A 3QA9A 2JD0A 3MEQA 2ZTUA 5JO0A 2EV9A 2B4RO 4DREA 1DAPA 4S1VA 3HDJA 1R15A 4OKIA 4UUPA 4E0BA 5F1PA 3JQEA 3L77A 4YRAA 3HB5X 3KETA 4EYEA 4FFRA 2H1SA 4B79A 2O2YA 4XKJA 2J3IA 3PWZA 1T2DA 4RF2A 7MDHA 1P0CA 4ALLA 5IN4A 4XDYA 1UP4A 3WLFA 4KDFA 2B35A 4AJJA 1X7HA 3L6EA 1AHHA 3F6YA 4IINA 2FZEA 1DIBA 1U28A 4XGNA 4CMCA 2W2LA 1Q7GA 3U4CA 3E9NA 4JN6B 4ZU3A 3TZQA 3ZDFA 2BFMA 3GG9A 1ZO8A 2DUUA 4TMFA 3V1TC 4Y67A 1QORA 3AOGA 4D42A 1CYDA 3MJEA 3PZRA 5C3MA 2D8AA 1CDOA 5KTKA 1GEGA 2HMUA 1GUZA 3GVHA 1I33A 1GADO 2GO1A 5G4KA 2ZK7A 5EMHA 3JYOA 4Z9FA 3WGQA 4OIMA 2ZYGA 5DZSA 1RYDA 4J16A 3FBTA 1YBAA 4K6CA 5G0UA 3SEFA 1VKOA 1ZVMA 4XD2A 5U1PA 2JAPA 1YRLA 1T25A 2ZCUA 5G0VA 5H82A 1GQQA 2HKIA 5IG2A 4DIOA 3BMNA 2HCTA 4PLPA 4Q3EA 3SJUA 1ADGA 4DLBA 3N7UA 2PK3A 5ENDA 4HFJA 3ENKA 4XEHA 1BXZA 2JHFA 2CDCA 5JDIA 3WWYA 1H6DA 1X7GA 2GASA 4CLHA 4DLLA 3IL2A 2D0IA 1QYVA 1N7GA 2DVMA 4DPMA 5CDUA 4AFNA 1NVGA 4N54A 5G4KB 1ARZA 3WOHA 4UVHA 2HRBA 1HE3A 2B4TO 5BNFA 4UAGA 5JMPA 2CZCA 5CFZA 3L9XA 2Q2VA 2LDXA 5KVQA 2PR2A 4IM7A 1DIHA 3AW9A 2IZZA 3A9WA 3EYWA 1ZXLA 3QQPA 1E6WA 1IL0A 2E48A 4WGGA 5GZ1A 4ZQGA 4EI2A 2WDZA 3BMNB 4R51A 5C7OO 4YWJA 1CIVA 1NHWA 1T1SA 3FBGA 2O4CA 2HMSA 1M2WA 2ZQZA 3JQ9A 1PJ2A 2EIHA 3ZWXA 1XU9A 3WIDA 1UDAA 2H6EA 4E2WA 3ENNA 2B37A 4Z0PA 4EEZA 2C2XA 4U8GA 4PVDA 4OHUA 5TLSA 1BDMA 3AY7A 3GRKA 4IDBA 4ALKA 2FY8A 1V8BA 3HDYA 4PZDA 3ANMA 3WG9A 5JYDA 1YE3A 2DFVA 5I7EA 2X22A 2DQ4A 4ZRNA 2DC1A 4YAJA 4N18A 3VVBA 2AQIA 2VHYA 3ASUA 4E2ZA 4OGWA 2DTDA 1XR3A 2G17A 3DBHA 4CV3A 1YONA 4RGBA 1LBEA 2Y1EA 3QWFA 4O6VA 1YDEA 3QRWA 3PFFA 2V6GA 1NPDA 4HY3A 2QW8A 3F46A 5JC8A 1Z45A 1DXYA 3AOEC 2CF5A 1HEUA 3K9QO 3OF2A 3RJ9A 3DTTA 4A03A 4CUZA 3NX4A 3E82A 5IDQA 1PS9A 1P77A 2J5RA 2GDZA 2X58A 3X2EA 1ZMOA 4GPD1 5L51A 4WLFA 4WK6A 2J5QA 3DBHB 3LZ6A 5FYDA 5H81A 3KO8A 2DFDA 3GDFA 3Q11A 5ITWA 4OQZA 4E31A 4QTZA 1QP8A 4R1TA 2GN6A 2D1YA 1T24A 1E7QA 3GQVA 1ZJZA 4PRLA 5T8KA 3WBFA 2VWGA 4IZIA 1Z6ZA 3A4VA 4JJGA 4RO0A 4MIEA 5EL0A 5CEEA 2VQ3A 4BGUA 3GAZA 4QUKA 4RLHA 2NQTA 1WZIA 1KY4A 2X9VA 3E6AA 4Y98A 3TZCA 2OBNA 1AHIA 3U9LA 1UXHA 3D3WB 1HDCA 2YYYA 1JTVA 3WQQA 1PS0A 4IDDA 1UH5A 2EG9A 4DBVO 1O94A 4MVJE 2RHCA 4G81A 5KJ1A 1ONPA 3FF4A 4J3FA 9LDTA 1E7MA 2UDPA 1VL0A 1ONOA 3DMTA 4IMPA 1T2AA 3D4OA 1DJQA 2PKQO 4PLVA 1WVGA 3C8MA 3F9IA 1J0XO 1DSSG 3PRJA 3L4SO 1O0SA 1WAMA 4D3DA 4EBFA 1F8FA 2I3AA 2BGMA 2JD2A 3CSDA 2BFPA 4N5MA 3ZI0A 5C7LO 3QWHA 4GWKA 3DB2A 5JCJA 2Y99A 1GZ6A 4IXWA 4QXMA 1Y1PA 2PNFA 3G3EA 4BNTA 1HDYA 5L4SA 1P44A 2DAPA 2NVUA 2SCUA 1MC4A 4XIYA 2HDHA 4FC7A 2D59A 4IIUA 5FWNA 3HNPA 1ML3A 1U5CA 2AE1A 4IQ8A 4R5MA 3JQFA 3TRIA 3UVEA 4ZGWA 1TEHA 4HV4A 4XDZA 5A06A 4Z3DA 1B3BA 3E48A 3LF2A 3JYLA 4YPOA 1I36A 2OP1A 4JLWA 5JY6A 3ZNNA 2YFQA 1ZJYA 3O4RA 1U2GA 4GL4A 3ZWYA 4B4UA 4DTIA 3BTOA 3DDNA 4E5KA 3H3JA 4GX2A 2O50A 4BUCA 2Z1MA 3K30A 1N92A 4GKVA 3JQDA 4BMVA 4J4BA 1OI7A 4NDNE 1PR9A 3FNFA 4UEOA 1H6BA 2IXBA 1PQWA 3ABIA 3HDHA 4K9DA 2VZ8A 4KUEA 4W82A 5DDIP 2DUWA 2HRZA 2PH3A 2Q49A 1Y9AA 4BNLA 3BHIA 4CV0A 4ZQBA 5EERA 1QSGA 2C5EA 1QLHA 1ZUD1 3NGLA 3RASA 2NVUB 3ONFA 2YV1A 3GEDA 3W4JA 4CR8A 2XAAA 2B83A 1LLQA 1R16A 1YH3A 1E1NA 2GN8A 1ZH8A 5AVOA 3TZHA 4OH1A 3JTMA 2P5YA 3ITKA 4YB8A 3GK3A 3STHA 3W6UA 1EK6A 1BXKA 2RH8A 5CEFA 4FSHA 4CMIA 3GZNB 3D64A 3ZU2A 1PQPA 4ALIA 5K0ZA 3C3XA 3TPCA 2OGUA 4CUJA 3RCBA 5JLAA 3WMXA 1QYCA 4P4LA 1E3LA 3LSYA 4P4NA 3U0BA 4ZRMA 2IRWA 4W7IA 4AJNA 4J0FA 1ENOA 1FK8A 2ZATA 3KVOA 1UDCA 1GQ2A 2EXXA 3RUFA 4GLOA 4IJKA 4JP3A 2PD3A 3FR7A 1R37A 8LDHA 3FR8A 1WW8A 4GVXA 3JD0A 4A7PA 3MTGA 1MC5A 3ZWNA 3NDRA 2HK8A 3RUAA 4OQYA 4EJ6A 1UP6A 4CMIB 1JKJA 4UUOA 4XYGA 2QIOA 4YDRA 3RC1A 1BWSA 3MZ0A 5HS4A 3GGGA 4DYVA 1F8GA 2RAFA 4FFMA 1DAOA
chains in the Genus database with same CATH superfamily
1S6YA 4FD3A 3SIPA 2G0TA 4J0KA 4D96A 4EO9A 5KJEA 3HCBA 3W3AA 4FCCA 1T4DA 2V98A 4MAMA 1PS8A 3BGSA 3EYAA 5EQTA 1XTPA 2X86A 2C7BA 4ENPA 1AQLA 3QPWA 2WV9A 1KYWA 1J99A 2Z30A 5ADVA 4OAOA 1JDJA 1QRTA 5IN5A 1G8YA 4UE3S 1XMSA 2J3KA 3K1AB 4KOAA 3SOPA 1BYIA 4BKOA 3OT1B 2YZGA 4K6MA 3DOUA 3IP9A 4NFSA 3ETLA 3FPCA 1PUJA 3CUEF 2Q0SA 1RI4A 2FMIA 2HWWA 3MSCA 1G8PA 1HQDA 3UJ6A 1QHXA 3BUSA 5ALRA 3SSAA 4QZVA 1S96A 4JJZA 1ZEMA 1OA0A 1Z17A 2P7IA 4FGUA 3P0IA 5CYGA 3AEQA 1G3RA 4FGLA 4WXPA 4PLTA 2AZDA 4IIFA 4ARUA 3FGNA 1A27A 3LYLA 1WZ2A 1ORVA 4HRXA 3B9PA 1C9EA 3GAMA 4LQLA 3JRNA 4HS4A 5K51A 3U7GA 3MXTA 4HBZA 5ENZA 1BA2A 1KFEB 1I2ZA 3DOFA 4MP8A 3OF3A 721PA 1M34B 5BXQC 5LP6A 1L7VC 2GEUA 3VH3A 4MYHA 1IOVA 3OI7A 2HJWA 3C7DB 3H16A 4M1TA 3K7EA 4F9FA 4M9SA 4KWIA 2ZRKA 3B60A 5IBCA 1XPOA 1E4EB 1S1MA 2M6KA 1VP3A 3U9TA 4KMSA 1QYWA 3KOOA 4QBTA 1YR3A 3PEFA 3MWKA 2J9YB 2R85A 2Z9BA 2R4TA 3PFWO 5EZ5A 2WTUA 1G19A 1NSTA 4LZLA 2BMJA 3ZWBA 4CEIB 1FRQA 3DG9A 2P8JA 3OE4A 1XKQA 2GWHA 2P6NA 4RIEA 4ZV7A 3W8NA 3LQQA 1YGPA 1GPNA 2C4MA 3JVUA 1YIOA 4QQNA 1I14A 2BI8A 1NUHA 2OE2A 4MEJA 3FVTA 4BKPA 4JT2A 1II9A 1XRQA 2AFVA 1R0SA 2REOA 1E6MA 2VDPB 3BGDA 3OD1A 2V03A 1GOTA 5EJAA 4YUVA 1M54A 3B85A 2BN4A 4TKLA 3WMRA 1CERA 3T1YB 1W36C 2ARKA 1BVUA 4MS4B 3GHHA 4LVUA 1ECJA 3RRZA 5K0CA 2ZIGA 1SU7A 4LRUA 5KWIA 1R0BA 2E4VA 3QA3E 3UZUA 1YVEI 3KPJA 5SY4A 3AYZB 1HWYA 4M7PA 3AVPA 2PWYA 3BEDA 3LUCA 4WPGA 3KZCA 5D86A 1ID1A 2K6GA 2IJGX 1XUOA 2IT1A 3NJRA 1AGXA 1C1YA 1XIVA 2ECFA 3REGA 1HFWA 4L15A 3GBSA 1K08A 5BV0A 4P3XA 2NO9A 3K71B 1I2MA 4TV9F 2NPFA 3QG1A 4YT2A 3IAM1 1N75A 1O97D 2OYRA 3OMLA 2J87A 3I5UA 3EGXB 2EFCB 2PLAA 3AZOA 4GQBA 5GOTA 4BQRA 4EPYA 2IPMA 2FK8A 1YVDA 1OPRA 4OXYA 4H7KA 4RUKA 1QQ6A 1M0WA 4MYRA 4QTYA 2JFGA 2WKPA 3LIIA 2PXAA 5EY5B 2RGWA 5SY6A 3BTSA 3ABZA 1LD3A 2AMVA 1M8KA 4Z9YA 4ACAA 4C0JA 4DG9A 3KE8A 4Y6GB 4Y9UA 1FA9A 2EW2A 3MLAA 2FOLA 1RXWA 5K3OA 3BF8A 4N3NA 1AN9A 3SNKA 4AS1A 1S4MA 3FBWA 2X8JA 4BO8A 5FLXA 1KVQA 3FVVA 1VYTA 2Z6UA 4MO9A 3VHLB 4C29A 2Z2XA 3AHGA 4JQZA 4GW3A 3PYLA 4E3ZA 4CUKA 3TFOA 5J4KA 4RK7A 5IU6A 1SB9A 2H31A 3D0KA 3PEEA 4I50A 2G7ZA 1YB5A 3FNBA 5K3CA 1ZITA 2ZPTX 1EBFA 4MW6A 5I4KA 1GA1A 4ZVTA 4TT3D 3WLTA 2KPOA 3TGLA 1YDWA 3I5MA 1J2TA 3CUVA 4QNMA 3K92A 2ADFA 2HWXA 4N82A 1G38A 2YXDA 3ER6A 3CUUA 5TR9A 4D8YA 2C3UA 1TQDA 4Z6KA 4GBED 4MWOA 4MPJA 2RFLA 2JIMA 4FDAA 2Q7XA 4X1KB 1FMJA 2B7LA 1O4WA 5DYTA 2JJ2A 2JIBA 3P2EA 4WINA 1S8FA 3NHAA 4YP9A 3ZOZA 2GN1A 4OQNA 2UV8A 1B0PA 1KBQA 1Y1KE 1FZTA 3SX2A 2A7QA 3C97A 3SWWA 4MDFA 1DARA 3C5HA 1XNJA 4MARA 2PTGA 3FKSA 4IIYA 4C78A 2C2GA 3TJMA 2Z3ZA 3QEJA 4MS1B 3BWCA 3DKVA 5JDCA 1QTNA 4B85A 4AWXA 5HRCA 1KO1A 4PPGA 1B1AA 1HEYA 5AVSA 3OHSX 1F7VA 1EINA 2RK4A 2IY9A 3Q12A 2C2BA 3FUUA 4TLDA 3JD4A 5EIEA 3BMQB 1RS0A 3TKAA 2HK6A 2AOUA 3BFPA 2JW5A 1P1JA 5BR7A 2O2SA 2HQRA 4KYTA 3L7JA 1TPZA 3V9PA 2QV0A 4FINA 4DEVA 3EH2A 1KI1A 2XZOA 3GZJA 3REFA 1BVHA 4JI6B 2P91A 1VCOA 4UEJA 4UM7A 1XTIA 2C9ZA 2GEFA 1KEEA 4S05A 5JMTA 3A6HA 2VNIA 5DF1A 5GAJA 5JNLA 4I5DA 1PR1A 4PZEA 4WOKA 4NYMQ 3FAKA 3Q8XB 1RYEA 4LOAA 1MOZA 2R8XA 3LLUA 4J43A 2Q8QA 2WFMA 1I51A 2JGDB 1JHOA 3HO8A 3LPDA 1Q44A 2AE2A 1XVLA 3ZY5A 3LY5A 2Z2ZA 2P4EA 2R6JA 2P2NA 1P6QA 4LN1A 1GZSA 2WMNB 4M7WA 2O20A 4AF6A 4HN4B 4LS3A 1UMDA 2O8NA 2PL9A 2W37A 3IVRA 5GM1A 4FOOA 2XRZA 5IAJA 1GO2A 1M2OA 3RREA 2IEYA 5BPHA 1IC6A 5C4MA 5LQUA 2BM9A 1N5DA 3EIOA 4WDQA 2WILA 5CURA 3BHNA 3FLMA 5LNK1 5J5CA 5HE9A 5DN9A 5B6PA 2OHGA 5IABA 3O8OA 3KDAA 4DSTA 1H0SA 3KXIA 3AL3A 4OHRA 5EPEA 3JXEA 1Z25A 1AGYA 3OPNA 1D0IA 1ZK4A 5IULC 2XWQA 1QKIA 1X15A 4F46A 2E5WA 3PXDA 4LSMA 2HN9A 3B1WA 1YZKA 2J46A 3CX3A 3DZBA 5EZYF 5AVJA 3YASA 4DVJA 4I4IA 3FTCA 3H1BA 4LIPD 1L1EA 4PQEA 1CUEA 2PT9A 1FFXB 2F3PA 3PNLA 4CNBA 5L8VA 3MTBA 3AUUA 5E9AA 3TN7A 2P35A 2QJFA 2IIPA 3WS7A 5IJ9A 2FRDA 2IDZA 5HRAA 1VYVA 3EEFA 3NIFB 3PGA1 2JFOA 3D02A 3DZJA 5DV9A 5T64A 2LD4A 3A4YA 3OPXA 4B83A 2IE0A 2XMCA 3TTSA 3WNQA 5BRAA 3J81A 3OC6A 4PO1A 2VTBB 2AMLA 3WQBA 2QM8A 3HYCA 1UJNA 5H70A 1AKMA 1EFPB 1JDVA 4RQBA 4DN6A 2KHZA 2DBRA 4ZREA 3MMSA 3KQUA 3VJLA 1CS0B 1I4TD 2HF9A 2GLTA 4YJGB 3W7AA 1E7RA 1EVZA 2OZKA 4AJIA 1K66A 4AJLA 3K1JA 3ZIDA 2UXBB 1JS1X 4ZEWA 5MN4A 3U56A 4MLDA 1VE9A 2OPHA 4WERA 1Q7EA 5B30A 2XD4A 2O59A 1MCZA 3FHCB 3OZIA 4C5AA 1C4OA 1XNGA 1N8TA 3RHFA 4DGQA 2F59A 1VMAA 4IQGA 1TLLA 2AX4A 4RZQA 4IVRA 4ZGBA 4QBIA 1Q3KA 4JGIA 1UQUA 3HB7A 4PBRA 1NUPA 4GI2A 1R8QA 1NTRA 2IXFA 3BCSA 2PZMA 4ZO4A 2EBHX 3SEZA 4DA7A 4BMNA 1TYZA 2CNBA 3HY4A 1AXGA 4REQA 4M3NA 5K20A 1LDBA 3FZEA 4G4IA 1HA3A 5DHPA 5DYYA 4PLZA 3OESA 1VLVA 4EVSA 1KQGA 3R0ZA 1ZGZA 1VI5A 1T9ZA 1O5IA 4E51A 4S1TA 5CFQA 5EFZA 1E62A 2A35A 5HQTA 1H2XA 2WKQA 1FX1A 2H17A 4DWVA 2GBIA 4JYCA 4NZNA 4NZYA 1V48A 2YW9A 3X1WA 4JYPA 3TQSA 2F67A 3B12A 4JLMA 4ETNA 2K4MA 4MPDA 4UVEA 1YTLA 2D0OB 4WBSA 5IDVA 4QJIA 1FVFA 4LQDA 4X1OA 2C4WA 2RHRA 4Q01A 4CTOA 3HFJA 4P0QB 3WICA 3D6HA 3CVYA 1IBLB 4YAUA 4IEEA 4XOIA 3BXFA 3GGJA 1NJ1A 1US8B 4MWDA 3GJXC 3K2EA 1LVHA 2VC2B 4R3NA 1VLMA 4L4ZA 2W6IA 2W9XA 3MRSA 3QW2A 5I5EA 1E4OA 1EFCA 2ZUSA 1D04A 1N57A 1O87A 1OYOA 1T3SA 2PQMA 4JT8A 4XYMA 5DW3A 3VTZA 3ZZNA 1D7AA 4KLCA 3RC9A 3UWMA 3KHUA 4B7AA 2WOOA 4YJ2B 1XN1A 4C6HA 4DG5A 1SHKA 2D1SA 2ZE6A 4EKEA 1CPYA 2BMAA 2YWGA 6REQB 3IR6A 2XHEA 2WSIA 4G24A 4BV9A 1IB0A 5JV5A 4PYKA 2VDRB 5CVVA 2FWRA 3FMVA 1V45E 4H3VA 1G2OA 1JAYA 4UBMA 3AESA 5I7AA 1EBBA 4YY3B 1SVUA 3RT7A 1CVIA 1BXGB 1Q7RA 3DUFB 1JB9A 4KV7A 3LCCA 1IQRA 4FZ5A 1D5CA 1GGFA 1ZOLA 1G6Q1 3AIIA 1QP0A 1M75A 4C3ZA 5DK6A 1RPZA 5BOSB 2X9LA 1CK4A 1CR4A 3PCTA 3A25A 3AFGA 1NYTA 3OCVA 5F5NA 1Z07A 1KJNA 4H31A 4O4HF 2VZLA 4TTRA 4KG7A 4NPHA 3BRQA 4RVSA 1X9IA 1ZRHA 4OLFA 4PWZA 1SUIA 4CV2A 3QXXA 1L4MA 1DIRA 1QVZA 1U11A 1B3RA 4P3OA 3GCGA 3UPDA 5LYJA 1DTEA 2CL0X 3IP5A 3P8ZA 3EXHA 3RVOA 3RC3A 4Q1CA 4C7BA 3E58A 4H1WA 1VIYA 1D2MA 1XE3A 4LXQA 4MJLA 4HX2A 1NURA 3PEWA 1XEXA 4RTLA 1EZ1A 5AOBA 4YLYA 4B3CA 3A26A 1W581 1VP9A 3W8EA 3SKXA 4D3XA 4KR2A 4NOJA 1L4KA 1JZQA 1NRWA 1Q22A 5ITZB 2OOKA 3LUJA 5FPQA 5HKLA 3SC6A 3ZDBA 3HH8A 1D1TA 4YJ3F 4EPTA 3G49A 3PE4A 4KCGA 4IIJA 4EG6A 1KI7A 2WNIA 3S2IA 3V8QA 1PT9A 1Z8DA 1BCRB 1TUBB 1X1QA 4IPTA 4O5OA 4PRKA 1C7EA 5DBIA 3UCEA 2BFNA 2I7VA 3I5YA 1TEZA 1P2SA 2BISA 1AH2A 4DUGD 4PYOA 5DN6D 1DEOA 1DVRA 4V0NA 4CM3A 2W4MA 2WNSA 3QKTA 4RW0A 4IDUA 1KR5A 1N2XA 2FUEA 2YXLA 1CX9B 4K9KA 4N65A 2ZBUA 1MG0A 3R5JA 1VL2A 4LYEA 4RVGA 3C1OA 3LECA 4L2IB 1GSAA 2VJDA 2ZIXB 4HGQA 5HF8A 4NBTA 2QG9A 3HP1A 1SHTX 5LMCA 1PGJA 1Q21A 2ZJFA 4Y9TA 1LC3A 4ND5A 4ND6A 1W85B 3VRHA 2XDAA 4R41A 5FB3A 2DQYA 3GZTB 4GEKA 5TJ9A 3OM0A 4MR7B 1I0IA 4IJUA 4XR4A 2O8EB 1DBWA 2COEA 4MR8A 1EESA 2WM8A 2FP4A 3DONA 1YDMA 1ZGAA 4MUMA 3WR5A 4BVBA 1U2DC 3LBAA 1E2LA 2O0HA 4AB1A 5HW0A 4H1HA 4YONB 3F3KA 3UV3A 1LLUA 1QFMA 1JQLB 1SN7A 1UXGA 3WWCA 4MW2A 2J9XB 1KDRA 3LO5A 3DAHA 4FKZA 3FOEC 2QY9A 3KQHA 3VC7A 1J49A 1DTWA 1QE3A 1RJDA 5BSEA 2HMWA 5FL7A 3FROA 4KXLA 2BFEA 5IM4F 4LHWA 4CF7A 3R9XB 4RTOA 2G76A 3IODA 3PA8A 4RKEA 5D87A 3Q7RA 4CR7A 1JR3A 1E2PA 4Q16A 2WKWA 1EVJA 2I76A 2JDIA 4GUAA 1NF8A 5CJPA 4LJYA 2Y1CA 3THSA 3UV6A 3ZJ5A 1U0JA 4CKWA 3A2MA 3QFTA 4EF6A 1SUAA 2VJMB 3ANXA 4ND8B 1XLTC 3TTYA 4AZWA 1W4RA 3CSSA 3CT6A 3DOOA 1JEDA 1X80A 4R3WA 1PWEA 4BNWA 1I1OA 1HYEA 4TYPA 4QELA 4PGHA 4ROTA 1QIFA 5IKOA 1YVRA 4LI0A 4JITA 1YJAA 2JJ1D 4NL4H 3D4BA 4EHIA 1A9ZA 1NVVQ 4V0RA 2AOXA 2I7TA 1VG9B 1VI2A 4CL8A 3N2EA 5ICSA 5EJFA 1AK9A 4P5EA 2X2EA 2HU2A 1SU8A 2GK6A 4X7PA 1OWOA 1OPXA 1NW6A 3AEZA 2VHWA 4K1XA 3ETDA 1O0CA 4E5SA 3S81A 2RAVA 3AWDA 4L78A 5LZ2A 1DBRA 3LHKA 4MCAA 2X2OA 2QSJA 1X19A 1KBZA 2X0IA 3DHYA 2XOEA 3QSGA 4HLCA 1JEJA 4LI3X 1JVBA 3HKEA 4ZD6A 1RWXA 2UZ3A 3RVPA 3B70A 2H07A 3ESAA 4O4LA 3N8IA 4HNHA 4TSKA 3HY3A 1MGOA 2PUBA 1U0FA 1TUGA 1SCKA 2VPPA 2WAXA 4N3CA 2EJVA 4FBMA 4OYRA 1E32A 5A7HA 5A5VA 3AK4A 5E95A 2FB9A 2QX8A 3OWXA 5KNCD 3Q0TA 3DFZA 3NU1A 4DR6B 5ED0A 5JSYA 4C89A 1B73A 1PTJC 3DDOA 3TCXB 4NRDA 1DOZA 1SZJG 1AZSC 4YX9A 4IBOA 3QLVA 3ICQB 3CB2A 5HJ7A 1MJGA 2B5WA 2W58A 2V4MA 2WM2A 3QHPA 1HPLA 1U3VA 4UEWA 1HZZA 1U2RA 3K0AB 4UXHA 4B3GA 3CURA 2H1HA 3R09A 2HT1A 3VGJA 4P1ZA 3FUXA 4PQRA 3GY0A 4ZVQA 3GLRA 1IAVA 1LS6A 2V7XA 4M60A 4D9JA 2JLCA 3WYEA 1JLLA 5B1DA 4RDHA 2PUCA 1PEKE 1YOVB 2A5FA 3A3YA 2O2JA 1J5XA 3G0CA 4NPCA 4PO3X 1NJ8A 1DAIA 4M53A 3V1UA 3RYCB 2VAVA 3DNFA 5I9BA 2GK7A 3ON5A 1K5PA 2C3OA 2O7QA 2ONZA 1E5LA 3RTGA 3ZGYA 4BDTA 4EPRA 3ND6A 1L8LA 5TEWA 4AZ0B 4RTJA 5K0TA 1Z4QA 4MRSA 1KH1A 2IXDA 2G88A 2CEKA 3Q4GA 1NMZA 2H51A 3VOSA 1GL9B 3G79A 3RS7A 5KMGB 3KYIB 4WAUA 5IBRA 1X3SA 1I4DD 4P7GA 1QK3A 1QIIA 4K6HA 2ZYDA 4S24A 5GOZA 2OT3B 5GP1A 1SU4A 2BKXA 2HJHA 3BYZA 3GFGA 2VN8A 3OIDA 4MQ5A 3RTAA 1ZU4A 2RGAA 2W00A 1A4IA 3DKPA 2BZSA 1Y8AA 4WCFA 4I5FA 4YAGA 2EJCA 1PSDA 4BNDB 3HKBB 3SXUB 3SXJA 4BL5A 3GYGA 1M8FA 4UASA 1BRMA 1E0JA 2BZ0A 2EFEB 4F38A 1A9QA 1KWKA 4GNRA 1HGXA 4XGRA 4C2TA 3HNOA 1TZ2A 3G8CA 4Z3KA 4URXR 4BC0A 1KSGA 3U7FB 5KNLA 1F60A 4XJSA 1TTTA 4BNVA 1P0QA 5BURA 2CVOA 1CDZA 2WMOB 3EDQA 3GN1A 3M6VA 4HQKA 3G2HA 4W8HA 2JLYA 1WBDA 4K3VA 4Q4JA 2GPNA 3ORHA 4GSYA 4U9IS 4WD3A 2DUJA 1T9KA 1W4LA 3KZMA 1OC2A 3TW8A 5DU2A 1W48A 2OO3A 3KR2A 3P0EA 3COZA 4LVNA 1N3IA 1E64A 1BEZA 1JPVA 2JJYA 2M9MA 3HR7A 4LY6A 3K3PA 2O3UA 2VUIB 4INPA 4RJJA 2FKNA 4WH0A 4QBFA 3UA4A 3MHTA 4LFAB 1W19A 4QHYA 5ARDA 1F14A 1BH2A 3EF3A 1YMVA 2FRXA 4X97A 3KU1A 4BNYA 3AONB 1HDXA 1ZLXA 3AW8A 1T8RA 3FSGD 4TXHA 4V24A 5LQCA 1J23A 1OAAA 4UOZA 3CRW1 3IR7A 1A9OA 4FLMA 1T0BA 2W2XA 4MA5A 3SDSA 4QE3A 2AN1A 5HZMA 1B8VA 3QUQA 5J63A 1OWNA 3TSYA 5JJCA 1Z4PX 1XO1A 1GUBA 2ST1A 3D7SA 2H92A 3OKAA 3TIGA 4J9UE 4RVFA 4DXHA 4GYWA 4TUYA 3C7CB 1UMBA 3MPUA 4MGHA 2Q2NA 3OQOA 2ZS7A 2J3HA 2MYNA 3PUZA 4E09A 4JKOA 1B16A 2PN1A 1COZA 3T3NA 1GZ4A 1YQXA 1KOLA 2LZ0A 4DLZA 3AKZA 2B1QA 3MJ4A 4GM1A 2QDXA 5IAEA 2FPGA 3QWAA 4FYXA 5IXJA 3HXPA 4AKEA 5LOVA 3MLBA 3UWDA 2FZ5A 1R4ZA 3WGHA 4V39A 2BGLA 3NPAA 4LYAA 2HLHA 1FC0A 2B0JA 1WETA 3FIUA 4BX2A 3KQNA 4ZZ2A 3OPMA 4F97A 1ZLYA 5CCDA 3PEYA 1W93A 2OCPA 4MMYB 3LO8A 3KUCA 4A8JC 3DZKA 2ZDHA 5JVDB 3G59A 5I7UA 5KPJA 2H4FA 1BHJA 4I55B 4AIIA 3A7DA 1VSQA 5EP1A 1HZJA 4OGGA 4HT3B 2UYHA 2EZUA 1FP7A 3DYVA 5JISA 4ZI3A 2ZWMA 2BAGA 4TRRA 2HLDD 5LSAA 5FOUA 3ZR4B 1XU7A 3I30X 1F5SA 1P4SA 4GE0A 2OO5A 4KXNA 2FWPA 1Q1ZA 2MT9A 5B1IA 2PKRA 5FPTA 3TW0A 1QC5A 4B34A 3TH5A 1L7XA 1L6RA 4EB3A 1IRXA 2P9HA 1L4LA 1SVWA 3BZUA 4IGKA 1X70A 2AI1A 4MUHA 4WEOA 1HYGA 1QFYA 3N2NA 4KWTA 1C3EA 4KZKA 3TKLA 3H1AA 3Q5EA 3N0WA 5AXCA 2B8WA 3EUFA 1LVUA 1FRZA 1N4DA 1QHYA 3AZQA 3DW1X 3FMGA 3PR2B 3B82A 1A7JA 1K1EA 4X8OA 4G0UA 3GT3A 2WVHA 3LC7O 4EB0A 3NUGA 1QP4A 2MOKA 1VIAA 1JR3E 2GAAA 2VNJA 1U8AA 3A3PA 4R9RA 3WHLA 2PGDA 3O6VA 4I1IA 4DZRA 3AY0A 3V55A 4W6QA 2FPIA 3BQMB 5IJAA 2A5DA 1NLFA 2HA6A 4Q15A 4CNQA 1FLAA 3U4MA 1WPXA 1N78A 2NTJA 4XH9B 4BS9A 1LBSA 2FMHA 2WAYA 4Q7JB 1W73A 3G2NA 1JALA 5DM0A 2UZAA 2B2XA 3ADOA 1OZHA 2YWXA 3EQZA 1Y33E 3N7AA 3OQ1A 4K9SA 2Q3EA 1C8VB 2J3QA 3KKQA 3NHSA 4FMBB 3H2ZA 3UXEA 1XCPA 4M46A 1GL3A 2Q4BA 1Q0HA 4KGZA 1UPUA 2ZS9A 1NVEA 2AR0A 2HJVA 3EXEB 3HK2A 3K73O 1S9HA 2P2CA 4D0RA 2WHPA 5JDIC 4NZZA 4AJKA 1JA9A 3H2YA 3H9EO 1MEJA 4I1RA 4N7BA 3TTTA 2CHUA 2WR8A 4NZMA 3UJ7A 3AGQA 1U04A 3N2LA 3OAAA 4N0QA 4J7CA 4DA8A 3NMUF 1XAHA 4PSVA 4XGQA 3LBFA 2WYUA 4EO4A 4EL5A 4JKYA 4RMHA 2FAXA 3N07A 4UQPA 3ND8A 1QRDA 4M54A 1QAOA 5DSXA 1S2NA 2ORVA 1FSZA 1NQ5A 3HU3A 3PHGA 4ND1A 1G0NA 3ZDXB 5EYPA 3K9BA 1Z8FA 3EPLA 5FNVF 5BYBA 1NVFA 4ZVSA 4CHTA 4Y8VA 1R0CA 2NU8B 2DLDA 4IH4A 4ZYUA 5CBPA 2VO1A 4UUAA 2QX7A 2D4HA 4MUNA 3EN0A 5G1OA 1VPVA 4OMFG 2A59A 2AKAB 3P0HA 3LXMA 4M0DA 4F5WA 5KVCA 2QY6A 3D59A 1DV1A 3MWDB 3RK4A 3V4ZA 1N2CE 2YJ5A 1XRRA 3TTXA 3LRPA 3OZTA 2RCYA 1QO0D 1KIAA 2PUWA 4V38A 1EHCA 3E8SA 3I4LA 4C7JA 4HLDA 1R4NA 3ZHUA 4BCCA 5EIAA 1KXZA 2HNKA 2ECKA 1B8PA 2AQHA 2VYNA 3OZ7A 3VO1A 2Z04A 5KYXA 1ZVVA 4JMLA 2ID9A 3SQNA 1FFCA 3G0BA 1IN6A 5KKAA 4OGKA 2PJRA 4GKKB 1M1NA 3IMEA 4W5JA 1IZ7A 3RVQA 3VYTB 3R3SA 3UJNA 3PR3A 4Q3NA 3JVDA 3VH2A 2RI0A 2CLKB 2WIKA 1OZFA 1NXVA 1P4RA 5DGHA 3SFZA 1NUUA 5I48A 4D56A 3A6PC 4GI3A 2C58A 1YU6A 1SXGA 1NT4A 5F1OA 1KAMA 2W11A 4YMLA 2VR1A 4H7PA 1I6KA 3GARA 5M2QA 1CSEE 2H0RA 3NIWA 1RNLA 4GRAA 5LQDA 2J3MA 3SQMA 5CR9A 3AJEA 4Z7NB 2PD6A 4XJTA 4UCXA 4DCUA 2W0MA 1I2DA 2DTXA 1UR5A 1Z35A 1ZXBA 1ZPDA 4IV8A 4EJSC 2PQ2A 1NA5A 2WJ3A 4KXXA 1E59A 1GG5A 2C83A 4J1NA 4AS3A 3C5EA 3E22B 1VLHA 3P9XA 3Q6MA 2C2WA 2PPVA 4ISCA 5HIIA 7YASA 4XUCA 2IYAA 3NYRA 3KKOA 5THXA 3I92A 3RIEA 4IWNA 4JB0A 2FOXA 1RFLA 5HK8A 4L3VA 4BC1A 2QLJA 2FP3A 2ZTSA 4KV9A 4KXQA 4XQGA 3ZBUA 4YV1A 5M5BA 1YTUA 1KQPA 1V5IA 4EYKA 1YUBA 2HCJB 5D5QA 1IZ0A 2RK3A 1YFKA 2VZ0A 3CU5A 4Q05A 3RARA 3T1VA 3K6SA 4B3SB 1ZISA 4L0QA 1L4EA 3W05A 1DTSA 3A06A 2CW5A 5KVVA 1JNYA 1L5GB 1OGYA 2RK6A 3RABA 2O7NA 2FJUA 4UMDA 2CD7A 3MCAA 4UMFA 4WEQA 3CEPB 2HO5A 4NDZA 5KREA 2WA2A 4P4SA 2JHCA 5CXSA 1KZHA 1RCUA 3IOYA 1HLGA 4Z1MD 3DHEA 1TD9A 1AQNA 2C20A 5JQGB 2HXYA 3KC2A 2DHQA 2WJWA 5HS6A 3IB6A 3WFZA 1EXVA 3AFIA 1KO4A 4R1UA 4QU0A 2PZBA 1NBIA 3CEJA 1ZJ5A 3CNOA 1CUIA 2CV2A 1FXSA 5AK5A 1I01A 2IY8A 5HKBA 1NZFA 3H84A 2KLHA 1Z68A 4P86A 3TTUA 1LFAA 5LZ7A 2QKYA 4ZCTA 2B78A 1P1IA 2RGRA 1U80A 3NDIA 5FORA 4MP6A 4FHDA 2AOUB 4AQDA 3DE2X 2ZRCA 4BNGA 3H87A 2YHAA 2VT7A 2ZAOA 1I24A 3W6ZA 2W6ZA 4KQHA 5DXFA 1F6BA 4BO1A 3GLQA 1PZFA 4RGVA 4I8DA 2AG6A 2QR5A 1Y7IA 3DT6A 3P0JA 3DXFA 3VQTA 4CLOB 4Q48A 2K87A 1Q7TA 4TLEA 1E1KA 1OLUA 1ST3A 4WNYA 2JRLA 3RS2A 2XQIA 3U7QB 4DIBA 5C5EA 2F3UA 2PUGA 3DC7A 3TVTA 2C04A 1X8XA 4XPIA 2ZXFA 4OQPA 2XDYA 2POQX 5LU9A 4MVJH 1ESZA 3QPAA 4JBHA 3CS3A 1KIFA 4A9AA 1QQAA 5DX0A 4QECA 1IY0A 2YV3A 4Q7MB 2AJ8A 4BFWA 3DEIA 1YR6A 4LNAA 5JCJD 5EXSA 3O9ZA 1A8QA 1N8KA 3KEOA 4P4GA 4NSNA 3B6KA 1N36B 2XSZD 1XCOA 4O0LA 4LJRA 3UT6A 5F7XA 3OVMA 1A2KC 1F8UA 2J3JA 1ZSNA 2JLRA 2NAFA 2OQRA 3NOQA 4US0R 1RXSA 5FBQB 3W7VA 3JQFC 1QHIA 2HSDA 3ELBA 3H13A 5DHRA 3WO1A 3OUTA 4L5AA 1LUAA 2NV2B 2O7RA 3A1NA 1II0A 2QEQA 2O2XA 3C7KA 2APJA 1H6AA 2WA1A 3FTPA 4H7DA 4KFSA 2QS9A 4RL6A 5DIFA 1WB4A 3EPJA 2C97A 1OBCA 1UJ2A 2XIJA 4R83A 1NP7A 2CN1A 4IIHA 4PC1A 1WPQA 5BV8A 3UUGA 2D5CA 3I72A 2O14A 3OQIB 2ZE5A 1DGQA 2QG6A 5JH7B 2NN3C 3CVVA 3QXCA 1F4LA 4OGFA 4YTEA 5IJ9B 3KZKA 1UM8A 1YL7A 2P9QA 3SCZA 1S01A 4RK4A 3IV6A 3DZ8A 5T3YA 1KFKB 3JASB 3H5AA 1A5AB 1XTRA 2OYSA 3GQBB 3L6OO 5IHPA 1N7JA 3L1UA 1R4MA 1SAYA 3JQ8B 4UQOA 5F5XA 5HFAA 4GLLA 1E6CA 4WESB 3SHWA 2XQGA 3TL6A 4DLKA 3JR7A 1Q0ZA 5JZVA 4OJMX 3DFUA 2DJIA 2VA8A 2AN3A 3ND7A 4WJZA 4UHCA 1QV6A 3X1MA 2XF2A 3D6NB 1X6VA 4FNGA 5AW1A 4IY1A 1I9GA 4M1YA 1SCUB 4ZICA 4RCVA 5J3JA 3I37X 2JGFA 4QBHA 5KDOA 3WXBA 1SY7A 4BZWA 2M32A 4LGMA 4PO9A 5JD5A 2Z6QA 3LTEA 1UBRS 2V9CA 1NJ5A 3VPAA 2OCXA 5JROA 2PMKA 1L7EA 3QFHA 2O6LA 4M7RA 4EHJA 4DCPA 5CH5A 5CG1A 3VOTA 4DLVA 5EZSA 2X7XA 3KSZO 3W2EA 5BUCA 4WN9A 1TGVA 2IYNA 3I45A 1JT2A 1EQUA 1G42A 4REQB 2W6JD 3H8VA 3QBJA 4N5LA 4O33A 3FKQA 3K0CA 4O2BF 5EHZA 5KCZA 4X1YA 2AB0A 4EZBA 3SJZA 3RC7A 4BRSA 3I6IA 1T9HA 4MGIR 4NBRA 2F8SA 1UBJS 1ETUA 4XD7A 1KEVA 1YHNA 3HB9A 3U60B 2CXPA 1X1DA 2PQ6A 5E6UA 2P2YA 2OKCA 1JXMA 4EY8A 3PWSA 2MYUA 4N41A 1T1RA 2Q3JA 3G2MA 3TD6A 3HXQA 1X86B 1FX0B 1EFRD 1YHZA 4LRQA 1EB9A 1KY3A 2AI3A 4G8DA 4OQMA 4WOCA 5BSMA 1DLIA 3RIXA 3GLHA 4JP2A 3ILHA 2XE4A 3KG2A 5EWMA 1V8OA 4XB1A 3L4BA 3QE3A 4UVIA 2F8TA 4EQ6A 5B3JC 2AC7A 4DRYA 1GD1O 1PKXA 3A1SA 3E4CA 5K3SA 4FZ3A 3WDLA 1Y63A 1XLWA 1H9CA 3EBPA 1ULSA 1YL5A 4KEAA 2AUNA 4KPGA 4RQAA 1QIEA 2D7CA 5TNXA 3MOGA 4HWRA 4YQYA 3NEAA 5LQNA 5BT9A 4UU8A 5KTOA 2JIOA 3OA2A 4RKRA 3OEEA 5WRFA 3L8MA 4B76A 1IQ0A 4XOUA 4F60A 4IF4A 4IDPA 4R0VA 1VJRA 1VHWA 4WCDA 3SICE 3NP9A 4LJKA 4FMDB 4FT4A 2IYLD 2FPUA 2H7XA 1RBMA 3HG7A 4RNDB 4CIWA 1KFCB 2FVYA 2P5UA 3T8YA 4II2A 4QPNA 3THXA 4H6WA 4DVGA 3IUYA 4EG8A 1A4RA 1D8TA 1T6XA 3S2UA 4PX9A 2P27A 1UWLA 1BQ3A 2ATEA 3HA5A 2NUTA 4S04A 2I2BA 4M99A 4OXNA 5AKHA 1OUMA 2C8LA 4GIBA 4NCHA 2A4KA 4RXUA 3EFHA 2WWWA 3COYA 4O2BB 3I1IA 2DFNA 3L7NA 3PR1A 4BV8A 3K9FC 4OK6A 4QDKA 2BFWA 4O4IA 2NP6A 2P1RA 2VWQA 5JS2A 5KNCH 3QYPA 2IHYA 2PUAA 4C05A 4IQFA 2ZFUA 3A9VA 1NKSA 3ED1A 3I2FA 3PV0A 3QYFA 3ACDA 4JT4A 5H0IA 5SV2A 2OZLA 4HDNB 4C9BA 1ZWLA 2ODAA 4OK5A 2JGLA 2YJ6A 4BMDA 5KTRA 4IR7A 2HHJA 3NAZA 1U9IC 1WF3A 3CWCA 1Z4OA 4KXFB 4FVTA 3WGYA 1QV7A 2JB9A 2OPBA 1M72A 3FB4A 4DAEA 4YJ3A 3L8ZA 1W9MA 4GQIA 1G6OA 1RW4A 3QNWA 1A0OA 5AI0A 2EFDB 2WUWE 3HABA 5C8DA 2FDXA 3V1MA 1T2NA 4FNOA 1U90A 2R7MA 4YJHB 4DM4A 3AL2A 5JXIA 1P4GA 3GG2A 4DNPA 3FUWA 1TW2A 1QCDA 2Z1DA 3KJXA 4F4FA 4N8SA 4D9BA 4O2AA 1P9LA 4B87A 3S1LA 4GPZA 2N42A 4Q9LA 4EDHA 1DPGA 1XQYA 3TRJA 1J1ZA 3VZBA 2ACEA 1DXOA 1HH4A 4UE6A 2FMFA 3LWDA 4EEXA 2JI7A 3CXRA 2V7UA 2ZBQA 4JUAA 1WDKA 1D5WA 3AUJB 1XDBA 3H9CA 1R6BX 3MTDA 3UO8B 2GBLA 1WCXA 4NEHB 1O96A 4KX5A 1N1GA 3RIHA 4UFOA 7REQA 2EF1A 5CD1A 4M6WB 1RQGA 2XYGA 2XT0A 2PSFA 3AF4A 1GNRA 2HA0A 3BMCB 3DFMA 1XNHA 3GPBA 4MRRA 3QW4B 1HDGO 2GH1A 4DCVA 4P7JA 4G97A 4RIIA 3ODPA 2X76A 3NTXA 2G9NA 3RYIA 4KQEA 2J07A 4P2GA 5IDWA 1XBTA 1JSLA 2V7QA 3PS9A 4OXKA 4RPGA 1KJZA 2I7XA 4OATA 3OU6A 4BFYA 2VEOA 4Q1DA 3WIEA 3U7JA 1IU9A 2JJ8A 2R1UA 5CTAA 2YN0A 1FQWA 2Y9PB 3GGDA 4LXHA 1X2EA 1I3MA 2AEMA 2HSWA 2YJZA 4HRAA 1RRPA 4PHGA 3BA1A 1TYBE 5BMVF 1NIJA 4Q3AA 2JZCA 4YXWA 1EUCB 4AUEA 5FWYA 3LVFO 3F98A 1FJHA 2ISCA 1LPBB 3AM4A 4BVGA 1Y4AE 5IM4A 3EX7C 4QOGA 4REMA 1E92A 3OTQA 3M1IA 1QH0A 4F7WA 3DAGA 3WTBA 2Y1KA 4AP6A 6GPBA 4RJLA 5BN4B 4O1HA 621PA 5BR1A 2CJWB 4RA6B 4R3UC 3WQRA 1S02A 2QNBA 1FSPA 2IITA 2YHUA 1U3GA 1K9SA 3K5WA 4NK4A 4ZEMA 5BWBA 1DJNA 3D7MA 2EDAA 1ORTA 3DVLA 5K6AA 1CUVA 2J4DA 5ALFA 4CQMD 2PSJA 3GX1A 4AZVA 3KEMA 3RS5A 3EMVA 1AF7A 4GL2A 1VHJA 1L6IA 1VB3A 3EGWA 1XJWA 2XCUA 1FFGA 3K96A 3VC2A 4YPFA 4CODB 5AJXA 1Q14A 1SCDA 1Y3CE 2VWPA 4CN9A 4PF1A 1AMUA 3KXPA 1X42A 1LC0A 1R9NA 5DYGA 5K03A 1Q12A 2JJ2D 1UBEA 1OWMA 2I3ZA 1E9SA 1NDQA 1NBMA 2GFQA 3V48A 3QVXA 3VNVA 1S7GA 3EIQA 1J8DA 1OX6A 1QM5A 4N7MA 5ERYA 2W2KA 4FXPA 2ZXUA 1IN5A 2GBFA 3AC0A 1EX9A 1MV5A 4JVLA 4LOLA 1G3IA 1Z5WA 4P3KA 1SD2A 4KXMA 1SC6A 1V3VA 2Z4RA 3BCRA 3FKSD 2DPYA 4AJHA 4BE9A 3SU8A 1E1QA 3KPYA 1YR7A 2HO4A 3V8BA 2Y1WA 1DJMA 2XCIA 5J1TB 4S35A 5AIBA 3P26A 1CQPA 2GSDA 1SPXA 4RVNA 1X38A 2A5YB 1EG7A 3TEJA 4N3AA 4HQRA 1R2QA 4BNUA 2RIPA 2YRFA 3OM8A 2MTBA 1KI6B 1IUNA 1LRJA 1E2UA 1DQYA 2V55B 3VDRA 3NHUA 1RQNA 3NTOA 2GOYA 1WDWB 2F3QA 4QYXA 4YT8A 4R1PA 1G60A 4F96A 2WNHA 4MKZA 3IP8A 4AYWA 4WKCA 4C30A 3C1UA 2YVLA 4RMNA 5BMVB 4DA9A 1QU2A 3NNDA 4RLSA 3SC3A 1M67A 3GUUA 3JWHA 3T7SA 4H77A 3ST7A 3R4CA 3UMVA 1Z75A 5CAEA 4FM9A 4YRCA 1XCJA 2QJRA 4FWIB 3ZGXA 4D80A 2Y4OA 3CEMA 3JARB 1TJPB 4GBMA 4ZVUA 1GYQA 5U9CA 1WXIA 3GJQA 4UUQA 2UYOA 4XWAA 1I5OA 2IP1A 3SNHA 1R6VA 1ZGCA 5CA0F 4YVFA 3QKIA 1UBNA 2PFSA 4CKCA 3SVTA 5BR8B 1ZNQO 3KTAA 1GV1A 4CI0B 4N40A 1IBRA 1Q5PA 1RJ9A 4X85A 4XIIA 3ZWKA 3IRUA 3FHTA 3N8KA 3DTYA 1KEWA 1MPXA 5IJ0B 1NZJA 4HC4A 5HCNA 3TOXA 3MB8A 3S6JA 4DMUB 1CRPA 3FYHA 3C3MA 4XA8A 2JGRA 1JLLB 2WG0A 3W78A 3EXG1 3KQLA 1Z7WA 2AYYA 4FX2A 4TKMA 1DOHA 4OQ4A 4NCBA 3K70D 1LY1A 2J1LA 2OK8A 2RMKA 4G4SP 4KJZA 4LSZA 3ONDA 2HPAA 3NTLA 1G7TA 3EBOA 3TIXB 1EPUA 4M1ZA 4RDIA 4XX0B 3MOIA 4DMLA 1ECCA 3TQCA 3EC2A 4EMBA 3TGWA 1LCIA 3GDHA 2HAEA 5ALDA 4J0DA 3T95A 3BT7A 3B78A 3GLHE 5K4HA 4X0EA 1PFYA 1SJ9A 2O3JA 1TK3A 3I2IA 3EZYA 5B1SA 5BN5A 1W75A 5E6SB 4EAQA 5JZMA 3P9ZA 4J91A 1X3LA 2PGXA 2VTKA 3ZG6A 3HWSA 3L18A 4LOKA 1MH9A 3CONA 3SK0A 4WADA 3SZRA 3OJOA 3MRVA 4WCFB 2VRCD 5T6MA