4B8ZA

Crystal structure of human gdp-l-fucose synthase with bound nadp and gdp, rhombohedral crystal form
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
308
structure length
308
Chain Sequence
MRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GDP-L-FUCOSE SYNTHASE
publication title Crystal Structure of Human Gdp-L-Fucose Synthase with Bound Nadp and Gdp, Rhombohedral Crystal Form
rcsb
source organism Homo sapiens
total genus 99
structure length 308
sequence length 308
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b8zA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4b8zA02
1GL3A 3MJVA 1I3KA 3SJUA 1Y8RB 3TFQA 3PHLA 3VDRA 1SCUA 1B2LA 3AJRA 3OJEA 1GYQA 4WECA 4X54A 2O3JA 3U4HA 1GUZA 3VC7A 2VRCA 1V35A 4K26A 4Q3NA 4LMRA 1SPXA 3RSHA 3U9LA 4C7KA 5L95A 4J2OA 1DHRA 3DHEA 3O03A 2H9IA 3RUIA 4DMMA 1XHLA 4FFPA 1WLYA 2B37A 4EW6A 3I3OA 4AJOA 1N8KA 3OP4A 4JQCA 3WX0A 1PSDA 3EVTA 4CQMB 1U7HA 1KVRA 3DMTC 4B4OA 4HWKA 2ZJ0A 3S8MA 2JFGA 5EPOA 4BO6A 2Z1MA 2BLLA 5A3VA 5ILOA 2FY8A 3VPSA 3I1JA 3DZKA 3I9JA 1V6AA 2AEJA 3DAFA 3FI9A 4FCCA 3AY3A 5TT1A 1N2SA 2QRJA 1D1TA 1Q0HA 1BW9B 2EW2A 4F6LA 4J4HA 4IQGA 3W4KA 4R54A 4TKMA 2ZYDA 2HMTA 3F47A 5HBRA 3OJLA 3JQ8A 4MKZA 3O8QA 1ULUA 2AE2A 4WJZA 2Y1GA 2C5AA 4HFNA 4MVJI 5TQVA 1Y9EA 3QY9A 4PLWA 1B16A 1Q0LA 4B7XA 1A71A 1T2CA 2VT2A 5BSGA 5JW6A 2ZB7A 1UJMA 5JCXA 4KDEA 1PS0A 1DB3A 2WSBA 3PHJA 3ANMA 3TOXA 2PZJA 4WCDA 1N7HA 4RL6A 4YTEA 4M54A 5A02A 3W4IA 2HU2A 4J0EA 2VCYA 4J49A 4GQAA 4H7PA 1P1KA 3VVCA 3NYWA 2PV7A 3S2FA 2A94A 5AYVA 1U4SA 3WNVA 7ADHA 4JJFA 3S1LA 1YE3A 3NX4A 4W9NA 3AOEC 2Q45A 1B26A 4RJTA 2Y0DA 1F0YA 4FD3A 2FPGA 4IQ8A 1TLTA 2X7HA 4MVJA 3C24A 3TN7A 2GSDA 2G17A 2LDBA 4PG5A 1FXSA 1MFPA 3H65A 4BS9A 3GFBA 2B5WA 1NVMB 3HUDA 4FN4A 1PJBA 3DHYA 4BOYA 2YUTA 3KYDB 4DL9A 3ZHXA 1GPJA 1VC2A 3AI1A 2FPIA 4E5YA 2I5PO 4BNNA 3BIOA 4A10A 4UVHA 2NACA 4I9UA 4A2CA 3BTVA 1EFKA 6ADHA 3FBGA 1KVTA 3GA0A 1I0ZA 4TQGA 2SCUA 1GDHA 3TJRA 4TRMA 1DIBA 1YQDA 2DAPA 2QG4A 4WCFA 4RF3A 1DPGA 5L7TA 3K9QO 2DQ4A 1VSVA 2PR2A 4JIGA 5JC8A 4Q3BA 3AUAA 3FSRA 3JD3A 1R0LA 3E48A 4PZCA 3PJFA 1JVBA 1HTBA 1HDYA 2ET6A 4FC6A 2VUTA 4WOJA 1BXGB 4AJNA 1H6CA 2P4HX 1SEPA 3GMDA 2PD4A 1BXKA 3ROMA 3P19A 3E9QA 3GNTA 4EGFA 4RO0A 5J23A 1ADCA 2GASA 3BMOB 3AK4A 4YYZA 3FWNA 1YJ8A 3TPCA 3RFVA 4BKOA 2NU7A 4TRRA 1WWKA 4L0QA 3OIDA 4GWKA 3TZCA 5L53A 1U4OA 1HLDA 2ZYGA 4TRJA 4A5OA 2TMGA 5JCJA 4E5KA 2PFGA 1CETA 2XXJA 1KVQA 3MOIA 1WW8A 1T1SA 5FFFA 5KJ6A 1KEVA 5G4LA 3VPXA 1LDGA 1Y81A 1OBFO 4O59O 5TC4A 4IBOA 3SLGA 5IDXA 5A9TA 1CRWG 4RF2A 1YOVB 3JQ6A 4JP3A 1XLTA 4E6PA 2Y68A 2D0IA 3ADPA 3BAZA 3GRKA 3OQ6A 4WLFA 3RU9A 2ZTUA 1K2WA 3PHHA 1U5AA 3LF2A 2NU6A 5LDGA 3PDUA 4MOWA 5ER6A 2QZ9A 4JP2A 2JD0A 1D3AA 4BGEA 3KSUA 1R0SA 3HQ4O 1MFZA 4MVJE 4CMGA 4E13A 3FBTA 5I7EA 3UVEA 1U3VA 2EW8A 1JQBA 4G81A 4RVUA 3DO5A 3D0OA 2HMWA 3GZNB 3C85A 4WOKA 2C7GA 1ULSA 4UUPA 4WEOA 3UW3A 4A73A 3GFGA 4FR5A 1BTOA 1VE9A 5K9ZA 3QVTA 5CPFA 5JMWA 1LJ8A 4BGUA 1T25A 2GN9A 4EJ0A 2NWQA 3DC2A 1N5DA 4B3IA 1KEUA 4DTIA 5A1TA 1HZJA 2I99A 1P1IA 3AM4A 5G0SA 4R9RA 4E12A 1HF3A 1Z75A 1ZBQA 3F3SA 3IQDB 1M6HA 1X15A 3GT0A 3MTJA 1E3SA 1QRRA 4XJTA 4B4WA 2P68A 4I5FA 4RPGA 4U0JA 3BTUA 1IPFA 3WGYA 4D43A 1WAMA 1ZH8A 5DULA 3QIVA 3ANLA 1I5RA 5MGBA 2V7PA 1E77A 1P3DA 3KLMX 3DZIA 4IXTA 2VYVA 4KQXA 3E9NA 3GPIA 5FYDA 1F12A 1NYTA 4QEDA 2VOEA 1AE1A 2X0IA 2E48A 3FPCA 3HADA 5DN9A 4YAIA 1X7DA 1EBUA 1B8UA 2OL4A 2BRUA 2VTEA 3D5QA 4K6FA 1BWSA 5TS3A 1AHHA 3Q2KA 2HJRA 2XXBA 2O3QA 1PZGA 1QLJA 2PKRA 4R16A 1ZK3A 4NJMA 1D7OA 5LCXA 2HLPA 1GV1A 5AXCA 3C7AA 5JDCC 1VPDA 2IZZA 4BNMA 3I83A 1C0LA 1Y5RA 1GAEO 2DT5A 3QV1A 4M89A 1OC4A 2C7VA 2OHXA 4EYEA 4YQZA 2W90A 4J4TA 4XQGA 4WNCA 1JLLA 4OIMA 1XYGA 3RUHA 3GN1A 4CV2A 4NBWA 4QSMA 3VOSA 3H9EO 5JLAA 3Q9UA 4EEXA 1HE5A 1GUYA 1HLPA 2P9CA 1A4UA 3LC7O 4E5NA 1E7SA 1UH5A 2Q1UA 3H8VA 1W4ZA 5B4UA 1EUDA 3EDMA 5HA5A 3RUFA 2V6MA 2Y1OA 1HZZA 3OEWA 5F5NA 4BIIA 3PDJA 5ICSA 4FGWA 2B36A 1HDRA 2AW5A 3JQ8B 1U1IA 3O8QB 4XA8A 5HTOA 4I1IA 2RHRA 1UZMA 3GGOA 1NHWA 2FMUA 2NVUA 1WMAA 4ALIA 2YY7A 3MWDB 4RLHA 1F8GA 1FDTA 1TEHA 4HNHA 1Q7BA 3B6ZA 1EVZA 3PLRA 5BSHA 3KEQA 1XCBA 3GVCA 1ENOA 1EE9A 3NT4A 4UVIA 4ONEA 1RKXA 5AXBA 1XELA 4IJUA 4KUEA 4AJIA 2YJZA 3I4FA 1D1SA 1KY5A 4BNZA 4DQVA 4YRAA 2DBZA 3PPIA 3ZHBA 2HK9A 4AJLA 2DFDA 3H7AA 2HO5A 4BNHA 3OJFA 4NPCA 1VL8A 2X0JA 1H93A 2RHCA 3OECA 3VZPA 4YRBA 3IUPA 2I9PA 3WGTA 3KETA 1PJLA 5A9RA 1TT5B 4FOOA 1OFGA 5F1PA 3OSUA 3QWFA 5EL0A 3INGA 3NJ8A 3IJPA 1BRMA 4KWIA 2EF1A 3NTRA 4ZRNA 1CQIA 4CM4A 1GYRA 2O7QA 4YT8A 4LRSB 1GU7A 2ZTVA 5EN4A 5TSDA 3GEGA 1PJCA 3HN2A 4YR9A 5JO9A 1AXEA 3INRA 2JCXA 4M1QA 1XU9A 1T2AA 2UAGA 2YHIA 5K6AA 1LC0A 3F9IA 1I36A 1ONOA 4WCFB 1F8FA 4FPXA 1ISIA 3RFTA 4PLYA 1E3WA 3GVXA 3AUSA 2QZZA 3FTNA 3WGZA 4BNVA 1T24A 3D4OA 3RVDA 1Y8QA 2CNBA 4RDIA 1YJQA 1NVTA 3AOGA 5B4TA 2ZB8A 3CINA 4RVSA 3PHIA 4UEKA 1PS8A 4IS3A 1R37A 3GGPA 3KM0A 1B14A 3OQBA 4E5PA 3ONEA 3NT5A 2X58A 4QTZA 3ZNPA 1Y8RA 3D3EA 3GDFA 4J43A 3RBVA 1IHYA 3LC2O 1SZJG 2Z95A 1HRDA 1MX3A 1P0CA 4LSMA 4J3FA 1WZIA 2ZQYA 3TL3A 5JC1A 1XU7A 2X5OA 1RM3A 4B8WA 1HETA 3ICPA 3PGXA 3VKVA 4AVYA 1XGKA 3KSZO 1HEUA 4DPMA 3E1KA 3R6DA 3MJ4A 5COBA 2CDCA 2C29D 2HMUA 1LXCA 1SBYA 1AUPA 4L76A 4TWRA 1I10A 1Q0QA 4YWJA 3UN1A 1QV6A 1C14A 4J6FA 4WASA 4AJPA 5I9NA 4NIMA 1DIAA 3U4CA 3OMLA 1OC2A 1KBZA 1W0CA 3OA0A 2V6FA 4R51A 4XX0A 4CLXA 3A9WA 3FNEA 3U0BA 3IDSA 3GNQA 4DLAA 2RCYA 1ZFNA 1LNQA 1BW9A 1LRLA 1X1TA 4D46A 2J3HA 4W7IA 1U2DA 2YFQA 4GWGA 2B5VA 3RI3A 1Z82A 4YCAA 4GX2A 2VNAA 1LLUA 2PY6A 3HSKA 4FS3A 3I6IA 3UXYA 3JYLA 2Z5LA 1J4AA 3PYLA 1MG0A 4OHUA 5COQA 3WYCA 2YZ7A 4OGWA 4R3NA 1OI7A 3N74A 3NGXA 3ZW8A 1WPQA 3LT4A 4A27A 2AQIA 3G3EA 3TL2A 1LBEA 1O8CA 1DSSG 1Q1NA 1BDBA 4IY1A 4BNUA 3RAJA 2Y1FA 5JE8A 1PL6A 1RM4A 2CF5A 4E32A 2VUUA 1UUFA 3PI7A 1CWUA 3KO8A 3OFSA 1GEGA 2BD0A 3P5SA 4ZN6A 4UVEA 4E2YA 3FN4A 3KVOA 2JAPA 2O3RA 1D8AA 1H6AA 1K6XA 4Z3KA 4DC1A 1NR1A 1B15A 4UULA 1E7QA 2ZTLA 2GZ2A 3WOHA 4MPDA 3BMQA 2CD9A 4H3VA 3Q0EA 4NU5A 1ZJZA 1U5CA 4QFCA 3VAZA 2QIOA 1DIHA 4D3FA 5KWEA 2WMDA 1IL0A 5EIOA 5F1OA 5L4NA 3ROQA 4NJMB 1DRWA 1LDNA 4JBHA 1XEAA 1P0FA 4L4RA 1SC6A 3WWYA 4IIUA 2XF8A 1V0JA 3ABIA 4IJVA 4MKRA 2QRKA 4DPKA 5IFLA 4NBVA 3ZGYA 5ILGA 4CV0A 1ADFA 4CM9D 4BNYA 4UEOA 4WKGA 2Y0EA 4R1NA 4ZHSA 1QYWA 4ZQGA 5CG1A 1NBOA 1RJWA 2PZKA 3S2IA 1VLLA 4BGVA 4XYEA 1VJ1A 3ZWNA 3RC9A 5L7YA 4GX1A 3INTA 3VPGA 4FJ0A 5IN5A 5TJHA 4OSOA 2HUNA 1I8TA 3JYNA 2BGMA 2P4QA 1LSOA 3ZV5A 1UXKA 2J3IA 3DHNA 1NQTA 1YB5A 4FFOA 1D4FA 4R41A 4EBFA 2CVOA 2P2SA 4PN3A 5DBIA 1QG6A 4HADA 4Y67A 1NNUA 4D79A 4F46A 4XD2A 4B7UA 1P45A 1P9LA 2NVUB 4MVJP 4EZBA 5IDQA 3WLFA 1V9LA 4IINA 4JN6B 3ZZNA 4CMJA 1E7WA 2POQX 3I9OA 2NTVA 5HM8A 4J2HA 4DMLA 3UUWA 1X1EA 3DZGA 3F5SA 4MKXA 1T26A 4WCFC 5ENDA 5I7FA 2ZYAA 3VZSA 1FDUA 3H5RA 3P2OA 2F00A 3RJ5A 4OOEA 4FQ8A 5JS6A 4CMEC 3AUUA 3E03A 3RKRA 2P5UA 3L4BC 4U0KA 1KOLA 1OAAA 2C5EA 2E37A 3W8DA 2EJVA 4GX5A 4R69A 4RQUA 3AI3A 2EHDA 3KEOA 8ADHA 4Q3EA 1M76A 5KVVA 4MVJG 1QYVA 2IDZA 1DC5A 1O94A 1PX0A 2ZATA 4GBJA 4KDFA 1EK6A 3DBHA 4YJGA 3H6KA 3ZWMA 3WNQA 3SC4A 4DRYA 2JHGA 1WDMA 3I23A 3JYOA 1UP4A 2WDZA 2DUWA 1FMCA 3V1UA 1XDWA 2YV2A 1HT0A 3D64A 2RH8A 5K0ZA 2C59A 2WYUA 4U5QA 3EYWA 4DUPA 3I5MA 1AN9A 2FSSA 1U3WA 4PLFA 1J49A 4XEHA 5AOVA 4ZVVA 4CM4B 4EUEA 4PG8A 5A3JA 1IPEA 5A04A 3DBLA 3DDNA 4XJSA 2EKPA 2VT3A 3DB2A 3E5MA 3KUXA 3QRWA 3B1FA 5TNXA 1HSOA 2YHIB 2O7SA 3PP8A 3SLKA 5G0WA 3HWRA 1WDLA 5JYDA 4ND2A 4EJ6A 2HJSA 2X6TA 1E3WB 3NDJA 2VZ9A 4DYDA 3R0IA 4LRTB 2EIHA 3GAFA 4WEQA 2Q3EA 5CP8A 4J9VA 4PLHA 1B8PA 1ZNQO 3TQHA 3RBZA 1GY8A 4NK4A 1DRUA 1HDGO 4K9DA 4YAJA 1X7HA 4KUHA 1ISMA 2PWZA 3WR5A 1DDOA 3NRCA 3KYBA 3WDSA 3WIEA 4U6QA 5JSFA 3CIFA 3QWAA 3ICCA 4XIYA 1GADO 5ES3A 4AFNA 1E1MA 4UUMA 3V2HA 4TVOA 4J7XA 1DFHA 2G0TA 2Y99A 1I3MA 3F1LA 2YHUA 3QWBA 3KSDO 1GR0A 1IE3A 2ZTMA 3JV7A 3L6OO 1XQ1A 2E82A 3X2FA 4QFDA 4ZICA 2CFCA 3QLJA 3NDRA 4UUOA 1NWHA 4WUVA 5C5IA 1ZIDA 3MJTA 4AJ4A 4AJHA 1IYZA 3EAGA 3IUSA 3L07A 3B20A 3PYMA 3ZWCA 2D1YA 4BNLA 5I7VA 3QVXA 1KC3A 2E4AA 4MVJF 2J6IA 2OP0A 3GVIA 3NJ4A 5DCYA 4XYLA 4JXKA 1A27A 4FFNA 4I9HA 1PR3A 3WG9A 3LC1O 3PWKA 3N7UA 2OGUA 4UVGA 3HB5X 1PGJA 1ZVMA 2D5AA 1E1NA 1XR3A 4XQCA 2GN6A 1SMKA 4BO1A 5IZ4A 3ETDA 3KXDA 3PIDA 1LLQA 9LDBA 3PTZA 3DZHA 1E0DA 1ONNA 2ZK7A 4MINA 3DZBA 1QKIA 3JQDA 4LCJA 4BB5A 2J8ZA 2X0RA 2CVZA 3ZU2A 1EVJA 5IXYA 2PD3A 4TSKA 4IGEA 4MDHA 4K28A 1I24A 3ZU3A 2NU8A 5DF1A 5ADHA 3PEFA 5G0TA 3W8FA 5I9MA 3H5AA 1JU9A 4LISA 3WQRA 3BMCA 1PL7A 3O26A 4J1SA 5DOVA 4HFRA 1YVEI 4LK3A 4ALMA 2CMDA 3NGLA 4N5MA 4TRNA 1J5PA 1H9BA 1HE2A 2BGKA 2OORA 3VPFA 4IDAA 1BGVA 3ASVA 3R1IA 3IS3A 3RC1A 1JW9B 3SXPA 4DIFA 3SJ7A 4Z6KA 3GNSA 2I6TA 4MIOA 1P44A 2BKAA 1TT5A 4A03A 4XB2A 2NU9A 1Z6ZA 3GHYA 3G0OA 1CIVA 3G1UA 1YO6A 5JPIA 2B4QA 3W8EA 4XZ3A 4GX0A 1HYHA 3BMQB 2JFHA 3BXXA 1Y1PA 2Y05A 3U5TA 5JDIA 4DBZA 2OZPA 4L74A 1C0IA 2PLAA 3KLPX 3TZKA 1XSEA 4E0BA 3B1JA 1GYPA 4J0FA 2JKVA 5JFOA 1PZHA 1XKQA 1UDCA 2R00A 5THQA 3T4EA 1SOWA 4I5EA 1JKJA 4E30A 4I5DA 1U8FO 3VKUA 3LU1A 4XR4A 2DTDA 4FW8A 4HX5A 2DBRA 2GLXA 1O9BA 1ML3A 4CR6A 2NTJA 1E7RA 3CKYA 4ND3A 4FGSA 2NSDA 3WFJA 2GF2A 2GPTA 3F5QA 3BZUA 4HY3A 3DTTA 1WP4A 3RC7A 1O89A 3JCZA 4D42A 2A4KA 1ADGA 3C3XA 1E1KA 2ZKLA 3IP1A 3Q9NA 4DIOA 1HDZA 2X4GA 2RH4A 3CH6A 4DPLA 2HRZA 3WXBA 4F6CA 2NUAA 2WYWA 2D59A 4J91A 1PJ2A 4JNKA 4WLEA 5KNLA 2CZCA 2YFHA 3JQBA 5L3ZA 1UDAA 3F6YA 5IZCC 4N18A 3QWHA 4INAA 3VTFA 1MXHA 1YKFA 4ZGWA 4YVFA 3EHEA 3PXXA 2FOIA 2OOSA 5DP1A 3WS7A 1GTMA 8LDHA 2OFPA 2VWHA 3L77A 1YXMA 3EY4A 4ND4A 2PGLA 3IL2A 4CQLB 5KOIA 3IMFA 4R68A 4JK3A 4S3MA 4CM8B 3I6QA 4CLDA 1LRKA 3FR7A 5BSFA 1UZLA 4HXYA 1NQAO 3PIIA 4EDFA 5FWNA 3G1TA 4DYVA 5B4VA 4KQWA 3GGGA 4MO2A 4IMRA 4NFYA 4IUYA 3JYPA 4EI2A 3ZV3A 1NFFA 5DDIP 3ZWPA 5F21A 3KOUA 1Y9AA 1IY8A 3BHMA 4IDDA 1HDXA 3DBHB 2EGGA 4YJGB 4CJXA 4CM9A 2I67A 4OKIA 3QP9A 1X7GA 3PGJA 2HRBA 4LCEA 2XOXA 3RIHA 3HDYA 3M1AA 3OF2A 3LZ6A 4NMHA 4ZA2A 3VDQA 4HV4A 1NASA 5BNTA 3UICA 4PLTA 4F3YA 3IC5A 4WNIA 2UYYA 3FHLA 3GVHA 1ZCJA 1ZW1A 2PNFA 3T7EA 3H3FA 3DBLB 2JHFA 2UV8A 2DTXA 4M55A 4XR9A 3DR3A 2JCYA 1U2GA 4Z9YA 1E5QA 1W6UA 2GDZA 1LUAA 1PZFA 4IIVA 4BUCA 3OIGA 2JD1A 4J1TA 3TFOA 4RVHA 3TZHA 4BHTA 2CUKA 1ID1A 3BHIA 3B1KA 1DEHA 2IZ1A 4XDZA 4E5MA 1KEPA 1R4MA 1S7CA 1VKNA 3MJEA 3TOZA 4HKTA 1SO8A 5HRUA 2CY0A 5L9AA 1HYEA 3PWZA 4AJ2A 4L9RA 2PTGA 2W98A 5ITWA 3DBRA 1QSGA 1DIRA 3O38A 2BH9A 3C1AA 4IDEA 1PJTA 4BB6A 1DHTA 2I66A 4Q3DA 1HE4A 3WGOA 3D5TA 5LC1A 3WIDA 1EUCA 3OM9A 5ITVA 1ADBA 4PVCA 1UP6A 3ZWWA 4LN1A 1NQ5A 3I9KA 1C1XA 3DMTA 2VYND 1ZK4A 1LDEA 4NR0A 4YRDA 4DVJA 4GL4A 1EE2A 1R4NA 5KCZA 3EVNA 4NBUA 4CMCA 2IYPA 5CDUA 5EERA 1PR9A 4CMBA 4YDRA 2ILTA 3SX2A 4OXYA 3EW7A 4J7UA 5ENVA 4I8XA 4BO2A 4ZQHA 2G1UA 3D4NA 3VH1A 2B4RO 2FRDA 4NFSA 5G0VA 4KOAA 1UXHA 2NV6A 2JL1A 4G65A 3ZW9A 2HCTA 1T4DA 4QQRA 1BMDA 1CEQA 3ZWYA 1E3IA 1JDJA 2QW8A 1YBVA 4LSWA 2WYVA 4NG5A 5CHEA 3KRTA 4IM7A 1ZK0A 5EINA 1EDZA 2OBNA 2GERA 3QW2A 2EKQA 3NT2A 5H81A 4JBIA 4BMSA 5CDTA 3LT1A 1PEDA 1ISHA 3TSCA 3FD8A 1UDBA 2H63A 3MJSA 1X13A 4Y6SA 2NTNA 2IYOA 3DWFA 4B3JA 1W8DA 3GRPA 1ENPA 3FR8A 4YEDA 3UFXA 3BMCB 1EUZA 1H5QA 3A06A 2D4AA 1O95A 3FWZA 3LT0A 5JAZA 4E3ZA 3ZWAA 2B4TO 1LDYA 5A9SA 5I7SA 1DFIA 1YBMA 2P9GA 4BNFA 2VHVA 2TMDA 4RV9A 1K3TA 3JQ9A 1T1RA 3K5PA 5FF9A 2VWQA 3AWDA 1ISGA 3CPSA 4LGVA 1DFGA 4XYBA 1CQJA 4B7CA 4BO7A 1ZJYA 5G2OA 3AUTA 2IEBA 2X86A 2Y0CA 3ETEA 3ULKA 3DAGA 1TA4A 5C7IO 3RBXA 5TX7A 2O3TA 2UDPA 3COSA 3MZ0A 4M8SA 4RLSA 1W73A 2E6UX 4WLUA 3C7CB 4H15A 3ZI0A 4XYMA 2Y1EA 2DM6A 3KBOA 4QO7A 1EQ2A 3H5NA 3W1VA 1QP8A 1O5IA 4LVCA 3ITDA 2VWGA 2AHRA 2OMEA 3OEYA 3UGKA 5IF3A 3O4RA 1ZSNA 4ZQBA 3UCXA 4AL4A 1DC4A 4Z9FA 2GO1A 2ZB3A 2O3SA 1ARZA 3JQGA 5KVQA 3JQAD 4FC7A 1A9YA 3FNGA 4PIVA 4O0LA 2E49A 1IZ9A 1GEEA 4MVJH 4BV8A 1PTJA 1ORRA 2P5YA 4GLLA 1JTVA 4U6SA 2CDAA 3WSVA 1V8BA 2DPGA 3A28A 3CXRA 2OBYA 3JD4A 4QX6A 3PFFA 1LA2A 3ZV4A 1J6UA 4PZDA 2BF7A 2D5CA 3ZWVA 3OA2A 4Z9XA 1YL6A 1JN0A 3E18A 5A06A 5FEUA 4OXNA 3RROA 3VZQA 4CLHA 4DWVA 1BVUA 2R6JA 5L4SA 2I3GA 2I65A 2QYSA 3AFNA 1NAHA 5BNFA 1LSSA 1QYXA 1VI2A 1NHGA 4JX8A 2ZQZA 4IDFA 3Q6IA 4L75A 1CDOA 4ZQEA 1MG5A 3GLQA 4HBGA 4OXKA 2GN8A 2QYTA 2UUPA 5CEEA 1EBFA 1FK8A 3WGGA 3RUEA 3JQEA 4RDHA 4EEZA 1QYCA 1LRJA 3DONA 5B12A 4U8GA 5G4KA 3DZJA 4UAGA 1KC1A 4J90A 4L4SA 3TNLA 3PQDA 1DLIA 1UXGA 1IB6A 1JVSA 2G82A 1JKIA 1J0XO 4R9SA 1ZKMA 2B35A 3ZU4A 1H2HA 4DQXA 2D2IA 3K2BA 3C8MA 3HN7A 1H9AA 1YL7A 1K89A 3LDHA 1RM5A 1B3BA 2BFMA 1H2BA 2C2XA 4KZPA 5IXSA 5FI3A 5CDYA 2WD7A 5EESA 4GPD1 1G1AA 5G0UA 5A5EA 4C7JA 2GYYA 2EKLA 3JQCA 3NKLA 4YT5A 2Y66A 4GGOA 5HWSA 4YQYA 3RD5A 4MVJM 1P1FA 4YAEA 4Z3DA 5MDHA 2F1KA 3FRJA 4NHEA 2DBVO 4A0SA 2HSDA 5GY7A 1R12A 2IEDA 1C0PA 2PK3A 2WTBA 4N54A 5KIAA 3GR6A 3RASA 3GHHA 1XIVA 4PCVA 2QX7A 3WWZA 2P91A 2Q4EA 3PVZA 1ZK2A 1SB8A 4Y9DA 2XAAA 2J3JA 2Y1CA 3E5RA 3NTOA 3OBBA 5GZ1A 4URFA 3PZBA 1IULA 1R4MB 3DFZA 4GH5A 3U09A 3STHA 4CL3A 2A9FA 2J5RA 4BVAA 3JD2A 4PLPA 1HYGA 2CSUA 3DBRB 1S6YA 2DKNA 2WD8A 1NPTO 4PZEA 3WGIA 5GZ6A 3MTGA 4P8RA 3I52A 4Q39A 4F45A 4O6VA 4XWYA 4WE3A 4E31A 4BO9A 3GZ4A 4ITUA 4RVGA 3ANNA 4WLOA 3NV9A 1ISJA 3AI2A 3MEQA 5I8WA 3LLSA 1U3TA 4Z0HO 1C1XB 1HKUA 5C3MA 3E82A 4NBTA 4E2ZA 1QYDA 1ZXLA 5U9CA 1O0SA 1R4NB 3VH4A 5KKAA 5DBFA 3FF4A 4K1LA 4P38A 4BGIA 2B83A 4BNJA 1N7GA 4FFRA 4BNTA 1K5HA 4W9NC 1ENYA 2O2YA 1VRWA 3W4JA 2EV9A 1NM5A 4PLZA 4AICA 2FZEA 2I76A 1TVEA 3LT2A 1NTOA 4DQUA 3ZU5A 2YQ4A 3D4PA 4PG4A 4WK6A 2OO5A 3M2TA 3E8XA 3NAQA 1KYQA 5JDIC 2B0JA 2EJWA 4CM6A 3RUDA 4R4JA 3ZCXA 1PQPA 4CM3A 1YQXA 3U62A 1A7AA 4RGBA 1LSJA 3O9ZA 2RBEA 2R00C 3GEMA 2QHXA 1JAXA 1RM0A 1DOHA 3CMCO 1WXDA 3BA1A 1YB1A 1X0XA 3AY6A 4AG3A 4ALLA 2VHZA 4CQLA 1FJHA 2BMAA 4ALJA 1DJNA 4CM8A 3V1TC 3DEYX 1K0UA 3U3XA 3CMMA 4IQ0A 5A9SB 5JXWA 2VYNA 4BKRA 3ZDFA 3G79A 4W99A 2O4UX 2CVQA 4BO4A 2EEZA 4MIEA 3FCOA 4L8VA 4BNXA 4D45A 3JTMA 1EK5A 2J5QA 3V8BA 3EMKA 1DJQA 4O1MA 4ILKA 5F5LA 1P33A 2GR9A 3TDKA 3IKTA 1G0NA 3GF4A 4ZRMA 5EQFA 3AU8A 3LYLA 4NK5A 1U28A 3AY7A 3IJRA 5IAAA 2V65A 4FB5A 1MV8A 2EP5A 5CG2A 4BNWA 2VZ0A 3L9WA 5CEJA 5IDWA 3ETGA 2O50A 4BKPA 1GV0A 4CODB 2FSVA 2HK8A 4CLOA 3QVWA 5GMOA 1BDMA 3K30A 3JYQA 3MWEB 1VJTA 1IUKA 5A5FA 2FR0A 3H4VA 3JQGB 1R66A 1H94A 5C7LO 1MA0A 2WE8A 3WQQA 1KVUA 3GVPA 4MP8A 3A1NA 2X23A 5F1KA 4HFMA 4IS2A 1NPDA 3FNHA 2XPCA 3UCFA 1RWBA 2HMVA 3Q11A 2LDXA 1A72A 4EJMA 4LMPA 3GY0A 3ST7A 3S55A 2O4CA 1VL0A 2C54A 3W6ZA 4CL8A 4R5HA 1JA9A 1SEVA 4Y8VA 2BI8A 2O3UA 5CPBA 2OXIA 2VHYA 4JJIA 2J5KA 3V2UA 3QVSA 4NDNE 4K6CA 1V3TA 3G49A 1QV7A 2NNLD 3G17A 3OH8A 2PGJA 5IJZA 3MJCA 4WPGA 3K96A 3F1KA 5L7WA 4PVDA 1C3VA 3WYEA 1ZK1A 2DU8A 5CDSA 4AJ1A 4BO8A 4NFHA 1MB4A 4DGSA 1HDOA 2BI7A 3EZYA 1NFRA 4IJKA 3ZH2A 4UEJA 2D8AA 5T6BA 4XCVA 2Q1WA 1EVYA 4OO3A 3CE6A 5G4KB 1P74A 2GRAA 3WICA 1ZSVA 5COAA 3WMWA 3P2YA 3R3JA 1LQTA 4W82A 3CEAA 1NPYA 4D44A 1DBVO 3VVBA 1ZO8A 4R01A 1R16A 1GQYA 4NU6A 3JQAA 5U4QA 3AM5A 5A03A 1EFLA 1TT7A 3K8ZA 4XRRA 3T4XA 4OQZA 5EQDA 2EERA 2X5KO 3F4LA 4GI2A 4KTVE 3OHSX 3HB4X 1MC5A 2WD7B 1CERA 1N1EA 1M6WA 3WJAA 1H6BA 2Q1SA 1EVIA 3WTCA 1NWCA 3NTQA 4DA9A 4DIBA 3GN2A 1L7EA 2X9VA 1PWZA 1U9JA 1PIWA 1ZZEA 3LVFO 4TKLA 3UHAA 3LSYA 2Y93A 4IDGA 4B4UA 5DCUA 4CMIA 1Z74A 4MJLA 3GG9A 3RQSA 2AEMA 1UAYA 2Q50A 3CZRA 1L7DA 3RKUA 4RVDA 1GPDG 1WZEA 2HK7A 3IAHA 2H1SA 2AG8A 2X5JO 4QECA 3WFIA 1I33A 1YGYA 3H2ZA 3WBBA 1V3UA 2VZ8A 4O63O 1V3VA 4BKQA 5THKA 3HNPA 5IN4A 4JROA 3ITKA 3QWIA 3KHUA 4YAGA 3W6UA 4BQPA 4RZIA 1SB9A 3N58A 3A4VA 4OQYA 1YBAA 3TWOA 3GG2A 1E92A 3HDJA 4M49A 3VH3A 1PQWA 4FJ2A 1T2FA 1VL6A 4O5OA 3DBVO 2AA3A 7MDHA 2PKQO 5JY6A 4J1QA 1N92A 3WGHA 4D3SA 1UAGA 2H5LA 2VTDA 4I08A 1E1LA 5TT0A 3RUAA 2X0NA 3ZN2A 2VNSA 5HS6A 4WLNA 3GQVA 3HFGA 2ZCUA 1HL3A 3JQ9C 2OP1A 1PGNA 4RF4A 1LI4A 3L6EA 4CMKA 4RPKA 2GZ1A 2IE0A 4GGPA 4XIJA 3PJGA 3AM3A 3M6IA 2VHWA 3OICA 3V5NA 4II2A 4TVBA 1NAIA 2EP7A 5I8ZA 3PQFA 4CQMD 1H0KA 1HXHA 1HDCA 3BMNA 4DXHA 4L4XA 3ROPA 4KUGA 1YDEA 5KVSA 4DC0A 1E6UA 4IXWA 3TZ6A 3F4BA 2WJPA 1ZXBA 4U7WA 5JMPA 3HHPA 4RF5A 4DLLA 3C1OA 4ROSA 4QO8A 5DT9A 5H83A 5B37A 1LSUA 4YT4A 3WYBA 3RCBA 4EUHA 4YXFA 3K2EA 1M2WA 1DAOA 2VHXA 4CMEA 1YQGA 3F46A 5K6AC 3L4BA 5JO0A 2BGLA 4IPTA 3GDOA 4PFJA 4R1SA 3I9LA 2EXXA 1MGOA 2OUIA 4OJNA 3V1YA 4UREA 3WSWA 1MP0A 2Q99A 1LDMA 2CF6A 3KYCA 4RPHA 3UAGA 4DLBA 4CLRA 1F06A 3E6AA 4GAEA 4PLCA 3JD1A 2V6GA 4KP7A 4RPJA 1P31A 1K6JA 4JBGA 2C0CA 1XWFA 4BO3A 3Q3CA 5T8KA 4ESOA 4PRLA 2FHSA 5CFZA 3UCEA 3K31A 4GKVA 1TXGA 3GMSA 3U4IA 1T4BA 2YDXA 5F3RA 1Y5MA 1VSUA 3DXFA 4P4LA 2AQHA 3QA9A 5TRTA 3DOCA 2GCGA 3EK2A 1NR7A 1R6DA 4N5LA 2W2KA 1ZSYA 4FFLA 2DVMA 3D1LA 4DREA 3JQFA 2FP4A 1IOLA 2A92A 4PGFA 2A35A 3PYXA 3DZFA 3SBOA 4P22A 4CLOB 4E4YA 5A05A 4CPDA 1X14A 3C1TA 3RC2A 4KMSA 4B8ZA 2DLDA 2C20A 2DUUA 3DTYA 4OKNA 5B1YA 3NEPX 5ER9A 4CR7A 1A7KA 1G0OA 2NVWA 3GC6A 1QLHA 1Z73A 1OOEA 1JWBB 5DOZA 5TGDA 1N9GA 5DCWA 5JY1A 4CLEA 2FR1A 4XGIA 2W8ZA 1QR6A 1DIGA 1Q7GA 4YJDA 4J7CA 4TROA 5DBGA 3SVTA 3WMXA 3QQPA 1I2CA 3H9GA 4FFMA 4NI5A 1MXFA 1QORA 2JD2A 1G6KA 2X9GA 4FDAA 2PZLA 1ENZA 1HWYA 1QMGA 1U3UA 2DTEA 3DAPA 6LDHA 3S2EA 1NXQA 4ID9A 3RWBA 1Z7BA 1NQOA 4E33A 3H2SA 3OJ0A 1E7MA 3ORFA 4D7AA 1PZEA 1M66A 4CM7A 1DC6A 1B3RA 4OAQA 3RFXA 4Y6RA 4YACA 4OYRA 4YB8A 4ZD6A 4FJ1A 1EQUA 5L4LA 4G2NA 3EZLA 4HFJA 5H82A 1KIFA 2JCVA 1KY4A 1LC3A 2O48X 4I5GA 4NH4A 1I30A 4XQ9A 2AQKA 1DXYA 3CUKA 3MCVA 4BO5A 1DRVA 1T2EA 3ENNA 4DBVO 4NJOA 5A4DA 4Q3CA 5TF4A 3Q1LA 4PRKA 1GZ4A 3WTBA 1O6ZA 4XB1A 4CMAA 3TF5A 3WGQA 1WDKA 3BTSA 2V6BA 5KJFA 3KZVA 4XDYA 5TLSA 4YAKA 4XGKA 4PG7A 3JQAB 3Q2IA 4MIYA 3KTDA 2HAEA 2PGDA 1DC3A 3VPHA 2PD6A 1PGOA 5AXDA 3L0DA 3ZWBA 2Q2QA 4E21A 2RAFA 3PFWO 2W2LD 2FWMX 3K73O 1VKOA 4E2XA 5KJEA 1C1DA 2EWMA 4IMPA 4NQZA 1P77A 4Y98A 3OETA 1QXSA 2DPHA 1FDWA 2ZB4A 1SOVA 2ZIZA 4CMIB 4CUKA 3RJ9A 3K92A 5T5QA 5KJCA 5BQFA 2O23A 3AOEA 4CMHA 1YDWA 3GDGA 1E3JA 3FPLA 4OMUA 1EZ4A 1GZ3A 2G76A 3ZWOA 3ZWXA 3WJ7A 2AG5A 5IDYA 3WQSB 1PJQA 4ZJUA 4YJHA 1A9ZA 2Y67A 2C07A 2G5CA 4BKUA 1M67A 4QXMA 1PGQA 3AFMA 3L6DA 3UKOA 3H9QA 3HZZA 2VOJA 5CAEA 4C4OA 2WWRA 1PU2A 3B70A 2Y1DA 1F17A 1GCUA 1PWXA 1XQ6A 1B8VA 5EJ2A 2YYYA 1WVGA 1HE3A 1Q2XA 1YWGO 2GN4A 2IXAA 1B7GO 3EUWA 4OL9A 3ZNNA 4GKBA 4CV3A 4P4GA 3U49A 1C0KA 2VQ3A 1E5LA 4JCOA 5ICMA 1NX6A 2NM0A 2UUOA 4FOSA 3ENKA 1SAYA 2UVDA 4M86A 5T57A 2X1HA 2Q4BA 3ZHZA 3RUCA 2NQ8A 3IIEA 3DFUA 4WLVA 4GVLA 1ONPA 4BNKA 1N1GA 1TI7A 1NVGA 3RU7A 1YB4A 1Y6JA 1Y7TA 1FDSA 1KEWA 4S1VA 1CJCA 2VRCD 4GSLA 5C7OO 3SC6A 1E7YA 4WGGA 4IJWA 4YJFA 2IRWA 3DQPA 4BQRA 3D3WA 1KERA 1TB4A 3JQ7A 4CV1A 4R1UA 4B4VA 2Q1TA 2YV1A 4LW8A 4EITA 2IXBA 3LK7A 2ZCVA 4TZKA 4GLOA 4RPLA 1LU9A 1NFQA 2BHLA 1YS4A 3BMNB 1I2ZA 5IG2A 2BELA 3R3SA 1KS9A 5FI5A 2NQTA 4QT0A 1H6DA 4JLWA 3ONFA 1ZMTA 5IZCA 3ONDA 5EMHA 1VM6A 5T67A 2YQ5A 4TZTA 3KB6A 3HFSA 2WE7A 5T64A 3BYZA 3UOGA 2AE1A 3TZQA 2QRLA 3H9UA 3IP3A 4PLVA 2IZ0A 4OH1A 4RCVA 4M87A 4FIZA 4QUKA 1ZMOA 2RIRA 5AVOA 1K6IA 3CTMA 1LEHA 2YW9A 3LLVA 4XRGA 1RPNA 4ND1A 5JAIA 4CLRB 5BSEA 3KYCB 4W7HA 5DP2A 3H9JA 3D7LA 4BO0A 3EGOA 2PA3A 5BNIA 3WLEA 1ZUD1 5HS4A 4G5HA 4ALNA 3E9MA 5KTKA 5L45A 4RVFA 3PWSA 1EEHA 1I3LA 1LQUA 2DC1A 4IDBA 1BSVA 2BFPA 1PGPA 4BV9A 4L73A 4MP6A 1P1HA 4TMFA 2PKQP 5U1PA 3I9MA 3P7MA 4MP3A 1B0AA 1UP7A 2C2YA 4XQEA 1YH3A 2PH5A 3ASUA 2HQ1A 1CYDA 1YL5A 4BL5A 2P9EA 2W2KB 1CF2O 1ZEJA 4CQMA 2YV3A 3QJ5A 5BT9A 4D3DA 2HDHA 4D0SA 4MVJD 2B69A 1DLJA 2X22A 3ADOA 3HE3A 5LDHA 1L1FA 3L4SO 4E2WA 3K6JA 1GZ6A 1OMOA 3M1LA 4RQTA 1ISFA 3GUCA 2R2GA 5C37A 4ALKA 1DAPA 1N9GB 2YDYA 1MC4A 5KKCA 2WM3A 4I9NA 5DNAA 1X0VA 3PLNA 1GQQA 2HMSA 3HJAA 4J4BA 3LQFA 2ZJ1A 1MLDA 4GMFA 3QHAA 4YA6A 1BG6A 3KV3O 4XKJA 3VTZA 4B79A 4ZQFA 5JAMA 2Q2VA 5I9LA 3GK3A 4Q3AA 1AGNA 4P4NA 2J3KA 1UXIA 2X8LA 4FSHA 1PJSA 4D41A 1BVRA 3AU9A 4ND5A 2Q2WA 2WEKA 2VWPA 5JDCA 3PRJA 1KETA 2FN7A 1R0KA 2W4QA 3A14A 4W4TA 4R5MA 3FNFA 3GUYA 3MOGA 1I3NA 4CUJA 3VH2A 4PG6A 4A26A 4YBZA 5JNLA 5JBIA 4UUNA 3ZNQA 4J1NA 3ROKA 1EMDA 3OJOA 4NBRA 4ZU3A 4BMVA 1YONA 2GD1O 2FZWA 4PLGA 4YT2A 1BHSA 3QE3A 5JCJD 1E6WA 3QVOA 1GQ2A 4HP8A 3PZRA 3IKVA 5L51A 1PL8A 3KYDA 1E3LA 4BNGA 3QSGA 5AQ1A 1XG5A 4J9UE 2NLOA 1E6EA 3NUGA 4AJEA 1LLDA 3U4DA 2GNAA 2I3AA 4FBGA 4NNJA 1UR5A 5TIIA 4J16A 1T2DA 1A4IA 1GUFA 3ZV6A 2FR8A 5DZSA 1FDVA 3I9NA 3PJDA 4CR8A 1Z7EA 4GSKA 3ZNOA 5KVCA 1IHXA 5BR7A 1LX6A 1C1DB 4IDCA 2AEFA 3UH1A 1LDBA 3HDHA 4JGBA 2GZ3A 4XGNA 2AXQA 1AXGA 1PQUA 1JKFA 4N7RA 1XA0A 5CDGA 5KJ1A 1FF9A 4OM8A 1BXGA 2GGSA 2NVBA 3X2EA 1F14A 3L9XA 4A7PA 1MUUA 3CSDA 4Z0TA 3GH3A 1YRLA 3JD0A 3ON5A 1UZNA 3BHJA 3PQEA 3BMOA 4YJHB 5JAQA 1I01A 1LLCA 5AXAA 2X9NA 2GUGA 4RORA 1U8XX 3UF0A 4II3A 4GVXA 4IZHA 3WB9A 3JQBC 3WBFA 1DO8A 2QQ5A 1AHIA 1U7TA 1JAYA 2AMFA 4NZ9A 5GZ3A 1SNYA 4OSPA 2CDBA 4XYGA 2VN8A 2VRBA 2VYVD 4JJGA 1PJ4A 2VUSA 5JYEA 3IOYA 1YOVA 2Q49A 4IGFA 4OOFA 3GEDA 4Q9NA 3GAZA 2IODA 5TJ9A 2BFAA 4BMNA 4HNGA 2DFVA 2H6EA 2JFFA 2HKIA 4Y6PA 4CUZA 2NADA 3T7CA 3GOHA 2W2LA 3LF1A 3I4CA 5T8KC 3DL2A 2PZMA 3DMYA 3S2GA 3TRIA 1NP3A 4CM1A 3VZRA 4CM5A 1KVSA 2D3TA 1I2BA 4IZIA 2DBQA 3DOJA 3HDQA 3NDIA 4YJFB 3H3JA 1OZAA 1JWAB 3D3WB 1WMBA 2Z1NA 3EC7A 3JQ7B 2BFOA 3GZNA 1I32A 5CEFA 2FPPA 3SEFA 3V2GA 1ZEMA 2JJYA 1PS9A 1P1RA 1EDOA 1A5ZA 4HUJA 3VHRA 2C82A 4EUFA 3OQ1A 2EGHA 4LVUA 1P1JA 5L40A 3M2PA 4BNIA 4D0RA 2JAHA 3FTPA 4RZHA 1RYEA 3JQFC 1GFSA 1IZ0A 1RYDA 2PH3A 2O2SA 4GMGA 1R15A 2Q46A 3BTOA 3PJEA 4R1TA 4KTTE 4B3HA 3CZMA 4KWHA 4Z0PA 1VJ0A 3PHGA 3HG7A 1BXZA 2AQ8A 9LDTA 3GPDG 3JSAA 1PJ3A 1E3EA 3DOOA 1UXJA 1GD1O 1Z45A 1HSZA 4YPOA 3AW9A 1Y8QB 4R3WA 1Q7CA 1GCOA 4N5NA 2EG9A 4AJJA 4UVDA 4W6ZA 4H16A 3PK0A 3C7DB 4AJKA 3OIFA 1LTHR 1WNTA 3ZHYA 1M75A
chains in the Genus database with same CATH superfamily
4DA6A 2C7BA 5GAJA 3SXUA 3CJRA 1UPCA 2XBLA 2MSDB 4K6GA 3D6NB 4MULA 3TFQA 4B40A 2PUTA 2WHPA 1DRJA 3N0VA 3R3WA 3LRTA 4JSYA 3WLTA 1SCUA 3HB1A 3EFOA 3ZKWA 2JIZD 4MPTA 1W8IA 2Y76A 1VPTA 4GWLA 4K26A 2QD3A 4Q3NA 3RSHA 3RVPA 2EKZA 1PD1A 5L95A 3A36A 1JHQA 1DHRA 1O6FA 3G9XA 3OJXA 1T6YA 4J2OA 4P92A 4RMHA 4U3JA 1XHLA 2IXGA 5EMLA 4AKIA 1FTQA 1ZRHA 2B37A 2WZBA 2ZW9A 4X8MA 2HSJA 3OP4A 4DZZA 3UJ6A 2R8OA 3QLVC 2O5VA 1TZJA 2CL7X 2DSTA 1Y7HA 3NC0C 4CQMB 1D1QA 3L7AA 1U7HA 4M0MA 4FOTA 3SVTA 2OZKA 1RC1A 3N7AA 4JLAA 3RTGA 3SSNA 1CZRA 3UTCA 5C1OA 2WBLC 2XY4A 2QMUA 1A8HA 4G85A 4HNQA 2CBZA 3HFRA 3RSLA 5ILOA 2FY8A 2E4XA 1V6AA 2JASA 4FCCA 5BWCA 3CVJA 2QV7A 3GJZA 4Q7EA 3VJMA 1JHAA 4OU5A 4JB3A 3VYTB 2IWRA 1D1TA 4UARA 1BW9B 4KQCA 4D4LA 4IFTA 4RMNA 4F6LA 4BV3A 2G06A 3ZXIA 4OCZA 1V37A 3T3DA 2AFIA 5K8IA 3AO0B 3N2KB 2GCOB 2NW6A 2W11A 3OJLA 3FPKA 1JHPA 5DWDA 2FDXA 1XVIA 4K40A 4D02A 1OZ0A 2RHWA 3VYRB 1M33A 4WJZA 2Y1GA 2C5AA 3KS9A 4HFNA 1XPOA 1Y9EA 3P8ZA 1X9HA 3CH7A 4PLWA 2XYVA 4ZCQA 1XDBA 1ZESA 5BSGA 1IZZA 1RBQA 2PX4A 2ZB7A 4ARZA 4OJTA 1II9A 3GT7A 1B41A 4P3YA 2WKQA 3E1GA 2ACEA 2UUCB 3SBEA 2BZGA 4PCUA 5F33A 3TOXA 2PZJA 3M1YA 2R6GA 4QUIA 3EVGA 1N7HA 4OG2A 3QMMA 3PXAA 1P2TA 1NN1A 4LPSA 1K8YB 3TE6A 1HTTA 1F2DA 4XSHA 2VCYA 1JHXA 3SEAA 2CXRA 1W0JD 2IT1A 2XQGA 1PNVA 3A25A 4F4IA 1MH1A 2W2XA 3I39X 4TV9B 4EI8A 1WXQA 1G2PA 4RSGA 5B7GA 3BEOA 3UHJA 3UB2A 4C7OA 2ETVA 3S1LA 3RR2A 1MW9X 1U3DA 3QVMA 3KPWA 3AOEC 2X13A 2GAJA 3TRJA 1JECA 4NZOA 1F0YA 1WP9A 1PLLA 2XTMA 4S0ZA 3UPUA 4AXBA 2R5NA 5AM4A 2FKNA 2XKJE 3T3HA 2FPGA 2C94A 1YNSA 2X7HA 1Q74A 1CULC 3GMIA 2H1IA 1RSZA 3EZ2A 3OX2A 2B30A 3OE5A 3KKPA 5E9JA 4R2HA 1MFPA 3Q8WA 3H65A 3ZY3A 1RYFA 2H48A 3I0NA 3TDNA 1NBAA 2GXQA 4FN4A 4BOYA 4DL9A 2GJKA 1OGYA 3AI1A 2E5WA 4C0HA 5BXYA 1QOQB 3T94A 1JAHA 1T36B 1YT5A 1WSDA 3L8YA 4ZPJA 2NACA 1CV2A 4KI7A 4FHZA 4UJ3A 4A2CA 6ADHA 5ALSA 3FLAA 1T34A 3IOEA 1YA8A 2WF6A 4JC8A 721PA 2HT1A 2AW3A 4KPEC 3P9SA 4I2NA 1UBTS 1ZUNA 3EF3A 4LYEA 4PZUA 3OOEA 4BC0A 3ETCA 4RF3A 3OU2A 1DPGA 1ZIOA 2B1QA 5L7TA 1SHTX 3K9QO 1K86A 3PUWA 1WBBA 3ZG6A 2A9VA 1AS0A 4YJ3A 3RB8A 4AP5A 2ZS8A 4AY6A 1EFRD 3EC1A 4PGGA 1AU9A 1JHOA 2PRZA 2V58A 3E48A 2PQ2A 4GS5A 5AI6A 5DX1A 4CZ2A 2J6BA 1FSFA 1S9HA 5DHTA 1BDHA 4RIEA 1FQKA 4WOJA 5FV4A 1NU6A 1P9RA 4EG1A 1SXGA 1JHDA 3KB2A 3R5XA 1Y80A 3Q3GE 4XPIB 3TD6A 1YKSA 1J97A 2FPXA 4XB6B 3FMFA 3KBBA 3KTAA 1EFVA 4JLPA 4JKOA 4M83A 3ROMA 3HVKA 5DXFA 2AWNA 1NT4A 1K92A 3R6WA 1VKHA 2OYRA 1WF6A 1T0IA 3AJ9A 2R5WA 4GZMA 3RFVA 3SMVA 3TIGA 2VYCA 1WMSA 4BKOA 5JXJA 1BHJA 1IN4A 1JBQA 2QX4A 1DOAA 3N0RA 3F4KA 4LZOA 5DYIA 4RESA 3ONVA 1HTWA 3R7LA 3QU5A 3C7TA 2PANA 5JCJA 2PX0A 3FIJA 5JPCA 2WPDD 2XXJA 1Y1QA 3B7GA 1XXHE 1QRTA 1XKTA 5FFFA 4CKWB 3FSJX 5G4LA 3TOCA 3PDIA 3AB8A 3PGVA 1FUUA 1OBFO 3SLGA 3CC8A 2MYPA 3F96A 2QTGA 2B8WA 4W8HA 5IDXA 5A9TA 3Q5DA 1YOVB 2GAIA 5EVCA 1EFPB 3EH1A 4Q1VA 2CSXA 2D0IA 2GFHA 4R1PA 3V4PB 1X42A 4BP9A 5FI0B 4QTXA 1JLHA 3FCCA 3G2QA 4MYCA 4Y7DA 4AZSA 4MRMA 1W9MA 1X8XA 5LDGA 4DY6A 5ER6A 1RXWA 5KC9A 4EPWA 1S1MA 1SA0A 1R0SA 1YQTA 4MVJE 3O8RA 1OH8A 3ZY2A 1Z68A 3BB1A 2ZDHA 4R0MA 4JI5B 1R64A 2P2NA 1OZGA 3LUDA 4Q9JA 4K6MA 2YFKA 3EXIB 4C4ZA 1UIMA 4KITB 4XJVA 3RQIA 3HXOA 2ZUVA 1V11A 4MX8A 2C5HA 4X3CA 1RBZA 2VJYA 4BAUA 5FR2A 3UXHA 2FPPB 1S2NA 4A73A 1P7YA 3GFGA 1VE9A 1I7NA 4DAEA 4O4LF 2W7TA 3H5TA 4ZOLA 2O1SA 3V4SA 5JMWA 3THYB 4EJ0A 2GN9A 4FE7A 3WL3A 1CUZA 1QYIA 2QR5A 2IOFK 4Q7QA 2MINB 2R6AA 4DTIA 1W36D 1W2WB 3AM4A 4R8KA 4ZZ1A 4HHEA 3A3KA 4PSDA 2GFIA 5LZ7A 2PCJA 3QF7A 1HG1A 2WC1A 3ZHQA 3U16A 9ABPA 1M6HA 1X15A 3GT0A 3MTJA 1E3SA 4OHCA 4X20B 5IYZB 1N78A 2GJ9A 4JI7B 3NGMA 4I5FA 4QJ3A 4U0JA 3BTUA 4Q3LA 4F9TA 1RVV1 4ESEA 4D43A 1WAMA 2CD7A 4D8XA 4F84A 3K5IA 5MGBA 2V7PA 1BWPA 1ZDMA 2D7DA 1E77A 1P3DA 3KLMX 5JJKA 5E2IA 2H2AA 2VO1A 3DZIA 1W4CA 3A05A 1DQYA 2HSWA 3PC4A 5CA0F 1W47A 4GGMX 3ACCA 1NYTA 3WL6A 1YHZA 2EYQA 2X0IA 3FPCA 4W6QA 5DN9A 1SVLA 4YAIA 4RQBA 1EBUA 2C97A 2WSMA 4PR3A 4K6FA 5CM9C 1XC7A 4YECA 2DFNA 1Q0UA 1W5EA 5DLPA 3OF5A 4U7GA 5G41A 4DHWA 2NQ2C 3IEVA 3C97A 3TEMA 1M2VB 1C9KA 3KZNA 2QLBA 2OK8A 3NVAA 4GR5A 4R0VA 1WD7A 1ZK3A 4OI4A 2JBHA 1CY7A 3T35A 3T9DA 4LZLA 4C2TA 1VPDA 1JR3A 1VXRA 1EI9A 1GAEO 4G1MB 5KYUB 4EVRA 3X1WA 4IOKA 2C7VA 4L2IB 2OHXA 3VR5H 4EYEA 5JCOC 1I7SB 2OFOA 4J4TA 1JLLA 2HLHA 3TNJA 3DEZA 5AVRA 4CV2A 1FP7A 3P71T 2DWCA 2R7AA 3H9EO 3Q9UA 4MMZB 2FVXA 4M46A 4NBWA 4EEXA 1G3RA 1Y5NA 1K8XB 1TNDA 1WCIB 4MW4A 1FS5A 5AKHA 3FZGA 4YNBA 4ODIA 1L4FA 1EUDA 3L1HA 3EDMA 3NLLA 3O4FA 2FSGA 4BPBA 4NCIA 2Y1OA 2GZSA 1HZZA 2JGJA 4Q37A 1E89A 4BIIA 2ZS7A 2AG6A 3PDJA 3TNDA 3LXRA 3DLAA 2AW5A 3H11B 3K1JA 2NYRA 4G0ZA 4XH9B 5HTOA 1F7VA 5FT9A 3PB3A 4B8YA 1SXQA 3H5LA 3GGOA 1M2JA 1WMAA 4CTKA 1GXSB 2XKKA 3HU3A 3IIJA 3QNWA 2KE5A 5HX7A 3SHFA 1HDIA 4JOCA 4IIBA 4RLHA 1XEXA 1D07A 4HNHA 5M29A 2IYEA 1Q7BA 1ZMRA 1RWMA 3ESYA 2XZPA 1BVYF 2A2ZA 1ZM9A 3H2BA 1KQNA 3T9BA 5BSHA 3KEQA 1XCBA 3QE0A 1JHUA 5I7HA 5LP6F 2V55B 2IE8A 3GROA 5AKZA 5E6UA 1WF3A 3EFBA 3TTUA 1RKXA 3UYKA 1JFFA 3C43A 3G0BA 2DR0A 4NZPA 5EE9A 3FUXA 3I4FA 3TAHA 1KY5A 1TU3A 3FE2A 1V47A 4BNZA 2JIZA 3OKPA 4DQVA 3U4QA 3PLAE 2FG6C 5FPYA 1GAQA 2UZ0A 3H17A 4WINA 4XI9A 3HCEA 3SM3A 4EOGA 2I6FA 1YFJA 2Z2YA 2HK9A 4NHOA 1BFDA 4BUZA 2DFDA 2YMMA 4DG5A 3F2VA 3H7AA 3BWMA 3OJFA 2QE6A 1RJGA 2IBMA 3A6FA 2RHCA 3VZPA 4LY0A 4MZXA 3KETA 3IUPA 2NN3C 4EX6A 1PJLA 1XF9A 1Y3DE 3RM3A 4JDUA 2NU9B 4KV9A 2O8EB 2RIPA 4Z51A 5BUCA 4QUDA 2VNJA 3PICA 3U7EB 3OSUA 3QWFA 1R6AA 3KPJA 4OHVA 3IT0A 2EATA 4R98A 4UMEA 2OZEA 5GPBA 1J0DA 4B3SB 1KO4A 3TSWA 5KSYA 4XOUA 1REQA 2YVQA 2C4TA 1YZLA 3DOIA 4JLUA 4REQB 4KBFA 1N6KA 3T41A 5CBPB 5HFJA 4C0SA 3CF4G 3UGTA 2I4LA 5D8DA 4CM4A 4BVJA 3P20A 2X2FA 5DMXA 1CX9B 1SUPA 1XL1A 2YZGA 2C00A 3HMKA 1CJKC 4GD3Q 1J1ZA 3GEGA 5B1SA 5I51A 3HN2A 1F0PA 2C1XA 2IY9A 5KB3A 2VPIA 2AN4A 3GFPA 3BCRA 2VA8A 4IRUB 4M1QA 3E27A 2SCUB 1SCJA 1LB1B 2UAGA 2PUWA 4FNMA 2BEVA 5EJ7A 5K6AA 2DB3A 3LK6A 3WIBA 4L0CA 4QL3A 5FULA 3PFKA 1UBLS 5HOQA 1ISIA 4PLYA 3THSA 1P9OA 3OLZA 1VPEA 2QZZA 4NMMA 4BNVA 4D9BA 5ARBA 3H5WA 5IBPA 2WUDA 4LTNA 1M1NB 3M7IA 1EJ6A 1OYYA 3H2GA 4YMUA 2ZB8A 3B3FA 3CINA 4RVSA 4WZAA 5E7IA 5KYVA 3DJYA 1QIJA 5FUBA 1W0JA 2CDRA 4QGFA 3RTDA 4EGSA 2WA2A 4HLUC 1AK2A 2W4MA 3AF6A 2VZLA 3GGPA 2OCLA 2ID8A 3KM0A 4G9BA 4KXWA 3CEPB 2Q6KA 3QPBA 2Z8ZA 4JI6B 4PSCA 3A8TA 3OQBA 1KKUA 3ONEA 1U0SY 4NFLA 4QTZA 3UJPA 1GVNB 2G80A 3O1HB 4QYIB 3TRDA 3BE5A 3AETB 2BR5A 2YJ3A 4YP9A 7AT1A 3AEXA 5EXTA 3RIXA 2AOVA 3VR1A 5EJ8A 5JI3E 3NBFA 4HDSB 3VSBA 1NJ6A 1P0CA 1QGUB 3K8OE 4QAJA 3WRYA 4AO7A 1VTKA 2ZSJA 2JGNA 4I66A 3ICPA 3WE7A 3VKVA 1GT91 4Q66C 4E88A 3FAZA 4IVRA 1XGKA 1Y3BE 3IURA 4PFKA 4DPMA 3L7KA 3R6DA 3BULA 4DZTA 1ZH6A 1JEDA 2PCLA 1Q57A 3IERA 5KTMA 1EFDN 5EWMB 3PXUA 4ENUA 3K72B 5IULC 1NC3A 5TARA 1L5YA 4MV9A 1JT9A 1Q0QA 3UN1A 2YWGA 1D03A 4J6FA 4JL8A 3BXEA 1DIAA 1Y3HA 3PRYA 3W9SA 1KBZA 1W0CA 3OA0A 1RXYA 1CBUA 3A9WA 2CNOA 3R3ZA 1A5TA 2YXNA 3HVIA 5LZ8A 2GN1A 4W7IA 3OZGA 2GJSA 4C4AA 1GLGA 4U2GA 3EYAA 4ZI5A 2B5VA 4F86A 4BKMA 1W49A 1EFRA 5GGYA 4DJEC 5JFGA 4QPZA 1Z82A 4YCAA 2G4VA 2PY6A 1LLUA 2BKUA 4H7EA 4DQDA 3HSKA 5CDFE 1V1RA 1N9KA 3CV3A 2HA6A 2FH5B 3JYLA 4X7MA 2F9LA 4V02A 1C80A 1U6JA 1UOEA 1J2RA 1IN7A 2YZ7A 2C2HA 4INJA 4MS3B 2PNJA 3AUFA 3RS4A 3WYCA 4DNXA 4F5ZA 4B1FA 4V1CA 3KQLA 1W0KD 1GSHA 3CO0S 2Q0XA 4QREA 3ZW8A 2ZAYA 3ZZ0A 3ZQKA 4LI3X 4HVLA 2ZIAA 3G3EA 5ALIA 3U7QA 3TL2A 1E2QA 1DSSG 1L1QA 1Q1NA 1ZNXA 4IY1A 1DTWB 5ITSA 4NS1A 3CZPA 4PPFA 3RAJA 3R75A 1E18A 3C7KA 1RM4A 3HEBA 2DYKA 5DI3B 4B6OA 2VUUA 3EASA 4KG7A 4EW1A 4CEIA 3FFWA 3OFSA 1FFGA 1J8QA 2WPDA 1E2JA 1YE5A 5L40A 2BE7A 1TQ2A 1AF4A 3EQ9A 3O8LA 3MJFA 2VEOA 3QVLA 4G1UC 3L5KA 5ALUA 2KLHA 3D0RA 2V6JA 2VPZA 5E9QA 4ZI7F 3KSBC 3FN4A 4KN6A 2Y27A 1JDSA 4HRAA 2O3RA 1S2LA 1VP9A 5EGNA 4MI1A 3FWPA 2H1CA 3HKCA 3MAGA 3VSAA 4KR7A 1J07A 3BMQA 1G38A 2NYAA 3BGIA 1EWQA 3NCTA 4H3VA 1EUQA 2ZB2A 5EJIA 2PV0A 2ZZKA 3ELUA 4BBZA 3VAZA 2QIOA 3PSHA 3S0JA 2Z5GA 3JQPA 3QU2A 5KWEA 2WMDA 1FYVA 1ZCBA 4RIFA 5CXXA 3HKBA 4AU1A 1XNQB 3ROQA 4NJMB 4B0OA 1GUDA 1US8B 5EJ5A 5JASA 1X7ZA 4KE8A 1ZD9A 2XEXA 1XEAA 1EM8B 1YB2A 3WWYA 2V9ZA 2JJ1D 4I9FA 4ZAZA 2VBFA 1OXUA 2OR3A 1LTQA 3IA2A 2QRKA 4QBFA 1BWQA 4Q7LA 4N8SA 1M9NA 1TTQB 4LZZA 1BOOA 1ADFA 2MT9A 3SE7A 1U0BB 2I2CA 4NS4A 3PQCA 4R1NA 4R8SA 2JAQA 5ITZA 5J58A 1KAGA 1U2QA 1VLLA 2BJHA 3M3DA 4Q4AB 1F1BA 5JH7F 3RC9A 3DDHA 1G8KA 3INTA 5B3KA 4RETA 2F9FA 4O5AA 3NM5A 2OCXA 5EYPB 1I8TA 3I32A 1W96A 2FEOA 2BGMA 3GWGA 3NPMA 4DM7A 4IIHA 3B13B 5CURA 3VZDA 3SYKA 5ALPA 1UXKA 4C4XA 5IFKA 3DHNA 1YB5A 4FFOA 1D4FA 4EBFA 1A7JA 1XT6A 2CVOA 2PUCA 2W9XA 2ZDGA 5FNVB 1QG6A 4K9SA 4D79A 5AD1A 4K0RA 5EJ4A 3VFDA 4XCQA 3A27A 2RGXA 4TV8F 4EFMA 1P45A 4KBYA 3KKEA 4PZ0A 5EHNA 1ZD4A 1KWKA 4YHHB 2F43B 4EJFA 1WY7A 4B32A 4EZBA 1NSFA 5EIEA 4IINA 1Y34E 3O84A 1SGWA 2PTHA 1TC1A 2NTVA 2Z3VA 5HM8A 1J1UA 5C1PA 4LJ6A 2IU3A 3UUWA 3DZGA 4DG8A 1I6LA 4HZGA 1QP0A 4UAJA 3P0EA 2ZZNA 1Z6YA 4B43A 3L46A 3H5RA 3QVVA 3RE1A 3T3EA 3U13A 3HA5A 3MRSA 1UEXC 3EGDB 5FJJA 2CCKA 4FQ8A 4PQFA 2JCSA 3QFCA 5CX1A 3HA2A 1KOLA 4U0KA 1IM8A 2C5EA 4YWHA 3PNOA 2DFLA 4Q9LA 3W8DA 2N1MA 2RAUA 2I2AA 3ICOA 3PPWA 4GX5A 1B0ZA 2LNDA 1EFHA 3U3KA 2ZYIA 2VDMB 5DHQA 2CMFA 3AVQA 4PO3X 1M76A 4Q3EA 5AI5A 4AIRA 8ADHA 2ZBFA 3FKSD 2AYYA 3OTHA 3C39A 1PX0A 2I6GA 3TQFA 3QKUA 4KDFA 1EK6A 3F9RA 4P32A 4S2EA 1URPA 3CRNA 4YJGA 3ZWMA 1DRKA 2HB6A 3D6AA 4URUR 3SC4A 3WNQA 4GU5A 2PX8A 4C6TB 1SRQA 2JHGA 4WNYA 3CNQS 5AHRA 1R0BA 1UP4A 3ZTYA 2JRCA 1ECJA 2YV2A 3FYUA 2ZI3A 3D64A 3X1KA 1IY0A 2J0VA 3ORRA 3MCWA 4JSRA 1MH9A 2PRKA 8MHTA 2WYUA 1K7XB 3EYWA 4DUPA 4XEHA 1J49A 3ZY4A 4Q0MA 1ZJ4A 5A3JA 1YQQA 1IBCA 5K05A 5A04A 2YRXA 4UQPA 5B7PA 3DBLA 1XZEA 1FP4A 4RYLA 4XJSA 1DTEA 1UC5B 2HOQA 5CR9A 5CJJA 1FFBA 3KUXA 5LA6F 3VX3A 3E8MA 1GSIA 2OGWA 3KJQA 3LNTA 4TL9A 1AGRA 2HQBA 3QRWA 4KPFC 3TTTA 1HSOA 3EISA 3QI7A 2O7SA 5HEKA 5ICCA 3HWRA 1BOFA 2ZWAA 3KX2A 4EYSA 4TMTA 4ND2A 2JA2A 2OC4A 4J0HA 4ZYVA 2HJSA 1E3WB 3C2QA 2VXYA 3A9UA 4BRZA 5I45A 1IWOA 3T5DA 4O2BA 1G5QA 5CP8A 1W85A 2AZXA 2D2FA 4KXNA 4TLCA 3U1TA 4QQKA 3EG9A 3G2MA 1CLEA 4CIXA 1YR7A 7REQB 5KNDD 4B3XA 1B6SA 1HDGO 1BE1A 1R5OA 1XMQB 1BCRA 1PFKA 4RV4A 3WI7A 1E8DA 1DDOA 7GPBA 3KYBA 1A50B 5EIHA 1YJCA 3CIFA 5EE0A 3ICCA 1IZ7A 1N3LA 2LR0A 2TYSB 3NFRA 4QE3A 4LZNA 4XIYA 5MGNA 5ES3A 5LM3A 1UC8A 3TQTA 4UUMA 3GAAA 2RHDA 4FWIB 4J7XA 4TVOA 3ENVA 3ZGOA 5JSYA 2H1FA 2Y99A 4CL0A 2XCQA 1I3MA 3QBEA 4GIBA 4EF6A 3KDSE 3T15A 3JV7A 3WAJA 2JGLA 1XQ1A 2E82A 5FTMA 2CFCA 1MQSA 4MLCA 3FZQA 3BD7A 3L04A 2GEJA 5FADA 3CLRC 1J8MF 1R9MA 5CB4B 1IYZA 3IUSA 5I7VA 3PYMA 3JWIA 2NO4A 5T4BA 1XFAA 4MWOA 1IJKA 1C7JA 2AEEA 4J03A 4N8EA 2NO5A 2ODNA 2J6IA 4JVSB 4MVJF 3IQXA 4OJMX 3D4IA 5AJTA 5DCYA 4J8PA 4ZYWA 1H1TA 1O1YA 2GBPA 3WV5A 4A6DA 2CXNA 4C7MA 3I2FA 4HJRA 2H3EA 5FOWA 3RVJA 3AYZB 4BX2A 1NOJA 2RKOA 4UQOA 3S68A 4EBBA 4DJTA 2BN4A 3BDAA 3N7UA 4FM9A 1ZVMA 1IHUA 1NMEA 3C6YA 2LW7A 2GN6A 3CZ5A 1A76A 2ECPA 3FWHA 2KYRA 3KXDA 3L8ZA 3MCTA 3W2TA 2PO7A 3LKDA 1BX3A 4L85A 4LY3A 5C8YA 9LDBA 3HWWA 1JG7A 5E1BA 5KYXA 3ZHOA 2ZK7A 3KV1A 2BGNA 1ZVKA 2Z5VA 3HYNA 3JQDA 3TKAA 1F0NA 4BLOA 4DLUA 2J8ZA 4LV5B 1G59A 2CVZA 1F5SA 4PTLA 5IXYA 2HZ7A 1QFJA 2PD3A 3DVQX 1Z6TA 2WTEA 4IGEA 5DLEA 4HF7A 4KWCA 5LIRA 4KFCA 4ZDIA 3TW8B 1UKEA 1FE8A 5FBLB 1OJLA 1DG1G 1VYTA 2ATIA 2DQSA 2WHYA 1SJ9A 5DF1A 3VV2A 3PEFA 4ZOQI 2PE5A 1U80A 5GJBA 4EO4A 1JU9A 2FFHA 4CKZA 2W8BA 5EI5A 1SC1A 3OPVA 1W75A 1GKIA 1PL7A 1EBBA 4RFSA 1XDDA 4MTLA 2JAUA 2PXXA 4FFSA 3CZAA 5AJXA 1AZWA 4C0QC 1S2IA 4P4SA 5HE9A 1KS2A 2BGKA 3K4HA 5A2GA 5KYYB 3ASVA 4R6WA 2C92A 3I04M 2VC2B 1HZZC 2QROA 1KJ8A 3CUEF 4O4IA 4Q24A 4YP0A 3RS0A 3QEJA 1GCAA 4TLLB 3TXYA 3VPBA 2IS4A 4ZAVA 1A77A 3GNSA 2O8DB 3PNVA 3ECAA 2WJAA 3N0WA 2DEUA 4E22A 1IM5A 1JG3A 3QUTA 4LJKA 3IA7A 1UEIA 1Z12A 4IGIA 3G0OA 5FFMA 1CRLA 1E60A 4QGGA 5JPIA 2JHAA 5BN3A 1HYHA 4CKCA 1Y1PA 2F4NA 2J0UB 4PQRA 4WXRA 4LQDA 4BLWA 3U5TA 4N3CA 1FCJA 2PJZA 2PLAA 3KLPX 3RYHB 4BX3A 4ZQIA 1KTVA 2B6NA 1ST3A 1PF7E 2RI0A 2QRPA 4KQKA 4Q4HB 5KO2A 5T7BA 3K9BA 4HAZA 2CLFB 1SOWA 4I5EA 3CNEA 4S35A 4XIFA 3UWMA 1EZ1A 3CKMA 2WFLB 4CT5A 5CDHA 3FYDA 2WU1A 1QWOA 2O52A 1MJGM 3C3KA 3VKUA 2DTDA 1Y8AA 2J30A 3AWIA 1MIHA 5EMJA 5BR4A 1L7MA 1ML3A 1NVDA 3VR6H 2XYGA 1E7RA 1W0KA 4YAUA 2FFJA 4O3FA 3WFJA 2NSDA 3RU3A 4LJ5A 2W2MA 3DD5A 4KODA 5M3BA 2GF2A 2ORED 2GPTA 3F5QA 4IYJA 1IZYA 1CR2A 2E18A 4HY3A 1WP4A 5LB2A 4N41A 4A2QA 4EHDA 3AVOA 1QHNA 2OXCA 4HB0A 3VR4H 3JVEA 5CFLA 4D42A 2HR1A 1ADGA 4OQXA 5DYGA 5A4KA 3ZBQA 4UTPA 2MTBA 3ABZA 3CH6A 2ASVA 1NNLA 5C81A 4RWZA 4LSZA 3WXBA 4U2DA 2DMRA 3V9AA 3GLHB 4DA8A 2NUAA 2NXNA 3MCUA 2WYWA 4PTYA 2D59A 2QU8A 2R1VB 1PJ2A 4JNKA 4UQLA 4OMFG 2F1JA 3BG5A 5KNLA 1P4RA 2C5LA 3DV2A 2GI4A 3JQBA 4NENB 3W2FA 1J25A 3F6YA 4JVMA 4N18A 4INAA 5IZCC 1QIGA 1FNSA 4KX5A 2F64A 2ZUEA 2RC6A 1U2SA 5EA2A 1T5DX 1GTMA 1RADA 3KJZA 3IL2A 3L77A 3GYBA 3ER6A 3GAMA 1EUYA 3UC9A 5KOIA 4BQSA 2COKA 4CM8B 3M6XA 5AUQA 4CLDA 4CTOA 4X6XA 4HXYA 3N2IA 1Y6QA 3PUVA 3W3ZB 3G2NA 2JFNA 3OZTA 3GGGA 4ER5A 5B4VA 3C6ZA 3G8AA 5CD1A 5EE5B 3HKEA 3B8EA 3K7EA 5ENVA 3HJFA 4A36A 2PLNA 1VLMA 3N75A 5HCNA 4E6EA 3JYPA 5DDIP 2G9NA 1HNXB 1RLMA 3JARB 2JJ1A 4HEJA 3ZU6A 4ZOCA 4F2DA 3JAMA 4PIPA 3EGEA 4IUBS 3CRVA 5J2UA 5I4IA 2JLZA 1MW8X 3DBHB 2I7VA 2CBXA 2EGGA 3V8EA 1LI7A 2QTRA 2XWSA 3FPEA 3JX9A 1Z36A 1F5NA 2GJ4A 1X7GA 1PZXA 3QP9A 2GCNA 1RZUA 4TL8A 3GB9A 5BV8A 4BQEA 3NHWA 3QF4B 1SVNA 4DANA 5EWJB 5HPYB 1N3BA 3AP3A 3LZ6A 2ZR7A 4B45A 2A1IA 3R3VA 2AZTA 3HACA 3A9SA 2PKYX 3G02A 3UICA 2M1ZA 1OILA 2EJCA 1LGYA 4F3YA 1I7QB 1Z47A 4L72A 2FG5A 2HLNA 2Z2XA 1YUBA 3IR7A 3RVKA 2AN9A 3FHLA 3GVHA 1JEYA 1LJLA 3OT4A 4FT2A 2JPDA 1GHTA 4RD6A 3H86A 3TQIA 1UPBA 3WKDA 1N32B 1FMJA 2DJIA 4XR9A 1T8YA 1UK7A 2AKAB 1SZPA 1MCZA 3LT5A 4CF7A 2PMFA 2FW7A 2QMOA 5JSZA 4IIVA 3WK4A 1C9EA 3WL7A 2IL1A 3LIIA 4BHTA 4G41A 3BSSA 4A8HA 4JBNA 3UXMA 8AT1A 5KMGA 1HYBA 2JGDA 4ZVSA 1L7VC 4PYKA 4JLDA 3BUSA 1DEHA 2IZ1A 1AUQA 1UBJS 1WY5A 3O4GA 4XDZA 5K5EA 1IQPA 4RADA 5CK4A 3GGSA 1XTQA 5AWFC 1G3QA 3QXSA 1I6KA 2WJJA 1UFKA 3OUZA 4KPGA 4PF1A 4TYPA 5HRUA 5AHKA 3EOBI 5IS2A 2R79A 3AVPA 5LXTF 4AJ2A 2PRIA 5ITWA 5DYNA 1ST2A 1U81A 3DBRA 1SD1A 2E4YA 2WIFA 3KKLA 3WDMA 2FW8A 5C35A 1DIRA 1EB8A 1F48A 1QANA 1LD3A 3C1AA 3FKSA 2BCJQ 1PJTA 3MFYA 4IDEA 4P2BA 2K4MA 5AQEA 4Q3DA 2IWHA 5KWVA 3WGOA 2NXEA 1B76A 2BMJA 4MNTA 3SLRA 3VDMA 1M2HA 3HYLA 1UP6A 4PVCA 3RVSA 5BV0A 5CLJA 4LN1A 3GLRA 4KXFB 3I9KA 2ZFUA 3Q9LA 1ZK4A 1G8YA 3PXDA 3TSYA 5TMBA 2WINI 1YS2X 3MQFA 2HA7A 3UMVA 5IVPA 1G5PA 2J46A 2GPYA 3EVNA 5TS2A 1IEVA 1Q20A 4REMA 5EERA 3TLYA 1SQGA 4CMBA 4YDRA 3F2IA 2ILTA 2Q29A 1TMYA 1EGAA 2QTCA 3PDHA 1T0HB 2JNWA 4V3BA 2IV7A 4BO2A 3AL2A 1OHHD 4ZQHA 5EXSA 1RABA 1VI6A 2P9BA 1X92A 3RRYA 1CP3A 3FOAA 2B4RO 3PCTA 4Q7MB 2FRDA 1NY6A 4H1TA 1KEEA 4KOAA 4MRSA 4NZZA 4IGAA 2FPLA 3ZW9A 3K16A 1NVBA 1TPZA 2IKQA 1P18A 1UBEA 2WDPA 3D6JA 1BU8A 1M5RA 1CEQA 2JI6A 3ZGXA 4G1BA 1DKQA 1JDJA 1N6LA 4MGIR 4Y9TA 2HXSA 4AW9A 5CHEA 3UGQA 4G0XA 3KRTA 4IM7A 4WOCA 1LLFA 2XBUA 5EIWA 1EDZA 4Z86A 1W46A 4UUAA 1QQ6A 2EKQA 1CUDA 2BHNA 1SZCA 3NT2A 2WYOA 1TO2E 3D54D 4JQOA 4BMSA 5KNDA 2YIVX 3CWCA 1JEJA 1JQAA 4QAQA 1PEDA 1ISHA 3EULA 2CFTA 1AOXA 3O2NA 2P9QA 3SGLA 1UDBA 1JFSA 3WLKX 1ZQ9A 2IYOA 2FR8C 3D7MA 3TMAA 3ZDRA 1JDVA 1W8DA 3JVDA 5ESXA 5EMMA 4UPEA 5BUSA 4NYJQ 4CQNA 3BMCB 1EUZA 3DV0A 3A06A 2WWWA 1W36C 5F4ZA 3BE4A 4WGFA 2Q3BA 1D2EA 1JB1A 1YBMA 4BNFA 5A9SA 3UJNA 5F78A 2JEOA 2TMDA 4FGLA 5IJ0A 5FF9A 5H5JA 1DMSA 3DLPX 2FEWB 3DCYA 1XDUA 2RGNA 5JBNA 2V5AA 3THYA 2QTFA 3W05A 3EDOA 4GLJA 3TG8A 6PFKA 3AUTA 4F3CA 2IEBA 2Y0CA 1KNXA 2ISCA 3UJ7A 4JP8A 4FK8A 2HU7A 1BE6A 3DAGA 3FHCB 4FFWA 3SPXA 4LS3A 3UG7A 2WOOA 3A4YA 3FF1A 1W73A 2E6UX 3LSTA 5K20A 3I1YA 3ZI0A 1T6BY 2DM6A 3KBOA 2IGTA 2C7RA 1RI3A 1EQ2A 4EMBA 4KFSA 3W1VA 1JIVA 3O3NB 3BCUA 1JG1A 3D02A 3ITDA 3NDBB 2OMEA 3UGKA 5IF3A 3H0EA 2ZETA 1ZSNA 3ZI4A 1RFGE 3T7IA 1NE7A 1J2TA 3QPCA 3MWEA 2ZB3A 4Q03A 4HB2A 1A5AB 1ARZA 4ZFNA 1FDOA 1JKJB 1HT3A 4LSGA 1NRXA 3PHCA 1EDEA 2FF5A 4JI3B 4LXTA 1WETA 4TUYA 1TF7A 4O0LA 1GGEA 1YD7A 1S0UA 3JW8A 3T7TA 1UWKA 3CCBA 4U6SA 4ASUD 2CDAA 1CY0A 1V8BA 3CA8A 1LNZA 1JKXA 3A9TA 3LV8A 3OUUA 2P7IA 4IHKA 5KYKA 4QX6A 2C78A 1CUCA 3OZRA 1QWSA 1BX0A 1CS4C 3FYUC 3KKMA 5IMSA 3LY8A 2KQUA 3GLIB 2ODBA 1H65A 4NCHA 1J6UA 2ZI9A 1ZNZA 4RNCA 1LFAA 1U9IA 5HGJA 3UFBA 4EL0A 3VXKA 5HXAA 2ZSDA 3NALA 5MN4A 1O4WA 3ZWVA 1JS1X 2AI3A 2JIQA 3HBFA 2IK8A 2ZITA 1NI3A 2A1UB 5IJXA 5FEUA 2OXRA 1SKBA 4R05A 1BMQA 5FI1B 4AN4A 3PDWA 3RS5A 4BNIA 3AFNA 3LPCA 1NAHA 3V00A 3THRA 1LSSA 1VI2A 1NHGA 3HJRA 2HF8A 5GP1A 3P0FA 2UVPB 4LZWA 2CC2A 2XVXA 3BM5A 1NXTA 3L4KA 2PGIA 1MG5A 2CLSA 3AC0A 1XMOB 1R8QA 1JPVA 1RQLA 3M3PA 1B4DA 1FBTA 3FJOA 4JLSA 1EBFA 1TGYA 3RAGA 4YMTA 5JSHA 3WGGA 2Y2UA 3RUEA 3CH4B 3JQEA 1FP6A 5KQRA 2MOKA 4O1HA 3VAYA 1PNRA 4J90A 1ESMA 1CC1S 1L4BA 3F5DA 4PBRA 1S01A 3HZHA 3DM9B 4PX2A 2VJKA 1EHCA 2BFDB 2JDID 3IAS1 2P8JA 3LM8A 4LIPD 2B35A 4CFZA 1T5BA 1NN0A 4KB5A 2D2IA 3AUXA 1XCGB 2PWBA 2FTKE 3B89A 3C5EA 4F56A 4J3NA 2HPHA 3S40A 3KR1A 3RRJA 4HDCA 1GPAA 5ALLA 5IXSA 1NVXQ 2OV3A 5FI3A 2C96A 5EESA 1FFYA 3SS7X 1ETHA 3FGZA 3G88A 1SIOA 5K3FB 1R0CA 3N3BC 5NLLA 2VJOA 2EKLA 2QK4A 3I37X 5DYTA 1K1EA 2OSVA 4EFKA 3OCCA 4YT5A 5BV7A 3V48A 4GGOA 5KQLA 1Y98A 5KWJA 4LDJA 4EEKA 3RD5A 5ED0A 4UBNA 4YAEA 4B80A 2FPWA 1Z2PX 4Z3DA 1P2FA 1WOMA 2NZ8A 1J39A 4A0SA 1EXNA 1XMIA 3NMUF 2FXVA 2YS7A 1KOGA 4DBLE 1C0PA 4DG9A 2LD4A 5FAXA 3CONA 4N54A 1D0IA 3EJWA 3RASA 2DFKB 4JYZA 4E07A 2F8SA 2QX7A 5CNMA 2Q4EA 3VC3A 4H77A 3S2ZA 4QDUA 4UDNA 2V0GA 3C4JA 5CLQA 1O8BA 5CYFA 2J3JA 4M6WA 2GPNA 2ZT8A 3MN1A 5EZ5A 4X9XA 3THXB 3NTOA 3OBBA 1OLXB 1IULA 1G98A 3EOZA 3WXMA 1N2GA 2VJQA 4WZAE 3CS3A 4GH5A 3ESBA 1S2OA 5BNWA 2VP6A 3SXJA 2A9FA 3UWDA 5GVSA 4BAZA 3L7NA 1HYGA 4EW3A 1BEUB 2J9XB 2QSJA 5K8JB 2I22A 4X7BA 2R66A 3V4OA 2CXTA 3IVCA 3RK0A 5CVTA 1POXA 1Q84A 1TUBB 4Q39A 5TQJA 5JNVA 3K4QA 4PPNA 4D9KA 1YZYA 3NH6A 2PS0A 3AJDA 3ZK9A 1XAIA 4IXNA 1M6YA 5K8LA 1ISJA 3LLSA 5IVKA 5C3MA 5FBKA 1NVVQ 1QQ7A 2ECOA 4D26A 4KK3A 4N49A 5AKXA 5U9CA 1IY1A 1O0SA 3AZOA 3SFVA 5KKAA 3UV6A 3VH4A 5C5CA 2VJLA 1D09A 2AC2A 3B36A 4JSTA 1PEYA 4FFRA 3ED5A 3RF6A 4EIWA 3LYAA 1ZD5A 1Y89A 2CB9A 4W9NC 4DKJA 4CU2A 4DCMA 4ITVA 4Y3UA 1OWOA 3ZGZA 3K94A 4WQMA 1PTKA 3BREA 4PLZA 3M8KA 4I4TA 3ZU5A 2POCA 1C81A 2YWEA 2OCAA 2QIPA 4I36A 2Q6OA 2GN0A 1RRMA 1YR6A 2H3HA 3A9CA 2H2DA 3B2EA 1E1QD 2O1XA 2X3UA 3H1PA 3PFIA 4KRYA 3DMFA 3REQA 1C3JA 4PEVA 5DJ5A 1OYOA 4ZV7A 4B17A 4ZIRB 4DSUA 4U39A 2I87A 3TUIC 4NBSA 3X44A 2HV9A 3E8XA 3TQSA 2O06A 2RHTA 3K0KA 1SUSA 2PZ8A 4HXGA 1UPUA 2EJWA 2Q2NA 2YUIA 3RUDA 2G25A 4Y2XA 1UPAA 5EJ6A 1E9EA 1IG3A 2WICA 5IDVA 3U62A 2AI2A 3E4DA 4RGBA 5D2CA 2CV1A 4OBWA 1Y4UA 1VBNA 2G63A 1KMHB 1GQSA 1ORDA 4DCTA 1NXOA 1VZ3A 2DWPA 1Y4AE 4TX1A 4FEGA 1E8NA 1EVLA 3BA1A 4FX5A 4MRPA 5HKLA 1DMRA 3R77A 1OE0A 3IUQA 2VHZA 1MNAA 4MWGA 1FJHA 1ND5A 4CQLA 3O90A 3HI6A 3I01M 5FUMA 1W29A 4NYMQ 4MUFA 4O4HA 3WWDA 1K0UA 3DHWC 4LVNA 4P0TA 1IHPA 3Q8LA 2MSCB 5LU9A 5EZ6B 4B2PA 4RTLA 1ICEA 4AY3A 1KKLA 1I4TD 4C3VA 3HP1A 3C6XA 4HR7A 5DK4A 1M34A 2V96A 1Y9DA 2ERYA 1B6TA 1I3OA 3IVMA 4LPKA 2L0XA 4F60A 4W5TA 1MEEA 3FCOA 2ZG6A 3L1KA 2V8BA 4BNXA 3T1YB 5HQJA 1SKMA 2AOWA 2PH7A 4PS1A 3J81k 3CVUA 1A88A 1SVSA 3ESXA 5TY0A 3V8BA 1OHHA 5A3RA 3O9VA 4P7BA 3X1YA 1F8UA 2P40A 1VLJA 5B3JA 1K5PA 2OCIA 2X4DA 2VSXA 3R4CA 3TLXA 2CNDA 1G0NA 3LUAA