4B8ZA

Crystal structure of human gdp-l-fucose synthase with bound nadp and gdp, rhombohedral crystal form
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
308
structure length
308
Chain Sequence
MRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-L-FUCOSE SYNTHASE
publication title Crystal Structure of Human Gdp-L-Fucose Synthase with Bound Nadp and Gdp, Rhombohedral Crystal Form
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 99
structure length 308
sequence length 308
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b8zA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4b8zA02
4NJMB 4XX0A 3DMYA 1ISMA 4CR7A 2HSDA 1HETA 1ENOA 4RF4A 4AJNA 3JD2A 1CRWG 5JO0A 2NVBA 4IDBA 3VPHA 3ZWMA 3DMTC 3F3SA 1PJ3A 3PEFA 5COBA 4IDEA 1ZH8A 4EGFA 1NP3A 2X9GA 1K5HA 2DFVA 1ISGA 4R3NA 3SJUA 3FBTA 4WCFB 3C3XA 3MZ0A 4CMAA 5B4TA 3T7EA 2PKQO 4MOWA 3BMCB 3BMOA 1E3WA 3GMSA 4Z3DA 5TRTA 1DC4A 1E3SA 1PJCA 3A9WA 3VZSA 1MP0A 4FN4A 1AHHA 1P44A 3OF2A 2W2KB 3ROPA 4KZPA 4UULA 1BXKA 2GERA 5A5FA 1PIWA 7ADHA 4PFJA 3INGA 2VHYA 2E37A 1KERA 1UZLA 1ADGA 4J90A 1OC2A 3ZWCA 3K96A 5AXAA 3BMCA 3OIGA 2PD3A 4AJOA 5AXDA 2QIOA 2YQ4A 4QECA 5CDSA 2P4HX 4X54A 3UAGA 3ANLA 2ZTLA 3GVIA 3KRTA 4KTVE 4OOFA 4CQMB 3LT0A 3DZIA 5F1KA 5L4SA 3ONDA 3DAPA 1X14A 3ORFA 1R4NB 4AJIA 3RD5A 4HY3A 3U0BA 2ZIZA 2NQTA 1NFQA 4ZQBA 3JQ9C 1M76A 1XGKA 1V3UA 2BI7A 1BXGB 4XRRA 4CMGA 2Q46A 2YFHA 4D43A 1K0UA 5JAIA 1FJHA 5T8KC 2WYWA 3DBHB 1CQJA 1K6XA 2NLOA 3PDUA 1V3VA 4KUHA 4GKVA 5F21A 1LRJA 2AEFA 4MKRA 4WCFC 4GLOA 4OOEA 3ZW8A 2CVZA 4OYRA 3TZCA 4RVUA 3WGGA 1PL8A 1O95A 2DBZA 1NAIA 1R0LA 3AW9A 3QVWA 4ZGWA 1DAPA 1GPJA 2G5CA 1HF3A 1PJBA 3ETDA 4F6CA 2Y1FA 3RASA 3D1LA 3AOEA 1U4OA 3FCOA 3NTRA 4D3SA 4FFOA 3V2GA 1PWXA 3WYEA 5JY6A 2HAEA 5KVCA 1PZFA 4RZHA 4AJ1A 1GEGA 4R5MA 4A10A 4BNWA 2I9PA 4R9RA 1MX3A 1R12A 4BMNA 3KSZO 4RPJA 1EVJA 4GLLA 2V6MA 5HS4A 2VZ0A 2B35A 2Y93A 4QQRA 4XEHA 4E2YA 5BR7A 1IB6A 3RVDA 1L1FA 4YAKA 3COSA 2EGHA 3CSDA 2EJWA 5ICMA 3VTFA 5BSFA 2J5KA 5CFZA 1LLUA 3FNHA 4E21A 1PR9A 4ALMA 4D46A 5CG1A 1GFSA 4K6FA 5ITWA 4E31A 3DBVO 1AXGA 3ST7A 1P1FA 3AJRA 3I6QA 1JQBA 1ZMOA 4CM8A 3DZHA 1NM5A 4HFJA 5C7OO 1U8XX 1NR7A 2WM3A 4P4LA 4FGWA 4JX8A 1I2BA 3UW3A 4N18A 3ZV5A 3DBRA 3HNPA 4QSMA 1WNTA 5A9RA 2I6TA 3DAFA 2Q1WA 4JN6B 4QUKA 4XQGA 1B8UA 1C0PA 1T2DA 5JYDA 1KVRA 2OFPA 4GVXA 5JPIA 3OFSA 5H82A 1IUKA 2DPGA 4YQYA 3W8FA 1C14A 2UDPA 1ZK4A 2Y1CA 3JQEA 2I67A 1ZEMA 3T4XA 1K3TA 4E5MA 5BNIA 3K2EA 1IULA 4I5DA 4CM5A 1UR5A 5A3JA 5DCWA 2Y1DA 3WXBA 1Y9EA 2D3TA 2EEZA 1GYPA 3PJDA 2D5AA 2VN8A 4TKMA 3GNTA 4XR9A 4JBIA 5KJCA 1CDOA 4JCOA 1AN9A 1LLQA 1V9LA 3BTUA 4BMVA 5IZCA 1BG6A 2O3UA 4QFCA 2PNFA 1Y8RA 1DLJA 4O0LA 4KUEA 1E6UA 3CIFA 1BSVA 1E1MA 3NUGA 5CHEA 1R15A 1WZEA 1E3JA 3OQBA 2CY0A 4PVCA 5A4DA 3E9MA 3GVCA 3OETA 5GZ3A 2NTNA 1DFIA 3NV9A 1XU9A 1P0CA 3BTOA 3KYCB 4I9HA 4WGGA 2BD0A 4DGSA 4ND2A 4XGIA 2X9VA 5LCXA 4W9NA 4Q3CA 4PG8A 1LX6A 1ISHA 1A71A 4NJOA 1F14A 1B14A 3RAJA 4BO1A 2GRAA 1GUFA 1PX0A 4R1TA 2O3TA 3WIDA 4M49A 3ZWYA 1CEQA 3I9KA 4J2OA 1SAYA 1SBYA 1P74A 3ETEA 3BMNA 5CPFA 2NNLD 1HE4A 5DZSA 5KWEA 4AJJA 1H93A 1DB3A 3OH8A 1MG5A 4XYLA 4BMSA 5F3RA 1WP4A 4FJ2A 2JAPA 1P77A 3D3WA 4Z0HO 3IS3A 1Y7TA 3H5NA 1MGOA 3GG2A 5FEUA 3EZYA 4B7CA 1EUZA 2AA3A 3WG9A 3QWBA 5HS6A 2NU9A 4IZHA 2HMTA 4LK3A 3KSUA 3VDQA 4DREA 2PFGA 4Y9DA 8ADHA 3GZNA 4J3FA 1FDTA 1RYEA 4WASA 1NWCA 4XQCA 3PZRA 3RC1A 3RKRA 4Z9XA 4BNTA 3WGQA 1UDCA 4P8RA 3TWOA 4RO0A 1EE2A 1FDSA 2NU8A 4NMHA 1PGOA 1TXGA 3OQ6A 4LSWA 3OEYA 3VKUA 5A9SB 2RCYA 1XA0A 2CSUA 4RLSA 2Q4BA 3DZKA 2UYYA 4I1IA 3ZHXA 4R1NA 3OM9A 4AJLA 4ZHSA 2NVUB 2Q99A 2PZMA 1SOVA 1DLIA 4NI5A 1P1HA 5JC1A 1Y5MA 1EVIA 2E4AA 2Y1EA 2PR2A 5C7LO 1S6YA 4R69A 2AQ8A 1LC0A 1MFZA 1DJQA 3WGZA 4JBGA 1QYWA 3NT4A 3LYLA 2O50A 1QKIA 4BL5A 4I5EA 5MGBA 1KVUA 1GCUA 1R37A 2GUGA 3GLQA 4OHUA 4RVFA 3B1KA 2J6IA 3VPFA 4J16A 1YBAA 1W73A 4L8VA 4AICA 3TN7A 4Q3BA 3H2ZA 1NASA 5ER6A 3AY7A 3I9LA 1HYHA 2UAGA 4XB2A 3DZBA 5LC1A 2CZCA 2VT2A 5A06A 1ZW1A 3ZV6A 4RJTA 2PGDA 2V6FA 3JQ8B 5HM8A 3ANNA 4L75A 2PGJA 3WIEA 5IN5A 4AJHA 1E3LA 1O94A 1VSVA 1X1TA 2HMSA 5G0TA 3E18A 4Y6SA 3A28A 1T2CA 5KJ6A 5A05A 1BXZA 1SC6A 1LUAA 4W4TA 4XGNA 2YDYA 4BKQA 4DPMA 4QO8A 4W7IA 2WD7B 3WJAA 3DDNA 3KETA 3ZDFA 1AHIA 4YRBA 1UUFA 2FPGA 3NEPX 1ZCJA 1E7SA 5AVOA 3RUCA 1B26A 4MVJM 1WMBA 3L0DA 4AJ2A 1U7HA 1T4DA 1NX6A 1SB8A 2CDBA 3HJAA 2X1HA 4NFYA 4WCDA 2ILTA 2GDZA 2JAHA 1P9LA 2OP1A 1NXQA 1WDLA 3PYXA 3LT1A 1BMDA 2G1UA 3OA0A 3TNLA 2P4QA 2VRBA 4GWKA 3C8MA 2Z95A 2G17A 3NJ4A 4YQZA 4CLOB 5ES3A 4A5OA 2R00A 4AJ4A 3BHIA 1KETA 4CLXA 1C3VA 4PRKA 2EP7A 4FIZA 1I3NA 2YJZA 3RU7A 1I8TA 2CF6A 3H8VA 4OXYA 1LU9A 2O4CA 3IUSA 4YJFA 1HDCA 2E49A 2ZB7A 4CQLA 5JCXA 4NBTA 4XQEA 4EITA 1NAHA 4YJHB 4EJ0A 5JMWA 3CPSA 1Q7GA 5CEJA 5L7YA 2HRZA 3S8MA 4Q3AA 3GHHA 3Q9NA 3SLGA 4DUPA 3FI9A 4E12A 1NWHA 2CVQA 2Y05A 3EUWA 3PJEA 1UXGA 3RKUA 3QRWA 4CL8A 3VOSA 1BVUA 4MDHA 3DBLB 5IAAA 4RZIA 8LDHA 3ZZNA 4BNVA 2CNBA 3JTMA 1QSGA 4D42A 2X5JO 3H3FA 1LXCA 5L4LA 1DFGA 1V0JA 2A9FA 1QMGA 2D0IA 4P4GA 4W82A 5KTKA 1QRRA 1KVTA 1WMAA 3WGHA 2JKVA 3E9QA 3HZZA 3PYLA 2ZCVA 4LRSB 2R2GA 3JYPA 1J0XO 4WUVA 3QWIA 9LDBA 4MVJA 5I9MA 3H5AA 4PZCA 1M2WA 2HCTA 2V7PA 3K92A 3U62A 1PL7A 1DDOA 1E3IA 1DC6A 3NTQA 3QWFA 4U5QA 4WOJA 2AHRA 2IZ0A 2WMDA 3GFGA 5DDIP 1Z82A 4I5FA 4L4SA 2C7GA 5BNTA 2X0RA 3RFXA 4OIMA 2P5UA 3G79A 4BNIA 1E0DA 5EERA 1E1LA 2DAPA 1MC5A 1Z7BA 3N74A 1B8VA 1N1EA 1QP8A 2FZEA 5T57A 1Q7CA 1DHTA 4IDCA 4GWGA 4M8SA 2ZB8A 1ZMTA 4CM9A 2XOXA 4CV2A 3RUEA 3E6AA 5TGDA 2Y66A 2V6GA 5DULA 1SMKA 2FR8A 3H9EO 3QWHA 2J5QA 2DFDA 4R1UA 4E30A 4UVDA 5G4KA 3GVPA 1E92A 2Y99A 4A2CA 4U6QA 3P7MA 1Y8QB 3HG7A 1SNYA 5B4UA 3A1NA 3MJTA 4RVGA 1H6CA 4WLEA 3GMDA 3OQ1A 4BNUA 2I66A 5L7TA 1QYDA 4XKJA 3TOXA 3M2TA 5L9AA 1UZNA 2X58A 4EUFA 1GTMA 2YFQA 2VYVA 3PPIA 1E7YA 5IFLA 3EYWA 4UVGA 1EDZA 1TA4A 4K1LA 3AWDA 2B5VA 1P1KA 4ZQGA 3WGIA 5JDIC 2AMFA 2WYUA 2ZTUA 2XAAA 2QHXA 5TT0A 1Y8QA 3F4BA 2C2XA 3CTMA 2NTJA 1ZSVA 3G1TA 3DZJA 5K6AA 3FWZA 5JXWA 1XG5A 4E0BA 1GPDG 3O26A 4B8WA 1K2WA 4JJIA 4ND4A 1YB1A 1ENPA 4MVJD 3KB6A 4XRGA 1ULSA 3CKYA 3PQEA 5IJZA 5T67A 3AI3A 1YWGO 2YHIB 1X0XA 2BGLA 2D4AA 2DC1A 3PWKA 6ADHA 1F8FA 4FSHA 3K9QO 1Q0LA 2VWQA 1O6ZA 1UP4A 5KOIA 3TRIA 1YKFA 1JKFA 4U6SA 1YJQA 3DAGA 3KLPX 1X1EA 5JCJA 3C1AA 3BIOA 3LLSA 4G5HA 1C1XB 3OJ0A 5AXCA 1SEVA 5LDHA 4P4NA 4NG5A 2QZ9A 1Y1PA 3OJLA 4RF5A 1PS8A 4PCVA 4TRMA 3EW7A 1Q1NA 4AFNA 3O8QB 4IQ0A 4BNHA 1E7MA 3H6KA 3MJVA 2XXBA 4PIVA 1I32A 1U3UA 2E6UX 2EGGA 2Y1GA 1N9GA 1Y81A 1VLLA 3JSAA 4JROA 3SBOA 4EEZA 4ZRNA 4BNJA 5C37A 3P2OA 1QXSA 4H3VA 3GZ4A 4MIEA 3HDYA 3DHNA 2ZB4A 5ADHA 2VYVD 3VH2A 5HTOA 4UEKA 1HE3A 3WQSB 3VH1A 4JP3A 5KNLA 3AK4A 1GY8A 4E6PA 4CLRB 3EY4A 1YQDA 1A9YA 2O2SA 2Q2VA 2OBNA 2C29D 4YCAA 3PFFA 2HQ1A 3RWBA 1SEPA 3W8EA 1HWYA 4CJXA 5ILGA 4MVJH 2AE1A 2F1KA 3GRKA 1K6IA 2CDAA 4N7RA 3B1JA 3SLKA 3CXRA 4HFRA 4XA8A 3ABIA 2VZ9A 1N7GA 5L45A 3OHSX 2IXBA 3LF1A 4CMEA 1YOVB 3DL2A 1KY5A 4UUPA 2A35A 1KY4A 2OGUA 1PGPA 1I3LA 2I3GA 2JFHA 3RU9A 4BKPA 4H16A 1I36A 3S1LA 1HSZA 3I9JA 2WD8A 2DM6A 3GR6A 3IOYA 4NBVA 1ADBA 1SO8A 5TNXA 2YY7A 2GCGA 5JCJD 4DL9A 3K30A 3WMWA 3G17A 4NPCA 3PZBA 1MXHA 4GBJA 3TZ6A 3E5MA 2AXQA 4BO9A 1NHGA 2C7VA 4C7JA 4CMCA 4JJFA 5G2OA 5ITVA 2F00A 1ENYA 2A92A 4GX0A 4GX2A 4Z3KA 3TFQA 5U9CA 4R41A 1UXJA 2Z5LA 1VPDA 3B20A 3JYLA 1U3VA 4YT5A 5K0ZA 1LBEA 2NM0A 2PLAA 3GT0A 1IYZA 3WICA 1WDMA 3JQBA 3BMOB 3ON5A 1E3WB 3I52A 3O03A 4BKOA 5JBIA 2C82A 3ZWPA 4QFDA 3BYZA 1NHWA 3LDHA 1NPYA 3G1UA 3I23A 3HWRA 3CUKA 3O38A 2GLXA 3AUUA 2G0TA 4KWHA 5F5LA 5A3VA 3JD3A 3STHA 2AW5A 2WSBA 4FJ0A 1UXHA 1A5ZA 1T24A 1W8DA 3JQ7A 3JYNA 5KVQA 4B4UA 1FF9A 1LLDA 2G76A 4MO2A 3TL3A 5COAA 2Y68A 1WPQA 4ZA2A 4DYDA 3DOJA 2I5PO 4MINA 3JQFC 5JDCA 1LRLA 1Q0HA 1YH3A 4OH1A 3B70A 2DBQA 5T5QA 1PSDA 1JWBB 2B4TO 4YTEA 2BELA 1LQTA 4IINA 3Q2IA 1M67A 3U4IA 2WJPA 1LSJA 4PGFA 1PZHA 4E2ZA 3ZU5A 4M86A 2GN6A 3L4BA 4I08A 2W4QA 4R9SA 3ZWAA 4BNZA 4F45A 5L53A 5ICSA 2H63A 4OKNA 3M1LA 2X0IA 3U9LA 3E5RA 3WFJA 3N58A 4YYZA 3E03A 1PJ4A 5JW6A 4IQ8A 1C1DA 1UXIA 2AE2A 2BGKA 3E48A 2D5CA 3DOOA 3NJ8A 3KYBA 2Q4EA 1V6AA 2VZ8A 4L9RA 3ZHZA 1OZAA 2W90A 3GPDG 4I9NA 4WLNA 1TB4A 1EK6A 4YRAA 4XGKA 4EDFA 4L76A 4N5NA 3U5TA 2FMUA 1I2CA 1QYVA 3L4SO 1O5IA 5HBRA 3C1TA 1HTBA 4RDIA 4EZBA 4YVFA 1XIVA 5DOVA 1YB4A 4PZEA 4NH4A 4BKUA 5DN9A 3DWFA 4BQPA 1CERA 1LSSA 1G0NA 4FS3A 1QV6A 4FJ1A 5JS6A 1N7HA 4FFLA 4DIBA 3ZH2A 2NV6A 4MVJP 1PU2A 3GF4A 2LDXA 4E33A 1Q0QA 1GYRA 3VPSA 1HLPA 4WECA 4P22A 3D5QA 1N1GA 1E7RA 4Y8VA 4KP7A 4W7HA 1I3MA 4YAIA 1LJ8A 4YT8A 3UUWA 3ZNQA 3HN2A 3KM0A 4J7UA 4D41A 3LT2A 1NVTA 3WSWA 4BNNA 4CPDA 1ML3A 1FDVA 3IDSA 3L6DA 4BO4A 3RBZA 1DIHA 2ZTMA 3QWAA 2VHZA 4INAA 4YAJA 3EK2A 1HZJA 2P9CA 1M75A 3PQDA 4O1MA 3HB5X 4NIMA 1LDBA 1ZBQA 5FWNA 3EAGA 4CM8B 3Q2KA 2WWRA 4HNHA 5EQFA 3VH3A 2UV8A 3LU1A 5TS3A 1YL7A 2HMVA 2ZYGA 3C7AA 3DBRB 4BGVA 4BNFA 1D1SA 1YS4A 5EN4A 2HK8A 1OFGA 1VI2A 1LTHR 3AFNA 4B8ZA 3D3EA 3AOEC 4EJ6A 4GH5A 4Z9YA 3LVFO 3S2FA 2XXJA 2YV1A 5DP2A 3ROQA 4B79A 1U1IA 1CF2O 4PG6A 4ROSA 3LC1O 1JU9A 3S55A 3GDGA 4IGFA 2J3JA 4JP2A 1AE1A 1T2FA 1BTOA 3ZWWA 2CVOA 2GR9A 3ICCA 3U3XA 1JLLA 4YXFA 1LDMA 2VHVA 2PH3A 2AEMA 4TROA 4CLHA 1NPTO 3MTGA 3RUDA 4B3HA 3GPIA 4CM1A 3WGTA 1EBUA 5CP8A 2P9EA 2IRWA 2Y0CA 3RC7A 1ULUA 5JMPA 5IXSA 3C7CB 3KHUA 1BRMA 5ENDA 3RUFA 1ZSYA 1XELA 3KO8A 5DBGA 3ZCXA 3CMMA 1HDYA 1Y8RB 3ANMA 3JYOA 4YPOA 1U28A 4ZVVA 1YL6A 1IPFA 4B4WA 3FPCA 3JQGA 1CJCA 3KEOA 1AGNA 4MVJI 2GN8A 4IPTA 4JNKA 5DT9A 3DQPA 3RUIA 1JWAB 2D8AA 2JCVA 4U7WA 2VQ3A 3RI3A 4PZDA 4QX6A 1A27A 1B8PA 5I7EA 1HSOA 5CDTA 1H6AA 3D5TA 5A02A 5H83A 1KVSA 3WTBA 4YT2A 4FBGA 1RM3A 4DLLA 1U3TA 3BMQA 5U1PA 1K6JA 4DXHA 3Q3CA 1J49A 3HDHA 3VAZA 5EINA 1GL3A 1CYDA 3AUTA 1MLDA 2XF8A 3BMNB 1VKNA 4XYBA 3VZPA 3VKVA 3WNQA 4RCVA 1ENZA 3EGOA 1NNUA 1RM5A 3H7AA 3I9NA 2VYND 4M1QA 4XD2A 2OO5A 3FNEA 1GUZA 4NK4A 3D3WB 2PY6A 4J7XA 1PJTA 1QV7A 3TFOA 4KOAA 4BV8A 1D4FA 4S1VA 5GY7A 4CUKA 3CH6A 1SOWA 2AQIA 4WEOA 1EQUA 3ZN2A 4G81A 1EK5A 2H9IA 1WVGA 2RBEA 3RROA 5IZCC 5JFOA 3SC6A 4PLHA 3RFVA 3VDRA 2BFPA 1EUCA 3V2UA 3GZNB 3RC2A 3UF0A 4CLEA 2PK3A 4Y6RA 2I76A 4YB8A 2EIHA 4XQ9A 2BRUA 1QLJA 1YBMA 4GSLA 3ZWOA 4RF3A 2GSDA 4LVCA 3GC6A 1YQGA 5KJEA 1IPEA 3HFSA 3S2IA 3Q9UA 4Z0PA 1UP6A 2QYTA 2X5KO 3INTA 1LQUA 4TRRA 3U4DA 1HXHA 2DPHA 4RVSA 4W9NC 4F6LA 1L7EA 2PV7A 3DFUA 4XDYA 1YDWA 4DQUA 1H94A 4WNCA 4J1NA 5IF3A 4UEOA 2ET6A 1GD1O 4IMPA 2EKQA 1RM0A 3LF2A 2Q45A 3ITDA 1BHSA 4OGWA 5T64A 2X23A 3KYDA 4E2XA 1DIBA 4J49A 4BVAA 4DIFA 3AU9A 2B5WA 3IL2A 5B4VA 4JIGA 2Q49A 3RCBA 3VTZA 3PP8A 4KDEA 5DBIA 4KDFA 1O0SA 1GQQA 2ZCUA 5TT1A 3WX0A 2O3RA 1B3BA 4HKTA 4MJLA 5JE8A 3RFTA 4DC1A 2GF2A 4E32A 3AM3A 3OJEA 2NU6A 4FFMA 2IZZA 2SCUA 4IJWA 3V1YA 5JSFA 2PD6A 3VVBA 3G3EA 2JD1A 1VM6A 3QSGA 4FC6A 1UXKA 1XLTA 3PLNA 3L9WA 3WWYA 3ULKA 2GZ3A 1DAOA 4IBOA 4TSKA 4KQXA 4XIYA 1XCBA 3DHYA 2BH9A 1KOLA 3TZKA 1TT7A 2QW8A 1Z73A 4H7PA 1E6EA 4BNYA 2Y1OA 2EKPA 4RVDA 4IJKA 2YZ7A 1GADO 1GU7A 5ER9A 5AQ1A 3HDQA 3NDIA 3DO5A 2FY8A 2RAFA 1YBVA 5TF4A 3WJ7A 3ZNNA 4QT0A 1PZGA 2B37A 2TMGA 1DPGA 1IE3A 1XDWA 5J23A 4DMLA 3QA9A 5BT9A 1J6UA 4O63O 4GPD1 1KBZA 5CDUA 3ZNOA 1MC4A 1EQ2A 1DC5A 4UVEA 4XR4A 4BNMA 4L4XA 3R6DA 4B7UA 3GY0A 1GR0A 1VJTA 1I2ZA 1PEDA 1GAEO 3VPGA 4FFRA 1LEHA 2JJYA 1C0LA 4YJFB 1TT5A 5DOZA 1N8KA 1ZK0A 2BFOA 1Y9AA 3FNFA 3GOHA 4J0EA 2YV3A 4CQLB 2RHRA 4WLFA 4RLHA 1ZZEA 4RORA 3OA2A 4IY1A 4Z0TA 4HUJA 3UCFA 2PZLA 4GX5A 3FPLA 3EC7A 5GMOA 2OOSA 3ZGYA 1EVZA 2WEKA 4YR9A 4O6VA 3WFIA 2X22A 4DPLA 3GAFA 1D3AA 1IHYA 3WMXA 3X2EA 1HEUA 1QYXA 4E5NA 3KBOA 1D1TA 2CDCA 3LK7A 4LVUA 3A14A 4AJPA 4PLFA 1KEVA 1W6UA 1ZO8A 3WOHA 4R3WA 1JKJA 4UVIA 3T7CA 1JW9B 2DTXA 4WJZA 3ROMA 2X4GA 1KC1A 2ZYAA 3KV3O 4F3YA 4GAEA 1L7DA 1HDGO 1T1RA 3VPXA 4CV1A 4YAGA 1B0AA 1ZIDA 2UVDA 2QRKA 2ZTVA 1VJ0A 2HMWA 4NBRA 3WB9A 5KIAA 2Q3EA 2R00C 3CZMA 1C0IA 3AI2A 2PH5A 1WAMA 2VHXA 3OBBA 5TQVA 2OBYA 3KTDA 4URFA 4UUMA 1E1NA 4E4YA 3TPCA 4DTIA 3FBGA 1ZJYA 4H15A 2HK9A 4ESOA 1PZEA 3Q0EA 2JFFA 1I10A 3FWNA 2IYPA 4TRNA 3PDJA 4NBWA 3GRPA 4QO7A 2QX7A 2B0JA 2NWQA 4G2NA 4OL9A 4RPHA 4PG7A 4GX1A 4CMHA 3K6JA 3W1VA 5ILOA 2H5LA 3ZWBA 2W2LA 1NBOA 4YRDA 3PQFA 3K2BA 1NQTA 3ADPA 5G4KB 3LZ6A 3PIDA 4M87A 4E5KA 3E82A 5KKCA 4DVJA 4D0SA 3HSKA 2OHXA 4CM4A 4HP8A 5AXBA 4AL4A 3GGOA 5THQA 5C5IA 1ISFA 1T26A 2GO1A 4N5MA 1ZKMA 1ZVMA 5TX7A 4BO8A 1P1JA 3PHLA 5CEEA 4CL3A 4CM6A 1H2HA 2IEDA 3IP1A 4ND5A 5I8ZA 2CUKA 4BB6A 4DLAA 4JBHA 4JLWA 1PGQA 3RQSA 3D64A 2VNSA 4MIYA 4DIOA 2HJSA 3P5SA 3IIEA 1Z45A 3ENNA 3IKVA 4OXKA 1U4SA 4KMSA 1KEPA 3JQCA 3KVOA 5TJ9A 4UUNA 3PVZA 2BHLA 4UUOA 2X5OA 3N7UA 2Q1TA 3R0IA 4NR0A 4J6FA 4EUHA 4IXTA 1GYQA 1PQPA 2WE8A 2Y0DA 1R4MA 4OQZA 1LA2A 3DXFA 4HWKA 1U8FO 4NU5A 2PA3A 4D3FA 1DIGA 3TL2A 3PWZA 5G0SA 2DTDA 3S2EA 3DR3A 4FQ8A 2NTVA 1X15A 1MB4A 3SC4A 1TI7A 4TRJA 5KJ1A 3QE3A 4CMIA 4IIUA 4DMMA 3EHEA 5G0VA 3MJEA 4BNXA 4N5LA 5G0WA 4B4OA 1F0YA 1HL3A 3WYBA 1NQAO 4XJTA 3H4VA 2I65A 4J4TA 2I3AA 4XYGA 3DEYX 1DRUA 3ENKA 3K31A 1A4IA 4TQGA 3UICA 3NGLA 4FC7A 1T25A 2H6EA 5FF9A 4FB5A 1YXMA 4ND1A 4EBFA 2YV2A 4YJGA 1A9ZA 1R16A 4YAEA 1JKIA 2W2LD 4IJUA 3GN2A 3ZHYA 3TJRA 2JCXA 1XQ1A 3GAZA 1N9GB 3ETGA 2QYSA 3R3SA 4R5HA 2Q2WA 1RWBA 3ZV4A 3ZV3A 4C7KA 1P33A 4D3DA 2HMUA 4RV9A 3VH4A 5K6AC 4MP8A 3E9NA 3L77A 4TMFA 1B3RA 3AFMA 4OQYA 3RC9A 3PXXA 3EVTA 5GZ6A 4O5OA 2FRDA 3UH1A 2VWHA 3A4VA 3IAHA 3RSHA 3LLVA 4R54A 2ZJ1A 1NVMB 5TJHA 3SJ7A 2YYYA 4FCCA 1IZ9A 2O3QA 3PHJA 1RJWA 4IQGA 2EERA 3VVCA 1OMOA 1LNQA 3NT2A 4NFHA 1PJ2A 1YL5A 3CMCO 3L6EA 4R68A 1PQUA 2J8ZA 3JQAD 4FOSA 2ZQZA 7MDHA 5BSHA 2AG5A 3I6IA 5CPBA 3GK3A 2B4QA 1OI7A 4BGIA 1E7WA 5EESA 3GVHA 1V3TA 3PGJA 2EW8A 3BHMA 1WXDA 3WWZA 1Q7BA 1HDZA 2IYOA 4R01A 4DBZA 2J5RA 4J1QA 2RH8A 3FNGA 1MUUA 2VNAA 4XZ3A 4OSOA 1ZUD1 3QQPA 1PS0A 1PQWA 1MG0A 4G65A 2O2YA 5H81A 1JTVA 6LDHA 5EIOA 4W6ZA 2EHDA 3GHYA 4WLVA 4HBGA 4W99A 1NPDA 3NGXA 4FOOA 3F9IA 2O3JA 1LI4A 2VRCA 1YONA 4LMPA 4RPGA 4AJKA 2NVWA 3DZFA 4ZQHA 5JAMA 1D8AA 1ARZA 4WK6A 4BUCA 1GEEA 5LDGA 3PLRA 3RJ5A 1A4UA 1H2BA 1TLTA 2X0JA 3UOGA 2NUAA 1GQYA 2OMEA 3QVTA 4J43A 5KVVA 4IMRA 1HE2A 1GZ3A 3ASUA 3HFGA 2VTDA 1T1SA 3AU8A 3F47A 3QVSA 4QXMA 4CR8A 3C85A 3PI7A 5A04A 3EVNA 3WGYA 4BIIA 1QLHA 2JD2A 2NSDA 4CMEC 2J3KA 4N54A 3GN1A 1EE9A 3HN7A 3JQ7B 4XB1A 2IODA 2WYVA 1XHLA 3DMTA 2EF1A 3O9ZA 4YJDA 5GZ1A 3KOUA 1UP7A 2EP5A 2BF7A 1VSUA 1XKQA 3NDJA 4RPKA 3WLEA 4K6CA 4RGBA 1B7GO 3NYWA 2OZPA 4MP3A 3AY6A 3HHPA 1P0FA 4XCVA 3U49A 2VOEA 4DC0A 3QJ5A 4BOYA 4NU6A 2Y0EA 3F5QA 4NNJA 4A26A 2JL1A 1XSEA 3OIFA 2JFGA 4ZQEA 5AOVA 5JC8A 2ZK7A 4FFNA 1M6HA 3U4HA 1B16A 1V35A 2W98A 1C1DB 3PJFA 1PJSA 3FD8A 1N2SA 4TVOA 1I3KA 3GQVA 3AM4A 1H0KA 4EYEA 2B69A 4BGUA 4PG5A 3JQBC 1Z6ZA 1FXSA 5CDYA 2I99A 3MOGA 1QR6A 2B83A 3ZHBA 2PZJA 5CG2A 4OKIA 3F1KA 1KYQA 2GZ2A 2VRCD 3EZLA 5I7SA 1F17A 4NJMA 3ZU2A 1YGYA 3GEGA 5L3ZA 3OEWA 1A72A 3PHIA 4FFPA 3TQHA 5I9NA 4YT4A 5G4LA 4HFMA 3BHJA 4MKXA 3KSDO 4RDHA 3WGOA 3JQ9A 2NU7A 4QTZA 1ZNQO 3KEQA 3WDSA 2D59A 2ZJ0A 5T8KA 2YW9A 2V65A 5BSEA 1I5RA 2YQ5A 1GZ6A 2J3HA 5KJFA 3ASVA 3SEFA 2HK7A 1XU7A 2EXXA 4WCFA 4GQAA 5JDCC 4B3IA 1ZK3A 1ADFA 3NTOA 3F4LA 3M1AA 4PLWA 3ZI0A 2VT3A 4WEQA 4OMUA 3QIVA 4FW8A 1VL8A 1J4AA 1IL0A 3SVTA 2AEJA 1U2DA 2VUSA 3PHHA 4B3JA 2IDZA 4D44A 2TMDA 3DTTA 2FPPA 2O7SA 2PWZA 3E8XA 3L4BC 4DBVO 2W2KA 3D4NA 3EDMA 4XYMA 1ONOA 3JD4A 4IDAA 1J5PA 1T4BA 2C0CA 2HKIA 2J3IA 3OP4A 4DA9A 2BGMA 4LSMA 3JYQA 4LW8A 3QLJA 1Z74A 4JQCA 3UGKA 3W6UA 4GSKA 4ZICA 2WTBA 2V6BA 1LSUA 4BKRA 4A73A 2WE7A 1OAAA 3GFBA 2Z1MA 3WLFA 4CQMA 5A5EA 3QHAA 2DVMA 4L73A 4PLYA 1O89A 1EUDA 3L6OO 4Z6KA 2HUNA 2VHWA 5IDWA 2FR1A 5K9ZA 4BO6A 1R4NA 3WQQA 1R66A 4OM8A 3DHEA 1D7OA 2BLLA 4R16A 1AUPA 1YRLA 1BXGA 1NVGA 4O59O 2QZZA 5JLAA 3DBHA 3GEDA 3DOCA 4MPDA 3GUCA 1I30A 1WWKA 4GGOA 4IXWA 1DC3A 2FOIA 1KVQA 3IKTA 2HDHA 2YUTA 4A0SA 2VOJA 4IM7A 3D4OA 4KTTE 4CM7A 3TF5A 1B15A 5I8WA 2VYNA 4PLTA 2HJRA 3W4IA 3JV7A 1U3WA 5TIIA 3GG9A 3I9MA 1H9BA 1E1KA 1VE9A 3EMKA 1B2LA 2X0NA 1DRWA 4NZ9A 3QY9A 3W6ZA 3X2FA 4ALNA 4PLVA 5DNAA 2IZ1A 3ONFA 2PZKA 4Q3EA 5T6BA 3JQGB 1G0OA 5JYEA 1BDMA 1BVRA 1HLDA 1P1RA 2IEBA 1AXEA 1CETA 1PJLA 5EL0A 4II2A 3PIIA 1YO6A 4IIVA 3K5PA 2D2IA 3FF4A 4PLGA 2C20A 1ZXLA 4WLOA 1DJNA 1RM4A 4D7AA 4IJVA 5F1PA 3IP3A 3DTYA 3ZU3A 1LSOA 1ISIA 3BMQB 5JAQA 1HE5A 2C07A 2OORA 4U0KA 2ZKLA 3P19A 3BTSA 2LDBA 3Q6IA 1QORA 1XWFA 3FR8A 1PTJA 3UXYA 2P9GA 3KXDA 4CQMD 4BB5A 2QQ5A 3AUAA 2POQX 4CLDA 3QVXA 2DUUA 3GNSA 3ZW9A 2X6TA 1IOLA 1DO8A 1HZZA 2HRBA 1I01A 1JN0A 1HDXA 4IS2A 4Q39A 4RVHA 1CQIA 2EJVA 3Q11A 3W8DA 2HO5A 4WPGA 4ZJUA 3WR5A 4OAQA 3HDJA 1HKUA 4JJGA 1W0CA 1VJ1A 1YDEA 3FN4A 3OMLA 4HX5A 5I7VA 1EFKA 1H6DA 3TSCA 1LDNA 1VL6A 4UAGA 2EKLA 1H9AA 4D0RA 2A4KA 2DT5A 3IJPA 4K9DA 3UFXA 4R4JA 1E5QA 4GMFA 1X7HA 3MJ4A 2O3SA 3IUPA 2OL4A 5FFFA 5IDXA 1Z7EA 1DFHA 1DOHA 4FDAA 3WQRA 3Q1LA 2VTEA 3F5SA 4J1TA 1E77A 4LISA 4AJEA 1M66A 3PTZA 3MCVA 1K89A 4E5PA 4NDNE 1IY8A 4HFNA 5HA5A 1UDAA 4DQVA 1SCUA 3KYDB 4J9VA 1LDYA 5U4QA 4AG3A 5B12A 1UZMA 4A27A 1OC4A 1YE3A 4WKGA 4BQRA 1NR1A 3LQFA 4MVJG 5EPOA 2GPTA 2DBRA 2Q50A 1GQ2A 3RBXA 4LCJA 3V5NA 3BAZA 3DZGA 1EZ4A 4GL4A 4J1SA 4ID9A 3CEAA 3D4PA 1KC3A 2ZATA 5EMHA 3UN1A 1JDJA 1F8GA 4FGSA 3KYCA 4LGVA 2PKRA 4Q9NA 2GZ1A 2ZQYA 1EDOA 3ICPA 5MDHA 4CM3A 1O9BA 4BGEA 3G49A 2PGLA 3VHRA 2EWMA 2C5AA 3U09A 2O48X 1KEWA 1XR3A 3DC2A 4I5GA 4Y67A 3WYCA 9LDTA 2P68A 5L51A 4IDDA 5EJ2A 5I9LA 3GA0A 2E82A 4DYVA 2PTGA 2C2YA 3H2SA 2IXAA 1RYDA 5A9TA 1X7DA 1MA0A 1Q2XA 3I4CA 4GGPA 4RF2A 2QRJA 1PGNA 1FMCA 1DIAA 3PGXA 3MTJA 3I4FA 4TZKA 1NQ5A 3JQDA 3A06A 3HE3A 2H1SA 3R3JA 2HLPA 1E7QA 4ALLA 2O4UX 4IDFA 3V1UA 2Y67A 3W4KA 3RUHA 1PL6A 4OXNA 4OJNA 3D7LA 1QYCA 3QP9A 4NBUA 1I0ZA 4QEDA 4B4VA 1ZK1A 4ILKA 4DRYA 2GN9A 2FSSA 3LSYA 4BO3A 4ALJA 4PLCA 2GN4A 4LMRA 4FR5A 3SXPA 4D45A 1ZK2A 1P45A 3H65A 3PRJA 4GVLA 3C1OA 1N5DA 4P38A 1EVYA 1ONNA 1SPXA 1QG6A 5C7IO 4KWIA 2DLDA 3SX2A 4XDZA 1GCOA 1TT5B 5IDYA 3BTVA 3I1JA 1LDEA 3AM5A 3HB4X 5A9SA 4DPKA 3NDRA 5ENVA 1P31A 2FSVA 2NVUA 4YEDA 1HDRA 3TZHA 1ZEJA 4JK3A 2D1YA 3FTPA 2GD1O 4LN1A 3OJFA 3MOIA 2Q1UA 3OJOA 1BW9B 4M54A 2G82A 3PFWO 3HADA 3MJCA 3OSUA 4RQUA 1JVBA 1KEUA 4BO2A 4Z9FA 4D79A 1G1AA 1ZFNA 3PWSA 1LLCA 4TWRA 2C5EA 2EV9A 4Q3NA 2X7HA 1TEHA 1ZXBA 1Z75A 1FK8A 3GVXA 1GUYA 1VRWA 4BO5A 1G6KA 3U4CA 4NQZA 2X86A 4YA6A 4ZN6A 4IS3A 4CUZA 2RIRA 4EUEA 5THKA 1MV8A 4CMJA 1BW9A 3S2GA 4A7PA 2GGSA 3JQ8A 4CMKA 4RPLA 3AI1A 3PK0A 3TDKA 1ZSNA 1FDUA 2UUOA 3HQ4O 4HXYA 4J9UE 3WTCA 3GEMA 4YDRA 5CAEA 1JA9A 5FI3A 3QVOA 1Y6JA 2CF5A 1PS9A 1UH5A 3UKOA 2DBVO 2EW2A 4J4BA 1U5AA 2CFCA 2VWPA 4OSPA 4S3MA 4EW6A 4XJSA 2VUUA 5JAZA 3QW2A 2VCYA 2WD7A 1ID1A 4XWYA 3QV1A 3ADOA 3ITKA 1GDHA 5IG2A 3NKLA 4FD3A 3B1FA 1P3DA 1CWUA 3TZQA 1HYGA 4YBZA 3FR7A 2XPCA 3RUAA 3WNVA 3ZU4A 5JY1A 4ZRMA 1ONPA 3PJGA 3MWDB 1PR3A 1U7TA 3CE6A 4BO0A 1VL0A 1U5CA 5IZ4A 1DRVA 2Q1SA 2QRLA 3INRA 3H5RA 1X0VA 3VC7A 3T4EA 5JO9A 4IDGA 2VUTA 3K73O 2W8ZA 4CLOA 3FHLA 4CM4B 5HWSA 4CUJA 1E6WA 2AQHA 2B36A 2YDXA 2FN7A 1DEHA 1JAYA 1EEHA 2GNAA 2E48A 3AUSA 2FPIA 3C24A 1KIFA 4J4HA 3RJ9A 5L4NA 1XEAA 3H9UA 4L74A 3E1KA 1JAXA 4WLUA 1EFLA 2DU8A 4YJHA 2X9NA 1OBFO 4HNGA 4CMBA 3AY3A 4CODB 1H5QA 3V8BA 1GZ4A 4R51A 1EMDA 2QG4A 2HU2A 5A1TA 2ZYDA 1ORRA 1CIVA 1S7CA 4EI2A 3AOGA 4M55A 1C0KA 2DQ4A 3V1TC 5BSGA 4E2WA 2JHGA 4U0JA 1R4MB 2R6JA 3DBLA 1YB5A 3JD1A 3JQAB 1MXFA 4UEJA 3ROKA 1A7KA 1GV0A 4B7XA 3UCXA 2IE0A 1MFPA 4TKLA 5DBFA 2OXIA 2O7QA 1EBFA 3I5MA 5G0UA 4RL6A 4FPXA 4K26A 2DUWA 4BS9A 4CMIB 2GASA 2BKAA 4PRLA 3FTNA 4JGBA 1X13A 4CR6A 3ZNPA 4TZTA 4ZQFA 3UVEA 4MVJE 5TC4A 3FSRA 3I3OA 1PGJA 4CV0A 1ZJZA 1O8CA 2B4RO 4DWVA 4L0QA 2C54A 2NQ8A 5B1YA 2RH4A 1I24A 1UAYA 5BNFA 5JDIA 3C7DB 3JQAA 4ALIA 1HT0A 1NFRA 3IJRA 4TVBA 5EQDA 5L95A 1HRDA 2P5YA 3IMFA 1LC3A 4BHTA 1JVSA 3GUYA 3R1IA 1R0KA 1DXYA 3JD0A 4YJGB 1R6DA 3K8ZA 4KQWA 4GI2A 1M6WA 2OP0A 3KZVA 1P1IA 1N92A 3OECA 5B37A 1VC2A 1NYTA 4HADA 4CV3A 5DCUA 1XYGA 2OUIA 4PLZA 3BZUA 1RKXA 5FI5A 5L40A 2FP4A 2ZB3A 3RIHA 2FZWA 3BXXA 3GDFA 3UHAA 2FWMX 4BV9A 1BWSA 3O4RA 2NADA 2DTEA 3ONEA 4NHEA 3NRCA 4A03A 4J2HA 5DCYA 5TSDA 1WLYA 3GDOA 4M89A 5HRUA 5L7WA 4I9UA 4AVYA 1DIRA 4WNIA 4DLBA 4ZD6A 5FYDA 5IN4A 1BGVA 4U8GA 1X7GA 3GGGA 5KCZA 3IQDB 4LRTB 3BA1A 1NTOA 3LC2O 4BNGA 3RBVA 2O23A 2FR0A 1VKOA 4PLPA 3F6YA 1DSSG 1T2EA 1BDBA 1UDBA 2C59A 4II3A 4R1SA 4ND3A 3M2PA 1IZ0A 3H9JA 4L4RA 1NQOA 1Y5RA 1TVEA 5TLSA 4IGEA 3WBBA 1ADCA 3PHGA 3LC7O 3WBFA 4E3ZA 3NAQA 4J0FA 5DP1A 5IXYA 3JCZA 3TOZA 4Y6PA 3GGPA 3W4JA 5CDGA 5CEFA 2GYYA 2FHSA 5AYVA 3V2HA 1R0SA 4CM9D 3GNQA 5DF1A 5A03A 3H9GA 3L07A 2YHIA 3NT5A 3H3JA 3ZWNA 1V8BA 4ALKA 1F12A 3F1LA 3WS7A 3WSVA 4MIOA 3LT4A 4WOKA 4XIJA 3CINA 2Z1NA 4JXKA 3DFZA 5IDQA 1F06A 3DB2A 1OOEA 1WZIA 1LDGA 2AQKA 4BNKA 3OIDA 4NFSA 3I9OA 1C1XA 1XQ6A 4OO3A 1HDOA 3VZRA 1YVEI 2P2SA 1IHXA 3PYMA 4MVJF 4WE3A 4YWJA 4UREA 1KS9A 5KVSA 4IZIA 4F46A 4K28A 4MKZA 3MWEB 3O8QA 1FDWA 1PWZA 3H9QA 4MP6A 2P91A 4NK5A 3D0OA 1NFFA 3I83A 2RHCA 3OICA 5F5NA 4LCEA 4YACA 1W4ZA 2WDZA 3MJSA 3L9XA 4XYEA 3KUXA 1E3EA 5F1OA 2CMDA 4GMGA 3GH3A 2UUPA 4C4OA 4E13A 3HUDA 2PD4A 3DONA 4BNLA 1U2GA 4Q3DA 4IUYA 4E5YA 1T2AA 3UCEA 1SZJG 5KKAA 5C3MA 1E5LA 4KUGA 2BFAA 4CLRA 3F46A 1WDKA 1UJMA 5BQFA 2X8LA 1YJ8A 1PJQA 1SB9A 3ZWXA 5JNLA 3KLMX 2CD9A 2BFMA 2JCYA 1GV1A 3B6ZA 4EEXA 2NACA 2VWGA 4I8XA 4DQXA 3NX4A 2BMAA 1A7AA 2BI8A 1DBVO 4J7CA 4ZU3A 1I33A 3JQ6A 4GKBA 3ZWVA 3G0OA 1YOVA 1U9JA 2PKQP 4PG4A 4HV4A 2A94A 1UAGA 2JD0A 4UVHA 4PVDA 1LRKA 1YQXA 3M6IA 4J91A 3P2YA 1DHRA 2DKNA 2AG8A 1H6BA 2YHUA 3VZQA 1RPNA 3MEQA 4EJMA 4PN3A 1ISJA 4RQTA 5I7FA 2JHFA 2EG9A 1HYEA 3CZRA 1WW8A 4ITUA 3JQFA 3IC5A 4ONEA 4BO7A 4Y98A 3FRJA 5COQA 2Q2QA
chains in the Genus database with same CATH superfamily
3MJFA 2QKYA 1GT6A 1EVLA 4QGBA 1XP5A 4PM4A 1ENOA 4E14A 3DE7X 3WL7A 4AJNA 4DY4A 1X1QA 1VKRA 3ZWDA 1VP3A 4RD1A 4IDBA 3VPHA 3ZWMA 3RYFA 3WP1B 5EXDA 3DMTC 3F3SA 2NU7B 2W6JA 3U4AA 3UWMA 1I1NA 3FDFA 3UFBA 4BP1A 4BX3A 1IK6A 3GA5A 1YZLA 3DUFB 4FDVA 2YIMA 4EGFA 4KQKA 2XUKA 4P33A 3E9RA 4KCGA 4OQFA 2XVXA 5TEVA 4WK4B 2I6FA 3PXBA 2IU4A 1LVUA 4EGJA 4G1VA 2AZTA 3FW1A 4R2XA 3CLVA 1HYBA 3ER9A 3C3XA 5SZJA 1TKRA 4NWIA 2HGSA 1DXQA 4UTXA 4AIIA 3N9IA 4JIMA 1RXCA 1AU9A 2RJ3A 3BMCB 2JVJA 1POWA 3IXMA 3GMSA 4Q7LA 1A4RA 3WK6A 3IB6A 1E3SA 1P91A 4BBJA 4LHSA 1OVMA 2BGIA 2ODEA 2GM3A 2RHWA 3A9WA 5T41A 4QM7A 4FN4A 3TSYA 1P44A 1WLSA 3OF2A 4GECA 2FHPA 3QOWA 4CEJB 4YMWA 1AC5A 4TN1A 5IUJC 3BWXA 1SUPA 2E4XA 3O4FA 1MJ5A 1BXKA 2GERA 5A5FA 4C20A 3I1YA 3BXOA 5LP6C 1XUOA 7ADHA 3VKWA 2W6MA 2EFEB 1JMKC 3HCDA 4QEZA 1KEEB 3AESB 2JFYA 4S0XA 4ZMBA 3BMCA 5D84A 3OIGA 3ZHVA 4ZOAA 3QUBA 1KMCA 5JBQA 2QIOA 3IT2A 2K6GA 4IIFA 5GOTA 2R25B 4X54A 1PL0A 2IYEA 5EJFA 2ZTLA 5EQJB 3OHMA 4PE5B 3UAGA 4NYMR 1M6NA 3E7XA 3RYHB 4BX8A 4RWZA 1W581 4KTVE 2KI5A 1AKTA 2YJ5A 4US0R 5F1KA 3IKMB 1W4CA 3QOFA 2JFWA 2HDWA 2I3BA 3NTLA 4A6DA 3ZXYA 3HMKA 5D7NA 4AJIA 1QYIA 4HY3A 3VKFA 1PJRA 1ST2A 2YTZA 5FNZA 3RVLA 1M76A 5C46F 3W2TA 4CMGA 2QR5A 2O14A 4BV3A 3S7ZA 1UDXA 2P6UA 1BA3A 1FJHA 4K2HA 5T8KC 3SE7A 3ZIUA 3THWA 1LPNA 1TTPB 4LBYA 2SKEA 1EK2A 1V3VA 3QTLA 1FNBA 3E1SA 4Z1MA 4A8JA 5C8ZA 3D8UA 3D5EA 3TLAA 3D6JA 1QQ6A 2I7TA 5AIAA 3CCCA 3T94A 3G8DA 3DYBA 1N2CA 4NV1A 1DL5A 4G0VA 1JJBA 1OBVA 1HDIA 5B7GA 1D1PA 4OYRA 4Z7JA 3UJ3X 4WUTA 2JZCA 1ZMXA 1U2DC 1KFEB 1KS2A 4RV5A 4BEJA 1CDZA 2YXDA 3NOOA 1HF3A 1DGQA 1P4GA 4F6CA 2Y1FA 4MJ3A 3CWZA 3IQIX 1D4AA 1W49A 5BOVA 1F6BA 4FILA 4D3SA 1TCUA 3TIXB 5DO9A 1KJYA 1Q16A 3B6KA 4FFOA 3VU9B 1L5OA 4K9OA 4AX4A 3FAZA 3IESA 4PGGA 3FMPB 2PVPA 1GEGA 4A10A 1PUIA 4UUQA 1NMYA 1CK4A 3GX1A 4BP3A 5I7RA 4I6GA 1KK1A 3OUZA 3HSSA 4WMLA 4BMNA 5C5EA 4RPJA 4R1OA 2IEYA 3O74A 2XBUA 4O8ZA 4B09A 2A7XA 1CVIA 5DTRA 4QA9A 1XPRA 2B35A 2Y93A 3OZSA 1U1GA 1K5DA 4Y9RA 3EPRA 3D2AA 4RY8A 3RVDA 5DV9A 1VKZA 1P0IA 2EJWA 3K5HA 3WLMA 3VTFA 5ESWA 1ISPA 1LFDB 2I1WA 2FV8A 2HRQA 4Q7JB 4ALMA 4D46A 1JG4A 2Y1XA 5D51S 4K6FA 2IXTA 2PRZA 1SOUA 3OOJA 4C2BA 5ITWA 1I1HA 3DBVO 4KOEC 4AS3A 1IM8A 3AVUA 3UIEA 1T36A 3ST7A 5D2CA 2JK1A 3CLRC 1QFZA 3U56A 1U0NA 3E9EA 3N5KA 2UUAB 3IB3A 1ZMOA 2ZUBA 3L84A 4CM8A 2JH3A 4CKEB 2J0UA 1H3NA 3SFVA 2ZIWB 1ABFA 1NR7A 2P75A 4J0JA 5C7OO 5JBNA 1AO0A 1KY2A 1AH2A 4YQFA 1GFZA 4QNMA 3EZFA 4JN6B 4ZFNA 4LQ4A 1C0PA 2BR5A 3HVKA 1R5JA 4R2JA 3QLUC 3R5FA 2R84A 2NV2B 3UYKA 5H82A 2O7VA 1TX4B 1NURA 4YBRA 3LY9A 3R23A 4QJBA 3RYCA 5FX2A 4QLBA 3HBNA 1EP3B 1LVHA 3OX2A 5E8RA 5K8LA 1O95D 3JQEA 4BN4A 2EDCA 3RT7A 1K97A 2WZBA 4US2R 2I67A 1ZEMA 5BNIA 5FWYA 1IULA 3PICA 2AW3A 4HXEB 1RQXA 2E1PA 1MB9A 4PGHA 3WK8A 1JG2A 1Y9EA 1YZFA 2B1JA 2EEZA 2X8JB 5DEOA 4BLSA 1GPBA 3HP4A 4EECA 4Q01A 2EJTA 3EEQA 4MV3A 4LJ9A 1ETUA 5CCBA 3HY3A 4IIJF 5K3DA 4PQEA 1KARA 4B6RA 4EQZA 1V9LA 4BPBA 2A67A 4BMVA 1RJ9B 3FZNA 2IY9A 1BG6A 2IZ6A 3NRBA 1PTJC 3PHCA 1RJEA 1DLJA 2DR3A 4F4JA 1MENA 4KUEA 1YULA 2XCQA 3CIFA 1BSVA 3QHPA 4IW3B 1EXDA 2YICA 1GZSA 3NUGA 5ALZA 5MN4A 3C3MA 3S2UA 2X8JA 2C4UA 4MQ4A 1ODJA 3K2QA 2RGWA 2H1RA 5B6IA 2Q6TA 1JFFA 3ZQUA 1URPA 1GSIA 4I3FA 1QB8A 2CNOA 2NTNA 2V4ZA 4Y2JA 1G7SA 4Q12A 4YONB 2QG6A 1HZZC 2QTCA 1XU9A 3DJYA 1FP2A 1BGXT 2QLTA 1FTSA 2EWWA 1G4AE 2C83A 2FGKA 3K9HA 5JJCA 1ZJ6A 1KZ1A 1VLZA 2ZUVA 5K2MA 2R8BA 4FWBA 1LX6A 3AVVA 4OJMX 3AEUA 2A0XA 1UDWA 3AVPA 1A71A 3OTHA 4F56A 4G07A 5FOSA 3FCAA 1B14A 1I6KA 3V4SA 3EGCA 2DQYA 3AL2A 5CTJA 1SQGA 3EWNA 1OVGA 1MW8X 4M49A 1LF5A 1Z0KA 5JANA 4PHTA 5D85A 1SAYA 2GVZC 2VP9A 1SBYA 1P74A 2FEKA 3BIFA 3ETEA 3HVIA 2IF2A 4YAFA 1Z5NA 1OSNA 1PR2A 3L6CA 4PCLA 1HE4A 4YMIA 4LDPA 5DZSA 3SEQA 1APBA 3NETA 4A3SA 1YA4A 1H93A 1DB3A 1Z8DA 2IYUA 3Q8WA 4BEBA 3U6BA 3B5JA 3NIFB 4LQLA 3MGKA 4L4UA 2JGKA 2AF4C 4HG2A 5DBHX 3ZJTA 3WYDA 4BMSA 2ZR7A 5F3RA 2MMCA 1CJVC 2CZQA 2X15A 1ZNYA 2XUIA 3HI4A 1OU0A 3FXAA 4ARUA 2AS0A 5DT2A 4RNCA 3W7BA 2J3DA 3JRNA 5JPDA 1EUZA 1V2HE 4Q82A 1SU6A 2C7QA 3QWBA 2E21A 2J7PD 2NU9A 3IVCA 3QA3E 3D3JA 3KSUA 5I4CA 4IRMA 2PFGA 1DAMA 2AF3C 2IGBA 4S1TA 4F9GA 3GZNA 1UPFA 1X39A 4QUHA 4WASA 1JFTA 4XQCA 4FEYA 4CT0A 4Z9XA 2D5IA 4BNTA 4Y2XA 5C80A 4P8RA 5JWOA 3HC7A 3EAFA 2ECOA 2NU8A 3RSLA 3ZDRA 3PV0A 3I2IA 4GOLD 1DXOA 2WUWE 4DXAA 3EC1A 3G0DA 1R18A 2P2LA 3AF6A 1X1DA 4EQ6B 1YMQA 5HVNA 2GJAA 2JLRA 4B9AA 3ZHXA 4FMDF 5LA6B 2NVUB 2Q99A 4ZHSA 3TKAA 3UMYA 1V1RA 5AW0A 3DV0A 2IK8A 4X44A 3P4UA 3OWXA 4HDSB 5E3JA 4LY3A 4PYQA 4CEIA 1U0TA 1ZCBA 1CSEE 1FZTA 2HXGA 4LPKA 1USVA 1QVWA 1OGJA 4YUWA 1W5BA 1UIRA 5EKSA 3R6GA 1C7EA 5KO2A 1DCTA 2QVLA 1MFZA 3STXA 1EAYA 4YMVA 8ABPA 4QREA 1NC1A 4JBGA 2Y1KA 2ZJYA 3NT4A 2ZRKA 3DTVD 4C2TA 2X0EA 1JF8A 3HB0A 4DDMA 1SIWA 3G8CA 3QMVA 4I5EA 5MGBA 1KWKA 2XOKD 4OHUA 4ZTBA 1PNRA 1G5QA 4J16A 4L8VA 1C3EA 1W73A 2BMVA 3TN7A 1YC2A 4AZ0B 4B3FX 3U81A 3U7QB 3AR5A 4P81A 5LC1A 2CZCA 2RJOA 1UWCA 5A06A 2L69A 2MINB 3N3BC 4I55F 3AXSA 2CWWA 1NKSA 2PA0A 4BN0A 3KKQA 4PYLA 1RXIA 2BEWA 2FN9A 2HU5A 3JQ8B 4FZJA 5B3LA 4QUAA 1OUMA 3WIOA 1DV1A 1KU0A 1EHCA 3G8AA 4XD7D 4AJHA 5IXJA 3HKCA 4M0MA 1UJ4A 3KNZA 1V5IA 1ZM9A 2WTMA 5CAEB 3T7TA 2B78A 1J39A 5B1DA 4CBVA 1HT2E 4PSUA 3A28A 1N6HA 4G0UA 5K0NA 2RH5A 4CKWB 4DY6A 1BXZA 1JMVA 1RPJA 4W4TA 4YNBA 5C18A 2AWOA 1RRCA 1EG2A 2WD7B 3O9VA 3DDNA 2PWBA 2PR7A 4FYPA 3L0BA 1KZYC 4PGAA 1THTA 1OFTA 4B6EA 1UUFA 2IEZA 1RRKA 3NEPX 3TGWA 5JVDF 4FFSA 5BV2P 1UFOA 4EB8A 3RUCA 4M3NA 5LQAA 3ACCA 3ZV7A 1AD2A 4B3TB 2ZSHA 4AJ2A 4WQMA 5DTIA 1U7HA 4RFSB 2NZWA 4GZ3A 4IFBA 3TINA 1SXJB 3HJAA 2IP4A 4V0OA 3EIQA 2A6PA 4OHPA 2ILTA 2OP1A 1I4TD 4L5AA 5L3RA 1CQWA 4ED9A 1A8HA 3UJNA 2DWOA 1NSTA 4XAQA 1K7XB 2OBFA 1BMDA 4F1KA 2VRBA 1I5EA 3E7DA 3I9V1 1OYWA 2G17A 2O8VA 4FX5A 4R2IA 4TV8F 1V8OA 1E4YA 3KUCA 4AJ4A 2ZJ6A 5BVHA 5JS2A 4CLXA 3QPVA 1Z4LA 2Z98A 4PRKA 2YJZA 1XFDA 3G9QA 4PYNA 1LU9A 5KTNA 2LPMA 4FGKA 1CZOA 1FFXB 4YJFA 1HDCA 2VJYA 2ZB7A 3HXOA 5JCZA 2V7QA 3H5TA 1SXJA 4HDNB 5JCXA 2OO7A 4NOLA 2UYCA 1RC0A 1XLWA 1ZGHA 2GEFA 1S2LA 5DYYA 3CPSA 4XSHA 1TZKA 3SOPA 2P9QA 3I2YX 3GHHA 3Q9NA 3SLGA 2OAEA 1RVV1 5SZIA 2BTQA 4YJ2B 1G8HA 1XOIA 4DRZA 2Y05A 4ETMA 3ABQB 1WB5A 3PJEA 1UXGA 2N46A 1NMSA 3PIRA 3QRWA 1BVUA 1V41E 3LA6A 2ZIXB 2RB5A 3P2MA 4RZIA 5IAAA 1DO0A 1NW9B 2I8AA 2A86A 2ZRMA 3G59A 3K1JA 3LYHA 4YPVA 4BNVA 3Q2OA 1FFXA 3TSOA 2I7XA 3HVUA 3ZGXA 1QSGA 3I3SR 4D42A 1CIJA 4R8MA 3GFSA 3HH8A 3TSZA 2OCBA 2X5JO 3OZIA 5K0GA 3P9SA 2F3TA 1O94D 3R44A 4JJEA 1DFGA 4FD2A 4WA7A 5FHRA 2A9FA 2D0IA 3LGSA 2JI4A 3EEFA 4P4GA 2R97A 4W82A 1TK2A 1QRRA 1FX1A 1KVTA 5AW7A 5LUAA 2ADMA 3IT0A 4M9QA 3MBIA 4MV7A 4CKCA 2WA1A 3QWIA 4MVJA 3DT9A 1TRHA 1X7WA 5I9MA 3H5AA 4PZCA 2V7PA 1LNZA 4MGEA 1E6CA 4IICA 3ORYA 2CT8A 4L15A 2GD6A 4PC1A 1UKCA 1ZM2A 3R24A 3O21A 1VXRA 1Q83A 2WUDA 4I5FA 2HHAA 1G21B 4L4SA 2XB9A 3LLCA 5KSWB 1OH7A 1BKDR 3PCRB 1FFYA 4C7OB 4PXAA 4AWBA 2QN6A 1UBHS 4OIMA 3SKYA 2P5UA 4N6OA 1H5NA 2PH1A 5JS1A 3Q9LA 1WY7A 2QP4A 1Z7BA 4WNAB 1RQGA 1FYVA 3N74A 1N1EA 3CF4G 4G1UC 2BZGA 5T57A 4EDHA 4QGSA 4MR8B 1L5ZA 1G9XA 3RRNA 3Q98A 4EP1A 3FUCA 5I7OA 5IABA 4EW2A 1DHTA 4IDCA 4Z2YA 2WG2A 2NSLA 4GWGA 2JW5A 1SHJA 4FYHA 3DL4A 4CM9A 4IRXA 1YF3A 4UMDA 2FP4B 2Y66A 4NJEB 3ZYZA 2PUCA 3PPVA 1SMKA 4COOA 5KQMA 3HWSA 5GV8A 5G40A 3FF1A 1JHYA 3GJ8A 2FW6A 3ZCVA 3E05A 1OB5A 2ZYHA 3JALB 4LE2A 3WYGA 3OCJA 2QAIA 2Y99A 4X85A 3WWPA 1D0VA 3P7MA 2PXAA 2OZLB 1SNYA 2B4AA 2E4UA 4Q0MA 3UTDA 5T3UA 4IOLA 2C2BA 4RVGA 1P4SA 3A4NA 4WLEA 3GMDA 5IJXA 1I4OA 2NT4A 3OQ1A 3WL4A 3H6HA 4W5TA 3ZL9A 2CDRA 5F33A 1BCSA 5L7TA 2RAPA 3IEMA 3DV9A 4KU4A 5L9AA 3SVZA 1QIGA 2QX8A 3VV2A 3I8SA 3ZHUA 3JAWA 4GXQA 2CLMB 3EYWA 1XEXA 4RMNA 1TMGE 5F9HA 4K0RA 3AWDA 5F35A 3NBKA 3REQA 3QEOA 1OLXB 1P1KA 3JALA 4ZQGA 5H8WA 5JDIC 4HH1A 1KMNA 2PKCA 5FNVF 4DDVA 2D5LA 5KDOA 3TKLA 2ZSJA 1X1AA 4G41A 5D86A 1YR7A 3RT9A 5ISMA 3F4BA 3CTMA 3DCYA 3OLZA 4WWHA 3GLGE 3G1TA 3SJBA 5BUCA 1ISSA 3FWZA 4D4KA 5K6AA 4FMBB 4GOXA 4MWTA 4YUXA 4PHFA 1K2WA 3M6FA 4JJIA 1DG9A 4KAXA 4ND4A 1RJDA 1V37A 1F8UA 2PKEA 4ZHQA 3A6FA 5EWJB 5KOJB 3Q7EA 4L51A 4XRGA 3CKYA 3PQEA 5D5PA 3FFWA 3S2SA 3SVLA 4BZPA 2QNBA 3K1TA 4YFVA 4Z86A 5BRAA 1C41A 3K32A 3CH7A 5J3JA 1NI5A 2Y4OA 3K9QO 1L6IA 3KVVA 4FKBA 5BWCA 2CL5A 3BDIA 3KYIB 1PQ4A 3TRIA 1DAFA 3BD9A 3LBHA 3R0VA 7MHTA 4FONA 3E8MA 3SPXA 4E03A 3C1AA 1T5SA 1XLUA 2EJBA 2H18A 4XIFA 1C1XB 2WHYA 3EGWA 3VM6A 5AXCA 1LW6E 1DQSA 5LDHA 1XTZA 1Z12A 4NG5A 3PF8A 3NR2A 4E15A 3ZBTA 2NX2A 2PWYA 2QXUA 4X7MA 5BNFA 5KAMA 4PCVA 1YUNA 2J3QA 2A0YA 2W6ID 3EW7A 4LNUA 4TRMA 3O8QB 5T6MA 3T5DA 1U0FA 1E7MA 1OI2A 2OECA 1H2FA 4QU5A 3SM9A 4D6PA 5AVZA 1WV0A 1NVWQ 2BFEA 5EAIA 4WESB 5DWDA 3FUTA 3TTXA 4WXRA 1QV9A 1HC7A 4N4AA 2XJ9A 4XX1A 4UHKA 3WLKX 3JSAA 2EP8A 3SBOA 4HLUC 3KJEA 1QHHB 5ALLA 3NBMA 1YRYE 3BDAA 3GZ4A 3VXKA 2ZB4A 2HBRA 5LP6B 1HE1C 3E4CA 2OYSA 3KKZA 1K8RA 4JY7A 1J7KA 4TWAA 3W2HA 3TTYA 4DLTA 1ND5A 4UEKA 1EFVA 1HE3A 2WKRA 3BC1A 4FNMA 1RS0A 1AF4A 4JP3A 4OQDA 3AK4A 4Q1VA 3AVOA 1Q3KA 3ZHCA 2O2XA 3MCWA 3PLAE 1YQDA 2GFIA 2C77A 1EG7A 1A9YA 1QF9A 2O2SA 2OBNA 4YRNA 2GBIA 3PFFA 1D2NA 2B21A 1TQ6A 4QVKA 4MVJH 5HZKA 5C35A 4IUDS 2EFDB 4QXQA 3O83A 1K6IA 1A5AB 2CDAA 2V1XA 3B1JA 3FPEA 3OPNA 4HFRA 3HR4A 4N7RA 2VDWA 1B73A 1W4LA 3SLKA 2BBTA 3BBPA 2ECFA 1QC5B 4HDMA 3LF1A 1WXQA 1XMPA 1RBQA 1ILWA 3VHXB 1RRGA 2HNBA 1YOVB 3MS4A 4HL6A 2NZ2A 4JVNA 2JJ1D 5ED4A 2PO7A 4ZYLA 3NS7A 2B20A 1PGPA 2OGUA 2RHMA 1VBFA 2I3GA 2WDPA 3ESCA 1O1YA 2XAUA 1DAKA 1E9CA 5HCUA 1V8FA 2H0QA 3Q5DA 1W4BA 1SKAA 5CK4A 2AG0A 4ZAYA 4BQOA 4EHHA 4YV0A 3ZLBA 4WOPA 1I36A 4GBMA 1ZH6A 4H6VA 5F2OA 4NBVA 1SO8A 4HGOA 4B48A 4G37A 4RM3A 5TNXA 1N5OX 2YY7A 2J87A 1YMVA 2GCGA 2ZWIA 1E99A 3H2YA 1UPCA 3IQFA 3GJ7A 3NIDB 4FGUA 4MI6A 5IAGA 3WMWA 1E6LA 1MXHA 1B23P 521PA 1NBMD 3E5MA 2AXQA 2Q1YA 2VHCA 1NHGA 2C7VA 5LWQA 1BJTA 4H60A 5DRTA 1KO7A 1QS0A 3VOAA 1W5SA 3TRKA 5EZYB 3OZDA 4BB9A 3TFQA 1T8YA 3PUXA 1CHDA 4BJ3A 5D00A 1CU1A 1L7OA 1U3VA 5CNMA 3MTDA 5H02A 2E6KA 5BN3A 2OV6A 1LBEA 3ML1A 1EFTA 4BEVA 5ADVA 2NM0A 5K0ZA 1RJFA 1E0AA 2PLAA 4C4ZA 1PHPA 1C9NA 3GT0A 4DARA 1IYZA 2O5RA 3H87A 2B61A 2ZUUA 2QT1A 3I52A 2QD3A 3QBTA 4IHJA 4XWAA 3PXGA 2MMGA 4HS4A 5JBIA 1N2ZA 5D3KA 2PM8A 2NUPB 1CB7A 4HWTA 4M1YA 4Q24A 4RVOA 2XMCA 1YTLA 4QDXA 1NPYA 2OPBA 3G1UA 3I23A 3CUKA 3D31A 1EFPA 1QE3A 3AUUA 5F5LA 3NHBA 5D5HA 5A3VA 3ZVLA 3NTUA 5LM3A 1L5MA 1ODCA 3IULA 4MR9B 3NC1C 1ZJ5A 1AQYA 1UXHA 3H99A 3P0JA 4M7PA 1A5ZA 5SYMA 5KVQA 3KQTA 4KQHA 4NMWA 1A97A 3L7YA 1FF9A 1LLDA 1RXWA 2DQZA 4AO6A 4BX2A 3BJIC 3TL3A 4N9QA 1T9KA 3N53A 1EZZA 5COAA 3CNEA 4M9ZA 5DNWA 3VQTA 1XNRB 2OV4A 2DHQA 3DJFA 3EH1A 4DCNA 1VJ5A 4RMIA 5JXIA 2NUPA 1CJMA 1BE8A 1M7GA 1YH3A 4MICA 4V3CA 3R3YA 2B8NA 5CA1F 1CS0A 2DBQA 2G7MC 3B70A 4X7BA 5T5QA 4P98A 1Z7GA 3NM6B 4LZZA 4UFOA 3M5CA 1ZIYA 1M67A 5IUNC 1RD4A 5H3CA 1AZSC 2F1JA 1UMCA 1L4LA 1UPTA 4BVKA 1PZHA 2IELA 4FN5A 3RAFC 4CIDA 3ZU5A 3AIKA 2W71A 3R9XA 4YDHB 4CCYA 2VDOB 3WDMA 2FWJA 2FZ4A 2AZMA 3ZE1B 1U7DA 2H63A 4CTKA 5HGJA 4L9SA 1KDPA 4DT1A 3G2QA 3N58A 1BHQ1 4H0FA 3VFDA 4IQ8A 1YS1X 5A5VA 1E2DA 1EJBA 1QANA 3DOOA 4OHVA 4TLAA 3KQKA 3ET5A 2ACWA 9GPBA 2PN1A 3BG5A 3OZ7A 3ZHZA 2W90A 2OHIA 1YDHA 4U7HA 4W1PA 3UG7A 1NBAA 1ZZGA 1EK6A 1FU8A 1II8A 1L4NA 1FJXA 2Z6UA 4MWBA 4TSFD 3U4GA 2C8VA 2ZSIA 5J2TB 4RDIA 3AR8A 3O3CA 3FGOA 4NH4A 4BKUA 1IN4A 1S3IA 3DWFA 4LY6A 3B8HA 5T4BA 3BCSA 1CERA 4A0FA 5I4KA 1P9RA 1YZUA 4FS3A 3GLRA 4RPIA 1F2TA 5JS6A 4ND8B 4WTOA 1Z07A 2W8BB 1QTIA 3H5WA 3ZH2A 3WGLA 3JWPA 3MGBA 3Q3GE 4BVBA 5C32A 4J0DA 1PBNA 2EL7A 3JR7A 1SOAA 1ZJ4A 3D8NA 3PKZA 4TTPA 5ALHA 2RHBA 1SHTX 4LYJA 4P22A 2FEWB 4F92B 3MMSA 4D4GA 4MUIA 2H8KA 3FOWA 3KPWA 4XWGA 3V4OA 3G8YA 2WP8J 4B85A 4GM1A 2GKOA 4ACBA 1TW3A 2RI6A 2E5LB 3AVTA 4J7UA 3VSEA 3BEDA 4RQBA 1U2ZA 2JGFA 4KITB 1U2TA 3FHOA 3OJXA 4RIEA 4I50F 4YASA 1JEJA 4ZT3A 1U6KA 1X1CA 2XWPA 2ZTHA 3AJAA 3C70A 3QI2A 1Q14A 2A57A 3MLAA 3L8HA 4C5AA 3DEKA 4ZZ1A 5LLTA 5LQKA 1PEKE 1M75A 1MV5A 3CEJA 3UHPA 3HB5X 4CGZA 2Y77A 3TOCA 1XFAA 1ZBQA 5KNCD 1ELOA 3QEBZ 3V8VA 3NM5A 1A9PA 1NT4A 3WRXC 2WWRA 1JDNA 5EQFA 1XZNA 3DEJA 3OC0A 4NDAA 4X41A 4KXQA 5CB4B 3U4QA 2OV3A 3V4FA 5ALMA 3DBRB 2W43A 3F71A 4LUCA 1O95C 3RNLA 4RJJA 1P62B 3COVA 4R7GA 2HK8A 2WU4A 2XGOA 1VI2A 2OQRA 3HGTA 2E7ZA 5MF6A 1NVUQ 3SZRA 1ZVVA 4B8ZA 3SC2A 1O7JA 2HNAA 3D3EA 3RTDA 1REQA 3WOVA 5JI3E 1J24A 2NW6A 1SG6A 3GT4A 1BJKA 1J0EA 2HADA 4QXPA 3K09A 3K9FC 5EE0A 4DMUB 1YHYA 3K94A 4K6KA 4KXYA 1BFDA 4ZPXA 5TPWB 3S2FA 3U5ZB 1ZJJA 5DP2A 4OQEA 3ROQA 1U1IA 4PG6A 2ZYWX 3KBBA 3QPWA 4FMCB 3ONNA 1JDTA 3EVDA 4MQEA 4DJEC 3S55A 3SNHA 2ZE7A 1GG5A 4RCYA 2H0AA 2TECE 3RSQA 3SMQA 2CVOA 1XDSA 2XZDA 3MB8A 4KBGA 4KN9S 1LDMA 3WO1A 2AEMA 2GZMA 5I5GA 1V45E 3BJRA 3I05A 4XB6B 5C4IA 4ZXPA 1OH8A 3W5CA 4CM1A 3SX4A 5T4FA 3QFTA 2Y0CA 1GG8A 1Z63A 1HT1E 2LNDA 1HGXA 1ZRHA 5ENDA 4EGCB 4WFIA 4ILEA 4XUGB 3UMJA 3PR1A 3FWYA 4YRLA 4GZ5A 4OHFA 5DBGA 4ZCTA 3CMMA 1HDYA 1Y8RB 3AKYA 4HEQA 1RW4A 1LBHA 4J94A 4A9AA 3S7TA 4DMHA 1GXSB 3VNAA 1FU7A 1GQOA 3DDUA 1IPFA 2I4MA 3FY4A 4FYYA 1U0SY 5BQPA 3T7KA 3KKMA 1AGNA 4MVJI 4IPTA 1UBMS 2CHUA 3VX4A 4BYGA 4CT5A 1M2VB 2VQEB 2COEA 3RUIA 4PBSA 2FJUA 5LD2C 5AHWA 1NM5C 2C2HA 3CXUA 3L46A 4G01B 4JZYA 5LZ5A 4X6XA 3TH5A 2HWXA 2VDQB 3C48A 2CV0A 2ZULA 4TYMA 5CDTA 1M5UA 3HA5A 1OZHA 2NTEA 4V0KA 4Z3OA 3D5TA 3R3XA 2HREA 3T9BA 5IU6A 1ZAKA 5H83A 2BKEA 3JYHA 2FPUA 2JDIA 5EMKA 1TYAE 1GKIA 1MT3A 4HSGA 5JNRA 2RD2A 2R6R1 3ZY2A 4B43A 4DXHA 1W2GA 1J49A 3HDHA 3HO8A 5CIYA 3VAZA 2YV5A 3A9CA 5J5AA 1BKSB 1DV2A 2WW8A 2ZWAA 2ZBRA 3BXEA 4JWKA 5CVDA 3D2LA 5E2AA 2B1QA 1MLDA 2XLCA 3KQQA 3GYGA 1RIIA 4EUNA 2ZE8A 5GADl 1TL7C 4D82A 3M5PA 4OEHA 5AOBA 2CLLB 2IHYA 1V11B 1XX6A 3I9NA 2QXYA 4M21A 4UAJA 4H6PA 5EJ5A 1OH6A 3FLAA 3LG2A 4MSUA 1EFDN 1GUZA 4NAUA 2JNWA 2EZTA 1TU4A 3GP5A 3HUUA 2CE7A 1ZOLA 4J7XA 5JWRA 1PJTA 2HSGA 3PXDA 3GLUA 4V1CI 4DLUA 2VDUE 1ESMA 5EXEA 1N2JA 1Z0AA 4HB3A 4Z4EA 4YP9A 4LAFA 2QTHA 5FTMA 1WVGA 3CR7A 1DX6A 1I7LA 2OAGA 3QVLA 4G36A 3MG9A 5CX1A 1KJJA 4AY5A 4PLHA 4ZK6A 5FBVB 1CUWA 3AR7A 4Q6WA 2PGNA 3L41A 3TM5A 3UF0A 2QIPA 1I1QB 4YB8A 4IIBA 5DGDA 1NW3A 5LLDA 2WIKA 4X6UA 2PX2A 2XNKA 4CG3A 3AHEA 3ESBA 3EIEA 3PUZA 4J3JA 3BREA 3PRYA 3NOXA 3R4VA 4IO1A 1S01A 4JXJA 1OXKB 2GFHA 4HMPA 1V5WA 2F64A 4Y2UA 5FBKA 3M4ZA 2X5KO 1I6LA 3BUSA 1LQUA 2YIVX 3U4DA 4H3HB 1IK4A 1W2HA 2H2GA 1HXHA 2RHLA 2JH8A 1JDZA 2DB3A 1M2FA 1QGUA 3ELYA 1L7EA 1JLSA 1QVAA 1VI5A 3DFUA 4HGYA 4KI7A 2IH5A 1XF9A 4D96A 4DQUA 5F3WB 4JBYA 1R9MA 3Q3EA 4IAOA 1H94A 4NVRA 3SYKA 1GD1O 4UJ5A 2GAJA 4UM8B 2ZVQX 1G17A 2Q45A 5CXQA 4E2XA 3DF9A 2V6IA 4J49A 3UJ9A 3DYIA 2C7PA 2G07A 4Q21A 2C8KA 4HF7A 3R9WA 3KUDA 2Q8NA 5JD6A 3QXCA 4RYDA 3VTZA 1SKBA 4IWXA 4HX2A 1H0HA 4I2VA 5DBIA 1YZVA 4KDFA 4WK0B 1O0SA 2G25A 3KUUA 3L6BA 5EUBA 1N8NA 2Q4RA 1XWWA 1B3BA 4MJLA 5DU2A 3RFTA 3BRWD 2Z9DA 2RHJA 2RDMA 4DC1A 3QJGA 5TGTA 3KKOA 5A7GA 1KZ7B 3WB0A 3HDTA 2NU6A 4FFMA 2IIVA 3UC5A 4F4UA 2IZZA 3IPLA 4CL2A 1KI2A 1E4OA 3V1YA 4XCXA 1NW4A 2IQIA 4G84A 4EWLA 4KIJA 5KYGA 4X61A 2YYSA 2VFAA 2JD1A 4PS0A 2QW1A 2B3DA 1H65A 2C03A 2YWCA 4XIYA 1JPVA 4LMBA 4X45A 3DHYA 2BH9A 2E3JA 3TZKA 1TT7A 2QW8A 2Y76A 4I0WB 2MJLA 2RGDA 3BZBA 5E1BA 5A3RA 2Y1OA 4DN6A 2EKPA 5JJBA 4O0MA 5EZSA 3HDGA 5GJVC 2YZ7A 1FBTA 2VJMA 1GU7A 5B3AA 1UEJA 3H8SA 3HDQA 3NDIA 3E35A 3EHDA 1B43A 3TW8B 4YUAA 5KQSA 1OI4A 1LS6A 2RAFA 2Q6OA 3MMNA 4NZPA 4FOLA 4L3OA 3TCXB 3LGXA 4WOBA 2WJ4A 4MAAA 4MQFA 2B37A 1IEWA 2TMGA 2WYOA 3T12A 2OG1A 3JARA 3FKQA 3V97A 3CVJA 5FH9A 3V4PB 3NCTA 5J23A 1KOGA 5BT9A 3OAAA 3W0LB 1J6UA 1UJ6A 4ZOQI 5KSZA 1RRVA 3ZDZB 2R8ZA 4RS4A 2CXNA 4UDNA 1MC4A 2I4TA 1USUA 4JJKA 5JROA 1J09A 1OXSC 4U7FA 4L4XA 2X0KA 4AMYA 3OOYA 5A0TA 1GAEO 3OPYI 3VPGA 2NO1A 1LEHA 4MV0A 4B3RB 3NAMA 3R41A 4TMWA 4UNPA 4MAFA 2B8EA 3ESDA 3FNFA 3EZ2A 3GOHA 4QBGB 4ZDKA 2XQVA 4W5NA 4RLHA 1ZZEA 1ZHFA 1XD2A 3C6YA 2J0QA 1CVLA 1QWSA 3HVRA 3HUFA 1H4SA 1T9GS 4IKOA 5ALIA 1H4VB 1B0PA 4G4JA 4QWMA 4LF7B 2D1SA 5EP1A 3PC6A 2PZLA 4TYNA 4GX5A 1JQDA 4LCBA 1O94C 3RSSA 3ZCPA 4C0LA 5ITZA 1Z2CA 2DLCX 1CCWA 2R47A 4IDUB 1WCWA 2WEKA 3DOEA 3CZPA 4NS1A 4DPLA 1RLTA 1Q11A 3PC8C 3NHYA 1L5VA 1E2EA 1WCV1 1N0VC 3KBOA 1D1TA 2QUJA 3A14A 4AJPA 4PLFA 4F5EA 2G09A 4RM2A 1CRQA 3IBCA 2GUWA 1T35A 2OENG 4X1YA 4BLPA 2Z6AA 1VMKA 2EG5A 5LR6A 1GPH1 2ONZA 4RY9A 2AD5A 1VYVA 1FFSA 1SXIA 1WW3A 2D13A 3KV3O 4FFBB 4JXZA 3EZ7A 2I2WA 1JNXX 2BM0A 4F96A 2VSQA 3VPXA 3LY5A 4CV1A 4YAGA 1B0AA 1ZIDA 2UVDA 2QRKA 3TG8A 4Y6OA 1M2OA 1VJ0A 3L8FA 2I22A 4TXHA 3WB9A 3JX9A 1P60A 4PSAA 2HX1A 2XWBF 4UM9D 2R00C 5FUVA 3TLGA 3BH6A 3R76A 2HOQA 4WHMA 1C0IA 4F8EA 4FLMA 2PH5A 4ZAXA 5BN4A 5IAJA 1G8GA 4W8OA 1R9NA 4MVWA 4URFA 1DS6A 1E2LA 3ITNA 5BV1A 1S0UA 1WTAA 4E4YA 1CHNA 4IIYA 1ECLA 2ZAMA 2ZJ5A 2C97A 5K3BA 3JXEA 4BX9A 5DXFA 3G2NA 3M9WA 3PC2A 3F8WA 3Q0EA 2QVXX 2ZR0A 3LO5A 5GQSA 4JQSA 4CYMA 5A4IS 4BFCA 3PNYA 3GRPA 1DADA 4N3AA 3Q8KA 4OL9A 1RFLA 4HZUB 1EIZA 1DBSA 2Q6VA 3SHQA 3W1VA 5ILOA 4R1LA 1E5TA 1P8JA 3BN3A 1N5RA 4HOYA 4L72A 1NBOA 5D1HA 3DE1X 3K2BA 1Z17A 3ADPA 3OT1A 3LHKA 3R0QA 3RVQA 4CF6A 3QXHA 1A82A 1GNSA 1YRHA 3EAQA 3E9CA 3EVFA 4J8PA 4MB6A 4MS3A 3SE0A 4DVJA 4ER0A 3QV2A 3HXTA 5AXBA 3UKDA 3ZCUA 2VH1A 5CK5A 1GARA 1PK8A 1N0WA 4AL4A 5KYVA 2C9CA 2GO1A 4AF7A 3EXHB 4JASB 4Y30A 3E7PA 3L7KA 3MTBA 1IHUA 5CEEA 3RWOA 1W1IA 2IEDA 4ND5A 1GILA 1NMQA 1WDWB 3CEHA 3KV1A 4F4HA 3P1JA 1TLLA 2C2ZA 2VIIA 2Q5FA 2VNSA 3DVAA 2O2ZA 3K5IA 2X1VA 3P5SA 4P32A 3IIEA 1Z45A 3LIPA 3IKVA 4OXKA 1U4SA 4EFKA 1VECA 1KH3A 3P9XA 2PLRA 3LFUA 3PVZA 1Z39A 3F3YA 3TXXA 3WZ2A 4XJVA 2FQYA 3AHIA 3M6AA 1IY1A 2R62A 5FO1A 2F1OA 1HG0A 2BLNA 3ED1A 4NR0A 1OLSA 4EUHA 2DPYA 2WE8A 2C7RA 1R4MA 1XTVA 1TZ2A 1WA5A 1LV8A 2OZEA 3DXFA 3ELWA 3EQ7A 4NF2A 5IAKA 5LA6F 3OM1A 4D3FA 1DCFA 4K9RA 1WBDA 1NKVA 4JVLA 2PPVA 2C2WA 5M2QA 4NULA 3JS5A 3ZKAA 2QUHA 4TKZA 1ESCA 2NSYA 4G9EA 3AERB 1XC7A 2NTVA 4FQ8A 4RAOA 2O2HA 3FIJA 3KHKA 4DAOA 2OTCA 3P9IA 4NARA 2WRZA 2O54A 2O0LA 1KI9A 5AK5A 1I2MA 3M82A 4Z9AA 5G0VA 1E18A 3BKXA 1I13A 3MJEA 4Q4DA 3ZZTA 1GTRA 2CSXA 2XTMA 5CFNA 2PMKA 4F12A 1FRQA 1HL3A 1PVDA 2PT7A 4OGLA 2NZJA 2ZIVB 4YRPA 5KTMA 4URYR 4DV1B 3QVVA 4XYGA 1NW8A 2IV3A 1KA9H 3VR5A 2WIBA 1ODSA 4JYAB 2O7RA 3E81A 3DT8A 3ENKA 1BQ4A 1NONA 2XD9A 5TXGA 3USZA 3F3MA 3W2IA 4Z5XA 1YR3A 3NGLA 4RD2A 4ZREA 4MKIA 5BWBA 4FC7A 1XMQB 1T25A 2H6EA 1T1IA 3TK1A 3A2KA 1RI2A 3F96A 2TSYB 4MYHA 3OE1A 4DBLC 4J0HA 4G0ZA 3N7AA 4YAEA 1NP7A 4KQJA 3ZHYA 3TJRA 3O3NB 3U3ZA 1LK5A 3I2KA 4N0EA 1EUQA 4REQB 1VSBA 2I4NA 2JCXA 2OWEA 4DA4A 4Q1CA 1GZ7A 3LVBA 2BEUB 1I3OA 1N9GB 2DUMA 3ETGA 2QYSA 5B1IA 4QQNA 4LF4B 4X1IB 2NMVA 4R5HA 1CJKC 2X7JA 3V00A 3ZZUA 1FW6A 5FI1B 1RQ7A 4ABYA 2R6DA 3U39A 4IR7A 3V55A 2EC5A 3DBOB 2MR6A 2DUJA 1VMIA 4D3DA 3A9SA 1XNHA 1JHOA 4HQLA 1IZZA 4KQCA 3VH4A 1ZGGA 2IPNA 5AHXA 5LXTB 2GBFA 2HRCA 1FCJA 2IKQA 2WAAA 3EVTA 2FKAA 2FG6C 2ZDGA 3L7BA 4HEJA 2FRDA 3FCXA 3KLBA 4PGMA 4O3MA 4B6FA 3FNRA 2ZWVA 2KMLA 4R54A 5TJHA 1NVMB 3SJ7A 4OHZA 3MSXA 3AF4A 2G9NA 1IZ9A 1JDBB 3KJZA 3Q8MA 1MX1A 3VVCA 1OMOA 2FH5B 4ZXFA 5E95A 1W5EA 2EFYA 3OY2A 1SBQA 2J4CA 2AJLI 1GKUB 1F51E 2YWJA 3D1VA 4KMOA 3STYA 5BOSA 1TGYA 4MZXA 4B2IA 1VE6A 2BJHA 3ILHA 1BS2A 1NVKA 7MDHA 4P4SA 1QK5A 4H4EA 1CR6A 5CPBA 4LGMA 5F52A 1A7JA 1Q6ZA 3OMWA 4BGIA 2FUNB 5A62A 3GVHA 4Y7DA 4KN6A 1JHXA 3PGJA 3T61A 3TRDA 4AURA 1NUTA 3WWZA 1WXDA 3GFVA 1H23A 3FGNA 3NBXX 1N3LA 4GDFA 1L3CA 4HTFA 1OHHD 1C9YA 1NJ5A 5KNBA 1AUXA 4GO1A 1P80A