3F67A

Crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
240
structure length
240
Chain Sequence
NAIIAGETSIPSQGENMPAYHARPKNADGPLPIVIVVQEIFGVHEHIRDLCRRLAQEGYLAIAPELYFRQGDPNEYHDIPTLFKELVSKVPDAQVLADLDHVASWAARHGGDAHRLLITGFCWGGRITWLYAAHNPQLKAAVAWYGKLVGEKSLNSPKHPVDIAVDLNAPVLGLYGAKDASIPQDTVETMRQALRAANATAEIVVYPEADHAFNADYRASYHEESAKDGWQRMLAWFAQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative Dienelactone Hydrolase from Klebsiella pneumoniae subsp. pneumoniae MGH 78578
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
molecule tags Hydrolase
molecule keywords Putative dienelactone hydrolase
total genus 81
structure length 240
sequence length 240
ec nomenclature ec 3.1.1.-:
pdb deposition date 2008-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3f67A00
1XQWA 4DYHA 1XZGA 5LIPA 3PDCA 4AMYA 3HI4A 2B9VA 1T4MA 2PKYX 2DHCA 2CJPA 3V1NA 5DTJA 1A88A 1QFSA 2P8SA 4Y2VA 3H2HA 4TVKA 5ALZA 1ORVA 4FNGA 2VJAA 3V48A 3B3QA 4QLAA 5HK9A 1Q0ZA 1CUFA 2QS9A 5BV7A 1XZIA 5AKKA 3R3UA 1LNSA 3OG9A 3DDUA 2C4HA 4BTVA 3I1IA 4KE6A 5D6OA 1L7QA 1BE0A 3B5EA 3DYVA 4JYMA 4BDSA 2QUBA 1MNAA 4X91A 2I3ZA 5AK6A 3W2TA 3BL8A 4Y2PA 4LKOA 1OCEA 4W1RA 2XQGA 1JJBA 4MQMA 3S2ZA 1XROA 4LYEA 2WTMA 5DYYA 1FSSA 1PV1A 3WIBA 5CXUA 2OAGA 2XMQA 3RARA 2RONA 4BAGA 3H2KA 4K6GA 4A5SA 4CIBA 1BCSA 1Y37A 2WIGA 3UMJA 4HRXA 2HDWA 3C70A 4J0KA 3GFFA 2E3JA 4UHCA 1JJIA 3ESBA 2XLBA 1GKKA 1ZD3A 4M0EA 3C5WP 5HK8A 1SCQA 3SX4A 2WFMA 2XUAA 3P2MA 4V2IA 2VSQA 5AM4A 4U2DA 3DCNA 4WFKA 1VOTA 1J1IA 1VKHA 3V1LA 3BIWA 4FTWA 5K3EA 1YSCA 3D59A 3DQZA 5AM0A 4DLNA 5DLPA 2VJDA 4KR0A 2HA3A 3BWXA 1QLWA 4XIIA 5EHZA 2EEPA 3WYDA 2WIFA 5ALPA 3RLIA 3G7NA 3X3HA 3D3NA 1Q0RA 5EFZA 1CUWA 2PSJA 4DNPA 1DINA 3I2IA 3FVRA 4N5IX 5FLKA 5HZGA 1XLWA 3A2NA 5LLSA 1WPRA 3FYUA 3WKCA 1XZAA 2QXUA 3WI7A 2WG0A 1XLVA 2ZJ7A 5EIAA 1VXOA 2WHPA 1FFAA 4CIAA 5LZ2A 3M3DA 4C87A 1CUCA 1EHYA 5CH5A 1TCCA 4AX4A 1WB4A 5AOCA 5CT9A 1R9NA 1AURA 4E46A 3G9ZA 1ZI6A 5ALLA 1VA4A 2OPHA 5A2GA 4AZ0A 5JZ9A 2OCKA 2R11A 3WA6A 4LYDA 1XZJA 2HU8A 4Y2JA 5LYYA 1UKAA 5JARA 1BN6A 4ZREA 4EZIA 1MX9A 5BOVA 5AKLA 5DJ5A 2GBCA 4BVKA 1A8SA 3D0KA 3G02A 1LPNA 1ZI8A 2DFPA 5AIBA 4KRYA 4DMFA 1MX5A 4B6GA 4WFJA 2QOEA 5HF8A 2FUKA 4BZZA 1CIJA 1CUIA 1USWA 4AMZA 5AICA 1DTEA 3DD5A 3VJKA 5D3ZA 4JH0A 1NU6A 3H2JA 5JANA 2OGZA 4DMHA 2DSNA 2PSHA 5LZ7A 3QMVA 1ZD4A 3H18A 5E2IA 5CT5A 5YASA 1BCRA 2GBIA 4OB6A 1R50A 5AK5A 2HA4A 4EY4A 2Y1KA 3IVMA 3A70A 1FFBA 2WUGA 4XWGA 3WWOA 1QZ3A 4B85A 1WOMA 3WLAA 2WUFA 3D2BA 5JD6A 5LKRA 1XRRA 3F96A 1R88A 2GZSA 2WUEA 1SC9A 5IVDA 4BC0A 5ALTA 2D5LA 5EHNA 2WSLA 4OYLA 3FYTA 1VE7A 4H7KA 4JYPA 1UOPA 4G4IA 2QJWA 5ALQA 1PJAA 4BTLA 1ACJA 1XFDA 3AZPA 5HKAA 1I6WA 5KREA 3DL7A 3WZLA 1DT5A 1ZGBA 3STWA 1EDDA 5DNVA 1QOZA 1XRNA 2ONCA 3H17A 5ALIA 2OQIA 3WK8A 3WQHA 1R4ZA 3OM8A 4U2EA 3WK4A 4B0OA 1ZGCA 4ZV7A 2QJRA 5JADA 1H22A 1GKLA 4W9RA 2XMDA 5ALHA 1XQXA 2HFJA 1ZD2P 2WFZA 3ESDA 3W05A 4PO3X 1DWOA 1VXRA 1ZIYA 1IMJA 5JYCA 1U65A 1E8DA 3F97A 4LXGA 4WY5A 1VLQA 3ICVA 2XDWA 2JF0A 4Y2RA 3BF7A 3FBWA 4MWTA 4Y2SA 1DQYA 1EINA 4J7AA 2H9YA 4BE9A 2J3QA 1TKRA 4LXIA 4KAFA 2C5FA 5JALA 3MUNA 4X85A 3I2HA 4U2CA 4NZZA 1MAHA 2XE4A 3SWWA 2ACKA 4C01A 3G9UA 1QIHA 5JASA 3AIMA 1EB9A 1XZLA 2ACEA 3G9XA 4RPCA 1W6RA 5EGNA 2IIVA 5DWDA 5AI4A 5BWCA 3A6ZA 2XQIA 1W76A 2OCLA 3SC2A 4M0FA 2JGIA 2AJDA 2VATA 4PNZA 3HC7A 5DTIA 4Y2TA 5I9IA 3GELA 4DIUA 4QWWA 3V9AA 1E8NA 1MN6A 3EIOA 1QTIA 3F98A 5ALWA 2H7CA 2ZSIA 1ETHA 2Y2UA 4AXBA 2WG1A 5AM1A 2QKYA 4F21A 1X2BA 3JWEA 3IDAA 3FAKA 4J03A 3O4GA 5AKHA 1ODTC 5FDFA 4EHBA 4MYSA 1NX9A 3T52A 3WKAA 2J4CA 4OB8A 1FJ2A 4MEAA 4BB0A 3H1BA 2X76A 5AKXA 1BS9A 3VJLA 2XUJA 3BXPA 2Z3ZA 3WWDA 4RE5A 4N8DA 3IIIA 1SOMA 4PW0A 2DQYA 4QDXA 1QIJA 5ALUA 4QDOA 4BAUA 1A7UA 4Y2UA 3STVA 5K3BA 4G4GA 4WDQA 1W4LA 4OU5A 4C89A 2VJBA 1IZ7A 2JEYA 3NUZA 3OPMA 1UKCA 4IHAA 3CCBA 5FOQA 3DOIA 5T4BA 1XZMA 2PU5A 3I28A 3HXKA 7YASA 1CUHA 5DYWA 3LCRA 5AHXA 1H2XA 2G63A 1N8SA 3KWFA 5ALKA 2JGMA 3R3XA 2BFNA 4S0XA 3L1IA 5KBYA 5DNUA 1GQRA 5AKZA 4J0CA 1C4XA 1VZ3A 1FFDA 2C58A 1N1MA 2WJ6A 1A8UA 1F6WA 2XUOA 3R3YA 4DMKA 1EVQA 2YXPX 4WCVA 4P9NA 3GROA 1Y7IA 3CN7A 4W1QA 1EDEA 1AX9A 4MEBA 1Z68A 5JD5A 1BRTA 4BCCA 5JZBA 2X5XA 5FXMA 3I6YA 4G4JA 3AFIA 4P92A 5DNWA 4KEAA 3FLEA 3IUQA 5DYTA 2WIJA 5EIEA 3B12A 3DKKA 4DSZA 4GLBA 5AI6A 3AIOA 3G0IA 3WIOA 3D5EA 3MUOA 3Q0TA 3UUFA 1F8UA 3WJ2A 1X70A 5LZ9A 2WHPB 3O95A 4O08A 2EDCA 2VJCA 4JUIA 4FWBA 1CUEA 5AOAA 4DTCA 1A8QA 2QR5A 4FFVA 4B83A 2BAGA 2PM8A 4P93A 2D0DA 2ECFA 3FNBA 3I6MA 3PUIA 2FJ0A 1XZEA 3PF9A 3C8DA 2XMRA 4Q3LA 4M0MA 1JU4A 1AUOA 3E0XA 5HF9A 5ALMA 2FX5A 2BCEA 1RYYA 5EHXA 1AMNA 4X6XA 1G4HA 2OXEA 5T4HA 1TCBA 5ALOA 1G66A 5IVIA 2VA9A 3GBSA 3QVMA 5CURA 4N5HX 4ETWA 3PE6A 3ZV7A 5AK3A 2OCIA 4G9EA 4WY8A 3NOXA 5CXXA 1MTZA 3GZJA 5LZ5A 2NW6A 5CT4A 4FLFA 5K5EA 4XX1A 3W04A 4Q3OA 4H18A 5JZSA 1HL7A 1T2NA 2WG2A 1JU3A 3IUJA 2XUGA 3RK4A 1JT2A 1JFRA 4UUQA 1G5FA 1PFQA 5AH0A 4AB1A 4HXFB 4XVCA 1P0IA 1IUNA 2C0QA 1ZI9A 1EI9A 5FRDA 1M33A 4AN0A 3PICA 4G9GA 4OCZA 2WJ4A 1AGYA 4UBJA 3STUA 4UHDA 2XI4A 3BJRA 3QZUA 3FVTA 1EH5A 2JGJA 2Z8ZA 1IUOA 5T4EA 5ALRA 2YASA 5KWIA 3DEAA 4J0DA 1ODSA 3TJMA 4F60A 2DHEA 1Y7HA 5JAOA 1MO2A 3AIKA 1GPNA 4C4YA 3I2FA 3T4UA 2BGNA 3VISA 1CUJA 1K8QA 1C7JA 2GYVA 4FDMA 4NMWA 5FUMA 1XRPA 1E89A 1VJ5A 4B9AA 4GI1A 1JI3A 4LIPD 4UBOA 3WL6A 1CUGA 3VKFA 4G8DA 1CUSA 3G0DA 1UOQA 3A2LA 1UK7A 2QM0A 4J0HA 4BVJA 2DR0A 3O9MA 5A7GA 1BN7A 1UFOA 4QDTA 4PSDA 5K3AA 3WMRA 3WJ1A 1DU4A 4ARAA 4B0PA 1FFCA 3K9BA 2XMSA 3M82A 4Y2XA 1D07A 1LPAB 3O0DA 1LPMA 4YASA 5A7HA 5C81A 5IVKA 4Q82A 5A6VA 2ROQA 4X95A 4NS4A 3KOOA 4FLEA 2WKWA 3QM1A 2UZ0A 3PUHA 1DWQA 4H7JA 4IH9A 2IITA 3ZLTA 4X7BA 4X71A 1KU6A 3OOSA 5A7FA 4U2BA 1XKLA 2Z5GA 2Z3WA 2G5TA 3ZPXA 1Q84A 1CUZA 4X97A 2PUJA 1S8OA 1B6GA 2WQZA 1HLGA 5K3FB 1QFMA 1N5RA 4UFOA 1K63A 4X90A 5ALGA 1ZD5A 1LBTA 4P08A 3QH4A 4OYYA 3A2MA 3KDAA 5D7BA 2XB6A 4CCWA 4DM7A 2VTVA 2HU7A 4L72A 3OTQA 2GYWA 5JAUA 4C4ZA 2WUDA 2QXTA 4K2AA 1YAJA 1F0NA 3C6YA 1KU0A 5AI9A 3U0VA 5ALYA 1THGA 2WHQA 2ZYHA 1TAHA 2PL5A 5K3FA 1P0MA 2VF2A 4I3FA 2EDAA 3WK5A 2HA7A 1WB5A 3WZMA 4EA6A 4H7HA 4BATA 1TQHA 3QPDA 5HQ3A 4CG2A 4PV7A 5ESRA 3IA2A 1KEZA 2BGRA 2ZVDA 1GQSA 2AXEA 1BEZA 3AILA 1QO9A 5SYMA 4MXDA 4U2FA 3PFBA 4DGQA 1ODCA 1YA4A 1E5TA 1K5PA 1ZJ5A 2YYSA 4ZRDA 4EUSA 2QZPA 4BP8A 5IH7A 3CXUA 2C5GA 1XZDA 4B9EA 3WWEA 3G8YA 1QIDA 2OCGA 3FSGD 3C6ZA 3G0GA 3MGAA 2C0PA 4CCYA 3V1KA 2V9ZA 3OC0A 2G4LA 1SCIA 3UUEA 1RP1A 4Y7DA 3E1GA 4PF1A 2W6CX 2K2QB 2PBLA 1CFJA 2BUAA 3D2AA 2XUHA 1H2WA 5IKXA 4JEIA 2I03A 1QONA 4FBMA 3FYUB 2ZJFA 1E66A 2WM2A 4W1SA 1GPKA 4HS9A 2VAVA 4Z49A 4DMCA 1MAAA 3FYUC 4GEGA 4QWMA 4J3JA 1XLUA 1SFRA 4CG3A 1JJFA 2OG1A 2GBFA 1XZCA 1AZWA 4A23A 4BYMA 1Q83A 2O2GA 4OD0A 4WJLA 3ZLUA 3C45A 2PU7A 3VVLA 3STTA 4GDMA 3D2CA 1YB7A 1CPYA 2HFKA 3DL4A 4AQDA 2V97A 4J0GA 5AK4A 2XQFA 4FOLA 1U8EA 3NWOA 5C8XA 4H7FA 5BWBA 3LIIA 2VEOA 2AJCA 1TIBA 4BCDA 1QIFA 4UFNA 2DHDA 5CMLA 2X8BA 1RWQA 3QITA 5E4JA 2XMBA 2QMQA 1XZHA 3HSSA 4CI9A 1YS1X 3H2IA 4UBNA 4LXHA 2PSDA 1LPPA 3HEAA 4B80A 4J0JA 1UK9A 1CVLA 3C8HA 1JKMA 2PPLA 5FPPA 2OAEA 2Y6UA 5CH3A 2ORYA 2BUCA 4PSCA 5HFNA 2CKMA 4UHBA 2OQVA 3S8YA 1THTA 2XUKA 1TRHA 2RIPA 2QUAA 4X00A 4L0CA 4QEKA 5AKEA 1AQLA 1ZIXA 1CR6A 5AI5A 3RM3A 2XLCA 5FPQA 5AM2A 1NU8A 2CZQA 3WL7A 5C8VA 3BDVA 2V96A 1MNQA 2ZYSA 4ZI5A 2XMGA 4ARBA 1TK3A 4IH4A 5IVHA 3D7RA 3F9CA 4HXGA 3WK7A 4FMPA 1MPXA 4FHZA 4G1FA 4DNOA 1QGED 4C88A 1YS2X 3G9TA 3IULA 1FFEA 3ANTA 1CQWA 2WTNA 1YR2A 2JGFA 1H2YA 3AZQA 1HQDA 1YASA 3CN9A 3DOHA 4YX9A 2XQJA 2PSEA 3ICWA 1U2EA 3EQ8A 5ALVA 4PSUA 1WM1A 2Y2VA 3O4HA 1K4YA 1CLEA 4AZ3A 4XJVA 3E4DA 4CG1A 3R3ZA 3PFCA 1LZLA 5AM3A 3LS2A 5E4TA 2VQ6A 1BROA 1MU0A 3W9BA 5FV4A 4K6KA 4INZA 4EB0A 4F5ZA 1R3DA 3JW8A 1XZKA 1AC5A 3AJAA 1ZICA 1GPLA 4Q05A 5AM5A 3HABA 1QIEA 4E14A 1B41A 3IBTA 3E3AA 4UBLA 1K6EA 3LIPA 2RI6A 5AI8A 1XRLA 2HIHA 3KXPA 2WJ3A 4OUKX 2WHRA 5LZ8A 4EY5A 1U4NA 5JIBA 4KACA 4GHWA 3TEJA 4BZWA 4RNCA 1CUUA 4E11A 3NGMA 4Q1VA 2XUPA 2B20A 3QPAA 4ZXFA 3V1MA 1EXWA 2O7RA 4G8BA 2XQKA 1HPLA 4QE3A 3R0VA 1MJ5A 5AO9A 1QJ4A 2XMZA 3VVMA 3BIXA 3I2GA 1LBSA 4Q3KA 4G5XA 3HLKA 3N2ZB 5SYNA 5AKYA 3FLBA 4AO8A 3R41A 3PF8A 3VJMA 1JMKC 4K5QA 2H7XA 1MX1A 3DNMA 2GBGA 4N8EA 3I2JA 2QT9A 3O9VA 1EB8A 4G8CA 4UBIA 1CV2A 4X94A 3FCYA 3GUUA 5AKIA 2C7BA 3ESAA 3HZOA 4KYVA 3PI6A 5EHQA 2DQZA 1IUPA 4QA9A 2HHAA 2CUTA 2ES4A 2ZJ6A 4UHFA 2XUDA 1ZOIA 5I8PA 1WPXA 2OGTA 1J06A 4OPMA 1QIKA 2Z8XA 4FNMA 4BDTA 2HRRA 4H7IA 3K6KA 2JGEA 4RE6A 4GBGA 4UBKA 4B84A 6YASA 4QDUA 3HYSA 4BE4A 3KD2A 3IUMA 3N0TA 4X93A 1E3QA 4EY7A 3H04A 5K3CA 1YCDA 3AUKA 1R9MA 2R8BA 3FLAA 1XQVA 4GWLA 3KWJA 5F4ZA 2JBWA 1EK1A 3C6BA 3IUNA 4OSEA 3DLTA 5J3JA 4L3WA 4FBLA 1QIIA 5HFAA 1CUBA 3WK6A 4CFSA 4KE7A 4BRSA 3ZLVA 3WWPA 1HDEA 3EQ9A 2WIDA 1YA8A 3WL8A 4TPKA 1R1DA 3DS8A 2H7YA 4QLOA 3QPCA 4HVTA 4L9AA 2GYUA 5AP9A 1UK6A 5C8ZA 2AJBA 1LZKA 1LPSA 1UZAA 4MWSA 1VZ2A 4B82A 5JAHA 5CTAA 2XUIA 3R3VA 4HRYA 2QRUA 1QIGA 2J3DA 4OB7A 3HJUA 3ESCA 2CB9A 5JD4A 4UBMA 5LP1A 3BJMA 4HZGA 3O4JA 3R40A 3F8SA 4FFWA 3OURA 2O7VA 3WA7A 5A71A 5FP0A 5CT6A 4H7EA 2BJHA 1QE3A 3C5VA 4K6HA 4C4XA 5EI5A 4X92A 5C7YA 4BP9A 1W1IA 4H7DA 3WK9A 5CBKA 2B4KA 1XRMA 3FOBA 3R3WA 4FLMA 2WILA 2O2IA 2FJPA 1GT6A 4NVRA 4QZVA 4YPVA 5CT8A 3I6ZA 5I7UA 2HA5A 1P0PA 4UFPA 4WDRA 1GXSA 4E15A 2AJ8A 5ALSA 3ANSA 3STYA 5HKBA 1ORWA 2Y6VA 1UWCA 5HCUA 5AKGA 5AOBA 5CH8A 4JNCA 1UOOA 1OILA 4J0IA 4QDZA 1XKTA 4A16A 1GZ7A 3KSRA 4H0CA 2W22A 1QTRA 2HA2A 4EY6A 1LLFA 2CMFA 1UKBA 2WFLA 3ILSA 5JAPA 4H77A 4CCYB 3BF8A 4D9JA 4Q34A 2HRQA 1JMYA 3SK0A 2Q0XA 4DNFA 1OXMA 1L7RA 4W1PA 2XT0A 3I1YA 5FKJA 2VT7A 1W75A 5HF6A 1X2EA 2OGSA 4BVLA 4U2GA 4UHHA 5ALJA 3CCCA 3FSGA 4KAAA 2QTBA 4MQLA 3AZOA 1CUDA 2JEZA 3DYIA 3Q8WA 3VDXA 1CRLA 3BDIA 1EX9A 1O6FA 5AI0A 4OU4A 4QNNA 5AKJA 4FKBA 5ALXA 5EIHA 5HQ3B 3AINA 2XUQA 4WFIA 2B61A 2ZYRA 5AJHA 3WWCA 1AKNA 1EK2A 5KWJA 1YB6A 3DKRA 3EQ7A 2JGLA 3F67A 4I19A 2HL6A 2RAUA 2LIPA 2I78A 2XMCA 1WHTA 3H19A 2RHTA 2GZRA 4DSAA 1ZJ4A 5T4FA 4X3CA 4BRZA 2IX9A 4BCBA 3K2IA 3U1TA 2YH2A 1UK8A 4H35A 1LPOA 3M83A 1BU8A 2ZYIA 2J4FA 3EBLA 1XQYA 4GXNA 5D3KA 4UHEA 4ZGBA 3GA7A 1C7IA 4GECA 3IB3A 5ALEA 4X6UA 4YK7A 1L7AA 1XRQA 4ITVA 3YASA 4TGLA 3TGLA 2OLEA 3C87A 5ALDA 3FWHA 4IQ4A 4BC1A 5K3DA 4Y2QA 1HBJA 2JIDA 2BKLA 1SCKA 1H23A 2QVBA 5LKAA 4B81A 1CQZA 2PSFA 3L1JA 4KRXA 2WU4A 1EVEA 4HXEB 3G0CA 1WHSA 3QMWA 2HA0A 3L1HA 5HF5A 2VT6A 1YAHA 1CUAA 2V98A 3HRHA 3I2KA 2RGUA 1EDBA 2WLSA 3QYJA 3H1AA 2H1IA 5ISMA 2WU3A 1LPBB 3VXKA 2PX6A 5CRIA 1UXOA 1BEEA 1DX4A 4EBBA 2DCMA 1CUXA 1DQZA 3JYHA 3QMMA 2WFLB 3HACA 4UPDA 5ALNA 1DX6A 5JATA 4ZV9A 2HM7A 4ZWNA 3IURA 3BE8A 4IH1A 1IZ8A 4AO7A 3WL5A 1CUVA 3G0BA 1WCYA 4PQEA 2HU5A 1ISPA 5AIAA 3ED1A 1O6GA 3M81A 2XUFA 4BAZA 4KJXA 4EY8A 3EF3A 3QBJA 2BUBA 2ZSHA 1VE6A 1N5MA 1EA5A 1H2ZA 4IO0A 4I4CA 5CW2A 3WYNA 2RHWA 4KE9A 1TCAA 1DT3A 4B7ZA 4DNQA 4KAJA 1WB6A 1CUYA 1XZFA 1W52X 4ROTA 1MT3A 1CEXA 1E8MA 1P0QA 2HADA 3WKDA 2CBGA 1UT6A 4AO6A 1J2EA 1F0PA 5LZ4A 3W06A 1QIMA 4GW3A 2CEKA 2I3DA 2PUHA 5E4YA 1DWPA 3TRDA 1XZBA 4MJ3A 3C43A 4X6YA 1ACLA 5H3HA 2HA6A 3MVEA 1IVYA 4HTAA 3LLCA 3D4LA 1J07A 4BBZA 5A62A 2AJLI 4C6HA 3ZI7A 3WKEA 2G5PA 1G42A 3C6XA 3LP5A 5ALFA 3W9UA 4N8SA 4LHEA 3FCXA 3O4IA 1GGVA 4Y2YA 4RGYA 2PVSA 1VA5A 4MYDA 4KE8A 3ZWQA 3RKSA 4F0JA 4AN1A 4Y9SA 3H0CA 2WIKA 3DJYA 2O2HA 3WKBA 1LGYA 1HKHA 1QO7A 2VAXA 2JGKA 4HAIA 4W63A 3H2GA 3STXA
chains in the Genus database with same CATH superfamily
3VYRB 2NYUA 4N5MA 3ZN2A 5FHRA 1FS6A 1PP4A 3LZDA 4F5EA 2ZYUX 1U3FA 1VPEA 4BLVA 1AUXA 3TPFA 4ED9A 3OTGA 3PDCA 1BVYF 1PL7A 4KLCA 4FDUA 3T38A 2B2NA 4HNVA 5J4HA 5TMBA 2XB4A 1T4MA 4G5HA 3VBCA 2OHFA 1UMCA 1OZ0A 1QHHB 1XHFA 3OAAD 1JDZA 1F1JA 4PIMA 4Z8XA 3HYRA 1XDZA 1PK8A 3K09C 5BSUA 1KJJA 3SC3A 5T67A 2FPWA 4EMUA 2BP7A 1XDDA 1DKPA 3GDWA 1D4OA 5SZKB 1MT0A 3B5JA 1NG9A 2ET6A 3F9RA 2CLOB 1LS1A 1MIHA 4RY9A 5CM8B 3WMFA 5KYYB 3V48A 3IAHA 3DTVA 4YP6A 3HWRA 2VKQA 3QHQA 2J6HA 2RKOA 3LAWA 4B76A 4YRIA 3RSZA 1TYBE 3GGCA 1Q0ZA 1JIQA 3ETHA 2VDQB 1X94A 1RI3A 1WPGA 2CLHB 4FR5A 3U19A 4TKVB 1E2FA 4IOMA 4MAFA 4OUDB 1QNFA 3L8CA 2ZSKA 3H75A 1I94B 1W9MA 4OGLA 1B15A 5C8YA 4X0EA 1L7NA 3KWMA 4MIYA 4WSOA 2I62A 2HWKA 3C7DB 3I1IA 4XVRA 4KE6A 3NI2A 5DGDA 4B8WA 4YRMA 2BGLA 1DO0A 4B8YA 5KHOC 5DWQA 3IDOA 4L4RA 4MLZA 2C9ZA 5BWCA 1KJNA 2FOXA 5E0KB 1P2BA 3KXLA 3DYVA 4NAUA 5L3RA 4EENA 1OFGA 3M9WA 2HD4A 1BO6A 4BDSA 1RWOA 3OKAA 3NNDA 3IBCA 2GSDA 2GN4A 3OCYA 3HHPA 5AVKA 3WGOA 4EHKA 3K70C 3SQWA 5F3WB 1FEZA 4GS5A 1NXVA 1JEYB 2V7XA 3L1VA 3KZVA 2VTBB 2PL1A 1CHDA 1NAIA 4LWQA 4M37A 4P2BA 4GVPA 1JJAA 2XQGA 3HP1A 4IHQA 1TZCA 1VMIA 2AG5A 2WOOA 1CZNA 3M9XA 4LYEA 1RCUA 3HR4A 3REFA 3NEAA 2OZEA 1B1AA 4L3OA 1C8BA 5T6MA 3ETCA 2ENWA 4H27A 3PR2B 3F71A 3V1NA 3WIBA 2B7CA 4OYHA 2IP2A 1AHIA 3RARA 5LXTB 4ARUA 2D0PB 3IBFA 3IJRA 4TV9A 4XYBA 2VTDA 4PLCA 4P4SB 5DGCA 5DHSA 3AWIA 1G98A 3ITDA 4LHVA 4YR7A 1CEEA 1Y34E 4RK0A 5KYGA 3D8BA 2J7PA 2A6PA 4RF2A 3T9BA 2WIGA 1FVFA 4Q12A 3UMJA 3KALA 4JN6B 2GJAA 3C70A 3L40A 3GFFA 2NTVA 4HDCA 3VTKA 1JVNA 1JHRA 2FPMA 2E3JA 1HGXA 2JATA 4L27A 3B6MA 4K03A 3SS8A 3ESBA 3RFTA 1QHHA 2XLBA 4I6GA 3PXAA 4B31A 4O33A 2DQ4A 2HMUA 2H4ZA 1GKKA 2P9GA 1SG9A 3CBGA 3P0HA 4M0EA 4F3CA 1HMYA 2CXPA 5HK8A 1SUFA 2B4RO 4B3IA 3PFNA 3PV0A 4BO2A 3SAJA 1B26A 5HEKA 1KYQA 3U39A 2XUAA 1J24A 3TR5A 1JZTA 3V8EA 2HLHA 1W4CA 5DM4A 3KOZA 1GHTA 3GQBB 3HEBA 2NSLA 4PYQA 4DR7B 3DCNA 4G81A 1B43A 1O54A 1J70A 2M1XA 2OILA 5DBEX 4WE3A 1CLUA 1VKHA 2AD1A 2ZS9A 2NZYA 1T36B 1RR6A 2RBGA 5CK4A 3A4NA 4CUZA 4YRNA 1RRVA 4FTWA 4XJXA 4CJXA 5K3EA 5F2NA 5KNDH 4KR3A 2QA5A 3D6JA 3DQZA 3E23A 2QRMA 3KPVA 3QUTA 1ZY2A 4MKIA 4RFLA 4V0RA 5DLPA 3Q9LA 1SRQA 3SFTA 4ZGWA 5AXAA 4UU7A 4FK8A 5A02A 5CNIA 3PTAA 3VX4A 4NYIQ 2WIFA 2RARA 4IJKA 3I52A 4FFNA 3QVTA 3G7NA 4P4GA 1F9EA 1COWA 3SHQA 2Z3VA 1CUWA 2ORWA 1TFUA 2CWDA 3EIHA 3L7AA 4JLSA 5B3JA 3VNQA 3ZNPA 4KPYA 1J25A 4JFRA 1KS9A 3EZGA 2PKCA 3LYHA 1JZSA 2GKGA 1HKUA 1DEHA 3WHPA 3GK3A 2IZ7A 4D82A 1W94A 5L3SA 2VHVA 1QRAA 1GVHA 2WC1A 3FMIA 4TUYB 1XLWA 2O2YA 4R3NA 2P9TA 1SD1A 2AVDA 2XGGA 3A2NA 3OU2A 3B9PA 5I9LA 5JXWA 3FYUA 4KQHA 3WKCA 1XTRA 3KLPX 3D7MA 1VKNA 2QXUA 4KWIA 2JKVA 4HD8A 2WG0A 4BL5A 4Q4CA 2ZJ7A 4KPFC 1MV8A 3U3ZA 3WB2A 1KGDA 3I5AA 2WHPA 4MLDA 5GIOE 2VQEB 1FFAA 5ULLA 4MVWA 4ZVOA 1GOTA 2FXVA 1YIDA 2SICE 1RAFA 2XDAA 2ECQA 2H1SA 2XWSA 2E5FA 4JITA 2PH3A 1WVIA 3EC1A 3IIJA 3L5KA 4MI9A 4O4LA 1IOZA 4FONA 3RRFA 3RK0A 3TLZA 4AFNA 2BEKA 2JKZA 3GAAA 4X8OA 2RG7A 1E1NA 3JSXA 3TR6A 3ZDDA 3R7NA 5IUJC 3D8UA 1OH6A 4AX4A 3SC6A 2AOWA 4JI2B 5H5JA 3ETEA 3ZW7A 1F4PA 3GVPA 3S44A 1A8IA 1P4AA 2VYND 3UCEA 3UK7A 2PX4A 2Y68A 3PVZA 4TTJA 1AURA 1MVOA 1VKZA 1UQTA 2Z1MA 4IEFB 4QL3A 4E46A 1AB6A 1YZHA 1RYHA 4HWTA 3K9WA 4MV8A 4BMYA 2J9GA 1CZRA 3EEYA 2Q8NA 2WW8A 3C6MA 2CXOA 4FFOA 1KO7A 4IV5A 1G21A 4V02A 1EBBA 2BEUA 3S7ZA 2JRLA 4ERNA 3W5CA 2REQA 1QGUA 4HRAA 4N3CA 4MAAA 2ZT6A 2X2PA 1LXCA 1VLLA 2IE0A 3JAKB 4LDQA 1X6VA 5JCZA 3ER6A 1IG3A 3E18A 4NMHA 5C1BA 3PKZA 4TX1A 4KREA 3WA6A 4JL8A 1JNXX 2XADA 3CUKA 1QLHA 3UHOA 2D59A 5HNKA 2C2WA 1KS2A 5LYYA 5ICMA 4G86A 3GQVA 5JARA 4YLEA 1KKMA 3QX3A 4WINA 3NT2A 3Q7QA 4YEDA 4D3YA 2HMTA 1MENA 4JZYA 1ZW6A 4TV8A 4ZREA 3OM1A 4WK4B 4KBGA 4MP6A 1K6JA 3FYCA 4MGZR 2YFQA 1AA9A 5TQ2B 4Q21A 1W19A 1OC2A 1WO8A 4MW7A 4BVKA 3FG9A 1T0IA 1CEYA 3IV9A 3SIWA 3H8VA 3IAM6 5JPCA 3ZHCA 1M76A 3HB5X 4OV6B 4M3NA 4GU5A 5ICFA 5KO2A 2QAGB 3OQJA 5JD3A 4CN8A 1J8QA 1JUDA 1JKJB 4WOCA 1YBMA 2QENA 5AIBA 3HM2A 4OGWA 2YVUA 2O14A 1IN4A 2F9MA 2FWMX 5KOJB 4B6GA 4WFJA 2B8NA 2QMZA 4BNYA 2PCLA 4RZQA 1SUSA 1CUIA 3NTVA 2MOKA 4AMZA 3TNDA 2YYAA 3L3BA 2UUBB 1DTEA 2YZMA 3EMBA 3ORRA 4MWEA 3QWIA 5IBPA 1XSEA 3EZ9A 4JC8A 3QJYA 2IUYA 2FQWA 3KB8A 4JBWA 3KEFA 4R8VA 2JBHA 2OXTA 5DBFA 4I50F 4MUKA 2ZUUA 4Q9NA 2FW7A 1GR1A 4FCWA 2GA8A 3V2UA 4HLNA 4OX9B 1U7ZA 1MW9X 2I4OA 5K7SA 2PYDA 3K0FB 4CMEC 2DSNA 2AE2A 1S3FA 2PXAA 3EFOB 4RYDA 5K45A 2DH5A 2OEPA 5ICEA 1C0PA 2YJGA 3H18A 5E2IA 2GBIA 3GRCA 4N0DA 4OB6A 3WHIA 5A4FS 2DBRA 2F17A 2JCBA 3FPBA 3JVEA 3L2OB 5AUNB 1UDXA 1EAMA 2QTHA 4YIKA 3R0IA 2R9VA 3T41A 4RD4A 4NONA 3NO4A 2ISCA 4F06A 3P0RA 3DXZA 2W00A 1OIWA 1DZ3A 1WXHA 2R1VB 2XX3A 2REOA 3FCSB 3KEQA 3KPJA 3GI1A 4LY9A 3L4BA 4UREA 4XWGA 3RNLA 2P1ZA 4N76A 2RHRA 2VHJA 3GLFE 4A0HA 1PG0A 2CL7X 5K9ZA 1D8AA 1N2CB 3GCDA 4MA0A 1JAXA 1AG9A 2HQBA 4G5SA 4G0ZA 4KO8A 4JOQA 5JD6A 2XH8A 4UE2A 5LKRA 1U1IA 4IVPA 1DKNA 1TOAA 3VU9B 3F96A 4MVJD 1PJZA 4DV7B 2OCYC 1MB2A 2UXBB 5IDWA 1TUEA 3IELA 4I1RA 1UT5A 3JQEA 5IVDA 2W6JD 2VLIA 1PWYE 1JEOA 2VNIA 1ST2A 2FWNA 2R87A 4DR2B 4PZLA 4H1WA 2O0LA 2OBBA 2H4XA 2WSLA 4XPIA 4OHUA 5BUSA 2XA1A 4W5WA 1OGYA 3JQPA 1ZN9A 1VKRA 3R5SA 3KUKA 1VSVA 4JYPA 3BMNB 5IN4A 5J4VA 3QF4A 2YIJA 1EX6A 4B09A 4CIWA 1LNQA 2GXAA 4FJ2A 4RANA 4P3YA 5IJ9B 4TM7A 4INPA 2G9ZA 1A5SB 4MCAA 5ANRB 4ASUD 1NJ5A 1WCWA 3ODGA 4JVMA 1XFDA 3OX1A 1WSWA 4HJRA 3GJ4A 3D54D 1I6WA 1AQJA 4AUNA 1EGVB 1ZJYA 2OP0A 1GO2A 1CULC 3ZDXB 2XNDD 3EIQA 1EVLA 1U2DC 1P91A 1SA0B 1MC8A 1SAYA 1V4NA 3K94A 4RL6A 4FEYA 1DT5A 3JD3A 4N7MA 4R0MA 1EUZA 1VBMA 4OA5A 1OLOA 1E1MA 3ME5A 1GZSA 2CF5A 3DZBA 1YOVA 2GAIA 3DLHA 1XRNA 2ONCA 5G3YA 5L6MB 3H17A 3R0JA 4GLJA 2OQIA 4P2GA 5F21A 3PDHA 4D8TA 1QF6A 3MYRA 2G0AA 1TJ3A 4FW8A 4BFLA 1VKOA 1PR3A 1XC7A 4MR7B 5A3VA 2OHJA 4PCLA 3Q12A 3ABQB 3U13A 4NOJA 5JADA 4R3WA 4LRYA 4MSUA 1XFAA 2P67A 3N28A 1U94A 1MUUA 2HUPA 3OQVA 4FS3A 4U02A 4ZC8A 1H93A 3ESRA 2LXNA 3I42A 3MQ4A 3SU8A 3PFHA 4WEQA 2ALJA 2YZ7A 3V7FA 4EW3A 2CCJA 3ADBA 2HFJA 2XXAA 3TE7A 5B1HA 4WCFA 1T36A 2J8ZA 2QLJA 1KFCB 4I1IA 4UXHA 2DOKA 4ZO8A 3CZMA 3TUZC 4CLXA 3IOEA 5H70A 4L5IA 4FM9A 1N5LA 5JROA 4QASA 1YZKA 5BR4A 1O94D 3NHFA 1E8DA 4A0SA 1XLTA 3KE8A 3BBPA 1LBEA 1RVV1 3EFOA 3PC4A 4LXXA 3HWWA 2A88A 4OHOA 4GXRA 3T7RA 3HZRA 1MOSA 3D4PA 1JHVA 3DXYA 3H05A 1G5HA 2P4HX 3ZWPA 3ITNA 1O5TA 4OFWA 4IRUB 1K6MA 3HP7A 1NR7A 1E61A 1NN3A 2F90A 5DX1A 4CCSA 2VYQA 3Q88A 4D44A 1OHHD 3LT4A 4NU0A 4RTJA 4QXQA 3BF7A 3CWQA 4FZJA 4DLYA 4MWTA 2EJUA 3IC5A 4BECA 2C2BA 3GP3A 3DKIA 1T9KA 2HZBA 5CM9C 4ADSG 2K7FA 1IXYA 4ANFA 4KYUA 2QE6A 3L8FA 4CG0A 1YFZA 1M34E 1Z82A 2P2LA 3PPVA 4RPKA 5C4GB 5HKKA 2BFEB 4FYIA 5AXDA 3ZXSA 3PSAA 1XU9A 4KAFA 5JALA 3MUNA 3P52A 3QWHA 4HFJA 3CUYA 1KETA 2D1TA 2ZSUA 3GHYA 5T3YA 1ECGA 1QKIA 2JD2A 4BQOA 2Q5CA 2HWYA 3FMFA 5ESWA 2IEAA 4E51A 2XTAA 4YPFA 1MAHA 2G1JA 2GPAA 1W93A 2Z83A 4EJ0A 1G2OA 3ZNQA 3ZZNA 1HI9A 5JI2E 3SWWA 4AZSA 1G19A 4MUAA 5LQSA 4TZKA 4XRGA 4DLBA 1H8HD 1GTVA 2GTIA 2ACKA 4XQ9A 3T5CA 1P0FA 4PVCA 3BBLA 1YF3A 1JPNA 1TVKB 2CCKA 1FYEA 5FR2A 3SEQA 1I0IA 2RGNA 2VJQA 3INNA 4RADA 2ZUEA 3MRSA 1I4OA 2VP6A 4FD2A 2F4VB 2R00A 4F4IA 4B3DA 2IIVA 3RS2A 1EP1B 3OZTA 3TQFA 2C5SA 3N3BC 5AI4A 2Z56A 1QHFA 3AVTA 3UCXA 1KZ7B 2OCLA 3SC2A 1LW7A 3A8TA 2GN6A 4RVHA 2ORVA 1Z6QA 1MH9A 2QP4A 1WXEA 1QGUB 1YULA 2PYIA 4LBZA 3N2KB 2VDOB 1V1MB 1Z6YA 4CQLA 2QW1A 5KREA 3OMXA 5EXTA 3N53A 3TXXA 4TMFA 4F4HA 3L6DA 1FDTA 3A1NA 2C7QA 1W2HA 2H59A 4Y2TA 2NADA 5I9IA 2W70A 1R5BA 4DC9A 4CIDA 1V9LA 2VWPA 4JFAA 2RGCA 4RQTA 1LK7A 1C41A 2AK2A 2GN9A 2QTRA 2VF4X 3KCQA 1KDYA 2V7WA 4IHJA 3TDNA 3DDHA 3V9AA 4BLQA 1I9GA 5AJYA 4B34A 1MC4A 2W37A 1E2DA 3LCCA 4GQIA 3RYFA 1OXUA 4G23A 4QTYA 3T3MB 1NMYA 1BJRE 5KYYA 3KJXA 1MG5A 5ALWA 1NMZA 1P61B 1TQ8A 2RIRA 4JBYA 5C8DA 4PO1A 2ZSIA 4J49A 4C78A 3B7WA 3KZNA 4BVFA 1QFZA 3E58A 2ZUVA 3N2KA 3ECAA 1WNFA 3OLYA 2FWAA 2RGDA 1G2IA 1T2AA 2IZ6A 3AXTA 2BGWA 4EI9A 4Y9DA 3JWEA 1KJZA 3FAKA 3IDAA 1DIHA 4H6WA 4KH1A 1MAUA 3O4GA 3BTSA 1ODTC 3VR5D 2EFYA 3ISTA 4Z0PA 5IP5A 3LWNA 1BFDA 2ZE8A 1R0BA 5FJJA 3WFIA 3CX6A 1RJ9A 1HQYE 3PZBA 3TQRA 3GB9A 5AKXA 2BI4A 4YCNA 5JSUA 4JJKA 4L74A 3VJLA 3H6HA 4TMZA 5EIXA 1YA6A 1GUYA 3TEFA 4DVGA 3FPJA 3MMNA 3WWDA 2FE1A 4ZYZA 3WLQA 3RKUA 1P74A 3PWKA 1M2JA 1XAIA 4KUEA 4DLTA 3IKTA 5FOSA 2OYRA 4XVQA 4E2XA 5HBGA 3I83A 2BEJA 4B45A 1SOMA 2DQYA 1M6VA 2IZOA 2K5UA 3HO6A 1OZGA 3D3KA 2IYSA 3I73A 5DT9A 2BHRA 5GMOA 5REQA 5IJ0B 4LXYA 4BNDA 4C7KA 2PUFA 4FOTA 2FSIA 4OFZA 3AERB 1TF5A 2P2NA 4O4IB 3STVA 2H4WA 4LV5B 3ZXYA 3WGZA 1WW8A 2FEWB 3QU5A 4JYCA 1XG5A 2WHYA 3KJFA 2IP1A 4RXUA 2GVZC 4F8YA 3MWLA 2ZGVA 2GVDC 3PGVA 1IZ7A 3CVVA 2JEYA 2O3RA 3OPMA 1XA4A 4DYDA 1FP7A 1DCFA 4PYRA 4RFVA 1SKUA 4AZVA 3NIBA 3NIGB 4HYQA 5FOQA 5LN1A 3DOIA 4AG3A 1EUCB 1IHPA 2WF8A 3REQB 4C0XA 1NZDA 2CN1A 4AJOA 4KV9A 5JWRA 3SYNA 2PU5A 4ALMA 4IIHA 4BZXA 2WQ7A 3C3EA 3ZIAD 5JH7A 3HXKA 3DC7A 3DGFC 4IDNA 1IBRA 2IXEA 2A0FA 3OQ6A 1NLYA 3LLMA 5FBLB 1I0LA 1TMKA 3ZWCA 1C7ZA 4BNZA 1N8SA 1D3AA 3IPLA 3HBNA 4KX5A 4YQFA 3WLIA 3GFRA 3MAGA 1WEHA 1SU8A 4M9XA 1MGPA 2NV0A 3EVGA 4QREA 1CYEA 4QO7A 1YI1A 3ID6C 2OESA 4O3MA 3CT6A 1HYBA 3NFRA 3OPVA 3VHXB 5NULA 4PO9A 2B8WA 4UXIA 3K2QA 1WUTA 2WJ6A 3LNCA 4YQYA 3EARA 3ROTA 3QVXA 4Q9HA 1Y3CE 5KOIA 3GOHA 1EVQA 3M6AA 2GBLA 3LXUX 1RMQA 5HIJA 2YXPX 1COWD 1ZEJA 3GF4A 3TL3A 2BBTA 4YJ2B 2V58A 2YZ2A 4I55F 1OWPA 3IEPA 4P9NA 3VKWA 5GINE 4PYOA 4JR1A 5SV2A 4V1CA 1Z3CA 2E4XA 1Z5PA 1KYIA 2Q4OA 4MRMA 2EQAA 2H16A 3O1LA 3FMOB 2IHNA 1Y7IA 1J21A 1HE1C 2DFDA 2B21A 2W4IA 2WTBA 3AL3A 3CIFA 4RD2A 2DX7A 2XTZA 3FDFA 1NASA 1OA1A 1PT5A 3ED5A 3LWBA 4HH1A 4M8IA 2XZOA 1OXSC 3OM0A 3AVPA 3ZU3A 5I7RA 2DJIA 3VZBA 3UOGA 2JIQA 2X9QA 1H85A 1RJEA 4KHZA 1NVWQ 3NZEA 5JZBA 4YMSA 4CT5A 4HWPA 5G0WA 1XRJA 2BTOA 2Q3EA 4KPUA 5EZQA 5FXMA 3RT1A 3R77A 3SICE 3NX4A 4O4HA 5LQJA 2GN2A 1CXZA 2VN8A 3DHNA 3RF6A 4CR8A 3LBFA 4G4JA 1GZ3A 2DYKA 2A86A 4K9KA 3V33A 1F8GA 2QTLA 2IXAA 2PH7A 3PIIA 1U5BB 1XTKA 1YB1A 1M1NA 2VDNB 3IE0A 1AZLA 3PEEA 1TUBA 3JQFA 3NYRA 3FDJA 5DYTA 3Q9UA 3NWBA 1ENOA 1OFHA 2PJZA 4HI0E 4M1ZA 5CX1A 5EIEA 2J46A 3B12A 1DARA 3DFZA 3I64A 4AY5A 4OQNA 5L53A 2RGRA 4LBWA 4YFVA 1HTBA 2C3UA 3KBBA 4ZPXA 1GCAA 2Q1YA 3G0IA 2P9YA 1RXYA 2IW1A 3VPFA 1OGIA 5IT4A 1MTOA 2JJ2D 3JR7A 4YRJA 3O2JA 4FU0A 3ROQA 2NACA 5DX8A 2G28A 4E2ZA 1EWQA 3PE4A 1VL5A 1HTTA 3KR0A 5IAEA 5E2AA 2B25A 1X70A 2WHPB 4QEDA 1B7GO 3HDHA 4CWAA 5LOVA 2OB1A 1Z45A 1QQ5A 1H6AA 1U3GA 1OVMA 3B53X 3RF7A 4JLVA 1TXGA 3KEMA 4AVYA 2V8OA 1N32B 1D4ZA 2IU0A 2DPLA 2BAGA 1QHYA 1T5LA 1W2WB 3FNBA 4LKRA 2IKQA 3OEED 1FPQA 1YRBA 4B1FA 2XA2A 2FOIA 5EJAA 1E2UA 3Q3GE 1XZEA 4FINA 3VPCA 5JV5A 4ZODA 4OYRA 1A50B 1NQVA 5JYBA 2WMOB 1A9OA 3NMUF 4PX2A 2PZGA 3FMGA 3DF7A 1NJFA 1EFVA 4IIVA 5JXGA 1AUOA 2W90A 1R6AA 1Q6YA 3WDLA 4IEEA 4QELA 2PS9A 5CK5A 1SXPA 1UXGA 3E0XA 3URMA 2X4LA 3ZDYB 1USIA 2E1RA 4E08A 1IM5A 2IP4A 2FB9A 2QVGA 4B7XA 2WSYB 1SHUX 4CQMD 2O3QA 2F48A 1FFYA 2IIBA 2B1GA 5EHXA 1WMAA 2KBFA 4U7HA 4DLZA 9GPBA 4X6LA 1DKLA 1G4HA 3PFFA 4I55B 4XUCA 3REGA 1K2VN 2IOYA 1W5TA 4M0KA 4NYIR 3OA2A 3W2GA 4DV0B 3E2IA 3FZNA 4RTKA 4PLHA 1IWBB 5T4HA 5FHQA 1TCBA 1PWHA 1QGDA 3AR4A 4HDSB 4HDKA 5KNBA 1CCWA 1FQKA 3K9LA 1QHIA 3JZDA 4N5HX 3LKZA 3OZWA 3SDZA 3JAWA 5K8CA 1FXWF 4GVLA 3L6RA 2I29A 4ZVSA 3QUAA 2VYVA 3P5SA 1P3JA 3ODPA 3QE4A 5COAA 1KARA 2DF8A 4CU5A 5CVJA 1YFLA 3AVVA 2HAEA 4PAMA 3TPCA 5EUCA 4AMGA 4F96A 3B36A 5LZ5A 2RJNA 2HCFA 1PR0A 3BXFA 3QU2A 4UQLA 3VKHA 1U4OA 1RPTA 2GTHA 4HDMA 1Y3DE 4UM7A 3O8QB 3UB2A 2I8CA 2OFXA 1HSOA 4E5YA 3H6KA 1NNI1 3BGSA 3L0ZA 5AVWA 2C5EA 1TK9A 4PX9A 2W6MA 5CXQA 3R5KA 1GPAA 2M6SA 2QSUA 4MUFA 5ESDA 2BM8A 5JZSA 4HOYA 1ITZA 2QGZA 4QEZA 1KOLA 2BIFA 2G76A 5U9CA 2V9CA 5CPBA 1J33A 5KQSA 3LPDA 1QG0A 3B3AA 3DBRA 1P72A 4IMIB 4C0BA 1VG0B 1M83A 3TTSA 4DEYA 5L51A 4GO1A 13PKA 3CF0A 3PA8A 4ZMRA 1G5FA 1NDUA 1TEVA 3Q87B 4JLUA 2FMFA 3JQAD 3R9XB 1SVMA 3DW3X 5HS4A 1XPOA 2D2FA 5BP7A 4U9HS 2G5CA 1MORA 3HY3A 5D00A 3VR3A 2KYRA 3P19A 4QM7A 1I3MA 2PN1A 2YW2A 3PR3A 3QVUA 1NVDA 2VP4A 4K9SA 3JCZA 4MVXA 1ZI9A 2JFUA 3AFMA 5FRDA 3SM3A 1E0KA 1ZBDA 2IYUA 5JEEA 2GPSA 2H06A 3RS8A 1FW8A 4IHJF 4AN0A 1X1BA 4R6XA 3TTYA 3UFXB 4G9GA 1KNXA 2Q3HA 1XEAA 4XOIA 2Q4RA 4OXKA 3STUA 4K9DA 5AQ1A 4WASA 4UHDA 2DLCX 1L3BA 4JC0A 3I1JA 1D1QA 2XI4A 4MKRA 3RVKA 1Z7EA 4AD8A 1K9VF 1XEXA 4XA8A 3QZUA 3U44A 2JGJA 4W7IA 2CMHA 1C8LA 2Z8ZA 4XZ3A 3SIXA 3WS7A 3A4VA 4WJZA 6ADHA 2YASA 2Q50A 3FPCA 4RPHA 2QZ4A 1LW6E 4E5NA 1G0OA 2Q5OA 4QOFA 3CZ4A 1NI5A 1HURA 1NHGA 1PN3A 1ZYUA 3OZFA 4TKMA 1NMEA 3TJMA 3L1UA 4DIBA 4CNBA 1TM3E 2DHEA 1LTQA 3UOAB 1NUPA 1Y4SA 3CEMA 2GEDA 4FYHA 4EAQA 1JS1X 5JAOA 3OZSA 1NATA 3FWPA 4PZUA 5IM5A 2FQ1A 4MITA 5EHGA 1DELA 1BKDR 3N2YA 3W3ZB 4JSYA 1POWA 3RVMA 1YHYA 5NLLA 3VM6A 1K8QA 2RAFA 2VO1A 2Z09A 3K8YA 1KE1A 4C2AA 1Z83A 1AXEA 4W5HA 4NMWA 1LWOA 4UVEA 3KSAC 1TLLA 5ED4A 4OLAA 1KI6B 1WMBA 2X0DA 3WOHA 1OZHA 1AVTA 3WLMA 3H5OA 3WYAA 3BWVA 3EHEA 1IUKA 3UT0A 4D0RA 4CM3A 4NBUA 2NZWA 1P7YA 4WLFA 1CUGA 1KPGA 4O1IA 3T9EA 1KDOA 3EDCA 4K9MA 3OO0A 4AF7A 2Q3JA 121PA 3QKSB 4M76B 2ZIWB 3T1VA 1QQTA 1Q77A 5P21A 5JH7B 4YJ3B 1NOJA 4BVJA 1X7WB 4NYMQ 3U7IA 4TROA 4BUZA 3LT2A 2FPXA 3T1NA 3L0IB 2ZSEA 2DR0A 3CLUC 3DE3X 3K6RA 3I58A 2VYCA 3RRYA 2GD1O 2IY7A 3OY2A 4FDLA 2ZXUA 4BV2A 1MIOB 1NY6A 2X9LA 3IT3A 4YGXB 4BMCA 4P7FA 4RKFA 1BU5A 3FDIA 3ZKAA 3U4QA 4GH5A 1NBAA 2GEUA 3P2OA 4AWBA 1CE8B 4ZANA 3GN2A 2EL7A 1Z3IX 3ZHYA 4YGYA 4DCTA 1VTKA 2AFVA 3I30X 2AMJA 2X5NA 5EMNA 5B58C 1J0BA 2PWZA 4QSHA 3W5IA 3WNVA 4O2AB 3AKZA 4Y2XA 2E4AA 4RK4A 2FFAA 4M55A 1YJAA 3UA3A 4Q4AA 4ENQA 421PA 1W88B 3I09A 1SB9A 2Q4TA 3DAPA 4TWZA 5B4TA 1HH4A 4W9NA 3E8SA 2GD0A 2O05A 5CBPB 1YC5A 3GA5A 4MTCA 3VPAA 3RG8A 1NI4A 1NOIA 4G8JA 4GXQA 1SXQA 4UMEA 2X8JB 1A9TA 4DA4A 2PL3A 4NG4A 1FF9A 3PUHA 1BE8A 2CV0A 4UUNA 2B8JA 3VKVA 2Y67A 3ZD6A 3FLMA 2DFTA 2WKQA 1YR1A 1KA9H 1KU6A 4HZUA 4D4GA 5A7FA 2H1WA 2NTEA 3SVTA 4GZ6A 4NU6A 5IAJA 1X42A 4Z4GA 3OZIA 3LC7O 4IXTA 4OAOA 2H5IA 3DE0X 3VU3A 5D3MB 2AHRA 2QG4A 3ZWXA 4EL5A 1Q84A 3R76A 2ADFA 1YB5A 2I6SA 1USGA 5J23A 1X1RA 1YR8A 4DCPA 2PUJA 5CIWA 4P84A 5HKOA 3HDVA 3TE6A 5J4YA 5CG2A 4Z3DA 3S2EA 3EQ2A 5ALGA 4A3SA 1QU3A 2V0GA 3DA8A 2OE2A 5FPHA 3AY7A 1GRRA 2C2YA 3GLVA 1KOJA 3EEQA 4G26A 3KX2A 5K51A 3QLTA 2CJWB 1U6IA 5EVCA 1W36C 1P5JA 1Z0KA 3K0AB 3JAKA 1CP3A 1WBDA 2PZFA 1K2WA 1RYDA 3HNOA 3WISA 2A1IA 4IVRA 5DKFA 2WB2A 1V25A 3GLRA 4CHTA 1BX1A 2WMYA 4QD3A 5EPUA 5B12A 3I5UA 1NP3A 1KI1A 2GYWA 4DDKA 2Z57A 3DL2A 6ABPA 2YNMC 4X54A 3ZI0A 5H82A 5JAUA 1KZYC 2WUDA 4K2AA 4JI1B 3EWNA 3T54A 1Z33A 4OG2A 4EFDA 5ES3A 5DCYA 1F0NA 1FQJA 1TLFA 3E7FA 1JLLA 1LTHR 5BOSA 2WJYA 4ALKA 1KU0A 3FOWA 3EWSA 2J41A 3M34A 1M67A 3U0VA 4X64B 3GLFB 1GGEA 2WHQA 2H1OA 1ZN2A 2EFCB 1TAHA 4P4UA 1E2IA 2A5LA 2I7XA 4MDYA 4JB3A 5K03A 1H2HA 2AUNA 3H1PA 1YRHA 3H97A 1RHKA 5DMXA 1R8XA 1ZMTA 2DH6A 2VF2A 4C08A 2HXYA 5JSFA 4D9MA 2YHIB 2EDAA 3VI4B 1EK6A 3K8ZA 3TAXA 4DIFA 4LVOA 2YV2A 3K5IA 3SFZA 3WZMA 2MSWA 4EA6A 4RSGA 2Y1OA 4BATA 4AY6A 1BKYA 1TQHA 4QBIA 5EJGA 1N9GB 4LSZA 4AJIA 2QZ9A 3QPDA 1NHWA 4L50A 3E22B 1NVXQ 2ODNA 2FWJA 2F59A 4EJSB 2P6PA 4L4XA 4YRFA 5KB3A 2YFYA 3KLBA 5EJEA 4CKXA 2AL7A 1OX4B 3CT4A 2I99A 1I2MA 2HRZA 3TQTA 3AY3A 1SD2A 4QBHA 3WSVA 1LDYA 3AILA 4X41A 2B2XA 4RIEA 1OJ7A 3K9NA 3NDPA 2I4LA 4JU9A 1EXVA 1HEIA 2XGSA 2OFWA 2WTXA 2EAUA 3R0QA 4DGQA 1YA4A 3CUWA 3DLBA 3PDIA 3H5NA 3OD5A 3KVVA 1DJLA 2BCGY 1JYFA 1FMLA 2YYSA 1XBTA 1N7HA 3PXEA 2PKQP 1SBNE 1GGHA 5IH7A 1D7OA 1VJGA 3FJYA 3NEPX 2C5GA 3RFFA 5B4VA 5FA5A 3RC8A 1JFLA 3G8YA 1JLMA 5IJAA 1PFKA 2OCGA 2ZCVA 3ANMA 3BSSA 3FSGD 4RTMA 3CWZA 3OOHA 1ZNWA 4RVGA 3PS9A 3ZVMA 2AG8A 1YHNA 1EZZA 4CCYA 5EFOA 1GA6A 1S3IA 1C8KA 4UEWA 4NCXA 4ER6A 4BO5A 4YUXA 2G4LA 1UPCA 4QG7A 1JSXA 1WZIA 4Y1GA 4Y7DA 1U7XA 3E1GA 4PF1A 2ZIFA 4QYIB 3UMBA 5M04A 2GEJA 1IU9A 1QHXA 1GUZA 3LTNC 3M70A 2MT9A 1G4UR 3CNQS 3MINA 2XUHA 4HNHA 5EE9A 2E4ZA 5IKXA 4JEIA 3ZZ1A 1OU4A 2I03A 2LBPA 2WPDD 3EDRA 4FBMA 3NALA 1ENZA 4M36A 4XGKA 4BJ5A 3IHTA 2OD9A 4BQPA 2WJWA 3FDZA 1PJCA 1RRKA 1V95A 3FYUB 5CJ2A 5GOZA 2WM2A 4W1SA 4IIJA 2AMVA 3JQ6A 3F78A 3VV3A 1ZITA 2G7MC 3HVKA 1OBFO 3CRW1 1U0LA 4AUMA 2F1HA 3FZGA 4DQKA 1UUFA 3ZWYA 4ZKDA 1U0NA 3X1MA 3X0DA 5LQKA 1X1QA 1FQWA 4QWMA 2HPZA 4RTPA 4X84A 3KEOA 5B1DA 3BRWA 4NR0A 2R84A 2R4UA 1ESEA 2IOFK 2ATIA 2DFLA 3ZWVA 4YDQA 4PS1A 4YMIA 1D0IA 2X0NA 1JJFA 4W7SA 4DA8A 3MXTA 5ICGA 5AJXA 1P2UA 4KQ1A 1RVDA 3EZ2A 3EG5A 3OKPA 4A8JC 5I7OA 2XPCA 4MHSA 4WFQA 5L7TA 1E79A 4XTCS 5C5CA 1Z47A 1DBIA 2JHFA 2QTFA 2RMKA 3GT7A 1RQLA 1FYVA 1U3UA 1WV1A 2PU7A 1MOQA 2FSPA 2V6FA 3BB1A 3NJRA 4LZLA 2VWHA 3UHAA 4GDMA 1TCUA 2Q46A 3LBIA 2ZVJA 5U4XA 3UAXA 4DQVA 2GRUA 4HB4A 1BXGA 2A30A 4J0GA 3CVYA 4H0FA 5AK4A 4FOLA 3KQUA 2HBZA 3OQIB 2X1MA 3DZIA 2NNWB 1PJRA 1U02A 2WVJA 5LCXA 3FOAA 4N12A 5CB8A 1P0CA 1UL1X 5I8WA 3D4BA 2ZUWA 4ZTBA 4UUPA 2VEOA 3LHKA 3RW9A 4M9ZA 3KKEA 5BQPA 5KEIA 2AOTA 4OKIA 1UKYA 4GRIA 5CMLA 3MYYA 1Y7PA 3JYQA 3R4CA 3WB9A 3A7DA 4YT4A 3ZXIA 3GDHA 1XGKA 1UIMA 3RVNA 5EZSA 3QU4A 1EFRD 4QOGA 1TPZA 4DADA 4QM6A 3NIWA 4RMGA 1XZHA 3ZV4A 3JAMA 1GQFA 4CI9A 5DNCA 3HRKA 2VHQA 4GGPA 4MUBA 5JRDS 1A2KC 3H0KA 2QEQA 1IJEA 2A0WA 3OEEA 3HEAA 4S2EA 4J1TA 1NQUA 2DE0X 2YBEA 1LJ8A 4J0JA 4GBMA 1LRJA 1IFXA 2A67A 2NSHA 2W43A 4TMTA 4CF5A 5IXYA 1SH7A 2CJXA 2QRVB 4RMIA 4BLUA 4TWBA 4Z0TA 3C8HA 1EFCA 3PZRA 4M0UA 3RJ5A 5E1MA 1CY7A 2OAEA 1CJBA 1PE0A 1ZK0A 2ATVA 3OZEA 4GBJA 5ERGB 5BV1A 4XEUA 5F3RA 4IOJA 4NCHA 2Q5QA 2RH5A 4OQEA 1ZESA 4ENPA 3FTFA 3MGGA 5HRCA 4QICA 4PSCA 2I2XB 5K8UA 3VO1A 3A9VA 5HFNA 1EFPA 1N6IA 1RQ7A 1RXUA 2PS1A 1G2QA 3NNSA 4LGCA 4XH9B 3W0LB 2OQVA 4Y6SA 3S8YA 5HA5A 3ZIUA 3VNBA 4UVDA 2FP4B 3J81A 3ZWAA 2YVKA 4AP5A 3QX7A 1TTHA 4MVJI 1F6BA 2XBUA 4K9NA 2A0YA 3QXXA 1E1QD 4QFCA 4WZBB 3I12A 2XLCA 3RM3A 3DAGA 3ZDRA 4URFA 1IWPB 1TTQB 1ZNZA 3BHMA 3K5PA 4NNPA 2J9FB 3TMAA 4D8XA 1NU8A 3EXEB 3M4JA 1XNHA 2IFTA 4TN1A 4C03A 5HM6A 3WL7A 5F5XA 4Q1BA 2NAFA 3W78A 4F8JA 3ADCA 4QGAA 3MAJA 4F6CA 3BTOA 5AUQA 3IPXA 3PB3A 3Q98A 2DMRA 1TJPB 2CDBA 4D2IA 2W6OA 3S8MA 1RKVA 4AP6A 4ACBA 4BFWA 2GHRA 3FNRA 3PJGA 5BMVA 4KTVE 1J8DA 3RIEA 3WLEA 5HIAA 3WLHA 5EZ5A 3OIWA 1ZJWA 2JAPA 4ARCA 3T5AA 1E98A 3OA0A 2QTNA 2PR2A 5MGBA 1K4KA 3CH4B 3WK7A 1NF2A 3UENA 3MS2A 4KB5A 1CQIA 2J33A 3BB4A 4DNOA 4LXTA 1QGED 2W6ZA 4LCEA 4M86A 3L0OA 5IF9A 4A0FA 3QYPA 1Q0HA 4I4TF 3OE5A 4M1QA 4MPJA 1JXMA 5C0OE 2MYTA 4EABA 2XWBF 2WTNA 4C21A 1B4DA 2JGFA 3ULKA 4WK0B 4PFQA 3TF5A 1IXSB 4F3RA 3HGMA 2WB4A 3OIUA 2QTWB 2MMGA 1DXYA 1RQGA 2ZEJA 2AC7A 4J7XA 4BVBA 2CVZA 4BMZA 1HQDA 3CN9A 2QVCA 4HWSA 3JQDA 2OZLB 2QJTA 1WB9A 1JIUA 1HZZC 4C9BA 2PSEA 3OT5A 3ZQKA 2AN5A 4LZNA 4D4MA 4US2R 2BGKA 4QFBA 3PXBA 2R44A 4Z6KA 1FVOA 3DOUA 3N1UA 3EQ8A 1E20A 4ZA2A 4GKVA 3S2IA 4CE6A 1HC7A 3M4ZA 3IP9A 1PDVA 4J2HA 3K9QO 4PSUA 2VDPB 3JQBA 3NTXA 4TRRA 2J6BA 2ZRLA 1WM1A 5CJPA 4E5KA 1GVNB 1VB5A 1K6IA 1I2ZA 1K4YA 4N5NA 4EFMA 5A9SB 4ZZ1A 2QL6A 2A1UA 2FRVA 2PX5A 2YWEA 4AUKA 4CODB 5EG5A 1TQ2A 2NUAA 1I4WA 5C53B 3Q9SA 4LA4A 1NJ6A 3U9LA 1NF3A 1U2TA 3PFCA 1JAYA 3LA8A 4TSRA 4U7JA 4Z8YA 3Q3IA 3DO8A 1QXSA 3D64A 1FJHA 2ASEA 2PT9A 3OJCA 4EW6A 3KO8A 1U2PA 1XA0A 2HSZA 1HFJA 2YUIA 3HKEA 5DM1A 2D3TA 1NVGA 1Z17A 1I3OA 5FTMA 3KR1A 3PP8A 4Q24A 4TS3A 4W1QA 3MC1A 4R2JA 4F5ZA 1VHLA 4CLDA 1JSZA 5BSEA 3HB4X 3M1YA 3F4BA 3H1FA 3FFTA 3FI0A 1FDVA 1KVUA 2CD9A 2JLZA 4EF4A 4ICIA 2CHQA 5FI5A 2OA0A 1ZICA 3T9FA 1V2HE 2BFBB 4JR0A 4MPRA 4Q39A 3WADA 4LQ4A 3E8MA 5EE0A 3PI7A 3THRA 1B41A 3RCBA 1NE7A 4Y98A 4UMDA 1L5KA 3VDNB 5A6SA 4X20A 4MVJH 4O1MA 4UNPA 1IZZA 1KMHA 1DGQA 4XGIA 3LIPA 4BKRA 4XJTA 2HIHA 3MERA 4KZPA 4PS0A 5KIAA 2R48A 3BH0A 4OUKX 2ZPTX 1U7PA 2D0OB 1YO6A 1E5VA 1GNVA 1U4NA 4DILA 3D0RA 3LC2O 3TINA 2YXEA 3IQEA 1S0UA 5J2TB 4GUDA 5G1NA 1QHEA 4PR0A 2G83A 3ORSA 1YVUA 1MFPA 4MHTA 3DHEA 3SEAA 3QPBA 3QLVA 3OTIA 4AMUA 4FCCA 4JLJA 1E6EA 5IAGA 1DKQA 3RREA 2ZAIA 3UKDA 3F6PA 2F8MA 5B53A 2II6A 4JIMA 1GUDA 3C4VA 2AMFA 3EA5A 2X8LA 2NO0A 3FH0A 3M8KA 3MCAA 2DWPA 3AI2A 4BKMA 1CF4A 1HPLA 3M7IA 4L2IA 4IIGA 1CY2A 3NBQA 1GQQA 3QKTA 4S1WA 3MRVA 1SBHA 4GXTA 3R7AA 1I1QB 2PV7A 3NRBA 4HN4B 4OGGA 3W2HA 4DANA 1QJ4A 4JWKA 1JBKA 1S1MA 2EFHB 1I24A 2G1AA 2Z5FA 4RSRA 1K9SA 1JB1A 5LMUB 4CMGA 4OI0A 4GP9A 3R6GA 3VNSA 2DPXA 1KEKA 3HA5A 1F0YA 3I2GA 4J94A 1LBSA 2XZTA 2BGGA 1GKUB 2XW6A 4R8KA 4HDAA 3HLKA 3N2ZB 3CC8A 1WVMA 3N8NA 3GEGA 4AJNA 1AY0A 2IHTA 1YDWA 3EXG2 3PWTA 4N0EA 4PEVA 3RVJA 2QD4A 3HNPA 3FOZA 2QX9A 2GM5A 1TT7A 3MILA 4RO0A 4QJ4A 3VH3A 1KO5A 1CJVC 3R20A 3RIMA 1P1BA 2IYWA 2QHXA 3KVOA 4K5QA 3U6KA 4Z4EA 2D8AA 2OOSA 1OPXA 3BE4A 3SSOA 3BWCA 1MX1A 2FLWA 1OXXK 1WCIA 1GCOA 2FCRA 2GBGA 4IINA 4Z9YA 3MUEA 4XOUA 3BXEA 3O9VA 4CQMB 5TE9A 4G8CA 1XCGB 2HMYB 1RP7A 1G7SA 2W98A 2DAPA 1CB0A 2J48A 2ZR0A 3SR3A 1YRQA 3FY4A 5AKIA 3M2TA 1NPTO 4OXQA 1MVLA 1N9KA 2QRQA 3L6CA 4OFBA 4BX3A 2ZW9A 3W6NA 3MLAA 4D43A 4D97A 2VJMA 3AKDA 2W2TA 1Y9ZA 2X9NA 3M3PA 1E3SA 3FCCA 3QEMB 4V39A 5EUBA 1HQCA 1DQNA 3W8RA 4Z99A 1T9DA 1LLCA 2HHAA 3WGHA 1ZSYA 2CUTA 1DXHA 4DWOA 1KWGA 1W29A 4GKJB 4IIJB 3BZUA 2QN6A 3KYJB 4O3FA 3P4UA 1CT9A 1E92A 2YN0A 1F8XA 4HFNA 1D1TA 1GRCA 2VLBA 1RYZA 3ZOKA 3FKJA 3BD7A 3WR5A 1WPXA 4HWGA 3OZRA 1DAOA 3F6EX 4RCZA 2WNSA 3IGFA 4DAOA 3MEQA 4OPMA 2FTKE 4UAGA 2BP7B 3OOWA 3USZA 1E0AA 1Q2XA 2HRRA 2HMVA 1P7PA 2JGEA 2YOFA 4MULA 3FHTA 4R01A 2VK2A 4B84A 1ZA1A 4R1OA 1JZQA 1SQ0A 2BF4A 3HYSA 3OVMA 4DF3A 1WLSA 2CHEA 2EKBA 1DXOA 1G4AE 3N0TA 4D9IA 3C74A 3E9NA 3TG2A 1A69A 1RAAA 1JQ3A 3MMZA 4O8CA 4G5YA 5K3CA 1J6UA 5F51A 2XHEA 1M75A 1R9MA 2OHVA 2VPTA 3AUKA 3DBLB 1SXGA 2WD8A 4Q16A 1JVBA 1AQUA 3EGIA 3FGOA 3OQ1A 3NAZA 5F9FA 2QT1A 2AOUB 3CY6A 2XE6A 4LF4B 1VJ1A 2XAAA 3GPCA 5IARA 3GDOA 2L0XA 3C6BA 4R1TA 2N42A 3JXEA 1C3VA 4H15A 4AJ4A 2FNAA 1E3MA 3DB2A 1J1ZA 3OCXA 5F78A 4WNYA 4DV4B 1M6NA 1JR3D 1U8FO 3EE6A 3DLTA 3F90A 5TMEA 3QLUA 2CFTA 2EZUA 2QAGC 1PVOA 1Z7YA 4L3WA 4UTXA 3W8DA 3BIJA 3OT4A 3HXQA 4YACA 5C32A 2UYHA 2E0IA 1RAIA 4LX8A 3BUSA 3LP8A 4DHEA 4EATA 4LC9A 4JUDX 3S5UA 3AQIA 4BRSA 4XR9A 3G5MA 4E21A 4NOMA 2GESA 1K1EA 4L02A 3EQ9A 3HGTA 1WZEA 1YA8A 2LNDA 4Z9BA 3WL8A 1R1DA 3MS4A 3MJTA 5EGSA 4E5PA 3HKCA 3EGWA 2HBYA 2H63A 5F35A 5L40A 4A91A 2UVDA 4KYIB 4A8PA 1N9GA 3KKPA 4RY8A 1BXRB 4AX8A 5AJUA 5IKOA 3GDFA 1T4GA 3H0EA 3NIDB 3ZU6A 4V3BA 1QOPB 1ZVMA 1TL7C 3SQDA 1U2SA 1PQPA 3QOYA 3O0TA 2X6QA 4Q4DA 1NRWA 4AG6A 3N87A 5BR8B 1UK6A 5LP6C 5C8ZA 1UZAA 1LPSA 3Q5DA 3F6CA 2IF2A 1IZ9A 2VRCD 3WGQA 4K3UA 5EOVA 3F5DA 1IY2A 5JAHA 4ZCRA 2CLIB 5LP6B 1V26A 3I0MA 3RBZA 4JY7A 1DQPA 1QIGA 1ZK3A 4V38A 1KK3A 1T10A 1NBIA 1Z4KA 4S24A 4ISBA 1KQGA 3IO3A 5E6UA 1LFAA 3DP7A 3JARB 4BNGA 3NEYA 4DSOA 1NVFA 1R74A 3VC3A 3KUDA 1HOTA 2MDTA 2OL4A 3C3WA 3M6XA 2A9QA 4AC9A 2DULA 5LP1A 3KP1A 3BD6A 2ZJ4A 3DLCA 1ST3A 2RI1A 3DZDA 1F2DA 4LRUA 2AC4A 3H2BA 3V3TA 1LKZA 2O8EA 1WTCA 4JT9A 4NQZA 2PKEA 4JX9A 3UBMA 4EPYA 3CQ9A 4XLZA 2BD0A 1QH8A 1WXGA 2P4QA 1LWNA 3BICA 3JVVA 5ESXA 4XUDA 4BWVA 5A71A 1A9QA 3OEYA 2ARKA 4AKEA 2JLQA 2BJHA 2NV2B 4C4XA 4K6HA 4M2LA 2RHMA 1KZ4A 1MA3A 5KYXA 1ZGHA 2WUVA 3QVOA 4MTLA 3NCHA 2ZJ8A 2JI7A 2DT8A 3G49A 2ZJBA 5EI5A 4DR5B 4H3HB 2EP5A 4BP9A 3MFYA 1QKKA 3N2GA 2V6GA 3LO8A 3L7LA 3WK9A 4YDRA 5AW6A 1XTTA 1KHHA 3LQQA 3FOBA 3FPAA 4FLMA 4RWZA 4Z0HO 3O2QB 3OQNA 4ZI7B 1PNQA 4DR6B 3LBYA 3OE7D 3JASB 5HBRA 5JMTA 1W47A 3DVSX 4GSYA 4OIMA 2WBLC 3CRVA 4DIOA 3DE6X 3T3OA 3L49A 1O4VA 3CEPB 4JB2A 4LVUA 1XT6A 4JL5A 3WIOA 4ZFNA 2DQSA 4QZVA 4HZUB 4LW8A 3QTLA 2F1RA 4TVOA 4ZAVA 5CT8A 1WWKA 1C3EA 4Q66C 4RH1A 5F9MA 5L3SB 4CKBA 2UYCA 1XIVA 1IB6A 5BWMA 4TYPA 4GSKA 3Q41A 4ES6A 1OTYA 4WDRA 1PBNA 4E15A 2ZWMA 2C7RA 2AJ8A 4CLHA 2BFCA 1KVQA 1ID1A 1NVBA 3ANYB 4RVNA 5F77A 4EOGA 4QX6A 3STYA 2E85A 2XODA 3QE3A 4RU1A 4M54A 1O2DA 3I1FA 2IYVA 2OHOA 1EGAA 1Z15A 5IEBA 5LQMA 1XMPA 1LA2A 1ULBA 3OOYA 4HEA6 2ZCUA 5HCUA 4F6RA 1AO3A 3ZCPA 3B7PA 4B3BA 3NAGA 2DKNA 4JNCA 3P2YA 1Y8RB 5BSRA 1FFWA 4R2HA 4JQZA 1IJKA 1X1TA 3EZFA 4YAKA 1WXWA 3U4IA 3JQ7A 5FWXA 3SHTA 4QDZA 1NV9A 3MHTA 4RTQA 4A16A 2ADMA 1GZ7A 1L2TA 1YNSA 2JD1A 3QBEA 3D6NB 4FHFA 3QXCA 4KWEA 5GJWC 1AXGA 1AD2A 5DYGA 4G89A 4DDUA 1QTRA 3SSNA 5HHTA 1XP8A 1GNLA 4ZT5A 1NWHA 5E38A 4EY6A 3WHKA 2A84A 1UKBA 3ILSA 5KQPA 1XMOB 3RC7A 5KQMA 2EP7A 3LCVB 3VVLA 4H77A 1HA3A 1M7BA 1S9DA 3BF8A 2EV9A 3C3DA 4Q1CA 3OF5A 3R3HA 1JMYA 2HCJB 2Q2WA 2Q7DA 3WGNA 1RLUA 5L95A 3UMVA 1K68A 5KOHB 4EDHA 4EHHA 3UA4A 3ZCQA 2QX7A 2XE7A 3CJTA 3MBKA 1I4TD 1UXHA 4HPXB 1OXMA 2CVOA 2IOFA 2CE7A 4NG5A 4OQ4A 4QRIA 4WXHA 3RABA 4GNKA 1L7RA 1BFUA 5CB4A 1IIBA 3B8EA 2LP4Y 2ZI6A 4F9EA 1MC1A 3WL3A 2Z6QA 2Y1LA 1S96A 4GI7A 1DAKA 1IVNA 1TQ4A 3W6UA 3GJTA 4UHHA 5MN5A 5ALJA 2B37A 3EOAI 3EIFA 1Q6ZA 1ESMA 3H5IA 4YYZA 1ZJ6A 1KO8A 2QTBA 3P0EA 2NXNA 2O3JA 4JP8A 1D8TA 1SUBA 2WYVA 5TJHA 3VDXA 4WZ6A 1KC1A 5SYAA 3SYLA 3BDIA 2DHQA 1E1RA 2V54A 3GH3A 3ZHOA 2ZT5A 2I87A 4N4AA 3R8XA 2RGXA 1P9RA 2BHSA 4JLKA 1QTQA 2AIRA 5AKJA 2H17A 1KL7A 3BA6A 4IJQA 2PAAA 1GR0A 2PXCA 3GMTA 3MJHA 3OPQA 5ALXA 4EJSA 5EIHA 1E64A 5KX5B 5HQ3B 3O8RA 2VR1A 1KAEA 1T3LA 2I8AA 4CCAA 1J4AA 4D8YA 1H5NA 1KXJA 2G06A 3BGIA 4AIIA 5I3ZA 1EZ1A 1AKNA 4J7CA 1YB6A 3DKRA 4RV5A 4RVOA 4S3MA 2HHCA 3SXPA 1TVMA 3CJQA 4I19A 5LJLA 5FA8A 2RAUA 1O1YA 2I78A 2Q6LA 3HQ4O 1A7AA 2BL4A 1N5KA 2XMCA 1MQ9A 1Q7EA 3DVLA 4KO1S 4L75A 2YVQA 2GERA 5DPMA 5ENZA 1BEUB 4EB3A 4ECEA 3LL7A 4RFSB 2D4HA 1ZIPA 3IILA 3P9PA 4A6PA 4BMXA 3PQEA 4DSAA 3OUUA 1JE0A 3ZVKA 1WV0A 2HK8A 3OOEA 2GQ0A 2JVJA 3D3JA 3O26A 4O1HA 1T3GA 3FRIA 4BRZA 1TD9A 2IX9A 4I9NA 4JNKA 2I6GA 3VR5H 4AJEA 3MT9A 4LMRA 3AUYA 1SBZA 3UV6A 4ZHSA 1UK8A 4JJEA 3H5AA 1P44A 1R0RE 2HIGA 2HLDA 3D4NA 1KSFX 2QX4A 2VP9A 3HZHA 4LYYA 3CZAA 2O8BA 2ZYIA 3GLIB 3EBLA 3UNXA 4CIXA 3LT1A 1DOAA 3I5MA 4R8SA 2P3QA 1KERA 5B30A 1JHXA 3PNYA 2NX2A 3HVUA 4UHEA 4LJYA 3WFJA 1XF1A 4NF2A 4MJXA 1C7IA 2RGYA 5KYNA 1HE5A 2HCTA 3AFNA 4DQUA 3NT5A 3QFHA 1C0EA 1JJ7A 4LHZA 3UAGA 4Q0MA 5I7SA 3AR5A 1AUPA 2IBSA 2Y0EA 3D6AA 2C0CA 3CVJA 3QFSA 2H08A 2RGAA 4Q7JB 4FKMA 3EXIB 4NU8X 3FHJA 3OP1A 1I5RA 3HV0A 3TGLA 5JY1A 2J4DA 4BO1A 2OC9A 3NC0C 5H1YA 2FMTA 2ZE6A 4D3SA 5K3DA 5HWSA 2ZWAA 1S7CA 1FVHA 2XE8A 3QHAA 3TRFA 3LBAA 3ZLBA 3THXA 3WC4A 2OGWA 2JGDB 2JIDA 2J6IA 3QXJA 2G5GX 2BKLA 4IZOA 3KAJA 4ZQEA 4FEEA 5C5DA 4BNJA 4I1VA 2B30A 4MS4B 3CTPA 4EG3A 1DUVG 1FUEA 1YMQA 2HCRA 4FOPA 3SLKA 1F4LA 3M6LA 1UC5B 3W9YA 1UM9B 3E53A 4TRJA 1A3CA 4A10A 4PC7A 5KPDA 1FLDA 2CFSA 2BR5A 3PXXA 5TDHA 4LJ9A 1YJCA 4HXEB 5G3ZA 4EHDA 2NTJA 1RE1A 3WBKA 1E5DA 1PLJA 3C1UA 3IPRA 3OO1A 1MDBA 3QMWA 4PICA 4OA8A 4TYQA 1QB8A 3OCCA 3OFNA 4QUIA 4QQFA 2JJ1A 4EYEA 1W88A 1IOVA 3B3JA 4P83A 2G9RA 1NC3A 2BZ0A 3E84A 4W9NC 3BL5A 3EXHB 3PDUA 2H1VA 4UZEA 1WAMA 1NSTA 2IEDA 1I14A 4GOMD 4RSMA 1EE1A 2ZANA 1UBEA 2O57A 1EDBA 1YE8A 4NZNA 4P54A 3DDWA 3VR5A 2C98A 4RQUA 2I4RA 4Z9XA 2UZ4A 5EVJA 1OJLA 1HSZA 4C7OB 1SUAA 5BNZA 2VBFA 4YR9A 5U4QA 2H1IA 5ISMA 3H4MA 2HYIC 2WU3A 4LQCA 2RHCA 4QTXA 3UZUA 2JFFA 1K7FB 4JBLA 4W5RA 1EUDB 2R60A 2GZAA 3AB7A 2ZG6A 1FBTA 4GI3A 4FT2A 4L9SA 2NVWA 5A3SA 3VXKA 1SVKA 1E6MA 3HBAA 3ZEAA 4KQFA 5BVHB 1XX6A 2REQB 2Y1DA 2D2IA 4A8HA 5TGZA 3GL9A 3O93A 3PWZA 2C3YA 4XCXA 1Z6AA 1SC6A 2B99A 3OMLA 1WZUA 1JQLB 3ZIDA 3SGLA 1RAGA 5KNBD 3PUWA 5BY2A 2QDKA 2QGNA 2Y1FA 2ZRKA 4TZTA 4BNTA 2ID9A 2R96A 5IYZA 3RWBA 2DTEA 3DW1X 3IP1A 2YS7A 3HO1A 4HDRB 3T4EA 2P5TB 1BSVA 3HACA 4UPDA 2N1BA 5ALNA 1R4NA 3LNTA 3MS7A 5G0SA 5K8IA 3M33A 3E2MA 2JIOA 3DEJA 4D6YA 2HM7A 3RVDA 4PRLA 2P8JA 4URYR 1K5GA 5G02A 4M1OA 4CM6A 1WSDA 1EZ4A 2YDXA 1A1VA 1IN8A 2WU0A 4AO7A 2R6AA 4G0XA 1CUVA 5JVDB 1WABA 4K3VA 3WL5A 5A1TA 5BWOA 1OXVA 1WCYA 3IUSA 5HPYB 1ZNQO 3KRTA 3IOBA 5DH9A 3RSFA 4NV3A 2ADOA 5BN5B 4EG5A 1UBHS 4R9VA 3SKVA 4WVFA 3ED1A 4HC4A 2ZKIA 3N7TA 2IYRA 3CLSD 3BG5A 3GYBA 4GOOD 4KJXA 1H8HA 3B9RA 4BAZA 3EF3A 5FOUA 1GEEA 3N0VA 3QBJA 4Q9LA 3F2VA 3O4VA 5FO0A 2VBCA 1N5MA 1EA5A 1JEYA 2QUHA 4Z7JA 4C5BA 4DA9A 1TTPB 3OZDA 1JEDA 1PLKA 4OP1A 4X9XA 4NAHA 5CW2A 2ZJYA 4M88A 2RHWA 2FW1A 3BMOB 2JHGA 3T5MA 5LQAA 3EPJA 4FFMA 4KE9A 4BS9A 1L7EA 5FBVB 2VDJA 4AJ9A 1FMFA 3WL4A 2ZB3A 4TYNA 1GUFA 3E9DA 5HE8A 4DNQA 3M5WA 4KAJA 1UMDB 3H83A 4GP7A 3B7GA 5G0VA 4ENWA 1US8B 1NW8A 2TMYA 4H7PA 3UMGA 1HLDA 1E63A 3QLEA 4J4HA 1W52X 4J7UA 1ABFA 3N39C 4QUEA 5K1ZA 1ZO8A 3DF9A 2WWVD 2PD6A 3RTBA 5CEEA 4J9VA 3UK1A 3KKNA 1GQ2A 1MT3A 4ZQBA 1CEXA 1R16A 1R4MB 2ILVA 3AJ9A 2A1TR 1R0SA 1KSJA 2CBGA 1KGSA 2GN8A 3HHEA 4LNUA 4X1YA 3SDBA 1E9RA 3WKDA 4UEQA 1XZQA 4CMIB 1A5TA 1JSLA 3ZE6A 3O03A 1YZVA 1IONA 1JHYA 2NZ8A 1ZRHA 3DE5X 1QAOA 1BX3A 3BXXA 5I8ZA 5KNCH 1KY4A 1U8CB 2P40A 2WV7A 3RUFA 1GDHA 1H8EA 2HA6A 2OV1A 3KQTA 4TTRA 3GEBA 4DA0A 4FB5A 3LLCA 2Q1SA 4R8MA 4MMYB 4GX1A 2H2AA 5EKUA 4DMGA 2ACVA 1XD8A 3ZW9A 2ECOA 4REQB 2O50A 3D8SA 4QQKA 3K4HA 1G55A 3TUIC 4BBZA 4CTOA 1J42A 4MLPA 1A1SA 3AU8A 1XMJA 4RKWA 3GLGE 4QVIA 1KI9A 2PQ0A 3QP9A 4ECAA 4Z4FA 5AW9A 4O4JB 4CMKA 3R0ZA 2G5PA 3BM5A 3IAEA 2PWBA 3JQ8B 4P36A 3EIXA 2HF7A 4YONB 1W73A 2L17A 2GKSA 1ZC3A 2EQ5A 3NNNA 3UGKA 7GPBA 3DT8A 4S2UA 3EIWA 2Q0SA 3C6XA 5EUMA 5A6SB 3JALA 2M2IA 2YX1A 4BUCA 1OBOA 4N8SA 3UANA 1Z2OX 1FXWA 3BH7A 2YZKA 2P65A 5ITZA 4Z4CA 3LRPA 3HNRA 3PNVA 4UNSA 1D5CA 3JWHA 1ES9A 1VA5A 4MYDA 3KCNA 5GZ1A 1H1TA 4KE8A 2V9PA 4WQMA 1DEXA 1PJ4A 4YP9A 2GILA 5SY4A 4EVRA 5ADHA 2Q6TA 3MBOA 1PW5A 1S02A 1D2CA 4JHLA 4JLBA 3KQQA 1SO8A 3V1TC 4YRZA 3H0CA 2BKUA 1Q1AA 1XKQA 2WIKA 3FB1A 3H5WA 1P39A 2BE9A 4JEHA 3UIEA 1NGSA 4DNPA 2IXDA 1IHDA 3DJYA 1QAMA 3V4LA 5DNAA 1DC5A 1L5MA 1HKHA 2Z1DA 3OCJA 1D9XA 1QO7A 3V4VB 1V37A 1EK0A 5DW3A 4XM0A 2R6FA 2HNAA 3A6EA 3IKVA 3IOYA 3PSHA 5J9FA 4CM4A 4BNMA 2WE8A 3IBYA 4ZCQA 4DLVA 3ITKA 2B7LA 3STXA 1UMBA 1Y8QA 2P35A 4UDXX 4JKIA 2HJVA 3N8KA 4Z4HA 1WP4A 3IE2A 1XMVA 3Q7RA 2QR3A 3P71T 2A33A 3E8XA 1I7DA 1GAXA 3HBJA 2JH8A 3AF4A 3QIVA 1FU8A 1WX1A 3KPUA 4LBVA 5C2JB 1K7SN 2PUWA 3HI4A 2B9VA 3UV7A 1G8AA 3DJFA 2ZRNA 1M0SA 4J9UE 2CJPA 3O73A 3BWEA 1K7CA 2Y0CA 3EAFA 1N3BA 4L28A 1T6ZA 1DB3A 2HT1A 1QFSA 1NTOA 3N2NA 4LJLA 4WXYB 1YBFA 1ZINA