3F67A

Crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
240
structure length
240
Chain Sequence
b'NAIIAGETSIPSQGENMPAYHARPKNADGPLPIVIVVQEIFGVHEHIRDLCRRLAQEGYLAIAPELYFRQGDPNEYHDIPTLFKELVSKVPDAQVLADLDHVASWAARHGGDAHRLLITGFCWGGRITWLYAAHNPQLKAAVAWYGKLVGEKSLNSPKHPVDIAVDLNAPVLGLYGAKDASIPQDTVETMRQALRAANATAEIVVYPEADHAFNADYRASYHEESAKDGWQRMLAWFAQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dienelactone hydrolase
publication title Crystal Structure of Putative Dienelactone Hydrolase from Klebsiella pneumoniae subsp. pneumoniae MGH 78578
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
molecule tags Hydrolase
total genus 81
structure length 240
sequence length 240
ec nomenclature ec 3.1.1.-:
pdb deposition date 2008-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3f67A00
1UK8A 1K63A 3H2GA 1QIMA 4Z49A 3WL6A 2B4KA 2EEPA 1MJ5A 1VE6A 3SC2A 3H17A 1AKNA 2GBIA 1HQDA 2QM0A 1XQWA 4UBJA 3QMWA 2QXTA 4AO7A 3I6ZA 3H04A 1T4MA 3SWWA 1Q83A 5HZGA 1XZKA 5K3FB 4H7DA 5C8VA 3VJKA 4P9NA 1N5MA 2RI6A 4ZV9A 2OQIA 4GEGA 1TK3A 5AOCA 2WHQA 3QMVA 4BDTA 1XROA 4BAZA 4J0CA 3G7NA 5A7GA 4X6YA 2H1IA 3STUA 4AX4A 1ZJ4A 3BL8A 3CCBA 2BCEA 5AP9A 2I3DA 3D0KA 4FFVA 3E4DA 1UOQA 1ORWA 4P08A 3FWHA 2IX9A 2Z8XA 3MUOA 1P0IA 3T52A 1WPRA 1JJBA 2QR5A 1BROA 4CIBA 2QJWA 2ZSIA 2WUGA 1DQYA 1NU6A 5HQ3A 4AQDA 3QITA 3HC7A 3R41A 4CCYB 4BB0A 2HRQA 5JAUA 2DQZA 2C5FA 3W2TA 3HYSA 5A62A 5AI0A 3QPDA 3RLIA 4TVKA 2OQVA 3FLEA 4ITVA 5HF5A 2GZSA 5AOAA 1ACLA 2ZYRA 1X70A 2CEKA 2Z5GA 1CUEA 3GELA 2DFPA 2YH2A 3H2KA 5AI9A 1LPNA 2OLEA 3FYUA 4HRYA 4FTWA 4EUSA 4BP9A 4G8DA 3WK9A 1Y7HA 1W4LA 1MO2A 3WLAA 1R9NA 4M0MA 2VSQA 3C8DA 1C4XA 4UBNA 1YR2A 5CT5A 3D5EA 3V48A 5LZ7A 1QE3A 4F21A 4YPVA 5AK3A 4DGQA 2H7XA 2BJHA 1G5FA 1WB4A 1CUXA 4X6XA 4BCCA 3OG9A 5C8ZA 1QJ4A 3D3NA 1W52X 3WI7A 1OILA 1VZ3A 3IVMA 3IDAA 4KYVA 3QPAA 5FDFA 4JNCA 1QIKA 4C01A 3WZLA 5HK8A 5CT8A 3WL5A 4DTCA 4Y2UA 3BE8A 1SCQA 4J0DA 1WOMA 2CJPA 4NVRA 3UUFA 1QGED 4JUIA 4ZV7A 5AKYA 4J0HA 5T4FA 2DHEA 1MNQA 4Q1VA 5FPQA 3WWPA 2JBWA 1DX6A 2GYUA 5AKGA 2V98A 2FJPA 1TAHA 2PVSA 1CIJA 2HIHA 4Q3OA 1J06A 1BN6A 1SOMA 4FLFA 2BUAA 5ALWA 3L1HA 5AIAA 3GROA 5AICA 3QM1A 5IVHA 1YAJA 4Q34A 5ALXA 1R50A 1X2BA 2XQJA 1VA4A 4XVCA 3ILSA 3G9TA 1JJFA 1XZDA 5A7FA 2PBLA 1AGYA 5HFNA 3FYTA 5BV7A 1QLWA 1VXRA 2QJRA 3MUNA 4ZREA 2WUDA 1XZGA 2FX5A 1AC5A 4FFWA 5I7UA 3WK8A 2C5GA 1YCDA 1VJ5A 2HFJA 4EY6A 4QEKA 5K3BA 3D2CA 4YX9A 2ZJ6A 4X85A 3BIWA 4Y2PA 4NMWA 2QMQA 4G4IA 3C6BA 4PW0A 3PE6A 2B61A 2VATA 2HA2A 3A2LA 4FNMA 3DYIA 1BS9A 2IIVA 4H18A 1QO9A 1JT2A 3NWOA 5A6VA 2R11A 3O0DA 3WKCA 5DLPA 4BRSA 4QDUA 3MVEA 3A6ZA 4UHEA 4B81A 3LP5A 2JGIA 5FV4A 2IITA 1HL7A 4Q05A 2XUDA 5LZ2A 3EQ8A 5HF6A 2I3ZA 2OGSA 2LIPA 3SX4A 2WHPA 3PUIA 3ZLVA 1MN6A 4L72A 1Z68A 3WQHA 2QXUA 5AM1A 2VAVA 3C8HA 2DHCA 2E3JA 3LLCA 4EBBA 1ETHA 3B5EA 2RHWA 2C0PA 2ECFA 5JAOA 3H1AA 1QO7A 3W05A 1DINA 1K6EA 3EF3A 4PSCA 2OGTA 1EINA 3IUQA 4KJXA 2AJDA 4FDMA 4BVLA 5DYTA 3B12A 1RYYA 5ALOA 2XMQA 3U1TA 1BCSA 4NS4A 3WL8A 1XKTA 5H3HA 3ESBA 4IO0A 4GI1A 1ISPA 1UZAA 1EDDA 1EB9A 1EVEA 3A70A 5ALTA 3WKBA 1JFRA 5ALIA 3UMJA 5AM4A 3QBJA 4BTVA 4LIPD 2EDCA 2WJ6A 5KREA 4Y2JA 3C6YA 3O9MA 5AI8A 3RK4A 3AIMA 1QIHA 3HZOA 4QDTA 3C70A 1FSSA 4TPKA 1OXMA 1YSCA 3FSGA 3C43A 1TQHA 1O6GA 2XMBA 4G8BA 5DNWA 4GWLA 3IUMA 4OB8A 2XMCA 1I6WA 5C81A 1BU8A 4IH9A 1E66A 1H2ZA 4DLNA 3WYNA 3S2ZA 1L7RA 1AUOA 4P93A 5AK4A 5JAHA 3VVLA 3G9XA 2J4FA 2WUFA 5JARA 3BJRA 2WJ4A 4C88A 1CQZA 3R40A 3G0GA 4U2GA 2D5LA 2YYSA 2H9YA 5EFZA 5AI5A 5JALA 1HBJA 1FJ2A 4U2BA 1FFAA 2OXEA 4C89A 1Q0ZA 4UFOA 4U2FA 4EZIA 1ZI9A 2PPLA 4BZWA 3BXPA 2XLCA 3STWA 1ACJA 5ALNA 4PQEA 1IZ7A 2PM8A 3IUJA 3FVRA 4RPCA 3W06A 4F0JA 1GT6A 5ALMA 2PX6A 1F6WA 3IUNA 2XDWA 3DEAA 3VJMA 3M83A 5DYWA 1LPAB 1ZGCA 4DNQA 3LIPA 1QIJA 4I4CA 5D3KA 2ACKA 3WKEA 4H7KA 5FXMA 3D7RA 3HRHA 3E0XA 3R0VA 5YASA 4M0FA 2GYVA 5A7HA 5A2GA 2WIJA 4QDZA 4B0OA 3D2BA 4MQMA 4FHZA 5ALKA 4CG2A 3LCRA 2C7BA 5K3CA 1GPKA 4OPMA 1CFJA 1DT5A 2WLSA 5AHXA 4G8CA 5IVIA 4EY5A 4C4ZA 4G9EA 3QVMA 2FJ0A 4BAGA 4AN0A 3STVA 1QIGA 1JMKC 5LLSA 5AI4A 4E14A 5AJHA 2J4CA 3YASA 1LPBB 5HQ3B 2O2GA 1RWQA 1XQVA 5AM3A 4AMYA 2HDWA 4FBMA 4QNNA 1QFSA 3WWEA 4FLEA 2GBGA 2WIDA 1B6GA 4UHFA 3HABA 4N8SA 3WIOA 4BTLA 1K4YA 3VISA 2WQZA 3IB3A 5E4JA 2ZJFA 4UHBA 4W1PA 1XZLA 2HA0A 5AM0A 3FYUB 3F8SA 1HPLA 3A2MA 4ZWNA 5FUMA 1IMJA 3STXA 2HU5A 3QZUA 1LPOA 5JADA 3DL4A 5E4YA 5AKEA 4OUKX 1J1IA 1YB7A 5CTAA 5IKXA 2I03A 3WWCA 1MTZA 4EB0A 5J3JA 1CUZA 1A8UA 1H22A 1CRLA 1UKAA 5KBYA 1WB6A 3I28A 4B0PA 1IZ8A 2ORYA 2J3QA 2XQFA 4ARAA 1MX1A 1J07A 1W6RA 1ZD2P 4OU4A 4I19A 1N1MA 1JJIA 4QLAA 1MX9A 3LIIA 4PSDA 1H2WA 2XMDA 3G9UA 2ONCA 3G0IA 1IUNA 2RAUA 1H23A 4K5QA 3C6ZA 4MXDA 5JIBA 1BEZA 1YA8A 3BF8A 1XZIA 3N0TA 1UK7A 5DYYA 1MAHA 3H19A 1EB8A 4P92A 2YXPX 1JKMA 4ETWA 5JZ9A 1O6FA 2CMFA 2G4LA 3HXKA 3H18A 4GW3A 2WHRA 4OCZA 2WFZA 4HZGA 4J0JA 5LKAA 2J3DA 3KXPA 3DOHA 3H2JA 3HJUA 1LPPA 1EK2A 3TRDA 2HHAA 3BIXA 2Q0XA 4F60A 5CRIA 3I1IA 2AJ8A 2WFLA 1YS2X 4J0IA 2GZRA 5FLKA 4HXFB 2B9VA 3H1BA 3FLBA 2RHTA 1IUPA 1UK9A 4MEAA 1ZICA 1DWQA 5JATA 4EA6A 5EIHA 3PICA 2CB9A 1XRPA 5FPPA 5E2IA 1QIIA 3H2IA 1XRNA 3KWJA 1EH5A 4X97A 5EGNA 1S8OA 1EDEA 2R8BA 4X91A 1XZEA 1E8MA 4HRXA 2OGZA 4G5XA 4UBOA 3V1KA 4ZGBA 4PF1A 1CVLA 5IVDA 2XUQA 5LYYA 1EDBA 2GBFA 2QOEA 1E89A 4FWBA 1E8DA 4UBIA 4RE6A 2PSEA 5HF8A 2BGRA 5HCUA 5CXUA 4D9JA 4W1RA 1XRLA 3TEJA 4FKBA 3ZV7A 2AJBA 2ZSHA 1W1IA 4ZI5A 3IIIA 5CBKA 2OAGA 3TJMA 1R3DA 2WHPB 5FP0A 1JMYA 1GZ7A 1WM1A 3HEAA 4RNCA 1MT3A 2JGKA 5ALZA 2PU5A 4RGYA 2BKLA 2G63A 2XUJA 3I2GA 1QOZA 4B80A 2PUHA 4A5SA 3OM8A 1TCBA 2ZJ7A 5DTJA 3RKSA 3M3DA 1HDEA 4AO8A 4DMCA 1T2NA 4UHHA 5CXXA 1ODCA 3QMMA 1CUVA 4G9GA 1BN7A 4BC1A 4Q82A 1TRHA 2BAGA 3IULA 3CCCA 4J3JA 5CT4A 5I9IA 2PKYX 2BFNA 5DWDA 3GZJA 3O4JA 4QDXA 3WK4A 2XB6A 2Y2UA 5F4ZA 3WMRA 1LLFA 1TKRA 4K2AA 3NUZA 1CUGA 1K5PA 3C6XA 5AI6A 1UOPA 1G4HA 1XZFA 2Y1KA 4E11A 4DMHA 4MYDA 4GECA 4F5ZA 3O4IA 1TIBA 4X6UA 2AJCA 3H2HA 3G0DA 1MX5A 1QFMA 4U2DA 3BDVA 3HI4A 1VE7A 1QIEA 1UOOA 5D6OA 4E15A 3STTA 2XUAA 5IH7A 5AKKA 2VA9A 3SK0A 5BWCA 5BOVA 4MEBA 4L9AA 4C6HA 5DJ5A 1ZI8A 3G8YA 5FOQA 1ZIYA 5EHNA 1DTEA 3I2JA 4EHBA 3QH4A 2JEZA 3M82A 1LGYA 3GFFA 3BF7A 4AMZA 3DNMA 1HKHA 1P0PA 5CMLA 1XRMA 5ALVA 2WTNA 3O4HA 1CUIA 1WPXA 4MJ3A 3KDAA 2PSJA 4DM7A 1IVYA 2VT6A 4KE7A 4IHAA 4WFIA 3IA2A 3WA7A 4KAAA 3DLTA 2BUCA 4BVKA 1FFEA 3AIKA 1GGVA 2CKMA 5KWIA 3FBWA 4WJLA 2WG0A 3V1LA 2W6CX 4KE6A 3ESDA 5AK5A 2XQGA 4DYHA 5JYCA 1DU4A 4H0CA 3L1IA 5LIPA 4XX1A 5JD6A 5ALDA 1PJAA 4PV7A 3VVMA 1UK6A 4HS9A 4HVTA 4YASA 4UFPA 4N8EA 4PNZA 4X3CA 3FOBA 1QTRA 4WFKA 5AKXA 3HACA 3ZLUA 4J0KA 3K6KA 1A88A 3WIBA 5CURA 5T4HA 2VAXA 5HKAA 5JASA 2XUGA 1CUSA 5HKBA 3V1NA 4GLBA 4FOLA 2HRRA 1GQSA 1P0QA 1EVQA 4E46A 5JZSA 4J03A 1CUYA 4KE9A 2UZ0A 4OB6A 1XZHA 1ZD3A 4KAFA 5EHQA 4ZXFA 5T4BA 1CUHA 5AO9A 1CUCA 3C5VA 1XRQA 2QTBA 1W76A 3O4GA 3FCYA 4K6HA 2JGJA 3AUKA 2C58A 4XJVA 4QWWA 2VJCA 3FYUC 1PV1A 3WJ1A 5CH3A 4W1SA 2DSNA 4X90A 4CG3A 3N2ZB 2JEYA 1C7IA 1CUDA 4Y2TA 3QYJA 3O9VA 4CG1A 5K3DA 2WU3A 2GBCA 2QZPA 2WIGA 5DNUA 4UFNA 3T4UA 1MU0A 2YASA 4HTAA 1KEZA 4AZ3A 1E5TA 3D2AA 4Y2YA 5D3ZA 1VXOA 5FKJA 2DQYA 5T4EA 4DSZA 3NGMA 2CUTA 1BRTA 5BWBA 3I2FA 2W22A 4X93A 3ICVA 1DX4A 1A7UA 2AJLI 5ALRA 2XE4A 3W9UA 5SYMA 2V97A 4B7ZA 2OCIA 4N5HX 3WJ2A 4OYLA 1AZWA 5DTIA 1J2EA 1ZGBA 2HM7A 4Y9SA 3MGAA 4C4XA 1DT3A 4AXBA 4L3WA 3WKDA 3DL7A 1XZJA 1ORVA 4PSUA 3V1MA 3Q8WA 5K3AA 3G02A 4N8DA 1BCRA 1WHSA 3C45A 2Y2VA 3I2KA 1R4ZA 2HA3A 5EIAA 5ALGA 3STYA 3FCXA 1ODSA 1A8SA 1FFCA 4LHEA 1VLQA 2PSHA 3R3YA 4DMFA 4H77A 4H7EA 1XLWA 7YASA 2PU7A 2WFLB 5AIBA 2WU4A 1F0PA 2OG1A 2VT7A 2V96A 4BP8A 1ZOIA 1LPSA 4QE3A 1RP1A 3U0VA 4QLOA 4BZZA 1ZIXA 4DSAA 4Q3KA 4CIAA 1D07A 5AM2A 4K6KA 2BUBA 3GUUA 2EDAA 4O08A 1LBTA 3AZPA 4DNOA 2VF2A 1DWPA 1YAHA 4NZZA 3R3WA 3BDIA 4WY5A 5JD4A 1Q0RA 1BEEA 3R3VA 3F96A 2WIFA 1GPNA 1DWOA 1XZAA 1UWCA 4BVJA 5SYNA 5JANA 3KWFA 3O95A 2HA7A 2XI4A 2O2HA 5ALPA 3PDCA 3DCNA 3PF8A 1CUJA 2HADA 1XZBA 3WK7A 2XUFA 4B84A 2WG2A 3HLKA 4OYYA 2D0DA 4BE9A 1EXWA 1CEXA 5LP1A 5AOBA 3R3ZA 5HK9A 3PF9A 2NW6A 5EIEA 2Y6VA 2XUPA 3RM3A 3G0BA 2WG1A 2PL5A 4G4JA 3F67A 4CFSA 3K9BA 3I6MA 2WFMA 1CLEA 2QT9A 2DHDA 5D7BA 3D59A 2XQKA 1VZ2A 1R88A 3CXUA 1IUOA 1XZMA 2H7YA 4KR0A 2QUAA 2V9ZA 4LYDA 1EHYA 3E3AA 1ZJ5A 5ALFA 4RE5A 4A23A 2VTVA 4C4YA 1VKHA 1XQYA 2DCMA 1BE0A 4XIIA 3PUHA 1X2EA 5CW2A 3I2HA 4H7HA 3WWOA 2XUIA 1PFQA 4WDQA 1FFBA 2XMZA 1FFDA 4Y2SA 4K6GA 2VJAA 4LXIA 1CUWA 5HF9A 4WFJA 1H2YA 1THGA 3KSRA 4S0XA 1MAAA 4B6GA 1L7AA 4HXGA 1CPYA 2I78A 4W9RA 1W75A 2ACEA 5CH8A 5ALHA 4QWMA 3DD5A 4GXNA 2JIDA 2O7RA 4H7FA 1E8NA 5LZ9A 5ISMA 2C0QA 4A16A 5KWJA 4IH1A 3S8YA 4B82A 3JWEA 4B9EA 1LNSA 2RONA 1G42A 1VA5A 3DDUA 3G0CA 4OD0A 5LKRA 5JD5A 1YS1X 4LXGA 1ODTC 5E4TA 4KE8A 4X71A 5AK6A 4QZVA 5ALEA 1CR6A 3P2MA 2HU8A 5ALJA 1KU0A 1WCYA 4X95A 3RARA 4PO3X 4DNPA 1NX9A 4UHDA 3JYHA 2VJBA 3HSSA 5LZ4A 3V9AA 5K3FA 4J7AA 2OCLA 4WY8A 3FAKA 1TCCA 5LZ8A 1L7QA 3UUEA 1CUFA 2OCKA 1CUUA 5DNVA 2XUKA 4W63A 4CI9A 3NOXA 1GKLA 1THTA 2OCGA 2C4HA 3JW8A 6YASA 2HA4A 1UFOA 3WKAA 2PSDA 1VOTA 1LBSA 4Y2VA 5K5EA 5AKHA 3H0CA 4AB1A 2WIKA 2OPHA 4Y7DA 2ZYSA 1CQWA 3PI6A 4CCYA 1N5RA 4BCDA 3IURA 1YA4A 3AFIA 5C7YA 5ALLA 2QS9A 5ALUA 4MWTA 3OPMA 2JGFA 3B3QA 2VEOA 3FNBA 1WB5A 4INZA 1Y7IA 4KAJA 2QRUA 4QDOA 4GHWA 1UKCA 1XLVA 2BGNA 1U4NA 4BYMA 3WYDA 5EI5A 5IVKA 1C7JA 4I3FA 4B9AA 2Z3ZA 4BBZA 1N8SA 1TCAA 3AIOA 1CUBA 2Y6UA 3FLAA 4UUQA 3DQZA 4IQ4A 4U2EA 5AKJA 3ANSA 3VXKA 2Z8ZA 3WL7A 4X7BA 1R1DA 1AURA 5C8XA 4H7JA 2QKYA 2X8BA 2B20A 1QONA 2XUOA 2PSFA 4DMKA 2K2QB 1MPXA 3DS8A 3R3XA 4H7IA 2FUKA 1HLGA 3PFBA 3ESAA 4XWGA 4FMPA 4FLMA 2HU7A 5ALSA 2JGLA 1U2EA 4LKOA 5CH5A 1LPMA 3W04A 3K2IA 3OC0A 2G5PA 4X00A 4YK7A 3F97A 3WK5A 1XFDA 3DOIA 3GA7A 3C5WP 1M33A 1YB6A 1H2XA 4JYMA 3R3UA 4UBLA 4ARBA 1EI9A 3AZOA 2RGUA 2ZVDA 4W1QA 4OB7A 2O7VA 5AM5A 3EBLA 2P8SA 3EQ7A 1EK1A 4JYPA 3DKKA 3KOOA 3OOSA 3EQ9A 5LZ5A 4IH4A 2HFKA 2CZQA 2JGMA 2X76A 1EA5A 1ZD5A 4UHCA 3DJYA 4G4GA 3G9ZA 1JU4A 4AO6A 4U2CA 2WTMA 1AQLA 4KRXA 1SCKA 4FNGA 4B83A 1CV2A 5ESRA 1OCEA 4M0EA 2XT0A 4QA9A 4BC0A 5JAPA 2CBGA 4BAUA 4ROTA 2ROQA 4BCBA 4WDRA 2XUHA 1QIFA 4HAIA 2HA6A 4DNFA 4EY4A 1R9MA 4X94A 4UBKA 4G1FA 4BRZA 2WJ3A 4X92A 4EY7A 3M81A 3X3HA 1LZKA 3VDXA 2H7CA 4JH0A 1UXOA 4N5IX 3VKFA 1JI3A 4FBLA 4KEAA 2XMRA 3AZQA 5AKIA 2ZYIA 5K3EA 5I8PA 4OSEA 4B85A 5AKLA 3ICWA 2XMSA 2WILA 3ESCA 5JZBA 3WA6A 1WHTA 3DKRA 4HXEB 2WUEA 4MWSA 2XLBA 3LS2A 4Y2XA 3L1JA 1Y37A 2HA5A 1AMNA 5AH0A 2JGEA 5EHZA 2AXEA 3OTQA 1YASA 1ZD4A 4LYEA 2X5XA 4LXHA 2OAEA 3TGLA 3AINA 4V2IA 4GBGA 1XRRA 4MQLA 1G66A 3ANTA 1SCIA 3EIOA 5HFAA 2PUJA 3ED1A 2O2IA 3AILA 4UBMA 3ZLTA 2RIPA 5A71A 2GYWA 2QVBA 1SC9A 5ALQA 3PFCA 4L0CA 4H35A 3WZMA 2Z3WA 4DIUA 3DYVA 1QTIA 2G5TA 1KU6A 4TGLA 4MYSA 1ZI6A 3ZPXA 2QUBA 3CN9A 1XKLA 4GDMA 4BDSA 4BATA 3FSGD 3FVTA 4KRYA 1U65A 3KD2A 3OURA 1F8UA 4Y2RA 4Y2QA 3Q0TA 1P0MA 3D4LA 1K8QA 1EX9A 2WKWA 4ZRDA 4KACA 4C87A 2HL6A 5AKZA 2ZYHA 1GPLA 1UT6A 3WK6A 1B41A 3GBSA 1E3QA 2DR0A 3QPCA 3CN7A 1JU3A 1GXSA 1QZ3A 3ZI7A 3WWDA 4WCVA 3E1GA 1GKKA 5CT6A 1QIDA 3IBTA 3VJLA 1A8QA 1LZLA 2WSLA 2VJDA 1GQRA 3ZWQA 3A2NA 1SFRA 2WM2A 1NU8A 2XQIA 1MNAA 4AN1A 4OU5A 1XLUA 1UKBA 1DQZA 4AZ0A 5FRDA 2JF0A 4UPDA 3AJAA 3I2IA 3I6YA 3W9BA 1XZCA 5EHXA 2VQ6A 4EY8A 2XMGA 3BWXA 3C87A 3F9CA 1USWA 3F98A 4J0GA 1XQXA 3BJMA 5ALYA 1AX9A 3I1YA 1Q84A 2ES4A 4CCWA 1F0NA 4JEIA 5CT9A 1U8EA 4Q3LA 1CUAA 4BE4A
chains in the Genus database with same CATH superfamily
2F2TA 1UK8A 4DLYA 2HREA 3V46A 3EOBI 4LOAA 2GTIA 1VG8A 1W1UA 2FKAA 3AESA 3ABZA 4Z2YA 3DMDA 3UOAB 4BVGA 4Z54A 4JXKA 5HKKD 5T7BA 4L7QA 3P9PA 1QG4A 2X8JA 2C2KA 3BA6A 3I8XA 2LKDA 1I3MA 1NF9A 1JVBA 3SC2A 1Z3CA 4QUKA 3ITDA 1DC6A 4J90A 5FOXA 4A6DA 1NM5C 1CE8A 1J90A 2WKQA 1RHUA 3QF4B 1X1BA 3E9DA 3NJ8A 4UBJA 1E1MA 4U63A 2UZ3A 2PKEA 4WEQA 3WLLA 1N92A 3A4IA 4IDAA 4ZGGA 4WE3A 1M72A 3O47A 2W4MA 1H9CA 1G21B 3E35A 2N47A 2HV9A 3VZDA 4B6PA 4GICA 3ME5A 1W9MA 5C8VA 4GX2A 3QE4A 3A4YA 3D5QA 4OI4A 1SULA 2R79A 3P9ZA 2AUMA 4OGKA 1N5MA 2YHUA 4LTNA 4TQAA 1DC5A 1NBAA 1X9IA 3DR3A 3QEJA 4IEEA 4IRXA 1Q6ZA 2WMDA 4GS5A 4UE6A 5D3QA 2XHEA 2JJ8A 2WMOB 3CX6A 4JEHA 3LOQA 5LQSA 4XWOA 4WNAB 1ZJ6A 4KIUA 4ND5A 1RWXA 2BV3A 4ZAZA 3NXKA 1PYOA 2WWTA 3HR7A 3QMVA 5EMLA 1WDTA 4B6QA 4HGPA 3RDPA 5B1HA 4K9RA 1O57A 4M22A 1O4WA 4LC0A 4J0CA 1E1RA 5A7GA 4Q9KA 3LKZA 1C5KA 1GKUB 4AVYA 2V8OA 3BJIC 1RMQA 4XUGB 4AX4A 1KDZA 3IP6A 2HT1A 3SBEA 2VI5A 3CCBA 5AP9A 2RGYA 3F5QA 3EDOA 2LRHA 2REQB 1CDZA 3D0KA 1VCNA 5EZ6B 3EHEA 2B6HA 4XQ9A 3ZY4A 1TUEA 5LJIA 4PWYA 3QLTA 2BY4A 1ORWA 4H4CA 4X8HA 4BIIA 4WBXC 4ZAGA 3T52A 1P0IA 4U4AA 4AM8A 5LKAA 4W5RA 4KPYA 4MDFA 1Y4UA 2QR5A 2BEUB 3O83A 4BNWA 4DWWA 1A4UA 3S5JA 2OCBA 1GIAA 1QX3A 4RVHA 1JF8A 1KEWA 1NU6A 2E7ZA 1P62B 4XLLA 3N3AC 2ZM6B 3ZQ6A 4V38A 1FDTA 4C0KA 4CCYB 3HC7A 1D8TA 1N9GB 4BB0A 3MW8A 3H4VA 4BQSA 1DPGA 4GE3A 1CJMA 1QP0A 1ADYA 2H9AA 1EJ2A 3DBHA 4BQOA 1E3IA 1E3TA 3D4BA 2QD5A 3NC0C 4J49A 2VJMB 3HYSA 4TM7A 5SV2A 4PYIA 1R10A 1RWKA 1QAQA 1WPGA 4IX1A 5A62A 4D46A 2HOQA 3SFZA 5HKLA 1E32A 1DMRA 1Z5UA 3RLIA 2OHFA 4D02A 1W0KD 2HWKA 1NXOA 2WDPA 4HDOB 3SFTA 4PFKA 5LNK6 3ET5A 4M2LA 4ID3A 3U7RA 2AEFA 3GU3A 5TQ2B 2JCYA 1P1JA 5IAKA 2JFBA 1CZRA 2ECOA 5CJPA 1ACLA 4UOEA 1WBJB 4BAZA 2BJWA 1GU7A 2CEKA 4WN9B 1K2VN 3LUPA 2OXCA 2DFPA 1QHHA 2YH2A 3H2KA 3G5UA 4AJEA 4D96A 1NN5A 1U28C 2OLEA 4CEIA 2O8BB 4J1SA 1JG7A 3IUBA 3FYUA 3SZLA 3QOYA 4HRYA 4EUSA 1JS1X 4DR7B 3KCNA 1TU3A 2H4JA 2ZXUA 4E70A 1U3CA 4BP9A 1UMBA 2XGJA 2BMJA 4G5HA 2OORC 4OL0A 2X7XA 5B3JC 1Z2EA 3O9ZA 1MO2A 3DUFB 5BY2A 3ZDCA 3L8HA 3TW8A 2VSQA 1NZFA 1ULTA 1UPXA 3TRIA 3B3JA 5MF6A 3HYLA 2X15A 3V8BA 5KTMA 4YP9A 1K8XB 1YR2A 3QLVA 3KT8A 3DE4X 3FUXA 3PDIA 2H07A 4RQBA 4YJGB 1RTKA 4YPVA 1VPEA 1CBUA 3W8RA 4UD2A 1ZEJA 4FDVA 4EP1A 3V4ZA 4G81A 1WB4A 5IH3A 5ITVA 2HJSA 3BBPA 2SECE 4S04A 2WE8A 1J4AA 3B9RA 1QRSA 1BVUA 4BCCA 1SXJB 4K1XA 4R9NA 5LQCA 5AVRA 4RC9A 2QTRA 3SM9A 5EJ8A 1E9VA 4R2MA 1QQ6A 1QYCA 1X38A 3I52A 3GVPA 2NZUG 5C8ZA 4X62B 2HRCA 2NXEA 3JWIA 1A76A 3D3NA 4U5XA 5F5NA 1GGKA 4B4VA 1W52X 3AP1A 3EB9A 3WI7A 4P3XA 5F9MA 5A06A 4BLTA 2YWCA 1VZ3A 4L5CA 1SQGA 1GPJA 2A3RA 2OHVA 2P5TB 3FOAA 3OE4A 4KYVA 4N6GA 1E1QA 3DVAA 8AT1A 3J80A 3MJHA 2HIGA 4QFCA 4QOEA 4JNCA 2WU0A 4DE5A 5L51A 1Q1NA 4U7PB 3WZLA 1RYDA 1E1KA 5HK8A 1EFDN 3K0KA 4DIKA 1J8QA 2VJQA 1X13A 2ZIWB 4FJ1A 2EW8A 4Y2UA 2FPWA 3DF9A 3GJ0A 1IHOA 2JCGA 4L8GA 2G04A 3ZNNA 1JQ5A 1XJCA 3RTCA 1UZLA 3SY8A 2O8DA 4ZT5A 1FX1A 3RIHA 1R5JA 4ZV7A 2ZE8A 4KBYA 2Y1DA 2YJZA 2AQIA 1U9IC 1YJ8A 2IUSA 3CRMA 3F6RA 4TRRA 5T4FA 2GAOA 1AQJA 4Q1VA 5LOVA 1OI4A 3CLUD 2JBWA 1O9GA 3LC7O 1IULA 2FI1A 1WCWA 1D09A 2ZYUX 1N2HA 2FWIA 5A0TA 1R6BX 2FJPA 2ZI6A 3E0QA 1J7JA 2D62A 2TRSB 3OPYI 5COQA 2B25A 3FW1A 5K4AA 4HLQB 5JR3A 4FYXA 3N58A 4QATA 1Z07A 4B8ZA 1M5RA 3O6VA 4GUDA 2H8KA 3L1HA 1G8YA 4Z1MA 2HTFA 3ZVMA 2FHPA 3GRYA 2NUTB 4DMMA 1TA9A 3GT3A 5M5BA 3U09A 1WSWA 2PZKA 1XTQA 3QM1A 2H29A 5JECA 4YLGA 3INNA 4RO0A 5IVHA 4C7XA 1SO8A 5JXGA 4WKOA 5JSFA 4Q34A 4YDSA 3FDJA 3EGXB 3NBUA 1HZJA 4LV5B 2XQJA 1N0WA 1VA4A 1F12A 3DXXA 5J4KA 2O14A 3N7TA 2R8ZA 4FW9A 4XYBA 2QG4A 1YFZA 1K8RA 1SHKA 3G9TA 1CZNA 4HFRA 3QXJA 5A7FA 3G23A 2K4MA 2ZYTX 2EX0A 2NYRA 1PT9A 2NWQA 5EWJA 1XEWX 3FMGA 3PQCA 1QLWA 1VXRA 2FR0A 1LC3A 2QJRA 3F7OA 3GAMA 3MUNA 3NHAA 221PA 4CM9D 4FFWA 4KDFA 2H3HA 3BIOA 2RHMA 3ETHA 2HQRA 1P5HA 1YCDA 2WHYA 3PA8A 2GWHA 1VJ5A 1GTMA 1QDLB 1RACA 2QGNA 4R3WA 4JU9A 4QEKA 4EO9A 1K7CA 1I2ZA 1MKYA 2GZAA 1K86A 3D2CA 1SCJA 3IBCA 4DREA 2C92A 4WW0A 1GNTA 4YX9A 4C29A 1DTWB 5DGHA 1L5ZA 1N6IA 3GT7A 4N4AA 4HPWA 1H8HA 1U8CB 2W6IA 1C30A 1KI3A 3FH0A 5DHRA 4A27A 1E1QD 4F38A 1USUA 1JIUA 5ALVA 1JA1A 4PW0A 1KRXA 1DTSA 2FZLA 1RWWA 2J87A 1EUZA 2MSKA 1X7YA 3J7TA 2HA2A 2EGHA 4YI5A 1SBHA 4FNMA 4O02B 1NV9A 1XWIA 1UP4A 1NZJA 4RQAA 5DN9A 5KO2A 1ZH2A 2NUAA 3IODA 2YQ5A 3M0EA 4EL0A 2WYOA 3PK0A 3CGWA 1FVHA 2DZDA 3AI7A 4PC2A 3RRBA 4BNIA 4CT4B 2XEDA 4R84A 3WL4A 2HJWA 2NPFA 2GN4A 4FIDA 4WCDA 4AK9A 1P2SA 2UZ4A 4EUKA 9LDBA 5AW6A 1Z56C 5CVTA 3PGVA 4HN9A 4FZ5A 5DB4A 1IBLB 4ZRNA 4AUMA 2FDRA 2HCRA 2CMKA 2HN9A 2LVBA 3WNQA 2NNLD 3A6ZA 4DANA 3GRRA 4DLPA 4EG1A 1ILWA 2ZRMA 4INOA 3SZOA 1XNHA 3K0BA 4B81A 1EZZA 1UQRA 4IR7A 3QEKA 1PDWA 2HK7A 1BKDR 3EXIA 2JGIA 1OT5A 4KDCA 4ER6A 4P5EA 4HEHA 3UK6A 4FSXA 3WLMA 3EGDB 1XHEA 3VC2A 3C1UA 2WM3A 4Z1MD 2QVCA 3D54D 3S55A 3OQOA 5A9RA 1WU7A 5LZ2A 2CSUA 2V7QA 2GESA 2A7QA 1NW9B 3BRSA 4TUYB 2LW7A 1TVMA 1D6SA 3AU8A 4XH9B 4AC9A 1NQOA 2LIPA 3C3PA 4Z5XA 4Q1FA 3TIGA 3F7NA 1Q1AA 1FP7A 3HDTA 3MWEB 5LQRA 4L72A 1X7WB 3WOHA 5KNBD 1FPMA 4AF8A 4ZVQA 3IT2A 3MWDA 4O4HF 3ZZNA 2CXOA 2OM6A 1GNSA 2ZBDA 3DLIA 4H27A 3WZ2A 2QNIA 4HC4A 4ETNA 1U7PA 3WQHA 4MKIA 2QXUA 1VPLA 3G5TA 1EK6A 2JD2A 2VAVA 4ZP1A 1SCAA 3WXMA 3C8HA 1FLAA 2FPIB 5ERXA 3WWZA 1LW6E 1KMNA 2OMKA 2H2WA 3DF7A 3LRPA 3RHFA 4P7BA 3LLCA 2J3JA 3DP9A 1Q1EA 3I34X 1ETHA 4JUFA 2RHWA 5KQRA 1XCLA 1D3AA 2QN8A 4HWSA 1HNWB 4ISCA 2ECFA 2BC9A 3ZZ1A 3PFFA 4UZFA 2PGJA 3RRJA 3QSGA 3K1JA 4J4TA 3NJ4A 4KO4S 4V3CA 1B42A 1U0FA 2PX2A 1M2FA 1LI4A 3DVSX 3PGLA 4HRVA 2JHCA 1DRWA 3D2LA 1N6OA 1D1SA 2ZIFA 1T5BA 3K1AA 3IXMA 3RYHB 5TEVA 1EINA 1Y6RA 2NACA 1T10A 1TZ2A 3CLSD 5KC8A 1VSQA 4KJXA 4FDMA 4L4UA 3IT3A 4BB5A 2QRNA 4EUHA 1CHNA 1WLSA 1GZUA 3CU5A 4UUBA 1X8XA 1XD2A 2CKDA 5DZSA 3PXGA 4CR8A 1RYYA 1PQYA 2XMQA 3A26A 4O2BF 5ALOA 3DOUA 2JFGA 3P0EA 1Z4OA 3TKLA 3T3GA 4P3YA 1XKTA 3BXXA 2C1ZA 4NBNA 1QCDA 3ESBA 3LUFA 3ZVRA 4CCAA 3NTQA 1ZN9A 2AS0A 4RM2A 2WSYB 1TM2A 1N9KA 1YI1A 3N7AA 4QPNA 4OGFA 2AEEA 2Y05A 3OY7A 3RGWS 1EB9A 5ALTA 3G2OA 3HBAA 1L7EA 3PNMA 2C98A 2QTVB 2RB5A 2EATA 3DBLB 1WCIB 1KAMA 2FU5C 2Q9AA 5AM4A 1OZGA 3I39X 5CEEA 1XPOA 3DLBA 1V3UA 1RXUA 3GNQA 1D2MA 3JRXA 1OI2A 5CCBA 1RJ9B 2UXBB 3JQ8B 2C9OA 3V33A 1R9JA 3NBFA 1X42A 3RS0A 1PDOA 1T0BA 3IAM1 1G5RA 2ZAOA 5DNDA 1QIHA 5EJ6A 1VM6A 5ADHA 5AW0A 1FSSA 5EUQB 3GGGA 2J9FB 4TPKA 5DBFA 5AW9A 2G6BA 1GG9A 4AWXA 4C21A 3OQIB 4KREA 1OB5A 2HK8A 5DMXA 4D44A 3HXOA 1P2GA 1GL7A 1H5UA 2C42A 2IXDA 2G72A 4E5MA 3C3BA 3LBYA 5HRAA 1TMOA 4QTXA 5EN4A 3BMNB 4GWLA 4W99A 2QVZX 1XTPA 1U2GA 4Q9HA 1BU8A 2Q3EA 3DEZA 3EGOA 1KDRA 3WLSA 4C4OA 1T8UA 2O4CA 4OEHA 4Q7JB 4UAUA 1R5OA 3RVOA 4IH9A 5K6TA 2BBOA 3P9QA 3P9IA 1OLOA 4K0KB 1M2VB 3F2VA 4AZ0B 1H2ZA 4NJMB 3WYNA 3S2ZA 1F20A 2Q5OA 4MRRA 5FJJA 1REQA 4MVJP 1U1DA 1HFEL 3PENA 4B46A 1W47A 5K0CA 3MJDA 5NULA 5AK4A 2AR7A 1I7SB 4NZ9A 1Q19A 3F49S 3PD1A 4O4JB 1SVUA 5E3JA 3HXTA 3PGMA 1M6VA 5EAIA 3SBOA 3U2QA 2PGLA 4AKSA 4CODB 1NXQA 5K0GA 4J9UE 2Y1LA 1JDUA 2OAP1 3COVA 3MHTA 1VKOA 3DOFA 1V8PA 3T06B 2KLBA 4B71A 3PEFA 5A5EA 1RCTE 3D3EA 5ED4A 4LVCA 3RTEA 4F72A 2RGNC 1VIDA 3UH1A 1M66A 1R0ZA 3TLGB 2UKDA 2P0EA 3GLHA 4E1BA 5AQ1A 2WWYA 4NE7A 4CKXA 2P1DA 4PLHA 1QHXA 2QLNA 4WPGA 3AJ9A 2QD4A 4M6WB 2W2OA 4MV9A 1FMCA 1S3IA 2H9YA 1LLUA 2OE2A 1B6SA 2GEUA 1B0UA 1PNQA 3K4HA 1QDEA 3C0KA 2X58A 3QLVC 5KQGA 1RFLA 5LLTA 1FJ2A 1K7EB 1K92A 4GMDA 4CN9A 2I91A 3VRHA 4K6OA 2W37A 2OXEA 3VU0A 3ZUGA 4EDFA 3THYB 1IVSA 1GQQA 4UFOA 5TVKA 5H4GA 2VL7A 3DMYA 3OM0A 2X4DA 3BXPA 2P9YA 2UV8A 1VHJA 3NWPA 3SXPA 3N07A 4BKRA 2GK6A 3STWA 5TX7A 2MSDB 2R47A 4ALJA 5B6JA 3NDBB 4F5EA 1IZ7A 2PM8A 4JLUA 5F7OA 1JDBB 4JI5B 5T6BA 4MKZA 1E96A 1XNQB 1A95A 1Q20A 1RAGA 2JGNA 3ID6C 4HP8A 3X1KA 3NTOA 4AMUA 4F0JA 2IZZA 1NX6A 3BIJA 3VNUA 1TUIA 4LYYA 3ZGXA 1T1IA 3TOCA 3DDZX 3VJMA 1DE0A 1YDWA 4FCTA 4LWPA 5DYWA 1ZGCA 1D4FA 3A37A 2ZUSA 2AX3A 2CLOB 1MDBA 4V0OA 2B4AA 4FOPA 3FCSB 4LK2A 4LF6B 1U0RA 2ACKA 3VX3A 3WKEA 4H7KA 1KJ8A 4N9WA 4I4LA 3Q6NA 1V96A 2PS1A 3AB7A 5AUPB 3ESXA 5A7HA 4JVLA 3OT5A 2ASEA 3NPMA 4O0MA 4RTNA 3CX8A 4QDZA 2W43A 1CULC 1KEVA 1VCHA 1AM4D 2P3QA 3D2BA 2NV6A 5DM60 1WSDA 2B8TA 1QQAA 2F3RA 1EBUA 2GLXA 1JFFB 3HB9A 1XL1A 1CY4A 1MR3F 4EFDA 4ERXA 2FF5A 1E2KA 4JCOA 1EEHA 2M1ZA 2WI8A 4OPMA 3B1WA 4HFJA 3H87A 4OO3A 3FFTA 1GNRA 2WV7A 1N5JA 4D9KA 1ODJA 1RD4A 4YROA 5EJ5A 4XWWA 5CFPA 3R0JA 3RAFC 2FJUA 3QVMA 1N6RA 5KVCA 2ZBPA 1LX6A 1Z6YA 3GVXA 1L5MA 4B79A 2YWDA 1MOSA 5DHAA 4AN0A 3U4GA 1MX3A 4IDCA 4M0LA 4KYTA 3P52A 4HJXA 3VI3B 5AI4A 4E14A 3GR6A 5BR8B 5AJHA 2J4CA 3N8NA 3L7YA 5FPTA 4F4HA 4RFSA 5TMBA 2EQBA 1NVVQ 1H9BA 3RYFB 1NF8A 3TLMA 4UNQA 2W2VA 4KIWA 3KYIB 4BWFB 2EERA 3L01A 3QW2A 4XFKA 4QNNA 4CT0A 3Q3IA 3WWEA 2I3BA 3D3QA 4PZDA 1CC1S 3UC9A 1ZSVA 3ZE8A 4UAVA 2IIQA 5KQLA 1A0OA 3TQTA 3S1AA 1JNXX 1ZA2A 1ZAKA 3DZKA 4Q3BA 1QS0A 2GPTA 3SDBA 2MSNA 1CP2A 2PNFA 2EJCA 1T8TA 2LTAA 3AC0A 3KYCA 4UHFA 1ILEA 4BFZA 1BWRA 1RI5A 1JP7A 5EXTA 2NO0A 4EJSB 1G63A 1MB9A 3W2EA 5KYXB 3GPCA 3NHSA 1T13A 1Q95A 4X3PA 2NVBA 3C39A 1U0LA 2IYNA 3PLRA 1RQNA 3U3JA 4F45A 1ADFA 4NRDA 5K0LA 1I36A 4V24A 4ECEA 2EF0A 2NU6B 1XGKA 4F6CA 3G59A 3GEHA 1Y63A 2BFDA 3PUXA 5ADWA 1BX0A 5AM0A 4LRUA 4NZMA 5BORA 5ES4B 1QRDA 1ODFA 2OZLA 4ESEA 5K9ZA 3UF0A 3BFXA 1SBZA 2JBAA 2HNKA 3NDJA 2E4XA 3D43A 1C3OB 3VYTB 2CMDA 4X54A 3W5CA 3IEVA 4CKCA 1FQOA 3KSBC 2Z4RA 1YIOA 1Q0QA 3WICA 5EJAA 4EZBA 1C1DB 1Y3IA 4G4SP 3D8UA 2C78A 1VYVA 1JFVA 2XZOA 4F96A 3RFTA 1DJMA 3LZ6A 5CLQA 5DW3A 3DL4A 1P77A 1EQ2A 1UDRA 1UODA 2ODWA 5LXTF 2QRVB 1EUYA 4WLFA 2E4WA 2EZ4A 1Z2CA 2IPAB 1QZXA 5E7IA 1ZMRA 1J1IA 1T3TA 1SZJG 1FBTA 3T9AA 3CF4A 1YB7A 1Z0FA 2OENG 4H1UA 4RULA 2PS0A 4AI6A 5IKXA 3QX3A 4NOMA 4HGQA 1VMIA 1U1GA 4W4TA 3A1EA 1TFRA 1OXTA 3DL0A 4AZSA 1CRLA 1UKAA 2JLAA 2X2EA 4KBGA 2A88A 2BFBB 1WB6A 3JAWB 4GM1A 4XEUA 3TW0A 4DW8A 5CA0A 3ZWXA 4ARZA 1GUDA 3PJDA 1EGAA 4HUJA 1W88B 2XQFA 1MX1A 1J07A 1V5IA 2FZCA 4OLHA 4EHAA 1SVMA 4PPYA 1AKRA 3R0IA 2DFDA 1PJ4A 3UXHA 1RLUA 3KIPA 4HAZA 4I19A 4GPD1 1CY0A 2V0GA 4YAOA 2EJWA 5LQMA 4FSDA 4J16A 2W00A 3P9KA 1E4VA 3E4CA 1G0OA 4X41A 3ZU2A 1YFLA 2YBDA 1UKVY 1TGYA 3K5IA 3MF4A 2D1FA 3OH8A 4NYIR 5CCEA 4CM4B 3OCZA 1TJ4A 3OUUA 3LIIA 4PSDA 1NFQA 1BQEA 4Q4JA 2NU9B 2Z30A 5E6RB 3ADBA 1YJXA 3AVTA 4NCNA 2XMDA 2R5FA 1OTHA 1E6WA 2BFCB 1X8JA 3CF6R 2YFQA 4JEUA 4IXNA 4JQYA 2ZJ8A 4NI5A 4WBSA 3QELA 2HNAA 1HX7A 4JLWA 3RIGA 1JWAB 3LPAA 2H4WA 3KXKA 4E09A 2QW0X 5LBTA 1JU9A 1C1YA 4IOKA 3SVTA 1AA9A 1B3RA 2P9TA 1E3SA 1KMHB 3AFGA 2OXRA 3UWOA 2CK3A 5E3HA 4DCJA 1UJ2A 4RIEA 3E70C 1KY5A 4G6ZA 4HDKA 3F4BA 1OJLA 1XZIA 3QWAA 1EWRA 1VBMA 2ZATA 3FNQA 3HYNA 3O38A 3OZWA 4HCJA 1ZDMA 2PAFA 4JLMA 5EJ2A 1DELA 3O8OB 1KVTA 4F92B 4JYBA 2O7SA 1IL0A 4JLVA 2ZBEA 3GGOA 3P9CA 1RXVA 3SDSA 2FSPA 1N2OA 1P2UA 4EATA 5L4NA 3REGA 3HCPA 2OV8A 3UJDA 5IG2A 3MCAA 1I1OA 1UPCA 1YO6A 4DLSA 4MI9A 4EG3A 3C15C 5KNBH 4P81A 1M2KA 5BXYA 5JZ9A 3QKTA 2G4LA 4TV8B 5CYGA 4NCBA 1EFKA 3H18A 1JZSA 4OCZA 2WZQA 5ECGC 1B1AA 2OCXA 2ZJBA 4HZGA 3SQWA 3CZ9A 1C9NA 1KYVA 1U3TA 3ZLUA 2G9ZA 3K0AB 4YMUA 1PZMA 3D3JA 4P4TA 5ICFA 3MS7A 4CLOB 1LPPA 2P6MA 3H11A 4OBBA 1T2DA 3BIXA 1HTWA 2R6CA 4OXQA 2L82A 2Q0XA 4O2AB 4MHSA 4WOJA 3HU5A 4PQGA 3PNYA 1ZVJA 4KO2S 1F2UB 5HOQA 2O1EA 1I1HA 3M3PA 4FFLA 2WICA 4XPZA 3ZNPA 1C0EA 3U4QA 4MROA 3IDZA 3VNSA 3IOMA 3FUUA 1YS2X 1W8IA 2D0OB 4GO1A 5DU2A 4HXFB 1FX0B 3DAFA 4ZT6A 1C7ZA 2ZR9A 3KB8A 1BC5A 4KQKA 4N54A 4EA8A 3I58A 1FFWA 4MEAA 3RVBA 4RF3A 4HTFA 3LUDA 5HS4A 4MYUA 2AMYA 4AT1A 1V2HE 3IHLA 5IYZF 3H9CA 4MOWA 4YFVA 3E53A 5DM0A 4YAKA 1H65A 3FF4A 4GWKA 1TUBA 2OLJA 3SF8A 3GLIE 4DV6B 4M9RA 4KG7A 3VPAA 2C4VA 5EE0A 3OE7A 4BKQA 4QVIA 1D4OA 3GRUA 3U9SA 3WLRA 3BPSA 1JL3A 5IJWA 3GLQA 4C0BA 1LNQA 2D7CA 1QLJA 4D3YA 1U2GC 5KQMA 1ZXBA 3U7EB 5EGNA 3UAGA 2YW2A 3MRTA 2R44A 3DWIA 4Y9UA 3WMWA 2R8BA 1ISRA 1E5XA 2X40A 4TV9B 4U0KA 1GYQA 1SRRA 2WF6A 3HJCA 5F1YA 3AFHA 3SMVA 1M7HA 2HLDA 2OGZA 1LQTA 3E1KA 1UKEA 3EPPA 2J30A 4INJA 4UBOA 2COEA 1GLVA 5DCLA 2I6GA 2I2BA 10MHA 2NADA 3N39C 5L3QB 5IVDA 3KJNA 4LMBA 4J0QA 2XUQA 3E22B 3T5AA 4M1ZA 3JQGA 4LYGA 5HZMA 1T4CB 3V00A 5IK2D 3ADDA 2XT6A 4KXUA 1E0AA 3ECAA 2GPSA 2H5LA 2ZJ0A 3E8SA 4DWJA 1U6KA 1ECJA 4MDYA 3PRJA 2CF6A 1WW3A 4YRJA 5K3SA 4FFMA 4D4IA 4WGGA 5HF8A 5L4SA 1FDRA 2BGRA 3MPOA 2SICE 2XGGA 3FFWA 1FNBA 2WTBA 1QR2A 4NXMB 2J3HA 4W1RA 3ZW7A 5CDSA 5DIFA 3ZV7A 4BPBA 2XE8A 1SXIA 1I2DA 2R65A 3DW3X 2ZSHA 3LHKA 2I66A 4ZOCA 2BFAA 3NRCA 4MWCA 1RYMA 4QX6A 4ZI5A 3Q8KA 4P80A 1Z5VA 4X45A 1U7DA 2ZIEA 4ZU6X 3IIIA 3OLXA 3DBRA 1M67A 1P1CA 2BF4A 2PRZA 4IG4A 1V8DA 3CE6A 1I4DD 1JMYA 1QXSA 1GZ7A 5BSEA 1Z4PX 3NO4A 5CCDA 2ZYAA 3I2YX 3VO1A 1HMPA 3H7AA 2ZIZA 3QLJA 3CR8A 1ZHHA 2IHYA 1Z4QA 2V59A 3T0GA 3NYQA 1N2ZA 3CO0S 2OHJA 4CWAA 1KTIA 2A0FA 1QOZA 4KGZA 5EE5B 3IILA 5AVXA 2NQ8A 4PFQA 2W70A 4B80A 1FLVA 1MAVA 3U3OA 1FSGA 1OU4A 1VPTA 2ZJZA 3F46A 5L8VA 3T1QA 4HB3A 5BMVB 1MW9X 4I1UA 1YKSA 3DWFA 1AHPA 4M8NE 2ZJ7A 1V9CA 3NHKA 2P11A 4IVNA 2WJWA 4MV3A 4U00A 2X0FA 5J5CA 3A36A 3WB1A 3DTVB 5CB4F 4FCVA 4R0VA 4ZQIA 1HGXA 2EW2A 1RXCA 3FGOA 3Q1KA 4KP7A 5JZVA 1E3EA 3PDJA 3Q7RA 4KODA 3BB4A 3KEMA 4FYWA 3BRWD 1X94A 4P5PA 1BN7A 2IEAA 1DWUA 1JJVA 1BXGB 1N2XA 2FDCA 1RBQA 1ZUWA 4HSEA 4DR5B 3FHLA 3DB2A 1LW7A 4KTVE 3FWYA 3RKRA 1WVMA 4E7OA 2QTFA 5CT4A 2BD0A 4ESOA 3L8EA 1F4PA 2QAGB 2RCNA 5UKDA 5I9IA 4QVKA 1K75A 3CNNA 1U2ZA 1FTSA 2BFNA 1IATA 2FN8A 3C7AA 2V7XA 5ELLA 3ETNA 3FKQA 2X5OA 3FMVA 3ONVA 3QPBA 2JLQA 4LZAA 2FCRA 4JP8A 1Q1BA 4QDXA 2AXPA 2UZIR 4R51A 2VHJA 4JB0A 3HO8A 3M49A 4NTZA 4OHBA 5F4ZA 1UC9A 2NSJA 1W48A 5BN5A 5EE9A 3T3PB 1EP1B 3AUXA 4KQXA 1JW9B 3OPXA 4HDAA 4IDHA 4QRIA 4EG5A 2F3UA 2NTNA 4Z4CA 2V7BA 3W5UA 3KRTA 4YAUA 3M4XA 1XMJA 1GTG1 3WMRA 2HLDD 1C0IA 5E9AA 1ZR2A 2PZJA 3OPNA 4B32A 2XXAA 1OLUB 3WTCA 1C9KA 2EJTA 1CUGA 4RVGA 1DIRA 2WPDD 3C98A 2JANA 2FG7C 5G1PA 3SD7A 5CITA 2VJYA 5AI6A 1PX0A 1OIWA 2QIOA 3SS9X 2R0QC 4DUGA 1XZFA 5MN6A 1DCFA 1EFVA 1RJGA 2P6OA 1JXMA 5KYWB 2WRZA 1W36D 3MPUA 3H1GA 1F17A 2MMCA 2WD7B 1FMFA 5GV8A 1P9NA 4JKYA 3HNOA 1L9XA 1NBME 4JC8A 4YN3A 4Z4GA 4NMMA 4XAQA 1QQ7A 2IOHA 4CUZA 1MX5A 2AI1A 4Z9XA 3FUCA 1T5LA 4ZODA 3QQPA 2NO9A 5DK4A 2OGWA 3PGA1 3CNHA 2IPXA 1GZ4A 1UOOA 2ZZNA 2ZRBA 3OZSA 4G5FA 3ABOB 1L5HB 2JRLA 1K0UA 4CKYA 1P5RA 4IW3B 2P77A 2VA9A 5AKKA 4JI6B 3SK0A 2DB3A 1SIOA 2WM9B 3M6MD 1DB3A 4J43A 4U6SA 2QBYA 1A9TA 2BH9A 4PYNA 1T9DA 2ID9A 4L9AA 4EJMA 3DLCA 3R7BA 4NWIA 1BKYA 1U8XX 2C07A 1XQ9A 2YWFA 3D6NB 1TMGE 5DJ5A 4A0QA 3CX3A 4AJ1A 3TB4A 1DC8A 3UJ7A 1RM5A 5EKXA 3SS7X 1DQNA 3LPDA 4LHZA 1BDMA 2EKPA 3W4IA 1L3CA 4ZEXA 3V8PA 3K2QA 4DXAA 2ECPA 3LPCA 3H9BA 3UHJA 5IJ0B 1PP4A 1LBQA 4LDNA 3FLMA 4PLYA 4BFVA 4X61A 2D2IA 3MM4A 5HTKA 1DKLA 1FFGA 1U8FO 1MEJA 1WUTA 3T3IA 3SYKA 3D6TB 1GHTA 3BD7A 3VZQA 2XOKD 2PGDA 1NBMD 4JL6A 4KMOA 4RMGA 4CT5A 3M82A 3CNEA 3DXZA 4GI2A 4AMZA 3ETGA 1CYDA 4KV9A 1Z35A 3FRJA 2O5CA 1YRQA 1HKHA 3L6CA 4D5GA 1EVJA 2R00C 2Q4TA 2Y1XA 3IKJA 4HXYA 5T67A 4DBLC 5K45A 1VJCA 1VP3A 1JQDA 3AP2A 3GX1A 2X3UA 3KHKA 4B2LA 4BPRA 4OKNA 1Y5RA 5LP6A 1TQ6A 1P1BA 1SCNE 5J1TB 1KE1A 1KI6A 1JPVA 2FOLA 2WTNA 3H4MA 3O4HA 4U1RA 5HG0A 1WPXA 4MJ3A 4UU1A 5DPMA 5HUJA 3LY7A 5AW4A 3FHCB 4MUJA 4QBTA 1J49A 2MWMA 1IVYA 4WWHA 3BWCA 4KE7A 4YIKA 3TLJA 3ZZMA 4CEJB 3L2OB 5JHGB 4FN5A 4IXTA 2EIHA 1Z18A 3OZBA 3WA7A 3O26A 1C8KA 3BMQA 2CLCX 1ZQ9A 3KTFA 3OE5A 1HY3A 2FWBA 1O87A 4N0PA 3DKPA 2QNRA 2VRCD 1MGPA 3DLTA 1RXWA 3PQ3A 4JMLA 2IIPA 3Q5EA 4BNDA 1OYYA 5BV2P 4WCFA 3UTCA 2P4SA 3JZFA 4BVKA 1O5TA 2C2WA 1RRPA 5IZCA 2FW8A 3AIKA 5KWIA 1PLLA 3HXMA 2Q1WA 4RD1A 4PLCA 3ZWKA 1SR8A 3FBWA 3ZH2A 1JDBC 3AHJA 3ILVA 4IAOA 3V1LA 4MR9B 4KE6A 4ZIRA 1U2QA 2NZVG 2R5NA 3ESDA 4NV1A 4LHXA 4ZQBA 1UMKA 2XQGA 1GLGA 1YWGO 3HYCA 4RY9A 4F4DA 3EEQA 4J16C 1VRCA 1V1MA 4Q9NA 3OBIA 2D8AA 1DQRA 4Q12A 2LCFA 4P4SA 4GDFA 3T5DA 1SPBS 4TROA 1U9YA 1DU4A 1H4QA 2PX5A 2OHIA 3PFGA 3AGQA 1WMFA 3MTIA 5LIPA 4XX1A 1FNDA 5ALDA 3PPIA 3NLLA 3PQ4A 1B43A 3CKMA 2FFQA 4GQIA 5ICGA 2XCSB 3MRXA 4HEA1 4F3YA 5FBVB 4YP7A 3X2EA 4PV7A 4FDTA 1V39A 2A4MA 2AZDA 4R98A 2VDWA 1NNI1 3JZAA 4Q21A 2Y4NA 2ZWIA 3RBVA 3T4PA 3GJTA 5KOJA 3KR2A 4FGZA 1W0CA 4R4JA 3GLRA 3L1UA 1QTRA 5HR5A 3LDGA 2GGSA 5FAKA 2GF0A 2TSYB 3U6KA 1J2TA 4JLSA 2D3WA 3GLGE 4NNJA 3HACA 1RWBA 2WAYA 3NG1A 3QY9A 4AICA 3RROA 5BUQA 5KOHB 4F1JA 5FI1B 3T1TA 2ZR7A 4G0OA 3DHWC 2FPGB 3ZGZA 1XQ1A 3NBYC 2IV7A 3U26A 3R0XA 4LBVA 4PIMA 3HEMA 3TD6A 2GPBA 4NNOA 1QAMA 2R2AA 1MO3A 4MRVA 1ZGGA 4JI3B 3TEMA 1HYGA 1N2CE 1PEDA 4DSUA 2QMYA 1CUSA 3AERB 3Q7SA 5IJ9A 4XJTA 3AVOA 1XF1A 1TF7A 3BH6A 3PXEA 4P3OA 3RABA 3QIAA 4V1CB 4J75A 4IJ6A 2AC4A 5HQTA 4L7VA 4FOLA 2DLNA 1HYHA 1GILA 5G0UA 5EQTA 1D8AA 4I1IA 4M49A 1C1XB 2GN9A 2V03A 3FDXA 3OD1A 4FHEA 1IBKB 3U9TA 2VF8A 4EFKA 3CUUA 2QPLA 3KQNA 1CUYA 2B1JA 2MSEB 4HUQA 3HP7A 4RHEA 1FNNA 3KK0A 3VYWA 2CC2A 2P3SA 3OOHA 1FFHA 5IUJC 1OU0A 4L9WA 1ZSYA 4H15A 4R1LA 5U1PA 3TQRA 4KAFA 4DY4A 3E7WA 2O0HA 4EYOA 4HHEA 1XUOA 5T4BA 4CV2A 3HU2A 4BX3A 2QSUA 1YOBA 3O92A 2EFYA 1T9GR 2JA2A 4U7DA 1SBQA 1I3KA 5GZ6A 1J9EA 2H51A 2ZGVA 3VSDA 2OYRA 1IG3A 3O4GA 1G8FA 3FZNA 4K6HA 4AX8A 3O3NB 1T8WA 2BI8A 2B78A 2GM9A 3WJ1A 2HYDA 4Y6OA 1Y1SA 3U17A 2B69A 5BNZA 1W5TA 2AC2A 3FE2A 4R9VA 1KJIA 3WJAA 4EG4A 2JIPA 3WGLA 5CFRA 3E2MA 2H0AA 5EESA 4BN5A 4OHRA 3HUFA 1FL9A 1ISJA 5LQUA 4ILEA 3N2ZB 1JUDA 3K20A 1CUDA 4DLKA 4NPCA 5TV2A 4QFMA 1LQ2A 1M7GA 5TPZD 5AVSA 4RJJA 3TSAA 1VHQA 4I4TF 3O1JC 1DZIA 1MAWA 5AVKA 5LBUA 1PGOA 4I5DA 4B6RA 4QJ5A 7REQA 4M1WA 2FPXA 4DSTA 5C4IA 5B3KA 4D0NA 1WDMA 3U48A 3JATA 3DKIA 1DV1A 3PEYA 1BXRA 3NNDA 1L5LA 4F1WA 4O2LA 4I55F 2BBTA 1MU0A 3E8MA 1FW8A 2QRPA 5IX8A 5EIBD 3JQEA 3LF2A 1C4WA 4F2PA 4Z8YA 3IKMB 2ZB3A 4D0LB 1VL8A 5GM2A 3SSOA 1GUBA 2M6RA 3P45A 1JQ3A 3UT6A 3JQDA 2XPCA 1NBIA 2LXNA 2FH5B 2QW8A 4NBVA 5L3VA 1G64A 1ISHA 3MMPA 1UDXA 5D3ZA 1C41A 4GKBA 3WBJA 3LP8A 2O1XA 4B3JA 1Y4SA 1Q7TA 2OKGA 3OWOA 1QYVA 3T5BA 3VU1A 4BXOB 4EVRA 5C8DA 1O94C 2JGAA 4CLRB 2P9ZA 2WU1A 5KPDA 3P8ZA 2I99A 1RS0A 1S1CA 5KDLA 5TQJA 1MOZA 2VSFA 2I6FA 2IXEA 4HLUC 4IYJA 4CQJA 1I5OA 4EX6A 4MW7A 1DJPA 2CUTA 3IPYA 4RH3A 2LE0A 1B73A 3VOTA 1AF7A 3A28A 5TY0A 4FFBA 1IWBB 4CJXA 2RGWA 1YRBA 4PPFA 3UFXB 5A03A 1VL6A 1KBQA 3BYZA 3ZE2B 3GAFA 2AWNA 2I0FA 1EE2A 2J08A 2AJLI 2REOA 3LRTA 1PJ3A 4R1QA 4UMVA 5AR1A 5I4CA 1KRWA 3CGGA 3E1SA 3W9UA 4TWRA 1XN4A 2AZTA 1ORIA 1OSNA 4MVJG 2OCIA 3GG2A 4HX2A 4FZ3A 3OECA 2IH2A 4NYMQ 1ZJYA 1UDWA 2C2MA 4CDGA 4AF6A 5EP1A 1LJLA 3VYUB 3BA1A 4GP6A 3IPXA 3BSYA 3I5UA 4CKWB 3TIIA 1J2EA 4WD3A 1K7XB 1VE5A 2VLBA 2QQGA 3UA3A 2MU1A 3LUHA 3VPDA 3QSYA 2DXIA 5A2QA 2I7TA 3JQ7B 4OX9Y 4ZJZA 2IHTA 3L05A 1DT3A 2CL0X 2FSSA 3D1VA 3IDFA 3N2IA 1SUFA 4NYJR 1PR2A 1LDEA 1HYQA 4MW5A 1BW9A 4NU6A 4CM6A 3BQNB 1IK6A 3IE2A 5BPHA 1XZJA 4QBHA 4P32A 2COUA 1B8OA 3RVJA 4TWIA 4XYGA 5EJGA 3T1YB 2O05A 3JV7A 1P2BA 2Q4EA 4WI1A 1AH2A 3L0DA 4TTPA 1W29A 1CZKA 3B1VA 1YE8A 2P69A 4WH0A 2JLVA 3B6JA 1BS1A 4WOBA 2R2GA 4EGJA 2Y2VA 1GR1A 1TQDA 4WSOA 2YNMA 3ETCA 3RFVA 3UVEA 3ZX4A 5ALGA 2ZVPX 4PFJA 3RNLA 3CC8A 2EGUA 1O96A 4ME6A 3KXLA 2WP8J 1BD3A 2JLRA 1V3VA 2QK4A 4JFAA 4QUIA 4N3AA 4Z9BA 3PCTA 3FCXA 2V5VA 3VPGA 5HRUA 3OEYA 5DHTA 1N6LA 4I5GA 4ZCMA 5HUQA 1GSOA 1GGNA 4U7TB 4TZTA 3THWB 1MHTA 4JI8B 1IWOA 1I2BA 1R6UA 4H77A 5B3LA 3KB6A 2PH7A 1GQYA 7YASA 4D9NA 1VPWA 1IM8A 2VSYA 3CZCA 2O8FB 5IXJA 4TKUB 1OY1A 3D6UA 3VGJA 2BBWA 5AIBA 4EB8A 4KPUA 3M5WA 3HNRA 3RH0A 2Z4SA 1BWPA 4CMIB 2PNJA 3TB6A 1LPSA 4J07A 2DKOA 5KYUB 1J33A 1PZFA 1T5SA 4YRZA 4JJIA 2Q46A 2J0SA 1RI4A 3K0FB 4HJRA 4OK5A 4Q3KA 5K0JA 1BE1A 2IBMA 3C41J 4TYMA 1XVVA 5ARDA 3V4PB 4DNXA 2XAAA 1ICEA 1SPXA 2WT4A 2G77B 3GN2A 4MMXB 4UTZA 1IE3A 3AZPA 2WYIA 3FPBA 1M54A 4LMAA 4MVYA 2VF2A 4DNOA 1YAHA 2P4UA 2PD3A 4IFTA 4BNJA 3RUAA 4NZZA 1V35A 1ESDA 1HRKA 3R3WA 5EHIA 5EWMA 3UGTA 1DG3A 1ZD9A 2RHJA 4M0PA 4OUDA 1Y3BE 1TL7C 2XSZA 2HJRA 5CA1F 5KC9A 2G0NA 5AUOB 4BMCA 5FTJA 1MQAA 3AO0B 5JDIA 1GPBA 3BHIA 1AUQA 3KQSA 2FW7A 4QELA 3V8RA 4NSNA 2IYYA 5P21A 3JALA 3PT5A 3U3KA 2NYUA 2EFEB 1O0SA 4OHFA 4WLNA 1HSOA 1NVEA 4JL5A 3ABSB 4X84A 4YDRA 4IIFA 1E2JA 3E48A 5T64A 3VPBA 1W0JA 2Q5EA 4LECA 2IZ1A 3ANLA 2FXVA 4HH0A 4XUEA 2E1PA 3KWFA 5ECDA 3T3MB 4CM5A 5JANA 2QJTA 3Q3JB 3T5PA 1KERA 2B0CA 2QAIA 1P4RA 3R5TA 2HA7A 3SI7A 2XI4A 2B1RA 1IIRA 2W2KA 5ALPA 1DBPA 1C9JA 3K9WA 3QVGB 3LHSA 3PDCA 5JXJA 4COKA 4OLJA 4DCMA 1NWHA 1UWKA 2XNKA 3OKCA 4Q24A 2AVNA 5FUWA 3S2FA 4JVSB 3L92A 1P0CA 3LWZA 1XTBA 1Z0ZA 3DVAB 4YCSA 3O2NA 1V6AA 3EY4A 3P0RA 1ONNA 1S3GA 2ZT7A 3FMPB 4FD2A 3QVOA 1PNVA 3PHLA 4OYYA 2D0DA 5BQ5A 3U80A 1VL5A 1RWVA 4NICA 3UGJA 4NEHB 1SA0A 1LSUA 5LP6C 3GGJA 1EXWA 1CEXA 5LP1A 3FMFA 4NCKA 4OQDA 3WYGA 4Y1FA 1A9RA 1OREA 4GPBA 2C31A 2OB1A 2YNMD 4O8CA 3GFGA 3AHCA 2CD7A 5BURA 1N7HA 3C5CA 1ZC3A 2EJBA 3NUQA 4M9QA 4IHJB 2PR2A 3IQXA 2Q07A 2VCEA 4FFRA 4G9BA 1SVSA 2O8NA 4G4JA 5CUQA 3UWMA 4EMUA 5EJEA 1QG6A 2PMBA 3OQJA 3CX4A 1EU1A 3K30A 4EUFA 2JFFA 3K9BA 3QVUA 3WYCA 4WCFC 4CTOA 3KJZA 4YRLA 3KUKA 3EDYA 1UXGA 3H9JA 4JC4A 1OAKA 2OAQ1 2AI3A 3TDNA 4XX0B 5A5FA 2Z8YA 3OHPA 1YU6A 3RSOA 4X60A 1D2NA 1P81A 3U7IA 3IAM6 3OFNA 5ABPA 2FY8A 3RD5A 4RKYA 2XQKA 5FWYA 4R01A 2BLNA 3NOOA 5E0OA 3KQLA 1H8EA 1RW4A 5KJCA 2H85A 1XXHE 1VI5A 1TADA 1LI5A 2HO4A 2ZSBA 3HU3A 4G5OA 3IP1A 3OAAA 1QKJA 2Q5LA 4Z9YA 1SELA 5K0NA 1QB7A 2QAGC 5L95A 1JKIA 3RAGA 1JT9A 3A3NA 2AW3A 2Y1GA 5HHTA 2IXBA 2DKFA 4EGSA 2IJGX 4R8MA 4C07A 3HRIA 1ORRA 1OOEA 1JLLB 2G1AA 2V9ZA 1WG8A 3EZ2A 4QOIA 3TNLA 3R5HA 4DL9A 4O0LA 3MB8A 4G0ZA 1EHYA 3KKEA 1PWHA 4IIJF 2J67A 2JPDA 2XSZD 3ZGNA 1ZJ5A 3OEED 1O5OA 4G1VA 4MVCA 2VHUA 4ZVLA 2FW1A 1M75A 4W7HA 1F06A 2F4VB 2R66A 3NANA 4K1LA 5I01A 3L7MA 3PQEA 4JR2A 1B0ZA 3BMCA 3BTUA 3I0ZA 1ONBA 4TYPA 3L0PA 4WX2B 2VJKA 3CT4A 4MINA 4C4YA 2YKGA 2ZZMA 3A1SA 3OIDA 4DJJA 4DPKA 3MYYA 1PR0A 4FI3F 1T0IA 3H83A 2C03A 1MVNA 2GDZA 1X2EA 2RHOA 4I0WB 4PYQA 3V97A 3M7IA 5IEJA 2I7VA 2YTZA 1G41A 2I7DA 2PFKA 4H7HA 1HC7A 2PJZA 2XUIA 4CDRA 4WDQA 2V8BA 3ZHOA 3RVMA 1FIUA 1AHIA 4BVBA 1YCHA 2TMKA 2ZXEA 2YHBA 2CZCA 2C2OA 4ML3A 2X0DA 4TRMA 4BECA 3KYDB 1CUWA 1KF0A 1NWCA 4LSZA 3BBLA 4WFJA 4FZJA 4WXPA 3WRYA 2VEDA 4DMLA 3KAQA 5FNVA 1MAAA 1NUPA 4NESA 2G5GX 4GYKA 2WE7A 5KB3A 4YJFA 2QI9F 2OKCA 4NR0A 5KJ1A 1QCZA 3BQMB 4HXGA 1RQXA 4W9RA 4MI1A 2X1MA 1GKIA 1FUUA 1Y0BA 1SHUX 3H6HA 5ALHA 4R40A 4EB3A 4J1TA 4IF6A 4JELA 3M1YA 3DD5A 1P9WA 3EG5A 4KRGA 3GN1A 4HMQA 1NNLA 4GXNA 4QIHA 5KYYB 1PQ4A 1NL3A 1UDAA 3ZBTA 4H7FA 2PO7A 4R8RA 3IC5A 2GLTA 3DZ8A 4Q9LA 1N2GA 1TM7E 3AUAA 2WAMA 2P2ZA 3DMGA 4KHZA 4HWPA 4ESVA 1EGMB 1RWNA 2P5YA 3IVAA 2UZ1A 2C97A 4TMZA 1FUEA 4IH1A 4Y1RB 5KWJA 2PANA 1Y3HA 2PSSA 4KSYA 1GPUA 1MB2A 4NJEA 1ZOSA 3EMKA 1OGYA 1KFEB 4A73A 3KKMA 3JWEA 3K8YA 2JL1A 2OPBA 5CFNA 2DC1A 4PBRA 1QTNA 2C00A 2GN1A 4O4IF 5DBIA 5J2TA 2IW1A 3GGPA 4EYSA 4FDLA 2WMYA 4RWEA 5JHHB 1G42A 4MUMA 2ZCJA 3GZNA 4K8OA 1G4AE 3DDUA 1RU3A 4KLAA 2JKYA 3G0CA 4MPJA 1JHUA 1JMVA 2NZ8A 2UDPA 1Z13A 2JI7A 3M1AA 4HD8A 3TFWA 3NVDA 4HDMA 3ZOZA 3D64A 1GVNB 2MIIA 4LXGA 2XWSA 1CERA 4LYJA 1JHZA 4XKJA 5E4FA 4ZCPA 5REQB 2CLDX 1H8ED 1EX7A 4QG7A 1CZLA 4QZVA 1NBEA 2RI0A 1QGUB 3GFPA 5ECYA 5K0ZA 3JD0A 4UM9D 3F6CA 2VYVA 4LQ4A 3RUDA 3U9LA 1H3FA 1UCFA 3N2GB 5ALJA 1WCYA 5EFOA 4IDBA 1EVLA 2WWRA 2YHIA 4X95A 5CX1B 1JHYA 3KR9A 4OHZA 4Q01A 4IDFA 4UHDA 2WY2D 4Z7JA 5L7YA 1LDNA 3OOEA 4V0SA 1WEHA 3HSSA 3O7WA 1JG1A 4LV8B 2F1HA 3L43A 4PRYA 5F12A 3TZ6A 1BYIA 1QYRA 3GCGA 1T6ZA 2XCLA 2BMFA 4L6IA 1TCUA 5K3FA 5LSAA 4GZMA 2WOOA 4MR8A 3ZLBA 3RAJA 4J7AA 1GR0A 1P7PA 3A6EA 3AY0A 4M89A 4HNUA 2GYYA 3K70B 4NATA 2C0CA 2FMFA 2C61A 5KX5A 1VHTA 3PYLA 3OFJA 2C3MA 1QE0A 1X1SA 2I6QA 3F5MA 3OHMA 3PFHA 4UEWA 5D3MA 3V55A 5IAJA 1ACMA 1TCCA 4Z7QB 5IJZA 4YMWA 1XDGA 5LZ8A 4HGZA 1RRVA 1JYEA 1L7QA 4AJNA 5M04A 3SLRA 3MBOA 1CUFA 2OCKA 5EMMA 5KNDH 4OBEA 5BSRA 3W5IA 3FUWA 3LD9A 4LEIA 4EPYA 5DNVA 5JH7A 3BCUA 4M36A 2EZUA 4HWKA 4W63A 4O4LA 5IDWA 2Z6UA 1GKLA 1MA3A 4LY9A 4KQWA 2OCGA 4CF4A 4IFEA 1GFZA 3C4VA 3GK3A 3JW8A 2CW5A 6YASA 4CF5A 1UFOA 1QC5B 3WKAA 1A72A 2C2XA 4FIZA 1L8OA 4KQMA 2IC5A 2W6ZA 4Z6KA 1LBSA 4TQ9A 1PFVA 3A6PC 3H75A 1AN9A 5K5EA 3NR2A 1PV2A 1S3FA 2QZ4A 3OETA 4DB4A 6ADHA 4AB1A 2DE0X 1OPXA 1CCWA 2EG5A 3T1NA 4QDKA 2BEVB 3DEIA 1GGMA 2NVWA 5CXSA 2PZ8A 3MFQA 4XR9A 1EFAA 3PI6A 3CNBA 4NU0A 1DOZA 2P4EA 3HCNA 1EZ1A 3RJ9A 3NV7A 1TYAE 3FVQA 3NH9A 4ALLA 4BCDA 4A1OA 4TVOA 2OFXA 4AS3A 2F43A 1EQAA 2GN6A 1IZ9A 1HXHA 1W5AA 4RX1A 3SVZA 4C4RA 1FMLA 4GOLD 2QS9A 4P98A 4UEKA 4G65A 5LA6B 1MB0A 1RM0A 1II0A 4BRWA 5FLXA 1WB5A 2ONZA 1Y7IA 2VP2A 3K0EA 5GONB 3TFQA 4ARIA 2DOKA 1E61A 2I3GA 4K9KA 1E59A 4FGUA 5K8JB 4KMSA 4GHWA 5FYQA 1XLVA 1DIOB 3F2IA 2Q9CA 1WXHA 4BYMA 3ODGA 3N70A 2QXYA 3HVJA 3MJSA 4P22A 5TEWA 4E5KA 3RVQA 4FS3A 4EA9A 2FSVA 2ZWOA 3VHLB 4PYJA 5IVKA 1QG2A 1ZH4A 1C7JA 4E5NA 1XR3A 3OT1A 4B9AA 4F2GA 5D8DA 3LNTA 1YUNA 4QSHA 4YQEA 2Z3VA 4QU5A 1RLIA 4L5AA 3AIOA 3E9EA 1SB9A 2HYIC 2Y6UA 5AKJA 4NOJA 3ND7A 4U2EA 3RS5A 4A0HA 4E21A 2Z2YA 1FS6A 2MR5A 3GFTA 3PR3A 1U4SA 2O8CB 1X8LA 4KXXA 4NQRA 1BMFA 1YRHA 1QH8B 1FMTA 3NCTA 7MDHA 4E33A 4WKGA 2Q4BA 4FFOA 5C8XA 4U7GA 3FZQA 1P3Y1 2VP3A 3AF4A 3NTUA 4BE7B 4URXR 3LYUA 4GQBA 1UPAA 3LLVA 3TK1A 3I05A 3ENNA 3QBVA 2IBTA 2IUEA 3CB2A 1PFWA 3JZDA 2ZYWX 3N05A 3W9SA 1L9KA 9MHTA 3C3JA 3HBNA 2X8BA 2DPMA 2B20A 2AEJA 1USIA 4I9FA 3NFRA 4S2UA 1COZA 1M8FA 3K9QO 3PVZA 3DS8A 7ADHA 5JVDF 3U44B 1SVLA 3GRVA 2DFLA 3I3SR 5AVJA 3PFBA 3SP1A 1B8PA 3MYRA 5BNIA 3PUJA 1ID1A 2DY0A 3KAJA 4FYMA 2IHNA 4XWGA 2CDRA 2W6MA 3OQNA 2ZIXA 4MPRA 3JQ9A 4RJKA 2X19A 3UFBA 4DDHA 5JROA 2HU7A 4GM0A 4BLUA 2LR0A 2HCJB 3RJMA 2C88A 2JGLA 3DE6X 1K3UB 3HA3A 3HKCA 3K7EA 4OQPA 4Q1EA 5HWSA 3F78A 1LPMA 1X74A 2KQUA 1P72A 3OC0A 4X00A 4YREA 5A4MS 3MJTA 3VHQA 1U3FA 3LT0A 1Z0DA 1JFLA 2C9DA 3LQRA 3UMRA 1F51E 4WLUA 3DFUA 3AEUA 4KGXA 5JLAA 1KO1A 1XFDA 3QOFA 2PZGA 4AS1A 5BN1A 2Q1YA 3GA7A 5CG2A 2VJLA 1E2HA 2WZCA 4RV4A 3UM9A 3VR0A 1T26A 3BD8A 3HB1A 2YXLA 3KG2A 3V2HA 4IOMA 2W4IA 3DE0X 1KJYA 5HS6A 3L79A 1FP4A 1KH1A 3BFPA 3HN7A 4JYMA 4U0JA 3WDLA 2IHBA 2FDXA 1FBNA 2F9LA 2GVNA 2I6XA 3EVAA 3A05A 4UZSA 3RKUA 3C7TA 4ZVVA 3UC5A 4ARBA 1VHDA 3EGWA 2LV8A 4BQNA 3WGVA 5I9LA 2OILA 1PBNA 1NOIA 2RGUA 1GCGA 2ZVDA 5B7PA 3F6YA 1RIFA 2O7VA 2WJGA 2YHSA 4FX5A 5AM5A 4E12A 5BQFA 5M2QA 4AP9A 2IVZA 5FUBA 2F3PA 3SQDA 1LJ8A 2IYOA 4PSVA 4TMFA 4C06A 4DMUB 4ZTZB 3OOSA 3UK0A 2XCIA 5ICCA 1DADA 1JR4A 2CZQA 2AMVA 3DYBA 2X76A 4IINA 4NULA 3P94A 4GOKA 1ZD5A 2ASVA 1E62A 4PGGA 5DHSA 3RUCA 4CTNA 2RDMA 2B1QA 3PU6A 1TTPB 2J5QA 4M8LA 5CX4A 2QT1A 5JTUA 4KR9A 4C7VA 2OSVA 3K9CA 3LF1A 4YRAA 3P4YA 1QHFA 4TTSA 3M2PA 4NP6A 3RNOA 3GRZA 1QVWA 4ZEVA 2DTEA 1W8DA 3HBFA 1BMFD 4H60A 3LCUA 3CEMA 3MLAA 5HCNA 4HVCA 2H16A 4PX9A 1W96A 3K09C 3LPLA 4P7JA 2FAXA 5E95A 5E8RA 4NZYA 4URUR 4M0CA 5FADA 3TR5A 4BY9E 2QMZA 4GC9A 5K09A 4EYKA 3NOQA 1FC0A 1R8XA 2QYTA 5EIOA 1CV2A 1OCEA 2RBEA 3DV0A 4OXKA 2IOFA 4PIVA 2ZAIA 3TX6A 4DBVO 2A84A 4A03A 3Q2OA 1GLNA 1UJCA 1YK0A 3DZCA 3N5KA 2W8BB 4XVQA 5E0KB 2CBGA 4F4IA 3L02A 3TTWA 3MCWA 2FB9A 4ROTA 3FPHA 2G80A 2ZE7A 2ZSFA 4LVUA 1ZLYA 2RC6A 3B6KA 2CY0A 4CQMA 4BJ5A 2XOXA 4DG8A 4MGIR 4HAIA 1RTTA 2XYRA 1SBCA 2VK2A 3MK31 4EB6A 1XEFA 3KJEA 3W8DA 4CM8B 2PUVA 4UNPA 3RUIA 1NP7A 2WWWA 4ZEWA 3F4KA 1IN5A 4PS0A 3M4ZA 4X94A 1OVMA 4UBKA 1SOUA 1AQNA 3HN6A 3FTPA 1E92A 4WLOA 4I46A 4X92A 4O2RA 1MB3A 3TLCA 1ZD8A 5F23A 4JH0A 3R7DA 4O2BA 3VKFA 3IPLA 3GDGA 2PWBA 1XDZA 4DWVA 4Z0PA 2P7IA 3QNUA 3F3YA 3DNPA 3OOYA 3N3BC 4UU0A 2XXBA 3KYJB 4CDMA 5DHPA 4BGIA 2FUG1 3HB7A 1Y8CA 3VNBA 4KSBA 1CQIB 4COOA 4YMTA 2XMSA 2Y1EA 5C51B 2DH6A 5JZBA 1XCPA 4FC7A 1WHTA 1ONOA 4HWOA 5HJEA 2ATEA 4HXEB 2GF9A 3LT5A 3UMMA 2OESA 1H85A 2W58A 1A5BB 3WLIA 2PH3A 2Z95A 1U3DA 1UQUA 1E2QA 1GPDG 5K3OA 1XTUA 2PGOA 2XLBA 3IJEB 4IUDS 3ROXA 4N3CA 5LQJA 3VR5H 4RF2A 4DCVA 2YFKA 2OGUA 1UH5A 1A8IA 2Y0DA 2C2YA 1GPH1 2VDRB 3PUKA 5AH0A 1CZUA 3CNOA 5DLDA 2ZXFA 4GLLA 2BSAA 5EWLA 4UNRA 5EHZA 3GWZA 3KT3A 3NFYA 3PQ2A 3WGJA 2PZLA 4R5HA 4RF4A 3G3EA 4Q7QA 1W94A 1T5TA 4M7PA 3O8CA 1AIPA 1BNCA 2WTAA 1DFHA 1EXNA 2QU8A 2XKBA 3I53A 5ER9A 4CIVA 3LC0A 3EGEA 4KFCA 2H5JA 4F85A 2E4YA 5JQGB 4GWGA 3V2GA 3VZPA 2AN4A 2ZDGA 3JARB 4LSWA 1TZCA 1PVVA 2VTKA 3ANTA 1ZCBA 4HNGA 2AYXA 2C4UA 5B2EA 3WLNA 1L6RA 3P27A 3FSEA 3HA7A 1M0EA 2XNDA 1PUXA 3C1TA 4GPAA 5FBZA 1E3MA 1ISSA 4AUNA 3W1EA 1CKEA 1JHDA 3ML1A 3AP3A 4AW9A 1SC9A 1VMDA 2DFNA 3TW4A 1R0XA 1OLXB 4H35A 4DIUA 1KVRA 3GT0A 4PZCA 1SVIA 3KU1A 5LYJA 3BN3A 5DTMA 4Y2GA 1L0BA 3HDVA 1KU6A 3A3YA 4LOKA 3DKVA 4YTEA 5IN5A 1JLMA 4GX5A 5I3CA 2QQFA 1ZI6A 2P3LA 4MQUA 4MZXA 3ZPXA 1RYZA 5AHOA 9ATCA 2VNAA 3VTKA 3PXCX 1XKLA 4GDMA 2PUTA 1LBHA 4CQMD 4ZMBA 1OH7A 2I71A 4B2YA 3KQMA 1VBKA 5AHWA 3ZXSA 1PJRA 3OP4A 2IS6A 4QM7A 3VBCA 5M29A 3L0BA 1P33A 3FSGD 4LTMA 4MJXA 3OU7A 2VHXA 1U65A 3GLIB 3KD3A 3KD2A 3OURA 4CU5A 5FQOA 4ER0A 5I7VA 3S70A 1XDWA 1PJZA 4WKCA 1TW3A 1F8UA 1UPBA 4Y9DA 4ZK2A 2D3TA 4JOCA 1MBZA 1KAHA 1V4NA 3E9ZA 3M6FA 3KLMX 1IQRA 4YQFA 1G5IA 1TM3E 3OSZA 3RO7A 1SUIA 4HBZA 2ZAYA 4QOSA 2PGIA 2WT8A 3CE9A 3MCVA 3D4LA 3O2QB 3QHAA 3LBFA 4HGOA 3B7PA 4KACA 2B2NA 4CLXA 5AKZA 2ZYHA 4ETIA 4QOFA 1FXWF 5ITZA 3H11B 4B7AA 1KAQA 3OTGA 4J1NA 4RVSA 2W8ZA 4DOMA 4ZYWA 1C4KA 2GSWA 4H1WA 1EFPB 3K6RA 2DR0A 4M88A 3DWGA 4ZICA 1SXHA 3G2QA 3DMRA 1NDQA 2BZSA 4URVR 4DVJA 4EY3A 1QNLA 1T3LA 3I23A 1RJWA 2G28A 3OZUA 4N7JA 4WCVA 2I7CA 1T3HA 2R8PA 3TLEA 4QYIB 1JEAA 2Q3CA 1TZMA 4BVEA 2ZRKA 4Q66C 1E1CB 1LZLA 3ZV6A 2N75A 2VJDA 4EEXA 3ZWQA 3A2NA 2Y68A 2WVGA 1J5PA 1Q74A 4YMSA 1SFRA 1RE1A 2OD2A 3K9NA 1MIOB 2W6NA 4JSRA 3EGVA 2NVOA 2IYWA 4QNRA 2F59A 4FR5A 2GD0A 4GP9A 1EVIA 2C5LA 5CVCA 1IY8A 3HHEA 3WL3A 5JSQA 1VB5A 3PXUA 3X2SA 1UKBA 3V8EA 1DQZA 2CGEA 2HPZA 2ODNA 3A9RA 4C1BA 4MWBA 1LDGA 2IOYA 3KHTA 2FMKA 5F1PA 5IF9A 4YCAA 4A6EA 5FRDA 2BMAA 3RTDA 3PHHA 1Y89A 3BULA 3I6YA 3GY0A 2R4QA 3MMXA 2QP4A 4PLFA 4XW2A 1XZCA 2XNDD 4MWZA 4OH7A 2WYWA 2AQ8A 1K3TA 4EF5A 5EHXA 4HQNA 5CLJA 2UVPB 5KKNB 2OMEA 3BWYA 4E88A 3QKUA 4WESA 4YV7A 1ML3A