3F67A

Crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
240
structure length
240
Chain Sequence
NAIIAGETSIPSQGENMPAYHARPKNADGPLPIVIVVQEIFGVHEHIRDLCRRLAQEGYLAIAPELYFRQGDPNEYHDIPTLFKELVSKVPDAQVLADLDHVASWAARHGGDAHRLLITGFCWGGRITWLYAAHNPQLKAAVAWYGKLVGEKSLNSPKHPVDIAVDLNAPVLGLYGAKDASIPQDTVETMRQALRAANATAEIVVYPEADHAFNADYRASYHEESAKDGWQRMLAWFAQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative dienelactone hydrolase
publication title Crystal Structure of Putative Dienelactone Hydrolase from Klebsiella pneumoniae subsp. pneumoniae MGH 78578
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
total genus 81
structure length 240
sequence length 240
ec nomenclature ec 3.1.1.-:
pdb deposition date 2008-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3f67A00
5C8ZA 2PM8A 1AUOA 2FX5A 5AO9A 3KXPA 2RIPA 4E15A 1BE0A 4BDSA 4BTLA 3G02A 2BUCA 3H2KA 4BC1A 5DNWA 3DQZA 3SWWA 4U2EA 3M3DA 4B0PA 1G66A 2VEOA 1XRNA 1MAHA 4X91A 5A2GA 4IHAA 1ZICA 3PFBA 3C6BA 3QMMA 1QZ3A 1K6EA 2GBCA 3F96A 1XQWA 3ZWQA 3FNBA 4X92A 4C4XA 1MTZA 4G8DA 1MNQA 3PUIA 1XZAA 3KSRA 5FDFA 1W4LA 1ZOIA 2WIKA 1B6GA 2WFZA 5E2IA 3ESCA 4G9GA 1AX9A 4C88A 3DOHA 4OSEA 2RGUA 2XMQA 2DFPA 3FSGA 3MUOA 1QTIA 3DL7A 4U2FA 4B84A 3DEAA 4BZZA 4PF1A 1E8NA 2WJ4A 4UFNA 1XZJA 1CUBA 4X95A 1IUOA 1WOMA 5LZ4A 1SCQA 2B4KA 2X5XA 3PUHA 4J0CA 4FLMA 1FFCA 2WUDA 1CRLA 5AI8A 3KDAA 3WWEA 5AICA 4BCBA 4QLOA 1UKCA 1U4NA 2WG1A 5CT8A 5CT4A 4UFPA 3M82A 3C5VA 1LPBB 1QE3A 3NWOA 5JARA 1KEZA 2VAVA 1MX1A 2J3DA 5BV7A 3WK7A 5HFAA 3C45A 5LZ9A 3BJMA 2HADA 4JYMA 5JZSA 3WA7A 4OU5A 4B83A 2DHDA 4QWMA 4Y2PA 5FLKA 1WPRA 4G8BA 1SFRA 1G5FA 3BDVA 1GPNA 4HXFB 2WIDA 4K5QA 4L0CA 1JU4A 1XZDA 2WSLA 3IB3A 1JJFA 2EDCA 1BU8A 5JADA 1QTRA 5LZ5A 1UK9A 5CXUA 1FFBA 2QUBA 5I8PA 2O2GA 3V1LA 3G9UA 3O9VA 5FXMA 1MNAA 4EY4A 4K6KA 3DKRA 3AINA 2OG1A 1WB6A 3AZQA 4NMWA 1VKHA 4WFKA 4MQLA 1KU6A 4ROTA 1W52X 3R3UA 3D7RA 1QIHA 5ISMA 1XRLA 5AKIA 3WKAA 4KRYA 1XZHA 2HFKA 3E0XA 4H35A 5AI0A 1UFOA 3QH4A 1EXWA 1YA4A 4MJ3A 1XQYA 1H22A 3G9ZA 1YS1X 1VA5A 3NGMA 5HK8A 1EINA 5EFZA 5CBKA 2XUDA 3G9TA 3V9AA 1VE7A 3WIOA 1SCIA 2XDWA 4FWBA 4AN1A 1QIDA 1CQZA 4OB8A 1CQWA 1N5RA 1ZD3A 5T4EA 3AZPA 5SYNA 3CXUA 1WHTA 5DNUA 5A62A 1YS2X 1HKHA 1CUHA 2PVSA 5DLPA 3BIXA 3AILA 2ZYHA 3SK0A 1SOMA 1A8UA 3H17A 5CT5A 5ALJA 2E3JA 2JGLA 5HCUA 5ALMA 1DTEA 1K4YA 5AM0A 2FJ0A 1CUUA 3STUA 1MT3A 3R3XA 5K3BA 2C7BA 4QDUA 3EQ9A 2YASA 5A7FA 1JMKC 3W05A 1ZD5A 1H2YA 2CEKA 3K9BA 4ETWA 2OGZA 4EY8A 2DCMA 2IIVA 3D2AA 4F60A 1IZ7A 2QXTA 4Z49A 3DKKA 2JGMA 3O4JA 1YB6A 1X2EA 4Y2VA 4KRXA 4G8CA 4UHDA 4GEGA 4MXDA 3V1MA 2DR0A 2XI4A 2OCKA 4IH4A 1U8EA 1E8DA 3D5EA 2PSEA 5A7HA 3HC7A 2WFLA 1S8OA 1TRHA 4WDQA 3LS2A 4EHBA 1R88A 2PSJA 1PFQA 5IVHA 3WK8A 5ALNA 3QVMA 2ROQA 1LZLA 1YA8A 1DWQA 1UKBA 4ITVA 1WB4A 3JYHA 4H0CA 2JF0A 4J0KA 4LXIA 5DJ5A 4PW0A 5IVDA 1IMJA 5AH0A 2VJDA 3I1YA 2HDWA 3G0BA 5AKXA 3RLIA 1TCCA 5AKHA 1XZLA 1X2BA 2WHRA 1ODCA 3IUMA 4UBNA 3WK4A 4LIPD 4MYSA 2XUGA 5ALHA 3WJ2A 1YAHA 4X3CA 4P9NA 3EQ7A 4DMFA 5J3JA 4OUKX 2HHAA 2B61A 5FPPA 2GYWA 5BWCA 3FLEA 2JEZA 4MEAA 1EI9A 1DU4A 1L7AA 5LZ8A 4HRYA 3FAKA 3R40A 1EB9A 2G5PA 3HLKA 1CLEA 3STWA 4W1QA 3KD2A 2PUHA 4KR0A 4E11A 5C8VA 3C6XA 4QEKA 2X76A 5AOCA 4DIUA 4ZWNA 2B20A 3QMVA 5LYYA 3KOOA 3N0TA 3WZLA 4CG3A 4J3JA 3D4LA 5T4FA 3LIPA 4W1SA 5JALA 4FDMA 3L1JA 5AKEA 2H7YA 4DSZA 5F4ZA 2ZYSA 3UUEA 1BEEA 2AJDA 3SX4A 1ZD4A 2W6CX 3I2IA 1C7IA 2HRRA 5LP1A 1CUEA 3VDXA 4QDZA 4J03A 2C0PA 2YH2A 4AMZA 5AKJA 3UUFA 4EY6A 1L7QA 2X8BA 4NVRA 2XLBA 1UK6A 4K6HA 1MN6A 4PSUA 5AM5A 2ACKA 1RWQA 2ZSIA 5ALOA 5CMLA 2Y2VA 1W75A 4CG1A 2QKYA 3BIWA 3R3VA 4A16A 2ZJ7A 4RE5A 3A2NA 1AGYA 2Z3WA 1QGED 2BFNA 3E4DA 5FUMA 4JEIA 4N8EA 1EA5A 1LLFA 3W9BA 2PPLA 5ALVA 1H2ZA 5E4YA 3I2HA 4BC0A 1TIBA 1JMYA 2QT9A 4KAAA 4DYHA 4H77A 1H23A 1E66A 2XUAA 5AKLA 1BCRA 2OQVA 5JAOA 4ZREA 2VTVA 4INZA 4UBIA 4F5ZA 3CCBA 2GYVA 5AK3A 4KACA 2XLCA 2H7XA 5JYCA 3QBJA 4DNQA 3ICWA 1R3DA 2BAGA 4WDRA 5LLSA 4QWWA 3G7NA 1JJBA 4H7DA 3K2IA 4CCWA 4EZIA 2PUJA 4HRXA 1CFJA 4B0OA 2HA7A 3WIBA 1FFAA 1QFMA 3F8SA 1IVYA 3IUQA 4CCYA 4BVLA 1HQDA 1LPSA 2RI6A 1XRMA 4GWLA 2GBGA 2JGIA 1TAHA 2VA9A 1F0PA 2XUHA 4WCVA 4DM7A 2ZJFA 4TVKA 1C7JA 3H04A 5JD5A 4PQEA 4Y2UA 1CUIA 5AIAA 3ED1A 3O9MA 1DWOA 2HIHA 3LCRA 5ALFA 1C4XA 3JWEA 5T4HA 2WFLB 3U0VA 5LKRA 5ALWA 3I2KA 4JH0A 4BE9A 3G0CA 1EH5A 1Y7IA 1QOZA 4G4JA 1Y37A 1XZEA 3H2HA 3DYVA 2WG2A 5DYTA 2OAEA 1CPYA 3E1GA 4M0FA 3T52A 3RARA 3AIOA 4OPMA 1VE6A 1UZAA 4BB0A 4BCCA 4D9JA 1DQYA 3M83A 1AMNA 3R3ZA 3A2LA 4FKBA 1U65A 5AM3A 3VVLA 2P8SA 2VATA 1CV2A 3GFFA 4Y2TA 1AQLA 1VZ3A 4QE3A 4YK7A 3GA7A 1ACLA 1R50A 2J4CA 5FV4A 4OYLA 2HFJA 5T4BA 4MWSA 2WTNA 2R8BA 1XKLA 4Y2QA 2YXPX 1G4HA 1MO2A 4Y2RA 3G0IA 3BF7A 1BEZA 2BGNA 2RAUA 4B6GA 1DX6A 2HU5A 4PV7A 1Q84A 5CXXA 3GBSA 5AM2A 4Q3KA 2CUTA 2V97A 2XUQA 4LXHA 4UBKA 4KJXA 4QDOA 1GPKA 4DNOA 2K2QB 3D2BA 3EBLA 2XMGA 3IDAA 1LPNA 5A7GA 4CIAA 5ALTA 5ALZA 3V48A 1K5PA 1UKAA 1TKRA 2XUJA 1UOQA 1K8QA 4GDMA 3WL6A 5I7UA 1A88A 4QLAA 4N8SA 1JT2A 1UOOA 5EIEA 1THGA 4M0EA 1VA4A 2QTBA 3I1IA 3A6ZA 3DYIA 2PL5A 4B81A 3V1KA 3P2MA 1P0QA 2J4FA 4IH1A 2ECFA 5EHZA 5AKYA 3W06A 4OCZA 1X70A 4DMKA 5EI5A 4P08A 2GBFA 4BP8A 5HF8A 2GYUA 4C89A 5LIPA 1CUGA 4FLFA 4U2CA 1R4ZA 1XRQA 2XQFA 3H2JA 4ZGBA 3I6MA 2HU8A 2WLSA 2XMSA 5DTIA 1UWCA 1M33A 2CJPA 4WY5A 3DDUA 3MVEA 3WL5A 2JGKA 4AMYA 2FUKA 2XMBA 3STYA 1UK8A 4WY8A 3H18A 4FLEA 4H18A 3CN9A 2Y2UA 3Q8WA 2OAGA 1LBTA 2OCIA 5ALGA 4G4GA 4RNCA 3A70A 2W22A 4PSCA 1O6GA 4ZRDA 1ODTC 1GGVA 1EVQA 1GT6A 1ZJ4A 3WI7A 1QONA 3GELA 2CZQA 3BE8A 1ZIXA 3LP5A 1JU3A 2XUKA 1QIGA 4MQMA 2C4HA 5ALRA 4CCYB 1XLWA 3PI6A 3STXA 3R0VA 3WKDA 1E5TA 4PSDA 3F97A 3I6YA 4KE8A 3HYSA 4CI9A 3DJYA 4UBLA 2WTMA 1GPLA 1EDBA 2VQ6A 4B9EA 5CT9A 5D6OA 4U2DA 1NU6A 2JIDA 3TJMA 1G42A 4RPCA 1W6RA 3C70A 5CH3A 4ZV9A 3TEJA 5CH5A 3STTA 3WWPA 1HBJA 4AO6A 2WIFA 1UOPA 2BKLA 4FNGA 1VZ2A 1FJ2A 4AQDA 5AK4A 3FOBA 3G0DA 4BAZA 1LPPA 4G5XA 3FBWA 2GZSA 2UZ0A 3S2ZA 1ZIYA 2EDAA 3W9UA 1THTA 3FYUC 4J7AA 4H7EA 2WKWA 2J3QA 2PU5A 5K3EA 4W1PA 1ZGCA 3OOSA 5ALUA 4BRSA 1LGYA 2HL6A 4X00A 3EQ8A 4PO3X 2QXUA 2XQKA 5ALLA 4XWGA 5CH8A 3MUNA 1CUYA 3YASA 1F6WA 3C43A 3WL7A 5HK9A 1CEXA 2XMRA 3ZPXA 4FHZA 2EEPA 1RP1A 1UXOA 2BGRA 2Y6UA 4UHBA 1F8UA 1QO9A 4X94A 3RK4A 4EY7A 3HXKA 1BCSA 5D3ZA 1N5MA 2G4LA 4FFWA 3WYDA 3TGLA 1RYYA 3U1TA 4CFSA 5A71A 3ESDA 5ALXA 3DL4A 1ETHA 1NU8A 1DX4A 4MEBA 2GBIA 4BVJA 3CCCA 1VOTA 4M0MA 5AKZA 1PJAA 3BF8A 2AJBA 4IH9A 1EVEA 4WFJA 1QIEA 1IUPA 1LNSA 1B41A 2QJRA 1NX9A 1P0PA 3K6KA 3C6ZA 5HF9A 4EUSA 4UHHA 2O2IA 1QFSA 1JJIA 5AM1A 1DQZA 5ALYA 3BXPA 4W63A 5EHNA 3I28A 3QZUA 5ALEA 2XUOA 1XZMA 3H1BA 4BVKA 1AZWA 2DSNA 4W1RA 3STVA 1LPMA 3GROA 4BP9A 1R9NA 1J2EA 5FP0A 5K3FA 1TCAA 3HEAA 3W2TA 4QDXA 4I3FA 4QNNA 4FOLA 4B85A 1CIJA 2V98A 4E14A 3FLAA 2XQGA 4FBLA 1A8QA 5K3CA 1QIIA 3R3WA 3EIOA 4FTWA 3Q0TA 4X85A 1N8SA 2ES4A 4KAJA 4UBOA 1Q83A 2PKYX 2BUBA 1T2NA 3WJ1A 2AXEA 4DMHA 3HSSA 4K2AA 4KYVA 1ZI8A 1WHSA 4AO7A 2ONCA 4UBJA 5AI5A 1R1DA 1FFEA 2QR5A 4Y2XA 1EB8A 2VAXA 4Q3LA 1GKKA 5EGNA 5K3DA 3B3QA 5AIBA 2QVBA 3FYUA 4Y2SA 3KWFA 1XRRA 4AO8A 2PSDA 2HRQA 3WK6A 1N1MA 1VLQA 1GQRA 4ARBA 2WU3A 2OCGA 3IUJA 2I3ZA 5D3KA 2WUEA 1J06A 2XB6A 1J1IA 2XQIA 2Q0XA 2JGFA 2Z8XA 3WYNA 2ZYRA 2AJLI 1MX5A 2JEYA 1UK7A 2H1IA 1CUFA 3B5EA 4BAGA 3VJKA 4RGYA 2XMZA 1W76A 3VJLA 2IX9A 2VJCA 1OXMA 2RHTA 4YX9A 3QPCA 4N5HX 5C7YA 3TRDA 3D0KA 4MYDA 5K3AA 1E8MA 1YAJA 3ESAA 3FLBA 3C87A 5JIBA 3F98A 3RM3A 2PSHA 3DLTA 5DWDA 1FSSA 3D2CA 2V9ZA 4AX4A 1D07A 1QO7A 4J0HA 4X6UA 1QIKA 4K6GA 4QA9A 3O95A 4I4CA 2QS9A 3PDCA 4J0DA 3WK9A 3CN7A 3FWHA 2H7CA 3G8YA 2OLEA 5DTJA 2DQZA 2AJCA 4S0XA 4Q05A 5AOBA 3X3HA 2WQZA 1CUDA 5ALPA 4LHEA 3H0CA 4HXGA 2ZYIA 5HKBA 2YYSA 1ZI9A 2Y1KA 4C4YA 4HS9A 4EB0A 1VXOA 4Q82A 2C0QA 2VSQA 4Q34A 5AJHA 3W04A 1Q0RA 3N2ZB 2XUFA 5CURA 5C8XA 3L1HA 1SCKA 2WJ3A 4RE6A 5JAUA 1MPXA 1WB5A 5HQ3A 3IURA 3PFCA 4FNMA 1HLGA 4ZI5A 1XZGA 2DHEA 4G1FA 2XMCA 1XRPA 1QLWA 3WKBA 3FCXA 2XUIA 2AJ8A 5AHXA 4FMPA 2LIPA 4GBGA 2WUGA 2CMFA 1E3QA 1CVLA 4Q3OA 5K5EA 1T4MA 5CTAA 3AJAA 4PNZA 4X7BA 2VJAA 1OILA 4J0JA 3ANSA 2WHPA 4YASA 1CR6A 1XQXA 4UBMA 3DD5A 4A5SA 5AKGA 2RHWA 5IVIA 3VISA 1QIJA 1IZ8A 3G0GA 5A6VA 5JD4A 1XKTA 4I19A 2OPHA 5JD6A 1I6WA 2XUPA 4H7JA 1DT5A 1BN6A 5K3FB 1F0NA 4FFVA 1KU0A 3AUKA 1XLUA 4W9RA 4X6YA 4FBMA 1ZD2P 3ZLVA 1CUXA 4HVTA 4C01A 4GI1A 5JZBA 4X6XA 4LYEA 2WFMA 5CW2A 5E4TA 3WLAA 1WPXA 3BWXA 4J0GA 5JAHA 4BZWA 4KAFA 2G63A 3WA6A 4G9EA 4H7FA 4IQ4A 3GUUA 2WUFA 3BJRA 2WIGA 3PF9A 1MU0A 2Z8ZA 3DS8A 4O08A 1IUNA 5DNVA 3GZJA 1H2WA 5D7BA 3C8DA 2ZSHA 1BROA 4AN0A 1TCBA 1CUWA 4XJVA 5AK5A 1MX9A 4KE7A 3ZLUA 5EHQA 1XFDA 1PV1A 2BJHA 1EX9A 3H19A 1ODSA 3FYUB 2I78A 2C58A 4QDTA 4DTCA 1SC9A 2WG0A 4XVCA 4C4ZA 4C6HA 5C81A 5HKAA 1CUAA 3VJMA 2HM7A 3O4GA 1QIFA 1ZI6A 3L1IA 4BBZA 1XZKA 1A7UA 1E89A 5AOAA 3VKFA 2OGTA 3OM8A 4OB7A 4JNCA 2VT6A 5H3HA 1CUCA 2XT0A 4BRZA 5EIHA 5FPQA 3AFIA 5ALQA 3DCNA 2XQJA 4B7ZA 4EBBA 4HTAA 5AKKA 3IBTA 1OCEA 1JFRA 2ORYA 1ZGBA 2C5FA 4B9AA 4CG2A 2VF2A 3HZOA 5FOQA 1GKLA 1EDEA 5AK6A 4UHCA 4Y2JA 4Y7DA 5E4JA 2JGJA 3O4HA 3HI4A 3JW8A 1ZJ5A 2QRUA 3ZV7A 1GXSA 1VJ5A 5FKJA 2CBGA 5EIAA 1GQSA 1P0MA 4BATA 1XZFA 5ALKA 5LKAA 4U2BA 2DHCA 3WKCA 3E3AA 4ARAA 2I03A 3LLCA 3OG9A 1R9MA 1TK3A 3PICA 1YASA 1DWPA 1GZ7A 4H7IA 4U2GA 3UMJA 5JATA 1UT6A 3F9CA 3QPAA 1P0IA 4OD0A 4TPKA 4X90A 4LXGA 3QPDA 4L3WA 4EA6A 3H2GA 3AIMA 2VJBA 5KWJA 5HQ3B 3WKEA 4P93A 3MGAA 1YR2A 4BCDA 2ZJ6A 6YASA 2HA6A 3OC0A 3ESBA 2B9VA 4DNPA 4DNFA 3HRHA 3C8HA 3B12A 7YASA 2C5GA 1EK1A 3FCYA 4GECA 1HPLA 3ILSA 4WJLA 3WQHA 5ESRA 1W1IA 3I2FA 4Q1VA 3O0DA 3AZOA 4KE6A 3AIKA 2WHPB 3V1NA 2O7RA 3ZLTA 3NUZA 2WJ6A 3D59A 4H7KA 3HJUA 4BDTA 4HAIA 3T4UA 3OURA 4GLBA 4OYYA 5BWBA 1TQHA 3RKSA 3O4IA 1K63A 1FFDA 4F21A 4HZGA 3VVMA 1AURA 1EK2A 4Y9SA 3R3YA 3I2GA 3QMWA 4H7HA 4BE4A 1Z68A 3WMRA 2IITA 4EY5A 4WFIA 1LPAB 3HACA 4BTVA 5IVKA 5IKXA 4BAUA 3WWDA 4UUQA 3KWJA 2OGSA 4E46A 1ORVA 3WK5A 3BDIA 2O2HA 4X71A 4XIIA 4GXNA 1XZCA 4L72A 4DLNA 1XROA 4KE9A 1VXRA 4AZ0A 4UFOA 3FSGD 3FYTA 2PBLA 2JBWA 5AI4A 1DT3A 5BOVA 2XE4A 2O7VA 4UHEA 4NS4A 1A8SA 2WU4A 3QYJA 4UPDA 1O6FA 3QITA 2ACEA 2HA5A 4ZXFA 2PX6A 4JYPA 4A23A 5JAPA 1YCDA 4DSAA 3WL8A 3DOIA 3I6ZA 3IIIA 1YB7A 1ISPA 4JUIA 3M81A 3IUNA 5YASA 1BN7A 4YPVA 1H2XA 1BS9A 4J0IA 5LZ7A 2Z5GA 3OTQA 2VT7A 2QOEA 4UHFA 5AI6A 5DYYA 3R41A 1ORWA 3EF3A 1YSCA 5DYWA 2D5LA 5IH7A 5CT6A 1CUVA 1CUJA 3H2IA 4GW3A 4X97A 3D3NA 5HF5A 1EHYA 3BL8A 2HA3A 2V96A 1CUSA 2DQYA 2I3DA 3WZMA 4LYDA 2HU7A 2JGEA 3OPMA 4HXEB 5SYMA 5AP9A 2XMDA 1AKNA 3A2MA 3DNMA 4GHWA 3ZI7A 2OCLA 2Y6VA 3VXKA 1Q0ZA 2FJPA 3WWCA 4N8DA 4LKOA 5I9IA 3PF8A 1BRTA 5FRDA 4V2IA 4N5IX 5AI9A 2QJWA 3QM1A 2NW6A 4B80A 3ANTA 4TGLA 3S8YA 4F0JA 1WCYA 2Z3ZA 1LBSA 2BCEA 3HABA 1XZBA 5KWIA 1CUZA 3F67A 4C87A 2WIJA 2WHQA 3H1AA 3LIIA 3ICVA 5JANA 3PE6A 2OXEA 1ACJA 4IO0A 3WWOA 4CIBA 1L7RA 2QMQA 1HDEA 3IA2A 5HZGA 2OQIA 2R11A 4L9AA 1WM1A 1LZKA 1Y7HA 4Y2YA 2RONA 5LZ2A 2ZVDA 2HA2A 1XLVA 4BYMA 3G9XA 5AM4A 5CRIA 1J07A 1JKMA 1QJ4A 2GZRA 3FVTA 4DGQA 4ZV7A 2BUAA 4B82A 2QM0A 1HL7A 4AB1A 1XZIA 2QUAA 4DMCA 5HFNA 5JASA 3IVMA 4OU4A 4NZZA 2H9YA 5ALDA 1XQVA 5JZ9A 2HA4A 1AC5A 4X93A 1USWA 2G5TA 5KBYA 1EDDA 2PSFA 2D0DA 3C6YA 1DINA 1LPOA 5EHXA 4MWTA 1MJ5A 4OB6A 4AXBA 2QZPA 2PU7A 3IULA 3NOXA 5ALIA 3C5WP 3SC2A 2HA0A 4XX1A 4QZVA 5ALSA 4P92A 2WILA 2CB9A 3FVRA 4KEAA 1JI3A 1U2EA 2CKMA 5HF6A 3I2JA 1MAAA 5KREA 4G4IA 2WM2A 4AZ3A 1QIMA
chains in the Genus database with same CATH superfamily
3QOWA 1T8RA 5C8ZA 3HNPA 3QQ5A 3SQMA 4F3KA 1KJWA 5HP4A 3P4XA 5BQ3A 5C9ZA 3E1KA 4NZNA 5EMHA 3T4PA 2GK3A 4C9BA 2O14A 1IONA 1RR6A 1M74A 2XBUA 2L19A 1V37A 3AEUA 4YRRA 2GN9A 3TUJC 3WFJA 1X42A 5I5GA 3ZNPA 4NCBA 5IDVA 3OF3A 2QLNA 3KAJA 4RQAA 4BGVA 2O05A 2OXRA 4B6PA 1VBNA 2B25A 1GGMA 2ZAOA 2WJVA 3LAWA 4J0QA 2IELA 2VPTA 1KERA 3S2SA 3UWOA 4IF6A 5KTOA 2HHHB 1X7XB 1I4WA 3ZZUA 2C9OA 1TIKA 4M1ZA 1NVXQ 3PSHA 2VEOA 4X91A 4FCWA 4IHAA 3VM6A 1WWKA 2HSZA 4RAOA 4W7IA 3DVLA 1ZICA 4NFLA 4N7RA 2XJ9A 2XJ4A 5TMEA 3PKJA 3DZKA 5DHRA 4M7WA 2PNFA 4CKBA 1MG0A 4M1KA 1D4ZA 2FF7A 5U4XA 1JLMA 1O0BA 3WJAA 3KUDA 3ZXXA 3CLTD 2NUPA 5KQMA 4C4XA 1Y9DA 1C1HA 2HNBA 2FWIA 3C1UA 2VHXA 3CLHA 1MNQA 1KYQA 1CS4C 4IHJA 2WMNB 1XZAA 4B76A 1W4LA 2WIKA 3M5WA 5E2IA 4U7WA 1NUQA 4MIYA 3IBSA 1UWLA 1IPEA 4C0WA 3JX9A 2P3LA 3L0CA 3NHAA 4JFAA 1GFIA 1E6CA 2NZVG 5CLHA 4DZRA 5CFNA 3NT5A 5CGQB 4OY3A 2JJYA 3OBIA 4PANA 3RT7A 4AJ4A 5HIAA 2X8JB 4XCXA 5TQ0A 3DE4X 3H9UA 1D2HA 1FDRA 1SU6A 3DM5A 3E2PA 3W6ZA 3RJZA 3L18A 2OXIA 2ICAA 3H4VA 3T4XA 1DDIA 3U3XA 3SIRA 3H2YA 1HNNA 2CBZA 3KWLA 3O7MA 1FTGA 3OHSX 4R7TA 5CVVA 2YV4A 3W3AA 3C74A 2FCAA 2H59A 3IALA 3N0RA 3SMVA 1EDOA 3DXZA 1BZYA 1LNQA 2VYVD 4FONA 4X95A 3ZQ4A 4KR2A 3IERA 4MB0A 2WE7A 1IHUA 2NV6A 3EPJA 3VZCA 2PAAA 3FUWA 1YI0A 3Q6IA 1JJVA 4BV2A 4M0DA 3QA9A 3GPCA 5FOWA 1KF0A 5BPHA 1EFHA 1A9OA 1LSJA 3TFQA 5K20A 2M6SA 2WUDA 5EKXA 5AI8A 5LQJA 5E8RA 4K9OA 2A33A 2H92A 1QH1A 4IWXA 4KIUA 2J45A 2D5BA 3AHFA 4BNWA 2CXOA 1L5FA 1UKCA 2R6FA 1U4NA 2CDCA 3RS2A 2DYKA 1L4YA 3M7IA 4LJ7A 4I08A 1TYEB 1H6BA 4IXWA 4NNPA 3M82A 4UW9A 3WLJA 3R8FA 1QE3A 1LK7A 3A4YA 4WFQA 4LWZA 1JQEA 2J48A 2WV9A 1F14A 2H0AA 1OLUB 2J3DA 2V74B 3ADPA 5LXTB 4PYIA 1WP4A 5LNK6 4RSGA 1JQDA 3CB4A 3PJEA 3LBYA 1P1BA 1XTBA 1N2OA 3E48A 4IWNA 4P3NA 4DS3A 3NHFA 2VHCA 1F5SA 4ABTA 5DFAA 2KBFA 1M2OB 1N6RA 1N5KA 4P7GA 5EERA 1E7WA 2EZ4A 4BBAA 1PHPA 2ZWIA 3LQFA 3MMXA 4OU5A 2WSYB 3CR8A 4US0R 4XCQA 4Q3AA 4UNSA 3D6FA 2NSDA 2IYSA 2UYHA 1WMAA 3JQFC 5IPFA 2HJRA 1SURA 1U2DA 4ZODA 3HKBA 4Z7JA 5HS4A 1SFRA 1ISSA 2VUIB 4HDKB 1LQTA 4X61A 2WIDA 1UPUA 3JVIA 5JWHA 1ABBA 1T5SA 2PVCA 4GX0A 5K9ZA 4L0CA 4XUCA 3HDJA 4QT0A 3B82A 1NXSA 2WSLA 3CJTA 3RKUA 4INOA 1NW9B 3BAFA 3IB3A 1TUGA 1BE6A 2P35A 2QRJA 4P36A 3RVJA 5HUJA 5JADA 5BMOA 1ZUHA 5CXUA 2Q3JA 1VLJA 1YBMA 3KOUA 1TTQB 4HGPA 4G1EB 2XTJA 3R8CA 2ZVJA 4P3XA 4NBWA 1FFYA 4L5YA 5KYWB 1D0SA 4PBRA 4Z8XA 4HDNA 4CMIB 4EY4A 7GPBA 3TINA 3B6MA 4RF4A 4EFNA 3B2NA 1NP3A 2ETVA 5TEWA 4V0OA 2NTVA 3QWBA 2B36A 3EIEA 4ECAA 3NYRA 2ODAA 4X7PA 3WRYA 4PQGA 2OSBA 3P27A 1U0FA 4HX5A 4PRYA 4JC4A 3WB1A 3C3CA 4GEKA 4MVJI 1N4AA 3AP1A 4CCSA 4F8JA 1HF3A 1S3FA 1P62B 1KAHA 2QMHA 2GD6A 1T2DA 3L04A 4IIJA 1TKBA 4KP7A 2COKA 3WKAA 1US8A 8OHMA 1SOVA 2OCBA 3EGXB 3RQIA 2BY4A 2CDBA 2VNIA 1S9HA 3ITEA 3RVSA 4A0RA 4RZXA 1AB5A 3H5VA 1ZH2A 2Z08A 3QTTA 2DLCX 1XJ5A 4H35A 4EGQA 2VP2A 5AI0A 1YONA 4RXTA 1U3GA 1YA4A 1FPMA 3LHDA 3Q2IA 4Y0VA 3LK7A 1H22A 5BY2A 3G9ZA 4N01A 4RANA 2PZGA 2CJXA 3SSOA 3AK4A 4URUR 3AG6A 3ZWMA 1WMSA 2BEJA 5ENVA 5F1KA 1UC9A 1ZPDA 2XUDA 4KRGA 4C3UA 3P0IA 2Z4SA 4OLHA 3VPSA 1EQ2A 4L8WB 4F1JA 5JY6A 5GADl 3IX7A 3I62A 3U1VA 4KFTA 4FOPA 1KA9H 1Q7RA 4P7BA 4C1BA 2AWNA 2GF2A 3DAHA 3KJGA 4V1CI 1BYIA 2QSZA 1QZTA 2FUG1 4IYJA 3NKFA 4XXHA 1SCIA 3T7SA 2HLNA 1Z07A 4UTVA 4JYAB 1ZJ6A 1VJDA 4E94A 2XDWA 3DXFA 2FR0A 3WGJA 2QT1A 1MX3A 1NMXA 2GNPA 3EDYA 2K4MA 3HBJA 4Z0PA 5FWDA 3OD1A 2J6HA 5L3SB 4DREA 2XCUA 4KZKA 3BQ9A 2R96A 1OBFO 3OAAA 4G5OA 3AZPA 3O8OB 1UPCA 1N2EA 1Y8QB 3C5CA 3LL7A 4RF3A 4CETA 5AVXA 2N3ZA 2Q8NA 1M1NB 3DAPA 3B70A 1FUIA 4MUGA 4OFWA 4WKOA 1IOVA 5IJ9A 2NVUA 2X9QA 1XHFA 2G5CA 4COOA 2WKSA 4A2QA 5DLPA 2BZ1A 3BIXA 1C3OB 3UOWA 2OV8A 2OCAA 1XA0A 3SI7A 4XSVA 1QWOA 2QP9X 3S2EA 3AJ9A 3C8ZA 3OA2A 1A8UA 1RRKA 2C7GA 5CT5A 3SS8A 2ZJYA 4R1SA 1CYEA 5BOSA 3EA4A 1RXIA 2M6LA 3KCNA 2FR8C 2X42A 1NRWA 2IYPA 2H4YA 1OLXB 5EQJB 1XNRB 3W5VA 1JDJA 4JAVC 4K6OA 3EMBA 5HCUA 1DTEA 4INPA 2XVYA 2QROA 4HAZA 3JVEA 4LJLA 4Y2GA 4CBVA 1NZFA 4JODA 4UQLA 3EVZA 2D2EA 1Y3BE 1JEAA 3V55A 3HXPA 4UUAA 3TE6A 2RD2A 3DV9A 3STUA 4YJ2B 2W2QA 4BLSA 4N7MA 1SPBS 3KQNA 4CFZA 3QU4A 2I6QA 3V00A 4PN7A 3QUBA 1NUSA 5A7FA 4CEJB 2IS6A 3D3EA 1P7YA 1P4GA 2VUSA 2X9VA 3AKYA 2HSDA 2HHLA 4XM0A 1W48A 2QAGB 3CWQA 3K9BA 1S4MA 2F1OA 4WECA 3HB5X 5F3RA 2CL6X 1JEYA 2V45A 3HO6A 1QYIA 1V96A 4AZTA 4HSGA 4BEWA 2JFYA 2YIVX 3C39A 3GGSA 1T8SA 3OX4A 4KI0A 3TB6A 1ATIA 1H0HA 2YVAA 2YZKA 3A1NA 4GX1A 4GYKA 5CJPA 4Z49A 4XLLA 1YB6A 1QK3A 4XB6B 1RFGE 4G5QA 1YACA 2VA8A 1WCIA 5TY0A 3AUUA 4N41A 1W5SA 3RTDA 4YTEA 4Y2VA 1JZTA 1NLZA 1TYAE 2IPOA 1E3WA 2PNJA 1EM8B 4GZLA 3TZQA 4BWFB 5BVGA 4YEDA 3GEEA 4DUYB 4RJJA 2JL1A 1O1YA 1T8TA 2HMAA 5DW3A 2VK4A 4C6TB 1VL2A 4LRWA 1P7ZA 4OHYA 4X0EA 4CLHA 3OIFA 4L5BA 4Q16A 4WD3A 1J6UA 1WXHA 2WDPA 1RI1A 5EHIA 3ZHSA 4JOBA 3AR2A 3VR4H 4EGSA 2IH5A 3EEQA 2VP9A 4Q4HA 3TW6A 1S8OA 1TRHA 3WYBA 3LS2A 3HWSA 3PIDA 4EHBA 1R88A 2PSJA 2ZJ8A 3JQFA 4M9CA 4MUYA 1BVRA 2EEZA 4AJ9A 5IVHA 2OESA 2OHIA 1VLMA 1BMFA 1PEYA 3JQAB 4UM7A 5ALNA 3T3PB 3WK8A 3IQXA 3QKIA 3IAS1 3LNTA 5FQOA 3VNBA 3S7TA 4EMBA 1SZJG 1LZLA 5FPTA 1JRLA 2WWHA 4IIVA 1YZGA 1NXTA 2YXNA 4YV7A 3EEOA 4M1OA 1IXSB 3BSYA 2Z6AA 1NFRA 4ITVA 3UANA 3KOMA 1T8WA 5LXTF 3RFVA 2HT6A 1PYGA 4QYTA 4F4UA 2PJZA 5CA1B 3RHTA 1B93A 1DL5A 4MI6A 4D43A 4HNAA 1RQ2A 1YUBA 3OWXA 2JCBA 1BGXT 1F4LA 2CMGA 2WF7A 3GGDA 4IUDS 1GUBA 5T57A 4PPQA 3N2KA 3N75A 4GOND 3QYFA 5DJ5A 5I7SA 3RE1A 4XJSA 1IMJA 4C22A 1P3JA 1T0IA 1V45E 3CNQS 3JXEA 4OI2A 2JJ8A 1RRGA 1GGJA 1O6ZA 1DRWA 5AKXA 3FPEA 5K7SA 5H80A 1FU4A 1KR5A 1ZYUA 4UJ3A 5FL3A 3WLIA 3RVPA 4WESB 4RKEA 1UEXC 4C4RA 4CQLA 2WHRA 4DPKA 3HU1A 1E4YA 2QMEA 3IUMA 1E99A 4JFRA 1YBAA 1HO3A 4UBNA 1WTCA 2VT2A 4DG9A 5L45A 1NJ5A 2XWBF 4YRBA 4KYIB 2IEBA 5E7IA 4LZNA 4TTQA 1YXMA 2HRDA 1D4FA 1QRAA 1TD9A 3UJ3X 3VOTA 4XIFA 5I4CA 1WDKA 1C9NA 1WSBA 1QF6A 2CN1A 5THQA 3DP7A 1M34A 1VI6A 4IIUA 5FOXA 3F7NA 2H54A 1PLKA 5B53A 3VNAA 1ELOA 1Y7LA 1RXEA 4US2R 3SX0A 3QXXA 1JNYA 3IJEB 1XQ9A 2FOXA 3JTEA 3IPYA 4MEAA 4BPBA 3IEVA 1EX1A 1PWYE 5AJUA 4J0EA 4R41A 5C7IO 1U9ZA 4D8UA 1TC1A 1NNLA 5DHTA 2H16A 5JNTA 2H2DA 4QASA 1U9JA 1KJIA 1U7UA 4HRYA 1L8LA 1X7ZB 3E7DA 4EPYA 3JD2A 1HETA 1QS0A 4B35A 2JD1A 3L7OA 1U2SA 2VTEA 3L4EA 3W1VA 3TLCA 4YRNA 2QRVB 3I9NA 2ZR8A 4YJFA 4BX3A 1FDTA 4YRIA 4ONEA 3HLKA 4QUJA 3STWA 4D9NA 3H7IA 3PR3A 2EIHA 1ZMTA 3UGKA 3QLTA 2C8VA 1VSUA 4KR0A 5EYPA 1LBQA 3LUPA 2X76A 5AOCA 3COSA 3W5JA 3EAGA 3BS4A 3PGMA 5J47A 3QMVA 2VZLA 1NMYA 3KOOA 4J3JA 2VXBA 4GKBA 1JLRA 1ZNYA 5CFRA 2F4VB 4XR4A 1GV1A 1WZEA 2AN1A 3LIPA 1ZEMA 5KJ6A 3TTWA 5IC5A 5DM70 3HUEA 1QK4A 4FWIB 1FFXA 3EVTA 4UTZA 4W1SA 3AERB 4BJ5A 5JALA 1OH7A 3TW8A 1BDIA 4YRJA 2Z0MA 2MYNA 4ZMRA 1S1MA 4UZSA 1Y5RA 1GZ5A 4DSZA 1BDJA 1BEEA 1G7TA 1TKAA 3WAGA 2I34A 2ZRFA 3FHCB 3FPKA 2W6CX 2QYSA 3NFYA 4MQ4A 3WNZA 5KDLA 2FR8A 2W8BB 2O1EA 4IXTA 2V8OA 4FI3F 4FCCA 1LX6A 1G0NA 1XDDA 3NPAA 4HB3A 3VKWA 4P3KA 2WP0A 3ZI4A 3TLJA 1E4EB 2Y1CA 2ONZA 1XJCA 3PLRA 2C0PA 3DFFA 2C2KA 2YZ7A 4J03A 4MUMA 4REQA 3WR5A 1GCUA 1JDUA 3EG9A 1L7QA 4EY6A 3THWA 2DLNA 2R25B 3C5EA 3F46A 3LPMA 4GAEA 3AVWA 4ITUA 4MQEA 1KYVA 4V02A 3DWIA 2NAFA 5AHKA 1OI7A 4ENPA 3L92A 2A3RA 4PSUA 5AM5A 2YMMA 4PS1A 4R8VA 2Y1DA 1RWQA 2D1SA 1AQYA 2AL7A 2GPWA 1L7VC 1UDBA 2OLJA 2ZSIA 3ZY3A 4OHCA 1W75A 4ZYTA 2L69A 2PKEA 2FVYA 3BIWA 2WMOB 1P2SA 3QP9A 3R3VA 1U9CA 3B13B 4L74A 4RHEA 3A2NA 4TWJA 3AR5A 5AVOA 4ESOA 5CFZA 1V16A 1AGYA 3N39C 5JS2A 3WYGA 1K7FB 2FVXA 2GWHA 4L57A 3W3AH 5H9WA 4PZLA 2Z3WA 4KQ1A 1QG4A 1QGED 3EIFA 5DNAA 2D3WA 3ESXA 1EGVB 3U3MA 1NBOA 4KW7A 4TYPA 2BFNA 4A26A 4DLXA 3OFKA 4Y1FA 5FTWA 1NW6A 1AKYA 4GPIB 3L7CA 3PVSA 4ZQCB 1A76A 4N6GA 3EZGA 5FFMA 3BB4A 4YJ2F 4OHZA 2A0FA 1IY9A 1I4TD 4PG5A 1N34B 2P8JA 4I55A 1AO3A 5KQRA 3ZBPA 2PPLA 3FMVA 3PC8C 1H2ZA 1W93A 2GN1A 1JLLB 3I2HA 1Z12A 3JSAA 4XQGA 5E4YA 1NVAA 4E7PA 4AP5A 5FEUA 5JUWA 1Q7GA 2C7PA 5BOVA 3VPDA 2XRFA 3QEOA 4OA5A 3FUUA 4H77A 3PGXA 1SXJB 3SYNA 3VZQA 3UMFA 4LYJA 2EWWA 3DBHB 3BRQA 5EXXA 3C16C 3HWRA 4JP1A 4MS4B 2OQVA 2O4UX 1ZESA 4DEXA 5C4MA 2IEGA 4OH1A 3UH0A 3K3PA 3LT0A 4KOAA 4ZI7A 1RJ9B 1YWGO 3OZIA 2GZMA 3O84A 1JYFA 4KJZA 2RAVA 4CQMB 4D44A 4REMA 5BORA 2AC7A 2ACVA 2VTVA 4TMFA 1NLFA 4UBIA 4MUHA 3ODGA 4P53A 5FWXB 5IM4F 1UBRS 2Q1WA 3P26A 4MR7B 2XLCA 1PBTA 3HV2A 4XFKA 3RFTA 1AGXA 1Z2CA 1I14A 4EDFA 2H0QA 5LA6B 1E0KA 2IEIA 1I32A 2VYFA 1Z4LA 5CYFA 4YMWA 4QYIB 4JUAA 2FB9A 3B7GA 4N3BA 2REBA 4R31A 1LRJA 2DC1A 5E95A 1KNXA 1JJBA 3MCZA 3IVRA 5B1DA 1JIQA 1N57A 2ERXA 3K2IA 4QFBA 4CCWA 3R74A 1KMNA 1PJ2A 2XBLA 3FKJA 4EZIA 1PZNA 1TMOA 1ECBA 2P1DA 5C1DA 3WICA 4FGUA 4TQ9A 5MF6A 3RAJA 4UQPA 4RKQA 2PZJA 1KMHB 4WASA 5EUQB 3WQQA 1T2EA 3K53A 3HWWA 1D2MA 4MJ7A 5LBIA 3P19A 1IVYA 1E3DA 1T6BY 1WU7A 4RA9A 2ILVA 3W1EA 3U5ZB 2IGBA 2Q07A 2CFRA 3E61A 3SVLA 1DEKA 4RVOA 2QIOA 3TJZA 4GWLA 2YR0A 3RHZA 1P17A 2JGIA 1P1CA 3KAQA 3LVQE 1GIAA 4YWJA 3RTAA 1M1UA 5JRZA 1B7GO 3GCZA 1CY4A 2XUHA 3HV0A 4PEVA 2EWMA 4DM7A 4F72A 1FP6A 1KFKB 3OESA 2ALJA 1DIGA 1SWVA 4U7JA 4C4TA 2Y8EA 1CUIA 3P9RA 1Z15A 4E70A 2OV1A 3QVOA 3OEYA 3DMFA 3QSYA 2P0YA 3CLSD 5JMTA 2FN3A 1H1LA 1UJ4A 3G68A 3LCRA 2MSDB 4CMEC 4QXAA 5EKTA 4H1WA 1JEQA 1S3SA 4O2AA 1OAAA 3I9V6 2J3MA 1VCMA 2O3QA 2WFLB 3MTAA 3E3MA 2BHTA 1L9KA 1XJWA 1IY2A 5LKRA 3L7KA 1NSYA 3EGVA 3CLUC 2QPOA 4IDHA 4KREA 3AEXA 4N6OA 1JAHA 1FX1A 2QTHA 2WTBA 3G0CA 4QFDA 4RJKA 3HA3A 3HPRA 1E61A 4G4JA 1ZA1A 4F9TA 2LXNA 3E6AA 5FX2A 2VJLA 3H2HA 5IJAA 4GFDA 2MSWA 2EXXA 1N0WA 4QJ5A 1EG7A 1U0JA 3AF3A 5HQTA 1VB3A 3ETLA 5IDXA 2TRSB 2GDJA 3GFQA 5D5QA 3AY3A 3BD9A 2OAEA 3E03A 2G9UA 4M2LA 3W8EA 4DLBA 1CZHA 1JMVA 1EBUA 1GUAA 2A67A 2X41A 4HUJA 2JGNA 4RZSA 2ID4A 3ETJA 5C3MA 5T6MA 3IQDB 1UP6A 3PLNA 2J5RA 5K03A 5IHPA 2QGNA 1EU1A 2XODA 4OPMA 3IP6A 3IAXA 3ZDYB 1Z28A 4E1VA 1P29A 1KC3A 2ZJ3A 1YHZA 4LBZA 4D9JA 1K7YA 4LMAA 1DAGA 1FRNA 1UM9B 5JCJD 3EXHC 1AMNA 1HWYA 3UNXA 6PFKA 4HNGA 4GM0A 1YE5A 4BO4A 2DLDA 2WAOA 5HRAA 3PDHA 5AM3A 3VVLA 5HVNA 4HK4A 2I2FA 1QGZA 3R7WB 2VATA 3GJTA 3RRJA 621PA 2NP7A 4DL9A 2ZUCA 1CV2A 2FX3A 2JS7A 4B4VA 1JEEA 2RBGA 5C35A 1EIZA 4MV3A 1E59A 3OO0A 4EZBA 4Y2TA 1E2NA 1AQLA 1VZ3A 4C0BA 2WB2A 4Q6BA 2ID7A 4W4TA 1YE3A 1DZIA 1U7TA 1GNSA 4CN8A 3QE3A 4RIEA 2I5PO 2PDAA 3R3HA 4W7HA 5FORA 4WXYB 2G1PA 1R50A 4EG7A 4Q93A 1X77A 3F6EX 4OYLA 1YO6A 4TLEA 3UHAA 1YK1A 1P2TA 4MWSA 3N0XA 5JXJA 2Y1XA 3FOWA 2ISCA 3GD7A 1XKLA 1DKOA 2YXPX 1PV2A 3K5IA 3VOSA 1X14A 1B1AA 3ZBUA 2O3SA 4FZ3A 5KCZA 1J00A 1IN1A 1GQ2A 3G5UA 3I58A 1XALA 2GETA 3IFSA 1KK2A 4GPZA 2ZETA 1NONA 2NPFA 1XTIA 3ZNQA 2JLQA 2JAUA 4GR4A 4CM3A 2E55A 2RAUA 3LE8A 5CUQA 3ZV4A 2HSWA 1NF9A 4HKTA 2BGJA 2QLFA 3A9VA 3JWJA 3KBBA 3VHRA 2JJ1A 1E2MA 1Q84A 2E48A 3NHSA 4QULA 2XDAA 5AM2A 3NHWA 2H1HA 4Q3KA 2XUQA 2WI8A 3EVEA 4TRRA 3RHFA 1XHEA 5KNBA 4PRZA 3B6KA 2V7VA 6REQA 1KTVA 2QTVB 3CRRA 4KJXA 4MS3B 4DZTA 5JCXA 3SF8B 5KYUB 1G5RA 4NRDA 2C7QA 4I1PA 2ODPA 2GKOA 4KO8A 1GPKA 1PJRA 2ADMA 3PC8A 2C59A 3QKSA 4BWYA 4CT5A 3D2BA 4QBKA 1SR8A 4LQDA 3EBLA 5AT1A 4EJ0A 5TPZD 5JQGB 5CGZA 4OUDA 3VSAA 4XH9B 3FLMA 3QF7A 4KOEC 1ZO8A 3CZ5A 1GO2A 2W2TA 4YP5A 2GXQA 3FIJA 3JVDA 2R5WA 2XE8A 5E6UA 2D3TA 5I7UA 2RK6A 2V4MA 3GJ3A 1A88A 1N1EA 1Z6ZA 3H2ZA 4GX5A 3N1UA 3EWIA 2YWCA 1UOOA 5LCXA 4DA4A 5FNZA 1R2QA 5JSFA 1LDEA 1E9DA 2I87A 1VA4A 4OLJA 1E92A 3A6ZA 5FJJA 5LU9A 3UFXA 2WB4A 4PPYA 4WNAB 1NN0A 2FLWA 4XDYA 5AW8A 3B38A 4HQFA 5CVCA 3WDMA 3V1KA 2WU1A 4YT4A 4LZZA 3EXAA 1JV2B 1L7BA 2O5RA 3Q15C 1ZJZA 3H9BA 3MN1A 2W2LD 2G71A 4IH1A 4M7PA 2ECFA 2AK3A 5EMMA 4L4SA 1QK5A 4N54A 5AKYA 5LQUA 2ZXUA 2G9RA 2ECOA 3R5KA 1P5JA 1E1CB 4KUHA 3A6FA 3W06A 2YKGA 4GGPA 4KK4A 4UNPA 2PZBA 4ZGGA 5JY1A 1YDHA 3FPSA 2JHFA 3OE1A 1Z5UA 2RBKA 4JQZA 5JS6A 3GZNB 4BP8A 4WKBA 3AVUA 1QP0A 3D7SA 1R00A 2X7JA 4KXXA 2GFQA 1QHXA 3LLVA 4DY4A 1SKYE 1I1NA 1CQJB 2C3YA 4MV8A 4QO8A 5K01A 2QGZA 2WWWA 1XRQA 3B6ZA 2EX4A 3TH5A 2PRSA 4M7OA 1D8AA 2VDQB 3H2JA 3K4PA 4QLBA 3IEMA 1SAYA 3I6MA 1XTUA 2W2PA 3UJNA 3GT7A 5ITVA 4FJ0A 1C9DB 5DTIA 2MTBA 3QOFA 1UWCA 4RIFA 2OGWA 1SVKA 2IK8A 1UCFA 2XA9A 4A5OA 4C04A 3VSEA 4JB3A 4QECA 2OHFA 3TO5A 3BA1A 2J5KA 3FTQA 4H3KB 4I9FA 5ECDA 1BVUA 5EJ8A 2WIAA 1N4DA 2AOTB 1UK8A 1K6XA 1KS2A 1USVA 5A3SA 3AF1A 3UIEA 3LT1A 2QW8A 3FCAA 1L3IA 4CMEA 4GQBA 2G77B 1UMCA 2IDMA 3HYRA 3MERA 4QOFA 5HILA 4CPDA 2F67A 2OAGA 1UKVY 3QHQA 3ULKA 1G8MA 1H5NA 2DG2A 4FILA 1L7OA 4IEFB 4WRRA 5EWMB 1QH9A 2CK3A 5AUQA 4EUEA 2JFVA 3PS9A 3M6FA 4AJOA 4MI1A 5JEEA 3R7LA 2WM8A 3LC0A 1XD2B 5KB3A 2QSUA 1PNTA 4YRSA 4FGZA 3N2EA 2FW6A 2VWHA 4J1NA 3GDFA 5B37A 4PYMA 1DI0A 3TS1A 4XYLA 1CBUA 2XWJI 2QM8A 3DTVB 3QKUA 3VOBA 3N87A 3FM9A 4ZRDA 1OUMA 4AIRA 4EQZA 1I1OA 1OFUX 1WXFA 1SVLA 2B99A 2C2WA 2ZRGA 4QODA 4TKZA 5AR1A 2YVQA 1B23P 3WI7A 3DPIA 4UM9B 1FTQA 2BV3A 2GM9A 3MWDB 1KI6B 1RHQA 2W42A 1JU9A 1GLGA 5LVAA 1HLDA 1TUIA 2GZ3A 4FGLA 3WFZA 2ZRQA 1V25A 3ADOA 3GJ8A 4MV0A 3RHSA 4LOKA 4ERXA 1QWSA 2A9KA 3C7KA 1JAZA 4Y9DA 5SZJA 3IAAA 1QIGA 4RDXA 4ZDJA 5JI3E 1FJGB 3MD0A 2XNJA 1I3LA 3R1IA 3EDMA 3SHWA 4IDDA 4DJJA 3UB2A 3RC1A 1BX0A 1T4GA 1AHIA 3EXHA 3OTWA 2ZUTA 1UDXA 5JI2E 3STXA 4JI5B 2EBWA 2NO9A 4OGLA 5K8JB 3L46A 2GZ1A 3A6LA 4QBFA 1SUFA 4IMRA 2WF8A 2I91A 2IH2A 4Q47A 3BMQA 1SBZA 3HYSA 4CI9A 1ID1A 5DNYB 4WXHA 5DNCA 2A0UA 1K97A 3KEQA 3GLIB 3QX9A 5EE0A 4BE7B 2C2HA 3QKWA 1A69A 4N4AA 4WXPA 1HSOA 2LCFA 1J99A 1NJ1A 1OF1A 1OZFA 2QUKA 5JSKA 1FCJA 4B9EA 1HL3A 1Z34A 2O2EA 1DCMA 4Z6KA 4I1OA 1HDOA 2AFHE 1FYXA 3Q98A 4YXFA 1OBCA 3BRWA 3UJ6A 4DHEA 1SKUA 4H0NA 4K9NA 1GKYA 8LDHA 4DV3B 2XECA 4TYWA 2JIDA 2TMKA 3T61A 4AYWA 2AQ8A 3GLQA 3D0OA 4ZCLA 3TJMA 4FCVA 1G42A 2PKWA 3LPAA 5TQVA 3C70A 2XVXA 4HPXB 1R0CA 2IYOA 1F3OA 3HP1A 4B7XA 3GR6A 2PD4A 4ZYWA 2IUFA 1EFPB 3D2LA 1WCV1 3KQTA 4GC5A 4ZVQA 3I5UA 3LSTA 4PGGA 3S40A 2W6NA 4ED9A 4HJXA 3WWPA 5C1BA 4W5JA 2HD4A 4RY0A 3RADC 5B1SA 3CPEA 1R5NA 1CR1A 1UOPA 1T6ZA 2WIFA 2ERCA 2HDNB 1NQXA 3LDGA 3ZWNA 2O59A 2NU6A 1EJ2A 1N0IA 4LGYA 3B3GA 5EPEA 1FBTA 5ILGA 3LW8A 2BKXA 2C2ZA 4X8OA 1CXZA 5AK4A 3RVQA 3EPHA 1RZUA 3IMEA 4YMIA 2QTFA 4XGKA 4KV7A 5T3UA 3OQMA 3ZDXB 2A9OA 2HUPA 1Q1GA 2IYNA 5AOVA 1ZIYA 3S44A 4ARZB 4LF7B 1XKXA 4PZEA 3W9UA 1Y8RA 1XNJA 3IOMA 3FYUC 1NYQA 2CL5A 4R7ZA 2V3VA 4M99A 4MKZA 5EJ9A 1Z6GA 4H7EA 5JMWA 2ZM6B 4LRXA 1G18A 3P97A 3KZCA 1UC5B 2AXNA 2PU5A 5K3EA 1SCAA 2O6HA 1YTUA 1BVHA 2W0MA 3B1VA 1RHRA 1YQGA 3LTEA 5JH7B 4KRFA 2OWDA 2FSFA 2GSDA 2ODTX 2RAFA 3EQ8A 2O8DB 4J4HA 5HOEA 4V0NA 4OREX 2CMKA 4GZMA 2Z2KA 2CE7A 1OXBB 4RY8A 5ALLA 1JGTA 3O1JC 1V9SA 1Z2PX 4U3JB 2YOGA 5HBRA 3SQLA 4DDUA 5EP3A 1VL8A 2RIRA 1JHVA 1YIOA 1CYDA 4OGWA 1Z45A 3ECSA 4G86A 4OQYA 3ZV5A 3V97A 3KU4A 3C43A 3YASA 2BFMA 1RAEA 1WBBA 1CEXA 4GU5A 4CM9D 1QC5A 4I36A 1UIMA 2DU8A 2O9JA 4ID9A 3SDSA 1R27A 4BO2A 1C3EA 4LC1A 2BGRA 2EP7A 4V0LA 3ZR4B 3BUSA 1ZOOA 4MUIA 2IEZA 1K5DA 4R2WA 2IUUA 2I33A 3DFIA 4H4DA 3O03A 4CF3A 1AA9A 1U2PA 2AI2A 4ZKDA 3PYXA 2IXEA 1BKSB 5AW0A 1HFEL 1IAQA 4U9HS 3OM1A 1V8PA 4FFWA 5FH9A 2YWHA 1W25A 5DK4A 2BM1A 4PQYA 1CF2O 1RYYA 3HUTA 2P3QA 3MLAA 3U1TA 1SUWA 3E5MA 4PYLA 3WV5A 1TMYA 1I13A 4WPGA 3S4YA 3WAKA 4K26A 4PNEA 5EIBC 4AICA 4MRPA 3DL4A 1ETHA 4URHA 3W3ZB 5ITZA 4TN1A 2GBIA 3KXIA 3UF0A 5HGXA 1O8CA 1UR5A 1EWVA 3TIVA 1KJNA 1R0XA 2XTNA 4HDSB 1GPAA 2ZR7A 5A4MS 4TL8A 5KOYA 3EPKA 2FU5C 3KKZA 4WJKB 4B1FA 3V8BA 1D6JA 4TSKA 3BFPA 5AKZA 1HFWA 4X9XA 1PJAA 3BF8A 3GOQA 1K8YB 4NBRA 4YJGA 1EJ0A 5DEIA 1SULA 4B8WA 3OQVA 4BO8A 1Q1NA 4ENTA 5LYJB 4WFJA 3DE2X 1QIEA 5CLIA 2Z95A 3CRQA 1LNSA 1SG6A 5E9JA 1T26A 3GXBA 4E7OA 2LWIA 2HCFA 2VYCA 1BXGB 1MRSA 4NPAA 4BV3A 4EB3A 2RHHA 2HWKA 5DGIA 1VKZA 3FPJA 4EUSA 1ID8A 4JLDA 4OATA 4JC0A 1O5OA 3QENA 1NW3A 4YRCA 1ENZA 3M5PA 3KOXA 1DARA 3PGVA 4FFSA 2NOAA 3A04A 4LYGA 3AEYA 2FH5B 3HN2A 1OGIA 2I62A 3BXPA 4WOJA 4YS6A 5E7QA 2QI9C 1O7JA 3KVYA 4L4ZA 2FSUA 1ZU5A 4BVKA 2W2XA 3GDHA 4JR2A 3FZEA 4Q00A 5DTRA 3BXOA 3PQ8A 2XBMA 4KFSA 4IG9A 1PW5A 1TE2A 2ZPUA 1FB5A 3S99A 3TTUA 2W0SA 4EB6A 1U94A 1E2KA 4KNVA 3GLHB 1UZNA 1KKLA 2I4LA 2Z9BA 5F5XA 3STVA 3ZTWA 3G7SA 3C1OA 1UT8A 3DQQA 4JROA 1KC1A 1R9NA 3PEVA 4PC6A 5CIWA 3ICCA 3UTDA 3VSDA 5IT4A 3EASA 2Y9MB 3JQBC 1RPJA 1AV7A 3WTBA 3FTCA 4NBKA 2NM0A 1DB3A 4NOLA 1RJDA 2QZJA 2QTGA 1Q50A 4QDXA 2EL9A 4WZ6A 4I3FA 5HGJA 2PFKA 3DMHA 3E2MA 2QPLA 3HCWA 5C4GB 4YY3B 2WQ6A 2FRVA 1BVYF 2J7PA 2LUOA 3OLQA 4WLVA 3TZLA 4MW1A 1TYBE 1NVDA 1ZAKA 1ZKMA 3U4AA 5EXEA 5A04A 5I45A 5EJ2A 1D04A 5BUSA 1PG2A 1WG8A 3KLMX 2B94A 2GEBA 3GPIA 4OFXA 3TF5A 4PPGA 3RS0A 3C3PA 1WPGA 2QE7D 3C41J 1YR6A 3AETB 3VPBA 1QM5A 3SJUA 2HDHA 1WTAA 2Z6UA 5KVCA 1VRWA 3LWZA 5EL0A 3VR3D 3ZDZB 2XQGA 4Q7LA 1Z13A 4JCCA 1PVVA 1WCXA 3NYQA 2HK6A 3DHYA 5ENDA 4Z1MA 5FBVB 5K3CA 2EG5A 4FYYA 3DZFA 2AF4C 1X9HA 3TYXA 4ZP1A 2GNAA 1LVHA 1WU8A 3V6LA 3OU7A 1YIDA 2VF5X 2W6JA 3NRCA 4H3VA 3RWMB 2ES4A 3CH6A 2AOVA 2P68A 3AHIA 4UBOA 2ZB8A 1KO5A 2BM9A 1QO0D 3WO0A 3DLIA 3UK7A 3SYLA 4Z1OA 5BT8A 2VQFB 2H5LA 3SQDA 2BUBA 1T2NA 3MCVA 3N5CA 1Q1QA 1H2HA 3PQ7A 4MW5A 2EOAA 3PJFA 3DE6X 4LTMA 4X5OA 1NV8A 1P6UA 2RDMA 3ACCA 2PO5A 1FW6A 4RLQA 4QG3A 4TYNA 3HEBA 1WUJS 3EIUA 3B2QA 3ZCUA 1YDMA 4V24A 3NXKA 4GG1A 2JI6A 2ONCA 2Q41A 4GM4A 2P9CA 1XYGA 1LDNA 1P6QA 3CH7A 1KRHA 3JAWA 4L2IB 4RJ2A 4G26A 1R1DA 4LVOA 1UMDB 1FFEA 2QR5A 2X0IA 2X9NA 1KP2A 3FMGA 2CFIA 4W9NC 4UM5A 2MSKA 1B6RA 1EB8A 4BFXA 2VAXA 4ENUA 2IXGA 4Q3LA 4R0MA 4JXZA 5JG7A 1IZ0A 3J80A 1NJSA 5KMGA 3K72B 2QW1A 1J7KA 3HDTA 1IZYA 4Z9AA 2J3EA 4MRSA 3FYUA 4TMWA 4D0LB 3TCNA 1KEKA 1U1CA 1AKQA 2XOKD 3PGJA 4CIWA 3U4HA 3B1JA 2QDXA 2HRQA 2FMKA 4J90A 3F6CA 4LOJA 4KPFC 3JPYA 3O26A 5EPOA 3WK6A 1PGOA 1TC2A 3IV9A 1NLMA 2FW8A 2JHPA 4V1CA 5LMZA 5ESDA 4ARBA 4CM4B 1YRYE 2YHAA 4IGKA 4XX0A 2AI1A 2W93A 3NXSA 5K8IA 1OQAA 5C8DA 3PNPA 2IVZA 2OCGA 4EYSA 1DFIA 1KI7A 1A8PA 4YI5A 2BHLA 5D3KA 1TM3E 1RWNA 2OFWA 4MI3A 1BXRB 3KJXA 2PUGA 2CL7X 1A4UA 2MINA 3AC0A 1KVRA 2GI4A 4NBSA 2NSHA 2W71A 2GGSA 4PXYA 4K6CA 3T3OA 1LK5A 2D1FA 3SC6A 1WUHS 4JYBA 1BTOA 1NVTA 2I4RA 2FE1A 3PPXA 1PNVA 4RGYA 1CZLA 4E33A 3W5DA 1Y6FA 2Z1NA 4HPJB 3OFVA 4PLWA 4B5LA 1W76A 1FSZA 1DAEA 2VJCA 4DM4A 2H9AA 4GQAA 5JOQA 1RWXA 1UPFA 3KLOA 5DHAA 2HCTA 5FFNA 4TYQA 1BDBA 3QPCA 2FEPA 3QU5A 4N5HX 5I9BA 1E1QD 3DEIA 3B6JA 1RKUA 3M9XA 4I46A 4FMDB 1F3LA 1G9XA 1ZDMA 5JH7F 3WLTA 1LWOA 4LJAA 1Z5ZA 4V0KA 2Q5OA 3M2PA 3AKZA 3QX8A 3CU5A 4YRKA 1C81A 4C05A 1KWGA 5E1MA 3ZC3A 1E8MA 3M2TA 4LYYA 1GSHA 1VQ1A 2G6BA 4A4DA 4D96A 2R7LA 4P84A 1E3SA 3ESAA 1RD4A 1MB9A 4R4JA 3RS9A 4ZCMA 3RVBA 2NZUG 2CVZA 1M72A 3FLBA 5JC8A 4M36A 2RH4A 3CNLA 3F98A 3RM3A 1V4BA 2PSHA 4C0LA 1BJKA 1JPUA 3DLTA 4D5GA 5JNWA 3JQDA 1JLSA 1SG9A 3L05A 3BTSA 3EWNA 4HQKA 5GOTA 4N3CA 3TAHA 3UGQA 1MOSA 5L7YA 2F62A 1I7QB 3RIEA 1Y3DE 2O8VA 4RV5A 3BMOB 1VGVA 1QO7A 4D79A 2FMFA 2X77A 3C1AA 1HDZA 2AKYA 4FD2A 4S35A 1QIKA 4N6NA 5KKNB 4S04A 5DRYA 3ZHCA 3VZDA 1X19A 4QA9A 2O6LA 2RK3A 2BH9A 3KJHA 3WMXA 3NDBB 2AUNA 4DDHA 2Z56A 3GVIA 3PXCX 5FR1A 2OLEA 5DTJA 1ZLXA 2ZITA 3BIJA 3MOSA 3VFDA 2E21A 3GRCA 3ZE0B 4S0XA 2V1UA 4O5AA 2FP4B 2D1RA 1KY2A 2P6RA 5AOBA 3A2KA 2VJMB 3MTDA 3ZDFA 2NO5A 4OHVA 2R6JA 2R1UA 2WINI 3H0CA 2E5WA 4HXGA 2BZSA 3D4NA 3PQEA 1E1RA 4YN3A 1U28C 4KWTA 1LW7A 2FW1A 5ARDA 4MITA 2AEJA 1JXMA 4EB0A 1VXOA 1L5WA 2YW2A 3N2YA 5LYJF 2CXNA 1SZCA 1FDUA 4DA8A 3L7NA 2ZB4A 3QVXA 2AA3A 1M7BA 3JQBA 2IS4A 1T3HA 3FFBA 3H2SA 5KYTA 4TL7A 5JCPA 1Q0RA 3IJPA 3N3BC 1G8JA 1FP4B 4ZVPA 2WJ3A 4LMRA 3HDQA 3BHIA 16PKA 3ZNOA 2DQSA 4BUCA 3T7RA 5HQ3A 1WXXA 3LOQA 1MP0A 1J8DA 1EFTA 2JJ2A 1BOFA 2VK2A 1G8KA 4C43A 4ZI5A 2DHEA 4G1FA 4IFBA 4QQKA 4TXNA 3MAAC 4UOEA 1NKVA 3RJ5A 3E7WA 3MSXA 1YKSA 1II0A 4CKZA 4MX8A 3TSWA 4W5RA 1P72A 4DCNA 2O8BA 1PFKA 3EXG1 5JAQA 1WKVA 1GU1A 3FCXA 2KE5A 3WGQA 5B3LA 2ACWA 4HTFA 1ZGGA 4F9GA 1MB2A 5I01A 3FJOA 1GAEO 4KLAA 1V6SA 3OCWA 2J0UB 3OE7A 2XCOA 3CMCO 4NCHA 5EJ4A 2EVWX 4X65B 2B0JA 2WUGA 2XIQA 3VYWA 4Q9HA 4JI3B 5BRAA 3D5TA 1VPWA 1YD7A 3ZOZA 1PX2A 2Y05A 4HWSA 3TXAA 3NX4A 3K70B 3JQ8B 2V7GA 3L2OB 1K5HA 1WKBA 2QG4A 3P9QA 4X7BA 3UV7A 1X3SA 3W77A 3WNQA 2CLOB 2YVLA 4RIIA 4B3DA 3TPZA 3UO8B 4Z54A 1CJBA 2IW3A 2P9YA 5LDDC 1PGPA 1OWNA 3NTQA 4G1MB 3EEIA 2EG9A 3K1AB 3EH1A 4IZHA 4YASA 3RI3A 4Z4CA 1IK4A 1P1RA 1QE5A 2BEVB 2NUTA 2DP4E 4MVYA 3U7RA 3DD5A 3CNOA 1M2EA 2J9FB 2X8AA 3KFLA 5BP7A 2G3YA 2RHWA 2WAAA 4O1IA 1QIJA 1W5FA 3PJDA 3ZD9A 1GGEA 3E9MA 3ONDA 4DLKA 2ZBEA 3C24A 1Q21A 3G0GA 4NNOA 3SQXA 3R0ZA 5KDDA 3UKOA 2IGTA 4J7UA 1SB8A 2C04A 4MVJE 4X20A 5A6VA 5JD4A 4FUQA 1HX7A 5G40A 5JD6A 4NJEB 1HE3A 1T6NA 1QHIA 4WIAA 4UDYX 4BQIA 2F55A 5A3RA 4NOJA 3JATA 1F0NA 4WXRA 1W49A 5IHXA 2EKBA 3PWZA 2PZMA 4N5NA 1UODA 1JE1A 1R9JA 5IWCA 2GARA 3N86A 3GW8A 3L8MA 1HT2E 2OWEA 4W9RA 5GV7A 3QPBA 2FFHA 3FR7A 5FHRA 4ZJUA 2OHGA 3ROQA 3HR4A 2ILTA 2QE6A 1YRBA 3JZDA 4LVNA 1EBBA 3MJCA 4RS3A 4B6JA 8ABPA 5JXIA 2WVAA 4E09A 2J6BA 3LY9A 2DEUA 1YS6A 5AJWA 3ZLVA 4W5TA 4U02A 4XB2A 1C0KA 1K7XB 4J9UE 1Z6XA 2YHIA 4UU8A 3S70A 1QG0A 1E96A 2ZROA 2PWZA 1NI3A 4LECA 3FYSA 1GQOA 1C4KA 1URPA 2B8WA 1O4WA 3A9CA 3MEQA 4LJ6A 3ZHYA 5JJIA 1HQYE 3IGFA 5AVUA 1ZSVA 4WA7A 1YA6A 4TLCA 2BP7A 4P5EA 2QY9A 3IBCA 4Q0MA 1C1XB 1UQUA 1OIWA 3DQPA 3RVOA 3USZA 4HEJA 4MWCA 3X1DA 2PT6A 1M5UA 2XB9A 3DDOA 1U8CB 1T1IA 2WFMA 1ZVQA 2J4DA 1G2OA 2BM8A 2SECE 3BL5A 3GARA 2R62A 4QVGA 1TTPB 2VDLB 5CW2A 4QKQA 1V8ZA 4WX2B 3TOCA 1R15A 5DOZA 2JFOA 5IXJA 3D4PA 2BKUA 4F7WA 4N12A 2NU7B 4J0GA 2FFAA 3NBMA 1E62A 2F9MA 1Z33A 3KEOA 2YOHA 1FFSA 2FSPA 5CDGA 1G20E 1DC6A 2G63A 3WA6A 4Z2AA 3WSVA 4H7FA 4CM5A 1MCZA 4FZVA 5HJ7A 1QVVA 4QL3A 3KSMA 2E6KA 3RSFA 1OB2A 1HQKA 1CRPA 1MB3A 1G3IA 3EXEA 4HNSA 1T9KA 1MU0A 2H5EA 2IIPA 5IM5A 1T36B 2BR5A 2C99A 2GHTA 4IZOA 3NM5A 1C4WA 2H57A 1OPRA 5DNVA 1QGUA 5C51B 3FF1A 1AQUA 3C8DA 4RVGA 4RVNA 4RJIA 3RSLA 2ZSHA 2HV8A 1BROA 1J9GA 3WX0A 4G5HA 5AK5A 1Q7EA 3SR4A 2Q1SA 5HWSA 1WKCA 3BMCB 4C29A 3DMTC 3ZLUA 1O03A 5H82A 4PTYA 4RTSA 2VHVA 2Z9CA 5BWLA 2OXCA 5B7GA 2BJHA 3VHXB 1U8XX 3JYOA 4M98A 3V7NA 5DLYA 1PJ8A 3U0BA 4QPNA 5ADUS 4DWJA 2VBGA 3ABSB 5AUNB 4L50A 4L16A 1QZZA 1K6JA 1S8AA 1K8RA 3NH9A 3VU1A 4ARVA 5E2AA 2AKEA 1OLSA 3SY8A 4OHKA 3MWFA 2CLEB 4YMUA 4QDTA 3NDRA 4DTCA 5TX7A 5A6SA 3K8ZA 1SC9A 4PC3A 2E7ZA 2YJZA 3H7AA 2P3SA 2XYPA 3GYGA 3RU9A 4KLRA 3NG1A 4P3PA 1GQYA 5AJXA 3W6UA 7ABPA 1P80A 3U3KA 4BNDB 9GPBA 3LL4A 2Q2VA 2FW7A 2WMYA 3M6UA 4IXDA 1DEHA 1MIHA 3F4KA 3PQ5A 3FTDA 3AOGA 4O4LF 3QX7A 5JLAA 2HM7A 2E4WA 4UTPA 4MW9A 1M67A 1X39A 4CV0A 1KEPA 4RMHA 3O4GA 3L1IA 1C41A 3PPWA 4INAA 3Q7SA 4YH1A 1KQPA 5AOAA 3BTOA 3WGMA 1OR8A 1U28A 4EF4A 2QB5A 1KAMA 3ORFA 3R77A 2Y4NA 4FJ1A 3NNNA 2V4UA 1KKUA 2ZSJA 2FW0A 3KJQA 4BJHB 4RTMA 4H27A 4RSMA 2J0EA 3MMSA 3C97A 5J5AA 1QDUA 1GU0A 1SRQA 2E1PA 2XH8A 2HMUA 1M0TA 3A26A 2XT0A 2MR5A 5G41A 5FYQA 3BCSA 4LWOA 3WLFA 1PZFA 1MA0A 1UJMA 4G0XA 3CCFA 3FMOB 5ALQA 1YDEA 4MQBA 1RYHA 5BMVA 2QTTA 4LGCA 1NMQA 4RGBA 4FPXA 4LWPA 4B7ZA 4JLSA 3RG2A 2YQZA 1KK3A 2P9TA 2QMZA 5JSZB 4AF6A 1BW9A 1E64A 2C7OA 1K06A 3KELA 4KN8A 5EXDA 1RI2A 3DDWA 2XEDA 4L28A 3IBTA 4AKEA 1JFRA 2D2FA 4OSPA 3L4JA 1EFUA 4UDOA 2FG5A 3V4ZA 2CF6A 1JR2A 3LVBA 1R8SA 4E1AA 1M6YA 3IA7A 1V5WA 2JAHA 4J2TA 3WHLA 1Y89A 1WVIA 3PVZA 2NVWA 4PONA 5E9WA 4Y2JA 5FYDA 1ZH8A 1L4KA 3BFKA 3SHOA 3GI1A 2BFFA 3NI2A 3O4HA 4OAOA 3ZV7A 1PP4A 1XEXA 3U4CA 4YJHB 2VDWA 3K0FB 3OU6A 5MN6A 5FI5A 2O2DA 1U1IA 1UT5A 4BNLA 5JXHA 5AQ1A 3AXSA 3M4ZA 1JG7A 5IXYA 1P0MA 1YJAA 1NW5A 2R5NA 4ZXPA 1U63A 3VR4D 3EBOA 3LQQA 3R5HA 4JGGA 5FWNA 5AHOA 3LYLA 3VHLB 2P2SA 1H8ED 3L79A 3WL4A 4DEYA 3OZUA 3EXIA 3MIZA 3TRFA 2CV2A 3E3AA 2KM1A 4QPPA 5DM4A 3TEMA 4RC9A 1KI4A 3Q85A 4MCJA 1J2TA 2OO3A 4YAWA 1LDMA 1W36B 4NENA 2I03A 1RCUA 1WQ1R 3ORSA 2HGSA 1TQ2A 2EBHX 4TXJA 5FULA 4IMPA 3FDZA 1NWCA 3NORA 4YQEA 2OXTA 4O4HB 3LWNA 1R9MA 1TKCA 2WSSD 4OYHA 4HC4A 1WDLA 1DWPA 4YYZA 3E82A 1CY8A 5COBA 3KTAA 2F43A 4HT3B 3RUPA 1ZUIA 4DIKA 2LZ0A 2WT8A 2Q5HA 4M6WA 2WPDD 4JVSB 2Z3VA 1PG0A 4MVJH 2AMYA 4KG7A 4NDAA 1EE2A 1A4XA 1FLAA 2J33A 5EQDA 1CW2B 4LXGA 4YR7A 3SG0A 4K0KB 2DY1A 5I7VA 2YXBA 4F96A 1VG9B 4Y98A 5ECYA 3MMPA 4CF7A 4QOHA 4E4TA 3KO8A 1I4OA 1XJ0A 2GN4A 5J2UB 2VDNB 3GQBB 4MS1B 5CTJA 3AP2A 4G01B 2IE0A 3F5FA 3MGAA 4A6EA 1A5BB 1EP2B 2BMWA 4PYNA 1KGDA 4B2LA 1GTVA 4IJ6A 2ZJ6A 4UZEA 4XD2A 1TJ5A 1QVAA 1CR0A 2Q3BA 1CDOA 5FBWB 1LLCA 3QLVC 2KYRA 1DKUA 1JHOA 3FPBA 3IQHX 1JPVA 2HA6A 3ESBA 2WD7A 3RJMA 3NOVA 2AD5A 3M9WA 3JD1A 5IK2D 2BSQA 4O4JB 4IUCS 4CLOB 2HWWA 1DKNA 1NP6A 1MRZA 2YY7A 3DZGA 4GLFA 4BFLA 1OWOA 1YQWA 2VRCD 1A9ZA 4IJWA 4C2TA 2OK8A 2C95A 2C5GA 1QMGA 5C34B 4IFTA 4UUOA 4EHIA 2UZ4A 2BGIA 2IYYA 5EIOA 3KT3A 1XT6A 4GECA 2ORED 4KN5A 2PZ8A 1TUBA 1C8VB 4M3NA 4C4SA 4AAYA 1TK2A 4DG8A 2VDUE 3JQGB 4P7JA 4OVKA 3QLUC 2XNDD 4UVIA 1W1IA 3T1VA 3H65A 3KHUA 2B5WA 3KB8A 4XI9A 5FUBA 4F3CA 5A4IS 1IDOA 2BELA 3O0DA 2PXAA 3PLAE 2P2ZA 1MXHA 1BGVA 3AZOA 3PFKA 4KE6A 4GKAA 4AK9A 1NW7A 3VKHA 3K2EA 3A4MA 4GP6A 5DHSA 1C7QA 4NJOA 3ZDBA 3BH0A 3I9OA 3L0DA 2IVFA 4G1VA 5DRTA 4TQGA 5IJWA 3ZVKA 2AN3A 1OGJA 2XSZA 4JLPA 3IOEA 1IVSA 1IBCA 4J2HA 3T4UA 3UB3A 4A6DA 4BMYA 4FXPA 4JP2A 2HIGA 1VE3A 1MABA 3Q7PA 1Z4QA 2O1SA 4OYYA 2HZBA 4YAGA 4YBZA 1M6HA 3DMTA 3DYBA 3HCOA 4Z4HA 1SZDA 1GILA 2Q2OA 2MJLA 3QW4B 4PAOA 1K63A 2HNAA 4JZKA 4BEJA 5BURA 3CJRA 4EA9A 2G7ZA 3O1HB 1KEWA 2HV9A 2P67A 3R5SA 2W90A 1DIAA 1AURA 4FIDA 3G59A 4Y9SA 3ZHXA 4CZ2A 4GRAA 2H5JA 3R3YA 2ZXEA 5BR1A 2I0FA 3KPWA 2UKDA 3EA5A 2CXHA 4RLFA 4DABA 1YVDA 4KVZA 3G2PA 1JECA 4L4XA 1ZY2A 1P2GA 3ZTYA 1D5WA 2OC4A 4MR9A 1QQ6A 2Z4RA 4B3SB 1W88B 3WOHA 4WFIA 3AKDA 1JG4A 2BGMA 4UEWA 5IVKA 5FOSA 3EYAA 1KMQA 1RS0A 1E3MA 2IOYA 1DJLA 5CM2Z 1Y5IA 2I4NA 2P27A 1QVZA 3RSZA 5LQAA 3R4VA 4JI2B 1RHMA 3AFMA 2P6PA 5FXMA 5AW4A 4EFLA 5JHGB 1X7XA 3E22A 4ZQEA 3W7AA 4J1QA 5F9MA 1GT91 4MIKA 1N5DA 4AJ2A 4CTMA 1WJGA 3KG2A 4DSOA 4HEHA 4IDAA 4YP9A 4J9VA 1OKKA 4X7MA 5HUQA 4DLNA 1IHPA 2RHGB 1YCFA 4LRUA 5KTSA 1TA9A 3BTUA 2WVJA 5B64A 4UD6A 7MHTA 4ON9A 4Y0AA 3U2QA 2HMYB 1Z37A 4JUCA 4OKSA 1QKJA 3RB8A 4D80A 1VYHA 4B32A 3W9SA 4DPLA 2C9BA 1I0LA 3HFSA 1JPNA 2A59A 1DT3A 2A5GA 2JBWA 2MIIA 2VSNA 2XPCA 2ZEJA 3IE0A 1J0BA 2O7VA 3NBXX 4ZAWA 4GVPA 5BSMA 4LZAA 5LBUA 4B2YA 2YY5A 3SN6A 2B7BA 1O6FA 3QITA 1V3TA 4ZTUB 4AURA 2FZVA 3U13A 4DIFA 3S55A 5CM9C 2FUG6 1X1QA 3AGQA 4MQFB 4OM8A 1GL6A 1XBTA 3KHTA 2ZI6A 4RF2A 5KTRA 5JAPA 4XJTA 2OHVA 4CUZA 2X8JA 1KAEA 4PPFA 1KIMA 3W2GA 4JLOA 1INLA 3FR8A 4D9KA 4KK3A 3RUDA 3WYFA 4BO7A 3CG0A 1B4DA 1YB7A 1ISPA 4GPD1 2MOKA 2AEFA 4DVGA 3I04A 3R7AA 4NH4A 4F2WA 2FXVA 2ZOSA 2GH1A 1BN7A 5TR9A 3IKMB 4EELA 3T7IA 2OL4A 3GAMA 1WS6A 3M8KA 4DAOA 1NIJA 5BN3B 5CITA 5AK0A 4YJ3B 4F12A 1YQDA 2ZI5A 4UZFA 4YNBA 2IEAA 4ZOLB 1QHHB 2VAPA 5UKDA 3IXMA 1J5XA 2W43A 2REOA 3WQBA 1QVRA 5LZ7A 2O8FB 3L1VA 1HLFA 2ZK7A 3OTQA 1GN9A 1XA4A 1KVSA 1M1ZA 1NVGA 2ENUA 2VT7A 2WMDA 2YVUA 3NHZA 1YKFA 5H16A 3S2FA 4K6MA 4ZVSA 1I2ZA 5LSAA 3DCJA 2OG2A 2QAGC 5DYYA 2FEMA 4LW8A 4JLMA 3EF3A 4CM1A 1VLHA 3G1TA 2JLZA 4W99A 5HKKA 2V5AA 1TU0A 1NSTA 3TZHA 1PQUA 4ZZIA 3ENWA 4ISCA 5IH7A 1I51A 1DO8A 3NT2A 3NP7A 4NARA 4YLGA 3SYTA 3KQQA 2C92A 2BH2A 2B69A 1OT5A 3PHIA 2EKDA 1BFKA 2C98A 2JHAA 1D1SA 1OLUA 3TNJA 3ZXSA 1Q7TA 5LXTA 5A0VA 2DQYA 3TUIC 2IIQA 1XYYA 3NBQA 3WFIA 3HB1A 1VGRA 1HYHA 2JGEA 4ZICA 4KX5A 4C0XA 4L6CA 2G72A 4IEIA 4HXEB 1M2OA 4B3BA 2YJ3A 5ARBA 1PFWA 2PX3A 1I7NA 1W30A 4WBNB 1H1DA 1KYTA 4MTCA 2PGNA 1M0EA 3PG5A 5T64A 2C54A 3MJTA 1Y4DE 3TR5A 4RHFA 3UK1A 3WLLA 5JEDA 4F6LA 2PEYA 2Y6VA 3WLSA 4YCMA 2NAPA 3GN1A 4HDKA 2VRWA 4PG6A 1Y42X 4LKOA 4J43A 4O4HF 1A1SA 3UWSA 3QKTA 1BRTA 5FI1B 4DR5B 1ZM9A 2FK7A 3OJLA 3QLVA 2VPYA 3QM1A 3GMDA 3K16A 3BTVA 2WOJA 1R4AA 4TGLA 5B55A 2CDRA 4P80A 3S8YA 1WCYA 5A4AA 2EF1A 4Z5XA 3RTEA 5KYWA 4FYXA 3HABA 4CMIA 2EYQA 5KWIA 1Y3CE 1RQ7A 1ZFNA 3TGWA 4IOJA 2JB9A 5J2UF 2IY9A 3I5AA 2A4KA 4RELA 3IO3A 2ET6A 1Q14A 2BTOA 2D0IA 3KQWA 3O1IC 1RACA 2NXCA 3QLUA 4X44A 3W8NA 4LJ8A 2OQRA 3DE0X 3N28A 3OPQA 4OQQA 5IMSA 3FW1A 5DBGA 1E2DA 2G0NA 3H1AA 3QSGA 1T10A 3V2GA 4BMPB 2OFFA 3PK0A 2A5LA 5TS3A 3IAS6 2XRZA 4RIGA 5G3YA 4BNZA 3K9LA 3THRA 3RSHA 5ITWA 5CFOA 3OT1B 1SC1A 3WYEA 4NMHA 5KVQA 5J2TB 1NLUA 1X86B 1GTJ1 4O2BA 1XF1A 2FSVC 3E70C 4RADA 1II9A 1EWKA 1LDBA 2XDQA 3BZBA 2XA2A 3LHSA 5B3KA 1MOZA 2JKYA 5FTJA 1KEVA 5AVZA 5FV7A 3VC2A 5K0TA 1F60A 5AJVB 3S1LA 1K7CA 1SKAA 3GQVA 3U3ZA 3UG6A 4E22A 2JK0A 5DHQA 4YUXA 4QHYA 1TT7A 2X4DA 3FJYA 5ARCA 2MYUA 3ITNA 4AU1A 1M6WA 1UFRA 1KQOA 1QAMA 3FYCA 2I55A 2PUCA 3ODPA 4FXOA 2GCEA 1HMYA 1NBWB 4O1MA 3W34A 3KK0A 4ZU3A 1KOFA 2RONA 3OOHA 3ZVRA 1UF9A 2EX0A 2GKGA 3EVBA 1PR1A 4Q7QA 5H68A 3L7AA 3QUTA 1TJNA 5TQJA 1NXWA 2OBMA 4OXNA 2QGFA 4D8TA 4ZYUA 1T9CA 5AM4A 4L51A 3LKVA 3CUWA 4D0SA 2G1UA 5CRIA 5BWNA 1PS9A 4PFJA 5E0KB 1J07A 5IANA 1V39A 2GZRA 2CL0X 4GKJB 1OOEA 3RLFA 2YN2A 5B1HA 2AG8A 3UMYA 3JYLA 4B40A 4KN6A 4J8PA 4S0ZA 1U0NA 3O3CA 5L3SA 1P1KA 2HQBA 3V8EA 4B82A 2ORIA 5L8VA 1PR9A 4DRXA 1CC1S 5TB5A 3TR6A 4RFVA 3ABZA 4V0SA 4CIXA 2IY7A 3HCPA 4P7FA 4KO4S 1M75A 3W5IA 3GGOA 3O8OA 2FLKA 1IXYA 3RVRA 1Y8QA 2V5UA 4IJQA 5HA5A 5JASA 1R4NB 3KJEA 1ZA2A 4QPZA 4DWOA 5KPJA 4OX9Y 1PT7A 2AKAB 4AECA 3FPAA 3DTYA 4R5HA 5ALDA 5ELXA 4OGFA 1ZOPA 3TRHA 4YLYA 2BIFA 2G5TA 3EDOA 4P4TA 4X93A 2P9EA 2PSFA 4UEOA 3BHMA 5SV2A 4RESA 4RM2A 3SZMA 4DF3A 1NNI1 3VU3A 1TZMA 1C3OA 1G3MA 2ZAGA 4LK3A 1DRUA 4TZ0A 1U5AA 2GPAA 4AXBA 4PLGA 5K8LA 3RC2A 4BWVA 3AV0B 3GZTB 5FBKA 3HU2A 3IULA 3BE5A 1K89A 4GOOD 1ICEA 4N0EA 5J59A 2QTZA 5IVPA 5BVGB 5CIYA 2FG6C 2N9UA 2YZNA 1OLXA 2WILA 1K2VN 3MJSA 3SFVA 2CUNA 3GRYA 1FLNA 4G0NA 4V38A 1MBZA 2BEWB 1ZXLA 3B6EA 2OVBA 1GAWA 1OTXA 3FWKA 3HXTA 4KR3A 1JR3A 4L7VA 4JI8B 1E3JA 2C9DA 1T8UA 4Q4HB 4V0MA 3ZJ5A 1KARA 3T3DA 2VHJA 4E5NA 3ZDRA 4MVXA 1E5XA 1QTNA 3QTBA 3KYJB 1LRLA 2ZPTX 4EHAA 3BL6A 4GYWA 2IHKA 1KORA 3AOEC 4HYQA 1AUOA 1QX3A 2I2AA 1NI4B 1UBJS 5AO9A 2NZ8A 4LQ4A 4KWEA 3DZDA 3QNMA 4CEJA 2VUHB 5ELMA 1P7CA 1Q74A 2OCYC 1DNPA 1OYOA 2PLNA 3M3HA 4IS2A 3RT1A 2QAGA 3IR7A 2QRLA 4IDNA 4OH7A 2J32A 1B6SA 1R3UA 2B98A 1UP7A 2BUCA 3G02A 3H2KA 4BDSA 1Q2XA 2LE0A 3DUFB 4GBJA 4CL0A 1JE0A 3FWZA 1E1LA 4A1OA 4GQIA 1D1QA 2ESRA