3F67A

Crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
240
structure length
240
Chain Sequence
NAIIAGETSIPSQGENMPAYHARPKNADGPLPIVIVVQEIFGVHEHIRDLCRRLAQEGYLAIAPELYFRQGDPNEYHDIPTLFKELVSKVPDAQVLADLDHVASWAARHGGDAHRLLITGFCWGGRITWLYAAHNPQLKAAVAWYGKLVGEKSLNSPKHPVDIAVDLNAPVLGLYGAKDASIPQDTVETMRQALRAANATAEIVVYPEADHAFNADYRASYHEESAKDGWQRMLAWFAQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative Dienelactone Hydrolase from Klebsiella pneumoniae subsp. pneumoniae MGH 78578
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
molecule tags Hydrolase
molecule keywords Putative dienelactone hydrolase
total genus 81
structure length 240
sequence length 240
ec nomenclature ec 3.1.1.-:
pdb deposition date 2008-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3f67A00
4G8BA 2XUQA 5AKHA 5HFNA 3LLCA 2QZPA 4PNZA 2OCIA 3KXPA 4DSAA 3LP5A 4M0MA 5HF5A 1Y7IA 3DJYA 3FYUA 4F0JA 4AB1A 2WJ6A 5CH8A 3L1IA 4E14A 5YASA 4QLAA 5AO9A 2AJBA 3G9XA 2YYSA 2HA4A 4U2BA 4UUQA 4PW0A 5ALNA 4FLMA 3M83A 4EA6A 1ACLA 1TRHA 1AUOA 1VA5A 2WQZA 1ZJ5A 5LZ7A 2XDWA 4XX1A 3WA6A 2HFKA 3QBJA 3O9MA 2JEZA 3FLAA 2I3DA 5AKGA 5ALRA 3B3QA 3NOXA 3GELA 2G4LA 1C7JA 1B6GA 1ODCA 4AO8A 5K3AA 3CN7A 1R50A 4FLEA 5AKLA 3DL7A 3R0VA 4H77A 4Y7DA 3E1GA 2YASA 3O4JA 4BP8A 2V96A 1ETHA 2X76A 2XQIA 2J4CA 3STUA 1VLQA 1QIMA 2X5XA 4Q3KA 5EHQA 5T4BA 4UFPA 3G0IA 5FRDA 4UBLA 4AZ3A 4OB7A 2J4FA 1DWOA 2XMCA 1BEZA 2WU4A 2VA9A 1IMJA 1CEXA 3V48A 5JIBA 4A23A 3H04A 3WJ1A 4W1QA 5LKAA 1TCBA 4XIIA 4WFJA 2DR0A 4HAIA 3WK6A 2PX6A 2XUFA 3BF8A 4RPCA 5AK4A 3WIOA 4G5XA 1RYYA 5CT8A 5EHZA 4XJVA 2XUOA 1XLUA 2CJPA 2HA3A 3L1JA 4HXFB 4KRYA 2VT6A 3ZV7A 4EHBA 3H17A 3VVLA 1ZJ4A 2B9VA 1WPXA 4B81A 2VATA 2DHEA 1A7UA 5AI6A 1CRLA 4H7FA 3WKDA 3MVEA 1QJ4A 1XZBA 3GROA 4X00A 4TVKA 4PV7A 2WIGA 2BAGA 1X2EA 4DLNA 2HU7A 5D3ZA 2V97A 4BRSA 2WG1A 1DQYA 2QKYA 3G7NA 5AI8A 3H2KA 4K5QA 1LPSA 1H2WA 2WILA 1F8UA 5CRIA 2BFNA 1R3DA 2DQYA 3LIPA 5ALDA 4CCYB 4BAUA 1RWQA 1YA8A 1XZKA 2OG1A 1XZJA 5ALXA 3AIMA 1HLGA 3K6KA 3QH4A 3WK9A 3G0GA 1CUZA 5BWBA 2C5GA 1CV2A 3DYVA 1USWA 1QGED 4YASA 4FDMA 4BRZA 3RK4A 1EK1A 2XMRA 2CB9A 4X91A 1MAHA 1GT6A 3G0BA 4WY8A 5H3HA 1GKLA 1EINA 5IVDA 5SYNA 3PUIA 4DSZA 1GZ7A 4BATA 1XZHA 2XUPA 2XMSA 4GXNA 2WUFA 5JYCA 5LIPA 2GZRA 4J3JA 5CT4A 1XFDA 2YXPX 4ZV9A 4UHHA 2C0QA 1CUBA 1P0QA 4QE3A 1EA5A 3D7RA 3UUEA 5CXUA 1YAJA 2DHCA 5A7HA 1AQLA 1C4XA 4KAAA 1BS9A 5AKYA 4JH0A 4U2GA 4IH4A 1QIFA 2PSJA 5JARA 4BDTA 1NX9A 4U2FA 3FYUB 3DNMA 3O95A 3V1LA 4B82A 5AOBA 2O2GA 1N5RA 1K5PA 2IITA 2ORYA 1AX9A 1TQHA 4UFOA 1QTIA 4BCDA 5ALFA 4P92A 3L1HA 3OOSA 4YX9A 2Y6UA 1E5TA 1FFBA 3AZOA 1U8EA 4HXEB 1QIHA 3DCNA 5D6OA 3QYJA 1R9NA 2HADA 5T4EA 5ALJA 2FX5A 2YH2A 5ALPA 5ALTA 1XKTA 4EY8A 3IA2A 1ZD3A 2ECFA 3TGLA 1EHYA 3IURA 5JZBA 2JGJA 3HEAA 2R11A 3O4IA 2OGZA 4BC0A 1F0PA 1UWCA 3QMVA 4DGQA 5AKKA 3A2MA 1TCCA 2IX9A 2Y1KA 2ZVDA 3BF7A 1J1IA 5AM2A 5HCUA 1AGYA 1ORVA 4AQDA 3H18A 1YCDA 1YB7A 1YAHA 1VOTA 4X3CA 4BCBA 3K2IA 1JU4A 1MAAA 3HJUA 4H7HA 2WHPA 1QIGA 3ESBA 5FKJA 3O4GA 1DT5A 1HDEA 1QE3A 3G9ZA 1X70A 3OC0A 5JAUA 5K3FA 4PO3X 1ZIYA 1CUYA 4AN0A 1GGVA 4YPVA 1VKHA 1A8QA 1LGYA 3PDCA 1UKAA 1W4LA 2VJBA 1BCRA 2HRQA 4LKOA 3O4HA 4HVTA 2JGKA 2VT7A 1WB5A 4E46A 1G66A 1E3QA 1E8DA 3V1NA 1XZGA 1E66A 3VISA 5JADA 2HDWA 3H1BA 3ILSA 5ALUA 5DNWA 1XZLA 1L7QA 3N2ZB 4FFVA 4DM7A 1D07A 3K9BA 1H22A 4OYLA 5AICA 3WK4A 2XQKA 3C8DA 1HQDA 2XQGA 3AZQA 4ZWNA 1C7IA 4LXHA 4ZGBA 4L0CA 2WTMA 1EK2A 5HF8A 3WQHA 3AILA 1FSSA 1EDDA 1MTZA 2XMGA 3FCYA 4H7DA 2BGRA 3DEAA 3AIKA 3I6MA 2G63A 1SCQA 2JBWA 4PF1A 3H0CA 5ALGA 1ZI8A 4B80A 4MYSA 2QRUA 2W22A 2VJAA 4DNOA 1CQWA 1P0PA 4BZZA 5CXXA 1IZ8A 1J06A 4CIBA 1UOQA 2PSDA 4OSEA 1CVLA 4Q05A 3HYSA 4Y2UA 4RE6A 1G4HA 3M82A 5E4TA 2Z3ZA 5AM4A 5CBKA 1IZ7A 5LKRA 4AN1A 2ZYRA 1A8SA 1GPLA 3IULA 1MN6A 4BTVA 4G4IA 5BOVA 4LXIA 5I7UA 3C5VA 5LP1A 2PU5A 3SX4A 2AXEA 1DWPA 3NUZA 3BJRA 3IUNA 1PFQA 4B84A 2RONA 4LHEA 4U2DA 1DX4A 4IO0A 4X85A 1QFSA 3BIWA 3HSSA 3OG9A 3PFCA 1VXRA 2QVBA 1QO7A 4B9AA 4JYPA 5DYTA 1ZD5A 4AX4A 1LNSA 3C6YA 1E89A 2CKMA 5T4FA 5AHXA 3F9CA 2GYWA 2XMQA 4NMWA 4AMYA 4Y2RA 3IUQA 3V1MA 5DYWA 1MO2A 2I3ZA 5ALKA 5HZGA 2O2HA 5J3JA 3DKKA 5JAHA 5EHNA 3H2JA 5JANA 4BCCA 5KWJA 4BB0A 2J3DA 1UKBA 1J07A 3H1AA 1Q0RA 4X95A 3C43A 1QLWA 1XQWA 4QWMA 2D0DA 4W1PA 4HZGA 4Y2YA 2G5PA 4EZIA 1WOMA 4DTCA 5C8VA 3BJMA 5IVIA 2DSNA 2HU8A 3ICVA 3WZLA 3FCXA 3HXKA 4C4XA 1ISPA 1YB6A 5C81A 3R41A 2RI6A 1XRRA 3BIXA 1EVEA 3VDXA 1MNQA 1CIJA 3WYDA 2QUBA 1TAHA 2Y2VA 3AJAA 3I6YA 4BTLA 3D2AA 2ZSHA 2XUJA 4G1FA 3A6ZA 1JJFA 5CMLA 2Z5GA 2H7CA 3HACA 2PUJA 4CG2A 4ARBA 1CLEA 4UHEA 2JEYA 4W63A 4GWLA 5IVKA 3TJMA 3ANSA 2Y6VA 5A2GA 4C4YA 1IUOA 4QNNA 3AINA 4PSCA 4H7JA 3FLBA 1K6EA 5AK6A 4CCYA 1IUNA 1HL7A 4BZWA 3HABA 3DOIA 5ALHA 1F6WA 1FFCA 4ZI5A 5AK3A 3EIOA 4KE6A 4DMCA 4FMPA 1BROA 1T2NA 3W06A 1MX5A 3BDVA 2UZ0A 1KU6A 3R3XA 4W9RA 3ICWA 1GPNA 2WU3A 3TRDA 1UOOA 3QPAA 4DNPA 3IBTA 1ODTC 3GA7A 3GFFA 1U2EA 4FHZA 4KYVA 4Q34A 4FNMA 1GQSA 5F4ZA 2PSHA 1W76A 1Q83A 4OB6A 4WDQA 1Y7HA 1DTEA 1GPKA 1G42A 4MWSA 3N0TA 1UK6A 3B12A 2WJ3A 1CR6A 3EQ8A 4L9AA 4UFNA 3FLEA 1XZIA 4GECA 1L7RA 1UK7A 4D9JA 1ZIXA 1T4MA 3A70A 4B9EA 1NU8A 4X94A 1BN6A 3BL8A 4OYYA 3G0DA 1CUAA 1QIIA 2QM0A 3WL6A 4UPDA 5EI5A 5DYYA 2XQJA 1QIKA 3RLIA 2WHQA 4CIAA 5LZ4A 4QA9A 3I6ZA 4Q3OA 2XLCA 5AM0A 4LYEA 5EFZA 4ZV7A 3WKAA 2HM7A 1XZDA 3S2ZA 5AM5A 3R3ZA 5LYYA 1KU0A 3PI6A 3R3VA 5CH3A 5FXMA 2JIDA 3I1YA 2ZJ6A 5AP9A 4FBLA 5HQ3B 4CG3A 1ZOIA 5K3BA 1FFDA 3STVA 3WWOA 3ESCA 5AJHA 4NS4A 2HHAA 3NGMA 5CH5A 3WL8A 1H2ZA 1SFRA 1JKMA 5I8PA 3I1IA 1MX9A 4KACA 2H1IA 5JZSA 4K6KA 4H35A 1ZI6A 3LCRA 3I2JA 4DIUA 2ACKA 1H2XA 5FDFA 1Q84A 1THGA 3I2HA 3F98A 1XRMA 1TK3A 2BKLA 5JALA 3EQ7A 3U1TA 1J2EA 4Y2PA 4RNCA 1CUUA 2HIHA 1N5MA 5A6VA 5CW2A 5DNVA 4Y2TA 3OPMA 4DMHA 1X2BA 3R3WA 1THTA 5HF9A 4ETWA 3O9VA 3HC7A 1JMYA 4U2CA 4J03A 3Q0TA 4TPKA 1SCKA 2WUGA 3O0DA 4Y2JA 2PBLA 2JGEA 3WL7A 4X92A 3D5EA 4WJLA 5EIHA 1Z68A 3CXUA 2FUKA 4BBZA 3PE6A 1CUGA 1EDBA 3QPDA 1Q0ZA 3VKFA 4LXGA 2O7RA 5JD6A 1VZ3A 1H2YA 2HA7A 5K5EA 1K8QA 3PUHA 3FNBA 2WIKA 1W52X 2Y2UA 1DU4A 4X90A 4J0KA 2BGNA 3EF3A 4FLFA 1EB8A 1TIBA 2WUEA 4B7ZA 2WM2A 3QITA 5HKAA 4JEIA 2JF0A 3I2KA 4KAJA 1CUHA 2JGMA 5JD4A 3G9UA 1LPOA 5AKEA 4ITVA 2DQZA 1CUSA 5ALOA 1OILA 2VQ6A 5SYMA 5FOQA 4B6GA 4WCVA 3RKSA 5KWIA 3A2NA 3H19A 5BWCA 5T4HA 3IDAA 1XRNA 2CBGA 2Q0XA 4P08A 3U0VA 4PSDA 1GQRA 2HL6A 4Y2XA 4KR0A 3C6ZA 5DNUA 1ZGBA 4DNFA 3GBSA 3QZUA 4G4JA 4UBKA 2HFJA 4OU4A 2XUHA 1VA4A 1YS2X 5D7BA 1I6WA 3DLTA 3FVTA 4GHWA 1VE6A 2NW6A 5EIAA 4W1SA 1YR2A 3W2TA 1W1IA 4HTAA 4DMFA 4KEAA 2GBFA 4N5IX 4W1RA 4S0XA 3RARA 4LYDA 5FPQA 2WG2A 5AH0A 5FLKA 3ESAA 3RM3A 3H2IA 2WTNA 2ONCA 1MU0A 1F0NA 3IIIA 5LLSA 1EX9A 4MJ3A 1CUCA 4K6HA 3FOBA 2AJDA 1DWQA 4KE7A 4BVJA 1R4ZA 1LPNA 2Z8ZA 4B0OA 4JYMA 2EDAA 3KD2A 2OLEA 3BWXA 4NZZA 2Z8XA 1YS1X 3DQZA 1XLVA 1QFMA 4G9GA 1UXOA 2QOEA 2CZQA 4YK7A 4HS9A 1CQZA 4Q1VA 1UFOA 3G0CA 4X6XA 5AKJA 2ES4A 5LZ2A 3WWDA 2I78A 4ROTA 2CEKA 4F60A 5LZ9A 4BAGA 2GBIA 3KOOA 4MQMA 4CCWA 4AXBA 4WY5A 3FSGD 3QVMA 3PFBA 4GEGA 2XUKA 4XWGA 5ALIA 1OCEA 4J7AA 4KRXA 4O08A 3WI7A 4K6GA 4TGLA 1XZMA 1JJIA 3WKCA 4J0JA 5ALQA 2XMDA 5DLPA 1CUFA 1RP1A 2ZYIA 4EY5A 1R88A 3DL4A 2PKYX 3W9BA 2ZJ7A 4C87A 2PL5A 2D5LA 2WHRA 1MJ5A 1P0MA 4V2IA 4B0PA 2CMFA 5KBYA 4IH1A 1AURA 4C4ZA 2QS9A 2IIVA 3C6BA 4QEKA 3R3UA 2WG0A 4UHDA 3W04A 4FOLA 4OUKX 4I4CA 3D2BA 1YSCA 2K2QB 1WCYA 4EY6A 1YA4A 4IHAA 3E3AA 3ZPXA 3IVMA 5KREA 3WWEA 2C58A 2V98A 4EB0A 3MUOA 2WJ4A 3STYA 4GW3A 1UK9A 3FWHA 5A71A 4OPMA 4WFIA 5JAPA 3B5EA 5AM3A 3WKEA 1LZKA 4J0HA 5EHXA 1JFRA 1KEZA 3V9AA 5ESRA 3A2LA 1LPAB 5C7YA 4UBOA 1XKLA 3ED1A 2QR5A 2WFMA 2DCMA 3LIIA 5EIEA 4C88A 1ZD2P 3BE8A 1QOZA 1ORWA 2GZSA 2XUIA 3P2MA 4WDRA 1QTRA 1HKHA 1DINA 3QMMA 5A7FA 3FYTA 4INZA 3OTQA 2QXUA 3IB3A 1EVQA 3M3DA 4AO7A 4F21A 4B85A 3DKRA 1O6FA 1K4YA 2OPHA 5JATA 1TKRA 1U65A 4BYMA 1R9MA 3KDAA 3I28A 2J3QA 1MT3A 2HA2A 2OCGA 1MPXA 5HF6A 3TEJA 1CUVA 2OCLA 3ZLVA 1WM1A 1BEEA 3DDUA 4FFWA 4F5ZA 2ZYHA 4H7KA 3WL5A 2WFLB 1ZI9A 2B61A 1FJ2A 3R40A 4AMZA 1GXSA 3VJKA 1BE0A 2C5FA 2FJPA 5HFAA 4C01A 3X3HA 3HRHA 3W05A 2RGUA 2WHPB 3QM1A 3NWOA 2I03A 4UBIA 3VJLA 2BCEA 1JMKC 4E11A 2VTVA 4FBMA 1UZAA 4FKBA 2LIPA 5ALLA 3ESDA 5AK5A 5A62A 2WKWA 2P8SA 4M0FA 1ACJA 4J0DA 5HK8A 4BE9A 4QDXA 2XQFA 3PF9A 3C45A 3F96A 2XT0A 5I9IA 4P93A 1R1DA 3CN9A 3D59A 4AO6A 3WK5A 3PICA 2VEOA 1JU3A 4N5HX 2Z3WA 4BC1A 4I3FA 2RAUA 3DD5A 1Y37A 1EDEA 1LZLA 3WIBA 2OAEA 2PSFA 4G4GA 2ZSIA 5D3KA 4L3WA 2PSEA 2BUAA 5BV7A 2C0PA 2ZJFA 2AJCA 2EEPA 5K3EA 4Y2VA 1AMNA 4G8CA 5FP0A 2HRRA 4E15A 5ISMA 1SOMA 3GZJA 1UT6A 2WLSA 4C6HA 2RHTA 4I19A 4MXDA 2BUCA 1JI3A 4Y2QA 3C6XA 3CCBA 4QDOA 1MNAA 1P0IA 2RHWA 4Y9SA 2HA0A 1GKKA 5HQ3A 4G8DA 3S8YA 4ZXFA 3HZOA 4MEAA 2E3JA 1VJ5A 3JW8A 1FFEA 3STTA 1UKCA 4FTWA 4MYDA 3HLKA 4DNQA 4N8EA 3SK0A 1LBSA 1IVYA 3ZLTA 3DYIA 4MEBA 4J0IA 4DMKA 5JASA 3I2GA 4N8DA 3KSRA 2OAGA 5K3CA 5AKIA 2ZYSA 1A88A 2HU5A 1XRPA 4OCZA 2AJ8A 5AIAA 5FUMA 4EBBA 3I2IA 3WK8A 4PQEA 1TCAA 2XUAA 1XQXA 2JGIA 3JWEA 3MGAA 4BP9A 2QXTA 4Z49A 1LPPA 2QJWA 4BVLA 4X7BA 4UHBA 3H2HA 5ALMA 1AZWA 5C8XA 1O6GA 4GLBA 3WLAA 1BCSA 1L7AA 5IH7A 1N1MA 3CCCA 3AFIA 1LLFA 4J0CA 2G5TA 4KAFA 3OURA 4HXGA 3G9TA 4X71A 2QMQA 2VJDA 5AOCA 2PM8A 2GBGA 4H7EA 3BDIA 4GDMA 2OQVA 4OU5A 4A16A 5EGNA 4EUSA 2PVSA 3HI4A 3SC2A 3FYUC 5FPPA 4A5SA 3STXA 2WUDA 1VZ2A 2BJHA 4M0EA 4IH9A 1E8MA 4MWTA 4GBGA 5E4JA 3E0XA 1XQVA 4X97A 5FV4A 2W6CX 7YASA 3WJ2A 3H2GA 1XZEA 4P9NA 4QDUA 2GYUA 2AJLI 3LS2A 5ALEA 5ALZA 4AZ0A 1WB4A 4U2EA 3WA7A 4JUIA 1W75A 1FFAA 5ALVA 3D0KA 1YASA 1AKNA 4RE5A 5ALWA 4C89A 2WFLA 3FSGA 4QDZA 4CI9A 1HPLA 4Q3LA 4QLOA 1EH5A 4G9EA 3DOHA 3C87A 1OXMA 1CUWA 4B83A 2VSQA 1H23A 4L72A 2EDCA 3D4LA 5AKZA 5LZ8A 4J0GA 2XE4A 1XRLA 5CTAA 3AUKA 2QJRA 2VAVA 1M33A 4NVRA 1WHSA 2JGFA 1PV1A 1EI9A 1S8OA 2WFZA 5AI9A 1B41A 3G02A 3PF8A 5CT6A 4OD0A 3WYNA 1UK8A 2WSLA 2HA5A 4X6YA 5ALSA 4PSUA 1XZAA 4ZREA 2OCKA 2V9ZA 2H9YA 4K2AA 2RIPA 3JYHA 4UBNA 2PUHA 4UBJA 4QDTA 3QMWA 1JT2A 1WPRA 3KWFA 4BDSA 1WHTA 3C5WP 4H7IA 4N8SA 1A8UA 2B4KA 1XZCA 3UMJA 1NU6A 5CT9A 2WIFA 1G5FA 4FNGA 3I2FA 3VXKA 3F97A 4KE8A 3FVRA 3T52A 1BRTA 2ROQA 2XI4A 1DX6A 4H0CA 5AIBA 1N8SA 5JAOA 2FJ0A 1PJAA 2XUGA 5AOAA 5JZ9A 2OGTA 3ZWQA 5ALYA 1XRQA 4HRXA 3Q8WA 2PPLA 1SC9A 5E4YA 1AC5A 3WKBA 5AKXA 1SCIA 1ZICA 3OM8A 3EQ9A 2OGSA 2C4HA 3DS8A 5A7GA 2QT9A 1CUIA 2CUTA 2XLBA 4ZRDA 2B20A 1BN7A 1U4NA 4ARAA 1ZD4A 2H7YA 4BAZA 1XLWA 4CG1A 1CFJA 1QZ3A 4MQLA 1CUJA 4KE9A 4QZVA 2WIDA 3G8YA 2HA6A 4X93A 3AZPA 5CURA 3F8SA 3E4DA 1BU8A 4UBMA 3W9UA 5HK9A 2BUBA 1ODSA 1UOPA 2WIJA 3EBLA 5DJ5A 3FAKA 3D2CA 5AI5A 2VAXA 3MUNA 3FBWA 3IUMA 1QIJA 2OQIA 2XMBA 4IQ4A 3STWA 2OXEA 2X8BA 1XZFA 2C7BA 1DQZA 4RGYA 3WWPA 3C8HA 2GYVA 3QPCA 1QIEA 5HKBA 4BVKA 5E2IA 5DTIA 3GUUA 1W6RA 1LPMA 2ACEA 3WMRA 3VJMA 5CT5A 4JNCA 3C70A 4FWBA 4GI1A 3VVMA 3AIOA 1E8NA 4DYHA 5AI4A 2DFPA 4Q82A 4OB8A 1HBJA 5AM1A 3KWJA 2H7XA 3D3NA 4H18A 1CUDA 1CUXA 1QONA 4HRYA 2VF2A 2QUAA 2O2IA 3R3YA 1QIDA 2QTBA 2XUDA 2XMZA 4EY7A 4LIPD 5K3FB 1CUEA 3ANTA 1MX1A 1WB6A 1EB9A 5AI0A 3WZMA 3WWCA 4X6UA 3BXPA 1QO9A 4UHCA 3WK7A 4XVCA 1CPYA 3YASA 6YASA 1LBTA 1LPBB 3V1KA 2R8BA 3F67A 4Y2SA 4BE4A 1JJBA 5IVHA 1VE7A 2VJCA 2JGLA 2DHDA 1ZGCA 1XQYA 5K3DA 4CFSA 3T4UA 1IUPA 4UHFA 4EY4A 2PU7A 5DTJA 1VXOA 4WFKA 4QWWA 2XB6A 5JD5A 2GBCA 5DWDA 4KJXA 3ZI7A 5C8ZA 5LZ5A 5IKXA 1EXWA 1K63A 2O7VA 3SWWA 3M81A 3IUJA 1XROA 3UUFA 3ZLUA 1DT3A
chains in the Genus database with same CATH superfamily
4G8BA 1B8UA 1NWCA 1OLXA 2QVGA 2Y4NA 3OZDA 5AKHA 3PCXA 3H4VA 4RQAA 2PIAA 3O5AA 4F4IA 2PD4A 2TMGA 1HEUA 2QZPA 3T3NA 2YFKA 2FDCA 1QWOA 2BBSA 2OCIA 2R5WA 3HO6A 5ENDA 3AJDA 5HVNA 4TMWA 4BKRA 1V5WA 2G72A 2TYSB 2IH5A 5H8WA 2DPHA 3D9QX 4F0JA 2QX4A 2F4NA 3ZWAA 3H8JA 4E1AA 1KSGA 5J2TB 1FRZA 1U1DA 4GRIA 3S7ZA 3BH0A 4BWGA 5A9SA 1EVKA 1JLKA 2OVFA 3L1IA 4FW8A 4DV2B 1YBFA 1XIVA 5B7QA 1RAHA 1E2IA 1UEIA 2BKUA 3MRXA 4C3ZA 3R5HA 3UV3A 1NBEA 1Z0FA 2DY1A 2O8NA 5BO5A 1RXEA 3SC3A 2DPXA 3OQPA 2FOXA 4PW0A 3RG8A 2X4IA 3M83A 2G07A 3OAAD 4EA6A 4EO4A 3HY4A 1AUOA 4M98A 2WQZA 1JYSA 3RS7A 4AK9A 5CB8A 3IQWA 3TL6A 1UBOS 1L5WA 1XKQA 4W9NA 3A27A 4UAVA 2DFTA 3MJ4A 3CEAA 2A1TS 4CKCA 1U2QA 1R0ZA 3L6UA 1U0FA 3UV7A 1Z18A 3HL0A 4B33A 1GFIA 2GTPA 2JEZA 4GPTA 2I3DA 4ZOBA 2VVTA 4KI0A 4H16A 3WSTA 2P40A 1KJ8A 4DT1B 3RT9A 1V5EA 3RF7A 3B3QA 4L1KA 3GELA 2JGDB 3D7NA 2GEFA 2NMVA 4YDRA 5C1DA 4AJOA 1JYEA 1ZK4A 2H06A 2YYZA 1B6GA 1AKMA 3TIGA 3O2SB 1WVMA 2WWIA 4E5YA 5DNCA 3K0SA 3P2IA 3OJWA 5CX4A 3EGCA 4PYIA 1V8DA 4HB2A 4BO3A 5ECDA 3Q72A 4FLEA 3H5AA 1II8B 1U0JA 3DL7A 4H77A 3V42A 2PUBA 4LF6B 2UUBB 2FU5C 3O4JA 2R5NA 4JI8B 3FCEA 4WL0A 5HW0A 2OD9A 1N0WA 2JHGA 1EVZA 2EQ5A 3PVZA 4H6PA 5JY6A 3KJQA 1EGQA 3O0TA 1D5CA 3COSA 1F2DA 3L6OO 1VLQA 4D79A 1T4DA 2XWSA 2X5XA 4Q3KA 1NXXA 3QWAA 4YCAA 3AP3A 2REOA 5T4BA 1SXJC 1QQAA 3OX3A 4EEXA 1AQIA 1P9RA 1OTYA 3IAFA 1NUQA 2NYVA 2G17A 3DG9A 3K0BA 1AKEA 4OB7A 4UBLA 4MWGA 3PFIA 3UGKA 3OHMA 2WU4A 3AUAA 3UXEA 1KAGA 4HZIA 1CEXA 3V48A 5GJBA 2FVYA 3LCUA 4A23A 2XCTB 4ZK6A 1HT1E 1I0LA 1ODJA 2IUTA 3H04A 3WJ1A 2ZU6A 3KP1A 3HB9A 1T4BA 1CERA 4NATA 1Q7EA 4PQRA 5JU6A 2OXTA 3D31A 2E18A 5LKAA 2O19A 1LLQA 4XIIA 4WFJA 4OM7A 1U2ZA 1ZN8A 1MGPA 2QRHA 3WK6A 3AVUA 1JHVA 1GPMA 1PT6A 1VI2A 2ID8A 3TSWA 1NUTA 1FDVA 4NZ9A 2QTRA 3CLRC 3ENVA 3EXEB 4CKEB 3E1KA 5BURA 4Y1RB 5B58C 1CWUA 2IOFA 3DM9B 3IP8A 3K0CA 1Z4IA 4G5XA 3U80A 1PZEA 1DJPA 1SK8A 4PCAA 2EG5A 3S5JA 4ZGGA 1OZHA 2PNFA 2HA3A 1WSWA 3ZZNA 3AU8A 4KLRA 1RBZA 4BMXA 2PUFA 2XZOA 3PX7A 4LJYA 3ONWA 3EGXB 3P9KA 4QTXA 4AAYA 3QUTA 1UPXA 3D1VA 4KDCA 3WLNA 2B9VA 1JG3A 5F23A 5JNLA 3BYZA 1E32A 2A92A 4PC6A 1TZMA 4Z86A 1EK5A 4B81A 1XCLA 3SD7A 1A82A 4FHEA 3ZGZA 5F98A 4TYMA 4J1QA 1XZBA 1M5UA 5T67A 5LQMA 3VI3B 1Z9BA 2H11A 2ZCVA 4PV7A 3RLFA 4BEBA 3K6JA 4P5EA 2VSOA 2Z8YM 3NCTA 2ACWA 2IS6A 2J9XB 3UAVA 2QLFA 2V7WA 3PKIA 4QNRA 3Q7IA 1ZK1A 3NG1A 4F2HA 1DQYA 2DVMA 2QKYA 3G7NA 1XTRA 4U63A 4M8IA 1IOLA 1ZXLA 2GEJA 4O25A 5JZMA 1IJKA 3NOQA 5EG5A 4RVDA 4F85A 3FHJA 3U26A 1LPSA 3JYQA 3EGXA 3VR4H 3TG2A 1H2WA 2BM8A 2Z2KA 1IHYA 2WILA 4WNAB 5GP1A 4Z4EA 1XV5A 5EJ7A 2BFNA 3UHAA 1OFTA 4FN4A 1R3DA 5JNRA 2AI3A 5AJXA 1VYTA 4MKHA 3LDHA 3LIPA 3L82B 3ORFA 121PA 4DBVO 1GD1O 1A71A 3BB1A 5L9AA 1F7VA 1URPA 4RM2A 3RG2A 1Z0SA 5I9NA 2GO1A 1RWPA 3CY6A 1U5CA 4R1OA 4O2BA 1EUYA 3DOOA 3DBVO 1QGYA 3LX4A 1JEQB 3DWGA 4OQDA 3KVRA 4REQB 3PNVA 1N2HA 4C04A 1I3LA 4FYIA 5H7XA 5DGHA 3KZKA 3NEAA 4UPVA 5E1DA 3K6KA 5BNIA 4JI4B 2EXXA 1F8YA 1D2RA 2WE7A 5LP6F 1CQPA 2BOVA 1FMCA 3DHVA 3ITNA 1CV2A 4S1PA 3FHLA 3WHLA 4ALMA 4CL8A 4URXR 2XRFA 4FBGA 4BMVA 2FPIB 5I4CA 2AFIA 5KYYB 4RANA 1QGED 1QH8A 2ZJZA 3HDGA 5LDDC 3B52X 1APBA 2YWJA 1N5DA 1NSTA 3MTQA 3ODPA 3QWFA 3O1IC 4FDMA 4IJWA 4ARAA 5AW6A 5L7TA 4NAVA 4C4OA 3N6VA 4DLBA 2CB9A 3HS3A 3MD9A 3O7WA 4IVQA 3H2ZA 3KEMA 3L7DA 4CKEA 1VKNA 1UC5B 3TTWA 3B13B 1H6BA 3TLEA 3GMIA 2BI4A 5FWYB 4C07A 8AT1A 1CDOA 2IF0A 5CVUA 1K5GA 4KITB 3CSDA 3SKXA 4F4FA 4DKJA 3DTVB 3ASYA 1GT6A 3G0BA 3QKTA 4FE4A 2AD1A 1RFGE 4WY8A 4D3FA 1YI0A 1L4EA 4G1UC 4O63O 7GPBA 1AT1A 1D2EA 4EATA 1DIOB 3HR4A 1I32A 2HXGA 1E62A 3SBEA 4B71A 2ONKA 1FJHA 4ZJYA 5MFPA 2JJ1A 2RSLA 4QU8A 3V5NA 4MRVA 2PL1A 1SXGA 3DONA 1OIXA 2YICA 4GXNA 3QUQA 2R4UA 5JYCA 4AP9A 2QZJA 4L85A 3IV9A 3KKPA 5CT4A 3SXPA 5CG1A 1KO7A 1I13A 3NHYA 3GCWA 5A9RA 1ULSA 1XFDA 1CZHA 3T1HB 5LUBA 3CUSA 3V46A 1NA5A 2BGMA 2YXPX 3MWFA 4CKCB 3ZE1B 1RYEA 3ZWBA 3B53X 4RA9B 1SCBA 2C0QA 3ZUGA 2HCRA 2JH3A 1LVGA 3TKAA 3AT1A 3WYFA 4A6XA 4BXOA 4MNTA 4DFDA 1EA5A 2V45A 3LPMA 1E69A 3D7RA 2CVOA 1KYIA 4OXKA 2QUIA 4TSKA 1EAYA 1HQCA 1RLIA 4LSMA 1RCFA 4N65A 4YWJA 2PV0A 3EVEA 1QHFA 1T3HA 1B3RA 3HVIA 2OO5C 5CXUA 4BS9A 4XJXA 3PXDA 4YJFB 2BF7A 3FX2A 2C4TA 1QP4A 2WUWE 2Y68A 3I04A 5T8KC 1G19A 1EGAA 1S2OA 1P72A 4G0ZA 4J1SA 3KQNA 4IH4A 1QIFA 5A9SB 4RTRA 3WNZA 1RNLA 2VPYA 2FR8A 3PNBA 1QH0A 5FJJA 2J07A 4UEOA 5J59A 1KVSA 4YDHB 1KRWA 5KDLA 1QQ7A 4DDHA 3QJYA 4UEKA 2NZJA 1CRQA 3DNMA 3I0MA 4P81A 1JFFB 1OBCA 2FTKE 2P4SA 3JU3A 4F7WA 2DLNA 1SULA 5AOBA 1DBRA 1B0PA 1JNXX 3N2IA 4M1EA 3P9NA 3RUDA 4BB6A 3IQHX 1IN4A 1IRIA 2G04A 1DRJA 1VJGA 2I1LA 4S3MA 1Q7TA 1A9TA 3KYCA 5JHGB 3DFZA 1I30A 5ALFA 4X8MA 3VTKA 1M8GA 2Y4OA 3Q15C 1X14A 1C8VB 2PZFA 1KI3A 3HA3A 3OOSA 4TSFA 2H07A 3JALB 1L4BA 1Y6JA 4FIDA 721PA 4XUDA 1XP8A 1B15A 1SU6A 1U8EA 2B37A 4WOBA 1G0OA 4GQBA 4KX3A 3AMVA 1L8QA 3X1WA 4EX6A 1ODIA 1XMOB 4O2AB 3LT1A 3KZ1E 4NHOA 4HBZA 3PUKA 2CBZA 2DBRA 1E77A 1JR2A 4FS8A 1IJEA 3IE2A 4L2IA 2A0XA 1UUFA 4IW3B 1R9NA 4O4HF 4ZOLF 3B9QA 4IM7A 1H65A 4P32A 5T4EA 1P19A 4PX5A 3FTPA 2P5YA 4XKJA 2FX5A 1OLXB 2WYVA 1Z5OA 2AXNA 4JBWA 4IIVA 4BY9E 1G21A 4CIWA 1TUGA 4DV0B 2WFAA 1XKTA 3PFNA 3LTEA 3DPUA 4EY8A 1G2OA 3OOYA 3ON5A 3V8QA 4IUYA 2P7HA 2EIXA 2WJHA 4IICA 4PINA 1O6BA 4E08A 1NPDA 1ESDA 4RBNA 3TGLA 2TMKA 2ERYA 3G68A 3KSMA 1EHYA 1M1UA 2WICA 2Y92A 4KXYA 4NFHA 4R3UC 1VLLA 1NW4A 5FBHA 1S2GA 4RDXA 5JZBA 4F6RA 3LWDA 3PV0A 1T34A 2EQBA 3C8MA 3TZCA 1ZU5A 4ARCA 3IUPA 2FSGA 5TMDA 3DMDA 1R0YA 3WYBA 2ZRJA 1JT9A 2Q07A 1JX6A 1Z75A 4U7DA 1V11A 3OX1A 4FEYA 4TLBA 1MF7A 2WRZA 1FRQA 4OXYA 1NV9A 1I0ZA 3TDMA 1MGOA 5T3UA 3A2MA 5FPYA 2QE6A 4Y6GB 4LQLA 2RHGB 1I9GA 3S99A 3A9RA 5AM2A 2H8GA 2X4LA 2XEXA 5CR9A 4ER3A 4Q9LA 3W34A 1AGYA 3HBNA 2AR0A 5C4MA 1TEXA 1GAWA 1WL8A 1J5XA 1NQWA 4AJHA 5ITWA 4AQDA 3ICEA 2VFAA 1IPEA 3WGNA 3QFCA 4COOA 1NT4A 3EVGA 3LCCA 4S1WA 1DJQA 4X3CA 1N6KA 1VMIA 3X44A 1Z63A 2R8OA 5FA5A 1JU4A 5B3JA 2ZXFA 5LBTA 3FKSA 2H0QA 1DMSA 2WZQA 1IN7A 4P4LA 1TJYA 1NE7A 1QF7A 1MD9A 4XVQA 3E3NA 3KU4A 3DE4X 3ORRA 2PYIA 2WHPA 4MV3A 1PJ2A 1DO8A 2PQ6A 1E3TA 1UANA 1NN3A 3WLEA 4ZI2A 2Q3BA 2V7TA 3GOHA 4MQBA 3ZJVA 4KGVA 4C20A 5JCPA 4LHVA 4LK3A 1L4FA 3BILA 4JYCA 2V8OA 1CY1A 1V0JA 3QOXA 3TLZA 2C57A 2YJ4A 4RTQA 4LY9A 3EZ2A 5HKKD 3L0DA 3E82A 5JQGA 2A4KA 3CLVA 3WQBA 4KNYA 5JH7A 3LKBA 1EWRA 4P3NA 3HG7A 4I1UA 4QREA 3PPYA 1W2HA 1IEXA 1PX0A 2H4YA 3OLCX 2QTGA 4J7XA 4YPVA 1N3IA 5IARA 2ZSDA 2ZPAA 3GFPA 5IAOA 3F71A 2RGCA 2VJBA 3Q2KA 1DZIA 5D01A 3ROGA 1KQOA 1UQUA 1Q77A 1UPUA 4FYMA 2OM6A 5UKDA 4AF7A 4NBSA 2G77B 1F12A 3AOEC 1A9OA 1KQ3A 4IJ5A 2IUSA 3E9EA 2EEZA 3O4HA 4OHRA 4PRYA 3BMCA 5GM1A 4BV9A 2IXFA 5BW4A 3IV6A 1Z3CA 4CKZA 1WB5A 4E46A 1P9NA 2J7PD 2ZRNA 3EPPA 5K3SA 3DC7A 1OX4B 4J43A 3TB4A 2GCPA 5HIKA 4BLSA 1GZ3A 1FXUA 1LSSA 2PZGA 3RUAA 3W0LB 5J9FA 2IVZA 1H4SA 4GG1A 4RJ2A 2BGTA 2Q45A 3GU3A 3RBAA 2ON6A 4WACA 2ZIXA 3THSA 4J4BA 4I7EA 4F1JA 4BLWA 5K99A 4L16A 2HMVA 3NIFB 4DA0A 1BQ4A 3ILSA 4AP5A 1QR2A 4IUCS 4JR0A 1XZLA 4Q4DA 4JIMA 1P7PA 3ACCA 3KLBA 4HDQB 1XWIA 4N3NA 3GLGA 2FLKA 4TVOA 5TQJA 1KH1A 3DFMA 2YWEA 4UU7A 3N2ZB 4XUEA 1XCJA 5IBQA 1M6YA 3RT7A 1D07A 2GLTA 1MB0A 1U0RA 4PZ0A 1ZIPA 2O54A 1MA3A 1T24A 5GZ3A 2HEIA 3OEEA 2XXJA 4RHCA 4JASB 4QICA 5DX0A 4YP9A 3TRIA 3WK4A 2OLKA 2XQKA 1PJZA 3O2JA 4I08A 3NB0A 2UXDB 5L7WA 3MWDB 4HB3A 1XTZA 3MT8A 4OHPA 2H2DA 3HNOA 2P6OA 4ECAA 3MCVA 3RVOA 3AL0C 2BFDA 5L40A 3R4CA 3T5GA 3EDYA 3ZWKA 1SHJA 4LISA 4ZD6A 3SEFA 1NWHA 3B60A 1BGWA 3PENA 2DQKA 4GM1A 4R16A 3PPXA 3F0TA 1Z0ZA 3OOEA 3RFVA 2AK2A 1YQ9A 2V55B 2JAHA 4FR0A 4MKRA 4DDMA 4OP2A 3AIKA 2B5OA 4U9HS 2QD2A 1TEZA 1MR3F 5AQ1A 3DMRA 2QL7A 1TU4A 3CWZA 1SGWA 1KH3A 2BL4A 4HP8A 2ZEJA 5EXDA 3TZHA 1W5FA 1YBVA 3PP8A 1EKXA 2CJYA 3V7FA 1U6KA 1ST3A 1USVA 5DBFA 1X7GA 3KNZA 1EVLA 5D1HA 1Z36A 4B80A 1R9JA 1U1CA 2KS6A 2W5UA 1Z82A 2QRUA 2W22A 1W5TA 3VR4D 2NZWA 1CQWA 3DHEA 1RHJA 1THZA 4NSNA 1IZ8A 1J06A 2FWIA 4HEA1 3P2OA 1KAEA 3U4DA 4W5OA 4FFRA 2QAGA 1BTOA 2RAVA 2V0GA 4HNTA 3F3KA 1SD2A 3HYSA 1X7ZA 2V54A 1MVNA 3M82A 2RARA 3DUWA 3LKZA 1PG0A 2ZB7A 4R98A 2PJRA 2F90A 2ZB3A 3ER8A 3CLHA 4QUEA 2CHVA 5JCJA 4EYGA 3UMMA 1IZ7A 4Z0HO 2Q21A 1GJRA 1WEKA 1C9DB 4R40A 5LKRA 4PNEA 3K0AB 1SG6A 2PH7A 5KX5F 1V1JA 1A8SA 2ZYRA 2AZMA 4FGZA 3PFWO 4H3HB 4OGGA 4XI9A 4GMDA 8GPBA 1YR8A 1A9QA 2UYOA 4TKLA 2OHOA 3LU1A 3SKYA 1WF6A 1SK9A 1KYQA 5GV8A 3SYRA 1NASA 3VDRA 4LA4A 4BNKA 1FDTA 3ZEIA 5I7UA 4LFAB 2IYPA 4IOLA 2OKCA 4L76A 1Q3KA 1GGNA 2NUPA 5HE8A 2NP6A 4LRXA 2UYQA 3ZOKA 4QM7A 2I91A 2AXEA 4PG6A 3SE7A 3GP8A 4BLTA 4DWWA 2FZEA 3BJRA 1VL8A 3BC1A 3IUNA 3V8BA 1PFQA 1ZQ9A 4O59O 2ZJ5A 1GQYA 2XNDD 3OT5A 2YFHA 4NKRA 3AEXA 4B84A 2VYND 4HLUC 4CTOA 3U44A 4C43A 1H42A 3TNDA 5IF9A 5CA0B 1P73A 1NNSA 1PJSA 3B48A 3GAAA 3Q5GA 2X1HA 2XKBA 3CRRA 2V7EA 3DMFA 2OHJA 1DDIA 1TTHA 3COYA 2P27A 2PG3A 1ENOA 1LBIA 4HYYA 3OG9A 1E6LA 4M3NA 4QUGA 4GAEA 3GH3A 3J81A 5IN4A 2RJOA 1L5LA 2F1OA 3LDGA 3GRRA 4B9AA 4YAFA 4Y9RA 1P9LA 1RXSA 5LQRA 2VDWB 5JEDA 1Z5UA 2AVDA 1UJCA 3ITEA 4UE3S 3ZS9A 4BFVA 1ZD5A 3T1QA 3I53A 3CR3C 3FWYA 1FUUA 4KBFA 2R1VB 4ANFA 3ZDDA 1S2NA 3X0DA 1VSQA 2AMYA 2CKMA 5T4FA 3SM3A 5AHXA 4TV8B 4ZYXA 4BFCA 3CNNA 4ISBA 4U6NA 821PA 1KJQA 4AMYA 4FFNA 2I34A 4JUAA 1RLMA 2I2AA 3P1JA 1K0UA 3IV7A 3PGKA 3A14A 1RPTA 1TFRA 3GARA 2AG0A 3VSBA 3O21A 3DXZA 2FDXA 1SZPA 4IWNA 4EI8A 3FJ1A 2J0VA 2NVOA 4QO7A 3SI7A 4RXMA 3UXYA 3I01M 3JQQA 4Q7QA 4K81B 4JLWA 3WHPA 5I5EA 5A0VA 3T9FA 1Q7GA 2KB0A 3C85A 3MLEA 4HS4A 4JOSA 2PWPA 1GTJ1 1T9KA 1Z0UA 3GIDA 1ZYUA 3OM9A 2AMFA 4LDAA 1CB0A 2J41A 3RI3A 4ND1A 4XWWA 3LUPA 2WYUA 1W8IA 1NVXQ 4I99A 2YNMA 4Y7CA 5E0KB 2IEBA 3U7QA 5KWJA 2WB2A 2J3DA 4OLHA 5CVCA 1O94D 1KDYA 3N05A 4IMRA 4YV0A 1J07A 3D6JA 1Q0RA 1F2TB 2B0JA 1QLWA 1QRTA 1XMSA 2IPOA 1FQJA 2D0DA 3DAFA 3ND8A 4W1PA 2AC7A 3W5VA 5A06A 3EUEA 4LWPA 3RUFA 3D1JA 4A8JA 2NQ2C 1FP4B 1WOMA 1GTL1 3BMQA 3VR6A 2VZLA 2XHEA 5L95A 5TEVA 2XB8A 4MW0A 3CBGA 3CNBA 1B2LA 3PQ7A 2DSNA 2JJYA 3ML1A 1XEAA 4FC7A 4P38A 2HU8A 3DAPA 3CF2A 5LA6A 3WZLA 3Q7SA 2MSDB 2O7NA 3RU9A 1QAMA 2B82A 2MTBA 5DLYA 4HVAA 4BV3A 2JJ2A 2V5AA 4CGZA 1W47A 1T9BA 4EECA 1XCBA 2E4VA 2IHBA 1QMGA 3AB7A 3DFKA 3EPHA 5C81A 3R41A 3UG6A 4RC9A 4QHTA 4FX2A 5EUBA 3USES 5IJ0A 1OAKA 4JI1B 5DGDA 2GJ9A 3CVJA 1ZBDA 2IE0A 4KPUA 4RZUA 3OQBA 2Y2VA 2E4UA 4FOPA 4DIFA 4R41A 2BGUA 3CRZA 3KQWA 2HSJA 3Q12A 3UJHA 1IIBA 3ANYB 4O2AF 3SQDA 1U2GC 1YVPA 4IYRA 3SF8A 4IG9A 2IBMA 4P1ZA 4OFBA 2V3WA 4P80A 1P2VA 4A2CA 2FPLA 5CMLA 3A9UA 4C0HA 1P7VA 2HCFA 4M7WA 3DTYA 5J2UA 3TIXB 1FTGA 2C2YA 2PUJA 3EIUA 4Q4JB 4A0RA 3VPCA 5C8DA 1C9KA 1IE3A 1TKAA 1CLEA 5E9QA 1HYGA 1S7CA 3HCRA 5L3QA 2XZTA 4LOKA 2EWWA 1KP2A 1QCCA 4EVRA 4A27A 1YF3A 5IVKA 2JFQA 1RHUA 1OKKA 1G20B 2A9VA 3H75A 3BD9A 2Y6VA 2D2EA 3D8SA 4DF3A 5A2GA 4FQ8A 3UGTA 1IUOA 3E9MA 2GD0A 2GN9A 3AINA 4EG6A 5F7XA 1VCMA 2UUOA 4Y9TA 5AJTA 5K0NA 1E2NA 3F6SA 2ZYAA 5IULC 4O29A 4C2UA 2ERCA 3O6VA 1Q0HA 3HABA 4BZWA 1XU4A 1O08A 5KNDH 1U7XA 1GYQA 4ZN6A 2XWJI 4ZI5A 1SOVA 3JY6A 4HQ0A 2XXBA 2ZOSA 1XPJA 4LY6A 1MPTA 1LDBA 4OQXA 2MMGA 2ZB4A 4BZPA 4O4JB 1CJBA 3S81A 2JCGA 2XRZA 4QBFA 1V8FA 4DB4A 3MB8A 5JHHB 2VJPA 3QLUC 4U6QA 4WLOA 4W9MC 3LBHA 4WV3A 1ZQ1A 3O8CA 1LBEA 2CLHB 2ORIA 3R3XA 3DW3X 2H2HA 4IXTA 4C5AA 3JQ7A 2YOGA 4EJFA 3MRVA 5HX7A 3DO8A 3ICWA 2EHDA 1O57A 2ZRBA 3MCZA 2AUNA 1RKVA 2FWRA 3DE1X 1C4KA 2MYUA 3NWPA 4D4JA 2QR3A 2J3IA 3KUCA 5E6SB 5KJEA 4DMUB 3FIJA 3FR8A 3GFFA 3NFRA 2DETA 4L8WB 2JARA 4EGCB 3VH3A 1ZSYA 4KYVA 1GA4A 4TT3D 3K1YA 4Q34A 4HGQA 3W5IA 2ZR7A 1P33A 4XD7A 2AEJA 5JWRA 2G4VA 2JFZA 3KC2A 4KXXA 1GQSA 3KM0A 4TUYF 3DHYA 5EJIA 3WYCA 1IOVA 1N4AA 1JR6A 2ZRLA 3LVRE 1W59A 1T5OA 2B9EA 3GLHE 3OIVA 1ACMA 2GF9A 3EVAA 4OTZA 1SBNE 1W76A 3V2IA 5BOSB 3I83A 1JIQA 4EYEA 2JRLA 2PT7A 3DDSA 5KAMA 2VF8A 2GO7A 3F49S 4N0DA 1HT2E 2H48A 1I14A 2Y0BA 4FFOA 1Y7HA 3ETGA 4OB6A 4BEJA 5KC8A 1QBGA 1FFXB 4EJSA 3QBEA 2HIGA 4YNBA 3U3XA 1GPKA 1G42A 4MWSA 3THOA 5BN3B 3B12A 3EIEA 3SKVA 1PD0A 4UU8A 5DI3A 1Z2NX 3UKDA 3HJRA 4WINA 5FO1A 3EQ8A 4XCVA 5KCMA 5BQ3A 1VHWA 2VDLB 4AZVA 4DA6A 2RAFA 1E3SA 1QZZA 4LQDA 4C22A 1SZCA 2C1EA 2G06A 1G8JA 1R0XA 2VHYA 3FNIA 1GZ6A 2IYAA 1NP3A 1NXVA 2YY6A 4DJJA 2UAGA 3BBPA 4GECA 4YCCA 3OEYA 4WZAE 5FJIA 1N5JA 2PZAA 5C52B 3JSXA 3ZGNA 2C8VA 2PWAA 2P11A 1UK7A 5EXXA 4M38A 3V9PA 3WLLA 3LBNA 3D5QA 5H4HA 5LD2C 4GRAA 3CFYA 2A9RA 4URHA 1AZLA 3AP1A 5DYNA 1TT5B 1BKDR 1YKFA 2KI5A 1RW4A 2P4HX 3SAJA 4MQFB 3WYGA 2ZBRA 3DM5A 1CUAA 3G0DA 4NCHA 2JD1A 4GOND 4EK9A 3K31A 1QTQA 1I4OA 2I4IA 2GUGA 4NCNA 4UPDA 2HUNA 2HBZA 3FRHA 3OZEA 1G2QA 3QEOA 1BVRA 4ASUA 2J9YB 2DTXA 2G1KA 3BXEA 3IAS6 3NNSA 1D6NA 5HTKA 3ZJ5A 3A26A 1OJLA 2C7PA 4MA0A 4PCUA 2X8AA 3PDWA 4QA9A 2R1UA 3I6ZA 1HL3A 4Q3OA 3HXPA 5JS2A 5IZCA 1W36B 1YGPA 4CDMA 2GX6A 2IYFA 1DEAA 2R8YA 3AHGA 1WXEA 1UJ4A 4LYEA 3UK2A 1RYZA 5LJLA 1L1FA 4AURA 5KYXA 1J4AA 4LUCA 3DKVA 5TX7A 3S2ZA 4DUGA 2BPOA 5LYYA 5LMZA 3RUPA 2XF2A 1KU0A 3A10A 4PHFA 1SCJA 1Y81A 2AHOA 2C77A 4Z0NA 4KR6A 1RBYA 2XOXA 1L4LA 4FGLA 2FSVA 4M8LA 2P2CA 4URZR 2ZTMA 2NPOA 3EIFA 3IKJA 4WOJA 5D5QA 5FXMA 3ZLJA 2WKPA 1XMIA 4BMOB 2VJKA 3EWIA 2P4QA 4FB4A 2O2ZA 5M04A 4P33A 3GNTA 1FQKA 4ZJZA 1W93A 1P4RA 1Y3FE 2FEKA 1UDBA 1NR1A 1WABA 3DNPA 3Q6MA 1YZHA 3RUCA 2HSEA 1OWPA 1V4NA 2JCBA 1CEQA 2JJ8A 2M2IA 2ZJOA 2C83A 5IBRA 3H2SA 1BYIA 3UB2A 3ZBUA 5AJHA 4YR7A 3N7UA 5I45A 3NGMA 4BNMA 1YCHA 5CH5A 5DCUA 3WIUA 5DLEA 3VR3A 5I8PA 5DGTA 2JI6A 2V9CA 4AG6A 1SWVA 3I1IA 3S2IA 4Y0NA 4KACA 1E0AA 2IVFA 2IYRA 1PGQA 3FJYA 2GVNA 2QROA 1U0EA 3A6KA 4H35A 4F3KA 4IRMA 4BNFA 5K4GA 5K9ZA 1Y5MA 2BEKA 2ACKA 1ADJA 2MYNA 3TX6A 5FDFA 2Z5VA 4HNAA 3W8FA 3F98A 4PLHA 4CLRB 3SZRA 3VOTA 4AZTA 3U1TA 1J2EA 4GI5A 3TXXA 1C1XA 1CUUA 4RNCA 3OCCA 1N5MA 2AF3C 1D04A 3JD0A 3OPMA 2EGUA 4Z99A 2R60A 5F2EA 3OBIA 2O8DB 5DM0A 2Z4RA 1KVTA 4EB6A 4DVJA 3ZY3A 2JL1A 3SR4A 4KZKA 5EQFA 4AU1A 5E6RA 3HC7A 3GT0A 4PY2A 3TR0A 3HDYA 1JMYA 5EZ5A 1GADO 3URKA 3TD9A 1J42A 2WWRA 3JWGA 4JCCA 2HN9A 1V7CA 2XWPA 5IM4F 4TS1A 1OSNA 3TINA 3OQIA 5MN6A 2IYZA 3WYAA 4CMKA 2CL7X 2GQ0A 4LAFA 4WLNA 3NTXA 4FN5A 3D5EA 3HB7A 4LZLA 4D6YA 4EARA 5FTLA 2Q4EA 4FZRA 1AB6A 3GK3A 4IJMA 5KNBH 1NNEA 1UMCB 1Z68A 3C3YA 3CXUA 4V24A 5EIHA 1RDFA 3PE6A 1JFVA 2OUKA 3QXHA 1EDBA 1DKNA 1U81A 1U6JA 2FZVA 1XU7A 2GPAA 1GQ2A 1VL1A 1JQ3A 4ND4A 5I9MA 4NP6A 2EW1A 2LW7A 3HCDA 1TD1A 1VB5A 1X38A 3PS9A 2YQ5A 3QPDA 4OHXA 3WYEA 2DUUA 4YALA 2NPIA 3M5DA 5EWMA 3L9XA 1H2YA 4YP5A 2D62A 1C1DA 2W90A 5B57C 3F2VA 3D3WA 2GPJA 4FE7A 3VKUA 2P4UA 4CCAA 2AZXA 3PE4A 5LMUB 1K08A 3UAYA 3KKNA 1N25A 3BRSA 4Z5XA 1E9BA 5JS1A 2HLDA 4Z0TA 5JZOA 3FTCA 3NDJA 1QLJA 1BA3A 2IELA 2Y2UA 2KHZA 4HYTA 4AIRA 3AVYA 1HK7A 3VH2A 2FX2A 4ND6A 1X39A 1E0KA 1NLUA 4MWBA 1ADGA 3VU1A 5KUTA 4C0XA 2QRPA 1QQBA 3OAAA 1FFYA 1ZONA 2FPUA 5KU7A 2VAPA 2PHZA 3JVEA 4M6WA 1QSGA 1XD9A 4KQMA 4UM9D 3RYFA 3S0JA 1D9XA 1RWWA 1Y4AE 3HEBA 5D3MA 1O95A 2XXAB 1QKKA 3MJDA 1RQLA 4G0PA 4B31A 1AXRA 4DGSA 3MLAA 2BKXA 1UBJS 4R5HA 1ZC3A 3LC2O 7MHTA 3I2KA 4KAJA 1MO4A 4OL9A 3TDNA 1XMVA 3WLPA 2E7ZA 1U8ZA 3ILYA 3QUBA 4L95C 4OSPA 1N2SA 1U9ZA 4NBVA 1GXSB 2DPMA 4ZYYA 3I76A 3OUZA 3PZBA 4D9FA 5BYKA 1LPOA 1Y5IA 3QFFA 4NMMA 4AJIA 3BX1A 2DQZA 2P91A 3ZWYA 4NOKA 4GP9A 3I5AA 4CBVA 1PGJA 4RZHA 1OILA 1KR2A 1TOAA 2CSXA 2HXSA 1M1YE 1TVEA 4I4TA 4DXHA 2EIHA 1Y63A 1WLYA 5FOQA 2R48A 1Q16A 2PGJA 4JELA 2WHYA 4JS0A 3RHTA 5CA1B 5KYNA 2V7VA 2H5LA 4KR7A 1QHEA 4ZQEA 4PO1A 3I0NA 1GHTA 4XGQA 3RKSA 3DKIA 4TTSA 4BQPA 1YR3A 3A2NA 2ZDGA 3FPAA 3LY5A 1AK1A 1Z28A 2R6ZA 4JGIA 5FWAA 3UAOA 5KTSA 2OCXA 3LCMA 5T4HA 4TRJA 3OIDA 4Q4JA 4MJXA 1D4ZA 4MYRA 3KZCA 5EC8A 1VRVA 1V1MA 1Z83A 2R66A 4NYMR 4RF3A 5EPUA 3RS2A 1ZS9A 3V1YA 3TW6A 4MRMA 2CDRA 4M89A 2UUPA 3U0VA 3ZE6A 4UUPA 4EMTA 4P31A 1E2DA 5GONB 1Y8CA 2J0EA 4BB9A 3R75A 1PJQA 3FUTA 1HQYE 1ADCA 4R8KA 1QQ5A 4NOMA 3C7TA 4EF6A 4DNFA 4OQPA 3SHQA 5EJ5A 4G01B 4YDSA 3L0PA 1DXHA 3HA2A 3VAZA 3DE3X 5AHRA 3QZUA 4BNNA 2WSSA 1ZA2A 4UMDA 2BLLA 1Z73A 1A4IA 1Z88A 4IGKA 2J59A 2IU4A 4TZTA 1VL6A 1O96B 4U7WA 5BSGA 1DEKA 4FMDB 4M4SA 4K6OA 4MGHA 9LDBA 2ZM5A 3IC5A 2HQSA 2XUHA 2I66A 2W6IA 5LQJA 1VA4A 4XR9A 4LDPA 3RSHA 4KO1S 4MJ7A 3G59A 4GFDA 4GHWA 4KQFA 5CD1A 1CIVA 1W49A 1OIWA 3IP1A 1Z4NA 1NXOA 3HNRA 1ZSNA 3E3LA 3MQ4A 1NXQA 4H1TA 4MSUA 3THRA 3K09C 4CM9A 2QDXA 2YC2C 2BW0A 5EIAA 2V03A 2YW2A 4GXQA 1KEKA 1MABA 4HTAA 4GS5A 2BEJA 4UZFA 3EHDA 5PGMA 2PH5A 3HCAA 1PT5A 2GF0A 5FADA 2FCRA 3QPBA 4IIYA 3MS7A 2GJAA 4W1RA 2P6MA 3JD1A 4JENA 4TT3A 3RARA 3VC2A 4RTPA 1NQUA 5F1YA 3HBMA 4J7CA 4ZRMA 3RVQA 2NOAA 3TO5A 2HRBA 3QA9A 5FLKA 1IK4A 2DU8A 4V0SA 5CK4A 3UJBA 4UASA 4KYUA 4BZQA 4D0GA 6GPBA 2WTNA 4URYR 2JANA 3RUEA 1MU0A 1F0NA 3C6MA 1XWFA 3GEMA 3C98A 1M2FA 1BE6A 1PCXA 4AZWA 2OV3A 2OP0A 1CUCA 3PTZA 4M36A 1EM8A 4K6HA 4MJ3A 1TYCA 1MW9X 3R7NA 1EZ4A 1DX9A 1VJCA 1XPOA 5EYPB 2GK7A 1WNTA 5DW3A 1JV2B 1C1HA 3L6EA 3SJCA 1X7HA 2X9GA 9MHTA 1XJ5A 2ZZNA 2EDAA 1I51A 3ONVA 2CLOB 2J6IA 4X62B 3RSLA 4C4AA 4K9QA 4EEKA 1FFGA 2Q3DA 3IJRA 4PXSA 3QUAA 3GVXA 2QF7A 1SUIA 3QVOA 4TM8A 2XECA 5CAEA 3INGA 2LVBA 2LWIA 1DUIA 1OZ0A 1QFMA 2P6PA 3LUHA 4MGIR 2QOEA 3STHA 4G5FA 4NMHA 1Q7RA 3OCZA 4DR1B 1YL7A 1CQZA 3JZFA 5D2CA 2R6DA 3H83A 4Z7OB 2BGJA 5CUQA 5KEIA 4CQNA 2PV7A 3M34A 3G0CA 1LLDA 2C31A 1YZNA 3LBAA 1E2MA 1A2OA 1ISMA 3PK0A 5IM4A 4IXMA 4KUEA 4WOCA 1DCFA 1U1FA 2HK9A 3B1JA 4M7RA 3ZUPA 3Q3EA 4YRGA 4KWEA 3R4VA 3K9GA 3SPXA 2VOJA 4F60A 4NWIA 2AR9A 5LZ9A 3W5BA 1XDWA 1WDMA 4NCKA 3EGIA 4CMJA 2OQ2A 5BMVA 7ABPA 5DISB 3GFVA 4ZAZA 2OAP1 5M34A 3QOWA 1I1OA 3GNLA 5ANRB 4AXBA 3WG9A 1ZVMA 2I22A 2O1EA 1SKBA 4OXIA 4RGBA 3U4CA 1ZJWA 4J7AA 4KRXA 3GZNA 1DAIA 2Q9UA 4NZPA 4X41A 1VG0B 2A8YA 2O2JA 2YHIB 1UM9B 4IIXA 1X80B 4XYGA 1MB2A 1Q15A 2BM1A 4TGLA 4TXLA 1XZMA 4J0JA 3UAGA 5GINE 2IYWA 2MOKA 3R77A 4MV6A 1KY4A 2Q1XA 1RP1A 2ZYIA 5CG2A 4MYHA 3I8XA 4DUPA 1XNGA 1R88A 2JAXA 2R00C 2NUPB 1NI3A 2VDPB 4JLUA 4P4TA 4Q47A 5IDQA 5FOVA 4ZYTA 1PL6A 1SU7A 1Z16A 1M75A 4C87A 4N41A 1J49A 1H2EA 2A0YA 3G0OA 3K71B 3FMVA 3QVJA 1RWOA 2COUA 1C7EA 3U3MA 4ZA2A 2Z5FA 4DQUA 4LJ9A 1MBZA 1YR1A 2YOHA 5THQA 3E48A 2CMFA 2XF8A 1AKYA 1M6HA 5AVJA 2LV8A 1G8YA 4B0PA 2W93A 4I8DA 5A6SB 3RAGA 2IIVA 2W4IA 1MOPA 4QEKA 4YQFA 2DFKB 4LY0A 1HYEA 2VRCA 5KNCA 4WLEA 4YH1A 1TVKB 1LWOA 1L9KA 2FZKA 4BJHB 3D2BA 2HBQA 5JAIA 3U7FB 1ABBA 2B4RO 2OTCA 5LP6B 1VJ1A 3OP4A 4O8CA 4UOQA 5K0JA 4RJKA 4KXFB 5K0LA 2P30A 4LN1A 5KNDD 2HK8A 2IHUA 4FMCB 4HGNA 4JEMA 4JN6B 4YMWA 4YRJA 3TLBA 3IVMA 1PQYA 4CQMD 4ER5A 4GXTA 3DBHB 3JVUA 1AKTA 3OEHD 5KREA 3EFOB 3DMPA 1EIWA 3GZNB 3CU5A 3F5QA 2ID7A 4U7GA 4GBMA 2QX8A 1MXHA 3WDLA 1YZTA 2GPBA 1TUBB 2ZIZA 4JT9A 4B6PA 1H6DA 4H9GA 4YRDA 2G9ZA 4D81A 2FR0A 1RI1A 2N1BA 3G2PA 2J31A 2V98A 3MUOA 5JSZB 5DHTA 3UGJA 1XAJA 3DEKA 3USCS 1RJ9B 4C0AC 1IULA 1WHTB 3BRWA 5DBOA 3KO8A 3ZV5A 3NTQA 5ICMA 5IASA 4NJEA 4MAAA 1Y5RA 2VSNA 1CBUA 1KOJA 2IGTA 1W0JD 1DOZA 2XR1A 1K89A 3G85A 3QJGA 5CX1A 4L78A 4Y2HA 3ZH9B 2CHFA 3H65A 2J3HA 2ODAA 2DFLA 2GOYA 2JJMA 1KEZA 1T2CA 2PMDA 3ISTA 2QSJA 5GONF 1ZEMA 5K8CA 2X14A 3FBGA 4JHXA 5HEKA 5ESRA 1E2HA 1R2QA 4UBOA 5GY7A 1ZUNB 4Z7JA 4ZRNA 1ZESA 2V3CC 4KUGA 3P19A 1RLUA 1BWQA 1SAYA 1GFWA 2IUYA 3GGOA 1PUXA 2WKSA 4J07A 3T99A 1Y1RA 1ZD2P 1SOUA 4Y0VA 4Z1OA 3CUKA 5KPDA 2W6ID 3OPQA 3RSZA 1OH8A 1NKSA 1F20A 1NIPA 4MVCA 1WVGA 3V4FA 3GDWA 1G2PA 1K7XB 1JQLB 1UBEA 4IF6A 5AMXA 2X58A 5FOXA 1VE5A 4C7VA 1WUHS 4CR6A 3FCOA 3HDJA 2YVQA 3O83A 3LC1O 1FVFA 3LGXA 4B7UA 3COPA 4PAWA 5HE9A 4DCSA 2CLEB 1UJBA 3QMMA 2ORVA 2XB4A 2YKGA 2WJAA 3FYTA 4LHSA 4I5DA 3OTQA 1H66A 3OQJA 3JPYA 4KQWA 1QV6A 2QXUA 2Y9PB 3HU3A 5JI2E 2BLNA 3JARA 4YVFA 3BSWA 4IIBA 4QOEA 1ZCBA 3QU7A 4M88A 4OOEA 1RZRD 3Q7PA 1A3CA 3E9YA 3AY3A 4FEAA 4JCOA 2OPHA 1JG6A 1FK8A 1I9CA 1D5WA 3HUEA 4DJEC 1MABB 4DMRA 5JATA 2Q3FA 4DAOA 2ST1A 1C9NA 1A5BB 1GZHB 1U65A 1YUNA 2LTAA 2WINI 4N9QA 4Q01A 1QGUB 1VPEA 4B6FA 3DF7A 5F3WB 3MINA 5E7JA 1JKIA 3U7JA 4E03A 2BDUA 1XYVA 2PDAA 3PRHA 1WMAA 1L4GA 1J1UA 1T3GA 1MT3A 3DMYA 4MCAA 2WP8J 4PEVA 3ANXA 5K0ZA 2AQKA 3R24A 3RR2A 4ZI7A 3AX6A 2JGRA 5IT5A 3SFVA 1ORRA 3BAZA 4CEJA 3QVGB 3DSRA 5FFMA 2ZYDA 1WMSA 1EVJA 1HE8B 3FRIA 1CR0A 1OUMA 1BEEA 3OOHA 4FFWA 2PMCA 3B1WA 3L8GA 2A14A 1V3UA 2O57A 1ZGJA 3PPIA 3QY0A 4OAOA 3U4GA 3ZZMA 5HJ5A 4GU5A 3A1DA 4R7GA 3WL5A 5F1KA 2YN0A 2Y0CA 5FOWA 2CDCA 8OHMA 1ZI9A 3BGOS 3V2HA 2F55A 4LXXA 4NCJA 2GFHA 1BG6A 3T7IA 1QRUA 3EZNA 3HGQA 3L9WA 1M7BA 4LW8A 1D8TA 1JEOA 2QN9A 4DLZA 1YQDA 3TTVA 3C16C 4M9ZA 1H5NA 3L0ZA 3W05A 1P6QA 2WHPB 3KKMA 1HDIA 2ZUDA 1NQOA 2C5AA 1QGAA 1IY8A 1ZITA 1O5TA 4UBIA 2Z3VA 4IP0A 4OM8A 5CYPA 3VJLA 4TZ0A 3Q9SA 2IYOA 4E11A 3U60B 4YRBA 1G16A 3CVUA 4HLCA 4ALJA 1E3LA 1NMYA 1PK8A 2AOVA 3UMFA 3ZV4A 1YFKA 2OZVA 4RENA 3SSAA 1WKBA 4FBMA 3SYLA 4AIIA 3ZU5A 4LCBA 4OLJA 4FKBA 1W0KD 2VDQB 4BMYA 4RLHA 1G59A 2WZDA 2YWHA 4HATA 4Q9JA 5TB5A 4Q7JB 4Z9AA 1UKYA 1MZVA 2QENA 4DRYA 1T3LA 4XM0A 1Q0LA 2JFGA 4EI2A 2P6RA 1LI4A 4RELA 4AP6A 2DCUA 1E4EA 2B4AA 2GKSA 2Z30A 4QARA 4QDXA 2LGJA 4OQNA 1JEDA 3AL3A 4P83A 1M2NA 5FBRB 5BWOA 1PHPA 1J1ZA 2XQFA 4RACA 5DHRA 3E7PA 2JLXA 4S2EA 3W7VA 1XO1A 3TRJA 1FTWA 5K0BA 4AX8A 4FQ7A 2ZVQX 1PJ4A 3EYAA 3HO8A 4V39A 2O4CA 4RTJA 1H0KA 2AE1A 2QYHA 3DHNA 3JRXA 3WK5A 5AVXA 3O7MA 2CJWB 4IQGA 1TX4B 1C3OB 2C9YA 2QJTA 2VEOA 4YXWA 4E4RA 2XCRB 5HS4A 2OYCA 4N5HX 3TSZA 1T6ZA 4XEUA 5KYWB 2HWKA 1HM5A 3MMXA 3T61A 1NP6A 4P4UA 2CF6A 1BXRB 1MOZA 1JHZA 5CVDA 3Q7QA 4GP6A 2PGIA 4LK2A 4R2WA 1EQAA 5EWMB 4RY2A 2OAEA 2PSFA 4IWYA 4AWXA 4BGDA 2B8TA 4G67A 4XDHA 3WWZA 5CNIA 3VAYA 3RC8A 5ITSA 2BUAA 2F6RA 3L8EA 2YV3A 5DMXA 1FNSA 2J7PA 1EFVA 4HQLA 2C0PA 3KXLA 3C48A 2P69A 1L5QA 2YINC 1YR9A 3A4YA 3EOBI 2HMTA 2F62A 1OA1A 4I50F 2PUGA 5SZKB 5B53A 2JVIA 1AMNA 4OATA 4G8CA 3HWSA 1PK9A 3NXSA 4EGQA 1RRVA 3CUUA 3SIPA 4E15A 2TRSB 1L4NA 4PYQA 3R7AA 3I23A 4A91A 1WQ1R 4EKYA 5MF6A 1TZ2A 3IXQA 3KYCB 3VKHA 3DZBA 5FOTA 3MOSA 5DXAA 1NF9A 2WP0A 3TTUA 1IL0A 1ZG3A 2WLSA 5EJFA 4OHBA 2X7XA 2XA9A 2VNAA 3PR1A 3MPOA 4HPJB 4MIOA 4G6ZA 2KWIA 5AVVA 1VHQA 3TQRA 2VBCA 3L7BA 3BAFA 4WKCA 4QGSA 2G9UA 4MXDA 4R2HA 2X23A 3H42B 4EB6B 1X9IA 2NSJA 3CCBA 1KRHA 4NECA 2ZQ5A 4HDMB 2O3QA 4MVJE 4HV4A 4HDAA 2JK0A 2GS9A 3FDXA 1J56A 5CVTA 3W2FA 4AQ7A 3DWEX 2PMWB 2QSUA 4H2DA 4IS2A 3SM9A 4EG3A 2X4GA 3BTSA 1B1AA 4CNQA 2H7VA 2ZT5A 3HZOA 3OETA 2QG9A 1GGKA 3HYRA 2AOTA 2E49A 4YHHB 2A6PA 3N39C 4F8JA 1E1DA 2YIDA 2FF5A 2E3JA 5DN6A 5B37A 4KQKA 3WJAA 2PFGA 2ZYVX 1VJ5A 1CHNA 2JIZA 1TUIA 2IWHA 1EBFA 4OGKA 4JJ4A 4BNGA 3NQ41 1FFEA 1TC1A 3N3AC 4RX1A 1O58A 1K66A 3LBYA 4ZT4A 3SZOA 1TF5A 3TR5A 4KVZA 4KKVA 3H9GA 4FXOA 1BDJA 4RFLA 4UCFA 3IJPA 1P5HA 3ROEA 2L19A 2D7CA 2X7HA 2GH1A 4N8EA 1YT5A 1H8EA 1NHGA 1IVSA 3ZLTA 3DYIA 4J0IA 2IODA 3ZE2B 5CIYA 5JASA 2JHPA 3B3FA 2W2QA 4LYGA 4Q5IA 5KYYA 1YDHA 3LWNA 2A59A 2XGGA 4YAEA 3ZD7A 2WTAA 4KO2S 4FNOA 3PIRA 5FLXA 2OAGA 3OWOA 4RO0A 4TUYB 4TTJA 4RXTA 3TM4A 4EHAA 5TIIA 3R0JA 1AF7A 4KIGA 2D1SA 1C0KA 2HU5A 1OW3B 3EXHB 3NKFA 3O8DA 2YZ7A 3PHJA 3IUBA 1BHO1 3PL1A 5DT2A 4EL0A 5KNBD 4P58A 2QBYA 4JOCA 1N2EA 3GH1A 4FPXA 1CRPA 4F5WA 2DLCX 3OMXA 3EIQA 3P0RA 4J9VA 3SEQA 1JF8A 5SICE 3KQYA 2R62A 3EMDA 3I4FA 1O0CA 3WK8A 2IS1A 2ZRMA 3KCQA 1VE3A 4GI2A 4EJ2A 3I52A 1Q3TA 2QLLA 3AH8A 5LFAA 3OE1A 4W5RA 3ASVA 4P2BA 3UB4A 2EGHA 1ZHOA 2CVPA 2DFDA 1IATA 2JGIA 4E13A 3JWEA 1PR1A 3DWIA 1SVNA 3R5JA 4ARIA 3CZ4A 4BP9A 4BO7A 2AWOA 5JQWA 1OBOA 2F7SA 2ZZMA 4L5IA 1WCV1 1XQ9A 4BVLA 2PGDA 1H1LB 13PKA 4BFLA 4UHBA 4EELA 2CL0X 5SZIA 1AZWA 3Q98A 5BVGB 3OT1B 2B99A 4HBGA 1PZNA 4LMBA 3PNYA 4I14A 1E5XA 2EZ9A 4X61A 1MLDA 2NTNA 3T9EA 3VOBA 4MQFA 1BSVA 2YQZA 2YX1A 4HDRA 3COZA 4GLBA 4R6XA 5C37A 1SN7A 2E4ZA 4CQLB 4A15A 1JA1A 4K9OA 4XJTA 3WLAA 5G40A 1GAJA 3MIIA 3MJSA 3ONEA 1SCDA 3LQFA 1BXRA 2CNWD 3OZUA 4BQRA 4BUZA 1S02A 1RYNA 1XZNA 2G5TA 3BGDA 3F47A 2H5JA 3IIEA 3Q5EA 4KAFA 4PC7A 4WADA 3RVPA 1IPFA 2RJNA 1N9KA 1D7OA 1WKCA 3B6EA 3C8ZA 4LEIA 3P71T 4OQ4A 2VJMA 3X1MA 4C5BA 1C3OA 4RQBA 5ARBA 2HW8A 1HNXB 3ZZUA 4JLBA 1M0TA 3LFTA 3RROA 3QYAA 1A7JA 3E05A 4MS3A 3MAJA 5GOZA 5BVHB 4NENB 1X94A 1UPTA 3ZIAA 2BD0A 3Q8LA 4ZANA 4H7EA 3BDIA 4GDMA 2DXIA 2VUSA 5A1JA 1OX6A 4FMBB 1HT0A 1VMKA 1OT5A 4OU5A 3RVMA 4WASA 3B6KA 3QXXA 4F4CA 2CUNA 5EZYA 4ODIA 3RYHA 3B8EA 1AUPA 3FWKA 1CQIB 3CA8A 3U7EB 1CHDA 3SS9X 2XKAA 4DWVA 1KRXA 3AF2A 3CMCO 3M9WA 2A4MA 4FK8A 4AM8A 1UPFA 2APJA 3SC2A 3GRKA 5FPPA 3UC5A 2R65A 5CXXA 4BNJA 2RHDA 4XWTA 5DK6A 4K9KA 2JAQA 4UE6A 1KA9H 2H00A 4YP1A 4G4SP 3OJCA 1XG5A 4KYTA 4R6WA 4REOA 1LRKA 4CKWA 1T5LA 4LSWA 4IH9A 3QYPA 4JLKA 4MR9B 2SICE 3NJ4A 4G85A 2M6LA 3I45A 4MWTA 4GBGA 3IVXA 3TMAA 2FY8A 2EU8A 1G20A 1XQVA 1VLZA 2PXAA 2CFOA 3LD9A 1YFJA 3VVBA 1ULUA 1SHZA 5KX5A 3NDBB 2CHQA 4MCJA 2CYBA 1B7GO 4WZAA 5K0GA 4TTPA 1GFZA 4GC9A 1W94A 3LE8A 2QMYA 2ZYGA 4WK2B 5DV9A 5FFFA 5FOUA 3DMHA 2J33A 3HYLA 5T5QA 4RA6A 5JV5A 2P5UA 2Q1TA 3O4FA 3BCRA 4TWBA 4BOYA 3PTLA 1Y3AA 2GYUA 2XNSA 1BDHA 5JC8A 1FLNA 2WWWA 2HSZA 5ALZA 1V45E 4U2EA 3WA7A 3CHYA 2Q0SA 2ZBQA 5ER9A 2VDJA 5TPWB 4F2GA 4C2TA 2GZ3A 1BOFA 1FFAA 1WUTA 3CIFA 4S0ZA 3WB1A 2J08A 4Q39A 3FR7A 3CLUD 3D0KA 5F9HA 1YASA 1TA9A 2OPBA 2WAAA 3ZHOA 2FDRA 5ALWA 1E92A 1FC0A 3F7TA 3N59A 3CM0A 4IKEA 4RE5A 4C89A 4ZCMA 2ZTSA 2YMPA 2E2WA 2ZM6B 4WVFA 1SIBE 2ENWA 3JQ9A 1KZ7B 2CK3A 3PT5A 4D5GA 2HQ1A 3GLTA 4L6CA 5DSXA 2MWMA 2PMFA 4YRQA 5IAEA 4CI9A 4EHFA 3A3PA 1DRWA 2AYYA 1XUOA 1G21E 4LX0A 3I9OA 3DOHA 4IXWA 1QQTA 1UKVY 4LTNA 1I7PA 3KLPX 1CW2B 2BH9A 1OXMA 1CUWA 2GN0A 4JWKA 4HWSA 2G9RA 2BCGY 1NXWA 4WBXC 3WGYA 4E5NA 2YMMA 1QCZA 1NBWB 4M99A 4UM9B 5A5DA 3WLHA 3ZCUA 3DHWC 1H2FA 1RXIA 3NHRA 3WHIA 4DTIA 1M72A 1T3TA 4BBPA 3OFVA 2QTVA 1V9SA 2YIJA 4HC4A 4P34A 4A8JB 5AKZA 2ID9A 3CJQA 2OVBA 5FCDA 1HE4A 3KX2A 5KYTA 4JOBA 4XCXA 3QWIA 4YQYA 1KJ9A 2GFIA 1GGFA 3NALA 5CCEA 5LCXA 2TECE 1BOOA 1FMJA 3AUKA 4KPUB 2QJRA 1AK9A 1GKYA 2VAVA 2R86A 4RIEA 3G2LA 1WJGA 4YAWA 4X64B 3JD4A 5AUOB 1II8A 3SF0A 5DCWA 4UM5A 1BJTA 3BA1A 2D8AA 1LJUA 5EMLA 2FEMA 1L5HA 1T1EA 1UC9A 3AM3A 1HE1C 1L7PA 1YO6A 1CR4A 2E21A 2RI1A 4LNAA 5CT6A 3VC7A 1C7ZA 3PQCA 4B8WA 1LTQA 1P1IA 3V97A 4CE6A 3KWLA 4KQ1A 1WDWB 3KAJA 1YFZA 1IPHA 1T2AA 2NYAA 3DZKA 4PLVA 4V0OA 5G0TA 2WSLA 1I2MA 2NNWB 5LA6B 2HT1A 1IHUA 2FI1A 2HA5A 2JGNA 2PAFA 2PZMA 3OM1A 5U9CA 2Z56A 4PSUA 4FEEA 1RQGA 1A96A 1Z3IX 2V9ZA 3SSNA 3EFHA 2FHSA 3ETNA 4D4LA 4KQCA 4EKNB 4ENUA 4Q4CA 2H9YA 3JCZA 3NWBA 1K3UB 1G98A 2C3MA 2B69A 3DAGA 4K2AA 4V0RA 4M86A 1XXHE 2R8RA 3LLVA 3QELA 2GILA 3UKJA 2Q2QA 5IJ9B 3RS9A 4DJ5X 5FBZA 4I5EA 5CX1B 3HCOA 4BBAA 1CSEE 1QFXA 1CJUC 3OZ7A 2WNHA 2BEWB 3QMWA 3DEJA 1JXAA 2PO7A 1EP9A 2VDWA 3ITKA 1DFHA 3KWFA 4BDSA 1YACA 2C00A 2FKNA 3C5WP 4N8SA 5CLIA 1J7JA 3BWYA 4KWIA 4LC9A 1G9SA 1XZCA 3EDMA 3O8QA 3D8NA 5EESA 4HJRA 1GAEO 4D4HA 3U5ZB 3F6CA 3M6XA 2AKAB 4B3RB 2A9KA 1RAAA 5J2TA 5REQB 4OKSA 1NU6A 4RD4A 2L17A 3FPKA 1UT8A 3BG5A 1S0UA 1ISHA 2EKLA 2RK3A 1G5FA 3LW8A 1NVKA 4IGAA 4WFQA 4XAQA 5L45A 4M0KA 2PFKA 4TTVA 3UQYS 1U3FA 2QW1A 4N49A 5G1OA 2F3QA 1TM5E 1WUYA 1ZC4A 2X1VA 1YKSA 3MCTA 4ZQHA 3UENA 3VNAA 2QX9A 3E5HA 5AIBA 1I2DA 5LP6A 2FJ0A 3IR5A 4RADA 5AXAA 1OYWA 2EX1A 1ECCA 1R4MA 2IHVA 1M8KA 1U9IA 2AJTA 2WD9A 3DEHA 3I72A 3K70C 3FOEC 3U61B 2J8ZA 1EVYA 4M1WA 4XGRA 4ZEXA 5TV2A 2CF5A 3KYIB 1QC5B 4Q9IA 2PBFA 3N58A 4HRVA 3RPEA 3S7TA 4AY5A 4O2BF 4JYBA 3R76A 3ZU4A 1FX0A 5JPCA 3ZWQA 3ZHQA 2GRUA 3V8VA 2GA8A 4B3DA 3UH1A 2O07A 3JYLA 5DWQA 3X43A 4DR5B 1RWXA 2RHRA 3ORHA 4HRXA 1KZ4A 2QRLA 2JLQA 2I55A 4K6MA 5H9WA 2FGKA 1AC5A 4FIZA 3WKBA 5AKXA 3IMEA 3QNUA 3DCYA 4ES6A 1GL3A 1CJVC 1S3IA 1YHNA 3NMUF 1UOEA 2C4HA 2DUWA 2X0IA 4U5XA 1Q95A 2F4VB 1CZLA 3KJXA 3KUXA 2FK8A 1J09A 4NBLA 3K73O 1KF0A 1IHXA 1RC1A 2CUTA 1CUIA 1YJ8A 4GNRA 5A4IS 3JWHA 2XLBA 5HILA 4QVGA 4IDOA 4MTLA 3RASA 4DM3A 4QGHA 2J3MA 4M21A 4RMJA 3OZIA 1YS7A 1G8PA 1SVWA 1JIUA 1U4NA 1AXEA 2GRAA 2H9AA 1N5KA 2UYYA 1NI4A 3AHFA 3CCFA 1FP6A 3GMDA 3PX2A 1ZD4A 5CNMA 2XZLA 1XLWA 3UA3A 2ZBVA 4NR0A 5F2KA 5LBIA 4KVFA 3RWOA 5IDYA 3V8NA 4DV4B 5DP1A 3EODA 2RHOA 5HZKA 4MLZA 2YJZA 5IEJA 5C4IA 1Y1SA 4WJKB 2AR7A 1E0DA 1A97A 5KJ1A 4MQLA 4OREX 2BFWA 4ZQGA 4GOLD 4S1VA 5ICFA 2YIVX 1QYRA 1FXWA 4QXRA 4KE9A 4EKIA 4Q9AA 3L3BA 4L7QA 1HFKA 4Z53A 2FPKA 1KK0A 1FU8A 1VSBA 1SVSA 2IEZA 2BGKA 3AJRA 4D9MA 4DARA 1VJTA 1DXYA 2CNOA 4X93A 4D45A 1N57A 1PTJA 3CEPB 1BU8A 2E5FA 4MX8A 3BD7A 4Q3DA 1QZUA 3I32A 1M73E 1ODSA 4OK3A 1JYFA 4UQOA 4P7JA 1KOLA 3VX4A 3PUYA 5IXJA 4ND8B 2A33A 1VMAA 1SA0B 2MCFA 3HADA 5H3LA 1GKIA 3NH9A 3RV3A 3WE7A 4F8YA 2WYHA 5CPBA 4KN8A 1TYDE 2ZANA 4CJXA 3ZHUA 4F45A 1J7KA 3CSUA 4OIFA 2Q3CA 4CM5A 1LS1A 5FI5A 5ER6A 1U4SA 4ZCIA 4Z3KA 3MUNA 3AUFA 2OT3B 5JXWA 3JWIA 4G37A 1Q74A 1TM4E 4JV5B 3H4MA 4GOOD 4KWHA 1A4XA 1KFKB 2W2OA 2VSFA 5H59A 1M2VA 1FX1A 1XA3A 2OQIA 3ADOA 4PC1A 2WJWA 5HQJA 4G1VA 3TMKA 4OGFA 4JFAA 1M74A 3QNWA 1F60A 1QE5A 4D8UA 3CVXA 1PSZA 2WAMA 3OA2A 1I4EB 1E99A 3IKVA 3PB3A 2FR8C 3CX4A 4MV5A 4TTIA 4I0WB 1SBIA 2OOSA 3EY9A 3FZGA 2FPMA 2XE6A 2WM8A 3OZRA 2X9NA 2R6R1 3FZQA 1JHRA 1HSOA 4MULA 1IM2A 3AWDA 5F77A 3GFSA 4RJLA 3BSYA 4DBLC 1CNEA 3WSVA 5JDIC 3GG9A 5E2IA 3GVHA 1OYOA 3LL4A 2QL9A 2H1RA 4FDVA 4CQJA 1F6BA 1XYYA 3H11A 1W6RA 3ZDBA 1A2QA 1P9OA 1GZVA 1ZM9A 1ML4A 1LPMA 3CZRA 3SR3A 1MQ9A 4DQ0A 1O54A 2YL2A 3TW0A 2E4XA 3EHEA 3DA8A 5BORA 3FOZA 2H3EA 1XN4A 4JNCA 2PXCA 5F52A 4PHCA 3AF0A 3VVMA 4DYHA 5B55A 5ITVA 2XCSB 4ALLA 3H1EA 3PGXA 1OXVA 4XVRA 2Q4RA 5HGJA 3TF5A 2W9XA 3V80A 5A5FA 1M2VB 3E3MA 4OHWA 1NN0A 1M2KA 1V48A 1X1BA 3L7MA 4OXQA 5IMBA 1UAGA 4BO0A 2VBGA 3GAZA 1LNZA 3R9IA 5C9ZA 2O5EA 4JSYA 1UFVA 2A5JA 3CVOA 2JIMA 2FAXA 3TZQA 5AM1A 3KWJA 2D2XA 4H18A 4I5GA 1WD5A 4GI7A 4W5WA 2M6KA 2RH5A 2WA2A 4EW2A 2ZK7A 1JAYA 4K9PA 4ZOQI 1H2RS 2I2DA 2NO1A 3TRFA 5C4GB 4DLXA 5CA1A 1UBLS 4KVAA 5A4KA 2O2IA 5DM70 1LU9A 3LZCA 1JQKA 4RCZA 1AUVA 2OD2A 2JAPA 2XMZA 5AUPB 2I2BA 4ZOAA 1HMYA 4KU4A 1NW6A 3AERA 4JUDX 5K3FB 3RYCA 2IT1A 3GGDA 5CB6A 4QULA 5JQGB 3V4ZA 3ADCA 3KBBA 1C41A 1JLHA 1SH7A 4OGWA 3A7DA 1TW2A 4BVFA 3FPHA 4F5DA 1QK3A 4F91B 2QTTA 3SFZA 4AMUA 2JW5A 2DG2A 2VRBA 3AWIA 4PGMA 3TD2A