1RVDA

H-ras complexed with diaminobenzophenone-beta,gamma-imido-gtp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
160
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN P21/H-RAS-1
publication title Guanosine triphosphatase stimulation of oncogenic Ras mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 57
structure length 160
sequence length 166
ec nomenclature
pdb deposition date 1999-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rvdA00
3BJIC 1E79A 3AUYA 1P9NA 4PC1A 4Q1DA 4Q47A 1FQKA 2O0KA 4S2EA 5L8VA 4S35A 4D82A 3C41J 1R0ZA 3K9HA 5LD2C 3ETLA 4B3CA 2H7VA 1SXJD 1SVLA 2GF0A 5KSZA 5KNDA 1E9AA 2FE4A 4KVGA 2ZYWX 3CWZA 5EE9A 4CEHA 4QL3A 3EG5A 4FMDB 1LW7A 3IIKA 2WIAA 4TLCA 4F92B 2PZEA 2WKPA 1C1YA 4OQXA 2CVFA 5JJLA 1FMJA 1JEDA 4P3YA 5DGXA 2ZI6A 2OCBA 2AXNA 3CNNA 4GOXA 3AVOA 3ZVMA 3F5FA 5P21A 2O8FB 3DKPA 1DE0A 5EE3A 1PUJA 2AXPA 2O52A 1JJ7A 4CDGA 5SZKB 1EESA 2XGJA 5E3HA 5B58C 4PPNA 4AD8A 1YVDA 2VHUA 3SS8A 3I8XA 6Q21A 3TMKA 3PEWA 1DAEA 2JJ2D 1WXQA 2ANCA 3QG1A 4TYNA 4TL6A 4JVLA 1VDZA 4URWR 1NMYA 3LAWA 3B1ZA 3KB2A 1YHNA 2G6BA 1UJ2A 4FIDA 4ASUD 5TDHA 5IF9A 2FMXA 2VSXA 3EW9A 2CCJA 3QE0A 1NL3A 3KJIA 1YZLA 3SJCA 4D0LB 4UNSA 2AFHE 4O0MA 3I4LA 1P72A 1UBGA 1VYUA 3Q8XB 1OB5A 5TMPA 4JVNA 4ESVA 2VSFA 3QKSB 4QG7A 3B9PA 2QSZA 1AM4D 4LI0A 4BLSA 3EA0A 4TQUS 4PC7A 4A0HA 3O8BA 1R2QA 3MSXA 5DI9A 1E3MA 1TPZA 1NRJB 1UBCA 4GZLA 4BLPA 2C96A 1SVMA 3NTUA 4KAXA 3H2YA 2ZANA 3VHLB 4HAXA 4ARZB 4OHVA 4F93B 2QI9C 1IOZA 3QXJA 4HB0A 4B3GA 2BV3A 1EX6A 3QF4B 3TVTA 1IJEA 3CH4B 4BASA 5C2JB 2CJWA 4WBSA 3K0FB 1NBMD 3FKSD 1WF3A 1S8FA 3LO5A 4Q19A 5JWRA 3KQLA 4B73A 3IIMA 3K1JA 3L2OB 2AKAB 5GJWC 4CVNA 3GJ5A 1G6HA 1XJQA 1Z5ZA 4D4JA 1N6OA 3DZDA 5EP4A 3DL0A 4ZIRA 1N6KA 4KV9A 5CM8B 1P61B 2GEUA 3AKDA 3UXMA 2IK8A 1VG8A 4WZAE 3U7HB 1KO1A 4DLZA 1P62B 1NG9A 3O8RA 5CIQA 4Q21A 5CDFA 3I8SA 3TJZA 2IUTA 4LHVA 4E07A 3HYTA 2Q9BA 2W6JA 5JZVA 3BK7A 2QRZA 1J99A 1VIAA 2WVJA 1DEKA 1W49A 3FWYA 5KDOA 3NC0C 4ZDJA 1CJMA 3DOEA 2VSOA 1NVWQ 2F3TA 5FPYA 3R7WB 1G5PA 2ZE7A 1VCOA 3E70C 4JS0A 4LY6A 3OF5A 4R98A 1NN0A 4O25A 3UANA 1P9WA 5CB8A 4QHTA 2WM9B 4MGIR 5AJYA 4CZ2A 3EPKA 121PA 1XPUA 3OZXA 2B7CA 5AJZA 5EE0A 3I72A 2C98A 2G0TA 2DWPA 2VHTA 1G7CA 3ZIAA 1II9A 2MMCA 3WNDA 4JT2A 1VHLA 2V3CC 3UWKA 2J7PA 4FXPA 5D3MB 1VHTA 2J87A 5FPHA 4XJXA 2VA8A 3N2IA 2JLQA 1Z28A 2GZDA 1IHUA 4PPQA 2GWHA 2XXAA 2WSSA 3WP0A 1ONBA 1ZUIA 3U60B 2GVZC 3V4FA 5FI1B 4GSYA 4IXNA 1GAJA 3WXMA 1E2HA 2Q3FA 1XWIA 2ORIA 4XTCS 2PEZA 1HA3A 4LPSA 2IYVA 3CPJB 2VHJA 1J8YF 5IHPA 2VO1A 1NIPA 5FTNA 4R71A 2WIBA 3KJHA 2VHCA 3UWOA 3ZH9B 3GLGB 1BIFA 1LF5A 5FFMA 4URYR 2PT5A 2HCJB 3EIQA 3W90A 2W2TA 3TR5A 2J59A 1RRCA 3BRWD 1W44A 2F1IA 4AYTA 2XEXA 3CF2A 2JLRA 5FR2A 4NU0A 3K9GA 4KFUA 3CZPA 4MYCA 1P6XA 4IOMA 1QRAA 3I3SR 4D4KA 4GI7A 3WP1B 2ERYA 3AV0B 1OV4A 1XU4A 2BJWA 1G5RA 3C15C 3SJBA 3RRMA 3UG6A 3KXIA 2ZJ2A 3LXXA 2H92A 3AGPA 4EAQA 5B64A 2QORA 5DO9A 1W46A 4OQLA 3RLFA 4OI4A 4DSTA 1T9HA 1LS1A 2YC4C 3WMGA 1WB9A 3L0PA 2W2XA 4U00A 3DMNA 3K0EA 4M22A 1C4OA 2FZLA 3VMFA 3GLIB 1VCMA 3REGA 3D31A 4Q7JB 3T61A 3LBNA 2XSZA 1ZVQA 2PMKA 1E9RA 2WWIA 1F2UB 1A4RA 1Y3AA 4NP6A 2OSBA 4HLUA 4RY2A 4Z1MD 2F7SA 4BEJA 5F3WB 1ESMA 2FSGA 2VQSA 2F6RA 1XF9A 5C46F 1JEEA 1IY2A 4MGYR 4M1YA 4GP6A 2R9VA 4RD4A 1XPRA 2FFBA 4JSTA 3SN6A 2P6RA 2R44A 3P27A 2O8EB 3AH8A 2GCNA 1XD8A 3TNFA 3Q72A 2EFGA 2ECKA 3BH7A 2ZI3A 1NMZA 3VKWA 4RJLA 3RRYA 2FPKA 4YXWA 2P5SA 2FGKA 4OQFA 1JR3E 2D06A 2NGRA 4MA4A 1IXRC 1QG2A 4A0FA 5KNCA 1FW6A 3EAQA 3KDSE 1N6LA 3OEHD 3CF6R 4OI0A 5FOUA 2X19A 5KO2A 1NI3A 2XJ9A 4CEJB 1OLOA 3BB3A 2VP6A 3CNOA 4JIMA 5E4FA 1IAQA 1PLJA 2AL7A 4YDHB 5HE8A 3X1ZA 5M04A 1KMHB 3NBYC 3VKGA 2NO1A 4Q02A 3T1OA 1F5NA 1RJ9A 1M74A 2BCJQ 2JDID 4AY2A 2JLVA 5KSPA 4L9SA 1XMSA 1ZRHA 1JB1A 2G77B 5TARA 1U8YA 2XNDA 1HE1C 1GIAA 3DKVA 1FQJA 4KCGA 5F2EA 3T06B 1NG1A 4CIDA 1U98A 1E2QA 1HT2E 1XXHB 2BEKA 3GLHB 1YJ5A 2IYYA 4M8NE 5DH9A 2XOKD 1IY0A 2DR3A 2YWHA 5KDDA 1GOTA 2KB0A 1OYWA 4A6XA 2CK3D 2GXSA 4DUGA 1GDDA 4F7WA 4RZ2A 5BYKA 3KTAA 4X8HA 4WIAA 4HLUC 1W47A 2ZRNA 4P0TA 3K0AB 1X8LA 1G3MA 1Q22A 3CX6A 2QAGB 3U7EB 3I61A 5AWFC 1Q3HA 1W36C 3DZ8A 5AUQA 4MGZR 3KQUA 1RPZA 1UEIA 4US2R 1VTKA 2ZE6A 3ZQ6A 1GILA 2YOFA 2D7CA 5DN6A 3KJGA 4GZMA 4LOAA 3TK1A 5FOXA 1SKYE 1XTIA 1E2KA 2ZEJA 3TSWA 2EU8A 1UKYA 1YRAA 2UZIR 3LH5A 4R7ZA 4GBMA 4UNPA 1G8PA 2IYWA 3QXSA 1YQTA 2V7QD 4G1UC 2W83A 5DI3B 1M8PA 2ONKA 4LBZA 3RRNA 4H1UA 3KQKA 2XB4A 4DSNA 1YE8A 4NCNA 4Z54A 1GKIA 3GJ4A 2QENA 4GOJA 3U3JA 1NNEA 3VTKA 5HTKA 4E09A 1W0KD 1NJFA 3ZS9A 3DMDA 4M0LA 5ELXA 1J90A 1TNDA 2VP4A 5TY0A 4B3FX 2GAAA 2IL1A 3B1YA 4Q9HA 1OH6A 1G4UR 3KFXA 1X8JA 2OV2A 2QU8A 4D80A 2GJSA 1LF0A 1GRNA 5FOSA 1Z6XA 3U44B 2ZI4A 2OHFA 3A1UA 3EZ2A 2F3RA 2W6IA 4EJSB 3RSOA 1G21E 4DCUA 2PZGA 5TXGA 1R7RA 4OHWA 2NO0A 1PZNA 3IQXA 4ZPXA 4ZCMA 2BMEA 5K8UA 2JIZD 5FL3A 2XAUA 1E2NA 3BS4A 4PXAA 2ZITA 3DDCA 3X1DA 4HUQA 4BFUA 2IYXA 4L16A 1NMXA 3ZDQA 1SGWA 3NWJA 4TL9A 5JECA 2CLCX 1SVWA 3EIEA 1V43A 3SFVA 1CRQA 4KLNA 1N6IA 1MOZA 1IN8A 1VG9B 2ZRBA 3SNHA 1QHGA 2WTUA 2NO6A 3EC1A 4UXIA 4KO8A 2C77A 1E1RA 1MO5A 1SVOA 3P1JA 1W0JA 2EYUA 2FA9A 1CJKC 2ZU6A 3PR1A 4IVPA 4Q4JB 4CEIB 3MWLA 4MITA 4EIWA 2EVWX 1M1YE 2BC9A 3IGFA 1VYVA 1D8TA 3TGPA 2GXAA 3C5CA 3UPUA 3SQWA 3ZJYA 4GMXA 4Q9IA 1LY1A 5EZ5A 1RE0A 2YKGA 3ZZ0A 1SHZA 1X6VA 4NCJA 3CRMA 3FKQA 2ZYVX 4GP7A 1S0UA 2RGCA 4AYXA 2XTNA 1TADA 3A8TA 3LLUA 1M6NA 2OLJA 1COWD 3AVQA 3IBGA 3MLEA 4UKDA 1VECA 2R65A 1Z3IX 4I4LA 2QMEA 1N2CE 4B34A 2V6JA 4AIIA 2NO9A 3ZZUA 1I2DA 2P67A 1XBTA 2Z4RA 4P32A 1N5IA 1TL7C 1G1MA 3KKQA 2FU5C 1U0HC 4TTQA 4AG5A 2ZM5A 3T1QA 4C9BA 2N1BA 2LKDA 3W3AA 1G20E 5F9HA 2WJHA 3BOSA 2WWGA 3TSOA 4LJYA 1QZXA 1JALA 3L8YA 2O8CB 1N5JA 4M1OA 5KNBA 1GG2A 1OE0A 3H86A 4EQ6B 2VRWA 1RFLA 1Z6YA 4NZYA 2WJYA 4Q5IA 1BH2A 2F1HA 3GEEA 1DTSA 3AGQA 3B1XA 3KFVA 2ZJ5A 4PQFA 3W5JA 3MWKA 2FFQA 1G7RA 3ADBA 1US8B 3CRW1 4E03A 3AKCA 2RAPA 4L8GA 3SI7A 2RGDA 2WWFA 5JRZA 1S4QA 2BJVA 2YJTD 4LUCA 2F1JA 4YMTA 3RRZA 4BLQA 3O8DA 2ZSDA 4FCWA 2VH5R 2CL0X 1ZM9A 2O0HA 2R6GA 4W7SA 3PENA 3KB1A 4M1SA 4RD3A 5GADl 1G16A 3LW7A 3KL4A 5GJCA 4TSFD 1G9XA 3DM5A 1E4VA 3K70D 1YR6A 1HT1E 3MAAC 4NONA 3QXCA 2FSFA 3KKPA 4MUAA 1XTQA 4PSAA 2XITA 3THWB 1OXXK 1HURA 1E2IA 3QPVA 3U4QB 3OE7D 4LBWA 4BRUA 2D2FA 4A8JB 1TQ2A 1FNMA 4YQFA 2REOA 2Q3MA 1P2TA 1OH5A 3ZZTA 5BN5A 1II8A 1F6BA 1LS6A 1IONA 1HV8A 2RGGA 1P5ZB 3THYA 1ZNZA 1XEXA 3IUYA 3THXA 2GXQA 2IXGA 5L3QB 5EQTA 1QHIA 2WPDD 4DLVA 2QGZA 3TQCA 3Q7QA 4B35A 2IEYA 4OK3A 3AVUA 4OHZA 3U44A 1W5TA 4BQSA 3FE2A 1GVNB 3QNUA 2O8DB 4B3BA 2G83A 1KDOA 2W0SA 3QKTA 1KHTA 1Z0FA 1XMVA 2FFAA 4LJ8A 2KSQA 4JLNA 4L5BA 2VF8A 1QBKC 2ZSFA 2HXSA 3KZ1E 3PXGA 3ADCA 2J45A 2ZRAA 5CB6A 2NIPA 2ZJYA 1R0XA 2ATXA 1ZAKA 4FWTA 2ZJ8A 2CL6X 1N3BA 2J9RA 2A2ZA 5HZHA 1WRBA 4OBEA 4IHQA 4C7OB 5DHAA 4PZYA 2F9LA 4LJ7A 1U90A 4ZCIA 4XH9B 2FWRA 2IT1A 2IEZA 2OBNA 1M7HA 2OCPA 5IK2D 1ELOA 2CDNA 1R0YA 1Z6GA 2GAOA 1E1QA 2ZTSA 4NHOA 1W2HA 3GLFE 2E1RA 3K0CA 1M7GA 3D8BA 1AS3A 1KZGB 1KIMA 3THOA 3QF7A 4WXRA 8OHMA 3B78A 4MQBA 4OQMA 3A4LA 3CNLA 4TMTA 1N0VC 4PO9A 4CT4B 5LBIA 1GL6A 2O5VA 1A1VA 2C8VA 5AUOB 1TAGA 4IDPA 3LVQE 2A5YB 2AWOA 3QPUA 3V00A 4F4JA 1XB2A 2EFDB 1ZC4A 3C14C 5A5GA 4JLMA 1Z6TA 2C78A 2WJIA 3A1VA 2V4ZA 1QHNA 1IXSB 2C03A 2OEPA 2ZI5A 3WRYC 1OKKA 2R62A 1KO4A 3C7KA 4ILEA 2IXFA 3A37A 2GZHA 1FL9A 2Q6TA 3NBFA 2BMFA 2GNOA 5FOVA 1Z83A 3U5ZB 2IA5A 4IXMA 4OQNA 3A4MA 5EZ6B 2YWGA 4D4LA 3QKRB 1VMAA 1SULA 1IQPA 3LX8A 2QZ4A 3RS4A 3MD0A 1FTSA 2QPAA 4Q4HA 4WZBE 1P2VA 3GFTA 3HR7A 2H1LA 1LNZA 4A6PA 4DIDA 4URZR 4B75A 5JBQA 4MRPA 4D81A 4QOSA 1OIWA 4NKRA 4KVAA 2G0NA 3K0CC 3BWDD 1OB2A 1TUEA 1LVGA 2J3EA 4PPGA 1NN3A 1E94E 4DBLC 3BD9A 1F2TB 4M1WA 1G7SA 2ZAOA 4R9UC 1MABA 5JLJA 2FEOA 1H8HD 2GEVA 3NIBA 3AVTA 2Q0HA 2QTFA 3AUXA 3V9PA 1U8AA 2HLDA 3BGWA 2GK7A 4LHYA 1E96A 2LCFA 4BRWA 1TU3A 2E9SA 1Z22A 3BORA 4RZUA 1MKYA 4HZUA 4TL7A 4XD7D 3T5DA 1SXJB 2C95A 3ECCA 4PQRA 1JR3D 5L3SB 2G1JA 5J47A 1Q1BA 2RKOA 4CGZA 3CBQA 4HDQB 2JJ1D 2WWYA 3P20A 3THWA 3JVUA 2QT0A 4NBSA 5FPSA 2C9CA 1OT3A 4FD2A 4A8JA 1XX6A 5AUPB 1E4YA 1X86B 1WQ1R 5C18A 1K6MA 1L4UA 1FX0B 2W00A 4LJ6A 2J0UA 1UKVY 1TTTA 2KI5A 4DLWA 2VHQA 3C16C 1NP6A 4BFZA 3MWJA 1JI0A 3AVPA 3ADKA 3F0TA 3B2EA 3HYRA 3EZ7A 2NTYC 1JXOA 4G01B 3H4MA 1SKYB 4NH0A 4PSKA 1G4AE 3U2QA 2GKSA 4ACBA 4HI0E 4AKEA 1AGPA 1TQ4A 4TYPA 4URXR 4C4PA 3CM0A 4YMWA 5FUWA 4QNRA 3GFPA 1AN0A 2JLUA 2VP9A 1DS6A 2ZUDA 2RHMA 4I1SA 4Q7MB 2QMOA 1Q3TA 1P3JA 1RIFA 5G40A 2ZXUA 2CNWD 1DG1G 4V0ME 5B57C 2WSMA 4QGFA 1Z8FA 5CJ2A 4C0KA 3WRXC 3FMPB 4C7OA 4AKHA 1F3OA 4NYJQ 3MJHA 1E2JA 5GVSA 2VBCA 4NTZA 5JS7A 4IDQA 3QEOA 3TR0A 1XMJA 4WA7A 5IRCD 2YINC 1S9HA 2EWWA 1SHKA 2WZQA 4NYIR 1Z2AA 5KOYA 3Q85A 1WBBA 3IHLA 4DDWA 5L3VA 4V03A 2DPXA 3W8RA 3WY9A 2J7PD 5ANRB 1XTRA 3QJYA 3QQ5A 2B7BA 4DCTA 1KI6A 3RS5A 3UIEA 4A8JC 5C1BA 5JSZB 5GVRA 3A1SA 3GJ7A 3UATA 3I5YA 1CXZA 1XPOA 2NZJA 4KHZA 1LTQA 2AWNA 1XCMA 2NQ2C 2WAYA 4GOKA 1NLFA 4DCNA 2CE7A 3PEYA 4TTRA 4BFYA 3UMFA 2PLRA 5CIWA 1NN1A 421PA 1K8RA 3EA5A 4F4IA 4BZXA 3FMIA 4DWJA 5J40A 2O8BB 3KXLA 3C4JA 3W6PA 5JI3E 5BWMA 1FZQA 1XRJA 5KSYA 3FDIA 2J0QA 1BYUA 1ZCBA 1ZW6A 1ZM3A 4B47A 2PX0A 1GKYA 3PCRB 3MWYW 1KSGA 1ZM2A 3RANA 1XD9A 2J41A 1Q1QA 3CZQA 3NH9A 1KK0A 1EFRA 2X2FA 4Q7KA 2HF8A 2RCNA 4A0GA 3CO5A 4OHYA 1RRFA 4YC7A 5SZIA 3KUDA 2V9PA 4Q1AA 1WBDA 3DVLA 2QM8A 3BFXA 5JMTA 3ZVRA 3NDBB 1MRSA 3HP1A 1TQDA 1XTJA 3NEYA 4UNQA 2JLYA 1BO6A 1MV5A 3TE6A 2DFKB 1B0UA 1T5LA 3QG5A 3UK6A 1DAMA 2IUUA 2AN9A 2WJJA 1GL9B 3TAUA 2EFCB 4XIGS 4TLDA 1YU9A 2XSZD 1P7CA 1XD2B 2F43B 4G5OA 3P32A 4JLPA 2ZJAA 1Q21A 1QHHB 4V0OA 1PVOA 2CL7X 4UQOA 3M1IA 2OXCA 1S1CA 1J70A 1R6BX 1SXJA 4I1UA 4YMUA 1OHHA 4UNRA 4A2QA 3D7MA 1G41A 1G3IA 5JJKA 2NG1A 1UADA 3MGCA 2AD5A 1PV4A 4RZ3A 5AR1A 4Q4AA 4X8LA 1P9RA 3P4YA 3QSYA 1I4TD 2BCGY 4I81A 4LRWA 1NN5A 2C2HA 2FNAA 3FHCB 3EZ6A 4RD2A 5CK5A 4TYQA 3RWOA 3AKEA 3LX5A 3TIFA 4BLRA 2YOGA 4JVMA 1TEVA 1AZSC 2HUPA 1Q1EA 1RZ3A 1CEEA 3N5CA 1PJRA 4QFMA 1J2JA 4LBYA 1CF4A 2H57A 2P6NA 3L8ZA 1NSTA 3DHWC 4OI1A 1I2MA 4XWOA 1JR6A 2BBSA 2IYZA 4ASUA 3HU1A 3FPAA 4JLAA 2ZRPA 3BH0A 5FR1A 4GPTA 1R8SA 4M1MA 4TMWA 4KFRA 2ZIAA 1VKJA 2ZRIA 1M34E 2BMJA 3E5HA 5FUXA 2OO7A 2O8FA 1B23P 5HPYB 4DEXA 2CHQA 4B2LA 5HKKD 2J5XA 5JEEA 2DWQA 2GILA 3K9LA 2FV8A 2ZS9A 3IPXA 5BXQC 1E2FA 1JPJA 1CR1A 1DAIA 3IO3A 5IDVA 1SXJC 4BWYA 5AJVB 1KI2A 4G5SA 2DY1A 1RRPA 2VLIA 3WYAA 3B82A 4DLTA 4GDFA 4A92A 1CS4C 3LDAA 3ND9A 4URUR 2IS1A 2IYUA 2OUKA 4RCZA 4DC9A 5FBVB 3B85A 3MFYA 4GRAA 4UJ3A 5C4MA 3QVUA 3QKSA 2QRNA 4BFXA 1BMFA 3B1WA 1NBMA 4QBHA 1P2SA 2OCYC 3FKSA 3LFUA 4UJ5A 2BHRA 3GMTA 4CF7A 2R6FA 2QSYA 5EP3A 2X1VA 5L3RA 4F91B 1DAFA 1ZYUA 4J0QA 2YZ2A 4U02A 4LV5B 4M2LA 4D2IA 1GITA 2HXYA 3WMEA 3R20A 3EWSA 1R5BA 3OAAD 2D2EA 1GRRA 4JLDA 1CR0A 1N6RA 4MKIA 4I1OA 4ARZA 1W7AA 3QXHA 4DB2A 4LK2A 4KFSA 1DELA 5GJBA 2AK2A 2O8BA 5H70A 4M1TA 3SDZA 3CONA 3GLFB 1EGAA 2ODNA 3QF4A 4LYHA 3R8CA 3FOZA 1TQ6A 2VP0A 2QUZA 1V5WA 2MSCB 4QXAA 3S1AB 4ERNA 3K0FA 4US1R 3TH5A 4FMCF 2W6ID 4Q9LA 2D4HA 4YMSA 1YZNA 4PO1A 4KU4A 2BOVA 3F8TA 2YHSA 3R9XA 4W5HA 3RS3A 1K5GA 2GCOB 3OIWA 1AQYA 4LJ9A 4DJTA 4FN5A 2AR7A 5CJPA 4KXFB 4IFEA 1FFHA 4Z8XA 1XMIA 3K8YA 4IEEA 3X1YA 4BFSA 2FDCA 4RFSB 3AF2A 2HEIA 1CKEA 3OFNA 4JBWA 1KYIA 2GVDC 3GJ3A 1OXTA 4QKQA 1KMQA 2NOAA 2REBA 1E98A 2XNSA 1E1RD 5UKDA 5CDFE 4K81B 1P60A 2V6IA 1QHHA 1A2BA 4HDCA 5K8LA 1OF1A 3R7WA 1P73A 1RVDA 1E9CA 3W34A 3TUZC 4IVRA 2PCLA 3SYKA 1YZGA 3FGNA 3BB4A 3KQHA 3VNUA 2V8OA 2IXEA 3NEJA 4LC1A 1KI1A 2TMKA 4Y0VA 2ZVPX 4P33A 3FVQA 4KFTA 5FTKA 2PT7A 4BEBA 4DSUA 2B92A 3CPEA 3W3ZB 1P4SA 4XTRA 5SZJA 5KDLA 5D3MA 3JVVA 3EZ9A 4KJZA 3IHWA 2D3WA 2CHVA 2H8KA 4DZZA 3GEHA 3CW2A 3ICQB 1RYHA 4C0JA 5IT5A 2IUSA 1NLZA 2F1RA 1QG4A 3KKMA 3GJ8A 2I4IA 4LPKA 1KI9A 5G3ZA 1CP2A 3SFZA 4TWZA 2GHIA 4RKFA 2AHOA 4PHFA 1HQYE 3L0SA 1GKUB 2OE2A 4ESHA 1N0WA 1KAOA 3CRQA 2JA1A 1T4GA 2ZU0C 3IEVA 5FTJA 3TAHA 4IOKA 3GLGA 1NJGA 1NVVQ 1D6JA 1R4AA 3CH5A 2PL3A 3W9YA 4D0GA 1A2KC 1YR9A 4QGAA 2ZRCA 3IDQA 4ZO4A 3EARA 4IDNA 1NY6A 1HEIA 3FFAA 2OFXA 4AG6A 4QM6A 2QAJA 1ZNXA 1T3LA 2ONJA 4BE7B 3R9WA 4B3DA 5H8WA 2GZAA 1E0SA 1DADA 4Z1MA 1T8UA 2FGJA 4Q00A 2V54A 2J0SA 3NG1A 1E9EA 2FOLA 3LXRA 2GJ9A 2CLSA 4OK6A 2BM0A 1CBUA 4LBVA 1T6NA 1JJVA 3HDTA 1JQJC 2IWRA 1AS2A 1X1SA 1NVUQ 4L4UA 2GA8A 1CRPA 2JAQA 5BYJA 4KITB 1Z63A 4M21A 3GLIA 2PBRA 1DO2A 4Q66C 3RNLA 4NYMQ 3NDPA 2BMDA 1D2EA 3TW8B 1YKSA 3ASYA 3OEHA 3PEUA 1F2UA 5FBRB 2HYIC 2FZ4A 5EJEA 4RKEA 4X8OA 4Y0AA 4I99A 3T35A 5AUNB 1H8ED 3IEUA 1WA5A 4TQAA 3A1WA 2IW3A 3ZYCA 2WICA 3OEED 4TMZA 4JLOA 3RYTC 4KODA 3E1SA 1UEJA 4PR0A 3AQ4A 1N6HA 4V0NA 3BH6A 2RGEA 1EFHA 3LLMA 3LVRE 4R2IA 2FPLA 3A36A 3VHXA 2O8EA 2QE7D 5E7JA 1AKYA 1JAIA 3GFOA 2DB3A 1KI8A 1TMKA 2AKYA 3D3QA 2XZPA 3VNVA 1NY5A 2QPTA 2HJVA 2ERXA 4H1VA 2CK3A 4B71A 5GJVC 2GJKA 3LQQA 4CEJA 4ZV4A 3AM1A 1Z08A 1W48A 4QBIA 1FP7A 3EASA 4II7A 2G9NA 2KWIA 1KMHA 4KBFA 4RD0A 2KBFA 5BN3A 3F3YA 1AKEA 3PJRA 5DLQC 4A36A 3HU2A 4JYCA 4B33A 3EC2A 5KU1A 3IPYA 5FUVA 3GEIA 1NF3A 2JLXA 4DT1B 2WMNB 2R6CA 3BAFA 2GRJA 2W0MA 2JLZA 1W4BA 1KNXA 2GK6A 1XXHA 3GLHA 4B2PA 2OLKA 2Z4SA 1E1QD 2JASA 1CIPA 2ZYUX 2CMKA 4ZI2A 1ZCAA 2V7QA 1DAHA 4D26A 4N0EA 1EX7A 4AWXA 1W2GA 2ZJOA 4OJQA 4JLVA 3IIJA 3LY5A 5JHGB 4LC0A 3B5JA 4KSCA 3K0AA 4JJZA 4RVCA 3K70B 2QAGA 1MO6A 1IXZA 2CVHA 5FI0B 1Z07A 2H17A 3BXZA 2H16A 2ZRMA 4DIEA 1W0KA 4MRNA 1GM5A 3FHOA 3CRRA 4B6EA 1GL7A 5LD2B 3ICEA 5H1YA 3EPHA 3CR7A 4P31A 1D2NA 1W1WA 2HT6A 2N42A 3UMSA 2OZEA 4A2PA 2QBYB 3CIOA 1U9IA 4HB2A 2A5FA 2PCJA 1E9BA 2NO7A 5DI3A 1IM2A 2X77A 3LW8A 5HCNA 3IKJA 4TT3D 3WBKA 1Z0IA 2WJGA 4EFLA 2ZS7A 4TYWA 3X1WA 1C9KA 1FNNA 2VEDA 1GSIA 2JIZA 2ZROA 1RKBA 3CX7A 1GNQA 1HTWA 3BFKA 3U3OA 4UNNA 5B30A 1SZPA 5SZHB 2GF9A 5FPTA 3H1TA 2PH1A 1UF9A 1XFAA 3SJAA 4TYYA 2IF0A 3ZD6A 1PLLA 4Z51A 4MKFA 3FFBA 3OIVA 4K46A 2NPIA 2VIIA 2A5JA 2B21A 1YR7A 1CU1A 5CYOA 4JMPA 2PJZA 2BBOA 3M6AA 3WBJA 4AKGA 3TSZA 5TV2A 4P4UA 1KO7A 3NHBA 4X8MA 4EJSA 5HR5A 1TF7A 2QA5A 2QT1A 3KKOA 4DDTA 1XEFA 1CLUA 2G3YA 3CR8A 1R0WA 1KKLA 4JKYA 3QKUA 4DEYA 4QBGB 1UDXA 2FEMA 2QAGC 4FI3C 1WMSA 3UG7A 4BFTA 2XZOA 1U99A 3AVYA 5G3YA 2HLDD 3RVBA 1OFTA 4PAOA 1Z06A 2HJGA 4LX0A 1N6NA 4MDEA 821PA 1SVKA 4Q1BA 5LB4A 5JCZA 1U9IC 4CEHB 3AVWA 4JL5A 4KYUA 3B8HA 1IN6A 1E2DA 5DSZA 1DBSA 1L4YA 1EFTA 5FL7D 4RZXA 1GNPA 1G17A 3JZMA 1COWA 621PA 221PA 3ZVNA 4G0NA 3KXKA 4LWZA 4Q4JA 4CEIA 1D5CA 1E32A 1E0AA 3VR4A 2WKQA 1E79D 2V1XA 3CB4A 1EXMA 4Q1CA 3GJ0A 1UAAA 2ORWA 4Q01A 1KI3A 1Q1ZA 2UVQA 2QQEA 1XP8A 2SHKA 1YZUA 3B1VA 3KUCA 3BE4A 3IILA 1QHXA 4F38A 3RC8A 2EWVA 2WOJA 3U6KA 1QHYA 2CEAA 5JEDA 2FFHA 1S2MA 3SBDA 3Q5EA 2BWJA 3EX7C 2BKEA 2QP4A 4JLKA 3IO5A 4AYWA 2CBZA 2QM7A 4MYHA 3ZLJA 3HWSA 2OILA 1IN5A 2EQBA 3RS0A 1E2EA 4JZKA 4EJSC 3PVSA 4OJKA 2Z0MA 3MUFA 1ZD8A 4PZZA 3VFDA 1D9XA 4LCBA 1UFQA 3QPWA 4FCVA 1JQLB 1S9DA 2VYFA 2IWHA 4TZ0A 2I1QA 3SBEA 4KBGA 1JAHA 5EXSA 5HCIA 4CRWB 4ITRC 4OYHA 4L15A 2CCKA 1J7KA 4BECA 1M7BA 3IQWA 1OSNA 4JBXA 3AF0A 2O8CA 2MSDB 1N25A 4EUNA 2HCBA 4HDOB 3U3RA 4EQ6A 4BFVA 3CRVA 1CJVC 3C8UA 3ONWA 3W6NA 2NMVA 2RGXA 4TMKA 2WHXA 4HAYA 1XJCA 1U2RA 1E9SA 2ZREA 4L9WA 1G8HA 4Q4LA 3LQRA 4RCYA 2VP5A 3VR2A 1KZ7B 3A58B 1US8A 3OE7A 3AEZA 1DPFA 4LHZA 5LDDC 1IBRA 3QY0A 4DCVA 2RGNA 3NBZC 4MRVA 1ETUA 3V4RA 4NCKA 1MT0A 5FTLA 3U61B 2OFWA 5EUQB 4WZ6A 1G3QA 5J4LA 2A30A 4IOJA 2WPDA 4NYJR 3CF0A 1GZSA 2GJ8A 4DLUA 4ZIRB 1XZPA 2P65A 4QJ3A 1UDWA 3BB1A 1Z0DA 4HATA 1IN4A 4MKHA 4D0NA 1E0JA 3GCGA 4URVR 3VU9B 1GUAA 2BIFA 3LWNA 2OESA 2VL7A 3RS2A 4EFNA 3U4QA 2HYDA 2J0VA 4GMDA 1OW3B 4LGMA 2GEDA 1A7JA 3NHAA 2IYQA 4NCHA 2JLSA 2ORVA 3JZAA 1T91A 2HV8A 2Q21A 1E99A 4A2WA 2H18A 4O2LA 2YOHA 3CWQA 2B6HA 2D74A 3FYHA 4XWAA 4DDUA 3VR3A 1OXVA 2IC5A 2XTZA 3NBXX 5L3QA 3PUVA 1GRQA 2ZJZA 3MMPA 4Q18A 5FTMA 4B44A 3Q9LA 2ZR7A 1KI4A 1Z6AA 5J4YA 1CR4A 3X1XA 2O8DA 2QP3A 1KO8A 2GESA 5J5CA 1PUIA 3HJNA 2IF2A 4IKEA 4NMMA 4TLAA 1OFIA 5E7MA 5H68A 5KUTA 4FWIB 1HQCA 4PSVA 1G291 1SKQA 3K70C 1KJWA 2W6JD 2ZRFA 1HYQA 4QC2A 1X8KA 1UPTA 4JL6A 4FMCB 2HF9A 2XXAB 3WHKA 2G1KA 1EG7A 2P6UA 2YWFA 2PJRA 1KTVA 2RGNC 1VCNA 4V0KA 1XTSA 1KDPA 3E2IA 1KJYA 3AKYA 1K5DA 3DO6A 3TBKA 1OHHD 1X1RA 2C99A 1MH1A 2ZQ5A 2DFLA 4BPBA 4P4SB 4U7DA 1CULC 2LWIA 3QXXA 4GT1A 1Q44A 3NVAA 5TVKA 4BUJA 1Z47A 1YZQA 2PEYA 3VR6A 3WNCA 4LJAA 5EE5B 3H0KA 2V1UA 3ZIAD 2L0XA 3SJZA 5FOTA 1IN7A 4E5UA 1XZQA 5DIFA 1GTVA 2ZRDA 3RABA 5KYKA 2WWWA 4MGKR 1KSJA 1TF5A 4O2RA 4PHTA 3PG5A 2WSSD 4Q1EA 1W4CA 521PA 4IRUB 4DRZA 1UM8A 4JLBA 4EPYA 4KYIB 1LB1B 4G5QA 1KAGA 2QY9A 3I92A 4PZLA 2W2VA 3HPRA 4ZKDA 4JT4A 4BZPA 2IS2A 1UKEA 2QQ0A 1U8ZA 1FUKA 4N3NA 2XB2A 2A7QA 2OM2A 3LA6A 2QNRA 3N2EA 2JEOA 3SYNA 4QGGA 2A5DA 4D6PA 1A5TA 2JLWA 3H84A 3QI2A 4PO8A 5A0FA 5CITA 2VPPA 4JJKA 2A3RA 3T12A 2YYZA 4HAVA 4NPHA 2P0EA 4Q1FA 4Q03A 1H8HA 1Q57A 1XJ0A 1NKSA 3QBVA 2J46A 3QKRA 2VP2A 2YC2C 4DSOA 2REXB 4TL8A 4A82A 3EWAA 2ZUCA 1KGDA 2R2AA 2P2LA 4XD7A 1W36B 1E0KA 4QJ5A 1P75A 2OXRA 2XJ4A 3AF4A 2RB4A 4MDFA 1JR3A 1LV7A 1MO4A 5EUMA 1T3HA 3I5XA 3FHTA 2ANBA 3EZFA 1IY1A 3L0IB 1I4DD 1G5TA 2JJ1A 4ZI3A 1KNQA 1S3SA 4KSBA 4OL0A 4DLSA 1BMFD 4B74A 2JJ8A 1F2TA 1ZNYA 1XTKA 1YZTA 2OFOA 1DG3A 1Z0AA 3B6EA 3OIYA 4LYJA 2K5UA 4BFWA 3P4XA 3GJXC 4C0LA 4HLQB 2ODEA 4NYIQ 2FF7A 1Y63A 2GJAA 3K09A 2IHYA 4MH0R 1W36D 1WDTA 2KE5A 4LYAA 4DCSA 1A82A 2Y8EA 5DNYB 2F55A 1RJ9B 2D62A 4H9GA 4F4CA 5AJWA 1BS1A 5L3SA 5D3QA 3QENA 3VU9A 4B43A 1FTNA 2QMUA 1XEWX 4LJ4A 2ZUBA 2I3BA 4LDJA 2OAQ1 4YXWD 1E9FA 4MYTA 2DYKA 1ZU5A 4M1KA 5BN4A 1D9ZA 2CNWA 1GNRA 4ZKEA 4US0R 3ND8A 1FX0A 2ODBA 1G3UA 2C9OA 1AA9A 3Q5DA 3SEAA 1F60A 1T3SA 3KTAB 5JI2E 4TLBA 3I62A 1HUQA 1DARA 4DVGA 3K0SA 2ODWA 3CPHA 2JJ2A 1RW4A 2UZ3A 1OIVA 2XTMA 3BERA 4QNMA 2BEJA 1E2PA 2G88A 4Q7LA 1AIPA 1U81A 4B76A 1ZUHA 2XNDD 1G6OA 1G19A 5JWOA 4AI6A 5DISB 5LPNA 3OFND 2WBLC 1Z29A 2CE2X 2GDJA 1UKZA 2ZETA 2WOOA 2ZSAA 2CCGA 3DOFA 4YDSA 3VR5A 1KI7A 4DUGD 1KSHA 1Q0UA 1Z0KA 2YVUA 1ZMXA 3W5IA 3J81k 4EDHA 4WAUA 4AKIA 1DAGA 3ASZA 3P26A 2V55B 1AJEA 4P4SA 2XZLA 3K09C 1E69A 1AQUA 1VCIA 4IVQA 3WYFA 4TLEA 3A1TA 2N46A 3ZQJA 1DAKA 4C0BA 2FX3A 4FW9A 4FCTA 3R9IA 2ZI7A 4ZDWA 5DN6D 4PX9A 4OK5A 2BM1A 2ZVQX 1MO3A 1E9DA 3LRPA 2ZYTX 4UXHA 1KY2A 1OYYA 2FSHA 5JSZA 1UBEA 3K53A 2C5LA 5CYPA 4AK9A 1GP2A 2I1VB 3AP1A 1SVSA 4U5XA 2ZS8A 3GQBA 3U3MA 5JCPA 2J1LA 2R6DA 2NPFA 4IJMA 4JVSB 4CYMA 3AB3A 3ADDA 4PTLA 2OBMA 4M9SA 1KKMA 2ZAMA 2LKCA 4CT5A 1E2MA 2RHDA 1JPNA 4HUQB 1VYTA 3PV0A 3PUYA 3T5GA 4HEJA 5CK4A 1CJTC 3PITA 3A6PC 2BBTA 3KX2A 4ACAA 1HE8B 4EFMA 2ZSBA 3BIFA 1EFCA 4CW7A 2BKUA 3AVVA 2Q3HA 2ZRLA 1G3RA 2WWHA 3CUEF 1BOFA 4B3XA 4Q9KA 1KY3A 1WP9A 2B8TA 4LHXA 1PLKA 3WYGA 3TLXA 3OHMA 5J4KA 1R5NA 4TMXA 2ZSEA 1II0A 4HYYA 4MKGA 4W5JA 2QTVB 5K8IA 3BBPA 4UXJA 3OIUA 3KJEA 2FH5B 5FPKA 2WKRA 3VR1A 2W58A 3ZS8A 4FMDF 1JNYA 2R8RA 3LBHA 4PC2A 3PUXA 4JSYA 4DHEA 1BKDR 1H65A 1JBKA 1NSFA 3N70A 4V0LA 1BYIA 3HR8A 1CJUC 4N1AA 1NVVR 2Z83A 1XD2A 2F43A 2QG6A 3SR0A 4YMVA 3AVXA 1UBFA 1DOAA 4A15A 1W0JD 5EXPA 3U6BA 4E22A 2QP9X 2YWEA 4C2TA 2A9KA 1FOEB 1JECA 1OXSC 1TX4B 4XSHA 1VPLA 2HT1A 1ESNA 2WJVA 2YNMA 4LV6A 2DCUA 2Z6VA 4IFBA 2CXXA 2B8WA 1OIXA 2ZRHA 3B60A 1SXJE 3PUWA 5FBWB 4OKSA 4HZIA 4AC9A 3FB4A 1W4AA 1KK2A 4M53A 2E87A 2OT3B 3K9NA 2HDNB 4B2IA 2KBEA 3CX8A 2ZR0A 4DLXA 1AS0A 3LD9A 2H5EA 2O0JA 3SC3A 5B2ZA 5HKKA 4NYMR 1S3GA 3TKLA 2NZ8A 1CR2A 2JATA 1AZTA 3AF3A 1N5LA 4HSEA 4XVQA 3RAPR 5EXXA 4IW3B 2EYQA 3SE0A 4BLOA 1L7VC 2F9MA 1JXMA 4Q9JA 1NKTA 4Q48A 5C4GB 3L82B 2IS4A 3T15A 1Z2CA 3R8FA 2Z43A 1EWRA 1LFDB 2IYRA 4C0QC 1HH4A 3RS7A 1E6CA 3A4NA 4JBYA 3PUZA 3QBTA 1Q20A 1ZJ6A 4EPWA 3W6OA 4IEIA 3T34A 2MSEB 1T8TA 3AP2A 2CLDX 4PHGA 4R2HA 1R5OA 1S1MA 2BVNA 4DLRA 3TRFA 3T1TA 1KJZA 5FOWA 5FH9A 3OAAA 2QGNA 3UKDA 2IYSA 4HLCA 1II8B 2OAP1 1MR3F 2PLFA 1KK1A 3VX4A 3LV8A 3BC1A 4WOPA 3WNBA 3THYB 2P3SA 4D4MA 1XEXB 4HLDA 4HB3A 3THXB 3QUSA 4LHWA 3KKNA 4JKIA 1IJFA 5CLLA 3AF1A 1G18A 1E2LA 1SVIA 2ATVA 1J8MF 2ZRKA 2DWOA 5HE9A 5JHHB 1ZIPA 4HB4A 5E7IA 1W4RA 4AURA 3TW4A 5EP2A 3ZVLA 4C0AC 4QHSA 2ZR9A 1DVRA 4IDHA 4PHHA 2X2EA 3QEJA 1NBME 1GWNA 5DE3A 4PANA 2C9YA 3SHWA 5FBLB 4LSGA 2GCPA 3VKHA 2A5GA 2JDIA 2EFHB 3B9QA 2QN6A 2OG2A 4RSGA 4KI0A 3RC3A 2ZRJA 4G5GA 3GLFA 1QDEA 4NE2A 3U7GA 5CM9C 2Q9AA 4OI2A 3S1AA 3PQCA 3LBIA 5BQ5A 1X3SA 2XOKA 1U94A 1VG0B 3MJRA 2ZI9A 4Z8YA 4K8OA 3QIAA 2RGAA 1EK0A 4C0HA 3O8CA 1N6PA 1L2TA 2ZPTX 4YLGA 2GCOA 1VIYA 1ZP6A 2JGNA 3L43A 2A78A 4ZDIA 1NLYA 5EXTA 1L8QA 4ZCLA 4HAWA 4RFSA 4C0SA 3EPJA 2J7KA 3B13B 3U7FB 3REFA 5F98A 3ZGXA 3I73A 2QEQA 4ABYA 1TF2A 4JYBA 1WCV1 1TEXA 5KHOC 3RHFA 3WHLA 5EP1A 2WWXA 1ZBDA 4O3MA 4LZZA 4NDZA 4QBFA 1ZNWA 3FMOB 2XX3A 3UMRA 2EW1A 2BBWA 3G82C 2QTHA 1TUIA 2GETA 1ZD1A 3PEVA 2WV9A 3GPLA 3QVVA 1S96A 2X8AA 5AJXA 3EXAA 1G7TA 4EPVA 1KK3A 1FUUA 5EE1A 2IBMA 4GNKA 1R8QA 4DKXA 3MRSA 1T0JB 3G5UA 1ODFA 4JL8A 2AFIE 1XDBA 2FJUA 4TQ9A 1OFUX 4Q4HB 1QF9A 2ZJBA 2FPMA 2ZE5A 1YRBA 1OKKD 3FTQA 2D7DA 1OJLA 4MRSA 3W8NA 1Q12A 2WAXA 4MRRA 3HPQA 2YV5A 1WE2A 2FSIA 4JLJA 3NKVA 1U0JA 2Q9CA 4LYFA 1F48A 4EPXA 3SQXA 1MABB 4XOIA 3MG9A 4XVUA 4M9ZA 3TUJC 4RD1A 4B48A 2IYTA 1KSFX 3ZD7A 3RSLA 3PFIA 4TTPA 4EPTA 4ZDKA 1O87A 1W5SA 3VQTA 2PX3A 4HZUB 4PC6A 5BW8A 2VF7A 4LJ5A 5FUYA 2AK3A 3SU8A 3GLGE 1G8YA 1ANKA 1XEWY 3Q7PA 5JFGA 1ZINA 2WMOB 4YONB 3EPLA 4HAZA 4BZQA 1H8EA 1NIJA 4W9MC 5AK0A 2CHGA 2P5TB 3OEEA 1OPXA 3SYLA 3NXSA 1CTQA 1RRGA 4RFVA 3DEFA 5E95A 3BFVA 2ASEA 4TMVA 2PZFA 1SQ5A 4PFSA 1QHSA 2J0UB 2QE7A 3PIRA 2DFTA 5LB2A 5KPJA 4HAUA 2RGBA 2IHBA 1OXUA 5JWHA 4EPRA 3D6TB 1T0HB 2QPOA 3I32A 2VTKA 4BGDA 2QL6A 3GP8A 2DFNA 2R6AA 5KTYA 4POAA 2MMGA 3GD7A 4V0MA 1KO5A 5DYGA 3GLIE 3GJ6A 1G8FA 3MCAA 4FMBB 4C30A 3NC1C 2DBYA 4RD6A 5DYIA 3TQFA 4W5WA 1N0UA 4C3ZA 5G41A 3M0EA 5A4JA 1M2OB 1FMLA 4KLZA 2OBLA 3O47A 5K8TA 5J4VA 3TUIC 3Q3JB 1OH8A 3I1FA 2ZRGA 5JS8A 5KPDA 3B7GA 2RMKA 4G5RA 5JJIA 2PMDA 4EKDA 2OCAA 2IYLD 1TU4A 3QOFA 4QHYA 3SZRA 3C5HA 1U0LA 4PQYA 1EFUA 4C2UA 4QJ4A 3CLVA 1ZD9A 1FP6A 2C04A 1RC8A 1ZC3A 1ZM4A 2BDTA 4V02A 2DHRA 4N0DA 1KI6B 1VG1A 1XCPA 2GBLA 2UKDA 1QVRA 4I1VA 1AGRA 1T5IA 2KJQA 4DXAA 2IX3A 3HU3A 4DT1A 1EWQA 5J4HA 5FBQB 1ZU4A 2RH5A 5KSOA 4DDVA 1DO0A 1KDRA 2QMHA 4XSGA 4HUTA 2ZE8A 1NVXQ 1G8GA 4NL4H 1ZUNB 4QM7A 2EFEB 1E2GA 1D2MA 1XXHE 3GLHE 1KDTA 2JCSA 4TT3A 3G0HA 4PAMA 4TSFA 3U3KA 721PA 3TVDA 2IS6A 4DB4A 1ZIOA 3WMFA 4TN1A 1YR8A 3FMFA 1N5KA 3RDPA 5F9FA 4M9QA 4OHXA 4M4SA 2CJWB 2QROA 1OFHA 3X2SA 1FPMA 4XWKA 2GXUA 1R10A 4FINA 4BLTA 1XNJA 4PAQA 4DLYA 4TZ6A 4A1FA 3T1VA 2QBYA 4WVFA 1I4LD 1XCGB 3RWMB 3EIHA 3OESA 1AK2A 2Z5FA 3M4YA 4QRHA 4A9AA 4GL2A 4WW0A 4A0RA 3L0OA 3NH6A 5HZKA 4MUBA 4G3XA 4GFDA 4IOLA 3CKLA 3IBYA 5TB5A 4PPFA 4P4TA 3VAAA 1RYFA 1ZM7A 5CLQA 1KOFA 3DM9B 4LV8B 4PC3A 5DHFA 4D25A 2AX4A 3VX3A 4A4DA 4B6FA 2GBLC 4M9XA 4XVRA 3KQNA 4NCIA 1EFRD 1GFIA 2GTPA 5JRJA 1MRNA 3SHFA 1P2UA 3SOPA 3DPUA 1QVAA 1OH7A 4WXPA 5IK2A 2FG5A 3AP3A 4IDOA 4B32A 4ON9A 4MYUA 1Z0JA 5G53C 2AD1A 1O3YA 1YZKA 1HY3A 4Q4AB 5FL7A 2FN4A 3LNCA 1G64A 4QGHA
chains in the Genus database with same CATH superfamily
2EW8A 2R00C 2XOEA 3QE4A 4ZQFA 3P2EA 1E79A 2XPCA 3QJ5A 3COWA 4Q1DA 4PF1A 4Q47A 4S2EA 4R01A 4CKCB 1QV9A 4HGPA 4D82A 3BTUA 1X9GA 1R0ZA 3K1AA 4XSVA 2F8SA 2FXIA 3ETLA 2H7VA 1LPBB 4Y2UA 5EHIA 1JLRA 5IBPA 1R8YA 1U4NA 3F4BA 1DDOA 5DX1A 2JIBA 3OTQA 1P5JA 3EG5A 2ZAGA 5JVDB 4DNQA 1PVDA 2OBXA 4FMDB 1LW7A 2OB1A 4H1HA 2D2XA 5HG0A 1O57A 4BNXA 2WKPA 4J0KA 1C1YA 2C20A 2CVFA 1OX5A 1FMJA 3HGMA 4R3WA 3V1LA 5DULA 5EKXA 5C34B 5IZ4A 3ABRB 1AU9A 3H0CA 3HVUA 1H93A 2BFCA 5K2MA 3T5PA 1ORVA 5CG2A 1LPAB 5FA6A 5EHZA 3EXIA 5I47A 2JHFA 1G8MA 5D3ZA 2J48A 5IJ0B 2NU6B 2AXPA 2O52A 2H4HA 3JRXA 4MVJG 5FTWA 5E3HA 1OXBB 1Y6GA 2VHUA 3PYLA 4EUKA 5B7GA 4ZD6A 4FGWA 2QZ9A 3FNRA 3QG1A 4B46A 1L5KA 2YUIA 4A3SA 4URWR 4JVLA 1VDZA 4DS3A 5AVXA 4QREA 4WLEA 1GGKA 1LI7A 3KCQA 1QIFA 2ZULA 3TDMA 4F9TA 4D57A 3SFTA 4LWQA 2PUBA 1DKNA 1Q95A 1WD5A 5IF9A 2FMXA 5EA2A 3WGTA 4DXDA 3AKZA 2CCJA 4D0LB 1AO0A 2PKXA 1HOTA 3HJHA 2DPYA 4K6OA 1VKHA 4BKRA 2W70A 4CIAA 4DR7B 2DFDA 2Y71A 4EKNB 1UBGA 1VYUA 2YASA 3FWHA 3NI2A 3Q8XB 1ISHA 3HKEA 3R75A 2ODQA 3NPAA 3QKSB 4EZBA 3I2FA 1T5OA 1UDRA 2PTHA 3QELA 2GHTA 2NADA 1LJ8A 3LYLA 1ECJA 1VI6A 1ZL2A 1IB6A 2QSZA 3D1LA 3EA0A 4RPCA 3A6KA 2HA6A 1N77A 4IIJA 5D3KA 4OYYA 1TTHA 2BYTA 4XEHA 4BMZA 2IDKA 1UKCA 4GZLA 4QUEA 4Z3OA 1SVMA 1X3LA 4NULA 3H5AA 3FUUA 3PT9A 2ZKIA 3A6GA 4HGYA 4ZANA 4O4HA 3V97A 1X1CA 4CLEA 4LF7B 2DBZA 5FNVB 2OCKA 4F93B 3I1JA 1T10A 2J3JA 3ZZNA 3QXJA 1STOA 4OP3A 4B3GA 4C4ZA 2WM8A 3AOEA 1FBNA 3KR0A 1QCCA 1IJEA 3ZDZB 5K7SA 3VISA 4BASA 1YMUA 2KYRA 3CF4A 4JHXA 1ST2A 4WBSA 2FWIA 1QFMA 1Z34A 4AW9A 4F71A 1WF3A 2P9YA 1PNVA 4I8XA 3LO5A 5C31A 1AUOA 1UXJA 1OBVA 4B73A 4E2ZA 1U3WA 4IJVA 3T5TA 2FW6A 2Y4OA 3JCZA 3OZWA 5GV8A 5KAMA 3S5JA 1HX7A 3ILYA 3PJDA 4BWGA 4CVNA 1PL6A 4ZOAA 1XJQA 1T9CA 1XVVA 1Z5ZA 2OD7A 4D4JA 5KZMB 3DZDA 3PKJA 1RYYA 3DL0A 3I9JA 5ENVA 5J5AA 4ZIRA 1MDFA 3OU7A 3AKDA 1VG8A 3OJFA 4WZAE 3IUSA 3RV3A 3PGKA 5B3AA 3AB7A 1YI1A 3I8SA 1B43A 1OFVA 3IVGA 4LHVA 5CDFA 4OIMA 4BP3A 4DJAA 5CDUA 3HYTA 3T4EA 3UHOA 5JZVA 1FP2A 3AWDA 4MP3A 1VIAA 2H2AA 5JZOA 1GL3A 3I42A 3MGGA 2DLNA 3FWYA 3NC0C 4ZDJA 1P1FA 2QVYX 4CLOA 5FPYA 1KS9A 2CMHA 1BMDA 1G5PA 2X0RA 5EMKA 4AJOA 4CMIA 3OF5A 5CT5A 4W1PA 4EYQA 3WIVA 3AJDA 2IZ1A 1FFAA 3NKLA 4R98A 4JI3B 3Q5GA 3V1UA 4B0OA 3QPAA 4MGIR 3X2FA 4F12A 121PA 3ER6A 3HCNA 4PX2A 3PGA1 1O97D 3BUSA 1RQXA 3I72A 5LLSA 5CFMA 1J2YA 2K7FA 4JLUA 2WNHA 3PQ3A 2HJSA 2AFIB 4WN9A 2WA1A 1FNDA 3L5KA 4AMBA 5CRIA 3ANYB 1AQNA 3DLBA 1P0QA 3T4UA 2ZGVA 3WNDA 3H2SA 1NP7A 3D1VA 3DAFA 5BVHB 3QVXA 5FPHA 4D3ZA 1VHTA 2J87A 4XJXA 4U8HA 5D84A 1JSXA 4ZTBA 1Z28A 1IHUA 1LRLA 2GWHA 4PPQA 4MHTA 5DNVA 1ZUIA 4MWZA 3U60B 1MX9A 4RCVA 2I8LA 4GSYA 4IXNA 1GAJA 4L50A 4NZPA 4J7UA 1U0RA 1MXHA 1GXSA 1LDBA 1XWIA 2Q3FA 3MS4A 5I8ZA 4LPSA 5LBUA 3V4LA 3IUEA 1FFBA 4MOWA 1K86A 2E4YA 4MI3A 2VHJA 2X5OA 1UZUA 4IXTA 4IDBA 2GN9A 4R71A 2B7LA 2WIBA 4ND2A 5DHQA 3REOA 2R6ZA 5TGTA 3ZH9B 3GLGB 1BIFA 3MTAA 1LF5A 4UTXA 5FFMA 2HCJB 1IZ9A 2P62A 2FG6C 2W2TA 2J59A 4MVJF 4OUDB 2WM3A 5D8DA 3RBZA 1UL1X 3W8DA 5IMSA 3A3OA 4M1ZA 5DRYA 3CF2A 1HDOA 1JU4A 2H63A 3JQ7A 4NU0A 5FR2A 1EDOA 2DQYA 2PSEA 3NTLA 1OX6A 4KFUA 3WDKA 5DEIA 3BYZA 4NOLA 1JDVA 1CE8B 1Y6QA 3IB3A 3UJAA 5EJ5A 1L6RA 1P3DA 4P08A 3BULA 3H2KA 4QG3A 4JLWA 4M0DA 1OV4A 1XU4A 1ZOLA 5AW9A 1EM8A 1G5RA 4UULA 4V1CB 3SBOA 3LXXA 2FTKE 3OCJA 3MINA 4MLCA 4HFRA 2R6JA 5B64A 3LIPA 3JR3A 1ZH6A 1K92A 4UEJA 2B2XA 1R88A 4OI4A 5ITWA 3TGLA 1T9HA 1LS1A 2DP4E 3KYCB 3NT5A 3F9RA 3L0PA 3RUIA 3IHTA 1EUCB 3WMGA 1RWVA 1NTRA 1G1AA 4U00A 3EMKA 3LC2O 4M22A 3PA8A 4NBWA 1VIDA 2VRNA 4XWTA 2FZLA 3H9UA 3FOEC 5AESA 5KX5B 5K0JA 5JXGA 3VU0A 2PRYA 3LBNA 3NB0A 1ZVQA 4IILA 3F73A 3N86A 1TCVA 4Y7CA 3E9MA 2OCLA 1W88B 2A0FA 2YYSA 3PCXA 3MMZA 4ER5A 4EUSA 5BO5A 1SCUB 5AD1A 1XTZA 3NKFA 1U0GA 5DCUA 3R5FA 4WGGA 4M54A 4BEJA 3CINA 5F3WB 3OFVA 5KJFA 3L7BA 4J75A 4Q39A 5I5GA 3T3GA 1LTKA 3EW7A 1SCAA 1JEEA 1IY2A 1U6JA 2EQAA 2Y6VA 4P7JA 1NTOA 1D6SA 3RC9A 4C7VA 5CA0F 1T8YA 1HL7A 4CF6A 1XPRA 2BFDA 2R44A 2GCNA 3AR7A 5GZ6A 4Q16A 3FPJA 1EFVB 2ILVA 1B0ZA 4P7GA 1OFGA 2ZI3A 4UM8B 4TTVA 1JIIA 4PXYA 4MA4A 5LOVA 3EH1A 3HM9A 1P80A 5KNCA 1YJAA 4F2HA 1BRMA 3HZOA 3JQEA 4A6DA 1XYYA 3OP4A 1DRWA 4J91A 1P1RA 5F3DA 3BB3A 3CZRA 4MIYA 1P1HA 2COUA 2Q1WA 1IAQA 2AL7A 4RTKA 1U6KA 3O91A 4U7HA 4F6RA 3NBYC 1U2EA 4R2MA 5JTTA 2NO1A 3T1OA 1EWVA 4CE6A 5JROA 1RNLA 2ONCA 3V6LA 5CMLA 1KYQA 3AR9A 3EAFA 5KSPA 3OZCA 2JLVA 1F5SA 4L9SA 2RC6A 1XMSA 1USVA 3NTXA 4L28A 5ULLA 1KJ8A 4JEHA 5FWAA 1KWKA 1HE1C 2DJ5A 4N5LA 4IHJF 5CT4A 5EKSA 3VHRA 3RGGA 1Y34E 1E2QA 1HT2E 2H1HA 4UUNA 1HO3A 2E89A 2IYYA 2R3SA 1T4DA 3OJWA 2XOKD 4V3CA 3R7DA 3TRIA 4CV0A 1UC4B 3OFKA 2YQ5A 2DR3A 2NX2A 5AIBA 2KB0A 3IODA 4BVJA 4CIBA 1KGSA 3BWYA 4P4LA 3ER8A 1T1SA 3BGSA 4RZ2A 1JLSA 1XQVA 5AVUA 1NLMA 4UW9A 1MB0A 4P0TA 4N5DA 2X22A 1X8LA 1YQGA 2VC2B 1RM0A 3FJ1A 3HXQA 2PGIA 3F9CA 4D02A 3RVQA 5AWFC 2E6UX 5KTOA 4HOYA 1D4ZA 5BWNA 4DBZA 3C6MA 2XGSA 3KQUA 2ZTMA 1UEIA 2QD2A 3JD3A 3JY6A 1KQ3A 1VTKA 2QDKA 3ZQ6A 2YOFA 2D7CA 5E3IA 2VK1A 5AOCA 2VTBB 5A6SB 1NU8A 2CDCA 2IEIA 2ZJ0A 1FXWA 4FN4A 5FOXA 2AHRA 4PAWA 2ZEJA 1XZGA 3OJEA 4MVWA 2EU8A 4RX1A 4X1IA 5FI3A 3LH5A 3FW1A 3GGJA 1TUBB 2IYWA 5F52A 2B3TA 3H9GA 3R23A 2WIKA 5DM1A 5EJ7A 3WLAA 4XI9A 1AK9A 1DQYA 1YE8A 1Z15A 5I7SA 5JAQA 4ARUA 1QRTA 1UDCA 3GT7A 4CMKA 4ARIA 5DK6A 1A88A 3GUUA 4G4SO 4GOJA 4IS3A 2HHCA 4MTCA 3TRKA 5HTKA 1N36B 4OHMA 2YVAA 2OGTA 4GLBA 3SSAA 3DMDA 3HBMA 3LXMA 2GF2A 5TY0A 4B3FX 1FFDA 5A4FS 1E1YA 1E9VA 4FYMA 3H9JA 1Q11A 2VPQA 4Q9HA 5LXTF 4ECAA 1N2SA 1X19A 3O2JA 3D7SA 1QTIA 4UMDA 1Y7HA 1GRNA 2OC4A 1LSUA 3U4GA 4C4OA 2C7OA 4ZVKA 3U44B 1ZIXA 4XKJA 4A16A 1NAHA 3WOVA 3FOCA 2QVCA 5K3SA 2PZGA 5TXGA 1R7RA 3CO0S 4NK5A 4YGXB 2WD8A 2W8BA 2LCQA 1PZNA 4ZCMA 1Y4AE 2D5IA 3MSCA 3BEOA 2JIZD 1ZSYA 1U8FO 1YJXA 3TG2A 3WHIA 3FPGA 1X9HA 3RK1A 3X1DA 3DZBA 3JWIA 4DLRA 2UYCA 2FW1A 3COVA 1SXQA 3TW6A 1K0UA 4GMFA 4MWCA 3OKCA 3SOZA 4Y9SA 2H7CA 4GQIA 1CUDA 3L8CA 1SVWA 2ZDQA 3SFVA 1JG2A 1Q7TA 1HFJA 1N6IA 1MOZA 1VG9B 1T1EA 3DL4A 3PHIA 4KLNA 1M54A 3RIGA 4M86A 1F20A 1BX1A 2DERA 1EMDA 2XA2A 1H6BA 4KO8A 4DQ0A 3QZUA 3OUZA 1VIVA 4ER6A 1MO5A 1KZ9A 2UYGA 3E9EA 1CD5A 2VK8A 3P1JA 1KF0A 4MINA 1ZCZA 3C45A 2WTEA 1G0NA 2YW2A 4LE2A 4QIHA 1CJKC 6NULA 4IVPA 1JFTA 4CEIB 3NNNA 1UOPA 1BU5A 4GWLA 4YNBA 3ROTA 3ZKWA 4NSNA 2DH5A 3GFBA 3JQAA 3IGFA 3MW8A 3T3HA 2ZVDA 1EEHA 1VBNA 2H9IA 3CU5A 3TGPA 4L72A 2XYVA 2GNAA 3MTDA 3AERA 2OAGA 2BR3A 2ZT8A 2BPOA 4Q4DA 3LK6A 8MHTA 1NRXA 1T1RA 2VCHA 4PG5A 3FDZA 3K9CA 1X6VA 1IBMB 3WL4A 1RAFA 3DULA 4G5YA 1DEOA 1C0PA 4OOFA 1WMAA 3DR5A 2WIDA 1N8SA 2HO5A 1RMQA 1TADA 2L19A 1PZHA 3B48A 3RH0A 3PYXA 3AIKA 2OLJA 3AVQA 2R65A 4MV9A 5ALOA 1N2CE 2JAWA 2C83A 5E38A 4ZZIA 3ICOA 4WL0A 5LU8A 2UVDA 4FBLA 4RPHA 4BXOA 4KQXA 2CJFA 5FHRA 2P67A 1MDBA 3DE1X 1UXIA 2Z4RA 4RV9A 1YF3A 1TL7C 1UM9A 4U2FA 1VKNA 1W1IA 4GX1A 4Q9NA 2WWTA 4NICA 3OQIB 4NZMA 4POOA 3DFZA 3TF5A 2Q1UA 1LLFA 2UZ0A 3W3AA 1SPBS 4HZGA 3HB9A 3GFSA 1R9JA 2WWGA 3VNBA 4LJYA 1QZXA 2C92A 2WRZA 3L8YA 3SZGA 4IMJB 5KNBA 3LVFO 5AVZA 1OE0A 4X6YA 3WK6A 1PL7A 1EG2A 2X7JA 4C87A 5ESRA 4AJPA 1EFLA 4Q5IA 1BH2A 3O4HA 3MXOA 5B37A 2ZB2A 1JQBA 2YXNA 3KFVA 4KWTA 5EKUA 2C58A 2QR5A 5I3CA 3AR4A 4REQA 4H16A 1O03A 1GZVA 3PD7A 4HVCA 2XLBA 3SI7A 4Q7QA 5KNCH 3PPVA 3MA0A 1HOXA 1BXZA 2CYBA 2Y4NA 1YMVA 4I50A 1U8TA 4WZAB 1AUPA 1I33A 4YMTA 1VRVA 2QTNA 4N5MA 5WRFA 2Y1FA 3O8DA 3N0VA 4KSYA 4ENUA 5AVYA 4MAAA 4YWHA 3JRWA 2R6GA 2RIPA 1RACA 3K94A 3KB1A 4FYHA 3I09A 4M1SA 3PWZA 1L4KA 5DOVA 2OFFA 1QG6A 4HADA 2FQ1A 3ZXSA 1WOMA 3JZDA 3SF8B 5GJCA 1BDHA 4KPYA 5CA1A 3SSMA 1YR6A 3QXCA 4ND8B 4ZMBA 4ZTZB 5LL6P 4HDKA 3A06A 5A7GA 5J2UF 3FZQA 3F71A 1E2IA 4IH4A 2YXBA 3UOWA 5MN5A 2D2FA 3F6RA 3Q7EA 2CKDA 2QMZA 4RA6A 1QQ7A 1XTTA 2REOA 3INGA 5ILQA 3AL0C 4XGKA 3WQQA 1IZYA 2RGGA 2UU9B 5E9WA 1WCYA 4TWBA 4BO4A 3K5WA 5EINA 1GG9A 1I32A 3I6IA 4AJ1A 2IXGA 4PLFA 3P2YA 2QTAA 3PPWA 3WYNA 2WPDD 4PSUA 4O1MA 2AN5A 3LOQA 4DLVA 4B3TB 3L4SO 3TQCA 3LI2A 4B35A 2IOFK 4OK3A 5EWMB 3T7TA 2X3YA 5K3FB 1NBAA 4BMPB 3R7NA 4DQKA 4UPEA 1C8VB 2W0SA 4E88A 1LCIA 4JLNA 4L5BA 3I0ZA 1QBKC 4KXUA 2IIPA 1CZNA 3KR9A 1XVTA 1BFDA 2FXVA 4X6LA 2JNWA 1E5XA 2CVOA 2EZ4A 2HGSA 3IVMA 1E1KA 3R7SA 1C50A 1NVDA 1JJFA 3FZEA 2ZJ8A 2XUZA 1XDDA 3A1CA 3L18A 5FP0A 4JJ7A 4DARA 3N8KA 4DA4A 1ZEMA 3RI3A 1QH1B 2FWMX 2RHOA 2F9LA 1CY4A 1SBNE 1X0VA 1OT5A 1FDWA 3LQFA 4HWOA 3F8SA 3U9TA 2IEZA 5LN1A 1J39A 1CRLA 1PS0A 5E2IA 1OZGA 1E1DA 4FUTA 2CDNA 4DVGA 1IOWA 4JZYA 2GAOA 4D74A 5K4AA 1W2HA 4U5QA 1J6UA 1M7GA 1AS3A 3IA7A 1JHQA 1KIMA 4UREA 5BSRA 3KJXA 2YCLA 4I3HA 4MQBA 1U9CA 4PIPA 2X0KA 3Q0IA 4X93A 5JMPA 3WQHA 5LNK1 3AG5A 2ECPA 3CNLA 5A4KA 1L5MA 3DBHB 3VR0A 1VMDA 4UU1A 4IF6A 4BLWA 3AG6A 4EJ6A 5LBIA 4PU0A 2XGOA 4EGFA 5FV7A 2CWDA 2C8VA 3FUWA 4IDPA 2PV0A 3LVQE 5EWLB 2AC2A 1I7LA 5EC8A 4BJHB 4D46A 3V00A 1Y3DE 3TLBA 4IH9A 3MUNA 5G4KA 1KAHA 3UK2A 1OZ0A 4MX8A 3VR6D 3CIFA 4EOGA 2ZI5A 2OEPA 5TJ9A 2JCVA 2B1RA 5DYTA 4B3SB 1MQ9A 3C7KA 3H1GA 4LC9A 3GCZA 2CUTA 2LIVA 3TFQA 2JBAA 4BN0A 1BG6A 2GZHA 1RQGA 7ABPA 2R86A 3BMQB 4ZT2A 2PUGA 4DNPA 3USCS 3A1EA 1NE2A 1TPYA 5HKOA 3KWJA 5FOVA 1LRJA 5HMMA 1Z83A 1CUSA 5JSKA 4DG5A 4X1KA 3ZG6A 2BP7A 2IA5A 3TB4A 5ALMA 1DT5A 4OQNA 3EUAA 4KP7A 5EHXA 3BMOA 1UJCA 3TZBA 3ROKA 5JNLA 1TJNA 2MU1A 4CTOA 3G0CA 3EFBA 1SJ9A 2H6EA 2PMFA 4HTAA 4DMUB 2P2DA 3FGZA 3O4GA 2Q3JA 1SULA 4TZKA 1Z5PA 4LE0A 5F35A 1FTSA 3V4SA 2QPAA 7ADHA 4Q4HA 3OCWA 2I62A 2RAVA 1LNZA 1PQ4A 1X74A 4Y67A 4A6PA 2X0IA 4KNVA 1XYVA 4MRPA 4BQOA 4C89A 2PWYA 3IERA 4MWGA 5CBPB 3MYYA 2D0IA 4KVAA 2G0NA 4MQ4A 5ALGA 2F4NA 3Q88A 1WPQA 2IXBA 3V32A 3EEOA 3JARA 2RC5A 2RK4A 2EJTA 1P7ZA 4DBLC 2HI0A 1GTRA 2GM3A 3BD9A 4M1WA 2YY7A 1SEVA 3GA5A 3I2YX 1IM5A 1PWXA 1YR2A 3DXFA 1EEXB 1GT91 5FWYA 1TYZA 1BNCA 2Q0HA 3AUXA 3H8WA 4IUYA 1B6TA 4MCHA 2XUKA 4D6XA 4EYSA 1U8AA 3UQZA 3BGWA 2WUVA 2GK7A 4MEJA 2GZ3A 1I36A 4OA5A 1NW6A 2YV3A 1Z22A 3AQIA 3H5TA 4NDAA 2HMYB 2JD2A 2PIAA 4QUAA 3T5DA 1A69A 4E3WA 1T1IA 1OLSB 1RWMA 3OTHA 4L8VA 2AA3A 1EZ4A 3O1IC 4IIHA 5L3SB 1CUGA 3C0KA 4ROSA 1JEQB 2HWUA 2O23A 2HW8A 4HDQB 4KR6A 1QR2A 1JBEA 2A14A 2NAFA 1ZK2A 2IX9A 2Y1EA 4HN2A 1GD1O 2QT0A 2RHCA 5FPSA 4Y6LA 1OT3A 3SZUA 3JYLA 3TRDA 3UKOA 1JFSA 3WVNA 2ASVA 5BN4B 3MCWA 2H29A 3W3AH 1D2HA 1R9NA 1WQ1R 3X1JA 4B4KA 4XLLA 4BHTA 5C18A 1FX0B 1QS0B 2J0UA 1HDEA 1GGHA 1UKVY 4RGQA 1EFPB 4CU5A 1TTTA 1O7JA 2KI5A 3GF4A 1E92A 1F06A 1OVMA 1QIKA 2MYUA 4DLWA 1PK7A 2Z4TA 4RVGA 4BFZA 4YLEA 3MWJA 3INYA 4JBNA 5DM60 3BHIA 2AI2A 4I55A 5CGZA 3ADKA 3ZOZA 5ALTA 1RBQA 1JKIA 3VU8A 3QA9A 4X20A 4PSKA 5H81A 1V9LA 5G4LA 4AKEA 5ABPA 1RHRA 1LC3A 1AGPA 1IIBA 1TQ4A 1YHYA 5JCJD 3RADC 1QYVA 4R4JA 4Y6QA 5JBNA 3SP1A 3VPGA 4NEHB 5ARBA 4CR8A 3WRWA 2HU8A 4PLCA 5AICA 3AF6A 2IHVA 3C7CB 3M70A 1OBOA 4G0YA 1Y3IA 1U80A 2FPRA 5CP8A 1ODSA 2D13A 3Q3CA 3T7SA 5TIIA 3FMPB 2K7ZA 1AY0A 1CUJA 4FCCA 3BGIA 3I04A 3A9SA 3MJHA 4NYJQ 1C2TA 2VBCA 5GVSA 2VPTA 4X5OA 1JSZA 4DRXB 4KWCA 1C1HA 1N8KA 3CLRC 2BUBA 3QEOA 5J59A 4P3OA 3R5HA 5AK6A 4GOLD 2Y77A 1AF7A 3C70A 2YINC 2VXBA 3CJRA 2OHJA 3BMNB 4DPMA 4J1SA 3ITNA 3LY8A 3Q85A 3PUJA 5SY4A 5HWSA 4DDWA 4MJXA 5K3AA 5L3VA 2DPXA 3W8RA 3UAZA 2J7PD 3H42B 2D54A 3LDGA 4CQMD 1ISGA 3JQGB 3PXDA 4FS3A 1X7ZA 1R12A 3RS5A 4ALIA 1PFYA 5HQ3A 4WOBA 5CA0A 3ZQUA 4OEHA 3AJ8A 1DIHA 2JLAA 3DFFA 2WTNA 5AW1A 1Q84A 1LTQA 2AR0A 3FA2A 3M81A 5H82A 3VAYA 4YRFA 2B8EA 3JQRA 4MUHA 1QV7A 3AEYA 2VDWB 2XA1A 4GOKA 1NLFA 3JYOA 2FZVA 1QWOA 1ITZA 4BCCA 4OLFA 4ZGWA 4G86A 5IABA 2C1EA 4IHAA 1QVVA 2C07A 3N8GA 4HQKA 4O5AA 2PLWA 1K8RA 3C8MA 4E31A 2RHGB 4F4IA 1ZNQO 4Y1RB 1CDZA 5AW4A 4NV0A 3I6QA 5AW2A 5GTDA 5J40A 2O8BB 1TC1A 2XUFA 2O5EA 1ZJ5A 3F3KA 1FZQA 3UJHA 4QLBA 5HK9A 3K6KA 4WLFA 1ZW6A 5FBHA 3JWHA 2RBKA 1ZM3A 4P5DA 4RHFA 5TVGA 1X7HA 4B47A 5A5FA 5BR7A 2HBYA 4DJ5X 4L75A 3NASA 4Z9FA 2B4QA 1J07A 1Q1QA 3CZQA 1V7QA 3NH9A 4CM4A 5JAPA 4ID9A 1NQXA 2RCNA 3CO5A 2OZLA 3GGDA 1DXHA 3S2ZA 1IBSA 4JP5A 1JN0A 5CURA 1DKRA 3V1KA 3DVLA 1SG0A 1NMQA 2Z8YA 1R0LA 2BI8A 3DSRA 4HWPA 4K28A 3AEXA 1YC5A 5KYYB 1ZONA 3DDWA 3HP1A 1XTJA 1V4NA 2C4VA 2GYWA 1QAQA 1TT5B 2QI9F 2ECQA 3TO5A 4ZK2A 5KWSA 5CD1A 1BO6A 1ZSNA 2H4YA 3TE6A 1BDJA 1JVNA 1B0UA 1T5LA 3MRVA 3UK6A 3E22B 4LXTA 1E0DA 1FMFA 1SHUX 3GZNA 7REQB 2AB0A 3ONVA 2EFCB 2OKCA 3GPCA 4XM0A 3ZI7A 1DAOA 1GGMA 1TZ2A 1N2CB 3OH8A 3PL5A 5JZSA 4JLPA 3BD6A 3H3XA 2RFLA 3G3EA 2BKLA 1RWPA 3KL2A 3W2GA 1PVOA 1RYBA 3M1IA 1JHXA 5JSFA 1R6BX 3NEPX 1CNFA 5HBGA 4DM7A 3OCYA 1C3OA 3GIDA 3FRJA 2VHEA 4YMUA 4A2QA 4P3XA 4KNYA 3A14A 1P2BA 3AUKA 3D7MA 5C8YB 5HM8A 3CKYA 2NXCA 4TOIA 4M0EA 4XDGA 3BCHA 5AXDA 5LSAA 1GSAA 2NG1A 3PD0A 3R0XA 3ELDA 3WA6A 2UYOA 3DDHA 2LZ0A 4Z0HO 3EIOA 1JXQA 1VMKA 2NYVA 4LCJA 1QDLB 2NYRA 1HTTA 3I9NA 2C4UA 1XQ1A 4MAFA 4QOHA 3KLNA 4HNAB 2BCGY 1QPBA 1CQJB 3B38A 3LPNA 4L5JA 3CNEA 2C2HA 2OOSA 4EJFA 5TPWA 1E1MA 1B3BA 3KS9A 1WXEA 4EHAA 4KIUA 3BWXA 3EOBI 4HHEA 4NBKA 2CLFB 3TIFA 1BD3A 1JBQA 3R4CA 3PDIB 4JVMA 2O20A 1TEVA 4GM4A 1AZSC 3AEUB 2PMBA 2P4QA 1CUUA 1N0HA 3R6GA 4D6YA 2VJMB 1REQA 3O9MA 4RK5A 4BVBA 1J2JA 3JASA 2CXUA 3JV7A 3PFNA 1JKXA 4LBYA 4P1ZA 1L5HA 5A1JA 3L8ZA 1NSTA 1P7YA 2I4RA 5DYWA 3ZNOA 5K6TA 1CQXA 2AG1A 1M0EA 1Y7LA 5U1PA 4H4CA 5IMBA 3M3DA 4X44A 4P0PB 1ZLYA 2AV6A 2GK4A 4TMWA 2EC5A 4GLOA 4KFRA 3DOCA 4AMYA 1M34E 2ZPUA 3STWA 3L6UA 3TD2A 2O8FA 3F4KA 3ZY4A 3IVXA 4ZAVA 3TI7A 2CHQA 4B2LA 5JEEA 1WLYA 2HJRA 3G49A 3OO0A 5A3VA 3RTCA 2FV8A 9LDTA 2HRQA 2P2GA 3HS3A 2W4MA 2JKYA 2P4HX 1P2FA 2G9ZA 3C1OA 4BWYA 3IQHX 4GIBA 1KI2A 2G7MC 1RKUA 2DY1A 4LGVA 1H42A 4MSUA 3OIFA 4OUKX 4TXNA 5EI5A 1AE1A 4YIKA 1AO3A 2DSTA 3B82A 3EQZA 1MJGA 3BZBA 4FFMA 4A92A 4DLTA 1CS4C 2WINI 3LDAA 3ND9A 3V6MA 1P18A 3WZLA 4NECA 4YFVA 1JMVA 4GMGA 5J9FA 2AQHA 2IYUA 1NBIA 1AKUA 2ZB8A 3HBNA 4RCZA 4RW0A 5IP5A 1RYZA 1THMA 4GRAA 3X3HA 4EABA 1NJ1A 2VPXA 1I10A 4MA0A 3ZV4A 1ZN2A 1LD3A 5BQ3A 4QU8A 2XUQA 1PGNA 2OCYC 4QBHA 4DMMA 4CF7A 5KWIA 3HADA 3NALA 3FCXA 4K6HA 2DHEA 4YHBA 2X1VA 5EP3A 2NU8A 1DAFA 4EB0A 5IFLA 4KN6A 4U02A 2VN8A 1HM5A 4E5KA 4EG8A 2EJVA 4D2IA 1QZTA 4R83A 4NQZA 2HXYA 4GGMX 5DTMA 5CH3A 1YI8A 2I3GA 3WMEA 4XYMA 2WYHA 3EVGA 5JO9A 4WQMA 4W99A 1R5BA 4QQFA 4HK4A 1JIXA 4X95A 3E61A 4JLDA 4NENB 3HVIA 4IWYA 4E30A 1N6RA 3QXHA 4DB2A 3PDWA 4D4IA 2VHWA 2EWMA 4KFSA 4CM8A 1ML3A 3EWNA 4PQEA 5A5EA 3BIXA 1XRNA 5H70A 5B1YA 4TWJA 3T1HB 5J3JA 3Q8MA 4Z4IA 2Z6AA 3AL3A 2ODNA 3QF4A 3RTGA 3FOZA 3JQ8B 1TQ6A 2QUZA 1V5WA 2HLPA 4ERNA 3IJPA 3ENVA 1N75A 1BW9A 1DG9A 3TH5A 4RQBA 2IYNA 3U7QB 1KIFA 2EKPA 3IP8A 4Y9UA 3WFZA 3R24A 4EHIA 3F8TA 4HT3B 1SXGA 4PGHA 4W5HA 4ZYLA 2ZM6B 3WRVA 2GCOB 4R8SA 3QNMA 3FCSB 2IZ5A 5JVDF 4XGIA 1ENPA 3G0IA 4DJTA 4M9RA 1GY8A 2AR7A 3FWZA 4BB0A 1ESCA 1FFHA 3R7FA 1ABFA 3TLGA 3ZZMA 2BHLA 1XHFA 1ZA2A 4BNGA 3WLLA 4U2KA 3AF2A 1I5EA 2VXOA 1FSFA 3P0JA 4JBWA 4P93A 4KPEC 4RHTA 1DXOA 1HKUA 1TIPA 2GVDC 2QVXX 3TNJA 1I0LA 1F8XA 1KMQA 1SU6A 2QXTA 2VDRB 4ZMRA 1VBMA 2VF2A 2XNSA 3ESBA 4IDGA 1JT2A 1V9CA 2Z04A 2JGLA 5FULA 5THXA 4ZGGA 4WACA 3FYCA 1P0CA 1A2BA 2P68A 3ES9A 3RTAA 1D4OA 2AGVA 1P73A 1RVDA 2AYZA 1E5VA 3PNVA 4H17A 2CLLB 1TW3A 4MJLA 1TM5E 5G0WA 4G8DA 3IP3A 3WGOA 4UE6A 3SYKA 4F6CA 3JAWB 1B15A 4MQLA 4F8YA 4WFJA 1FUEA 3VNUA 3LUCA 3BGVA 2IXEA 4AS2A 3I34X 1RU3A 2ZVPX 4ZODA 4NAUA 2J0EA 2P9BA 1GCIA 4IQ0A 1GFWA 4OHRA 4LF8B 2OOKA 2PT7A 3BXHA 3DWIA 3R3WA 2OG1A 4DSUA 4KREA 1J8FA 4AQ7A 3DWFA 3P9XA 1FTWA 1I9GA 1TVKB 3ZHRA 2W6OA 3TB6A 5D3MA 2SKEA 3TSAA 2WF6A 3K20A 1K75A 2Q1XA 3IESA 1WZUA 2QTZA 1RCFA 3AT1A 3IHWA 2AXQA 2CHVA 4V24A 3S2YA 4D8XA 5KOHA 3DB1A 3N8HA 3GEHA 4DZZA 1RXCA 1GA4A 2EOAA 1L6IA 3KKMA 4LPKA 5C1IA 5BMVB 1KI9A 5G3ZA 2EAUA 2BSQA 1O5IA 2YDYA 2QL7A 3SFZA 2M6LA 4TWZA 3U31A 2KHZA 2FUCA 4CR7A 3L0SA 1KZYC 1CK4A 1R8JA 4KQIA 1Q3KA 1A71A 3OQ1A 1CFJA 4YXFA 3ZHSA 3KD2A 3WGJA 3GP5A 1AUQA 2JA1A 1CQIB 3KELA 1T4GA 3GDOA 2ZU0C 5FNVF 5FTJA 3IEVA 1O97C 2WU0A 3PPIA 1NJGA 1R4AA 3W9YA 4AF8A 3PTLA 1MAWA 4ZO4A 4RJ2A 2XA9A 4IDNA 1HEIA 1K5HA 5CG1A 1PDWA 1EGHA 3RTBA 1LZKA 2QAJA 4GXTA 5IDYA 1EKXA 4FT2A 3D5TA 3DOUA 1M5TA 1KYYA 2QIOA 3PGLA 5TT1A 3ENWA 4TKZA 4Y2JA 4WKNA 2DT8A 3OZDA 1T8UA 3KEGA 4TVSA 5CX4A 4NR0A 2V54A 3WAGA 1UPUA 1MFPA 3NG1A 1A98A 4P5EA 1JEJA 1CRWG 4RPIA 2C2ZA 2CLSA 3JR7A 4OK6A 2BM0A 3EIWA 4M8SA 3FROA 5HM6A 4LBVA 1TM7E 4ZQCB 1AS2A 3GNSA 1NVUQ 4MRMA 5H02A 5T3YA 3VBCA 4AMVA 2JAQA 5BW6B 5BYJA 2W11A 5E7QA 4ALMA 7GPBA 2P0AA 4MPPA 2FJ0A 4F9EA 2QUHA 2FPOA 1DO2A 1QORA 4Q66C 2H3HA 3HKCA 4NYMQ 4YJFA 3DWEX 2JA2A 3RNLA 1TC2A 3PEUA 2W4IA 1F2UA 3ESQA 3QX7A 1O2DA 1SRQA 4KLRA 4B79A 2NTVA 2RJ3A 4XRRA 2HYIC 3GAFA 4RKEA 4B5LA 4B82A 1W5BA 1JQ5A 2YWXA 2TMGA 4UATA 3ZYCA 3HXLA 3EVAA 4WUTA 4Y6SA 3UMBA 5JXWA 1SOUA 1BX0A 1P6QA 1WNTA 2K2WA 1A72A 4ZVOA 3TTVA 4AF7A 5I9IA 5TC4A 1SD2A 3SC6A 1Y1KE 4V0NA 2HRZA 2BF7A 4Q9DA 4ENVA 2G5GX 3U56A 4GC5A 2O8EA 1CHDA 2A0WA 5CUQA 4R1TA 3FPHA 1UBHS 5F7ZA 3PJFA 1JAIA 3RIYA 5DTEA 1KFKB 2J3HA 4PYJA 3KSZO 3RK4A 1KI8A 4GOND 5K0FA 1KH3A 2LDBA 3HACA 3OZEA 2RD2A 5IH7A 1U7TA 4BX8A 1LWNA 2OO5A 1NY5A 1UWVA 2Z2YA 3L8EA 2GFIA 4FGJA 4UTVA 1BVHA 1Z2EA 1C9YA 5CT6A 4ZV4A 1Z08A 1QQBA 1H1LA 2A84A 3AXTA 3EASA 4II2A 4EYKA 1VPEA 2ORYA 3G88A 4KBFA 1ISJA 1HDXA 1XVAA 2WA2A 4MP6A 3D9QX 1I4WA 4P6VF 5BN3A 1S8OA 5F4ZA 4AZ3B 3ZCSA 3HU2A 5JD6A 3IUNA 4YJGA 5CVCA 2GO1A 1QP4A 1FZTA 2FEXA 2Q1YA 3DOIA 4H77A 1E1CB 3A7DA 1CZKA 1DWUA 4HXEB 2GM4A 4BV9A 5JNUA 2WMNB 3S2UA 2R6CA 3BAFA 3QRWA 4RK6A 2GRJA 2JGFA 2DX7A 4YMHA 5IC4A 1W4BA 5DNCA 1KNXA 2DH6A 1VL8A 3GLHA 2JAUA 4M0UA 4A26A 1CG6A 3MTQA 4UD2A 5AVTA 2OLKA 2DTXA 2Z4SA 1Q7CA 5BR1A 3RVRA 3E18A 2AEEA 3K05A 4MW1A 3DF7A 1ZICA 4HLNA 2W90A 1EQ2A 4IGEA 4LXQA 1BC5A 1EPUA 1JI3A 1PJZA 1JFLA 1P7WA 4QULA 1W2GA 1T8WA 3LLCA 4JLVA 3LY5A 2OUIA 1QWSA 3B5JA 4RVCA 1GPUA 1T1GA 1O9BA 2IP2A 3W5VA 2FF5A 1J00A 2QAGA 3WSVA 2QRQA 5K9ZA 1CF9A 5DOZA 3BXZA 1TOAA 3EG9A 4GZ6A 4XX0B 1RYDA 3FHOA 5IVHA 3ORFA 5LD2B 1K8YB 4LOKA 5H1YA 3N7TA 3CR7A 1TDJA 4P31A 1D2NA 1T4BA 4W1SA 4RPGA 3U7JA 5EPOA 3UMSA 3CVOA 2HFKA 3CIOA 4XUDA 4H7JA 3MMXA 1EH5A 1U9IA 1F7U