1RVDA

H-ras complexed with diaminobenzophenone-beta,gamma-imido-gtp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
160
Chain Sequence
b'MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN P21/H-RAS-1
publication title Guanosine triphosphatase stimulation of oncogenic Ras mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 57
structure length 160
sequence length 166
ec nomenclature
pdb deposition date 1999-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rvdA00
1FTSA 1N6HA 2HJVA 3HP1A 4ITRC 5K8TA 1COWD 5HCIA 5FR1A 1D6JA 3NEJA 3B85A 3HPQA 1G19A 4KLNA 2A5DA 3G5UA 3GLGB 1YZLA 5E3HA 3NDPA 4BFTA 2IYLD 3SBDA 3BB1A 5FFMA 1K5DA 3GD7A 1TL7C 1LF5A 1AQYA 2ZUCA 5FL3A 1GUAA 2QMEA 5JWOA 3FMIA 4V0MA 2UKDA 3K0SA 3O47A 3CH4B 1KI2A 2ZRGA 5TMPA 1R0YA 2OAQ1 1IXRC 2OLJA 2R62A 3M4YA 3WXMA 4BFSA 1IONA 4NYMQ 2Z83A 4NHOA 4UXHA 3OE7D 1E2JA 3ND8A 4IOMA 4P31A 4P4UA 1T3SA 5CYOA 5AK0A 4EPVA 5JEEA 3U44A 4D26A 1HY3A 2JAQA 4E03A 1JJVA 4AI6A 1GM5A 1TU4A 2ZRIA 3OFNA 1HTWA 2J0VA 3PUXA 5FUYA 2BDTA 3RAPR 4NYIQ 4B3BA 1NMXA 3QF4B 1G64A 1ZM7A 4PANA 4DLVA 2D3WA 3AUYA 3ZD6A 1FPMA 1RRPA 2ZRHA 4A1FA 2FJUA 2VP4A 4ILEA 4A0FA 1HE8B 1HV8A 3NWJA 4V0KA 2NO0A 2GXUA 1RFLA 3IILA 3KJEA 3SOPA 4C0HA 2NO9A 4WVFA 3RNLA 2ZS9A 4HLDA 2ORWA 4HUQA 4J0QA 4YMVA 4ZIRA 1UF9A 2W2XA 5M04A 3IPYA 4RD1A 1NN1A 1GSIA 3I32A 4A0GA 1S1MA 4B2PA 3W90A 3TR0A 1TUIA 3W8NA 3GJ5A 2JLVA 2V9PA 1JR3A 4TMWA 1E0AA 4GT1A 3CX8A 3PV0A 1XXHA 4QBGB 4RZUA 1M7HA 4GMXA 4CRWB 4NU0A 4DUGA 4HB2A 2W6JD 3FYHA 5CLQA 5IRCD 2QBYB 2AX4A 2HYDA 4B43A 3TH5A 1SXJC 3IEUA 4OK5A 2OXRA 5EUMA 1YVDA 1E1RD 3ICQB 1Z2AA 3T1OA 2QROA 4WW0A 5JJLA 4LBZA 3EWSA 3MRSA 1CXZA 3GJ3A 1OH7A 4MKFA 2IEZA 4GPTA 4DSNA 5L3VA 3DKVA 3R20A 1XMIA 1N5LA 3BH6A 3T61A 3GLFE 3AVTA 1G5RA 3CW2A 3Q72A 1OFIA 4HDQB 521PA 3O8CA 2RGEA 2RGGA 3IKJA 4B6FA 4BZXA 3CRMA 4B76A 1X1SA 3C16C 3HU3A 2V1XA 1XTSA 2XOKA 3PEVA 1W49A 1M7GA 1N0UA 4TT3A 821PA 3ZIAD 3Q7PA 3KL4A 5CM9C 5EE9A 3WRYC 4TMXA 3CBQA 1GITA 1K8RA 1R6BX 1C1YA 3LNCA 4TN1A 1WA5A 2MMGA 3HU1A 1ZD8A 4CZ2A 3A4NA 2JLWA 1VTKA 221PA 3U3MA 1NN5A 4M2LA 4ZDKA 2XNDD 2Q3HA 1UEJA 4ABYA 2VHCA 4TZ6A 4D4JA 1KK2A 3C41J 4M1MA 1EFUA 2ZI9A 1TX4B 2C99A 1XNJA 4QGGA 5LBIA 5KSYA 1U8AA 2OFXA 5FOSA 2JLRA 2ZR0A 3F8TA 3P4YA 5FBRB 3WYFA 4I4LA 3TJZA 4DSTA 4JLAA 4RD6A 4JZKA 5JWRA 3DKPA 3GFTA 4HB3A 5AUQA 4NPHA 4OK3A 5JBQA 3LLUA 4FCVA 1RJ9B 4X8HA 4GZLA 2W6ID 2ZTSA 3RS7A 2GCPA 3C7KA 1PUIA 2CNWA 1QG4A 2HUPA 4ACBA 1AA9A 1AZTA 1IXSB 5FUVA 5AJYA 4PHHA 3REGA 5JJKA 1A5TA 1NIPA 1S9DA 5KHOC 4LHYA 1P2VA 1TAGA 2X2EA 1KI9A 2ZJ8A 4JLKA 3IQWA 1GTVA 3KXLA 4WA7A 1L4YA 2J46A 2QZ4A 4KSCA 1F48A 1JEEA 3X2SA 1XEFA 4PAOA 1G5TA 4B3XA 3I3SR 2EW1A 1MO6A 1H65A 4LBVA 2O8EB 4EUNA 3I8XA 1VG0B 4QJ3A 2JLZA 3RABA 3RS2A 4EFMA 4IOKA 3RANA 3LQQA 4EFLA 3GJ4A 1A1VA 2WBLC 2ZSFA 3EARA 1E2QA 4PSAA 4YC7A 1E0SA 1E96A 5JLJA 2ZJOA 2EFGA 5CLLA 1G21E 1QVRA 2OZEA 2QI9C 3AB3A 4US1R 4D4KA 1XD8A 5FPKA 4TL6A 3L8ZA 3ZQ6A 4ASUD 1AJEA 2ASEA 1W0KA 4GNKA 4V0OA 1RW4A 2IYVA 3MG9A 4C0SA 2ZJBA 3ADBA 4BFYA 3RVBA 4HI0E 5FBVB 2P6NA 1E2IA 4HAUA 3NH9A 4Q7MB 4QRHA 4URVR 1JI0A 2HLDA 3I5YA 1DAHA 1X8KA 4TMKA 2OUKA 2YV5A 5JZVA 5BYKA 1T6NA 2ZS7A 4A2QA 2HXSA 4I1SA 3AF2A 1YU9A 5EE1A 2OG2A 3TBKA 3TLXA 4OKSA 4B3CA 4BEJA 5JCZA 5JHHB 4AIIA 2WPDA 1E4YA 3PJRA 3AEZA 1P2UA 4Z8XA 1XFAA 2E1RA 4EDHA 3X1YA 4EPRA 5DN6D 1KDTA 2CLSA 4Q19A 1WDTA 1N2CE 2LCFA 4B32A 1TF7A 3BD9A 1OB2A 1OH8A 1W5TA 4M9XA 3U2QA 4BECA 3K09A 1JAIA 2PMDA 1P2SA 3GEHA 4JVNA 1U99A 1S2MA 2REBA 2OO7A 4MUAA 2KE5A 3RHFA 3MJRA 1DVRA 2CVHA 421PA 3CLVA 1IOZA 1RZ3A 4FIDA 4LI0A 4P4SB 3PIRA 2FMXA 1IM2A 3GFOA 2OM2A 2GJ9A 4GP7A 2N42A 4IFEA 3VHXA 4AYTA 121PA 3GPLA 5CK5A 2Q9CA 1JALA 1EFHA 3T5GA 3ZVRA 2RGXA 1XEWY 2WKRA 3MUFA 4KVGA 4KVAA 2J7PA 5FI0B 4QHTA 3SZRA 4KYIB 3SE0A 2YOHA 3REFA 3VQTA 1PJRA 4GFDA 1XD9A 3A37A 2VA8A 4UJ5A 2YYZA 4B3GA 2VP2A 1G8HA 3OEEA 2A30A 2V7QD 4PX9A 2WWGA 1NP6A 4OJKA 2OSBA 1SVOA 3TKLA 2ZREA 1P72A 1R5NA 4E22A 3B13B 4V02A 2BJVA 2WJGA 4OBEA 3F3YA 5H70A 3RC8A 4IKEA 4R9UC 2EWVA 3PUVA 3BXZA 4FMDF 3QKRB 2JJ2D 3GLIE 5BW8A 3W34A 4O2RA 2JCSA 3B5JA 4MGZR 3D7MA 4M1KA 4KXFB 1EFRD 5FPTA 4D81A 1VPLA 2FF7A 1J99A 4LV8B 1KJYA 4DDWA 2K5UA 1MH1A 2V8OA 3SJCA 1BO6A 4Q9KA 1FMJA 2WOOA 3BGWA 4I81A 2YJTD 2F1JA 5CB8A 3LA6A 4IVQA 1N6KA 3GLGA 1Q1ZA 3JZAA 4XWKA 2NZ8A 3BB4A 2ZM5A 2ZYWX 5JMTA 2NMVA 1CLUA 3L0OA 3KZ1E 3OEHD 1W7AA 2G77B 1YZGA 4Z1MD 1G1MA 1W4RA 1NKTA 3ZZUA 2A5JA 4OHXA 1F2UB 3KUCA 5E7MA 4PZLA 1VG9B 2IUUA 1W1WA 3Q5EA 2ONJA 1G20E 1SQ5A 2WV9A 3WYAA 2WOJA 4OYHA 5FOTA 2JASA 1MABB 3RWMB 1VHLA 2UZ3A 3G82C 3K0CA 2OBNA 5CJ2A 1Z63A 3T12A 4KO8A 4LPSA 1JBKA 2H5EA 4C0LA 1E9AA 4Q01A 2R6GA 3KB2A 2PMKA 4L15A 3W3AA 2IWRA 3SQXA 4ZPXA 2VP0A 2FFAA 2QAGB 1W36D 1VECA 1KJWA 2OFWA 4A0HA 3AM1A 1KI8A 2IA5A 3DMNA 1OT3A 2ZUBA 1CJKC 1QHHB 5SZKB 3T34A 1N3BA 2OE2A 2R9VA 1XD2A 3RYTC 5EXPA 4DCUA 3MMPA 1R7RA 2G0NA 1F3OA 3MGCA 4KSBA 3T5DA 1LVGA 1XZQA 3EC2A 1E6CA 4JBYA 1V43A 4WZBE 4EJSA 2G0TA 5HCNA 4BEBA 1GZSA 4KV9A 1AN0A 1ZNYA 2KWIA 3QF7A 3B60A 1QRAA 4E5UA 3O8BA 2XJ9A 1CS4C 3FDIA 1L2TA 4PSVA 1G18A 2P3SA 5EE5B 1W4CA 1RRFA 3SFZA 4HUTA 1XJCA 2FE4A 1BMFA 2ATXA 5KO2A 5KPDA 4JLMA 4ERNA 4MGKR 1TU3A 1GILA 4PPNA 3U7FB 1VCOA 4OHYA 1CJMA 2WJVA 1C4OA 4QBHA 1KO5A 1KNXA 2H17A 3DM5A 3HDTA 4RJLA 5AUPB 4BLQA 1FNNA 3SR0A 1D9ZA 3U4QA 1G7RA 4PQYA 2WICA 2DY1A 5SZHB 1HYQA 3SJZA 2HJGA 4QM7A 2AXPA 1H8ED 2JIZA 1F60A 3LXXA 4OQXA 4X8OA 4DLSA 4DSUA 3K9HA 3TK1A 4DVGA 3Q7QA 4A36A 2HV8A 1MOZA 4JLPA 4XSGA 4TMZA 3LAWA 3ND9A 3ZVNA 4OHWA 4PHFA 3UATA 4IDHA 2PL3A 5DHFA 2OESA 5FTMA 1NVVR 2NZJA 4ESHA 3UWOA 1OB5A 4AKGA 5KU1A 3AV0B 3RLFA 2BEKA 2N46A 5L3SA 1D9XA 3HR8A 3IQXA 2CJWA 1Z0AA 4TLAA 2GAOA 1FMLA 4DLRA 3QKSB 4N3NA 5DYGA 1N6LA 3ADDA 4DLWA 4AKHA 1TEXA 3FKSD 2G9NA 1L8QA 4U02A 3DPUA 3ADCA 4O3MA 4UQOA 4Z54A 1Z06A 4LRWA 5E4FA 2BVNA 3KDSE 5HKKD 1GKIA 4M0LA 2IUSA 4O25A 1Q44A 3CF2A 4TQAA 3KTAA 1F2TB 4JIMA 4RZ2A 1N0WA 2ZI3A 1OKKD 3SS8A 1XCGB 4B47A 5FPYA 2VHQA 2IYQA 4MKIA 1IN5A 1SHKA 1U0HC 4Z51A 4ZDJA 1E2NA 3SQWA 2D2FA 2QSYA 4TYYA 1XTKA 1RPZA 1KZGB 1W44A 1G3UA 1HE1C 1NLZA 1CULC 2GF0A 2ZRDA 3KKOA 2GAAA 1E9SA 1CR4A 1Q57A 3WMGA 3OESA 4LJYA 1COWA 1A7JA 4HAXA 2FSIA 2ZE5A 1JECA 2SHKA 3P4XA 4IDOA 2WWFA 3EG5A 2J87A 3WBKA 5BQ5A 4Q7LA 4RD2A 1KDOA 1X6VA 3H0KA 3I61A 2DWOA 5FBLB 4RSGA 1BOFA 1N5JA 1U0LA 1Q3HA 3ZS9A 3BH7A 1FX0A 2CE2X 2O0HA 5AJXA 4UNRA 1M6NA 2QUZA 2NO7A 1Q0UA 1JQLB 2VYFA 3HU2A 5D3QA 1PV4A 3TUIC 3VU9A 4F4JA 2A78A 5B2ZA 3LBIA 2RGDA 4QHSA 3OE7A 3KKQA 2GJSA 5CYPA 2BMDA 4E09A 5K8IA 5EXSA 2GBLC 3BFVA 4ZDWA 4KHZA 1XF9A 4Q02A 1DAIA 4LC1A 3TW4A 1AS2A 1WQ1R 1OYWA 1XEXB 3SYNA 4CEHB 2O8FB 1GL7A 3FE2A 1T3LA 1G9XA 1ZM3A 3NHAA 4E07A 4D0NA 2CHVA 4B2LA 3LW8A 5C2JB 1VHTA 3FGNA 1TQDA 4GRAA 4Q1FA 2JLYA 2WWWA 1G8GA 1OXXK 4BUJA 2NPFA 2IF0A 2VH5R 1CR0A 2E87A 4IEEA 3IPXA 1P62B 1VDZA 4V0ME 3AF3A 3WNCA 1YQTA 2H18A 4BLOA 4Q47A 1T91A 2O8CA 3DZ8A 2O5VA 5HR5A 1W36C 1M74A 2BMEA 1US8A 2OBMA 4EQ6B 1ZMXA 4JYBA 1SVKA 3NBZC 4C30A 1QZXA 1IJFA 4PC6A 5DE3A 2ZSAA 2FOLA 2RGNA 4PC2A 2F3TA 2C5LA 4CDGA 3VR2A 1EFTA 1OV4A 2QT1A 4ARZA 1P9NA 2W6JA 2W58A 2VIIA 2EU8A 5JS7A 2O8BB 4DC9A 2TMKA 4UNNA 1VMAA 3B8HA 1IN7A 1KDRA 1E1RA 3E1SA 2GVZC 3KQLA 4PSKA 2CL6X 2ZJZA 2ZRAA 2DFNA 4JLBA 4QL3A 2WSSD 2ZJAA 2KJQA 4LJAA 3UG6A 3UKDA 1R10A 1U8ZA 1E1QD 4XWAA 4CYMA 2YWGA 3BOSA 4XTCS 2RMKA 3H86A 2ZI6A 2FEOA 4KBFA 2J0UB 1N5KA 4DWJA 4NBSA 4QJ4A 2YKGA 3K09C 4JBWA 3ZIAA 1YR9A 3W5IA 3SYLA 1AS3A 4LCBA 1OIVA 4F93B 2ZSBA 4DT1B 3JVVA 3WY9A 2CCJA 2GJAA 3LVQE 4D4LA 4TYWA 2QRNA 2ZRFA 3IDQA 1GIAA 2FGKA 5TVKA 1T5LA 2FNAA 4C7OB 2QTHA 1MO3A 2Z6VA 2ZVPX 3WRXC 1MR3F 2QPOA 2ZAOA 4MYHA 2XNDA 4BFXA 4Q4JB 4D2IA 4DBLC 4EIWA 1IBRA 1B0UA 3QXSA 2GEDA 1N0VC 3QPWA 1NLFA 4XD7D 3RSLA 3NDBB 1KI3A 4MA4A 2WJIA 3FHOA 4NCNA 4Q00A 1VCNA 1Q3TA 3CIOA 4EPWA 2VRWA 1GRQA 1D5CA 1FQJA 1CR2A 1KSHA 3FMFA 4XVUA 2XXAA 1R0ZA 3LRPA 5CM8B 5SZJA 2H92A 2I4IA 2AFIE 2YHSA 2G83A 2OT3B 4KFSA 4RFVA 2ATVA 3VNUA 3MAAC 2W6IA 3W8RA 1UEIA 2NQ2C 1RIFA 4OQNA 5GJWC 1KSFX 2GEVA 4URYR 2QY9A 1TNDA 2FG5A 3O8DA 2PJZA 3KQKA 2VP9A 2IYZA 1DPFA 3D3QA 1IHUA 4DEYA 1MV5A 2CMKA 4HZIA 2V1UA 5EQTA 4EFNA 2J3EA 3I5XA 1EFCA 2FPLA 1E32A 1Z0JA 1A2KC 3KJGA 4QBFA 4L4UA 4PC3A 4YMTA 3U3JA 2IT1A 2R6CA 3GJ0A 1SVMA 3GJ7A 2BEJA 2NGRA 3RS5A 3NH6A 2DFTA 2GK7A 3NKVA 3FMOB 1E9DA 1WP9A 3LLMA 4PO8A 2KBFA 3THXB 2IXFA 3DM9B 1E9FA 5E95A 2Q21A 2Q0HA 3R9XA 5DGXA 4XWOA 1M34E 1TADA 3S1AB 2IYWA 2ZS8A 3K0EA 4HB4A 4TQ9A 4G5QA 4YDSA 4HLQB 4S2EA 4ASUA 3LX5A 3B1YA 2QL6A 4BLPA 8OHMA 3PQCA 4C2UA 3K0CC 3B1ZA 1IN8A 3GP8A 1J2JA 3EC1A 2C9YA 3G0HA 3H2YA 3WP0A 3PUYA 4Q7JB 1W0JD 2VP5A 5A5GA 1HQCA 3T1VA 4HSEA 3A1TA 2YWEA 3BRWD 1V5WA 2FZLA 3WHKA 4MRVA 5ANRB 4CEJA 5GJBA 3KKMA 5EE0A 4A2WA 3AVOA 5J4HA 2O8DB 2CVFA 3VX3A 3CRW1 4M1SA 2R44A 5DN6A 5TXGA 3A4LA 2DWPA 5IT5A 1SXJB 4DEXA 3L8YA 2P6UA 2QPTA 3ASYA 3EIHA 1N6IA 2WIAA 4EJSC 4PAMA 1JNYA 2B92A 4D0GA 3V4RA 2BBOA 1A4RA 1G7SA 4TMTA 2X2FA 1SKYB 4FD2A 3FTQA 1E2GA 3SNHA 4A8JA 4ACAA 1GVNB 2X77A 1ZUNB 3FKQA 3VTKA 3Q9LA 5J40A 2ODEA 3AP2A 1TPZA 4Q9HA 4LYAA 1IY1A 4L5BA 1RKBA 3KX2A 2F1RA 4RD4A 1S3GA 3KKNA 2XEXA 5HE8A 4NYJQ 2G1KA 5GJCA 5HTKA 1Z6XA 1Z3IX 3C5CA 4OQMA 2AKYA 1XMJA 1G41A 1YJ5A 2P5TB 1AS0A 3F0TA 2QQ0A 2IBMA 1AGPA 3RRMA 1S3SA 4NYMR 1T3HA 2WHXA 3WMFA 1Z0DA 4IOJA 1YRAA 1IY0A 1Q21A 3WP1B 4A6XA 2V4ZA 2ZRNA 2V7QA 4K8OA 2W00A 4A0RA 2D62A 3GLIA 2PZGA 4C9BA 4JBXA 4LBWA 3H84A 4YXWD 1OFTA 4B74A 4DCSA 2F9MA 4AD8A 4RFSB 4JL6A 2D4HA 4LJ4A 4LJ5A 4Q4AB 5F9FA 2VQSA 3K0FA 5DI3B 1R0WA 3EPLA 2GCOA 3CX6A 3UMRA 3N2EA 2WJYA 3AKEA 5B58C 5EP2A 2JGNA 2RAPA 4LX0A 4GZMA 2BV3A 1EFRA 3SJAA 1ANKA 3AKYA 1R5OA 2PX0A 1U90A 5DYIA 2A3RA 1ZINA 3IEVA 3UMSA 1FW6A 5IF9A 4DRZA 1KNQA 1K5GA 2JATA 4Q4LA 4DCTA 3DZDA 3W6OA 2CHGA 1BS1A 1NRJB 4MQBA 1AKYA 2YC4C 1UM8A 2GBLA 3QUSA 4Q5IA 4UJ3A 5LB4A 1OSNA 4WZAE 3UANA 4A15A 1E79D 2ZEJA 5FUWA 1ZCBA 1DE0A 5JI3E 3MCAA 3LFUA 3OEHA 1KI6B 2Q3FA 2VLIA 3A8TA 4FN5A 4Z1MA 4XVRA 1KSJA 1VG8A 5F9HA 1FL9A 1NKSA 1U8YA 1FUKA 1TQ4A 2P0EA 1E2HA 3TGPA 4UNSA 2AFHE 2BMJA 4MDFA 1ZNXA 2CBZA 5JSZB 1KI4A 5DH9A 2ZRLA 3K53A 4AK9A 3NBXX 1VYUA 4NCJA 3QENA 2FPKA 5P21A 4NMMA 3QOFA 1JAHA 4PC7A 5TARA 4C0KA 4LYFA 5H8WA 1GKYA 4IEIA 2VTKA 1DEKA 4LPKA 4A9AA 3C8UA 4R2HA 2WWXA 2QN6A 1II8A 3MFYA 4NE2A 5DI9A 4KLZA 2R65A 2GK6A 1VYTA 3EX7C 4R7ZA 1KI7A 4BFWA 1PVOA 2H16A 2XZPA 1TF5A 1E3MA 4AYXA 2R6AA 1VIAA 3SHWA 4RKFA 3A1UA 1AIPA 1NN0A 4NCHA 3R7WB 4LBYA 2WAXA 2CK3D 2ZR7A 1HT1E 3THOA 3UWKA 4KI0A 2IUTA 1LY1A 2BCJQ 2G3YA 3LQRA 1UBFA 5GJVC 1E2KA 3E2IA 5DLQC 4PAQA 3J81k 1QHYA 3FHCB 4D6PA 1JB1A 2B21A 1QF9A 2KBEA 2WMNB 2VHUA 4LDJA 2QENA 1NVUQ 4O2LA 4C4PA 5K8LA 3GLFA 4CEIB 2F9LA 2QEQA 5A4JA 3CM0A 1ZVQA 3D31A 4IJMA 4IOLA 2AR7A 5FUXA 3TSOA 3NHBA 1I4TD 1XTRA 1KYIA 1Z08A 5C4MA 4TL7A 1Z28A 1KIMA 3RWOA 3TSZA 3B6EA 4HYYA 1ZUIA 3THWB 4PPQA 3VR6A 2XGJA 4EPTA 3B9PA 5EZ6B 3TAHA 1II9A 1ZIOA 1H8EA 1FFHA 2Y8EA 1GRRA 3TE6A 1UKVY 4P33A 1XB2A 4OI0A 2DHRA 1SXJE 2PCJA 1OYYA 1SZPA 5J4LA 4Q1EA 4MRSA 2VPPA 4BLRA 3BORA 3GLHB 4GOXA 1GL9B 1UKZA 2ZJYA 4LJ7A 4OL0A 2RGNC 1C9KA 1WBDA 3SJBA 3THYB 2HYIC 2BJWA 3IHLA 1SKYE 1SVIA 2QQEA 3K9GA 3B1WA 2V6IA 5H68A 5LDDC 5EP4A 5AR1A 1ZW6A 1OHHA 3PENA 4Q4HA 4DXAA 5E7JA 3ZQJA 5BXQC 1DAFA 1RC8A 3TQCA 1XU4A 4IDPA 2FFBA 4W9MC 4LGMA 1D2MA 1I2MA 1NY6A 4UXJA 4XTRA 3RRZA 3FKSA 3A36A 3L82B 4QBIA 4HAVA 3GCGA 2GA8A 2IX3A 2GVDC 4QJ5A 1P5ZB 2R6DA 4MYTA 2F43A 4IVPA 1KMHA 2XOKD 4BE7B 4ZI2A 3K70B 1KGDA 1KO8A 5HKKA 3K0AB 4ZI3A 2PT5A 2ZITA 3C5HA 2AK2A 3B82A 3TSWA 3FFAA 4D82A 1XBTA 2JDID 3IGFA 3QG1A 3W9YA 3BJIC 1OKKA 1QHNA 2XTMA 1N6PA 2ZE7A 4FWIB 3OAAD 2QG6A 4QKQA 2NTYC 1BYUA 4NZYA 3MSXA 2QMHA 4RCYA 3CPJB 2FFQA 4Q9IA 1P75A 2QE7D 4IXMA 3MWLA 1Z07A 4YONB 2RHMA 3P27A 3PG5A 2IC5A 3AP1A 1HEIA 3IIMA 3DVLA 4HAWA 4HZUB 4DB4A 3U61B 3QE0A 2EYQA 4UKDA 5AWFC 1XPRA 2A2ZA 2Z0MA 1T8UA 3CPEA 3SFVA 3AF4A 3KKPA 1ODFA 4AYWA 2W2VA 5C1BA 1CIPA 1QHSA 3BBPA 2IEYA 4Y0AA 1ZU5A 1UPTA 2JEOA 4U00A 3QPVA 4MYCA 2GEUA 3EWAA 3F5FA 1MRNA 1CRPA 2IF2A 2CL7X 1NBME 2ECKA 1CTQA 4AWXA 5CDFE 2P6RA 4RVCA 2OILA 2PZFA 4ZCLA 1W4BA 2FX3A 5KOYA 2ZXUA 1XMVA 2IW3A 2FV8A 2WM9B 1T0JB 4YQFA 2GXQA 1DAGA 1XCMA 2CCKA 1DO0A 3QF4A 1E2PA 2D7CA 1QHIA 4TQUS 2GCNA 1NVVQ 1DS6A 5FTLA 3UMFA 2IK8A 4IRUB 3AUXA 3KQHA 3NIBA 4AKIA 4L16A 1AK2A 1O3YA 1Z8FA 2O0KA 5G53C 4D80A 4C2TA 4PHTA 5BN3A 4LJ9A 3EPJA 2QGNA 1XTQA 2ZETA 1ZU4A 2P65A 4PTLA 2FSFA 3EAQA 3MD0A 4FXPA 1BKDR 4NH0A 4B35A 2QM7A 1NSFA 1NVXQ 1Z6AA 2CE7A 1W48A 4JVMA 3U44B 1DAMA 4HAZA 4L8GA 1ZP6A 2IYSA 4KAXA 1UBGA 2QAGC 5DNYB 5DIFA 4A92A 5CJPA 4K46A 3SYKA 1S1CA 1VKJA 3Q85A 2ERYA 5L3RA 4HLUC 5D3MB 3M6AA 1RRCA 4PQRA 3EA0A 2EYUA 2YNMA 2QBYA 2IXGA 4QNMA 2F3RA 1G17A 2GNOA 3FOZA 1PUJA 1KO1A 2I1QA 3X1ZA 2GKSA 1OF1A 2EFHB 4DCVA 4UNPA 5EUQB 4HUQB 3Q5DA 4ZIRB 1BIFA 2G88A 4Q18A 4FMCB 4C3ZA 5EXTA 2AWNA 3FMPB 1SVWA 3LBHA 3U6BA 2FN4A 1Q1QA 1MT0A 5L3QB 3GJXC 3AVYA 4CGZA 2OFOA 4O0MA 2OCPA 4BPBA 2WSSA 1OXVA 2O52A 1XXHB 1FZQA 1R2QA 3KQUA 5EXXA 1E1QA 1U2RA 2ZRKA 5LD2B 3Q8XB 5FH9A 2VSOA 2DWQA 2A7QA 2FFHA 5J4KA 3P26A 4D4MA 3MWJA 2HT6A 1E2LA 4TYQA 1BYIA 1KK1A 1L7VC 2BBTA 2GJKA 3U6KA 2GXAA 3NBYC 1EG7A 1UBEA 1NF3A 4N0DA 4IDNA 1VIYA 3AKDA 5KPJA 3WNBA 3GLHE 3M1IA 4JJKA 1TQ2A 4A8JC 5GVRA 3EPKA 5JJIA 1XWIA 3ONWA 3KXKA 3HYTA 4HEJA 1EXMA 4K81B 1E9BA 2XZLA 3OIWA 3SU8A 1TQ6A 2NPIA 1WXQA 2ZANA 4JKIA 1JR6A 3QVUA 1H8HD 3TQFA 1KMQA 2VSXA 4XD7A 3R9IA 4JLJA 4B34A 2QTFA 3PCRB 5JI2E 3R9WA 3ADKA 2QM8A 3FWYA 2PEYA 2HEIA 3T1TA 3ZH9B 1OXSC 5IK2D 1E4VA 4LK2A 1RJ9A 3V00A 2ZQ5A 3U5ZB 2QPAA 5F2EA 1J70A 2NG1A 4NCIA 2QMUA 3EZFA 4QGAA 4FWTA 1EESA 1P73A 4M1WA 1G291 3R8CA 1YZUA 3RRNA 4X8LA 3L43A 1NIJA 2IYRA 5FL7D 2BM1A 3W3ZB 2IYYA 4Q1CA 1DTSA 2YVUA 3QKTA 4XVQA 5UKDA 2XTNA 1U9IC 3RDPA 2N1BA 4DSOA 4PQFA 2AD5A 3VFDA 5KTYA 2O8EA 3QVVA 5KSZA 3NVAA 4G01B 1DO2A 4QGFA 1ZC3A 4HLCA 2C95A 2OV2A 3VAAA 721PA 1FP6A 3TVDA 3BK7A 4EKDA 2ZYVX 1XX6A 2BBSA 1U0JA 1YE8A 1DBSA 1G3MA 2W0MA 3LW7A 4JL8A 4L9SA 5SZIA 4BFUA 2WWIA 3GJ8A 4KU4A 5BN5A 2OCBA 3PEYA 1X1RA 2GTPA 1G3RA 1ZBDA 3H1TA 4LV6A 5KNCA 3AGQA 1XJQA 1Z0IA 6Q21A 4I1VA 4WZ6A 3AF1A 2B8TA 4AKEA 3RC3A 4MUBA 4KODA 2GESA 4NONA 4LJ8A 1EX7A 3QNUA 2CLDX 2H1LA 3NC1C 4FI3C 2BKEA 3B1VA 4B44A 2PT7A 1NG9A 1YHNA 2X1VA 1WE2A 1OFHA 1N25A 3LY5A 4G3XA 4ON9A 5FTKA 1DADA 1DAEA 3KJHA 2C2HA 5EE3A 3IBYA 1ZNZA 3QEOA 1MO5A 3A4MA 2VHJA 2AHOA 1W0JA 3IIKA 1AQUA 1MO4A 1WMSA 2OEPA 1R4AA 2A5FA 3QXJA 4WOPA 2CXXA 3DOEA 4Q1BA 1EX6A 1ELOA 3K9LA 1SXJD 5CB6A 1IY2A 4W7SA 2IYTA 1CRQA 3P1JA 1NI3A 1ZYUA 3I73A 3B78A 2F1HA 4V0NA 3DL0A 1E2FA 4ZCIA 4NTZA 2C03A 1HURA 2FSHA 3CX7A 1X86B 3HYRA 5AJVB 2ZE8A 1IAQA 1P4SA 1DOAA 1EWQA 3PUZA 1Y3AA 2XITA 2OBLA 4KFTA 4F4IA 4P4SA 4M9QA 5FPSA 2DB3A 2KSQA 3OIYA 4TLEA 2FEMA 5J4VA 1OPXA 3C14C 5AJZA 1ZAKA 2H57A 2C9CA 4B75A 4MDEA 2J45A 2QAJA 3NXSA 5TDHA 4LHVA 2AD1A 1CR1A 1CU1A 3KXIA 4R71A 2YWHA 4A82A 2VO1A 1JR3E 2ZRCA 3GMTA 4JVLA 3ZVLA 4BFVA 2ZI7A 2ZIAA 1A82A 2ONKA 3ZZ0A 1RYHA 1XXHE 4NKRA 4G5GA 1W2HA 3EZ6A 4JLVA 1LS1A 3NC0C 4D0LB 4IDQA 5AUOB 3UXMA 3B2EA 4TSFD 3WHLA 5GVSA 4BASA 2R6FA 3QKRA 1GP2A 2DR3A 2JLXA 3PXGA 2RGBA 1D8TA 1E0JA 1E9CA 3AP3A 4YXWA 4WXRA 2YINC 4FW9A 3WYGA 2FGJA 2HXYA 4URZR 1XTIA 4DDVA 2H7VA 2HT1A 3AVVA 2J41A 4GBMA 4LV5B 3QI2A 3VR3A 3TUZC 3IIJA 2ERXA 3EIEA 1KOFA 4LC0A 4Q21A 3ASZA 3GEEA 5EJEA 1K6MA 4JJZA 1T0HB 2WWYA 3IUYA 1NBMD 4FCTA 1OIWA 4Q7KA 4PR0A 4PZYA 3W5JA 2PZEA 2WJHA 2ZPTX 4F7WA 5J47A 3SN6A 2Q9BA 5A0FA 5FOVA 4AG6A 1Z5ZA 2OLKA 4C0QC 1R0XA 2ZE6A 4EPXA 4RKEA 4HAYA 1KTVA 4D25A 2C8VA 1NJFA 3BAFA 3LH5A 4EAQA 2CHQA 5J4YA 1E79A 1F2UA 1W46A 1E2MA 2RB4A 1SVSA 3AKCA 1XPOA 4KFRA 3CNNA 1PLJA 2ZRMA 3U7HB 2NOAA 2ZAMA 2ZSDA 1MABA 2R2AA 3NTUA 3TW8B 2AXNA 4M4SA 1FQKA 1U81A 2BIFA 2GZAA 2BWJA 1FUUA 4ZV4A 2ODNA 1CJUC 1KHTA 2AL7A 3IBGA 2NO1A 3QBTA 1NSTA 2ORVA 4G1UC 4R98A 4Q9JA 1KDPA 3EASA 4LHWA 2QAGA 1QBKC 3C15C 3DMDA 1AZSC 1Z0FA 3LWNA 4HB0A 3GJ6A 3BS4A 1MRSA 4TTQA 4AC9A 4PO9A 1QHHA 4KCGA 4QOSA 3M0EA 4HLUA 3QJYA 4TL9A 4QFMA 3IO5A 4V03A 3W6PA 1EK0A 3U3OA 2DCUA 5G3ZA 3KFVA 1T8TA 2DFKB 1I4DD 1XEWX 3KUDA 2WTUA 4XH9B 4I1OA 3U7GA 2ODBA 2JJ8A 1HH4A 5EZ5A 4BZQA 1Z83A 1P3JA 4ZDIA 1IQPA 2VL7A 3CKLA 3AVPA 3QY0A 2JJ1D 3WNDA 2CK3A 2F1IA 3LBNA 4Z8YA 2GHIA 4NL4H 3TMKA 1J8MF 4II7A 4LSGA 4WIAA 4M1OA 5TY0A 2QU8A 4LOAA 4TTRA 2VHTA 4OQFA 5D3MA 3ZVMA 4LHXA 5BYJA 1G4AE 1XD2B 2BOVA 2Z4RA 2C77A 1J90A 3CF6R 2FZ4A 3X1XA 1YRBA 4JSTA 2MSEB 1MKYA 1KO4A 4EJSB 3DDCA 4U7DA 2REOA 2QSZA 2XX3A 2H8KA 3BFXA 3EW9A 3EIQA 1E69A 3TVTA 2Q3MA 1JJ7A 2P67A 2QNRA 1X3SA 3QXHA 2MSCB 3DHWC 3AQ4A 3CR7A 1OFUX 2EFDB 3C4JA 3OIUA 4M1YA 5LB2A 5L3QA 5G40A 1Z0KA 4BWYA 4PHGA 4WAUA 1II0A 4DLUA 2C98A 1DG3A 2ZJ2A 1WBBA 4MRPA 2G1JA 5KSOA 4QM6A 2Q6TA 2YOFA 1KI1A 4F4CA 5KDDA 2IS1A 3BWDD 4BLSA 4JMPA 2LWIA 1AKEA 1HQYE 3W6NA 3U4QB 3ZJYA 3QKSA 3K8YA 3O8RA 3LV8A 4IXNA 3EA5A 4Q48A 1FTNA 2C78A 5C4GB 1KY3A 1TTTA 3KFXA 4GDFA 1G5PA 1SGWA 2EFCB 1W47A 3K70D 2KB0A 2LKCA 1ZNWA 4NYIR 3TUJC 2FU5C 3V9PA 4OI4A 1D2EA 1F2TA 2WWHA 4PC1A 4TYPA 1D2NA 5DSZA 1P7CA 3ICEA 2JJ2A 4GI7A 4QG7A 4G0NA 4OHZA 4B33A 4DKXA 5L3SB 2WJJA 1U9IA 2CJWB 4TLBA 2JDIA 4LZZA 4QHYA 4FMBB 2BC9A 2W2TA 3NBFA 3KB1A 2CEAA 2NO6A 3OAAA 4N1AA 4PO1A 1NG1A 5G41A 1SKQA 1GAJA 4W5JA 5F3WB 3CR8A 4HDOB 4RCZA 3SHFA 3ZDQA 1OIXA 2D2EA 1KZ7B 3ZLJA 2I3BA 4TLDA 3LDAA 5JS8A 4YMSA 2QE7A 4Q1AA 4TZ0A 3KTAB 1KK0A 1Q1EA 1IJEA 3TR5A 2OXCA 5KDOA 4YLGA 1G6HA 2QA5A 2XSZD 2ZUDA 3VR1A 2GILA 3VKWA 1XP8A 2DBYA 2DFLA 4XOIA 3KQNA 1NY5A 3QEJA 3CWZA 2OCAA 1PZNA 4Q03A 1G6OA 2WSMA 3HPRA 3TIFA 2WKQA 4MKGA 2XJ4A 2B7CA 1UBCA 2UZIR 4Q9LA 3VR5A 5E7IA 3IHWA 1N6NA 2FSGA 1DARA 4TTPA 1TUEA 2I1VB 1UADA 4MRRA 1YR8A 3A1SA 1JEDA 4M1TA 4XSHA 5IHPA 2B7BA 2V3CC 1YZNA 2VEDA 4C0BA 5FOXA 4ZKEA 4LWZA 5BWMA 2NIPA 2RH5A 4U5XA 1XEXA 4CEHA 4GOJA 4NYJR 4DLZA 2BCGY 4A2PA 1XPUA 2O8FA 1ZD1A 3CF0A 2JLSA 2IWHA 1W2GA 3HJNA 3BB3A 3NG1A 3VHLB 2E9SA 1FX0B 3CWQA 1ZM4A 3GLGE 4B48A 4KITB 2G6BA 1JXMA 1W4AA 3VU9B 1Z6TA 4Q66C 4RD3A 2BBWA 2IS2A 3DO6A 3OFND 4JKYA 1F6BA 2UVQA 3FPAA 3CZQA 4X8MA 1BH2A 1OXUA 1XMSA 3UPUA 2YOGA 4EPYA 3LX8A 1JPJA 2MSDB 4EQ6A 1CEEA 1KK3A 3GEIA 2HCJB 1CJTC 1GNQA 2D74A 3CRQA 3PR1A 4MKHA 2PLFA 4RZ3A 5K8UA 1E2DA 2J9RA 3P20A 1OE0A 1VCMA 1PLLA 2OCYC 2CL0X 1OLOA 1ETUA 5LPNA 2O8BA 1G4UR 3OZXA 2Z5FA 2W0SA 5KUTA 4CT4B 2W83A 1CF4A 4FCWA 1JR3D 2BKUA 2QTVB 5CK4A 2X8AA 2V54A 4CT5A 1VCIA 4URXR 3U60B 2O8CB 1XTJA 3AF0A 3I72A 4DUGD 1US8B 2PCLA 4UNQA 3MWYW 1B23P 1I4LD 3A1WA 3PUWA 2J0UA 3MJHA 1U94A 3RS4A 3RRYA 4MITA 4CW7A 5C46F 2WZQA 1Z6YA 2IS4A 3D6TB 4ARZB 4JSYA 2ZU0C 2FWRA 3WMEA 4DIEA 5HZKA 2P5SA 4R2IA 1GG2A 4DLXA 3CNOA 1G3QA 2QORA 3CZPA 4ZCMA 1KKMA 2CDNA 4GP6A 1GKUB 1KJZA 2LKDA 5FTJA 4XJXA 4DT1A 4DZZA 5KNDA 1ZCAA 3QBVA 1P9WA 4C7OA 1G3IA 3T15A 1E2EA 3P32A 4KBGA 4FMCF 4PZZA 3TNFA 3CRVA 3TRFA 2R8RA 4Q4JA 2QP9X 4TT3D 4F92B 1TMKA 3FHTA 5EP3A 2RGAA 4H1VA 1E9EA 1GDDA 1QHXA 3EXAA 4US2R 2IYXA 1JPNA 2C9OA 1ZM9A 1H8HA 2ZROA 5FI1B 4B2IA 4Q1DA 3BFKA 3N70A 3Q3JB 2ZI5A 4QC2A 3ZZTA 5AUNB 3QKUA 3VX4A 3PFIA 3U3KA 3RS0A 5IK2A 2A5YB 3L0SA 1LS6A 1LFDB 2XAUA 4M9ZA 4QXAA 4NP6A 5DISB 2RKOA 2YWFA 4GOKA 4B73A 4TLCA 2IHYA 4P32A 2ZVQX 5FOUA 3UIEA 3AVWA 1IN4A 3K70C 3I62A 3EZ9A 1G16A 5ELXA 1NLYA 2XNSA 1ZC4A 2EVWX 4PPFA 1DAKA 5JFGA 3AVUA 1OXTA 4M8NE 1R8QA 2ZYUX 5FL7A 1XZPA 2HF8A 3U3RA 1F5NA 4DLYA 4PFSA 1JQJC 5TV2A 2J7KA 1QDEA 2XXAB 4TYNA 1Z6GA 4HATA 1R5BA 2QP3A 5JWHA 2VSFA 2CNWD 1E9RA 5CIWA 5L8VA 1G7TA 1Q1BA 5FPHA 1WB9A 3THXA 1ZRHA 1XRJA 1OH5A 3MWKA 5HPYB 3A58B 5F98A 3SI7A 2J5XA 3TAUA 5C18A 1HUQA 4WXPA 4B71A 1IXZA 3S1AA 3BIFA 3CRRA 1HA3A 1Q12A 1ZJ6A 3AVQA 1GNPA 1M8PA 4WBSA 1NMZA 3OIVA 4B3FX 1JXOA 2O0JA 4L9WA 4G5SA 4KYUA 5AJWA 1RYFA 1XDBA 2ZI4A 4DIDA 1E0KA 1FNMA 1AM4D 4LJ6A 4DHEA 3LD9A 4MRNA 2WIBA 3X1WA 2PEZA 3VNVA 3LO5A 1GFIA 1P2TA 2AWOA 2F7SA 4G5OA 3QIAA 4QNRA 4MGIR 1N6RA 2ZSEA 4M9SA 4BFZA 2L0XA 4CF7A 2D06A 3RSOA 3CUEF 1W0KD 5IDVA 4GL2A 1Q20A 5B64A 2DPXA 2YC2C 2ZR9A 4KJZA 2O8DA 4C0JA 4N0EA 3K1JA 1SXJA 1R8SA 4IFBA 1Z29A 1UFQA 4P4TA 4TWZA 4BGDA 5FBWB 2HLDD 2IYUA 4JVSB 3L0PA 2JLUA 1X8LA 1HT2E 5B57C 1KY2A 2GWHA 4ZO4A 3U7EB 2ZJ5A 1ZD9A 4AY2A 3QPUA 3AH8A 3B7GA 1G7CA 3UK6A 2VBCA 1S0UA 2QGZA 5JRJA 2WPDD 4P0TA 1GNRA 1Z2CA 2GDJA 2J0QA 3LXRA 2C04A 2GETA 2FPMA 3BE4A 3PVSA 1AGRA 2VP6A 4CEJB 4P3YA 1XJ0A 2PBRA 3EZ2A 5JEDA 4AURA 2GZHA 4AG5A 1TF2A 4BRUA 3QSYA 5G3YA 4BLTA 4TL8A 1OH6A 2EFEB 4LY6A 2PH1A 1CBUA 4IHQA 3V4FA 1QHGA 2ORIA 2HF9A 1NVWQ 2WAYA 4FMDB 4OI1A 1ESMA 4NDZA 1CJVC 4A8JB 1S96A 5JHGB 1UKYA 2Q9AA 3OF5A 5DHAA 1ZIPA 1NJGA 3B1XA 1J8YF 4DCNA 1P61B 1SVLA 3X1DA 1G8FA 1Y63A 4KFUA 4RFSA 4TSFA 4JS0A 4Q4AA 5LD2C 2J7PD 5DI3A 1OHHD 4JLOA 4H9GA 1SHZA 2WVJA 1NMYA 4JT2A 5GADl 2WKPA 5FOWA 1M1YE 3OEED 4FINA 5DO9A 1S8FA 1VYVA 1ZUHA 3WBJA 4IVRA 4DLTA 4TMVA 2ANBA 3E5HA 5HE9A 4XIGS 3SDZA 3ZGXA 1NBMA 1X8JA 2ZRJA 2IHBA 3GLIB 3CNLA 4RY2A 3PEWA 4US0R 1GL6A 5CDFA 1QG2A 1S4QA 3T06B 2GF9A 1KAOA 3I92A 1L4UA 1KI6A 1T5IA 3B9QA 2XB4A 1OJLA 5FTNA 3K0FB 1CP2A 4OQLA 2GCOB 1G8PA 4V0LA 3CO5A 2AK3A 3QQ5A 3JZMA 3ZYCA 2XTZA 2HCBA 5JSZA 1VG1A 4BZPA 1TEVA 2ODWA 3GQBA 3VMFA 4YMWA 3H4MA 3RS3A 2A5GA 2ZU6A 2ZRPA 4I99A 3T35A 3AGPA 1NNEA 2IXEA 2RGCA 4JLDA 3UG7A 4A6PA 4MGYR 4YMUA 1E98A 1KKLA 2ZYTX 4OHVA 1KO7A 2C96A 3JVUA 1YR7A 4QGHA 2RCNA 1Z47A 3IO3A 4YDHB 5FR2A 5HZHA 1E94E 2MMCA 1GRNA 4HDCA 1LB1B 2QT0A 3N2IA 5CITA 2JA1A 2J1LA 5KYKA 1KAGA 3SBEA 2CLCX 2RHDA 3DEFA 2JLQA 2AN9A 3QXCA 4Y0VA 4LHZA 4W5WA 2ANCA 5FBQB 2Z4SA 4DJTA 3PEUA 3PITA 1LNZA 2GRJA 2EQBA 4OI2A 1Q22A 2AKAB 2PJRA 2F6RA 3R7WA 2V55B 1WF3A 2QP4A 3EZ7A 5CIQA 2OAP1 3L0IB 4F38A 1IN6A 2B6HA 2Z43A 4OK6A 2QRZA 3I4LA 4BRWA 4LYHA 4UXIA 2JJ1A 3FVQA 3N5CA 4CVNA 1W36B 2DYKA 4ESVA 3K9NA 3GFPA 3MLEA 4DDTA 5JCPA 4M22A 1II8B 4CEIA 2WMOB 1P60A 1P6XA 1YZQA 1UAAA 4M21A 4C0AC 4G5RA 1PLKA 4PPGA 2HDNB 2X19A 3OHMA 3VR4A 2BHRA 5KSPA 1M2OB 4A4DA 3NEYA 3THWA 1NN3A 4NCKA 2REXB 4JL5A 1Z22A 2FDCA 5JRZA 4JT4A 1QVAA 4MH0R 1BMFD 1WCV1 4URWR 4LUCA 2ZRBA 4GSYA 1LV7A 4OJQA 4POAA 1N6OA 1EWRA 1J7KA 4W5HA 1FP7A 5KDLA 1DG1G 2GZDA 1GOTA 4H1UA 3HWSA 1LW7A 5J5CA 4B3DA 4IW3B 1UDWA 3GLHA 1YZTA 3GLFB 2GJ8A 1YR6A 2A9KA 2GXSA 4RD0A 621PA 3THYA 3T1QA 1XCPA 1YZKA 2BMFA 4GMDA 5B30A 3EPHA 3CB4A 2JIZD 5JECA 3CH5A 2XZOA 2D7DA 4JYCA 2QMOA 1U98A 1W5SA 3FB4A 1RE0A 1WRBA 2V6JA 3FFBA 2PLRA 3VKGA 1ONBA 2PX3A 3R8FA 3E70C 1CKEA 1I2DA 3SC3A 3AVXA 1A2BA 3CONA 1P9RA 3ETLA 4MYUA 1DELA 3I8SA 4URUR 1T9HA 1E99A 3K0AA 1EGAA 1SULA 1LTQA 1NL3A 4BQSA 1T4GA 1S9HA 3VKHA 1LF0A 2B8WA 2XB2A 1ESNA 3BH0A 3L2OB 2YZ2A 2J59A 3LVRE 4DB2A 3QXXA 4Q4HB 5H1YA 1RVDA 5TB5A 1KSGA 3SEAA 2FH5B 1GWNA 1RRGA 1ZM2A 2VF8A 4ZKDA 1N5IA 1UDXA 4B6EA 4PXAA 4I1UA 1YKSA 3D8BA 3QG5A 2FA9A 4F91B 1UJ2A 4S35A 2EWWA 2F43B 2J0SA 5EP1A 1KMHB 1UKEA 3BERA 3KJIA 4HZUA 5BN4A 4JLNA 3A6PC 3I1FA 4DDUA 3ECCA 2BM0A 2IS6A 2F55A 2P2LA 3ZS8A 3ZD7A 1O87A 4LYJA 4CIDA 1OW3B 3CPHA 3A1VA 3HR7A 4M53A 2XSZA 3BC1A 3DOFA 1M7BA 4RZXA 1FOEB 1G8YA 2OHFA 2VF7A 5KNBA 2IL1A 2KI5A 2CCGA
chains in the Genus database with same CATH superfamily
2WJAA 3TQIA 1N6HA 2HJVA 3HP1A 4JMLA 3DT6A 1T43A 3KSUA 3MINB 5HCIA 4QARA 2IPMA 4N03A 3NEJA 1FVFA 4R84A 3B85A 3HPQA 4YP9A 1VSUA 3KPVA 2GVNA 3GLGB 5JOQA 1H6AA 1P1FA 3IQDB 4XM2A 5DIZA 1DFHA 3OTQA 1JE0A 5FFMA 1Q0HA 1LF5A 1AQYA 1TL7C 2ZUCA 3NKFA 3NU1A 3OLXA 5E6RA 3TUJC 3UWDA 4D4IA 4MQ6A 5JWOA 5FBZA 5IPFA 1YIDA 4JP3A 4X7PA 4V0MA 1SD1A 1P39A 2XCOA 3FYCA 4A5OA 1V8OA 3GEBA 3S99A 2ZRGA 3H5LA 1KVSA 4JI1B 3U4AA 2ZB7A 2R62A 4IV0A 4MICA 3WXMA 4F3KA 1NVKA 4Y6RA 4X92A 5GY7A 2ISSD 4BFSA 3DVSX 4MUEA 1AV6A 4PGMA 3M1LA 5A3RA 4GI5A 5AK0A 2DULA 1JAYA 3LVBA 2OC9A 3OETA 4P4UA 4CL0A 2WKSA 4D26A 1HY3A 4P35A 4P7FA 2V58A 3HS3A 1J6UA 1M2KA 1TU4A 3AW9A 3OFNA 2FSVC 1QO9A 4MUGA 1JIKA 3PX2A 5FUYA 4AS2A 4GE3A 1BWRA 2R5NA 4B3BA 4F04A 4LF8B 4PANA 3H5VA 3E05A 3ZD6A 3AM5A 1ADCA 2V74B 4BVKA 4H27A 2FJUA 4IS2A 4ILEA 3CEJA 5EHNA 4N4AA 1C3OA 1IUOA 1HE8B 1HV8A 1M0WA 2Y9MB 3FTDA 3KB8A 4HVTA 4KXMA 3SOPA 2I6FA 5JJCA 3NBAA 2QI9F 4HMQA 1K2VN 3OQPA 2P2CA 2RD2A 2C3UA 4HDNB 3UT5B 3VJKA 3TLJA 2IEIA 4KR2A 1UF9A 3U7IA 5M04A 3IPYA 4UMDA 5ALZA 4XUEA 1O9BA 4EKIA 4M6WA 2CMGA 3W90A 2ALJA 2VNAA 3LYHA 4TSRA 2YDXA 4URHA 5TE9A 4YUAA 1CHNA 1TM1E 1E0AA 3H13A 2R5WA 1BJTA 3M6UA 3CX8A 3WB2A 2ST1A 4YROA 3PV0A 4Z0PA 2CFTA 4RZUA 5JISA 1E8NA 4CRWB 3L46A 3VR2D 3O9ZA 4YRSA 4J6FA 5LM3A 5IRCD 2ZAYA 5CLQA 3VNBA 5I4KA 2QBYB 4B85A 3OPMA 1FF9A 3SDBA 1P5JA 4HPJB 4OK5A 4RLFA 5EUMA 1CETA 5DXFA 3CVWA 3SHOA 3H19A 3ICQB 4OKNA 4RTKA 4GRIA 4H0CA 1Y7LA 4D8WA 5BR4A 4DIBA 3L1HA 2L18A 3K72B 1PNVA 4YCCA 2FB9A 1PCXA 3BWXA 1OH7A 4MKFA 3FH0A 4P54A 4D99A 4WINA 1QWOA 3DKVA 2PVCA 2RHCA 2Q62A 3MM4A 5A0TA 1G5RA 4MW7A 2WDZA 4M76B 1OXKB 3IKJA 4B6FA 2WVAA 4BZXA 3CRMA 2ENUA 1C0KA 3RUHA 1ZS9A 2FEKA 4OXRA 3HU3A 4PGHA 4LAFA 1QMPA 3HBAA 3PEVA 1I6WA 1U4NA 2ZTUA 1SHUX 1M7GA 1N0UA 4TT3A 821PA 3ZIAD 3FF1A 3MQFA 3Q7PA 2R8ZA 3A7EA 4KW7A 1O95A 2J3LA 4MWGA 3KL4A 4HNAA 1VBMA 2J9XB 4U1RA 1Z7EA 3O75A 3TRJA 3L1VA 1D3AA 4W9NC 3LNCA 2XUPA 4K0RA 3H5NA 4CM8B 1GT6A 2MMGA 3C0KA 5CDYA 5EIEA 2GZ2A 3A4NA 1VTKA 221PA 2D0PB 5HNKA 5L6LB 1AA6A 3DDZX 3OOJA 1TA0A 2XNDD 4BXOB 1G8SA 4IV5A 4OO3A 4Y18A 3TLGB 4QPNA 4ABYA 1OLXA 2UUOA 4GXQA 2CLHB 2C99A 4FDMA 1KJQA 5EPUA 1XNJA 5LBIA 2DUMA 4MQFB 4G26A 2OFXA 4KGXA 5FOSA 5LCXA 3WWPA 2ZIVB 2JLRA 2ZR0A 3F8TA 3WYFA 4DSTA 4ESOA 2JGRA 5K0CA 2BFNA 5MDHA 3OKAA 4ZOQI 3OICA 1X7ZB 5AUQA 2ODTX 2UZ4A 3G0GA 2OV3A 1G0NA 2R4TA 1RJ9B 3AM4A 3AEQA 1JDJA 4NSNA 4TV8A 1HKUA 3ANSA 3BT7A 2GCPA 2HUPA 3OZEA 2FLKA 4L50A 3RF6A 2ZGVA 1O6GA 5DHQA 4MV3A 3REGA 1D4AA 1Q1NA 1EP9A 3CSSA 4JLKA 2E21A 4FKMA 1M1NA 1GTVA 3KXLA 3MTEA 3OX3A 2J46A 3OG9A 4P1ZA 4KSCA 1C9JA 1EE2A 1F48A 5C5DA 4Q05A 3PNMA 5JSKA 2Q3LA 1X0VA 3AFOA 4UCWA 5BW6B 2VUIB 3I3SR 2EW1A 1MO6A 1H65A 1NOKA 4C2AA 3HJFA 1U65A 1FXSA 3S70A 5CVEA 4EUNA 1VG0B 4QJ3A 3KTDA 4J43A 4KVFA 3CH7A 3B6MA 5GIOE 1FFEA 3L41A 4J0DA 3WLEA 4QPZA 1UUFA 2NYAA 2QF7A 3LQQA 3N2GB 4DUYB 1YCDA 1M6VB 4ZHQF 4DMKA 4R31A 3BJEA 1E2QA 4BNXA 4PZ9A 5BN5B 1C41A 1E0SA 1E96A 1IHPA 1QH0A 3PC3A 1Q5PA 2QI9C 1B76A 2ECQA 3AB3A 4LSMA 1YD7A 2AE1A 4KKXB 1I7PA 3FOBA 4US1R 3SZUA 3ZQ6A 5TNXA 1W0KA 1LV8A 2HAEA 1AX9A 2ZBFA 4MJXA 1Z4MA 1RW4A 4GX5A 5CJJA 5I8WA 3TN7A 2A4MA 4R1OA 3I5YA 1TCAA 2ZJBA 4TV9F 1OWNA 2HWUA 3WLQA 1F14A 4HI0E 2P6NA 1E2IA 4HAUA 5K2OA 2PS0A 1SBYA 1Z2NX 4Q7MB 2IVFA 3UV7A 3QPDA 4HBZA 1JI0A 3V8NA 5AVSA 8LDHA 4TMKA 1JJAA 1EFVB 4H16A 2CJYA 2J4CA 3MTBA 2N75A 3COYA 1TRHA 5BYKA 1EAMA 2ZS7A 3LDGA 4UEQA 4AUKA 1FSPA 4AJ4A 5JSYA 1QM5A 1V41E 1YU9A 3AF2A 1V2HE 3FYDA 2OG2A 3GC6A 3HI6A 4OKSA 2FXVA 4NBLA 1P0QA 4BEJA 5JHHB 2F3UA 3IT3A 3TLZA 3NV7A 5BV0A 2WT8A 1A97A 1ISRA 1P2GA 4F60A 2XVAA 1HEYA 4B3RB 5DN6D 2E18A 4C4RA 1UDAA 3D6UA 4Q19A 4ZCSA 2UUPA 3K5IA 1XNGA 3OHSX 1F5SA 1H05A 4XLTA 4AZVA 3BD9A 3AU9A 1W5TA 2YIDA 4JK3A 3OQ1A 5BV1A 2PMDA 3R75A 1U99A 2REBA 1FS5A 3RSCA 2R47A 1MP0A 2PK3A 5CFRA 3TFOA 1C50A 4EHDA 3IQFA 3KR2A 3CF4A 3U19A 5HBRA 1IOZA 3RJTA 3C85A 4UUAA 4W8GA 6REQA 3EQZA 2Z2ZA 1D0IA 3PIRA 1KE2A 5BVGA 4QGBA 1D5WA 2FMXA 2V7UA 5B4TA 1PT7A 1VBKA 2IHUA 3ZCPA 4I3GA 1LLDA 4YFYA 4Z49A 2ACVA 3V7FA 5EHZA 4PX3A 3MT8A 4MK4A 2ZUTA 5A5DA 1EFHA 2G28A 2FUG1 3E0QA 3PE3A 3T5GA 1GQ2A 5HWSA 2WU8A 4UHHA 1F0PA 2SKCA 4HY3A 3SZRA 4BRSA 2Q6IA 1W2WB 3VQTA 4XVHA 2QN8A 1XIVA 4GFDA 1DRKA 1XD9A 3A37A 3NORA 2VA8A 2YJ5A 1NZJA 3D0KA 4G9EA 4R2JA 4ER0A 3EAGA 3ZDEA 5J2TB 1GTRA 2J6IA 1MVLA 1G8HA 2YL2A 1CZOA 1RI5A 2A30A 3FRIA 4QASA 4X6YA 3ONNA 1EWVA 2B8NA 2UXBB 3I2KA 3IJRA 1U1CA 3KOYA 5EMMA 3L7AA 1P72A 1R5NA 3QBJA 5DM70 2WJGA 3EOZA 2FG6C 3IE2A 1XYYA 2YJ6A 2EWVA 4IKEA 4OHRA 5FLKA 4OQDA 4E5PA 2VJBA 3QKRB 2VYCA 1MQ9A 2BZ1A 2WHQA 1CS0A 4HWOA 4JCOA 3SIRA 3LF1A 4O2RA 4UAUA 4WUTA 4YI3A 2JCSA 3KT0A 4FX5A 3DC7A 2B2XA 2B5VA 2KS6A 5FPTA 4KQWA 2JS7A 4RHFA 5JNUA 3U26A 2V8OA 3IMFA 1SUSA 4MIOA 4TRNA 5DGHA 2MDTA 5EERA 3BGWA 3L40A 3MMZA 2PMFA 2XYRA 1BVUA 4UDOA 5HUQA 1V8BA 1EMDA 3OQ6A 4BV8A 2A0FA 3JZAA 2QNIA 4G8BA 4XQ0A 2ZM5A 4UTOA 2HPHA 3OI7A 3L0OA 4ZAWA 4A23A 1YZGA 4Z1MD 1G1MA 3IV6A 4JEUA 1W4RA 5CTAA 5IM4F 3VV2A 3BN3A 3RQSA 2B4QA 1C3EA 3FBWA 3KUCA 4XX0A 5TIIA 2IUUA 4C4AA 1ZQ9A 5AI8A 1RWKA 2AZ4A 2WV9A 1KORA 3I6YA 4I14A 2OHHA 4W5OA 3WYAA 2WOJA 4CNQA 2PZJA 3RWMB 1ZONA 4X1IB 4I5EA 2F3QA 3UKJA 1FP4A 1SVUA 2V7WA 4I5DA 5DYWA 1Z63A 3A2KA 3T12A 5F3DA 1XE3A 1JBKA 1KOLA 3SXJA 1N36B 3RAEC 2QAIA 3KJFA 4XGIA 4EDFA 5JASA 1QQ7A 2IWRA 4HRVA 2WUGA 1P18A 1F7VA 1KJWA 3RUFA 4ZO8A 2IGTA 3H9GA 4DIFA 1A5BB 5C5IA 4HGRA 3ONDA 4A7PA 1NBHA 1OI4A 3IAXA 2M9MA 1SXIA 4TUYF 1QHHB 5DU2A 5SZKB 2DM6A 2OG1A 2R9VA 2ZTVA 2AZDA 3NNSA 2FF5A 1Q91A 2HC9A 3STVA 3T4XA 3BIXA 4GI3A 4NARA 2G0NA 2GN9A 5SV2A 3IMCA 1ZN7A 1O96A 1V43A 5HKLA 2K87A 4JYMA 4EJSA 3C8MA 4C3OB 4BEBA 4KV9A 2CB9A 1IWPB 2C1ZA 1AN0A 1AO0A 2HA0A 5LLTA 2QDXA 4D45A 4E5UA 4FDTA 3O8BA 2A35A 2D5BA 4L08A 2BHNA 3K6JA 1RC0A 1DX9A 1Y7PA 3FSGA 5EE5B 1ZL0A 5JLAA 5GP1A 1W4CA 1HQDA 1SBCA 4FI3F 4RH3A 1QVWA 4BO6A 4J1QA 9MHTA 3SFZA 5KOHB 2AJ8A 1ZISA 3NRCA 4O08A 4YR9A 1K0UA 5KPDA 2WA1A 4ERNA 5AI0A 2IBTA 1D03A 4ND1A 2NU6B 2WTNA 5JCJD 1TGYA 5HXAA 4YVFA 5D7NA 5JBIA 1C4OA 3GUYA 3WKEA 3EVNA 4N6NA 2EEPA 1E3IA 2H17A 1ADBA 2WMDA 3HDTA 3ON5A 5AUPB 1PJTA 4YALA 3SR0A 4P0PB 2EL7A 4PQYA 2HTFA 2WICA 2F48A 2LPMA 2HSZA 3EGDA 3TJRA 2QHXA 4RHUA 5REQA 3GGPA 4TKUB 2HJGA 4AJLA 3ZZ1A 1SU6A 1HLPA 3NANA 4DLSA 1AU9A 3AZOA 2WF8A 4UM7A 5LZ9A 4NZNA 2Z6QA 1WD5A 2WJ6A 5HKBA 2FZVA 2XKAA 3GWZA 1A5AB 2PLWA 2BKAA 1XZJA 4F3NA 2JARA 5EWMA 2B78A 4JUDX 5HF9A 3LAWA 4OHWA 5ADWA 3JD4A 4TQGA 3UK7A 4IDHA 4N7RA 2PL3A 2NZJA 2BT4A 4K2HA 4D4GA 2P9YA 2NXWA 2MHCA 3CZRA 3UWOA 4AKGA 4FEGA 1NUUA 3OKPA 4DGQA 2ABWA 3L0DA 3AF5A 2B3TA 2UXCB 1D9XA 1QQ5A 1QU3A 3IQXA 1RVV1 3KSDO 4UE6A 4UEOA 4ZV9A 3ER9A 4ZVMA 3BWVA 3K8ZA 4FZ3A 1ZA2A 2QZZA 2XYQA 2WWTA 3G2MA 4LZOA 4RPCA 3T7AA 1KAMA 1L3BA 3EOBI 4R1UA 4U02A 5K3BA 5EUBA 2G9NA 3A28A 4IX1A 3WIEA 2H2HA 4C89A 3DKRA 4LMBA 4Y1EA 3ADCA 3EZGA 7ADHA 4W8HA 1XQ6A 1Z06A 2QRVA 3OP4A 1NVEA 5E4FA 4M98A 2YHAA 3KDSE 2WA2A 1GKIA 1T2AA 5HKKD 2XCLA 2ZUFA 1E6EA 2CNNA 3F6RA 2DJ5A 2XUZA 4LRSB 3WK9A 1DCMA 2PS9A 3HE3A 3PNLA 2Q4EA 3QHQA 3Q3CA 4QD3A 4HVLA 1IM8A 1MC5A 1Z37A 2ZI3A 3AU8A 4ZXPA 1YB5A 4L22A 3SS8A 4HH1A 4B47A 4I8XA 1TIKA 4R9NA 4HSGA 5CPBA 5AM3A 3BDVA 5AVVA 1WUIS 2WY2D 3DVQX 4ZDJA 3WWEA 3U6KA 1GAWA 4QPJC 3OC0A 1A71A 4X97A 3G5TA 1CULC 1CSEE 1CNFA 1J33A 2ZRDA 3EDQA 4PAWA 1FYWA 1WV1A 5IAAA 3CTMA 1FYEA 1ZSVA 1AQLA 2I99A 4TOIA 3TRDA 4Q4DA 4IMJB 2E4AA 3F5DA 3P4XA 4BLWA 2IKQA 4IDOA 4EJ2A 3DWEX 3W1EA 4YRGA 1ODTC 2E85A 3EG5A 4Y6PA 3K31A 2HSDA 1EHIA 1CY0A 1O77A 3HUFA 4MB6A 3BDAA 5CCEA 4JP2A 4NXNB 4RD2A 1KDOA 1R0LA 2G06A 3JSXA 1TO6A 3PNOA 2MR6A 2AFRA 3TO5A 1K89A 4C7VA 4FFOA 3AEXA 2FQQA 4IJVA 3HWWA 3KEGA 4GPIB 4Z3DA 4QX6A 1GGEA 1OJ7A 1GR0A 2VHYA 3RD5A 4JT9A 2EJVA 4MJ3A 3M8KA 1UJNA 3NYQA 2QR5A 4OHOA 4U2GA 3S29A 3RVLA 3TUIC 1WPRA 4JQSA 3P9SA 1R12A 4FGUA 2JHFA 4OV6B 1JDSA 4M8SA 3U37A 5B2ZA 1VIMA 1EJ0A 4QHSA 1VBFA 3ITEA 3KKQA 1NYRA 1MG0A 1TZBA 5K8IA 2BZGA 2BUAA 1EUCB 1BE6A 1HE3A 2RONA 3ZXYA 1DJNA 4ZDWA 4LC1A 3AY3A 3OA2A 1L6IA 2Q07A 5C9ZA 4Q9NA 1AS2A 4LNHA 4YAGA 1YC2A 3T3HA 2NP7A 1I6LA 3W5HA 3CLSC 4A27A 4I3FA 1LI4A 1TAUA 4BEVA 5KAPA 4YV1A 3UPDA 1RYYA 2A5LA 3PF8A 2Q6OA 4W5TA 2WUDA 2Z3ZA 3ZE9A 2R7AA 3DBVO 3QYFA 2G63A 2VDPB 2YXPX 2VZ9A 4Q1FA 2I91A 3K0BA 4U6NA 2ZT6A 4EA8A 3PJFA 4U0KA 2QVGA 1V8PA 2M1ZA 2GAFA 4GRDA 3V4OA 1CYEA 2O7QA 1Y5MA 4QUAA 3EXFA 5KTOA 1QFJA 1TCUA 3RJZA 2YZ7A 3T7JA 3DZ8A 4RHEA 5I51A 4OREX 2JZCA 3EFHA 1NW6A 3F2VA 2R751 4YIHA 1U8TA 3JTMA 2YNMD 4C30A 1VKNA 3HKBB 4COKA 4NOKA 4CJXA 4TGLA 1KS9A 1U1EA 1PJQA 5J59A 4KE6A 1BQ3A 3K4QA 3KRTA 4URFA 2GD0A 4HTFB 4F21A 1B8OA 4N9WA 1XCJA 2EKDA 3BFJA 1PS0A 3W5UA 1VMAA 4NZZA 3IKLA 1VKOA 3ASUA 1DKQA 1KDRA 5JV5A 3KQLA 5GGYA 4MW6A 1POWA 4C4YA 2CL6X 1FVXA 2R7KA 3KJXA 2IH2A 2JKZA 3G6KA 4QL3A 3V55A 2QLNA 2ZJAA 3R5HA 5M5BA 4AQ7A 1WULS 3D3NA 4M89A 4C5AA 1Q0QA 5H9WA 3C45A 1XA3A 2V9ZA 3DH0A 2W6PA 4XTCS 1U9ZA 2C2WA 1F2VA 2AEJA 2QN1A 3H86A 5F1PA 2J0UB 3HRHA 3MEQA 1XT6A 3R7AA 3UAZA 1MHTA 2JIPA 2IXTA 3H7AA 4DWJA 2IZ1A 4L1KA 1L4LA 2PKEA 2YWRA 1H5QA 3K09C 2CWWA 4CKCA 5MFZA 3ZG6A 3SYLA 1JLKA 3UHPA 1AS3A 4RVNA 4LVUA 3NBUA 3OY2A 3ZW7A 4YAUA 2ZSBA 2VDLB 4AB1A 1C8VB 2P9HA 3JVVA 1JH8A 3A4YA 3RT1A 2CCJA 5IT4A 1PQUA 4Z4CA 5KTTA 4TYWA 2COUA 2ZRFA 2YV4A 1RMTA 1WCYA 5G0VA 2Z09A 2FGKA 2HF2A 2CYCA 5TVKA 2XMPA 2FNAA 4JITA 2Q7DA 2QTHA 2I78A 1JU9A 1QIEA 2ZVPX 4CM3A 2QPOA 4MYHA 2PPVA 3O4FA 3THSA 5C1OA 1P31A 1AHPA 1VB3A 4KI7A 2RI1A 1E7YA 1WHTB 3QXSA 2B7LA 4XD7D 3OQHA 4CLHA 3KEMA 1YVPA 3I0NA 4NCNA 1Y37A 2XOEA 1ZLXA 4K86A 3VNRA 4K6HA 5E6UB 1Q3TA 1EK6A 3FMFA 4LHSA 2HOQA 3DE7X 3P45A 2ISQA 4GHWA 3LRPA 4C7XA 1X74A 5A04A 5K05A 2NUAA 5ADHA 4NBRA 1A9TA 3KUUA 4DQXA 4ZQBA 2G83A 1QYWA 4KFSA 4RFVA 1AD2A 4WXEA 1ORVA 3MAAC 4LOJA 1SPBS 1MO2A 4W1PA 4F2GA 4IDCA 3W8RA 4IUYA 1UEIA 4GKAA 1RI3A 5DCYA 4DMRA 1LNQA 3UPUA 1L7RA 1PKXA 4KV7A 2R0QC 2HJRA 3BSYA 2QY9A 3KR1A 5DVZA 4ZVVA 4M7OA 3WYCA 3NT5A 2DHEA 3OC6A 4QSMA 1DPFA 3NHYA 3BCHA 4AJJA 5AHKA 4DCMA 5EQTA 1L8XA 1TU0A 3IB6A 3MPUA 1KEVA 1GFSA 1NJSA 3QVXA 4L4RA 3UICA 1EFCA 1G6Q1 3HL4A 3DOIA 3I5XA 4N01A 1A2KC 1O5TA 3D6VA 1WF6A 1P8AA 4GMKA 1HT0A 4RABA 3U3JA 1AURA 4X66B 3T3OA 6CHYA 5SYMA 1YQEA 3GJ7A 4S2UA 3R6GA 2Y4OA 1ADYA 4HNUA 5C81A 1OI7A 1AGNA 5MN5A 3EDMA 3PA8A 5HM6A 2DFTA 2GK7A 3DCIA 3GWGA 4LDAA 5GOTA 4PCUA 4AO7A 2WM8A 3LLMA 2JGFA 3THXB 4RGBA 3ZV5A 2IXFA 4N48A 1EB8A 1GAEO 1L4FA 2KM1A 3HB7A 4IKOA 4DLLA 1W6RA 3LXUX 2VNKA 3P2IA 4OP2A 4DC1A 5LQAA 1AUQA 1EQ2A 1M34E 2YWJA 4D79A 1OTYA 1E7QA 2BDEA 2Y66A 2ZS8A 4M7RA 4YEDA 3WC4A 3RRXA 4M8LA 1PN3A 4S2EA 2NVUB 2XUKA 3DZCA 1VL0A 4O4HA 3B1YA 3TAXA 3UZUA 1GTL1 4BLPA 4BKQA 3PQCA 4MR7B 2V6BA 3OCYA 3IULA 4FONA 5BWBA 3GP8A 1IN8A 1HWYA 5KWVA 2J3QA 2JLBA 2EJCA 2VHXA 5GV7A 4I9GA 2C9YA 5AOVA 1V48A 3RR2A 1A9XB 5A5GA 4X44A 3UT6A 4N0QA 1ZK1A 4Z3KA 2EX0A 1Q7BA 5EWLA 3Q7EA 4WD3A 3MA0A 4HSEA 3A1TA 3SC4A 2QMYA 1V5WA 2WSBA 2B82A 1FNDA 3QXGA 1ZHHA 4GU5A 3Q3HA 4MRVA 1ZVVA 2C59A 5JU6A 3WJAA 4A91A 3I30X 1Z17A 3DMYA 2ZATA 1IPFA 3EVTA 4EW1A 4M86A 2RBEA 3CRW1 2YRFA 1TQ8A 3CLKA 2R60A 4DSZA 5L53A 4KZKA 4DEXA 2P4EA 3MLAA 3OJLA 3GVCA 3DEYX 1O6ZA 1K68A 1NXQA 2QPTA 5CUQA 4BQOA 4HN9A 4BQQA 5JXGA 5K0FA 2WIAA 4RPJA 3U1BA 1JNYA 5AVYA 1GPKA 3HXKA 1DP4A 3T3PB 2BJHA 4XQ9A 3V4RA 4QU0A 3OTHA 4EFKA 1UK9A 4OVKA 1A4RA 1GG8A 1G7SA 1V96A 1Z82A 2B4YA 1JJIA 4R1TA 4TMTA 1XA4A 4FD2A 4M3NA 4M8KA 1BEEA 3ZHBA 4F4IA 3P9NA 2X77A 5IFKA 3PFKA 1QPBA 4N40A 2H4FA 2P9TA 2ODEA 3PKIA 3GMIA 3C3KA 2EGHA 4Q9HA 1A69A 1IY1A 2X9LA 3KYDB 4L5BA 5G4LA 4EMTA 1L4EA 1S3GA 4BWFB 2XEXA 3KZCA 4ER6A 2VH2A 4G4JA 4L76A 1Z6XA 3N39C 3C5CA 4OQMA 1TTQB 2YNMC 1KQPA 4OIMA 1JHDA 4BO0A 4D41A 4EF4A 1EDDA 4H3VA 1AS0A 4Y3UA 4B6SA 4MPRA 1NATA 2IBMA 2NLOA 1S3SA 3L4EA 4R9SA 4YAOA 3RUAA 3AL0C 5B4UA 5L7WA 2BGTA 3L4BC 1HT3A 3CMMA 2JCXA 4IOJA 4MO2A 4BMDA 2G40A 3PSHA 4YCBA 3H9BA 1UBLS 5EVJA 2ZTMA 5IAEA 2V4ZA 2Y1OA 2YFKA 2ZRNA 2Q7XA 3OEYA 4CMIB 9LDBA 3DMTC 3AINA 4AUNA 4CKEB 2QTNA 4AJIA 1FJGB 4KQJA 1TJPB 1PD1A 3SNKA 2BMWA 4OXKA 4ZT4A 1DIRA 1TRKA 2D4HA 2MU1A 3GYBA 3MGBA 3RB8A 3TPZA 4Q4AB 3UHOA 4D57A 5JY6A 5IJ0B 1R0WA 1LTKA 1WKCA 3AIOA 3KQSA 4OOFA 3TF5A 4O4IF 1DWPA 3L8DA 4Z4GA 4QNNA 2V7EA 2J09A 3AKEA 3AFNA 4BTLA 3H2IA 2BFEB 3AIKA 1C3JA 5KVAA 2HK6A 4LX0A 3EVCA 1NVAA 3IBTA 3GXBA 4XLLA 3RGGA 3PL5A 2PX0A 1U90A 1HE4A 3R24A 5DYIA 3IESA 1XJWA 3RVKA 3I9FA 4OU5A 3V4SA 5LN1A 4LSZA 5A9SA 4XWTA 3UMSA 3ACCA 3BE6A 1BGVA 2IV3A 4LF9B 3Q6MA 4OAQA 3DZDA 1MF7A 3W6OA 4JXZA 4DJJA 5EUCA 2I1LA 4QELA 2CT8A 3QUSA 2GBLA 3I6BA 2ZBEA 4Q5IA 2FZKA 4UJ3A 3FGOA 5AW9A 5BWCA 1E79D 1NVTA 3CG0A 5FUWA 4FBGA 1SHJA 1EH5A 1SUDA 1FBTA 4MS1B 1JA0A 1KI6B 3I01A 1TZKA 3IKMB 1UODA 2OAEA 3EVFA 2BEWA 3LGSA 4MV6A 3FYTA 4ZJUA 4X85A 1U8YA 3JR3A 5E0KB 5C5CA 3ESBA 4XW2A 1TQ4A 1E2HA 3HNPA 2E2WA 2PGNA 2V7PA 3ZNQA 1PE0A 5BT8A 3BD6A 4UARA 4UNSA 4PX5A 4FGSA 1ZNXA 3LOQA 1ORRA 3HDYA 3ISTA 5FWXA 4CQNA 2A86A 5DV9A 2AQHA 5DNUA 1OFVA 2LDXA 3TXAA 3VC7A 2HDWA 2OO5A 3VVLA 3SR4A 3IDZA 1UBMS 4NENA 1PNRA 4JXXA 1WUTA 2A6PA 5KX5F 4Z3OA 3QENA 4JLSA 2FPKA 3EXHB 5P21A 3EBLA 4NMMA 5BN3B 3LUDA 2Q5LA 3FTPA 4FFWA 3T6KA 3WMXA 1ACJA 1FS6A 2VUSA 1ZX1A 1U11A 2YYAA 5FI5A 2HDHA 3S3TA 1P0FA 4DIUA 2AOUB 4A9AA 1B26A 3C8UA 3V48A 1II8A 3MFYA 3NV9A 4IZOA 4NE2A 4BWVA 4KPUA 3WDSA 2NP6A 4ZGGA 1QB8A 3EY4A 2WDPA 3I83A 1EA7A 4IQ4A 1VIAA 4PWYA 1NN0A 4FJ1A 1RTTA 4RQBA 2CK3D 2ZR7A 3BWEA 1HT1E 4KXUA 4DM3A 1JHVA 1HDYA 4EW2A 5DX8A 2EX4A 3KOUA 3CNBA 4XI9A 3OOSA 1E2KA 3E2IA 3QLVC 4P2GA 5GJVC 4CLDA 3J81k 4YV7A 3T3NA 5CGQB 3FHCB 3Q11A 4FQ8A 2B21A 2KBEA 2XYHA 4FK8A 4LDJA 5KYVA 2RHHA 1B16A 4O0LA 4EFDA 5KYXB 3SYTA 3M6LA 2F9LA 4BO9A 2QEQA 3HBLA 5A4JA 5KMGA 2DFPA 3D31A 1USWA 3BIJA 3FNQA 1I4TD 2ZCVA 1XTRA 1Z08A 4D43A 1GZDA 3R3UA 3PPVA 4OHBA 5DEIA 2I2XB 3DYVA 3H17A 3CISA 1NE7A 3HJBA 4P8RA 1DUIA 2GD2A 4UM5A 2ETXA 4B79A 1ZUIA 3K2IA 4H0FA 3H05A 4N5HX 5JNLA 1SKMA 3IOYA 3PQ4A 2B1QA 3B9PA 3JQ8B 3TD6A 1II9A 2DOKA 1ZIOA 1H8EA 3OE1A 4WV3A 1Y8CA 4LTDA 1FFHA 2Y8EA 1KFKB 5DX1A 5IJ9A 5EHXA 4YWJA 2E3JA 3N07A 2YN2A 3FYUB 2DHRA 1NZDA 1SXJE 1Y7IA 3AHFA 3OJ0A 4I36A 5CAEA 2R48A 1YF3A 3WRXA 2Q1UA 2VF2A 1SZPA 2NU8B 1QGDA 2VPPA 3RSHA 5A6VA 1LKZA 4PO3X 2WIKA 1BVYF 4YA6A 3GLHB 3JALB 1MGPA 2CV2A 1GL9B 2Z9DA 2ZJYA 3L7DA 4DPLA 1I1NA 2D2VA 3KK0A 6GPBA 2H5IA 1C9KA 2A58A 4HQRA 1IZ9A 4HAOA 3HLTA 5CXUA 3IHLA 5H68A 2QQEA 5LDDC 4CUKA 5EP4A 4ZTZB 1JRLA 3PENA 4Q4HA 4UDNA 4DXAA 5GZ6A 4LRUA 4CNBA 2HY7A 4EECA 2FFBA 3P8ZA 5B7GA 1D6NA 2Y1WA 1JPUA 3VISA 4OH1A 1ZHOA 1PX2A 3L82B 1T2FA 5LQSA 3GCGA 5IVHA 1WUKS 2GA8A 2CFOA 3MELA 2IX3A 2R6DA 4IYRA 2QIPA 3TEMA 2IY8A 4ZI2A 4WY2A 1FSFA 4QUDA 5U9CA 1KGDA 5KWIA 3K70B 3DE6X 4ZYLA 1M72A 3CKMA 1M2WA 2BI8A 1LLCA 2ZB8A 4DW8A 3CCCA 4G1VA 3TSWA 3FFAA 4R8SA 3REOA 3VZCA 1RKXA 4BNUA 3BJIC 4MI1A 2BFOA 2XT9A 1OKKA 5LOVF 5HJ2A 3E58A 5A3VA 3SD7A 1VI5A 2VAWA 5K4AA 1S01A 2BGLA 3L0ZA 2VYNA 3ZCUA 4BZZA 4YJ3F 3FRJA 3MINA 4RCYA 4WJZA 5HGXA 1WX1A 4ENTA 4Q9IA 1YB7A 1P75A 5B1EA 2P78A 4QSHA 3KPJA 4DL9A 1MB4A 3W06A 2V65A 3P27A 4YONB 1MQSA 1ULBA 2IC5A 4G86A 4O4LB 1UIRA 4HAWA 2MOKA 4HZUB 3QV1A 5BN4B 3INTA 4Q3CA 3V7YA 1KETA 2F67A 2ZSKA 1ZOPA 3CPEA 3B8EA 3WTCA 3AF4A 3LPAA 2YCLA 1EXWA 3K8QA 1CIPA 1QHSA 2O0MA 2PH3A 2PSDA 2UUBB 4PYIA 2FW8A 1JSLA 4Y0AA 1J9GA 2JEOA 4U00A 4XRGA 4MYCA 4EUHA 1KYXA 3RC7A 5IBPA 1MRNA 4Z9YA 4X65B 4RM3A 4EOGA 1C1XB 3K2QA 2QG9A 4G67A 2Y1DA 2YMPA 1CTQA 4AWXA 4RU1A 3N0XA 5M29A 4RVCA 1WO8A 4GR4A 1M67A 1E6UA 2WJZB 4ZCLA 3I2JA 4BQNA 4TXNA 5D85A 4PYLA 3JPWA 3EVBA 3MJSA 1T0JB 4F5WA 2GXQA 5K8VA 1GGFA 3CX3A 3LGAA 1XCMA 4BB9A 3O3NB 1E2PA 1WEHA 2D7CA 2VT6A 3SMVA 2PUAA 5FTLA 3LLVA 3GRKA 3L07A 3PC6A 5LUBA 1IG3A 3UMFA 4EZIA 1C29B 3AUXA 3O90A 3I9KA 4O63O 3TLCA 1AK2A 2AFVA 5JSUA 2D8AA 5CBKA 1WB6A 4D80A 3GDGA 3CLUD 2BRUC 4PHTA 2CVOA 2E5WA 4RJJA 4AO6A 3EPJA 4HYTA 1ZU4A 2ATEA 4BKRA 2P65A 4HDNA 2XD4A 3GDFA 4GG1A 4PTLA 1P5HA 4KTVE 3UT5A 4B35A 1BKDR 4E08A 2BFMA 4R51A 1Z6AA 3I09A 3ZXUB 5HRCA 3OUZA 1OREA 1W25A 2IYSA 4OMCA 4KAXA 5F51A 2K7ZA 2A9QA 2J9FB 5CJPA 2NW6A 3CPSA 2Q3BA 2C82A 3V2HA 3ABQB 1DQNA 1UT8A 1UBKS 3FUCA 1CR6A 1OA1A 4ESEA 3IQGX 3OCZA 3NPAA 4L8VA 3IRUA 5I3ZA 4PU0A 3AYXB 5D1NA 1JJFA 4HGNA 3M6AA 5D3MB 1RRCA 2QBYA 2BGMA 1GNVA 1QUFA 1DCFA 2IXGA 3AL2A 2AYYA 1LWNA 1G17A 5DEOA 3STYA 3O7MA 1RPJA 1YO6A 2FTKE 1C4KA 4DA8A 3HYLA 4RJTA 3LUKA 4ZHSA 4UNPA 3UJ9A 3Q5DA 4GC9A 1FDIA 3PUIA 3ICPA 4LY3A 4W82A 4AUEA 3BREA 3LM8A 2XDAA 5DB4A 4F7DA 2ZIGA 2W42A 3S8MA 4F2HA 2IEGA 2RGUA 1WTAA 1Q1QA 1MT0A 2FN4A 2QSJA 4OD0A 4PQGA 1VFPA 4TROA 5CVDA 1JLRA 3W5SA 4F2PA 4CGZA 2OFOA 3WOVA 3F9CA 3OFJA 3VPAA 4YUXA 3T7IA 1GPNA 5GONB 5HBGA 2O52A 4HX9A 1FZQA 3FUWA 1ECBA 3A31A 4GPD1 4QRDA 1B6SA 5EXXA 1E1QA 5HQJA 1KYVA 1M2NA 3ONVA 4GUDA 4MQLA 1E4OA 2W4IA 1PTJC 3L84A 1LDNA 1DRUA 4UM9D 3G89A 1IYZA 2C5AA 3GBPA 5GM2A 1HEUA 4WZZA 1T2CA 4DF3A 5J4KA 2GPWA 4ZVRA 1CUSA 3LMKA 1KK1A 2FX2A 1L7VC 4CM8A 3UJPA 3HYNA 2VRBA 4M8IA 4PCVA 2V4MA 1SRQA 4GP9A 4U7HA 1NF3A 2XH8A 3A3OA 3U1VA 4C1BA 4EITA 5KPJA 4DQUA 5EJ9A 1K9VF 3M1IA 1NJ2A 4CTKA 4BXOA 2XGGA 3IT1A 3L7OA 3TLGA 2AI1A 3KXKA 3ZHQA 1FU8A 3MT0A 3F6EX 4HEJA 4TSKA 4K81B 1E9BA 1Y8AA 3GPIA 4RBNA 4BJ3A 4FQ5A 3DF9A 5G1OA 2PKYX 4E2FA 2YJGA 3L49A 2ZANA 5ABPA 2XECA 5AP9A 3O1HB 2AF3C 3QVUA 3ZWCA 4MQFA 1GZ5A 5C7LO 1MN6A 1H8HD 1JQDA 1KMQA 2YMMA 4FWBA 4FYMA 2QRHA 2QTLA 2LIVA 3H4VA 1C9YA 4B34A 1Z7WA 3MERA 3E3MA 4FTWA 4RKQA 3ZU6A 2HHHB 3SEZA 5TMBA 1X7ZA 1RPNA 5CW2A 4A5SA 4BYMA 3I2FA 3INRA 1E4VA 2RJ3A 4LK2A 1BXZA 3RNOA 1RJ9A 1QOZA 3V00A 4V1CI 3HBMA 2QPAA 1SCJA 4BFXA 1ONOA 3FNHA 1J70A 4KEAA 2I8AA 4IIUA 1CUHA 3WQRA 4QGAA 5TS3A 4ER5A 1EESA 2HA7A 2VEOA 1CZLA 3GJYA 4HCJA 4UHFA 4GXRA 4WESB 5CA0B 1EVLA 3ROKA 3IDOA 4LYGA 1JFFB 3MXTA 3RK4A 2R7MA 5CG2A 2QTCA 5FKJA 4HPWA 2WWVD 1FUIA 3T54A 4EI9A 2BM1A 3V6MA 3W3ZB 4HEA6 4Q1CA 3T38A 1DTSA 2PUWA 1WSDA 3IAUA 3PFNA 3LBAA 3Q40A 4XVQA 5CCDA 4AF7A 4LF4B 2XB2A 4DA9A 2G4CA 2XTNA 1L9KA 2FSSA 2PX2A 3RDPA 3WFJA