1RVDA

H-ras complexed with diaminobenzophenone-beta,gamma-imido-gtp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
160
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TRANSFORMING PROTEIN P21/H-RAS-1
publication title Guanosine triphosphatase stimulation of oncogenic Ras mutants.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 160
sequence length 166
ec nomenclature
pdb deposition date 1999-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rvdA00
2GA8A 3KJIA 1N5JA 5KUTA 3LVRE 4B74A 4Q48A 1L4YA 2HDNB 4TWZA 1HQYE 3HU2A 4HB3A 1JPNA 2ZI3A 2J0SA 3C41J 3NEJA 4P32A 1MR3F 1XBTA 3KQUA 2QNRA 4YMUA 4BGDA 1Q1ZA 2ZETA 3D6TB 2OT3B 3S1AB 4Q00A 4Q4AA 4FWIB 3LLMA 2ZUDA 3BJIC 3GEHA 4LZZA 4LHZA 3CNNA 5CYOA 4MDEA 2VHJA 1G19A 3JVUA 4BLSA 1NSTA 3DKVA 1C1YA 2GZDA 4DCSA 2J45A 3QEJA 3FKQA 1P60A 1PUJA 2C5LA 4MGKR 2MMCA 3NKVA 2NGRA 4TT3A 4GZMA 4E07A 5DHAA 2REXB 3FDIA 4P31A 3TE6A 1E94E 4PO9A 3VX4A 1G3IA 3GP8A 1P72A 4B75A 4PHFA 1OLOA 2D06A 5EE0A 5BN4A 1Z0JA 2J0UB 4XVRA 4Z8XA 1WCV1 3I3SR 3LRPA 5G3ZA 1VIAA 1YHNA 5CB8A 1HYQA 3AVUA 4ACBA 3NC0C 2AHOA 2OXCA 2QP4A 3K9LA 3B85A 5P21A 2YKGA 2O8BA 5DGXA 3QENA 1YVDA 2XTMA 3P4XA 3CW2A 1KI6B 3E1SA 3RRNA 4A8JC 1UBEA 4ZO4A 3SBDA 1FX0A 2WHXA 3W5JA 1FNNA 4A15A 1OKKD 1UDXA 1S1MA 3GFPA 4ASUA 5JRZA 4JJKA 3WBJA 1JXOA 3BE4A 3HDTA 2JASA 4B2IA 1RC8A 3MUFA 5DYIA 1HY3A 1MH1A 3EWAA 3C8UA 4BFYA 3GEIA 2ZRJA 4ZIRB 3TW8B 2V1UA 5JRJA 4JYCA 3AM1A 2PZFA 2VP6A 4D4LA 3PEYA 2AX4A 1GRNA 3CO5A 1JXMA 3NTUA 4BFSA 5EP4A 1IN5A 1N25A 4C0KA 4HUTA 5D3MA 1E9AA 5FTJA 4B3DA 3OF5A 2OCAA 1KIMA 4P0TA 4B35A 1XJQA 3QOFA 5H70A 3GD7A 2QPTA 4LI0A 5J5CA 1EXMA 3OAAD 4D6PA 2NOAA 2WIAA 4N3NA 1QHYA 3IGFA 5K8LA 3TVTA 3NDBB 3AB3A 4UNRA 2QTVB 1MV5A 1NRJB 4LDJA 2EFEB 1IY0A 5FL7D 2Z83A 3F8TA 1SHZA 2R6CA 3H2YA 2D2FA 3P1JA 4R7ZA 1BO6A 5FPKA 2FNAA 2BMDA 4FD2A 3CONA 4M9ZA 2Z4RA 5EP3A 1SZPA 2ZRFA 1NJGA 3A4LA 4V0NA 4Q4HA 1OPXA 2NZ8A 1W2GA 1HE1C 4NCNA 1FFHA 4FMCF 4DSOA 4HB0A 4C2UA 1Z6XA 2ZE8A 2UVQA 5FL3A 2GCNA 4MUBA 1PLJA 3I92A 4YLGA 1M7BA 1KMHA 3FFBA 1E9BA 2GF0A 3E2IA 2XJ4A 4B34A 2XB4A 2F3TA 2RAPA 1UKVY 3UWOA 3LXRA 2XZOA 1LS1A 3C14C 2RH5A 4JBXA 5E4FA 2W0SA 3NG1A 4MYTA 2O8EA 4LUCA 2WOOA 5AWFC 5JFGA 1Z6YA 1YQTA 2CCKA 2CHVA 3TUIC 1SXJA 1TTTA 1YZKA 1NKTA 2O0HA 3L0OA 1G3MA 2ZRDA 4EPTA 2CVHA 2XX3A 5FI0B 2C04A 4E03A 4PTLA 2Y8EA 4XJXA 5KHOC 1NIPA 2P2LA 3WBKA 5J4VA 4HDQB 4KI0A 4MRVA 3RDPA 1E0SA 2GBLA 2QSZA 4URZR 1QHNA 3WP1B 3C5HA 1IY2A 4MUAA 4YDHB 3BBPA 2FFQA 3THWB 2RGBA 1UBGA 2WAXA 1NBMA 3BC1A 3ZGXA 3CRVA 2G3YA 3AVQA 3OIYA 3GLGB 4QHYA 1UEIA 2CK3A 4KVAA 2O8FB 1G20E 4OQLA 3T12A 5DI3B 3ASYA 3KKQA 3KX2A 2AKAB 1CR2A 2FSHA 3B8HA 5FPHA 1CR0A 4TMKA 3RABA 1GTVA 2ZITA 2C9YA 3ECCA 2ZRCA 2QPOA 1T6NA 3V4FA 5SZJA 5FUXA 1UBFA 3LD9A 1SVKA 3ICQB 1AA9A 1OT3A 1YKSA 3GJ4A 3MSXA 4M1OA 2ZRBA 4JLVA 3RYTC 1EFRD 4JT2A 4QHTA 3VU9A 1E2IA 1F2UA 2FPMA 3NC1C 3WY9A 1XMIA 1CJUC 4M21A 4GL2A 4NCJA 5FBQB 1Z0KA 1P75A 3AVVA 2Z5FA 2ANBA 2DB3A 4D4MA 3OE7A 2ZS7A 2DWOA 1E96A 3UKDA 1W2HA 4JLMA 3EPHA 4LJ4A 3TK1A 1XMJA 2RMKA 4CZ2A 4TYWA 5JECA 2FN4A 2YOGA 1E1RD 3SZRA 3OFND 3IHWA 4M22A 3QG1A 4P4SA 1R5BA 2P5SA 3SE0A 1G7RA 2RB4A 5JZVA 1KO7A 2PJZA 1JJVA 1IAQA 2ZSFA 4PXAA 2J46A 1HEIA 5DE3A 4P33A 4GSYA 4URWR 3ZZUA 3CRQA 2DFTA 3THXB 3LQQA 1D2EA 4DLTA 4DB2A 3H84A 1FTSA 2P67A 4BFXA 1N5IA 4PC1A 4TQ9A 3UXMA 2AFIE 3K8YA 3LH5A 3LXXA 3ZZTA 1JJ7A 4EJSB 4IXNA 1G7CA 2B7CA 1YU9A 2ZYUX 2AD5A 4HZUA 2EYQA 1WDTA 3H1TA 4RFVA 5JWOA 3KJEA 4G0NA 3NIBA 4JKYA 4BZPA 4JLJA 4PHGA 2GJSA 3THYB 2QENA 4LJ6A 1CF4A 1US8A 3TSZA 4H1UA 3ND9A 2FF7A 1OXUA 1P2SA 2HF8A 3W6OA 4D0NA 4QBFA 1DOAA 1RJ9A 2FGKA 3GLHE 5JSZA 2NG1A 2IT1A 3O47A 2KB0A 1CXZA 1W48A 2NPIA 3GJ7A 3MLEA 1UF9A 2EYUA 4DSTA 1DVRA 2QT0A 1VCOA 2RGDA 1V43A 1PJRA 2R44A 2JLRA 5TXGA 5C18A 4Y0AA 2F9MA 3QY0A 4JT4A 3PEWA 2FMXA 3DEFA 4LYFA 5EP2A 4BPBA 2ZQ5A 2H7VA 2RGAA 3QJYA 2FEOA 2QRZA 2W6ID 1X8JA 1P2TA 2ZUBA 1BIFA 3NH6A 3ICEA 4PSVA 2V4ZA 2ZSDA 5KSZA 5KDDA 1GRQA 5JCPA 1RFLA 2B92A 5EUQB 2WWYA 2ASEA 2H1LA 4MDFA 1P9NA 4D82A 1W4AA 2F1IA 1DAKA 1E69A 2HCJB 2E1RA 2WWFA 3AEZA 2PLFA 1AQUA 4DT1B 1W4CA 5IK2A 5TB5A 4RFSA 4W9MC 2ZR0A 1EFUA 3SDZA 5JJIA 4UXJA 5FR2A 1FQKA 2HXYA 2XXAB 1ZBDA 1L7VC 3EC2A 1SVWA 3CZQA 2JLZA 1T5LA 1YR6A 4B33A 5G41A 2WV9A 1OFIA 2ECKA 1DAMA 4LBZA 3QXXA 4BEBA 4QNRA 1OXVA 4X8OA 3M4YA 3V4RA 4NHOA 1X3SA 1P62B 2BC9A 3OESA 5SZKB 2N46A 4XD7A 3KB1A 3U4QB 5HZKA 1D8TA 2IUUA 5L3QA 4UXIA 2GZHA 3P32A 4TL8A 4D4KA 2BBTA 1Y63A 2JLYA 3U44B 3EXAA 3UANA 4US2R 4KSCA 3SN6A 1KI8A 2K5UA 3QKUA 3CPHA 5KOYA 2VP0A 5FOTA 5KPJA 1YRAA 4RKEA 4KV9A 3SBEA 2GCOA 4Q5IA 2EFGA 4QFMA 2OO7A 3TKLA 1WB9A 2ZIAA 1UPTA 4BLOA 3TIFA 2IYZA 2FE4A 5FTNA 3FVQA 1CIPA 2FEMA 4YONB 5G3YA 1X1RA 4NPHA 1J8YF 4CRWB 2ZPTX 2G1JA 4LCBA 4ZPXA 2F6RA 4V0OA 1HT2E 1KK1A 2B8TA 1N6KA 4H1VA 4M8NE 2AK2A 1U2RA 1YR8A 2IYRA 3CNLA 3FHTA 1HUQA 2PX0A 1R2QA 1KJZA 2OE2A 1XTQA 3CBQA 5FPYA 2IL1A 1KSFX 2OBMA 2C03A 3IPXA 2YC4C 4HEJA 4WXPA 2H18A 5FBRB 1U9IC 3EZ2A 3RANA 2VH5R 4ESHA 3IIMA 4ZDKA 1R10A 3CPJB 1QHXA 2ODEA 1XCMA 1N0UA 4CT4B 1OF1A 2ZE6A 1NKSA 4IJMA 5FR1A 4C0AC 4LJAA 4A36A 2GHIA 2O8DB 3CF6R 2GBLC 3EIEA 3KJHA 1XNJA 4KBFA 1G18A 5B64A 1UAAA 1BKDR 2W6JD 2ZI6A 1VHLA 2X2FA 2QE7A 1FUUA 3K0CA 2IBMA 1G5TA 4I81A 4OK6A 3VR1A 1S1CA 3T5DA 3IPYA 1LV7A 1NVVQ 1UKEA 4HATA 1QHGA 3W34A 2BVNA 3CIOA 4PZYA 4GPTA 3SFZA 3BD9A 4B3XA 1Z0AA 3LFUA 4EPXA 4RZ2A 1QVRA 3R8FA 2FG5A 4WIAA 4M1MA 4KSBA 4W5HA 3UATA 2P6UA 4TL6A 2VP4A 3OEEA 4AG6A 2ZRIA 1VDZA 5C46F 2A5JA 2QMHA 1SQ5A 2CLSA 1XF9A 1RW4A 2VL7A 3RS7A 1FP7A 1T3HA 4URXR 4G5RA 1AKEA 1GNPA 1NF3A 1G4AE 1E2DA 2CL6X 2ZSAA 3LO5A 4URYR 4QJ5A 4RKFA 4DXAA 4TMTA 3B78A 3I8XA 3BFXA 4EAQA 3AGQA 3L0IB 3RRMA 1JEEA 1VIYA 1E0AA 2ZJYA 4ZKEA 1P5ZB 3VR4A 1M2OB 3QPVA 2J41A 3EIHA 4IEEA 1E4VA 4ZI3A 2QAGB 3VNVA 5F9FA 3X1YA 4V03A 1U0JA 2EFDB 4B44A 2OV2A 3TBKA 3RSOA 1FL9A 3Q5EA 2VHTA 2ORVA 1P4SA 3ZJYA 1Z2CA 2FSFA 3D3QA 3VNUA 1LTQA 1AS2A 2QMUA 1SULA 2V55B 4HUQA 2DFLA 3TNFA 4BLQA 821PA 3AF2A 4RZUA 5F9HA 4AK9A 2PH1A 1EFHA 3ZLJA 2VHQA 4D80A 3ZS9A 5KTYA 2JA1A 2QY9A 3IBYA 4NYIR 3VTKA 2J7KA 3FPAA 4L8GA 4YDSA 1C9KA 1G8PA 3VKGA 3UG7A 1EFTA 1O87A 4M1KA 1G5RA 3X1XA 4A2PA 2GF9A 1KO5A 3CF2A 3RWOA 3QI2A 2P5TB 2ERXA 2OCPA 4BRWA 4BQSA 2L0XA 3SNHA 1P6XA 4NKRA 4EIWA 3OIVA 4BZQA 3BGWA 4PPFA 4TT3D 2CEAA 1W4RA 4DSNA 4LJ9A 1JPJA 2OUKA 3G82C 3E70C 1MRNA 1ZRHA 1G291 2PLRA 2WZQA 1YE8A 3ND8A 5EE1A 5JJLA 2XSZA 4LRWA 3UG6A 4NP6A 1E2KA 1KO1A 1B23P 3K0EA 2BIFA 2G1KA 5IHPA 1XX6A 2I1QA 4L16A 1OHHA 1DAGA 1F2TB 4QGAA 3WMFA 1U8ZA 3AVTA 4M53A 3MWYW 1TF7A 4IVRA 2NIPA 5B2ZA 1A1VA 4EFNA 3A1SA 3MJRA 3EWSA 3B2EA 4UJ5A 2ONJA 4LJ8A 1Q1EA 4GP6A 1XPUA 4AYTA 1YZNA 2IXGA 4HAZA 3SYLA 4ASUD 1SKYB 3TVDA 4ACAA 4KLZA 2V1XA 2ZJBA 3TAUA 1W36C 3T61A 3KJGA 4PZLA 1G3UA 2JIZA 4TSFA 2KJQA 4KYUA 4QNMA 5H68A 4L9SA 1RKBA 2QORA 3QBVA 2Z4SA 4B3GA 2QGNA 4RCZA 2JAQA 1AGRA 1NN3A 1KSJA 1OYWA 5H8WA 2IEYA 4CEJB 1N6IA 4AURA 1LFDB 1W0JD 2CCGA 4XH9B 1JR3E 2R6GA 1YR9A 5J4YA 2IYSA 3T06B 4JLDA 4IHQA 3B6EA 4A2WA 1D6JA 3SHWA 1Q20A 1II9A 1XJ0A 3PVSA 3R20A 1A2KC 2YWFA 3P27A 2AN9A 2LKCA 2NTYC 2PBRA 4G5QA 2WTUA 1XPOA 2QRNA 2Q6TA 1XD8A 2C99A 1SVLA 2R9VA 4KLNA 2GILA 1N6NA 2WJYA 3EZ7A 1TF5A 4DEYA 2J1LA 5LDDC 1FMLA 4MH0R 2QP9X 3RC8A 2OAQ1 2A78A 3A1TA 4CEHA 5FFMA 2O8CB 1G6OA 4IRUB 3IILA 4GP7A 4Q9JA 3WMEA 2A5YB 4WVFA 1QG4A 2VHCA 5TV2A 721PA 2RGEA 2VA8A 4A82A 3TW4A 1UM8A 1E2EA 2X19A 1TQ2A 1FMJA 2QUZA 1N2CE 4LBVA 4OK3A 4J0QA 5AJWA 3RAPR 4BFZA 2JLVA 2IS2A 4K81B 4XWOA 2FSGA 2FPLA 2WWWA 4QBGB 1TQ4A 1D2NA 3A6PC 1YZLA 1SKQA 2Z0MA 1NLZA 2XJ9A 4GOXA 5AUNB 1UDWA 1AJEA 2QT1A 4DDWA 3FMPB 4CW7A 4JLBA 2N42A 2V8OA 1KK3A 1DE0A 2QSYA 4KITB 3U7FB 3UMRA 3ZD6A 4MGIR 4MRRA 3BH7A 4L5BA 1S96A 2PMDA 2XTNA 4DSUA 1DO0A 2REBA 3IEUA 3W3AA 4IDHA 4HB2A 1UKZA 4Q7LA 4TYYA 1NBMD 4BRUA 2CK3D 1ANKA 5E7IA 1CKEA 1XTJA 1WRBA 2PEZA 4EUNA 1N6HA 1ZCBA 2H57A 5JLJA 1P73A 5HE8A 3K0CC 2GVZC 1K5DA 1W4BA 4A8JB 3L82B 2E9SA 2A5FA 1YZUA 3SR0A 2GXAA 2ZU0C 4KODA 5LB2A 4MYCA 1QHHB 3L8YA 1WA5A 3KQHA 1XEFA 4DJTA 5GJBA 3THOA 1GWNA 1ZVQA 1SKYE 2CBZA 2OLJA 2SHKA 4NCIA 4PPNA 3L43A 5KNDA 3MRSA 4M9XA 5BN5A 1DAHA 3AGPA 5KNCA 2BMJA 3OE7D 1TU4A 1XD2A 1ZM3A 4LHWA 1WBBA 1VPLA 2IWHA 4BZXA 2KWIA 5B57C 3ZQJA 1H8HA 1FUKA 4JKIA 3FWYA 2ZUCA 3BWDD 1P3JA 4LSGA 3LVQE 4IDQA 2ZTSA 3TQFA 5IDVA 3CR7A 3ZIAD 5CB6A 5M04A 1G5PA 2H5EA 3TH5A 2WSSA 1A7JA 4RD0A 2QL6A 2QPAA 3B82A 3GLHA 5C1BA 1X8KA 1ZM7A 4OHYA 3BH6A 4M9QA 4ZCIA 4I1SA 1WXQA 1YRBA 1WF3A 4B32A 4BE7B 1GUAA 2R8RA 1Z07A 4WA7A 4LJ7A 4HLCA 3I61A 3BRWD 3NBXX 1GIAA 3DKPA 2W58A 2RGCA 1Z22A 3VR2A 3MJHA 1A4RA 3ZVRA 1XMVA 4JMPA 1NP6A 1XXHE 4E22A 5KDOA 4V0ME 3DMDA 3UPUA 2BJVA 4ZCMA 4LBYA 4WAUA 2GZAA 4QL3A 4NYJQ 3QXHA 1U8YA 3B5JA 3OZXA 3EAQA 4QGHA 2ZU6A 3PUWA 5DI3A 2O52A 1G7SA 3DHWC 3DM5A 4TZ6A 2P0EA 4NE2A 3T35A 4CEIB 4Q1DA 2GEUA 1VYUA 4OBEA 3DZ8A 3UMSA 2OBNA 2CLDX 3WRYC 3X2SA 1E2MA 2NQ2C 1NIJA 3GJ6A 4ARZA 3GLFB 1CTQA 1KZ7B 4YC7A 2IYUA 3ASZA 4D4JA 1N0VC 5UKDA 3KUDA 2KE5A 2ZRHA 2AWNA 3DVLA 2ZREA 3PV0A 2AWOA 2QBYA 2Z6VA 2IXFA 4POAA 2VP9A 1IQPA 2BBWA 1M7HA 1W36D 5IT5A 1W0JA 1NMXA 1MABB 1RE0A 4EKDA 1D9ZA 2PMKA 4C0HA 4QBIA 3FGNA 2H92A 2JLXA 1XPRA 1JR6A 4AIIA 4TLAA 3CRRA 5IK2D 1ZM9A 3CF0A 5FOXA 4QJ3A 3QPUA 5FBLB 4RZXA 5JWRA 1BH2A 3D7MA 1TU3A 2GNOA 3C16C 2QI9C 5EZ5A 5L3SA 2J0VA 2ZJ8A 2VF8A 4DIDA 2FZ4A 5HR5A 1R7RA 3REFA 4NL4H 3T1QA 4GMDA 1ESNA 5E3HA 1VCNA 3H4MA 2H8KA 3K0AA 1U0LA 5DLQC 1HA3A 4RD2A 4XD7D 2PJRA 3B13B 1E0KA 4Q7KA 3N70A 5EE9A 1XEXA 2CDNA 3G5UA 2ZJ5A 3NHBA 4AKGA 2JDIA 3LNCA 4NTZA 2JATA 3SYNA 1WQ1R 2X2EA 2BEJA 2IEZA 2MSEB 4A6XA 4HYYA 1DS6A 5FTMA 3RRYA 2AXPA 4TLCA 2XB2A 3PG5A 4FCTA 5EP1A 1WBDA 2IYTA 1U9IA 4U7DA 3T1OA 1P2VA 3F5FA 3HYRA 1GILA 4IXMA 4K8OA 4TTQA 3BIFA 1OH7A 4AWXA 2IX3A 3TQCA 1D2MA 1YJ5A 4CDGA 4GT1A 4OHWA 1KYIA 1OYYA 3MWJA 2D3WA 2YV5A 3AKCA 3NWJA 3QF4A 4NBSA 5FPSA 2IK8A 1OJLA 2LKDA 4KBGA 3TUZC 4C3ZA 4Q4AB 2IHBA 1OIWA 3AF4A 4HDOB 5CITA 1S9HA 3SJAA 3C15C 1G41A 2ZJAA 2IS4A 5EQTA 5K8UA 3MCAA 1N6PA 1OFHA 1UJ2A 3SS8A 3ZZ0A 4H9GA 3GJ0A 4PO8A 2IC5A 3F0TA 3UIEA 4LY6A 1IN4A 1W1WA 4US1R 4PZZA 3NBFA 1JI0A 4UNSA 3DM9B 5JBQA 1AM4D 1X8LA 1ZM2A 1Z29A 2QE7D 4DLRA 3EIQA 3QPWA 2OBLA 1HE8B 4B2LA 1EGAA 1R6BX 3IIJA 1S4QA 1XTKA 1QG2A 4IFBA 2FX3A 1M8PA 4ZDWA 2FSIA 5TARA 1E4YA 2A3RA 4DCUA 1YR7A 4LV6A 5DSZA 2QU8A 2O8BB 3I5XA 2IUSA 3JVVA 5FBWB 2JJ8A 3IBGA 3QKSA 3Q7QA 2ZRGA 2AK3A 2J59A 421PA 2IYXA 1ZNWA 2P3SA 2ZAOA 3ZIAA 2ZYWX 4PFSA 1FX0B 3K0FA 1ZNXA 3NH9A 2FA9A 3OEED 3D8BA 4L9WA 2V54A 2YC2C 4U5XA 1Z63A 2ZI5A 2ZYVX 1TUIA 3EPJA 4PQRA 1T4GA 4NU0A 3TSOA 3AF3A 3UMFA 2FPKA 3RHFA 4F4IA 2RGGA 2DR3A 4NDZA 2BOVA 1AZSC 1Z5ZA 3AP3A 4S35A 3SOPA 4DLYA 5D3MB 3DPUA 1EESA 3FMFA 4HAWA 3AKDA 4B73A 1R5OA 3LX8A 3PUXA 1AS3A 5SZIA 3H0KA 2R6AA 3I5YA 1DARA 3HR7A 1BS1A 3EZFA 2ZJZA 1T3SA 4Q1BA 2EW1A 1PLKA 5F98A 3LQRA 4GZLA 2PX3A 2WM9B 3EX7C 3QEOA 5CDFA 4DVGA 4FCVA 1XB2A 3CX8A 4JL8A 4JLAA 1U0HC 1LB1B 1KI2A 4TYPA 1NLFA 3PIRA 1ZAKA 4B6EA 1LW7A 1W47A 4C0JA 4QXAA 3PR1A 5C4MA 5DN6A 2PL3A 1QZXA 4DLUA 4NYMQ 2W2XA 1KI3A 3TJZA 4Q4JA 2ZI7A 1KDTA 2DFKB 2AFHE 5B58C 1NY6A 1XRJA 1DG3A 1KMHB 3VR6A 2BKEA 3FTQA 3R8CA 2QGZA 4BFWA 2WICA 4X8MA 2IYYA 1JR3A 3LW7A 1GAJA 2XSZD 1NG1A 2O8EB 5AUPB 3V00A 3GLGE 1SXJB 3RWMB 2G88A 4V0LA 2XEXA 2GK7A 2IYLD 1G64A 2AL7A 2WPDD 2E87A 1OHHD 2D74A 3EPKA 1GOTA 3NXSA 1E2JA 3B9PA 3LX5A 4UXHA 5LD2C 5HE9A 2X77A 1Z83A 4JLPA 2OILA 2G83A 2WAYA 3DO6A 4RVCA 5KSPA 1A5TA 4GOJA 4Z1MA 2OXRA 2ZSBA 3IKJA 1S9DA 1G3RA 1UADA 2JIZD 4TSFD 2Q9CA 3PXGA 2QG6A 1LF0A 1HQCA 4JVNA 2YINC 1OIXA 4K46A 4PC7A 5FUYA 3ZVNA 1Z28A 2OG2A 3A4NA 4PX9A 1G16A 3KKOA 4JSYA 2AKYA 2Q0HA 4LPKA 1FPMA 1N3BA 2GXSA 3FHCB 4CYMA 1YZQA 4ZI2A 1KHTA 4LV5B 1R0ZA 1F5NA 1G8YA 3MWLA 1XCPA 3GJ5A 5DH9A 2WJHA 3HP1A 1ZINA 3BB1A 4R2HA 1GFIA 4HSEA 5JI3E 1M7GA 3VU9B 1F2UB 1VMAA 1E3MA 2EQBA 3R9XA 3FMIA 3KB2A 3CWZA 4UNNA 4Q9LA 2LWIA 3QG5A 3BORA 2GEVA 2W2VA 4OL0A 5DI9A 2QQEA 4FW9A 4I1OA 3GMTA 4URUR 1K8RA 2QM8A 1E2NA 4KHZA 2WVJA 1EX7A 3FKSA 3AVYA 1L2TA 1Z2AA 1EFCA 1FNMA 3QE0A 4P4SB 3SFVA 1R0YA 1TPZA 3FE2A 3I4LA 1ZJ6A 2F43A 4QRHA 1VKJA 2NO0A 1AN0A 2BV3A 3IHLA 3K9GA 5E7MA 4YMWA 3HJNA 2A7QA 2I1VB 1OB2A 3P26A 1NJFA 4JVLA 3EA0A 1XEWY 2JLQA 1EG7A 1N6RA 2XNDA 4ON9A 2OAP1 5JEDA 1F2TA 2JJ1A 3VHXA 2D4HA 4PQFA 5AJZA 1N0WA 2YVUA 3Q5DA 2V7QA 4A9AA 2DHRA 2OFWA 1JECA 1I2MA 3VX3A 3A4MA 1Z6TA 2HCBA 4HZUB 3W8RA 1MO3A 4PPGA 4Q21A 4XWKA 4NONA 1U99A 1X1SA 1NMYA 4AD8A 1R0WA 4HLDA 3T1TA 4KCGA 4W5WA 1US8B 2OFXA 3I1FA 4D25A 4OQMA 1TAGA 3NDPA 2VQSA 1BYIA 1ETUA 3B7GA 1H65A 5A0FA 3VHLB 2XOKA 1RJ9B 1XFAA 2GEDA 3FOZA 1Q22A 4PAMA 2WMOB 2WWGA 3F3YA 8OHMA 5JSZB 3QKRA 2Q21A 4DUGA 2HLDA 4OQNA 3AUXA 2QN6A 2V6JA 5TVKA 5LB4A 1KSHA 3ZS8A 1NVWQ 5J4HA 1SXJE 1XJCA 3G0HA 3RS3A 1J2JA 1F60A 4TTPA 5CK5A 4JL6A 5J40A 5J4LA 4PC3A 3K9NA 4LC1A 3WRXC 1C4OA 4DWJA 3PEVA 4W5JA 1H8EA 1S8FA 4KFRA 4QBHA 3RS0A 4AYWA 4BUJA 1G7TA 2JLSA 5KU1A 1SHKA 4JLKA 1W36B 1N5LA 3Q85A 2RHDA 2GETA 1U90A 2EWVA 3N2IA 1XXHA 3HYTA 4V0MA 3I62A 5BQ5A 4CVNA 5FBVB 1UBCA 2X8AA 2HV8A 3W90A 3K70C 4LPSA 3KQNA 4EPWA 2NO7A 4RD3A 3WP0A 1H8HD 4OJKA 3AVOA 2QM7A 2B8WA 3I73A 1KSGA 2CJWA 2EFHB 4B47A 2BDTA 2WSSD 4F91B 4DB4A 4EQ6B 1OH8A 4N0DA 1VG0B 2D2EA 4OYHA 1Z0IA 3SU8A 1KNQA 3LWNA 2ZS8A 3PENA 4RD6A 4B43A 2REOA 3VR5A 1Z0DA 2EU8A 4TMZA 2HXSA 1NG9A 5F3WB 3R7WA 1T0JB 4UQOA 2IS6A 4HLQB 4F4JA 3TGPA 3QSYA 3SJBA 3U6BA 5L3QB 1PVOA 3X1ZA 1XMSA 3U7GA 1KZGB 2BBOA 3M6AA 4F38A 3WYFA 3CH5A 1ZU4A 4WOPA 4GBMA 3KKNA 4GRAA 4YMSA 621PA 2F1HA 4XSGA 2GCOB 3M0EA 3BXZA 4PHHA 3PJRA 1E6CA 2VLIA 4TQAA 4BASA 1M34E 1RYHA 4O25A 5CYPA 5TMPA 4ZDIA 2OESA 5GVRA 2GVDC 4IVQA 2WPDA 3L8ZA 2XZPA 1XEWX 2WSMA 4DHEA 4X8LA 3KTAA 1II8A 1I4DD 2A5DA 2CNWA 2RCNA 5L8VA 4QGFA 4JLOA 3WNCA 1NN0A 1R8QA 3BERA 4QKQA 3U7EB 1NVVR 4R2IA 2VO1A 2HF9A 1QHHA 3R9IA 4F93B 4O2LA 4JJZA 5JHHB 2ZJOA 3M1IA 2X1VA 4MA4A 1RYFA 3K9HA 4B48A 3CUEF 1O3YA 2C98A 4N0EA 5C2JB 3DOFA 1KAGA 2BKUA 1CJMA 2TMKA 4D2IA 3QKTA 4II7A 2DCUA 2ZJ2A 2IA5A 3HPQA 1RRGA 2ZE5A 1CEEA 3GCGA 1PV4A 3EZ9A 3VR3A 3CNOA 3S1AA 1U94A 4LK2A 4C0SA 1AGPA 4OHVA 2IWRA 2Z43A 2N1BA 3PUYA 1W5SA 4LOAA 5GVSA 1ZC3A 3FMOB 2QAGC 4A0RA 4D0LB 1KDPA 3K53A 2VTKA 1NSFA 3PFIA 1J70A 2GXUA 1G21E 1OH6A 1L8QA 1R0XA 1OXXK 4MYHA 4EFMA 4L15A 2VIIA 3SJZA 5B30A 4G3XA 4HDCA 1TQDA 2OM2A 5HZHA 1QF9A 4IKEA 2P6NA 4LJYA 2O0KA 2ZANA 2J0UA 3KFXA 2D7CA 5KNBA 2GESA 2LCFA 1Q57A 4C30A 1SGWA 1OB5A 1F48A 2JDID 2H16A 1QRAA 3TLXA 2OHFA 2QTHA 1DPFA 2VRWA 2JCSA 1TNDA 3TR0A 1XDBA 4XTRA 1EK0A 2ZI4A 4A92A 1KI6A 3QBTA 1N6OA 1XCGB 2KSQA 4P4UA 1IJFA 4WZ6A 4DRZA 1E2GA 1XWIA 2BM0A 1KMQA 3CM0A 1SVIA 3FB4A 1D5CA 3P20A 2HEIA 3OEHA 4BLTA 3U5ZB 2HT1A 2C77A 1GM5A 1CR1A 3B1XA 4HUQB 4PHTA 1RRPA 3W3ZB 4HAUA 1HV8A 4ZIRA 1ONBA 1NN1A 4DEXA 3K0SA 2GJKA 1I4LD 3O8BA 2ZRAA 1U81A 1ZD8A 1E2LA 3O8CA 1IJEA 4Q18A 3RLFA 2CHGA 1RPZA 4CGZA 1E2QA 1T9HA 3BK7A 1KAOA 1YZTA 2BM1A 3LAWA 2ZRNA 2XITA 1QVAA 1S3GA 2HJVA 4Q66C 4AY2A 5JS8A 1VG8A 2W00A 2FZLA 1TADA 3DL0A 3MG9A 2MSCB 4DLSA 2FJUA 1T5IA 1CLUA 2NO1A 4KO8A 1Q3HA 1FW6A 4DDUA 4FWTA 3GFTA 3QNUA 1Q0UA 4PSKA 2ATVA 2WJVA 1P2UA 1SVSA 2CCJA 1G6HA 4BEJA 2XGJA 1Q3TA 1W49A 4M2LA 3L0PA 3QUSA 5ANRB 1KOFA 4KYIB 3RRZA 1KJWA 3TAHA 5EE3A 4NH0A 1OXSC 3DMNA 2O5VA 1JNYA 5AUQA 3U3OA 4NCHA 3OIUA 4DLXA 2WIBA 4RD1A 1NLYA 3Q7PA 3N2EA 2BCJQ 4PSAA 5KYKA 1IBRA 5JCZA 1BMFA 2WWHA 1IXZA 4Z51A 4LYJA 1TMKA 1B0UA 5IF9A 2RHMA 3K70D 3ETLA 2UZ3A 2UKDA 1OH5A 2ZRLA 4UNPA 2CMKA 2J3EA 3AVWA 2G0TA 1GVNB 1FOEB 1HURA 5FI1B 3ZH9B 2DY1A 3IEVA 3A58B 3A1VA 2J87A 3WNBA 3WYAA 4OI4A 4I1VA 5DIFA 4M1SA 5AR1A 3CX6A 3K09A 5DNYB 2YHSA 1ZD1A 3I72A 4I1UA 3SC3A 1DAIA 2WMNB 4IFEA 5GJVC 3AKEA 3PCRB 3QXSA 2DPXA 5EUMA 2R6DA 4HB4A 1TEVA 4Q1EA 5AJYA 2C96A 1CBUA 3THWA 3LA6A 5D3QA 4IDPA 3FHOA 1VECA 1FP6A 4C0LA 3GLGA 5FPTA 4AYXA 2O8FA 1IY1A 3X1WA 4XOIA 3U3RA 4MRNA 4PQYA 1E0JA 2VBCA 3W5IA 4TLEA 3Q9LA 3SYKA 1GZSA 4CEHB 3GLIB 2PCLA 2A9KA 3AQ4A 1G1MA 1KK2A 3RVBA 4DBLC 5DN6D 5HTKA 4Q4LA 1IHUA 1W46A 3PITA 4MKHA 4Q7JB 3ZD7A 3EASA 3C4JA 1KY2A 2ATXA 3DDCA 3LBHA 2CXXA 4R9UC 4W7SA 3W9YA 3KQLA 4L4UA 3WHLA 2BBSA 2IW3A 4B76A 1KI9A 1E9SA 4TZ0A 1CJKC 4MGYR 3V9PA 3KKPA 3RSLA 1P61B 1JR3D 1K5GA 1ZP6A 3EPLA 2NZJA 4LJ5A 4PAQA 2ZEJA 2YOFA 3EW9A 3MAAC 4I4LA 2DFNA 1GKIA 1LS6A 2GJAA 4MRPA 2WWIA 2F9LA 1Z6AA 3AF0A 3JZAA 4TN1A 1HT1E 3X1DA 2QMOA 3MWKA 1COWA 5G53C 3THXA 4QHSA 1K6MA 2GWHA 5DO9A 5LBIA 4F92B 1Z8FA 1G8HA 1QHIA 2ORWA 1E79A 3ONWA 2YOHA 3HU3A 3NBZC 1GKUB 4Z1MD 2R2AA 4EJSA 4LYHA 2NO6A 5L3VA 3A8TA 4M0LA 2A5GA 4Q1FA 3B1WA 2F1JA 4LX0A 4C7OB 1KKMA 2YWHA 1XZPA 1E9RA 1WE2A 1VYTA 5KPDA 2JLUA 3THYA 3UK6A 2VPPA 1VHTA 5K8TA 2ZI9A 1T8TA 3B1ZA 2R6FA 3AP2A 4XVQA 3A1UA 3CR8A 1ZIPA 3KXLA 4M1TA 4XVUA 2ZXUA 1BOFA 4XSHA 1GNRA 1DADA 2ZRMA 1E98A 2R62A 3AP1A 4IOMA 4KU4A 5HKKA 3KXKA 1S3SA 1DBSA 1KY3A 2CE7A 2QZ4A 4A2QA 2KBEA 2XAUA 1XD2B 4U02A 4JVMA 1Z3IX 2WKQA 5BWMA 1JAHA 4RJLA 3U3KA 1N6LA 1XZQA 3FKSD 1HTWA 3BS4A 4GDFA 4NYJR 1IXRC 1KJYA 4WZBE 3GLHB 2ZR9A 3B60A 2IYWA 1E99A 5A4JA 2WJGA 2QTFA 4FMDB 1E2FA 2V6IA 5TDHA 1CULC 4OHZA 4ZKDA 1Q1QA 1W0KA 2ZVQX 2GTPA 2XNDD 2F3RA 4AKHA 3WXMA 4DT1A 3U60B 1JAIA 2JJ1D 1UEJA 1KDRA 2JGNA 4A0HA 4JBWA 5JHGB 1KGDA 4AKEA 2XXAA 1ZUIA 5H1YA 2V7QD 3BOSA 3NVAA 3L0SA 4V02A 4C0QC 2WOJA 3VFDA 3GLIE 4OQFA 4IOJA 4IDNA 4TL7A 1ZCAA 5AJXA 3VKWA 1EX6A 4US0R 3I32A 4MGZR 2IUTA 4EPRA 4C4PA 4Q1CA 3GLFE 1MKYA 5BYJA 2AXNA 2R65A 3ZDQA 1G8GA 2HYIC 3CWQA 1E1QA 3FYHA 2WJIA 5JS7A 2Q3FA 4IW3B 3U4QA 4G5GA 4RD4A 1KI1A 2XOKD 4QOSA 4TTRA 2XZLA 1QDEA 3U44A 1OFTA 3LW8A 5AJVB 2YWEA 1ESMA 2HLDD 4MRSA 1AK2A 4DUGD 2B21A 1E9DA 2ZM5A 4PC6A 5EXXA 4ARZB 1KDOA 4ITRC 5LD2B 3IUYA 2PZEA 1GL9B 2JJ2A 3KQKA 2RGNA 2VP5A 3REGA 4DDVA 5J4KA 1MO5A 3U7HB 1ZUNB 4FXPA 5HCIA 4F7WA 2PT5A 2QBYB 1H8ED 2BHRA 1AQYA 4TYQA 1JQJC 4QGGA 2VHUA 2CL0X 4HI0E 3UWKA 5FTKA 4LC0A 1A2BA 1OIVA 2ZRKA 3VAAA 3QQ5A 4M9SA 2G9NA 4M1WA 3RC3A 4JYBA 3U2QA 2P6RA 1G4UR 4MKIA 4Q1AA 2GRJA 3K09C 3EC1A 5L3SB 1OV4A 5DISB 3D31A 5AUOB 4TMVA 1IN6A 1OSNA 1TF2A 1TL7C 1TQ6A 4KFSA 4IEIA 2C78A 3W8NA 2O8DA 3I8SA 3CRMA 2ANCA 4TMXA 5L3RA 1KI4A 3BAFA 3BB3A 3K0AB 3PQCA 3ZVMA 4WBSA 3TRFA 4FMBB 4ILEA 1VYVA 4Q4HB 4A0GA 1Z6GA 4CF7A 2HUPA 4KJZA 1XEXB 4Q01A 1XP8A 1W7AA 3QXCA 4ABYA 2RKOA 4FN5A 2FGJA 4MITA 2HT6A 1XD9A 4QM6A 2FOLA 5CIQA 4AKIA 1T0HB 3LDAA 2ZSEA 3OIWA 1D9XA 1GITA 4DC9A 2DWQA 3U3JA 4YXWD 4B71A 1R5NA 2Q3MA 2IXEA 3GJ8A 2PEYA 1OKKA 1T8UA 2KBFA 3N5CA 5CJPA 3H86A 4MKGA 3Q8XB 1II0A 3PUVA 4WW0A 1ZNZA 3HPRA 4YMTA 4NZYA 3A1WA 4GOKA 4NMMA 1DAEA 3EA5A 2WBLC 4OKSA 2W83A 3TUJC 2CNWD 3QF4B 3K1JA 4ZDJA 5GJWC 1OE0A 4DZZA 1GNQA 5E95A 3CRW1 3TSWA 4XIGS 1BYUA 2Q3HA 3DZDA 2OLKA 3SJCA 4FI3C 2J7PD 3U61B 1DTSA 2QAGA 5EXPA 5EXSA 3B1VA 5IRCD 4HLUA 4AI6A 2OCYC 2EWWA 2OCBA 2VSOA 2GCPA 3SEAA 3R9WA 3KZ1E 3OAAA 3O8DA 2ZROA 2FFHA 1J90A 1DAFA 5JWHA 4GI7A 1Q44A 2QP3A 4KFUA 4RZ3A 4EFLA 2B7BA 4Z8YA 1PLLA 2ZYTX 2O0JA 5CM8B 4C2TA 1PZNA 5FL7A 3ZYCA 4FINA 2ZR7A 4MQBA 4EQ6A 4UNQA 4TMWA 4LGMA 3LLUA 4GMXA 1PUIA 1FQJA 4Q9HA 3ADKA 1N5KA 4DLVA 4DLWA 4EJSC 4C0BA 4PPQA 4BFVA 5ELXA 5JI2E 5C4GB 1Y3AA 1KK0A 2P65A 4DIEA 4TLDA 3W6NA 1R8SA 3HR8A 4R71A 4YMVA 3QKSB 4P3YA 5K8IA 1MO4A 4BFUA 3NEYA 2GK6A 1G9XA 1VG1A 3K0FB 1CR4A 2W0MA 4M4SA 3K70B 1E2PA 1RRFA 4GFDA 4ZV4A 3C5CA 3T5GA 5G40A 1M6NA 3AF1A 1DEKA 2IYQA 2CHQA 5AK0A 3QVVA 4B3BA 2YNMA 2ZAMA 2FH5B 2GAOA 2RGXA 1QHSA 1CJTC 5GJCA 1MOZA 5A5GA 3TMKA 3GJ3A 4MKFA 1W44A 4NYIQ 5EJEA 2BMFA 1ZNYA 3IQXA 4WZAE 4Q47A 4BLPA 4E5UA 4NYMR 2HYDA 4JVSB 4O2RA 2OZEA 3CX7A 3SQXA 2BMEA 2PCJA 1JEDA 1NVUQ 2BEKA 1IN7A 2QA5A 4N1AA 2MMGA 1Z08A 2GJ9A 1Q21A 2WWXA 2FDCA 2C9OA 4TLBA 2CVFA 1AS0A 4EPVA 1Z47A 3OHMA 3OEHD 5KSYA 4LHYA 4V0KA 3T34A 221PA 5HPYB 3GPLA 1SXJC 1CP2A 1M1YE 3AH8A 2G0NA 1M74A 1RRCA 2WKPA 1GL7A 4G1UC 3IQWA 4X8HA 1XTRA 4CEJA 4TQUS 2I4IA 4Q19A 4FMDF 3L2OB 2V9PA 1FZQA 4DDTA 2I3BA 1UKYA 1GRRA 2ODBA 1EFRA 1E9FA 2VEDA 2WKRA 4B2PA 4C9BA 4Q03A 5CJ2A 1ZM4A 3AVXA 2IS1A 1XTSA 3CPEA 1W5TA 5FUWA 1KO4A 1J99A 4JL5A 3BFKA 4Q4JB 4RY2A 5F2EA 3EARA 2Q9AA 3KXIA 3MD0A 1P9RA 2PZGA 4KXFB 1Z0FA 2BCGY 3HU1A 1I2DA 1IN8A 3PEUA 2ZS9A 4EPYA 1VCIA 1WP9A 1E1RA 1OFUX 1DELA 2YYZA 3OFNA 1NBME 2O8CA 2GAAA 4DLZA 3IO3A 1FTNA 1T91A 2CLCX 1CS4C 1OXTA 3HWSA 4JSTA 1GDDA 3CB4A 1WMSA 3GEEA 3EZ6A 1E32A 1S0UA 3QIAA 4KVGA 2ERYA 4LV8B 4Y0VA 3VMFA 3U3MA 4RFSB 3C7KA 4Q7MB 4JZKA 2UZIR 2WJJA 4IOKA 1UFQA 2OEPA 2FFBA 4RSGA 521PA 5J47A 4PR0A 2RGNC 1X6VA 3WNDA 2CE2X 1BMFD 4HAXA 1Q1BA 2IHYA 1L4UA 1U98A 4D26A 3CLVA 2YWGA 4CT5A 1TEXA 2ODNA 3P4YA 4DCTA 1CJVC 3KUCA 4P4TA 1X86B 4NCKA 1P7CA 5FOVA 4FCWA 4LYAA 5FTLA 1ZD9A 2BWJA 4D0GA 4XTCS 4DCVA 4LBWA 4OI2A 2F55A 4B3CA 3EG5A 4LHVA 1ZIOA 5DYGA 3AKYA 5KO2A 1OW3B 5BN3A 2VSFA 4O3MA 4IOLA 1J8MF 2G77B 3A37A 5KSOA 2A30A 2BJWA 2F7SA 4PAOA 3SI7A 1V5WA 4S2EA 2J9RA 2QQ0A 4HAVA 1CRQA 3E5HA 4RCYA 5CM9C 2FFAA 1CRPA 4PC2A 4A1FA 5E7JA 3BH0A 1LVGA 1CU1A 1HH4A 1KO8A 2DYKA 5EZ6B 4YXWA 2ORIA 3CKLA 1NNEA 3SQWA 5TY0A 4FIDA 1AIPA 1IM2A 1RIFA 1E9CA 2FWRA 1EWRA 2YZ2A 2C8VA 2FU5C 1ODFA 4OQXA 2B6HA 3BFVA 3LBIA 3QF7A 3ZQ6A 2IYVA 4TL9A 1YZGA 4A8JA 3IO5A 2DWPA 1GL6A 3SHFA 1GSIA 2W6IA 4B6FA 3RS5A 3CH4B 3MGCA 4BFTA 2F43B 4R98A 4JLNA 2VSXA 4U00A 1ZMXA 2W2TA 1MO6A 1JQLB 2ZVPX 5JEEA 4UJ3A 4QM7A 3WMGA 2J7PA 2GJ8A 2QROA 2VYFA 5GADl 4AC9A 1MRSA 1TUEA 4JIMA 2Q9BA 1GG2A 4LHXA 1Z06A 3IIKA 4B3FX 1S2MA 3QXJA 4AG5A 1SVMA 2V3CC 1GP2A 1XU4A 121PA 2JEOA 4M1YA 3PUZA 5CLQA 5CDFE 1NY5A 1E9EA 2QAJA 3NHAA 4URVR 2MSDB 3IDQA 1NN5A 2D7DA 5SZHB 3VQTA 2OFOA 2J0QA 5CK4A 4BWYA 5FOWA 1ZYUA 3Q3JB 2XTZA 1F3OA 4UKDA 3B9QA 2GXQA 2NPFA 1R4AA 3CZPA 3JZMA 1QBKC 4KAXA 1G17A 4HLUC 4A0FA 1COWD 2D62A 1ZW6A 4FMCB 1JB1A 2HJGA 4OI1A 1E79D 4DCNA 5KDLA 1LF5A 2EFCB 1RZ3A 2ZE7A 3QKRB 4OI0A 1KNXA 4PO1A 4I99A 5DHFA 4MYUA 4Q02A 5CLLA 1LNZA 1MT0A 4IVPA 3T15A 4HAYA 1G3QA 1TX4B 4PANA 5JJKA 1ELOA 1NVXQ 2VF7A 3LBNA 4Q9IA 5FUVA 3KKMA 2DBYA 1G8FA 2YJTD 5HCNA 1F6BA 2ODWA 3LY5A 3DOEA 5BXQC 6Q21A 2C2HA 1AKYA 2PT7A 4OK5A 5FOUA 3O8RA 3AUYA 1IOZA 4Q9KA 4CEIA 1ZUHA 3GLIA 1XXHB 2AD1A 2IF0A 1J7KA 1ZC4A 2C95A 5FH9A 2FV8A 3TR5A 5HKKD 1DG1G 3AVPA 4G5OA 1EWQA 4O0MA 4G01B 2A2ZA 3A36A 5BYKA 3GLFA 3ADBA 2EVWX 4BLRA 3ADCA 3WYGA 4ZCLA 1JBKA 3U6KA 3ADDA 1Q12A 1VCMA 2J5XA 3WHKA 2CJWB 2KI5A 4JBYA 4ESVA 1NI3A 3ZVLA 1GKYA 4YQFA 2QEQA 3KFVA 1IXSB 4A6PA 4HZIA 2CL7X 1MABA 1VTKA 2GDJA 4Z54A 1IONA 1I4TD 4OJQA 4ERNA 3KDSE 2W6JA 4WXRA 2C9CA 3B1YA 5FOSA 1SXJD 5BW8A 3RNLA 1NMZA 1W0KD 2IF2A 4F4CA 3R7WB 2ZRPA 2VP2A 3Q72A 3MFYA 3RS4A 4D81A 4IDOA 5EE5B 1KI7A 1KTVA 1VG9B 3GFOA 4TYNA 1E2HA 1P9WA 4QC2A 1LY1A 2ONKA 1T3LA 2H17A 4QG7A 1XTIA 4BECA 2QMEA 4EDHA 2G6BA 2NMVA 4LWZA 4JS0A 3W6PA 1ZU5A 3T1VA 4CIDA 1KKLA 4E09A 3AV0B 3GJXC 3RS2A 3J81k 1E1QD 3MMPA 4C7OA 4G5SA 1A82A 3KTAB 1II8B 1NL3A 3KL4A 1U8AA 2GKSA 5EXTA 4KFTA 2OSBA 4OHXA 2JLWA 1SVOA 2NO9A 3FFAA 4XWAA 4DKXA 2AR7A 4QJ4A 4A4DA 1RVDA 2XNSA 2F1RA 3LV8A 3NBYC 4GNKA 3BB4A 3QVUA 5JMTA 5LPNA 3VKHA 3GQBA 1AZTA 2JJ2D 1JALA 5CIWA 1DO2A
chains in the Genus database with same CATH superfamily
2R5FA 5DP1A 2OY0A 3L7KA 1RLIA 2ODTX 4MLPA 3UT6A 4OX9B 3T4XA 4B74A 1SOMA 3I0NA 1XELA 4GLOA 4TWZA 5JEDA 1HQYE 2JBWA 4FFBA 3F3SA 4E5YA 3ZHYA 2LW7A 5HYVA 2QVYX 1E8DA 5FWXA 1E6EA 1T9GR 1K6JA 2L42A 3QVKA 3KQUA 1DU4A 1PQWA 5HRCA 4P1ZA 2FW7A 1Q1ZA 2Q4OA 3KK0A 4CWAA 2WAOA 4NG5A 2PFGA 3DTNA 1BRTA 2ZUDA 3KJFA 4MLDA 3UAXA 4NARA 3X3HA 4D98A 1UBHS 2HHJA 3DBRA 3PPXA 1D0VA 1DC3A 3DO5A 1XFDA 3KYBA 5E1MA 5CYOA 4RX1A 4C7MA 3KHSA 4WK0B 4MDEA 3RYHB 2VHJA 1RT9A 1P0PA 2QIPA 2WUWE 1ABFA 3H9GA 7REQB 2QRJA 3DE3X 1HZJA 4I5EA 4ZEXA 3NX4A 4DCSA 2H7CA 4FGJA 3FKQA 3M34A 4IJWA 4FYHA 2RJNA 3T0IA 5AI9A 4DF3A 2G5TA 4H4EA 3NKVA 2DCMA 4TT3A 1YMVA 3CZAA 5ADVA 2YJZA 3H5NA 1Q0RA 3N8NA 2REXB 3EEQA 4COOA 3HA5A 3KEGA 4P31A 5A1JA 2WSIA 3VX4A 2HRRA 5BUQA 2HDWA 4Q3CA 1XHFA 2FPWA 3GP8A 4I9GA 1P72A 1KEEA 3H2KA 1BDMA 5K20A 3LLCA 4MHSA 4L5YA 3ZE2B 2C7GA 4BTLA 4Z8XA 1WCV1 3I3SR 5TQ0A 4LF6B 4G23A 4U2CA 2PNJA 1OLUB 4BE9A 5AVZA 1K68A 1SCAA 1MT3A 3AVUA 3QHAA 3SSAA 4BNGA 2AHOA 4JP1A 3I2FA 2A92A 4ESOA 2OXCA 3AM3A 3BD8A 1IBSA 5P21A 6CHYA 4FE7A 1N57A 4NBLA 3SOZA 3MUNA 3FLAA 3U1TA 3IUSA 1VP9A 1LFAA 5JQWA 3DG9A 1KI6B 3E1SA 3M5CA 3RRNA 4BS9A 1FX0A 2OHHA 3IEXA 2PKRA 5H9WA 3AI1A 4KQGA 4RL6A 2DQZA 3GFPA 1SWWA 1DV1A 4FCCA 2OOSA 4PG5A 4MMYB 1G66A 2ZCJA 3B6JA 3HDTA 5KO2A 2Q4RA 2W2LD 4F6LA 3Q7EA 3RAGA 1KHHA 4AW9A 4JEIA 4F11A 1DDOA 3NI2A 1P81A 4NPCA 5EFOA 2H4ZA 2P3OA 2ZRJA 3RVMA 4Y9UA 1T9ZA 2XA2A 3FUWA 4DIKA 3AM1A 1N9KA 4OYLA 1CQZA 4I6GA 2LBPA 3W9UA 3WB1A 4OLHA 3WO0A 5J2UA 1D2CA 5AUOB 1QO0D 1XTZA 4HUTA 1IN5A 3G2IA 4C0KA 4NNPA 5D3MA 4QXQA 3MERA 3W1EA 3S4YA 3BTOA 2OCAA 3FYDA 2ZT7A 1XJQA 3QOFA 4RJIA 5E1BA 4DGSA 4AJJA 2GHRA 2VZEA 4LI0A 1I9GA 1GAQA 4GPIB 3WIBA 4WGFA 1M1UA 2WIAA 1J4AA 2N3ZA 1DSSG 2OHXA 3TVTA 1Q0LA 2OGTA 1ST3A 4CQNA 1MV5A 2C92A 1WJGA 2CKDA 4LDJA 5IVIA 2XXBA 4PINA 1IXKA 3A2NA 3ZV4A 3DB1A 3B89A 1QZUA 3RUDA 3ZVKA 1F1JA 4XYMA 5FL7D 4AX8A 2WHPA 3TCXB 1GRCA 2HU7A 3OCZA 5BVGA 4YAEA 4YJFA 3QLVC 1BO6A 4FD2A 1F4LA 1TQHA 2WF9A 2BM8A 2AFRA 2ZBRA 1J8VA 3HCNA 1ZOPA 4FFVA 2ZRFA 1CE8B 4EUHA 2PGAA 3PR3A 3ESQA 4V0NA 4DR4B 4Q4HA 3V8QA 3ZBUA 2NZ8A 4G1MB 1W2GA 4L8YA 5CJJA 3R74A 3SXJA 1S2NA 3OIFA 3V6MA 1F2VA 3J7AC 1AUOA 1T9BA 1YR1A 1BWQA 3GROA 2UVQA 1JXQA 1OI3A 2AOTB 1EE2A 3I92A 2Y2UA 3UJDA 1X9IA 1E9BA 2GF0A 1SOWA 5SY6A 1V41E 3F6RA 2NP6A 2CFTA 1L9KA 3HY3A 3UWOA 3VH3A 2Z6UA 1NVEA 5E4FA 4YRKA 3NG1A 3TGLA 2KLHA 3RREA 1ZH4A 2O8EA 5FB3A 2YNMD 2CHVA 1GPAA 1SRRA 1HGXA 1O95C 1T2AA 3KQOA 2ZXFA 4E5DA 2O0HA 1AKMA 2IY8A 2ZRDA 4R6WA 5JS2A 4O4LF 3AOGA 5L53A 1FYVA 4MIKA 1RYNA 2PS3A 1O9GA 2ZJ7A 1REQA 2Y8EA 4XJXA 5DN9A 1B6SA 5KHOC 3OJ0A 5I4CA 2Q2QA 4KI0A 4RZQA 3RDPA 1E0SA 1S7GA 2GBLA 2QSZA 3IP3A 1KORA 1LX6A 4V3BA 4LFCB 3WP1B 1YHZA 1IY2A 1T5HX 3A04A 1EZ4A 4ENRA 3BBPA 2W6PA 1UBGA 3JQ8B 3BC1A 3ZGXA 1QTNA 1C4WA 4F12A 3ZGLA 1KP9A 1EJBA 4KVAA 2O8FB 4OQLA 2C7QA 3UHPA 1JG3A 3ZEAA 4OAPA 5DI3B 3KKQA 4EKGA 1CS0A 7ADHA 1UBTS 3B8HA 2LGJA 1CR0A 1NRIA 4TMKA 1H2BA 3B5EA 1Z39A 1BKSB 3RABA 4GX0A 3R7BA 2PPVA 3UJBA 4EY5A 3EXEB 2FUG1 4JYMA 1L5YA 5SZJA 1YF3A 1JA9A 2IP1A 3QVMA 3LD9A 1J0CA 4JLSA 3ICQB 1OT3A 1V11B 3IAFA 1BW9A 3MSXA 4HADA 2ZAYA 1DMRA 2ZRBA 1NFFA 3RYTC 4C1BA 1EFRD 1TMYA 2NXNA 4KHPB 3NC1C 4PXYA 1GZ4A 4U7JA 1CJUC 4WH0A 1H23A 1WM1A 3ASVA 2JVIA 5ALZA 2GZ1A 4MWTA 2C5EA 3DKKA 1N2SA 5IEJA 4UE3S 1TRKA 1OGIA 2DWOA 2PQ6A 3PYMA 4KWEA 3CVYA 1PDOA 3OZ7A 3ACBA 4D3ZA 1GG5A 3TDNA 5JH7F 2Z30A 1UZNA 2VH2A 3IVCA 3M5WA 4MULA 4TUYF 4PX5A 2ZXEA 2B25A 4P4SA 1EH5A 1R5BA 3GZNB 3OQPA 1WKCA 2P5SA 3P0FA 4N4AA 1G7RA 4L0DA 2E48A 3HKEA 2A9JA 1W1IA 1NR7A 2PJZA 2ZSFA 4PXAA 1OTHA 2CUNA 3VC3A 2P75A 1XZJA 5DE3A 3A4YA 2XUAA 4GSYA 2H0AA 3BSSA 4LXQA 1X2BA 3BRWA 4DB2A 3WDMA 4CQLA 4FHCA 4BFXA 9ABPA 5IM4F 4DCCA 1VDMA 1PZMA 3LH5A 5HWSA 1SELA 3FHJA 3VJKA 1ZVMA 3HXTA 4JI1B 2BONA 5CFOA 4W9NA 2B7CA 1RYDA 2ADOA 4DR7B 2H2HA 2WF8A 1EXDA 1G60A 2CHUA 3HMQA 1JHOA 1F8XA 2AD5A 5BWNA 2Y2VA 4GRIA 4HZUA 1ATZA 2EX4A 1SPXA 1VHJA 2BFDB 3E9CA 1IK4A 1FS5A 3H1TA 4RY9A 1PS0A 4RFVA 5REQB 1KMCA 4J90A 4G0NA 3T7DA 2I78A 1GG9A 2QENA 5A5FA 1F7VA 3C43A 4LJ6A 5CVVA 1SUEA 3R7DA 3RE1A 5JC8A 4H1UA 2WJWA 1Z2DA 2BTQA 1NUAA 3HJBA 3AIMA 1DOAA 1IDOA 3F49S 3TRKA 1RJ9A 1RPTA 2FGKA 2NX2A 3GLHE 3QPCA 3ILHA 2LIVA 1UR5A 4EI7A 1TCAA 1Z7YA 2DKNA 2GRAA 1QFZA 2XMCA 3C1AA 1UWVA 3NGLA 1PVDA 2IOFK 2ETXA 1UF9A 4C05A 3OQMA 1AY0A 4LMAA 4G26A 2OCDA 2DLCX 2RGDA 1TIPA 1B8PA 4GZ5A 3DL4A 2P8SA 1VFNA 2R44A 5C18A 4Y0AA 1XMOB 2F9MA 4PZ9A 1OBHA 4ND1A 3PEWA 3UCEA 4BPBA 1CJSA 4IAOA 1PDWA 2FEOA 2QRZA 2W6ID 1DC7A 4GL4A 3PC7A 4JC0A 1FX1A 2ZUBA 5FLKA 1BIFA 5I7VA 2FFRA 3R1IA 3E9NA 4D4HA 4FM9A 1G6KA 2V4ZA 3H5OA 2ZSDA 5KSZA 4LYDA 3N2GB 4X84A 1GRQA 3RU7A 5ES4B 1M0WA 3GA0A 2LVBA 4I5FA 5JCPA 4I8XA 2BPOA 5BR7A 1Z4LA 3C6XA 5F7OA 1DAKA 3AUTA 4P7BA 5K3FB 4DT1B 1A4IA 2PLFA 2PRIA 3EHDA 4Q9NA 5AI0A 3EGDA 2DQKA 4UXJA 4Q3NA 5FR2A 3LG2A 1L7VC 1SVWA 4YCCA 1GU0A 1MMFB 2YR0A 3D64A 4GI5A 3T9CA 4FOOA 3GGPA 3TFQA 4B33A 2JBAB 2ZBEA 3NWPA 1OFIA 4L72A 4MQ4A 2X3FA 4LBZA 3QXXA 4TM8A 5TQJA 3C3WA 4QNRA 1W87A 3PQ6A 2A1TR 3C4QA 1CR6A 1P62B 2R60A 1FTWA 2BC9A 5KHLB 2NQ8A 3I05A 1RCUA 3DT8A 3MXOA 3OESA 4H1HA 4MKZA 4JI4B 1TZKA 1TZ2A 3IB6A 4RACA 3D1JA 4Y6GB 5ABPA 5M5BA 3BSFA 1D8TA 2WJ6A 2DLNA 3FRIA 3U4QB 1YQGA 1CY1A 2N47A 2IUUA 3SAJA 4PNZA 4Z6KA 4FT4A 1LSSA 4ZZ3A 3P32A 4BKUA 3RSGA 4DNOA 3JXEA 3W78A 2PN1A 2JLYA 3U44B 1PQ4A 2NLOA 2H0RA 3VAZA 2F8SA 4US2R 3G23A 4QT4A 4B4OA 3QKUA 2K5UA 3ZWDA 3CPHA 1QG0A 2Q6LA 3EY4A 1E59A 3R5FA 1YRAA 1JZQA 2GD1O 2WFAA 4KQ9A 4RKEA 4JI3B 5JCOA 2M6SA 4Q5IA 1JPUA 4RPLA 1I13A 4QFMA 2X0IA 3TKLA 4D74A 3W1WA 3AFMA 1EX9A 5FTNA 1RAFA 1QMGA 5TR9A 3SD7A 3FOBA 4WJZA 5CP8A 1X1RA 4CRWB 3UPTA 1USIA 1C29B 3ZR4B 4H1VA 2WSBA 1ZBQA 4UDYX 4FZ3A 1RPNA 1U2RA 3C3YA 4LNUB 2ZUUA 5CX1B 3FHTA 1ESDA 2NUAA 2OE2A 5GP1A 1FZTA 1B42A 3CBQA 1J0XO 3GGOA 1P7YA 1SOUA 2OBMA 1WMFA 2YC4C 4O2AB 1M34B 4KXUA 4BMPB 1SD5A 3PC6A 3KKLA 1MAUA 3N75A 4EA9A 3EVZA 3EZ2A 3P9RA 5CT9A 5J1SB 2PA3A 3D2CA 3IYLW 3OE1A 1FYWA 3GU3A 4ESHA 1LBSA 2I4MA 3AXSA 4Q16A 3UMJA 4CL0A 4MUEA 4C03A 1N0UA 5HOQA 4E3WA 2ZE6A 1NKSA 4IJMA 4LOJA 3RU2A 4LJAA 3K0BA 2GHIA 3QI7A 2GM5A 3H9CA 5BNFA 5IBPA 1ZK4A 3KYCA 4KWHA 3UJ6A 4ZGGA 1XNJA 1PQYA 1G18A 4ZO6A 4GR9A 4Z86A 4N39A 3P9IA 4HVCA 2NUTB 2X2FA 4EHKA 3AEKB 4I81A 2JF0A 4F9EA 3ZGZA 3P0IA 2CNNA 4IUCS 2B5VA 3T5DA 2EF1A 3P2IA 3QVGA 1TT7A 4XYGA 3ZW7A 4DCGA 2WQ6A 2BVNA 4L2IB 4DFDA 3SFZA 4G09A 1DQRA 5K3EA 4MPRA 1BHSA 2VQ6A 1DXQA 3LFUA 1NAHA 3N0RA 4RZ2A 2E1PA 2VK8A 4FYPA 4WIAA 1PQUA 3G1WA 1ITZA 3KAQA 1Z56C 4DM4A 5A0TA 5EESA 2ZZMA 4OREX 4AG6A 5C46F 1MJFA 2A5JA 1VC2A 2NYAA 3A6GA 1E0DA 1SQ5A 1XAGA 3P97A 4HNGA 1XGKA 1XF9A 1ZWLA 4JEHA 2JFZA 4OVKA 1H3EA 4URXR 5BR8B 1FTQA 4PIVA 2YVLA 1GNPA 4EZIA 1V1RA 1GPBA 1OJ7A 4DXAA 1BNCA 4AJ4A 1JFSA 2POCA 3P9QA 1AF4A 4CKWA 3EVDA 4JWTA 2ZJYA 4BO5A 3C3BA 4ZKEA 3WYBA 3D6FA 1NXTA 3OHPA 2Q8NA 3N2LA 2C58A 4IINA 2UUBB 2ZQZA 4Y7DA 2P91A 4KN6A 4KRGA 2QAGB 4H6WA 3H1AA 1U0JA 2WJAA 3WS7A 3PQFA 1DOZA 2Q5JA 1OD6A 3D8HA 3TBKA 1LZLA 2IDJA 2DPMA 3GT0A 3HLTA 1DX9A 3RSOA 1FL9A 1R8JA 2PUEA 4PE5B 3IMKA 5LQDA 1P4SA 3X1MA 2P5YA 2I71A 3VOSA 2PRZA 3RHTA 2PWZA 2Z9DA 3PT5A 3PEEA 1TD1A 1AS2A 1V8DA 5HK9A 1UJ5A 1P33A 3V4OA 3DZHA 4RANA 2V55B 1EYZA 3PXXA 4BCCA 4BP1A 3P9YA 4OXRA 3WGQA 5BQ3A 4AK9A 821PA 5I4BA 3ZLJA 3QUTA 4DQKA 2GS9A 1TJYA 4AZWA 2ZJ6A 2QY9A 3IBYA 3FPAA 4UQPA 3B6ZA 2DETA 1C9KA 1D1QA 3PPVA 4OBXA 1G8PA 3KQVA 3ESZA 3MCTA 1U8UA 1O87A 3AJ8A 4RH3A 1N32B 1CETA 4A2PA 2G80A 3GLUA 3RWOA 1JWLA 2P5TB 2OCPA 3MF4A 1DHRA 2J6CA 4FFLA 5DLPA 3CA8A 3GRKA 4L1KA 3BGWA 2ZCUA 4ZPJA 4E6PA 3HCCA 4BV8A 4LJ9A 1JPJA 1O94C 1U2DC 1RYZA 4F8YA 5HDQA 3KXDA 3AM5A 1BFUA 1JQ5A 1MRNA 4LXHA 3WKBA 1ZRHA 1JKXA 2PLRA 2WZQA 2YV4A 1YUMA 4CNBA 1EM8B 1O4WA 2NZXA 1GTZA 1R74A 4KRFA 1EQ2A 3W8DA 2G1KA 3QFRA 4BWFB 1DC8A 3VH1A 4L16A 4RXMA 1OHHA 1D2GA 1O7JA 1XQXA 4MNTA 1U8ZA 4MWBA 4F21A 4M53A 3MWYW 4XW2A 4ZK2A 2GD6A 3HNPA 1Q11A 5B2ZA 3G79A 3ZJVA 2DUWA 3D02A 5TQVA 5TGTA 3B2EA 4C4XA 2CL5A 2YW2A 5DASA 3DZKA 5KTKA 4BPRA 1XPUA 1L8LA 8GPBA 2I9PA 1NUSA 2OXIA 1HM5A 3VZRA 3DKIA 4ASUD 3TVDA 1MEJA 1NW6A 1XWWA 4RO0A 1UODA 1QIJA 2C42A 2ZJBA 4MX8A 1ADFA 3F4LA 4PYOA 5DHUA 1PD0A 3UWMA 1YBAA 4CFSA 1QIIA 4Z9XA 5HSGA 1E3TA 1WS6A 1NVBA 3G8CA 4B3GA 4QNMA 3W5UA 4MEBA 2BKAA 1MAHA 1SU8A 4Z4QA 2PUGA 4K86A 3TLGA 4UFPA 1U7PA 2Z4SA 4RA6B 5HFNA 4EO4A 3R9KA 3KB6A 2JHPA 4RA9B 5H8WA 1V0JA 3WLIA 4PZ0A 4AURA 2CCGA 4AM8A 1A69A 1RZVA 2HQOA 2R6GA 1XROA 3RR2A 4IHQA 3QE4A 2HBRA 1D6JA 2WHEA 4M0PA 4ZQFA 4A2WA 1Q20A 1SWVA 1FU8A 4IV8A 4K9RA 3IESA 5G0UA 2YWFA 2HCFA 2PBRA 4G5QA 1TQ8A 4J1NA 3MT0A 4O33A 1XD8A 1SVLA 2R9VA 4YRPA 3RGWS 3A10A 1KETA 3B1JA 4LOHA 1N6NA 1U2SA 5DTRA 5C35A 4R1MA 1MOSA 3RC8A 2WM2A 1HFWA 2A78A 4CEHA 1E66A 3CEJA 2NYUA 4KL8S 2FSVA 3FD8A 1Z37A 3IERA 4FJ0A 3I9MA 3W9SA 2A5YB 1UBNA 4WVFA 4CIBA 1UT6A 3SC4A 3JAKA 4P9NA 2RGEA 5L9AA 2HBYA 4D6YA 2P0AA 2XZTA 4LNHA 4RM3A 4EW1A 3DAPA 2X19A 3S2GA 1FDTA 4DIBA 4PNPA 1N2CE 4KGXA 4NJOA 4J0QA 2XYPA 3VPCA 3WKEA 1Z17A 1XRSB 1HLFA 5LUBA 4KO2S 4FILA 4Y1RA 2QTLA 1EEXB 5IBRA 3SIWA 1C9DB 4O4JB 3QMMA 1QVZA 5KQSA 3N2ZB 3A6PC 1YZLA 4IIYA 1Y80A 2HSEA 4YRLA 5DCLA 4YRQA 1Q3KA 3PUIA 5LN1A 1UP7A 1AJEA 2QT1A 3DFIA 2VSYA 1Q7BA 3BUSA 1QFMA 3I9V6 2F8LA 1I94B 3I1JA 4TKZA 2YS6A 3DDSA 3IIIA 1B14A 3NLLA 1YJBA 4URFA 3WBBA 3EYWA 2IU0A 3QPAA 3A6FA 3BH7A 2AG0A 1YFJA 4J7AA 5IUJC 4GXRA 4DSUA 2ESRA 2AE2A 1BRMA 3SLRA 1WZEA 1SHLA 2R7MA 3NNSA 3TLCA 4TYYA 3CNQS 1UKZA 4OMFG 3M3DA 4B6QA 3ETNA 4QDUA 5DEOA 1GCOA 1NI4B 3DGFC 2NZWA 3EXHC 3G9ZA 3D5QA 4N47A 1IN1A 4F5WA 3T3EA 2JGKA 3OCXA 4WJKB 4ZU3A 1ILEA 4EP1A 1WRBA 5A0VA 5CNKA 1N6HA 1ZCBA 1VL1A 3HACA 1P73A 3MIZA 4R0NA 4ZV9A 3VO8A 3D8NA 4AJ1A 3F4KA 3JAWA 1K5DA 1W4BA 3JQFA 2JGMA 1YZUA 1DIGA 3JQ7A 1RLMA 2GXAA 1QV7A 2ZU0C 2W4IA 5LB2A 2QTVA 3E3LA 1EP2B 3QFCA 3RWBA 4EUEA 1WXGA 2Y67A 3PGVA 1Q7RA 1QHHB 1TOAA 3FYUC 4JCOA 1FNBA 1UQUA 1WA5A 4HPWA 1OREA 4UD2A 4D9JA 5GJBA 3EN0A 1E9VA 3BN3A 5G1OA 3FDZA 3R40A 1GWNA 2ERCA 2JGAA 1PWYE 2SHKA 2ZP1A 3MTDA 4REQB 3L43A 5D85A 5H7XA 1MW8X 4ZQIA 2A94A 4L4ZA 3T41A 4DG5A 1M1XB 1PFWA 3LBFA 4JBHA 1R16A 2BMJA 1X87A 1XD2A 4W9RA 3OX2A 4BZXA 2IWHA 3IPCA 3MRVA 1K5HA 4MV9A 5FHRA 5JG7A 3W5HA 5B7GA 1H8HA 5AVVA 4DEVA 1Y6GA 3FWYA 3O2QB 2Q0SA 4EITA 3A7EA 2ZTSA 4R3UC 5F51A 3CR7A 3TQFA 2VCEA 3KPVA 1G5PA 1S2IA 1B6RA 1C80A 2H5EA 3TH5A 1BDJA 3CF4G 1X8KA 2VEOA 2VT3A 1VJDA 1X0VA 3BH6A 4ZCIA 2QV7A 2XGSA 1RHJA 1WXQA 4DCJA 1WF3A 4L3WA 4NF2A 1SQGA 3SZMA 2Z3VA 3NTQA 2WA2A 4Q05A 4FLFA 2PMBA 3BKXA 3IDAA 4HLCA 4LJ7A 5I7HA 1WXFA 4GE3A 4LDNA 3I6MA 3NANA 4YT8A 3ZZMA 3OZVA 4JOBA 4DA6A 4N12A 2YMPA 2QF7A 2OL4A 3TTUA 2BI7A 3WNQA 1A4RA 1ZDMA 5ALFA 1KYTA 2AW5A 3GVHA 4PFJA 1NP6A 1JTFA 1LK5A 4NBNA 5KDOA 2W48A 4JQOA 4UATA 4ZCMA 2INGX 1TVEA 4NYJQ 2I7DA 4PEVA 1YB6A 3D3WA 3OZXA 3R0ZA 1RJDA 3ZWYA 4E2FA 4NESA 4QGHA 4ABTA 4TTAA 4LDRA 1X2EA 2AOUA 3Q1LA 1PJ8A 3OJCA 2V74B 4P7JA 1Z6QA 1GYPA 2W4QA 1RDFA 4XIIA 4CQMA 1FXWF 3WGYA 4NK5A 5EEGA 2WRZA 4HAOA 1ABBA 4QOEA 1PGJA 4XLZA 1U31A 2GEUA 1VYUA 1CYEA 3NT2A 3ZDFA 3WRYC 4GMFA 4BO0A 3PIDA 3C1TA 3GJ6A 4UVHA 5BPHA 3GLFB 1M2VB 1CTQA 2G4CA 3R4VA 4B17A 1QANA 2IYUA 3SQNA 1BJRE 4P83A 3NV7A 5H5JA 1EBBA 3EE6A 3KUDA 5ALWA 4D7AA 1L7QA 2ZRHA 5IZCA 1O58A 3VH4A 4HKTA 1IQPA 2BBWA 4BWGA 5IT5A 4K6HA 1W0JA 1NMXA 4EKDA 3STHA 4FSHA 1TK3A 4UTVA 3IV6A 2R8YA 2WILA 4MCJA 2DRIA 3PDIA 5P8WA 2HMWA 2CSXA 1E64A 3HFGA 1FS6A 3WNVA 4AIIA 3OMXA 1UT5A 2QT9A 3CF0A 1J2YA 1UMDA 5FA6A 5MFZA 4G67A 3JASA 4PRZA 4LZWA 3D7MA 2WDPA 4KQ6A 4ES6A 4J2HA 3PXCX 3HGQA 2C7RA 4MQFB 2BGGA 3H1GA 4ND7A 3ONDA 5J23A 5CIYA 3F74A 3H8SA 5G2OA 1IZ0A 1M33A 2VF8A 3HJRA 5M29A 3G7UA 1BQEA 1GQSA 5LXTB 4RJ2A 2JARA 4BKQA 1S3FA 2XCTB 4RQAA 1G8KA 2PUCA 4GMDA 2VXBA 5DNAA 3NHLA 1UJCA 4ENPA 4UPEA 3IMFA 3T5TA 4HO1X 5DLQC 4EBBA 1HA3A 2ADMA 4RD2A 1ZWKA 1E0KA 2EL9A 4Q7KA 3SKVA 1I1OA 3HY4A 2ETVA 2K2QB 2KLBA 3PGMA 5AJUA 1AV6A 2JDIA 5EJAA 3K1AB 5H02A 4AKGA 3MFQA 1VSUA 3OO0A 3NEAA 4PX3A 1S2GA 1WQ1R 2R7LA 2X2EA 4D6XA 1NURA 3GH1A 1EM6A 2IEZA 4MB2A 5J2TA 5FWAA 1DS6A 2H4XA 1WU7A 4O1IA 4N6OA 3CR3C 5FTMA 4AZSA 4TMYA 4DHWA 4D5GA 5CD1A 3FZEA 1SK8A 4TXLA 4KKXB 3NM4A 1H5QA 3RV3A 1U9IA 3SSNA 3NP7A 1P2VA 4IXMA 4FJ1A 1GILA 4XGKA 1V48A 3KZKA 3LCMA 4H3HB 3HXMA 1OH7A 1XZFA 3N1UA 3F5SA 3ANMA 4H18A 2C29D 3BIJA 3AI3A 4F3RA 4DYHA 3I2KA 1KP2A 1SUDA 2Q2VA 5KQLA 2GZMA 2PS0A 3Q0TA 4OHWA 1ULUA 4EB6B 2D3WA 1V5EA 5K3OA 3QF4A 3MMXA 2G5PA 5LSAA 5FPSA 1DTWA 2IK8A 4HDAA 4B7XA 5F78A 4CMEA 4DA0A 5ITWA 3NT5A 4J6EA 3K0HA 4KBGA 5A3VA 1ACLA 4Q4AB 3IP8A 4G0UA 2YS7A 4I8IA 1I9CA 2F2TA 3K8ZA 2J3DA 3AF4A 2A84A 4K2AA 5TC4A 2JLZA 1U5CA 5JQGB 5CITA 1S9HA 1H2EA 3NGXA 2NADA 3BD6A 1Z5PA 2CFCA 3BXFA 1JV2B 3DUWA 5EQTA 1Y9JA 3HUTA 2PRSA 3MCAA 4I5GA 5K3AA 5K8UA 2H4WA 1PFUA 2FZCA 3OQ1A 4EVSA 5TGZA 1VSBA 2GPWA 4UM8B 4ZVOA 3HI4A 2XF8A 1THZA 4IIBA 2J3HA 4DADA 4OGFA 4KR6A 5JBQA 1H5NA 4BAGA 1ZM2A 1QYWA 1AXRA 1RKVA 1Z29A 2QE7D 2PWAA 2ZYIA 3QPWA 1EAYA 1KBQA 4MDHA 4HNUA 3LUAA 4ZT2A 3SDSA 3SQDA 2RHJA 1EWKA 1ORVA 1YMUA 3IBTA 3PPIA 3SHQA 4X7RA 2FX3A 5EJ6A 4ZDWA 3N39C 3N8DA 4OQPA 5K0SA 4YWJA 1BX1A 3EVGA 3QVLA 4KAJA 3MT8A 4CKEB 2O8BB 3I5XA 2BF7A 4WKGA 1XQ1A 4AUKA 3IBGA 2JHFA 1CB0A 3GRYA 3O3MB 3Q7QA 3COSA 3ABIA 1KVRA 3QKSA 1ZNWA 2P3SA 3VVBA 1Z4PX 5GY7A 3ZIAA 5A2QA 1EXNA 1Y5MA 5EMNA 1ZK3A 1ZNXA 3NH9A 5GONB 1AB5A 5DTQA 4EY3A 5AW7A 3FJYA 2V54A 1VXOA 4DJFC 3OT1B 2YYAA 1PGOA 1ZIXA 1X1AA 3DBOB 4RF5A 5BW4A 1AF7A 2QLLA 1TJ5A 5AW5A 3U9LA 4QYWA 4G25A 1PR1A 4TQGA 3QFSA 3TXXA 4DUZB 1AKVA 4XQGA 3AF3A 4MJ3A 2WSLA 1ZKDA 2FPKA 5PGMA 2XRFA 2G72A 3CH7A 1MJGM 4F4IA 1EK2A 2BOVA 1AZSC 2Q7XA 2YFQA 3LSYA 4QWMA 1JQ3A 3DMFA 3SOPA 4BNUA 1DXOA 2NNWB 4ZARA 3LXUX 2HSZA 3FMFA 4QGSA 1D07A 5ALTA 4A10A 2VKQA 2QVGA 3AKDA 1R5OA 2OV3A 3L7OA 4LE1A 3TJMA 5AD1A 3RKRA 4PYIA 1XZLA 5CU7A 2QDXA 4U7TB 4H35A 1EP9A 2OPBA 3EGCA 4ZEOA 3I5YA 1PWEA 1J0DA 3O4GA 4KX5A 4EI2A 3CLRC 4EOGA 4FYXA 5D00A 2OAGA 4X1KA 2EW1A 1PLKA 1T0PA 4CM9A 1M5TA 4G4GA 5BSKA 4GZLA 1HLPA 3OCUA 4ND6A 5L3ZA 3EX7C 3QNMA 1RWNA 4Y9TA 4CF6A 4DVGA 1HNWB 3V4LA 2JIMA 5ADUS 4FGLA 4RY0A 2VK2A 4JLAA 4IMJB 1XRNA 2CZQA 2YWCA 1CIJA 5BOVA 1LB1B 4X20B 1KI2A 1NLFA 4B6EA 4C0JA 4QYIB 3UN1A 2OMKA 3DLCA 4KTTE 3GRUA 3RU9A 4NYMQ 4G2NA 1GXSA 3ENWA 2OLEA 1H85A 3E22A 3NORA 3PVZA 4MR7B 3GAAA 5TF4A 5C7IO 1ECGA 1GGFA 3AL3A 1KAEA 2HFKA 3QK7A 5F77A 1KDTA 2DFKB 5K0GA 1O54A 3WZ2A 3RUFA 1ZEMA 1T3ZA 3L0DA 3R8CA 1PKEA 1S02A 1T8RA 2C97A 4G6ZA 4QXOA 3USZA 3F73A 1X7YA 1RBMA 5DHQA 3TW6A 4BFWA 4DMFA 2WICA 4N01A 4X8MA 3DKRA 2IYYA 2WE8A 3HJHA 4MPTA 4RMJA 1SC3A 2I3DA 2HHLA 3RUPA 2ZAIA 1YS9A 1E6KA 4UTPA 2XWJI 3EUFA 3KLPX 4E5MA 4H15A 2GK7A 3VZSA 3EBPA 2PJDA 1KFKB 2D74A 5ALRA 3COVA 3Q6MA 3NBKA 1PDVA 1UBOS 3DL2A 1IWBB 1E2JA 3B9PA 2ZGVA 3LX5A 3WYEA 4CMBA 3Q5GA 5LD2C 2WSYB 3B1FA 4S1NA 1DBWA 3C1OA 3S2ZA 2ZCVA 1UQRA 1RXSA 4XR4A 1UP4A 2GAIA 2VYND 1P18A 5AK4A 5KSPA 3G85A 1NT4A 1NXQA 5HGXA 1B8NA 1M2OA 3DVRX 1UJMA 1KVUA 4GUDA 1FBTA 1SVUA 1Z88A 3AU8A 3GHYA 4FUTA 5THXA 4RMGA 3PXGA 1RFGE 4EH1A 2FWNA 1TYAE 2QG6A 1ULHA 2E5FA 1Y3CE 4JVNA 1B26A 2AYYA 1SD2A 3MBOA 3RIEA 1MJHA 3NHKA 5FUYA 4Z3KA 5TEWA 3ZVNA 4O3FA 2PMWB 4J7CA 4U63A 1GARA 3E4CA 5ALNA 1I24A 1XL1A 1ZH2A 2GXSA 3PF8A 3R3ZA 4G81A 4ZQCB 3KSDO 1TAQA 2RDMA 4I7EA 3GLFA 3REQB 1DUVG 3HP1A 3BB1A 4R2HA 2ZFUA 4HSEA 3EUEA 3KALA 3PWSA 1M7GA 4L07A 4PICA 1VMAA 4RLSA 5ALYA 4WUVA 3TLYA 4CUJA 4F2DA 3RJ9A 4LEIA 4M54A 5E6SA 4GHWA 1BCRA 1SXPA 1AKNA 1MNQA 1X7WB 4KGDA 4MS3A 4NEHB 4RTJA 1PNVA 5FA8A 3V80A 2GEVA 2IV3A 4KR2A 2W2VA 3UB2A 5DI9A 5C5CA 1A77A 1B8OA 3TM5A 1JJAA 3BMNA 2QM8A 1E2NA 4I1RA 1SD1A 3L84A 2B4YA 2EJUA 4KHZA 4NWIA 4NECA 3BL5A 3WYNA 3FKSA 2COEA 5LXTF 3TLKA 1Z2AA 2BLNA 1UPAA 2VDWA 1BGVA 3QE0A 5H83A 3WLRA 1SIBE 3AZQA 3K2EA 1W5BA 3I4LA 3ZHVA 1PV2A 4QRHA 4NE7A 2W8ZA 5E7MA 4YMWA 4WACA 3DCYA 3DT9A 3IP7A 1JLKA 2VNSA 3P26A 1NJFA 3L0BA 3EA0A 1XEWY 2I7XA 3Q8WA 4WD3A 3CUVA 4RHUA 1EG7A 1OYOA 5EIBD 2HHAA 3I28A 3PWTA 3FOZA 3EXIB 1ZICA 1W5AA 3VOBA 3DXZA 3U0BA 1E1DA 2AC7A 2JJ1A 5ICSA 5LLTA 2UZ1B 4ZT6A 3PHCA 1G0NA 5EMJA 3OC0A 2YHBA 1QBGA 3CY6A 4RVGA 2F3UA 5AJZA 2V7QA 5IVHA 3H4VA 5K9ZA 3ZCSA 4JI7B 2GO7A 4FE4A 5DHTA 1A97A 5JARA 4JYAB 4KK3A 4NXMB 2VJMB 1ZIYA 4K3VA 5J5AA 3DDHA 4ZAVA 4XWKA 1Z4QA 5AOVA 4NONA 3ZCRA 1QCYA 1U99A 2VJCA 1X1SA 3H11B 5DNCA 3UUEA 2XGOA 3T1TA 5ARBA 4N9QA 2C20A 3CEHA 3WXBA 1US8B 2F9FA 3JPWA 1NZDA 2R4TA 3WWOA 1P0MA 1H65A 2G9VA 3S7TA 4C01A 4OM7A 2GEDA 5I7WA 4OXYA 1HG0A 3HDYA 5JQGF 1P2BA 3JYNA 4A27A 1CZUA 2ODPA 4XVCA 5U4XA 1HLDA 3BXGA 2QN6A 2UUCB 5TVKA 1KSHA 4HDSA 2X5KO 3CCCA 3PGA1 4HGZA 4J91A 5AI5A 2ZUEA 2GKOA 1H4SA 3AWDA 1MJGA 3PHJA 1AZLA 1Q2XA 1T9KA 3MOIA 5IXYA 4R7GA 2BN4A 1VBNA 3OFVA 1DX6A 1TW2A 3HCEA 3ZTTA 2XBMA 5LU8A 2HWXA 3WRXC 1PNQA 1C4OA 1QAMA 1IY9A 4BB0A 1G7TA 2R00A 5BQOA 5KU1A 1SHKA 2P8JA 1W36B 3VYVA 1N5LA 1CY0A 2BM9A 4K8RB 4TGLA 4BNKA 2RHDA 1TIKA 1JHAA 2GETA 2PKWA 4G63A 1A7KA 3DP9A 4UE2A 5CFNA 3N2IA 3IA7A 4FVTA 4BIIA 3BDAA 1AO0A 3I62A 3QIVA 4CVNA 3NP9A 9GPBA 3K70C 4QREA 1ZKMA 1JYEA 5FUBA 3BE6A 3UYKA 4Q6WA 1RHUA 2HRDA 3PXAA 3ROQA 2EBHX 3M6XA 4ZHQB 3W0LB 4Q4CA 2Q4TA 3E03A 4RD3A 2X86A 3W79A 1EFKA 1TB4A 3L1UA 2CYBA 4QG3A 2J9XB 2QM7A 2V5VA 4O5AA 1GPDG 1KSGA 4B47A 4RIFA 5CBPA 2A0FA 2BDTA 5GONF 3U7JA 4F91B 4BNIA 4KREA 1I10A 3KLNA 3E3NA 1OH8A 1VG0B 2D2EA 1U3CA 2HK7A 2WR8A 3SU8A 4S24A 5C37A 5IXJA 1H2ZA 1AQNA 2I91A 2ROQA 1FQWA 3D8RA 3ZU6A 3OC6A 3D7RA 1Z8DA 3EOAI 3OSZA 4BJHB 1U0EA 5ILOA 4HWKA 2HLNA 1MIOB 2HY7A 2Z08A 1NNLA 1SXHA 3S99A 1O0BA 4UU0A 2WIDA 1Z0DA 4FZJA 8ABPA 2HXSA 1DIHA 4R31A 2M9MA 1T0JB 2P2YA 4MV4A 4UQOA 2IIPA 3VV2A 4C14A 4F4JA 3TGPA 1DRJA 3I23A 1PVOA 3A6DA 3X1ZA 1WDMA 1ZK0A 3IT0A 3NHWA 1Z7WA 1YONA 3CU5A 3KPYA 4JP8A 3VR2D 2BBOA 3DBLB 4L3VA 3WIEA 1ZU4A 4J4HA 5CM2Z 4Y1GA 3V8RA 3ZDEA 621PA 2F1HA 3D1LA 4XM2A 3IAUA 1LDBA 4RTKA 1Q7CA 3M0EA 2Y93A 3BXZA 3PJRA 5EIXA 4NK4A 1UXGA 4ZOLA 5D1NA 4C6TB 4HRXA 3DTVD 3A11A 2GVDC 3MTAA 4IVQA 4TWJA 5GVRA