1RVDA

H-ras complexed with diaminobenzophenone-beta,gamma-imido-gtp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
160
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN P21/H-RAS-1
publication title Guanosine triphosphatase stimulation of oncogenic Ras mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 57
structure length 160
sequence length 166
ec nomenclature
pdb deposition date 1999-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rvdA00
1GDDA 4L8GA 1XCGB 1NIPA 4KBGA 4Z51A 1CP2A 4IOKA 2ZI4A 4X8MA 2RB4A 1MH1A 2IX3A 2PZEA 1SXJE 4BLPA 2OBNA 4JLMA 2RHMA 5JHHB 1QHSA 1Z0IA 1KJWA 5FL7D 2XNSA 4US0R 2GILA 2AWNA 3U7FB 4XH9B 3U3OA 2OUKA 1YZGA 3CRW1 2WPDA 3CKLA 4NCHA 2IF2A 4MYCA 4IFEA 2P5TB 2RGBA 2QMOA 4RZ2A 3PUVA 1IY2A 2ZI6A 1ZU5A 3N5CA 4FMDF 2CDNA 3EAQA 3BWDD 4QGAA 2KBEA 4UNQA 4F4IA 3VR6A 1KTVA 1GRRA 1KI3A 1T0JB 2WV9A 3X1DA 2H7VA 1WMSA 2LWIA 1D9XA 4ZDIA 2H8KA 1NN5A 4C4PA 3AP3A 3EPKA 1GP2A 1XCPA 2VIIA 1IXRC 4M2LA 1G291 3U3JA 1XDBA 4Q19A 4IXMA 2AFIE 3BB1A 4BLSA 4G5QA 5E4FA 1OHHA 2WAYA 2E1RA 2WKPA 4QBIA 3TUIC 3SQXA 4JSTA 1Z5ZA 3IBYA 1E1QD 3AKEA 1MV5A 1NMZA 1E3MA 4IHQA 5KO2A 4XVUA 1E2JA 2CK3A 4QGHA 1G6HA 1DO2A 1ZCBA 3GQBA 4Q4HB 3U44B 3PUWA 3A58B 1XD2B 2RGGA 4BZQA 1QZXA 4BLOA 1A5TA 2W0MA 1G64A 2QPOA 4AIIA 4ABYA 4IVRA 5LBIA 3WNBA 3M1IA 2EYQA 2XOKA 1Y3AA 2ONKA 2EW1A 4A0RA 2YOFA 4NCKA 5IT5A 1YRBA 4XWAA 1E99A 2R6FA 1KI7A 1OPXA 3KTAB 2HUPA 3TRFA 5C46F 2P2LA 4IDOA 4FWTA 3LVRE 4JJKA 3PXGA 2ASEA 2WMNB 3TAHA 4LYAA 3KJHA 2OSBA 2FMXA 2ODWA 2V8OA 2NMVA 4NE2A 2QROA 1IN7A 3IQWA 3KB1A 1T5IA 4MYUA 2IWHA 2GJAA 3RRMA 3QIAA 1KO5A 4OJKA 2G1KA 2ORWA 4CEHB 1BMFA 4HZUB 4D0LB 2RGNC 3CIOA 3LV8A 4C3ZA 4RCYA 1HEIA 3NBYC 1Y63A 3UIEA 3K9GA 4JLJA 3KKMA 5G3ZA 3HDTA 4RFVA 1YE8A 2XITA 1FZQA 2WSMA 2BM1A 5EQTA 3HU1A 1NJFA 1XTQA 3ZVMA 2NIPA 1JXMA 2GVDC 4OHXA 2GTPA 4XVQA 5TVKA 4A6PA 3L8ZA 1GL9B 4HAZA 2O8DA 1JAIA 2BV3A 4QJ4A 4IW3B 3AQ4A 1GNQA 4QJ3A 1ODFA 4AG5A 1E2EA 2IHBA 1OB5A 3IHWA 3ETLA 1VCIA 1T3LA 2ZM5A 1ESNA 1W44A 4IVPA 4DDUA 4Q7JB 1DO0A 1P9RA 4NYMQ 3T06B 1T3HA 4G3XA 4MDFA 3L0OA 5AUPB 4A9AA 1RKBA 2WKRA 4QJ5A 3BD9A 2REXB 1VHTA 1S1CA 3B5JA 3N2EA 4EPYA 3K70B 3VKHA 3CPEA 1M2OB 4H1UA 1TADA 1QHGA 4DRZA 4P31A 4AYTA 1E9AA 2RAPA 4YDSA 1W0JD 3V4FA 2QM7A 3PG5A 3N2IA 3ZGXA 5DNYB 4I1OA 3GEEA 3TSZA 4W5WA 4NH0A 2OE2A 2V54A 3E1SA 3KKPA 2ZR0A 4JL8A 3FKSA 4BLRA 3TUJC 4C0HA 4EJSC 1FP7A 1TUIA 5B57C 4TZ6A 3T12A 3TW8B 3NBZC 1W36C 1VIYA 3U3MA 4QG7A 4KODA 4PHTA 3JZAA 1N0UA 2J59A 2FX3A 2OBMA 4LJ5A 5FPKA 4JYCA 2FFBA 2VQSA 5K8TA 5C18A 3CW2A 2GZAA 1MKYA 4EIWA 4QM7A 3QF7A 2FFAA 3WBJA 2WWFA 4KLNA 4G5OA 1SKYB 2REOA 3VR2A 2ATXA 4S35A 1NKSA 5DN6A 3GJ5A 1JR6A 5DISB 1KO8A 3LFUA 4ZCMA 2BBSA 4JVMA 3D7MA 1WCV1 1EK0A 2NPIA 5AJZA 1D5CA 1TQ2A 2OHFA 1OXSC 2R62A 3LLUA 1KKMA 2D4HA 2QUZA 3MGCA 4TT3D 1TEXA 2OLKA 2QNRA 3F3YA 2ZRLA 4Z8XA 3U61B 5JLJA 2QMEA 4YQFA 1Z6GA 4PQYA 1E0JA 1OYYA 4OQNA 2ZRAA 4ARZA 4PPGA 1P60A 2FA9A 2I3BA 3NXSA 3Q72A 2KWIA 4V0OA 2YVUA 3AVOA 2IEZA 4Q4HA 4HLCA 3U44A 1N2CE 2GCNA 4CEJA 1UADA 1XD2A 1D2MA 3CX8A 3EARA 3DZDA 1NG1A 1X8JA 2QAGC 3LBHA 3X2SA 3AEZA 4ACBA 2JCSA 4BFUA 2K5UA 1KNQA 3RC8A 2VEDA 3QKRB 4XD7D 3B85A 4TMTA 2J87A 3VMFA 4IKEA 3NEJA 1UF9A 1NVXQ 3K09C 2J1LA 3GFPA 3SNHA 3U7EB 1P9WA 2ORIA 4QBGB 2GDJA 4TZ0A 3AVVA 4YLGA 2ZR9A 3KTAA 2O8EB 3WNDA 3V9PA 4Q5IA 2N1BA 2QSYA 4WA7A 1KMQA 3HR8A 4L9SA 2Q9CA 3WP1B 4GFDA 3KKOA 5C4MA 1QHHA 3BBPA 3PR1A 1Z28A 3WBKA 3MD0A 3IIMA 3HR7A 4Q1CA 3THYB 4CEHA 4PC6A 5JCZA 1KDRA 4GL2A 4FD2A 1VKJA 5B58C 3FDIA 1NN0A 2KBFA 1CTQA 1KSFX 4NBSA 3I5YA 2PT7A 1RIFA 3UWOA 3FE2A 2A30A 4P33A 3X1XA 4MRVA 4M1MA 1P72A 1VECA 5GADl 5AJXA 1KIMA 4HB2A 4NHOA 4Q21A 5FH9A 2D3WA 3T34A 1ZW6A 3MSXA 3ZZTA 1YKSA 4JLPA 1IN5A 3LW7A 2EVWX 1VHLA 5EXPA 2H16A 3R20A 4M9QA 2NO7A 4IVQA 4HDCA 1E9CA 3RNLA 3W8RA 3KXLA 1Z22A 5FPYA 3SFZA 1M74A 3H4MA 1R0WA 5FR2A 4HUTA 4G01B 3NG1A 4GRAA 3D6TB 3GLIE 4RZ3A 3ZQ6A 3VNVA 4LC0A 3AVQA 3CF2A 4TTPA 1HY3A 2A5YB 4AYWA 4QGGA 1KI6B 4TTRA 2QSZA 4AG6A 2DYKA 1E2IA 1Z08A 2F9LA 3LQQA 5A5GA 3I5XA 4URYR 1RJ9B 221PA 2IXGA 4UNRA 5CDFA 3W8NA 2MSEB 1OH6A 3KQUA 1R5OA 4CGZA 2J41A 1SVSA 3KJIA 2RGCA 2ZVPX 1OIVA 1JR3D 2IYUA 2OCBA 3IGFA 2FDCA 3DZ8A 3IDQA 1W47A 4GT1A 2X2EA 1Z06A 4MGIR 4P4SA 4DLXA 4I1VA 1KMHB 1HQYE 4KVAA 4PO1A 1GL6A 1XCMA 2B8WA 2CVHA 4A8JC 4LCBA 5B30A 5KHOC 2EFGA 1F2TB 2OXCA 4I4LA 4K81B 1R5BA 2WJIA 4M8NE 4S2EA 1XF9A 1H8EA 2WICA 2QTVB 4B2PA 1ZIPA 2KJQA 2VH5R 2VO1A 2D62A 2CNWA 1G16A 4PSKA 4UXIA 2OCYC 2VF7A 3B9QA 2XAUA 1G9XA 4OKSA 1K6MA 2H92A 2AN9A 3SU8A 3OFNA 3CRMA 1B23P 3CPHA 4JSYA 1Z6YA 2R8RA 5JJKA 4NONA 1BIFA 2J0VA 4RVCA 4XIGS 3EXAA 4ZI2A 2DWOA 3O8CA 5AUOB 3KXKA 5L3SB 3A1SA 1HH4A 2ANCA 1Z0AA 1SVMA 4YMSA 4BASA 4JT2A 4F7WA 4FMCF 2YZ2A 2CEAA 4AY2A 1P2UA 1ZAKA 5A4JA 4MKFA 5LB4A 1FOEB 3A6PC 2FSFA 1AS0A 1XXHB 3QJYA 2AK2A 2BVNA 3CZPA 1DG1G 1US8A 3EIQA 4M9SA 3WYAA 2BWJA 2FJUA 2RKOA 4DXAA 3WHLA 2NTYC 1EFCA 1UKVY 3Q5EA 2ZIAA 5H68A 4B2LA 2X1VA 4FWIB 1VYVA 1Z07A 2C78A 2OFWA 1FL9A 4FMDB 1Q22A 3AH8A 3MAAC 1NSFA 2GJSA 2ZTSA 3K0CA 5IK2A 2QN6A 4HB0A 5FTMA 1HT2E 1ZMXA 3TBKA 3RAPR 1PV4A 3A4MA 4CEIB 4Q7LA 4OL0A 4RY2A 2F1RA 3DM9B 2ATVA 2ZROA 2OAQ1 2ZYUX 2DCUA 4YONB 4C9BA 3RS5A 1AA9A 1XTRA 4LUCA 1M7GA 1DTSA 1RRGA 1SXJD 4UJ5A 4LHWA 4DCUA 4BFSA 4DLRA 3GCGA 4WAUA 5H8WA 1U94A 3C16C 3JVVA 2ZUCA 2A78A 1QHXA 1E9FA 2W6JA 2GWHA 2P5SA 4UXHA 5EE1A 3THYA 5DLQC 1PVOA 1LTQA 3QXXA 3CH5A 2G83A 3NKVA 4MDEA 1Q20A 4UNNA 1T6NA 4O2RA 3SOPA 2ZE8A 5CB8A 3KKNA 1DADA 2GZHA 3KX2A 4W5HA 3VR4A 4M1YA 4ZIRA 2ZI7A 3B78A 4TMZA 5UKDA 2WJYA 3LX5A 4LJ9A 2FPMA 4UNSA 1KJYA 1AKEA 3HU2A 1HE8B 1VYTA 1GKIA 2P6UA 3QXJA 5JECA 2RMKA 3GLHB 3QF4B 5CJPA 6Q21A 3V00A 2IYQA 2WSSA 3Q3JB 4EKDA 3AKCA 2IXEA 4AYXA 2ZSEA 3SS8A 5D3MB 2B92A 1PUIA 1G7TA 1DBSA 2ZRNA 4JL6A 1FX0B 4W9MC 2Q3FA 4YMUA 3K9HA 3AF0A 2DWQA 2Q9AA 2O0HA 1N6PA 4ZDKA 3MJRA 5BWMA 3UMFA 1AQYA 4IOJA 3RWOA 1Z0JA 4R2IA 1DAEA 3OEHA 1A4RA 1RJ9A 2ZVQX 3CNOA 5HKKA 5KTYA 4PR0A 1W0KA 1E94E 1J70A 2A9KA 2XNDA 5KDOA 3QXHA 3MWLA 4IEIA 4B75A 2F55A 4KBFA 5JHGB 1P2SA 1R0XA 4BWYA 5JWHA 3GJ8A 2F43B 1RRCA 1NBMA 1OF1A 4Q4JB 1Q44A 3RYTC 1EGAA 3BFKA 2OFXA 4Q7MB 3SN6A 4C0JA 1GNRA 1KMHA 4DCNA 1E2KA 1P5ZB 2ZETA 3LQRA 1OH8A 4LV5B 1F2TA 1N6OA 1G3UA 4X8HA 2I1QA 3RC3A 3VKWA 2DY1A 2ZJZA 2GK7A 2FPLA 1ONBA 2QTHA 4CVNA 3IIJA 3RRNA 3QI2A 1R4AA 2VYFA 2PZFA 3HPRA 5FBRB 1HQCA 1TNDA 1XMJA 2MMGA 1DARA 4CT5A 2OG2A 2J0SA 2C2HA 3NBFA 2Z83A 4FI3C 2XB2A 4AKGA 1Q1ZA 1TQ4A 1EX6A 2IS1A 2IUUA 2EFCB 2OV2A 5L3SA 2FSHA 3ASZA 2CLCX 4TYYA 1G19A 1XMIA 1TMKA 3KUCA 2CCGA 3MJHA 3ONWA 4D4MA 1W2GA 3U6BA 2VP4A 2ZJ5A 4A4DA 3AP2A 1NSTA 1ZM4A 2EFEB 1QHNA 2C03A 2ZRBA 4LY6A 5FI1B 3HU3A 1PJRA 1RC8A 3FMPB 4F38A 1OKKA 3VHLB 1Q12A 4BUJA 4BEJA 1TF5A 4JT4A 1JNYA 4PAMA 4TLCA 3W5JA 4BFTA 2VP2A 1VG8A 2PMKA 2GJKA 2N46A 3A36A 4OJQA 1H8HA 1ZU4A 3BERA 1CJTC 1NF3A 1NY6A 1TF7A 5CK5A 2DHRA 121PA 2SHKA 4UJ3A 4CEIA 2PEYA 1KZ7B 1KSHA 1G21E 1U99A 1NVUQ 2W58A 4G1UC 1Z6XA 1Q21A 2GEUA 4XSGA 3RS2A 4RCZA 3ZS8A 4OI0A 1RVDA 2HCBA 3KL4A 1G41A 1RYHA 1XEWX 3V4RA 3KJEA 4KU4A 3EWAA 4YC7A 2REBA 1W7AA 3LH5A 4UNPA 1XD8A 3Q85A 3WNCA 1CRPA 1UEJA 2B8TA 1MO6A 4FCVA 4IJMA 4B74A 1KYIA 1BYIA 2P6NA 1JB1A 1N6NA 5DI9A 1N6HA 4PFSA 5FPHA 3CRRA 4PC3A 2WWGA 1WBDA 1E2MA 1E98A 1W36D 4IOMA 4Q9IA 5K8IA 4LHZA 2ODNA 3TAUA 4LYJA 2OXRA 2WM9B 1XNJA 2A2ZA 3W5IA 3FKQA 2UZIR 3GD7A 3R7WB 1JEDA 5FUWA 1ZUNB 2IYTA 1OIXA 3B8HA 2ZRCA 3KZ1E 3A1WA 4QXAA 2C8VA 3C41J 3OAAD 2J7PA 3ND8A 1R0ZA 4WXPA 3GLHA 3QF4A 1E9BA 2PL3A 3AVWA 1KI2A 4PC1A 4KJZA 2IBMA 2IUSA 1ZM2A 2ERYA 5D3MA 4Q66C 3WHKA 4CW7A 4TQUS 1ZJ6A 3ZIAA 4DCTA 3SJAA 1FX0A 2QE7A 3NDBB 4KAXA 4NP6A 3KQLA 4NYIR 4C0KA 4A0HA 4EFMA 2CCKA 2UZ3A 2BKUA 5FTKA 3UG6A 1OB2A 1U2RA 4PHHA 1WDTA 1R2QA 2XXAB 2XGJA 4PANA 2W6JD 5JWOA 1T9HA 1E32A 1M8PA 4OHZA 4TYQA 3EZ7A 1JAHA 4DWJA 2AXNA 1TPZA 2HT6A 3GLGB 4B34A 1Q1EA 2ZJYA 2JJ1A 2GNOA 2O8FB 4PSVA 3B1VA 2JJ2A 1GAJA 4OI2A 1SXJC 5FPTA 4ZCLA 3TKLA 4URVR 1ESMA 1UBEA 3MWKA 4O3MA 2F43A 1DELA 3TVTA 3IIKA 1EFHA 4LI0A 5EUMA 5GJVC 4JIMA 4LGMA 2VTKA 1P61B 3R9WA 3DHWC 2QZ4A 5L3QB 1NLFA 2VHJA 5E3HA 2IW3A 4ASUD 4LHVA 5BN3A 3THWB 2RH5A 3RS7A 1SULA 3CR7A 1GOTA 4M9ZA 4LJYA 4LBYA 1XPOA 1N5KA 4M1OA 4NYJQ 4WIAA 5GJWC 3T1VA 5J4VA 2PJRA 2FFQA 3LVQE 2ERXA 1AS3A 4HAYA 4DSOA 3BJIC 5KNCA 3AGPA 4YMWA 4BLTA 3SJCA 4JLBA 1G7RA 4RFSB 2WJVA 2Q3HA 2Z6VA 4Q9JA 3ZH9B 2IS4A 4LHXA 1U0HC 4US2R 1WF3A 4A2QA 3ZQJA 2O8CB 3AVXA 3D31A 3IO3A 2IA5A 1TTTA 4B73A 5IF9A 2BC9A 2CXXA 3E70C 2OT3B 1YU9A 3Q8XB 3GJXC 3LBNA 1XTSA 3P26A 4LWZA 5JS7A 2AR7A 5DI3B 2B6HA 4PC7A 1V5WA 1VCMA 2HLDA 4QOSA 2QG6A 3THOA 3L8YA 1KI8A 2IYYA 3QENA 5E7IA 4BGDA 3L0IB 4L16A 2J46A 3I8XA 2FF7A 3PUXA 1TU3A 2KE5A 1KJZA 2H17A 2VP6A 4F4JA 3PIRA 4F4CA 2AK3A 1S9DA 1K5DA 1K8RA 1OV4A 1W4CA 2J5XA 3UPUA 3AUYA 1VPLA 4A0FA 3PQCA 5EE5B 1MO3A 4Q1AA 5KSYA 4GP7A 3WY9A 1W2HA 4RZUA 4FMCB 5AJVB 4BFWA 1IY0A 3KUDA 4EPWA 5JWRA 4LYFA 4NU0A 4Z8YA 3AM1A 2BM0A 1FQKA 2BEJA 1COWD 3U60B 2VHTA 2YWGA 3FVQA 4V0MA 3KFVA 1IJFA 2ZUBA 5AJYA 3SJZA 1ZIOA 3SE0A 1HA3A 1UDWA 1ZC4A 3PV0A 1Z0DA 3BE4A 4LK2A 4DLWA 4DUGD 4P32A 1U8ZA 1ZNXA 4D80A 1YZTA 3K0SA 4P4UA 2NPFA 4ZDJA 2IYRA 1ZD1A 2IYWA 5KSZA 2ZRKA 4I1UA 3QVVA 1HUQA 1KK1A 3NDPA 1N6LA 3R7WA 2VRWA 4QKQA 2GESA 4KYIB 4TYWA 1H8HD 5CDFE 1G5PA 3OIWA 4LV8B 4MH0R 3ZLJA 2Z4SA 4M21A 5J5CA 3CX7A 1T3SA 2ZJOA 2HF9A 2NO6A 4B76A 5HCIA 1Q1QA 4D0GA 4NYMR 1YQTA 1HE1C 1TEVA 4I99A 1XTJA 1J8MF 1PLKA 2P3SA 2RGAA 2YWEA 1EWQA 3JVUA 1IXSB 1CU1A 2QBYB 1E1RA 2HCJB 2AL7A 2Y8EA 5E95A 3IO5A 3SQWA 2RGDA 2F3TA 3FMOB 4UKDA 4DIDA 3X1WA 3NC0C 2XXAA 1GKUB 1F60A 2AWOA 1SHZA 4ZO4A 4GMXA 4CF7A 3PITA 1R8QA 4YXWA 4M0LA 3EC2A 3H2YA 1MR3F 2E87A 2CLSA 4LDJA 1XJQA 4GI7A 2O8FA 1OXXK 3ZS9A 2NO9A 4B35A 3THXB 4UQOA 1Z47A 3BFXA 2W2TA 3F8TA 1X8KA 3ICEA 4GZLA 5L8VA 5E7MA 4MKGA 2B21A 4DBLC 1SKYE 3ICQB 2XZOA 2TMKA 1E0KA 1KO7A 2W0SA 3TLXA 3OEEA 1YZLA 2DR3A 4GOXA 4Q01A 4TWZA 1P75A 3DOEA 2IS6A 1OH7A 3KKQA 2AXPA 4PHFA 4B3DA 2ZRIA 2WJGA 4A92A 3BORA 821PA 1G3QA 3THWA 1IY1A 3EZ6A 3A1VA 2X19A 3QBVA 1X86B 1P73A 5FPSA 2CCJA 3B9PA 1EFTA 2XTZA 5DE3A 5LD2C 1NG9A 1OFUX 4K46A 4LYHA 4RD0A 2O0KA 3TR5A 4ITRC 2X77A 4ERNA 1G8GA 1A1VA 2CHVA 3CWQA 1J8YF 4B3FX 1OIWA 3I62A 3AVYA 3BGWA 3K0CC 1JBKA 4A2PA 4AWXA 1ZNWA 2QMUA 4RFSA 5G41A 3IKJA 1LW7A 3IUYA 3EPLA 1U8AA 2IC5A 3GJ7A 3ZD6A 4CDGA 2ZAMA 2IUTA 4Q00A 1CEEA 2C95A 1UPTA 3QKUA 4LV6A 1U98A 2WOJA 1ELOA 2FZ4A 2Q6TA 3W6PA 1LFDB 1TQDA 4D81A 4MQBA 1J90A 4IDHA 2CL0X 2RGXA 1KNXA 4LJ6A 5CYOA 4Q9KA 4EAQA 2GF9A 5TXGA 5DI3A 3E5HA 1N6IA 4RD2A 4RSGA 2CL6X 2F7SA 2JA1A 2AX4A 4LHYA 2WPDD 4D4KA 1ZM9A 3A4NA 1M7BA 3QKTA 3BAFA 1U90A 4JS0A 5JBQA 1XTIA 2YJTD 4GDFA 5JJLA 4WOPA 3AGQA 2ZSBA 3NHBA 2C04A 1QHYA 3BC1A 1KZGB 3VU9B 1JEEA 1SQ5A 2JASA 5C1BA 1K5GA 5K8UA 2V7QA 3W3ZB 3PEVA 2QT0A 1W36B 4KFUA 4OQMA 1XFAA 3R9XA 1R5NA 5CIWA 1HTWA 5KDLA 1OHHD 1G8PA 3VX4A 3QBTA 3OIYA 4HZUA 4BE7B 4GOJA 1T0HB 3BH7A 4G5RA 4TL6A 4V0KA 1BYUA 3B60A 1E6CA 3G5UA 4I81A 1G3MA 2OZEA 4R9UC 1JPJA 5FTLA 4Q4LA 2O8BB 1UBCA 4EQ6B 2ZEJA 2HXSA 2CK3D 1CLUA 3MMPA 4JVLA 3NH6A 1LS1A 1SVIA 1S96A 1E9RA 4B3BA 4TL7A 5C4GB 3RS4A 1OH5A 2HLDD 4GBMA 2V9PA 5DO9A 3RWMB 1VCNA 2O0JA 4JYBA 4NL4H 4PPFA 4CYMA 5DGXA 2IYLD 1Q0UA 3GJ4A 3RSLA 1AIPA 2QL6A 2GA8A 1T5LA 4IDPA 4N1AA 2XOKD 421PA 3U7HB 2W2VA 3CF6R 3SFVA 3Q7PA 3X1YA 4PAOA 4XSHA 4QM6A 4FIDA 3T1QA 1NBME 1W1WA 4C0AC 2QBYA 2QAGB 2ZU0C 5J4KA 4EPRA 3WYGA 3K8YA 1UDXA 3W6NA 1Z2CA 3B2EA 1SKQA 2P65A 3ZYCA 4B3GA 4Q03A 4JLVA 4WW0A 2IWRA 2QM8A 4XWKA 4D82A 1KGDA 1SZPA 4ZPXA 4OI4A 1BMFD 2H5EA 1Z0KA 1GZSA 2XJ9A 3BH6A 2PJZA 1XRJA 2VP5A 2G77B 3AV0B 3TR0A 1UBFA 4PSAA 4KLZA 3ZJYA 4KFRA 1OJLA 1VYUA 3THXA 1KI9A 1RRPA 4AURA 4ON9A 1ANKA 2WTUA 1GM5A 4TLBA 3A37A 2FNAA 2BMEA 3P4YA 1W4BA 3SYKA 1XP8A 4TSFA 621PA 1CXZA 1YZQA 2ZS8A 2QP3A 2W2XA 3SC3A 2R65A 5F98A 2G1JA 1SHKA 4EDHA 2WWIA 1M6NA 1DAKA 1LVGA 1YRAA 3AP1A 2P6RA 1FMLA 3QXSA 1DS6A 2XSZA 1GITA 2FZLA 4POAA 1R8SA 2QGNA 4R2HA 1ZNYA 2G88A 1XXHE 2IEYA 2WJHA 1BH2A 2ZE5A 3AF3A 1OXTA 1G17A 1UBGA 1A2KC 1VTKA 2B7CA 3SZRA 1ZVQA 1FTNA 3I1FA 2ECKA 3B1ZA 2JAQA 3UMSA 3EIEA 2OM2A 4HATA 2AFHE 2QGZA 2ZJBA 3QNUA 1U8YA 4DSTA 3AVPA 4B33A 3EA0A 2QA5A 3B82A 3K53A 2ZJAA 3FMIA 3C5CA 3C7KA 3HJNA 1CBUA 2G0NA 2J3EA 5CLQA 5BW8A 1W49A 1Z83A 3BH0A 4A2WA 2V1UA 3CH4B 3NEYA 2D7CA 1GUAA 1CIPA 1KDTA 2G9NA 4E09A 2ZREA 1W5SA 1QHIA 4L5BA 1XB2A 1XTKA 3FKSD 1CJVC 1N0WA 2R6DA 1SVOA 3LAWA 1NVVQ 4KI0A 4G5SA 3EC1A 4Q1FA 2FOLA 5TB5A 1NN3A 3QKRA 1T91A 3WMFA 3K0AB 1N6RA 4A82A 4MUBA 1IM2A 3CUEF 4HI0E 3EPJA 2BOVA 2OO7A 2VHCA 1JECA 4BRWA 1Q3HA 1GL7A 3VU9A 3FHOA 1RW4A 4DLZA 3DOFA 1DAGA 1UFQA 4BFVA 2O8EA 1KY2A 2GKSA 4X8LA 2FEMA 1NP6A 2V6IA 2Z0MA 1G8HA 4JLOA 2PH1A 3B1WA 1NVWQ 3OESA 4HLUA 5DN6D 5KOYA 1II0A 5EZ5A 1JALA 3GLHE 2E9SA 2JLVA 4QC2A 4KV9A 2W6IA 3IEUA 2YKGA 4JBYA 4LJ7A 2F3RA 1D2NA 1G6OA 2HF8A 1Q3TA 2JLRA 4MKHA 1E2DA 1XWIA 1E79A 5DSZA 4GMDA 2IYZA 4B6EA 2F6RA 1Z2AA 4L15A 3AKYA 4EQ6A 1DAMA 3ADKA 3FB4A 3WMEA 1GVNB 2WWYA 3TJZA 4XWOA 2WBLC 1BOFA 1KAGA 1CRQA 2I1VB 5EE0A 4TMVA 4FMBB 1DAHA 1I2DA 4B43A 4BQSA 3AVUA 1QBKC 4W7SA 5FBQB 4F91B 2WKQA 2ANBA 1JQLB 3UATA 4DEXA 3CNNA 3NC1C 2WMOB 2IL1A 3G82C 1W4RA 3GJ0A 2BJWA 2QRNA 3QEJA 2FEOA 3GP8A 4AI6A 3LW8A 3FWYA 1AN0A 2VP9A 4UXJA 2BIFA 3EASA 4BPBA 3T15A 5EUQB 1X6VA 2QAGA 2R9VA 3DMDA 5EP3A 4FCTA 4F92B 3G0HA 1NI3A 2CVFA 3M6AA 3EWSA 2D2FA 4R7ZA 3RANA 2J7KA 5HTKA 5CYPA 1P7CA 4HZIA 3H84A 2Z43A 2ZJ2A 1W46A 3K09A 2JDIA 1GRQA 1XEXB 3KDSE 4LJAA 5FL7A 1KI6A 2GVZC 3QEOA 4O0MA 3CZQA 1F2UB 2ODEA 3P4XA 3GEIA 2G3YA 4AKEA 1E2NA 2HYDA 3C5HA 4DLYA 4MRSA 4XVRA 2ZRPA 1E69A 4PTLA 2EYUA 3PEWA 2HEIA 2R6GA 3PCRB 4B47A 1AM4D 5JZVA 5CLLA 1KK3A 2GEVA 1R7RA 3EZFA 3HP1A 1YR8A 3VR5A 3DPUA 2OEPA 1SVWA 2FSGA 3ECCA 4Q4AB 2WIBA 2GXAA 4Q9LA 1M34E 4MRNA 4DLVA 5KNDA 4BFXA 4DSNA 1E2QA 1G8YA 1RZ3A 2C9YA 2GETA 3GJ3A 3KFXA 1X1RA 4PAQA 3P20A 2Z4RA 1VDZA 1D8TA 2QENA 5LDDC 2W00A 2GBLA 2V3CC 3PENA 1KK2A 3WYFA 1E2HA 1YVDA 2GK6A 1D6JA 2PEZA 5KSPA 3RDPA 3NWJA 2BKEA 3CF0A 4MKIA 2LCFA 1XX6A 4IDQA 2OILA 3FFAA 4DHEA 4ESHA 5G40A 3NTUA 1DE0A 3EPHA 3T1TA 1ZD8A 4Q1DA 4HB3A 4DB4A 1CR0A 1FFHA 5JI2E 5FOVA 4IOLA 3TSWA 1XXHA 5GVSA 2IT1A 5SZHB 1QF9A 3EZ9A 1XZPA 3TW4A 2FPKA 1E2PA 2BDTA 3REFA 4PPQA 2QP9X 4V0ME 3FHCB 1C1YA 5AUQA 1W48A 5CIQA 3BB3A 1MRNA 4ZCIA 3LO5A 2ZJ8A 3K0AA 1Z8FA 4MYHA 1H8ED 1WA5A 2QQEA 5FBVB 3LXXA 3B7GA 2WOOA 1KSGA 2CNWD 2C9OA 2QAJA 1UM8A 1VCOA 5JS8A 1AGRA 1QRAA 1E0AA 1WQ1R 1UKEA 3OFND 3BIFA 3RVBA 5GJBA 1S2MA 1ZD9A 2V1XA 1CR1A 1GRNA 4C2UA 4QHYA 5CJ2A 4KHZA 4C0LA 2C98A 2AHOA 4M1TA 4AC9A 1V43A 3J81k 3R9IA 3SI7A 2ZI9A 1OFTA 1ZINA 2GXQA 2YYZA 1N25A 4MGYR 1L2TA 3ND9A 2VHUA 4QL3A 5AJWA 3UKDA 1S8FA 2ZYWX 2H18A 2OBLA 1WE2A 3MFYA 4HAUA 3NBXX 3OIUA 3P32A 3VAAA 5ELXA 3CWZA 4GPTA 4MUAA 2FGKA 2IK8A 4OHYA 2JIZA 1Z6AA 4A36A 3GJ6A 3O47A 2OCPA 5EP1A 3GLFB 3QSYA 3K9NA 1YR6A 3L0PA 2YWFA 3AF4A 3GFTA 1UJ2A 5L3RA 4A0GA 5IK2D 1EFUA 4YMTA 5JFGA 2PZGA 3U4QB 2MSCB 2ZS7A 4LX0A 1FPMA 5SZKB 4MRRA 5J4LA 3ZZ0A 3AB3A 4Q18A 1L4YA 4FW9A 1GIAA 1W0JA 1KI1A 1XZQA 4QGFA 3SBDA 4E5UA 1MABB 4PQRA 2JLQA 2YINC 3TK1A 4DDVA 4EFNA 4EPTA 1IN8A 2BJVA 5KNBA 2JLYA 2Q9BA 4JJZA 4MRPA 2GHIA 3GFOA 2A7QA 5J4YA 4BZPA 2CHQA 2W6ID 4OI1A 4BRUA 1XEXA 2RCNA 3DMNA 4XTRA 2R6AA 2X2FA 5DYGA 4TLDA 1F2UA 3FPAA 4G0NA 1NMYA 3TMKA 3TUZC 3CRVA 1FQJA 1E79D 2JJ8A 3VNUA 4NTZA 4PPNA 4XOIA 3VTKA 4CIDA 2VSOA 2WIAA 2ZRMA 4NCNA 2WWHA 2XTNA 5IRCD 4BFYA 4EPXA 5J40A 4Q4JA 3B6EA 3LXRA 4WZAE 2ZE7A 4JBWA 1OSNA 1OW3B 1R0YA 1CULC 1E2LA 2XZPA 2GJ9A 4NYJR 1AKYA 1FUUA 2X8AA 1YR9A 1I4LD 1P62B 2WSSD 4TMKA 2UVQA 2ZQ5A 4OQXA 4EPVA 1JQJC 2ODBA 1KAOA 2BBOA 4JKIA 4TL8A 1D9ZA 1SGWA 3NHAA 4TT3A 5TDHA 3I73A 5F2EA 1Z0FA 3QE0A 4O25A 1NLZA 1UEIA 2D06A 3MUFA 4KXFB 2D2EA 5DHFA 4TMWA 4DT1B 5A0FA 4U00A 2R44A 3KJGA 3BK7A 2JDID 4JBXA 3S1AB 4B3XA 2ZR7A 1IN4A 5EXXA 5HE8A 3REGA 2OCAA 3SHFA 4DVGA 1XPUA 1IBRA 4FINA 4LPSA 3OEHD 3ADDA 5HKKD 3H86A 1W0KD 5JJIA 2C77A 2QPTA 1M7HA 4M22A 4XD7A 2XNDD 4TN1A 4OK6A 4DDTA 3RABA 4ZDWA 2VSXA 2KSQA 4HEJA 2HXYA 4JVSB 1AS2A 3L0SA 1NBMD 5TMPA 3QQ5A 1DAFA 1NMXA 3DDCA 3QOFA 1F5NA 1XJCA 1J2JA 3FFBA 4MGZR 4PXAA 1F48A 4AKHA 4HAWA 3W6OA 3ZVLA 1SXJB 1ZUHA 1O3YA 4JLNA 1S0UA 4TL9A 1BKDR 1Z6TA 2P67A 1XJ0A 5BN4A 4PO9A 2VPPA 4D4LA 5JMTA 2PLFA 4JKYA 4ARZB 1XPRA 4BLQA 4I1SA 2WAXA 1G3RA 3CBQA 5EE9A 5SZJA 1S1MA 2A5JA 4CEJB 5FTNA 1ZM7A 3BB4A 4DIEA 4NPHA 1ZCAA 4IDNA 5CK4A 521PA 5FBLB 3A4LA 1WBBA 3AF2A 3LRPA 2GCOB 4JLDA 4TQ9A 4ZKEA 1P3JA 1U9IA 5DIFA 1GSIA 2NG1A 3OF5A 2N42A 3UMRA 3ZDQA 2V4ZA 2Q21A 1RPZA 1EWRA 5FBWB 1OKKD 3WMGA 2FWRA 2BMFA 4FN5A 1KKLA 1Q57A 4C30A 1RFLA 2DFNA 1I4DD 1KDPA 1MRSA 5FUXA 3GLFA 4V03A 3EZ2A 1QHHB 4Y0VA 4OHVA 3IEVA 3MG9A 2GAOA 1EX7A 3TGPA 4JLAA 2Q3MA 1GFIA 3U4QA 1CJMA 1G20E 2IYVA 2Q0HA 2VHQA 3IBGA 2GAAA 1DEKA 1XMVA 1LY1A 1II8B 3WRXC 5HZHA 4ZKDA 3SYNA 1E2GA 1MABA 3I4LA 1N3BA 1LF0A 4HLQB 3NH9A 1RYFA 4NDZA 3W3AA 4URUR 1JR3A 1WP9A 4QRHA 2KI5A 3TQFA 1M1YE 1A2BA 2FGJA 5IDVA 4E07A 1E9SA 4M1KA 2HV8A 4JZKA 4ESVA 1LV7A 1NY5A 2J45A 3SHWA 1AK2A 4LJ8A 4DCSA 1OT3A 4HAVA 1X3SA 2LKCA 3GLGA 1PLLA 2CJWB 5JCPA 2C96A 2JLXA 1JXOA 1W4AA 8OHMA 1VG0B 3RSOA 1TQ6A 2HYIC 1HURA 2A5GA 4WXRA 2Z5FA 2FG5A 1G7SA 2JIZD 3O8DA 2ZYTX 4DJTA 4Q9HA 5IHPA 3K70C 4WZ6A 1XD9A 1F3OA 2RHDA 3WP0A 3W9YA 4WVFA 3OE7A 5JRZA 1N5JA 3QVUA 2J7PD 3R8CA 3VX3A 1ZNZA 1OFHA 5AWFC 4RD1A 5L3QA 2MMCA 5G3YA 2QPAA 2ZRJA 4R98A 3ZZUA 2QORA 3TIFA 2AKYA 2JEOA 2BHRA 2GZDA 4J0QA 2ZANA 1D2EA 4JMPA 4BFZA 1YZKA 1DG3A 5B2ZA 4II7A 3ZIAD 1Z63A 2QE7D 2YOGA 5FOSA 1FW6A 4D2IA 2XEXA 4DT1A 2YWHA 1AJEA 3BOSA 2ZU6A 2QP4A 1FNNA 1X8LA 3UXMA 1KI4A 3WXMA 2DPXA 4P4SB 5HE9A 3VHXA 3S1AA 2B7BA 1S3GA 4KO8A 3AUXA 2O8CA 5JRJA 5FOXA 2JJ1D 4N0EA 4TYNA 1IHUA 2YNMA 2JJ2D 3RLFA 4RJLA 4X8OA 4HLUC 4IXNA 3KXIA 3LBIA 5L3VA 3CM0A 2DB3A 5SZIA 4JLKA 3IHLA 4YMVA 4HDOB 3SDZA 2J0UB 1L7VC 1NRJB 4PZYA 3A1UA 3OHMA 3W90A 4B3CA 4WZBE 4HUQB 5LPNA 4RD4A 1WB9A 1SXJA 4B6FA 2IHYA 1P9NA 3LLMA 1TL7C 5ANRB 5C2JB 3JZMA 1U81A 5BYJA 3SBEA 3OIVA 1ZC3A 1KK0A 2VLIA 3LD9A 2CMKA 1G1MA 2BEKA 4XTCS 1N5LA 1NLYA 2G6BA 3FTQA 4P3YA 1RE0A 4D0NA 4EJSB 3B1XA 1GTVA 1US8B 1EFRA 4XJXA 1II9A 4DLTA 3AVTA 5FUVA 4LZZA 1J7KA 1OLOA 3I72A 4TYPA 3KQKA 1EESA 3IILA 2DFTA 4PZLA 1UKZA 2C99A 2EQBA 5LD2B 3HPQA 1WXQA 4KITB 5KPJA 1ETUA 1BS1A 1OE0A 5EP2A 2QEQA 4H9GA 2EWWA 2GCOA 4HAXA 1ZYUA 3EG5A 4W5JA 3VR3A 2NZJA 3LY5A 1CR4A 3NIBA 3LNCA 2EWVA 4QNRA 1SVKA 2HDNB 2VSFA 3Q5DA 3QKSB 4PQFA 2ONJA 4BZXA 5F9FA 1CF4A 5AK0A 1ZRHA 2C5LA 4GP6A 3C15C 1JJ7A 4HB4A 3TH5A 4Z54A 1HV8A 2NO0A 4JVNA 2I4IA 2EFDB 1XEFA 5FL3A 1L8QA 5JEDA 3SR0A 3W34A 1E9EA 1LNZA 5KDDA 2VL7A 1FTSA 4OYHA 4Z1MA 2CL7X 1ZM3A 2ZRHA 2NQ2C 5LB2A 3KQHA 3T35A 3I3SR 1II8A 2WHXA 1I4TD 2J0QA 5FOUA 3LWNA 2F9MA 2WVJA 1G18A 3LDAA 4E03A 4KVGA 2V6JA 2V55B 2CE7A 4ZIRB 2GCPA 1NL3A 2ZSFA 4L9WA 4U5XA 3RRZA 4OHWA 3BFVA 1IN6A 1N0VC 4WBSA 1S4QA 2CLDX 2FN4A 2GBLC 4KSCA 1R6BX 1QG2A 5FOTA 3FMFA 1A82A 4MA4A 3ZD7A 2CJWA 3QPUA 1CR2A 4DCVA 4B2IA 1KDOA 3L2OB 2ZI5A 4IEEA 4A1FA 1GKYA 1E96A 3I32A 2BMDA 4M1SA 2F1IA 4B32A 2UKDA 2GJ8A 3UK6A 2OLJA 2RGNA 2XB4A 5JSZB 5FI0B 4DLUA 3CPJB 4TMXA 4Q7KA 5EJEA 1NJGA 2DBYA 2ZE6A 4OQFA 2KB0A 1P6XA 4V02A 5HZKA 4LBVA 5KSOA 3EIHA 1T8UA 3CNLA 4C7OB 3CX6A 1E1RD 1OFIA 2P0EA 4GOKA 3T5DA 2C9CA 4QNMA 5GVRA 1KY3A 3IPXA 3M0EA 3VQTA 2PCLA 1H65A 1E2FA 3ADBA 2WJJA 4A15A 1NIJA 3CRQA 4DEYA 2IYXA 3DKPA 4Y0AA 4B48A 5CITA 3ZVNA 1PUJA 4ACAA 4YXWD 5FUYA 3C4JA 3U5ZB 1CS4C 3IQXA 4Q1BA 4C0SA 2GEDA 4C0BA 1G8FA 3GLIB 4DLSA 5H70A 1O87A 1OXVA 4E22A 4PZZA 4TTQA 2VP0A 4DC9A 5TARA 3FHTA 3U6KA 2CE2X 1NVVR 1G5TA 5DHAA 4HSEA 4LBZA 2ZSAA 5BN5A 3QXCA 2J0UA 3OEED 2ZSDA 1MO4A 3OE7D 2DFLA 1KOFA 5HPYB 2H57A 4HUQA 2FFHA 2ZI3A 1KO1A 2CHGA 4BEBA 5J47A 3SYLA 4AK9A 2QI9C 5JEEA 3TNFA 1CJUC 1S9HA 3N70A 3Q7QA 1XEWY 1IQPA 3DEFA 3K0FB 1KO4A 3CB4A 3RRYA 4EJSA 3B13B 1ZP6A 1TX4B 3K0EA 1XBTA 5EXTA 4A8JB 4PO8A 1P2TA 5BXQC 4DZZA 2OAP1 1WRBA 5G53C 2PBRA 3OZXA 2HJGA 3CLVA 2ZITA 5TY0A 3M4YA 2ZRFA 3MRSA 4OBEA 5BQ5A 5F9HA 4RZXA 1EXMA 1JJVA 2HJVA 5FR1A 2OFOA 2GF0A 3OAAA 2OESA 4LSGA 3X1ZA 1AGPA 2JATA 4MITA 3QPVA 3QY0A 4URXR 1QVRA 3U3RA 2O8BA 3QKSA 4YDHB 1IONA 5H1YA 4US1R 1G4UR 3KQNA 3EW9A 2D7DA 1S3SA 4IFBA 2YC4C 4KCGA 4MYTA 4AD8A 1KSJA 5J4HA 2QY9A 4QBFA 3UWKA 5CM9C 1MOZA 1AZTA 1LS6A 2DWPA 3UANA 3AF1A 1DOAA 5GJCA 2JLZA 2GRJA 1SVLA 3F5FA 4P4TA 4RD6A 3U2QA 4OK5A 5CM8B 2EU8A 1Z3IX 3TVDA 1C9KA 1FMJA 1PLJA 1P2VA 3K1JA 5E7JA 3A1TA 3UG7A 3TQCA 2V7QD 1EFRD 5D3QA 4GSYA 2NO1A 5HCNA 3D8BA 1JI0A 3CONA 4D4JA 3DL0A 3P1JA 1E4VA 3QG5A 4QFMA 1TU4A 4CT4B 1VMAA 2YOHA 1DAIA 1MT0A 3U7GA 4C2TA 4O2LA 3QPWA 3CO5A 2QT1A 2FE4A 3K9LA 4D25A 3HYTA 1B0UA 4V0NA 3KB2A 5B64A 2JLUA 2GXUA 3GPLA 2A5DA 2RGEA 1P4SA 4ASUA 4RKEA 1OXUA 1IXZA 3H1TA 1T4GA 1W5TA 3ASYA 5EE3A 3RS3A 3PJRA 4G5GA 4Q1EA 4LPKA 2QTFA 4ZI3A 5F3WB 3VKGA 3T61A 4K8OA 2AKAB 4JL5A 4DKXA 5JSZA 2NOAA 1AZSC 1Q1BA 2ZRDA 4IRUB 4U02A 4PX9A 1CJKC 4HYYA 2ZXUA 2ORVA 4Z1MD 2IS2A 2WWWA 1DPFA 3PUZA 4DB2A 1E4YA 3DO6A 5FOWA 3FOZA 1CKEA 1YR7A 1A7JA 2IYSA 5EP4A 4C7OA 4ILEA 1GWNA 1LF5A 3I61A 3WRYC 3PEYA 4URWR 3O8RA 2BCJQ 2L0XA 1IOZA 4FXPA 2A3RA 4RKFA 1E1QA 1HT1E 1NN1A 2D74A 2BMJA 2QRZA 4TLAA 4B44A 2PT5A 1HYQA 4KYUA 4OK3A 1IJEA 3BXZA 5EZ6B 1T8TA 4R71A 3B1YA 4D26A 2NGRA 4L4UA 4LBWA 4ZV4A 2W83A 3GLIA 2O52A 3IPYA 4GNKA 4V0LA 3BS4A 4NKRA 3PUYA 5KUTA 1U0JA 1G5RA 5HR5A 1N6KA 1XU4A 4NZYA 1XMSA 2G0TA 3D3QA 3U3KA 1RRFA 1TF2A 1OYWA 4CRWB 1EG7A 2FH5B 2PCJA 3L82B 4M9XA 4TSFD 4KSBA 4C0QC 4EUNA 3AKDA 2NZ8A 1TAGA 5EXSA 1U9IC 2R6CA 1UKYA 4M53A 2XSZD 4PC2A 2XTMA 2WZQA 4D6PA 4AKIA 1JPNA 3MLEA 3MCAA 3TSOA 3I8SA 4DDWA 1COWA 4P0TA 3K0FA 1IAQA 1I2MA 5KU1A 2YV5A 3SJBA 2FSIA 4QHSA 4FCWA 4A6XA 1DVRA 4F93B 2AD5A 3QG1A 1FNMA 721PA 1U0LA 1E9DA 3RS0A 1YJ5A 4A8JA 5M04A 3A8TA 4DUGA 4LRWA 2BBTA 3T1OA 4MGKR 3GLFE 2FV8A 1FUKA 1L4UA 3E2IA 3I92A 3PEUA 3DKVA 3C14C 1VIAA 5KPDA 3PFIA 1PZNA 1TUEA 1BO6A 2XJ4A 4NCIA 2ZYVX 4TQAA 1QVAA 5KYKA 4U7DA 3K70D 2YC2C 2JGNA 1NKTA 2BBWA 4N3NA 4B71A 1VG1A 4URZR 4M1WA 4HDQB 2BCGY 2QMHA 1YHNA 3VR1A 1JR3E 2JLWA 3VFDA 1N5IA 4M4SA 1UAAA 2ZUDA 4QHTA 3Q9LA 1NNEA 2HT1A 2VA8A 4RD3A 2F1JA 4TLEA 3R8FA 2ZRGA 2R2AA 5BYKA 4QBHA 5AR1A 3GLGE 3F0TA 4NMMA 3ZVRA 1J99A 3DM5A 3DVLA 1GILA 5K8LA 3TE6A 1LB1B 4Q47A 4CZ2A 5TV2A 4BECA 1ZUIA 3CR8A 4LC1A 2ZAOA 2EFHB 3P27A 4LOAA 1AQUA 4Q02A 3MWJA 3BRWD 3SEAA 4H1VA 1G4AE 1X1SA 2PX3A 1Z29A 1GNPA 3EA5A 3NVAA 4EFLA 2PMDA 3O8BA 3GEHA 1VG9B 4Q48A 2VF8A 1E0SA 2H1LA 2FU5C 4HLDA 4OQLA 4N0DA 5JI3E 1GG2A 2QQ0A 2GXSA 3ADCA 2JLSA 2XZLA 2CBZA 3T5GA 2ZS9A 4KFSA 5DH9A 1ZBDA 3H0KA 4GZMA 5FFMA 3FYHA 2DFKB 2YHSA 3FGNA 1FP6A 5FTJA 2O8DB 2PX0A 3GMTA 3HYRA 4DSUA 4LJ4A 2IF0A 3LA6A 5P21A 1KHTA 3QUSA 2J9RA 3RHFA 2ZPTX 3L43A 3EX7C 2MSDB 2XX3A 3HWSA 1R10A 3LX8A 2PLRA 1MO5A 2IXFA 1C4OA 1QDEA 1G3IA 1QG4A 2QU8A 2VBCA 2LKDA 2A5FA 1F6BA 3MWYW 4KFTA 1YZNA 2F1HA 3C8UA 3PVSA 4Q4AA 5AUNB 4NCJA 4NYIQ 5DYIA 4PHGA 2WWXA 1G7CA 2AD1A 5CB6A 1YZUA 2O5VA
chains in the Genus database with same CATH superfamily
4TLMB 1XCGB 3FY4A 3HB4X 1DSSG 3ODGA 4KFCA 2FUCA 4CETA 3V6MA 1CP2A 2NUTB 4IOKA 4WESB 3W4IA 2EGUA 1KZ6A 1WUJS 2VK8A 2C42A 2RB4A 3EBPA 4QT0A 4XIIA 1U8UA 1TZ2A 4A5SA 1CUIA 1L1RA 5JHHB 3TRIA 4EA7A 1TYCA 4WN9A 1FFAA 1J4AA 2AWNA 4XH9B 3U7FB 3U0VA 1V8BA 1MIOA 4COKA 1E3LA 2ETVA 1E61A 1BW9A 2ZOSA 3GO4A 3PE3A 4HJXA 2XRZA 5DHSA 2EWMA 1S7GA 4RPGA 4OP1A 1Z82A 2CDNA 3Q7IA 3BWDD 3LC0A 2C07A 1L4GA 1ZBQA 3L0CA 3VR6A 2CVOA 4KXNA 4F4IA 5KKCA 4I1IA 1JQ5A 1KI3A 1AD2A 1T0JB 3CXRA 4P3XA 2LWIA 4INJA 5BWLA 1A76A 3AXSA 3PFBA 4MIOA 2H8KA 3K4QA 3AV3A 2PUBA 1UKCA 3PF9A 4G2NA 1AKWA 3NV7A 3PDCA 1GP2A 4C4PA 1XCPA 4QQFA 2OZVA 1K5PA 4Q19A 4KE7A 1KEPA 2VTBA 1EJBA 2BD0A 1ZZGA 1IEWA 4NF2A 4BO2A 4R0MA 1WHSA 1UBOS 2XYVA 1LBSA 5SY9A 1OGYA 3ZK7A 1QTRA 1N5MA 3ONVA 3EGVA 5JSUA 3AHGA 3TUIC 4HEA6 3SQXA 2XWSA 4JSTA 1Z5ZA 1Y4DE 3NBQA 4ITUA 1ZA1A 2LR0A 1GGJA 1E1QD 2WUWE 3C8MA 3AKEA 4IPTA 5I8WA 1SIUA 2P6MA 1ODJA 2OHIA 1E2JA 3LVFO 4QGHA 1G6HA 3I6YA 5TQ2A 5JBIA 3I37X 1EFLA 3H75A 3KOYA 2JCYA 5IUKC 4AJ1A 4BLUA 2RGGA 5K0GA 2FWJA 4ZQEA 3ENKA 2NYRA 1IM5A 2QXUA 3A0RB 1IRIA 3I12A 5EWMA 3UJ9A 2X14A 2RE8A 3B3AA 5E6UA 3MJTA 3G7UA 1JI3A 3D1LA 3Q98A 3PI6A 1Y3AA 5I4CA 5DM70 2YOFA 3JWHA 2VUHB 4XVCA 4BNLA 4CKZA 4LVNA 3KTAB 4FFNA 3MMNA 5EWLA 4FWTA 3LVRE 4ZMRA 1USVA 4YRSA 3OZEA 2DT8A 3NOVA 4G41A 3ZIUA 4F5WA 4JXKA 2OCIA 4XUCA 1ZJ4A 2V8OA 2ODWA 4FMCF 3Q15C 4RTLA 3O7MA 1JJFA 1T5IA 1M6WA 4MYUA 2IWHA 3SIWA 4OJKA 4ZVVA 3VPSA 2ORWA 4UFPA 4X90A 1BMFA 1SOUA 3QQPA 4C6TA 2XV1A 2AFVA 3ZDYB 5KYYA 3CIOA 3LV8A 5HFAA 2E5LB 4Q82A 3UUEA 4I4CA 1HEIA 3WB2A 3UIEA 3M5PA 3OPXA 3I1YA 5G3ZA 1ZN7A 4Y6QA 1NJ1A 2OB1A 4A6DA 2R1UA 3EGDB 1XLWA 1LQ2A 2XAAA 5EESA 1Y3CE 2ZIFA 4UULA 3CLUC 5JUWA 1XQYA 2FN7A 4B40A 3V1YA 1UFVA 1JXMA 4XWTA 3R3YA 3HKCB 3L8ZA 4OA8A 5J5AA 1X70A 4HAZA 4I55A 5EINA 2DM6A 2BV3A 1DEAA 3O3MB 4OLHA 1QKIA 3T95A 2FZEA 4AW9A 4QJ3A 1N3IA 3HH8A 1NQWA 4FEAA 1ODFA 1R00A 3IAHA 3U3XA 2IHBA 2WYUA 3I0MA 1Y4UA 3JAWA 1OB5A 3ETLA 3GN1A 3P0EA 1VCIA 1O03A 1PJTA 2YMQA 1T3LA 3HXLA 4LXGA 4YREA 3VGPA 3TDMA 3M6WA 4OYRA 4ESOA 4EL0A 4S05A 2RBEA 4IVPA 4DDUA 5BQXA 4KDRA 5FHQA 5AW3A 2AI1A 1AK1A 3HKDA 3T06B 3IUBA 1K3FA 1PR0A 1N2EA 1MQAA 2JHCA 4O1MA 9MHTA 4D9EA 2V4MA 3BD9A 4Y1RB 3N2EA 4P5PA 5HJEA 2PUAA 1GTZA 4IIJF 3WISA 2OSVA 4PRZA 4ZVRA 3VKHA 2H5LA 3VDNB 1QF7A 3RBXA 1PEAA 2ROQA 4H7DA 4OUDA 1F7VA 5BSUA 4PLFA 1P0IA 3FX2A 2QLBA 4ENVA 1IH8A 4TWJA 4DJAA 1W0JD 2QM7A 2WE8A 3PG5A 3WJ2A 3ZGXA 1I8TA 5DNYB 4ZEOA 3WIDA 4MVJA 3UW1A 4PU0A 4W5WA 1MVNA 4N6NA 2XQIA 3FUXA 2Y4OA 2VQDA 2V54A 4IDEA 4R8KA 1CUXA 5KYUA 5LUBA 1CUGA 5EFZA 2GRAA 1MAWA 2QS9A 4DBLE 2QZPA 2Y93A 2ZULA 4GKAA 3WGNA 4BLRA 4FE3A 3PDIA 4WOKA 1G2PA 4IINA 4EJSC 5IJ0A 4J8PA 1JSXA 4NULA 1UP7A 4FMPA 1RYMA 1TUIA 1Y5RA 1AKRA 3EXG2 5B57C 5IJ9B 5K8CA 3ZWMA 4DVJA 1W36C 1QE0A 1VIYA 3U3MA 4C4YA 5CR9A 5AJHA 4KODA 1IG3A 5H16A 4JI8B 4AFNA 1X8XA 1YRLA 3Q9UA 4PHTA 1GPAA 4X66B 2V58A 2FG6C 1GLGA 2PQ0A 3G8AA 4WTOA 1N0UA 2J59A 2FX3A 2OBMA 2ZBRA 4FNAA 3NTVA 3Q1LA 1NW9B 4JYCA 4NZZA 2JGKA 2VQSA 2WTXA 1F5SA 1CR6A 4BBAA 3CW2A 5LM3A 4KR7A 3H5OA 4B79A 2X4IA 3MTIA 5CAEA 1ZD2P 5B4UA 4MJLA 4P4GA 1SO8A 1T2NA 2WWFA 3G2OA 4YYEA 3VR2A 4YP1A 2ATXA 4S35A 2G6TA 3GLSA 5FOQA 4OATA 5J2UA 4R41A 1KWGA 3NZEA 3LFUA 4FOOA 1VLQA 4LSWA 3Q3GE 3HY6A 5BW6B 4WASA 3D7MA 1WCV1 2NPIA 3L1KA 3WL6A 1QTQA 1OILA 2OHFA 3LPMA 1BE6A 4A16A 1RKXA 3NATA 3NDIA 3ZDBA 1TEXA 2OLKA 2REQA 3F3YA 3GJYA 4WFKA 1V3TA 5CNKA 2BISA 1DUIA 5CCDA 4CIXA 1E0JA 2HPZA 1OYYA 1YI8A 1XT6A 4ARZA 3UFXB 1QIJA 2XYRA 3WXBA 1CDOA 2PSJA 2YWDA 3NAGA 3RIMA 1B16A 2I3BA 4HP8A 2KWIA 2IX9A 2VSNA 3S29A 2P5UA 4UARA 4ZHSA 2YQ5A 2ONZA 1SY7A 1XZCA 1JPVA 3CX8A 3DOUA 5BNFA 4FM9A 1NXPA 3DZDA 3K0KA 1X8JA 2AI2A 1O8BA 3LBHA 2C8KA 3OJEA 4JGGA 1BFKA 2JCSA 4ACBA 2PGXA 1GSOA 1JJIA 3I5UA 1RPAA 3NCTA 4HXYA 4P7BA 5DX0A 3B85A 4IKEA 4PX2A 3HZRA 5A6SB 5EGSA 4DQ0A 4E11A 2J1LA 1E8MA 1PR6A 1PJLA 4QBGB 3OX4A 4P86A 5EIFA 1R6VA 5DW0A 1VE5A 3EVAA 1ODTC 2XUIA 2D8AA 2C1EA 2HDOA 3WNDA 3IE1A 1E18A 2XUJA 3HO8A 3ON5A 4JB8A 4BFCA 4GKJB 4L9SA 4P1ZA 4BQQA 4U7GA 4GFDA 2HIHA 3MAJA 3UVEA 2CUKA 4X41A 4O2AA 5BORA 3TVYA 3IELA 3PR1A 3JW8A 2PGLA 1Z28A 3PHBE 4WZBB 1EFDN 1GU1A 3KPVA 3HXTA 1QKKA 4PC6A 2C97A 1GPKA 2Y1DA 2CNDA 8ADHA 4H15A 3CEAA 4D9KA 1VKJA 3UKOA 2PX2A 5LXTA 5B58C 3G2PA 4KK4A 1EM8A 3IV6A 2PHZA 1PZMA 2QRVB 4IDCA 3HC7A 4ZRNA 3I5YA 4O1IA 3UWOA 2A30A 1TYDE 1QAQA 4G0ZA 4MRVA 4M1MA 2WT4A 3ZWYA 4CKEB 4CIAA 4DR3B 4EKYA 1J9ZA 4HB2A 4Q21A 3ILHA 1I3LA 4R83A 3MSXA 3H17A 3FTEA 1YUMA 1YNSA 2AN3A 3DAHA 3H83A 3KQSA 2WHPA 3ZZTA 2C5AA 4MV4A 1ZSYA 1XVVA 5ALTA 2JANA 3REQB 2EVWX 4U7TB 5BRNA 3VVBA 3O5AA 3IAEA 4M9QA 1RDFA 4HNRA 3JR3A 4X54A 4IVQA 4X7PA 2WVAA 3PHGA 4GBGA 3ZCSA 3RNLA 1JNXX 1DQPA 2O4UX 3WK6A 1HOTA 1Q74A 4DWOA 5KB3A 3I64A 4IIXA 5EIBC 1MDFA 2JI9A 3ZKAA 3HVKA 5CIYA 2L69A 1JIUA 2B94A 1OTHA 3QU4A 2P91A 3WHIA 3WGOA 2GZSA 1TKBA 3GFFA 4RZ3A 2QV0A 4YIKA 3N6RA 4UFOA 3AVQA 1M2OA 1QIHA 2X0IA 5KYXA 4YJ2F 4QGGA 1KI6B 1HNNA 5EZYF 5FHRA 4AG6A 2KMLA 3MRXA 1GNSA 3LQQA 4QAQA 1ACMA 221PA 4N5DA 5CDFA 3BMNA 2EDAA 4H27A 4ZCQA 1JKXA 2J41A 3OD1A 1YK0A 3W3AD 1GU7A 1K89A 4BMXA 2XMZA 3GUYA 3A04A 2Z3VA 1KZ4A 2CHEA 4LXTA 3DF7A 2MCFA 2FP4B 4Y9UA 4J07A 3W4KA 3WRXA 1ZPDA 1QH8B 4I1VA 3N39C 1NOJA 1GL6A 3FWKA 2B8WA 4PFJA 4YT5A 1IU9A 3H5WA 1LPNA 2I2CA 2ZPUA 3O95A 4IYRA 4U9IS 3T94A 2FMTA 2EFGA 5C34B 2MSNA 4BVKA 3UO8B 4WJKB 5LA6B 5HUHA 1GPYA 4HDMA 5K45A 4YASA 3DPSA 1VP9A 5F9MA 1OYVA 2WJ4A 4RGVA 3BWVA 4UXIA 1MB4A 2WJWA 2VF7A 3E3MA 3B9QA 1M73E 2XAUA 2QMZA 3KLBA 2H92A 3KTDA 3MWDA 3BE5A 4I9NA 4NHEA 2RKWA 1W19A 3EVZA 4WXMA 5HEKA 3SU8A 3K1AB 3KYJB 3NNSA 1GV0A 2DQSA 3RK1A 4V2IA 1RQGA 4JSYA 4X61A 2B0CA 2R8RA 4BKUA 2J0VA 1BWPA 2O0LA 5JSHA 2GUGA 4I4NA 1VE6A 5DX1A 2OCKA 3HCDA 3KXKA 3HDVA 1V5EA 4YMSA 1Z0AA 1SVMA 1TK3A 2RHRA 5BPFA 2ZIEA 5HGXA 2ZUFA 2BYTA 2GBIA 3ZE9A 3RIGA 1H6BA 4JLUA 4MKFA 2IZ6A 3M4NA 2I55A 1FK8A 2FSFA 3L4JA 1AS0A 2BVNA 1LLQA 3CZPA 1US8A 5AIAA 2BWJA 2FJUA 2Y67A 4DXAA 1KU6A 2I7VA 2R4QA 4OMFG 2G5CA 1EFCA 1CK4A 1PZFA 1ADFA 3KB6A 3PC6A 4CBVA 2B5OA 3GEPA 1GL3A 1QRTA 4U2EA 3N3BC 1WV0A 1JA9A 5FO0A 2C84A 2C20A 1Q22A 2B9VA 3ABSB 3DF9A 3AH8A 4L8VA 1OLXA 2P30A 3SYRA 3C5VA 1Q0HA 2DFPA 2QN6A 3GGCA 2GMWA 3TCNA 2B5WA 2R8OA 3D2BA 1RYYA 2KHZA 1X1AA 3E61A 2X4DA 2LZ0A 2RHTA 4JLSA 4NENA 4R54A 2JAOA 3PK0A 4R0NA 4ZRDA 2JCVA 4KQ9A 3ZCQA 2ATVA 1C1XA 1ML3A 3G2MA 1QGUA 1KOLA 1V8PA 2QRHA 1XTRA 1CRLA 3FMGA 1ZXLA 3E84A 4UJ5A 4DLRA 2Z8ZA 3GHHA 1YU6A 3HWX1 2CC2A 4PG6A 2FJPA 4CCSA 4WAUA 5H8WA 1OLUB 3C16C 2VZ8A 3JVVA 3WADA 2A78A 3G23A 4OFZA 1E9FA 4JB2A 3UAOA 5EE1A 3WWOA 1OAKA 4C4AA 3QLVA 4KXUA 5M29A 1PEKE 2G83A 1D1QA 3NKVA 1A8QA 1RQ2A 4QNNA 4F21A 4UNNA 2J30A 3NX4A 1L4KA 4JELA 3N74A 1HK7A 2JFBA 2F3UA 3WK8A 1B0PA 3SOPA 2HW8A 1VSUA 3KKNA 2ZYIA 1SCUB 1P17A 1F9EA 1VSBA 1WAMA 3D4IA 3HGTA 2FQYA 1ST3A 3FSGD 3NHWA 3VSDA 4EWLA 1H5NA 2ZI7A 3DAPA 4ZIRA 5C4IA 3SAJA 1KFEB 5UKDA 2GLXA 4XLZA 5DLDA 2H1VA 2RGYA 3E58A 4DR1B 4C2AA 2ZJ3A 1NQ5A 1K7XB 1GKIA 3VR3D 3WLJA 1X1BA 1RAFA 2RMKA 5HW0A 1Z15A 1QH9A 1GUFA 1U8FO 4ND7A 3NB0A 3FNFA 1Q17A 1KQGA 1PFUA 1QP4A 1S2GA 5ALIA 2P2YA 4AYXA 1RQNA 2QTMA 3USZA 1DMRA 1KYXA 2B92A 5EVCA 3ZCTA 1WSWA 3B52X 1UAYA 3TLBA 1P31A 2J85A 4W9MC 2YW9A 1NVGA 2M6LA 1JEOA 3L6EA 4GIBA 3WBBA 1EI9A 3WMRA 1EMDA 2Q3FA 1JEYA 4LOIA 5JFTA 1Y7PA 2PX4A 3Q3IA 4WLNA 4ZHQF 3AF0A 1T1EA 2Q9AA 4R9NA 4EP1A 2CL5A 1Q95A 2YXNA 1RXUA 3ML1A 3A26A 5BWMA 4AJ9A 3ZU6A 2HHLA 4R2IA 4L5YA 2P27A 4N41A 4C0WA 3QVGB 5HKKA 1WDMA 2C0QA 3AI2A 1E94E 2Y0BA 2WD7A 4F2HA 3E6AA 2WFZA 4FZ5A 3HU5A 5KTSA 3C98A 2BJHA 2R1TB 3QXHA 4MJ3A 2I54A 5IAKA 3HVRA 1N4AA 3RIXA 1P2SA 2J48A 5JWHA 1EX1A 1Q44A 3BMOB 1L5VA 4RVDA 3OTOB 3ND6A 1GNRA 1KMHA 2YJ6A 2DZDA 4EDFA 4KQ6A 4DCNA 2OP1A 2P2NA 3LHFA 4TTIA 4UBNA 1D1TA 4JI6B 3NHUA 1JU4A 2WUVA 3LT1A 3GZNA 4LY3A 1N6OA 3STYA 5KWSA 3ETEA 4BVBA 4FLEA 3QTLA 2OHXA 3RC3A 1FFYA 3VKWA 2Q2VA 1SOMA 2ADOA 2AT1A 4AQYB 2GM5A 1ONBA 4CVNA 1W9MA 3CH7A 1PYDA 3J7TA 3NHPA 4M7OA 4A23A 4KPEC 2IPNA 1LBEA 1YOBA 3HB9A 4FZ3A 5H7XA 4FZRA 1N5RA 3L6OO 3O91A 4W82A 1GAXA 1HQCA 1TNDA 5EJ4A 1XWWA 4ZV9A 4IIJB 3ZJTA 3EFOB 3L07A 1DARA 1YJBA 3EXHA 5EPUA 2ECQA 2F8MA 3P9KA 2CYBA 4B6PA 1TJNA 5ICSA 3DFZA 5IT4A 3THYA 2WP0A 2RI1A 2AYXA 3CJTA 4BUCA 2EFCB 2C7QA 1A9QA 1M2JA 3B6JA 3ASZA 2CMDA 2CLCX 1FP1D 3AERA 3UXEA 1G19A 2JFGA 1YWGO 5B7NA 2PRZA 3KUCA 2CCGA 3MJHA 3QVMA 2VVTA 4IL5A 2QN9A 4ID3A 1MX3A 4JLWA 4MQ4A 3DMYA 5IW8A 3WL4A 4A4DA 1NSTA 2GSDA 3MNFA 4P81A 1JR4A 5JC8A 1H2BA 2ZTHA 2HF7A 4JITA 4LY6A 4ZV7A 3DE4X 3HU3A 4RHEA 4BP3A 3DTVB 4F38A 1ZEJA 2IDKA 3VHLB 1TF5A 4II3A 1JNYA 4PAMA 2BTQA 3V1NA 3X44A 1U2QA 3OC6A 4MR9A 2QQ5A 4MAMA 1J33A 4UMFA 3WC4A 5JCXA 1U80A 2PMKA 5ALUA 2GJKA 2N46A 2R2GA 3WK5A 2A9FA 3LSYA 3A36A 1T4CA 3OPYI 4B7CA 3KJNA 1E7WA 1H8HA 1CJTC 1NY6A 3TI7A 1EZZA 3GPBA 1CQXA 2FMHA 3STWA 121PA 2FZVA 5BN4B 4XDYA 5BSHA 2XCSB 2PEYA 3WAJA 2IU0A 1G21E 2DMRA 4DAOA 2PTHA 3TSCA 1KOJA 1Q21A 4OI0A 1ESCA 2HCBA 3KL4A 2XWJI 5G0VA 3WLTA 3G1TA 4RSHA 1JYFA 3SS9X 5FUQA 3W7VA 2ZUEA 3GCDA 3KJEA 4YC7A 5FT9A 1ZOSA 1W7AA 3ZLJA 1CVRA 1N1GA 3KZXA 1Y3BE 1HF3A 2WFAA 2D0DA 4PZ9A 4XFDA 5GV7A 4F56A 4QGSA 1CRPA 1HORA 1NI4B 2OQVA 3D2AA 1Z5OA 3O21A 1KYIA 2JBAB 2M32A 3ITDA 2JLAA 2AZDA 4QRIA 1TFUA 4BAZA 3IMFA 1N6HA 3NR2A 3LX6A 5IULC 3CRRA 2WWGA 2D00A 5CDGA 1E98A 5ADUS 2HQOA 2O3UA 2NN3C 1V1JA 3L8GA 1X3LA 4AY4A 3LOUA 3L79A 2OXRA 3TI9A 2A2ZA 4NBLA 4F9FA 1U0TA 4ETMA 2EATA 4G24A 5EKTA 4B31A 1GJRA 4MLZA 4UATA 5I9TA 3R7WB 1P2BA 4FJ1A 5FUWA 3BHJA 1QP7A 1OIXA 2R6JA 3BPSA 2ZRCA 1IAVA 3A1WA 1I3CA 1PGNA 2F1OA 1BCSB 1QX4A 4H7EA 4PICA 2XVXA 3HBLA 3OAAD 4IWNA 3ND8A 5E2AA 2P68A 4F5YA 2P41A 2PL3A 3U7IA 1KI2A 3UMYA 1PT8A 1K98A 1ONSA 1SOAA 2PMBA 4NV3A 2IUSA 1ZM2A 3ERCA 1KVUA 5D3MA 2QVBA 1CY7A 2VDRB 3EF0A 3FRIA 2RK4A 5AYVA 4EW3A 4DCTA 1FX0A 1F8YA 3I09A 4A8PA 4KAXA 4J2TA 5KJ1A 3KQLA 4EFMA 4WK2B 2A94A 4AY5A 2YJGA 2XOEA 4YAFA 2Q5QA 1JBEA 3DG9A 4M9CA 5D00A 3UG6A 1KRWA 4BJHB 1GZ5A 3TOCA 3OO1A 3RSFA 1ULAA 5CEFA 2A3NA 2BFDB 1OJ7A 2NVWA 1TPZA 3CJRA 4CQMA 2GNOA 2VJQA 1AKMA 4QG3A 1HBJA 2JJ2A 5A4DA 5DCLA 3HXOA 3CEMA 3O03A 4ZCLA 3RHSA 2YBDA 3TKLA 1L5ZA 4PS0A 1ESMA 4KK3A 2W2LA 5K3AA 1BU8A 1DELA 4QYIA 4JOQA 1PVDA 2PX6A 1MF7A 2BSAA 3CCBA 3EQ6A 5IAJA 1GZ3A 2ZIGA 1SHJA 4JIMA 1PK7A 2V3WA 3R9WA 2QZ4A 4R68A 3RVOA 1SQSA 1F51E 1MJGA 1NLFA 2G67A 3V7NA 4EW6A 4RL4A 5FI5A 5EN4A 4ASUD 4LHVA 5EIWA 1WNFA 3L84A 4M9ZA 3GFBA 4PFKA 2J31A 4B17A 1XPOA 1I7SB 3UHFA 2AE2A 2PJRA 5GJWC 3HP4A 1HG0A 1FTWA 1VBFA 1ZGJA 2WD9A 3RUAA 2FFQA 3LVQE 4HAYA 2Y0CA 5BSVA 1NF2A 3DXFA 3GQVA 3Q3CA 4EB8A 4E5YA 3NM5A 3QMMA 4YJ2B 4ZVNA 3N75A 4JLBA 1U1IA 5EZYB 3WGIA 4TXNA 2Z6VA 4Q9JA 1XO1A 4K6OA 3TEJA 2V7TA 1D1PA 1QGAA 1DIRA 3E5NA 4LXXA 1U0HC 5LUAA 5DWQA 2YRFA 3X1KA 1RKVA 3IAUA 3LOPA 4XKJA 1KEWA 3KJQA 3AVXA 1IVYA 4P22A 4R40A 5JARA 4OU5A 3AHDA 3IUNA 2IA5A 1TTTA 4H7IA 4G1EB 1N1EA 1M34A 3VZQA 3ZY4A 2CXXA 3F97A 3CRNA 1PNTA 1FU4A 3CSSA 1NXWA 1ZXXA 3GJXC 2YICA 3MT9A 2G06A 3WFIA 1CIVA 1XTSA 3I42A 3E82A 1AXRA 4DMCA 3A6ZA 3PA8A 3UBTA 5DI3B 3QLUC 4W5OA 2F90A 1M1ZA 4I1PA 1LW6E 1GAEO 3WQHA 4JN6B 3QH4A 5A4MS 3EYAA 1KI8A 4IUCS 1J49A 1K8YB 2Q3LA 3SQOA 3UKJA 3PR2B 4HRVA 2VDOB 4ILKA 4KN8A 3AL3A 3TLAA 4TKZA 4DA6A 4UE6A 4F4CA 1K8RA 1K0UA 3MMZA 4DM7A 4EYOA 1GNVA 5I7WA 3TBFA 1C7FA 3ENVA 3UPUA 4TS3A 4FJ2A 4YX9A 3P97A 5E38A 3CQ9A 1W2HA 2C2GA 2WSYB 3HN2A 3OX2A 4IV5A 4RZUA 4I4TA 5AJVB 5FYDA 3KUDA 1R6TA 2O7VA 3GGOA 4LDRA 4LYFA 2GGSA 4O4IF 4ZOBA 3RHZA 3VSAA 2R1VA 1WZIA 1FQKA 3U60B 3SX2A 4FFPA 1S01A 2YWGA 3EYWA 3FVQA 1Z0UA 2BUCA 2ZUBA 3MS4A 4HS9A 1L5HB 5AJYA 3ZV7A 2MTBA 4BC0A 5DSXA 3WK7A 3WKDA 4GGMX 1HA3A 1UDWA 1IPFA 1ZC4A 2G71A 2XADA 4KO2S 1U1GA 1VJCA 3BE4A 1Q1NA 4DLWA 4DUGD 1U8ZA 2K6GA 1JKIA 3QUCA 3KVRA 2DBVO 4ZD6A 5IC5A 2IYRA 5BSKA 2DP4E 5KSZA 3OF3A 4XEUA 2OOKA 4YRLA 1MAVA 3AUAA 4B4OA 3I45A 3BN3A 1TT5B 3KSZO 1VE1A 1O89A 1TRKA 3FUCA 1G5PA 1XRPA 3QXGA 2Q7DA 2JJMA 5HX7A 5EZSA 3M6IA 1VBNA 3AIIA 3RUHA 3WL5A 3UEOA 4L3VA 1P8JA 3U9LA 2WSIA 5HCIA 2PZAA 5SV2A 1JHMA 4GO1A 1XTJA 1J8MF 5ELMA 5LP6F 1KEEA 2TYSB 1CU1A 4KQXA 3WYCA 3UY4A 4MLPA 4O5AA 4CHGA 2R47A 2Y8EA 5E95A 4TS1A 4IIYA 4KQFA 2P2CA 3VV3A 3UMCA 2H4FA 2XXAA 1T1RA 4E12A 3A2KA 1SHZA 2YFQA 4RANA 3I04A 5AUPB 1J0AA 4BMOB 3A32A 5LDHA 4CMKA 4KIFA 4P58A 3DPIA 1E59A 4C4OA 2E87A 2CLSA 4Y9DA 1XJQA 4GI7A 1E6MA 2HX1A 2NO9A 1FFSA 4KLAA 3UM9A 1UXJA 4B35A 3THXB 2OC9A 3BGVA 3OPYA 4UQOA 3ZY3A 4Q3OA 4U0KA 3HNOA 5BSRA 3ZDXB 5KU7A 1JSCA 4MPTA 2B21A 5HG0A 1E6LA 4Z2YA 4DBLC 2DXIA 2V5VA 4UASA 1CZUA 4YA6A 3ICQB 4QAJA 2XZOA 1TM3E 1E6KA 1M76A 1CIJA 1E0KA 4X71A 4Y2YA 5HKLA 3UN1A 4KIGA 1ODKA 1B7GO 3WJ1A 4Q01A 5JH7A 4ZC8A 2G4VA 2VYQA 4JBNA 2IS6A 5ICEA 1GCIA 3LT0A 3BAZA 4B3DA 7AT1A 3W06A 4CR8A 1J2YA 2EERA 3OFSA 3L7NA 4K6FA 5EC8A 1IY1A 3A1VA 1AA6A 1VGQA 1A9ZA 1X86B 3OTHA 2B99A 3MINA 2NYVA 4MQFB 5DE3A 5FPSA 1PSDA 1TQHA 1OFUX 2OK7A 4J6EA 4LYHA 4RMIA 5CM2Z 5FV4A 1PS8A 1YCGA 3CT4A 4PSUA 2QYOA 4AKSA 3HSYA 1LPPA 2J3MA 4ZHQB 3PWZA 2OWEA 2XMDA 1OIWA 1YOVB 2QW0X 3BGWA 4P3KA 3AVYA 4RDXA 2OUIA 2QIOA 1UWLA 4FHZA 4QUEA 1ZNWA 2QMUA 3TQRA 5A1TA 3IKJA 3SX4A 2W2KB 3E23A 3W9SA 1QANA 1D07A 3C43A 1RXCA 2C95A 2ETXA 2VS1A 2JAUA 4B4UA 2VCYA 3AWDA 1EAMA 2BFCB 3HFSA 2NXNA 1OBFO 1XHLA 3GDHA 1G1AA 1NUSA 3V46A 4I3HA 3RFVA 4C2BA 3U13A 1NXVA 3HO1A 1FQOA 4FFOA 2CFIA 2CXUA 3EG9A 5BQ3A 1GPUA 3HVJA 1NPDA 1V26A 1Q7TA 1UBNA 3FLMA 4IH9A 2DUUA 1YCFA 1U1FA 4L51A 3ZGNA 4MUIA 5C7IO 3GLTA 4LCJA 3GRKA 3FG9A 3F2IA 1L0BA 3SF8B 4HFJA 3EQ9A 4Q1VA 4WECA 4Q9KA 4C6HA 5DM0A 5DKFA 3IALA 1G2IA 4W5QA 4RD2A 3VR5H 4HBGA 4RSGA 1YS1X 2CL6X 3OP1A 2JA1A 4FCCA 4PGAA 1CVLA 2AX4A 2C1ZA 4GL4A 5CYFA 3RSZA 4ZQHA 5BR7A 2FQQA 3DXXA 4DYHA 3BAFA 4EI9A 1AQLA 5KNDH 1C0IA 1P0CA 1SQ6A 4BTEA 1KAQA 2DUMA 1QHYA 1JX6A 4B2PA 1JEEA 5C1BA 3O38A 4IMPA 1EUZA 1YGPA 2J6BA 2XMQA 2WY2D 5L4NA 1KPIA 1Y6RA 2C8JA 3FZEA 1XKXA 4OQMA 1XFAA 3Q8WA 2CLHB 5CVJA 4DZRA 1HPLA 1R5NA 1WXIA 3LMKA 3VV2A 2OCGA 5KDLA 1JKJA 3VM6A 3OCUA 1F3LA 1G8PA 3IQFA 1VSQA 2I6XA 5A3RA 1QR6A 2J9GA 1T0HB 3BH7A 4V0KA 4JJFA 5AKKA 1E6CA 1G3MA 3NHKA 5J59A 2HAEA 4MYRA 1C2TA 5JXIA 4N40A 2O8BB 4LYGA 4EQ6B 2ZEJA 2HXSA 4FE4A 5CA0F 4Z4EA 2X5OA 3PX7A 1XHEA 3NH6A 4MUFA 2PM8A 1S96A 1E9RA 4LF5B 5C4GB 1YDEA 4ZZ2A 5CLJA 1KE2A 3RS4A 3HO6A 1BN7A 1E1NA 3FOEC 1OH5A 3MBOA 4GBMA 2V9PA 1YC2A 1VCNA 2O0JA 4JYBA 3IEXA 4PPFA 4WUVA 1KQNA 4CYMA 3Q8MA 1POXA 2CMGA 4H7PA 4L3WA 4WEQA 2SCUB 1T5LA 5ECWA 3KETA 1AQIA 2XOKD 4P38A 2VTVA 1XRNA 1O58A 2D1TA 3VAZA 4CCAA 4GX0A 2W2VA 4NEGA 2FPUA 4AZ3A 4CHTA 3FNRA 5TS2A 2GWRA 2VDNB 5CTJA 1QIIA 2BI7A 4XSHA 4D74A 4QM6A 1NBME 4C0AC 2NX2A 4HNAB 5J4KA 2XYPA 3Q6IA 2EZ8A 1H93A 3T7EA 3WYGA 1UDXA 5IUNC 2CF6A 4QZVA 1PNQA 1FLVA 2P65A 4Q03A 3AIMA 1JIXA 2DTXA 1YULA 3T7TA 1A5SB 2Q62A 4QUHA 5D7BA 4B7AA 4D82A 4NAHA 1CQPA 1V37A 1U2ZA 1N2BA 2QTWB 2TS1A 2FMUA 3BH6A 4LQCA 3A2NA 3TR0A 1UBFA 5K3DA 5FAKA 5MHTA 3LXMA 1O57A 2XZTA 2YUTA 5IBRA 1QF6A 2XIJA 4HMPA 4JMLA 4MWSA 4FB4A 1DQYA 1G20A 5L6MB 4E7OA 5JJCA 4ZTUB 2D54A 2YIMA 4L72A 1EHIA 2FNAA 2BMEA 2WAAA 3NBMA 5FWAA 1RAGA 1W4BA 4TWRA 3SYKA 1XP8A 2P9HA 3O83A 4K0RA 4M98A 5FPQA 2ZS8A 2OD7A 2QP3A 2W2XA 1D4AA 2HCTA 4RQTA 5T41A 3WJ7A 2P4SA 4EDHA 1PK9A 1DAKA 1LVGA 1BMTA 1TEHA 2GDZA 2O2IA 3QE2A 3U39A 1FMLA 1EVYA 2R79A 2H7YA 1GITA 2WZBA 4AMYA 5JQGF 3BGIA 4POAA 1DJMA 2R84A 1TT7A 2QGNA 4R2HA 2WJHA 4R01A 4YJHA 3ZW8A 1Q3KA 3PUJA 4HHEA 5EMMA 3DQQA 1YB7A 3SM3A 4B5KA 3C70A 4RV5A 1F12A 3I1FA 3FCEA 1JSLA 4OBBA 1SOWA 3B1ZA 3E7DA 1GG8A 4AKTA 3SR3A 1PJQA 5KNBH 2C3MA 3FZNA 1U8YA 4DSTA 2XUOA 4P5DA 3WLSA 3EEYA 3UC5A 4BNKA 4EZIA 3G1WA 2WKWA 4D3SA 3K53A 4KDCA 2X5JO 4G4GA 2W43A 1NNSA 4HV4A 1CBUA 2F8TA 1JS1X 1NXOA 3PT5A 1DQZA 3AETA 3BK1A 4I4IA 4PINA 2GN2A 2I6UA 4ETNA 2JHGA 3A9CA 1GUAA 1CIPA 2WJPA 4OSOA 4UU1A 4ZVUA 1BX1A 3GBPA 2R8EA 1OX4B 2ET6A 3BRCA 1R8XA 1W5SA 1E20A 3L0BA 2RC5A 1XTKA 3FKSD 3DVQX 1CJVC 3UYKA 5KJ6A 4RWEA 1SVOA 1NVVQ 3AF5A 5AVZA 1HEYA 4S1TA 4WNAB 1C1DB 3WRWA 1F4VA 3F9IA 3KXPA 2AJDA 4QRDA 3BA6A 1NW7A 4ZO6A 4D8XA 2WHQA 1IIRA 2OZPA 3S1LA 3SBXA 1IM2A 4F2GA 4TXLA 1ONOA 1QYVA 1UQUA 5L7WA 1JECA 2Y1CA 1Q3HA 1RHJA 1BXGA 4UFNA 3VZPA 3VU9A 1J1ZA 3WSWA 1FSPA 4P8RA 3V2UA 5J5VA 4E4YA 1I2BA 1RP1A 2O8EA 1NV8A 3J7AC 2CBGA 1FU7A 1ES9A 2OV8A 2P7HA 3BX1A 2VUUA 1KVRA 2B30A 3CXUA 3Q4GA 1L8OA 5LC1A 5THQA 1G8HA 3OOEA 3W5HA 1NBOA 3L3BA 1U3FA 2FSSA 3OESA 3GAAA 3AY0A 3BZBA 3GLHE 5LLSA 4EJ6A 1PX0A 3OG9A 4IIHA 2JLVA 3IAM1 2DCMA 2W6IA 1GQFA 3L0ZA 3SF0A 2YKGA 3Q7SA 2HBYA 3ICVA 4CMIA 1IBKB 3G3EA 5BT8A 3LX4A 4DCGA 3EEOA 3RSCA 1EDOA 1G6OA 2JLRA 4L0QA 1J00A 4OXYA 1U0RA 3SGLA 4E7PA 1RWBA 3OIFA 2EL7A 2F6RA 1EQ2A 3IRVA 4GMDA 4L15A 4TZKA 4B6EA 2G4LA 3H16A 3V4OA 1M0SA 1E3SA 1PJAA 3WMEA 2Z2IA 3TJZA 3QGMA 1KAGA 5JS6A 5BV2P 4ZCTA 1TC1A 1DAHA 2IKQA 5CCBA 4S12A 5LZ9A 1YFLA 3PJFA 1RAHA 2WEKA 5FBQB 4N5NA 3UT5A 8MHTA 1JQLB 4DEXA 1UODA 4U39A 3KL2A 3GLUA 2IL1A 2UV8A 3TB6A 4OJMX 3EHEA 1KE1A 2F9FA 2FEOA 3ZKWA 4DA0A 3GP8A 4AI6A 3ILVA 1GR1A 2WFLA 2SBTA 3LW8A 4MB0A 2BGTA 2YL2A 2VP9A 2H1RA 3EASA 4BPBA 3IE2A 2A9JA 1X6VA 2ZSJA 4RPJA 4RO0A 4EL5A 3HJFA 2C5FA 2CVFA 5ILOA 2HUNA 3M6AA 4O4IB 2D2FA 1QAMA 2Q6KA 3EISA 3OLCX 5HTKA 4O3FA 1SXQA 3KHSA 4UEWA 2WC1A 3MTJA 4HZIA 4CNBA 3HBAA 2ZJ2A 1NXXA 2VNAA 3HB7A 2H6EA 4M89A 3ZNQA 5B7GA 3OX3A 4CIBA 1DO8A 4YK7A 1S02A 1TKAA 3K2QA 5FL7A 2GVZC 1JHRA 5HQJA 2IEBA 3B3JA 4BNIA 2G3YA 3NRCA 4JR2A 3E2PA 2HMVA 1RABA 4GDFA 1WW8A 4F45A 4Q93A 1VJDA 1M2VB 1VL8A 1R6AA 1T5BA 5K3FB 1WETA 1KAEA 2R6GA 4BQNA 1QS0B 3QNMA 2P4UA 2X6RA 1T34A 1FVHA 4EW2A 7MDHA 3MELA 3OKPA 4OSPA 1KK3A 2GEVA 1U2DC 3DBIA 3L6CA 4BKOA 2J67A 1KC3A 3DPUA 3EVGA 4GPEA 1SVWA 1F0KA 5JZ9A 4Q4AB 2BGIA 2ZAGA 4KDFA 5LP6B 2JD1A 3AY6A 3QVJA 3UJDA 3V1MA 4Z9BA 1SC4A 2YZKA 4WT7A 4G9BA 3DUFA 1N2IA 1E2QA 5G0TA 3FLEA 1EJ0A 1Y42X 1EUQA 1SOVA 2P40A 3NFRA 2ID8A 2Z4RA 1V11B 1VDZA 1ZD5A 2GBLA 4EKIA 3AFHA 1KK2A 3WYFA 5K51A 1YVDA 1GAQA 5KSPA 1P0PA 4PEVA 3WQRA 4W5TA 3AILA 2HSDA 2X22A 4UHEA 5H83