1RVDA

H-ras complexed with diaminobenzophenone-beta,gamma-imido-gtp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
160
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Guanosine triphosphatase stimulation of oncogenic Ras mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords TRANSFORMING PROTEIN P21/H-RAS-1
total genus 57
structure length 160
sequence length 166
ec nomenclature
pdb deposition date 1999-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rvdA00
1RYFA 3IO5A 5HTKA 4BEJA 1KI7A 4GNKA 2D74A 3CX6A 2YZ2A 1VTKA 3R20A 3C4JA 2OLJA 5DISB 1ANKA 2J0QA 5CDFA 1PUIA 3OFNA 2ODWA 5EUQB 1ZM9A 2YOGA 4R7ZA 1KMQA 2G9NA 4BE7B 1XTSA 1Q0UA 1CF4A 4PZYA 3OIYA 2ZS7A 5D3QA 1N0UA 3U4QB 1W36D 4ESHA 4PC1A 3ZYCA 1XEWY 2V7QD 2RGNC 5DN6D 1N5LA 3A1WA 3AB3A 2A9KA 5JI2E 2JCSA 3A1TA 1KTVA 4TMWA 1ZCAA 2BEKA 3CUEF 2DR3A 4ZKDA 1ELOA 3KTAA 4EDHA 4R71A 3KKOA 2GEDA 4PQYA 1G5PA 2JA1A 3SQXA 4N1AA 5KNCA 2ZUBA 2CLDX 3K0EA 2D3WA 3CRW1 5EQTA 1OFTA 3KKQA 1HUQA 1P73A 3GFTA 5FOTA 1II9A 4LRWA 4C0QC 5AJWA 3ZZ0A 2P67A 4RZ3A 4X8LA 5E7JA 4I1UA 3SEAA 1JAIA 3VR2A 5IRCD 4WAUA 5GJWC 1S1CA 1EFCA 1KI2A 4Q7KA 5A5GA 3CW2A 2RGDA 1XTQA 3PXGA 3ADDA 4JYBA 1OE0A 5FTKA 2F1HA 3OIWA 5CITA 4X8HA 2KI5A 1KOFA 3AV0B 5FTLA 3LX5A 2XOKA 2YKGA 1Z0JA 3DZ8A 3IKJA 2F6RA 1PZNA 3B1VA 3OAAD 5L3RA 1DO0A 2BC9A 3E1SA 1Z0IA 1YU9A 5TY0A 4TMZA 4IDHA 1MV5A 1X3SA 2ZSDA 4PC6A 4CGZA 4LHYA 3K9LA 4JMPA 3RVBA 5TV2A 2GZHA 3AH8A 4HAUA 1RYHA 3B78A 3NEYA 4W5WA 4BECA 4EJSC 1E69A 4AIIA 3K09A 4DZZA 3P32A 4W5HA 1XDBA 2YNMA 3BH6A 1WQ1R 5JEDA 4PHGA 3ZDQA 4TLEA 2FNAA 3K9HA 3NBXX 1S9DA 4Q19A 4LHWA 2VLIA 2VP4A 1H65A 2GXUA 2ZE7A 5F3WB 1XMIA 3F3YA 2PJRA 1XEXB 4IVQA 3UXMA 5DO9A 3IDQA 3Q7QA 1U94A 2JJ8A 2KSQA 3T34A 1YHNA 4P4TA 4PSKA 2ZRKA 3WP0A 2XB2A 1EFTA 2O0JA 4BGDA 2VEDA 2IYRA 1VDZA 4OQNA 4FWTA 3TGPA 4LJ8A 3HPQA 5B64A 3EPJA 2FZLA 4PC2A 3VNUA 2QMUA 4NKRA 2GESA 4B73A 1J8MF 2W0SA 2OBNA 3OAAA 3B60A 1J8YF 4HLQB 3GJ7A 1GILA 3OEEA 3KL4A 2DYKA 1P61B 5KSZA 1G17A 1NG1A 2CK3D 5FTNA 4XTCS 1OH5A 3AEZA 1EG7A 3SYKA 4CEJA 1M2OB 3SJCA 1AK2A 4JSYA 2QP4A 4CEIA 2A5YB 4Q4AA 2ERXA 4U00A 1OB5A 1ZNZA 1MO5A 2MMCA 3ZS8A 4NYJR 1S1MA 2ORIA 2QPAA 1JQLB 4G5SA 1E2MA 3RRMA 1H8HD 5EUMA 3RS7A 4IOJA 1YZQA 3GFPA 3IUYA 4V0LA 1CXZA 1Q3HA 4ON9A 4DLRA 1CRPA 3RC3A 3AKCA 5KDDA 1E1RD 1Z8FA 3LBIA 4NCJA 1CP2A 5AJYA 4M9SA 3U3JA 5EE1A 3UWOA 4F38A 4XVUA 3O8RA 1YKSA 2X2EA 1SXJD 4DT1A 3I92A 3FFBA 2OXRA 5FBVB 3RWMB 2W2TA 4M1OA 4UJ5A 3RRZA 5AJZA 2JIZD 2REBA 1Z83A 3W6PA 4E07A 4OHYA 4PPQA 4PZLA 3VHXA 2OCAA 3B9PA 3KZ1E 4EFLA 3MJRA 3QVUA 3T1VA 1PLKA 2FFAA 5L3SB 4KYUA 5BYJA 4A4DA 1COWD 4W7SA 4B6FA 5TMPA 2LWIA 3PUYA 3QNUA 1W36B 4XD7D 1N25A 1NBMA 1E3MA 4JKIA 2H92A 3AVVA 3VR6A 4XOIA 3WNCA 4EKDA 4GPTA 1RFLA 3RANA 4M9ZA 1TL7C 1XU4A 5JECA 2WJGA 4LPKA 1SXJA 2J59A 1E9DA 1E0AA 4JYCA 1W49A 3VKWA 2IYYA 2V1UA 1E2IA 2YVUA 2XNDD 3AVXA 2E9SA 5DGXA 4TMVA 3IIKA 4CW7A 2NQ2C 4HI0E 1TEVA 3PUWA 2IYLD 1DAIA 5CK4A 1IXZA 1P3JA 1GNPA 2LKCA 5SZJA 2O8FB 2OBMA 3THXB 4CEHA 3SJZA 1COWA 3CWQA 1A1VA 2XZLA 2R65A 2WMOB 4MYHA 1TEXA 3L43A 3H86A 1HQYE 2QMHA 3AQ4A 3IPXA 3QPUA 4ARZA 3VKGA 1P6XA 2PZGA 3ZLJA 3EZ9A 3R8CA 3HYTA 1VCOA 1M8PA 4JKYA 3EPLA 2XTMA 4XD7A 2DWOA 3PUXA 1KDPA 1XTIA 1FPMA 1ZYUA 2GF0A 1G4AE 2QBYB 4QBHA 1ZNWA 4R2IA 4DCTA 3LLMA 1CU1A 3QKRB 4LYAA 3W3ZB 4D0GA 2PZEA 2NZ8A 4QOSA 5KOYA 2DBYA 1P9WA 2YYZA 1ZM2A 3Q5EA 4AYWA 5KTYA 1WBDA 4K81B 1Z29A 2DWQA 3R8FA 2VHTA 5E7IA 4V02A 1TUIA 3KXKA 2FF7A 2VYFA 1E2DA 4LC0A 2RHMA 4XSGA 3BORA 3IHWA 3THOA 2OAP1 1SVWA 1KAOA 4I1SA 4Q48A 3UPUA 3Q9LA 4HUTA 1UF9A 3CF2A 3CZQA 2AXNA 2PX3A 2H18A 2O52A 3IIJA 4R2HA 2R44A 5EE0A 5FPHA 3TK1A 2HT1A 1IN6A 3IBYA 4ILEA 1AIPA 3WYFA 1EGAA 1NSTA 4YMWA 1CJKC 1E2QA 4M8NE 4D6PA 3K9GA 1Q21A 4E22A 2ZETA 3WYAA 2RGEA 2WWHA 2EFDB 2I1VB 4MYTA 1US8B 3MCAA 3WMFA 2JASA 3V00A 2N42A 2ZJAA 3KB1A 3VTKA 4POAA 1RZ3A 1RW4A 4BLTA 5LBIA 3A1SA 2DWPA 1XTRA 2XX3A 2UZ3A 2ZSAA 4UNPA 1OIWA 4PQFA 2VSFA 4Y0AA 2QBYA 3KDSE 3E2IA 4BFTA 1FFHA 2QPOA 1TUEA 4GBMA 4MGIR 3U6BA 4CEIB 2GEVA 2J7PA 1Z08A 2GJAA 4ASUA 4Q21A 3U3OA 1K5GA 3EASA 4NYIR 2QQEA 2ZJ2A 1NMYA 2WMNB 4QXAA 2IXFA 3RWOA 2PMKA 3A1VA 2GBLA 4V0MA 5EXSA 3P4XA 5AUNB 1GDDA 5IK2D 3U44A 721PA 3N2IA 3A6PC 4OK5A 2AFHE 2Q9BA 4CZ2A 1ZBDA 4JS0A 1ETUA 4GMXA 4IOLA 1RRFA 1ZNXA 5IHPA 4Q1DA 2IYVA 1YZNA 2QROA 4L4UA 3TW8B 5HCNA 4QBFA 4WOPA 2BCGY 3GLIB 2GKSA 3LNCA 4IDQA 2ANCA 1Q57A 4R9UC 4HAVA 1UADA 2ZRMA 1U0JA 4DLTA 2BOVA 3LVQE 2PLFA 1DO2A 2MSDB 4FI3C 1GWNA 4XVQA 1GL9B 5DIFA 1Q22A 1E2NA 1XXHB 3BB1A 1UEIA 2FGJA 3KJEA 2R9VA 1BKDR 4ERNA 4LV5B 3P20A 4Q47A 1X6VA 2OHFA 3QBVA 1OFIA 1ZJ6A 4GZMA 1VCMA 2GWHA 5B58C 4A0HA 4LZZA 2OT3B 4DDVA 1NL3A 3SQWA 2CL6X 3U3KA 3GLFA 4A36A 2BEJA 4C0AC 1ZIPA 3LLUA 3L8YA 2UZIR 4JLNA 4KFRA 1XF9A 5AJXA 3EA5A 1EK0A 4G3XA 1TQDA 1GRNA 1ZMXA 2JAQA 1AA9A 1CR1A 3BXZA 4US1R 4OI0A 2ZAMA 2P2LA 5FBLB 4LUCA 5AJVB 2O8CB 3VNVA 4UXJA 5FBRB 4RVCA 2WSMA 4FW9A 2ZJ8A 4MH0R 4DCSA 4WA7A 2FPLA 4P3YA 3CF6R 4A2QA 2P6NA 4HAZA 1JBKA 1NJFA 4TYQA 1MABB 3FYHA 4JLPA 4URYR 4FMDF 1NN0A 2G88A 4DLSA 2QGZA 4KAXA 1VG1A 5BW8A 3U4QA 3LXRA 4CDGA 1IXRC 3BC1A 2H57A 1P2VA 2GRJA 3QEOA 4Q9HA 2OAQ1 1Z0KA 4NCHA 4UXIA 2VF8A 4A0FA 4DCVA 4C3ZA 2XJ9A 5EXTA 2OZEA 4LBWA 4QNRA 2J1LA 1H8EA 1PLLA 4GOXA 4TQUS 1KI4A 4IRUB 1KKLA 2IWHA 4B3GA 2VTKA 2JDIA 2G3YA 4FN5A 4I4LA 3EIQA 3AVQA 3QUSA 3NKVA 4IFBA 3QF4A 2ONJA 3WMGA 4E03A 1GKUB 4GOKA 1JR3D 4GT1A 3THYB 1P2SA 4ZDKA 5D3MA 4CRWB 3RRYA 4LOAA 2WHXA 1KI8A 3B1WA 2NO9A 3QKRA 2HYIC 2ZI7A 1ZC3A 2FZ4A 1ZAKA 1D8TA 1ZUIA 2GXSA 5G3YA 5KSPA 2C98A 1FX0A 1QHGA 4AKIA 1LFDB 1T4GA 1BS1A 5JCZA 1RKBA 4PO8A 4LI0A 4NONA 3I32A 2J41A 4JBYA 2BBSA 5GJCA 5FL7D 5GADl 2F3RA 2OFXA 2IYTA 2JLZA 4NCNA 3CNNA 5E95A 4B74A 2FMXA 2XB4A 3GLHE 2IX3A 2AHOA 4TSFA 1NP6A 3IQWA 2WIBA 4M9QA 1JALA 2WKQA 5EE3A 1YQTA 4A92A 3L2OB 4TYNA 2J9RA 5EP1A 4OHWA 4GMDA 3ETLA 3ASYA 2Z83A 3FMIA 3X2SA 3BE4A 4BFXA 1R0WA 3AF0A 421PA 2XZPA 3B9QA 3A4MA 4M21A 3W8RA 2BMDA 4IXMA 1G3RA 1W4CA 1E2HA 3LH5A 1SULA 2HLDA 4KITB 1ZVQA 2QY9A 3SJBA 3DM5A 3ICQB 4B2LA 4L9WA 4QM7A 3C5CA 1FNMA 2F55A 3B85A 2W0MA 3C41J 4PTLA 3CO5A 2FOLA 4XWKA 2JLUA 2OILA 2IWRA 1KY3A 4H9GA 2OLKA 1G7CA 1P2UA 3TR5A 5B57C 1N6PA 2VSXA 2W2VA 2V9PA 1XD8A 3VQTA 4Q1AA 3I5XA 5CYOA 4Q7MB 1Z28A 4RZUA 4A2PA 3QF7A 4URXR 2JLWA 4KLNA 2ANBA 3JZAA 1YJ5A 1XMSA 4HB2A 5FUWA 3ZH9B 3GPLA 4AKGA 3EAQA 1Z6AA 2KE5A 1ZU4A 3P4YA 4JLBA 2CBZA 2O8EB 4ZV4A 1GSIA 3ZIAA 4ZCLA 2O8CA 2ZE6A 4HLCA 2EYQA 1XMJA 1M1YE 3GLGB 4KHZA 1OKKD 1QHIA 2IEYA 1VYVA 1LV7A 1NIJA 1X86B 1HT1E 1ZW6A 4IDNA 1SZPA 3I62A 4B2PA 3U61B 1CKEA 1KAGA 3NC1C 2OESA 2ZJBA 2PL3A 3EC2A 4JLOA 1HY3A 1WDTA 3DEFA 1Z0AA 4MUAA 2PCLA 3VX3A 4ABYA 3C7KA 1E9CA 4C9BA 4KODA 2ZRJA 3QG5A 2ZRGA 4BZXA 1Z2CA 1Q1BA 3IGFA 2WBLC 4OHVA 5FFMA 2P0EA 3EZ2A 4Q03A 2C78A 2XTNA 2C9CA 4RD4A 3TW4A 1TQ6A 4PHHA 5KSOA 2LCFA 4B34A 4HLUC 4UNNA 2ZU6A 1DADA 3OF5A 4BFSA 1ZM4A 1CLUA 1WA5A 2BKEA 5M04A 3I4LA 2ORWA 1G64A 4FINA 4JLDA 4XJXA 4F7WA 1P9RA 2AN9A 4HEJA 3MWJA 3QKSA 1AN0A 3HU1A 2X8AA 2AWOA 2EFCB 4KBFA 2HJVA 4KFSA 3M0EA 5GVRA 1OH6A 2AKYA 2CMKA 2FFHA 3N5CA 4QKQA 3TQCA 1W36C 1OXSC 8OHMA 1KI6B 1HTWA 2CVHA 2J0UA 4DIDA 3RS2A 3Q72A 4UXHA 4X8OA 1TNDA 5G3ZA 3TAHA 3NDBB 1E4VA 4CEHB 3TUZC 1CR2A 5CLLA 5JSZB 1VECA 2ZUDA 2ZTSA 4WZBE 2P65A 3VR1A 3GLGE 2N1BA 4IXNA 1N6OA 3QXSA 5E7MA 5FBQB 3PIRA 3IPYA 4RFVA 2V54A 1W0JD 2ECKA 4JT4A 4DLVA 3R9WA 3WNDA 3KKPA 3PCRB 3U6KA 1Q1ZA 3W9YA 5JRZA 2ZJZA 2R6DA 1G8YA 4NBSA 3RLFA 1P4SA 5LDDC 1MRNA 2BMJA 3AF1A 1YR6A 1G4UR 1NY6A 2GVDC 2A3RA 4P4SA 4PPGA 1KDRA 1CS4C 1ZD8A 2F1RA 2CNWD 1QHSA 5ELXA 1VG9B 4ZIRB 2JDID 4KFUA 2QG6A 1OHHA 4U7DA 1FL9A 1SKQA 1XWIA 4K46A 1I4DD 4D80A 4EJSA 1W2GA 1NVVQ 1AKEA 2Q9AA 5FUYA 4TMXA 4YMTA 1L7VC 2QU8A 5J40A 1IJFA 4P4UA 2WAYA 3TE6A 3B82A 1J99A 4FCTA 4TL7A 4C0SA 4D4JA 3KTAB 3KXIA 3CPHA 3AVYA 4TZ6A 1G8FA 2B8WA 4M2LA 2AK2A 2QEQA 3GEIA 1U8AA 1G291 2QMEA 3F8TA 2HYDA 1OSNA 2A5FA 4FMCB 3QBTA 4KLZA 3LX8A 3D8BA 1D9XA 1DG3A 3AGPA 3GJ8A 3CWZA 2IYSA 2XSZA 3C14C 1KJYA 1FTNA 3LBNA 1W0JA 2GAAA 4D4KA 3HJNA 1IN4A 1KSHA 3B8HA 3VHLB 3MMPA 1BOFA 1HE8B 2P3SA 4C0LA 3L0SA 3NBFA 3NWJA 3SYNA 4DVGA 2VBCA 3FDIA 2GF9A 4MKFA 3GLFB 4M1KA 2SHKA 5JJIA 2CL7X 1JXOA 1R6BX 2NG1A 2OBLA 5P21A 1MR3F 4KSBA 4UJ3A 1TF2A 4PQRA 3V9PA 2CCGA 3L8ZA 3THWA 2FFBA 3LW8A 3AUXA 4QHTA 3LDAA 4MQBA 1IY1A 2DFLA 2ZE5A 4CYMA 1WCV1 4OYHA 4C2UA 4AKEA 2IHBA 3DKVA 2E87A 3KQNA 4DUGD 1W46A 4DDTA 3EWSA 3WRYC 3I72A 1F2TA 3QXJA 3F5FA 3ONWA 4EPYA 4Q4HB 2QA5A 1M6NA 5KUTA 4KVAA 2JJ1A 3QPWA 4OI4A 5J5CA 1G18A 3VR4A 1T3LA 2ZRCA 4TLDA 1QG4A 3FOZA 3I61A 1SVOA 1XPOA 2I4IA 2WVJA 4JBWA 2GA8A 2HCBA 4Q4HA 2V6JA 2IK8A 4TTQA 5FR1A 4BFVA 5JHHB 2ZROA 3ADBA 4ZDJA 4W9MC 1B23P 3TBKA 4LJYA 3VU9B 3TR0A 2ZRLA 2ZAOA 3I73A 3L0IB 1EX7A 1N5JA 3EZFA 5HR5A 1WB9A 2YWFA 2W00A 5DSZA 3Q8XB 1ZD9A 2QQ0A 3O8BA 4X8MA 1W5SA 2VP9A 1AZTA 1SXJB 1WMSA 4B48A 1M7BA 1TMKA 4JVNA 1FOEB 3B7GA 1YZLA 1GG2A 4OHXA 2XJ4A 2HCJB 3SDZA 1MOZA 3MWYW 3ZGXA 1AKYA 2A2ZA 3KKNA 3U7EB 2RCNA 1D2MA 3LAWA 5DLQC 1F2UA 4A8JA 1K6MA 2RGXA 3BAFA 3Q7PA 4S2EA 4V0OA 4XWAA 4PHTA 4BWYA 2GCPA 1E79D 2G0TA 4HZIA 3THYA 4TZ0A 4B35A 1G8GA 3QE0A 2PJZA 4ZI3A 3LBHA 3EX7C 3B1XA 2RH5A 3ZVRA 1ZD1A 3K0CA 2YV5A 1XFAA 2P5TB 4WXRA 1OKKA 3CX7A 2C95A 5K8TA 1E9AA 4Z51A 4QBGB 4Q9KA 2VIIA 1GIAA 3ZJYA 1TQ2A 2PZFA 3FMPB 3C8UA 3TJZA 3SE0A 4ACBA 1QHHA 4L16A 4DXAA 4TWZA 2FPMA 5JJLA 1KGDA 4QGGA 4BEBA 1Q1QA 4MYUA 4OK6A 1F5NA 3S1AA 5CIQA 3UIEA 2QI9C 2KBFA 2J7KA 1QVAA 4CT4B 1VG0B 3HWSA 4BLOA 3MSXA 3B5JA 1SXJE 3DPUA 2XXAB 2WJHA 1Z22A 2EVWX 1F6BA 4RY2A 1OF1A 2H8KA 2ZANA 3U60B 2FV8A 5GJBA 3BJIC 2IC5A 1UM8A 2IBMA 4JVMA 4PSVA 5FOXA 3WHLA 2ZJOA 2GK6A 4MDEA 2PCJA 2V7QA 2Z4RA 1W4BA 3AF2A 3QVVA 2CJWA 2ODBA 4Z1MD 5EP4A 1P62B 2G1JA 4FMDB 4KU4A 3GLIA 4TMKA 3KFVA 4B75A 1ZRHA 1VMAA 2QENA 4A8JB 3QOFA 5FUXA 5F2EA 2NGRA 2ATVA 4HLDA 5FUVA 2FN4A 1U81A 1GRRA 1PUJA 1G7SA 1W4RA 2CK3A 3IILA 1T5LA 3WY9A 3ZQJA 5AWFC 2CDNA 2ZRAA 3I1FA 2EWWA 4LYFA 4MRPA 1UKVY 2QTFA 2IYWA 3U44B 3CONA 3GJ5A 3JZMA 3PQCA 4HDCA 3W34A 3QENA 4PANA 2G83A 1VHLA 5HPYB 2O8FA 2IS2A 3FKSD 1IY2A 2VP2A 2PT5A 2WWXA 2GCOB 2VP0A 2C9OA 1R5NA 3TQFA 1HH4A 2JATA 2QPTA 3U7GA 4DKXA 2WWYA 1GKYA 3BIFA 1VHTA 3TVTA 4N3NA 1MRSA 3SBDA 1LB1B 3WBJA 1E4YA 4MGYR 2C8VA 1CJUC 2BMEA 5HE9A 4Q4LA 3LWNA 4LCBA 2I3BA 3BOSA 4IJMA 4YMVA 4BFZA 2VH5R 1KK0A 4XH9B 4BUJA 1YZGA 4PAQA 3WMEA 1NLYA 2O8BB 2PBRA 3ADKA 1DARA 1XNJA 4AWXA 2ODNA 2D7DA 2XNSA 4GP7A 2GAOA 5EXXA 3E5HA 5G53C 3AKYA 5DYIA 2GZAA 2GJSA 4C4PA 2DFTA 1T91A 1XD9A 3OEED 4MKGA 3RS0A 3NVAA 4PPNA 3HR8A 4D82A 4EPVA 3GLGA 1S4QA 1JR3E 2YWGA 2B8TA 4OI2A 3ZZTA 1K8RA 2VRWA 1I4LD 1KK1A 1KO1A 5IF9A 2YJTD 1E9SA 2W58A 5J4KA 2O0HA 1RJ9B 1LS6A 1U98A 2QRNA 1FMJA 4KO8A 2JLYA 1II8B 4LBYA 2EU8A 1KO8A 3DMDA 1HE1C 3MGCA 2O0KA 1T5IA 2L0XA 3H4MA 1ZCBA 2HV8A 4NH0A 1FP6A 1SKYE 1MO6A 1K5DA 3AM1A 4YQFA 5LD2B 2W6JA 4D26A 1GOTA 3BS4A 4M1MA 1IM2A 5HE8A 3SBEA 4P31A 3TVDA 1P5ZB 1YR9A 1TQ4A 3WYGA 1CJMA 1KK3A 1NG9A 2JJ1D 3SS8A 2Z0MA 4DCUA 2ZR0A 2PMDA 4PO1A 4ZI2A 4JJKA 4RD2A 4RJLA 3L0OA 1W44A 4LY6A 1TU4A 3E70C 4S35A 4I1OA 4M53A 4BFUA 1PV4A 5FPYA 4YONB 1U9IA 4ZIRA 2DCUA 2QAGA 2D62A 3CLVA 3MWKA 4BLPA 3NG1A 3TNFA 5DYGA 1J2JA 1P2TA 5IDVA 2ZS8A 2B6HA 2BDTA 3CR8A 1KDTA 5A0FA 3UANA 2OV2A 5FOVA 4JSTA 3KX2A 4B6EA 3T5DA 1NVUQ 1E9EA 4JT2A 4KJZA 5JHGB 1G20E 3CNLA 3K0FB 4LBVA 3RSOA 2BBWA 1E2EA 3QY0A 1R2QA 1XCGB 2R6FA 121PA 2B21A 4TN1A 1M74A 2VL7A 3SYLA 2JLXA 4JLKA 2BV3A 2IA5A 4LJ6A 1IXSB 3O8DA 3REGA 4B76A 2J46A 3GCGA 3GP8A 1MKYA 4B3CA 2EQBA 4XVRA 4LV6A 4QL3A 3T1QA 2FPKA 4U02A 1VCNA 2QM8A 2ONKA 4DUGA 5JFGA 4QHSA 4RD3A 4Z8YA 5C4GB 1OYYA 1V43A 4HYYA 4OL0A 4QGFA 4HAYA 1KI3A 2QN6A 1YR7A 1HA3A 4L9SA 1KIMA 1DVRA 1U99A 2GBLC 3AVPA 5BYKA 3PEYA 4URWR 1JB1A 1KK2A 1XCPA 3EIHA 4P0TA 1SGWA 5DNYB 2VO1A 4A8JC 1X8LA 2G0NA 3EC1A 4MITA 5DI3A 1EESA 2WZQA 1E99A 3ICEA 4RSGA 2KWIA 4QHYA 2BMFA 5JRJA 2RHDA 1OIXA 4DEYA 4Z8XA 2ZPTX 3K0AA 1JI0A 4ITRC 1G6HA 1P60A 2V6IA 4BRUA 2C2HA 3FKQA 4DSNA 2AXPA 2FG5A 1W7AA 2R8RA 4A9AA 1NIPA 2HLDD 2ZE8A 4AG5A 1T8UA 3TH5A 1FTSA 3CZPA 2VA8A 1ZU5A 3O8CA 5JWHA 2JLVA 4OQFA 3GJ4A 4HB0A 2H16A 2IXEA 1S8FA 3JVVA 1Q1EA 2KB0A 2Q0HA 5HKKA 1SVKA 2A30A 2QT0A 5EXPA 4C7OA 4D2IA 1YZUA 1BO6A 3KFXA 4JVLA 4TYPA 1RE0A 3LVRE 2QT1A 1RJ9A 1Q20A 5UKDA 3FVQA 4HATA 5H68A 1MH1A 5KHOC 4TYYA 4HAWA 4DLUA 4DCNA 1FQKA 4B44A 1AS2A 3KJIA 3OE7D 4IEIA 2AWNA 1AQUA 4HSEA 5DHAA 1E0SA 4DSTA 2W6JD 2W2XA 1NN1A 1S0UA 3AVOA 4ZO4A 3K70C 2BIFA 3EG5A 2X2FA 2WPDD 2CE2X 4IVRA 1G9XA 1E2LA 4GSYA 3VU9A 2UVQA 1OXUA 4IFEA 4JLMA 3V4FA 4ACAA 5HKKD 4NDZA 5KYKA 3MUFA 1OXTA 2V4ZA 1QDEA 3GEEA 3OZXA 3CH5A 3VR5A 4DEXA 1T6NA 3ND9A 2D2EA 2GCOA 1LS1A 4KSCA 1XCMA 3QKUA 1QG2A 2H1LA 4AY2A 2JJ2D 2ZRHA 1GITA 4YDHB 4BASA 5CDFE 1UBFA 4TL9A 3QJYA 1R7RA 1KY2A 4Q1CA 4Q4JB 1Q12A 2YHSA 5LB2A 1KJZA 2FWRA 2TMKA 3KJHA 3DL0A 2FEOA 3WHKA 3AVTA 2ODEA 1KO7A 3KUDA 4MDFA 2ZRDA 3B1YA 2CLSA 5H70A 4F91B 1ZNYA 2QSZA 4NP6A 3KJGA 5GVSA 1LW7A 2GJ8A 4O25A 3K70D 1Z47A 3T35A 3SFVA 3MFYA 3QXXA 4CF7A 3EW9A 1ESMA 3PEUA 4DIEA 2XXAA 3HP1A 3AP3A 4MRSA 2OFOA 2Z5FA 3Q3JB 1G8PA 2N46A 3RC8A 1JPJA 4Q18A 4RD0A 4B33A 3G82C 2A5GA 5BN5A 5CJ2A 1G8HA 3GJ0A 1RRGA 1AS0A 1R8QA 4HZUA 5FPKA 3ZD6A 2RGBA 4MGZR 2XGJA 2WJIA 2B7CA 4G0NA 3QSYA 2GVZC 3EPKA 4QG7A 3REFA 1G21E 1N2CE 3OIUA 5C1BA 2F9LA 3K0SA 5HCIA 1UKYA 3X1WA 2QSYA 3PEVA 5IK2A 4FCVA 4J0QA 3HYRA 2VPPA 2GEUA 1C4OA 5J4HA 1U2RA 2BM0A 4MRRA 2ZRFA 2G77B 1ZIOA 3AVUA 5FTMA 4UNRA 1B0UA 4DDWA 1OLOA 1OV4A 1OW3B 2W6IA 3A37A 2A5DA 2QP3A 1A2BA 4D25A 1CIPA 2VQSA 2XNDA 4QJ5A 1UBCA 5C2JB 4AYTA 1W47A 4HDQB 4NMMA 4M4SA 3ZD7A 3AKEA 1F48A 1R0ZA 3P26A 1E2JA 3RS5A 5ANRB 2C03A 1FMLA 1QHHB 3WBKA 4DSOA 4UKDA 3X1YA 1XJ0A 4QNMA 2AKAB 2WJVA 3BBPA 3K0AB 1G1MA 3EARA 3MRSA 1VYUA 1WRBA 5FPSA 4NZYA 4OKSA 4D4MA 4Q7LA 1CBUA 2OM2A 1E2KA 1E96A 2ZYWX 2GTPA 4KVGA 4RCYA 2P6RA 3P1JA 5KO2A 5EE9A 4Q02A 4TSFD 4AYXA 4PXAA 4OK3A 4C0BA 3G0HA 1VKJA 4JLAA 2V3CC 1OFUX 4Q5IA 1DPFA 2NO0A 4KYIB 1M7HA 2YINC 4H1UA 2FX3A 3U5ZB 1H8HA 2FJUA 4L8GA 4PX9A 3CPJB 4JL6A 1GKIA 4FXPA 3SZRA 4A0GA 4Q4JA 2ZU0C 1VPLA 3BB4A 1LTQA 2UKDA 1KSFX 1U9IC 4F4CA 3QKSB 4C30A 3EXAA 3LFUA 4AURA 4B71A 3BFXA 2BWJA 3BD9A 4M1WA 3OEHA 4BLQA 4GOJA 4TTRA 5EE5B 3FHTA 4MUBA 4URZR 3RYTC 4DLXA 4IDOA 4LJ7A 4G5OA 5GJVC 1NJGA 2PX0A 4WZAE 4F4JA 1UJ2A 4FIDA 4Q66C 2REXB 2WWGA 4PFSA 1MO4A 5TDHA 3W90A 2XAUA 4KXFB 2A7QA 1Z07A 1E79A 1BYUA 3H1TA 5L3SA 2BVNA 1E1QA 4US0R 2P5SA 5FH9A 4DJTA 3NTUA 1NY5A 4CIDA 5JBQA 3N2EA 5H8WA 4JL5A 3KQKA 3QI2A 4LHVA 4V0KA 4TLCA 4IDPA 3TMKA 1GL7A 2VHQA 1KJWA 1DBSA 4JBXA 2Y8EA 2CNWA 5BXQC 1DAGA 2CL0X 3LW7A 5LD2C 1LF5A 2CHVA 2GCNA 4C0KA 4RZ2A 3NH9A 2FU5C 4PZZA 1J90A 4PAMA 2GXAA 1S96A 3TAUA 2CJWB 3DM9B 1KZGB 2IYXA 2OCPA 2KJQA 2MSCB 2H5EA 3WXMA 4MYCA 5CM9C 4D81A 1UKEA 1UFQA 2WPDA 4YMSA 3ZQ6A 1RC8A 1XTJA 3T5GA 2OCBA 1X1RA 2QL6A 5FOUA 1XD2B 5JWOA 4Q01A 2GILA 2WOJA 3CBQA 4E09A 1FUUA 1OIVA 1ZUNB 4GRAA 2FSHA 1S9HA 3CR7A 4A6PA 1CR4A 3MLEA 5L3VA 4NHOA 4B2IA 3LA6A 1N6NA 2PEYA 3T1OA 1IN5A 4FMBB 4EJSB 1OH8A 1YRAA 1BH2A 1XX6A 2XSZD 2J7PD 3BH7A 3MG9A 2HJGA 3UG6A 2DFKB 4NE2A 2VF7A 1IOZA 4JL8A 2CHGA 2IF2A 2Q9CA 4EAQA 4ZCMA 3M1IA 1EFUA 1NKSA 3IBGA 3K0CC 2WAXA 4KCGA 4YDSA 5TVKA 3NIBA 5FL3A 3TIFA 3VFDA 3SNHA 4CT5A 2ASEA 1GL6A 2RAPA 1WXQA 3EWAA 4RFSB 3ZS9A 2XZOA 1JR3A 2YOHA 1AS3A 1ZP6A 3LQQA 2QNRA 1SVIA 2ZUCA 1N5KA 4LYHA 5JSZA 2O8DB 2R6GA 4F92B 5K8LA 3AVWA 2QZ4A 2IYUA 4O2RA 2QTVB 3ND8A 4PSAA 1W5TA 1N6LA 5DH9A 4EQ6A 3PEWA 2B92A 4F93B 3LRPA 2G6BA 2VHCA 3A8TA 2C9YA 5J4VA 3K1JA 2C77A 1E6CA 2QGNA 3D3QA 1DE0A 4FWIB 1TTTA 1XEWX 1Z5ZA 1AZSC 2ZM5A 2IYZA 1Z0FA 1BMFA 1X8JA 3D31A 3QKTA 4R98A 1KO5A 2GZDA 1GVNB 1Z3IX 2IS1A 4L5BA 3HR7A 1TPZA 1G41A 4Q1EA 4US2R 1KYIA 4ESVA 1SHZA 1XXHE 1GP2A 2F1JA 3SOPA 1JR6A 1RRPA 2IUTA 1KI9A 2BBTA 1PJRA 3T06B 4LGMA 4EFNA 1CJVC 1DTSA 2D2FA 2GHIA 3BRWD 2WTUA 2Z43A 4W5JA 3BH0A 2YWHA 5J4LA 3CM0A 3LQRA 4F4IA 2VSOA 2R6AA 3CH4B 1XPUA 4LYJA 4TQ9A 821PA 2MSEB 2BKUA 3VR3A 1BYIA 2HF8A 1TAGA 3BERA 4WVFA 1SXJC 1E1QD 2WJJA 1HEIA 1IBRA 4E5UA 1VYTA 4B3FX 4Z54A 2ZIAA 3B2EA 1E2PA 5JWRA 1GNRA 4OQXA 5HZHA 3AF3A 1ESNA 3VX4A 4D4LA 2CCKA 3GLIE 1QZXA 1QHNA 3R9IA 1VIYA 1NMZA 2ZS9A 3FB4A 4NTZA 4QFMA 4RFSA 5A4JA 3K70B 3RS4A 5KSYA 4EUNA 1XTKA 2FE4A 3CX8A 1IJEA 5FPTA 1KI1A 4WZ6A 1GFIA 4TT3D 1XRJA 4MRVA 1S3SA 2WWWA 2IUUA 1TX4B 4RD6A 3H84A 1PVOA 2NIPA 4NCIA 4WBSA 4N0DA 3MD0A 2H17A 4XWOA 3KQHA 1WBBA 3AUYA 3O47A 2BHRA 5FI0B 3UMRA 1NNEA 3IEUA 1DS6A 1NVWQ 1TF7A 1JJ7A 3BB3A 2ZQ5A 3W3AA 1LF0A 1TU3A 2ZRIA 3LY5A 4LJAA 2Z4SA 3NC0C 2CXXA 4UNSA 1R4AA 3K09C 1W0KD 4HZUB 1XEFA 4K8OA 521PA 5E3HA 1N0WA 2RGCA 2WM9B 1D6JA 2GJKA 4Q9LA 2XTZA 3CIOA 1UKZA 1WP9A 4PPFA 4EPXA 2DPXA 3ZVLA 5FL7A 5C18A 4OQMA 4DDUA 2C04A 2RB4A 2WWIA 5KDOA 4B43A 2A5JA 4TLBA 3KKMA 4JVSB 4AD8A 1JXMA 2QMOA 4M1SA 4PR0A 5JJKA 2PEZA 1Z0DA 5FTJA 3SN6A 2FSIA 2IT1A 3OESA 5CYPA 1UAAA 3G5UA 4O2LA 1GZSA 4RKEA 1XXHA 1XPRA 2R62A 3OIVA 4Q4AB 2IS4A 3CRMA 3Q5DA 2E1RA 2JLQA 3WP1B 2WSSD 2FGKA 1J7KA 4JLVA 1FW6A 4GFDA 5CB8A 3THXA 3KQLA 3RRNA 1U0HC 5JEEA 4DWJA 3NHAA 4ASUD 4A0RA 1Z6GA 2VHUA 3N70A 1XB2A 1G7RA 5EZ5A 3GFOA 3A36A 4HDOB 1HURA 3K0FA 1F2TB 6Q21A 1CR0A 2VP5A 4TL8A 1G16A 3CRQA 2IYQA 2JJ2A 3QPVA 4G5GA 1SKYB 3GEHA 5DHFA 1FX0B 4DHEA 4EPWA 1QHXA 2ZSFA 5KU1A 1A2KC 1GUAA 1KO4A 1T3HA 3SR0A 4ZPXA 1DEKA 2ZITA 3CPEA 1Z6TA 4WXPA 5SZHB 4G1UC 3I5YA 1A4RA 3MJHA 1H8ED 2ORVA 4QJ4A 1SQ5A 3DHWC 2WKRA 3QF4B 4YC7A 2WSSA 3QIAA 4ZKEA 5KNDA 1NSFA 3A4LA 3W6NA 4GP6A 1Y63A 2J45A 3K53A 1QHYA 2G1KA 4XSHA 2C5LA 4IEEA 1N6KA 4LSGA 2ZXUA 1LVGA 2OFWA 3RABA 1O87A 3GJ3A 2ZYUX 1NI3A 2OO7A 2D7CA 4PHFA 5BN4A 1I2MA 2QAGC 3TSWA 1T0HB 2HDNB 1N5IA 2V55B 4B3BA 5F9HA 1X1SA 5L3QB 2F43A 2YOFA 1MABA 3T15A 3DKPA 3PITA 1Z6YA 4B47A 2PH1A 4Q9IA 5TARA 1PLJA 4V0NA 1UPTA 1KMHB 1JNYA 3CKLA 3PFIA 3J81k 4FD2A 4PC3A 5AUPB 2ZYTX 4OI1A 2C96A 2BM1A 2NPIA 4I1VA 3T12A 1E9RA 2X1VA 4Y0VA 1W2HA 2HXSA 5G40A 1OH7A 5IT5A 3ECCA 2C99A 3W5IA 1N3BA 4JZKA 1ODFA 3U2QA 4QC2A 2CHQA 1DAKA 4I81A 3FMOB 4D0NA 1U90A 4QM6A 2EYUA 3P27A 1XD2A 4GL2A 3NBZC 3VAAA 2WJYA 2WV9A 4UNQA 1W4AA 1NBME 5TB5A 3X1ZA 3UWKA 4KI0A 4DLWA 3DOEA 3NXSA 4AC9A 3EIEA 2ZVQX 2F9MA 1A82A 1YE8A 4NYMR 1UEJA 2RKOA 1CEEA 4QGHA 2IXGA 1GTVA 4DRZA 1CULC 4II7A 1QBKC 5FR2A 3GQBA 1JPNA 3DOFA 1E94E 1VCIA 3C15C 4M1YA 4QBIA 3OE7A 1LNZA 3FHOA 3Q85A 1I4TD 2XOKD 1XJQA 1NKTA 4BQSA 5EZ6B 1NLFA 2FSFA 3C5HA 1R5BA 1AQYA 2QP9X 5JLJA 1A5TA 2CE7A 3X1XA 3I3SR 2WIAA 4KV9A 1EFRD 4IOMA 1CJTC 4PAOA 3FWYA 1NN5A 4LDJA 3C16C 4BFWA 1JEDA 2CLCX 3GD7A 1JECA 4BPBA 2HUPA 5B30A 3OHMA 3B6EA 4DC9A 1FUKA 2NO7A 2D06A 1TF5A 2ZREA 3QXHA 1G3MA 4TL6A 1CTQA 3U7FB 5KDLA 5SZIA 3SHFA 2OUKA 1RVDA 4EPRA 4O0MA 1II0A 1IN8A 4TTPA 4FMCF 3FMFA 3PR1A 2EW1A 1R5OA 4PC7A 2REOA 2ZI4A 3NBYC 1T8TA 2FEMA 1P75A 5F98A 4IHQA 2PT7A 4TT3A 1E9BA 4MGKR 1WE2A 2ZRBA 4V0ME 4NL4H 1X8KA 3BK7A 5EJEA 1E0JA 2BJWA 4YXWD 4DBLC 2V8OA 2WICA 4LJ5A 4N0EA 5SZKB 5JS8A 2HF9A 2WWFA 3PG5A 1DAMA 2AD1A 4BLRA 1GM5A 2O8DA 3RNLA 1II8A 4O3MA 1IY0A 1CRQA 1XBTA 1XMVA 2XEXA 1E1RA 1D9ZA 4OHZA 4DLYA 1N6HA 1YVDA 3SU8A 4LHXA 2H7VA 4LBZA 2BCJQ 2CVFA 3FHCB 4IVPA 4QGAA 3RSLA 5F9FA 4LJ9A 4A15A 5C4MA 3THWB 2CCJA 2RMKA 1EWQA 3GJXC 1HYQA 1SHKA 3M4YA 1BIFA 2QRZA 3GMTA 3HDTA 3W6OA 1SVLA 5BN3A 1US8A 3ADCA 5CB6A 1ZC4A 1A7JA 4C7OB 1S2MA 4NYJQ 1L2TA 2GK7A 4JJZA 3LD9A 3TRFA 1HV8A 2P6UA 2ZJYA 3FGNA 3MAAC 1KNQA 2ZI3A 4Q9JA 4DB2A 1T0JB 3HU3A 3TUJC 2R6CA 2D4HA 2DB3A 1OXVA 2ZEJA 1G5TA 4Q00A 3U3MA 1M34E 2YC2C 4P32A 4IOKA 3K9NA 4RCZA 1KKMA 3L82B 3RHFA 3PVSA 2IF0A 5K8IA 2W6ID 4QRHA 4GDFA 2GJ9A 1E2FA 2QTHA 4IKEA 4MRNA 4RZXA 1DELA 2JGNA 3LO5A 2FH5B 3SJAA 4LK2A 2QM7A 3GLHA 4GZLA 4MA4A 4DLZA 3KQUA 4CEJB 4Q7JB 2HT6A 1ZM3A 3ZVNA 4M9XA 1E9FA 3NDPA 4AK9A 5FBWB 1J70A 3TSOA 3DO6A 3CNOA 5DI3B 2RGAA 1AGPA 3UMSA 1E98A 3DDCA 5G41A 3WNBA 2RGGA 2OXCA 3QG1A 4AI6A 1P72A 1N6IA 1UDXA 1GAJA 1G5RA 2WOOA 4MKHA 2EFHB 4WW0A 3ASZA 3D6TB 1NRJB 1OXXK 5CM8B 4TLAA 4TYWA 3IQXA 2GDJA 1N0VC 1EFHA 4PO9A 2JEOA 2WKPA 1QVRA 1IQPA 1R10A 1FNNA 1DOAA 4RD1A 2DY1A 4XIGS 4HUQA 2W83A 2IHYA 2NPFA 3ZVMA 1IAQA 5EP2A 4EQ6B 1OT3A 4LWZA 2IUSA 3EA0A 5TXGA 3GLHB 1EX6A 1QF9A 2K5UA 2OCYC 2OE2A 1D5CA 3OEHD 4HB4A 4BRWA 4OBEA 2HXYA 4WIAA 2HEIA 5L8VA 3RDPA 3BFVA 4NPHA 2FSGA 3AP2A 2JLRA 5AR1A 4B3XA 3F0TA 3CF0A 3WRXC 3GLFE 2KBEA 1AGRA 4B32A 1E2GA 1UBEA 1WF3A 4UQOA 4AG6A 2X77A 3IHLA 4G5QA 1MT0A 1JAHA 3BFKA 1AJEA 2ZSEA 3HPRA 4ZCIA 4JIMA 2ZR7A 3UATA 1I2DA 1P9NA 2QAGB 4ZDIA 3AP1A 1HT2E 2B7BA 4BZQA 1F60A 3CRVA 3SHWA 1AM4D 2OSBA 5DI9A 2ZSBA 4M22A 4NCKA 1RPZA 1RRCA 3TUIC 5JCPA 5JMTA 1N6RA 1E32A 5C46F 4NYIQ 5K8UA 5EP3A 3PV0A 4RKFA 2GETA 2ZVPX 3AGQA 3BGWA 3TLXA 2RGNA 5CIWA 4OJQA 4C0HA 1R8SA 1W1WA 2BBOA 2EFGA 2IEZA 3IIMA 2DFNA 4EPTA 4LPSA 1NF3A 3RAPR 3D7MA 3UMFA 2R2AA 4NYMQ 4QJ3A 1KMHA 4DB4A 1Z63A 4Z1MA 1T3SA 2AK3A 3PUZA 4HAXA 2QE7A 2ZI5A 3L0PA 1OYWA 1LY1A 1JEEA 4GI7A 5JS7A 1EWRA 3M6AA 5CK5A 3GJ6A 3FKSA 1NVXQ 1OFHA 1UBGA 2Z6VA 4A2WA 2F7SA 2JIZA 1FZQA 1KNXA 5H1YA 3FFAA 1W0KA 2Q3MA 5B2ZA 2F1IA 3KXLA 1KDOA 2NZJA 2J87A 2ZR9A 5LB4A 1O3YA 1DAEA 1ZINA 2NO6A 2F3TA 2LKDA 4DSUA 5BWMA 1W48A 5AUQA 5CJPA 1Y3AA 5FI1B 1BMFD 3EZ6A 2NOAA 4KBGA 3UK6A 1VG8A 5KPDA 2OG2A 2J5XA 2EWVA 2O5VA 4G5RA 1F3OA 4Q1FA 2V1XA 1V5WA 1EFRA 1OJLA 2PLRA 3BWDD 4URUR 4YXWA 2NO1A 1IHUA 5E4FA 1G3QA 3V4RA 1HQCA 4LC1A 3X1DA 3B13B 1R0XA 1Z6XA 2ZRNA 3VMFA 1IN7A 3ZIAD 3T1TA 3DMNA 1KI6A 2J0UB 1KZ7B 3DZDA 1G3IA 1U8ZA 3UG7A 3SC3A 4B3DA 2FA9A 1TADA 2QE7D 3A1UA 3FE2A 1U8YA 2XITA 2X19A 3I8SA 1Z06A 2IS6A 2AD5A 4D0LB 3FTQA 1C9KA 1Z2AA 1ZM7A 1YR8A 4XTRA 2IW3A 1UDWA 2BJVA 3A58B 1GRQA 4Q1BA 4BFYA 5FOSA 4HUQB 2AL7A 5DE3A 2IL1A 3H2YA 2FDCA 1XEXA 3IO3A 1L8QA 1R0YA 1XJCA 4P33A 2VP6A 1MO3A 2J3EA 3R9XA 4A1FA 3H0KA 1XZPA 2ERYA 5CLQA 2AX4A 1KSGA 4C0JA 4TQAA 4U5XA 2I1QA 1ONBA 2GNOA 3KUCA 5BQ5A 3UKDA 3EZ7A 4OQLA 1ZUHA 4C2TA 3PUVA 3I8XA 2A78A 3CB4A 5D3MB 1G3UA 1U0LA 3NHBA 4BZPA 2ZJ5A 1KHTA 3W8NA 1KSJA 2YWEA 4TMTA 4YMUA 1L4YA 1SVMA 2ZRPA 1JQJC 5KNBA 3K8YA 1GNQA 4LHZA 2CEAA 1FQJA 1QRAA 3QEJA 4KFTA 1L4UA 4H1VA 4IW3B 3S1AB 2FFQA 1IONA 3PENA 1NN3A 1Q3TA 1FP7A 1NVVR 5L3QA 3HU2A 1NBMD 3U7HB 4LX0A 4NU0A 3QQ5A 4YLGA 3AKDA 4HB3A 3MWLA 4M1TA 3AF4A 4DT1B 1XZQA 4HLUA 5AUOB 2GXQA 3A4NA 5KPJA 621PA 2O8EA 1NLZA 2QAJA 1S3GA 1F2UB 1YRBA 1G7TA 3EPHA 1OPXA 1NMXA 1OHHD 4V03A 2F43B 3LV8A 2O8BA 2DHRA 5J47A 5LPNA 2NTYC 2YC4C 2MMGA 2Q3HA 3JVUA 4JLJA 1XP8A 4AKHA 1OB2A 2ATXA 3QXCA 1SVSA 2EFEB 2OEPA 3RS3A 4EIWA 2Q6TA 4A82A 4EFMA 1G6OA 4P4SB 1E0KA 4FCWA 4L15A 3R7WA 2Q3FA 3IEVA 1Q44A 3VKHA 2AR7A 4URVR 1DG1G 2NMVA 1VIAA 1JJVA 3ZZUA 1DAHA 5HZKA 2AFIE 3T61A 2ZI9A 3CRRA 5JZVA 4ARZB 3SI7A 3U3RA 3OFND 2J0SA 221PA 1YZKA 5AK0A 4MKIA 1M7GA 3TKLA 1D2NA 5J4YA 3B1ZA 4LV8B 5FOWA 4OJKA 4CVNA 2VHJA 1RIFA 3W5JA 1D2EA 3PJRA 1DAFA 2QORA 1G19A 4LJ4A 2JLSA 2J0VA 2QUZA 5JI3E 4I99A 4BLSA 2ZI6A 1P7CA 5DN6A 3TSZA 4ZDWA 3NEJA 4A6XA 1EXMA 3NH6A 3DVLA 1YZTA 3SFZA 1C1YA 1T9HA 4G01B 3LXXA 3KB2A 2Q21A 3FPAA 2ZYVX 4M0LA 3R7WB
chains in the Genus database with same CATH superfamily
2J4FA 1DKMA 1IU9A 1JA9A 2VHEA 3H2GA 4MP8A 3ZWNA 1X19A 2YZ2A 3BHNA 2PWYA 3R20A 4DJJA 1VYHA 5LP1A 2Q2OA 1W85B 2QD5A 3L6UA 3FDZA 2G9NA 4BE7B 1SIBE 4E5DA 2I71A 1A9QA 5CB4A 4GP9A 1UMDB 3ZCPA 2AG8A 4EVQA 4DS3A 3F67A 3T5TA 1R74A 1F8FA 2JIRA 4PGHA 5D3QA 3VPXA 2Q2QA 4AT1A 2YJNA 1VMKA 4S3MA 4ESHA 4XYMA 2A57A 1OREA 3RIMA 2QT9A 2GPJA 3H9CA 4CCSA 3A1WA 1PJTA 1W9HA 2AT1A 4LFAB 4K3VA 5JI2E 2JCSA 1BG6A 3N7TA 2PGNA 2XMQA 3GDOA 2PAFA 4XWTA 5BOVA 3KTAA 5IAOA 3DLIA 4R71A 4KQFA 4PQYA 5EIBC 1F4VA 4O8ZA 2ZUBA 2VNHA 1L5HA 1QIDA 2PXAA 2UXDB 3OC6A 3LM8A 1M66A 3KKQA 4WY2A 3GFTA 4UTZA 4FW8A 1CHNA 5MFZA 1MU0A 3R77A 1M3SA 3LPNA 4CV1A 4UARA 1VMDA 4X8LA 4RNCA 3KEOA 3IP1A 3M6MD 3LS2A 3VR2A 4HNAA 1H2AS 1IWBB 5TE9A 5IRCD 4NWIA 4CM5A 4E1VA 1OZGA 2R7MA 3NHJA 1JG7A 4Q7KA 3JXEA 3IQGX 1UDRA 2RGDA 1XA3A 2H85A 3JQ7A 1XTQA 3TFWA 3QV2A 4YO8A 5CNIA 2ZIWB 3O9MA 3HB4X 5AVJA 1P1CA 3I2JA 5FTKA 2F1HA 4TS9A 1RYEA 1Q15A 5LZ8A 1KC1A 3OFVA 2YKGA 4G5HA 3IKJA 3HHPA 1PZNA 3LKZA 2OQVA 1M1XB 5LXTB 4N5LA 4DLKA 3IT1A 4JP1A 4N3CA 2V7UA 3NIGB 4CMJA 4LQ4A 1A9YA 2Y1XA 4I1YA 3RYFB 1QC5A 4ISCA 2GZHA 4HAUA 4W5WA 3ZV3A 3NEYA 5H3HA 4ZZ3A 1BE6A 2ECFA 4AIIA 4D9FA 5A03A 2C61A 1XDBA 3BH6A 1WQ1R 4PHGA 2F1OA 4ZZ0A 5AKGA 3K9HA 2Q6LA 3L49A 4WXMA 2Q3LA 4LHWA 1Y6GA 2E4XA 3ITNA 2VVTA 4XLLA 3NRBA 5I4BA 4KR3A 2F67A 3F3YA 1RQGA 5CHYA 1F5SA 3AIIA 3R5HA 1KY5A 2DRIA 4I5FA 4IRMA 4PTZA 5IUJC 2BMWA 2IKQA 4EF4A 1U94A 2JJ8A 4QOEA 2KSQA 3DV0B 4P4TA 3T34A 2XB2A 5JNLA 4PM4A 1Z68A 4WKPA 4E3ZA 4HPWA 3NIWA 4BGDA 1C1XB 4UVEA 3LLSA 4FWTA 1Z4OA 4XCXA 1FY2A 3TGPA 4LJ8A 3LFTA 2XLBA 1JTVA 1DC8A 3CPSA 1F7VA 3QFFA 1YFZA 5C1IA 1NYRA 4CDRA 4TOIA 4C6RA 1J8MF 1B8OA 1F6DA 2F3PA 2V6FA 4HLQB 2NSDA 3PLNA 2CNKA 5EPOA 3OEEA 3GGJA 4H18A 1G38A 2D59A 4ITUA 2XAAA 4O4JF 2CK3D 1YR2A 4C78A 3R75A 3BGDA 1KWKA 5ALQA 5JAHA 1M2OB 1LJUA 2QNBA 3QUBA 3MIIA 3SJCA 4JSYA 4CEIA 1JE0A 4Q4AA 2XRFA 3IEIA 3U1VA 1G5HA 1R66A 1VGVA 4BN4A 2WW8A 2MMCA 4NYJR 5PGMA 3TTTA 2RH9B 2GPNA 2BLNA 2GPBA 1GU7A 1AY0A 1ZICA 2B2XA 1VC2A 3P71T 3PNQA 3SHQA 5CAEA 4PONA 4TGLA 5AM1A 2ZUTA 4GOMD 4AN1A 3VMMA 2O5EA 4V0LA 4GIBA 1CXZA 4S24A 3HCOA 4DLRA 2VZLA 5BOSB 1QX4A 1SCJA 3ROMA 3RC3A 3WLNA 3UJDA 4RQBA 4QXRA 3QPDA 1CUWA 4OIMA 3LBIA 1FB5A 4M9SA 2XT6A 2I3AA 4YJ3F 4R1SA 4XARA 1EAYA 2PKRA 1XDWA 4D43A 2ETVA 3AUAA 1GQSA 2HHJA 3FGZA 3I37X 4EHIA 4JJFA 3FFBA 5K01A 4CF6A 2OXRA 2FPRA 4BVAA 3C6YA 5HF9A 4C2AA 3E58A 4ZYTA 4RVFA 1TM3E 3I6ZA 4MLPA 1V16A 2JIZD 2REBA 4KXLA 4UBLA 1PP4A 4BBPA 4QDJA 1SUPA 1Z4JA 3KZ1E 3G02A 3MJRA 3QX3A 2VUUA 1NATA 4XPIA 4GWLA 3T1VA 1PLKA 5L3SB 5JSFA 4WFJA 5LOVF 3H99A 4LMPA 2D2XA 5EYPA 1JLLB 1N5DA 5JO9A 5CAEB 1VGRA 2H1CA 1A50B 1JEAA 3QNUA 1N2BA 4XD7D 3V46A 1N25A 1NBMA 3CIFA 3QLTA 3R0XA 3KKZA 4BO2A 2DBZA 3HDVA 4JKIA 2H92A 1E3MA 3AVVA 1L7XA 3FLAA 3TAXA 4OXNA 5EAIA 4Y6QA 4U3JB 3DV9A 1RFLA 4A6EA 4ZYWA 2YV3A 4N0QA 3ID6C 1HNXB 4LPKA 2J59A 4YHBA 4WERA 2R7NA 1D2RA 3IP5A 4ZCPA 2Y9MB 1E0AA 2VDPB 1KH3A 5ESWA 1A27A 2QRGA 3GCZA 4TRJA 1U8UA 4EF6A 1IZ0A 1MNAA 4PRYA 5DGXA 4AX4A 3QYPA 4YJ2A 1ZHOA 4TMVA 3IIKA 3O4VA 4DG5A 4DA8A 1TEVA 3PUWA 4IKPA 3EHEA 1U8CB 1EA7A 2N3ZA 3SDSA 1AX9A 1VL1A 1Y8RB 2ZFUA 5CPFA 2OBMA 5SZJA 3THXB 3N59A 4G0XA 5CA0A 2EGHA 3SJZA 1OWOA 2C9DA 1R0BA 1B6GA 1ULBA 5CX1A 3W6UA 4F4DA 2XZLA 3LP8A 3C6XA 4ZT5A 3IAHA 3H9JA 2DJ5A 2HHAA 1FYVA 1O4WA 3OZTA 4HS4A 3OLWA 3UENA 3IPXA 1KZ4A 4BPRA 4M0EA 2AFHA 3RU3A 3CLTD 3S1SA 3D64A 4W8HA 2VTBB 3O9ZA 4S1TA 3IP6A 3K5HA 3UXYA 2Q2NA 3AR8A 3EWNA 2H7XA 3L8GA 5TQVA 3UXEA 4CN8A 1QZZA 1XTIA 1FPMA 3GZTB 2GF0A 3ZI7A 1E1LA 3QKRB 3ACCA 5C31A 1C9EA 3WK6A 1RAEA 5BNWA 4RJJA 1QOQB 3GR6A 2NZ8A 4MAMA 4YRKA 2DFVA 1FXSA 2HKIA 1H0HA 4XVHA 4NS1A 1EFDN 5CA0F 3ICVA 1ZW1A 1ZM2A 3Q5EA 3N8NA 4K81B 1SBHA 1KMNA 4QU0A 5ARCA 4B5LA 4E3WA 3R8FA 1C7IA 1E18A 3K4HA 4DR3B 2XECA 5E6SA 4PZCA 2ZAYA 3L7OA 3O31A 1C0IA 1E2DA 2RHMA 3MOGA 3RK1A 1CE8B 4CG0A 5I7VA 1K63A 3JQGA 4LF7B 4XSGA 4MKZA 4WLNA 4F97A 3THOA 3H4TA 3T9DA 3LKVA 1XIVA 5B1IA 1P1BA 4MO2A 4DQLA 5JZSA 1UF9A 2Q5OA 4D42A 2B4QA 3CZQA 3EY4A 4DSAA 2GARA 1YO6A 1N2OA 2O52A 4ZQBA 1GZ3A 5EE0A 5FPHA 2Z2KA 5G1OA 3E53A 1V3TA 1VHQA 5CDHA 1AIPA 1KGSA 1Z37A 3S2GA 3ZKWB 1CJKC 1ZD2P 3PKIA 4K6GA 1CV2A 3N0WA 3NATA 5I8ZA 3F96A 1A4IA 2VBGA 3L7KA 3DWGA 3WYAA 2BRUA 1RP7A 2SBTA 2ZXFA 3PR2B 1TQHA 3HJHA 3N0TA 2I1VB 4MYTA 1US8B 5KYXA 5ILQA 1WO8A 2EKDA 2WFLB 3V00A 3ZU4A 4EI9A 3RRFA 4WD3A 1SCUA 3ORHA 1XTRA 3Q0IA 3BRQA 3SC2B 5JMOA 3T52A 3R41A 4NMXB 3O90A 4CMGA 2YBDA 4EOGA 3KDSE 1NJ2A 4AJKA 1U3FA 4XLZA 5EIHA 4MGIR 4WUVA 4CEIB 3ICEA 3G5LA 3HCCA 2GEVA 1DBIA 5MN5A 3BXFA 1RQRA 1SJ9A 2PNJA 2GRUA 3UAGA 1SQ0A 3HM2A 6AT1A 1RWBA 1TJPB 4Q21A 1NXVA 3GDGA 3MHPA 1WU8A 2R5NA 3KJFA 1NMYA 2FEKA 4QXAA 4OAOA 1HYEA 2PMKA 3KJZA 4REMA 5KYWA 2A7XA 4LEIA 4B2YA 1ZK2A 2JGEA 4IJVA 4WKCA 3UPTA 3P4XA 2G4LA 1R18A 4I08A 5AUNB 721PA 3HA7A 3N2IA 2NUPB 3S8MA 3SDBA 1Z4PX 2AFHE 2Q9BA 3NHUA 2ZJ7A 4JS0A 2VQFB 2IIBA 3EEQA 3DE0X 3ZUPA 1U80A 4FKZA 5IHPA 1GKLA 4Q1DA 1E1NA 2IYVA 1FUIA 4L4UA 1T8SA 3TW8B 2QVGA 4CETA 2BCGY 3Q9NA 2AOTB 3LYUA 1TC1A 2W8BA 3IBFA 3CN9A 2GKSA 2Q3BA 3CV3A 3Q0TA 4B4VA 3GLIB 3C6KA 2O0MA 3UHOA 3EEOA 1Q57A 4WRRA 1JL3A 1UADA 1X9HA 5CT8A 3M3DA 1KJ8A 2JI9A 5ICEA 2PLFA 2MSDB 2AN4A 1SCBA 2JCVA 4QOHA 2P69A 4KYTA 3BXPA 5ALMA 2VS1A 1QH8B 1LJLA 1FFBA 2PUWA 1TGVA 2YYSA 3I01A 1H0KA 2W70A 4MUJA 4X9XA 1Z16A 2ECPA 5H9VA 1GGHA 2O23A 1BKDR 4GR9A 4BNFA 2YJ6A 4ERNA 1HZZA 1X6VA 1CY2A 2GJ4A 4OB6A 4QYMA 2OHFA 2XW6A 4RENA 4HVCA 1I01A 4F5EA 1EEXB 1C1DA 3LE8A 1P9OA 3F6RA 2ZYHA 3A05A 3LP6A 3G7SA 2W6CX 1V4VA 4LWPA 4A0HA 1V9CA 3VZDA 2HDHA 3ZWOA 3GLFA 4UCWA 4UM9D 4BP8A 2BEJA 1A9RA 4KFRA 4F2GA 3I9V6 2XIJA 4L50A 2BFDA 4JJIA 3L8FA 2I6GA 3T3GA 1GRNA 1QRDA 1NV8A 2PZMA 2JAQA 4JOSA 2YN4A 1AA9A 1CR1A 2BP7B 2UAGA 1YK1A 2WD7B 1HTBA 4J4TA 4MS1A 5AJVB 1U63A 5JV5A 4MUKA 4I1PA 2A0WA 4GXTA 1GZHB 1CB7A 1USWA 2WSMA 4FW9A 3LT2A 4K9QA 4QUAA 2P2NA 2G76A 4MH0R 3TNLA 4D8TA 5K09A 1GFSA 4MWEA 4TRRA 2PIAA 4EHNA 3WOHA 1NJFA 5K8JB 3ONEA 5CD1A 4O4LB 3G9UA 1M2OA 5KINB 4JLPA 3JQGB 2G88A 2IPOA 5AK4A 1Y5RA 1YAHA 1H2HA 2QGZA 4KH0A 1ZIDA 1U8EA 4FSHA 1BHQ1 5IABA 3JQ8B 1P2VA 4Q9HA 4S1PA 1Z0KA 3NP7A 1ULZA 3IPCA 4UXIA 2B1RA 5F12A 1XTUA 1V1RB 5EXTA 2J1LA 4NH4A 1O6GA 1VLLA 3ICCA 1NTRA 4GOXA 4TQUS 3NUGA 1BMDA 2Z04A 5F76A 4AB1A 4LXTA 4XVCA 4JI0B 4FN5A 4RZIA 2QZZA 2CXTA 3CT4A 3SMQA 3FCCA 1M83A 2DHCA 1MJGA 3NKVA 4I2NA 3QF4A 3BWMA 4OKNA 3LRXA 2ONJA 3RROA 3WMGA 4GOKA 2GPTA 2CNBA 3OZBA 4FC6A 2O54A 4BNTA 3RRYA 4DANA 1QPZA 1Z6ZA 4BRSA 4XM1A 1FU8A 1U9YA 1TZ2A 4RU1A 3IOBA 1KI8A 3GPDG 2VK1A 2JS7A 3R23A 5BPFA 5AW5A 1C9NA 2C8KA 4EA8A 1P3DA 3OPNA 1K86A 5G3YA 5C32A 3RSZA 1M6HA 3RC7A 3O74A 3NHZA 1SY7A 1BS1A 1E7MA 4RWZA 3V1YA 4TTSA 4MULA 4C05A 4U9HS 5JCZA 3MQ4A 3JD1A 1RKBA 2OGUA 4NZ9A 2AVNA 5AVOA 4BVLA 2REQA 2W4IA 3N9IA 4BX9A 1A04A 1T26A 1F0PA 2BBSA 5K2OA 5GADl 5FL7D 3BJZA 3KZNA 6REQA 3HYNA 4UEQA 2J30A 2WYWA 2IH4A 1XZLA 3WGVA 2NXNA 1ZHFA 1GTZA 3PD0A 3PFNA 4UZSA 5E95A 4B74A 4NFSA 2AHOA 4TSFA 1NP6A 3IQWA 1GSAA 1AHIA 1JALA 2PXXA 3EFHA 4FBLA 1DBQA 4J1NA 5EE3A 4TYNA 3IEMA 4WXHA 1JB9A 4ZAZA 4ZHQA 3EGIA 4F7DA 2WIKA 3OU7A 1PNRA 3ETLA 3BK1A 2Z83A 4B81A 3B2NA 1C9JA 3X2SA 3BE4A 1TKCA 1R0WA 4BFXA 1CUBA 1SOMA 3KSRA 4DY6A 3TXXA 5LYJA 2IDKA 5AYVA 4DLLA 5KBYA 1T9BA 2AW3A 4IXMA 1G3RA 1W4CA 3C7AA 3CCBA 5KB3A 1P44A 1V7QA 2D1QA 1QXSA 1O77A 1SULA 3DAGA 3RBZA 1GAXA 1FJ2A 1J1ZA 3O93A 3PDHA 3NPMA 4K9MA 2QY9A 2V98A 4FMPA 3SJBA 3KEGA 3QTTA 4U7PB 4QM7A 3HWRA 1RPNA 1YRLA 3SYTA 4PTLA 4AAYA 3L07A 2JLUA 2HNBA 2P5YA 2A9VA 4AZSA 3QWHA 3CVVA 5ED0A 3I5MA 2ZQYA 2P9HA 2OLKA 2VUHB 1KJJA 1Z73A 4RMHA 1QX3A 4XJVA 1MG0A 2YS6A 5ALLA 1VKOA 3X43A 4KTTE 5EJMA 4ZAGA 3V7UA 5HZMA 2VSXA 4LXGA 4R2KA 5A6SB 4A8PA 4CTKA 1X74A 2C2OA 3FR7A 4EATA 3ZVKA 2I9KA 3VHXB 2WUFA 4L4RA 2WMYA 5JAPA 1Z28A 4CLOB 3CNHA 2QN9A 4V1CB 5L51A 4RIGA 3QF7A 2JLWA 3QHQA 2YVAA 4BJHB 2ANBA 1B8VA 3WWYA 3R6TA 4DYHA 1YJ5A 5FUWA 4L02A 3GPLA 2EX1A 2GYWA 3EAQA 4RUKA 5AKYA 3U39A 1RPJA 3LDFA 5F2KA 4N0PA 4U2GA 4KQIA 2O8EB 1XZHA 2W71A 4ZCLA 3W5CA 1OASA 4HLCA 4RDHA 2B98A 1M1YE 2NU8B 3TG2A 4U5QA 1G2QA 1GGMA 4RVUA 2IEYA 3ADPA 1VYVA 1X86B 2ONZA 4YRZA 1HT1E 5IMBA 3TLJA 1BD3A 5LDHA 1Q16A 4LKRA 1XRPA 1CKEA 1WG8A 4J0CA 3UV6A 4JLOA 1HY3A 2IYAA 3DEFA 3GF4A 1GG8A 1UBLS 4MUAA 2PCLA 2VSYA 2H2DA 4ZQHA 4AXXA 1U1FA 2ZT6A 4ABYA 4JI3B 2I2AA 5U4QA 3UA4A 1MORA 2ZRJA 3QG5A 2ZRGA 4AJJA 2BR5A 1NASA 1ODTC 4K6CA 4B3HA 4Y2HA 1CZHA 2P0EA 3EZ2A 2OZLA 3S28A 1PJQA 2JFOA 5JDIA 3AUUA 1SUFA 1PSDA 2LCFA 7MDHA 3A7DA 1GSOA 1DQPA 1EK5A 3UWDA 1ZG3A 1KQNA 3WGYA 2ZU6A 4K9PA 3TJMA 2A84A 2V96A 1UQUA 1IOLA 1G64A 4FINA 4JLDA 4XJXA 5GAJA 4F8YA 1VBFA 4QTUB 4RSRA 5KX5F 1I6LA 1ZOPA 3W79A 5IVPA 4MQUA 3UT0A 1ILEA 1XAIA 3AR2A 4CIVA 1N8NA 2X8AA 4G0VA 1D4AA 4IM7A 3B89A 4KBFA 2HJVA 1Z9BA 3DMTA 2VWGA 3CRZA 3IS3A 3K31A 4IHJF 1ETHA 5AOVA 5FFNA 5HMMA 3ZHSA 4QKQA 3I9JA 2DVMA 4UZEA 3G8YA 3F3MA 4XAQA 1JDZA 1QB7A 3BCUA 4KUGA 4TM7A 3TAHA 4UXHA 2CXHA 3NDBB 1E4VA 2QU7A 1WZ2A 4CWAA 4Y2UA 1K27A 2FUG1 4EHLA 2DKFA 1C3XA 1FNBA 1BU8A 3FI0A 3IJ5A 3SC6A 3VR1A 1UCFA 5IDQA 3GLGE 3A27A 1RWMA 3FOAA 3QVWA 5G0WA 2H00A 5E7MA 5FBQB 4RL6A 3IPYA 5D3ZA 5EIOA 4OLFA 5ALHA 1KFJB 3VH2A 5JBIA 1KYWA 1WCYA 2IH2A 3PCRB 3ZDZB 4UDXX 1RCUA 2DWUA 2ZJZA 4IQGA 4MWSA 3RFVA 1MHTA 4FGJA 4F3TA 3DZCA 3VSCA 1XQYA 2GVDC 2Y93A 1C5KA 3AESA 2A3RA 3D2LA 4EA6A 4GI3A 3HJFA 2X5NA 3FDXA 2R8PA 4Q4CA 1H22A 2O2JA 2VZEA 2ZKLA 4ZANA 3UTCA 4ZIRB 4KFUA 1UBJS 1WXHA 2YVQA 1ORVA 2JEYA 4C4SA 1SKQA 3LHIA 1I4DD 4MWCA 1UT6A 1W2GA 1E60A 3BRWA 5FUYA 3HYLA 3WMXA 2VJAA 1L7VC 2J32A 3WGQA 5J40A 5CM2Z 2WAYA 4J3FA 1UKCA 3AYXB 3CPHA 4B6GA 4E1AA 2B8WA 3KCNA 3LF1A 2AK2A 2QEQA 1KAQA 1U8AA 2QMEA 5EQJB 2A5FA 3ZDAA 2FZKA 3OURA 1USGA 5J63A 3K1TA 4BMPB 1MAAA 4KLZA 5AXDA 4BP3A 3MUNA 3WJ1A 1H3EA 4GAEA 5T5QA 2VF4X 4J7UA 4LQDA 4ZFNA 3CWZA 2Q07A 5LA6A 1AURA 4DDKA 2IYSA 3D3WA 4JUDX 1LX7A 1KJYA 1QAQA 2CWWA 3I05A 4CHGA 1IAVA 4RELA 4WKOA 1KSHA 4WINA 3VR6D 1K8ZB 2P9GA 4BAUA 3TINA 4DVGA 2VBCA 3UK1A 3JYNA 4GVXA 3SKXA 4MKFA 4E94A 2SHKA 2CL7X 1K2WA 3U3XA 1DC5A 1E8MA 4PQRA 3V9PA 3S2FA 4EBFA 2B8JA 2I4RA 3QX9A 3L8ZA 1L5ZA 4JGIA 4D41A 2BF4A 1Z2NX 2BFCB 2IUYA 2PZAA 1GG5A 3WIEA 1IY1A 3GZJA 1RZRA 2ZE5A 3HG7A 4OYHA 4B09A 4BJ3A 5IMSA 3DKVA 4G23A 3CUUA 4HS9A 3W6ZA 1C7JA 2K6GA 3KQNA 2PHZA 2FTKE 4MW9A 4LTMA 3EWSA 3PPXA 5ER6A 3GRFA 1F2TA 4FQ7A 3F5FA 3ONWA 4HP8A 5DM1A 4FGSA 4MA0A 5T4HA 3TNFA 3NANA 4EPYA 4E5SA 4F72A 4AZWA 5KUTA 1NQWA 2X1HA 4GKVA 4KTVE 4OI4A 5H3LA 5HDQA 3GJYA 3Q2OA 3G9QA 4K8RB 3VR4A 1I80A 1EPUA 4TLDA 3FOZA 5KYWB 3I61A 2GKGA 4U4AA 5C5DA 3JWJA 1QKKA 3EMVA 3P2IA 1EVZA 3HBLA 2ODTX 1CB0A 1SUSA 2WU4A 4LHEA 3ADBA 2V6JA 1GQFA 2CZCA 3CN7A 5FR1A 2ZROA 1B0PA 1B23P 3LY8A 3QP9A 4CCYA 4LJYA 3PC8C 3PX7A 4CI0B 1KH2A 4WNAB 2WD8A 5HR5A 4A0SA 1G59A 1TJ3A 2JJQA 3H7AA 2W00A 1KFKB 5DSZA 2R7KA 1N2SA 1YS9A 3ZY2A 3GC6A 1Q1GA 1UOQA 1Z18A 3QEKA 4HX9A 1T6YA 1TMKA 3BGSA 4JGGA 3SEQA 3H2KA 4B48A 2PWBA 1FOEB 3WQQA 1T9GS 1UODA 1H5NA 2CVPA 2AH5A 3OCYA 4MGHA 4G0UA 3ERCA 3T3DA 2IZ7A 2HCJB 2XJ4A 5ERXA 2V9CA 1IBCA 1MOZA 2IZ5A 3GUUA 2Q41A 3L6DA 3MWYW 4YRSA 5GIOE 3RJZA 1F2UA 1X2EA 4GWKA 3JY6A 4DG8A 4V0OA 1NVBA 2GCPA 1P91A 4BX3A 4BO3A 4C7VA 1NXTA 4YTEA 3I0ZA 3L6BA 1GSHA 2GMWA 2I2BA 2YXDA 2QRQA 3E3MA 1YQWA 4Q93A 4CLRB 1M0EA 3TLYA 1MB9A 1SA0B 3WRYA 4PBRA 1ATIA 4GPEA 1DKLA 3FNBA 3OD1A 4B45A 2PJZA 2J3DA 5IWCA 3M6WA 1L1EA 1VJ1A 3QOWA 3AK4A 2BFAA 5F77A 3U4GA 3D8UA 3VU8A 3DMYA 5K03A 2Q4EA 3G79A 4O5AA 3AL0C 1J25A 1XFAA 3MINA 1Z12A 3IT0A 4WXRA 5HVNA 4JBHA 4YQYA 1LI7A 3DUWA 3S3TA 4KYVA 4W8OA 2FB9A 4J43A 3VC3A 1I13A 2IZ1A 1GXSB 2VIIA 1WMFA 1NURA 4KQ6A 1I5EA 5M5BA 2FMTA 2O3QA 1C3JA 1VL2A 3FMPB 1NMEA 2AEEA 3C8UA 3HFRA 3KYBA 3R3ZA 1QHHA 3LK7A 4HGNA 4L16A 5D2CA 3ZW8A 3HCFA 3L6RA 1KGDA 4CLDA 3ROQA 2EKBA 2RHRA 1Q1QA 6CHYA 4IILA 1CVIA 4MVJI 3K5IA 1YDGA 2IELA 1F3LA 1VOTA 1R9JA 2J48A 2KBFA 2RBGA 4RZHA 4WKGA 2VBFA 2VRBA 5L3ZA 4C89A 2ENWA 1U3DA 2P90A 3BJRA 2B4KA 3NOOA 5I7AA 1UKAA 3PE3A 4R51A 3DPUA 1SXPA 1DEHA 1SCAA 1P0PA 1F6BA 1Q95A 4YMHA 1CEYA 5GGXA 2CB0A 3UYKA 4J9UE 3AQIA 3GO4A 3H2SA 4FFSA 2LCIA 2XNJA 1AK9A 3DNFA 3S5JA 5DMXA 4E14A 2Z4RA 4OMFG 4GR4A 4BNGA 5K45A 1FSZA 1FFSA 2ODBA 3UB4A 1H6BA 4ALKA 4Z1MD 4I8DA 4FXOA 2Q1TA 4K9LA 5E6UA 4D44A 4KU4A 4U39A 5LL6P 3OJCA 4TMKA 2ZJFA 1IJBA 1TAHA 1V47A 8GPBA 2NXJA 2NZWA 5L4SA 4A8JB 4YAEA 3AB7A 4W63A 3UT6A 5LZ2A 1U81A 2V59A 3EXHC 1G7SA 2CK3A 3M34A 1T5LA 5ALTA 4E32A 5EHNA 2DBVO 2QLBA 4JYPA 3IQZA 5LMZA 2EWWA 4LYFA 2Q50A 1MBZA 2QTFA 3PUHA 1Q7CA 2J33A 1XZEA 3I2KA 4JR1A 4OGGA 4RABA 1XRQA 3JZMA 2F2TA 4F45A 3U44B 3QENA 4PANA 2G83A 3PE4A 4NESA 1ODKA 3FKSD 1IY2A 2VP2A 3RAEC 1E0DA 1EB8A 3D4NA 4QATA 5DXJA 5K0EA 2PS0A 2WWXA 5EJAA 3MAGA 5LMUB 3MERA 3TQFA 2ZTVA 2JATA 4FILA 1BA2A 5TQ0A 4DKXA 1HE5A 5A4AA 3RHZA 2A58A 5CURA 3EXFB 1MQSA 3A1DA 3IH5A 5JSHA 3UHFA 4EECA 3AZOA 2XUDA 5IULC 1MRSA 1USUA 1LB1B 2NW6A 3O3CA 3SXJA 2OUIA 2P9YA 3B9RA 1PS9A 4R2JA 2C8VA 1ORHA 1HT3A 4IVNA 4RXUA 4Q7EA 1CJUC 4YLYA 1QF6A 1QO9A 3I9KA 1JZTA 1PQPA 3D81A 3BOSA 4IJMA 4YMVA 3CUKA 1NOKA 5A1JA 3WIVA 3HDHA 1C9MA 4KWIA 2PBRA 3ICOA 1FIUA 3LCVB 4NAUA 3KWJA 4JC5A 4PS0A 3D5TA 4XPZA 4U8HA 1K8XB 3F4BA 2XH8A 1D0IA 4H7PA 4C07A 2GPYA 2D7DA 3VGJA 4RDXA 2BTOA 1PR3A 3E5HA 5CT6A 3C3WA 4X64B 2GZAA 4C4PA 3RH0A 1P1KA 2ZQZA 1T91A 1UBTS 1VE7A 2VYND 4TN5A 5K99A 5KO2A 4YUWA 2FQYA 4JT9A 2DFPA 1W0CA 4BTVA 4EAAA 4W1SA 1XMPA 3ROEA 4D82A 1OAOC 3VPHA 3DBHA 4EPVA 1JR3E 4ZC8A 1AGNA 4RVGA 1J33A 3ZZTA 1UBSB 1KO1A 4H7JA 1E9SA 1GTMA 1V6AA 2W58A 3OT1B 2VCHA 4NOKA 2VTDA 5J4KA 2YZ7A 4DRXB 4LE1A 1Y6ZA 2Y0BA 1O9HA 1XL0A 5TLSA 1UEXC 2VDNB 5C3MA 1FMJA 2JLYA 1II8B 2G80A 1R4NA 1KO8A 4L2IB 4WESA 4O3FA 1TIKA 2M6LA 3NIDB 1CDOA 2IP4A 1NT4A 3MBKA 5B58T 3UICA 2ZXEA 3H4MA 5AI5A 2C31A 1SKYE 4AO6A 1O6BA 1NXSA 1PN3A 3KUUA 4RPLA 5LD2B 4HB0A 1F38A 1E3WB 1GOTA 1IM2A 3BS4A 1XLTA 3GRCA 2X2OA 3SBEA 3WYGA 1TQ4A 1FBTA 5F1OA 5CT9A 3GAFA 4RK1A 2EG5A 1CUFA 1RCTE 3T95A 4Z6KA 3SS8A 3R0VA 4KDEA 4RSMA 4ZI2A 4HWOA 4F3CA 3IAS1 4RD2A 4RJLA 1Y42X 3QVSA 3WLRA 2ZB3A 1SUDA 1TU4A 4LY6A 4YCJA 4BFLA 1AC5A 4M53A 4BFUA 3E2MA 1YIAA 4EW6A 2DETA 1JDTA 2G70A 2PU5A 1ONPA 4DMLA 2QAGA 1KMIY 3MWKA 4DV4B 4LYGA 1FFXB 3HLKA 2JHGA 4H3VA 5IDVA 1Q77A 5FKJA 4DRZA 4UHEA 5I48A 2C7RA 2D1FA 4DDHA 1P4HA 5FPQA 3TEMA 4B7CA 5FOVA 4JSTA 1HPLA 2PSHA 1HFKA 4B6EA 3T5DA 1NVUQ 5A71A 3RUCA 5IJZA 4LOHA 4IIHA 3CNLA 2BBWA 3A9TA 1R2QA 3O4JA 3UFXB 3IOCA 3QU9A 5CLHA 1JAYA 4MV0A 2JLXA 8LDHA 1OBFO 2WU0A 4D5EA 2BV3A 4AY6A 4LJ6A 1IXSB 3U26A 2Q1WA 2W4MA 3GCGA 4M0KA 4B3CA 1OBCA 1E3SA 4LV6A 1QV6A 3Q6MA 2BFNA 3T1QA 5GPBA 5J58A 3I0MA 3WISA 3ZE1B 5DNCA 4U02A 1VCNA 1G2OA 1L5LA 3VV3A 4DUGA 4E2XA 5A4DA 1NW6A 2B69A 5BSMA 4RD3A 4Z8YA 1TZCA 4OL0A 1USIA 1WXGA 3L8HA 4HAYA 3ITDA 4LX8A 2QN6A 3IUMA 5FJIA 5IYZF 3SG0A 4C5BA 5IYZA 1V11A 4RTPA 4D4HA 1U99A 4D1YA 3OM1A 4YAIA 1N9ZA 3H8VA 5BYKA 4NABA 2OV8A 4PLVA 3ZLVA 3OQPA 4DPMA 2FXIA 3ETJA 5DNYB 4FJ1A 3KEQA 2QHXA 5IX8A 4A8JC 1WUYA 3STWA 2Z9CA 4WFIA 9MHTA 5DX8A 1T2AA 1E99A 2PKQO 1X14A 2KWIA 4JI8B 1KEVA 2Z09A 1NDUA 4Z8XA 3K0AA 1G6HA 1P60A 2V6IA 5DNVA 5CW2A 4BRUA 4YRNA 3FKQA 1L3BA 3CF4A 3MTQA 2ZE8A 2P11A 2RAFA 3MJ4A 1SEPA 4KIJA 4ND6A 1ZU5A 1EZ4A 4G89A 5JWHA 1IHDA 3A0UA 3O5AA 1L5SA 1JDBC 4L7QA 3G0HA 3GL9A 2VUTA 3COYA 4GLOA 1ZGHA 4E2FA 3NWOA 4NQZA 2A30A 2QT0A 4QYWA 5EXPA 3KUXA 4MI9A 5FUBA 4NK5A 1JJFA 2QRJA 3NQ41 1GYPA 2QT1A 5CEJA 4ND8B 4ADSG 4M8KA 3FVQA 4MCHA 2VK4A 1VRVA 3OJFA 3BEDA 4G26A 4LRXA 4YX9A 5KHOC 2Q5FA 2B4RO 1JZQA 3PHLA 1JDUA 2JI4A 4B44A 1K68A 1Z2OX 4MHOA 2CEKA 3KJIA 1KL7A 4IEIA 2JAPA 1AQUA 3CE9A 4BFCA 3H5WA 1H85A 5TEWA 5JIBA 1Y0BA 2AEMA 4G63A 2AX3A 4H4CA 1YB1A 2W2XA 5J2TB 1MV8A 4YCNA 2G8LA 4F86A 5DGIA 1QUFA 3K70C 3HKCB 5A3QA 1JIQA 3KVVA 3MRXA 1BDHA 1RHJA 2GLTA 4QT0A 3CG4A 1BEUB 3D6FA 1G21B 1FA9A 1RT9A 2UVQA 4I2VA 5LLTA 1LWNA 3V4FA 5FCDA 4ACAA 4OLBA 1V0JA 5TF0A 2V4ZA 3GEEA 2OBXA 3OZXA 4FZ5A 4JU9A 3OWOA 1P5JA 3ND9A 2GCOA 3JSXA 2PSJA 2HPZA 1LS1A 4KSCA 4NXMB 1XCMA 3JYLA 4P6VF 2H1LA 1FCJA 2L18A 2DFDA 1CPYA 4D57A 3K9WA 2JCXA 3NVMB 5DU2A 3L1VA 3FH0A 2DPLA 2RAUA 5K3CA 1UBFA 4E2WA 1SRRA 1YHYA 3H5VA 3JVDA 1XCOA 2GN9A 3TRIA 3UHAA 5C52B 3C1TA 5CCXA 1KJZA 2N9UA 3TI7A 2YWRA 1AUQA 1ZEMA 4BU1A 1K97A 1I94B 2JZOA 2HIHA 1UK9A 2OENG 5E4JA 2VT6A 1R0RE 3LXMA 3KUDA 3OPXA 3AVTA 3B1YA 2X86A 4F91B 3STUA 13PKA 2I2FA 5ALNA 5TPWA 3REQB 2TSYB 3HGQA 4Y2JA 2OZKA 5A05A 1XVVA 2QLMA 3ABSB 3IOEA 2GJ8A 3P9KA 1NE2A 1Y4SA 4O25A 3T35A 4D9EA 4MKXA 3ZY3A 5IC4A 3GHHA 4CF7A 1OXMA 1S2NA 3EDOA 3AINA 3PEUA 3VSEA 1Z5GA 4B83A 4DIEA 4EKYA 3NZEA 2QS9A 5HGJA 5EA2A 3JD3A 5DGTA 2JHPA 1AGYA 3NT5A 3Q3JB 4UUNA 3UPDA 3RC8A 1V5FA 4Q18A 5BURA 1LK7A 2I87A 5BN5A 4RF3A 4R83A 4ZVLA 1R00A 1SOAA 5A2QA 3PBKA 3DCNA 2JGJA 2NXWA 2I1LA 4MGZR 3ZD6A 2IP1A 3ANYB 2UYGA 1JQAA 2WJIA 3H04A 4G0NA 5J2TA 1IQRA 3IVRA 3QSYA 2GVZC 3JQEA 3FLMA 1B4DA 2W93A 5C1BA 2I6QA 4F11A 2J07A 3T7TA 3IUEA 1YVEI 2ZYSA 1OAOA 2PQMA 3RE1A 4C6TB 1L5QA 3KJQA 2GYUA 3LLCA 2QSYA 3VSAA 3X1WA 1LKZA 5IS2A 4FCVA 4J0QA 3HYRA 1C4OA 2ES4A 1R6XA 3ABZA 1XRSB 2Z5GA 2PNFA 3FFWA 2O2SA 4JUAA 4K0RA 4RZSA 5AI0A 3I5AA 3UJ9A 3VVBA 1T2DA 2Z8YA 4BNMA 3RVQA 5FTMA 3UKOA 1R16A 1TK9A 3O75A 1OV4A 4DDWA 4UNRA 4OG2A 2W6IA 3WNVA 1XK6A 3S6JA 1HKUA 3OJOA 1BS2A 5FTWA 1CIPA 1U02A 2BMAA 5IFLA 4D25A 5A0TA 5IAJA 2BFDB 4XRRA 4HDQB 2QVLA 3HZZA 4NMMA 2C5HA 2E4ZA 2MYPA 1NYQA 5CD9A 2PDAA 3TRKA 4HSGA 2WF7A 5IFKA 5ENVA 2C03A 4OP1A 1QHHB 4PYKA 1CP3A 4RF4A 4X93A 3G6KA 3CLRD 1KS2A 4LZAA 4DSOA 3VBCA 3IODA 2V3VA 3MRSA 5BN3B 1HSOA 1WZCA 4FS8A 3I34X 2OM2A 1E2KA 4KVGA 4S04A 4JJ6A 1VSVA 1WVMA 1FSFA 2FEAA 5JAQA 5A7GA 4R0MA 4TSFD 2QV0A 2QPLA 1Y6RA 4OK3A 4PXAA 4RQAA 2RHJA 4ZGWA 3PNPA 2CNLA 1X80A 2OAGA 4JLAA 2X0EA 1OFUX 1ZN2A 5A5EA 5DYYA 3Q7RA 5EWMB 1M7HA 1T3ZA 1ISJA 4BYMA 1GQQA 1XGKA 2WTMA 2WB2A 5SYNA 1NM5C 3SZRA 1GKIA 1UXJA 2PQ0A 3OUZA 3CT6A 2ZU0C 4ZHQB 3KZMA 2R8OA 3OE1A 3OEWA 3VDMA 3BB4A 4X1YB 1T9KA 1U9IC 1PL8A 2C54A 1JLSA 2ZT7A 4MR7B