5DBEX

Crystal structure of o-acetylserine sulfhydrylase from haemophilus influenzae in complex with pre-reactive o-acetyl serine, alpha-aminoacrylate reaction intermediate and peptide inhibitor at the resolution of 2.25a
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
311
structure length
306
Chain Sequence
MAIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVKCRIGANMVWQAEKDGTLTKGKEIVDATNTGIALAYVAAARGYKITLTMPETMSLERKRLLCGLGVNLVLTEGAKGMKGAIKAEEIVDPSRYVMLKQFENPANPQIHRETTGPEIWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDLSIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSASERYLSTALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Cysteine synthase
publication title Crystal Structure Of O-Acetylserine Sulfhydrylase From Haemophilus Influenzae In Complex With Pre-Reactive O-Acetyl Serine, Alpha-Aminoacrylate Reactionintermediate And Peptide Inhibitor At The Resolution Of 2.25A
rcsb
source organism Haemophilus influenzae kw20
total genus 111
structure length 306
sequence length 311
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dbeX01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dbeX02
3V7NA 1K3UB 2ZPUA 5J5VA 4HPJB 1D6SA 4HN4B 1RQXA 3X44A 1PWHA 5CGQB 2TSYB 4D9KA 1K8ZB 5JISA 1OASA 3T4PA 3FGPA 5I7HA 2CLFB 1J0EA 2CLEB 2GN1A 4L27A 4L28A 2WSYB 2V03A 4D9GA 5B36A 3VSDA 5I7AA 3VC3A 5DW3A 1E5XA 4HT3B 5IWCA 2ZSJA 4OFXA 4D9CA 4LMAA 4H27A 4LMBA 4D9IA 3L6RA 3PC2A 4ZQCB 1UINA 1J0DA 1WDWB 2D1FA 2DH5A 5B3AA 5I6DA 3DWIA 4HPXB 2ZR8A 2O2EA 3VSAA 1A5SB 2TYSB 1C8VB 1TJPB 1O58A 1WTCA 1J0BA 1FUYB 4I1YA 4NEGA 4D97A 3FCAA 4D99A 1P5JA 2CLIB 3SS7X 5HBGA 5D86A 3SS9X 1BKSB 3BM5A 5B1IA 3R0XA 5E0KB 3L6BA 1PWEA 4D9MA 2J9ZB 3R0ZA 3IQIX 2BHSA 1KL7A 1Y7LA 3AEXA 4D9FA 2O2JA 1K7XB 5B1HA 4WX2B 4QYSA 5DW0A 1A5AB 1V7CA 2JC3A 2PQMA 1TZMA 1WBJB 2Q3CA 2Q3DA 4L3VA 5D84A 5C3UA 2EGUA 5J43A 5DVZA 5BW6B 5KINB 2GN0A 1UIMA 2RHGB 3L6CA 2ISQA 5DBEX 1UBSB 5I7OA 4ZU6X 3IAUA 1VE1A 4JBNA 5T6MA 1M54A 1KFJB 3RR2A 1BEUB 5I7RA 4OREX 2RKBA 4F4FA 1K8XB 1VB3A 2EFYA 5IW8A 3PC4A 1FCJA 4COOA 4AECA 4ZU1X 1CW2B 5KZMB 5B55A 4L0DA 3SPXA 1K7FB 2CLMB 4D8WA 1JBQA 1TDJA 1KFBB 2C2BA 1KFEB 1QOQB 1F2DA 1V71A 4D9BA 1WKVA 1CX9B 3AEYA 3X43A 2RH9B 4HO1X 1TZKA 4D8UA 1QOPB 1K8YB 2DH6A 3PC3A 3DKIA 5CVCA 5D85A 1J0CA 4D96A 5EY5B 1J0AA 1C29B 1TZJA 2C2GA 2GN2A 4JBLA 1KFCB 2J9YB 4LI3X 1K7EB 1Z7YA 2CLOB 4D8TA 4AIRA 3PR2B 1TTPB 1TYZA 3IQGX 2CLHB 4KKXB 4PCUA 1X1QA 3HMKA 3CEPB 4IL5A 3DWGA 2ECQA 1KFKB 2CLKB 4D9EA 1C9DB 2J9XB 1TTQB 3VBEA 1A50B 3VSCA 4D9NA 3TBHA 2TRSB 3IQHX 5D87A 5I7WA 5B53A 1Z7WA 3ZEIA 4XUGB 2Q3BA 1VE5A 4Y6GB 1A5BB 2CLLB 4D92A 5IXJA 4NU8X 5JJCA 5DBHX 2ECOA 2BHTA 1V8ZA 1TZ2A
chains in the Genus database with same CATH superfamily
3WGJA 3ZCRA 2C2YA 5FOSA 1UT6A 4RULA 2IU6A 4QJBA 2ZEJA 4ER5A 4JT9A 2GHTA 3KBBA 3MCWA 5BN4B 4FONA 1XZNA 4YMLA 1G5PA 1PNQA 3P0HA 3M81A 1LXCA 1NBHA 4F2WA 3VDXA 4LPKA 2B25A 4XWWA 2QJFA 1X74A 4BY9E 1PQPA 2FFQA 4EJ6A 4E3WA 1QKIA 1CUXA 2DQSA 2FWMX 4G3XA 5H4GA 3RVPA 2CNLA 4MVJG 4ZYLA 4F93B 3OTIA 3QBTA 3DYVA 3C5CA 2C0QA 1VG1A 4ZO4A 4G86A 3W4JA 3ZX4A 2DCMA 3PPXA 1IONA 3K8ZA 4J3FA 3DT6A 5E6RA 1H2BA 3WV4A 1YQEA 2EWWA 2SICE 3HADA 2NQ2C 3GLVA 3ENVA 4QQFA 4WN9A 3KBOA 1M1YA 1TE2A 4Y6QA 2ZBPA 1NV8A 3S2SA 3LQRA 1OXKB 4MITA 1PFQA 3A1TA 3P9IA 1TVKB 3A28A 4OAPA 4DGQA 3SQMA 1A2QA 1DQZA 2IEAA 2GSDA 3H42B 5JD4A 1J39A 3CVXA 1XCBA 2C7GA 4ZVLA 2ENUA 2GM9A 2JAQA 4CMKA 5HKAA 4Y6RA 1DRWA 2QN1A 3A6DA 2FLVA 3FHJA 3HCBA 4TWZA 3IESA 4XVHA 1JJAA 4XQ0A 3ZKAA 3UAYA 1J97A 3M49A 3ON5A 5FWYB 1ZG3A 3WAJA 5TGDA 3A2LA 3CN9A 2C9YA 1Z45A 1TZMA 3DL2A 3C98A 4QFDA 3FYUC 5T4EA 1NUHA 4YJ2F 3SEZA 3WLLA 3TPZA 2O2YA 4E13A 3Q8LA 1T4MA 3TRJA 2OBYA 4GMFA 4WT7A 5CVEA 3HXTA 3K9WA 2H07A 4UM9D 1G6HA 1G9TA 2Z9CA 2B1QA 5F3RA 4JP3A 2H4XA 4Y9RA 4OUDB 4ZU6X 1SU6A 1CUJA 4B4UA 2UU9B 2EOAA 2V8BA 1N2CA 3EDYA 2WSSD 1FCJA 1DB3A 1DI0A 1OBHA 1XTIA 2BHNA 2FZGA 2PN1A 3E9EA 3QENA 4M53A 4XTCS 3U4CA 4J16C 2PEZA 2PH7A 2XUIA 5GIOE 1AQJA 2O6HA 4L57A 5AYVA 3HKCB 3AFHA 3GRUA 2YHUA 1E9CA 3NGLA 5AW2A 4Z9FA 3ZHBA 2F3PA 2RAUA 2O7VA 4KSBA 4OBBA 2AFIE 3DO6A 1SBHA 2BLLA 2Q3MA 1JG6A 1P45A 3KS9A 2QAGB 1CUEA 1I36A 1KQPA 2P9ZA 3UPDA 5B3KA 5KC8A 1Z7GA 4GKKB 2XYVA 4BKMA 2XZDA 1T35A 4FN5A 3PEVA 1GFZA 3OLCX 1XMIA 3KCNA 1Y80A 4Y18A 4AYXA 2C07A 3NBQA 1DBPA 2J7KA 3X1XA 1M1NB 2I2DA 3EODA 3IQGX 1BQ3A 2B7BA 2HCTA 5HJ2A 3IBYA 2NZ2A 4YRPA 3TTTA 1BRTA 4IQGA 1NNI1 1B0ZA 4WOKA 4FZJA 4EB0A 3F6SA 1ZL0A 4K6FA 4KPEC 5BYBA 1MXFA 2CMDA 4OI1A 4Q7QA 5IDVA 1M6HA 1KXJA 1YBAA 3GBVA 3Q2KA 4INOA 3M5DA 2AZ4A 1A5BB 5IJAA 5EHIA 4M1TA 3BH7A 3MN1A 4JUAA 4DSTA 1QF7A 4YUAA 4ZA2A 2R1VA 3SYKA 3R76A 1AKEA 1QIHA 1VSTA 3CEHA 4WWHA 4ZAWA 3ZHZA 2BJVA 4ZJPA 1MRSA 5BQXA 1I5RA 6Q21A 4N82A 3TGWA 1B6SA 4RAQA 4CM9A 4NONA 3EYAA 1PWHA 3IP7A 1HFJA 1OKKA 4MGEA 5GV8A 1RW4A 1CRPA 1MVNA 2EGHA 4N9WA 1OVGA 3IQZA 2R9VA 1VRCA 2Y93A 4IFIA 4AXBA 4F84A 3PDIB 5IF9A 1W0KD 3ESBA 3HYLA 3MJCA 1J6UA 3PFFA 4L28A 4U9UA 1NVEA 1P1IA 5EN4A 4AWBA 5LMCA 2R4TA 4O0LA 4RHUA 2BY4A 2QP4A 2F3TA 3NDRA 4IX1A 5FPSA 1ZI6A 3PS9A 5J9FA 5LBUA 1DOAA 5KS2A 4K9MA 1ZVKA 2RJ3A 1KEVA 5DX8A 3U48A 5BSUA 2DP4E 1C1HA 2HLNA 4Q37A 4Q3BA 3Q3JB 3GVHA 3H75A 5CCBA 4FEEA 4IMIB 2XB9A 4PXAA 1S4QA 4HPXB 3UH1A 1ZITA 2XVAA 5EIAA 3D3EA 5FO0A 3AF4A 2I8CA 3OM8A 4Q00A 1F8YA 2Z3ZA 4BO3A 1T3LA 2ZBVA 3FUXA 1TOAA 2P1DA 3UFXA 4CFZA 2C8VA 1T9GR 4LRYA 4BRSA 4FQ7A 2IUTA 4HEA1 4FYVA 1E9EA 5T6BA 3HCWA 1YGPA 4F5YA 1FIUA 1XNGA 3EZ6A 4KDRA 2M9MA 3DA8A 4MO2A 4PEVA 4HEA6 4IMJB 4XB2A 1O6BA 4X3PA 1Q77A 2CMFA 2YIJA 2WIAA 1F4VA 4O4HF 1ZCBA 4TV9F 5KWEA 2GNPA 4X95A 1NJFA 4QO7A 5DBGA 4RVNA 1QGDA 3FWYA 1UBCA 2DGDA 3M4JA 3IUJA 1OZHA 4HNRA 5MGNA 1C3OA 5K2MA 3DFFA 1Y8RA 3AR2A 3KZNA 4TWRA 3RO7A 3ICPA 1DDOA 3DE3X 3MILA 3UMFA 4YR9A 4RGYA 1L7DA 5E4JA 5DBEX 3OZVA 1W59A 5E7MA 5KNCD 1R6TA 1JIVA 4FNMA 4P38A 1LDEA 4ZVNA 3WE7A 1GAWA 1KFJB 1X9IA 3G5TA 3PHBE 3D2AA 2ODNA 3TIFA 3GEMA 1SIUA 2FWNA 4WY5A 4QZVA 5HTKA 2H16A 1EFRD 1Y81A 2WB4A 3UGTA 1PSDA 1GG8A 3BDAA 2WD8A 5CYGA 4CIWA 3CZPA 3H13A 5DHRA 3RYCA 1I8TA 2Q3HA 4G8JA 2AL7A 5A4KA 2P62A 1JS1X 4P7KA 4HAVA 2H1LA 1ZAKA 1Z56C 3HQ4O 4U8GA 2PYDA 1S8AA 4YECA 2XMBA 3ZH2A 4BGDA 5JRDS 4LC1A 3R6DA 2ZVPX 2HK7A 1UBKS 5IYZB 1FRVA 1HM5A 4LNUA 4O4JF 1U2DC 2QB5A 5EP1A 3L0OA 1UPFA 3F3SA 5FOXA 3QYJA 4IDFA 1OYOA 5KVSA 3V34A 4FPXA 4MDFA 4JI0B 1Y3FE 3TLBA 1FLAA 5DK6A 5IX8A 4D9JA 4EYKA 4JJ8A 4QE3A 1IQ0A 2FEXA 3IR5A 4EY4A 2PQ6A 3B36A 3I04M 3I1YA 1BOOA 4KAJA 4C4YA 2E49A 3CLVA 2VHZA 2WVAA 3LGXA 1T8WA 5HCNA 1GZSA 2JAPA 2MYUA 1OLOA 1EGVB 1IY0A 2W37A 1EFPA 3C85A 4EUEA 3ZNQA 1YVPA 3BGDA 3V2UA 5EJ9A 4QUHA 1AXGA 1IB6A 1QP4A 3QTTA 2P9YA 1GIAA 1JYFA 3EXFB 3QVOA 5KVAA 3PA6A 2JHAA 1XHFA 2NYAA 3JQFC 5IUNC 1GEEA 3OHMA 1GRCA 5A4JA 5I7SA 1ZVVA 4X8MA 3SIWA 4Z1OA 3H1BA 3P2YA 4G5HA 3I6QA 3I53A 3Q7TA 4PTYA 5T4FA 4W5WA 4P36A 3KT3A 5ED4A 1CC1S 1WAMA 2NUBA 3LUPA 4JLUA 2IW1A 4CE6A 3EN0A 2Q2WA 3I04A 1QIFA 1R66A 3GN2A 4QVIA 3F6PA 3D2LA 3FOWA 4L4SA 4ILKA 4TTRA 1NRIA 1KDYA 1KQGA 4RABA 2XJ4A 3HXMA 5DZSA 4MGIR 1DWPA 1RE1A 3C8HA 4REQA 5TGTA 4RTPA 2ZZNA 1IVYA 3E81A 3A2KA 3PEEA 2FMTA 4RF3A 5I8PA 1T2EA 2VK1A 4JSYA 1G8KA 4RWZA 3SXUA 4ZANA 1VKJA 2DHQA 3N5KA 1JLMA 1NUSA 4CDRA 4ER0A 1N2HA 2I62A 2QD1A 1JFRA 1BIFA 4B3BA 3EW9A 3AG6A 4X71A 3GJ4A 4V39A 3TTVA 4EX7A 2HDNB 2FMKA 3E9CA 3QW4B 3A9RA 4FE4A 5I6DA 2ZS9A 3WNBA 3K71B 5HFJA 5KYGA 3BTUA 3EQZA 3VNVA 4EJFA 5DEOA 3QKRA 1Y37A 3GZ4A 1UXOA 1Z16A 4E08A 4YIHA 2OM6A 3NRCA 3QU2A 3RUCA 5LSAA 1BMFD 4ENSA 4TVBA 4EO4A 1YA8A 3MTQA 3QQPA 1JZTA 4PZYA 3ZWMA 1KI6A 4QGSA 4ND2A 4Z1MD 1Z4NA 3D0QA 1KL7A 5DGCA 2XEDA 4OHBA 1AUPA 1HPLA 1NL3A 1XTQA 2GZRA 3F8TA 4QWWA 5EPEA 2NU9B 2ZRMA 4NL4H 5FLXA 4HAUA 4GR4A 3ETHA 2CGEA 1K98A 3QVSA 4DUGA 3DUWA 1V8BA 4WPGA 5F2OA 2AUMA 3WOHA 1Z88A 5DHAA 1QNFA 4B74A 4DXDA 1B8NA 1JIQA 3DKKA 3QLVA 1U8UA 3PQEA 5TQ2A 1P2TA 4WQMA 2WUDA 2VJOA 3EY9A 4KXXA 2MIIA 2PUVA 2QD2A 2YZMA 3FZNA 5EUMA 5A1JA 1SRQA 3FYSA 1IL0A 4K0KB 1Y6RA 4HFJA 4MRRA 1W6UA 1PJ4A 5F9MA 4URUR 1EX7A 3UAOA 4F6RB 1E7SA 2KJQA 3ROXA 3I2IA 1IN8A 4G8CA 1SBIA 2Q1TA 4IJUA 4C3ZA 3HB9A 4E5VA 3B70A 2BRUA 4OH1A 4BE9A 1Z34A 3O26A 16PKA 4L6CA 3QX3A 1I3LA 2K2WA 2Y76A 3X1MA 3KXKA 1EDEA 2YVKA 2Q4EA 3T9CA 3TUIC 1EWVA 5LZ2A 3B78A 1G9SA 3FNIA 2IOFA 4ZVQA 5EHXA 2MSLA 3L1VA 1FYEA 1IIBA 1RNLA 3VPBA 1Y98A 1VL5A 3KFLA 3DB1A 3C4QA 3H5IA 2YVUA 3F3KA 3L7LA 5EJIA 1K2WA 1PV4A 1P2DA 2JVIA 4HVAA 1UC9A 3SM9A 1Z6QA 1N7JA 3CVYA 5JY1A 3KPUA 4CF4A 2VAVA 2HJGA 2IE0A 4RH3A 1GYRA 4ABYA 1KBQA 1IY1A 4KN5A 4NMXB 4YFVA 3R9XB 3U6BA 3EZLA 2W2LA 1AXEA 3U56A 1DAEA 2EW2A 1NBIA 1XFDA 2PWZA 2Y68A 2ZRNA 2ZTVA 3QJYA 4ZDWA 1F4LA 2BV3A 1YCHA 4ZI7A 2BF7A 4C7OA 4NHOA 3U3MA 1FSFA 4L5JA 1GP2A 2ZJ2A 4Y7CA 4G0OA 3AVTA 3AF5A 1FLDA 1G98A 4PX2A 4HJRA 2J5BA 2ZUVA 4OPMA 5ALNA 2I66A 1GRRA 2V1XA 2YY6A 3T7KA 2YQ4A 1ILEA 3T1HB 4FYHA 1DKRA 2X77A 5KQLA 4FBLA 3PHLA 4J91A 1CZOA 2H1OA 1EGQA 3UXHA 2CJYA 4HY3A 1I3NA 4JBGA 3ENWA 1PNOA 4G07A 1C7RA 3SEQA 4MCAA 1Z7BA 1ZK1A 4KRXA 1HI9A 2IC5A 4EW1A 1V7QA 3K9BA 4L76A 1LBHA 3WRWA 1Y8QA 1HLGA 3AR3A 2NT3A 5J1SB 3AERB 3W9UA 3R9WA 1P9LA 3A4LA 4YWHA 1F2TB 3L6DA 2HWXA 4DQDA 4DRXB 1BGVA 4IDHA 2UXCB 4Q47A 2L2QA 1N3IA 2NYVA 2PKWA 2VP0A 3FUTA 3JZDA 4DABA 3KKMA 1Y4AE 4QPZA 3WSVA 2QRHA 2W2PA 4PBSA 1NVTA 4BWFB 4ZPXA 4NKRA 4Y9UA 1Z5OA 5IT9A 4Q93A 4ZGWA 1QGUB 1Z25A 3MELA 4BNDB 1JTVA 1F06A 2D06A 4B7XA 5COBA 4C3UA 5KVCA 3VO2A 5EP3A 1AHPA 4Y0AA 2VP9A 2O8CB 4DR2B 4PGGA 5EKXA 2UYCA 1ZBDA 1Y9ZA 3O03A 1YH3A 2BGNA 1MW9X 2WP0A 2GILA 4PRLA 2DAPA 4TT3D 2ZITA 2XDAA 3O1JC 1UPBA 1PDWA 2I7TA 2PK3A 2Y66A 3OFJA 5DO9A 2YR0A 1KSGA 3WX0A 1PVOA 3LHFA 3CGGA 1CK4A 4NF2A 1N0HA 1IUKA 1RZ3A 5AVJA 3KOMA 3TXYA 1JX6A 3PLAE 2O8DB 2JEYA 3BAFA 5J5CA 4EA7A 4RF5A 2F1OA 1TFRA 1ZPDA 4JP8A 1WBJB 3VR5A 2XV1A 7ADHA 2HOQA 1R9JA 1E4EA 2IY7A 2GM5A 3AF1A 4HH1A 5T67A 1QG0A 2VAPA 4YJHB 2JHCA 2HSWA 1WOMA 1NURA 2IS2A 2WR8A 3TVDA 2Q4RA 1OBOA 3AB3A 3OAAA 3Q85A 4OSPA 5HKBA 1JQBA 2C8JA 2ADOA 2PMKA 4QU8A 2D13A 3EWAA 3G2OA 4CMEA 1QH1B 2RJNA 5ICEA 2WWRA 1FS6A 4CCSA 2C9BA 2XMQA 3EXG2 3Q7RA 1WPGA 1NXTA 1KMQA 2O7RA 1FFGA 4NBTA 2D3TA 2EX0A 5LQUA 2VRCA 2FOIA 1X7YA 2OYRA 1CERA 1D5WA 1ESDA 3OJLA 4M6WA 2Y1GA 4RLHA 2CSXA 1TM2A 5CFZA 2JASA 2JH8A 4H7IA 3E9QA 3U13A 2GMWA 4FHGA 1DS6A 2AC2A 2IH5A 3EAGA 3TLZA 1HNZB 3Q5DA 2G8LA 4DA4A 2NXJA 1RJEA 4E4RA 3VKHA 1ISJA 4WMLA 1Y5MA 5EHQA 4C1NA 3TQCA 4KGXA 4M76B 4O4LA 1XRPA 3T3DA 1XRJA 2IOYA 1R8JA 3I9KA 3R24A 4KLNA 4D41A 1FYVA 5CJJA 4QX6A 1W4ZA 3ETGA 1QHIA 4FBMA 2R3SA 2C5GA 3CCCA 4MZXA 1UK6A 3SJZA 3A32A 4BVHA 5HGJA 3FD8A 4XSGA 4WXRA 4O08A 5JSQA 2PL3A 4R6XA 2CNKA 1JNYA 2PGNA 2Q4DA 3NHRA 1GA6A 5G4LA 4OYRA 4ECEA 1IPEA 3I1JA 2P6RA 1W25A 3ERCA 1KKUA 1VSQA 1VE5A 1Y42X 1SKUA 3OIYA 3QRWA 5AW5A 3DXXA 3V55A 4BKOA 3TINA 5A4AA 2X9GA 4LJ5A 1G6Q1 2F8SA 3FDZB 2PZAA 2VCHA 3WWPA 4QUBA 1TFUA 3GCDA 1D2NA 2P6PA 2GEKA 5KTTA 4ZHQB 4YQZA 1DPGA 1UBLS 1M2FA 2BHRA 3A58B 3E05A 3I73A 3LF1A 5JDIA 1Z26A 3TZ6A 2A5FA 5A3SA 1CQJB 2EDAA 4B84A 2CHUA 4YAIA 1NUAA 1E1KA 1E1QD 3E4CA 3E2IA 1SXJB 4E5KA 4Y2HA 3DBHA 1U3TA 2GR9A 3NIDB 5HF8A 1L3BA 1MIOA 1WPXA 2D54A 3DP9A 3OA2A 3OEYA 2I7CA 4K6CA 1LVUA 1S1MA 2QX8A 3U39A 1KY2A 1SCBA 2BONA 1NJSA 4D26A 4O8ZA 2F4NA 1ZA2A 3AW8A 3OZRA 2GBLA 4L72A 4YAWA 5KJFA 1UBJS 3L2OB 3QF4B 1HT1E 3PT5A 3FKSD 1Y4ZA 3E9NA 3O8OB 1GA1A 3K5PA 2J33A 3MMNA 3L6BA 3QW2A 1IHOA 2A33A 2ADFA 3QBJA 4LJYA 4W7IA 3ZWAA 4YPVA 3H9JA 2BSXA 2DPLA 4LDJA 1KIFA 2BVNA 1ICIA 1NTOA 5HVNA 2R87A 3RAEC 1A0OA 3TRHA 2BI7A 5A7GA 2P1RA 4HQLA 5L3ZA 3RRMA 3S44A 1JHZA 4K81B 4JITA 4DM3A 3K1YA 4LY3A 3RNOA 2RK4A 4Q4JA 3HYNA 1YRBA 5ALEA 4KK4A 2ZXFA 1RU3A 2F17A 2FSUA 5TVGA 3PTLA 4IZIA 4NNJA 5IF3A 1BS2A 3OPVA 7REQB 2C9CA 4RL6A 4MUMA 3PLNA 1CULC 1DAGA 4HLUC 2I67A 2AJTA 1VJRA 3IBGA 2A5LA 3FOEC 3H19A 1WHTB 4OMDA 1IULA 2ACWA 4L6AA 1LI7A 1P75A 4YMGA 3RTDA 1H5QA 1LB1B 1QFZA 3HV0A 3TRKA 1TLTA 1E61A 3AVYA 4PC7A 1E2FA 2YWDA 4I5IA 2YS7A 4RD6A 1EB9A 5G0UA 4K5QA 1G55A 1DHTA 3JXEA 4Q3LA 4NVRA 4H16A 4G0QA 3DJFA 2BUBA 3QWIA 2FPPA 1FFWA 4YUWA 2FW7A 5KOIA 2WIJA 1O3YA 1RMQA 2E0IA 4WJKB 1EZ1A 1GPLA 1QPGA 1XLTC 3V1MA 2VQ3A 5IJ9B 1C8KA 1W9MA 1KMNA 3VHLB 3E8SA 5CB4B 3B1VA 2KLHA 1OAOC 4TZKA 3T7RA 1OFGA 5K8TA 1YR7A 1KYQA 4NOMA 2E55A 2ZKLA 2CLSA 2XD4A 5HJ5A 5K8LA 1Z2AA 4DLRA 1MZPA 5EE0A 2IOFK 2HT1A 3VVLA 4HQ6A 4GDMA 3WJ2A 5I45A 4PYIA 3TK1A 3TR6A 3DLCA 4KR3A 4XUDA 4RKQA 1I9CA 1KVQA 1U3DA 1GFIA 5T57A 1QLJA 1GCGA 4DJFC 3L8YA 1TAHA 3E9RA 3M4ZA 4TN5A 5JCOC 4DNXA 2YIDA 3O4HA 5C80A 4UM7A 1UXHA 5GONA 1F5SA 5LNK1 1FDVA 3Q7QA 1U2ZA 2VOEA 1IOVA 3O91A 1KPIA 1MO3A 3V1YA 1AURA 1SUSA 4WBXC 3E15A 4G0UA 4UNNA 2FDCA 4GR9A 3L4EA 1T0HB 3L82B 3NWJA 1O6CA 1TIBA 3UJHA 5KYYB 3N8DA 3DS8A 4EPTA 2Z1DA 2WF8A 3GJYA 1L4HA 2CHEA 3PI7A 1H8EA 4HDNA 5IKPA 2IELA 5FA5A 5JH7A 3IKMB 1G5RA 4RXTA 3PWZA 3U44B 1U1IA 2DFDA 4MICA 2BBWA 1JSLA 5ALWA 4MV3A 1JYSA 2NUAB 4D5GA 5BNTA 5KYKA 4RTOA 2J45A 3ICCA 3SVZA 3ZCXA 2XH8A 2DJIA 5AJVB 1SOVA 5DYNA 3NALA 5DLYA 3BCUA 2IXFA 1G66A 3W34A 3KT8A 5TQ0A 3IT2A 1G64A 3DP7A 3FYHA 1AS3A 1EVKA 1L8LA 2JKVA 3M70A 4WBSA 3F2IA 4WOCA 4WBNF 4TS1A 9LDBA 5HZGA 1IXKA 1TCCA 1WCV1 5CCXA 4QIHA 1EIWA 2P5SA 2Z57A 1NJ5A 1H0KA 2ENWA 4I2NA 5I4BA 2AFHB 4YI5A 2R6AA 4Y30A 1KHHA 3L6OO 1WXFA 3HXKA 3H9UA 4EB6A 4PLZA 3LT1A 5JW6A 1FMCA 4G84A 2BMFA 1IG0A 2H4FA 1O2DA 4F4CA 4AUMA 4F4FA 3L1IA 8GPBA 1ZFNA 3D6AA 1HQKA 5JCJD 5CDFA 4G0PA 1XALA 2OPHA 1GRVA 5BNZA 1YXMA 1EK6A 1RHRA 2QN2A 4CCWA 2XE6A 4RZ3A 3QX8A 2B4QA 4LHYA 3GELA 4M54A 1M6VB 3EQ9A 4RVCA 4WCVA 3UHPA 1ZU5A 2AOTA 3K9CA 3MB8A 1NDUA 2PWPA 3WLAA 2Y1CA 3GUHA 3M5CA 4JLOA 3ICEA 1N9KA 4KTTE 3RS7A 2Z56A 3EIEA 3DDSA 2ZIAA 4D43A 4PZPA 3CNOA 2VF7A 4Q9KA 4RDHA 4X94A 4MV0A 1KS9A 2HIHA 4ZTBA 1ZGZA 1P4RA 4GBMA 1C50A 1JQKA 2VH2A 3FCEA 5A4DA 3OQMA 5DHFA 2AMVA 3EY4A 3IRVA 4MYTA 2O9JA 1RYZA 3COVA 1ZJ5A 2XOKD 3IAAA 2ZS7A 2CFCA 3OJ0A 5BR4A 1THGA 1N92A 2CXSA 3KYIB 3BD6A 3WTBA 1C7ZA 4Q4CA 3I2YX 1EGHA 3VPXA 3AM4A 3LHKA 4HEQA 1AM4D 1TLFA 4C3VA 4W63A 1NWHA 3O8CA 3DOOA 4NBVA 3GFVA 3SIPA 1MC1A 3A36A 3NVMB 4TSFD 3GG2A 2R6DA 3H2GA 2GDZA 1RYNA 2C5LA 4YRZA 2ZWMA 1EJ2A 3FVQA 3QVXA 4WKGA 1GKLA 1VMIA 3RS4A 4PHTA 5CD9A 3I2HA 4PN3A 1BZYA 2NQTA 2PRKA 3NOVA 4IZ6A 4XX0B 5CM2Z 2GQ0A 4LV5B 4TV8F 1DC6A 1DMSA 1Q91A 2Z6VA 3LFTA 2AF4C 2ZJ8A 4PQFA 2VAMA 3UYLA 4QLAA 3UXEA 4AJ1A 4F0JA 3O47A 1GU0A 3QVKA 4ACBA 3FVVA 1IY9A 4LDRA 5A4FS 1QHHA 3OFNA 1O03A 1JMKC 5DGTA 1TGVA 1RCFA 1VDMA 1O95C 3DBRA 4K05A 4P9NA 4GIBA 1E63A 4IDDA 4EMSA 5LKRA 5DB4A 4O33A 4Q4HB 5GWXA 4Y67A 2JVJA 2WM8A 1JQ3A 3SYMA 4WLUA 3N58A 4ZC1A 1U5CA 2II6A 2HFKA 5IN5A 3CEMA 4EF4A 4M9SA 3DDWA 1NXQA 1A69A 3FNRA 1R00A 1D2RA 2CYCA 4GBED 4FR0A 3T1TA 3O1LA 4DADA 5JNWA 4C4PA 1GUBA 1ODCA 5CA1F 3TQSA 3Q8KA 3C7DB 2O8FA 3VR5H 2P65A 2O23A 5CFQA 5HUQA 2YQZA 4TYQA 3R75A 3F0TA 2FA9A 2FG5A 1Q0RA 2HZ7A 2WWHA 3MRXA 2X19A 3EBPA 5HF9A 4E2WA 2P5YA 2H0QA 4F9TA 4MQUA 1E3JA 3OLQA 5CNMA 1XXHA 5ALLA 1TAGA 3GZNB 3P2OA 2IGBA 1AV6A 2P6UA 3GFFA 1YRYE 3O2NA 1U0GA 2GXSA 2G04A 1U1CA 4RAOA 1TJNA 2OB2A 5G1OA 1WQ4A 3BFVA 3CLTC 3NRJA 4LWQA 4LDQA 5F76A 3L6CA 5CFPA 1P7VA 3QZUA 2FZ4A 2YY7A 3P9QA 2WA1A 5KOHB 4ZAFA 1SCNE 4J1SA 4MPPA 5H70A 1RCUA 3DVQX 1G19A 2CNWA 2WICA 3NHWA 4Z0TA 2NO0A 3TLAA 3WGVA 2BP7B 4ETMA 3SHFA 3TRIA 4YJDA 4PIVA 4D81A 4KAAA 5D3MA 1RWNA 1XZPA 3DD1A 1WHSB 1ZUNB 5EZYB 3STVA 2P2DA 1TIKA 1X1EA 2Y0EA 3LJKA 3W2HA 1RAFA 1ZX1A 4PZDA 3SQWA 4EZEA 1C9KA 3IULA 1XTPA 3FN4A 1ZISA 4A36A 3O3CA 1NNLA 4ASUA 3G0OA 1V25A 2X2EA 3K4PA 3AETB 1YKGA 4JS0A 3AP3A 2B8JA 1BCSB 3QV2A 3ICOA 4TT8A 1HZZA 2R8EA 1WZNA 2XT0A 1UEIA 3HDHA 4WV3A 5AOCA 4FKBA 4BC1A 2QUJA 1Y48E 3A0RB 4U0JA 5AK5A 4CODB 3H97A 4JP2A 4UU8A 3AONB 4PLTA 4C20A 1T0PA 4CRWB 1X1AA 1JWAB 2ZQZA 4JJIA 1CB7A 1RBYA 3R40A 2I3AA 4X44A 1A8SA 3MYRA 4TN1A 4F4HA 2PSJA 3CUSA 2YRFA 4GRAA 1QAQA 3DMGA 4AI6A 5T8KC 4HYQA 2VO1A 3AXSA 2OFOA 2QLJA 1E2DA 3C3CA 2OC4A 3I4CA 1H05A 4NZPA 4XUGB 3K5HA 5HGXA 4JJ7A 1QANA 4B3RB 3O8QB 5EIBC 5BOSA 3I5YA 1JSXA 3W2FA 3IURA 2XNDA 5FTKA 2I6SA 2QL7A 3H5OA 1CUYA 1L5WA 1Q84A 1U7DA 3O8BA 3E3OA 4KV7A 3EFEA 3S5JA 1VP9A 4D98A 5EWLA 5C4MA 3HJUA 3QPCA 4Q9NA 2WHEA 3FOCA 2H11A 2HBYA 3H2SA 3ZIDA 3V4LA 3QEAZ 4HK4A 4N40A 1YV9A 1A7JA 1ZH2A 4NC9A 4WACA 4JWKA 1U5BA 1E2KA 3A26A 4TWBA 2ZWVA 4BFLA 1W5EA 1NXPA 4OLBA 2FPMA 4X62B 5DM2A 1XOIA 2WJAA 2I4OA 2PCJA 5FOUA 4ZQCB 1N1EA 2DCUA 2AOVA 4HF7A 1LVGA 4IHQA 4JD5A 4WZBE 2HF9A 3P27A 5B3AA 2Z4SA 3MCTA 3M33A 1KH1A 1MNQA 1U7PA 1Z6GA 1GGFA 1S9HA 3DTYA 4G8DA 1QHXA 5K8JB 3VPGA 2L69A 1EM8A 2X9LA 4LOJA 5DTJA 3JAWB 2VWGA 3SS9X 3E53A 4L5CA 3N8IA 4M0MA 4IAOA 4TYPA 4TQAA 2EEZA 2IYAA 4QYWA 1NJ2A 1G4UR 4MYHA 3LVFO 3ADCA 1FMTA 1OLUB 2I2AA 2GO7A 4R98A 3ORQA 4AZ3A 4KN8A 2C58A 2REXB 3RUFA 4WFKA 4DCMA 4Y2RA 1E1NA 2C4TA 2CJPA 3IUBA 1IJBA 1BOFA 3JD1A 1CRQA 1AKRA 2ECKA 3HWSA 3M0EA 2UDPA 3NH9A 2H5EA 4LWPA 3P96A 4AKHA 2WMYA 1JB9A 4LYYA 4NZYA 1B76A 1P4JA 3IALA 5EIWA 2OLJA 5LC1A 3QHAA 3A4TA 4BMDA 2E18A 5DNVA 4WH0A 3VJMA 4C7JA 2IXTA 4E46A 4S05A 4O2AA 4QXAA 4G4IA 3WNVA 3AM1A 2MSWA 1P6QA 3OJFA 5BQ3A 3MS2A 4JB0A 3RGWS 2PLWA 1BQEA 1SVUA 1GVNB 2DKOA 5HQTA 3A3KA 4PNZA 3BK1A 2P3OA 3ASZA 2GUGA 4DUPA 3BK7A 4JQZA 4NK5A 5TJHA 3WRXC 1QXSA 4RD1A 1U2TA 2EDCA 4H4CA 1UIRA 1B74A 4JA0A 4NPCA 5JD3A 1PS9A 3H9BA 3O31A 2JD0A 2XB8A 5AI6A 4ZKEA 4B0OA 3TVYA 1U0RA 1HYEA 4OJMX 4XYMA 4QNMA 5BV2P 1TZKA 2P0AA 5E6RB 4ZMSA 2AB0A 1KIMA 3IO3A 4WN9B 3W06A 2B82A 2F62A 4DN6A 2C2XA 2UUAB 3HHPA 1AO3A 1OAKA 2QLMA 3FHCB 1ZIYA 1LJLA 4ZZIA 1V4VA 2BW0A 5C1PA 3Q6MA 1GAXA 1ZD8A 4LI3X 5ALOA 1BE0A 1E6EA 2WAYA 4CI0B 3WL4A 3FF1A 3SJBA 4Z7JA 4PC1A 1Z35A 3BN3A 4GBJA 3ET4A 2XAUA 1N5MA 1WABA 2ZAIA 4IOKA 2IODA 3KSBC 5I9SA 2E2WA 4EVRA 3HPQA 3OPNA 421PA 3NJ4A 1NFQA 3TBHA 3CVVA 2BPOA 3UAZA 3OE1A 4FYJA 1UFKA 1NVMB 3ZLJA 2ZBQA 3KOWA 4I4CA 3NKVA 5JJ5A 4AYWA 1EJ6A 3B6MA 4Z4CA 1TO1E 1OH6A 3GT4A 4MV8A 3VR6A 4TS4A 3KJZA 2JIZD 4MRSA 2FWRA 1T5SA 3AEQA 1ULTA 4J0IA 3CRMA 5DRTA 2Q5FA 1RQXA 2AQ8A 1QUFA 4PU0A 1DEXA 1NTRA 4F9EA 3KOYA 2EZ9A 4HXFB 2H3EA 1N2CB 4JKIA 5FPYA 3VA7A 1J99A 3AY7A 4R05A 1OR8A 5C7LO 1YOBA 1GZDA 4HXGA 1J0EA 5K6TA 3PEWA 2UAGA 3GAMA 4NZNA 4NYIR 5FOTA 4AP9A 4DDHA 1ZO8A 3ROMA 1PCXA 2VH1A 4A1FA 1F3OA 3OKAA 5JCXA 4FNGA 1YB6A 5JROA 1SG9A 4KCGA 1P0MA 4GM1A 4KGZA 5AIBA 4XLZA 2PUCA 1FBNA 4ALLA 3N8HA 2YUIA 1EDOA 3TOVA 2Q6IA 4UVEA 5F51A 5P8WA 3WMWA 5M29A 2BZ0A 2O2HA 3Q2OA 1J22A 4WLFA 3ESZA 2V54A 2AWNA 1FYXA 1OJ7A 3G2LA 1LSOA 1ISMA 3GW8A 2P2ZA 3EVDA 1ZMRA 2BFDA 2I1VB 2P8JA 3G5MA 1R6DA 4ICIA 3V7WA 1ZR2A 5E0KB 2ONKA 1MOPA 4XFJA 3CNNA 1EVIA 3MGGA 1Y8ZA 3OCCA 2DHRA 1DV2A 2IXEA 2ZRGA 4IFTA 4LRXA 2CDAA 2FRVA 3JZFA 3QX9A 4JOSA 1WCIA 2PGOA 1S5PA 3P4UA 3F1KA 4N0QA 4ZMRA 2NAPA 4OKSA 3OOYA 3CG0A 2XMZA 3ZU2A 3LQ1A 1CFZA 3UW1A 1D04A 3ZY4A 1H6BA 1YJQA 2R1VB 1MAAA 3V2GA 4ZYZA 4LC9A 3Q6NA 4A6EA 1UL1X 2PIDA 5CBPA 3U3ZA 2BFWA 3T9AA 2O5CA 1ZS9A 3HLKA 1L5MA 4LHEA 5DMHA 1XFAA 2ZR0A 5TEWA 4D0NA 4ND1A 5IN4A 4KWTA 1FDUA 1IY8A 4I08A 4QGHA 2ZVQX 1FVHA 1M6YA 3IQFA 2ZRQA 1OLSA 4LISA 5L45A 5KZMB 2GD0A 3V8MA 2RHMA 4UTNA 4WTOA 2XNHA 3WKDA 3ZXSA 3ITNA 1QFXA 2QGFA 2X8WA 5FEMA 4JKOA 3B8HA 1RSZA 3K31A 1XA0A 2YXEA 2QPOA 2SHKA 3IBSA 4OKIA 1K5PA 2X13A 3GC6A 3CW2A 3GPCA 4HC4A 1UM8A 3I6BA 4RDIA 4Y2JA 5D85A 1NRWA 4R8RA 5EOVA 3U3RA 2AMJA 4I50B 1NHWA 2AW5A 3BRSA 3ZK8A 1VG9B 4GPEA 4LXQA 2WTBA 2YUTA 2EARA 4OGFA 4QECA 4BO2A 1XZLA 5K0TA 3B13B 3UFXB 1MHTA 3ZD6A 4TL6A 1WY7A 3ZW9A 4OXKA 1UUFA 1T29A 1SC1A 4WINA 3DMHA 2H18A 1OUMA 2VDVE 3DO5A 4YCCA 4PQRA 4JASB 4PGAA 5I9NA 1MO4A 2HYIC 1LNSA 3W5BA 4UQOA 1S02A 1YF3A 2CL5A 2EIXA 5AKHA 1C3OB 1E79D 1Y8RB 4FHCA 4RTKA 1SG0A 5THQA 3G5AA 2RFLA 2WWGA 5DTMA 3SYTA 3BB4A 1K06A 4FR5A 5AHKA 5IYZF 2AG1A 2ORVA 4BV2A 4PXYA 1JAXA 4K2HA 3W6ZA 2QZZA 2BGUA 1VPWA 1C2TA 4HLNA 5C18A 2AFIA 1QORA 1UT8A 1K0UA 4B4KA 4YRKA 2LPMA 3V3TA 1U8EA 1CUVA 4UJ5A 4Q48A 1A1VA 3T3HA 2PPLA 5IUKC 1AGYA 1CS0A 3BDIA 4EG3A 1W34A 3Q3EA 1HMPA 4DLYA 1LBQA 4TQ9A 3QA3E 2HUPA 3F2VA 4DEVA 4Z4GA 1OZ0A 2JW5A 2QY9A 3GHYA 3UJPA 1G8PA 1NJGA 1PGQA 3GO4A 1SHJA 2XT9A 2HWUA 4XH9B 1P17A 5J4HA 4J0JA 3PIRA 4UU7A 4LNUB 1JHVA 3R6GA 3WAGA 1A04A 2GFIA 4YCJA 1WU8A 1BMTA 1RQGA 2VKQA 4MP6A 4RSMA 4CHGA 4D44A 3ILVA 1MEEA 1XG5A 1FS5A 2PUJA 5AT1A 3PBKA 4G85A 4QDJA 5LBTA 4LF6B 5HEKA 3DBIA 3DEAA 4M9XA 5AIAA 2AF3C 1HDRA 2EWMA 1GLVA 5P21A 3QKSA 4J1NA 2RGYA 2LIVA 1KYWA 1EFPB 2PZBA 1E8DA 4N49A 3GMIA 6ADHA 4FWTA 1N36B 1N8TA 5CLFA 2IPNA 3WHLA 5JE8A 1M2GA 5F1OA 4ZC8A 1PKEA 1V43A 3CISA 4CKZA 4YRTA 5CVDA 4L3VA 2JEZA 4ZQIA 3BF8A 2WJYA 4RJKA 1N77A 2PLNA 5IPFA 2XDWA 1K92A 4LHVA 2IBMA 3GJZA 5F1PA 4C88A 4C2UA 3U19A 3E7PA 3LSYA 2XBMA 3TI9A 1GNRA 2YVAA 1TM5E 4GAEA 3RKSA 3ONEA 4F91B 3R3WA 1GKYA 3U7IA 1US8A 4I1IA 1CRZA 4QTZA 2IWRA 4REQB 5CDUA 3FMFA 3BT7A 2WG0A 5KYXA 3RSGA 3ER9A 5DCUA 2AHOA 4EKNB 5AJHA 3UENA 4IBOA 3EARA 2HWYA 1SUAA 1ODTC 2NV2B 5JSHA 1VFPA 3MWDA 2JKZA 2CK3D 4XWTA 5CNIA 3SXUB 1S2DA 1Z08A 3S3TA 1DBQA 1HFWA 4GXNA 5H59A 1YRHA 4BQEA 3NVAA 2UV8A 3SNHA 3IFSA 4HFRA 3ZWBA 5KNCA 2JFBA 4CTJA 1M7GA 4JL8A 3SP1A 3MMZA 1LDBA 3RH0A 3OUTA 1U7HA 2CFIA 1C29B 2C2GA 3B6IA 3ENKA 2WUFA 2G0AA 1HDXA 1YMVA 1G5IA 1NUQA 3UK7A 3MMXA 5J4YA 1EFRA 3C6KA 4MH0R 1ZK2A 2PKYX 4ZQFA 2XAAA 3AF2A 1QVVA 1PR9A 1KI6B 1WXIA 3TPFA 3JWIA 2FLKA 3PHGA 4OMCA 5HS6A 3KD3A 1C9DB 1DJOA 1PEDA 1C9YA 2AX4A 4X8OA 3VR4H 2FF7A 4EW3A 1E2EA 4OAOA 3RSZA 1E62A 3EULA 2CN1A 3ZR4B 2Q6OA 4DJTA 1L1FA 4EEKA 3DWEX 1YULA 5AW3A 1P7WA 3KR1A 4LGVA 3AFMA 3BE6A 4ZO7A 2HUNA 2CLLB 5TQ2B 4UNIA 5JJBA 4FGSA 2Q5LA 2WAMA 2OUIA 3CWZA 3KZKA 2NO1A 3KZVA 3QVUA 4Q21A 1Z5ZA 3RSFA 4M98A 3NYQA 3V8QA 4ALNA 2OCKA 3PWTA 5EIEA 5LN1A 4OJKA 3W8DA 1EWQA 1C9MA 4QTXA 4EVSA 4IDQA 4BP1A 5KMGA 4ZKDA 3NAGA 5I51A 1BWSA 1NVVQ 2EJTA 3DAGA 3C41J 3MD9A 1NVDA 4Q9DA 2HBQA 1TK2A 4QJ5A 5I3CA 3KT6A 4KGDA 5I7AA 5K3BA 4RZ2A 3LOQA 4JMPA 4UKDA 5JAMA 3BEDA 4WLVA 3WJAA 3G68A 4E14A 4BNMA 1ATIA 3CINA 5B7QA 1WJGA 2RKWA 5CH3A 4EHDA 1JT9A 4DCVA 4BLTA 3DLIA 3FW1A 3IDOA 2C2OA 4OMUA 4D82A 4HNGA 4IF6A 1L5HA 1NASA 5DI9A 1DWOA 3R6WA 1WMDA 3CH4B 3E5RA 4LFCB 2W0SA 5SY9A 3STUA 1P5JA 1SELA 3CSSA 3DHVA 4QRIA 2XE8A 3PXUA 5DYWA 4EOGA 2FU5C 3GNQA 3HY6A 4Q3KA 4U00A 4Y0VA 4Y2QA 4UNRA 4AY4A 3NLLA 1VLLA 2B35A 1OIXA 1XF9A 3QJ5A 4QPNA 3EDCA 1TF5A 3FLAA 1G5TA 3ZDXB 3EOAI 1C8LA 3WWOA 1WUTA 2BBSA 1X7HA 3P9CA 4HEJA 4RACA 2HHHB 4RKYA 3HPRA 4ZI7B 5F77A 4KXLA 4PHFA 3PYMA 4C7OB 2XYPA 4UMFA 3RT1A 5IAAA 3ZU3A 3LMKA 3PJEA 1XD2A 3MJEA 1M7BA 3LPCA 1DC4A 4IVNA 1T6YA 2UUOA 3LY9A 3M1LA 5DOVA 2VCEA 1GPJA 1LNQA 3JQ6A 4OL0A 3OURA 4V2IA 4OI2A 2ACVA 2XPCA 4BP3A 4IJ6A 2C1XA 5C7OO 5I7OA 2QUBA 4HGQA 1KERA 5HP4A 1W19A 2LRHA 1KZ4A 3PZBA 5CFMA 2X41A 2XODA 5EPUA 2OORC 5LZ5A 1Y8QB 5AK4A 1AUOA 1MVOA 3E8MA 1WY5A 2QR3A 4PV7A 2O4CA 3RC2A 3GNSA 3HBAA 3N3BC 1P1CA 1EUDB 1EWKA 1JG2A 3VZCA 4EI9A 3VI4B 5JMWA 3Q40A 3MWJA 1VGQA 3U49A 1J8YF 4I8DA 2R85A 5GVRA 3ZHRA 5L8VA 2FSHA 2WTMA 4PSCA 1QRDA 2HQ1A 4WCFC 4XXHA 3T3MB 1JXQA 2LGJA 1K8YB 3FRHA 4JC0A 1U7UA 2RDMA 2ZZKA 5EJAA 3W4KA 4BLRA 4DFDA 3TZHA 4KFCA 4PR3A 3EGCA 1XZMA 4WJLA 1EDZA 2R6HA 2R7MA 4OXNA 4EKIA 1TM7E 2R86A 3U09A 3O4GA 5HWSA 2B98A 2F67A 2I3ZA 4FJ2A 2VDWA 1ZMOA 4PO8A 1H93A 4D8TA 5KDDA 1TTPB 5DOZA 1GZ4A 3R5XA 2OCAA 3PQ2A 5D3QA 2X5XA 3B9QA 3B53X 1K88A 5ARBA 1YJ5A 2Z2IA 2OXTA 4J9UE 5AXAA 2NMVA 1KJWA 1Z4OA 1SXIA 4NMWA 3WLOA 3VR6H 2J4FA 4W5RA 3DQQA 4J6FA 1QAMA 4AB1A 2C2MA 3OQJA 4D3ZA 2Q46A 1UCFA 4PS1A 1C5KA 3BGWA 4AKEA 2P2CA 3IQDB 4BIIA 4KRFA 2BCEA 1BFDA 1E4EB 3F7MA 3UB2A 1D2CA 4B6EA 2R5WA 1NNUA 1V8ZA 2G06A 5ALYA 2ZSAA 3JD3A 3O92A 3USES 3VTAA 5AKXA 5C3MA 1G6KA 4RKRA 3MJSA 3K30A 1AG9A 5KAPA 3U37A 2HREA 4FYXA 4F8JA 2G5PA 2XCSB 1OA1A 1BS9A 1VI6A 2AG6A 2YV3A 3ER6A 3HJGA 2E9SA 1RACA 5K09A 2P4QA 5C4GB 3TIGA 1H4VB 3EQ8A 1NXOA 3GPDG 1X7YB 1MQ8B 3ELDA 2R6CA 4M3NA 4NICA 4WDQA 5CHEA 1TTHA 1HR0B 1AKVA 4II3A 4M6WB 4P82A 1D2MA 4BEJA 2NX2A 4JLBA 4HNSA 4JLDA 4IKPA 3NBFA 1BEZA 2FR0A 3BJRA 4OGGA 4JI6B 3AKDA 4BOYA 3TCXB 5DHPA 2VJMA 1ZSYA 4G4SO 4HDQB 3N07A 4BFUA 3FUWA 2POQX 3KQSA 1WV1A 4F1KA 5ICSA 2Q5CA 4IJMA 4YR7A 3T3IA 2FN9A 2YRXA 2QTTA 2XQKA 2R65A 3LNTA 1G7CA 1IK6A 2ATVA 1JFLA 3BGVA 4K7JA 2PKCA 4O4LB 4AZ0A 1CY7A 1E69A 2PR2A 1UC4B 1VLHA 1W2HA 2YFQA 4JFAA 1Q7CA 2XMRA 3ENQA 3IQEA 2O7NA 4K0RA 2G0NA 2GZ1A 4H7KA 4JC4A 4JC8A 1OF1A 3TAUA 5K0ZA 2P79A 3BJEA 1Q7BA 3HNRA 4EUSA 1HX7A 2BGRA 3LLSA 2DUWA 2Q45A 3AJDA 5DW0A 5FX2A 3EIFA 1S7CA 2YYZA 3PQFA 3WBFA 3L0IB 4M7WA 3GVCA 4LYJA 3FHOA 4R01A 4B3JA 3M6LA 3P5BA 2VJCA 1FX0A 3RUHA 3WQQA 1USKA 3BX1A 3RS5A 4HDAA 1QX3A 2LIPA 1KETA 3H16A 1YDMA 3VPFA 5A5EA 3NV7A 2AYYA 2UYYA 2IZ5A 5TB5A 4D4JA 2I4IA 3SMQA 1RADA 1XPRA 4XAQA 2FPLA 4PBTA 5EUQB 2Y1XA 4ZRNA 4NAUA 1YR9A 3UXYA 3ED5A 4UE6A 2A58A 4B31A 1PBNA 4NV3A 4ZJZA 5E1MA 3OEWA 1OPXA 1GU7A 2VHJA 3GF4A 5DLEA 3ZI4A 1DWUA 3DBHB 4CFSA 1LK0A 2HBRA 5CDGA 3KFVA 1I2DA 2OSVA 2VEOA 3AX6A 3Q3IA 1ULSA 3B9RA 3R7LA 2X40A 3HA3A 4E1BA 1IXRC 1Z38A 1SGWA 2PS9A 4TTJA 1QZUA 2QSYA 1FXWF 2GN4A 3FMOB 4N5NA 4OUKX 4QEDA 1K5GA 2QYTA 3CG4A 3CX6A 3M34A 1NSFA 3S99A 4P93A 3OMLA 5SYNA 3JQRA 4BVAA 4CN8A 4FQ8A 5A03A 2H4HA 2VBFA 3IO5A 5ECDA 3SZ3A 4MINA 2XVMA 4P3XA 1N7GA 4A7PA 1KMCA 1XZFA 4IIDA 1DDIA 1OI4A 3LNCA 2BBTA 2FZVA 4HLCA 4YGXB 5L40A 2DKNA 4J90A 1HQYE 2DHEA 4S2EA 4C5BA 1JEQA 1EWTA 1P3JA 4EJSC 1GZ5A 4DMUB 4IL5A 4B4WA 1KFKB 2HK6A 4WD3A 1CG6A 2JI8A 3W6PA 4DR4B 4FFNA 2JANA 3KVVA 2IPXA 4E1AA 2XTMA 3L5OA 4R1LA 5ADHA 3DEJA 2CMGA 5CNKA 4CTMA 4Q9JA 2H63A 3I12A 2WLSA 3AL0C 2XA9A 2WWWA 4Q4JB 1JQDA 3QXXA 1NVXQ 2Z2JA 1MV8A 5DBHX 1PK7A 1ZUD1 3KEOA 4AZWA 4ED9A 1ODKA 4LJ7A 1PV2A 2YQ5A 3OOEA 1NVBA 1XQ9A 1UFQA 2LZ0A 4NS4A 1HKHA 4BLSA 1KYZA 1TTTA 1Q0HA 2O0LA 4P58A 2IW3A 2WDZA 2IEYA 5EZSA 4D9KA 1MF7A 1VE6A 4E4TA 4ALMA 4QEZA 3OKPA 1KZ1A 1GUDA 2IYZA 2Q9CA 4DG9A 5L7TA 4OFZA 1XLVA 3THWA 5A9TA 5CB4F 2CSUA 4J49A 2VQEB 3HO1A 2HA4A 3EDRA 3O5AA 2O2ZA 2CV2A 2XMCA 1OPRA 4U7DA 4HH3C 1IN4A 2QLNA 5CLQA 1LGYA 2JI6A 5FTJA 4EHHA 2OTCA 4PO3X 3VDQA 2WUEA 1PIWA 2GPSA 3OUUA 3RWMB 3DWIA 4DCPA 1NVGA 1ZNQO 1KSHA 3G9UA 2PD3A 4JT4A 1Y9DA 2FPPB 2GPTA 2ZI7A 3TAXA 3TLKA 5KTNA 1FP2A 2QMZA 4FGLA 2WJIA 1S2GA 3N8GA 3EBOA 4I3GA 4N5HX 2P3LA 1EWRA 4PWZA 3RT9A 3VPHA 1SKAA 3KZCA 5JFTA 5JJLA 2RH5A 1T2VA 5AM0A 1A1SA 1QPBA 4FHZA 1QRAA 4AN4A 4D9MA 4PSKA 5LD2B 3EEBA 3B6KA 4REMA 3BJZA 4YJ2A 1J9ZA 1TXGA 3QU9A 4BNVA 1PEKE 2R6ZA 3LDHA 1T36A 2XOEA 1EK1A 2HLPA 2X14A 3R5HA 4PLGA 3STXA 4OHUA 1G20E 1TQDA 1GSIA 2OCDA 2ZPTX 5T5QA 4V0LA 3BMNA 4RPLA 1BDBA 2R1UA 2AUTA 1PG5A 1ONBA 5H9VA 1E7YA 4M0EA 3PC7A 2Q99A 3DMYA 1MIHA 4MV1A 3W7AA 4MK4A 4PTZA 4UARA 4BGVA 5ELXA 2B8NA 2XEXA 5KKNB 1M66A 3IUEA 3MD0A 3W2IA 4BUZA 4EFLA 1EJBA 1KU0A 3C5EA 2Y99A 5KNCH 1T0JB 1VI2A 1NLYA 4JQCA 3S29A 1RI4A 1BWQA 5ALPA 3IA2A 4N5DA 5FO1A 2PS3A 4I7EA 1XEXA 3DV0A 1UOPA 3U26A 3U40A 3VZSA 1MZVA 1XMOB 5ECWA 3FDJA 4ZCTA 3IDSA 4K40A 1VQ1A 4KPUA 4MW6A 4HDNB 4LBWA 2WTUA 4Z4FA 5JH7B 2M2IA 1QV6A 2MHCA 3JYLA 3OJXA 5GQSA 3D5EA 2NXEA 4YH1A 1XA4A 5KUTA 1L4UA 1KGDA 4EYSA 3TECE 3IELA 4QBKA 2QF7A 5GJCA 1DBVO 4U7TB 2O5EA 1O89A 3KNZA 1JMYA 4KKXB 5IH7A 4IHJA 2HA2A 3TIVA 4JP1A 1AA6A 2OB1A 2OBXA 5TQ0B 1P4SA 2EHDA 2NGRA 3CW9A 3QYAA 1AU9A 3DAYA 2ZM5A 3C3DA 4BNNA 1BFUA 1UP7A 1A9ZA 3VX4A 3S1AA 1IRIA 1R6BX 3IIMA 1PUJA 4NI5A 3KSMA 1ZIPA 2X7JA 3WK6A 1XEFA 2RGEA 4CLEA 4Z99A 3N39C 3G9TA 2GPJA 2J0UB 2Z2ZA 4NMMA 3IPYA 3O8RA 4EB6B 1P19A 1XQVA 3BZBA 3MTBA 5IT4A 2QE6A 3E2PA 1ZN8A 1QP7A 4ZU3A 4DW8A 1ZJYA 4G63A 4KDFA 5K0SA 2D1TA 1NU8A 2YNMA 1U3UA 1GG5A 5AJYA 1CUAA 2IXBA 3MERA 4XA8A 1WCXA 1D7OA 3DE1X 5EJ6A 1INLA 4IR7A 3ILXA 5BW4A 1DTWB 1G17A 2PLAA 2WKPA 1JR2A 1SQFA 3FSRA 4D9GA 1FSPA 3EIQA 1CY8A 2ZBGA 3OVMA 2FPIA 3PB3A 1LPSA 2BFNA 1W8DA 4BNKA 2FSVC 1F7UA 2Q50A 3G8AA 2OFFA 1OXSC 2AOTB 1GNPA 3Q88A 1MX3A 3OHPA 3LYLA 3C8UA 4IQ4A 4E5SA 4F5DA 3IUPA 1LU9A 3SVTA 5I5GA 1H1TA 4B6SA 5HJ7A 2ETXA 3BMOA 1LX7A 3G0HA 4MKZA 5C1BA 1ISIA 3QLEA 1WBBA 1AMOA 1AF7A 2XE4A 1S1CA 1ZM4A 4R9UC 2NP6A 1F1BA 1FL9A 3DFMA 1HF3A 3OCVA 4TS3A 1FYDA 2FR8A 3JQFA 2BGIA 4PX9A 5FPHA 1NZDA 5H83A 1JAIA 1GAJA 2HDOA 1QO7A 2YV1A 4KFTA 3ET5A 4B09A 3CZ4A 4S1OA 3NIGB 5CH5A 3UJNA 5FPKA 1I4TD 1EVJA 4BLWA 1HYGA 2JGLA 2DBRA 1OB2A 3OSUA 5HXAA 4I4LA 5JS7A 3PSAA 3SXPA 3LHDA 3T5CA 5HKKA 4HWKA 4U5XA 5L51A 2A7XA 3PC6A 2EXXA 3TUJC 5H3CA 4F38A 4P86A 5KNLA 1W93A 4E12A 2PXHA 3A1DA 4YI3A 1SA0A 1VGRA 2RMKA 5TPWB 3PG5A 4KLCA 1W44A 4I1RA 2NYUA 1D4FA 1FZQA 5C8ZA 4XW2A 1IY2A 3GP8A 5FV7A 4F3RA 3FTFA 4J07A 3WRYA 2NTVA 3TLMA 2C3YA 2W5UA 2BCGY 2NZWA 4MYCA 4WFQA 5ER6A 3SKYA 1E2UA 2JGMA 1QHHB 3ZVMA 4C9BA 3VR3A 3OZAA 2NN3C 1TDJA 1HRKA 3DBRB 1UODA 1D07A 2BISA 5G0VA 1JLLB 1WW2A 3K8YA 5ILOA 3UT6A 3MS4A 3UUEA 1IN5A 1QH8A 2GK7A 3M6IA 4K9SA 4KVGA 4RS3A 4OGKA 3GGPA 4YB8A 3TDKA 3D2CA 2WILA 4QNRA 4UEJA 3CVOA 1EYZA 1GGMA 2VBGA 1QS0A 4GLOA 4MR7A 3BFXA 1ULAA 4Z4IA 1GYPA 3P2KA 5JSFA 5EJ4A 1M34A 3WDMA 1COWD 1DINA 1OFUA 2AQHA 5CBKA 1WU7A 2ZAMA 2O8BA 2O8FB 4RUKA 1AUXA 1WXHA 4O1MA 1NW4A 5TC4A 1LWOA 1IATA 2A9KA 4Q9HA 2CT8A 3IT0A 1XMJA 2C03A 5EZYF 2TMDA 2ZOSA 3FTQA 3LGSA 3W1VA 1XXHB 3QITA 5TXGA 2JFZA 5GMOA 1HY3A 4BV3A 4S1WA 4HWPA 4C2AA 1I7PA 1NUUA 2WTXA 1P1HA 3K0CA 5FIUA 1QDLB 4GQIA 3TW8A 1CUWA 4HNTA 2UVPB 4F46A 4RVGA 1XMSA 2OK8A 3ESRA 3TB6A 5IFLA 2EQ5A 4J0GA 1U4OA 5SYAA 3T1VA 1A72A 5E1OA 4BWGA 1YUNA 1XZBA 3L02A 5I4KA 3DLBA 4XIJA 1IAQA 2WM3A 3D3WA 1Q7GA 2JFGA 2XOKA 3MM4A 4ALIA 1WL8A 2VYND 1DKQA 5D3MB 1IQUA 5CX4A 1X14A 4NIMA 4FW8A 2XHZA 3OIUA 4LK3A 3W2EA 2JLZA 3SN6A 1KOLA 3D5TA 3NIWA 2HK8A 1VIDA 3KXIA 4HQOA 4IXWA 1QHYA 4EJMA 4GWKA 4YDQA 2GD2A 5CK5A 3U60B 1QIJA 1KRXA 2W4IA 2Z2KA 4DA6A 2WWTA 1RPTA 4RS4A 1U2GA 1PP4A 2QRVA 1XRQA 1G8YA 1PJAA 2DH5A 2R8XA 3L5KA 5HIKA 2IDKA 4YBRA 1W96A 5GIPE 4LCBA 4KQWA 3GOQA 5EKUA 1A7KA 2CJWA 3KQQA 4UTZA 5EL0A 4ZOAA 3T7CA 1VLVA 2AZTA 3L40A 1KO5A 3QVMA 1T43A 4F11A 4M1YA 2FE4A 1X9GA 1JV2B 3MJTA 2CCKA 2VHQA 3DWFA 5JSYA 4LSMA 4GT1A 3ZYZA 1EXVA 3ORFA 4CMJA 3T0GA 4HMQA 4BLVA 5JCPA 4JI4B 1D4AA 2XBLA 2I4MA 4X85A 3AHJA 3WGZA 4PAGA 2BDTA 1MR3F 1KAMA 3LRPA 1PQUA 4GXRA 3O9VA 2QU8A 5B1SA 5K3AA 4AJOA 2YWXA 4XM2A 4YT4A 3W7BA 1ATZA 3VKUA 3ZWXA 1YSCA 2VJBA 3U4IA 5BOSB 1Q3TA 2ZIGA 5JYBA 3IEKA 2Y0DA 3VV3A 4E5YA 4B2LA 5GGYA 4PG8A 4C7XA 3K0FA 3AR6A 3H11A 5KDOA 5LXTB 2A3NA 2VLBA 3HYCA 1ZM3A 3JVEA 5ISMA 1R0BA 2JCGA 4MVJI 4X90A 2Q2OA 2NZVG 1MC8A 4QUGA 4O2BB 2ON6A 1U98A 1TZCA 1YO6A 3FMGA 4G97A 4UBOA 1ZU4A 3SI7A 3UT5A 2FN3A 3ZOKA 3NJRA 4RKFA 4U2EA 3GI1A 5JIBA 4C0LA 5D01A 4L0DA 3KXDA 2BWJA 5K3CA 2L0XA 1U5BB 3AHFA 5K0FA 2V6JA 1ENOA 4HYYA 4IRUB 5A2GA 5IS2A 4PX5A 5JS6A 4LF4B 3OZCA 1E9AA 4MS3A 4QGBA 2VJLA 1VPEA 3EUFA 3ACCA 4WKOA 4HB2A 2XITA 3AESB 1CUFA 1RAHA 4XZ3A 1XMPA 4NYMR 3Q72A 2FN7A 1LY1A 2GEFA 5ALDA 1I1NA 4RDXA 2HRQA 2DFLA 5BOVA 4PGHA 5I4CA 3FRJA 2PUFA 1CQIA 1HEYA 3HRIA 5B1EA 3LCMA 1E5DA 4MMYB 3E7FA 4MUNA 4MI9A 2G80A 1SJ9A 4BVLA 5DHSA 2NPOA 2FK7A 3NHZA 5J59A 2YV5A 1NMYA 2QSZA 1ZP6A 2F9FA 2QVLA 3I9OA 3OJWA 5F5NA 3OD1A 4AZ3B 4C04A 1CS4C 3IP1A 2VYVD 4PIMA 2IH4A 3AI7A 1A9OA 3I8OA 4DARA 2P27A 4F4UA 2P7IA 4KI7A 2QTAA 2FSPA 1ZCZA 2W4QA 1UAYA 1YE3A 1M1UA 2V45A 3FSGA 3O4JA 1PT5A 3ANMA 3C16C 1X9HA 2RBEA 4DEXA 2WIFA 5IJ0B 1MPTA 2PV7A 4AMYA 1FDWA 1X15A 4NBUA 2EFJA 2LE0A 1JH8A 1Q2UA 4O2AB 5BQFA 2O1WA 5DK4A 3PFWO 2GM4A 5CT9A 3KJGA 3FRIA 3LFHA 3WMEA 3PITA 1VBNA 3IJPA 2YV2A 5FFNA 5HPYB 4OIFA 1L5QA 3G59A 4UAUA 4WNAA 4F56A 2XGMA 8ABPA 2C77A 4DR5B 4FYKA 4TRRA 2VDKB 1E5VA 1YRLA 5DW3A 5TEVA 5FADA 1I4WA 1NI5A 3TGPA 1UJ5A 4Q05A 3JQCA 4NBSA 4CJXA 1TW3A 1SXJD 1U31A 2GHRA 2W11A 1TUIA 3OLWA 3FPJA 3FZYA 3E61A 4FC7A 2FNAA 2C2KA 4CT0A 2CCJA 4CIYA 2E4XA 4E2XA 4QUIA 3WBBA 2W71A 7YASA 1RJ9A 1FYWA 4R2HA 1E92A 3EVZA 4YLGA 3SIXA 4JQSA 4PPQA 3H6GA 1M1ZA 1Z5GA 1R0KA 4CI9A 1Z4LA 4QT4A 4NPHA 4WAUA 4UDOA 1KEEA 4K9NA 1T3GA 4FX5A 5KWVA 4MWTA 4B3FX 3LUAA 4L3OA 2OHFA 4NE2A 4OQDA 5GV7A 1ZD9A 3DOEA 1F48A 3EMBA 5IKEA 1E9SA 1N5LA 4RVOA 1HT0A 1F38A 1JHDA 2YJZA 2PUDA 3I76A 5KSYA 1MJFA 1ECCA 1NATA 2WMNB 5JATA 3T38A 4KO4S 5EUBA 3CWCA 1C30A 3OIDA 2NOAA 4W1SA 4IGEA 1RMYA 2E5WA 3NHKA 3AEQB 4WZBA 3HGMA 4YLEA 3T3EA 1SUIA 1D1QA 1MJHA 3NV9A 3ISJA 4Q4AB 4XOUA 4Z2YA 1Z82A 2DZDA 4CKBA 1NW9B 2RK3A 4RVFA 4RPGA 2VZLA 5E3IA 4A4DA 1JLRA 2B1IA 1UJBA 3O84A 4K87A 4MKXA 3TX6A 1BKDR 1S89A 5EINA 4F3CA 3R7FA 1RRCA 3T5PA 5JXWA 2OO5A 4R84A 1QUEA 1DSSG 1CETA 3BICA 2ONJA 1GU1A 2IYTA 3WGYA 1KK0A 1OWLA 4D79A 2I6TA 1YIAA 4AJEA 1T2DA 1TYEB 1ANKA 3N9IA 3GX1A 3WL5A 3DT8A 2QM3A 1N6PA 4RF4A 5EIFA 4ZCQA 2WIGA 721PA 4H7EA 3QWHA 2BFDB 4LPSA 4YP6A 1UXIA 2CVOA 2OWEA 3L7NA 1RVDA 4G9GA 5H3HA 3BIJA 4BUCA 1JPJA 1FFHA 1EG2A 4R7ZA 4OFWA 4OJTA 3NORA 1TTQB 2ZATA 5LIPA 4KO1S 1WCIB 4N3AA 4YCNA 1OJLA 2O52A 4RYLA 1YZTA 4IIGA 1RKUA 4Z8YA 1DEHA 1MAVA 1NJ8A 2OBNA 4P4UA 4Y2SA 4E15A 4QUJA 4R41A 4UHBA 3S40A 1SD1A 3GMDA 2NYRA 3GRFA 3PQDA 5KWSA 4NPAA 4W1PA 2BHTA 2AK3A 3TZCA 3OEHD 2PKQP 2JLBA 1T6XA 1XI2A 2A94A 3DDOA 4S1VA 3EOZA 5CBPB 4I50F 2QRNA 1QHSA 3ONFA 5A9SB 4YUXA 3R74A 1K97A 1RJDA 3LU1A 4UULA 4FFBA 3PD7A 1P0IA 5CB8A 4OMFG 3GLFE 5HNKA 1OLSB 3DZ8A 3BFPA 1BW9A 1V95A 4NWIA 4E21A 2AG5A 3A6JA 4HQFA 5KJ6A 1G3IA 1OCEA 2IUFA 2AJCA 4QDXA 1E5XA 2AC7A 3TSWA 4JCCA 2WIKA 4Y6OA 4KU4A 4URWR 4O6VA 4OX9B 2XZTA 4UHCA 4N0MA 1CUCA 1E6KA 2BFOA 4EJ0A 1R0LA 1TU4A 4KI0A 3I52A 2EKLA 4UHEA 2JIZA 4IGIA 4NEQA 3UWPA 3HL0A 2H2WA 2FOLA 3V33A 2OHOA 3NBXX 1J0BA 2KB0A 2AN3A 4AJIA 3UKJA 3OWXA 3THXA 1P6XA 3WLSA 2IEIA 2FI1A 2V4MA 2Q29A 3CR3C 3LF2A 1MPXA 3LKBA 5LYYA 3W8FA 3RRZA 4NBWA 4BAGA 4C01A 3VPSA 1XUOA 3KIPA 4D4MA 1IQRA 2VPIA 3A14A 2PBLA 3B5JA 5IDYA 1ZVMA 5A6SB 1E96A 1PJTA 3ZU6A 5B1HA 4PYOA 2PJRA 4CR7A 5DCYA 5E95A 2ROQA 3B1FA 3CNBA 4A6DA 1XE3A 1F7VA 5ARDA 2XMGA 1BJRE 1MGPA 1IZ8A 3DR3A 4CPDA 1YZHA 3R7NA 1GCUA 2IFTA 2R8ZA 1OXBB 2ZIZA 4B76A 1D1PA 3WWCA 4X6XA 2PA3A 1R12A 4A9AA 5CAEA 1MOSA 5CEEA 1H1DA 1E3LA 4D4LA 4AKSA 2A9FA 3QLTA 4IY1A 4S1PA 5DBIA 3KWMA 2QVBA 3T7IA 2AFIB 2OV2A 3PQ6A 5ENDA 2PQ0A 4TKUA 4EA6A 2PNFA 2A4MA 5K51A 2FE1A 3BMQB 3EZYA 1XWWA 4IGKA 3TCNA 3RU3A 3UAXA 2C2HA 1Q0PA 3R0VA 5AW7A 2VP4A 5DM60 1EE9A 2OCBA 3LE8A 4Y2PA 3D5QA 1CS0B 3RHFA 4CIBA 3VNSA 5BYKA 4KLRA 3ZC3A 4AULA 5AUNB 2QWXA 1JBQA 2OXRA 2HT6A 1O4VA 3R1IA 4NQZA 2WMOB 5K0CA 3I62A 3ASVA 3LDAA 1RLUA 1BVHA 4FC6A 4I55A 2ZRLA 3TOSA 4EI2A 1SUCA 4LZOA 4BO5A 3FAKA 4HEHA 1BJKA 3AFIA 1DO8A 5THXA 3E1SA 4JBYA 1NF2A 2GN2A 4XARA 5IZCC 4RJIA 1VHWA 3R9KA 1YVRA 3IMCA 5FDFA 5J4LA 4N5LA 3A1SA 3OFSA 2H1VA 4YFYA 2VXYA 5K3EA 5FWXB 5TLSA 2J7PD 2C2WA 1WX1A 1Z37A 4CTOA 3RREA 2ANCA 2JFHA 3H5WA 1LC3A 3QKSB 4OHRA 3IVGA 5F3WB 3VOSA 3BOSA 4C0WA 5JAPA 3ZDYB 3UCXA 2HSZA 4B4OA 3ZHSA 3OQVA 4CKWA 1E77A 4J03A 3IX7A 3N8KA 3S2YA 1XZIA 2DQZA 4ROSA 1LF5A 3L4BC 1YBFA 3QE0A 4JI5B 3GUCA 3K6RA 4FD3A 3W8NA 1V96A 3DTNA 1QZTA 5EQJB 3I3SR 5B58T 5JOQA 2EJBA 2JH9A 3OJEA 4BC0A 5DXAA 1DL5A 4NDAA 2IZ1A 1W0JD 1ENZA 2Q8NA 3WAKA 1ORRA 1VLZA 5DISB 3ZLBA 3KB2A 4AROA 1US8B 1VKOA 3D4NA 1Z8FA 3F78A 3PTAA 2NP7A 4B45A 1L7BA 5DWVA 5KYXB 5CTAA 1I6MA 3HU3A 1EE2A 4ZQBA 1J9GA 2MTBA 1ZD2P 2Q49A 3Q98A 1P9WA 3MWDB 1IHDA 3A7EA 2XE7A 3OOHA 4H7FA 5JLAA 5BO5A 5ULLA 1N5JA 5TMPA 3EIOA 2A0WA 1KJJA 3JAKA 3K0BA 4O25A 4GI5A 4OATA 5JG7A 5TF4A 3UG7A 3D81A 2JAWA 1UJ4A 4EPRA 2WYUA 5J4KA 1SXPA 5CT4A 1XL0A 5JD6A 2ADMA 4DLTA 3OQHA 1L5YA 3D8TA 3VNRA 2Z08A 4B6QA 4D2IA 1M2KA 3AZQA 4GUAA 2CEKA 4H1HA 2GI4A 4L0QA 4Q1BA 4S12A 4WLEA 5GM2A 2CNOA 1VB5A 5TPZA 5D5QA 1K6EA 5EP2A 1U7OA 2Q1UA 2G09A 2W2KA 3FZQA 2VK2A 3LT0A 3T61A 4YEDA 3ANYB 4M36A 5J40A 1ZZGA 1VIMA 3A05A 1A8HA 3DEHA 5EAIA 3AJ9A 1XP8A 1GKIA 2NSYA 3VU9B 4MW5A 1XMXA 3KKOA 4IIEA 4BNLA 3N86A 1A5ZA 5D6NA 2RCNA 3EGOA 3VH1A 4BZWA 2F8LA 3FNQA 3LY5A 5E2AA 3P0IA 1NI4A 3MBOA 4XDGA 1ZHOA 3JATA 3WR5A 2DVMA 4GMHA 2TS1A 4LJLA 1A8PA 1QDEA 3IAUA 3REGA 2P1ZA 2ORYA 2GVZC 3D31A 4DCGA 3AYXB 1L3CA 4DCCA 1TEVA 5I7RA 1FRNA 2PBRA 3VH2A 5KMGB 1OFTA 3IDZA 3FWKA 4AMZA 3LZDA 4F21A 1DQSA 2J3DA 5D7NA 4X45A 1YASA 4LGMA 3BORA 1JEDA 4ZYUA 5IDQA 3LPLA 1T5OA 1RRFA 1YQTA 2FPSA 3ESQA 4EF5A 2O20A 4J2HA 5DTIA 1FDOA 3IC5A 4L8LA 1GPWB 2QX6A 2VHYA 3G0CA 4C3OB 1VSVA 4OKNA 1F2DA 1CZRA 1EP1B 1Z7EA 4LSZA 1B42A 1JLSA 1OYYA 3JVVA 5CIWA 1YRAA 5ALGA 3VAZA 3X43A 4ESHA 5CFRA 1JHMA 5BSWA 5LLTA 2RB4A 1NBME 5T41A 3RC3A 5FTLA 5HKOA 4HQNA 4DWVA 3AY0A 1L5HB 1NPTO 3QUAA 1Y1SA 5KYUA 4ZVUA 3RJ9A 2DFKB 3SC2A 2VJPA 4IQFA 3GT7A 1F0PA 3ES9A 5EEHA 3ZVLA 3HWRA 2QL9A 4ALJA 5BMOA 621PA 5CYFA 1M0TA 3OX4A 4JLWA 2C9MA 4JVOA 3RS0A 4YRMA 1P5HA 2JFNA 4KNYA 3TTUA 4MKIA 1FQWA 4FFVA 2AVDA 2FEMA 4G1MB 3KSZO 1T34A 3BB3A 1Z68A 2Y1FA 1XEWY 3G02A 1I2ZA 3NU1A 3R0IA 4IW3B 1LPPA 4PIPA 5EXSA 1MEOA 2Q21A 2Z1MA 3H04A 2HMAA 3OZUA 2R8RA 4RQBA 4TZTA 4ZTZB 1Z4KA 1JFTA 4AMGA 4ZT7A 1HZJA 1PWXA 1RDFA 1U6KA 1ZQ1A 1XD2B 4Q7LA 2QTGA 3VPDA 4DCTA 2D59A 2QE7D 4RCZA 1NP3A 1FNSA 1GTL1 1HQDA 5E7JA 5E38A 2HEIA 4GP9A 1YHNA 4P53A 1OB5A 4KXWA 3OUZA 1YJAA 1WXEA 2QJTA 5J5VA 4EARA 4RZQA 1M2EA 2Z5LA 2QM8A 2HRRA 1JJ7A 1V9CA 1U1FA 3AHIA 1MC4A 1SPBS 4JLJA 1RXVA 3JQBC 3F96A 2WT4A 1DXOA 1CVRA 2PX5A 3MGKA 4G1EB 3GLTA 2WUGA 4JJFA 1FVXA 1ZIXA 4OV6B 4PPGA 4MB6A 4WXEA 5IKMA 1O9BA 3M6WA 1B0AA 1LLQA 4QATA 1XYVA 4L07A 2QP3A 1J56A 3C3WA 1P2FA 3B48A 3DDCA 4RD0A 5B57C 3A6HA 3U17A 4V38A 3QI7A 5IH3A 2GJKA 2FCAA 1XNRB 3TBFA 4H3VA 2J08A 2Y0CA 2B0JA 3AOEC 1M83A 3TZQA 4DMRA 1KO7A 2OZEA 3AUTA 3G2QA 3KPWA 4ZGGA 1DRKA 1OW3B 1PZEA 5T8KA 4XIGS 2D8MA 1JDUA 3P0RA 3NX4A 4UQLA 1AZTA 5KCMA 1P3DA 5JNTA 3WHIA 5JC8A 1T10A 5JNSA 2O2IA 1OI2A 3WNZA 1GRQA 1YS4A 2DHCA 2FW9A 2IYFA 2VDWB 4CR8A 1I4EB 1N75A 4BFZA 3U31A 1E7RA 3AINA 4X1OA 3WB1A 4KO2S 1FVFA 2GS9A 2OOSA 2CNNA 1NBEA 4O5AA 1DGQA 1OXXK 4OXIA 1XJ5A 3LLUA 2OXFA 1H1LA 4C2BA 2ZJ6A 4ZAXA 4ZVSA 3ZHCA 3CCBA 1U1DA 4FS3A 4BMXA 5KTPA 1PF7E 3Q10A 5FOQA 1Z13A 2WY2D 1M76A 1J2TA 2XDQA 2VPPA 3OICA 4P3OA 3MUOA 2HBZA 2OM2A 4KIJA 3AB8A 4LNAA 4CG0A 4KPGA 2V3VA 1JI3A 2G7MC 3V5NA 4BGEA 2AMLA 2BTOA 4YT5A 3P5SA 1NMQA 4RGQA 5FULA 4FFLA 5C32A 3AUJB 4QBIA 1KC3A 4TM8A 4A3SA 3ZOZA 1H2RS 3D1VA 4O4LF 1ML3A 4ZP1A 2HJSA 3CLSD 4YAGA 5FJJA 2VWQA 3B6ZA 3DMDA 1NF3A 3PU6A 3V00A 3PJDA 2IP1A 4YV7A 3H3JA 2CLCX 3SG0A 2YMLA 5DH9A 4MGKR 2CW5A 2MU1A 3SPXA 4XB6B 3HBNA 2DLDA 4WESA 1NZFA 4BRZA 2JJMA 5GINE 3VKWA 2BGKA 4P7FA 2XW6A 5ITZA 1GTJ1 5I01A 1LQTA 2YW2A 3NGMA 4NJOA 1MX1A 5A3VA 4CDMA 4UPEA 4W9MC 3BQNB 2VJMB 4NZZA 2P4HX 1QE5A 3DLAA 4EO7A 3OM1A 1JFVA 1R0YA 3DNMA 1XAGA 2XCUA 1JJVA 3CO5A 2CEAA 3FWZA 3G5UA 1IBMB 2CB9A 1KYXA 4ROTA 1N0IA 2GZSA 2TMYA 3H6KA 3PNYA 3QNMA 4PICA 4ENWA 4JEMA 4CL3A 4A27A 1E6LA 3FPEA 3ZDCA 2D7JA 1KBZA 4DWWA 2A1TS 1BYIA 3LZCA 1YK1A 4HDSA 4GSYA 4NCBA 4F97A 2VQSA 1NBOA 5C34B 3PSHA 1R10A 4JJAA 3WB2A 1DU4A 2F8MA 2HKIA 5KX5A 4ND7A 5G0TA 2ID4A 1FTSA 4R16A 5LP6A 4MQMA 1NOKA 1O96A 1FX0B 2IZZA 4BMVA 1IOWA 4KLAA 4QU5A 4AW9A 1K6JA 2D5AA 5DN9A 2D3WA 1P8JA 3EOBI 4P0PB 1KVSA 2ARKA 3I9MA 5C37A 4LX8A 4NR0A 3W5JA 4DOMA 2JD2A 1G41A 4F7DA 3LC7O 3RLIA 4KX5A 1G1MA 4WKBA 1M6WA 2IHTA 5A7HA 5LMUB 4NZ9A 1G291 3V6LA 4YDSA 1XIVA 1EUCA 1YR3A 1C1XB 2K7FA 1Q44A 3L0ZA 4PZAA 3ZPXA 5I7HA 1G8FA 2IZ7A 2X76A 1WOYA 1T1RA 1PWYE 5CPBA 2PEYA 4BKPA 1COZA 2QAGC 2VJDA 1T5IA 3T7TA 3W5UA 3VZBA 5B4UA 4BLQA 5IK2A 3ZGVA 3MS7A 2BMDA 1FTWA 1ORHA 2OCXA 3R8CA 2CKMA 4WXMA 1VJ0A 1BRMA 2AJDA 2W6ID 4IFEA 4CEJA 1G6OA 3REQA 4EUFA 2LV8A 1RKVA 3C15C 1NRXA 1XU4A 3GRVA 3UA3A 3PUIA 1YZYA 5LUAA 1BXGA 1M75A 4KXMA 4N54A 4X63A 1UDAA 3DLPX 4KQXA 3AF6A 1JEQB 2QJWA 4MCJA 3K2EA 1JF8A 1OTYA 1Q0QA 3U4MA 1WM1A 4RZUA 3DOCA 4QAJA 2AK2A 2C31A 5EJMA 4YMTA 1GM5A 2G5GX 4O63O 1FYFA 1MX9A 1WLSA 3OZFA 1MO5A 1V3VA 1NUPA 2IS1A 1SKYE 3A6FA 8OHMA 2FX2A 2QHXA 2QRKA 3PX7A 4HGRA 1SBCA 4I5EA 1CEYA 3IHKA 1D2EA 2AG8A 3ESDA 4JLVA 5CK4A 2H57A 3W9SA 5GADl 1TVKA 2IBSA 3TRDA 3IHWA 1JKMA 2PLRA 5F2NA 3WZ2A 4CXMA 1HDOA 3A9CA 2G9NA 1TO6A 1NVUQ 2BFEA 3EIHA 3UUGA 1XKTA 3DBLB 4F72A 1Y9EA 2PLFA 3TQIA 3DM9B 2I91A 4CM9D 1AGXA 1QKKA 3DUFA 1OKKD 1VXRA 3SHOA 3THWB 2YS6A 3LHSA 2AWOA 1HYQA 2OK7A 3E82A 3FOBA 3MUEA 2YY5A 5BSMA 3HFSA 3STYA 1KFBB 1VYUA 3WIUA 1Y9AA 4OLHA 2RIRA 5LJLA 2B4YA 2VSYA 4QDKA 1JHYA 4F6LA 2J5XA 1UK8A 2FZLA 2PT7A 1YRWA 1J9EA 3DKIA 1EUZA 3GFBA 1G2OA 2AXNA 3DFKA 2RGRA 1CUHA 1ND6A 1K66A 1KY3A 3H3FA 1QG6A 3NHFA 1CQWA 4MV6A 4XM1A 2IV7A 5HK8A 1VOTA 2H1SA 4ZYWA 1Z74A 2ZLBA 3TQHA 3GEEA 5IVPA 1U3FA 1ZK4A 2AYXA 4IUDS 1O94A 1YB4A 4R3WA 4DIKA 5DTEA 4W6ZA 1KEZA 3IOCA 4JGIA 3FPAA 1LBSA 3OQPA 2ZXEA 1JBEA 3D8SA 2O8NA 3K96A 3NWEA 2CLKB 2I71A 4B7AA 1CNEA 2ZSEA 3EVFA 1T0BA 4R9VA 4CQJA 1QQ5A 1I6WA 1OREA 3F6YA 3QXCA 4LJ8A 1GA4A 3ZDRA 2JCYA 2BH2A 4MAFA 1WB4A 1Y3AA 3JQ7A 3IXMA 1M8FA 1MOQA 1KY4A 4KMMA 4JAVC 4RPIA 4CLOA 5AVTA 2ECOA 4FM9A 3BMNB 1YZUA 4FZRA 4I36A 5I9MA 2ZIWB 3W05A 5BP7A 5JH7F 4GM4A 2EKPA 2WVHA 4KX3A 2CUNA 2PS0A 2ZWAA 1U2QA 1PJQA 3FFWA 4LQ4A 2O0KA 2E7ZA 2B99A 1E2NA 1YHYA 1ZMTA 1RM4A 4CIDA 2QRZA 2OAGA 1IPFA 1L4GA 2GEJA 4CV0A 4W5QA 3E3MA 3W90A 1RJGA 2ZRAA 4YAFA 3EC7A 1ZHFA 1SUBA 2WTEA 5TARA 3ASUA 3JZMA 2PGLA 1ZGCA 2ORWA 3GLKA 5DCLA 2ZSHA 3NBMA 2ZJ4A 1Z5PA 3CX8A 3KD2A 3KETA 1XEXB 3DV0B 3Q0TA 2X22A 4BVBA 2HDHA 1K4KA 4L02A 4QOEA 1ABEA 4YCDA 4RKEA 5HQ3A 2Z9DA 1KQOA 1OLXA 1E6WA 1R64A 3UAVA 2GK3A 4I9UA 3DZHA 2XUKA 4RL4A 1ZRNA 4U6QA 4DWJA 4ZI3A 3PPVA 2DC1A 3UHAA 3F5QA 3FDFA 1SCIA 2R5NA 4XLLA 4XX1A 1GV0A 2EERA 5KTOA 3EEYA 2AMFA 2B94A 2OEPA 3IAHA 4IHJB 2Y1WA 2Y71A 1CR0A 2HH9A 3GRKA 3RVLA 5CIYA 4NBLA 4W7SA 3L7YA 1RIIA 4MVCA 5AOBA 2JZOA 1E1RA 2ZRKA 5EHZA 1J2UA 3ZQUA 3S1AB 4JJZA 3MCVA 1KSJA 3EFHA 5SZIA 2VXBA 4N1AA 1RC0A 1P9RA 2GASA 2WPDD 3ADPA 2IEBA 3KR0A 2GM3A 4X1IA 4XVQA 4B17A 1T25A 4EHKA 5DNCA 2GN0A 5KYVA 3Q3VA 3RW9A 1CY4A 1WCYA 1JWBB 1ONPA 4MTLA 4BLUA 1YJBA 1S6YA 2H9AA 6YASA 5AKLA 3RIXA 2Y1DA 4Y2GA 4OQNA 3UIEA 1UJNA 1L0BA 4QFMA 3IIEA 4JGGA 4K1XA 1MQSA 3G85A 5HM8A 1RYDA