4P7FA

Mouse apo-comt
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
213
structure length
213
Chain Sequence
b'GTKEQRILRHVQQHAKPGDPQSVLEAIDTYCSEKEWAMNVGDAKGQIMDAVIREYRPSLVLELGAYCGYSAVRMARLLPPGARLLTMEINPDYAAITQQMLDFAGLQDKVSILIGAPQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAVYQGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
molecule tags Transferase
source organism Mus musculus
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
total genus 69
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4p7fA00
4QVGA 3B3JA 3HCFA 4HTFB 5E8JA 4EMSA 4GOLD 2ZIGA 3G8BA 4FZVA 3P2EA 4CKBA 3E05A 3QOWA 2ZBRA 3SGLA 5LQUA 7MHTA 1JG3A 2ZULA 5BW4A 1RI1A 3DXXA 4GOND 2ZTHA 1SG9A 5K03A 2IBSA 3UJAA 1D2GA 5EMLA 3TR6A 5LQRA 3VC1A 1D2CA 4KIGA 1FP2A 4M38A 4PCAA 3CKKA 4AZSA 4FP9A 2XVAA 2YXDA 1BC5A 2AS0A 2AR0A 1XDZA 2V74B 3LDUA 3P2IA 3D2LA 2QYOA 5HILA 1M0EA 2GB4A 3BXOA 4U7TB 2QRVA 5K0GA 3VYWA 2PXAA 3ELDA 3U81A 3FTDA 4V0QA 3DTNA 3EVDA 2IP2A 3KHKA 4CKEA 4M37A 2EJTA 2YXLA 3LHDA 3P8ZA 2ZBPA 4GEKA 3UJCA 3P9CA 3GRYA 3G2PA 4LG1A 2BH2A 3PX2A 2ZFUA 4AZWA 2P40A 3EVFA 4FSDA 2IIPA 3DMGA 5EZQA 4QTUB 2PWPA 3M6UA 2ERCA 2AOWA 3ELWA 4PCLA 5FA5A 4QVKA 4E70A 1KPIA 3LBFA 4RVDA 2EFJA 3PFGA 3A7EA 4LECA 2P41A 4QDJA 4OQDA 3CC8A 4RVGA 5HEKA 3M4XA 1VLMA 2P3QA 4HH4A 1ZKDA 5EG5A 4C07A 2WA1A 3K6RA 3A26A 2NXJA 2ZWVA 3E7PA 3B5IA 3GJYA 3MERA 4QDKA 5CVDA 5FHQA 4E33A 2PWYA 3PT9A 5KVAA 4DMGA 3OZSA 1JG4A 2UYQA 4ISCA 5FWAA 4E32A 1NW8A 2AN3A 3BGIA 5CUQA 4C05A 1Q0SA 4EKIA 3EEOA 3OE5A 1X1BA 5DM0A 3G5LA 1RJEA 3AY0A 2I9KA 2FRXA 3NJRA 3MAGA 3QV2A 5C9ZA 4RVFA 2ADMA 2CMHA 1NE2A 3FUWA 3LKZA 3TLJA 3VC2A 3GRUA 4ER3A 5CIYA 1KYWA 4OX9Y 2PX8A 5GIOE 4E2YA 4P7GA 3KQMA 9MHTA 1G8SA 4AZVA 1U2ZA 1XCJA 3AJDA 3OU6A 5K0JA 4RVHA 4RV9A 1UFKA 1VIDA 3LDGA 4HGYA 4ER6A 5HIKA 4RX1A 1NV9A 4PYOA 4DA4A 4IV0A 2G72A 2IPXA 3M6WA 5HIMA 3UJDA 1FJXA 3MTIA 4KDRA 2A14A 3B89A 2I62A 1VBFA 2G1PA 3HTXA 4YUVA 1ORHA 1VPTA 3FPFA 1ZGJA 3BGDA 1H1DA 3I53A 2P1DA 2ZBQA 3K0BA 3O4FA 2O06A 4YMGA 3JWGA 3REOA 2BM9A 1SKMA 3UJBA 4X63A 3HVHA 3TRKA 4E2XA 2B9EA 3EPPA 4GUAA 4PGHA 5CVUA 2PY6A 1XCLA 3FUTA 5DXAA 1YZ3A 3EEYA 3R0QA 3LX6A 2BR4A 5CM2Z 3R9XB 1M6YA 1VQ1A 5EZSA 4EQZA 2C7QA 2I7CA 1WZNA 1RJDA 3KQVA 1JTEA 1KPHA 3P9NA 1O54A 3FUXA 1UWVA 2O07A 4DZRA 3GWZA 3HCBA 2B78A 2JJQA 2P35A 3NWBA 3LDFA 3TKAA 1FPQA 2AOTB 1XVAA 2F8LA 4KRGA 3DXYA 3G89A 4OA8A 2FK7A 3DULA 4FSXA 4O29A 1N7JA 3DLCA 1ORIA 3RW9A 2PT9A 4YV1A 5MHTA 5H02A 1EQAA 3F4KA 3NVKI 4HSGA 3KPWA 1G38A 10MHA 1RJGA 5LR6A 2YVLA 3SX0A 5K8VA 2ZIEA 2GH1A 3KPUA 1NT2A 3A4TA 3CJTA 4RTKA 3M6VA 3BWCA 1WXXA 2OO3A 2BR5A 2CWWA 2VDUE 3EVEA 4M7RA 3RIEA 1VL5A 3THRA 2VDWA 2Z6AA 2P3OA 1INLA 2PJDA 3ME5A 2HR1A 3KQWA 3OFKA 1QAMA 1X1DA 4RSRA 2JH9A 4XUCA 5T6BA 4YV2A 1Q0TA 2BZGA 1F3LA 5HFJA 5DX1A 1G55A 3BWYA 4KDCA 5EGSA 1ZQ9A 4C06A 4GC9A 2UYCA 1KYZA 2R3SA 2P3LA 5ICFA 2ONZA 5BW5A 5P8WA 2JHCA 3C3YA 3BKXA 5CCXA 3M70A 2FPOA 3CBGA 4PYJA 2PLWA 3UJ9A 2WA2A 3NWEA 5EPEA 1PJZA 2V7EA 1HNNA 3UJ7A 3SR4A 2CL5A 3EGEA 3TM4A 5EMKA 3GU3A 1ZG3A 2ZWAA 3H2BA 1R74A 4OBXA 3BWMA 4BLUA 4B17A 5EC8A 1R6AA 3OZRA 5GOZA 5FTWA 1NBIA 3FTCA 3GNLA 3IEIA 1WS6A 2ZW9A 3G2QA 2JH8A 4R8RA 3O31A 2NXNA 3TPZA 1YF3A 1JSXA 2G8NA 3KR9A 3E8SA 3FYCA 4OA5A 2O0LA 4U7PB 4C08A 3MGGA 5EHGA 1FBNA 4DCMA 1P1CA 3IV6A 3JWJA 1RI2A 2ZLBA 2OXTA 4RTOA 5E2AA 1IXKA 2IBTA 3DH0A 3KQPA 2Z6UA 3UWPA 5EVJA 2B25A 1O9GA 3PB3A 3OCJA 4XUEA 3UFBA 1YFLA 1NW6A 1D2HA 3G5TA 1SQGA 2QY6A 2UZ4A 3CVOA 3T0IA 3SVZA 4L7VA 5G02A 3P9KA 1IY9A 1V39A 5D1HA 3GGDA 4QTTB 1JG1A 3TFWA 1DCTA 1MJFA 4QPNA 1SUIA 3FPHA 3OZTA 5M5BA 2IH5A 2E5WA 4X60A 3AWIA 3THSA 3EVGA 1NV8A 4Y30A 4JXJA 4Y2HA 2DULA 3LCUA 5IH3A 5CVEA 3TOSA 4GQBA 3BWBA 1P39A 5DM2A 1FP1D 3ERCA 3HA3A 3BKWA 3C0KA 3I5UA 3FPGA 3RODA 2HWKA 3G88A 1ZHFA 1L1EA 2FK8A 2H1RA 3EGIA 2UYOA 2AVNA 3G8AA 3LPMA 5E1DA 5EOVA 4ZTBA 4P7FA 5LQKA 1AV6A 4E2ZA 3CGGA 2PVCA 2VS1A 4X41A 4AX8A 4RTLA 5DT2A 3UBTA 2PBFA 1DL5A 2PX5A 4BLWA 5ERGB 3C6KA 4FS8A 1XDSA 5T67A 2Z6QA 1VP3A 1I9GA 1JQ3A 2HNKA 2I6GA 2WK1A 1JR4A 3KR2A 3Q87B 3A7DA 3FTFA 1Y8CA 3DOUA 3ELUA 3LBYA 1XDUA 3LKDA 5EMJA 4R6XA 3TQSA 3X0DA 5E1OA 2EG5A 4F85A 2GAFA 1MHTA 2GA9A 4AZTA 4H0NA 4DQ0A 4E31A 2CMGA 8MHTA 5E9QA 3UJ8A 1RI3A 4FT4A 2AOXA 3PX3A 1QYRA 2IDJA 1R8XA 4QPPA 3LSTA 4MIKA 2YTZA 2ORED 5DWQA 5F2OA 5HIJA 3TMAA 5CVJA 2FCAA 2PT6A 5B1SA 5HZMA 3TM5A 3P97A 1YFJA 3HM2A 4HGZA 3HNRA 2O05A 4DM3A 3SMQA 4GOMD 4IV8A 3V8VA 3T7RA 2PSSA 4MWZA 2O57A 4RWZA 5E9WA 2PKWA 4ATNA 5K05A 3PFHA 5EKXA 2JHPA 5KYGA 4FT2A 3MQ2A 3KQSA 1TW3A 5GWXA 3HVKA 2AOTA 3NDJA 2AOUA 3KPYA 4PINA 1AQJA 1Z3CA 3R6TA 1T43A 4QQNA 2BR3A 2JHAA 4RTMA 1JQDA 3UZUA 5DTQA 5DPMA 2G70A 3OU7A 3ELYA 5FQNA 2XYVA 5DX8A 4FGZA 1KPGA 4RTSA 3HEMA 3NVMB 3HCEA 3FUUA 1KR5A 5EIFA 3A25A 2Q41A 3SM3A 1N7IA 2ZVJA 3O7WA 1SQFA 1SUSA 4GOOD 1JQEA 5CVVA 4YUZA 2ZZMA 4C03A 4YMHA 2R6ZA 5K01A 3GRVA 3KQOA 1NW5A 2PX4A 4KWCA 2PV0A 5FQOA 3UA4A 1WY7A 3PVCA 4PONA 4RTNA 3KR1A 1RI5A 2YXEA 3I9FA 3KQTA 5C1IA 4HRAA 5EIWA 5FADA 3ER8A 5E8RA 3BZBA 5DSTA 2GS9A 1EJ6A 4KW7A 5FWDA 4KVZA 4HTFA 4IKPA 5CCBA 2IH2A 2OKCA 2YR0A 3FUVA 2XVMA 2YUIA 4POOA 4RTPA 2PXCA 2AN5A 2IDKA 3ID6C 3JWHA 5D1NA 5EEHA 3FTEA 4OQEA 3V97A 3KPVA 3R24A 1KP9A 3DMHA 3KQQA 4XUDA 1G6Q1 2OPBA 5GP1A 2ESRA 1R00A 4YUYA 3CJQA 2JG3A 1EJ0A 3NTVA 3PLAE 3LGAA 4WXHA 3VSEA 3HCAA 1AF7A 4PWYA 3OU2A 4WVLA 1SVUA 4CTKA 1R8YA 2QM3A 4CKCA 1NW7A 2ZSUA 1O9HA 4ER5A 4ER7A 1VE3A 3KPJA 1KXZA 4GF5A 4R8SA 4DKJA 5F2NA 4AUKA 1NW3A 2P7IA 5EHIA 3I64A 2NYUA 5LQCA 1BOOA 3UJ6A 2KW5A 4C4AA 4EKGA 3GCZA 3EMDA 5K0EA 5LSAA 1JTFA 2OZVA 3KU1A 3B3FA 5FCDA 3SSNA 5K0CA 5U4XA 1I4WA 4F86A 1X1CA 1L3IA 3CJRA 2VZ9A 3HVIA 1N2XA 4MQ4A 4YUXA 3FPJA 4BY9E 1QZZA 3M6XA 4X61A 5EQJB 2C7PA 4PYIA 1WXWA 3C3PA 2IGTA 5K0FA 3BT7A 3DP7A 1NKVA 3AXTA 1L9KA 2AOUB 3Q7EA 3HP7A 3L8DA 1X19A 3NDIA 3DLIA 2P7HA 4LWPA 5GM2A 4BLVA 5LQAA 3DXZA 3G7UA 2HV9A 3PS9A 4M36A 4RTJA 3GRRA 3P71T 5DXJA 3SSMA 5HOQA 1R18A 3C6MA 3MB5A 3WSTA 2GLUA 2FHPA 5FUBA 3T7TA 3LL7A 5E1MA 4EVIA 5ICGA 4YV0A 2NXEA 2YX1A 3A27A 2H00A 3FRIA 3G2OA 3MCTA 5F2KA 2HTEA 4F84A 1AQIA 1JSZA 2EJUA 1EG2A 1KHHA 5DM1A 2P8JA 5C0OE 5DX0A 2BM8A 3PTAA 4MTLA 4E30A 1QANA 4XCXA 3DR5A 5E2BA 5HIIA 1BHJA 4YUWA 4RTQA 2ONYA 1P91A 1L3CA 2OBFA 4HC4A 3GO4A 1DUSA 2FYTA 4PYNA 3OE4A 1OR8A 3ANXA 2OY0A 3IYLW 3NW9A 3BGVA 3KKZA 2NP7A 4R05A 3B7PA 3MCZA 1WG8A 3LCCA 2N47A 4PYLA 2NXCA 5DSXA 4Z2YA 3P9IA 1YZHA 1UIRA 2NNWB 3DMFA 1ZGAA 4NECA 5FA8A 2NP6A 2EX4A 3FZGA 3HA7A 2AVDA 4BP3A 1YUBA 1I1NA 4E2WA 3HCCA 5DRTA 4CXMA 2VP3A 2AN4A 3MTEA 2OYRA 1IM8A 3G2MA 2C7RA 2QRVB 4X1OA 4PYKA 3KQYA 5T64A 5CD1A 1X1AA 3I58A 1BKYA 2OB2A 4EK9A 3S68A 5GINE 1EIZA 2Y1WA 4PGGA 3GIWA 3LCVB 2AOVA 4PYQA 4R6WA 5K09A 2UYHA 4GBED 4V0RA 5LQJA 3EVCA 5LQNA 3CCFA 2CKDA 5EMMA 5FULA 5K0BA 2G71A 1HMYA 5E1BA 2YQZA 3MHTA 1XJ5A 2K4MA 1XTPA 4G56A 3EVAA 1M6EX 2GPYA 1G8AA 3GRZA 3P2KA 1VP9A 4P58A 5IKMA 3IHTA 4BP1A 4A6EA 5KQRA 3EVBA 5DLYA 2XBMA 1XXLA 3BUSA 5DM4A 5JR3A 3UA3A 3OFJA 5K0NA 5DRYA 4ER0A 2C7OA 3TKYA 2PXXA 3LECA 4PYMA 3NMUF 3FYDA 2OB1A 3KR0A 4CWAA 1TPYA 3E23A 2HMYB 5DTMA 4PIMA 2QE6A 4HG2A 1G60A 3GDHA 4IWNA 4P7KA 3SSOA 2VDVE 2PGXA 5ICCA 4RTRA 1P1BA 3QOXA 2ZCJA 5JUWA 3EMBA 1YB2A 5DTRA 1KIAA 5FHRA 3EGVA 4LWOA 5E9JA 5EKUA 4K6MA 1PRYA 4CTJA 1B42A 2AZTA 1RJFA 4DCGA 1JG2A 4PNEA 3ER9A 4C04A 2Y1XA 2IH4A 3JWIA 3FPEA 3B3GA 2XYQA 4KIFA 3ORHA 5KS2A 1TW2A 2LD4A 5EEGA 2H11A 2PX2A 4OBWA 2XYRA 4A6DA 1F38A 3HA5A 1EAMA 1QAQA 2ZZNA 5GIPE 4DF3A 5BXYA 3OPNA 5KQSA 3M33A 3R3HA 3T7SA 5GM1A 3EVZA 5ICEA 4UOEA 5K0LA 2IFTA 3HCDA 4MHTA 2ZZKA 3HVJA 1QAOA 3AXSA 3GXOA 4RYLA 2B3TA 2ZIFA 4PIPA 4QQKA 1L3BA 1RI4A 3DUWA 2DPMA 4FR0A 4P7JA 4GC5A 1NBHA 5BP7A 3SXJA 2B2CA 3FRHA
chains in the Genus database with same CATH superfamily
5KJCA 4HTFB 1UEIA 5J2UA 1WLSA 1QV6A 4XWYA 3UT6A 3K2IA 3K6SA 1E9RA 3A3KA 2LCQA 1ULSA 1F8XA 3IRUA 2ZIGA 3N0TA 4KQWA 1KEVA 2REQB 2Y3IA 3HO6A 4JLPA 3PXGA 5IRCD 1U3WA 4MWOA 4NV3A 1CHNA 4RJ2A 4U3JA 1I80A 4EHBA 3G23A 1NQVA 3JALA 3N2ZB 2ZBGA 2NPFA 1F17A 1TIPA 1W0JA 2XEXA 3FROA 3KZVA 3QPAA 4MLCA 2X0IA 1A9OA 2R4UA 1TQHA 1Z29A 1XOIA 4IVQA 5LM3A 3REOA 4OAOA 2VJLA 3RFCA 2VUHB 2ZJ5A 4Y1EA 4EOGA 1BJKA 2WT8A 3VR2A 2JVIA 2SHKA 2HPVA 4Z0TA 4G09A 1JA9A 3VYWA 5JSHA 1QRRA 1V1RA 5K7SA 5JQGB 2W2XA 1XZGA 4S1WA 2NYAA 3QUTA 4WINA 1SBIA 3U0VA 2IYRA 4MV3A 1J42A 3AVXA 1QCCA 4HDMA 1ZRSA 5HJEA 4MEJA 2BH2A 4BQQA 1VPWA 1I5EA 2OA0A 1ZUD1 1A71A 2H1HA 3GZTB 5KYVA 1RZRA 3WNVA 2OCAA 3LQYA 2CVFA 2WOJA 3CUEF 4S1TA 4A3SA 1KAEA 2CLHB 5LOVF 3D6JA 4Q4DA 3RS5A 4OMUA 2JEOA 2R8RA 2RHLA 4EF6A 3DYBA 5ALPA 2W6OA 2GD1O 5CYGA 3MIZA 4JYCA 3CE9A 5ALKA 2RE8A 1JEEA 4RLFA 2IHKA 4ZC8A 4HH4A 3N7TA 2C29D 3MUFA 3PNYA 3AOEA 1TO6A 1P7PA 2MSEB 3QH4A 1LZKA 4Y6SA 1YMQA 2V4MA 5EIBC 3RK0A 3U7EB 3BREA 3BMCA 3LIIA 1Z5PA 3PR3A 5DGXA 4HPWA 3EIOA 2VLBA 3PTLA 5F1KA 1FU7A 1W44A 2JHGA 2PZ8A 5GZ3A 4HDKA 1EIWA 2RJOA 3U3JA 4B3JA 3BD8A 3IKLA 2WZBA 2V8OA 2BOVA 3TLJA 1UMDA 3SJ7A 5FPSA 3EXIA 2B5OA 3PZRA 4HGNA 3DFUA 1WHTA 4JBYA 4J0CA 4D1YA 1XA3A 2NV2B 2RKOA 4C3ZA 4KX3A 1KQOA 2YZMA 4YYZA 1ZSVA 3IQXA 4OB6A 2FZVA 1RC1A 5HSGA 1YS2X 1ZK3A 2HJ9A 1ZJ4A 4Q1FA 1HQYE 1ULBA 2ZTMA 3I2KA 1PKEA 4Q9DA 3PHIA 4ESVA 3UY4A 4OM7A 3OEEA 1KO1A 3SYLA 1GPJA 1MF7A 4BO8A 1Y5LA 3IERA 1VPTA 1VG1A 3PKZA 3WMGA 1CYEA 2V0CA 3I53A 2VQFB 1E9AA 1PI3A 3QOYA 1JG6A 1ANKA 1I1OA 3MYYA 1F48A 3TRKA 1YOBA 1KJ9A 3GGCA 3WR5A 1P2SA 3AR3A 4K5QA 1T10A 4FYJA 1Z6QA 1X87A 2ZQZA 2WRZA 1UPFA 3TBKA 1L6IA 1NF8A 2XMRA 4QFMA 2R8XA 1MNAA 5H7XA 3OUZA 3RT7A 2RGRA 2VJCA 2A0WA 4GEGA 5CX1B 3LC1O 4RV4A 2CZCA 4TTVA 4DZRA 1FLVA 1RYNA 1Z0AA 4FFMA 2B83A 4RPGA 2FFAA 3OURA 3TKAA 3E3MA 4I1RA 2QK4A 1EXDA 3I23A 3FY4A 3KB6A 5JAZA 1F51E 4DIDA 2W2KB 5FPQA 2BGTA 5CX1A 2HIMA 1DIGA 3PK0A 3DWEX 3RLFA 1WU8A 1X7HA 1DO2A 1Z82A 1QE3A 2G5GX 2I6FA 3OOYA 3PITA 1Y7PA 4KN9S 4RHFA 2YMLA 4ZCSA 1PLKA 1PIWA 2ZIEA 3F8TA 1SBYA 5TEWA 1CEXA 4CFSA 4CL0A 4CMGA 5BRJA 3EXIB 3JTMA 4KQCA 3OJCA 4MINA 4O3FA 5C8YF 3SYKA 1SU4A 1T5TA 1JJBA 4ARZA 1UMKA 1AURA 1UANA 1F60A 2NZ2A 5F35A 3R75A 3WGMA 4LC9A 4QTYA 5C5EA 4KXWA 1FTYA 2ZI3A 2PNFA 3GZNB 5UKDA 3PUWA 3F6EX 5C31A 2X2PA 5HFJA 2H4ZA 4YRZA 5BVGB 1QQAA 1PJ2A 1A72A 2Z6VA 2Z3ZA 4IH1A 5GOTA 1CDEA 3O8DA 4BP9A 2O5EA 1FMFA 2GK4A 4UD6A 3BCSA 3V46A 3H5TA 2YYYA 4RSGA 2HXGA 3KYBA 2CHEA 3NBMA 4FQ8A 4L72A 1PNOA 1RVV1 3LMKA 1LBEA 1SCIA 3AINA 4IJ6A 3UCFA 3EEFA 3A2KA 2HIHA 1EGMB 2FPIB 3SYNA 3SHTA 2UXBB 4PZZA 1KJYA 3EGEA 1QS0B 3TM4A 4BFTA 2W37A 2NO5A 1U9JA 4TSFD 3MSXA 3F71A 3OZRA 5JXIA 5FTWA 1XEWX 4TQAA 3G2QA 1U28C 1VJCA 2A1IA 2QT9A 1QHXA 1JSXA 1RBQA 2D1QA 4YT5A 4BNZA 3KZNA 4WBNB 3R9WA 3BSWA 2C5GA 3O91A 4W7SA 1JIVA 3KU4A 5AKGA 3ZCVA 1OLSA 1P1CA 3JWJA 4BYGA 1QJCA 1RI2A 1DBVO 3OJOA 3NANA 4D4GA 2JGDB 2Z9BA 4KXLA 4DOMA 3UK6A 2AXEA 1ADYA 1RXWA 1ENZA 3MUEA 3ETDA 4JX9A 4MW1A 4DIOA 4B81A 1PW7A 4HAYA 3ZGXA 3E2PA 2VQ6A 2NO1A 1XMSA 3JQFA 4YALA 3UFBA 1GKUB 4FOTA 4LV6A 1V7PC 3TZ6A 4E14A 2WV7A 2KPOA 2WM2A 3R0XA 4I55A 1UDWA 1E8MA 1LTQA 1FRZA 2Y1DA 2ZREA 3I0NA 2VWQA 1NXWA 2IYYA 3PFWO 4DIEA 5M7EA 4MV5A 1ZIPA 2QM8A 3L7BA 2VAMA 3WMRA 1K0UA 3LLMA 3TFWA 1SXQA 1OH8A 2I2CA 3O7MA 3TQIA 3HG7A 1I1QB 1VHQA 4HDMB 4MVJE 4CKBB 2K6GA 3DOEA 4NFLA 5CVTA 4AZ3A 2PX3A 5CVEA 5GPBA 3TAHA 2ZXFA 3ZUPA 4ACAA 5EPUA 4D98A 5CDHA 1LQUA 1WUJS 1Q12A 4DNPA 1TVKA 4I19A 4FGUA 2V5UA 3ZE8A 1XZBA 2PAAA 3HA3A 4U6NA 3DAOA 3INNA 3ADBA 3RODA 1F12A 1OBOA 1QQ5A 4RMHA 3HKEB 5L9AA 1P0FA 1MB4A 2FK8A 4TQ9A 4R8KA 2VT7A 2FPXA 4ZO6A 4P7FA 1XCGB 3HR7A 3ONFA 2Q2VA 4I9GA 2RI1A 2JLUA 5IC5A 3BMQB 3GUZA 2YNMD 4CG2A 3MINA 1TQDA 2FLVA 4WNAA 5EA2A 5JS6A 1A4RA 1NR5A 1F2VA 2DERA 5T67A 3GP5A 4EYOA 1E5DA 1VGRA 4FKZA 2RAVA 4ETNA 1HDGO 3RIXA 4CQLB 4KUHA 4XFJA 3LBYA 1NXTA 1GO2A 3BILA 4KLZA 1FDVA 5B4TA 3IEUA 1UC5B 1X1EA 2PH3A 1CDOA 2AC7A 4RD2A 1ZK2A 1KVUA 4E7PA 4H4CA 3F8SA 2GTPA 2Y1KA 3IR7A 5I9LA 4QPPA 3PR1A 4F06A 2WNSA 2HAEA 2IX9A 2ZR9A 4CEHA 2AR7A 3MWEB 1WNTA 3MTDA 1G2PA 4KR0A 5HZMA 1EBFA 4B8ZA 4DSAA 1PVDA 2FX3A 4AJOA 2XGGA 3QJYA 1T6YA 1TOAA 4R69A 2VHJA 3HB7A 4AROA 1ABBA 5F9MA 2ISCA 4BRUA 1X7DA 1BE8A 4OXIA 4WOBA 4L5IA 3ROGA 3VUEA 1OWOA 1E2LA 2QEQA 4IIBA 4DCSA 2XCSB 1JZQA 3N8DA 2R0QC 3IP5A 4OJMX 2IUEA 2P27A 4BNIA 1YB6A 1YU6A 3PC4A 4HFMA 2PRZA 4WZAE 4EW1A 1UJ5A 1R4NB 3IIEA 3GZ4A 4TUYF 5DI9A 1ZKMA 3W5IA 1E18A 4D96A 1U0BB 3GA0A 3IBCA 2XJ9A 4N9QA 1KK3A 3EE6A 3IAXA 1ELOA 3RYIB 1LD3A 1N7IA 2XGOA 3O7WA 5FFNA 1SUSA 2HCFA 1WB4A 4H7JA 5CVVA 4M60A 1KDYA 1FSPA 4C03A 2ZYIA 4B3IA 3B85A 4OMDA 2PQ6A 1KP3A 4FEGA 1HO3A 3KR1A 3L6RA 5F21A 2IWHA 4IOJA 3B1VA 1Z15A 3BRCA 3IA2A 5I9SA 3V8BA 1PL7A 1VYUA 2D1SA 2PQMA 2PCLA 2RDMA 3D3QA 3IO3A 3N2EA 3B1XA 4KV7A 1KMQA 4A9AA 4CT4B 2Q6TA 4YLGA 4HZIA 5KKNB 4AL4A 4KVZA 1UJBA 3TOZA 3HACA 1FOEB 3OY7A 1JJFA 4PPQA 1TCVA 2L42A 4X8LA 1N6NA 2QGZA 3ETCA 1IQ0A 1Q92A 5TARA 3TJZA 2CVQA 4KXMA 4JBWA 4F7DA 2M6RA 1GFWA 3LA6A 1LRKA 1P80A 4U7WA 4L8VA 3QFRA 4ZJPA 4DBVO 3Q0EA 2HQRA 3GQBB 4QIHA 3EWNA 2PYDA 4CZ2A 2W2NA 3GRAA 2QM0A 1U0FA 2CFTA 4BKUA 4LV5B 1DV1A 3EC7A 1UOPA 1SVUA 1EUCB 1S0UA 4EPTA 4F12A 2ZDQA 4ER5A 1KQFA 1FRVA 3FMPB 3WADA 4CGYA 3RC8A 3M49A 4WZBA 1V47A 2IUSA 5IFLA 3BSSA 4QOEA 4EG7A 1RYDA 2DM6A 3LV8A 1BG6A 2J3JA 2BI4A 1HDYA 2C77A 2NYUA 4HEA1 3FIJA 3VAYA 1BOOA 1LQ2A 4OHRA 2XY4A 3VTFA 1UFOA 3ED1A 2EVWX 2JJ1A 4LGVA 4UFPA 4O4LF 3LXXA 4N0EA 4H6PA 4URVR 4KDFA 1Y3IA 3OWXA 5JH7F 1JBEA 1TF2A 1XR3A 4PYIA 2QYHA 4RA6A 2OOSA 3GJQA 1ODLA 2G8LA 2AOUB 3TG8A 3BXZA 3IEKA 1N7GA 5JDIA 3EZ2A 3ZWAA 2HLPA 3MTJA 3AY7A 4DCOA 3VYRB 2GAJA 4LRQA 1SAYA 5A3QA 1Q7BA 3WSTA 4IF4A 1YZQA 4A5OA 3S2ZA 2O59A 2BFOA 2GAIA 3BMNA 3QNUA 4ZVQA 3DL7A 1AGXA 1J6UA 3LF2A 4K6CA 5CRIA 1E79D 2O3UA 4AO7A 1JSZA 2PYIA 3K4HA 4EFDA 3AL0C 2BAGA 3M9LA 2ZI6A 4G65A 3OECA 1NBME 2R8BA 3U48A 1GQOA 4IVRA 3DVQX 1MVOA 2RKWA 2Y9PB 3IP3A 3PXUA 1IZ9A 4G1EB 2ONYA 2ZRFA 3TVYA 2JKYA 3KYCA 4CF3A 1ZW1A 2PMWB 2OK8A 4MAAA 4KAJA 2Z1NA 5DCLA 1WG8A 4UCWA 5E4YA 2HXYA 3PGKA 1SIBE 2IITA 4Y2YA 2HCJB 2ISSD 3CN7A 3UG6A 2NNWB 4GWGA 1ZN2A 3CX8A 2X2OA 4DIBA 4DLWA 4F1KA 1R6BX 2R6FA 4PX2A 1CUIA 3JASB 1XCPA 1CZHA 4XM2A 3I9NA 2YHSA 4H35A 3ZDZB 3EHDA 4LI3X 1TZJA 4MW2A 5CBPB 1KFJB 4PYKA 1YCGA 3NJ4A 1JFLA 2QZJA 1GCAA 3GHYA 3MELA 1TLFA 4B7XA 1FNSA 1PLLA 1CJCA 1EIZA 1H9BA 3H19A 4RW0A 1NM5C 3IULA 5K09A 3KFXA 5LWQA 5H3LA 1P7CA 3FCAA 2WWIA 2WQZA 3KUXA 2HDNB 3K32A 5LQNA 2DE0X 4FDAA 1YL7A 4BWGA 1SD2A 3ICQB 3C5HA 1JF8A 3NAGA 2GPYA 2YOFA 1EWQA 1ESEA 1A27A 1U8ZA 1X74A 1Z2OX 4B6FA 3IHTA 2RH5A 4LBWA 5I3CA 1X0XA 1OA0A 2G06A 2EKLA 3EVBA 3OO1A 2ODNA 3GVXA 5DLYA 3UM9A 1AV7A 2EARA 4N4AA 3ESBA 5K0NA 5TPWB 1Y4SA 5DNUA 3AZOA 1RWNA 1Z9BA 5I8ZA 1K0FA 1M2GA 4JKOA 3C8UA 4UVGA 1WUYA 4Q9JA 2I1QA 2PUAA 4DSUA 5ESXA 1DHRA 4RCZA 1BHO1 2OWDA 2TMYA 2CXSA 2P9ZA 3M82A 2VHEA 3LBAA 2OTCA 3MOSA 5FL3A 3D4BA 1CJVC 1LLFA 1KC1A 4Z4GA 3QENA 2V58A 4O2AB 5FHRA 5I7RA 4TWJA 4R9RA 3HJTA 1B42A 5H59A 4DCGA 3WTBA 4FFRA 4YP6A 5L95A 2R4QA 1U0TA 1FLDA 1UDXA 4PXYA 4LZNA 2NX2A 1S4MA 2AF4C 4KH0A 4MTLA 1DI0A 4DRXB 1E2FA 1V5WA 2F59A 2VRCD 4RFSA 1NQUA 2FB9A 3WWDA 1KNXA 3DEYX 5GIPE 1N2GA 1N57A 5HX7A 2NU7B 3C6YA 3VR0A 3I0ZA 3Q8MA 3BHMA 4KO2S 3FSRA 2VJOA 4QXAA 3AEZA 2EKZA 3A1TA 3PUHA 3RHSA 1SRRA 4QVIA 3JYNA 4WL0A 2CSXA 2FEXA 2ILVA 5EJ9A 2QRLA 1YI1A 3UICA 2PE5A 5CA0A 3THYB 2DFKB 1W94A 2ODEA 4QVGA 5TEVA 1QP0A 1IWBB 2O1WA 3H83A 5HQ3B 3CUWA 3VVLA 1AHPA 1U04A 1ZESA 1KEUA 4XDZA 4YUYA 3BH0A 1E2IA 2FI1A 2GILA 3DOIA 4QARA 3MTGA 3LDAA 5B57C 2WZQA 4L4XA 2POQX 5KNBH 3MNFA 4JI3B 5ADUS 1QG0A 4BV9A 4LVUA 3USCS 1FFWA 1N5OX 2WNHA 2XVAA 2B92A 4FDTA 5JY6A 3OSUA 2ROQA 2NUAA 2LTAA 3D2LA 3MEQA 4IMPA 5TS3A 5KYWA 3WSWA 3CNOA 1I30A 4HDCA 4OTZA 3SBXA 1TDJA 2JIRA 2ZSKA 1D0IA 2E4XA 2VQSA 3KWJA 1IXSB 3GQBA 1T1JA 2IXBA 2A9KA 1H1LA 1KO8A 2ZUWA 2QROA 3EVTA 3H65A 3H9GA 3K9NA 4M37A 3QFSA 4NYJR 5DV9A 2O5CA 4GNRA 5CLIA 3OPYA 1AK2A 4FE3A 1M5TA 3LDHA 3UJ3X 3ND5A 3MD9A 1OAKA 2VPPA 4IM7A 1QP7A 3EVFA 5A0TA 1PX2A 4FSDA 4R3WA 3FWYA 3IMFA 4MPPA 4UBMA 3R7FA 3GLUA 2A4MA 4GSLA 4LEIA 5B58T 1SUWA 1GUZA 3A37A 2PWPA 4RJTA 4ZA2A 3BS4A 3G9TA 5A5FA 2BM1A 3IO5A 1IM5A 3SIWA 2I4RA 4MIYA 1QNFA 4AXXA 1GGKA 1W85A 3KXLA 2GXQA 3W4JA 4CIXA 1J00A 2E1PA 3AIIA 2WYHA 3SFTA 2EBHX 3VQTA 3QF4B 2CUZA 3K0HA 1NF2A 3CPSA 3I8SA 3MERA 4QDKA 4S35A 1MX1A 1RHUA 3EUEA 4TYMA 4TXHA 4U0KA 4JODA 4ZWNA 5LIRA 3KBBA 4IS3A 2JFVA 4NFSA 4AKSA 3KTFA 3O6VA 5F7OA 1OXXK 4BASA 1NW8A 4XUGB 4GZLA 3STTA 4ND8A 1P6XA 2J07A 1I7PA 2EW8A 4R1LA 5DHFA 3LRXA 1N5MA 3CNNA 1F8UA 1RFLA 2AUNA 3HLKA 2CHVA 4FK8A 3VOBA 4ZHQB 4ZI7F 1GTSA 2EZUA 3ZU5A 5AI5A 3TLMA 1KYWA 4GUDA 3F6YA 3FHJA 1UXOA 4ZT3A 4ZVOA 4HPJB 1LWOA 4I5EA 4M6WA 1PJAA 3E27A 4GLOA 4TTRA 4EKEA 3BFKA 1A9PA 5ALVA 3ASUA 5JS1A 4UEWA 4N0DA 3EAGA 5KB3A 1CUEA 4I5IA 3ZOKA 1DQNA 1NV9A 2YV2A 2MINB 2VYVA 3GT3A 4G81A 4KDRA 4IHJB 1JDPA 3KCQA 3J7AC 1TGYA 2A14A 3B89A 4E5NA 5B6IA 2ORWA 1BN7A 4ZDKA 1UBLS 2PBZA 1Q0PA 2UZ1B 3K0BA 5ANRB 4ZANA 3WGIA 4TLCA 2H1WA 1IC6A 1XTRA 2GN0A 3Q5DA 1JYSA 4LWQA 1ESZA 1QBGA 1W85B 4ZEOA 3WP0A 4M8IA 5ALUA 3F8WA 4OHFA 2HIGA 2W6NA 2COUA 3WBKA 4BS9A 1RC8A 2MYTA 5HRAA 3D7RA 2CCJA 5KU7A 1E7WA 1YTLA 1G63A 4IRMA 3T7KA 1BXKA 1COWA 2CHUA 3DBHA 3H8VA 5AD1A 1KDZA 4GXQA 1KPHA 1XP5A 2BEVA 2OZLA 4RXMA 4P53A 2B78A 1J2EA 3MINB 5CA1B 2P35A 1X42A 3OSZA 2WM8A 4NPCA 4EF4A 2WFZA 4X7PA 2Y77A 2RI6A 3H11A 2KJQA 2QL7A 1GZSA 1KO5A 3CBQA 5K99A 3CR3C 4YV1A 4CT0A 2IS2A 4Y2XA 5LDDC 5JD5A 1U7OA 2NZWA 4PHTA 4A8JB 3LUAA 2HX1A 2BEUA 1USGA 2FN8A 4WECA 2HOQA 4HH0A 4X7MA 4CQMD 2R5FA 3KJGA 4RYDA 5LR6A 3TZHA 5BV2P 2O8EA 1L7NA 1XG5A 3BL8A 5FOQA 3H5LA 2RH4A 2H85A 1XZKA 821PA 1H6DA 2XMBA 5AKIA 3OTWA 2BR5A 1E1NA 1K5GA 2F62A 3F9IA 3Q3GE 3GB9A 2VDWA 3K9HA 4LRXA 1E61A 3VR3A 3E9MA 4XUCA 4JOQA 4MWTA 5JCJA 5FL7D 3NRJA 4J1NA 4JQZA 1F3LA 3WY9A 3W2TA 3QXGA 2YNMA 4I1UA 5CFZA 1L9XA 4RDXA 1LEHA 3L6EA 1I3LA 2AMYA 5JYDA 1GUDA 1YRAA 3I9LA 1JDTA 4L1KA 3M4ZA 2HBRA 3PC6A 1A9QA 2CF5A 3D7LA 3W9UA 3STYA 4GZ6A 2HSWA 2JFQA 3A1NA 3OQ1A 5E7QA 1XJWA 5A62A 1KMNA 4DNOA 4G86A 1Z2CA 1N0IA 3GU3A 4RK7A 2ZWAA 4Q9IA 4XQGA 5EMKA 4B32A 5JZOA 1HE2A 1T1SA 3WQHA 3JZFA 3ZWWA 5BN4B 2ZRHA 4R83A 5IG2A 4M1KA 2ZBDA 1SN7A 3QWFA 4E1AA 4ILEA 3E1GA 4ZD6A 1QR6A 2K5UA 4L4YA 4YIHA 5C8ZA 2XA2A 4ZRMA 2P8SA 3MAAC 4FBLA 2Q4RA 2J5BA 2V96A 2GZ1A 3C4VA 3WLJA 4D0SA 1ZL0A 3W2IA 1XLVA 4M54A 5FKJA 4QNRA 2VP9A 3Q3CA 2B25A 4BV3A 3PB3A 4HV4A 1GHTA 4JJ8A 3IBGA 2FHSA 2YRWA 4JC5A 4DBLC 1FFSA 1ODSA 1EJ2A 1XGKA 4HYTA 5IUJC 2GMWA 3L8MA 1HDCA 1XKQA 2PKXA 5D5PA 1NM5A 2ZBFA 1K7EB 3B20A 5CLJA 2EX0A 1YQGA 3HUEA 2B20A 5K6RA 3AB3A 4U8HA 5FXMA 2Q9CA 2WUFA 1SUIA 4EJSB 1UK6A 3E4DA 2F1IA 2B35A 3W05A 5EWMA 4BWVA 4AUNA 4JSTA 4QEKA 5KQGA 3FWNA 3G1WA 3AU9A 1P2TA 3OT4A 2ZATA 1NJ8A 4YRMA 1E2EA 1TNDA 3AQIA 3HKDB 3I5UA 1RPTA 1VJDA 2L69A 1OYVA 3IOCA 4IJWA 4JJZA 4TT8A 4U39A 5DSZA 4CV2A 5A9SB 3EQ6A 2P62A 1AX9A 1GR0A 3RG2A 4EHJA 3TSAA 5IEJA 3ZX5A 1JR2A 5LYJF 4HT3B 2H18A 1CUXA 1TF7A 4HXFB 4M8LA 2NTEA 3G9XA 3OQBA 3R6LA 4TTSA 1VSTA 2UZ3A 4JSYA 1JJVA 2I33A 5G3ZA 3WDKA 3SIRA 4L74A 4D8XA 4ED9A 3OZFA 2FWJA 2IQIA 4ZC1A 1XQ1A 4DHWA 4E94A 3PDWA 1G8YA 4TZ0A 3EGXA 2ZI9A 4ZN6A 5JO0A 2QS9A 4MCJA 5D84A 1HLGA 1GNSA 5J63A 1D9XA 3WQQA 1D6JA 1TVMA 2ILTA 2WPDD 1IFXA 2BY4A 4QQ8A 3W7VA 2C58A 4B4DA 2DYKA 1PZHA 2X5JO 4P98A 2IZ0A 1F7VA 1OWLA 4QNNA 1CUSA 1M1NA 2PUCA 3Q0IA 2FSVC 2O48X 4F4HA 5AW8A 1HTBA 1Z06A 5ALNA 3ZDDA 2C1EA 3L0CA 1DLIA 3P4XA 5EGNA 3D4NA 1TE2A 2F7SA 3RHFA 3OCUA 3WYFA 1G291 4ZQBA 1EFTA 2PIAA 3JARB 4NU8X 3T41A 2R6HA 3GEEA 3T7RA 4FHCA 4MWZA 2ZJ3A 4X90A 5JQGA 2HSDA 3ODGA 1EX1A 1SVIA 1Z08A 4FD2A 3U3OA 2WP0A 3F3YA 3LVBA 1BU5A 1CZUA 2AOUA 1DS6A 2OUIA 3ILVA 3KPYA 2YJZA 2G9NA 2V8BA 4ALJA 1L4HA 4BNXA 5JXGA 4O0LA 3TX6A 1B1AA 1E3IA 1OWMA 2A78A 4QBIA 3QVUA 1EEHA 4LK2A 3L0YA 4HVCA 3X2SA 1SC1A 5ALDA 1KVTA 2HK8A 4Z7JA 2SNIE 3LWBA 4HLDA 4O8ZA 5BURA 1P31A 5E4FA 1SQFA 3T6KA 1JQEA 1H2WA 2I6XA 3LQ2A 2EQAA 3RJ9A 5E6UA 3RABA 2I9PA 2X4GA 3KQOA 1Z2DA 1G5HA 1X7GA 2OV1A 2AHRA 1R9GA 3FMOB 4PSKA 4B6JA 3ND9A 5IAEA 1I0LA 1KU6A 4YX9A 2YZ7A 2ZSHA 1I3KA 4CKEB 4DN6A 1CYDA 3IAM1 3TF5A 3HJCA 4MUAA 4L02A 5HYVA 4MR9B 3IXMA 3PR2B 5B3JA 5CCBA 3F5MA 4QXMA 2AWOA 3R3XA 2EBFX 3O2QB 1JLHA 2PSEA 1R0CA 4G4SO 2EGHA 5EY5B 3BMCB 4UREA 4V3CA 4A91A 1QC5B 3BDIA 4O4HF 2HNBA 2PL5A 3O4HA 4NY1A 1SUEA 4R41A 1FU8A 2VWHA 3EWSA 3MG9A 4PX3A 4FDVA 2RHTA 2FEMA 4F4UA 5HXAA 3A6EA 3PVZA 2G63A 3G13A 2G40A 4Y1RB 3O93A 2FSPA 1J23A 4IDOA 5HKAA 5A06A 4CR6A 5B6JA 3H4IA 1NZDA 4GMDA 4OJKA 2GHQA 2F8TA 2IOQA 1YUMA 1XFAA 4OI2A 3GUUA 3U4CA 2QZZA 3OT1B 1I7LA 3VYUB 4B4VA 2W2LD 5AVRA 4MVJP 4HGOA 2NIPA 4MQ5A 1E3DA 1YC2A 3NIWA 5EERA 2Z9CA 3QKIA 3FGOA 1UAYA 1K97A 4R16A 3AFOA 4HNHA 4DG8A 3F2VA 4I4TA 3A1DA 2E9SA 1JKJA 2FG6C 3BWXA 4K8RB 4BMXA 5E7IA 4R9VA 1Q1NA 4RELA 3PUJA 4YC7A 1I4WA 3IDFA 1L3IA 4MVWA 5CX4A 2GFQA 1LJUA 2J3EA 1A8UA 1J70A 4FKMA 1PZMA 3FYTA 2CXTA 1E6UA 1OA1A 3C5VA 3HP7A 2PKEA 4M9SA 1WW2A 4IIDA 4LWPA 5LIPA 2X8BA 4Y98A 4A36A 1GQYA 2HV9A 1FRNA 2EWWA 5IYZB 2YZGA 1J39A 1QIGA 1TXGA 2VPYA 3BHIA 2QX4A 4IIHA 3AM3A 2JZNA 4NJEA 5DHAA 3WGHA 4D6YA 5BN3B 4TZKA 3FOZA 2RGXA 4KC0A 2H00A 1E1CB 3Q41A 3QE9Y 2K2QB 1PD0A 3IOBA 5F2KA 5B55A 4DNFA 4D4KA 1QV7A 4G0NA 1BVRA 2WBLC 1U7WA 4FONA 3OFND 4NJEB 5EE5B 4MW0A 1P91A 2OBFA 4IUYA 3M4JA 1RAIA 2FYTA 1EBBA 1D6NA 3N9IA 1D7AA 1SBTA 1KMCA 1PSDA 4JYMA 4HI0E 3DBLB 4G07A 3HDJA 1P7ZA 4EH1A 3I4CA 1I7DA 2PWAA 3T9DA 5J1TB 2CB0A 2NT3A 4IJ5A 2L19A 5KZMB 1GN8A 4ZOLF 2FEOA 5H5JA 4B6GA 1MEOA 2H4YA 1BRMA 1XZ8A 2VJQA 2YIDA 2E4UA 2P69A 2QMZA 5F77A 4ADSG 4ZV4A 3U7IA 1Y9EA 1WY5A 4ITUA 3TPFA 1D2MA 5IW8A 2BMJA 5BWBA 1N1MA 4DLTA 5BN3A 1XALA 4EK9A 2CL6X 2JA1A 1O0BA 2MYPA 2HCRA 5F78A 3VH4A 3SWWA 1L5WA 3GJ4A 2V0NA 5FOUA 1OX6A 2QUJA 1U9IA 2D3WA 1O8BA 3CCFA 2QWXA 4QBFA 4TQUS 3M5CA 1DWPA 3JX9A 2BSXA 3R5TA 3SLRA 1JHDA 1M6EX 1UZUA 2EIHA 4Q12A 8ADHA 3WGQA 4WK6A 4A6EA 1PF7E 5B2ZA 2WIFA 5KSWB 1LC3A 1WPQA 4KU4A 1MFZA 3FCCA 3ZZTA 3AY6A 1Z8NA 3LYHA 1TVCA 1LPMA 2J3KA 3ROZA 2AMFA 2IYNA 1I7SB 3ZE6A 4CM8B 3O8LA 1NE7A 2FPGA 2PGJA 2FZ5A 4IWNA 1UOOA 3C3BA 1P8AA 1XDWA 2H1FA 3GLFE 2EV9A 1IZ8A 3LVFO 5DTEA 3S4YA 4Z8YA 1PX0A 1W19A 1C41A 2DBZA 2NTJA 2RCNA 4Y9RA 1TEVA 4YDRA 4GBMA 2BHTA 3IQWA 4LJLA 3TLKA 4H3SA 1QWSA 3PYLA 2B94A 4EGCB 2W6JD 1HWYA 3CPHA 3FPEA 3KYDB 2HF9A 2D2FA 3R7NA 3RJMA 2YMQA 1SRQA 4CCAA 1EDOA 5EIXA 3M4NA 4GXTA 1BCSB 2JLQA 3GVHA 5C51B 3LUKA 1IULA 1CS0B 1BDIA 1GTVA 5KJ1A 4M46A 3UT0A 3QG1A 4R68A 2X4LA 3IQIX 5B4VA 3DA8A 5L53A 4GOKA 3L4SO 4JB0A 1A76A 4QPZA 1NXOA 3QYAA 5AHOA 2MR6A 1OFUA 2X0KA 5FBKA 5HQJA 1L1FA 3I6BA 4MUHA 1RIIA 4OOFA 4CM7A 2AQHA 3GXOA 4FR2A 2CGEA 1GQRA 1L3BA 1WJGA 2B8WA 2EGGA 2IV3A 2XNDD 4EIWA 2CDAA 4KTVE 4NBLA 4HAVA 3U7FB 2BFDA 4UXJA 3WWPA 5L51A 4EJ2A 1BDMA 2MSWA 3IKTA 1DQSA 1QF7A 3C85A 5K8LA 3CWZA 4YH1A 3N8HA 3JPWA 2LCFA 1COWD 1MIHA 2NZVG 3WJ7A 3LM8A 3SEQA 2GESA 4WZBE 1OQAA 1XD2B 1IBCA 1OREA 1TYAE 1DC7A 4MI9A 2IBSA 4R9NA 4M22A 5H9VA 4OLBA 2OP1A 1V2HE 3C8DA 1UJNA 1D2CA 1C1YA 4G0UA 1YK0A 2POCA 2DETA 3NNNA 4CUZA 4JITA 1BC5A 3AW9A 3RRBA 1EKXA 1YJ8A 1E3LA 1U28A 2ZI4A 3ZNOA 1TPZA 3DKKA 4JEIA 4FYXA 2C8KA 4U2CA 1U2GC 3AI7A 3FPSA 4YJFB 3E58A 4ZCPA 1QZTA 5G4KB 4F38A 1IOVA 4GEKA 3AUYA 2A3RA 1KAOA 2WPNA 3IT2A 5BMOA 4L9RA 3KXIA 3RUEA 5ALLA 1FE8A 1PJBA 1PD1A 1R66A 1TTHA 1JMYA 1WDMA 2ZFUA 5JCOA 2C2YA 3RYHB 1B0AA 1WEHA 3VDXA 1T3ZA 1Q2UA 1LV7A 3UUEA 2Z3WA 3EBPA 1Y5NA 3LLVA 2FW8A 1G4UR 1ULTA 4HZUA 1GNPA 3Q7PA 5BQFA 3WI7A 4WHMA 2LGJA 4EVQA 4ZICA 2C95A 3CGWA 1OAAA 5CDSA 4UM5A 5JNVA 4L5BA 2ZUCA 5LYYA 4GLFA 4JBIA 4WOPA 1XC7A 3FVTA 2I2BA 5KQLA 4JR1A 2P3QA 4QG7A 2AIRA 4H6WA 4F60A 2FWIA 1CY1A 3V1TC 5DKFA 1ONPA 1LBIA 1VGVA 4EJ0A 3E8MA 3CF6R 1BMFD 1ZMOA 4Z1MA 3RK4A 1C29B 2O8FA 2AC4A 2QJRA 5B30A 2BWJA 1PK9A 2ZP1A 3R3YA 4RY9A 1W4CA 5AKLA 1Q3TA 1XRLA 4FHDA 1T24A 3SLGA 4I1SA 2I7XA 3Q8WA 2RK4A 1TT5A 2DF8A 3U4DA 3MAGA 3UATA 2RFLA 5C9ZA 3TH5A 1Z74A 2ZSEA 5CIYA 1XIVA 4OX9Y 4U4AA 4HNQA 3UW3A 1JHZA 1XMVA 3RASA 3WIDA 2PLAA 1H9CA 1U2ZA 3CVJA 3GGPA 1WUKS 4MIOA 3TW8B 1JAZA 2Z3VA 1JXMA 4E09A 2BFAA 1ZEMA 1JLMA 4RVHA 1DKOA 1WQ1R 1PV4A 3FTNA 1WP4A 3LDGA 2ZVQX 1E6EA 1Q57A 3U0BA 1C9NA 2QUIA 1EWRA 1T91A 3WK9A 2VSOA 2ECQA 4N5MA 3TQOA 5KDOA 5HE8A 1JHYA 1NXVA 4RHXA 1V2GA 3QX8A 5FWNA 4JMPA 1ORHA 3FPFA 4LDAA 3VFDA 1NLFA 2Q9AA 3OA0A 1RIFA 2RBGA 4CIDA 1AUVA 4ODIA 4ZI7A 4CM6A 2Q8QA 1V41E 4LC1A 1A8QA 4E2XA 4I66A 4H3KB 4HDOB 2ZAYA 3C3MA 5JJ5A 3QPCA 4MYSA 1U8FO 2BONA 2C42A 2WLSA 4UUQA 4JC4A 4YK7A 1J5EB 3CMCO 3DC7A 5I7WA 2DLNA 5HDQA 1EXNA 3PGXA 4Q9NA 3QE3A 2D1FA 4CKZA 1QZ3A 2COEA 2W7TA 3KEQA 5E0KB 5G4LA 3ROQA 3AFHA 1JAYA 2YNMC 4UCFA 3N2GA 2WIJA 4Y9UA 2V7QD 5HM6A 3I6YA 5J5VA 4EHAA 3VO9A 1XVAA 1L5ZA 2FPUA 5FBRB 2EJCA 2WMDA 3DULA 4PNPA 3C3JA 1LTKA 1L5VA 3BVPA 3PICA 2BPOA 4HATA 3SFVA 1V4BA 3DEZA 5I47A 1H5UA 1YCFA 4HWKA 2IVZA 1ONSA 4P81A 4P32A 4XD7D 1E3MA 3KPWA 4YR7A 3FVVA 5LZ8A 2B8NA 3HFRA 3IIKA 1J5PA 4O2LA 3I9JA 1XMOB 5AW1A 3LPAA 2OHOA 5HBGA 1I4OA 2Q9UA 3I05A 3GUCA 3WAGA 4WDRA 1U4NA 1Z12A 3NTUA 3ZWPA 1H3NA 1AKVA 3OFKA 1X1DA 4YV2A 1RP7A 5GV7A 1VSVA 4X84A 4LQ4A 1NIPA 1BHQ1 5J2UB 2V7UA 4JJEA 1CNMA 4NSNA 4YRSA 1Z4MA 1WDKA 5AXAA 2DH6A 2KMLA 3K20A 3OF2A 5EGSA 3T4PA 2R3SA 4KKVA 2WAAA 1K8ZB 2P3LA 5ED0A 4QC2A 1XX6A 2AFIE 5CM8B 5B3LA 2CEKA 4CDMA 1PS8A 5AVKA 2E4WA 1CR6A 3L05A 3BYZA 3M6AA 4Q48A 1NASA 4JZKA 4H7KA 4J7UA 4RMJA 1SCKA 2X3FA 2WJAA 4NZYA 1GV0A 1QORA 2OZLB 4XJTA 3CEMA 4DQUA 3NHBA 4M89A 5CK4A 1NJGA 1HE8B 2ZRIA 4IEIA 4PW0A 2I91A 3QUCA 1BD3A 1UKEA 2JZCA 4Q47A 4C6HA 1NJ5A 5HKOA 5IT4A 4JV5B 2NXNA 1YF3A 4OSPA 1MT0A 5AOAA 4U7PB 5IDXA 4M9RA 1C9YA 4QOHA 3EULA 3AUAA 2XUZA 3GC6A 3KEGA 4HJRA 1IUPA 4R8LA 5EHGA 5SZJA 3ZDEA 4BFZA 5KWSA 1LTHR 1PZXA 1N5RA 3BK7A 3ZIUA 1CQZA 2G9UA 3NV9A 4RD1A 1RQXA 1O4VA 3L8GA 4G5HA 3TFQA 2X5XA 3UAGA 4CODB 1QRUA 4BO3A 1E1QA 1FXUA 1SVWA 4KVGA 2IXTA 5CT9A 4G89A 3DGEC 3OEHD 4MUNA 4DQKA 4RV5A 1KOFA 1Z16A 2Z2ZA 4CDRA 2H7CA 1MGPA 3BCRA 3G8CA 3P9KA 2VJAA 5D1HA 1OJLA 1L5NA 2OORA 4IO1A 1Y3DE 1CXZA 3OETA 1TUEA 4RSHA 1I6KA 1R12A 1VLZA 3KRTA 3FPHA 2NTYC 3E5MA 3N0RA 4ZOQI 4EO9A 4KR3A 3S2UA 4U2DA 1KDRA 1FYEA 5DEIA 3LCUA 4UHHA 2TMKA 4M1WA 2W98A 1SQ6A 4JU8A 2OVBA 2QN3A 3KCNA 2IDZA 2NSJA 5LDGA 5KNDA 2QW8A 2EFEB 1EGQA 5FP0A 4XYLA 4ZO8A 4YAKA 2BLNA 2YHIB 4BJHB 2WWHA 1OT5A 3FNRA 3K9WA 3L0OA 1FC0A 1U2PA 4PR3A 4TMYA 4H1HA 4RZSA 2VP6A 2WC1A 4S1NA 2XADA 5BNFA 3WGLA 4PZPA 3DUFB 3QELA 1DXYA 2B1QA 1NBAA 2WEKA 3AIKA 5B3AA 1VB5A 4KI0A 5C1BA 3I62A 5AW5A 4Z6KA 2I3DA 5JC8A 1U9YA 1KI9A 2VZEA 4O6VA 1FJ2A 2W6ID 4LF6B 2G82A 4K2AA 1XDSA 3UIEA 3G2HA 3NHYA 3H6KA 4CIAA 4DUZB 3ETLA 3PG5A 1JQ3A 4BRWA 1BXGB 1PQ4A 3D6MA 3L5KA 1NRIA 5C4MA 3LVRE 2Q3HA 5LKRA 1BWSA 4KR7A 1IRIA 4ZXPA 3QKRA 5MN6A 1IK4A 3C6QA 2EG5A 1JA1A 1BGXT 2C59A 2GXSA 3PFKA 4LX0A 2ZBUA 4F85A 4D6XA 4Q0MA 5LJIA 4L76A 4UDOA 4KMRA 5INTA 1YZVA 1GAEO 1RI3A 3C48A 3NDRA 4BLSA 4N5DA 2DR2A 1VKRA 1LCIA 4BMZA 2QTGA 2V6BA 1H1LB 1P61B 1FDTA 2ORED 3IP8A 5DWQA 1HTTA 3GFQA 5CVJA 1MEJA 2HEIA 2PT6A 4QASA 4GO1A 5DCUA 1VPDA 4QU9A 1NKSA 2R1TB 2BGKA 2X40A 4HGZA 1E1KA 3KJZA 5DB4A 2VIIA 1DG9A 4G97A 2IS4A 3FE2A 5FWYA 1JLSA 3H6HA 5A4DA 1Z34A 3ITDA 4D56A 4MCIA 1MAUA 1NSTA 1D9ZA 5KTPA 3F5QA 4K9KA 3FPCA 4NYJQ 4JUDX 5B1DA 5F98A 3QBDA 1I6WA 3ZXXA 2ONCA 2JG3A 2PLFA 1E7RA 1KARA 3DTVB 4RJIA 4ZARA 5FQNA 5BN5B 5U1PA 3DFIA 2V9PA 4RFSB 5GVSA 2IELA 1Y98A 3GEHA 1S2DA 3LSYA 3HVRA 2P4SA 5EIFA 1XD9A 3FPKA 3KFLA 3SM3A 1ZJWA 3I61A 1UXKA 4TV8B 3B1ZA 5CNMA 1A2BA 1TZKA 2OP0A 3RO7A 1JIJA 1EWTA 3OD5A 1T4BA 4B0PA 3QG5A 2Z8YA 3HWWA 5J23A 1QG6A 1OLSB 4RPKA 2GZ3A 1QOQB 4J4HA 4MEAA 1ARZA 1AZSC 1H4TA 3LZ6A 3BC1A 3PRYA 2JATA 3ZJVA 4EB3A 1M3SA 3HO1A 3N2GB 5JASA 2ENWA 3TN7A 3GPDG 2UDPA 3FUVA 2ZJ6A 4UTPA 1SC3A 4YAEA 5D6NA 5H1YA 1WSBA 3M83A 2HC9A 3T15A 2X3YA 3K05A 5HMLA 1YT5A 2VHYA 1UIMA 3TLXA 1JIIA 4JI5B 3G68A 2FPIA 1KE2A 1C1DA 4X1IB 3UMVA 2J6BA 5I9MA 4R2IA 5HK9A 1X1TA 3CJQA 4JA2A 3HL4A 1CZOA 4ND3A 4BFWA 1P0IA 2GRJA 2XZPA 3RYTC 3IBFA 1UC4B 1NYQA 3M5WA 3S1SA 1KKUA 2DFTA 4MP3A 4C4SA 5CB4B 1NMYA 2ZYVX 3KWFA 4FFOA 3P1JA 3TOVA 3CZQA 3TSYA 2EKBA 4ER7A 2BBWA 2XTJA 4QJ3A 2VH5R 2CV2A 3NHJA 1TKAA 3WA6A 2HADA 2O0JA 1XRQA 3M3HA 3Q10A 4WAUA 2O2SA 5CLHA 2I55A 5EHIA 4AUKA 3I64A 4L0QA 1BO6A 5AVZA 5LQCA 5LA6F 4JEHA 4EKGA 2VQEB 4TXLA 1DCFA 1ULHA 2R1VB 5LSAA 1P4SA 2XXAA 2NUBA 1AQ6A 2MT9A 5E6SA 5L3QA 1YDEA 1YHYA 4OQLA 2AKEA 5F2EA 1OZGA 4Q4CA 1I7NA 1PNRA 4HWPA 3DM5A 3G2IA 2O6HA 1EM8A 2HU7A 2WINI 2WNIA 4GI2A 4LKRA 4Q37A 1LJLA 2JAPA 3SC4A 1FMTA 5DP1A 4WXYB 1MVNA 4AP9A 1QCZA 1TF5A 1WP9A 1YQQA 2RHGB 3HJNA 3L8DA 4P4TA 5DHPA 2DVMA 3QSYA 3GUVA 2YBDA 5TSDA 2OXCA 1G18A 4RC9A 1YS4A 5EJAA 4NZPA 4NAUA 3LL7A 3DLPX 3PD0A 3E5HA 1TEZA 4YPFA 4LSGA 3V32A 2WTNA 5HCIA 1QK5A 1AQIA 4HX2A 1ZM4A 2A57A 3VH2A 2W6CX 1X9IA 3FAKA 3ODPA 5FUVA 2BFFB 2R96A 2W0MA 4G25A 2BM8A 4F6LA 3GV0A 5CXUA 3JAMA 4Q39A 3IJEB 3RREA 3C87A 4KVAA 3L8ZA 9ABPA 1EDZA 3AX6A 1GQQA 3FKSD 3DL0A 3HZRA 4IYRA 2OY0A 1HZZA 2YZNA 3KKZA 4RESA 4KN6A 3ROXA 2COKA 1SVNA 1RZ3A 4JP3A 3TAXA 3UYKA 1OTYA 2H51A 2OXIA 5LU9A 1DKRA 4JC0A 4RA6B 4Z2YA 3IQEA 2C3PA 5L8VA 3DF9A 3FMIA 3D2CA 3OM9A 3FZGA 1PNTA 5BV0A 1GNTA 2O2DA 1ZGZA 2FMUA 2HHCA 2WD7A 3FPAA 2PG3A 1P62B 3HXKA 4N7BA 4EA9A 2F1RA 4M4SA 2WUGA 2WYVA 3EFOB 1ODJA 1MV8A 1CR0A 3EJWA 2MU1A 3Q3IA 1F6BA 1LK7A 1W48A 3FNBA 3LFUA 1OIWA 4Y67A 2WKRA 1K2VN 3UMCA 1XZAA 3ZBPA 5AVQA 2RHRA 1PBTA 2Q6LA 3U3RA 4XCQA 2FSUA 4HXEB 2IYPA 4BLQA 2B1IA 4YEDA 1UPUA 2VEDA 4R2HA 1E9VA 1NQOA 1LDMA 5LLSA 1XRRA 5K0BA 2XTZA 1XJ5A 1PJ4A 1YVEI 2SKDA 4BQPA 4HGPA 2DBVO 4DTCA 3TMYA 1W4ZA 5CXSA 4CF6A 3NIDB 1VRCA 1CS0A 1HKUA 4L8FA 1BCSA 1BE6A 1ATIA 2D2IA 3SKYA 5KIAA 5KQRA 4LE1A 2ZS9A 1W0KA 3RUCA 4RMGA 4E6EA 3FBWA 2R8PA 4BE4A 5DRYA 4XWKA 3ZW9A 3AKEA 5ECGC 3TK1A 3PEUA 1G8FA 1RBMA 3T5PA 3QKRB 3PXBA 4MQEB 2X76A 2VYQA 4CWAA 4KFCA 2O8BA 1CZKA 3LO5A 5JZSA 3OFVA 4YRRA 2E6UX 3U4GA 1N9GA 4N6GA 4GHWA 2W4IA 2NO0A 1A5AB 4O08A 1KC3A 3X2EA 5ILOA 2EYQA 1QO7A 2OFXA 3KAKA 3D8BA 1QH1B 3IE2A 1O94C 4QM7A 3LGSA 3FNGA 4M0PA 4PX9A 1KH1A 1E63A 4UMDA 3KETA 2QSUA 3OJFA 2LE0A 2IKQA 2IIQA 2XYQA 3IVXA 4Q3CA 3WL7A 3E48A 2I3GA 3F2IA 3BJMA 2HHJA 5CURA 1BEZA 1FUKA 2WHPA 1VJ0A 4LW8A 3HA5A 3NPAA 3ZKWA 5A6VA 1GPWB 1DJOA 1FTSA 1KI7A 2VXYA 4MRVA 4RKEA 2D2EA 4QRIA 1MIOB 3D3EA 1F0KA 4JUIA 5I7OA 4LXHA 2D2VA 2I4IA 3H2ZA 1ADBA 1DDOA 2Q29A 1SPBS 3FYSA 1A04A 3QLTA 1YDFA 3FB1A 3JYQA 2Y66A 3SXJA 1UC8A 2Q5IA 1NI4B 1J8QA 1Z6AA 3FZEA 3FYUC 4J49A 4E5VA 1PFQA 3WX0A 1ADGA 5BW8A 6LDHA 1K98A 3IX7A 4I1YA 1T9KA 4S24A 1W5AA 4E08A 3C16C 2W2QA 3FNIA 1J8VA 4EY4A 1XQVA 2YV1A 3GD7A 4MCAA 2HRCA 4CT5A 3P2EA 3QOWA 1B4DA 1MABA 4Z5XA 1DINA 1LNSA 4E03A 1K66A 4A26A 2ZULA 3ZHOA 4BVBA 2NAPA 4P35A 3UMRA 1DBSA 3CXRA 1CY2A 2Q5FA 1YBAA 2Q2WA 4KGVA 2P0EA 1NHWA 3HU1A 4PCAA 3VZDA 4AZSA 3HI4A 4CQLA 2WG0A 3DD1A 4WLVA 2ZRQA 2V74B 5FNZA 3JQ8A 2V6IA 3U7QB 1UXIA 1JR3D 5BWOA 2PSJA 4RSMA 4QGHA 1QLWA 1W88A 1L7EA 5F12A 3RVNA 4MKGA 3ZHXA 1OXUA 2XNSA 1QH9A 2A59A 3BMQA 3ILHA 3IUQA 5FI5A 5FTKA 3VZBA 3GMTA 4Q18A 2AC2A 2GFHA 1ZH6A 1BMTA 5BYJA 2WFMA 3BB1A 2ANCA 3B78A 3YASA 3QVWA 3V1KA 2VDOB 5TVKA 1RS0A 1TB4A 2CNNA 3WRWA 4DR6B 1WUIS 2PLRA 2Q2QA 2XNKA 4I1VA 2FQYA 2JVJA 4PG6A 4NU6A 5FA5A 4D81A 4EPXA 4RETA 1LS6A 2NQ8A 2YV5A 4LWZA 1TU3A 4RVDA 3NTXA 3A4NA 3VPFA 5HFNA 4LDNA 3QBTA 2WILA 3ESAA 3V80A 4XXHA 1WOYA 3AEUB 4LZAA 1F9AA 1CNFA 2C78A 1SOUA 4XSHA 3VNSA 1YU9A 2XODA 1LC0A 1G5RA 1C4WA 1XN4A 5IYZA 3C3KA 1HOTA 3KE9A 5F5XA 4G01B 2GEFA 2X1LA 4I50A 4ZZ3A 3ZV4A 1UP6A 3GAMA 5CUQA 3U4HA 1Q0SA 2XE8A 1M6VA 4MTCA 4R2XA 1U3DA 3QOFA 1Y7TA 1DRJA 4TS1A 2BFPA 4M0LA 4RLQA 3OC0A 2UKDA 4Z9AA 3I72A 4WZAB 2LWIA 3WL6A 2VATA 5FRDA 3ENNA 4GFDA 4PU0A 1UMBA 4V0OA 2BI7A 3ZGYA 1HC7A 2G1KA 3L7NA 5ALEA 1Z2NX 2IEAA 2VO1A 1C7QA 3NYQA 4AURA 2QSJA 3SQWA 1YJBA 5ENDA 2PTHA 4NU0A 3M6WA 1O94D 3P20A 1LQTA 3PGMA 3UJDA 1FJXA 1J9ZA 5D6OA 1V11B 5LLDA 1OXVA 1H1DA 1AK1A 2WI8A 3MBIA 1NQWA 3OTHA 4D92A 1AO3A 1U99A 1DJMA 1AVTA 2NUPA 3PRKE 4KZPA 4L8LA 4O02B 3RS2A 2P9QA 5JMPA 3UHJA 2PKQP 1X86B 4Q3DA 1J1UA 3G02A 2FN7A 4E0BA 4YXFA 1NYTA 3I12A 2B30A 3IRVA 1J56A 5JLJA 5CB4F 2VL7A 1WZNA 1N2CB 4FDUA 3B6ZA 4DABA 3WWEA 1K3UB 1SXJC 4PBTA 1ZH2A 1NPTO 5KVQA 4LGYA 3A1SA 2FUG1 1OBHA 3PXAA 2O07A 3IB6A 4JVLA 3FI9A 5G1NA 2J0EA 3IVRA 2WHRA 3EUFA 3ZWVA 2ZUFA 3HCOA 2Q5QA 4ZQHA 3IUNA 4L4UA 3FKSA 5SV2A 1N7JA 2F1OA 4R1OA 1HV8A 4AJJA 1SHJA 2HYDA 3W9BA 5K8CA 4XLLA 1Q0RA 4FKBA 4K7JA 4OSOA 4RZ2A 4W82A 1M34E 5JD3A 4BIIA 3AV0B 3JARA 1IAVA 4GPEA 3LK6A 2D6FA 3NVKI 1T29A 1CY8A 2GYWA 3PPWA 2NPOA 4GR4A 1UZNA 3SZLA 3K73O 4NBVA 1K3TA 4L7QA 4PFKA 3R5JA 1UODA 3HU5A 2IV7A 1V1JA 1GL6A 5EKDA 1BTOA 1YE8A 5EJGA 3VPXA 3BWCA 1Q74A 3GJ8A 3HUDA 2GDJA 2ZTLA 4TKVB 3V1MA 4BVAA 4FIDA 2XQIA 1V8OA 2OBYA 4I9UA 1GQ2A 1Z45A 1INLA 1FX0B 3ACDA 3BEOA 3VSAA 3H6GA 3KQWA 4EGFA 3KBOA 6Q21A 3QVVA 4KGDA 3U31A 2FH5B 2X7JA 5CIWA 3URMA 1Z4JA 4YAUA 3TR5A 3ICPA 3H1PA 4HZUB 4TV8F 4KO4S 2E5LB 1J33A 2VTEA 4MVJF 1GKIA 4QXPA 4C06A 1KAGA 2C4KA 1RYEA 1QSGA 4X20B 1T0BA 4TXNA 2G7ZA 4DM4A 4N82A 1E0DA 3Q9SA 3U9SA 4N12A 3C3YA 2WTAA 3BKXA 4NARA 5A02A 5AICA 2H48A 3FR8A 5CDFA 4KWTA 1KZGB 2JCVA 4RJJA 4HPXB 2Q1UA 2YOHA 5G4KA 4KGZA 5M3BA 1A1SA 4HH3C 2HEGA 3DMTC 1QPGA 3EYWA 3OX1A 2ZVDA 2PBLA 3L9XA 1R74A 4KKXB 1QGZA 1J99A 4LBYA 1FW6A 4GI1A 3PDJA 3FBTA 2O7RA 2Q4TA 1G6OA 3B1YA 1XXHB 1X8XA 3EGXB 2RHHA 1ICIA 3WL3A 1TM4E 2FFRA 4OA5A 2WB4A 3M6IA 5JS7A 3PFNA 3HXMA 5F4BA 3DJYA 4BVJA 2VI5A 1YGYA 4JBLA 1VG0B 2IUYA 4MKZA 1DPGA 1KVQA 1QLHA 4PHGA 3TB6A 1P6UA 4H0FA 4JNKA 1UXHA 1F8YA 4OY3A 3RT1A 1C7JA 1KY2A 1V7ZA 4BVGA 2FJ0A 1OHHA 2K87A 1NVDA 4BEWA 5CLFA 3EQ9A 2OQRA 1M1YB 4JLUA 1WNFA 3JQ7B 4C4OA 2JBAB 4D43A 1UBRS 1CFZA 4GLJA 4ND6A 5L7WA 1ESNA 2PT5A 3B51X 4LMAA 2HN9A 4AFNA 2WTUA 5AQ1A 1GAJA 1XWFA 1ZM2A 2HUPA 2PYZA 1DKPA 3HGQA 3NOQA 1MQAA 1A7JA 4AIIA 5M5BA 2VHCA 4IXDA 4EA8A 3PXEA 4O4JB 4Y30A 4X64B 5C1PA 1TQ2A 3OT5A 3TOSA 3OQMA 1AMOA 3PD7A 1A3CA 1XZIA 3FHOA 3K9CA 1CRQA 1TYEB 1GG5A 3IUSA 3L7JA 3PGJA 3EQ7A 5CB6A 3AP2A 2W2TA 4TLDA 1SKBA 1Q84A 1Z4PX 3SYMA 3UW1A 5BXYA 1M5UA 3VZCA 4QHSA 3H4MA 3LT4A 3GBVA 3ETNA 1ZX1A 4U2BA 5IZ4A 4E2ZA 3CGGA 3V4PB 3KSUA 2ZJAA 1LRLA 4G5QA 5ALXA 1P3Y1 1RE0A 2AEMA 2FXVA 1Y3AA 2O2YA 3PJFA 4IIXA 4KJZA 2P77A 3T3GA 3NI2A 3K8YA 4IOKA 4EZBA 5IX8A 3MGCA 1ZVKA 3RI3A 4PCVA 3FWHA 4MVCA 5ARBA 4I50B 3AMVA 1ZS9A 3CTMA 3KVRA 4RVNA 2JPDA 4Z3DA 3WLKX 2ZJ1A 1MHTA 4FHGA 4GYJA 5BVHB 1NF9A 4B3HA 1JDUA 2VHUA 3IP9A 4GWLA 3ZVMA 1YHZA 5AVWA 3IQGX 8ABPA 1GLNA 1QHEA 1V6SA 3E6AA 3NBQA 2HA2A 1GTJ1 2QAGA 1Z88A 3A6LA 3IALA 1IZ0A 5KNDD 3M89A 1BAPA 3WYDA 3QTTA 4HDNB 2ZUUA 4YB8A 3TM5A 1AZWA 3CSSA 3HM2A 2O05A 4IJKA 4A8JA 4TWIA 2HU5A 3V8VA 4JJFA 4NRDA 3SM9A 1GPUA 4PAWA 4PFQA 2EX1A 4LF7B 2QE7D 1X9HA 1Y9JA 2CDNA 1TK3A 4FT2A 3KQSA 4WN9B 5EWLA 3T7AA 3U2QA 4BGUA 3NASA 4S0XA 3TRFA 3ICEA 4NF2A 1M73E 2W11A 4DLAA 4BNYA 3S44A 1P4GA 1FS6A 2NVOA 3H1TA 2O9JA 1A2OA 3H2KA 5DLQC 3UMJA 3DL4A 4R2WA 3UT5A 5I3ZA 1KPGA 1PR3A 4M7PA 3FUUA 2Q3LA 3GFFA 2Q41A 1O96A 5HJ2A 5JFGA 3B6JA 5JNUA 2ZVJA 4RXUA 3DVRX 3Q7IA 4IIEA 5TQVA 2WIKA 3SZGA 1KRXA 4IO0A 5IUNC 4IFEA 4NMLA 1AS0A 4OHOA 5FQOA 3UA4A 3RT9A 3JD3A 4OQQA 4QGBA 4DW8A 4IQFA 1X15A 1Z47A 3KQTA 4HRAA 5A7HA 3ER8A 3UMGA 5E8RA 3PUYA 5IK2A 5LXTA 4UBNA 2O8CA 4NG4A 2WU3A 5FYQA 1E1CA 2XVMA 3CNEA 4IUDS 3WWZA 1M2VA 5T4FA 1IHUA 3BRQA 3VU3A 1ZUHA 2AJCA 3FTEA 2Z0MA 3T5MA 3LWZA 4PLWA 3ZV7A 3IPRA 1GKKA 2OPBA 2GSDA 4KQXA 4D3YA 1V3TA 4M0KA 3NGLA 1DKNA 1W75A 2XF8A 4Y9DA 4XEUA 2ZB4A 3RRJA 4RORA 4ZVNA 3N1UA 1JAIA 1FUEA 1QVRA 1MA0A 1JECA 2D06A 1SBZA 4RIFA 3QBVA 3ZV6A 3LUJA 4NK4A 5A6SA 3TEJA 3ZQKA 4FOSA 3U5TA 3TAUA 1ACJA 1JJIA 2JJ8A 1P45A 1VE3A 1Q0UA 3KT0A 4IP0A 4COKA 2EZ4A 3I01M 3V8RA 2D2XA 3LUBA 3A9RA 2BSQA 1FQOA 2PRKA 3KSDO 4LZPA 2Q5JA 5D01A 2P7IA 4C7VA 4OKSA 4H7PA 1E96A 5LZ9A 4FHFA 1EJBA 3W5AA 1JNXX 3Q88A 3ZS8A 3RTDA 4CKXA 1VTKA 4BP8A 4DMRA 4F86A 3CJRA 4C14A 1AKMA 1NWHA 1PT8A 3A06A 3AG6A 4YUXA 1MD9A 1QZZA 2OAP1 3CLTC 1Z4IA 3QX7A 4Y1RA 1CE8B 2VDKB 1QFXA 1WF6A 3L1VA 4MDFA 4Z99A 2FEPA 4ZVPA 5EUMA 4GX1A 3NPMA 5LQAA 2Y0CA 4V0LA 1IIRA 1XELA 2H08A 5L3ZA 2C5FA 3W06A 5EIEA 4FI3F 4B6EA 3K2BA 2EJWA 5HOQA 2WU1A 1CK4A 2SICE 2GLUA 2FHPA 1YQUA 4I14A 4EVIA 3PIRA 1LU9A 2OHHA 2F43A 4FD3A 3ZI4A 4N3CA 1KMHB 5CFOA 1G5PA 2P6OA 4UTZA 5JPCA 3WBBA 3WLQA 4GI3A 4A82A 1O0CA 1H9AA 3H9UA 4YJHA 5ERYA 3UB2A 2LZ0A 2W4MA 3VNRA 2HCTA 3I92A 5KI6A 5EE0A 1SCDA 3BDVA 4MLZA 5SYNA 1R6TA 1RHRA 2ZM6B 2Y67A 4NK5A 1DEXA 1CUVA 5JCZA 2XOKD 1QQ7A 3EF1A 1N78A 6REQB 4WMLA 2FJUA 3GELA 4EYEA 1R6DA 2RGUA 4J03A 2IW1A 2XCOA 1FMJA 1O9BA 1RFGE 5K0SA 2QNBA 2C2KA 3HCCA 1WSDA 1DKQA 1HK7A 2CJFA 1J8FA 5ALSA 4ABYA 1IM8A 3VU0A 2HF2A 3WZ2A 7YASA 2VBFA 3H3FA 4FTWA 4IZ6A 4C4YA 3K8QA 2OB2A 1WPXA 5JYCA 2AH5A 2BL4A 3NDPA 1EB8A 3OE7A 2HW8A 4ILKA 3F67A 2ECFA 2WW8A 4J1SA 3WQSB 2OCLA 3O9ZA 4GBED 1SNYA 2NU7A 1OPXA 1KI6B 3ADDA 2P5YA 1WKBA 5EIBD 1V8ZA 2DU8A 4ZVKA 3HXOA 3JRNA 3HE3A 3HHPA 1ENPA 1HE3A 1NVXQ 3B1KA 1VP9A 3OZDA 4L15A 4RADA 1Z62A 2Q0XA 3V55A 1E2MA 4LXTA 1Y4DE 2V1UA 4UTOA 3NBXX 3L7DA 3FOFC 1Y81A 2GM3A 3PPIA 4N01A 1L5GB 4ECAA 1IMOA 4HLCA 4B46A 1PR2A 1T25A 2CFIA 4JGIA 2CVHA 3KR0A 3Q72A 4XIIA 4MS4A 3CV3A 3WLLA 2AXNA 1I4DD 5A4KA 3LQQA 4TX1A 2JL1A 1FDOA 4FW8A 3GLIB 3WYEA 4S3MA 1CQIA 1FDRA 4H1TA 1R0XA 1JHMA 4HBGA 5AVOA 2I76A 1X7YA 4XIFA 4K40A 1H8ED 4Z9FA 4YJKA 1OB2A 2X13A 4YMIA 4KIFA 2EGUA 3N28A 5J2UF 4N65A 4N7JA 2ZJ2A 2J59A 1YVUA 5EEGA 4B0OA 2PX2A 3Q3VA 4ARCA 2NO4A 3D3JA 3L0PA 2EU8A 2ZB2A 1K89A 3HDYA 4JXKA 3VNUA 1HM5A 2Q8NA 3KL2A 3M7IA 3LTNC 3HCWA 1L4NA 1UFVA 5BPFA 3D7NA 3B38A 3O0TA 4QUEA 5KOJA 2RIRA 4RACA 4UOEA 1P29A 5K0LA 4DR7B 1DWUA 4C2UA 5JMTA 3S29A 4MAMA 3R3ZA 3QGMA 3SBOA 3TR0A 2Y1FA 4RZXA 1FYVA 1NUPA 2WSBA 1RI4A 3NATA 3G0DA 3NG1A 1XCMA 3QU4A 4I8DA 4L3OA 3K0FB 3QTBA 4MZDA 4YO8A 1ZK0A 3ZCQA 1ISHA 2H1IA 2VPXA 3WGNA 4LOHA 5L4SA 1T3SA 1I6LA 2VOJA 5DHTA 2JGFA 5BWLA 3FRHA 4DPMA 1RSZA 5G3YA 1Z22A 1GV1A 4G8CA 7AT1A 1L7QA 2JGKA 2R44A 3N87A 1NNLA 1VBMA 3HBAA 1G9SA 3EZ7A 3WMEA 3CX6A 1NP6A 2HMVA 1XJCA 2QBYB 1L8QA 4QUBA 2X3UA 3MBKA 4B75A 4Y2JA 4X1IA 3UJAA 2IEIA 3DE3X 5AQEA 5EMLA 3RC1A 1K8XB 2ZI5A 2ZRMA 3NHPA 4BQOA 2GNOA 4KIGA 4J0EA 3SICE 3E82A 1H2YA 3O90A 1W30A 2CY0A 3LQFA 1H4VB 2H59A 5CD1A 5DTIA 2AS0A 4A7PA 4F9FA 1MB2A 2GB4A 4QUAA 2BCEA 3KB2A 2Q5EA 3U81A 5BSMA 3U09A 4Y6PA 3FHTA 5EHQA 1HG0A 3TSCA 2O2GA 4TWAA 1NPYA 1VE6A 2YXLA 5B3KA 1KRWA 2ZBPA 2QRHA 3GRYA 3C3XA 2G25A 3PCXA 3PP8A 4GM4A 4N03A 3UUGA 3Q40A 3GHHA 1HFKA 1SK9A 2R11A 3UXHA 2DG2A 2R6AA 4PS1A 1WDLA 4X8MA 4LDPA 4JXZA 3VAZA 5B7QA 2QTWB 3TLYA 3U4AA 1JHAA 1MMFB 1D1TA 2EP7A 3ANTA 1IB6A 3E3LA 4KV9A 2IF0A 5JS2A 1MB0A 4MEBA 2PUEA 3B6KA 3AC0A 4GI7A 3NBUA 2QLFA 3EGDA 4RVGA 3OAAD 1A77A 2HJSA 2HWUA 5JVDA 5EG5A 1SBCA 3KDPA 3SQDA 3UCEA 1U5CA 6ADHA 1KJNA 2FQQA 2GEVA 1MX3A 2H16A 3OZSA 2HRRA 4F96A 2CHFA 5KKAA 3I6QA 4OHKA 3EEOA 1SG0A 3QLVC 3WISA 2JKZA 2FOIA 2UV8A 4XOUA 2OVFA 3WGYA 1XU4A 3QF7A 5IAGA 4FB5A 4TTJA 1IHXA 2GYYA 3R3JA 3QKTA 3NJRA 3COZA 3TLGA 2CMHA 2QD2A 5JCJD 3NHKA 2IOFK 2W2PA 1L0BA 9MHTA 2RHBA 1KZYC 2XBLA 4OEHA 2BD0A 4NABA 3B7WA 3C8MA 2HGSA 3DV0A 1XCJA 2QTRA 3Q4GA 4MROA 4GL2A 4E21A 5K0JA 4DMMA 3SJUA 2GBFA 5KHAA 3EIWA 5FLXA 4RUKA 1JWLA 1BJRE 2YHIA 3QXJA 4BE7B 1FBTA 4B40A 1EYZA 4LY9A 3K8OE 3M1AA 4XTRA 4KN8A 5L6LB 1C4OA 2PFKA 5JYEA 3NRCA 3LRPA 4OK3A 4UW9A 2MR5A 3FMGA 4NNOA 3HTXA 1ODFA 4RY0A 1W9HA 1AE1A 2W9XA 3T5GA 3WO1A 3BGDA 1RXCA 4G1CA 1CQXA 1M0SA 3CSDA 1QM5A 2QTBA 4MJ3A 3R7AA 1Z6YA 1SKMA 4U9UA 2UUBB 1UFRA 1Z5VA 4D9CA 2PH1A 5KYKA 3OZCA 1QPBA 1E60A 3NBKA 1ZD3A 3QELB 3FUTA 4EEZA 4Z1MD 2YCLA 4DA6A 1EQUA 3GLKA 1K5DA 4P2BA 3EEYA 5I9BA 1YZUA 1C8KA 2BR4A 1DPFA 3LX6A 3R9XB 1D1QA 1P81A 4WIAA 5ICMA 3D7SA 1B8OA 2F6RA 1MQ8B 2Y0DA 1T2UA 4HTAA 3HDQA 3K09C 4JFRA 3HCBA 1KZ4A 2JJQA 3SZMA 1S8OA 4CKWB 3WLNA 3DXYA 4H6VA 4IJUA 4OA8A 3DB1A 1KFBB 3TSZA 4F0JA 4CL2A 2XT6A 3JZMA 5KOYA 4ZVSA 3I9KA 1OXBB 3HBLA 4WY8A 1AZTA 5LLTA 1H94A 4KXYA 4H17A 4ZVVA 1YR3A 3UCXA 5FEUA 3JAKA 3L02A 1Z25A 3F4KA 3NEYA 5DISB 1Q3HA 4WBNF 5KYUA 3NTRA 3R0ZA 3N2KA 2X0FA 1BW9A 3PNOA 2YN2A 3BBPA 3WVNA 4EUEA 3KJNA 3C39A 1GCOA 1G8MA 1RAFA 2IKSA 1L7BA 2VSXA 3FNEA 3NC1C 4W5JA 4C7BA 4COOA 4OUDB 2B2NA 4LMPA 1DEKA 1Z7GA 4MIEA 4BU0A 3C45A 3NHMA 2PWBA 4D45A 2PJDA 1O6FA 2IZ6A 3HYCA 1ZVJA 3ME5A 3P52A 3PCRB 5IKEA 4M9CA 3U26A 4LA4A 1M8PA 1Z7WA 2IPOA 2X9LA 2P11A 3HCNA 5BYBA 4NATA 1PG2A 1Z7EA 2OQ2A 3F98A 2UYCA 1I14A 1G1MA 1VFPA 5ICFA 4M1OA 1MG5A 3AVTA 3N8KA 2PV7A 3ZQJA 3CLUC 3R5XA 5CTJA 1FIUA 1ND5A 2QPAA 4P54A 3K1AA 1DT5A 2KBEA 3G6WA 2C7VA 4O4IB 1G4HA 3UK7A 5SY9A 1EM6A 1IIBA 3LA8A 3OM0A 2V7EA 1HNNA 2Y68A 2PUJA 2WWTA 3X1JA 1J07A 2VTDA 3P0HA 4L27A 3WOVA 2NZXA 2XTNA 4BLUA 5KTYA 3UTCA 3FW1A 4B17A 4BMDA 3GDWA 4MKXA 5COQA 1TM3E 4P83A 2ZW9A 4O2RA 1G7TA 2AZ4A 4AJEA 5LP1A 1DVRA 1ZIYA 4UVEA 3RM3A 4CR8A 3DE7X 2DCMA 2JBWA 4BJ3A 2O0LA 3HB5X 5DI3A 4C08A 1Q7EA 1NYLA 1XQYA 2OV4A 2ZYUX 1T9DA 3KYIB 3P2MA 4IDGA 1AJEA 1EVLA 1II8A 3R23A 1EDBA 2JFWA 1FVXA 1EUDA 4KX5A 2Z08A 3JVEA 4YQEA 3DH0A 5HR5A 2IBTA 1NY5A 4OB8A 3VR3D 4QLOA 1BS9A 3OCXA 2R8EA 2YW9A 1T1IA 1SXJD 1RW4A 1UBNA 3AL3A 1D4OA 3DHWC 3L1HA 3ULKA 2DR3A