4P7FA

Mouse apo-comt
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
213
structure length
213
Chain Sequence
b'GTKEQRILRHVQQHAKPGDPQSVLEAIDTYCSEKEWAMNVGDAKGQIMDAVIREYRPSLVLELGAYCGYSAVRMARLLPPGARLLTMEINPDYAAITQQMLDFAGLQDKVSILIGAPQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAVYQGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
molecule keywords Catechol O-methyltransferase
source organism Mus musculus
molecule tags Transferase
total genus 69
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4p7fA00
2ESRA 1ZQ9A 4R05A 5GOZA 1ZGAA 2FPOA 4Z2YA 1R8XA 5LQRA 2IH2A 3UBTA 2I62A 1NW7A 5E8RA 4EKIA 5IKMA 2JHAA 1IXKA 2PXAA 3G7UA 1N7JA 1WXWA 3FUXA 4KDRA 4RTPA 1F3LA 4QQKA 3T0IA 5DX0A 3DR5A 4YUXA 1SUSA 2ZVJA 4C07A 2P35A 2FRXA 5EHGA 4E2ZA 2CMHA 2AOWA 3SSMA 3HCBA 1G8SA 1RJDA 2JHPA 4HG2A 3A26A 10MHA 4HTFA 2IIPA 4KVZA 2IGTA 1KPGA 1VP3A 1WG8A 2UYOA 5CUQA 4F86A 4PGGA 1SUIA 3E05A 3GRVA 4RVDA 4PGHA 2H11A 2UYQA 4POOA 2ZULA 4IKPA 3HA3A 2ZBPA 4LWPA 3MTIA 1KXZA 3QV2A 1DL5A 4P7FA 5ERGB 4PYJA 2AOXA 3M6VA 2IBTA 2I7CA 3I5UA 2WK1A 4GOLD 3DMFA 3VSEA 3EVBA 1JSZA 1M0EA 5K0CA 3P2IA 3SVZA 4O29A 3C6KA 4CWAA 3HCEA 1FP1D 4YV2A 5LSAA 3HCAA 1AV6A 1X1CA 3C3PA 3GJYA 5LQJA 3UZUA 3G2OA 3NDIA 4P7GA 3NMUF 4ZTBA 5H02A 3GIWA 1AF7A 1NBIA 3MERA 3KPYA 4PCLA 5P8WA 3PFHA 5DRYA 4K6MA 1JTFA 4QDJA 3EVDA 3FUUA 2XVAA 1ZG3A 1TW3A 4EMSA 5ICEA 4RVGA 4GOOD 4UOEA 1FJXA 5FTWA 4RTOA 2CWWA 2P3OA 2PVCA 4WVLA 3X0DA 4E70A 2YR0A 5DSXA 3REOA 3DOUA 4AZSA 3KKZA 3KQMA 3FTFA 3P9CA 1RJGA 1P1CA 3FPHA 3GU3A 3FRIA 1D2CA 3A27A 3TM5A 4PCAA 5EG5A 4PNEA 3G2PA 1YF3A 1JQDA 2YXEA 3R3HA 2O05A 2PWYA 4PYQA 3R9XB 4PIMA 2JH9A 3O31A 2NXJA 5EOVA 3R6TA 3CC8A 3CJRA 1NKVA 1INLA 3OFKA 2VDWA 3O7WA 3V97A 5T64A 4HC4A 2ZZNA 3TRKA 2CKDA 5E1MA 3RW9A 3LECA 3DMGA 5C9ZA 5CD1A 5EKXA 5FWAA 4DQ0A 3QOWA 4PINA 3DUWA 1X1DA 5ICFA 5DXJA 3SSNA 2AN5A 3LCVB 1X1AA 3GRYA 3LBFA 3MAGA 3UJ7A 3PB3A 2ZSUA 5K03A 5KQRA 2AN4A 3LCCA 1YFJA 5DSTA 2HNKA 2IFTA 3BGVA 3OCJA 5KYGA 4DKJA 4U7TB 1Q0TA 1G55A 2A14A 2ZIEA 1N2XA 3LSTA 2O0LA 3G89A 2Y1WA 1EIZA 3MCZA 3P97A 3PS9A 4HRAA 1NV8A 1ZKDA 3D2LA 5FA5A 1R00A 3EVZA 2I6GA 4BP3A 3NVMB 5JUWA 1XDZA 2IBSA 2ZZMA 3SR4A 5K0JA 3BKWA 3TPZA 1JG1A 1R8YA 1JTEA 1RI4A 4C4AA 2P3LA 3NWEA 2PX2A 3OFJA 3LDFA 1XJ5A 3TFWA 5DT2A 1SVUA 3LKDA 5FCDA 2AVDA 3KQPA 3EGEA 4BLVA 4DCGA 1FBNA 2UZ4A 2G1PA 4DF3A 3GNLA 4KW7A 1XVAA 2GA9A 3ELWA 3GRRA 3MCTA 3MGGA 5E1BA 4MTLA 3MTEA 1RJFA 2V74B 3UJ8A 2BR4A 3JWGA 2N47A 3E23A 3FPGA 1L1EA 2PV0A 1EJ0A 5LQNA 4CKCA 1JG4A 1PRYA 2PX8A 5K0EA 5KVAA 1L3CA 4GF5A 3I9FA 4YMHA 3PX2A 3EVEA 3DLCA 3TKAA 1JR4A 2YUIA 3AXSA 3B89A 1EAMA 3FZGA 3GO4A 3P2KA 3Q7EA 4L7VA 4E2WA 5GIOE 3VYWA 2HTEA 3P9NA 9MHTA 2AOTA 2B78A 4M38A 1R6AA 3E8SA 2EG5A 2C7RA 3PVCA 4R8SA 3UJ6A 5CIYA 4LWOA 1KYWA 3E7PA 4RSRA 2ONYA 5HIIA 2O06A 2QM3A 2P1DA 1ZHFA 4M37A 1KP9A 4FSDA 1G8AA 5MHTA 5EIWA 4GEKA 3EEOA 2ERCA 1P39A 2NXEA 2ZIFA 3C6MA 3HCFA 3RODA 5GWXA 1Z3CA 4BLUA 2NP7A 1HMYA 5FQNA 5HILA 4PYNA 4XUDA 1XTPA 3MB5A 4E30A 3FUWA 4OBWA 4C03A 2P40A 2ZTHA 3I58A 3KQVA 5HIKA 2CL5A 5GIPE 2GB4A 2OY0A 5K8VA 5BXYA 4RVFA 5DTRA 4FT4A 2IDJA 2VZ9A 4M36A 4GOMD 2QYOA 4FZVA 3ER9A 2K4MA 3NWBA 3DTNA 4P58A 1V39A 2PSSA 3AXTA 4LG1A 4FS8A 1I4WA 5E9QA 2PKWA 5EKUA 3DP7A 2OXTA 1PJZA 1JG2A 2VDVE 3HEMA 5BW4A 5ICCA 4PYLA 3CJQA 3ELYA 3FYDA 3FPJA 3HP7A 2EX4A 5DX1A 4GBED 3A4TA 4OX9Y 5EZQA 1NT2A 4PIPA 4V0RA 2Z6AA 1L3BA 3JWIA 1MJFA 2BR3A 4IV8A 2DPMA 5DM1A 1FP2A 1OR8A 3SGLA 3TLJA 1I1NA 4AZWA 3NVKI 3BWBA 1T43A 5DLYA 3KPWA 3DXYA 1QZZA 1TW2A 2B3TA 5DTQA 5GM2A 3UA4A 1XCLA 2YXLA 1ZGJA 2R6ZA 2YTZA 3NTVA 3T7TA 2OPBA 2AZTA 2PXCA 5LQKA 2P41A 3U81A 4KRGA 4BP1A 4QVKA 5EMMA 2BM8A 2UYHA 1G38A 4ER5A 3G8AA 1RJEA 5EMLA 4ER0A 2GS9A 1KYZA 1QAMA 1F38A 4CKBA 1SKMA 2ZBRA 4QTUB 1YZ3A 5DX8A 2I9KA 4XUCA 2GH1A 4DZRA 2AS0A 5C1IA 5LQCA 1RI2A 2OKCA 3CBGA 1RI5A 2EJUA 4GC5A 4X1OA 5F2KA 1B42A 2ZW9A 3HNRA 2AN3A 5CVUA 4EVIA 5HEKA 2C7QA 3I64A 5CCBA 2GAFA 2HMYB 2BR5A 2O57A 2JG3A 4YUVA 4C05A 3EVGA 3LCUA 3UA3A 4GOND 3A7EA 4PWYA 4R8RA 1X19A 4RTLA 5E1OA 3HVHA 3KQWA 5E9JA 3UJAA 4E2XA 5CVDA 4LECA 3PTAA 5KS2A 3HCCA 3LX6A 4E33A 1UWVA 5BW5A 3P2EA 3HCDA 4OA8A 4HGZA 4R6WA 3EPPA 4XUEA 2R3SA 5FWDA 3HVKA 4PONA 3HM2A 2WA1A 4A6DA 2XYVA 4C06A 5FHRA 2IH5A 1VBFA 3DXXA 1WY7A 4PYKA 4ATNA 2CMGA 4PYMA 4JXJA 1D2GA 1L9KA 4OBXA 3NW9A 3MQ2A 3BZBA 4QQNA 1QANA 2FCAA 5U4XA 2YQZA 5M5BA 1P1BA 3WSTA 2JJQA 5EVJA 1YZHA 3H2BA 2ZWVA 1KR5A 4QPNA 2NXCA 3SX0A 1TPYA 1FPQA 3B3GA 5E2BA 3S68A 4ER3A 3GRZA 2IDKA 2VDUE 5CVVA 3LPMA 3P9KA 4EQZA 3PLAE 2PX4A 4QPPA 2XVMA 4GC9A 1BOOA 3EVFA 2P3QA 5DM0A 4C04A 4Y2HA 5K0NA 2P8JA 5K09A 1XDUA 3CGGA 1O54A 4FGZA 4RTKA 1QAQA 2AOUB 5IH3A 1QAOA 1SQGA 2PWPA 3DULA 3FUTA 2HWKA 5DWQA 3UFBA 4QTTB 3K0BA 5JR3A 5GM1A 3OU2A 2ORED 4NECA 3TQSA 5LQUA 4MIKA 5EGSA 1JQ3A 5G02A 4OQEA 1G6Q1 3KQSA 3TOSA 1NW3A 1VPTA 4OA5A 4PYOA 3EMBA 4X61A 3BGDA 3HA7A 4RV9A 4E2YA 5BP7A 3B3FA 1VE3A 3BXOA 5DM4A 1YFLA 3THRA 2PXXA 1MHTA 4PYIA 1YUBA 5EMJA 2ZIGA 3GXOA 4CTJA 4X60A 2GPYA 4B17A 5FHQA 1Q0SA 2B25A 2QE6A 4V0QA 2OBFA 1VLMA 5FADA 1ORHA 1VP9A 2PJDA 3KHKA 2C7OA 2G8NA 2EJTA 2Z6UA 3JWHA 2BH2A 1EJ6A 4YUZA 2G72A 3OE4A 4AUKA 3IV6A 1BKYA 1Y8CA 5HFJA 1SG9A 3G5LA 4DM3A 2ONZA 3ER8A 4A6EA 2PT9A 5EHIA 3BUSA 1AQIA 5LQAA 1SQFA 3SSOA 3LDUA 1RI1A 3KU1A 4R6XA 1NV9A 5HIJA 2V7EA 3DXZA 2H00A 3G5TA 5EEHA 1L3IA 3KPVA 4RWZA 3PT9A 3OZRA 4AZTA 4MHTA 5DM2A 2YVLA 3FTCA 3CVOA 3UJCA 3FPEA 3AWIA 4RX1A 1ORIA 2IPXA 3G8BA 5T6BA 4F85A 2B2CA 5EIFA 3GDHA 3ERCA 2IH4A 2BZGA 3GGDA 3KPJA 4P7JA 2OYRA 4RTNA 5GP1A 3T7RA 1NW5A 5B1SA 2PBFA 1UFKA 3TM4A 1NE2A 3ANXA 3ME5A 4ER7A 3TR6A 2JH8A 4H0NA 4HH4A 2LD4A 5T67A 1KPIA 3TKYA 1QYRA 3F4KA 3PX3A 2QRVB 4IWNA 4RTSA 3B3JA 2NXNA 3OZSA 3FUVA 3QOXA 2ZZKA 3DLIA 4CTKA 2AOUA 2P7IA 3V8VA 2JHCA 3KR0A 2O07A 3M6UA 2XYRA 2ZWAA 1BHJA 4ISCA 2ZFUA 1R74A 4U7PB 3GRUA 1VL5A 3M70A 3BWYA 4QVGA 1KIAA 3P9IA 2PGXA 4RTJA 1HNNA 1P91A 4KIFA 4X41A 5K01A 2BM9A 2YXDA 3ELDA 1R18A 1XXLA 2VS1A 3A7DA 3ID6C 2EFJA 5E8JA 4RTRA 5K0FA 5E9WA 3KQOA 3EGVA 3K6RA 2Z6QA 3EVCA 3B5IA 2PT6A 3G2MA 4DMGA 2ZLBA 4YUYA 1VQ1A 2PY6A 2FK8A 1RI3A 5FQOA 2FHPA 3IYLW 4XCXA 3UWPA 3P8ZA 4RVHA 4KDCA 4ER6A 3R0QA 5EC8A 4FP9A 3VC2A 4CXMA 3JWJA 3KQQA 1I9GA 3BWMA 3C0KA 4GUAA 4E32A 3RIEA 3M6XA 5E1DA 1X1BA 2AVNA 3R24A 5ICGA 3CCFA 3PFGA 3GWZA 2NYUA 3LDGA 5DRTA 5K0LA 2C7PA 1JSXA 5DTMA 2XYQA 3UJ9A 1YB2A 5EPEA 4KWCA 1AQJA 1KPHA 2OO3A 1N7IA 4YUWA 1G60A 4FT2A 1WZNA 1IM8A 3AY0A 3LKZA 2VP3A 3P71T 3DMHA 3HA5A 4DCMA 2PLWA 2AR0A 2AOTB 5D1HA 3OU6A 2F8LA 3OZTA 5K05A 1XDSA 5CM2Z 4YV0A 3FTEA 5HOQA 3SMQA 5EQJB 1U2ZA 3THSA 4RTQA 1KHHA 8MHTA 3EMDA 3EEYA 3OU7A 3BWCA 4AX8A 3FYCA 3SXJA 3T7SA 1WXXA 3Q87B 3IEIA 3I53A 4HGYA 2E5WA 4C08A 4F84A 3LHDA 3OE5A 4HSGA 1O9GA 2QRVA 3KR1A 4QDKA 3UJDA 5GINE 2GLUA 4KIGA 4RTMA 2PX5A 4BY9E 7MHTA 4EK9A 2HR1A 4M7RA 2DULA 2YX1A 5DXAA 5FA8A 5K0BA 3FTDA 4CKEA 4HTFB 5DPMA 1BC5A 5HZMA 1XCJA 3CKKA 1VIDA 4FSXA 2B9EA 2NNWB 4FR0A 1EQAA 4OQDA 4DA4A 3M33A 3EVAA 2ADMA 5E2AA 2HV9A 1NBHA 1DUSA 3LL7A 3O4FA 3A25A 4RYLA 1UIRA 2UYCA 5CVEA 3BKXA 4WXHA 4AZVA 2ZCJA 3B7PA 4P7KA 2OB1A 5LR6A 3KQTA 3NJRA 3VC1A 4BLWA 3M4XA 3TMAA 1JQEA 2XBMA 4MQ4A 3LGAA 4YV1A 5F2OA 5EZSA 5F2NA 2AOVA 3CJTA 2OZVA 3G88A 3LBYA 3DH0A 3KR9A 3KPUA 2WA2A 1D2HA 3KR2A 1JG3A 2FYTA 3L8DA 4MWZA 2NP6A 2P7HA 3HVJA 1H1DA 2Q41A 5D1NA 1EG2A 4E31A 3MHTA 3HVIA 1M6EX 1NW8A 3IHTA 5EMKA 3HTXA 3BGIA 3EGIA 1M6YA 3C3YA 3NDJA 3FPFA 3AJDA 2Y1XA 5CCXA 5FULA 1IY9A 5HIMA 3SM3A 2G71A 3BT7A 2G70A 2FK7A 5EEGA 4YMGA 5C0OE 1DCTA 3FRHA 4GQBA 3GCZA 2ZBQA 5K0GA 5KQSA 2QY6A 3OPNA 4X63A 4IV0A 2OB2A 1NW6A 5FUBA 5CVJA 1WS6A 3G2QA 2H1RA 1O9HA 4G56A 3KQYA 3ORHA 3M6WA 3UJBA 4Y30A 4EKGA 2KW5A 3ELUA 2IP2A
chains in the Genus database with same CATH superfamily
3L06A 5G0TA 3P45A 4YAJA 4H7EA 3VMMA 2QP4A 1Z88A 1BE1A 4ZGWA 3Q0IA 1U4SA 1AGXA 4CG0A 2P77A 3D02A 1CUCA 1DQNA 1KJYA 4QQKA 1WUTA 2A86A 2AF4C 3P2MA 2HA6A 3H9EO 2V1XA 1ZONA 2I3DA 4I1RA 1RZVA 2P35A 3Q1KA 1X7XA 4IBOA 3D1LA 3T9FA 1A50B 1DBSA 2FP3A 3FCSB 3OFND 4GE0A 2JHPA 2FMTA 4TV8A 1T3ZA 1H85A 4KVZA 3VU9A 2J5QA 1VP3A 3TMYA 4CQJA 4BKPA 1D2MA 1KYVA 2OECA 4UXHA 3IP6A 4PVCA 2JVIA 3F6CA 4MQEB 1T36B 5KWJA 1Z2OX 3MWEA 2LIPA 1K8QA 3ZLTA 4DIBA 1MC4A 5CA0F 3EQ9A 3U3KA 3K6SB 2YQ4A 4P7FA 2VTBA 3ZGNA 2WUFA 2AOXA 3WICA 1CR6A 2Q07A 2YXNA 4IRUB 1I4EB 2IHYA 1JRLA 3BPSA 3GRAA 3LYAA 1IHPA 1NVXQ 4M1EA 1WXDA 2C82A 1L4YA 4RHFA 3K9NA 3ASVA 4XDGA 4HNUA 1A2KC 3IULA 3KEQA 3KB2A 4ZRDA 2ONJA 4O4IA 2I3GA 2R1VA 3RGWS 3H5RA 4QTZA 3O3NB 4TMWA 3AJ9A 1R15A 5B64A 4MLPA 5L3VA 2E87A 3ORRA 1U28A 5B3AA 5HNKA 1T9AA 4XDHA 1IRIA 4BNYA 5JZOA 3QVLA 2XVAA 4MW0A 3DC7A 1MX5A 2E89A 3CWQA 3FMVA 4LVNA 2HHLA 3FE2A 3GGGA 2VR1A 2VPWA 3VTKA 5TT0A 5EP2A 4EA6A 2IP4A 4ZYYA 1FJXA 1C5KA 4QZVA 1WXEA 1REQB 2A88A 2NVWA 4EIWA 1ZMXA 4FLMA 2E4UA 2V9PA 3EGDB 4DJAA 2X6TA 5BW8A 4R1LA 4PQYA 4J7AA 3LIPA 4PVDA 2O0HA 4HZUB 1JHYA 1TECE 2ZAGA 3IQFA 2FY8A 4E51A 2HCTA 2ZPUA 5TQ2A 2ZRGA 5CDSA 1EM8A 2V45A 4ZVNA 1PZMA 4OAPA 5FIUA 4B5KA 5AW5A 1ZIXA 3GGSA 1BWQA 5SYAA 1AK2A 1IMJA 4JXKA 3I6YA 4P86A 4O2BA 5EZ5A 1Y8ZA 3I9LA 1E1KA 2M98A 1WZCA 5LNK6 4BVBA 5CNJA 1ZRMA 1QVAA 1A77A 2ZSKA 1GGHA 1YDEA 4HQFA 4LISA 5AHRA 3LCCA 5K03A 3PDWA 4XGKA 1ZVKA 3QW2A 3WWZA 1S2LA 2W6QA 3UFXB 2LP4Y 4EEXA 4DKJA 1GNSA 2NYVA 1FYXA 2RH9B 1UXHA 2OSVA 2IF0A 4TMVA 1HA3A 4WLEA 3ZWKA 4EGJA 1BZYA 1IY2A 3B6JA 1X77A 3N2YA 3CVJA 4HRYA 3N2KA 1XDWA 1JV2B 1ZRHA 2ZGVA 4OH7A 4UUOA 2NTNA 3TW8B 2XWQA 2VAPA 3RJMA 2G8LA 3KVOA 3TPZA 3PD1A 4MV7A 5CNMA 1J99A 4BCDA 4JJ7A 2MMGA 1SVUA 3LKDA 1P5HA 4IHQA 1E0KA 4YT2A 3QWIA 4MYCA 5TS2A 3RYFA 4R01A 4ZTUB 2GDJA 3ELWA 4KYIB 4ZIRB 2V3CC 5EHZA 2ZQZA 3UPTA 1WKCA 1SWVA 4BLTA 5GMOA 5LOVF 1R9MA 1F06A 3B1WA 4FGUA 1GZ7A 1UDRA 4HUTA 1DBPA 2GLTA 3ZWWA 4C4PA 2IPOA 2JAPA 3IHKA 2CF6A 1XYVA 3GT7A 1QIEA 2JDID 4CV2A 1M83A 2WIBA 4I3GA 2E3JA 2HSGA 4MJ7A 4MROA 4RMHA 5L4SA 5GIOE 5CFOA 4QO8A 4L1KA 1R7RA 4KPUA 4F45A 4QUKA 5ECWA 2AOTA 3OBIA 1Z2AA 1IBKB 2VNAA 3SYRA 3PVCA 4MO2A 4NU8X 3C5VA 4OYRA 3E7PA 4YJKA 4ZJUA 5CBPA 3RVPA 1QHHA 2P75A 2RSLA 2O9JA 1KMIY 2B82A 1K66A 1W0KA 2H1FA 1WBJB 4OL0A 5EJMA 3UW3A 2PMCA 3VPFA 4DNFA 4IQGA 3O92A 4PYNA 5DYGA 1ZSVA 5BN4A 4M1ZA 2N1MA 4L8WB 2C20A 4BVHA 2GHTA 3I58A 2H3EA 2ZJFA 4L9WA 1DUIA 1DLIA 1DQYA 1LJ8A 4ZD6A 4A6XA 5BXYA 3PFWO 3ZK8A 5L7TA 4KO4S 1XMOB 1MRZA 4HOYA 2E82A 5FWXA 3SVTA 1NMEA 4KRYA 5CEEA 1JPUA 1J1IA 1KA9H 2RK6A 2QORA 2UZ3A 4MR9B 3DT9A 4P58A 3TZHA 3W5IA 2Z2YA 1RWBA 4RNCA 1EEXB 2EFCB 2ZI5A 3IJRA 4ZJZA 1LLCA 4ZKEA 3EZ2A 1M2KA 1RSZA 2BT4A 3H8JA 4QHTA 2VJPA 4XA8A 3W79A 1BGWA 4R3WA 1UKBA 1K0FA 3F3SA 3FPJA 3HP7A 2ZAMA 4RZ2A 1JU3A 2PNFA 2EBFX 5J9FA 1YE5A 4ENTA 2OCKA 4YJ2F 1D4FA 3IE1A 2B4KA 1V1RA 5TSDA 3W7AA 3GDGA 1W1WA 4ONEA 2Q7DA 4YR9A 1KJZA 4EENA 1N0UA 4UUNA 4FOPA 2AZTA 3W7VA 2HW8A 4K05A 4ZVVA 4KCGA 4MYUA 2VPPA 3HEAA 1X8KA 3N8GA 4L75A 4B3XA 4PG4A 1DBIA 5CB4B 3WLQA 1HE3A 4UPVA 3WBFA 1IN4A 3KVNA 2XUDA 1XMSA 3NBXX 1FMLA 3NGXA 4RK7A 1AKQA 4EZBA 2A57A 3RSGA 1NFFA 2Q0SA 2D1SA 3CBGA 4GC5A 2WKQA 3H18A 1TF5A 1DKQA 3CONA 4EY4A 1JVNA 3CV3A 3OIDA 2HOQA 4NH0A 3AVXA 4WJLA 3W1VA 3Q41A 2SECE 1LLQA 2YIJA 4OHWA 1KTIA 2DECA 4DV2B 4BWGA 2P9EA 1U1DA 2GTPA 3IBYA 4MMZB 4K8OA 4DR7B 2WIKA 3K94A 3FZQA 4IHAA 2CFSA 3DYVA 3I2JA 4BB0A 1LS1A 1WUKS 5KSWB 3UMJA 2RONA 4BGUA 2X7XA 1KMHB 1DI0A 3WDSA 1G2OA 2NLOA 5BW5A 2JARA 4H1VA 4R6WA 5EFZA 3W5UA 3AONB 3T5BA 5A9RA 6Q21A 1M72A 1W4RA 1R0YA 5FPQA 3KKNA 4UEQA 3I52A 1IEVA 2PZ8A 4RMNA 5J2UB 4L07A 4EELA 3U3XA 4C0BA 2XB8A 5U4XA 3MTJA 1IFXA 2JIZD 4J16A 5EVJA 5CDUA 2PYIA 4F6LA 1JHOA 4ZXFA 1IXRC 1V45E 3SX0A 1H6CA 1WD5A 4LCBA 1OYOA 3HRKA 3EYWA 4CQMA 4EI9A 2D5BA 2K7ZA 4FGWA 1GUFA 1OX5A 3LPMA 1S2IA 3IDSA 3PLAE 4V3BA 4KN6A 4WA8A 4JLKA 3QNUA 4ZCPA 3U0BA 3NM6B 2FN8A 4Q9AA 4LRSB 4YJFA 4GPEA 3RSLA 5JMWA 5JY1A 3QUQA 4RTKA 1P62B 3QLUA 1UOEA 5G4LA 2VEDA 2EGHA 4J94A 2RG7A 5ILOA 1ZJ5A 3E4CA 5SZKB 2BSAA 1N6RA 3AERB 1M66A 3NBMA 4ZT3A 4C1NA 1SD1A 5JSYA 4OA5A 3MG9A 1S96A 4RV9A 5AJVB 4RD0A 1Z5OA 5D7NA 3ZE0B 3I3OA 3B3FA 2FWMX 4DMLA 3F71A 4X60A 2VAVA 5EJAA 1TA9A 2AFHA 2FU5C 1D0IA 2WM8A 4L9RA 4V0QA 4YP1A 1IE3A 2QL9A 5FADA 2BHNA 1B26A 2C5SA 3DJFA 3LK6A 4R51A 4RZQA 2WSMA 3U5TA 3PLNA 4YUZA 3FBTA 1NQ5A 1XD2A 4B45A 4UVIA 3AEKB 2G72A 3EBOA 4W7HA 1VSBA 3KD2A 1BKYA 3LOPA 3NHLA 1J49A 4GEGA 4LZOA 4Y8VA 1UBLS 4E0BA 1KMQA 3LO8A 4BNLA 2G83A 4JJIA 2XCLA 5JWOA 3FR8A 2X5JO 5EJ2A 4R1TA 3SP1A 3TSOA 1KC1A 3PQ5A 4BJHB 3F96A 1H22A 3L1KA 5TMEA 5JNRA 5BQXA 4HNRA 1J0XO 1C9JA 1H2XA 2RGCA 4KXLA 3EGXA 4M0LA 3K31A 1PWYE 4O02B 5AMXA 5JQGF 4UM9D 4IJ5A 3AEXA 3VJKA 2J46A 2PX3A 2YIMA 3EC1A 1WCWA 1XA0A 3QBVA 4MPRA 4RX1A 1LX6A 4BAUA 2WG0A 3TPCA 2PAFA 1VE5A 2VJMA 3GDHA 4MNTA 2BZGA 3KPJA 2GCEA 1M1YB 2OCYC 1OLSB 2BFDB 2H29A 3IKMB 5B1SA 1AF4A 5A7HA 3Q8LA 1NE2A 2J5RA 4XIYA 2JD0A 1YV9A 2M9MA 4H0NA 3GFQA 3A9UA 2COKA 1QGOA 4H18A 1SKQA 4AP9A 2VXBA 2WJYA 2HO4A 1CWUA 4B3TB 2BEVB 1K2VN 4E3ZA 3A0RB 4FKBA 3HUEA 4DEVA 1RPTA 4HO1X 1H0SA 2PZLA 4DADA 5KYNA 3ZXSA 2XUGA 2VNHA 2IPLA 4FFNA 1XLWA 2UXCB 2OOSA 5AVYA 2CVOA 1XQVA 2C2BA 4LPSA 4JJGA 4WEOA 1BH6A 1FRQA 1QK3A 4TSFD 2JFBA 3Q3JB 2ZWAA 1BHJA 1KO5A 2X7JA 2HREA 2WSYB 3DNPA 4PANA 3PNKA 2GETA 4F60A 3H1TA 1C7ZA 4YCNA 1P91A 1A9ZA 3VBCA 2HH9A 3ELDA 1GA4A 4C7JA 1GDTA 3ESBA 1N5JA 2KPOA 1QIFA 4RHEA 5IM5A 3EFOA 3CPHA 4KLZA 3MSXA 1H3EA 2ODWA 1NG9A 3TQQA 1MJNA 1KSJA 3R7WA 5GJVC 1PF7E 3C3EA 5AYVA 1DFIA 2A9RA 3SF0A 4C43A 1L1FA 1KE2A 4N7MA 3PNPA 5L3SB 2QRZA 3BWMA 3TNLA 3SU8A 2Z5LA 4AWAA 1GA1A 4BASA 3E22B 1RW4A 3OP4A 4UHFA 3TEFA 5FL3A 3PFGA 5TQJA 5K0LA 2E4YA 1ECBA 3H86A 3KYBA 4I5FA 5CX1B 5LXTF 3RE1A 3RAEC 3MWDB 1OFHA 3UJ9A 5BQPA 4KWCA 3FOBA 2C0QA 2QTWB 4ESVA 3GYBA 3EFEA 2Y71A 1XD9A 1IM8A 3LBHA 1KWKA 1BFDA 5FUVA 2WHPB 4YIHA 2JS7A 1OWNA 2FWIA 3VKFA 4M98A 1ZSNA 3V4FA 2Q5LA 1OWOA 1RRPA 3HJUA 3QKWA 4YRDA 2H1OA 3PFIA 3EPJA 1OMOA 1SK9A 3B51X 3C97A 4PRLA 3ZCSA 3H16A 1A04A 1GARA 2GBLA 3DV9A 2NU6A 1NWHA 5FOVA 2Z6VA 2J33A 1KI1A 3AFIA 3QVVA 3W5DA 3ETCA 1OJLA 3ZY6A 2ZRIA 5BMVA 2Q8NA 2V5UA 3KR1A 5EZYA 4DRZA 5KDDA 1E1DA 4Y2SA 2RMKA 4BVGA 4ZVUA 3B70A 1VPWA 2YX1A 2VZ0A 2BAGA 1VYUA 2X4GA 4PYRA 5HX7A 2G3YA 3H5NA 5KYWA 4EA9A 2MWMA 1NVBA 2PJUA 3OZGA 4OAQA 4BAZA 2B9EA 2NNWB 4BP9A 1PAUA 3V9AA 4DSUA 1NUAA 1MB4A 4F93B 4AJEA 2ZUBA 3G1TA 4K9KA 1DUSA 1T3HA 2A94A 1S01A 4N3CA 2FN7A 2BBOA 4WXHA 3RYCA 2BMFA 1DJNA 2OB1A 4X8OA 1IL0A 2HQSA 1A7UA 4NS1A 1TUBA 1RPJA 4KSYA 3PG5A 4XAQA 1SCIA 2BTEA 4NYIQ 1AURA 4QT0A 2VHWA 3TNDA 4B6RA 4CMIA 4NBLA 3MT8A 1T1RA 3EMVA 5T8KA 4E7PA 1D1SA 4IFBA 1D2HA 2JEYA 2Q21A 4JWKA 2WPDA 3L8DA 4JKIA 4QJBA 1JEQB 2P7HA 3SQXA 3ONWA 1ZN7A 2QD3A 4JI5B 1UBJS 2Q3JA 1Z0SA 5D3MA 4TKMA 1QFZA 2FX5A 3HJNA 4YASA 5LQSA 1A2OA 1Q77A 2GSDA 5KI6A 3LL4A 1ZK3A 2N9UA 3NDJA 3O91A 5H16A 1C0EA 1F5SA 2VQEB 4E2FA 2DWPA 2II6A 4BQPA 5K6AA 4F2DA 4YJ2A 3M6LA 2V6IA 1RKQA 4RD3A 1U0RA 3FNBA 3GCZA 1ULUA 3GUVA 4GM1A 2LCQA 4BB5A 1P61B 2R5FA 1KDVA 4C5AA 1PNRA 3P2YA 4D6YA 1FP4B 4EWLA 2H1RA 1O9HA 3CRW1 2WJPA 4G63A 5CX4A 2YY5A 1KVRA 3IOYA 2G1UA 2PTHA 1X1EA 2KBFA 2WWTA 3B8HA 4RJ2A 3GLGA 1M7HA 4JNCA 4M0FA 1ZGAA 2FPOA 2FI1A 4JL6A 2JCXA 3K5WA 4R3NA 3RYIA 2QJRA 1L7AA 5FV7A 5LIPA 3ZNPA 1DWOA 3K70C 3ANSA 2XMCA 2ZUDA 1J07A 3DKVA 4BN0A 2O8CA 3X2EA 1FFHA 1U3CA 2ODEA 3NHWA 4D9BA 4FZ5A 1XNRB 4HX2A 1IUOA 2QN8A 1WUJS 2WQ7A 2G9QA 3IIEA 4OHKA 1N0VC 2C03A 4QOEA 1A72A 4MS4A 3E6AA 1ZNQO 1NI4A 1WL8A 2SBTA 4RD1A 1P1HA 2RIPA 2XX3A 3N59A 2KMLA 2DKFA 4UXJA 1YZGA 4WOBA 4PGGA 2BGGA 3SF8A 4U7WA 2J0QA 4ZO4A 1PYGA 2WSSD 5EIAA 5F3WB 2B36A 5E95A 3UMMA 2XUKA 4K86A 2I2FA 4OMFG 1SB9A 4K2HA 2MINA 1RHQA 3ZWBA 3QKTA 2PCJA 3C14C 2W83A 3CW8X 1CLUA 3H87A 3PVSA 3P0HA 1OSNA 1SVSA 1YL6A 2B7BA 1G7SA 3SJCA 1BX1A 5KQGA 4P3YA 2AW3A 2LRHA 2P65A 1JUDA 3FD8A 1U2PA 1RHMA 2D62A 3HCWA 3C4VA 3G1UA 5CFLA 1VKJA 3PWKA 1AF7A 1SQ0A 2X4IA 3HN2A 2IHJA 3NBQA 4LK3A 4RD6A 2PWBA 4MVYA 4ZYXA 5L4NA 5H8WA 4JI8B 2QQGA 2R7NA 4HXFB 4OF4A 4F8EA 5GJWC 4BQRA 4RF5A 5ADHA 4N6OA 4KX5A 1PHRA 4W5JA 4DUGD 4YT8A 2R6R1 1Y5LA 2D74A 5DBGA 2AD5A 3R8CA 4EMSA 2IHNA 2XMQA 4CKCB 5L7WA 1PL7A 3KUDA 4KYVA 4X24A 3KXKA 2OVFA 3U4MA 3VR6A 1OZAA 4ZGGA 1TZMA 2XE4A 4X9XA 2RGAA 1L5WA 2ZIXB 4GPZA 1CIPA 3KKZA 4HDOB 4AJOA 3QV1A 5BSKA 2HWWA 2Z8YA 2ISQA 1XZMA 2OGUA 3VPBA 3QMVA 1WQ1R 3SZ3A 4PR3A 5H4GA 1R0LA 2OQ2A 1TKBA 3O5AA 5EG5A 1O57A 1COWA 1N7GA 2V55B 3HWX1 2WF5A 3L46A 3R9XB 1CB7A 1V4NA 3C5HA 3COPA 5H68A 5U4QA 2B98A 3D4PA 5JSZB 5KREA 5FKJA 4W9RA 1SJ9A 2AC7A 4I1IA 2XSZA 3V97A 1SBHA 1KR2A 3OFKA 1HQKA 9LDBA 2AG8A 2PVSA 4NZNA 1UZAA 3ECAA 1PJ8A 1N0WA 3TRKA 3VFDA 2G40A 2WG1A 3NOOA 3PHIA 3TLXA 4X3OA 1J6UA 1VL6A 1SHTX 3RBZA 3PEYA 4HDMB 3MS4A 1YVRA 3BB3A 3BS4A 4BJ1A 1P9LA 3EXHA 3LFUA 4HUJA 2EERA 1CJTC 3QEMB 1CVLA 4BLPA 1I2BA 3ZZNA 3PB3A 2AKEA 4H7HA 1JGTA 1HLFA 2G88A 2J08A 3FROA 4TMZA 1YFJA 5FA6A 5B57C 2J67A 2ZUUA 3JQQA 5CVCA 4BC0A 1JIUA 1HY3A 4KUGA 4NXNB 4U7TB 2DLCX 3SHFA 4YWJA 4UOZA 4RM2A 1E2MA 1UMCB 4MW1A 4ILKA 1Z75A 3A58B 2CSXA 2VN8A 4UEOA 1PR2A 3L7CA 3A1SA 3ROXA 1V25A 3IH5A 3MMZA 1BQEA 3N28A 1XK6A 4MRPA 3UGTA 1NJSA 3ZHRA 5HJ5A 2FOXA 5H7XA 1XOIA 4EA7A 3K70D 3AYZB 1YR7A 3P4YA 2RAVA 4D4HA 4IZ6A 1RPNA 3IAM1 4I4NA 1YVPA 3PXDA 2ZSBA 3JARB 5BO5A 1YKSA 2Y1FA 1BU5A 2G1PA 4DF3A 3JASA 2F90A 4UTOA 1U7TA 3INYA 3GRRA 3LX4A 2I8LA 3RSOA 3WGNA 4CM9D 5ALYA 1I8TA 1CVIA 3KSZO 1ZMRA 4TRJA 5C32A 3H99A 4A0FA 1AX9A 3NHBA 2BKEA 3FPGA 2E5LB 2YS7A 4QG3A 5EJ5A 1TQ2A 4BBPA 3ZDYB 1QV6A 1FFWA 5JBQA 4AYXA 1QCCA 4N54A 3N5CA 4OHZA 3URMA 2QUIA 1YQXA 5DT9A 3OCWA 2HNAA 3H4TA 2P9FA 3HSKA 3N3AC 3QKSA 3MLAA 5DASA 1JHZA 4D7AA 2FZWA 5BWLA 4Y98A 4XUGB 3OKPA 1E5XA 5FFFA 5SICE 4D96A 1VCIA 3VR2A 1DEHA 1UK7A 2W2NA 2Y0PA 5CK5A 2JHFA 4TT8A 1PGOA 2B37A 5BSMA 3K0CC 5I7HA 1E6MA 2WHXA 2FWJA 2YRFA 3JD0A 4K6GA 4GP9A 3SQWA 4C7BA 5FAXA 4FZRA 1E9BA 8ADHA 2XZLA 1N75A 3LBIA 2ZBFA 4HPWA 3RODA 3HCFA 4GPBA 1EXVA 4E5KA 4QSMA 4ME6A 2CMKA 1O6GA 3R6LA 2IY9A 1EHIA 4U2EA 1OZ0A 2HC9A 4QOGA 1YQTA 5KEIA 1I6MA 2D2EA 3U7QA 3LE8A 3OQHA 1QFSA 3O1JC 1FU4A 5JJBA 2YNMC 3CF2A 4JT9A 3UC9A 2CLDX 4NZMA 4YAUA 4KODA 2JIBA 4ZAZA 1PK9A 4JI3B 4ABTA 3VH2A 3FTQA 5LXTA 1JDPA 3O95A 2MJLA 3DWGA 1DAGA 4W1QA 2C2KA 4Z9YA 3RUFA 2W71A 1KE1A 3FM9A 5BW4A 2WJZB 5SZJA 4TXHA 3TQOA 3CJQA 3IOMA 1E2JA 3C39A 4KRXA 1W8IA 3DB1A 3QUBA 2FPSA 3K9FC 5GONF 3ET5A 4KHPB 2Z5FA 1DIRA 3JD3A 5I51A 2EZTA 1QTNA 4WKGA 1RBQA 1TYBE 1T43A 1OT3A 2FJ0A 3PGLA 4P98A 3EXFA 5C3UA 4KR6A 2AYXA 4QXOA 4RW0A 2JD1A 2QNRA 5HF9A 4C4OA 3VR4A 1T29A 1FJGB 1S9DA 1ZINA 3E9CA 3TCKA 2QR2A 3NTLA 1X1SA 5HKLA 1YBAA 3WXMA 5AJXA 4AKTA 3MQ4A 2ZB3A 1XEAA 1LPBB 3QA9A 1GYQA 4NS4A 2ZM6B 1G16A 1SKMA 4DL9A 1ZW1A 4JBLA 1UQRA 1XAGA 2PO5A 3RABA 3A1UA 3U3DA 4YRBA 1XPOA 2I9KA 1GTL1 4RK1A 2PJZA 5FOWA 5F21A 1NQOA 3R5HA 3CVVA 1JEEA 1F60A 2VQ3A 1G7CA 3N7TA 1J33A 1AUPA 4N5DA 3AY6A 1AA9A 3KYDA 4LC0A 3KL4A 3ROTA 1XJCA 4NIMA 1EB9A 3PSHA 4QLOA 1E9FA 4S1WA 3GR6A 3T3MB 2D2VA 4W6QA 2OQVA 1SUWA 1NVVR 5LZ8A 1QUFA 5FTLA 4KR3A 1E1YA 3L92A 4Y9DA 1YAJA 2WSBA 1Y6ZA 1IBLB 3KKQA 3SFZA 1QV9A 3A1FA 3WYAA 1GM5A 1ZD5A 1N6LA 3EVNA 3UWSA 4FBLA 5EUMA 4Q1CA 1E5TA 2ZUWA 4HNAA 1F51E 1TUIA 1V8FA 4R84A 4YI5A 5KU7A 1S5PA 5FEUA 2NWQA 3TLCA 3O6VA 2DUUA 2RH8A 3LY8A 1RCFA 4HWPA 5ARDA 4ARVA 3H13A 4X8MA 4FCWA 3NATA 4PICA 2IHBA 1W5BA 1SU6A 2P0EA 5KPDA 2QZSA 2P2SA 4JXJA 3T52A 3WS7A 1QS0B 1GHTA 3K4HA 3L7YA 2QPLA 2YQZA 4QIHA 3CUWA 3K05A 2OHXA 4UHKA 3CN9A 5DN6D 5AICA 5BNTA 3AF6A 1RYHA 1XEWX 3IDAA 3NHAA 4RJLA 5KOIA 1FPQA 1Z82A 4RA6A 4J4TA 2H2WA 2TMYA 2X0RA 3UUFA 3HDJA 3Q3CA 5ECYA 5GZ3A 2FR8C 2V7UA 4EB8A 1P9WA 4QQRA 1IB6A 2CUNA 2G80A 2VBIA 3UATA 5JRZA 2DY1A 2ZU0C 1FZTA 3IUQA 4IMJB 1F4VA 1FMJA 1TM3E 2R7AA 5LA6F 3DMPA 3THYB 2VJLA 3PNOA 3HKCA 1KI7A 5CT6A 5AHWA 3LVQE 2VDNB 4E08A 3UGKA 2AIRA 3AY7A 2BGLA 3F9CA 2ZWMA 4JJ6A 4V0OA 2NX2A 3L8HA 4DGQA 1PWZA 3SN6A 3BXOA 2V6MA 2IEAA 4DREA 2X2FA 4U2BA 1XZDA 2ZIGA 3HZOA 4MVJE 1OYWA 4Z9XA 3FWPA 4AO8A 4EDHA 1Q14A 1WCXA 2XSZD 3DVSX 3EZLA 5KWEA 3ZU6A 3QYAA 4D9CA 3JCZA 2EJTA 4F4DA 3AIOA 3V32A 1R0CA 1ONSA 3D8UA 1HO3A 1KH3A 1F2DA 1A7AA 3ZTYA 6ADHA 1OTYA 4EUHA 4RK5A 5DBFA 4UU0A 5FR1A 1D2AA 1P7CA 4RC9A 1BCRA 3L7MA 4GVXA 4NFHA 1JJIA 2CB9A 4KFSA 1GGVA 1EJ2A 1RI1A 1PJ2A 4Q3CA 5J58A 2X3UA 5FOXA 5TGDA 5LYJB 4IHJB 1E2IA 4HAVA 1U0SY 2I55A 3WK8A 2DLNA 2L19A 3PT9A 1YVDA 1IQPA 4F5YA 2WU0A 1FRNA 5FPPA 1ORIA 3L8GA 5I6DA 1W6UA 2FEXA 3JPYA 1FTQA 4JYPA 1KOLA 3BN3A 5DGIA 4H08A 3UENA 4YDQA 2QNIA 3MT7A 1UK9A 5CURA 3F6PA 1E0JA 3B36A 1XJQA 5A02A 4RPIA 5LDGA 5I7WA 1LBHA 4F4CA 2WKPA 4XIFA 4OUKX 2CLHB 5E6RA 2Z2JA 2IW1A 3BSWA 1JAHA 4DCPA 4C29A 1DO0A 1PSDA 1A1VA 3SVLA 1M34B 3ETHA 3RG2A 3V4ZA 1YHNA 3SDZA 4IILA 1J42A 1W25A 5JVDF 3THWB 3QI2A 1UFRA 1YDFA 4OQ4A 1J2JA 2GSWA 1NBEA 1P5JA 2AOUA 4P2BA 4OIFA 2PUCA 1JHQA 2H7YA 2XRFA 3KXIA 4BFLA 1E2BA 2L2QA 5KTOA 3VM6A 1O7JA 2GWRA 2R11A 3LKBA 1QGAA 1VL5A 2BFFA 2JCVA 2ET6A 4R98A 3BWYA 1TJ5A 3H7IA 4FIZA 1Z12A 1OV6A 1CUXA 1VZ3A 3D3QA 3GOQA 1GCOA 2PGXA 3QVTA 2RGEA 3MYYA 4DNPA 3MWJA 2YXDA 3ENWA 5IAOA 3A7DA 4W1SA 5E8JA 4BNMA 2EFJA 4QVIA 1T0UA 1G2QA 3A9TA 2WINI 4LOKA 5F5LA 1TGVA 1BO6A 1ZK4A 4AURA 3HUUA 4MUXA 1ZHHA 1DP4A 1EFRD 3HDYA 1ZGGA 5AI5A 1XEFA 1THTA 1LF5A 1K9SA 1ECLA 1F2UB 3F7OA 3QITA 3NBYC 3R0QA 4KDCA 1ZH8A 3WGVA 3KYCA 1Y4AE 1R4NA 4Q02A 3IODA 2JAQA 3JAKB 4RVSA 2QTAA 5TPWB 3C1AA 2C7PA 5E38A 4C0AC 1U3VA 4KXQA 3IAAA 2WICA 1EM6A 1UINA 2OCAA 2PUJA 3CZCA 3FCEA 4P84A 2BONA 2W6CX 3ZLBA 1CY0A 2Q2VA 4LWQA 1FC0A 3OPYI 4RMJA 3T6KA 1ZZGA 2HUNA 2JKVA 3LQYA 4N03A 1DIBA 2XTAA 1SBCA 1EGQA 2GCPA 2NT3A 3HE3A 2VSFA 4PAMA 4X1YB 3DLBA 2WABA 4ALJA 3ACBA 4BKUA 4C0LA 2GEFA 4RCVA 4I6JA 1WF3A 4TS3A 4RTQA 4RE5A 5DGDA 3R75A 3KDSE 3JS5A 3WE7A 3OE7A 2JRCA 4DM7A 4XQ9A 4E11A 3DZIA 2DR3A 4UCWA 3RC3A 3VZQA 4KJXA 4M99A 3EYAA 1B8NA 4REQB 2CC2A 5HFAA 5AI8A 4YAKA 1X7XB 2XDQA 4IUDS 1VIVA 1D0VA 1CQXA 3TDKA 4RTMA 4NATA 3VISA 1Z74A 4KOEC 2DCUA 1HMPA 2ZBUA 5FA8A 2W0MA 5DPMA 1L5SA 1J21A 3VU9B 4L6IA 4EFKA 3EPLA 1FK8A 4PY2A 4B4OA 3E7XA 4FSXA 1XMPA 2X19A 1CZRA 1GT6A 3FSRA 5FRDA 3UBMA 4DA4A 3EOZA 4MUMA 2IXAA 3TLAA 2PGDA 4EKDA 1WSDA 5HF8A 2VCEA 1Z2DA 3V00A 3L02A 4P7KA 2VTBB 2HRCA 1KK3A 3TCXB 1RCUA 3H2HA 4M86A 3NHFA 1MLDA 4P80A 1OB2A 1YUNA 2AJCA 1Y82A 2EZ9A 3NNSA 1G5QA 1XLTA 2JB9A 2QZZA 4G5XA 4UM5A 1NVWQ 4C0JA 3EDQA 1HBJA 3GIDA 2FYTA 3GLUA 4WXPA 3TLGA 4COKA 4O4IB 2JLUA 4WDRA 2JGDA 2R1VB 2XZPA 4UNPA 3N07A 4XRRA 3BULA 3CUSA 5CDTA 1QO9A 4KIJA 2PL1A 3C3YA 2GGSA 4V0NA 3WDMA 1MB0A 4CV3A 4EY7A 1XMQB 1T9KA 2EX1A 4DA8A 1T1SA 1Z6PA 4YMGA 4KOAA 2DBZA 3NJ8A 1U9ZA 1TEHA 4WZBA 1G4AE 3H8SA 3DL7A 1CUBA 3IT1A 2QL7A 3R0IA 4MA5A 1GRQA 2P4SA 121PA 1RXEA 2ZEJA 3PTLA 3R5TA 4U63A 2KW5A 4D5EA 5JNVA 1FEZA 1QORA 1NQVA 3O93A 3UUEA 2HF9A 2O6LA 4CM1A 3WLMA 1CRPA 1ATIA 1YR6A 1IY0A 2YHIA 4IDGA 4MCAA 4RZIA 4MVJP 3PC6A 5AK5A 4C4RA 3CF0A 5BOVA 3EBPA 3G7UA 5C8YF 4NJMA 1EM8B 3FGPA 2EKLA 1QGED 4IDOA 3CEPB 2C4WA 2GM9A 2WD7A 4YRSA 4KQKA 1A5AB 1HL3A 1P2BA 3OY2A 4PGMA 5KO2A 2CMHA 1HDIA 3B5EA 3PHLA 1XEWY 4G01B 2OTCA 2C83A 4EHIA 2Q3DA 4Y2TA 4U5XA 1K88A 1GNVA 3MJ4A 3HFSA 2UYYA 1SHLA 4JZKA 3BH6A 3Q9LA 4L6AA 3WYBA 1RRVA 1VL2A 3O8LA 5DCYA 5KKNB 2FZGA 3T38A 2W2KB 4B8YA 5CLHA 2ZOSA 3GRKA 5IAJA 4UM9B 3VZRA 2AKAB 1CEYA 2OQIA 3SY8A 3GJRA 4O2AA 1O9BA 4PYJA 1V3TA 1I7QB 3E9ZA 1NE7A 3L7OA 4G4SO 4CMHA 5DOVA 1L8XA 4FE3A 3ZQUA 1LF0A 2J9RA 3QUSA 1E61A 3K0FA 3PD0A 2ZANA 5FEMA 3O84A 8ABPA 2W4IA 5IF3A 4K9OA 3RYFB 2YDXA 1DAKA 1GADO 1NVUQ 3QMWA 1KAHA 5BWOA 1COZA 1SXJE 4L8VA 4PCLA 1FX1A 5KHAA 2HIMA 4A1OA 1KDYA 3PEUA 3LC2O 4WCVA 5EP3A 1FVXA 5D6NA 2Z4RA 4ASUD 3AI3A 1T24A 3GDFA 4RIIA 1JTFA 4WBXC 2AX3A 1RACA 3NHSA 3RD5A 4P0QB 3EIOA 1ICEA 2ZR8A 3BFKA 3MMXA 4RVGA 4B3BA 1ODJA 1Q2XA 3KAJA 1Y6FA 2QBYB 1ULHA 5L3QA 3U3ZA 1U11A 1GNPA 5DSXA 1EPUA 3O8NA 1T0IA 3NHZA 2YYYA 3L7JA 4EATA 5LB2A 1E1LA 4B7ZA 2WVGA 1QYXA 4JP5A 4KPUB 3I01M 4LJ4A 2OM2A 3HG7A 2C7BA 4FKMA 2X2EA 4F3TA 3G2PA 2C1XA 6NULA 1QU2A 4IJQA 2D3TA 1ZUNA 5CBPB 3ZH9B 3GFOA 4DR1B 4QYIA 5EOVA 4CLDA 4YXWD 2B4TO 2Q29A 4NX2A 2WWIA 4B3RB 4RXTA 2OCBA 3J7TA 2EBUA 4WKCA 3W5SA 2Z8XA 2ZYAA 3L04A 5E1MA 1N5IA 2RBEA 1C80A 1VJ0A 1VE7A 2WJ4A 2YVQA 3LW7A 3KKEA 3QOWA 3M3PA 4N3GA 1X1DA 5BN4B 5K3SA 4ND1A 1SMKA 4H6PA 3MAGA 3GRYA 4Y6GB 4IDCA 4M53A 2FQ1A 4DG9A 5DSTA 1SCJA 2HNKA 3AZQA 4IGFA 1CUJA 3DCYA 5LUBA 5AW4A 3MOSA 3U37A 3AR7A 2O0LA 3MCZA 4X95A 2G0TA 3ISJA 2JZNA 4FK8A 1K8YB 4PN3A 5SZHB 1Q11A 5DTJA 5FP0A 3SBDA 1ZKDA 5JXIA 1RR6A 3M34A 2PFSA 2FWRA 3D4OA 1R5JA 1XDZA 2ZRFA 1JKXA 3GLKA 3BGWA 1LB1B 1NXTA 1RDFA 1KS9A 2C3PA 3QE2A 1V1RB 3TFWA 4KO1S 2IHZA 3KQPA 1KOGA 3ADOA 1C41A 3GNLA 1CEEA 1TTQB 2XCQA 4M87A 1TCVA 1ZJJA 1O96A 1O4VA 1NOIA 4O5AA 4FD3A 3IA7A 4E6EA 2QMQA 2ZYIA 1EJ0A 3L82B 5INTA 4LZNA 4MYTA 3RRZA 4N48A 1Y4ZA 3A4MA 4UKDA 3ZI7A 1QHIA 4TTRA 5BV1A 2XF2A 3OKCA 3DLCA 2FAXA 3KB1A 2B1JA 3AXSA 3ANLA 3B89A 3M5WA 2XRYA 3OA2A 3Q7EA 4MO9A 5A3VA 3T5GA 4JXZA 4MVJH 4G09A 1ZNWA 1P2UA 3O47A 3ZCPA 4EHNA 3T3DA 3X1XA 4IDEA 4ARUA 3V8BA 1PJTA 3KUCA 3L4BC 3LIIA 3UKDA 1P4GA 5A7FA 4U7FA 3SCZA 3CSSA 5ECDA 4MI6A 1FFCA 2G9UA 3L6BA 3UAVA 3BJEA 4JEUA 5T4FA 5LD2B 2BGMA 2DBVO 4MVCA 2EKPA 1Q21A 3SZLA 4ZZ3A 3ZD7A 2B34A 2ZIFA 1GEEA 3KZVA 3PXBA 1HDEA 1W30A 2GYWA 3F2VA 5EIBD 4C3ZA 2I67A 5HILA 1UZNA 3BC1A 1KL7A 1HC7A 1ZIOA 3TDMA 2ZTHA 4URHA 4LNUA 4FW8A 2PZJA 4X92A 4RVFA 2PUHA 2ZS7A 4FT4A 1PLLA 4XJXA 3ZHUA 2X5OA 1P73A 3ZC3A 4FC7A 4L7QA 1ISSA 2B2NA 3R9KA 4IJ6A 1DTSA 4CQNA 4DB2A 1GGEA 1CD5A 3M9XA 2X5NA 4JUAA 1JKMA 2ZRLA 3M6IA 1DTWA 5AVSA 5I4IA 3DFZA 4L8LA 1PKXA 3PRJA 3C45A 4X66B 4JI4B 1KEEA 2VDVE 5DMXA 1M2JA 4CQMB 4XVQA 2ZE6A 2ZBEA 4G4SP 1ZRSA 2VZEA 4E07A 3V9PA 1CY4A 3H5LA 5JPDA 3TLMA 1TGYA 1PHPA 1GAQA 1AHNA 4WK0B 3LQ1A 1CNFA 5DTQA 1YZUA 2RHCA 4IOLA 5DLYA 3WLNA 3ZW9A 1YKFA 1D1PA 1JJVA 4TL7A 4ZHQA 3IQGX 3RT7A 3L4JA 3GLFE 2GESA 3IB3A 5A5GA 2JEOA 2P41A 2V65A 3GJ3A 3EX7C 4PLZA 4YQZA 5EMMA 5ITSA 1C7EA 1YQUA 1DS6A 3IT2A 3GUCA 4CKBA 4C7KA 1SUEA 3RADC 2Q8PA 1WSAA 3IO5A 1UT5A 2AJBA 1GQQA 5C1IA 3DM5A 2VAXA 1YZLA 4O8CA 4EG5A 1NU6A 2AFHB 3LGSA 1B42A 3RVNA 1JEYB 3G82C 1J20A 4EFLA 3W5CA 3FRJA 2XYPA 3EWAA 3LU1A 2G17A 3I64A 1Z2PX 3AHDA 4V2UA 1ABBA 1NRWA 4QUEA 3Q7QA 4KDEA 2F3TA 5CBKA 3OECA 5ALRA 4B5LA 4ZVPA 5K3EA 4MJ3A 3RRBA 5NLLA 1T4BA 2H54A 3A7EA 3L0SA 4GKVA 2VXOA 4JD5A 3A1NA 3QWHA 2CXUA 3R3XA 1SA0A 4B47A 4LECA 4UVDA 4V24A 4ZCSA 4F46A 3ZVKA 1G6HA 3FI9A 3IALA 1SRRA 3IQEA 4LGMA 2R3SA 4G07A 3S0JA 1VOTA 3TG2A 2PJRA 3EGXB 2UZ1A 3INTA 3R8XA 5JMTA 1F2VA 1U8EA 2IITA 1D2NA 1OH5A 2B4RO 4ATNA 1KMNA 3D5TA 1LGYA 3RRXA 4DHWA 4EMUA 2Y66A 4CKZA 2WIAA 3ZGOA 3EF0A 4XCQA 8AT1A 3WSTA 2C3MA 2F48A 4G4JA 1Q16A 2GJAA 4CRWB 4Q9HA 5ERXA 3WAJA 2EV9A 2BTQA 1P0PA 3RHZA 4CODB 3IS3A 4PLHA 3KDAA 1Z0IA 2IYTA 4G1EB 3S2SA 2YVKA 2QM8A 1IPHA 2QLJA 4BMDA 1SGWA 3B13B 2FETA 3BRWA 4Y2HA 2OFOA 1QJ4A 1XTJA 2OCIA 4L4UA 3RBVA 2P8JA 4P4SA 3U7FB 1QOPB 4IRXA 4OJTA 1QBGA 2PKRA 4GMDA 4GYJA 2B92A 3UFBA 2IIBA 3ZGXA 4D3SA 5JECA 3H0EA 3DB2A 3ZZMA 5JNTA 2OCDA 4RHYA 2O3JA 3D8BA 4QUGA 4B7XA 2FW9A 3K1YA 1NVDA 1WO8A 4HGPA 3WBKA 1XZNA 1VI5A 3VGJA 3WY9A 3CM0A 4PPQA 3GMIA 3BB1A 3VPAA 1AZWA 4QEKA 1UBSB 3DEKA 1S2OA 2B5WA 4M8IA 3EFOB 1VLMA 4V0SA 2IYAA 2OORC 1L8AA 1IRXA 2X7HA 4OK6A 3R7WB 3P9RA 2B20A 4D3FA 4DPMA 4OX9B 1VBNA 2A7QA 1F0KA 1OZGA 4X7BA 1UJNA 1D09A 3OZ7A 2WWGA 4LXTA 5AH0A 3WWOA 1FQJA 2X9QA 2FUCA 4MJLA 5CNKA 5E4JA 5HFJA 2BISA 3EPHA 3TFOA 3DP9A 3P9PA 3COSA 4MWCA 1IXYA 2J1LA 4AJPA 2YCBA 2ZBDA 3WGGA 2IYYA 3KU1A 1IZ8A 2QMHA 2D06A 1BE6A 1R1DA 1APBA 5JAIA 4B3IA 2H00A 3IVGA 1L3IA 2XGMA 1OREA 3WISA 1O89A 1IN8A 1S2DA 2C5GA 5AKEA 5TVKA 3NNDA 5B1YA 4NOMA 3NPAA 2YIDA 1HLGA 4OMDA 1NBME 4EEZA 3JW8A 1BCSA 1JQBA 1Z5WA 4N40A 1K4KA 5LOVB 3FFTA 2QV0A 1J7JA 2CFOA 4P7JA 3QEKA 5FBHA 1SBIA 5GP1A 3T7RA 3LWDA 3OJ0A 1QOZA 1PTJA 2Y6UA 4M9XA 1CUSA 5AP9A 5JRDS 1ZA2A 5AVUA 3EXAA 3KL2A 2IGBA 3G5UA 5DI9A 5KTRA 3AHJA 3TKYA 5EPUA 5H3LA 3ZWAA 2LCIA 3HB9A 4Q4AA 1CR2A 1XNHA 1F0NA 2YHSA 2B9VA 2Z2XA 3B3JA 3EARA 3ED1A 3QGMA 4TLDA 1WVIA 5LP6F 1Z8NA 1Y7PA 1C0LA 1W0JD 2HMTA 2QQ0A 4IF6A 3K8YA 1EK5A 2B6NA 2O8VA 4PZUA 4V38A 4W4TA 5DLQC 4QGGA 1DGQA 2VNSA 3TI7A 1CJBA 4CLRB 4N3AA 3DBRB 2RIRA 2ZFUA 3UMGA 4OQQA 1UZLA 4LF7B 2O3SA 1W52X 2G1KA 7REQA 1UZUA 3O74A 5BNFA 2VSYA 1H8ED 3GJXC 3N2GA 3BWEA 4P3KA 4QVGA 5IAAA 1TUBB 2FLKA 1R8QA 4HAUA 1M74A 1XGKA 4V0ME 3W6ZA 1FSZA 1OC2A 3KZ1E 2GNAA 3ET4A 4HATA 4BFYA 4WERA 3HR8A 1FMCA 1A7KA 1YKGA 1F0YA 1OAOC 1TJ4A 3T7CA 3TIFA 1YXMA 1GR0A 1IQ0A 1VI2A 3OPVA 1ZU5A 3SJAA 3A6DA 2A1TR 4IJWA 3LHSA 1KU6A 2LIVA 5D3MB 1G5RA 1E1NA 2PD4A 4UFOA 1F5NA 1DEOA 1Z22A 3FLMA 4NAUA 3WNDA 2IYRA 4BZQA 1U8ZA 1W48A 4YVFA 2AJTA 1X38A 1WPQA 2HPZA 4NCNA 3U3OA 4RXMA 2JATA 3QVSA 3GEEA 4YJ2B 4LXYA 4WFIA 2PEZA 3DEAA 1PI3A 4GX2A 3A6GA 1VJ1A 1VI6A 2OO3A 2BRUA 5DTIA 3IR5A 1ZH2A 2YV3A 3OOSA 3H2YA 1CVRA 3AUUA 5DNUA 2W6JD 2AR0A 2DFVA 2EFYA 3AB7A 1E6WA 4S2UA 5G2OA 4NNJA 1H69A 4DBVO 3GLGB 2AQHA 1HORA 1QDLB 4MDFA 1HE5A 2DCMA 5LL6P 4YV0A 3NIBA 3W9UA 5EQJB 2ZRBA 1FE8A 1NXSA 3GH1A 4INOA 3QE9Y 3T7SA 1ZXBA 2UZ0A 1KK0A 2OL4A 2OO5A 2RI6A 3GLTA 1M75A 3A10A 3LHDA 1NJ2A 3OE5A 4HSGA 2O2HA 4LXQA 5GINE 3RUEA 4M83A 2FWNA 4ODIA 1G6OA 4MS4B 1XA3A 2OLKA 4P3XA 4DDHA 4ZQEA 1NI4B 3DC2A 4WXMA 3IUPA 1EBUA 4YI3A 1JYSA 2Y1KA 4EFMA 1Z7YA 2PGNA 4X7PA 2H63A 3FNFA 3ADCA 1XCJA 1P1RA 1SCQA 3LUBA 4R2HA 2DKNA 1PZHA 3WLPA 3LWNA 2PMDA 4LC9A 3STYA 3V1UA 1JFSA 3CY6A 5FBWB 3SF8B 2Z1MA 1KJQA 1NBHA 5KX5F 1Y3DE 2X0IA 3D43A 1HQCA 2UYCA 2VHQA 2CFTA 5CVEA 4IEEA 4C6RA 1E4VA 6REQA 1DJPA 2MINB 3GZNA 4KLAA 3RSHA 2JLWA 1GNLA 5BN5A 3LT2A 4ZANA 4BVEA 4DHEA 3PKIA 3H0KA 3CZ5A 4N01A 1HG1A 3EAGA 4W8GA 4GNRA 1LBIA 3R8FA 1AKMA 5BWCA 3MHTA 1OLOA 1UXIA 2W37A 3FI0A 1UXKA 3WYEA 1ODTC 3GZTB 4FQ7A 4G0NA 3FPFA 3AJDA 3LXXA 1N2HA 2XQIA 2VAMA 4DKXA 2WAOA 1O87A 4LZAA 4KXFB 3AVTA 4QXAA 1KJNA 4PLPA 4CU5A 4MQFB 3TR0A 3USES 4FHFA 5AK6A 3RVOA 4C0WA 4JLSA 1ORWA 4IWYA 1YK1A 1V5WA 1XVVA 4WCFA 3E9MA 3SQLA 5KOJA 3FPLA 3FTPA 4G97A 4R05A 3L7LA 3LVBA 1KEPA 3DSRA 5JE8A 4TT3A 1PFWA 1O3YA 3ZV4A 4MI1A 2SKCA 1PGNA 1SURA 1TK3A 8ATCA 2H1VA 2PBZA 3P7MA 1FSGA 2FSGA 2PL5A 1O5TA 3DHNA 3PYXA 1F20A 1L8LA 2W6OA 3L77A 5ETJA 4HBZA 3ZOZA 3DR5A 4YUXA 4JDUA 3G2KA 1OU4A 2EF0A 3TGWA 3WLAA 2PR7A 1P17A 1F1BA 1TA4A 2D5IA 1VKOA 3NT5A 4H6VA 3UO8B 4DA7A 2AOWA 3QTLA 4KX3A 3GL9A 4QODA 3JAMA 3NDPA 1KVUA 3EXHB 3PVZA 4ZEOA 1H2FA 3MW8A 4MVWA 3BMOA 5AJTA 1NAIA 3SBOA 3ZK7A 10MHA 1DELA 1AKWA 1VG1A 2XODA 2OMKA 1V7QA 3RLFA 3E58A 3EISA 2CHVA 2IEDA 3W8EA 5KMGA 5LLTA 1EESA 1PT6A 4C4YA 5K8IA 2Y1GA 4ZDJA 3IP5A 4MEAA 4OXRA 2YWDA 2PWZA 2DWQA 4I19A 1KI4A 4OMCA 4M9ZA 2Q99A 3Q9NA 3HA3A 1KY2A 1LTQA 3A2MA 3MTIA 4LWPA 5ITZA 1QP7A 1G19A 2VCHA 2R1UA 2HK9A 3HO6A 2FZCA 5TARA 4L78A 5JQGB 1M0EA 2VH2A 1ZI6A 2PV7A 3F5DA 4EBFA 5HSGA 1IY1A 4G5SA 2WTUA 3C6KA 1OH8A 4RACA 3OZWA 4ID3A 1K5PA 1HNWB 3NDIA 3H9BA 2RHDA 4DAOA 4ZTBA 1GUBA 3JASB 2JA1A 2YXBA 2HGSA 3S28A 1T4MA 3P27A 5J4LA 3HLTA 4ETWA 3FGZA 5AI9A 2WOOA 4XR4A 3JAWA 3V7NA 1ZG3A 2ZTLA 1II9A 2Y67A 1GPDG 4XSVA 3LUHA 3HEBA 3B3QA 2FRDA 3IUYA 1E3QA 4LSZA 4PNHA 3RREA 5B12A 5IUNC 4X94A 4AICA 4JITA 4EGSA 3QKSB 2IHVA 1BE8A 3I72A 3IIJA 5KYVA 5FUQA 4TQUS 4AF6A 5KJCA 4GQAA 3P9CA 3SYMA 1JDBC 1P1CA 2NO5A 3KSMA 3FRIA 1G5IA 1KK1A 1ZD4A 4LC1A 2VL7A 4OB8A 4BZZA 4YPVA 5D5HA 2C2MA 3PUVA 3GEHA 2H2IA 3S8EA 1AC5A 4GNKA 3O31A 3ETJA 1IIBA 1W5AA 3CZQA 1UT6A 2FWBA 3CJRA 1KMCA 4U2FA 2QP9X 1POWA 3I2HA 3QLEA 4HC4A 3VGPA 3BSSA 3FPCA 1MG0A 5HFNA 2J5KA 4CR8A 3CZMA 1P4RA 1OXBB 3DMGA 2OAP1 3P96A 5AJYA 4LJSA 4J0EA 1E7SA 1SVLA 1OZFA 2H9IA 4FLFA 1P5FA 3AC0A 5KQLA 4CJXA 1TFRA 3ZEIA 1J06A 3U7QB 4QFDA 2WQZA 1ODFA 2ZM5A 1E79D 4PC6A 1ZGBA 4FGJA 1SBZA 5U9CA 3ETNA 5BSRA 3VR5H 1MMFB 5COAA 1TM4E 4EZIA 5LXTB 5A3RA 2Z9BA 2YV2A 4HNHA 1WBBA 2JK1A 2PANA 3TRJA 3OTGA 1GCGA 4HYEA 3BQNB 3H1PA 1GTMA 1GO2A 4DR3B 3HUTA 2IBSA 2C98A 3KJFA 1FRVA 5JSKA 2JFHA 1UPBA 2EWVA 4WD3A 4CIWA 4H15A 5JD3A 3LUPA 1RRCA 4K3VA 2GD1O 3V8RA 3G2HA 5SYMA 5JLJA 1B73A 4BGDA 5FCDA 2AVDA 3CO5A 2PU5A 1TQDA 2ETXA 3K30A 4UVEA 2REBA 2FVXA 3NHUA 3MCTA 5BQ5A 4BKMA 3DD5A 2Z57A 4AT1A 3AHFA 4ZMBA 1MUUA 5ITWA 1N78A 3ILHA 2JI7A 3FDXA 3I5MA 1XZHA 2VSNA 4PZLA 5DMHA 2JCSA 3C98A 3D3WA 3DBVO 3EUWA 5LP6A 1PBNA 5J4YA 2QUBA 4F3YA 3EVEA 3PC3A 1IHDA 1GSIA 2C29D 2CD9A 2WKWA 3KSAC 1LFDB 2R2AA 3DZCA 4BQOA 4E2WA 3TLZA 1NUTA 3D6NB 3FJ1A 5EJ7A 4Y6RA 3KYDB 2DUWA 1OAKA 1Z5UA 3E8SA 1J2EA 1TDJA 3J80A 4NAVA 1RP1A 1CJKC 2GUWA 4H3VA 4XEHA 1J4AA 2H4ZA 1DCMA 1YQQA 5D00A 1PR4A 1P2GA 3AUSA 2Q62A 2DQSA 3EEOA 3F4LA 2Y0DA 3T7AA 1P1FA 3NCTA 1KBQA 3A06A 3L07A 5GWXA 1KYQA 3CR8A 1DDGA 4HNAB 4B4UA 1ZQ1A 1NN1A 1U3UA 3B85A 3GEDA 1LX7A 2FPIB 3DKKA 3WLEA 1IJFA 4J8PA 4E30A 2FEWB 1U02A 4FW9A 1DAEA 3I09A 4AMVA 4D26A 2XOXA 3ELBA 4RY2A 5FJIA 5DHAA 3EH1A 5TMDA 4LK2A 4D1YA 4FHEA 2C78A 2ILVA 3HB0A 1JEDA 4ZGBA 5AQ1A 1I4WA 1R5OA 2JIPA 3MLBA 4P7BA 3M8KA 3DP7A 1QF6A 3Q15C 3GQBA 3HEMA 4RA6B 4G9EA 3BAZA 3GI1A 1B8PA 2BI8A 3A6KA 5DX1A 4OHVA 1IK6A 1KKMA 4KMRA 4D46A 2AEEA 4MEBA 2GN4A 3U7RA 4AKHA 3CF4A 2FVYA 3UA4A 4LJ7A 1S6YA 1BDIA 4NC9A 4R16A 4K81B 2R6ZA 3BERA 3I4FA 3NTVA 4DSTA 4ZRNA 2O2CA 2O2DA 5J3JA 1AA6A 3QVKA 3TLYA 2Z9CA 1T8PA 2FUG6 3WRYC 2IEIA 2UYHA 3DCNA 4O4JF 3WIOA 3HFGA 3QMMA 1K7XB 3ZHYA 4N8EA 3TQTA 4EUKA 5KYYB 4KPYA 2BKVA 1NNI1 4TKUA 1NU8A 2PMWB 5FPYA 1SCDA 4D2IA 1DBVO 3ENVA 4Q82A 4X20A 3VNVA 3GP3A 3J7AC 2YWJA 4IINA 3VOTA 4JLPA 1W35A 2OKCA 3T7IA 2NO4A 2TRSB 3E2MA 3DFUA 4PSCA 4A2QA 2YHBA 4HLQB 2ZW9A 1T0JB 1KI2A 3QVWA 2FP4A 4IXTA 4KDFA 1PFKA 3MAAC 4IXDA 4KI7A 4PQRA 2GAFA 4RYDA 5THKA 1GQ2A 1ZJZA 1H2YA 3OZCA 2JG3A 4PFSA 5FNVF 1RXYA 2FZ4A 1SPXA 4PBTA 1LK5A 3VKVA 4MLZA 3BX1A 3GCDA 1A9PA 1W34A 1JG7A 3H4IA 3NEYA 3WNBA 4MUEA 4ZT5A 4DWOA 5IMSA 1JR3A 1QHYA 1PEYA 3DPIA 1SUAA 3OZEA 4Y2VA 1L7PA 3ZIUA 2MYUA 3R09A 4F2WA 3KQUA 3C1TA 4A6DA 3WOVA 5J47A 1IONA 3VR3D 4B3DA 1Z2NX 1UMKA 2PGJA 1IBCA 3KT0A 2FG7C 4XM2A 2R60A 1ADJA 1CF2O 4EP1A 1QR2A 2DG2A 1A5SB 3ITEA 5KNBH 3G68A 1RXWA 5M5BA 2O1SA 2PAAA 2PLRA 2OV3A 4DZZA 1G8JA 2Y99A 2WHYA 3T06B 2B61A 4WA7A 5CMLA 5E6RB 1QPBA 2O7RA 1L5QA 2JPDA 3OQNA 4UHEA 3VO2A 3P9KA 4EQZA 4PSUA 4KACA 2PX4A 3HL0A 1FB5A 5IU6A 1QGDA 4C04A 1AGPA 2CDBA 2ZCUA 3R5KA 4K87A 5L95A 4EEKA 1XDUA 2P69A 3RU7A 2BVNA 2HTFA 2XRMA 4GG1A 2AOUB 3H97A 3H1BA 1FVOA 3UMSA 3W2IA 1WJGA 1HT0A 4M8NE 1F48A 2E1PA 3B2EA 1TYAE 2QZ9A 1SUBA 4KGVA 4OHYA 1XEXA 2BLNA 4MIKA 3NC0C 4G2NA 2WV7A 1RBZA 4C87A 5HM8A 5ALFA 2QN3A 3W3AH 3GFVA 1LD3A 1F3OA 2J4FA 3HQ4O 3I12A 3Q8WA 4NDAA 5I4KA 3NRCA 4G1CA 1YFLA 2HWXA 1FLDA 1G20A 3HGTA 2WFLA 3GF4A 1P2FA 2AEFA 3LQQA 4I08A 1P0MA 4L9AA 3RS8A 3ZNNA 4BDSA 2J3IA 3KHKA 3IXQA 3D2CA 3R3VA 4JA0A 4RGQA 2YV1A 2IXDA 1IBSA 1XMJA 5CNIA 1CBUA 2JFQA 5EFOA 4DIMA 4EJ6A 1WHSA 1C3OA 2J7KA 3KYCB 4G6ZA 4MTCA 1JI0A 3FYHA 5DH9A 3WGKA 4Q47A 3NRJA 3QSGA 4NZPA 4PWZA 2PT9A 2EVWX 4M9UA 5EHIA 3AINA 3ZDRA 1NXXA 1L8QA 1N8NA 2GD6A 4JU8A 4YP7A 4X00A 3DAPA 3DHWC 1Z0UA 4LVUA 3Q8XB 4CYMA 1T2AA 2UUAB 2QRMA 4OI4A 2ZPTX 4YRFA 5HA5A 2HT6A 3D7SA 1QB7A 1SEVA 1SXHA 1IEXA 3LXMA 4YDSA 4C9BA 4DS3A 4I36A 3FOFC 1Z0FA 4UHCA 1VRWA 3L40A 4NZZA 1B6TA 1ZCZA 4Q7QA 5B30A 1Z63A 5T6BA 2W0SA 3O4IA 4KIUA 3UIEA 1UDWA 3Q3HA 4HS4A 1N6PA 3IVXA 1NULA 3JSXA 5EUCA 5LLDA 2Z43A 3PNBA 4Y0AA 1F7UA 5JS1A 3RUPA 1HZZA 3SC3A 1D9ZA 1QO0A 3I32A 5DZSA 2QQEA 2DQYA 2JI6A 5JXJA 4UREA 3SJ7A 2QTNA 4BGIA 1F4LA 1NSTA 4IIFA 2R00C 3LGXA 1KQGA 2BFEA 2PZFA 3PX3A 4G0ZA 4P82A 1U1IA 4F92B 4G81A 4G0UA 1SQSA 3FF1A 4FMDF 4UDOA 3VC3A 2G4LA 4HTAA 5FTJA 3DV0B 1Q0UA 4FOLA 4OQFA 1FTSA 2H2HA 3ZDZB 1E96A 1JIIA 2D8AA 5DXFA 1MJGA 1US8A 4F9TA 3PKJA 2X0FA 1LZLA 1FDOA 1U2DA 3LW8A 2GYVA 2JEZA 4YMTA 3MXTA 1XKQA 1VPLA 3FPBA 3OQVA 3W0LB 1NNSA 4RPCA 1VIMA 3E27A 1FZQA 2PK3A 4AJKA 5L4LA 2AT1A 3D8RA 4H7IA 3P9IA 4RTJA 4JEHA 4IGIA 3KAPA 4E5DA 4MKIA 3RV3A 1ADGA 1BDMA 2I4MA 4JBGA 5JJLA 1UF9A 5IEBA 1PBTA 3QXGA 3MGCA 4MGEA 5TPZA 3RFFA 4OHOA 1WBDA 3G9ZA 3FMIA 2Z8YM 4UMEA 4YCMA 1U2SA 2CFCA 3QQ5A 1MU0A 3M5CA 1RI3A 3F2IA 4D9JA 5FQOA 4XCXA 3UWPA 4CCYA 3HJGA 1ZLYA 3QH4A 3F6SA 4L27A 1GL7A 2JGDB 4IUBS 4JSTA 4QBTA 3T7KA 2HU8A 2XUAA 3U7JA 3QWBA 2N42A 1XTUA 1GG9A 1PZGA 2SKEA 1HYEA 3AR2A 4QT4A 5ALEA 2X41A 3HKDA 3UAOA 4A82A 4CEIA 5JDCA 2HJHA 1CUDA 5AW1A 2CK3D 4MQ6A 4PIVA 5ESWA 1A9OA 1T8YA 4WBNF 4LDZA 1EWKA 4WZBB 3KEGA 3FCAA 2C2HA 4I2NA 4BMVA 1D5WA 4BCBA 1CU1A 1I14A 2F7SA 5EHQA 4Q1EA 1I5RA 3BXEA 4TN1A 3S3TA 2BFNA 4N9WA 5TMPA 2HCBA 3L4KA 1ECJA 4XFJA 2ZE5A 2C77A 3HV0A 4D92A 2GZMA 3ZLUA 2YHIB 4ED9A 3GWGA 2AD1A 1KHHA 1XP5A 1H2BA 1JTVA 1GGNA 2H57A 2VOJA 3H17A 4NJMB 3ZQKA 4EBBA 4Z7OB 4YMWA 4KVAA 4DWWA 3WIDA 1LPNA 2WD7B 1KYTA 2NSDA 2A1UA 4XLZA 1RQ2A 1JEJA 3GHYA 5JDIA 3N6RA 3ZDDA 1AIPA 2Y2VA 4N7JA 4AQDA 3FTDA 4FNMA 3FCYA 4L0DA 1J0CA 4P33A 2AWOA 2RAUA 4NG5A 3ZBTA 4HQ6A 5AQEA 5HGXA 1IVYA 3TTVA 3PE3A 4AMYA 2HV9A 4RHTA 1V5EA 1QK4A 3VMFA 1N1MA 1GZ3A 2W11A 5HJ2A 4OKIA 3ZE7A 2G28A 3SE0A 1VSQA 1U7WA 1NLZA 1ZWKA 3N5KA 4I1YA 4OB6A 3KG2A 5D84A 4EVRA 3HZHA 4F4IA 1VM6A 2CXOA 1II0A 4MW5A 4Q01A 3QPAA 1FQWA 2J31A 1R64A 2QMYA 3N8KA 4PZEA 1I24A 4EA8A 3MUEA 2HQ1A 3OD5A 3SFVA 4EUFA 1GV1A 3K9CA 1JG3A 4YPFA 1PE0A 2H08A 4MW7A 2UXBB 1Z5PA 4JLNA 2VCYA 1Y5MA 4PLFA 1CIJA 3AEQA 2Q41A 4JMPA 3HCRA 5EMNA 3TNJA 4A9AA 5IUJC 4X8LA 4TLMB 1A98A 2L0XA 2YN4A 3TB6A 1DU4A 1TT5B 2LXNA 3CKLA 1O97C 2OVBA 3TSCA 5AKIA 1L5ZA 3H42B 2NU8B 1TRKA 1U6JA 2CJXA 3CH4B 1PEDA 4BUJA 4KWEA 5K99A 2Y9MB 4WZ6A 4EPRA 2OBNA 5EEGA 2FK7A 2WU8A 3K2EA 5H80A 2YH2A 3CN7A 4X63A 5L3QB 3CO0S 4FDVA 5LA6B 2A5FA 2GVZC 2E4VA 3NIDB 3R0ZA 4ND3A 3G2QA 3GEGA 4O2LA 5FUBA 3UGQA 1OYYA 5LWHA 2A9KA 3M6WA 5HJEA 4YP0A 2JAUA 4ZU6X 3SHWA 3ELUA 2ECFA 3KM0A 4DR2B 4O4JA 5DYTA 4QNMA 5L7YA 5FFNA 4HQNA 2PRJA 1ZUNB 2I62A 4H27A 1PR1A 4QYIB 1YHZA 1RWOA 2JIOA 1OGYA 1ZH4A 3T0IA 2WWWA 4W63A 4G3XA 4JYCA 1C3EA 1R5BA 2QOEA 3RSZA 3PSAA 5AVTA 2GQ0A 1UEXC 4OHFA 1UK6A 2FRXA 4JX9A 1T4GA 5EHGA 1IK4A 3VR1A 4BECA 1JVSA 1J5XA 1WPXA 4JOCA 5CB6A 3DWFA 3OLQA 3KQKA 3LT5A 2RD2A 1E7RA 4YCSA 2I91A 1MA0A 3A26A 4HBGA 3I2GA 4KGDA 1Q0QA 5DBIA 4DWVA 1BXRA 4EW1A 4OLAA 2N75A 3AV0B 3BIXA 2HSEA 2XE8A 4F9GA 2HGZA 2HA5A 4WFKA 4MGYR 1CDDA 3CZ4A 4F86A 3FFBA 4RVDA 1XWIA 4C88A 1E5QA 2IOFK 4GMXA 4PGHA 5HDQA 3W9YA 2UUCB 3QTBA 4CIXA 4GLOA 1SXJC 5UKDA 3ZGVA 1MA3A 5ERGB 3TFQA 5LMUB 1VRVA 4H7FA 2I7CA 1SOMA 4R2JA 3CX8A 3MXOA 3NWOA 3ITDA 4FWBA 2NSLA 5EE0A 3RV4A 2CBZA 3OQIB 3G9UA 1ZCJA 2GCGA 3FB4A 3UXHA 1LQUA 4DLRA 1IHXA 2MOKA 1FLNA 4IJUA 5LZ7A 3V1TC 5JNWA 5LQJA 3TNFA 4MIOA 2C5FA 4ZVRA 1EVEA 4WADA 2G0AA 5P8WA 1H2AS 1FYVA 1V26A 1O96B 4ZVLA 3P2JA 5ALTA 1C14A 1EDBA 4LOAA 2IU3A 2P6NA 1AO3A 1SY7A 4FKZA 2QQ5A 1SUDA 5T41A 4AJ9A 5KDOA 1KO4A 3RFUA 4QHYA 4GAEA 3NKVA 2BC9A 3RAPR 4UQPA 5JVDB 1SHJA 1Z8HA 1Q1AA 1QO0D 3DOUA 3IT3A 4FHZA 4GVLA 3W6OA 4ZALA 2FZ5A 5AOBA 5A9SA 2QAGA 4MUAA 2HRRA 2K2QB 2PGIA 3FPHA 1XZEA 1Z06A 2AC4A 4DYDA 1QWOA 5EJ6A 4QBGB 1AMUA 2FPLA 4BKOA 2IJGX 2ZROA 3DEYX 2WJHA 1GPYA 3EB9A 2EL7A 3ZHQA 5HG0A 2I66A 3IUSA 3Q5DA 2ECOA 3QXCA 5DV9A 2EKDA 2FQWA 1BKSB 2UV8A 2ZETA 3EZFA 4GRAA 4Y6SA 5LNK1 221PA 2OBLA 4IOMA 3WJ2A 4NCXA 5AHOA 5B3JC 2YWRA 3BCHA 1EX6A 3RARA 4YYEA 3AR8A 1QQTA 2VNJA 2RKOA 2WHRA 4LJ8A 1GU1A 3WJAA 3LRTA 3RO7A 2QZ4A 4J1QA 4XJSA 5F23A 4US2R 3BBPA 3LCVB 4LZWA 1LV7A 2VKTA 2YZ2A 2ZSUA 4LNUB 4KQHA 3Q2KA 2YASA 3I34X 4YLEA 1T6ZA 2HXYA 5FI0B 2H0RA 3AKDA 1FTGA 2X77A 5IHPA 2P11A 4IIBA 3ZY5A 2R6GA 5KTTA 1RLJA 2AYZA 3RKRA 2DEUA 5LZ5A 5TPZD 4IIVA 1TCBA 1VKRA 1RRFA 1BXKA 1DX6A 1NP3A 1UXGA 1YIOA 3IDOA 5JYBA 4DSAA 5K8UA 6PFKA 5KJ1A 1IN7A 5FA5A 3NV7A 5EE1A 1KEEB 4KYTA 2ZAYA 4BO8A 5LDHA 4L72A 4JV5B 2AXPA 5EXDA 1I2DA 1VGQA 4TKVA 5FPKA 2PG3A 2PX2A 2FSFA 4WFQA 4Y6LA 1JEOA 1LDMA 1UM8A 2SHKA 3GJ7A 4PBRA 4X7MA 3EWIA 3VV3A 2ZPAA 3EGEA 3JWEA 4I2VA 3RVJA 4WGGA 4RWEA 3BL6A 4KW7A 1Z7BA 4XQGA 1E63A 2FW6A 1V5GA 2DZDA 2VP5A 2VWPA 2Z56A 1DE0A 2NU7A 3UQZA 1OASA 2EWMA 1YULA 1CY2A 1QG0A 3AUJB 3BJZA 3SNKA 2CBXA 1C81A 1VLHA 2O52A 3KUXA 3N7UA 2C7GA 2XNHA 3PRYA 3VPSA 5DEIA 4CKBB 4MRMA 3GVHA 1O94C 1OGJA 5JCOC 4H7PA 1PNTA 1RABA 2R8PA 4K6KA 2V5VA 4I9NA 4HLDA 3THXA 4MMYB 1NUQA 3TKAA 4GXTA 1EAMA 1JLMA 3L5OA 5AK0A 1U4OA 3N05A 1BN7A 3G13A 3MM4A 3QU9A 4J7CA 4AMBA 1EBBA 3IMGA 1YJXA 1E62A 4IKOA 4TTVA 5ED4A 2EG5A 2C7RA 1NI5A 1GG8A 4V02A 2JKYA 3STHA 4WZZA 2Y76A 3GUUA 1YRYE 4QGSA 1KYWA 4XX1A 4BFVA 3COJA 2V7PA 3FX2A 4MLCA 1NTRA 3FUCA 1ZHFA 4WN3A 2Z3ZA 4RVCA 4ENRA 1BA2A 1L7NA 4XLTA 3D3EA 3PUIA 2NGRA 4FTWA 4LRQA 4RLFA 4TVOA 4Z3DA 2QUHA 1DAMA 3HPQA 4DV7B 5BSFA 3AMVA 4RADA 3KHTA 4IIJF 3S2YA 1SA0B 3HDQA 3OLCX 4BFUA 1KYIA 4POAA 2A2ZA 1JDNA 2M6SA 3HHPA 2NAFA 3OX3A 3MB5A 4R9SA 1BMFA 1K27A 1ENOA 4K6CA 2O23A 4C03A 2OV4A 4HWOA 5HIKA 1YGPA 2UZ1B 2CL5A 3SKXA 3NAQA 4KREA 2XZTA 5JFTA 2F3QA 4X6XA 3M4JA 2VJAA 4O0MA 5GAJA 2JC3A 3ER9A 5E9AA 2CXQA 3RBXA 4LYJA 4WOPA 4A26A 4ZZ2A 1PNVA 1FRZA 1PEKE 4FCCA 4XVHA 4BZWA 4E1BA 1V48A 1FJHA 1ORVA 2V5AA 3TO5A 4F7WA 1KAQA 2WT8A 4YP6A 3SIPA 3BA1A 4R40A 2ZWOA 1ZPDA 2CNDA 2BTQB 2M32A 4PYLA 5EHNA 1RFGE 4EG6A 4H3SA 2EYUA 1MF7A 1QLWA 2G5PA 4BMPB 2E4AA 3TLJA 1Z6GA 1OR8A 3VAYA 4G36A 2ZYRA 1TNDA 3RFXA 3CNNA 1GCUA 4BX3A 2C0PA 3PF9A 3AM5A 2Z95A 3NHMA 5J4VA 2YTZA