4P7FA

Mouse apo-comt
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
213
structure length
213
Chain Sequence
GTKEQRILRHVQQHAKPGDPQSVLEAIDTYCSEKEWAMNVGDAKGQIMDAVIREYRPSLVLELGAYCGYSAVRMARLLPPGARLLTMEINPDYAAITQQMLDFAGLQDKVSILIGAPQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAVYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
total genus 69
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4p7fA00
9MHTA 3CGGA 5CVEA 4DCGA 1ZG3A 2V7EA 4PYNA 5EPEA 3VYWA 3BT7A 1AF7A 3FUWA 2ZLBA 5LQAA 4PCAA 5BXYA 5CCBA 2O57A 5JUWA 4HTFB 2P8JA 1RI5A 1N7JA 1X1CA 4RTOA 3FYDA 5FHQA 4KIFA 2IGTA 1M6YA 3DLCA 4KW7A 3OCJA 4OQEA 4P58A 4R05A 2AN4A 3UJAA 4CTJA 4UOEA 1AQJA 4DF3A 3NWEA 1TW2A 3M6VA 4L7VA 5EEGA 2G72A 3BKXA 3CC8A 3UA4A 4QTUB 2ZZKA 4HG2A 4RVDA 3HCEA 3M6WA 4RWZA 1RI4A 1QZZA 2WA2A 3EGIA 1VP9A 2NXJA 1N2XA 3HCBA 5EZSA 4GEKA 5EC8A 2GH1A 3HNRA 3K6RA 5T64A 2IP2A 3ELWA 1KPIA 5HFJA 5CUQA 2IBTA 2BR3A 2K4MA 3P9IA 4MQ4A 3I64A 3DMGA 1NE2A 3NDJA 2OB1A 5GM1A 3EVEA 3ELUA 3LX6A 3FUUA 4FSXA 3EVAA 2XYRA 3CJRA 1F3LA 1ZHFA 1H1DA 5EKUA 4MHTA 2PX8A 1XXLA 2I7CA 1PRYA 3DXXA 3ORHA 5EVJA 3LECA 5E8RA 2CWWA 4CKBA 3LCUA 3P97A 3KQSA 3LBYA 1X1DA 3I58A 4KWCA 3KQQA 4M36A 4HC4A 1QYRA 2O0LA 5C9ZA 2ERCA 3PVCA 4GOOD 2YTZA 4P7GA 2AOXA 4DA4A 3G2MA 3UZUA 3BKWA 3HCCA 3C3YA 4H0NA 4OA5A 1ORHA 5FA8A 3VC2A 2IIPA 2C7QA 2PKWA 2B25A 3BWMA 1ZQ9A 3GRZA 5EMLA 2HR1A 3GNLA 3T7SA 4BY9E 2QY6A 2IFTA 4R8SA 3P2KA 2OO3A 4A6DA 3E7PA 1JQDA 1DL5A 2I6GA 3O7WA 3MB5A 3E05A 2O07A 4OA8A 1B42A 1VP3A 2YXEA 3B3GA 3FTCA 2NP7A 3DUWA 5EOVA 3RODA 1WY7A 1NBIA 4RTNA 2PWYA 1EG2A 1DUSA 1BKYA 4QQKA 2VDWA 4PWYA 4V0QA 4MIKA 2PV0A 3NDIA 3R24A 3EVGA 5LQCA 5DXJA 3AY0A 3LL7A 5E9WA 3KPWA 4PONA 4QDJA 4BP3A 4GUAA 2UYHA 3TRKA 3KU1A 4HGYA 2ZBQA 3TR6A 3NMUF 3EVBA 5K01A 2HV9A 1L1EA 3HM2A 4PYMA 4ER5A 3JWIA 3OE5A 3LHDA 3S68A 3H2BA 4R6XA 2YX1A 5DM4A 1VL5A 1NV9A 1JG1A 2CL5A 3HTXA 2DPMA 2OBFA 3Q87B 3SX0A 2PY6A 2ZIFA 3FPFA 5CIYA 1VE3A 3DLIA 3RIEA 4BP1A 1EAMA 1R8XA 2PBFA 3DMFA 3SSNA 4ER3A 2XYQA 2GAFA 5BW5A 3THSA 3OPNA 4DQ0A 2P7HA 3EVFA 5IH3A 3SXJA 5K05A 2CMGA 3DP7A 1XCLA 4XUEA 3BXOA 5EMKA 4C07A 1NW8A 3THRA 3EEYA 3I5UA 2YVLA 2XBMA 4PYIA 2NP6A 5LQRA 1JSXA 3TM5A 1UWVA 1U2ZA 2PXXA 2O06A 3E23A 5FA5A 5K0NA 4ER0A 2BM9A 5E2AA 3DULA 1G60A 1VPTA 5FUBA 1G55A 2ZFUA 2OYRA 3NJRA 4RTLA 4CTKA 3CJTA 3CJQA 3G5LA 3PX3A 4QVGA 3EGEA 1JTEA 2UYOA 4CWAA 4RTQA 2PX4A 5E2BA 5F2NA 4LWPA 5DRYA 7MHTA 5ICGA 3R3HA 3M33A 2ZSUA 1KR5A 5EHGA 3BGDA 3PT9A 5CVVA 4RX1A 2LD4A 5DTRA 3MTIA 4C03A 8MHTA 2AVNA 5EQJB 1TW3A 5GIPE 3FTEA 1BHJA 2ZTHA 3G89A 4GOLD 1YFJA 1NW5A 1YB2A 3CVOA 3BZBA 3EVCA 4HGZA 5HILA 4LWOA 4X60A 3V8VA 3FUTA 5KVAA 5HIKA 3EVZA 5D1NA 3GCZA 2ORED 2IBSA 3L8DA 4BLWA 3TM4A 2B78A 5DLYA 5LQNA 5LQKA 2C7RA 4ATNA 1XTPA 3HA7A 1IXKA 4E2ZA 4RTRA 1G38A 1I9GA 1JG4A 3DOUA 5DT2A 2UZ4A 4AZTA 3PB3A 5ERGB 3SSMA 2OB2A 3R9XB 3AJDA 2P35A 3U81A 5MHTA 5DSTA 2IH5A 2Z6UA 4B17A 4U7TB 3ERCA 5B1SA 4C4AA 5K0FA 2IDJA 4DM3A 5FADA 5CVUA 2GS9A 4R8RA 2UYQA 3JWHA 5HIMA 4BLUA 3DMHA 3GRVA 4RV9A 2OZVA 2AOWA 5FCDA 1DCTA 5HIJA 2NXEA 2CKDA 4X41A 2PGXA 4FT2A 3BGVA 1RI1A 4KDCA 5EEHA 2XYVA 4V0RA 3LCVB 2GB4A 3ELDA 2AOUA 2WK1A 4OX9Y 3KPUA 5D1HA 5U4XA 2BM8A 4RVGA 1D2CA 3MGGA 3P2EA 5K8VA 3SGLA 2QYOA 3LDFA 3REOA 3A7EA 3FRIA 3MHTA 3FZGA 3MERA 5HIIA 2H00A 3UJBA 4C06A 4ER6A 2JHCA 1MHTA 4QQNA 3LSTA 5KS2A 2YQZA 2ZZNA 3GU3A 3KQVA 3TOSA 4U7PB 2P3LA 5K0JA 3KR1A 2UYCA 5DWQA 3RW9A 3UJCA 1SUSA 4XUDA 3IYLW 3D2LA 2I62A 2Z6AA 4XCXA 1QANA 4PYLA 1EJ6A 1KPGA 2AN5A 2EX4A 4FR0A 1RJEA 5C0OE 2ZIEA 4PYQA 3ANXA 1KP9A 5DPMA 1JQEA 3P9KA 1ZKDA 5P8WA 3EMDA 2P1DA 1Q0SA 3KR0A 3E8SA 1JR4A 2ZBPA 5HZMA 2B3TA 1JSZA 1R6AA 2PXAA 3G2PA 2IH2A 3SSOA 1QAQA 2HNKA 3PFHA 3UWPA 4E31A 4AZVA 5C1IA 2OKCA 1R74A 4RYLA 3TKAA 4RTSA 3GJYA 2FK7A 4E2YA 3B89A 3G8AA 3R0QA 4C05A 4POOA 1V39A 1L3IA 2FHPA 2WA1A 3ME5A 1O9GA 3CBGA 2P3QA 3FPJA 1Q0TA 2PLWA 4FT4A 5DM2A 2ZBRA 3C6MA 3I9FA 3KQYA 4RTJA 5G02A 3T0IA 1JG2A 2OPBA 5DX0A 5DM0A 1KXZA 3HA3A 4MTLA 1X1AA 3IHTA 4FSDA 3CCFA 4F86A 3DXZA 1NT2A 3EVDA 4CKEA 5DX8A 5CVJA 3BUSA 3PX2A 3TFWA 2KW5A 5T67A 3KPVA 3KHKA 3IEIA 3NTVA 2B2CA 1UIRA 1Z3CA 3OU6A 4QDKA 4PGGA 1NW3A 3TQSA 2GPYA 2R6ZA 3R6TA 2FPOA 2VDUE 4X61A 1M6EX 4M37A 3LKZA 3VC1A 3HVJA 5GM2A 5E1MA 1L3CA 2XVMA 3GIWA 3KQTA 1G8AA 1Y8CA 4HH4A 2ZULA 2P3OA 3FPHA 5ICCA 3HVKA 1WXWA 4LG1A 2G71A 4E2XA 4XUCA 4AZSA 3KQPA 3M6UA 2AOVA 5GP1A 5M5BA 3IV6A 4CXMA 5GWXA 3MCZA 3OU2A 1D2HA 3C3PA 4C04A 3UJ9A 5LR6A 5GINE 3FTDA 3G88A 1I4WA 5T6BA 2PVCA 1SVUA 1AQIA 1RJFA 2ZWVA 5DRTA 3PLAE 3DTNA 2N47A 3DXYA 4IV8A 2PJDA 4DZRA 4DKJA 2ONZA 5F2KA 1JQ3A 1P1CA 5GOZA 3G8BA 5LQUA 3NVKI 2ESRA 5E1DA 1EQAA 1L9KA 5KYGA 5FTWA 2Z6QA 3UFBA 3TKYA 4GC9A 2GLUA 4AZWA 1EIZA 3OZSA 3I53A 2AOTB 3LDUA 4YMHA 2QM3A 2YUIA 5FWDA 3C6KA 3OU7A 4CKCA 2O05A 3A27A 1FJXA 1R00A 4F84A 1PJZA 3EMBA 3OFJA 3VSEA 3HCDA 4YUXA 5LQJA 4RTMA 2JH9A 2ZIGA 5KQSA 4QPPA 3NWBA 1YFLA 2ZZMA 1XDZA 5DTQA 1FP1D 4Y30A 3FPEA 2P7IA 2Y1XA 2YXDA 2BZGA 2AR0A 1O9HA 3GXOA 1SQGA 4GBED 3EEOA 1RI2A 4HRAA 3HVHA 2HMYB 4PINA 3B3JA 2AZTA 4BLVA 4AUKA 4GC5A 5EGSA 4YV0A 2ZW9A 4YUWA 3O31A 3ER9A 4AX8A 3QOWA 4X1OA 3P9NA 1UFKA 2EJTA 1KYZA 3B5IA 5F2OA 1X1BA 5HOQA 1HMYA 1XJ5A 2H1RA 4E2WA 3P71T 4KDRA 1X19A 3NW9A 2IDKA 4WXHA 3LPMA 3P2IA 2HWKA 1SUIA 1VBFA 3BWYA 2JJQA 3GRYA 4PYKA 4QTTB 3UJ7A 2AS0A 4RTKA 3SVZA 1G8SA 3G7UA 1FPQA 1RJGA 2QRVA 4IWNA 4KIGA 2GA9A 2P40A 5EIWA 5GIOE 1G6Q1 2A14A 5EMJA 2B9EA 2FCAA 1ORIA 4WVLA 4RTPA 5HEKA 3DH0A 3SM3A 2ZCJA 10MHA 3KR2A 1OR8A 2FRXA 3P8ZA 5E1OA 1XVAA 1FP2A 4F85A 4ZTBA 4PGHA 4P7KA 3BWBA 4YV1A 3GO4A 5LSAA 4FS8A 4X63A 2AOTA 2ADMA 2VDVE 3UJDA 3SR4A 4E70A 3MQ2A 2FK8A 4JXJA 5IKMA 3Q7EA 2VP3A 5CM2Z 5CD1A 3GRRA 2HTEA 5K0EA 3LBFA 5EZQA 3DR5A 1XDUA 2NNWB 3LKDA 4NECA 3QV2A 2JH8A 3AWIA 4Y2HA 2IPXA 3UJ6A 1INLA 2JHAA 3AXSA 4KVZA 5K0BA 3OZRA 2EFJA 3V97A 3GWZA 1I1NA 2JG3A 2BR4A 2ONYA 1R18A 2AN3A 3BGIA 5EKXA 1F38A 1D2GA 3JWGA 4P7FA 3HP7A 4Z2YA 1KIAA 4EMSA 3HCAA 3M6XA 4KRGA 4YMGA 3HA5A 1SKMA 2BR5A 2FYTA 2QRVB 5EG5A 4HSGA 3PS9A 5DXAA 2PX2A 2OY0A 3X0DA 4YV2A 3LCCA 3T7RA 3P9CA 4IKPA 5FHRA 1NW6A 2PXCA 3KKZA 3UJ8A 4YUYA 2G70A 2EG5A 2PX5A 2IH4A 4ISCA 1VLMA 3FUXA 3PFGA 4M38A 2ZVJA 3A26A 3ID6C 4IV0A 4M7RA 2DULA 1FBNA 3FUVA 4RVHA 1VQ1A 3MCTA 3TMAA 2AVDA 5DSXA 3FRHA 1NV8A 1NW7A 3CKKA 3A4TA 2BH2A 4OBXA 3ER8A 2VZ9A 3TLJA 2NYUA 3EGVA 4ER7A 5ICEA 3GRUA 1WZNA 4PYOA 1YF3A 4LECA 4GOMD 4MWZA 5EHIA 1MJFA 2PT6A 5ICFA 3A25A 5BP7A 4A6EA 5JR3A 1AV6A 1P1BA 3LGAA 1P39A 2C7PA 2PWPA 4O29A 1QAMA 4E30A 3PTAA 2YXLA 4GF5A 4K6MA 4EK9A 5K03A 4PIMA 1BOOA 5K0GA 3G2OA 3HCFA 3OZTA 3FTFA 5DX1A 2XVAA 4RSRA 3UBTA 1XCJA 1HNNA 2F8LA 2G8NA 3EPPA 4OBWA 3JWJA 4C08A 4GOND 3NVMB 1ZGAA 2V74B 1M0EA 3KR9A 5FQNA 3BWCA 2EJUA 5BW4A 3SMQA 2NXCA 2VS1A 1N7IA 2OXTA 5KQRA 4YUZA 3OFKA 2QE6A 3M4XA 2H11A 4PYJA 5FQOA 2I9KA 1YZ3A 1IY9A 1YUBA 4EQZA 2C7OA 1KYWA 4PNEA 4PIPA 3TPZA 1ZGJA 3LDGA 4QVKA 1RI3A 3FYCA 3G2QA 3MTEA 4PCLA 4RVFA 3HEMA 2PT9A 5H02A 3UA3A 4EVIA 2CMHA 5FULA 4R6WA 1TPYA 1L3BA 1R8YA 1P91A 1VIDA 5DTMA 5K0CA 3O4FA 1IM8A 4DMGA 4FP9A 5E8JA 5E9QA 3WSTA 2Q41A 1SQFA 3F4KA 1KPHA 4HTFA 4DCMA 3GDHA 1WS6A 1WXXA 2P41A 1BC5A 3B3FA 1JTFA 3AXTA 3HVIA 3QOXA 3T7TA 3KPJA 1SG9A 1XDSA 1YZHA 3B7PA 5EIFA 4YUVA 2AOUB 4E33A 4OQDA 3KQWA 4EKGA 2ZWAA 3K0BA 4FZVA 4P7JA 2Y1WA 1EJ0A 5FWAA 5CCXA 3G5TA 1NKVA 3KPYA 3A7DA 2NXNA 4GQBA 3C0KA 5DM1A 5CVDA 1RJDA 5E9JA 5EMMA 3ELYA 1KHHA 5E1BA 3GGDA 1O54A 5K0LA 3KQOA 2YR0A 4E32A 1QAOA 4EKIA 3OE4A 1T43A 2JHPA 1JG3A 2PSSA 3MAGA 4FGZA 5K09A 2G1PA 3M70A 2R3SA 3KQMA 4G56A 4QPNA 2E5WA 1WG8A 3FPGA 1NBHA
chains in the Genus database with same CATH superfamily
1DO0A 1TJNA 3GP3A 4L3VA 3KS9A 5DI3B 4DC0A 1E3DA 2VKQA 3SPXA 3D1LA 5IAEA 4KX3A 4YPVA 3MGBA 3RBVA 5G1OA 3U44A 1TO2E 4OFZA 3RRZA 2Q49A 4WKPA 4JI4B 2SKCA 4OLBA 2O3RA 4CQNA 2E4WA 4HF7A 2B0JA 3L8HA 2VSQA 1Z06A 3BXXA 1PR2A 3ED5A 5DULA 1W25A 1Z0IA 2FN8A 1ZEJA 3BRSA 1NYTA 1O87A 4BP8A 1QIJA 2I78A 3M6VA 3LQYA 4OFWA 5EEGA 1G6HA 1GA4A 4EO9A 1EI9A 4QU5A 2IDMA 1HG0A 3TO5A 1Z0UA 3RANA 2J7KA 2BEVB 4QOJA 2VJPA 4DLYA 2QVGA 1VKRA 3QUSA 5FIUA 2JIZA 2J5RA 3AZPA 5EC8A 3HNRA 4LE1A 1CZKA 3ECSA 2P5YA 1FOEB 4FHCA 3FMVA 1CUXA 3H9JA 4YQEA 4ZI5A 1CE8A 1RBYA 3CRZA 4UHCA 2HN9A 4KN6A 1IY1A 1MJ5A 1RVDA 2BY4A 1EHCA 4W7SA 3HBAA 3EXEB 4AU1A 2C5EA 4FIDA 1KO4A 1GP2A 1YS2X 3M5WA 2NSJA 3M49A 3NDJA 4E21A 3NIDB 4GO1A 4RWEA 3SJCA 4DY4A 5AHWA 2VHEA 1L4GA 1Y7LA 4DPLA 3P27A 4IQGA 5E8RA 2O8BA 1KF0A 1A96A 2JLBA 3PV0A 1O94C 5B36A 3DW3X 2PLNA 3QYJA 1U0RA 4YIHA 1HSZA 1UDCA 2C03A 2ERCA 1ZVQA 2ID4A 4JMLA 4P7GA 2AOXA 3LV8A 3OOHA 4TS4A 5HK8A 1E32A 1DXYA 4GI1A 4ENQA 4QGSA 5A4FS 4F93B 3U80A 5JBIA 3NXSA 2C78A 4O4IF 1QCZA 1U2EA 3T1NA 3OZEA 3ZWWA 4XWOA 2JGEA 2WILA 1JQDA 1DL5A 3L04A 4KQIA 3V46A 4B7ZA 5A5VA 4I50F 1DFHA 2NO5A 3HZRA 4ZVOA 2WB2A 4AMVA 3M82A 4M83A 2JFUA 4TMFA 1CHDA 3LC7O 1QVWA 2NVWA 1OWMA 2D0PB 1XTUA 4IFIA 4AP9A 5F76A 6CHYA 1VPLA 1XZHA 4QQKA 1QV9A 3QXGA 4D6YA 1YBFA 4IDNA 3GNTA 4K03A 4PY2A 2WWIA 3VI4B 5CA1B 4L4SA 4AI6A 1F0YA 5IW8A 2TMKA 4KQ9A 5JCJD 3B2NA 1W5BA 3P4UA 4CMKA 1VTKA 2ZYUX 1PWHA 4LJ5A 1NKTA 3V4FA 3S1LA 4HGYA 3AOEC 4GDFA 2FN7A 3EVBA 1TIKA 3U2QA 1QFYA 1SXJB 2XZTA 1V5WA 3K8OE 1JG1A 2H1IA 1N1EA 1I7LA 2RG7A 3AFOA 3BD9A 4HQRA 4J1NA 1WBBA 3SX0A 1W5AA 3RC7A 5GVSA 2FZ4A 2WM2A 2HEGA 3L93A 1BMTA 4O3MA 5F3RA 1I8TA 3E9EA 4Q6BA 5KNCH 3OMLA 3I8SA 1GZ3A 1PGQA 3EEIA 1C80A 4H6WA 5LOVF 4GZ3A 1SZCA 1MW8X 1U9YA 3OSZA 2J9ZB 2JRLA 1FC0A 3BULA 2O6HA 2QRHA 3KFVA 3Q7IA 4MRSA 1NVKA 2V7UA 2VHJA 1G8HA 4FOOA 2CF5A 3S2GA 1TCVA 2OA0A 3A1SA 3W5UA 4PPQA 4BAUA 3LWBA 3FOZA 3IQIX 2K6GA 4I5IA 8GPBA 1Y1KE 5J4YA 2X40A 5AVSA 3ZLBA 1UANA 1YR7A 2NSYA 1QK5A 3MVEA 4EMBA 3J7TA 4IQ0A 1G21A 1V5FA 4LYGA 3EXEA 1GPJA 1G55A 2XKAA 4EY6A 5EHXA 4R9RA 2XB8A 5JS8A 2O5VA 2PA0A 3P26A 4RXTA 2OD2A 3A1FA 5FFFA 1TGYA 1TM7E 3AM5A 1JTEA 1H0RA 5H4GA 5CCEA 2QMEA 4HLDA 1LSUA 3A1UA 3K0HA 2J30A 1C29B 4R2IA 2FEAA 3KJEA 4TSFA 3RR2A 3KSDO 4QUGA 1DC5A 1A7UA 3N6XA 2NSLA 4CKXA 4QASA 3RV3A 4DUPA 2NXWA 1ZIOA 3D6NB 8MHTA 3SE0A 3B1KA 1WMFA 2XT9A 4N1AA 4W9NC 3CNNA 3R76A 4AY5A 2J85A 1KOJA 4IDOA 1E3WB 1FRQA 1ZL2A 1NW5A 3KZKA 1QGDA 3I6QA 3F46A 5REQB 3MS4A 5K3OA 3F8TA 5BWCA 2UV8A 5KUTA 3AY7A 1NUUA 5IN4A 5JH7A 4OHPA 4HNQA 3ZIDA 2HU7A 1Z8NA 3CEPB 1JAXA 2OECA 2V9ZA 3TM4A 4BLWA 1JFSA 4TZTA 4DDWA 4DDUA 1PTKA 2H59A 2ZWOA 3IAUA 3DOUA 1YVEI 5JSZA 1Z29A 1LRLA 5DSTA 1Y3BE 5EIBC 1R5NA 3E9ZA 3RJTA 3B7GA 2A1UB 3H86A 4UBLA 1G1AA 4JBIA 4GRIA 2YMQA 1J8VA 3DQQA 3IVRA 4X91A 4CV0A 3BIOA 1VE6A 3GFBA 3P0FA 1P62B 3WV5A 1GXSB 1JRLA 3MUEA 2EBFX 2F9MA 2BOVA 4HXGA 4YLGA 3RSCA 2AE2A 3Q5EA 1DELA 1ZZGA 4PAOA 1E3JA 1EG7A 2QVBA 2O48X 4RVGA 2J32A 3GQBA 2XZDA 4JQZA 1Y9EA 2W43A 3AHIA 3I52A 2QP4A 3JS5A 3LDFA 3UQYS 5JISA 1JB1A 3MHTA 3L7AA 3QE3A 4I1YA 3ZDEA 4K9OA 4EDFA 4PTLA 2BE9A 4C06A 1X1TA 1CVIA 3C4QA 1ADJA 4TTQA 5BN4B 2QTCA 3AF1A 1R88A 2AF3C 2DPHA 1S9HA 3H2SA 2CLCX 2VUIB 4BTLA 4TYWA 1GCOA 2OT3B 3KR1A 2UYCA 1E4EA 3AFHA 3D81A 2IYVA 3RW9A 4NCHA 5AIAA 1ZK2A 5BMOA 2I62A 3DFUA 3PHJA 3H2IA 1BE6A 1PZGA 4N49A 4TLLB 1QLJA 1T9GR 1W0KA 3G68A 3R3YA 3VPSA 2OBLA 3EWSA 5DPMA 1I36A 2I6QA 3OIFA 4KP7A 5I9MA 1JR3A 5KHAA 3SKYA 2W0SA 1M34E 3KOXA 4UPEA 3KZMA 3SN6A 4ESOA 4CTMA 3PPVA 4WFKA 1DTWB 4DRZA 3DPIA 2J48A 3CB4A 1SU8A 1XZPA 2WWXA 3GB9A 2PXAA 1QHNA 3JQ9C 3MILA 3FWNA 1H5UA 3HJGA 4PZCA 4Y1FA 3TGPA 1PLJA 2ZQ5A 1TF7A 3H0CA 4ZDKA 4RYLA 1C4XA 3T5BA 1K92A 2RI0A 4KREA 2OMEA 1WBJB 3IT2A 4WOKA 2B20A 5TF0A 5JCOC 1DLJA 3GMIA 2CYCA 1Z7YA 1PBNA 5K2OA 1U94A 4KKXB 7AT1A 5K8LA 3LPLA 1BVYF 5KBYA 2DUNA 2ZBRA 3I9FA 3WGGA 3ZWYA 2OKGA 2X5JO 5DIFA 3JPYA 5L3VA 2ANBA 2W2PA 3HA3A 1E0JA 4BXOB 2R0QC 2JI8A 4CN9A 2YWBA 3H0EA 2P0EA 5FLEX 1U7DA 3R6LA 1U98A 3ZGVA 2HJRA 2R1TA 1ONBA 1GTG1 5IFLA 2X8WA 4CG1A 4I55A 3CX8A 5JVDA 2OHXA 1ZM9A 3ESZA 3TKLA 2ODEA 1ZICA 5FL3A 3I2JA 1JHUA 4BLRA 5DN6D 4XFDA 4K5QA 3O82A 4TROA 4IVNA 5EHNA 4BU1A 1T29A 1FSPA 2H52A 4JI5B 2GM5A 4HYYA 5DH9A 5C53B 1L4UA 4KR6A 4M89A 8OHMA 1WNFA 1MO4A 4MA5A 2VTBA 1G8AA 1RJ9B 2MYNA 1U7HA 3FPHA 4S1TA 4B1FA 1Q2UA 3F5FA 4BNXA 4DJDC 2NW6A 2ZWMA 5EZYB 5J40A 1W36D 4RZ3A 1HDGO 2V7BA 3CLVA 5LBIA 4TT3D 3RSGA 4P0PB 3M6UA 4KQFA 5E6SB 2Z2KA 3PEYA 3VKHA 2PKQO 3JZDA 4UEJA 4EW3A 1A1SA 2JEZA 1RR6A 4PFKA 3G8CA 1HPLA 2WYUA 3AI1A 4E6EA 3SYTA 5J2TF 3TMKA 4TN5A 4XDHA 2JAHA 1CUIA 1ODTC 3V8BA 3GV0A 5JYBA 1SKBA 3QTTA 3UIEA 2WWHA 3KKMA 1SK9A 3DP9A 4TQ9A 2QKYA 3KKQA 3WHPA 2HMWA 2REXB 1YZQA 1DQYA 2XSZA 3IILA 3M2TA 2AG6A 3GFQA 3RFFA 1COZA 5JO9A 5MFPA 5GOZA 4DC1A 3GYGA 2GOYA 2NSHA 5AVVA 1T3GA 4FSHA 3BBLA 4XQ0A 3W2HA 5AVRA 3FPCA 1SG6A 3L1VA 5FFNA 1QFJA 1WABA 3C39A 1F6WA 2AOTB 2R1ZA 3BMCA 1A5TA 1RCTE 2X5OA 2QV0A 4Q1AA 3IDAA 3KAQA 5ELMA 2PIAA 3STHA 1YA4A 5DP2A 5EJ2A 3ZE1B 4ZCSA 4AT1A 1GWNA 3PCXA 4HYQA 3GX1A 5K6TA 1HT0A 4ZFNA 1XZQA 3VR6H 1NP6A 2HRCA 1BTOA 3ESCA 3GFSA 3HXKA 4DNFA 5GTDA 3K6JA 1A4IA 5HOEA 1LTQA 1C41A 1UZMA 2H92A 4PSKA 3IIEA 3JV7A 2B4AA 4EF5A 3HVHA 2GPJA 4TLCA 2CV1A 4TYQA 2D5CA 2I6TA 3SBOA 4YRZA 4Y0VA 4ZODA 5KAPA 4ARSA 1X2EA 3UGKA 1ORWA 4IDAA 2O52A 4NV1A 4FFLA 5DYNA 1JFVA 1GR0A 3ZZTA 4E2WA 5BQXA 3P71T 3KLBA 4CCYB 1K2VN 3DOFA 1QE3A 3GRYA 2WJPA 2JVIA 2D2VA 4M1WA 1JHYA 4CLOB 5A4JA 3FYTA 3RG2A 2NO1A 4KTTE 2VUTA 4O5AA 3W4IA 4YQYA 1TEXA 3SZLA 3AHHA 2H2HA 3LS2A 1NZJA 3VPGA 3VNVA 1I13A 1HK7A 4D92A 1N5MA 1OLXA 1RC1A 5DW0A 1XVAA 1KA9H 1LPAB 2PBZA 2AFHB 1DEXA 2VJCA 3HKBB 2G76A 5CBPB 3VAYA 4TRMA 1YQXA 1SCJA 5DP1A 1XRSB 4G0UA 4XJXA 3MQ2A 2FK8A 4MO9A 2WZDA 5BPHA 1D6JA 1O4WA 5ISMA 4N18A 1OXTA 1DFGA 2HTEA 3N1UA 5CM2Z 4PX9A 1E92A 3AUUA 4R3NA 1XMIA 4HYTA 4PC3A 1M1YE 1M1YB 2AMYA 1A50B 5EKTA 3Q8WA 2W4MA 3RFXA 2WD7B 5KJ1A 1GFWA 3VVBA 3EG9B 4BQQA 3P96A 2VRBA 3HCAA 3BRWA 5C7YA 3AQ4A 3FOEC 1QE0A 1F6BA 1SOVA 1KQPA 5A1JA 2AR7A 5H5JA 2WUVA 3OUUA 4CKBB 2NVUA 4I4TB 4XGIA 1JEYA 4IEEA 1VLQA 4JBHA 1K6JA 2Q4OA 2ZYTX 4IR7A 3GLHA 3TX6A 4FI3F 2DTEA 3A11A 3M1IA 3ELBA 3OZGA 1WRBA 3MQ4A 3ID6C 2Z2ZA 5KDDA 5AYVA 3AHJA 9LDBA 4U6QA 5LU9A 2BEUA 3ZTWA 2VK1A 3CW8X 1T8SA 3R3ZA 1YK0A 1B6SA 1FSFA 2GRJA 3TMAA 1QYWA 3U60B 5DNAA 5BNWA 5JAOA 2JDIA 1O6BA 4MLPA 2DERA 1I4OA 2BH2A 3OPYB 3E9YA 3PNPA 3GLIE 2JB9A 3M9WA 3HR4A 5BQFA 3KJFA 4DA9A 4XB1A 4MQMA 5BSMA 5LB2A 2H1OA 1FYWA 1EQUA 3NBAA 3RVDA 3TRFA 1QCYA 2PWPA 3TB4A 1U8UA 5I7VA 4EK9A 3H5WA 4IXMA 3IAS1 4JH0A 2K2QB 4TX1A 4AY6A 1DOAA 3R7WA 1NBOA 1SMKA 2VTVA 3HCFA 1RHJA 1TYEB 2I87A 3H5IA 1U7ZA 3OG9A 1PQUA 4V39A 1IPFA 1ZH2A 1E1MA 4ZCMA 3UBTA 3TRHA 5A6VA 1UFVA 3ZLJA 2Y1FA 4OIMA 4WX2B 2C31A 2H5IA 2IKQA 2GTHA 3KZCA 3STUA 1PSWA 2JAPA 3GDFA 3KR9A 5EJ9A 2JGMA 2ZDHA 3BE8A 4BP9A 2WIGA 1N7IA 3X1YA 4YYEA 5FTLA 4NFLA 5JQGA 2BUBA 3IIIA 4Y2GA 5KYWB 2OL4A 2Y27A 3QPUA 4MDFA 1KDPA 4C7OA 1H4VB 1NM5A 2GCEA 3AETA 3B1JA 4PIPA 4RVFA 2HA2A 4PZPA 4IUCS 3RASA 3VO8A 3W6UA 4B8ZA 4MS4A 1TPYA 1OI4A 1R8YA 1WB4A 2HCRA 2GEUA 3ZDDA 4XTRA 2YQ4A 5JBNA 1OIWA 2XXJA 1QHXA 1EZZA 5LD2C 2D7CA 4AB1A 3KXDA 4IF6A 2I2FA 1KS2A 3B3FA 1GRQA 1UXIA 1IWOA 2Q4TA 3ZW9A 3O83A 4BO5A 1HYEA 1XDSA 3C6XA 1GKKA 3GROA 4DCSA 2A0FA 3GWGA 4TWZA 2D4AA 3Q1KA 1NUHA 4JU9A 4OQQA 1QHGA 4QOSA 5KNLA 4MWDA 4B6RA 1U0LA 3O8NA 1DC4A 2J08A 1T4BA 1QP8A 1AK2A 3M0EA 4M76B 5J1TB 3I9V6 1U0OC 5UKDA 1ESCA 3FVWA 4XR4A 2QLJA 4RKQA 3N0WA 4E32A 1A7KA 3JD3A 4JIGA 1YIOA 2A57A 2XUHA 4AF6A 3K31A 1J07A 1CFJA 1DKQA 1UK7A 3SXUB 1XEXB 4BEBA 2R751 3AVVA 1BEEA 2RHCA 1SCUB 3CPSA 1KFCB 3ZR4B 2NSDA 3Q9LA 4PEVA 2NLOA 2RB4A 3UUGA 4UHDA 3V9AA 1U5AA 2RHDA 3GP5A 3MUFA 4YASA 2ZJ7A 3KXKA 3UUEA 2W6JD 4F2WA 4AYXA 1COWA 3FROA 2ZTVA 4O2AB 1W29A 5CGQB 4OATA 2ATXA 3WJAA 3KEFA 5BXYA 1CDOA 2HWWA 4TLAA 5K3SA 1RRCA 3EXHA 4GLJA 4WBNF 1C8BA 5ALNA 4RDXA 1C4OA 1M2VB 4ZDIA 1SCNE 3AB8A 3G7NA 5MDHA 1HLDA 3MWEB 1TW2A 3NWEA 2XT6A 5L4LA 1P29A 4EJSC 3HFSA 4OM8A 1A9XB 3DW1X 5C7IO 4HDKB 1Y63A 3WO0A 1K06A 4AJLA 3I9JA 3ZD9A 1JHQA 4YCJA 2OHHA 5T64A 1IOVA 3UATA 2IQIA 4WIAA 3ILHA 3THYB 3ANNA 2IU3A 5AKEA 1U04A 1HY3A 1LSOA 1WDLA 3HNPA 3KWLA 4JBGA 1KK0A 3EVEA 3WIUA 5BSWA 5JVDF 3FUUA 4N3CA 2WFLB 5ES3A 3VZDA 1U0GA 1ZHFA 3A1WA 3K73O 4XIJA 4P33A 2NN3C 4KQEA 4LPSA 3W6NA 3EH2A 1QLHA 4A8PA 5CDYA 5MFZA 1TM3E 7ADHA 3AYXB 2OCLA 3R6WA 1ADFA 4WA8A 1C7ZA 2Q1SA 3CNQS 4XAQA 3OWHA 4YJ3A 1TAGA 4OB8A 1IQPA 3G49A 4MCAA 1UDWA 1JJIA 3WYFA 4KPGA 2V45A 5ERXA 3L6EA 1EXMA 3JQBC 1C3OB 3PQFA 5B58T 4FYJA 3FIJA 4I36A 4A2PA 1GGFA 2NUPA 3LC2O 4ZQEA 3EF1A 2QF7A 2Y67A 3V5NA 1LRJA 3B70A 3OESA 5E6RA 3E7PA 4A6DA 3AI3A 1DI0A 1QR2A 1XF1A 1WY5A 1R6XA 3GBPA 4FYKA 1IZZA 3RTCA 1DT5A 2FG7C 3CH4B 4ALLA 1N1MA 1ZMXA 2YXEA 3G2IA 4K9LA 5B7PA 4MGHA 3BSYA 3CH7A 1O57A 3JALB 1SVIA 3E7XA 3FTCA 3I30X 4N65A 4OK3A 3RODA 4CYMA 3M5CA 3VR6A 3LLUA 2V0GA 5KSOA 1DUSA 1Z4PX 4U9HS 2JFPA 4ETNA 3L1KA 9ABPA 2D13A 2MTBA 2E48A 3TQHA 1ORDA 3EVGA 4QVIA 1SA0A 4LV5B 3KHUA 4WJKB 2YICA 2EEPA 2HHCA 2JGRA 3FGPA 5JD4A 2PWAA 4RULA 5AXAA 1TT7A 1P1IA 4TV9B 4MHSA 1N3LA 1YZUA 4LCEA 5K01A 1L1EA 2NAFA 1WNTA 3GLHE 4MVJP 4XPZA 4MQFA 2Q2OA 2ZKIA 1T1IA 1WL8A 1NQ5A 1V3QE 4JR1A 2KI5A 2GXQA 2GZMA 4K8RB 3HLTA 1S2OA 1V8BA 1EE1A 2OBFA 2XKBA 4WESA 5ESWA 4HNUA 1JILA 2HPAA 3ESRA 3AVYA 2BMEA 4PZYA 2C7BA 3DO6A 2V7TA 3WGZA 1UQRA 4R1MA 3W6ZA 3V8MA 2DY0A 1TTPB 1YQTA 2GAFA 4I6GA 4JOQA 4L4ZA 3KYCB 5GV8A 3THSA 5BW5A 5I7OA 2VDJA 4DJAA 3DV0A 3QMVA 3EVFA 1KQOA 4LGYA 3L46A 1I14A 2NTYC 4GICA 1YBHA 4BNGA 1JSLA 2A59A 4P6VF 5IMSA 5DNEA 3PYLA 1Q16A 2BZ1A 3H8VA 3PFIA 1Q11A 4QFDA 4D8WA 3FNIA 2A58A 5K8UA 2QQFA 3GFOA 2AJLI 3M4NA 1WCWA 1Q21A 4NULA 2XZLA 3CR3C 2HA6A 2VP9A 3D6JA 1T2FA 3I3SR 5THQA 4PQYA 1E9FA 4FDAA 3N05A 2BDEA 1L9XA 1E3QA 2ZUFA 3R9KA 4GR5A 3THXB 4PW0A 1VKJA 3CJQA 3EVTA 3HU5A 4L0DA 4FC6A 1F7VA 3U40A 1CW2B 4BBPA 1PW7A 1RM5A 4HNHA 1Z82A 4W1PA 3DFFA 1PKEA 5IP5A 1OZHA 1BWQA 2GYUA 3W8FA 4CQLB 5FWXB 2ZSUA 4PLVA 1AKMA 4C78A 4BV3A 4D4GA 2LD4A 2PX0A 4G4JA 3HBLA 4R68A 1KU0A 3RVNA 1TW3A 1CIJA 2YRWA 1SVOA 1A2KC 1W2WB 2C94A 2ZQZA 5A1TA 4EY7A 1OQAA 2RC6A 5C8VA 3HUFA 4ZEOA 4LWOA 4C4ZA 3OSUA 3UFXA 3FCUB 2ZBVA 5MN4A 1FJGB 2GEJA 2W2VA 3ONWA 3T0GA 2WJZB 2NVOA 4GXQA 5E9AA 4HVCA 1M2KA 4E2ZA 4ZKDA 2QUHA 2ZYDA 1MORA 3CHYA 1DAFA 2YV5A 3ZHBA 2G5CA 2NTVA 3HY6A 4HAWA 4OI4A 5ERGB 1ESZA 3UPTA 2OO5C 2BBTA 5C5IA 1BGVA 3SJUA 1ZNYA 2GMWA 3SBDA 1CF2O 2J9YB 2GN1A 1QGUA 3ITNA 4WUTA 1E6EA 3E61A 4B4KA 4DM3A 4XH9B 2G9NA 4RDHA 1JDPA 4BLUA 3ZXUB 3ZU4A 5DIZA 3ZHQA 4NMLA 4DJEC 4ZI7F 4KQKA 2DUMA 1U3VA 1X3LA 1N34B 4U7JA 5GADl 2FU5C 1ZCAA 2GPWA 2I71A 2WK1A 2RCNA 3NIGB 1FNMA 2W2TA 4YREA 3U0BA 1VLZA 3PGXA 4IDPA 4KXXA 2HU2A 3JX9A 2GVNA 5EIEA 2JAUA 4K7JA 2QTVB 4P4SB 1Y1QA 4BO0A 1NDQA 4D9FA 2N42A 4LTMA 4BNZA 3ANMA 2H6EA 2X42A 4AKIA 4YRSA 4BAZA 5KX5A 3K1JA 1MH1A 3M9XA 4KNWA 4O4JB 2OPHA 2E4AA 3PGLA 3Q3VA 3T9AA 5LOVA 2HA4A 3ZWXA 2AIRA 1T35A 4CU5A 1PJSA 2FSSA 4IF4A 4NZNA 3CSUA 4PO1A 5IBRA 4RU1A 1KPGA 1PNQA 4Q7MB 1YGYA 2OENG 1VLJA 2ODWA 1QBKC 1I1OA 3PFNA 1UQTA 4OQFA 3SEAA 2CHQA 2ISSD 2V97A 5BN5B 4E6PA 3AUKA 3BMQA 1NF2A 3CZPA 3F6PA 4R01A 1USKA 5IABA 4B40A 2OK8A 4FFWA 4E0BA 3MPUA 1QAQA 1OBFO 1TQ8A 4HAVA 3VM6A 4KAFA 4S3MA 1KP3A 2VT6A 1SM4A 1UJBA 1WDWB 3TFQA 3VOAA 4CM8A 1JFTA 1L5QA 5HMLA 2PGIA 3KSRA 3LQ2A 2IEGA 1RAHA 4ZQGA 5EE3A 4KRXA 4U0KA 3HYTA 4ZAVA 1DLIA 4V2UA 5JE8A 5LJLA 4Q93A 3ABRB 3NUQA 4KKVA 4UC0A 1NNSA 2AXNA 1NR1A 3BVPA 3EY4A 3W8DA 1NF8A 2VWGA 1V45E 3CBGA 1YBVA 3PP8A 2D00A 3WS7A 2BFOA 1KETA 5ALUA 4O2LA 1YDWA 3ZOKA 3EGDA 3OEEA 1KXZA 5B6IA 4ZQHA 4MTLA 1XWFA 4QGHA 4E5MA 3U3RA 5ELXA 2OC4A 2R79A 5EQDA 4RJLA 1V1RA 3ZU6A 3ZU2A 5AM4A 2A3RA 4CTNA 2VYQA 1SBTA 2FFJA 1Y6ZA 1H2EA 5L7YA 1IXZA 3DWIA 2DYKA 2EIXA 4TS9A 4V0SA 1SEPA 3RSLA 4E2FA 4P80A 4D81A 4HCJA 4JB3A 3ROKA 2XCQA 5AKXA 2XRZA 2BFDB 4WKNA 2OILA 4QGFA 2C3MA 4MJ3A 3VU9B 1OFGA 2XVMA 2CLOB 2UYYA 4EHDA 4B43A 3NHMA 3DE3X 1GGNA 1N2OA 5IARA 4JXZA 3KUUA 3LW7A 4QXQA 5ADHA 1WCXA 4KU4A 4D9HA 2QGZA 3PRHA 2EW1A 3OEED 4MDYA 2OZPA 2XBUA 1CT9A 4P86A 5KKNB 5JC1A 2YXBA 2QTLA 3C1UA 3R2JA 2P3SA 4HXYA 2QIOA 2CBZA 3HGQA 1KZ1A 1C30B 3GEBA 3E3OA 3KIPA 1XJ0A 1LX6A 4KN5A 4DIOA 3BGWA 4NBUA 5JQGB 1I4WA 2RI1A 3GZNA 2CUTA 1MZVA 4MICA 2ZWVA 1NNEA 2IS6A 2WOJA 4IDBA 3EIQA 1USIA 3DXYA 1XDBA 4LRYA 2C2ZA 2NWQA 3ILXA 1W8IA 1FY2A 5EP1A 2AHOA 1LD3A 4IIHA 2ORVA 2WT9A 4JMPA 2ESRA 5E1DA 4RVCA 5A3SA 2XUJA 4WDQA 4OOFA 4CMEC 5DE3A 4F12A 3UF0A 1VBNA 1WCIA 2FX5A 4MLZA 3FNRA 1WZUA 1KP2A 1CDZA 3U7FB 3GCWA 5LQJA 3QITA 4B46A 4JYAB 3CLSC 4MR8A 3CZRA 3R6DA 4BLPA 5JYCA 1EP9A 2J6CA 2F6RA 1T9AA 4L0QA 4KXNA 4RH3A 3F2VA 1IC6A 5ALIA 3OLCX 5EZ6B 2HDWA 2Y1XA 1VJ0A 1KSHA 5IFKA 3SE7A 2AR0A 2XOKD 3EG9A 3U4CA 2JFHA 5EXXA 2M6RA 2AZTA 2ZIZA 1E1RD 3L79A 4FFSA 4MRAA 5LQDA 4NFSA 1UT5A 2WSMA 2V7QA 3E3MA 1GZHB 2F3RA 3QY0A 3RQIA 1QOPB 1T91A 4NMHA 1RQPA 1S1CA 1VKOA 3V7NA 4OD0A 4B4OA 3HLYA 2VSYA 3BWYA 1Z7WA 2FPGA 1OU0A 2I8AA 4ARAA 2GJKA 3GJ6A 3RADC 3IODA 4QXAA 3WNDA 2QT9A 1NDHA 3E2IA 3RU7A 1MDFA 3D5TA 5ANRB 2D54A 3EGXB 4MVJD 4TXJA 1FIUA 5BXQC 4FR2A 3PGKA 2NU8A 4A36A 2OGWA 4UOZA 4HVLA 2Y66A 5AM1A 5A3JA 4Q9NA 5JCJA 1LCIA 2N75A 4M8NE 4KJZA 3TBHA 1I3OA 4P4GA 5H3HA 2I9PA 2JLAA 1A88A 3UMBA 3QVTA 3GMTA 1JYEA 1XZEA 1CJUC 4JXJA 4UXHA 4C4PA 1TZBA 3F6RA 2BFMA 4BEWA 4C43A 3V1NA 5IF3A 1KY4A 4EW2A 4MWEA 1ONPA 2RHTA 5I7AA 4OI0A 1T0JB 1DBPA 5IC4A 5K0BA 5TQ2B 3FPLA 4MYSA 4XOIA 4KUHA 5G0TA 3WIEA 2AN3A 2XLBA 3PZBA 4JUFA 3QE4A 3SIWA 2O8VA 2I99A 3EIFA 1CUYA 3IL2A 1O94D 5AK4A 2OQRA 1ZD3A 1O5OA 1MB4A 2DFKB 5G40A 2PX2A 3T99A 3IRVA 1FTNA 1V0JA 3LUCA 3ZDQA 2CL6X 3OCZA 2LTAA 4XZ3A 3OX2A 3VBCA 1NHWA 1NW6A 4YIKA 3ZE8A 2X8LA 3TSWA 3DQPA 1CQZA 1GNSA 2GEDA 5K0CA 5KC8A 1VLMA 2Z09A 1GRVA 4BNTA 4PFSA 4GNRA 1Y7TA 1X1QA 3F74A 4LZZA 5HZKA 3H5VA 1F0PA 1K0UA 3QLVA 4Z8YA 1KI7A 2ID9A 4EFMA 1EGMB 2K87A 4F9FA 1UZUA 1HT2E 1XCGB 3H11A 4J1SA 4EUKA 1RQGA 3A6GA 3WOHA 4DDMA 3T9BA 1A72A 2HRBA 3ZBQA 2KE5A 4LECA 1Z5UA 3N8GA 3AG5A 3TTTA 3U7IA 3UAZA 1SULA 4KEAA 4AO8A 4Z51A 1FB5A 4R8MA 4BMCA 2A0KA 4EA6A 1ISJA 1WUIS 2QW0X 3HJUA 3PGJA 4XGRA 4ZAGA 3RF7A 1S8OA 4CG2A 2C5GA 4E5UA 2OGUA 1HKHA 2OVBA 3WK6A 1K8XB 1PGPA 4TM7A 5JJ5A 4DR7B 3I62A 1MLDA 4RLQA 2WKSA 1GAXA 3PK0A 1XB2A 2O20A 4D9MA 3JWJA 3ICCA 5TQJA 3LWDA 2V74B 1F4PA 3AIIA 5ER6A 4C14A 3DCIA 2A9FA 3SMQA 3NIFB 3V4LA 4FE7A 1GV1A 3IULA 2UXBB 5KWEA 1A0OA 5E6UA 3OFKA 4JLUA 1E5QA 1LBEA 2I9KA 5FBZA 3P9RA 3H9EO 3PVZA 2H48A 2VDMB 2SKDA 4QVKA 4HNAA 4D4JA 4R1SA 1C8KA 3KSMA 2LDBA 4E7OA 5EJAA 1N5RA 4ESEA 1JQBA 5A3RA 2OV6A 3GPDG 4DOMA 3K2EA 3O2NA 1K4KA 4I4NA 2H9AA 4CJXA 4PN3A 4FP9A 5JY6A 1NL3A 3QBEA 2WKQA 2I4IA 4EVRA 1NQWA 2XWSA 4MKZA 4K3UA 1C0PA 1OY1A 3X1ZA 5K6AC 4DBZA 1W36B 1O0BA 4O4HA 3KUCA 1KEZA 3AXTA 1NN5A 4UNNA 3V7YA 1YBAA 1TJYA 1P2VA 1OPXA 2X4GA 3NTOA 1XQXA 1A5AB 1AKRA 3B7PA 2CDAA 2AOUB 4R1PA 1AQNA 3I8XA 4L9RA 3ZDZB 1NNUA 1X8LA 2H4WA 4HWSA 1AD2A 5L45A 3JVDA 1E3LA 3OFVA 1ZU5A 1B0ZA 1VCHA 3GIDA 3KPYA 5JATA 4WINA 5LUAA 2AN1A 3KTFA 3L9XA 4IZOA 2VIIA 1LPOA 3ZTYA 2FJ0A 4OHKA 4DR4B 5D3QA 4J3JA 1WHTB 1BDJA 3NEJA 4KI0A 5ALJA 4YWHA 2VZ8A 3MSXA 4E51A 4KXQA 3CZ5A 2BMFA 2IUYA 3V3TA 4L4XA 5M04A 4PFQA 1Z2DA 3VSCA 4HUQA 4BEVA 1KGSA 1WG8A 1UJ6A 1NBHA 3DO8A 3IDFA 3V8NA 4BX2A 2XUFA 3MLAA 4HUQB 3VYWA 2Q5LA 2X9LA 2HNBA 5HDBB 2PVPA 5A0TA 5A7HA 2FPSA 1B41A 4CG3A 2PMWB 2F1HA 1M5RA 5LFAA 2H4XA 3MGCA 4TXMA 3LQKA 1GZDA 1A76A 1T6XA 2QUIA 1T3SA 4RXUA 2EQ5A 5K3DA 4KW7A 4E5NA 4HN4B 1C50A 1KC1A 4WI1A 2CFRA 1U8ZA 4NAVA 3RYIB 4Z4CA 3TPFA 1B23P 3C45A 1JR6A 4LY6A 5KYYA 1MVOA 2NT4A 3GT7A 5AKLA 1FTSA 1MW9X 2X8AA 3C41J 4M1OA 3RUDA 2NXJA 4KX5A 1N2XA 2Y68A 4RDCA 4XPIA 1RWPA 4REQB 1VL1A 1MX1A 4CL2A 2VQFB 1GT91 1YZFA 4JNCA 5HFJA 1WPQA 2XY4A 1AQYA 2FJUA 4DNPA 1NRIA 5LIRA 5BSGA 4ENSA 3T7DA 4MJ7A 3RS8A 2WT4A 1T9ZA 1XA0A 2R6R1 1IQUA 5EKUA 2HXSA 3PC6A 2EKPA 3F4BA 1F3LA 4IP0A 1Z26A 1AZTA 3VPXA 5KYXB 5BN4A 1L1RA 1XRNA 2GD6A 1D6SA 2VNSA 3CNBA 4C6SA 4DV2B 2DAPA 3OJLA 2MSNA 4YFVA 3X2SA 3EASA 2F7SA 1YVPA 3L7YA 4V0MA 3SYKA 4LXYA 4QULA 3IEPA 5D3MA 3ZHCA 4NFHA 5TMDA 1BCRB 3HWRA 4ZOBA 4ND5A 1A95A 1J0DA 2J0QA 1S2GA 3EF3A 3OWOA 3QYFA 3UZUA 4QZVA 2ZUCA 3SOPA 4CFYA 1Q1EA 1ZS9A 1M2NA 1W85A 2H4HA 2JGDA 3BXGA 1CJMA 1OYWA 2PKWA 3SR0A 1PQPA 4DABA 3W9YA 3EAFA 1TF5A 3CPHA 4FEEA 1LPSA 4LRUA 1AK9A 3TUIC 3W5IA 5G0WA 1XZFA 2OHFA 4H35A 3CCCA 3K0KA 1HKUA 3U37A 1JBQA 4ZYTA 3B3AA 3R7DA 2C59A 2ECFA 2P0AA 2QTRA 4G0ZA 4JCCA 4S2UA 3U4QB 2J09A 5KVCA 1XLVA 5CJ2A 3VZSA 5LKRA 1OJLA 1SC6A 4QPDA 2ZJOA 3OZVA 1J20A 1NW4A 2G1AA 1GADO 2PR7A 3OETA 4MINA 4KGZA 1G8KA 1ZC4A 2Q3EA 2QRJA 1EDDA 4MIKA 4BMZA 1OXBB 1XK7A 4ROSA 4FQ5A 4R71A 1UXOA 1AVTA 1XEFA 4KXWA 4QDJA 2GF2A 3CLSD 5FTNA 1L8OA 1OAAA 3NBMA 4IIFA 1YUMA 2P9CA 1C9JA 2V0CA 3FVVA 2P9HA 4C5AA 2X3UA 5BUCA 3V4VB 4QELA 5KNCD 1JPNA 1XZCA 4GZ6A 2VZLA 5AJUA 1T0UA 3KTDA 1QZXA 4RM2A 4BP1A 2Q27A 2VAVA 4IMPA 2PFSA 3T7KA 3VHQA 1Y5MA 4B6QA 1HUQA 2WU0A 2I5PO 2D2XA 3JQPA 4JEMA 3VJLA 1MB0A 4R2JA 4CT4B 1Z63A 1IL0A 3ITDA 4PSVA 3UMMA 2FWRA 1POXA 4IINA 2J9XB 3UAVA 3NWPA 1ZUHA 2OG2A 1JMYA 3FBGA 3RUHA 2A5LA 4FVTA 1SXJD 2XBMA 2J5QA 5L3SA 4TRRA 1O6CA 3W9UA 2GA8A 4CV1A 2W22A 1ORVA 4C7XA 5LQRA 5EIXA 5EZ5A 4X92A 1IZ9A 2O7SA 1HXHA 2F4NA 1G66A 3IHWA 4OYHA 3ZV3A 4WN3A 3HH8A 4PZ0A 1QJ4A 3PL5A 1T10A 2GDZA 3TCNA 2QRNA 5HP4A 4Z86A 5LQSA 1HYGA 1FMJA 1LY1A 1Q0RA 1RNLA 1MO2A 2YCBA 3KOWA 4TSKA 4LBWA 4ARBA 5B7NA 4DEYA 5IEJA 4OJTA 1S0UA 3SHWA 1G0NA 2F2TA 3M33A 2VJMB 2RHWA 3RNOA 3D3QA 3ABQB 1PJTA 3M6AA 4XSVA 4B6SA 3THOA 2HJHA 3PT9A 4C7MA 5DTRA 3OUTA 3E9CA 4MR9B 4P82A 1A9PA 3ZGLA 2BF4A 4DAEA 2ZTHA 4Y2XA 4K0RA 4HGZA 4FEGA 4YI5A 1EFRD 1XTTA 5KINB 2YWRA 2OLJA 3L40A 4FXPA 1QYDA 1HZJA 2R5WA 2PAAA 3BFVA 4GP7A 4H7EA 2FEMA 4R1NA 5D1NA 3R75A 1EXDA 1CEEA 1E2FA 3NWOA 3FNBA 5H68A 3A06A 3JQ6A 3LK7A 2HFJA 3JYNA 1K97A 2FSGA 2R7AA 3RC1A 3WQQA 3R9WA 4MW4A 4N7JA 1QTNA 2B1RA 4HEQA 4RIFA 5GONF 2FXIA 1PO7A 3I0MA 1RYDA 1CSEE 4XFKA 5IUKC 3H1GA 4U9IS 1PJ2A 1EBFA 1VYHA 2DHRA 1X7GA 4GP6A 4NDNE 3DV9A 1UINA 4RABA 2IEZA 1EVQA 2EJVA 3T1QA 4AJPA 1ISFA 1QUFA 2FLVA 3ZW7A 1AKTA 4N12A 2V3WA 3U7QB 4NE9A 3HU1A 5J4HA 2GJ8A 3PBKA 1FJHA 3ELDA 1P0IA 3I9MA 2CWDA 5B4TA 4NH4A 2WIJA 5LLTA 3ADDA 2ZYHA 4J7CA 4TRNA 3GDWA 1ULBA 1CYDA 3W6PA 1ECGA 4B33A 1LNZA 5B30A 2JD1A 4K40A 1P5RA 3RQSA 3A7EA 3AFMA 1T1EA 1D03A 3MERA 3PD7A 4MCHA 2IPLA 3IBFA 1HDYA 1Y82A 4EB6A 5DNDA 1TMKA 1RFGE 4IXWA 3F6YA 3CG4A 3F7MA 3T54A 1B6RA 3HABA 5IBCA 1P5ZB 2VCYA 2E89A 1F06A 2KBEA 3FWPA 1KWKA 3ETLA 2VHTA 3TUZC 3O75A 2YIMA 1MO3A 1U63A 1QANA 1P4RA 1GOTA 3E22A 4ARIA 1PU2A 4WVFA 2Y9MB 1UJ2A 2SNIE 4MGEA 4PYQA 3DD1A 4F9GA 1KP9A 3IHKA 5BOSB 4CRWB 2WU8A 1UKAA 4MITA 4XYEA 5LP6F 1U0HC 2FFQA 3QIVA 3ETGA 4UM7A 4XSGA 1URPA 5FOQA 1ZYUA 3DEKA 4DLKA 1RRKA 2ZAIA 5BSUA 3EZLA 1QS0B 2K7ZA 3BERA 1RAGA 5BVHA 1EEHA 1E2LA 3R5FA 5KVSA 4YRDA 2YNMD 1Z39A 2AG0A 1X14A 2ZSAA 3DVQX 3NIWA 2YXNA 3VSAA 3VGPA 2N0SA 2BSXA 4K9NA 2GFIA 2FK7A 4KCGA 3LTNC 3RC8A 1BW9B 4ZT6A 1AUVA 2DPXA 1XDWA 1Z6YA 4LAFA 3HP1A 4PLCA 5IDXA 4MYUA 1CVRA 2FNAA 2XWJI 2GBIA 3GYBA 3B78A 3AUTA 4KDFA 3KQHA 3FCCA 1J90A 1QFSA 5DM2A 2I3AA 4ZEMA 1GPUA 3VNSA 4WBXC 2VKTA 2DPGA 4J4TA 5BN1A 3TOZA 1QIGA 5AJTA 3UPUA 1QDLB 4DIBA 1FFXB 4PXYA 4X65B 4MRVA 1P19A 1FMTA 2BGTA 4NAUA 1DGQA 3CT6A 4K28A 4JJAA 3TTYA 4NNPA 2C0CA 4N7MA 3FAZA 3OZCA 4G8CA 4LMRA 2JC3A 1LDEA 2ANCA 2O50A 4IHJA 5JLJA 3DMDA 4B3JA 1WHSB 2IYNA 1IK4A 3AHGA 4HAYA 3TW8A 1C81A 1NVVQ 4B6FA 3PQ2A 2A9QA 2GX6A 3WYAA 1PN3A 2W6ZA 1DAPA 1KKLA 2A86A 3MSCA 3CIOA 1NUSA 1C4WA 3WL8A 5BR7A 4QBGB 1Q0HA 4KXFB 3WWZA 1RZ3A 3SD7A 3NATA 1TOAA 2F64A 1WXWA 2GO7A 3NYQA 4YECA 1HDRA 3UO8B 1QHHB 4WJLA 1I01A 2AOVA 5GP1A 3IQZA 3OU2A 2ACVA 3FNHA 3RK4A 5DYTA 3FKJA 5B2EA 4GAEA 3DKIA 2DBYA 5AUPB 2TMGA 2J0UA 4OQLA 1WOYA 4NYJR 1WO8A 2REQA 3DXFA 2PVCA 4YCAA 5F4ZA 1AKVA 4F97A 3RT9A 1EDOA 3IVAA 3FYSA 1E2QA 4KYUA 2PN1A 4LY0A 4QG7A 4QREA 3KO8A 3SM9A 1U0SY 3G8DA 2NU8B 4DKJA 2XF2A 2HF7A 3VMMA 1RPJA 1C9EA 3SC3A 1LLQA 3LZ6A 5FF9A 1F7UA 2ECPA 1A3CA 2FHSA 4P36A 1DDGA 3RB8A 1PT8A 4G5XA 3UFBA 1Z62A 3KVOA 4MWCA 2IIQA 4CMHA 5FWDA 4AF8A 3ONVA 4LJ8A 4PG6A 4TV8F 1Y6GA 1MPTA 3PC8A 2LPMA 2DWQA 3ADKA 3VSEA 5AO9A 4EHNA 4RTMA 2P69A 4MS1B 4PR3A 3IR5A 1ACLA 1II0A 2CXUA 2BHLA 3CFYA 4FLEA 4UE2A 1FZTA 1UM9A 2Z3VA 3T9DA 4MPRA 4OXQA 3WP1B 4YCSA 4BO9A 4EKNB 5DVZA 3ZX5A 3TQFA 3EC1A 2ZW9A 4AX8A 3K16A 4ZEWA 1Y4UA 4FC7A 4F60A 1LKZA 1NP7A 1YB1A 3HKDB 4DCCA 1VDMA 2IYRA 2OHGA 3KX2A 4TTAA 4EFNA 3CRMA 1V9SA 4O2BB 2IW3A 2R65A 1KDOA 4KQ2A 3OY2A 3ZHUA 2GFQA 4DIMA 3QA3E 3VZCA 1NPDA 1ODKA 5FBQB 1G98A 1C14A 2CK3A 2C2WA 3KSUA 3K4PA 2P40A 3PC3A 1I1HA 2R85A 2WT8A 4MXDA 4NEHB 4XQGA 4UNSA 5LDDC 3DEIA 1XKXA 4YDQA 3ZN2A 1ADCA 1IY8A 1RKBA 4GI2A 3JWEA 4HWRA 4ID3A 3DSRA 5AKGA 1M5TA 1HEIA 2C4KA 2O2SA 2VK8A 5CU7A 5C80A 1RXVA 2GHTA 2REQB 4XASA 4RIEA 5HG0A 4ARUA 3TQTA 5EJEA 3H0KA 1JJBA 5AOVA 5BV1A 3HKBA 3KSZO 3LBFA 1XI2A 2NNWB 3GZJA 4DLWA 3IQEA 2WQZA 2IPXA 1TYCA 2JHAA 4DPKA 4IGKA 1EGAA 1U7WA 2CK3D 1N36B 3QG5A 2X1LA 5IK2A 3SQMA 5CFQA 5EKXA 2J3EA 3G1WA 1C7IA 3RBXA 5JXGA 4N3BA 4EGAA 2XHEA 3M34A 4CODB 4IH1A 4X7MA 3VTKA 2QRVB 1Z28A 1QOQB 5G0VA 1L5FA 1X7XB 2X7XA 3JVUA 1FU7A 1CQXA 1TUIA 3L6RA 3LCCA 5E0KB 5B7GA 1WUTA 1EM8A 2NZXA 2EJCA 6ADHA 5PNTA 3B60A 4C0HA 2AFRA 2BMJA 5I01A 2JCYA 3ZZNA 5J23A 2QMQA 2XCOA 3P9ZA 4J1TC 5LP1A 2QW1A 1FBNA 1VLLA 1R9JA 2VN8A 5BV8A 4QOFA 1KOFA 3DR3A 4QYMA 5GJWC 1W0CA 4S2EA 5DNCA 3I01M 1B8NA 1W4CA 4PC6A 4EUNA 1YB5A 3FWKA 2BEVA 3T3PB 2C4TA 1T0BA 3B7WA 3U62A 4MWZA 4J90A 2PZEA 3IQHX 1MJFA 3L1UA 4LVOA 1DKOA 1RHMA 3G9TA 1CV2A 3L92A 4IMRA 4ZV7A 1QVVA 4L57A 5IBQA 1P39A 4AD8A 1GN8A 1NXTA 1QAMA 2CJWA 2QR2A 5JPDA 4UHKA 1PHPA 2OLKA 2X2EA 3BCSA 4S05A 4WV3A 4CV3A 1EFHA 1YB4A 1OIXA 2GTPA 3LBNA 3LUJA 1GV0A 1K27A 1X80A 3QRWA 4CM1A 3GLFB 3TOCA 5K3EA 1ZGAA 3JTEA 2GD1O 2O8DA 1BA3A 1E2JA 1A82A 1JFFB 2BGLA 4GOJA 1L8QA 1Q12A 2QTHA 5FR1A 4XE5A 4ZCQA 2IYUA 3HWWA 2QE6A 4M9UA 1USWA 2YC2C 3QLUC 1Z35A 5FQOA 3T3MB 1GM5A 4IIJF 3T61A 3IERA 1JPJA 2P2GA 3UA3A 4PCLA 4I1RA 1PF7E 4RPHA 5KYXA 2QPLA 3KLMX 5J63A 3MUOA 1XRMA 5C32A 3M4ZA 4TL7A 4V03A 1FP6A 2N1MA 5E8JA 4EABA 1J22A 5EQTA 2AFIA 2Z8XA 2HADA 4DCMA 3K2QA 3PEUA 3QVUA 3WGVA 3OD1A 3K92A 1QO9A 2PJUA 4M87A 1HYQA 3ZH9B 4BV9A 3PQ4A 3P4YA 5IAJA 3EZ6A 3GEPA 4AMUA 4EKGA 1MAAA 4EPYA 1JI0A 1DUVG 2BEWB 3IE1A 3F90A 1WZIA 3DBLA 1BN6A 1U0BB 1I6LA 2JJ2D 1E7YA 2QTAA 4O1MA 3U4AA 1QH9A 5DKFA 3WB0A 5KKCA 4QUJA 3VX3A 3KQOA 4EW1A 1T3HA 3Q3IA 2TRSB 3PXDA 1TPZA 3ZHOA 4EH1A 3RD5A 4DWWA 3A3KA 3TIFA 2G1PA 2GETA 4NP6A 4LHEA 3LX5A 4DQLA 1GG2A 4OHXA 5BV2P 4YMTA 1CR0A 1KJIA 3MTJA 5K8TA 1EINA 4UASA 5M7EA 4EPTA 5AQ1A 3OICA 1Q7RA 2R9VA 1T2UA 1I4EB 3AKCA 3KWJA 1PL6A 2GHIA 4YRTA 5AVKA 3EW7A 2YHAA 4Q1BA 3UJAA 1J9GA 1KSGA 1EHIA 1XYVA 2RH4A 3U61B 4DF3A 2J5XA 1JX6A 5KKAA 2I1LA 5LM3A 5BQPA 2WYHA 3DE2X 1ZD4A 4KO8A 4HG2A 4TMWA 2P6PA 3EH1A 1A8SA 3ZHYA 3N53A 4KSYA 2WA2A 4MYHA 4BX0A 5KWSA 2VJYA 5CDSA 2OZEA 1PNRA 1PD0A 3OCYA 5IAKA 4B87A 2PS3A 2GH1A 2Z5GA 5FP0A 3NXKA 1NBMD 5HKLA 1F8YA 3KTAA 4DEVA 2E21A 5D5PA 5BNZA 1BD3A 1SKQA 1QCDA 1ZMTA 2NYAA 4IHJF 2BR3A 4KMRA 2WIKA 4DMKA 1E3WA 2RE8A 5KI6A 5A7GA 1R64A 1P73A 4TUYB 2CNBA 3ZWKA 3VDQA 4G0WA 4GG1A 3O3CA 5F7XA 2O8FA 1WQ1R 3HG7A 1DX4A 4G0OA 4DUGA 3QQPA 5KNBH 2IIVA 1T9BA 1DV2A 5A5FA 3DCNA 1VJ1A 4YT4A 3ZY4A 4B4DA 4KWCA 1HORA 4ZYVA 4D41A 1WF6A 1L4KA 1ZXLA 5IC6A 2OV8A 2JCSA 1LWNA 1VYUA 2VFAA 4OA5A 3EDOA 4DWOA 1UKVY 1DARA 2GM3A 2O0HA 3C3JA 1TECE 3IR6A 4LYFA 1QPBA 2B25A 1N1GA 2ZJ6A 3W34A 2A33A 3A31A 4W5NA 5H70A 4KBGA 3HLKA 4GSYA 3H8SA 5AI8A 1TKAA 5C35A 5JXWA 2PUEA 2IS4A 3AM4A 1EBBA 1F20A 2OCIA 4P4UA 3CO5A 3AIMA 4Q82A 1A9QA 2H16A 4RD3A 2G63A 3B48A 1UBEA 3OA2A 4LDPA 3GXBA 4K26A 3H13A 3L7CA 3R3WA 5HUJA 3JAMA 4X84A 5D00A 1TTTA 3FYHA 4P08A 5CJPA 1M34A 4UU8A 1MOSA 3MYYA 1G4AE 4PRZA 4EPRA 1IU9A 4ITUA 2BWJA 1DQNA 2HHHB 4IG4A 1EESA 5A6SA 3BSSA 3PR1A 4G26A 4YYZA 3P9YA 3E84A 4OHCA 3NMUF 3W1WA 4ECAA 4QM6A 2CEKA 2PQMA 3ABIA 4QO7A 2MSKA 4KR2A 3MRVA 4L74A 1QB7A 4J07A 1Z0JA 7REQB 1J99A 1GCIA 4G0PA 3LT2A 2I76A 4UFOA 1CJKC 2Q3CA 2YS6A 4YJ2B 8ABPA 4HX9A 4BNLA 4OOEA 2FF5A 1DC6A 1Y3DE 2CUNA 3GAFA 3S99A 3VR6D 4YT5A 1RLJA 4ER3A 1JJVA 4QXOA 5TQ2A 3O8OA 1UC8A 4QIHA 4KE7A 1JHDA 4C0AC 4YXWA 2AMLA 3EODA 5IH3A 2G04A 3S8YA 5TR9A 2M2IA 3W5CA 1D2RA 2A5FA 4KN9S 5CW2A 4ALNA 4YV2A 5JPCA 1EKXA 4UEOA 2FN4A 5JT1A 3H3JA 4JBWA 3T0FA 4BMXA 4BE4A 3PDIB 2ZSIA 4WMLA 1SXIA 4CR8A 2LNDA 1BVUA 1G7TA 1ND5A 2GCOA 1DJQA 4M7OA 3S70A 2P6NA 3TVTA 3NH9A 2EYUA 2HK6A 3IO3A 3OO1A 2JK0A 2HH9A 2XUKA 1ZIYA 3IJRA 4HLUA 4OKIA 1J8FA 4UNPA 2A5GA 1L8LA 3DONA 3G9UA 1FNDA 3IAXA 4CTKA 2AMVA 2JCBA 1AIPA 4FEAA 4RIGA 2F3QA 4I5EA 4Y1RB 4M49A 3F0TA 4QJ4A 1DTSA 4RTQA 1L4YA 4FFDA 1QP7A 1M6NA 1SWWA 4AK9A 3A6HA 3VDXA 1SB9A 1X7WA 4R7TA 2VRWA 1EX7A 2VPIA 1JXMA 1E2DA 2D2IA 4AZ3A 4WOJA 3S2UA 4BKMA 1WB9A 1RXIA 2XJ4A 1FXWF 1Y4ZA 5AHOA 4CIBA 1WCIB 3DDOA 1WV1A 5HTKA 3BZBA 4YP0A 2X3FA 4B3XA 1X13A 2B3DA 2FGKA 2X23A 2XQJA 1ETUA 2IPOA 1B43A 1C3EA 3ETCA 4EI9A 3TEFA 4X62B 1GHTA 4UD6A 1KJQA 3BK2A 3LRXA 3LLVA 1XUOA 4W1QA 4C89A 3KZNA 1M0TA 1M9NA 1SKAA 1XCMA 2XUOA 4R5HA 5IYZA 3CF4A 4PX5A 5MHTA 2IH5A 1BHQ1 4CKCB 1P0FA 1PD1A 2J31A 5BVGA 1Z2CA 1ZAYA 3RWOA 4WBSA 1PZMA 1UBMS 4NPAA 3WLSA 2PXHA 2YWGA 3K9HA 3OTQA 4KHZA 1ZINA 1Y1TA 4W82A 1J1ZA 2EV9A 2PTHA 4B4WA 4FDVA 4AUNA 3U44B 1DCTA 2D8AA 4FCWA 3K1YA 4GKBA 3H9UA 1JUDA 3B1WA 4V0RA 3WFJA 4BL5A 3BTVA 5D1HA 3L1IA 2LRHA 1LSSA 4AS1A 2QYOA 3HDJA 1ZGBA 2G1KA 4RZUA 5DOZA 1V25A 4IKEA 4JB2A 2V7VA 4L6CA 3RUPA 2XHZA 2W6OA 1IVSA 1N0UA 4EEKA 2X2OA 3LBAA 4I1IA 1UK6A 2IZ6A 1YQQA 1J2TA 4ZT5A 3VZPA 2GKOA 4L27A 2VF2A 4F1WA 4GL4A 3HCPA 1I3LA 3H6KA 4C0SA 3K30A 5ARCA 2B34A 4BE9A 4C21A 4EPWA 2WZBA 2ZB2A 2DBQA 2X15A 3QY9A 1P0QA 4XCXA 1XR3A 1NVXQ 2A0XA 5JYEA 4DRXB 5HX7A 2PUHA 2GSDA 4LJ9A 4JI7B 5JJLA 2NQ2C 3ROFA 1OWLA 1YZKA 2ZG6A 1COWD 4ABTA 1U3WA 1MOZA 4P34A 4D6XA 1DBSA 1P5JA 4ZZ1A 4KFTA 1YK1A 1ZXXA 3FJOA 4C3UA 4JL8A 4J1TA 2HNKA 1GVHA 2N9UA 3BXPA 2LUOA 3ZVNA 1SWVA 4DVGA 4DG5A 5AICA 4Q3CA 4UBKA 4D43A 4C0XA 4E2YA 3AVQA 3TQOA 2VUHB 3F97A 2ZRKA 1HG1A 2GHQA 2PQ2A 2OZLA 3Q12A 3ME5A 2RJOA 1EFVA 4QUHA 4U4AA 1Q6ZA 3GT0A 2BJVA 5JJKA 5GQSA 3KQYA 1GYPA 3QF4A 5DLQC 2IGBA 2QGNA 2B6NA 4A8JC 3OEWA 1ZM7A 3TQQA 3IKTA 3FA2A 2P91A 2PZAA 3B6EA 3DL2A 3DNMA 4ZREA 4NWIA 3WL4A 2W5UA 3GLVA 1SRQA 2BGMA 1Y8ZA 3DXZA 3QLEA 1R1DA 3PYXA 4OHWA 4DREA 3HDYA 4XDYA 4WOPA 3TFWA 4BO2A 5KX5B 4P32A 3EZYA 4B8WA 4TWRA 4N6NA 5FTKA 1UIRA 5FNZA 1T2CA 3AR4A 5LKAA 1WSWA 5HFAA 4YAWA 1DDIA 1SKYB 2R6ZA 3KXPA 3ZCUA 4MPTA 3NB0A 4G5OA 5DBHX 4EA9A 3EIOA 4F6LA 2FA9A 2ASEA 2Z8ZA 4MZDA 3KYJB 4X97A 1J5XA 5DCUA 3UH0A 2ZWIA 4X6UA 3VPFA 1GNLA 3I72A 2DMRA 4HN9A 3OLVA 1EGHA 3I4CA 3FLMA 5AHRA 1P0CA 3S29A 3VHLB 7GPBA 1F5SA 1WUKS 2II6A 4RY8A 1Q74A 2B8JA 4I55F 4P8RA 4AICA 4AUMA 2QN8A 2Z3WA 3DD5A 3D1JA 2L0XA 3E3AA 3H9GA 2COUA 3K5WA 5CEJA 1QONA 2ZTMA 2BJHA 1ZBQA 3L4BC 3MCZA 1FRFS 1YVUA 1Z6XA 5JS1A 3STVA 1RAFA 4IDFA 4M1ZA 3KC2A 5AJHA 4ZOQI 4JBLA 1ZVVA 3PLAE 3ISVA 5A3QA 1Z6AA 5DJ5A 4D4MA 2UKDA 3S7ZA 2PWBA 3WGMA 2IHNA 2NAPA 2O1XA 3G8BA 2Y76A 5LQUA 3ANYB 3IT3A 1OC2A 4FUTA 4J0GA 4UVIA 5F1OA 1CHNA 2ZQYA 5AVJA 1M2OA 5FYQA 5AMXA 3AM1A 1H9CA 1OFUA 2RHGB 4ND7A 3AB3A 4M98A 2F8TA 5B12A 4GUDA 1O77A 2KLHA 3I53A 3A70A 3N87A 4FMDF 1U6IA 4JODA 5E95A 4H77A 2X4LA 4MV7A 2W8BA 4K2HA 5JSZB 3OFJA 1MT3A 3HCDA 4HDQB 1A5SB 5LZ2A 4MVJA 8ADHA 1IIRA 4OJQA 2O3UA 1U3FA 1P6UA 1GDHA 4X90A 1DBQA 5L3QA 1CTQA 2Q6OA 2WP0A 2YHIA 4B81A 4U7DA 1QF9A 3OQMA 4PINA 3B3JA 4YV0A 4IY1A 3C16C 1H6BA 1WLSA 3WKDA 1ZI6A 1J23A 1YAHA 2EJTA 3WG9A 4IOJA 4OVKA 3U4QA 4BV8A 1NONA 1UBJS 4JT9A 3S5UA 5CA1F 5JCXA 2DR2A 2WHPB 3FWHA 4RTKA 1H4SA 5I4CA 2IU4A 5ENDA 4LE2A 3C8MA 1HDCA 1W0JA 1VE9A 2GA9A 4FIZA 4KFSA 2QAGA 4ZZIA 2GN4A 3AOEA 4HMOA 5AKKA 4RMHA 1K8QA 4RTPA 3MRTA 2WM3A 3TIIA 1RQLA 4XD7D 1GDDA 1QX4A 4WZZA 1V41E 3LO5A 3P8ZA 4WNAA 2D7DA 2A3NA 4LGCA 2ENUA 2PD4A 4Z3DA 2VC2B 3FTPA 3T5TA 3VYUB 4WZAA 5CB4A 3GO4A 4RUKA 5M29A 4W5TA 5BRAA 3OA0A 2R8ZA 3AR9A 4KPUB 4LJ6A 4CM6A 1KI1A 1ZU4A 1P1JA 4JHLA 3TLCA 4EHLA 1NRJB 3FYUB 5LZ4A 2J7PD 3D3WA 4UQPA 5K0EA 2H85A 3OOEA 3QELB 3R9IA 4QATA 1IJKA 3DAGA 2P2CA 2W37A 3E70C 1L6RA 3NKLA 4PYRA 5DYIA 2ORIA 3HSSA 4MB6A 1O95D 4H16A 3LOQA 4MS3B 4Q05A 4G1VA 2OP1A 3V97A 2BR4A 1P8JA 1WXGA 1F38A 3CBQA 2O23A 5ETJA 3LFTA 4UZSA 1DT3A 4XPIB 3U1TA 1KAHA 1ZOOA 2FYTA 2OOKA 1R5JA 1NYQA 2HMAA 4ZOLB 3O26A 2WI8A 1WVIA 3EBOA 2NYVA 2EFCB 4LCBA 3N8NA 3GY0A 4QDZA 3TLEA 4DV6B 2YWJA 4PSUA 2MR6A 1SXJA 4ISCA 2FPIB 4AULA 2PH7A 3OEHA 4KXLA 4PE5B 1IXYA 4YAIA 4IRMA 3B8HA 2JFQA 3GRKA 3RS7A 3DZCA 1LF5A 1VQ1A 3P7MA 3QE2A 2V58A 5CFNA 2O4CA 3BMNA 3OQIA 4PPNA 5JASA 5JCPA 3BG5A 4WKOA 4Q16A 3TLJA 3HADA 4ZVNA 4PX2A 1WZNA 1YF3A 4GOMD 4RJKA 2E5LB 4G4IA 3ILVA 3BB1A 2ZBEA 3NAMA 3T4EA 2RC5A 5BPFA 5AW7A 4PG4A 3T95A 1M2GA 1DX9A 1SBCA 4P5PA 4QBTA 5GZ3A 1YH3A 5E6RB 4L2IA 1GR1A 3ONEA 5CB8A 1LW7A 4AWAA 1MU0A 2C77A 4TKLA 1P2BA 2BM0A 4CIVA 4TYMA 4FJ1A 4FB4A 1I80A 2Q9CA 2BGNA 4M55A 5IUNC 5BW4A 4B4VA 3TH5A 1GAEO 3K9QO 1GN9A 2OXTA 3E81A 3I04M 3HGMA 4YJ3B 1RBMA 4Z9FA 2IZZA 1QH8B 4JP5A 4KVGA 3EXFA 1VHLA 5GV7A 4Q3EA 4AY3A 3MJSA 4J0IA 2W2QA 3FYCA 4IQFA 1W87A 3X44A 1E58A 1FUEA 1YL5A 3C98A 3E58A 3LL4A 3WC4A 5A62A 4GH5A 3DKPA 1SB8A 3HMQA 4MOWA 1IM8A 1B7GO 1WD5A 2ZUVA 1G59A 1R8SA 4HAXA 1K68A 2JI6A 1E98A 3CNHA 4N9QA 5A5EA 2X14A 1E1YA 4IIDA 3WLHA 3OIWA 3PA8A 4HZUA 2RGAA 1JKFA 3GMSA 5KDOA 3JYHA 1ZRHA 3UMGA 3K0BA 4ZGGA 1E5LA 1PFQA 2JVKA 3SBEA 2ZE5A 4BS9A 5TLSA 1X0VA 4RHYA 2ET6A 4MCJA 1FS4A 1SC3A 1OI2A 2FE4A 3U17A 1E5VA 3EFEA 4Q7LA 1RJDA 4H1WA 5A5GA 1F8FA 2OV4A 3CURA 3D6FA 1A9OA 1I2CA 5KTSA 2NV2B 2XA2A 4HRYA 3D02A 3ZDRA 1GL3A 3L82B 5I47A 4I9HA 4ON9A 3AI2A 3RPEA 1GNPA 5KTMA 3ORSA 1NC1A 3FNFA 4H1UA 4L8VA 2C4UA 3C3CA 3ND7A 3RVRA 2VAXA 4KFRA 2WDZA 4N0QA 5HJ5A 5JEEA 3UJ3X 3VO9A 5E3HA 3ZH2A 3TK1A 1IE3A 1YJCA 4DXAA 2WAYA 1K8YB 2YCLA 3K1ZA 2AF4C 2OWEA 4HLUC 2ZUUA 4L73A 4LNHA 4CHGA 1T13A 2I2DA 4CQJA 3BD6A 1X1CA 4D9KA 2ZJZA 3DJYA 3HRKA 4MW0A 4E46A 4QUBA 4O8CA 2JBAA 4G23A 1AQJA 3CZMA 3PQ3A 4I4CA 3MAAC 1J1UA 5HF8A 4L7VA 5C51B 4MV3A 2QN3A 3WKEA 4I81A 3NVDA 4EGQA 1PGNA 2CGEA 3HCEA 3M6WA 2P9TA 4QUAA 2AI2A 3CF4G 3NKVA 2PH3A 3OIDA 4PGMA 3DLTA 5IS2A 1YB6A 2YS7A 2PK3A 1LRKA 5TPWA 4BVGA 3L7BA 1C0LA 3MT9A 2FFRA 4RK6A 1K08A 2C4WA 1SC4A 2E3JA 3AF2A 3ZHVA 1N8TA 3WAJA 1SBYA 4EB3A 1YRAA 2PIDA 4RSGA 3THXA 3RYHA 1A4XA 1FMLA 2H4FA 4QYWA 1DDOA 1AMOA 1OT3A 4PLGA 2FR0A 1NIJA 1PQYA 2OB1A 2QX9A 4M21A 4MP8A 2NU7B 4U2EA 4YJFB 3SS9X 3W6OA 3X1WA 4XIYA 1RYYA 5CXUA 1FTWA 1RKUA 3SICE 3U1VA 5C4IA 2GZ3A 2VT2A 3DB2A 4RKWA 4ZAYA 5CVTA 1HOXA 2PSHA 2ZAMA 1KS9A 3A14A 2B7CA 1GSIA 2FSFA 3IH5A 4N7BA 2D0DA 4WY2A 1G2PA 3AVWA 4EYQA 2C83A 3QKUA 2WJJA 3G9XA 1DUIA 3BKWA 3E1SA 4HDRB 4PRYA 2QG6A 3VC2A 4BVEA 4LBVA 3GGJA 2CHUA 3GNLA 3KJNA 4F21A 4L2IB 1DCKA 4NCIA 3TVYA 7MDHA 2R6GA 5EUCA 1KNQA 1UDXA 2ZSHA 1O6ZA 2DFVA 1JFRA 3B3GA 3Q7PA 2A4MA 4NXNB 3KDPA 5EOVA 1G6OA 1KZYC 1EFPA 4G8BA 4XB2A 1TQ2A 4N5MA 1CUZA 2VJMA 1KDRA 4RD2A 4LA4A 1BMDA 3D7RA 3ZWMA 3Q11A 4EA7A 2JLSA 2PL9A 3IEVA 4B84A 1QHEA 4HMPA 2P90A 4XB6B 3UB3A 1XK6A 2EFHB 2W6CX 2QSZA 2ZRMA 4MKIA 2ZI6A 1IUNA 3JD1A 2ZIWB 3IT1A 4FINA 3TOVA 1SRRA 4AMGA 1JLLA 1M2HA 2JAQA 3T1YB 1ML3A 4CBVA 3TBKA 5FJIA 1ECBA 3SJ7A 1UKYA 4XIIA 3AEKA 2YWHA 3O74A 1NZFA 1YU6A 5H8WA 2VJAA 4XOUA 1FNBA 1DU4A 1IBRA 2HJSA 2CLSA 4KVAA 5DM4A 3DLBA 1QQ6A 2GI4A 4EFDA 1NI4B 2AEJA 1CR6A 3A9TA 2EERA 5F73A 4DLVA 2JARA 1PT9A 1U8FO 4QYIA 3AR2A 1XRLA 3MGKA 3LT5A 3ROZA 1QIFA 3ACBA 4OUDA 3WZLA 1GUDA 3EZFA 4XVRA 4YN3A 1NMYA 4OFXA 1T3TA 1NBME 1Q57A 3NHZA 1ACMA 4ZKEA 2I3ZA 3UYKA 3ZDXB 4EQ6B 1M54A 1CEQA 2BCGY 2ZRIA 1CDEA 1DE0A 3CF6R 3PRKE 2MYPA 2RGNC 3WGKA 3ZZMA 4UJ5A 1EBUA 2HLDD 3EUAA 3H3FA 4P84A 1O9BA 4LEIA 1MB2A 1XXHB 3OEHD 3NLLA 3OOJA 4IILA 1Z33A 1KOGA 1QU3A 4W7IA 3SBXA 1XZGA 5A9SA 1CY2A 1VPTA 1U3CA 4ZQIA 2NU6B 4ZCTA 3NETA 1XDGA 3N9IA 1TA0A 3WNCA 1H2FA 2M6SA 4LWPA 5IDQA 4L75A 4UDYX 2WWGA 2NQ8A 2W4QA 4BEJA 4KGXA 4V0ME 3OQ6A 1IHDA 2QT0A 4DG9A 2B30A 4MV5A 5AW8A 2X0NA 1FRVA 5CVVA 1EXVA 3L0OA 4GPD1 2DUWA 1QV6A 2QV7A 4Y67A 1VKHA 4UHEA 4PAWA 1FTYA 3VH4A 5EJGA 1WZ2A 3GJZA 4HPXB 3NFRA 1GQRA 2XZOA 4DIEA 4IJKA 1FYXA 1XL0A 5F9FA 2JJMA 1G38A 3GRPA 3MZ0A 1ARZA 3Q7TA 2NU9B 5IK2D 2IZOA 1ESMA 3AP1A 4Y2TA 4H1VA 2Y93A 1BCRA 1MV8A 1NQOA 4YO7A 1UKEA 1J0CA 1CX9B 1LJUA 3U3JA 4B73A 2Z6UA 3ERCA 1I5EA 4MKHA 3HCWA 3RIYA 3QZUA 5IAAA 5K0FA 3IEKA 3JAKA 3MT7A 5CIQA 1LC0A 2ZJ3A 3ROPA 1MC8A 2IOQA 3O4JA 4RIIA 3Q0TA 3FN4A 5JANA 2H5JA 2OZVA 1EVYA 1V5GA 1FSZA 2C2OA 1XZJA 2NXEA 2I0FA 3P0JA 2NMVA 2IV7A 3ZBTA 3K9NA 1X42A 4IVPA 3FMIA 1UBOS 2W2KA 4YQZA 3W06A 4AQ7A 4JEIA 4BQNA 4JJZA 4RMNA 3R3XA 1KYXA 3IS3A 4P31A 1RDFA 3PFKA 5G4KA 1N2SA 1ZZEA 3RU3A 4M0CA 3QNUA 4CM8B 5FJJA 3UJBA 3TIXB 1ST3A 421PA 1GCUA 2BYTA 3PD1A 4QQNA 1DWPA 5EP4A 4OM7A 2Y0DA 2R4QA 2ZZNA 5CA0A 2X4DA 4IH4A 4RZXA 4TLEA 1RFLA 2JLQA 2OD9A 4FD2A 4PLTA 2IPMA 3DVSX 4PZ9A 5ENVA 4ZC8A 5C8YB 5I9LA 3VHRA 1QTRA 5C0OE 2ZIEA 1V71A 3WDKA 4NQRA 3ZQJA 2CV2A 3KV1A 1T15A 3L01A 3EMDA 5L40A 1ZVKA 2PRJA 1G9SA 3RS4A 3AGPA 3T3EA 2IU0A 1JR4A 3ZBUA 1ZI8A 3REQA 4DCJA 4IS2A 3TUJC