4P7FA

Mouse apo-comt
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
213
structure length
213
Chain Sequence
GTKEQRILRHVQQHAKPGDPQSVLEAIDTYCSEKEWAMNVGDAKGQIMDAVIREYRPSLVLELGAYCGYSAVRMARLLPPGARLLTMEINPDYAAITQQMLDFAGLQDKVSILIGAPQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAVYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
source organism Mus musculus
total genus 69
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4p7fA00
3P2EA 5C9ZA 4FT2A 3MAGA 3UZUA 3C6KA 4YUZA 1TW3A 3EVGA 3O7WA 3HCAA 5GIPE 3ER8A 4AZTA 4IV0A 4QPPA 5DM1A 5C0OE 2AOUA 2P7HA 1NV9A 3AWIA 3PVCA 1EG2A 4FP9A 2O06A 3G5TA 1L3IA 3MTEA 4PYIA 4CTJA 4QDKA 2VP3A 3LECA 3UJ6A 4HSGA 3LDUA 3KQMA 5CVDA 5EOVA 2AVDA 3NWEA 3MCTA 5E1BA 3MERA 5DRTA 3GNLA 4POOA 4ER3A 3OZTA 2AS0A 1AF7A 2GB4A 3EVAA 3OU7A 4MTLA 3M33A 2O07A 1VIDA 4YV2A 2XYRA 3E8SA 3MB5A 1DCTA 4P7JA 3HCDA 1RI5A 2Q41A 5CVEA 2QM3A 3GRVA 4LWOA 4MHTA 3R9XB 3EVEA 4O29A 1D2GA 4KVZA 4RYLA 4ER0A 2ZZMA 5EHIA 5K01A 2HNKA 1QAMA 3M6UA 5DPMA 2OB1A 2GA9A 1F38A 2Z6AA 2AOTB 4CXMA 4PYMA 3PS9A 2ERCA 2XVAA 1ORHA 3BKWA 3LPMA 5ICFA 4PYJA 5K0FA 3DMHA 2VDWA 4YMHA 3EGIA 3TMAA 2EJUA 4R8SA 3TLJA 3U81A 4ISCA 3THRA 3M6WA 1BC5A 1UWVA 5FUBA 3I64A 3LL7A 5DWQA 3BGIA 3KR2A 5U4XA 2P8JA 4GOOD 1IY9A 1DL5A 1VLMA 1KP9A 2C7OA 3I9FA 3NMUF 5LQJA 4PGHA 1G6Q1 1L3BA 3DMGA 2G70A 2PJDA 4RVHA 5LQUA 4EK9A 4HRAA 5EZSA 4YMGA 1ZQ9A 1X19A 3IHTA 1AQJA 1TPYA 4YUVA 3UJBA 3G7UA 3T0IA 2BH2A 3HNRA 2FRXA 2GLUA 5F2OA 3TKAA 10MHA 2AR0A 4AUKA 3ELDA 2Y1WA 3FTEA 2ZBRA 2IFTA 2G8NA 1L3CA 3I58A 3T7RA 4ATNA 1AV6A 4A6EA 5E8JA 3G8BA 5EEHA 2OPBA 3FUVA 1SQFA 4PNEA 3P8ZA 5KYGA 2PY6A 2HTEA 3UA3A 2IP2A 5E2AA 5FHQA 3KU1A 1VL5A 5FWAA 4KDCA 2PXXA 3GRYA 3OU2A 1G8SA 3EVFA 5EIWA 5GOZA 3KR9A 5MHTA 4RTQA 2PVCA 4RTPA 3QOWA 2O57A 5FTWA 2CL5A 2F8LA 5D1HA 1N7JA 5E1OA 4RV9A 4DM3A 4X60A 1BKYA 5FHRA 5EEGA 4EKIA 2G71A 1RJGA 3B89A 5JR3A 2EFJA 4OA8A 4QQKA 3AXTA 5G02A 3UFBA 2O05A 4GOLD 3MHTA 2ZWVA 4RVGA 3SXJA 3TQSA 2E5WA 3JWJA 1RI4A 5M5BA 1X1AA 5EQJB 2G1PA 4M37A 1NW8A 3HCEA 1SVUA 2FCAA 4G56A 3P9KA 3UJ9A 1I9GA 1R6AA 1XCLA 3KQQA 4UOEA 1YZHA 4R6XA 3GRUA 2BR5A 5GM2A 3A7EA 1ZG3A 3HVKA 1IXKA 3M70A 4EMSA 3PX3A 3HTXA 5FA5A 3CJRA 1VPTA 3DXXA 2K4MA 3HCCA 3A25A 5EVJA 2P7IA 5LQCA 4EKGA 5EMKA 3SM3A 2GS9A 1MHTA 3SSNA 2HR1A 4FS8A 3DLCA 2GH1A 3LX6A 3UJDA 2YUIA 4C07A 1INLA 1RJFA 4X61A 5LQNA 1OR8A 1RI2A 1P1CA 2IBSA 5KS2A 4KW7A 4DA4A 2C7RA 1FPQA 3OE4A 4RSRA 3G2OA 3TKYA 2JHPA 2UYOA 5T67A 4CTKA 2EX4A 4V0QA 5BXYA 2YX1A 2P35A 2OKCA 4GC5A 4KIGA 2PSSA 3KR1A 4ER5A 1KYZA 4OQDA 5KVAA 3JWHA 1U2ZA 2KW5A 1MJFA 1WG8A 2PT9A 1SQGA 3NJRA 5HZMA 3C0KA 3DMFA 3HP7A 1HNNA 3R24A 3R6TA 2ZZNA 2AOTA 2QY6A 4C04A 1XDUA 5K0BA 5JUWA 3BWBA 3FYDA 1O9HA 3GRRA 3FTDA 2IDKA 3KQVA 3G2MA 5FCDA 1FP1D 1SUIA 4JXJA 4ER6A 1R00A 3P71T 4OX9Y 1X1CA 3HVJA 4RWZA 1FP2A 4F86A 5LQAA 2IIPA 5FQOA 2PXAA 2ZWAA 3GWZA 1YF3A 2OBFA 1NBIA 2VDUE 4IV8A 3LHDA 4PCLA 2BM8A 2AVNA 3TR6A 4M7RA 2PX4A 5E1DA 5DM4A 2AOWA 3TRKA 2VDVE 4LWPA 2IH5A 4K6MA 2H1RA 4GBED 4KDRA 5CIYA 3BT7A 2ZVJA 4QVKA 3A7DA 2PXCA 1KPHA 3SSMA 2ZFUA 1M6EX 3ANXA 1O9GA 2H00A 2FPOA 2C7QA 3CCFA 3P2IA 3BWCA 3THSA 3CJQA 3FUTA 5BW5A 3OZSA 1XJ5A 5EKUA 1X1BA 3V8VA 4E33A 3R3HA 2NP7A 4GEKA 4PYQA 4E2ZA 3MCZA 4P58A 3ORHA 3X0DA 1P1BA 1EJ6A 4QVGA 5HIIA 2PKWA 5DM2A 5K0JA 1JSZA 3R0QA 5CUQA 4PINA 1I1NA 5E1MA 3UWPA 2AN4A 5EZQA 3KPUA 3CKKA 3ERCA 1G60A 4BLWA 4CKBA 1SG9A 1JG3A 5DTRA 1HMYA 2R6ZA 4C05A 4RTSA 1TW2A 5C1IA 3NDIA 2C7PA 3LGAA 2WA2A 3V97A 3ELWA 4OBXA 1NE2A 5DSXA 3MQ2A 4PONA 5B1SA 1O54A 4BY9E 5DX8A 1VE3A 9MHTA 3HCFA 3NDJA 4OBWA 5EMLA 2PLWA 1NW7A 3KPYA 5DTMA 5DX1A 4PWYA 1BHJA 5CD1A 3EEOA 1Q0TA 4L7VA 2AN3A 3RW9A 2YXDA 2IGTA 4Z2YA 3EPPA 5GWXA 3REOA 4E2YA 4RTOA 2Z6QA 2PX8A 4DQ0A 3M4XA 2A14A 1VBFA 1QAQA 3LDFA 3T7SA 5LQRA 2JJQA 3FPFA 5GIOE 5K8VA 3KQSA 3FRIA 1V39A 3FZGA 4DMGA 2YVLA 3CVOA 2AN5A 2FYTA 4CKEA 4V0RA 4AZWA 4ZTBA 5KQRA 2CMGA 1VP3A 4PYKA 4GF5A 3DR5A 4GUAA 2ADMA 2FK8A 2XYVA 3C3PA 3LDGA 3KQOA 4PCAA 5EPEA 3KQYA 4FSDA 3T7TA 4EVIA 4RTLA 2JH9A 3BWMA 4IWNA 3HA5A 2ZTHA 4HH4A 1ZHFA 2JH8A 3Q87B 3PTAA 2P41A 2P3OA 1XVAA 2ZLBA 5EG5A 3TOSA 4AZSA 2JG3A 3P9CA 3BWYA 3OPNA 4DZRA 4RTJA 2ZBQA 4FT4A 5ICGA 1I4WA 3GDHA 2JHAA 3BGVA 1NW3A 4QQNA 4IKPA 2BR3A 4R8RA 3BKXA 2ZULA 2NNWB 4P7FA 3NTVA 3TPZA 3DUWA 1NT2A 4QTUB 2HV9A 5E2BA 1XTPA 3LKZA 3OFKA 3DH0A 3HA3A 4M38A 4R6WA 2N47A 3GGDA 1NKVA 5EGSA 2V74B 5IH3A 4Y2HA 1Y8CA 2QYOA 1XXLA 5FULA 5HILA 3KHKA 2WA1A 3A26A 4BLUA 5CCXA 4PYNA 2IPXA 2OXTA 5IKMA 1F3LA 3EMDA 4XCXA 4DCMA 1UFKA 3A4TA 2VS1A 3DTNA 4E32A 3LCVB 4Y30A 3EEYA 5P8WA 3LKDA 3O4FA 3PB3A 5LR6A 1FBNA 2EJTA 3P2KA 4U7PB 4HC4A 2I7CA 1YZ3A 3IV6A 1PJZA 2R3SA 5CM2Z 5EMMA 2P3LA 5K09A 5LSAA 2B25A 1M0EA 1JG4A 5EMJA 2UYQA 1R8YA 3H2BA 1SKMA 2UZ4A 3JWIA 5K05A 2XVMA 2ONYA 3CGGA 3E7PA 1ZGJA 1D2HA 2PGXA 3FPJA 4M36A 5ICCA 1DUSA 2IH2A 3B3JA 3NVMB 4P7KA 1WXWA 2B9EA 4KWCA 1JG1A 3VSEA 4AX8A 3HA7A 4YUWA 3HCBA 1UIRA 4GQBA 5ERGB 2LD4A 2BZGA 3S68A 1R74A 3FRHA 3G89A 3RIEA 3FTCA 3MGGA 3A27A 5FA8A 3SVZA 3PLAE 2DPMA 2CMHA 4C08A 3KKZA 5HEKA 3LSTA 3FTFA 1JSXA 1NW5A 3NW9A 2NYUA 2XYQA 2V7EA 3PT9A 3TFWA 4B17A 2NXNA 3SMQA 5K0LA 3D2LA 1P39A 2YXEA 3O31A 2P40A 2YQZA 3DXYA 4MIKA 2PX2A 5FADA 3UJ8A 3BGDA 2ZIGA 4A6DA 4C4AA 1KIAA 3QV2A 4R05A 8MHTA 3GCZA 4OQEA 3KPJA 1Q0SA 1XDSA 5K0EA 5ICEA 2CKDA 2B2CA 3RODA 3K0BA 3P9NA 2I62A 5BP7A 1R18A 5EKXA 3KR0A 4P7GA 3ELYA 3G2QA 1T43A 1XCJA 4E2XA 3C3YA 1JG2A 2JHCA 4RX1A 4DCGA 4GC9A 3GXOA 2GPYA 2OB2A 5LQKA 1JTFA 4YV0A 2OYRA 3EVCA 4E70A 3VC1A 3NWBA 3P97A 4QTTB 5K0NA 3G8AA 3GIWA 2PV0A 2BM9A 1G38A 3SX0A 2FHPA 3AJDA 4BP1A 1N2XA 4HGZA 2G72A 3LCUA 1NBHA 2PWPA 4MWZA 5GINE 3AY0A 1RJEA 2GAFA 2ZW9A 3PFHA 2CWWA 2O0LA 1QYRA 3AXSA 2AOXA 2QE6A 3CC8A 4LG1A 5F2KA 1IM8A 3KPWA 1WZNA 2PBFA 1KHHA 4XUEA 2ESRA 4MQ4A 1RI1A 3I5UA 3IEIA 5CCBA 5BW4A 3CBGA 3OZRA 1QANA 2AOVA 3C6MA 2B3TA 2PWYA 2YXLA 3EVDA 3FYCA 3E05A 2OZVA 3FPHA 4XUCA 3Q7EA 4RVFA 3GJYA 1X1DA 1G55A 5D1NA 4YUYA 5HFJA 2FK7A 1Z3CA 1G8AA 1P91A 3M6VA 1H1DA 4DKJA 1FJXA 5CVJA 1N7IA 1SUSA 3HEMA 3OFJA 1XDZA 5HOQA 4HTFB 1YFLA 5CVUA 2ORED 2P3QA 2ZBPA 3OU6A 1ZKDA 3SSOA 3M6XA 4U7TB 2AZTA 3BUSA 4YUXA 2PX5A 5T6BA 3UBTA 3DOUA 4WVLA 5E9JA 4EQZA 1EJ0A 2HMYB 3HM2A 5KQSA 2YTZA 4F85A 2Z6UA 2AOUB 2WK1A 3CJTA 3FUXA 4LECA 1WS6A 3IYLW 3UA4A 2PT6A 5DT2A 1EQAA 4CKCA 4F84A 2IDJA 5EHGA 1ZGAA 3GO4A 4WXHA 5E8RA 5GM1A 4QPNA 5DXJA 3GU3A 4AZVA 4PIPA 4DF3A 2UYHA 2OO3A 3B5IA 1KPGA 4RTMA 3EGVA 1B42A 5GP1A 3OE5A 3VC2A 4C03A 3LCCA 1M6YA 4KIFA 3TM4A 4E2WA 5E9QA 3P9IA 3BZBA 5DX0A 4H0NA 4PIMA 2P1DA 3KQTA 4RTRA 2IH4A 4PGGA 2H11A 5EC8A 3B3GA 3DXZA 4E31A 2OY0A 4HTFA 4HGYA 5DSTA 5E9WA 3NVKI 2QRVA 2NXEA 2NP6A 5DRYA 7MHTA 3DP7A 3ER9A 3G88A 3ID6C 2ZZKA 3MTIA 1RI3A 4QDJA 1YB2A 4BLVA 5K0GA 4C06A 3FPEA 3EGEA 1RJDA 3L8DA 4PYLA 5K03A 1QZZA 4X41A 1L9KA 3FUWA 4FGZA 4PYOA 5H02A 4RTNA 3ME5A 4X1OA 1NW6A 5DTQA 3DLIA 3I53A 3F4KA 5DLYA 2Y1XA 1YUBA 3JWGA 5FWDA 2DULA 3SGLA 3WSTA 1KXZA 5HIMA 1JQDA 1L1EA 1AQIA 1KYWA 3G5LA 4E30A 5HIJA 3OCJA 2ZIFA 3B3FA 2NXCA 5EIFA 3UJ7A 1YFJA 3K6RA 3EMBA 5HIKA 1KR5A 3LBFA 3ELUA 4FSXA 3E23A 3LBYA 2VZ9A 2YR0A 4YV1A 3KPVA 3KQWA 1R8XA 3B7PA 4RVDA 4CWAA 2EG5A 4RTKA 4FR0A 5CVVA 5DM0A 1EIZA 2NXJA 2XBMA 4XUDA 2HWKA 1BOOA 3GRZA 1ORIA 1QAOA 3FUUA 1VQ1A 3PFGA 4GOND 2UYCA 3QOXA 4FZVA 2ZCJA 4KRGA 3HVIA 4ER7A 1JQEA 1D2CA 2I6GA 1JTEA 5F2NA 3PX2A 4OA5A 5K0CA 2QRVB 4GOMD 3EVZA 2I9KA 2BR4A 1WXXA 5FQNA 1NV8A 1PRYA 4X63A 2IBTA 3G2PA 1JQ3A 4NECA 3DULA 3TM5A 2ONZA 1EAMA 2ZSUA 3BXOA 5T64A 3FPGA 3SR4A 3UJCA 1VP9A 4BP3A 3KQPA 1JR4A 2ZIEA 4HG2A 5DXAA 3EVBA 3UJAA 3VYWA 2B78A 1KPIA 1WY7A 3HVHA
chains in the Genus database with same CATH superfamily
1XZJA 3KV3O 3UZUA 3DBLA 1OBCA 5ALTA 5AVUA 5K5EA 4XD7D 1YJ8A 1J0AA 2I3BA 4P32A 2R6JA 2JJ2D 2ENUA 2GJ4A 5C0OE 1SKMA 3W9BA 3VR4H 3MTEA 4R8MA 1UBUS 4D6XA 5BN5B 4D8YA 4HNRA 1ODIA 3AF2A 1YXMA 4DDHA 2HA0A 3LDUA 4HSGA 5EOVA 3RUDA 2E89A 4L6CA 1QVZA 5COAA 3JVIA 3C7TA 3MJTA 1W88A 1E1NA 4YQEA 3RWBA 1YK1A 3IBTA 3EZ6A 4BNDA 1NVGA 2FSVC 1QGUB 1AQ6A 2VOEA 1VIDA 2HCTA 3DEKA 5EGNA 3O0TA 4Q9IA 1VZ3A 3ZH2A 4C7VA 1H9AA 1HORA 2QPLA 3NBKA 1UZUA 3IHKA 4LWOA 1UJ5A 4QJ5A 4WXEA 1E0DA 1Y3DE 1X80A 2XNDD 3DMDA 2OXIA 1Z26A 2HNKA 2WHEA 4C1NA 4QUKA 1YDHA 4NMXB 1C9NA 4Q7MB 1LEHA 2FF7A 5AI0A 4CXMA 5BYKA 1LSSA 3PS9A 1T5DX 3L0OA 1Q7TA 5TV2A 3CUTA 1CZHA 1CZNA 1C9EA 5BO5A 4Z4HA 3R5JA 3ODPA 2BGKA 2O54A 4HEHA 2B6HA 1UFVA 3RS8A 3JW8A 3T06B 5DCYA 1RJ9A 1RYEA 2Q5HA 1C0EA 3ZOKA 3C15C 5BV0A 1VE5A 2PJDA 2ATXA 2HRBA 2RCYA 2WR8A 4ENUA 5CFLA 3V7YA 4NZPA 4C4OA 2LBPA 1RPNA 2EZUA 3P4UA 3TKAA 3V2HA 2HWXA 2NACA 4X65B 4CF5A 3R0IA 3MXOA 1SBIA 3SIXA 1Y7PA 5C1BA 2G8NA 2FSHA 4ZOLA 3CX4A 1DV1A 3I58A 2PL3A 1QQBA 5TC4A 1BN7A 5E8JA 1G66A 4A6EA 5DN6D 3U5TA 1YIOA 2SHKA 3FUVA 1KC1A 1ZOSA 4L50A 2JLQA 1Y37A 2VHEA 2Z08A 3H4MA 4MUGA 3ZKAA 5EZYA 5CBKA 2WF7A 2ZJ3A 2O1XA 2WSSA 3PGKA 3T9AA 1K86A 2CFSA 2PXXA 3ECSA 5H7XA 4TV8B 5TGDA 4ZT3A 3WIUA 2O8BA 4KGVA 4ZWNA 2A0KA 4UE3S 3QOWA 3X43A 4F5DA 5LN1A 1XJ0A 5EZ6B 1BMFA 5TGZA 3C3AA 2C78A 2ZJOA 2MU1A 2YMPA 1US8B 4PANA 1GCOA 1LA2A 4KVGA 4D9HA 3QPCA 2HIGA 3KKOA 4M0KA 2WU3A 1OH6A 1JX6A 2I4NA 4YRPA 2R6R1 2OHJA 3A0UA 1NZDA 3KHSA 3RYFA 3TDNA 4KXWA 1ECBA 1D8TA 1N4DA 4E13A 3DKIA 2WVHA 4RH0A 3PF9A 5DLPA 4OFWA 5EVJA 1XIVA 2P0EA 3KALA 3JX9A 2O1SA 4EJSB 2GS9A 1S2DA 3ENWA 4LDAA 4RS4A 1RWBA 2V0NA 3LX6A 1A97A 5EXEA 5F1OA 4EA7A 4ZVOA 1D4ZA 1PFWA 1USGA 2IBSA 3O95A 1P75A 1AQYA 3G0CA 3TQRA 4OG2A 1PWHA 3ZXSA 1OB5A 3FNHA 5DNDA 4OJYA 3FFBA 4RETA 5JH7A 5KO2A 5BSRA 1UAYA 4IIYA 4C0LA 4BUJA 1XXHE 1SCKA 1G8YA 2GHTA 4KE7A 2KPOA 2HHAA 3GQBA 4ZD6A 4JUFA 3T7IA 3ZR4B 3QMPA 4D0GA 3RFUA 4R1UA 5B1EA 3TAHA 3UUGA 5JPDA 3GF4A 2HQRA 4FGWA 4LK2A 1MJFA 2CY0A 4QYTA 5KVVA 4MDEA 4JVLA 3EC2A 3AKDA 4BNIA 1H0KA 3GJ8A 4M1OA 5TF4A 1QZ3A 3CUYA 5BR8B 1SVIA 1PJBA 3DOFA 4BQRA 4G4JA 2I78A 7YASA 1OFHA 5ALPA 1PJQA 2VDQB 3NGXA 2IZ5A 1RPJA 1AKYA 1UC9A 4H3KB 4XVQA 3WK8A 4CMAA 3EDYA 3COJA 4PPFA 2RAPA 1NL3A 3JRXA 3PE4A 3KOOA 5FT9A 5KREA 1QVRA 2BM0A 4D9MA 2ZSDA 2HYDA 1ND6A 3Q3VA 3LYAA 3COVA 2OBFA 1WKBA 2PZAA 3F2VA 2X13A 4MDFA 4ZC8A 3WMXA 1QCCA 3ZWWA 1ODLA 2GTIA 3GEPA 3TRKA 1MRZA 3LM8A 4HAWA 4GBED 5JANA 4O4JA 3ZTTA 1FIUA 4XASA 1ZONA 3G1WA 4UNIA 3N2GA 2W0MA 4IIJA 2ZVJA 1LI5A 2ETXA 3KS9A 1YI1A 3EFHA 4YJ3A 2CDCA 4ZVMA 1KPHA 1FSSA 4KDFA 1A7KA 1Y7TA 2BFFB 2H00A 2Q3FA 4B2IA 4GI7A 2DY1A 2MINA 3PLNA 2WT9A 2B8NA 3BFVA 4WK4B 5AM0A 3IHLA 5SYNA 4AS2A 2JBAA 3CIOA 3VSDA 3WFJA 4L76A 3GLIE 1WP4A 4ZK2A 5CNJA 1P1BA 2XNSA 1N7HA 1OWOA 3B53X 2IIVA 3EPJA 5EJ7A 1Q83A 1DVRA 1WCYA 3EDQA 4IXTA 3EIHA 1UKEA 1OILA 4A26A 1C3OA 2Q62A 3GFVA 1FW6A 5A7GA 1DC4A 2MR5A 2Z2YA 4LF5B 2NQTA 1WLSA 3C1OA 2GSWA 3DOCA 2IBMA 4KE9A 3X1DA 4DR5B 3B8HA 4ZYVA 3JSAA 4EI2A 1PJSA 2V3VA 2BE9A 5ECGC 1DX9A 4PAMA 5CMLA 5F1KA 4ZZIA 2XCQA 5CPBA 1KQPA 3K6SB 3F6RA 3IIEA 1KI2A 4R83A 3OPMA 4H60A 1U9IA 3QVXA 5D51S 5DGHA 5FL7D 4HO1X 1PG0A 4UHFA 2AZMA 5D85A 2QD2A 2BRUC 4I5GA 1FYFA 2BBSA 3NHBA 4NE7A 5AVZA 5GWXA 4PO3X 1VDZA 3JARA 3WISA 1QLWA 2DBVO 4H59A 4IHAA 4G81A 4NYMQ 1BEEA 4PBRA 3BWVA 3KT0A 1KFEB 1A9RA 1P2GA 3CPJB 4F4UA 1NRXA 3PD1A 4HXFB 4EYQA 4NJMB 3INYA 3P27A 4OYYA 3GJSA 2JJ1D 4XQGA 5KQRA 2R1VB 4YMWA 4YAEA 1C3JA 2EQAA 3OUTA 4ND4A 5IJ9B 2EIHA 3LPDA 1DOAA 4WNAA 1ZDMA 2VXYA 3T9EA 3BWMA 4OIMA 3K1TA 4MW1A 4HT3B 3TSYA 2H8GA 2ATIA 3QLVA 2G83A 1WOYA 1ZGHA 4PRLA 3PTAA 2P3OA 3TOSA 4S1NA 4A82A 3B8EA 2QX7A 3RC1A 4BDTA 1EE1A 5ICGA 1H0HA 1HYEA 2RIPA 3F98A 1AZWA 1LSJA 1QOPB 4N0PA 4P92A 4DW8A 3WK9A 3EARA 3LX4A 1VCMA 4CMBA 1XWFA 3R5TA 2ZB3A 5T6MA 1JWAB 2NXWA 821PA 3NHZA 4UCFA 3HM9A 3RARA 1O58A 1NXXA 4MV0A 5LLDA 4JYMA 1XTPA 3LKZA 1Z2OX 4XSHA 3Q8KA 3IUBA 3F97A 4IRMA 4M60A 1UBCA 4R6WA 3ZI7A 5LCXA 4CF7A 4AXXA 2I6XA 4G63A 5ISMA 4EELA 3DOIA 3EDCA 3K9HA 2CF5A 5HCNA 2D59A 3VO1A 1K98A 4YMUA 5REQA 2II6A 3T5PA 1WBJB 2JVJA 1KI6B 4EH1A 1OX4A 1FVHA 3RJZA 2VFAA 1CB0A 4LJ9A 4Z54A 1EVIA 1ESZA 3EFOB 3RLIA 2ZI6A 4ZOAA 3RUFA 4EARA 3AGPA 4JB8A 1WNTA 4AW9A 1QLHA 1QQAA 4CG3A 4GM0A 3SHQA 3UWSA 3GLHE 4BE9A 5FWXA 4I55A 4LBZA 1E59A 5LU8A 4I08A 3F90A 1UEXC 4U6NA 3W9SA 4B74A 5A2QA 4CKCB 2O8FB 5K7SA 3OUUA 1T9BA 3FOWA 1O8BA 4G1EB 4JLNA 2H16A 4ZQHA 3IAM6 1U11A 4BAZA 3I04M 2V7UA 4MK4A 1TTTA 2ODAA 1FS4A 4I4CA 3SC3A 1RBZA 2PA3A 4F6CA 1SHTX 5CHYA 1ITZA 3GJTA 3ZJ4A 3HCBA 5JS8A 1ZIXA 5CPFA 3RKRA 2GPWA 1OGYA 1B0PA 2AFIE 3NATA 3I05A 1TVKB 1YJXA 1G17A 3FTCA 1CR2A 1E1CB 3VV2A 2P4UA 1G8KA 2XMPA 1SU4A 3E18A 3STHA 5AKHA 5E3JA 1JKJB 1NW5A 2H92A 3QU2A 2QRHA 3R0JA 4J3FA 4ENVA 1NC1A 1GUDA 4KRYA 2F1IA 2GPSA 5ALYA 3R9KA 4OUDA 1KAQA 2C5AA 3KZNA 2P40A 3QMMA 1DUVG 2W2PA 3E70C 1U2RA 1Q7RA 3WX0A 3T1HB 3NEJA 1XRSB 2V7QD 3AFHA 2YNMC 3LW7A 3O4IA 3P4XA 4A8PA 2R8ZA 3TN7A 1Q0SA 3L7KA 4LGMA 4EY3A 5ICEA 2QZ9A 2VH2A 4ND8A 4FMCF 4UQLA 4HGRA 1DPFA 2EL7A 1R18A 4GS5A 5G1PA 1JR6A 4UEWA 5KNBD 4Y7DA 4EIWA 4ZKDA 1QRDA 2FPIB 1BAPA 1G4AE 3A58B 3AP1A 4E2XA 3QIAA 5KAMA 3KYDB 1N2OA 1LDGA 2XB9A 4OJMX 4AY2A 2XKKA 4AZ3A 4C20A 5ADVA 1XD2B 2YVAA 1K92A 1QS0A 1D0IA 4FC6A 4NBLA 3R0XA 4D98A 5DMHA 3NIDB 5CB4F 1SB8A 3S1SA 3K92A 1WDMA 4HWPA 4XM2A 5SZHB 3D3EA 3AKYA 4RY2A 1YZKA 3B2QA 3O6VA 3QVUA 4J43A 1NX6A 1Q84A 4LY3A 3ZV5A 4ZT2A 3LHFA 3ADPA 3KZKA 3KPWA 1M2VA 1W49A 3WGJA 3SEAA 1Q95A 2R87A 5TDHA 4HY3A 3IBYA 3L7DA 3O1LA 5AVRA 3L7CA 3V33A 4A4DA 3SNKA 1JPVA 3LUPA 4JZYA 2R86A 4LN1A 4LTMA 3JYHA 4HNTA 3EVDA 2XWQA 4DPLA 2JGRA 4W1RA 3QFSA 1RZVA 1X1DA 3NR2A 3ZJTA 2VJAA 4IHJB 1W4CA 4OUKX 2QT9A 1H1DA 1CQWA 2OCLA 5GJVC 1YK0A 3OFJA 3FMPB 4D8XA 1UT8A 5C51B 3U9TA 4ZCLA 4TUYA 2P3QA 2WJYA 4NEQA 5FTNA 3RT7A 2AMYA 3FF1A 2OC9A 1I3OA 2I66A 4ZOQI 1YCFA 4HNAB 5E9JA 3RV3A 3D4PA 4IVPA 4TLAA 1XZPA 4RZXA 4WI1A 2HSGA 4G8BA 2C2BA 2X23A 1PZXA 4L27A 4RBNA 4XQEA 5EYPA 4MZDA 2CYBA 4N7MA 4NBSA 4ZZ1A 4XD2A 3JPYA 3ZEIA 4AJLA 2Y2UA 4S1WA 4LA4A 5G0VA 4O4IB 5D8DA 3RS7A 3AY3A 2QWXA 3UWDA 4X44A 1M74A 2X0KA 3D3NA 4XRGA 1OSNA 2WJGA 4AZVA 4ONEA 4OV6B 4D9JA 2OO3A 4WY8A 4W5RA 4RXUA 1TYBE 2IEYA 2OZLB 1B42A 3RB8A 4LZAA 3N0XA 4A27A 4XYLA 3QZUA 1C1XA 1W75A 3BK7A 1IK6A 1YDMA 3I3OA 4TLDA 5E4FA 4ZQIA 3DTVD 3IAS6 3UC5A 4M0FA 4N5MA 1SB9A 1Z6TA 1FOEB 4MX8A 3IPYA 5JZOA 1ACJA 4ZO7A 1U8ZA 1J0DA 2D1RA 3NVKI 3GFFA 4TL6A 1Z36A 3TEJA 5DRYA 4JKOA 4H08A 2ZSFA 3LLMA 2PRKA 1O57A 4EPRA 2JKYA 3EXHA 3O8DA 4GPTA 3O1HB 2RHJA 1MOSA 4HGQA 1U1IA 1Z68A 3ME5A 1YS1X 3A4NA 4BKRA 1A8PA 3CUSA 1D4FA 5FORA 1BRMA 4V2IA 4BWYA 3TUZC 5JI2E 1DKMA 1UIMA 5AJUA 5TJHA 2QGFA 3RRMA 2D1QA 1O94C 1NHGA 3WGKA 3B9RA 3LOPA 3KVRA 4FUTA 5JYCA 3ITNA 1UMDB 3KBBA 2IX9A 1FNBA 2NZUG 2QMEA 1GL6A 3KVNA 3EK2A 3ZIAD 1GLVA 4CLOA 1YR7A 1HG0A 3FOEC 1I6LA 2UVPA 2YR0A 4KUHA 3LFUA 3WLAA 5HZGA 4JI8B 1CBUA 3SFTA 4CWAA 1NC3A 1TYZA 4TSFD 3A6ZA 2DLNA 5G40A 2VG8A 3RVPA 4DCVA 1NNLA 1VKOA 3L7MA 4WESB 5CT8A 4ZARA 3RVRA 3I5MA 2R68A 1WU8A 4LV8B 1VQ1A 3H18A 5G4KB 4BJ5A 2BKXA 4EMBA 3W5BA 4YLEA 1U0OC 3DE4X 4M76B 3SD7A 5AVJA 3F5FA 4HFJA 3AHFA 4L3VA 2TMDA 2BDUA 1Z0SA 2X0JA 4INPA 4MW5A 1DEAA 2BR4A 5FQNA 4U9HS 3M9WA 1E9EA 3KZVA 4PXAA 1MA0A 4MS1B 2C77A 3IO5A 4B4OA 3N8HA 2N3ZA 4ESOA 3DULA 1F7VA 1RRMA 3QFTA 3PHCA 2HMTA 4PNZA 1XEXA 2V96A 4R1PA 4HAUA 5DH9A 5DYTA 2UV8A 3TO5A 3MTAA 2V58A 5CCDA 4HG2A 1GQSA 3OOEA 4D9FA 1LK7A 1VSQA 1I3KA 2JFNA 4J94A 3ONWA 4Y2RA 4UHJA 3NFRA 4L5BA 5TX7A 2OYCA 4N3BA 4ASUA 4BEBA 3HCAA 1UBRS 2BBWA 1QGAA 4U7FA 1DWOA 4UASA 4DSTA 3UXYA 5K2OA 4EY5A 4K9DA 5DM1A 4IXWA 1HDCA 1YL5A 1NA5A 2J30A 1B2LA 1PZGA 1PBNA 1JKMA 3PVCA 4H7PA 4QLBA 1NW9B 4C6HA 2CB0A 2NUAA 4RTQA 5JVDB 3LUGA 1YZFA 1YR3A 4QFMA 1KVRA 3JQBA 4JGBA 1V5IA 1K8XB 1R8QA 3Q7RA 3ZWYA 4BC0A 2AS0A 2XNJA 1QIGA 2VAXA 2RHCA 4J75A 2VP6A 1QJCA 3EXEB 3E8SA 4P4LA 3JTEA 3MPUA 1AO0A 5F5NA 1C3LA 2GEBA 3AQ4A 4J76A 2CVOA 2YV3A 5KQMA 3I04A 4KVZA 1QFJA 2RGRA 5CFQA 3OTOB 4J3NA 5K01A 1AUVA 1FSFA 3G1TA 4JT8A 2ZJ0A 2QU7A 5ITSA 4BTEA 1XVVA 1I24A 1OZHA 3A9RA 1Q1BA 1V4BA 4MQFB 4TT8A 3TR0A 1L7QA 1THMA 3I8SA 1V95A 2WICA 4ALNA 5K3OA 2IDMA 3N3AC 4XZ3A 1QYDA 1QQ6A 2XDAA 3K1ZA 4UUMA 2MT9A 2QQ0A 3B9BA 2QIOA 3I6YA 3ZZUA 4MPRA 2I22A 5JO0A 1RKQA 3WYNA 4OGLA 5DWQA 1LSUA 3MMSA 2XUDA 1OF1A 3OI7A 3UXEA 4LYJA 1VLMA 4NATA 3WB0A 5ER9A 5IT5A 4BNXA 4TWIA 3VDQA 2XVZA 2ERYA 4EDHA 2WAXA 1ZM2A 5BNWA 3ILHA 3ZHXA 2G4VA 3NOXA 1ESCA 3OTGA 2BGJA 2J5BA 5CYFA 5EA2A 5JJKA 2D2VA 1A8HA 4MI3A 3EZ2A 4Q3EA 2IS4A 1U6KA 1GVHA 1HQCA 2FUNB 2XGSA 5I7EA 4AUKA 4CKYA 2D1SA 1RAEA 2JFYA 1UKVY 3QVTA 1GGKA 4DBVO 4RADA 1NZJA 4XDZA 2REQA 2FN9A 4V0KA 3C2QA 4QRHA 3ZDZB 5JYEA 2OPBA 3B5EA 1SQFA 2ZBVA 4C3UA 8AT1A 1J1UA 1E5DA 4I2NA 1ABFA 2AMVA 4IDFA 4LX8A 4WFJA 3F6SA 1H0RA 5HTOA 1WBDA 3EULA 3JQPA 5DSZA 3N05A 2I1WA 3QV1A 3FKSA 4ZHQB 2FEOA 5AM2A 3ENZA 1XPJA 1C8KA 1F4VA 1M1YA 1TU3A 1T5SA 1Z0AA 2CL5A 2EBWA 2J3JA 3E1GA 3LIPA 4LZLA 4NMWA 1L4EA 5IU6A 3HKEB 2XZOA 3B89A 3KKPA 2DSNA 1ZZEA 4LK3A 5CNKA 3UFBA 3S1LA 2O05A 5AM3A 5IAAA 1SD2A 1WMEA 2GVDC 5B37A 1I8TA 3VC3A 3G9XA 4ZYUA 5EQJB 2CCJA 2QVGA 4TLBA 1NQXA 1Q91A 2A0UA 4BO9A 4BJHB 1CQZA 4CODB 3K0SA 1EJ2A 4ZMRA 3MWEA 2QTTA 4G1BA 5EWMB 2I0FA 2PCLA 3HBLA 4WK2B 1RZRD 3T7JA 3PX3A 4P2GA 4S35A 1E5XA 5FA5A 3CJRA 2ASVA 1YGYA 2EWWA 2OCAA 3A25A 1TFUA 2AA3A 2P7IA 5IJXA 3WKAA 3LVFO 4DR1B 2B9VA 4DT1B 1GQOA 1PJAA 4TKUA 3V1KA 2YUIA 3V4SA 4BX3A 4FHDA 4CQMB 4PICA 2HI0A 4HQLA 3E9RA 2FSPA 3TLCA 1YBFA 4CL3A 1TJYA 1D6JA 4AJKA 3NPMA 3VYRB 4BNNA 3MS2A 5HXAA 3ETNA 1ESMA 3B78A 4LC9A 1QF6A 4BNVA 4F4HA 4R51A 2C9BA 1OLUA 1PR5A 3ZU3A 1A95A 2XT0A 3O21A 5BRNA 2Y0CA 2KWIA 3U7RA 3KQNA 2KW5A 2PSJA 4DGQA 1GKKA 2PX3A 2NT4A 4OLFA 5AKZA 2HLDD 4Z99A 1GG2A 4JELA 3ANYB 2F9LA 1H6BA 3HDJA 4AZ0B 4MVJP 2JDID 3E15A 1AO3A 3L92A 1VKJA 1CZKA 2QRUA 2XJ9A 3PUYA 1NVKA 1EM6A 3TBHA 1R00A 1Z73A 4I1UA 4M21A 1ES9A 4LRXA 3ANLA 4PXSA 1YKGA 4YMIA 3M34A 1CY2A 1K6IA 4F4CA 4EF6A 4JP3A 4GBJA 4QU9A 1S2GA 5JSHA 2B82A 3BFJA 5CH3A 4CVNA 1MKYA 1TUBA 3LUFA 1YVDA 3HR8A 1L8LA 2PSDA 1S2OA 3U37A 1EFKA 1HLPA 2BFBB 3OIGA 1AKMA 4LWPA 3RTDA 5A7FA 3S1AB 1PL6A 5LP6A 1SVNA 4OP1A 4M0EA 4PG8A 1U0FA 2ZRNA 4UFPA 6REQA 2OLKA 1D2RA 3PE3A 3HWX1 4AB1A 4EPXA 5C2JB 1GDDA 5HYVA 3QW4B 2AX4A 4RIHA 1P5HA 3CCFA 4IMPA 4GZ3A 3WGYA 3TNJA 3TQTA 3TI9A 3ANMA 1LK0A 4G4SP 1EDZA 2EJVA 2QAGB 1J90A 1X2BA 3CUUA 5FD8A 3GFTA 3A1CA 1N36B 3VYUB 4P6VF 3QMWA 3RUPA 4KPGA 1D0VA 2UZAA 3FB1A 5DM2A 1WXIA 5JPIA 1JQJC 3NO4A 2AYZA 5CUQA 5LBUA 4P0QB 2QS9A 4QELA 1CFJA 1F5SA 1VYUA 4MYSA 1YQWA 4MUIA 1XAJA 2YJGA 3X1XA 4L0CA 4F1JA 1WHTA 5DGXA 4F6RB 2QAJA 2YJNA 1QRAA 1XX6A 4GX0A 1RE0A 4ZI7F 2R6ZA 5D6OA 3OJXA 3RLFA 4W99A 1M1XB 1QXSA 1E9SA 1KSFX 4U2KA 5JMTA 2JFZA 3L43A 2P2ZA 1VXOA 4QAQA 1V8DA 1TK3A 2QN9A 1JDSA 2Q2VA 2QXTA 2RAFA 2W6IA 3SS8A 3EEOA 1WCV1 4I9FA 1C81A 1TKCA 4ZT5A 1Z56C 1KI4A 3OQMA 1AQLA 3OLQA 3UMVA 2N46A 2ONKA 3EPPA 4PAQA 4B80A 5FLEX 2Z6QA 1MPXA 1CNFA 1WP9A 1LXCA 5TVKA 3I5YA 3BRSA 3VYTB 2GBLA 1QAQA 5EWLB 1OA0A 4IQ4A 1E3IA 2JJQA 2IVFA 1OAOC 2XIQA 3C8DA 1NN5A 1N6KA 1JQLB 2BEVA 2Z5LA 2ZIVB 3PQCA 2WWVD 3S2SA 4NCJA 5C31A 1A9PA 4TVKA 4CLRB 3TFOA 1Y3IA 3B82A 1X7DA 5DNWA 4S0XA 4XH9B 4XWTA 1MZPA 1OW3B 4BZZA 2RIRA 3LCRA 1UDWA 4YP6A 3KQYA 2FPXA 2YWDA 3GNSA 4C2UA 4AICA 4IYRA 2BKUA 3HBJA 4FDUA 4OGKA 4OQXA 4G5QA 4EO7A 4GQAA 5G0WA 2BZ0A 4JZKA 1A5BB 2REXB 2F1KA 4JL8A 5CB6A 1PS8A 1V4NA 3OEHD 3PXCX 5KTSA 4F96A 4C22A 3QUAA 1EWTA 3HHEA 4QM7A 2WF5A 1JFVA 2HCRA 3HNOA 2BR3A 3SYNA 3BKXA 2G0AA 3ZHCA 4Q1FA 3TPZA 1KXJA 2QNBA 1EDEA 1RYBA 4C0BA 4LHXA 2DBYA 1PJRA 2UKDA 3ZTYA 5NULA 1MX5A 1I4EB 1FY2A 3NBXX 3OPXA 4JV5B 3IMCA 1DBPA 4JLPA 1ULTA 1UXJA 5E6SA 1TGVA 3KHKA 1L4KA 3OF2A 3KDSE 3QYJA 4O5OA 2G28A 5G3YA 3U17A 1L5QA 3O8OB 4LDNA 1YRYE 5I7WA 1F20A 3W8DA 1LBIA 3IMKA 1X7WA 3JAKB 3KUKA 2UYYA 1U0JA 2ACVA 4M46A 2ZYIA 3PRJA 4TS4A 1YB6A 2GRAA 3RIMA 3EPKA 1IHDA 2HRDA 2QRKA 2HNAA 1F12A 5J9FA 4D9GA 3QIVA 4LRWA 3D1VA 5FPHA 4OYRA 5C7YA 1EA5A 5IW8A 1N2IA 2C7BA 3O9ZA 2J32A 5ILQA 2A92A 3ABRB 4UXJA 1J2YA 1OT5A 1KBQA 1KMNA 2VBIA 5J2UF 3K70B 4V02A 5AVYA 4I4TB 5I8ZA 4C7KA 2NUTB 3JYOA 1AIPA 1VL1A 3TTYA 4CIBA 3EODA 1V6CA 4M36A 1RR6A 4M8KA 1PE0A 5ICCA 3HLTA 1M34B 4GZLA 1PNTA 4JBYA 5B6JA 4YCLA 5JJBA 5B1IA 1NJSA 3CF2A 2C04A 5JU6A 2X1MA 4ES6A 1FVOA 3VSEA 1VXRA 1TEHA 1LDMA 4HEJA 3UAOA 4MMZB 5TQ2A 3BDVA 4IGAA 1LKZA 2A5LA 1R74A 2QRLA 3RIEA 1O87A 2IP4A 2Y99A 3A27A 2I2FA 3WTBA 5H82A 1J21A 1W85A 3N3BC 4RY0A 3OF5A 4WOCA 1N3LA 4ZVVA 4MICA 1U0GA 4IMIB 2X8JA 4W5QA 2AD1A 1GILA 2BZ1A 4I0WB 4M54A 3ZVNA 3AIMA 3KLOA 5FI0B 3QV2A 1OLXA 1PJ4A 1XDGA 4QYIB 2OXCA 3DE5X 3VNVA 1COWA 4J1TA 3RODA 2WSSD 3RVMA 1ECLA 3ZW9A 4WKPA 5FNVA 4QREA 1B0UA 1TLFA 3L4BC 4W7IA 1ZEMA 3USZA 1WNFA 3CNHA 4R81A 5IAGA 2OFOA 4BVJA 1CX9B 3G2QA 1QRTA 4RKRA 5JS7A 1BMFD 4KI0A 1UZAA 4IQGA 5LDDC 2NVUB 3U2QA 5CNMA 2QB5A 1C0IA 4HWRA 1DBQA 3RD5A 5JXGA 1NKTA 1MV8A 3F7MA 4NFSA 3VC1A 5F1PA 2VIIA 3GLKA 2FMHA 1FRVA 1XYYA 2QRMA 3PQFA 1YUMA 3JQFC 4OQYA 3H9CA 4QODA 4ZOEA 4EM6A 5JD5A 2XECA 4LXIA 1AKTA 1PJCA 1CLEA 2GAFA 4FXPA 4G1FA 4UU8A 3QF4B 4B09A 4O1MA 3AF1A 2H59A 1IM8A 5JAQA 3B6MA 1VBMA 5A6SA 3I3SR 4OHZA 3ZDDA 1R37A 4IKOA 4QJ4A 1OFUA 3CBGA 2DHDA 4HEA6 4NV3A 2B3TA 3CUWA 3A6KA 2PWYA 3R44A 4MYCA 2PTGA 3FYCA 2OZVA 3M2TA 3OVMA 5SZIA 2UUBB 4RH3A 5HFJA 2PAAA 1XI2A 1UXOA 2R2AA 1FXSA 2X0NA 4O63O 3W3AD 1KZ9A 5KNDH 5CW1A 4KE8A 4ZODA 2VQFB 3I6ZA 3WLKX 1XDZA 2JBWA 1Z25A 2HMVA 3GBSA 3L02A 3LBHA 3LK6A 3ML1A 4IDEA 1SOAA 4Y2UA 5H8WA 2JAHA 2UVDA 3LF1A 2FSUA 1NXOA 4YRJA 4GI5A 1JKIA 5LDGA 4AULA 2QM7A 2WEKA 1DT5A 2EKBA 1RXYA 4II3A 2HMYB 3WB9A 2YFYA 2O2EA 5FWNA 1EGVB 1OC4A 5M29A 3FUXA 2OQRA 1EFDN 1NLUA 3BGOS 2ZI3A 2ZUEA 4JUBA 5ETJA 3NRJA 2YRFA 3CRZA 2OC4A 3FH0A 2V7PA 4IM7A 3ENNA 5L7WA 3AUXA 1ZGAA 4IW3B 2JI8A 1V3QE 1KBZA 4GKVA 2QPAA 1JAZA 3K0HA 3JRWA 3UKOA 3VVCA 4G5RA 1J0BA 4HRYA 3UO8B 1HR0B 4BLOA 2NU9A 3A9SA 2GPBA 2F3TA 1P81A 3DFZA 1EVZA 5D3QA 4GDFA 3KXIA 3OWHA 4NBWA 3L9XA 2PWAA 2Y1DA 2Z2JA 4Z4QA 1MIOB 1RTKA 1YONA 4AMBA 2OQIA 4Q6WA 1Z6GA 3IDSA 4QPDA 1P9NA 1WV0A 4E31A 1XKTA 3DXZA 2RJNA 5A02A 5DT9A 3BXPA 3R0ZA 4BB6A 3KTAB 4BO1A 4JROA 2CJXA 1K7XB 1E0KA 2O3SA 4K86A 2HV8A 5KU1A 3UMJA 2Q3BA 4X41A 3O4RA 4DIBA 3WKDA 4ESVA 2ZXFA 1U90A 3NTRA 5F3RA 3P9SA 2QOEA 1NW6A 1NN0A 2FVXA 4LYYA 2Q21A 5LB4A 4OSPA 4YQYA 1REQB 5DLYA 5IZ4A 3WOVA 3VDRA 1S8OA 4ZJYA 3VKGA 5K20A 1H6DA 1KYWA 2SICE 4BRUA 4DVGA 1YRLA 3OCJA 2OWDA 3B3FA 1B0AA 1SGWA 1XPUA 4J9VA 4BATA 1M6HA 4C14A 1KKUA 3SLGA 2XB4A 4LRSB 2VZ9A 2H07A 3N9IA 5BSVA 1LBEA 4X1IB 2NSDA 2HA2A 3PFBA 1PQWA 2PL5A 3TDMA 1W7AA 1HX7A 1NVTA 2FOIA 4OLBA 2ALJA 3TIVA 2GCOA 4LBVA 4CEJB 2W71A 1D0SA 2Q8QA 1RVV1 1PDWA 2BLLA 1V16A 1EFPA 2FLVA 1ZUIA 2QMUA 1H9BA 1QAOA 2X7JA 3RSSA 1UOOA 1ZMBA 3DQQA 2B5VA 4KRGA 2DY0A 1PNRA 4LCEA 3TUIC 3D7RA 3K6SA 2GAIA 3NHRA 4GOMD 2HYIC 3LL4A 4ARUA 2ADOA 5AM4A 4BNKA 4EVSA 1W30A 1E3LA 4GZMA 5GZ1A 2G5GX 5IT4A 3L8YA 4MI1A 4JT2A 2YNMD 3TLEA 4DMFA 4R9UC 4F3RA 3R09A 2ETVA 3QM1A 3DMTC 1V7CA 4L4RA 1HL7A 2ZQ5A 4ZQEA 4KOEC 1LV8A 4HN2A 5JT1A 1XMPA 1WUJS 4PGFA 5DHQA 3ER8A 4AZTA 3KTOA 3H1EA 3SN6A 3UM9A 3MT9A 4IIFA 2KJQA 5FPKA 1EG2A 4CBVA 4MKGA 4LF4B 3LLVA 1Z4PX 3BREA 4DNOA 2WZCA 1E4EA 3W06A 4YRCA 3SX4A 3DGFC 3IRVA 4IUDS 4Q7KA 3TTUA 3ZY2A 3ZQJA 1P74A 3C4QA 4CMCA 5ED0A 2ZVPX 1M0TA 4YAJA 3C5CA 4CKWA 4FDTA 3FSJX 2WQZA 4YV2A 4N03A 4B44A 1YUNA 2E4WA 4G09A 3E2PA 4LYDA 4ZAZA 1L7MA 2XTJA 3R9XB 3E3NA 3FNQA 2OENG 1HEUA 4AY5A 4CR8A 3E6AA 2OCYC 1AB6A 4PZCA 2G5CA 2GF2A 3ZLTA 4J7AA 3H9UA 2CLOB 1VB5A 3IAAA 4Q39A 1P1FA 1HLFA 1RDFA 1VYHA 2A3RA 1BW9A 3BZWA 4BNZA 1VJ1A 5K0FA 2P6RA 1M76A 2YV1A 3PDIB 1A9XA 4HYEA 1E9CA 4ND1A 4RHUA 1HPLA 3MTJA 4QU0A 4WXPA 4QBKA 3U0VA 3UUFA 4Z7NB 1XNQB 3SBDA 3Q8MA 4F3KA 2DH6A 4JH0A 1VHLA 2BLNA 3CKMA 2UVQA 4NI5A 5LQJA 2D2EA 3DMGA 1H4QA 5ERXA 1RXCA 1AKWA 1SIBE 3TIXB 4YMGA 1L4UA 2PU7A 1ADFA 1TPYA 2J59A 3EFBA 1V43A 5HRCA 5BYBA 3DBIA 2R8OA 2JLWA 1PFVA 3HXMA 1IZZA 2R8XA 3H42B 1KK3A 4BMZA 4FDLA 2AR0A 1GHTA 5TR9A 2IELA 2QI9F 3QYPA 3FDFA 4OO3A 1TM5E 1IBCA 2GNOA 4LSGA 3GMSA 1RLJA 4B82A 1AS3A 1X1EA 3R3WA 1K08A 1G6HA 1GZHB 4Q48A 4DA6A 2FMFA 1LX6A 4TQAA 4DNPA 4KQMA 4XOIA 1XN1A 2NVWA 5FHQA 3OU2A 3LV8A 1K2VN 3DF7A 3OSUA 5JFTA 3EZGA 1KDOA 1CJUC 2IEAA 1YJCA 2CNNA 4A92A 2IF0A 4DDWA 2WW8A 5KKNB 4O2BA 1PEYA 4DBZA 5E1OA 3FSEA 2IK8A 4MS3A 4CCSA 4FYYA 4Y8VA 2M1ZA 4KQ1A 1PTJA 1G3IA 1DRUA 3KB8A 4GHWA 3AXTA 5G02A 2F8MA 2I3AA 3K0KA 1Y6QA 2HZBA 4WKGA 3WKBA 1Q44A 1RI4A 4IS3A 3GJ4A 3P1JA 3HCEA 5AP9A 1TAHA 1MU0A 4IFTA 4Y0VA 5IAKA 4RH1A 2FPPB 2NZXA 3ZHZA 1EK5A 2BR5A 4TT3D 2W2OA 1O94D 1C1YA 1U8CB 4NTZA 5IDVA 3V2GA 1W48A 1C7RA 4FDMA 4X5OA 3QBEA 4FLMA 4PZLA 1X14A 1SVWA 1VDMA 2QQEA 3IP5A 3OIWA 1ORTA 5FP0A 3HCCA 1RPTA 1Z8HA 3CE6A 2AEFA 3WDLA 2ZUUA 4XLLA 2BCGY 3IX7A 3MTQA 3ZS8A 1UK6A 4XDGA 5AW4A 2CBXA 5GGXA 3RHFA 2QTVA 4WV3A 4IZIA 3IQHX 5C1OA 5KC8A 2DB3A 5CH8A 3GJRA 4GLBA 1T9GR 3TLYA 4UD6A 3IE1A 2C7RA 1GSIA 1STOA 3G2OA 4E5KA 3OKFA 2CNBA 4PZ9A 3T5GA 2HDWA 3ZXXA 5KWVA 1KFBB 1VGVA 1CQIA 2OKCA 3UMYA 3NTQA 2DR2A 2V7WA 3FG9A 2GZSA 3F74A 1DDIA 3L0YA 4Y7CA 4A03A 1JNXX 4D8VA 5HK8A 2W93A 2H1LA 2QUBA 1EFRA 4NOLA 3E82A 1HNNA 2JCYA 3HP7A 3LBIA 2QT0A 2VH5R 1L2TA 2XEXA 3RPEA 1G7CA 4TL9A 4WE3A 4KQCA 4UU0A 2WWGA 1LW7A 1Q17A 1ZGZA 2DWPA 3BIJA 2L17A 5AQEA 5FEUA 4JXJA 3P71T 1OPXA 1E7WA 3NVDA 1KBOA 3R20A 3IT1A 4OBEA 2VK1A 3HVJA 5FB3A 4CIVA 1L5OA 1UDAA 3QOYA 4J4TA 4J03A 3DFUA 1K5HA 2WDPA 3GCWA 5BT9A 1DQZA 2Y66A 3BTVA 3WSWA 2G0TA 2JFFA 4PCLA 1JXOA 1KS9A 2JANA 1KYTA 3RKUA 3TR6A 5IDQA 1BEZA 2WHPA 5DM4A 3HVUA 1XXHA 1TUGA 2BE7A 4B4VA 1BX3A 4O0MA 1Z4NA 3DBRB 3VM6A 4D8UA 1N0UA 1SC9A 3AUFA 4B85A 3OA2A 2DTXA 4PSKA 4QVKA 3HCOA 1ZK2A 4JBXA 3OWXA 4RVOA 5H4HA 5IVIA 4C7XA 4FDAA 1CRQA 5EMHA 3AF3A 4Z7JA 3FVWA 1WW2A 3TQCA 4V03A 4BZWA 1O9BA 3EG5A 1ZOPA 3OJCA 4MDYA 3BWCA 2I4RA 4QE3A 2JLBA 1T8SA 4ALMA 2D5AA 1SVLA 4A5OA 3KSMA 5LA6A 1WXEA 5HBRA 1QP8A 3QPBA 3DE6X 3IEXA 2NV6A 2GZHA 4BRZA 1IJFA 1WZCA 4QOJA 2BCEA 5KYYA 5HDQA 3AVUA 1MB2A 2FF5A 1MDBA 4I1YA 1N7GA 4F04A 1DELA 2XUQA 1JXMA 4BQSA 3OJWA 4C6TB 4Q4CA 4HGOA 4Z6KA 1PTJC 3DVAB 3HGTA 4NJEB 4UBOA 5D6NA 1CPYA 2P3SA 5FWYB 4C05A 5BVHB 2O23A 3OX2A 4PLTA 2PU5A 4PLCA 4TTQA 3MJCA 1A82A 1XUOA 4I1VA 1H6AA 4PONA 3K1JA 3SYMA 2AEEA 2CLIB 3FYHA 1B16A 2C92A 1DG9A 1YASA 6GPBA 4DR3B 4WNYA 2P6NA 4EG6A 3PQ7A 4WD3A 4F38A 2WYWA 4KDEA 3DDZX 2Z56A 3UW1A 3V7NA 3GLIA 1BKSB 2DPYA 2PLWA 3TNDA 4MGYR 4DIDA 3ES9A 1L4MA 5CD9A 5CD1A 4KLZA 4TV9F 4HI0E 3BB4A 2FW0A 1ZU4A 3I34X 1G5HA 1M34E 1ZD1A 1JPNA 3ZWAA 2IPNA 5BPHA 2NTEA 3HB5X 3K15A 3ZGYA 3NP7A 1SPXA 3W7AA 3VU3A 4RSGA 1J5EB 2WKRA 3KLMX 3F4BA 2P9GA 1OT3A 4QASA 1IOVA 5K8VA 4MLDA 5EIAA 1PX0A 4AT1A 1VP3A 4GF5A 4UAUA 1QHGA 2DYKA 3AFOA 4RK7A 1YVEI 3CZAA 3NLLA 3OWOA 4RF5A 5EPEA 1ZI9A 4MR9A 4XJTA 3ZV4A 5EE3A 1QOQB 4WRRA 1ZPDA 2XCTB 3W34A 3YASA 2Y3IA 4OF4A 4LW8A 3ET5A 2ZIUB 2ZLBA 3K5IA 1QWOA 4TZ6A 3IDQA 2BBOA 2PKYX 3L8FA 1KC3A 1EB8A 4FT4A 3IR6A 3UOAB 2AI2A 1ISPA 1HV8A 5EAIA 4LOIA 3V1YA 4BWFB 3AF4A 3T1TA 3JS5A 3UAWA 1MF7A 3QPWA 4XWKA 4KLAA 3PA8A 1B0ZA 2OBXA 1KEKA 4URFA 1U65A 4LV6A 3DL4A 3OOYA 4G8CA 3CR3C 3B13B 1TD1A 3NHKA 4OJQA 4MS4B 1KIMA 5IH3A 5DBEX 4Y2HA 1AXEA 1JB1A 4Y9UA 2GYUA 3KEMA 3CMCO 3PKZA 1KI7A 3IPXA 3G5UA 4FCWA 4FBGA 3VAYA 1WMAA 1YCGA 3COWA 2HQBA 3KOWA 4J91A 4MV3A 5KJEA 4AJNA 1L5GB 3DCJA 3IVMA 1MN6A 5ALKA 1M2HA 5F4ZA 3RYCB 5IKXA 2V65A 3EY9A 4JYCA 2B1GA 2VAWA 4J0CA 4OREX 2WB4A 4Y1RA 3WGGA 5JQGF 3FNBA 1VJCA 1YJAA 3CNOA 2VDLB 1GNVA 4REOA 4A0FA 4DSOA 1Y81A 2FPMA 5K8JB 3QUBA 2I29A 3OMLA 4JKIA 1MO6A 1T4CB 4GPIB 4ETWA 1KH1A 4MLPA 3RCBA 2WC1A 3CZ4A 4BKMA 5C7IO 1GYQA 1LQUA 3E7PA 2I4OA 4XWOA 3FPJA 1WMBA 3ZD7A 5KZMB 4PO1A 1SPBS 2EGHA 3RVQA 2IH2A 2XTZA 3M3HA 3DZHA 2QVYX 4AX8A 3A10A 7MDHA 2YQ5A 2XUKA 3C1AA 2FMXA 4NG4A 4OXNA 4EDFA 1WE2A 5U4QA 1WMFA 3R5FA 5F51A 4MW0A 1I6WA 3A28A 3MVEA 1V1RA 2FN7A 4TL7A 2A0FA 1FLAA 3RWOA 4BTLA 4F8YA 3K71B 1PS0A 1DT3A 2NYUA 2C4HA 1EUCA 2VHWA 2ZTMA 3EW9A 3GLHA 4U2BA 4D46A 4PLHA 3PYMA 3H2KA 3H5WA 1XVIA 1PK7A 1U9YA 3OX1A 5FPQA 1Y8ZA 1XNJA 2VJOA 2BH9A 4I5EA 5CRIA 3GVPA 4UMFA 3BGDA 2ZIGA 3BMQB 3E7WA 3OIYA 2CHQA 4A6DA 1KE2A 3GCZA 3VVBA 4OQEA 3KPJA 4CUJA 3IODA 4ZICA 1NOIA 3F9CA 2Q4TA 4OHOA 2RH5A 3NC1C 4S1PA 4O2AB 4CM3A 1TKAA 3FKSD 5DOVA 1N8SA 2AFIA 4H7JA 2D4AA 3ZHUA 4MQEA 5EESA 3S0JA 5BUZA 1SHLA 4TS3A 1QVWA 3O8QB 1G5TA 3GPIA 4NCAA 2ID9A 1K68A 3BORA 3GXOA 3M8KA 1OBVA 4MROA 5EE0A 3EQ9A 3MRXA 3AVWA 3NWBA 2Q1WA 3K0FB 4BS9A 2PKEA 2EFHB 2GHQA 4R9NA 1I9CA 3AJAA 5CLIA 3BA6A 1V5GA 3LCUA 4MV9A 2LDXA 2WPDA 3QMVA 4WEQA 2P5UA 4DA9A 2CWWA 2B4KA 2HKIA 2IGBA 5HDBB 4EHNA 2PAFA 4ZVSA 1JALA 4IDNA 5CB0A 2Z8YM 1OGIA 2CZGA 2I8AA 4X3CA 3S2GA 5BN3A 3I5UA 4KODA 3TQFA 4OHBA 2XKBA 1C29B 2ET6A 2VSFA 3BL5A 3ILYA 5FI1B 4JVOA 4EHJA 5LD2B 1XF1A 2DFLA 2HU5A 4G3XA 4KMSA 4XUCA 2DWQA 3G8YA 3LUBA 5AKLA 4AURA 4BOYA 5KJ1A 1G8AA 2VF5X 5EHXA 5JNSA 1AUOA 1Y33E 2GXSA 4FFBA 3DMPA 4WQMA 1BWQA 1RWWA 5CVUA 1CUVA 3UMFA 4PC1A 2C99A 2H9IA 4EYGA 5HA5A 2HSDA 2XF2A 2JGFA 3T5DA 5SZJA 4KIJA 3VH2A 3K6JA 1E79A 1P9RA 2AOUB 2EFEB 4RE6A 3TBFA 3R9WA 4XSVA 1BHQ1 3TJMA 4A6PA 3UA4A 4R16A 4OHVA 2ONCA 5C8YB 1IOZA 5DT2A 1JEYA 4FNOA 4K9RA 1OAAA 4FKMA 3LOQA 2R4QA 2BMFA 2NN3C 2P91A 3JQCA 3A31A 3FCXA 3OQVA 3R7WA 4ZEMA 1TMYA 4R2MA 1F0KA 1SU7A 3BXGA 3U9SA 3WRVA 5JY1A 1Z7EA 1C30A 2C9OA 1G41A 2V9CA 1MEEA 2ZEJA 4XM0A 1N6PA 2Z9CA 4MWGA 1IM2A 2QPOA 4EO9A 2I2WA 1L5HB 4WBNB 1XCPA 2C95A 4HYTA 1WCIB 2C7VA 4F92B 2ZE8A 1VG0B 3DLHA 3AR2A 2R85A 4DB2A 1RLOA 1QG0A 2J85A 3HFSA 4FZ5A 1U3VA 3RS4A 4D43A 3KOZA 3L6UA 1MDFA 3ESAA 3CVYA 2JGAA 1FNDA 1E8DA 1U3WA 1QZUA 3U4AA 1CP3A 1WUIS 1YA8A 3LX5A 3QVGA 2D8MA 4CM8A 2NTVA 3ZE0B 1TK2A 1OBHA 3HUTA 4BXOA 1JIXA 1M1ZA 4Y9TA 3MWKA 3HV2A 3NV7A 4I6EA 3W6PA 1OI4A 5CLGA 3WDKA 4DLZA 1CYEA 3LUJA 1RAFA 4TRRA 1ISMA 1GGJA 2HAEA 3BQNB 3QYAA 2C31A 3AI3A 3C5HA 4H6XA 3ZBPA 1KRXA 2Z2ZA 4NNJA 4W5WA 1RMQA 3USES 1BXRB 3PC4A 3D7LA 3H99A 5HIJA 1GJRA 3MBIA 4KSCA 5EIFA 1N3YA 1Q15A 3UJ7A 3VX4A 3QELB 2O8DA 1ST3A 1MO5A 3EN0A 4XWAA 1IPFA 2XODA 5B2FA 3WGVA 3ORQA 4FSHA 5BN5A 3TB6A 1TCCA 1A9OA 1Z5WA 2WABA 2CEKA 5IFLA 3VU9B 5G1NA 1R5NA 2XBMA 1RACA 2HRZA 1FU7A 1FFBA 2EWVA 3H0EA 1ULHA 1QGUA 4H18A 3ZK9A 3SQNA 2W42A 1QHXA 2POCA 4ZDKA 2WI8A 2FAXA 2UYCA 3QOXA 2OV8A 1S01A 3PXAA 1U3DA 4J0GA 1IZ8A 4DMHA 4JD5A 5E6RB 2I6GA 5BMVB 1UK9A 3KXKA 4AJ1A 1AVTA 2I9KA 1Y9EA 4PFJA 4AP6A 4JLJA 2A9PA 1ZRHA 4X63A 1QV7A 3KYIB 4JEMA 4QOEA 2VZ0A 5BQPA 3QKRA 3N0TA 2IZOA 4F9FA 1DXQA 1XVUA 3THXB 5IC4A 3NBQA 2VUIB 4LSWA 3UKDA 4LKOA 4UBKA 2X5OA 4DCSA 1VKRA 3Q2IA 3ZU6A 1NVVR 3L9WA 1NZFA 2GWRA 3BKWA 1E20A 4F8JA 4XGRA 2I65A 4KTTE 4YUZA 1EU1A 3VKWA 5BR4A 2QL6A 1Y1KE 3JYPA 4KR6A 3P0EA 1G8GA 1MTZA 1T2AA 3RSLA 4D3ZA 1TM4E 2Z4TA 5IUNC 2ZWMA 4TM7A 3VHQA 1SHJA 1JNYA 1SKQA 1HEYA 2FGKA 1H5UA 2CLSA 4TYMA 1F2DA 3T61A 1VLZA 1H66A 2KSQA 1NM5A 2RONA 3ANTA 3KQMA 3UT6A 4AMVA 5IULC 3QHPA 4POOA 5DGCA 3VNUA 2B36A 2AFRA 4HZUB 2Y8EA 4LQCA 3L0PA 3OETA 4M1QA 3CF6R 3MINB 1ZBQA 3E9CA 4XWYA 3V7WA 2V4UA 1GPWB 4L9WA 3V7UA 1A5SB 1AKEA 1CQJB 3SJAA 4DMLA 4UOZA 3IVXA 4DLRA 2QUAA 5EHIA 1KOFA 4YDRA 2CUTA 2BFOA 3C7CB 2IU4A 1XE3A 3KKMA 4FWBA 3P0HA 1DTWA 4D6YA 2GCPA 3H6KA 1I4LD 1X7HA 5AIAA 2YV2A 1NU6A 3W78A 4U0JA 3DTTA 5DW0A 3ILXA 3A70A 5IM4A 1ZIPA 2PH3A 2O8NA 4QRIA 5M34A 3VR0A 3OM1A 2GERA 1LW6E 1RP1A 3H5OA 4RHXA 3THRA 3W5VA 3EAQA 1Z2EA 5J2UB 2JLXA 5U4XA 5D86A 1HDOA 2ZTUA 3AR9A 3ND8A 4PVDA 4LS3A 2XDQA 2C00A 2AC4A 2C4MA 1K7SN 4IHKA 2QD4A 1E92A 3IHTA 5CGZA 3VR6D 2VUUA 2P0AA 2F3RA 1LBSA 2Q45A 1WCWA 1EDDA 1Y7HA 2NZJA 4QYMA 1VPLA 5COQA 1IZ9A 3ROZA 3K5PA 3DYIA 3VNSA 4DPMA 3UV7A 2EL9A 2IYNA 4HS4A 1J24A 1VIYA 3ELDA 3SNHA 3TXXA 3CB2A 3BCSA 1KR2A 2QEQA 2WZDA 4M1ZA 3UY4A 4Y0AA 2HRCA 3CO5A 3QU7A 5FBWB 6LDHA 3DQZA 3W6UA 2HTEA 2FE4A 2YWXA 3LWDA 1EVKA 2H5JA 4KDCA 2GPTA 3FWPA 4AAYA 1J8MF 1L7DA 3IBFA 1P4SA 1B3RA 1VMIA 1XNHA 3KZ1E 4N7BA 2Q2WA 5GOZA 4RTPA 1QIKA 1XSEA 3EIQA 4P31A 3TOXA 2PMCA 3QUCA 4X60A 2PZMA 1QDUA 3K20A 5FYQA 4XEHA 5JR3A 2FFQA 2FSGA 4NMLA 2LCQA 4DY4A 2NLOA 3NANA 2Z8YA 3MHTA 1QKJA 5JO9A 2E5WA 2VTBA 4AJOA 3R5XA 4YAKA 3REQB 5KOYA 1O95A 4B3GA 2BFCA 4I2VA 3IXLA 3O03A 3E5RA 4BRWA 2X3UA 1T4BA 1I9GA 4HPJB 4I14A 2QU8A 2EZ8A 4QBGB 1COWD 5FBHA 1EUDB 4YCSA 1SHUX 1MHPA 1BZYA 2QR5A 4BX0A 2H0RA 5CXQA 5K8CA 1IXKA 3DYBA 1DNPA 5IYZB 4HYQA 3EGCA 3ORRA 2ECFA 1VFNA 1ULAA 1SHZA 2GO1A 4PG7A 1IU9A 3KSZO 1GRCA 1YVRA 1HYQA 2W8BA 3INTA 5CITA 4BCDA 1DKLA 1Z06A 3HMKA 4M7OA 3GRPA 3RFFA 3ZGOA 4K9KA 3ZV3A 1MHTA 3FI9A 2EF1A 5CIWA 4XI9A 3LTNC 3DBHA 2I4MA 2PO5A 4FILA 2Y1GA 4QFDA 4KQHA 4N6NA 1NM5C 1T6ZA 1AY0A 2BFFA 2DKOA 2PUTA 4LYAA 2XA2A 4KBYA 1EEXB 2DQ4A 1U9CA 4URWR 3QBJA 3RVKA 2UZ1B 4RZUA 1K8ZB 1W5AA 3QX9A 5DBGA 1BDIA 3STYA 1QHHA 5EJMA 1TKBA 1XLTC 4ND7A 4MGHA 1CRWG 2CFIA 1B2RA 1NF3A 3T3NA 3BGSA 1EMDA 3BK1A 2GEKA 3GEHA 1Y9AA 1JAYA 2AN9A 1OVMA 3MT7A 4BHTA 1C0KA 1KYQA 1PNOA 4OFXA 4DIMA 5A9SB 2ZR9A 2IXTA 3JD4A 1OWLA 4H6VA 4NZYA 4EW3A 2B69A 1O9HA 1WV1A 1UJ6A 4WCFA 4DLYA 3AETB 1FP1D 3CRMA 3GG2A 4ER6A 1K5GA 2ANBA 3B70A 3FCCA 1I2ZA 1B8VA 1LJ8A 3TW8A 1XL0A 3BD9A 5KYUB 1FU4A 1UPXA 4RWZA 1JVSA 5FQOA 2YBDA 2XITA 1R16A 3CLVA 4IV8A 4C7OA 3LHDA 4OSOA 1JEQA 1P5FA 1W2HA 4XAQA 2NO6A 2W9XA 4QD3A 4FE7A 5LBTA 1O4VA 2C5SA 1F0YA 3GN2A 1DU4A 5CURA 5H16A 5SY9A 3X1ZA 4BMCA 2PS3A 4C6SA 1MFZA 4E3ZA 1UPBA 2Y67A 4ZCIA 2UXBB 4GXTA 4BQIA 3NHYA 2DXIA 2H4WA 4OI4A 2VHQA 4EJSC 2KBFA 3LY7A 6AT1A 3FPLA 4URXR 3ZOZA 1NASA 4ZEOA 3SHVA 3O38A 1SG6A 4BVAA 3THSA 1ODSA 1BMQA 4EA9A 3FWZA 4UUOA 1UBSB 1QCDA 5A5EA 5FX2A 5I5EA 1LC3A 1F8GA 1ZN7A 3BS4A 1LJUA 3G8CA 3TSWA 5IEJA 1EJ6A 2GT1A 1CC1S 1O0CA 4ME6A 3EXG2 3AEKB 3SPXA 2IS6A 5IJ9A 1M5TA 4JYBA 4Z7QB 2NYRA 4A1FA 2EP5A 4ODIA 4M8NE 5ALHA 1UBKS 1ADBA 3PNQA 1APBA 1SG9A 4JIGA 5HKKA 1J56A 3EA5A 3TPCA 4H77A 1TT7A 2YN4A 4L2IA 4P53A 4A8JA 2ZDHA 2WWIA 4KLRA 1RM4A 4UCWA 3CY6A 3GP5A 3V97A 3D5QA 4IX1A 5DSXA 5EL0A 3VHXB 2P2SA 1FFHA 1O95C 3ND5A 4N3AA 4DTIA 5IHXA 3ZDCA 3D3WA 4YI3A 5TQVA 1TTPB 1YZUA 3A36A 1QWSA 1UINA 2XUFA 3CT6A 4B2LA 3NDJA 1GVNB 3CZMA 3BXHA 1IXZA 2PYIA 5DTMA 2WM9B 4JP5A 4L7VA 3GT4A 1S1CA 2WTNA 4XQCA 4TX1A 5I4IA 1C4WA 2B8JA 1L5LA 2ANCA 5E3IA 4Q4LA 3OZCA 5F7ZA 3N86A 3OLYA 4Z51A 2PVPA 4ZJPA 1YSCA 1VJGA 5D7NA 3SSAA 1Z38A 2FMTA 1A9QA 2PEZA 4O4HF 4ZI7B 4OJNA 3SYRA 4CKEA 3CVOA 4F7DA 1G2OA 4PS0A 4NK4A 5HCUA 1GNSA 1MJGM 2CMGA 3FMOB 3KJGA 2ADMA 2IYUA 1PVOA 4D4KA 3KQOA 3T7TA 2ZR7A 1XJWA 5EFZA 4E2FA 3W9YA 3GI1A 1T1JA 1EAYA 2ZTHA 3F8SA 5A4IS 3RHZA 3C1UA 4LXXA 1K9SA 3SJBA 2BWJA 2VO1A 4HWGA 3T3PB 5BV2P 2OSVA 3ZYCA 1JILA 3AU9A 1GQ2A 2C8LA 4QZVA 5FH9A 3AWDA 4KG7A 3AY6A 4HLUC 4YJHB 4DLKA 4QQNA 2HMUA 1WB9A 3BJIC 4GW3A 4GYWA 4WZBE 3C6XA 1IHXA 4YAUA 4UHDA 2D1TA 2VNSA 2O5VA 3VYSB 2WG1A 2I03A 2QMHA 2I3ZA 1WVMA 3N6VA 2Q7OE 1X1TA 3HJHA 2VT7A 4EECA 4XYEA 3SBEA 1XXLA 1ZM9A 5FULA 1JLHA 4H7FA 2PSEA 3OIDA 4MP8A 3SHTA 5FJJA 1SWWA 3FA2A 3L6RA 2JGNA 4PFQA 1VG8A 2DCMA 2W2QA 3BM5A 1GKLA 4I4IA 1CP2A 4C7JA 1Z4JA 1X13A 3MJVA 2XKAA 3FETA 1W5FA 2VS1A 4KC0A 2YZMA 1YKSA 5P8WA 3HPRA 2C2GA 2A67A 1LF0A 3C8UA 1FBNA 1QHFA 2NGRA 4QGHA 3WFZA 1B7GO 4QLAA 1OFTA 3W2GA 3FIUA 5JE8A 3LG2A 1CJTC 2RHMA 3TLZA 1JGTA 1ODKA 1NVBA 2FP3A 1KZHA 4IBOA 1AKQA 4NCHA 2JA1A 1SM4A 2AB0A 5JLAA 1I2AA 3FCOA 2CMKA 1H1LA 1X7YB 2XHZA 1Z6PA 2BFEA 3JWIA 2XVMA 2ONYA 3PJEA 3BF7A 1DJMA 1D2HA 4PHGA 1LPNA 3PU6A 3NHWA 4ZOCA 5SYMA 5EJ8A 1XD2A 1ZN2A 4D9CA 1BYIA 3GMIA 3OCYA 5JSKA 4K87A 4ZYWA 1WXWA 2CLCX 1A4XA 3H97A 4MAFA 3FOZA 1ZM7A 1I7LA 1KK1A 1V71A 1E2DA 4K0KB 2WYIA 4QFCA 2CVHA 3MGGA 5FPSA 5FPPA 3NOVA 2IYOA 3BMOB 1HURA 5L9AA 1JSXA 3FXAA 1M1NB 3PTZA 3QWIA 1GITA 4M7PA 4PX9A 4XR4A 1PSWA 2Q6VA 1PFKA 3QQPA 1EX1A 4M87A 4P3KA 5DMXA 1MC1A 1D6MA 4Q16A 1TZCA 2A9FA 4KN9S 4W7SA 3DOJA 4TWRA 5FUYA 2QG6A 1G5PA 3NTOA 4MIKA 2EWMA 2YJ6A 3JZFA 1M33A 3U7HB 1PYGA 4YJGB 1Z82A 4E46A 4JSRA 3ZCPA 4TZTA 5K0EA 5JDCC 2IPOA 3VKFA 1HSZA 3VNAA 1LX7A 4QJ3A 1XTJA 4L4YA 4DOMA 2HF2A 3T4XA 3INRA 4B3XA 4EUSA 1TM7E 1CDZA 4NKRA 1WMSA 3EE6A 3VH4A 2JHCA 3PCRB 1HI9A 3DFFA 4JOQA 4ETMA 2FQ1A 2VWQA 4YI5A 4RD1A 5G2OA 3WK5A 5FEMA 3W5DA 1M6VB 3EVCA 4R69A 4M88A 5EPOA 1H2HA 4Z0PA 1TZBA 3C16C 3G8AA 1YFKA 1A50B 1CWUA 3H11A 3AKCA 3KJIA 2E5LB 3PI6A 3GW8A 2WJ6A 4MWZA 2H8KA 3GN1A 3MB8A 3QWFA 4BB0A 3CC8A 2QE6A 1C4XA 1NPTO 3E3AA 3GFGA 4CQNA 1XQ6A 3VR4A 1I0ZA 4YIHA 2ZI7A 3D4NA 3PC6A 5BW8A 1A69A 4G8DA 3WL6A 3AJRA 3ZCRA 1P9OA 3K5WA 1MAVA 4DB4A 3EEQA 2AW5A 3FGPA 5FRDA 1ATZA 2CL6X 1U5AA 3KAQA 1NWHA 3NI2A 3ZLUA 2HHHB 2P2NA 1SBTA 1T1GA 2GEVA 4ZCQA 2DBRA 2FWBA 5EIEA 2ZRPA 1SBYA 4DIOA 4DYHA 1IIRA 1CNEA 1E1RD 1KAMA 1PWYE 3HR7A 5DWVA 4Z1MA 3Q9LA 1D07A 5AVXA 5B30A 3EIOA 5AUPB 4EBBA 2CLMB 4MCAA 1YFLA 2DC1A 1QPZA 4Q01A 4U7TB 4AUNA 2GPAA 3DBLB 2QTRA 2PX5A 2WTBA 1ZGCA 3D4IA 3I76A 4KQFA 4WVLA 1MQ8B 1S3GA 2IZZA 4L0MA 5CW2A 5HE8A 4IIUA 4EG7A 2G80A 5GV8A 2PWBA 1ZY2A 3V4LA 1EFRD 3S99A 3L4KA 2BFDA 4J16C 5F76A 3ZJ5A 2QX9A 4D9NA 4KR7A 5FBQB 4M4SA 5EHGA 1W8IA 3FNGA 3QJYA 4OXRA 5E8RA 4BFTA 4R1LA 1Q77A 1W88B 4KPUA 2E7ZA 1P1KA 3HKBA 1YMQA 3CH4B 3COSA 2RHLA 1NTRA 2FWAA 2ZUBA 2OBLA 2YN2A 3VC2A 2XRMA 4C03A 3EBPA 2H2AA 2ZT6A 3WLSA 1X80B 4OB8A 4YECA 4H0NA 1MX3A 3HZRA 3KQTA 5T5QA 2GMWA 5BWCA 4RV4A 1II0A 1Y3FE 3CLRC 4FFWA 4W8HA 5EC8A 4RM2A 1P4AA 5AOVA 2W70A 2PGNA 2GK7A 2JW5A 3GGPA 3OMXA 3B3QA 1ZI6A 4NX2A 4F93B 2DFKB 3NUZA 3T35A 3ER9A 1NGSA 2O6HA 1RWMA 4IY1A 2PS1A 1DAPA 4KR2A 4R8VA 1CR6A 4AG6A 1N0IA 2X2OA 4RE5A 2IXEA 4IWXA 1Q6ZA 2AKAB 4RTNA 4OTZA 4EKNB 1QDLB 4J8PA 3UG7A 1M5UA 1L7XA 4P5PA 1Q92A 5B64A 2OHVA 5FWDA 1CR0A 1J8DA 3U80A 3TCKA 2PD4A 3L5OA 4CL8A 4CEHA 1EFLA 1WPQA 1JQDA 3D6UA 4R3UC 4RCYA 1YMVA 3AEZA 4MNTA 4JC8A 4BX9A 1GG8A 5KU7A 4PR0A 1MIHA 1YJQA 1CRLA 3BTUA 3EMBA 3R2JA 2P2GA 1R8SA 1MJGA 2AG8A 2DJIA 3HY6A 3KJEA 3OX3A 4D96A 2RHTA 5A9RA 2RBKA 1TU0A 3RUEA 4BZPA 4DJTA 1JFLA 1R0RE 4QBIA 2SCUA 4UCXA 3BSYA 5BWMA 4L95C 5CEFA 1DX4A 4C01A 2RI6A 3C8MA 3H17A 3G2KA 5DM0A 2F4VB 3M9LA 4JLSA 2A5YB 2ZYSA 2J5QA 2RG7A 1GD1O 3DA8A 3GJXC 4QYXA 5EZYB 1N25A 4HNQA 4M1KA 1KQOA 1RD4A 2CLDX 4QUBA 3WBJA 1Q6YA 4PY2A 4HQNA 3ZCSA 1TAUA 3QJGA 3D31A 1JZTA 4M89A 4DDKA 4P1ZA 2E37A 4RIIA 3P2MA 1FNNA 3EVZA 2VWHA 5JAZA 3JZDA 5KKCA 5LJLA 1Z9BA 1L5MA 1HWYA 1QRRA 1EVJA 1XALA 1U80A 1T1EA 2HA3A 1ZKMA 1COZA 1ZVQA 2A5GA 4MWOA 4PG6A 4ZEXA 1PX2A 3DZIA 4N8EA 4LYEA 4EJFA 1JR4A 3G2LA 2WFMA 1C9JA 4K2AA 2C3UA 3LT0A 2JAWA 2YRWA 4KFTA 1KPIA 1ISIA 2MSEB 4RXMA 3HVHA 2XPCA 3RYFB 3DBOB 4W5TA 5ALDA 1SU6A 2IOFA 1K7YA 3EVGA 2YWHA 3PEEA 2WUDA 3BDIA 5AT1A 1ZAYA 3MWYW 3HO1A 4UAVA 2QSYA 2WOJA 4Z0HO 2XD9A 2D5BA 2O06A 1OVGA 1P33A 4WNCA 1VRWA 1VYVA 2AT1A 2Q6IA 1LQTA 3MRSA 1PQPA 1KJQA 2JFXA 5CVDA 3ET4A 2FR0A 2ID7A 1J8FA 3BRWA 3HC7A 3UEOA 1HT2E 4BVHA 3FNFA 1TQ2A 5JH7B 3EVAA 3L7IA 4W9NC 2R44A 3BMNA 4J49A 3PXUA 1ZIDA 2O07A 3MJRA 3RQSA 4Q7QA 5H1YA 1NY6A 1S8AA 4P7JA 1PNQA 1PQYA 4GZ6A 4PPQA 4BNGA 4DNXA 2QRPA 5ADWA 2GXAA 1E98A 1C3VA 1MXFA 1Y89A 1XKXA 4IAOA 1NVWQ 2GD0A 4J1NA 4O29A 5DK6A 5JJ5A 4PAOA 4YJ2F 1QE5A 1XFAA 3IQIX 2J3QA 4BAGA 2IWHA 3L7YA 1U6JA 2YOHA 1POWA 4YQFA 5E7QA 4EYSA 1Q21A 2Y71A 4HPWA 3FDXA 3CW2A 1T9AA 2VRCA 3O8LA 3P9XA 1T8PA 4QPJC 5CG1A 4KMRA 3KIPA 2BEUA 4JLBA 4R8SA 3TMAA 5JNWA 3FBTA 1Q1ZA 2XRZA 8ADHA 1LZLA 4IIVA 3LD9A 5FUBA 4GPBA 2C8KA 4LMRA 2B6NA 1ONOA 4LZNA 1UPAA 3KEFA 4RD6A 3QSGA 4PG5A 1DL5A 1RRKA 4XVRA 1KP9A 4BTVA 2AWNA 4IQFA 4XLZA 5IVPA 3NX4A 1CDOA 2DUUA 2QLMA 2RARA 4Q3OA 4QO8A 3D8SA 3DV0A 4LJ8A 3TLGA 3OEED 4O4JB 3N07A 4YUVA 5L8VA 1OASA 2RGNA 1NF8A 1N6IA 2XRYA 3EYWA 1OTHA 3N2GB 4IIJB 3R8FA 1VJ0A 3JQAA 4TXJA 4EUFA 4GXQA 1Q16A 3EQZA 1GU1A 3T12A 1FBTA 1G2QA 2NPFA 1QGOA 1N2GA 2MINB 3Q9NA 5AHOA 1YBMA 2OLJA 2SKDA 2FPLA 1QR2A 4UAJA 2IT1A 3GGCA 4RMJA 4EW2A 3U3KA 1N5MA 1UJ2A 2OCGA 5BV1A 1ARZA 2Y1EA 5TT1A 3UA3A 1IJEA 1G3RA 2JLYA 3GRYA 3CU5A 5I9TA 2B5OA 1PEAA 5FFMA 2SECE 3O8RA 1PZHA 3GWGA 3IP9A 1C3OB 1E7RA 1UMBA 1XQ9A 2F8LA 2JCXA 3OF3A 5BSMA 3RU9A 4XYGA 3TZCA 3ZU2A 3GFSA 4CQLA 1AM4D 4ZC1A 3ZE9A 4N7RA 3OT1A 4O02B 1DRVA 4BGVA 4DAEA 1B23P 3QQ5A 2B4QA 3JWJA 4DMRA 3PRKE 3HP1A 1X86B 4M22A 1II9A 4AECA 4RCVA 4MV5A 1E6EA 2RH4A 4UBIA 4RSHA 1RYFA 1JDPA 2I6UA 5D5HA 3K0EA 3MG9A 3L84A 5DI3B 2W58A 5GM2A 5JOQA 3K0AB 3QY0A 3ETJA 1YR8A 5CJJA 3N0VA 3BD6A 1OMOA 1M2JA 3W79A 4ENQA 4HDQB 5KKAA 4DEXA 2I91A 1A9SA 3CX7A 4EKGA 3SSNA 2HR1A 4FS8A 1JXQA 2VPPA 4YRNA 4ZT7A 2NO7A 3JARB 3NHFA 1U4NA 1JECA 2J87A 4C2AA 1NIJA 2EHDA 3IAUA 4EYOA 1ZN9A 2C9DA 2PH5A 4CLXA 1NOJA 5A4FS 4ARZA 4BN5A 1JU3A 4KQEA 4UEOA 3JASA 1TO2E 1DC8A 4Q6BA 2GLXA 1FNCA 2OM6A 4HMPA 1GT6A 4YCJA 1PL0A 3IELA 2AD5A 2QAGA 3UH0A 4CTKA 1W47A 2PGOA 3D2CA 2C5FA 1MMFB 3BIOA 1A98A 3QH4A 2ZPAA 2O6LA 4G0ZA 4WNAB 3DZJA 4ER5A 3FW1A 2PT9A 3RM3A 4X6LA 2OR3A 5TXGA 4NDZA 1WIWA 4KBFA 4J4HA 4ALKA 2MMCA 3D81A 5JUWA 4MJXA 5AXAA 4F6RA 4ON9A 1JLLB 1W0CA 3KQVA 4QU5A 1R5JA 4AG3A 4CV3A 4LXQA 4KPFC 1Z4IA 1K3UB 4Q12A 4M86A 4OKNA 4LF7B 4G5HA 3MCUA 3CHYA 4B31A 1CUSA 4FGUA 1FP2A 2GX6A 1Y3HA 4E09A 4EHLA 2FQQA 2G4LA 5DCWA 6PFKA 4AJIA 4MRMA 1QFZA 5KPJA 3IXQA 2CV2A 5T4HA 1YQGA 3BXXA 3M1IA 1MEOA 2GGSA 3VPAA 4YCBA 1SXQA 4ZAWA 2PZJA 2ZYVX 1GTJ1 1EG7A 1K5PA 1XNRB 1J22A 5REQB 3O93A 3G3EA 2HGZA 4FFSA 2J4DA 4C5CA 1MR3F 2IODA 5JSQA