2Z9CA

The crystal structure of azor (azoreductase) from escherichia coli: azor in complex with dicoumarol
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
200
structure length
197
Chain Sequence
b'SKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALRAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FMN-dependent NADH-azoreductase
molecule tags Oxidoreductase
source organism Escherichia coli
publication title Expansion of Substrate Specificity and Catalytic Mechanism of Azoreductase by X-ray Crystallography and Site-directed Mutagenesis
pubmed doi rcsb
total genus 74
structure length 197
sequence length 200
ec nomenclature ec 1.7.1.6: Azobenzene reductase.
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2z9cA00
1T0IA 1CZKA 3GFRA 4S24A 5EMNA 5F4BA 3D7NA 1FLDA 3F2VA 5EAIA 1JA0A 3EYWA 1FX1A 1YCGA 2QMYA 5ULLA 4FGJA 3NHWA 1DXOA 3O2NA 5FX2A 3GFQA 5LMCA 3B6IA 4N82A 2FCRA 3NHSA 3ESYA 1QR2A 2D5IA 2QX8A 1DX9A 2KQUA 4NLLA 3NHRA 1C7FA 3OX2A 3OJXA 3KEGA 3FJOA 3HLYA 4BMOB 4FGKA 1TLLA 2RG1A 4QOHA 2V5UA 2FZ5A 3NHKA 3QFRA 3R6WA 1YRHA 2FZVA 3N3BC 2FX2A 4YALA 1CZUA 1WSWA 2XOEA 1KBOA 1I1OA 2OHIA 2WC1A 1CZRA 4XDGA 4C76A 5B3LA 1YDGA 3ES9A 1E5DA 4H6PA 4F8YA 1AZLA 1FUEA 1RLJA 1JA1A 5F12A 3W7AA 1QBGA 2R96A 4PTZA 1ZWKA 3HR4A 4QOJA 3ZHOA 3LCMA 3F6RA 2OYSA 4C14A 4CF6A 2ARKA 4DIKA 1XYYA 4Y7CA 4PTYA 2OHHA 1OBOA 3UXHA 3NHPA 5LVAA 1AKUA 1ZWLA 4Y9RA 4LTNA 1FVXA 2FLVA 4J8PA 1AMOA 4U7GA 3W77A 2Q9UA 2HNAA 2FOXA 3NHLA 2MT9A 1CZHA 4C0XA 3K20A 3ESXA 1XT6A 2QX9A 4ZVLA 2R97A 4XDHA 2BF4A 4YAWA 1V4BA 1FLAA 3OX3A 3GFSA 3EDOA 1RTTA 4OXXA 3U7RA 2MOKA 3W79A 1J8QA 1FLNA 2A5LA 1SG0A 2Z9DA 3OJWA 1OFVA 4Y9UA 1AKVA 3TEMA 2FVXA 1DXQA 1YCHA 2MWMA 2Z98A 3HA2A 4YAFA 1ZX1A 5TGZA 5JROA 3SVLA 3OWXA 4H2DA 2AMJA 3B6KA 3KAQA 4NULA 1D03A 5F51A 3QE2A 3K1YA 5FA6A 1RCFA 1YCFA 2V9CA 2XODA 1X77A 4FX2A 4ESEA 3TE7A 1RLIA 2QWXA 2Z9CA 2ZKIA 4ZVMA 4DILA 4QOFA 1VMEA 4HS4A 2X2OA 1YKGA 1QRDA 1J9EA 2B3DA 2HNBA 2QX4A 3B6MA 3NHJA 4N65A 1BVYF 3NHYA 3W78A 1CZOA 1NNI1 3OWHA 4U7FA 5NLLA 3G5MA 1WSBA 2OHJA 4DY4A 2M6SA 4QOIA 1D4AA 1AKTA 5LBUA 4QOEA 3FNIA 4ICIA 1CZNA 1CZLA 4QOGA 5LJIA 1BU5A 5LLDA 1FLVA 4GR9A 2N1MA 1H69A 2W5UA 4YAUA 1AKRA 4ZVKA 1B1CA 1YOBA 1AHNA 2F1OA 3B6JA 3ESZA 5EA2A 3L9WA 2Q62A 1QHEA 3L9XA 5LJLA 3F6SA 3NHFA 1J9GA 3OX1A 1F4PA 4HEQA 3OVMA 2QMZA 3KLBA 3UXEA 1AKQA 3O73A 4C0WA 1H66A 4LTMA 3FVWA 4U7HA 2GSWA 4N9QA 4R81A 2MTBA 4LA4A 5NULA 5BUCA 4D02A 1TIKA 3NLLA 2BPOA 3QFCA 5B3KA 1XI2A 6NULA 3N3AC 4PU0A 4GQIA 1GG5A 2BN4A 5LBTA 3FW1A 4LTDA 2QX6A 4YQEA 1C7EA 4CETA 3U7IA 3LT5A 1SQSA 2FDXA 5FUQA 1XYVA 2FAXA 2Z9BA 2V5VA 3N39C 3NHUA 4LAFA 1AG9A 4QODA 4YAOA 3S2YA 2X2PA 4BMPB 3P0RA 3JSXA 3NFRA 1D04A 3FX2A 1KBQA 3GAMA 1OBVA 2BMVA 1FTGA 4M0CA 3TZBA 3F90A 4ZVNA 5A4KA 3RPEA 2QR2A 1T5BA 1J9ZA 4GI5A 2M6RA 4FGLA 2BZSA 2KLBA 3KAPA 2HPVA 1AKWA
chains in the Genus database with same CATH superfamily
4B8ZA 4BCBA 1V25A 3I64A 4P7GA 3K4HA 3FRHA 1UDXA 4M60A 4JYPA 3FNGA 2BKEA 4BHTA 3HO1A 4R71A 2ES4A 2Z95A 2MDTA 2HA4A 4BNUA 2HLDA 5EP3A 1IZYA 1A2KC 1QH8A 5BV1A 1SQFA 3A31A 4BE7B 4I1RA 2ECOA 4CMEC 4FIDA 3IUEA 1U0LA 3PJDA 3QFSA 1TRKA 4UM9D 2I76A 4WD3A 3L4JA 3ECSA 3SSNA 2FZ4A 2HQSA 1SZPA 1FTNA 1POXA 4PC3A 3KUUA 4WOJA 4LXYA 4U39A 1T2UA 1IOLA 1NV8A 2JEZA 2HLPA 1E7WA 4MPDA 1EWYA 1V8DA 3P9SA 4C7BA 4DKXA 4FLEA 2WMDA 2JFWA 3ROMA 1ODIA 2DR3A 1NBME 2I7XA 1V1MA 4HAIA 3UTCA 4FOPA 4KQ6A 4BE9A 3V2UA 5GADl 1GGKA 3G13A 4I4LA 3HE3A 2CXNA 2H51A 3VBEA 2C99A 4ZV7A 5LPNA 4HB4A 3TLYA 2TSYB 4TN1A 4YYZA 2HF8A 4BFCA 3TQSA 4O2RA 3HU1A 4PTLA 4FE7A 3TS1A 3ZY6A 3OY2A 3QU9A 4KQKA 5FOXA 4A1OA 4BC1A 4QTUB 2VHZA 2ZRGA 2WNSA 2HMSA 3I5MA 5JCOA 3KV3O 1H9AA 1BIFA 1Y1RA 2WG0A 3GJSA 3WRWA 3AF4A 3SU8A 1JFLA 3DE7X 4C01A 1T9AA 2H85A 1M2JA 2QMHA 5HFAA 4OHFA 3QV2A 4Q1VA 5JCXA 4QLOA 1XCJA 3G89A 2HA5A 3K15A 1I4DD 3VSAA 1JXOA 4ZU3A 1EX1A 1PK7A 1WR8A 3LQ2A 2I2XB 4UXJA 3T1NA 1N2IA 2DBQA 4MA0A 4GZMA 5TQ2B 1V1MB 3HBFA 3KLOA 2ZWAA 3IQEA 3IT1A 4G0XA 2BR5A 4S35A 1Q0RA 1Y1PA 3VU3A 2Y1GA 1SPXA 3ULKA 4I2NA 2ZQZA 3RHSA 1N9ZA 3SHTA 3WR5A 2Y9MB 5JBIA 3I5YA 4RHUA 3TRIA 4CM8A 3L6BA 5FNVF 5BSFA 4LYDA 4J90A 3VDQA 4I55F 3D3WB 1N2GA 3MT7A 4MGZR 1CSEE 2EZ4A 4TWIA 3DV0A 3L93A 1YE3A 2FPOA 3L7LA 4HB2A 4JVMA 4BBAA 1Y4AE 1YNOA 3PF9A 4WGGA 1TU0A 4QFBA 3RVMA 3SQOA 2CDRA 2IEAA 2HADA 4XYBA 1Z8NA 1MOZA 3ZGXA 4BJ3A 1CR2A 1GL6A 2J3LA 1J7KA 3DZJA 2WTXA 3UENA 1RRFA 3SYRA 3N3AC 1SCBA 3HRHA 5FHQA 3VPSA 2FUG6 4EJSB 3KQOA 2P9CA 2VT7A 2Z0MA 4J2OA 3RKSA 3HVIA 5EXDA 1M83A 1T0PA 5JXWA 3D8TA 4EVRA 1F9AA 2QRPA 1URPA 4F21A 4PYIA 5JAMA 3PGKA 1VE6A 2PFGA 1XEWY 1XQ6A 2V7QA 1JAIA 3P0RA 3Q6NA 1QOPB 2R85A 3W2IA 2CL7X 3PCRB 3VNVA 3L7YA 2J0UB 4FU0A 4Q05A 2P9FA 3V7UA 4UATA 5BR4A 2YQ4A 3DBOB 2GXQA 3CPEA 3OOWA 1T5BA 3GHHA 1ADGA 2M6RA 3E35A 3O1HB 2ONYA 3CU5A 5I3CA 3DYIA 2C5BA 3LQYA 1P2SA 4R9UC 3PT5A 4KIJA 2ONKA 5FX2A 4RKYA 3F5FA 1QKIA 3BGOS 4TV8B 1NXWA 2VHQA 3QNUA 3R5FA 3JX9A 3RRMA 4BEBA 2O59A 1H93A 3E4DA 1NWCA 2IPMA 3I9V1 3E7PA 3SYNA 2C2WA 4MQBA 3RAJA 1DKOA 4CLRB 2P2SA 5BYJA 1XRMA 2RB5A 3I9NA 4GE3A 5B12A 3GLFA 4X66B 4NBSA 1WRBA 3GEHA 4DL9A 2VWQA 3EJ6A 4ISBA 4II7A 4F11A 5AUPB 4UZFA 2FK8A 1C1YA 1I32A 2PX2A 4UTZA 1DZIA 5AWFC 5EGNA 4Z5XA 1KFCB 1NSFA 3R24A 1C9DB 3MGBA 1MT3A 1T5TA 2IS6A 3PJEA 4AB1A 2WSYB 2ZDHA 3IBSA 4ER5A 3UANA 1FBTA 2AC4A 3W1EA 2M1XA 5ECYA 2WD7A 3D6VA 3PR1A 2X0NA 1C7ZA 2QLLA 1DUIA 1TAQA 3O0TA 5FULA 4JJ7A 1Z4QA 3GP8A 4DR1B 2QTZA 3AZOA 1U3UA 1OROA 1Z38A 1YZYA 3C3EA 1PR9A 4I3HA 3DXYA 4YXWA 5IBCA 4MIOA 2PRJA 2E0IA 4ID9A 1A7KA 4NE9A 2ZUFA 2FFAA 2YV1A 1JFFA 3MCAA 5E0OA 1NKTA 3EZ7A 4GOMD 1RI2A 3T7SA 4G0VA 4KXXA 4K3VA 4BXOA 3ZGOA 2BISA 2JFBA 2R87A 4FN5A 5TJHA 3VKWA 1P9LA 3GEPA 3JAMA 4RTKA 3TECE 4Z54A 2QTLA 3BREA 4J49A 2P41A 1D9ZA 2VZEA 1KKMA 5EPUA 5BUSA 5E6SA 2O8EB 3DZGA 3TW0A 2OL4A 1ZMOA 3QPDA 2J8ZA 3E9DA 4JBGA 4BAGA 3G6WA 1T8PA 4R41A 1H6AA 3ENWA 2DR2A 4JB8A 5F7XA 1BDBA 1U2DA 4ERXA 4OX9B 1HO3A 3IAFA 4F2HA 1BU5A 2HK9A 4DMHA 1BE0A 4QYIA 1XZ8A 1CR0A 4K9RA 2WFLA 1N4AA 4K8RB 4WDQA 1BS2A 3RSOA 1Z0IA 1DAFA 4ZZ3A 2VN8A 1L5RA 1H2WA 1L5MA 1YZVA 3BXXA 3FDFA 1BGWA 1L5SA 2E2WA 1HDGO 1KVQA 2CXRA 4I5DA 4U7HA 4IXMA 2QIPA 3W5UA 2AW5A 4H0NA 2FN9A 2QTWB 3DGEC 2XRMA 3I9JA 3ORFA 4GP9A 2J08A 2WKSA 5BUQA 3EE6A 2P27A 1WV1A 3AB7A 3AM5A 3ND7A 3JQAD 4WKBA 2OCLA 1N8NA 3U37A 1GILA 5EESA 3ZNOA 4IDHA 2IIBA 4OA5A 1NVGA 1TEXA 5JARA 3AEXA 2P2YA 2QORA 4BNLA 1UZMA 3GW8A 1W5TA 2E6KA 3ONDA 4XWGA 3BHIA 2WWXA 4QJBA 4RF2A 4S1OA 4QBFA 4L51A 3PYXA 1O95A 1ULSA 3ZHUA 2UV8A 3S6JA 3BWEA 4D5GA 1CDEA 3GA7A 1D7AA 1R6BX 5ALLA 5AVYA 4MV7A 2C57A 3FPFA 5SY6A 4Q4AA 2P7IA 1HBJA 3MFYA 3I12A 3KDAA 3ZWWA 5IJ0A 3R7LA 3ABOB 1G6KA 4PC2A 1HGXA 1M76A 3KL4A 1FYEA 5MN4A 2GEBA 1D2EA 2OO7A 1HDCA 1Y3DE 3GVCA 3KPVA 4HNSA 3T3GA 1GRNA 2ID8A 2QUBA 1FOEB 2IDJA 4YJFB 3UWOA 2VSXA 5CDYA 5IF9A 4H60A 1E3DA 3LF1A 2GCEA 3IBYA 4UNNA 4NC9A 3RIHA 3ENNA 4CDNA 1KSJA 3KKOA 2F1JA 2H1RA 4ITRC 5IVKA 3EZ6A 3OZCA 4LF7B 1WSWA 1SXGA 1CUUA 2A9PA 2BSQA 1SAYA 1VIYA 2PH3A 4GOND 5K0LA 5F7JA 3STHA 1ONSA 1L8XA 1T4BA 3AJAA 4YCDA 1E9SA 3A1DA 3OA2A 2LV8A 3S7TA 4BNGA 4NESA 4U8HA 4M8IA 3IPXA 2EFHB 3BOSA 3IVGA 3SYMA 1G8MA 3F97A 2VYND 4HWSA 5E3JA 8OHMA 3DZKA 3FCUB 4W5HA 2Y9PB 4G86A 3TD2A 4CF6A 1HDYA 2AG8A 4DWOA 4W6ZA 4F5WA 5BOSB 1WUYA 5KNCH 3HY6A 2BEKA 2BBTA 2H31A 2O0HA 1U7TA 2JIZD 2EW8A 2VSQA 3EGDB 3NMUF 1ZVJA 1YRYE 1J1ZA 4P4LA 1F2UA 1MJGM 3TAXA 2Z4SA 5K8LA 1TXGA 4CEJA 2EF1A 1XTZA 1NBAA 2QL7A 4XQGA 3DEZA 4N6OA 3RIMA 3AG5A 2XVXA 3OE5A 4HJRA 4N12A 4P82A 3ZKWA 5CXUA 5JRJA 5ADUS 3ND5A 1NN3A 2HLHA 3A7EA 5HE9A 4E2YA 2O23A 2XD4A 3MCZA 5JD4A 2JCBA 4LG1A 5K20A 2WFMA 2COKA 4EARA 2BGRA 1T1SA 3H86A 4D0RA 1ISHA 1N6HA 1E3IA 4NULA 3ZY3A 4UBMA 3CUVA 1YDMA 4GSLA 3VU1A 4UNSA 5TJ9A 3WWOA 3PEFA 3PUJA 2IYLD 4GXTA 1QM5A 1GDTA 1GSAA 3PHLA 4B47A 5K1ZA 4AJIA 3UAGA 5AUQA 3LDHA 4RZUA 3TOSA 4XGIA 1TRHA 2AMLA 1GKLA 3KQHA 1DB3A 4W5WA 821PA 1MBZA 4KSYA 5KYYA 1HV8A 5FFFA 3AEUB 1ORHA 3KK0A 3GJ5A 1NLFA 1A50B 3TGWA 3IHLA 5HJ5A 4NZMA 3WMFA 3AERA 1V8BA 1TKAA 3UMVA 1ACMA 4PE5B 1FMTA 2B8JA 1YJ8A 5FPYA 1N2XA 4F2DA 1I36A 1OH8A 5K8VA 3OVMA 1U3VA 2IX3A 1A8IA 3UWDA 4ECAA 1AUPA 2I2BA 4GGOA 3A1VA 2YWHA 4NYJQ 2VYCA 4KOEC 4M9CA 4Q03A 5GIOE 2OV1A 2VRWA 3AV0B 5KMGA 2MYUA 4PCAA 2W2NA 3UMJA 3T5GA 3O95A 4CEIA 2QRUA 1PQUA 1NXQA 1RXCA 2WJWA 5JBNA 2QIOA 4BLQA 5JATA 1RFGE 3CLUC 4I1SA 1A9TA 2C0CA 1JIJA 4J1TA 4O4HA 3A2MA 3PQ8A 1G5RA 4LZJA 2EOAA 5IAKA 1YJBA 1U81A 2JJYA 1SA0A 2V0CA 4ZZ0A 9GPBA 4M0CA 1OBVA 2BBOA 2Y1DA 5K03A 3W1WA 4ME6A 3UNXA 1UK8A 4WA8A 1G3UA 3L43A 1KEKA 2XOKD 4FKBA 5DSZA 1A9RA 4M7RA 1T9GS 4MUKA 4BFXA 1H5UA 1J97A 3QK7A 4RESA 2F1RA 3IRVA 5BRNA 4RZQA 1SOMA 3BRCA 1E9CA 4N3GA 4NWIA 1WBJB 2H4FA 2CWDA 3X1WA 5LSAA 3NHSA 4U2CA 1R5NA 1M8GA 1KIAA 3PKIA 1J0CA 1XN4A 5CXSA 5HF6A 4YIHA 4QYSA 3FJOA 4J75A 4O3MA 3T9BA 3FAKA 3BD8A 1MENA 4D8VA 2D1FA 5C51B 4EJ0A 1OBCA 3HA3A 4EJMA 1NUUA 2GVNA 4Y7DA 1W75A 4CMKA 1SBNE 3NS7A 4PINA 3TFOA 1IQ0A 3ES9A 4URZR 1TNDA 2QRVB 4UFPA 3L7CA 2CSXA 3I2KA 3U56A 1B8UA 4GP6A 1GIAA 2J30A 3QLVC 1TMYA 5ALQA 4DA6A 4IH9A 3IQIX 3FYUB 3MYYA 4OXIA 1JEDA 4QTXA 5G0WA 2CHUA 3C5HA 4ZCIA 3UFXA 4AKHA 3ROQA 2UUBB 1XWIA 4NMMA 5DT9A 1TCAA 4DPKA 5JS2A 2Q9UA 4IKPA 1HG0A 1NQ5A 3IAUA 2EQ5A 3MNFA 5ALVA 1YI8A 5E7MA 1Y34E 1ZCBA 2G7MC 5KYWB 2ZJFA 2QPLA 1XVVA 4ND8A 3ZY5A 2MCFA 4BNDB 1JYFA 2B1JA 4Z7OB 5GONA 2Y0EA 2WQ7A 3C3KA 1P7CA 2G1KA 4H17A 5ERYA 2ETVA 4HXEB 1BVUA 1RYZA 4Y2GA 4EG1A 3VC1A 3ESQA 2W6IA 3QWFA 3HFJA 5A4FS 1OFTA 3LDFA 3AQIA 3LLCA 2RCYA 2ZUWA 2ZYGA 1U7WA 4CU2A 3W04A 5C4IA 5KYXB 4URWR 1CLUA 2RJNA 3WLHA 2PZ8A 3IQHX 1XNGA 1W85A 1ZK1A 3I73A 5HGJA 2ZTVA 4HY3A 3TVDA 4X00A 2VP5A 3DL2A 5H0IA 4DT1A 1X1BA 4B6JA 1KQPA 2X0KA 3VHRA 1PI3A 4CMCA 4AG3A 4IDDA 3S29A 3TNLA 2QL6A 4ZT4A 4F93B 2YVUA 3VPAA 5JI2E 3FYHA 5K8UA 2YCLA 1IN8A 4FYPA 3IHWA 2FPSA 1JG3A 1SVNA 5CLLA 3KQWA 4EGQA 3PQ5A 3W3AA 1Z4LA 1FFAA 3JD0A 2C8LA 4W5QA 3WB9A 2XUHA 1SZJG 1NW4A 1N6RA 2AN1A 2F8MA 1VKHA 1MX3A 2XNCA 4FMDF 3WDSA 4L1KA 1L8AA 2AN5A 1WW8A 1U5BA 2R62A 4BUZA 5B7NA 1EFRD 1XNJA 5KVCA 4RIHA 4U2GA 1G1AA 3BXGA 2MTBA 3AR7A 4I3FA 3RRXA 16PKA 2QLJA 1N92A 2X5XA 3E3LA 3PTAA 2IIPA 1VFPA 3T7CA 1HE2A 5THKA 3R9XB 3WQHA 5H4GA 2J0UA 1MDFA 3OQIA 5EIBC 2M98A 4A10A 1GPYA 4XCXA 1SXJB 3IBFA 1KKUA 4F38A 3AI3A 4KFCA 3SX4A 1HEUA 1JJIA 1U0TA 1N34B 5F2NA 4RXUA 1JT2A 3MCUA 4KIWA 1TIBA 1UXHA 1CCWA 3NHUA 4UKDA 3RVRA 1IH8A 2EIHA 2GTPA 4M53A 1VTKA 3QA9A 3UG7A 3ZK8A 4FXOA 2I22A 2CD9A 4GP7A 2PUDA 3WWZA 5AFSA 1MJFA 4B6QA 2VDUE 1WMDA 3M6WA 4ZVNA 1Q0PA 3F9CA 3AL2A 1BJKA 3EVCA 5LQRA 5EE1A 2C5FA 2OORA 2ZROA 3H8WA 1TFRA 4GOOD 4Q4HB 4ABTA 1HDEA 5CT9A 1Q0UA 2OECA 3DHVA 3F7TA 4N6GA 4BNKA 5LZ4A 4IW3B 3Q8XB 3I0MA 4AMZA 2GPYA 4IVPA 1DC5A 5GY7A 1YSCA 1K8XB 4R2HA 5H68A 4DLKA 4A6XA 2EJTA 2YYZA 1MB0A 1FX0A 1QO7A 2A5DA 2RGBA 1QGYA 2W2LA 4X1YB 3GWGA 4Y2JA 5HBRA 2W9XA 2D5IA 1QLWA 3U9SA 1MO5A 5H83A 1QGOA 3I6BA 1PGPA 2G1AA 2R6CA 4H7JA 2YQ5A 4TS3A 3TJZA 1BQEA 5JQGB 2P6RA 4I2VA 2YMMA 2UDPA 1VPTA 2KLHA 2QAGA 1K8ZB 4RQTA 1NOJA 3V5NA 1MC5A 1COWD 3CUUA 2G5TA 3NR2A 3H6KA 6Q21A 4MZDA 3LDGA 3BEOA 5JO9A 3NXKA 5EXEA 5L6LB 1O08A 1UWLA 3PD1A 3FOEC 1PR5A 4G97A 1HE4A 4D4JA 2GBLC 4O2AB 2JJ8A 2Z6UA 1DBWA 2YY5A 1H3FA 2C9CA 4JKIA 1AA6A 4V0KA 1VSQA 3U40A 3C3YA 4PPFA 1KHHA 4KKVA 1WY5A 4RA9B 4WK2B 3WGOA 2O2YA 2BONA 1YRWA 3IEMA 1TT7A 2HNKA 3E18A 1AOXA 5CHYA 4RXTA 3THYA 4YJGA 2WWGA 1IXSB 3REOA 3GFGA 2AC2A 1P9OA 3L6DA 3TM5A 3F5QA 1FFXA 4Z6KA 5L4NA 3CISA 4DDUA 3JQQA 2RE8A 1ADFA 2OILA 4ETNA 3PS9A 1HE3A 3JQFC 1NATA 2JEOA 5TXGA 4E22A 4OSPA 1A9PA 4ZQHA 4O4JF 3N2KB 3RJ9A 5DK4A 1YFLA 1LV7A 2XYHA 1XLUA 3U7HB 2PXHA 5JNSA 2VJAA 4NPHA 2JLRA 3WNDA 4P7JA 3DAYA 2V9CA 1JU3A 3ZBUA 4IMRA 1W0CA 4DCUA 5A5EA 1HSZA 3ZDYB 1ORWA 3HN7A 4Q7JB 2V0NA 2FWBA 2BCEA 4D9GA 4RZIA 4WOBA 2EV9A 4WTOA 2FI1A 1L7MA 2AF3C 4RADA 1KIMA 3HI4A 2PRZA 1VLHA 4UHKA 2D8AA 2CJXA 2HUPA 4HVAA 4UAJA 3BJRA 1R0YA 4WGFA 4TLCA 2V3WA 4M8NE 1ZMBA 4ZI2A 3VOSA 2D2XA 5KOIA 3AU9A 4FBLA 5LNK1 3GT0A 3RARA 4C6SA 2DYKA 1THTA 2R86A 3JZDA 4DYDA 1BMDA 2OG1A 4HI0E 3UV3A 2Z09A 3PDHA 1TIKA 3GRKA 5BWCA 4IGIA 2RFLA 1FW6A 1G4HA 1LXCA 1XVIA 1Z74A 3ETLA 4QVKA 5G4KA 1WKCA 1OZGA 1EX6A 3AY6A 1V1RA 1H2BA 3T3DA 1X1EA 2VPWA 1U4SA 1IEQA 1YR8A 1Z25A 3BB3A 3O3NB 1D9XA 3LCRA 4PFQA 1REQA 1J90A 4P98A 1VSBA 5FYQA 2ZS7A 3U6BA 2Z9BA 4WAUA 4YAOA 3SJZA 4A5OA 4DUGD 1MCZA 4X1KA 2H17A 1QH1A 1GKIA 2VQEB 2QTMA 1R0RE 3EXEB 4YMUA 1U6IA 2ZP1A 1QH0A 3L7IA 1VKJA 1JTVA 3R7BA 1KY4A 1MOPA 2FMTA 3BIOA 3X1XA 3ENKA 5KJ6A 1JN0A 4BJHB 2FR0A 3LLUA 2PL3A 4XE5A 4Z1MA 4D0LB 5AM1A 4HWOA 4L5AA 3AFNA 1X9IA 3SQNA 4ZRMA 3IPAA 4Z4EA 3P9CA 4M9QA 4MWEA 2AJCA 4ZO6A 5LUAA 1A77A 3SIPA 3V6LA 1FUIA 4WZAB 4JJ6A 2EL9A 1DRUA 1UMKA 2AZDA 3MTAA 3OOYA 4HMOA 2V6BA 3FBGA 4K6OA 5H7XA 2G9NA 3ZLUA 5A9SA 5IJ0B 2O19A 5EGSA 5BP7A 3AUKA 1SN7A 4F3TA 5I9BA 3N0TA 2OXRA 3C5EA 4M99A 3O3CA 3DMDA 3W7VA 3ZVLA 2NADA 1DIGA 4GT1A 4NQZA 4ZYLA 4UEWA 3EFEA 2VHVA 3OCZA 4C3OB 5GMOA 3OOSA 5LM3A 3PC8A 1VJGA 4GX2A 1AT1A 2RGDA 2EBHX 3QLEA 5AJTA 4PYLA 5KYXA 3T7AA 3I6QA 1CY4A 4H7HA 1EFTA 2WIAA 3QNMA 3K05A 2FZWA 4BZWA 5BSWA 5GONB 4HATA 4U7GA 4XWTA 4MI1A 1SBQA 3ZD6A 1GRQA 3P26A 1ES9A 3AJRA 4LC1A 4YGYA 3W8RA 1FJXA 1P1BA 1W93A 5I4CA 4CLOA 4F9TA 1E58A 3KQVA 3NJRA 3QA3E 3TTTA 2WTUA 3MGGA 2I4TA 3QXHA 2HT1A 2BJWA 4PM4A 3BTVA 2GOYA 4DMCA 1MC1A 3OEHA 3OT5A 4FDLA 4KEAA 2I1LA 3CNHA 1I30A 3ZCVA 3B20A 3BE8A 4KQGA 4TTVA 4CGYA 3S2SA 2F64A 2FVXA 2Q45A 1IQRA 1A9QA 1GGEA 3N58A 2PH1A 1KIFA 2GN0A 4HLQB 2HTFA 4RZHA 1D03A 5JFOA 4YJKA 3TZQA 1ABBA 3KQTA 1PJLA 2XMQA 2Z2ZA 1DAMA 1LBTA 3ZZNA 3R9XA 3T7TA 3L07A 4B3GA 3C5VA 1DQSA 1GGMA 1OXBB 1KRWA 1BX3A 2YZ7A 3EC2A 1TYDE 1BCSB 1SQ5A 4OQ4A 3K6SA 2OK7A 4ZQIA 3CPJB 2VXCA 2IZ7A 4F46A 4PRKA 1YDWA 2VK4A 2PDAA 1T8RA 4MQEA 3FNIA 3LOPA 4HZIA 1V5WA 4O2LA 1Y8RB 2Q5EA 1G3QA 4MKHA 4JNKA 1W36C 2YNMD 5C3MA 1RABA 4E7OA 3ISJA 3W9UA 3UM9A 3R6LA 3P96A 1CQIA 1KFEB 3O7MA 5E4FA 3HUUA 5DIZA 3ML1A 4BU1A 4IOLA 4I6GA 5C8XA 1N5IA 1T6NA 2GFIA 5EZ6B 1PUXA 5J2TB 3O8CA 4ZCPA 1PR2A 4ZVPA 3QWBA 5K3DA 2ZAIA 2DLCX 1GVHA 1NW9B 5CFMA 1NYRA 1T6BY 4IUDS 4QTYA 3MLBA 4NV1A 2R8XA 1G7TA 4HDKA 1VI5A 3P7MA 4MPTA 1DLJA 1XZCA 4HVTA 4TUYB 2C5AA 3DEIA 3U0VA 2XB6A 3SNHA 1CY0A 4AIIA 2HSZA 4OQYA 1TA0A 3SX2A 4R0NA 4L0MA 1G38A 3CRRA 4OMUA 3H2GA 3DAGA 4Q0MA 2QVLA 2R5WA 5GWXA 5TT1A 3ZXIA 4BGEA 3ZDAA 2CY0A 4RHFA 1T5DX 3KTOA 3NNDA 1PRYA 3P9ZA 3V48A 2DHDA 2BGJA 5HKOA 1BWSA 3JYHA 2C04A 4G67A 2UYCA 1I7LA 1QE3A 4F92B 4WN3A 1R4MA 1CQIB 2LR0A 4HH4A 1SBIA 5F5XA 3RPEA 3ENZA 4MITA 4KK3A 3ER9A 5H82A 4AUMA 4P1ZA 3WTCA 3D7NA 3WYEA 4JJEA 3T3IA 5B4VA 5JH7A 3NVKI 2QUZA 3OZSA 1M72A 3CLSD 2CWWA 1X7DA 3AZPA 3PTLA 3G82C 4RMJA 4UM7A 4ZN6A 2DHCA 5C35A 5KPDA 5CEEA 1MW8X 1L4GA 1SY7A 2E9SA 2PKEA 1XTTA 1MPTA 4MV4A 1D1PA 3QJGA 1X0XA 4QRDA 5C5DA 1HL7A 1A82A 4FI3C 1X7GA 2GPNA 1S8FA 2WDZA 3NEYA 3F9RA 4TYMA 1W73A 3N2KA 3HXLA 4GEGA 1J5PA 4Y2XA 3C41J 1J5XA 4G2TA 2PZMA 4KXFB 2DT5A 5K0SA 1YBAA 4DSTA 3AT1A 4UNPA 1XPUA 4YROA 1UKBA 3D1JA 4BEVA 4MO2A 1Z0FA 3RKUA 4F9EA 3CX3A 4B79A 4JMLA 2OY0A 1KJIA 1THZA 1E1RA 3DC2A 1FDWA 1GTZA 2C00A 3AWIA 3I5UA 3L5KA 4FZVA 4ZOEA 1W88B 1CVLA 1E32A 3DLHA 4XB2A 4F04A 2F67A 4XUDA 1TO6A 2CT8A 2JZCA 4B8WA 1FYWA 2VP6A 2ZIFA 1NQUA 2GDZA 4Z3KA 1W87A 2NSHA 3HG7A 4I1OA 3W5SA 2IXAA 2DETA 3MBIA 1KE2A 1JEJA 1KI2A 3AP3A 3D2CA 1L7QA 5FBZA 1NJ5A 2Q2WA 4F2WA 1LC3A 4HZGA 5CEJA 5L4LA 2VF7A 3NRCA 3ZDFA 1YHZA 2CMFA 2GJ9A 1U9JA 3U9TA 1DRJA 3L7KA 4M46A 5CTJA 4ZVOA 4KAXA 5D1NA 1YZUA 1FTWA 2HA2A 4R9VA 2PN1A 3WK4A 5H9WA 4IOMA 2HMWA 2PT9A 3K8QA 1R4NB 5FWNA 5LP1A 1WCV1 4BY9E 2DOKA 2V6JA 2W8BA 3K73O 1T36B 3PNPA 3ZGNA 4U7TB 4UNRA 1NBOA 2RKWA 1DV2A 2G72A 2O1XA 5ECWA 2O8DB 5DTMA 3L7OA 3PC6A 5CK5A 3U7JA 4PGGA 3FKSD 4QOIA 1AIPA 5BUZA 1OQAA 2RI0A 3T3HA 2JANA 4DLNA 1DT3A 3KKEA 2CHVA 4DY6A 3WNZA 4V1CB 4QVIA 2OGUA 3MF4A 3MMZA 2OKCA 3O8QB 3AVTA 2B4KA 3ID6C 4CKWA 2RSLA 1YS2X 2G80A 3GROA 4TKVB 4P5DA 4PPYA 1RZRD 2XB4A 3T7EA 1IHOA 1VCNA 4JODA 1GZ5A 4QO8A 1DO8A 4O1IA 1S0UA 2CUZA 3CFYA 1GGJA 3LM8A 1JT9A 4GICA 4P35A 3SEQA 2LDXA 2D7DA 1VLQA 1QPZA 1R18A 5IJ9B 3TSAA 1UEIA 2OB1A 5ELXA 1NW7A 1QYDA 1W46A 3BVPA 2Y1FA 2X2EA 3T94A 3W5HA 5IN4A 3B82A 5A0TA 4KCGA 2IEZA 3FWYA 2GEKA 3THXB 4B31A 3QIAA 1X7XB 2VCEA 2XUDA 4PHFA 5J5CA 2UUAB 1K7FB 1QK3A 1UFKA 4FYYA 4IJQA 1A4UA 4L9WA 2HI0A 5IU6A 1I6WA 3T0FA 1MORA 3SF8B 2Z2IA 3B89A 5DOVA 3LXUX 3MM4A 2BEUB 1RIIA 5TMPA 2I1WA 1N2SA 2FFBA 2V7PA 4M98A 1PT5A 3COSA 5CNIA 1VHLA 1DQNA 1JBQA 1EFVB 2C4MA 4NU0A 4AKEA 3GRPA 5B3JA 5FJJA 5BMOA 2QZJA 3PDCA 3QTLA 1U28A 1CT9A 1NQXA 5JAUA 5DM70 1VL0A 1SVIA 1KQGA 3UMYA 5AKGA 4ENSA 1JLSA 1H3NA 1Z7GA 3GA5A 4IGFA 2QVZX 3C2QA 3OJXA 4Q4HA 3DFMA 1G7CA 3PPXA 4MROA 5ELLA 4AZWA 3T9DA 1Q5PA 2OFXA 2CMHA 3ZIAD 2DP4E 2FPGA 5CB8A 2FYTA 3HCEA 4QC2A 3O4VA 2IXDA 1FX0B 4HV4A 1FDOA 3H9JA 3DXFA 3QG5A 3KT6A 4MVYA 4U7PB 4EKNB 1T4CB 1YAHA 1VDZA 4JHXA 3JCZA 4DTIA 5HVNA 5JPIA 5IKEA 5B3AA 9ABPA 1E2IA 3AF0A 2RMKA 2PWAA 1JXMA 3AHCA 3CRZA 3G0GA 4JZYA 1ZOPA 4QPDA 4Q3NA 1ZCFA 5THQA 1NVBA 3BB4A 1KE1A 4YV7A 5E7QA 4C2TA 3RC8A 2IP4A 5FLYA 1IEXA 5HUQA 1WSAA 5EFOA 4RD4A 1X8LA 4H08A 1CUIA 1EAYA 1ZICA 2Q99A 3GWZA 1X8KA 4LYAA 4NMHA 1HE8B 1DOZA 1HRKA 4NHOA 4HXFB 2MSLA 3EULA 4LV8B 4L85A 4XDHA 5DM0A 1HY3A 4QJIA 3VI3B 4DJDC 1KNQA 4DLVA 4DQDA 4DB2A 4BTEA 1L4YA 5CDTA 2ZU0C 3VHLB 3JQ9A 2E89A 4F71A 5ALXA 1ODFA 4JQCA 5T4BA 4TT3A 4E11A 2EP7A 3OP1A 4E5DA 2GFQA 2GHIA 4OAOA 5ICCA 1J33A 4HX9A 4MWCA 4FMPA 1BE8A 1WHSB 2H11A 1ZAKA 2V98A 4EH1A 2ZM5A 3UYKA 4KMOA 2O3SA 3DBHB 4L7VA 4JEIA 2JGIA 1P5RA 3R5KA 2GX6A 1PSWA 3L6CA 3PQ3A 2P1ZA 1N2CA 2DEUA 2D1YA 3GB9A 4MV0A 1OILA 1P74A 2OBXA 3FGZA 3W05A 4EA9A 3OCYA 4EF4A 1Q7GA 1WSBA 2FWMX 4G0NA 1WDTA 2FN3A 4MWTA 1LGYA 3EXAA 4FZ5A 1V3VA 4CHTA 5DM1A 4RJTA 4FCWA 3P4YA 1V16A 1VP3A 3LCUA 4RVNA 4PBRA 3RABA 3SXJA 1P6QA 1TJ4A 3EQZA 3QVSA 4TTAA 3IMEA 1IY2A 3RT9A 1Z4MA 3TQOA 2I7DA 1LPNA 3OI7A 1MO6A 2BV3A 2VNHA 3B78A 3DP9A 1OY1A 4HXYA 5EHXA 1YIOA 3GEEA 1STOA 2NZ8A 2OC4A 3O2SB 1YQDA 2ATVA 1S9HA 1JV2B 1XI2A 1OFIA 1N8SA 1L9XA 4F5EA 3GG9A 1LSSA 1R10A 3RS5A 3CZMA 4LCEA 5K8TA 1CETA 1BE1A 1H6DA 2D2EA 3DPUA 1YFJA 5AK3A 3LT5A 4FB4A 2EHJA 3ILYA 3WKCA 1Y3FE 1AGPA 3IOCA 2WMNB 1Q16A 5AESA 3UH0A 4C0QC 3CE6A 3DEYX 4L8WB 4F45A 3D59A 3H6GA 1EVIA 1PHPA 1JSXA 1O9BA 2OG2A 2Q4DA 2WZCA 4RFLA 2VT6A 4D97A 1CQJB 1L5GB 3VVLA 1PSZA 4BMNA 3AUFA 4DCSA 1E94E 1RJWA 2EX1A 3BIXA 1OGIA 2HMYB 3H3XA 1IJBA 4C0BA 4Y1EA 1ITZA 5EQDA 5EJ4A 2JJQA 3OLCX 3INYA 3D4NA 5CFQA 4EFMA 3WP0A 1L5OA 3IEVA 3IPCA 5FL7D 2PNJA 3MD9A 3UBMA 2YWRA 3TD6A 4GLOA 4YT2A 3C6MA 5I45A 1W9HA 3AI2A 3RH0A 1LRKA 1N2CB 1JHRA 1F2TB 5FI3A 3TM4A 2AF4C 2P6MA 3B2EA 4KHPB 3PF8A 1GV1A 2OAQ1 3EPHA 5AHRA 5HMLA 5BNZA 1P45A 1QVWA 2W2VA 3UB2A 1IWPB 5HKAA 4LXGA 3G5UA 4F6CA 2ODPA 3G8BA 4D0NA 2B1IA 1SU7A 1JB1A 1N6KA 4HH1A 3RUEA 4KPGA 3IBCA 2R65A 1ICEA 4M9SA 4EKGA 3QENA 2OZVA 4M36A 4LZAA 4TXNA 3VYWA 3EXG2 2OSVA 1BU8A 2BFCA 4PY2A 1BXKA 1II9A 1NFFA 2CLCX 4EHLA 3RIGA 2H0AA 3TSZA 3RVPA 3OD1A 3JQPA 5E3IA 4KE7A 4LY9A 4LBVA 3SIXA 4S1VA 4RD1A 4WLEA 4ESOA 3Q3EA 2FW1A 4OA8A 2YJNA 3GCDA 4IP0A 4J7AA 3PJFA 4Z4HA 1NMXA 3CMMA 3MSCA 1OR8A 2OV8A 2ANCA 1IIRA 3EVAA 4K2HA 4ZOLF 3BGSA 5IDYA 1FFGA 2X0DA 4DR7B 3IL2A 4PG5A 3V1UA 4E21A 1FP4B 5EZQA 1AKYA 2YL2A 3DF7A 1T26A 2O1WA 4UMEA 4DSZA 4WZZA 3M6XA 3ZDEA 3ZZUA 5FOQA 3EGEA 2PHZA 2QTHA 2YXLA 2FHSA 3EW7A 3HP1A 4P4TA 2ODNA 4P92A 4RK1A 1I3KA 1O6FA 3GDHA 2BGLA 1UM8A 4W7SA 4IFEA 5HJEA 3KQPA 3GRVA 2ZUDA 2TMGA 4MVJH 4XFJA 5KBYA 1SUEA 1T1RA 4HKTA 5LQJA 3PU6A 5I8PA 3DR5A 4DZZA 3HDYA 3R1IA 3U4IA 3GEDA 2B2NA 1I2ZA 4FZRA 4BO1A 4RTQA 3IT3A 4PX3A 4S0XA 1D4AA 1YUNA 2CNWA 2H63A 2Y77A 4UDYX 2JD0A 4I5GA 3TXAA 4DIMA 1QOZA 1RR6A 2D5AA 4QPCA 1FLVA 4XEUA 4OUDB 3ZE2B 3MOGA 1K4KA 1S1MA 5EA2A 3II6X 3GGPA 6LDHA 5BUCA 4RVCA 2C0PA 3EXHB 4YB8A 3QYAA 2G77B 1ZUHA 5KTOA 4AUNA 4HGPA 3GGJA 3ESCA 4MJ7A 4TXLA 2YFYA 3THRA 1ZINA 3RAFC 1FFYA 1C3LA 1N7JA 2B7LA 5BOSA 1E9BA 2GO1A 2N47A 1WU7A 2FK7A 4NARA 4RUKA 4CTJA 4OXKA 4CIXA 4GQIA 3L7AA 3QKIA 1ESNA 5F1KA 5B4TA 5MN5A 2QLBA 4H3KB 5HPYB 3AF6A 2J0VA 2GAIA 2FZLA 3NTQA 1G8GA 3NVMB 3S2GA 1MFZA 5EHGA 3C87A 3DAOA 2AJ8A 4MLPA 4YI5A 3RSSA 5BO5A 3URMA 4BVFA 1Q83A 4J9VA 3TH5A 1POWA 1WABA 3EF0A 3HDQA 3CLVA 4OBXA 5LDDC 4IXWA 4LX8A 4CWAA 1Z9BA 1PWYE 5ICSA 4NCBA 1GYPA 1ORDA 3M89A 4FGLA 1AY0A 3DAPA 3DMYA 4LRWA 1ZM2A 2FWIA 3BBLA 2VHUA 3QI7A 4M1QA 1W4RA 3T7JA 2F55A 3GFFA 4UASA 3ABRB 3HBJA 4UBNA 5CVVA 1DXOA 4HNUA 2JLZA 4GGMX 2VJQA 2HD4A 1QG6A 4RVOA 2QSUA 1JEOA 4YAEA 1T1IA 3LT1A 3TZ6A 2E6UX 3WV5A 1Q6YA 1LDGA 4DBLE 3FOFC 5MDHA 3FTCA 4N7BA 3QKSB 2GD0A 2AFRA 1YJAA 2EDAA 2Q9AA 3A4IA 2JA1A 4NXNB 1G66A 2WWTA 2X3YA 2F2TA 4QGAA 5AXDA 4C76A 3QEMB 1JQAA 3DB1A 2W22A 1WTCA 3RV3A 2LVBA 2PIDA 1HQYE 4G63A 1R0BA 1A8PA 1V9LA 3T3PB 5ALWA 2PJUA 4C1BA 2P62A 5FB3A 1KNXA 3I3SR 2Y71A 3THOA 1Z6YA 3RJTA 5KQMA 1X13A 1SCQA 1XHLA 2PMBA 5LP6B 3QOYA 4EYKA 4KAJA 4S2EA 2R48A 4YJHA 1PJQA 2NIPA 1DTEA 3UFXB 5I7UA 4FJ0A 5EQJB 4PAGA 1QIHA 3T52A 3P1JA 1ZNWA 1FL9A 1XP8A 4R84A 1CQJA 5IW8A 4WCFC 4L8LA 1BCSA 4EGCB 1OVMA 2GZ3A 4DCNA 3KAQA 4BB0A 5E8RA 1XL1A 1UKEA 3IV9A 2FEOA 1Q7TA 1XMJA 2MYPA 3RTGA 3AEKB 4IVQA 4L15A 2XMPA 4PPGA 3M83A 3PDIB 4MLZA 2HSGA 4MICA 3UMGA 2VXOA 3I28A 3I37X 4K81B 4MV8A 1O6ZA 2PZAA 2QTAA 4QEZA 4M55A 1E2NA 1M1XB 3LS2A 5DHPA 2QHXA 3FYUC 1UDAA 2BT4A 1JL3A 1XD9A 1WUTA 1IK4A 2WLSA 4MVXA 1Q12A 4JVSB 1ZD2P 3HCDA 3TLAA 3GRZA 2CKMA 1DIRA 1RVV1 2EJVA 3B6JA 1KJYA 1GQQA 2IKQA 4BFYA 1CNEA 4PGMA 3ZCQA 2XKKA 3FTDA 1OC2A 2VF2A 1ADBA 5AICA 2YKGA 4X8HA 4JC0A 2HHLA 1E9FA 1RP7A 4IQ8A 4BGVA 4P7FA 4A8JC 1V7CA 2K2QB 4OGFA 4DA4A 2H2WA 3QELB 2FPIB 1SCJA 2QRMA 2YNMC 3E8SA 1Z4KA 1EE1A 4JXKA 5LR6A 1NGSA 2ZRJA 4RTLA 3OCWA 1YMUA 2J45A 5FH9A 3C4VA 4E32A 4WKNA 4X8MA 4K46A 4ZU6X 1NXPA 3S4YA 3GDWA 4DV6B 2R8BA 2YXNA 2ZB3A 3KSAC 3JARB 1NVKA 1T2DA 1ZKDA 3H2YA 4JSYA 5J1TB 1JG4A 2Q8PA 2P40A 2ZE5A 1JTEA 3HADA 5EINA 3UO8B 4UHJA 1XLWA 4BNXA 2PT6A 3WS7A 1LS6A 3OCJA 4TV8F 1QZ3A 3PLRA 1LB1B 2XT9A 1PEDA 1R5OA 3D6FA 4IV0A 2UYQA 4TMWA 1A27A 2AFHE 2F00A 1QVRA 5IEBA 2H4XA 1DKQA 1FDSA 5HZMA 4AO8A 1T6XA 3F1LA 3RREA 3ILHA 3D1VA 2REQA 1KK0A 2YOFA 3GNSA 1S96A 1Q11A 4MYCA 3L49A 5GAJA 5C81A 3N6RA 2HA0A 2NLOA 1UBFA 1HFKA 4QUHA 1UAAA 1BEEA 1XZDA 3H87A 1GO2A 4WJZA 1VC2A 1H5QA 4JT2A 1EI9A 3GEGA 4AJ9A 5FTJA 5JDIC 2FJPA 2Q1XA 1N1DA 2OESA 3HDTA 3I2JA 4IM7A 1CIPA 4MGHA 4XB6B 4GRDA 3VPFA 1KP2A 4B3CA 3TLGB 1CQWA 4GNRA 4WZ6A 4OGLA 3PICA 4L2IB 5GZ3A 3LX8A 1RC0A 4QT0A 1ADCA 2NSDA 1W0KA 2OBFA 3FDJA 3PG5A 2R96A 4I1IA 1WY7A 3RFCA 2O2EA 2G1PA 3GLRA 1EHIA 1K9SA 2ZSUA 2X14A 3DEAA 4XLTA 3W7BA 3IXMA 4BWGA 5JO0A 1JALA 1D2CA 1LDEA 5G1NA 4YRFA 4MEAA 3A32A 3AKEA 4MI6A 3BWCA 1SK8A 1UFOA 5CJPA 1YU6A 6REQA 1H6CA 2YFKA 2W37A 3E4CA 1PR0A 2BMAA 4O4JB 2RHGB 2V03A 5CYFA 5GVSA 4NG4A 2IPOA 2ABWA 3RRZA 2RHLA 1EEHA 1XVLA 3AOGA 4DC1A 5T7BA 4CF7A 4A2WA 3PITA 3OTQA 1GTVA 2J09A 4XLZA 1WLYA 1WXEA 1XCGB 3ROXA 3EWNA 4LSWA 2QGZA 1V71A 5H80A 2ZIWB 3WLOA 3ONEA 3ZI4A 4P3PA 5T8KA 1EGQA 1RM0A 2YC2C 1C3VA 5KJEA 5CVJA 2HU2A 2YICA 3TXXA 2WP8J 3WLNA 4JLBA 3UJ7A 4YUYA 3DV0B 4WY2A 1TZBA 3GLFE 2BM9A 3IEXA 4UVEA 4LF4B 3RVDA 2GF2A 3MRVA 4YDRA 2AR7A 4II2A 1Q14A 3A3OA 3UN1A 1TU4A 5JSUA 2B8NA 1WXQA 1B1CA 4HQLA 4M38A 4QECA 5LLSA 2VRNA 1U0OC 1ZM9A 5BPFA 4OJYA 5HJ2A 2XW6A 4IHJA 4XTCS 4DMLA 5EC8A 4MWSA 3WP1B 1IHYA 4G8BA 2LCFA 1KARA 4TS9A 1YR3A 3SQDA 5CG1A 4Y8VA 3KXDA 4WMLA 1ATZA 2GD1O 4IVNA 4E5NA 1VLMA 3GT4A 3NT2A 4G1BA 1U2SA 4KC0A 3ZHYA 1USWA 5HG0A 6NULA 3KUXA 3U19A 2NVBA 4Y2VA 5AH0A 2FGJA 2ZT6A 1BDIA 3ZJTA 5JE8A 1PLJA 1P2VA 4G41A 3R41A 4KXYA 4XAQA 5CYPA 3Q72A 5FIUA 2X1HA 2ZSBA 5B64A 3PJRA 4OLBA 4Y6LA 4MULA 3ROZA 5C80A 3QFHA 3GBVA 4BMXA 1E2JA 3MUNA 2GPAA 5CXXA 4F12A 2KMLA 5BW6B 1OU4A 2JBWA 2E5FA 1FFWA 2QRHA 2X9VA 5ADWA 4WBNF 4U4AA 4X97A 4RMNA 8AT1A 3MTIA 4QIHA 4BNZA 3E7DA 2IYOA 1MJNA 2BM8A 2IVZA 1GZVA 3KOOA 4HEJA 4F6LA 5EMNA 2VRCD 3AP2A 2OKGA 1Z13A 4EAAA 1Z82A 3GNQA 4Y6SA 3GLIA 4G4GA 3VU8A 4MK4A 1YS6A 4QXMA 1TEVA 4LXHA 1Y9JA 2VH5R 4JB3A 3P94A 2P77A 4QE3A 3D8HA 4IQ0A 3WLEA 3ZY2A 1RAEA 4AM8A 1U7ZA 4HDNA 2H6EA 4XCVA 4CR7A 2XT6A 1NBEA 3WFJA 3L6UA 3MMNA 5GJBA 4GOXA 3SVTA 5AVZA 1Z6TA 2X6TA 4KFTA 3IKJA 3PGJA 3V8VA 3ZIDA 1P8JA 5BVGA 4KFRA 5JY1A 4AY3A 1HURA 3RSFA 2W4QA 4IICA 4L75A 2OCPA 1CJBA 3I83A 4BXOB 3RSGA 1FRNA 2B1QA 4Z49A 1QDLB 1RM5A 5FI5A 1MAAA 3ANNA 4QU9A 3G7NA 2DMRA 1XYYA 2HWKA 3INTA 2QNBA 4Z8XA 3EA5A 1FP4A 4LXUA 4F1WA 3V1NA 1WUJS 2HJ9A 2SHKA 2Y27A 5IANA 2FPUA 4IIBA 1GZSA 3DVAB 3QSYA 4LDQA 5FBQB 3QX3A 1SXJA 2Q8QA 3PR3A 3OJFA 3UOAB 3CLHA 4ES6A 1O95C 2H2FA 2IS1A 1IM2A 1D0IA 3L4EA 4UHEA 5C18A 3ZWOA 4EK9A 1JVBA 1QG2A 4NP6A 4X95A 5FWDA 3QH4A 5A7GA 2GJ4A 2Z2JA 3MWEB 3WGLA 2QJWA 1KY5A 2XKBA 3BTUA 4QBTA 1P7PA 1P91A 3NT4A 4W5JA 5AHXA 5KB3A 1X2EA 1G17A 3MS4A 1RAHA 2JCYA 2JHAA 2R9VA 2W6MA 4HSGA 2C7RA 3ME5A 3UMFA 1R8SA 2B2CA 1EBFA 2NTVA 2JGAA 3ER6A 1CDZA 1P4HA 2HDOA 2UKDA 4IIGA 4DN6A 1V5GA 4YCNA 3I1IA 3VJLA 3CB4A 4NU8X 1WZEA 4RDIA 3OLVA 3RC2A 5ARCA 1Z0SA 1A2BA 3L6RA 3ZD9A 2A1TS 2FJ0A 2XYVA 1GG8A 3U5ZB 1AN9A 2Q0HA 5DM4A 3L7MA 2DH6A 1LW6E 1CJSA 3H7AA 3IE0A 4J91A 3ZTYA 5JSZA 3V1KA 3TKYA 4BQRA 2RHCA 4TMFA 1GV0A 3OUTA 2KSQA 2X5NA 2RB4A 2CFTA 1UK7A 1ZEJA 2Q0QA 1EVLA 4ZYXA 1IUOA 2JI8A 3DULA 5JECA 3VOBA 1SZDA 2XMDA 1G5PA 4L7QA 4ZTBA 4LJ7A 5TIIA 3AF5A 4EGFA 3FMOB 1YR6A 2VNKA 5REQA 2C83A 1CP2A 4JR1A 4X20B 4Y2QA 4OYYA 3IH5A 1EP2B 4HR7A 4BV2A 1XRJA 2I6XA 3DDHA 3IGFA 4G1UC 3WWPA 3HXQA 4PYMA 4Q3AA 1M6WA 4ZD6A 1KA9H 1L1FA 1RCTE 2P5SA 3WOHA 1US8B 1MA0A 4UPVA 2GEUA 3K09A 3HYLA 4B83A 3R0JA 4BQQA 2WU8A 2Z1NA 5JCZA 2FAXA 3UUWA 1U7DA 1DRVA 1IUKA 1JDBB 1IG0A 3QMWA 1QP8A 4G0PA 2AC7A 2WVHA 1FRQA 1VHQA 1GJRA 4JAVC 1NF8A 2P5YA 3EMKA 4QLAA 4MW2A 3ZV3A 1S2DA 3IVXA 1E2PA 2GJSA 1TFUA 1OTYA 3JQAA 3K0FA 1NE2A 1OGYA 2BAGA 4MMXB 5C4GB 1SQ0A 3BULA 3CNBA 3EVTA 1YVRA 3T1OA 3WNVA 1Q7RA 5H16A 4AO6A 4EMBA 2FX3A 2XYQA 3AJ9A 4PF1A 4EPTA 1L9KA 2VJKA 3GV0A 2A59A 1H8ED 2OGSA 4TVKA 2IF0A 1YA4A 3PPIA 1KO7A 3VH4A 1T4CA 4DT1B 3ZBPA 4OL0A 2C58A 4RO0A 1O95D 2HHJA 5J9FA 2NO6A 4QPPA 5C34B 2PTGA 3T3EA 2W98A 3Q6MA 1F6DA 3ZE9A 4AP9A 2IYWA 3UIEA 5AOAA 2IEYA 7YASA 3SZLA 4YRGA 3BWYA 3MOSA 3LV8A 2HGZA 2P35A 5JAIA 1G8YA 3JQ8A 2NUAA 3KYCB 1BFKA 2A1UB 1JLHA 4QL3A 1ZXLA 3U4HA 2FP4B 5A6VA 5AJWA 4DC0A 1ML3A 4D56A 4WEOA 3O75A 4KLNA 4N49A 4BN0A 3N76A 5D84A 2HHCA 1GPH1 3CEMA 1G4UR 4ZAWA 2QUJA 1KDZA 3JAWA 3KYBA 2IU6A 3ZU2A 1ZVKA 3CJTA 1S8NA 4GPIB 1XKLA 3E58A 4J8PA 1CYDA 1OXKB 1X7WB 2QAJA 1P80A 2QNRA 3Q40A 4L72A 2IV3A 1ZCJA 2HNAA 3RG8A 4ZJUA 3GFOA 2ZYHA 5TS3A 3ESXA 3IR7A 3IPLA 1O96A 1TEHA 4IIHA 1M0TA 1YIAA 4UU7A 1VJ1A 2Y4OA 4OFXA 4W8GA 1DFHA 3SSOA 2VUTA 4AD8A 5GTDA 4JL5A 1KSGA 5JAZA 3ZTTA 5IMSA 4KRGA 2NQ2C 2J5BA 1PKEA 2WLTA 4ZTUB 3ZU4A 4FILA 1T0BA 3O3MB 1SXIA 2GBPA 3Q7QA 2H1LA 4DLYA 5ANRB 1VIDA 3PGXA 5BW4A 4KBGA 4G5FA 2EKBA 1QTNA 1X1QA 3ZW9A 2B3DA 1ZGHA 4NOLA 2HZ7A 1E96A 1BVYF 1G5FA 1E5VA 2VTVA 4GMKA 3MZ0A 3EZXA 4IWXA 3NHMA 1V95A 3OLWA 1P5FA 3IODA 3WMGA 3DCYA 1PFKA 2A2ZA 3AJ8A 2XBMA 4KRFA 4IEEA 1VGQA 4PONA 4QELA 3D6TB 3HR8A 2V7GA 3ESZA 4IILA 4NFSA 4Y0VA 4EVSA 1SUAA 2ASVA 1P1CA 4XQEA 1NC1A 2OGTA 2WU4A 4TKZA 4B3IA 2PUBA 9LDBA 1EYZA 3L3BA 4BB6A 5DLPA 1BNCA 5JDCC 1RJGA 1UAYA 1NVEA 2WG2A 3BMQB 4KH1A 3KR2A 2DJIA 1J6UA 3FI9A 3P2EA 5FL7A 4Y98A 2OV4A 1TYZA 3ICWA 2HEGA 1JLMA 5JAQA 121PA 2RH4A 1LUAA 2J0QA 2FWJA 4UTVA 1C1XA 1Q0SA 2DQKA 3OU2A 1GG5A 1M1NA 4EW1A 2IZ0A 3HEMA 4A0HA 4FFNA 2OUIA 4QXAA 1XAJA 1GZ7A 2I1QA 2PVCA 4FQ8A 2BP7B 5DNAA 3S8EA 3F73A 5TF0A 1VL1A 1R15A 2G9RA 4ZXPA 1Q7CA 4AN0A 4EGJA 1M74A 1O5TA 5EE5B 5HGXA 4Q66C 5KNDA 4LDNA 4EZIA 1XPJA 2ZKLA 3GI1A 4CT0A 3FPJA 5TQ0A 3TCXB 4Y6RA 5LMUB 1U8XX 3HGTA 3F6EX 5A4KA 4JI1B 1MR3F 1ZJWA 5A5FA 4PC7A 4UBIA 4DMGA 4DDTA 4Y30A 5HJ7A 1M7BA 5H02A 5AVOA 4ACAA 2VPXA 3AHEA 2WIKA 2XEDA 4GQAA 4GUAA 1SUFA 3DWIA 4MQUA 1X1SA 2V96A 3EH1A 2PCLA 1UBOS 3PUIA 1B26A 1IJEA 2OBYA 4GZ3A 3FOZA 2ZJYA 3TLGA 3LK7A 4P34A 3H1FA 3VNQA 1AH2A 4AKGA 5F2KA 4X1OA 4I8IA 2BHTA 1Y4ZA 2EWWA 2ZSFA 4OHOA 4CKEA 3FZQA 5DTEA 2CK3D 2PSEA 2PLNA 4G9EA 4ZZ1A 3NHKA 3R6WA 3AY0A 5D3MA 3AIKA 4B2IA 5C5IA 1EBBA 4GVLA 4RSMA 1LSOA 3C6QA 1CZUA 4A0RA 4DFDA 4E09A 4OHMA 1YOVA 1I1OA 2WTAA 4ZQFA 5A62A 4F7WA 1YDGA 3ND6A 1DI0A 4YMIA 2YYSA 5GPBA 1N32B 4Q47A 5LMNB 2QRQA 1NLZA 4XSGA 5LDHA 1DP4A 4O4HF 2CEAA 2B8EA 2W42A 1LC0A 3LDUA 4I4CA 4O63O 1G21E 4NEGA 5D6NA 2FEPA 1QVAA 2P9HA 2OZKA 5CX4A 4B4UA 5F9HA 1U3WA 2VYNA 4K9PA 3PDWA 4ZV9A 5KZMB 1MTZA 4J94A 3NIGB 4L50A 4AKTA 9ATCA 2WV9A 3Q9SA 1R66A 1X8JA 5FWYB 2FWPA 4ZK2A 2JAXA 3NHLA 4HBGA 3E5RA 3PXGA 4MQEB 5HS6A 1WEHA 3R5JA 1GLGA 3UUGA 3TPFA 1ZZEA 4CKBB 2W0SA 4Q7QA 1YO6A 4KPYA 3VKHA 3Q3CA 1M2WA 1RYFA 4R7TA 1NN0A 1EX9A 1KQOA 3DCJA 5LQMA 3TEMA 1Q1EA 1FPMA 5IUKC 4MGKR 3VPBA 4C4TA 1EGMB 1EMDA 4RK5A 1K5HA 5JSQA 3WGKA 1BKSB 4BJ5A 5AKEA 4PAWA 4DEXA 1IOZA 3KDSE 13PKA 3PDJA 1SWVA 5AVTA 3FPSA 3HZOA 4UFOA 1TPZA 4C88A 2DPHA 1P2FA 2AKYA 2OR3A 5AQ1A 1XZHA 2ATXA 3E82A 3NDIA 5AVUA 5L8VA 1TIPA 5FBWB 1IBKB 4B4KA 1FQOA 4TS4A 4G81A 1WVIA 2DFNA 1PK9A 2R60A 2XGGA 3IIJA 3K4QA 2SKEA 4PV7A 2QDKA 3NBYC 4CLXA 3MWKA 5ADHA 2FSIA 2H7VA 2YWBA 3B1KA 4OTZA 5IK2D 3IOEA 1R8JA 4WACA 2RH9B 1EAMA 1K97A 4GL4A 1HE1C 1SOWA 5G02A 4CKYA 4UTNA 1H69A 1KZGB 3ETDA 2ZYDA 3ADOA 4PVCA 3WKAA 1GNRA 2A5YB 5E6RA 4RMHA 2ZIVB 2G0AA 1J0EA 5F9MA 4GOJA 1CJMA 3RYTC 3MJSA 2NO5A 3QY0A 3TOZA 1US8A 2DKFA 4BE4A 2ERXA 3P9XA 4YRDA 1OCEA 1ZJ4A 4QGFA 4RH1A 3B51X 1AXEA 2RK6A 1QK5A 5DYIA 3TL2A 2OM2A 2Y0PA 4KR9A 1I7SB 4KJXA 2VSFA 4UBLA 1G3MA 4OJMX 1C50A 3R6DA 1IXYA 5FWYA 5DBGA 3PFGA 2GA8A 3OPYB 1Y7LA 4K9DA 2BE9A 1NVVQ 1NI3A 3NBUA 4Q9KA 4CCYA 4NAVA 1NHWA 1SU4A 2F7SA 1KDTA 1L4NA 2FMIA 3L1VA 2JFXA 2OYRA 2IP2A 3CLTD 5FF9A 1Z2DA 4JWKA 4REQA 4HTFB 4M0LA 1P0CA 3JS5A 4HHEA 3ELDA 4L9AA 3I61A 2O8BB 2GBLA 2ZAYA 2JGKA 3HBMA 1NA5A 3A10A 4YJ2F 4BVBA 3FR7A 2ZWMA 2NQ8A 1M2OA 5F4BA 4A0QA 1ZGJA 4B6GA 1VKOA 4PHTA 3VPDA 1E3SA 4Z4CA 1A9YA 4Q48A 1DPGA 1CEQA 5KYUA 5LYJA 2OP0A 2ZIEA 3PKZA 2JH3A 1BRMA 2M1ZA 3OFVA 5LFAA 4ZKEA 1L7VC 2XCSB 4MVJM 2C8KA 1JQKA 4MNTA 2NVOA 4HCJA 1GU0A 4IIXA 3OX2A 1NKVA 4PG8A 4HT3B 1GA6A 4D9MA 5ILQA 2WJ3A 3Q9UA 1UEXC 2ET6A 1JEQA 4J4TA 1B14A 4LY0A 3D54D 3FFWA 3I2GA 3PIIA 4KX5A 3LI2A 2CSUA 1QXSA 1NXXA 3ORYA 2HJHA 3Q0TA 5T5QA 1DC7A 1DRKA 2LDBA 3AR2A 5CGZA 1CR6A 5CM9C 1VCMA 2IYFA 2HCBA 2X15A 3LW8A 4XOUA 1S2GA 2I78A 2O06A 1JPVA 2J9FA 3DWEX 2OQRA 1YHYA 3EGIA 3TI7A 1R5JA 1QGED 4KL8S 1JBEA 1ZM7A 1YBVA 2XTNA 3DE5X 2PUEA 4BO4A 5BVGB 1WMFA 3GZ4A 2X6QA 3AHJA 4K6HA 5KNBD 4XCQA 3MWDB 3RHTA 2J59A 2P2CA 5KTRA 2QN6A 3QMMA 1E60A 3G02A 4XD7A 2YRWA 2O9JA 2XHZA 4XVHA 3BWDD 1VL5A 3VM6A 1M2FA 1Z16A 3ZHZA 1T3SA 5CPBA 4YHHB 4HMQA 2P6UA 5D8DA 5JZBA 1Q84A 1U94A 5K45A 4WSOA 3WAGA 4GRAA 2NZUG 3U7RA 2JZOA 5D3ZA 1GPJA 5CDHA 1YTLA 1ABFA 4UPEA 5IDXA 1DKRA 1F14A 5IP5A 3DR3A 4KMSA 4CQJA 3SFTA 2FN8A 2JJ1A 4ZCQA 5HOQA 4G0MA 4I19A 3TUJC 1W52X 4QREA 3EBLA 4XM1A 4FX2A 2HGSA 1LPPA 3EUEA 1X0VA 1CC1S 1S7CA 1H05A 1SKUA 2AQKA 2DUJA 10MHA 1XNHA 4XTRA 3H2ZA 2AW3A 4MUMA 3TGLA 4JT8A 4L73A 3HDGA 3OHSX 1GTL1 4RNCA 1GN8A 2SBTA 1PL7A 5LBUA 5CLQA 5B1DA 2BRUC 3K9BA 3PIRA 4LYYA 5TQ2A 4ZGBA 1DHRA 3T3NA 5K6TA 5LZ9A 1GSOA 4R1QA 2D0OB 1VIMA 4CCSA 5FLEX 4UU0A 2R84A 2QDXA 1B43A 3BSFA 1B3RA 4PNEA 3F6SA 4BOYA 1ZH0A 3QVUA 2WRZA 4IIVA 1L7NA 3E48A 4PXAA 1UZNA 1RBQA 2ZZKA 4MWOA 4TL8A 3W8NA 3OPXA 4JA2A 1Z4IA 4F8JA 3ZVNA 5EKUA 2GSWA 2OHFA 1A5ZA 1ZGCA 3GNTA 4G5QA 2UZ1B 3R7SA 4B73A 4DAEA 3QNWA 5A9RA 3B3QA 1PAUA 3GK3A 4P2GA 4V0SA 5HKLA 2EBFX 4QFMA 3A3NA 2IYNA 4B48A 3FMFA 2XLCA 3CX4A 3I2YX 1C7EA 4JHLA 4XEHA 3JVUA 3ZHTA 2Q5QA 1ESEA 2I4OA 4U63A 4TLBA 3REQA 2GBFA 1DIAA 5IZ4A 1U7PA 3OEWA 1JWLA 3H9UA 2L0XA 3OEEA 1F3OA 1U02A 5KI6A 1DAHA 3BORA 1NJ2A 2ZBQA 2ZJ8A 2HOQA 5H1YA 1MN6A 3DZIA 2PV7A 4IPTA 1FFHA 1X1CA 2W6QA 2AEJA 2BJHA 3ILSA 5F1PA 2XQJA 3B7PA 3T5DA 4Q7LA 3VH2A 1BW9A 2AJTA 1F8GA 3EFOA 3UK7A 1E3MA 2LGJA 1F1JA 3B9BA 5BVHA 3CPSA 2OGWA 4KH0A 5JI3E 5BY2A 5LQCA 5F4ZA 3ZQKA 3RSLA 5E2IA 1OYYA 1YJCA 4YPOA 1DIHA 3KVYA 2OXTA 1VA4A 3W1VA 3HJAA 3KBBA 3U3OA 5KDLA 1VYHA 2CFCA 2K87A 4KTVE 3WYBA 1QONA 1XJCA 3X1YA 4LOAA 1N2HA 3W9YA 4G5RA 1Y6JA 2VBCA 2QJRA 5DNYB 3N3BC 2DHQA 4R40A 2XE6A 1OVGA 3ONNA 2IELA 4RDCA 3AF2A 3AIOA 4QUAA 4TN5A 1UKCA 5BRJA 3NPMA 3S8YA 2VBIA 1VPEA 1JKXA 4PYKA 5WRFA 1ZH8A 1YB4A 2IL1A 1U8ZA 4TYQA 1T13A 4N3BA 3G9XA 2C7PA 2D13A 4C0LA 3TTVA 1NUSA 2XRYA 1AKUA 3B6ZA 4LZPA 1YR9A 3GLQA 4XYMA 2FUG1 4MKRA 3WIUA 2BOVA 1OH6A 1MT0A 3M5WA 1IJFA 2EU8A 4DV4B 1GZUA 1YR2A 3NCHA 2P67A 3S2IA 4G84A 1T2EA 2FPWA 3QZUA 3S40A 3A6ZA 3VR5H 2VOJA 4O8ZA 4P4UA 3VU9B 1OV6A 3ZV6A 1IPFA 2XV1A 5AJVB 2I2FA 2V7XA 1L8LA 1DMRA 1NIPA 3IDAA 3IX7A 3VO1A 1L8OA 1WE2A 1SHUX 3JD4A 2ZETA 4L02A 3M34A 1X7WA 4NOJA 3K5PA 4WNAA 3A9RA 1DAEA 2ACWA 3VPCA 1ECCA 2Q9CA 4BB5A 4O2AF 4AP5A 4C3VA 3GGGA 1NXTA 1SK9A 2D7CA 3DFKA 3G9ZA 1KDYA 3K9LA 3LC1O 1SBTA 3ZBQA 1TF7A 3SQWA 2UVPB 3NKVA 4XM0A 1O4VA 2IH5A 2X3UA 1UPXA 1ULHA 2CDAA 1M54A 1QX3A 2OO3A 2NU8B 5HRAA 2JLYA 5K3FA 1W25A 2BMEA 4JV5B 1FU8A 4I50A 1HEYA 1DL5A 4Q1CA 3H1AA 4LN1A 1L7XA 2R47A 4AMYA 1ECBA 2WD7B 4DA0A 3UA4A 3AESB 3E9CA 3QVJA 1C4XA 3FLEA 5IS2A 2AOWA 2E4ZA 2ZT8A 4Y2TA 5ALYA 1SIOA 1Z6XA 2G40A 2ZSKA 3DLBA 3H97A 5LDGA 3CGWA 3KNZA 4FHFA 4QZVA 3KTAB 1KI6A 2O7VA 4HDKB 4W63A 3TB6A 1Y33E 1FFCA 2K6GA 3ELYA 3MSXA 1ZLYA 2Q1WA 3EQ6A 5DXFA 3OHMA 4YONB 1MX5A 3LSTA 1VLJA 2W71A 1JKIA 5ALFA 3UW1A 2WT4A 1U8CB 3FPKA 2F6RA 5E4JA 2JIMA 4TTPA 3VR2D 3EZLA 4FQ7A 3ZCUA 4QUDA 5KKNB 2UXCB 5JPCA 4ZT3A 1MRZA 1V1JA 1W0JD 3QFCA 4TMYA 5I4BA 4NF2A 3UHAA 3VR2A 4TWJA 3BMOA 1NJ1A 1V96A 1IPEA 1RWMA 4BN4A 4DPLA 3N2YA 4RHEA 1J42A 1NQTA 4DLZA 1W0JA 2AOUA 3PQEA 3NJ8A 4K9NA 4KRYA 1E92A 2XDAA 3JY6A 4GSKA 4M0KA 4R68A 4WBSA 3UV7A 4C2BA 4LF9B 2F8SA 2JI7A 2NMVA 2A5GA 1AG9A 2IBMA 3ITKA 5AJXA 3AI7A 4NZZA 4YP1A 3NFRA 2OHOA 4TQAA 3IP6A 3AI1A 3ZQUA 4RZSA 1QYIA 1TZMA 3CVOA 3DDOA 3CLTC 2WSLA 3FAZA 1KQFA 4WI1A 4HD8A 1J9ZA 1SQGA 2DM6A 2XXJA 4W8OA 4ZTZB 4X6LA 3DKKA 3T1QA 3AQ4A 1QHNA 3SPXA 1XEXA 3PL5A 4DBLC 5DXAA 4AO7A 5KNCD 2XI4A 1LVHA 1SA0B 1W4LA 1B15A 2J4CA 3RWOA 2WOOA 2KQUA 2VDQB 2GYWA 2WUEA 5DWDA 4U7DA 1FIUA 1UJNA 2IY7A 3K0EA 4IXNA 3M6FA 2E4UA 2WTNA 2ZULA 3JZMA 2Q4TA 3LY7A 3KVVA 3MEQA 3NV9A 3OO1A 4LHVA 4MYHA 3V4VB 4MYUA 1TJPB 3ICPA 1VHWA 2WILA 1G9SA 1QGUB 3MGAA 1KI6B 4HN2A 2Z5VA 2H00A 2GS9A 4NECA 2I3ZA 3E3AA 3HTXA 3PGVA 1E9AA 1DOAA 5ILGA 4ALNA 3J80A 4ON9A 3EXHC 3LCVB 4LXQA 5EXXA 1V8ZA 2PVPA 3NONA 3I8XA 4IDEA 1C3OA 5FOWA 1DCTA 3Q5EA 4YCCA 3FTNA 4AI6A 1J2TA 2Y4NA 3P52A 1Z36A 3OIVA 2J9RA 5JISA 2NO0A 1T2AA 2OD7A 2VJLA 3COVA 3SZRA 3DTVB 3GD5A 4DDWA 1RD4A 1MXHA 4X5OA 3WBKA 3K20A 3ZCPA 2XNSA 2GN9A 3IRUA 1SU8A 4BFVA 5JDIA 3SYKA 4NBUA 4KSBA 4KUEA 4LMPA 4OFZA 2CN1A 4RVHA 1P2BA 4QJ4A 4AL4A 4DV0B 4RULA 4U7JA 2X76A 2P8SA 1VLLA 3ZQ6A 4FPXA 3P4UA 4OLFA 3DVAA 5CMLA 1ODJA 4GMXA 3IOYA 2ZJ0A 5MFPA 2DFVA 2Y66A 2AYYA 4OLHA 3ZI0A 3ADKA 4S3MA 4KAFA 4W8HA 1AF4A 1I80A 2D1SA 3EVBA 3K8OE 2GCNA 5H4HA 5AK4A 2AEFA 2GVZC 2Z9CA 1NZJA 3IBTA 3KEFA 3EODA 1UJ6A 2O0JA 2PM8A 2X41A 4UM8B 4W4TA 2C4KA 1SKQA 1I0IA 2I71A 5IC5A 1D7OA 3S70A 3KKNA 2ZM6B 5CVEA 3HPRA 3UTDA 3L06A 4IWNA 2IK8A 4PXSA 5JAOA 2EHDA 1VB5A 4A6DA 1G21A 2F59A 4UMVA 2F62A 2FV8A 1WF3A 2QU8A 2VHJA 1JMKC 1M6NA 6YASA 5C7YA 2O2XA 1VI2A 1QV7A 2VJMB 3U39A 4A23A 4M83A 4YASA 2PA0A 4CTKA 4PLZA 4KPUB 2XYPA 4P9NA 4RH0A 5JZMA 5L3SB 4ZA2A 2O07A 4TLAA 3THXA 2V4UA 1G55A 3P9QA 2BFWA 2YHUA 4B09A 4OLJA 3IVAA 1Y37A 4WBNB 4NENA 6REQB 3DBRA 3M70A 4QULA 1J21A 4X62B 1H5NA 2UYGA 3FXAA 1FNSA 3N0VA 4RMGA 4B3TB 3DEHA 3KE9A 4AS2A 1RI5A 3LPCA 4OUDA 1PYGA 4MVJF 4YTEA 1GGVA 2VRCA 1IQPA 3INGA 3C6BA 4YAIA 2BMVA 5JZ9A 4ONEA 5DGIA 4DJ5X 2WU1A 4AY5A 4A4DA 3OQBA 3SJBA 1B74A 1ZCAA 1WKBA 4UUOA 2QVCA 1G20A 2ZTUA 2Y0DA 4A6EA 3UAYA 4B4DA 2WSSD 3PFFA 4EHFA 2DPXA 2F3TA 2FZKA 1FXWA 5A5DA 4JY7A 2B6HA 5ALHA 3O8NA 2ID7A 7ABPA 1SOUA 1AQUA 1SG9A 3N2IA 2XIJA 3Q2OA 5KMGB 3OM8A 4RD6A 4CBVA 4EEXA 4YH1A 4YMTA 1K4MA 4GNKA 4O2AA 4CDRA 1NSYA 2BKVA 2EF0A 1U1EA 2A4MA 3BH0A 3HFGA 3IMCA 4MWGA 6AT1A 2YVQA 3G2OA 2C4WA 3PIDA 1XK6A 4OHRA 2O8CA 3IUYA 3WTBA 1LX6A 1ODKA 4DUYB 2WC1A 3OFND 3EVEA 1CZRA 2D1TA 4MARA 5IDVA 3G2IA 4NONA 4DUZB 5DCUA 2NZWA 4MRPA 5KTNA 3HO6A 3TTWA 5JQGA 5KIAA 1QWOA 1U2PA 1Z0JA 3RC7A 1DKLA 221PA 2YZGA 1EDDA 4Q9DA 4RD3A 2QE7A 2VK2A 4RVSA 1Y6RA 4E46A 3FFTA 4BNJA 2Q3JA 1UOQA 3NBAA 1K06A 1WCIA 2C20A 2V74B 3E03A 5SZJA 2VJPA 4UM9B 5K8JB 4EELA 1RQRA 1JW9B 4E14A 1UP4A 5K5EA 1HMPA 1EKXA 1E66A 4E31A 1ZIYA 1E9RA 2B78A 3LBYA 4PLVA 4WKOA 5I7AA 3C8ZA 3UAVA 3LNCA 2BF4A 3GLIE 1KYVA 2ZITA 3EMVA 1Y7HA 2N3ZA 3M3PA 2ZI3A 3P9RA 4W1QA 2H59A 1K1EA 4YJ3A 3N6XA 3TVYA 1ZITA 3LVBA 5L3VA 1AZWA 3UT0A 1SCNE 4GVPA 3KU4A 3GL9A 5DBHX 3LTNC 4AG6A 4V2UA 3FHOA 2GCOB 5YASA 3Q85A 2PO7A 4BVJA 3H5RA 3BX1A 3LT2A 3K6JA 4BX9A 5LQSA 1S89A 3VKUA 2YV2A 3IDQA 3NH6A 3E3OA 3LW7A 1E6LA 3PXDA 4OQZA 1QC5B 4F1KA 2Z6VA 3W78A 1L6IA 1Q7EA 3YASA 1RVDA 1G5IA 5DI3B 2IY9A 2DECA 1CK4A 2XGMA 1ZK3A 3FVQA 4JLAA 3INRA 3KFVA 3LE8A 4BQFA 3RK4A 4BNHA 4BKUA 4ZO7A 3MK31 5K7SA 1CF4A 4G9BA 1DELA 2P79A 3T5CA 1K2WA 2RGCA 2FUCA 4L07A 4Z2AA 1GPBA 2AOTA 2XR1A 2GFHA 3KKQA 3ZCSA 3ZCXA 3FVWA 4HGYA 2QI9C 5CDGA 1UQRA 3BMCB 2WPDD 3NBKA 4HGRA 4AF8A 2AOXA 3H11B 4HUTA 4YCSA 4JYCA 2QI9F 2WJAA 3LAWA 1BA3A 4CHGA 4MCHA 1OIVA 2GZHA 3HNPA 5T4HA 3OTOB 4DR5B 2QTBA 1BEUB 2F8LA 4WZBB 2CHFA 5D5PA 2V65A 5FKJA 1R4MB 1ZCZA 2ZG6A 2ZU6A 3VOAA 4C1NA 1O8CA 3I2HA 1T25A 2ZPAA 2FMKA 3ZUGA 5A9TA 2C2BA 4CYMA 1U1IA 3MJVA 3ZJ4A 2WWHA 5EOVA 4JI5B 3NYRA 3DKIA 1QCCA 2I2AA 3VZQA 3PEWA 1DARA 3EGWA 1IM5A 2BFEA 2FR1A 4G0YA 3SLKA 1IVYA 1GCOA 1HETA 3QKUA 3NH9A 3TW8A 4B3DA 3BK2A 4XRRA 4BNWA 2JAOA 2ZATA 2XLBA 3V4FA 2XUOA 1PLKA 1Z4PX 1R00A 4KN6A 4R54A 2HA6A 1ZA2A 4D3XA 3HVUA 4KYUA 2CLFB 3ESDA 1QHHB 1UANA 1EH5A 2AZTA 3NXSA 4J4BA 1T8TA 4S0ZA 2BMWA 2EG5A 2ZIUB 5JW6A 4I9HA 4OMCA 4OVKA 1JH9A 4AURA 1Z33A 3NHRA 1CQPA 4L3VA 4YK7A 3ZLTA 3HLYA 3JRNA 1E6WA 1WEKA 2FSSA 1AKMA 4PAMA 1NMZA 4UQPA 3DMPA 2ZUVA 3S2UA 4YDSA 1HRDA 5DGHA 2FG6C 2IYXA 1PU2A 1KAOA 2R8RA 3OQ1A 4LSGA 4BZXA 5I7HA 1N33B 5DNEA 3EWIA 3K72B 4WWHA 5F1OA 1QZTA 2ILTA 3OUUA 4BNMA 2VPQA 3DQPA 3C43A 3Q15C 3A11A 1S7GA 3CX6A 4BLRA 3SLRA 2V6IA 2W93A 5FNVA 1J7JA 4EB6A 4A0GA 2PG3A 3LYUA 3U7EB 2J4DA 4B3RB 3TUIC 3CLRD 3HKBA 3TG8A 1C1DB 3DVSX 3ZX4A 1UM9B 1OWLA 1RAGA 3ICCA 3E9YA 4A03A 2C4NA 5I7OA 4TMKA 1KOGA 1T1GA 3EFBA 1U9CA 4MVJI 1L6RA 3UCEA 3SJAA 3WIOA 4NCXA 4XVRA 4EY6A 2Y67A 4W1SA 3T5AA 2PWBA 4MP3A 4LFCB 3OIYA 4N5DA 2BFEB 4CMAA 1W2WB 4BMCA 1ZN7A 2I34A 2PUTA 3C3BA 3G2JA 3FPLA 3N6VA 2D74A 5KC9A 4UD6A 1KO4A 1U4NA 3DAHA 3E7WA 1L5FA 5JNVA 5U4XA 4IDAA 5G53C 5HZKA 3C8DA 4GXNA 1ZIOA 5B2ZA 4QOFA 1EM6A 3BA1A 3V1YA 2AA3A 1WB4A 4LSZA 5BYBA 1S3IA 2B98A 2NPIA 3WLPA 5A02A 1EK6A 2C2GA 2BH2A 3DF9A 1H1DA 3MW8A 3DNFA 4DMRA 2L19A 2DFPA 1G3IA 1A5SB 1YQ9A 4GZ5A 4N3AA 2C54A 3T0GA 3TR6A 5GGYA 4IMPA 2F90A 4FHCA 1E2EA 3H05A 3ANYB 1JE1A 3UXMA 4BX2A 3GMTA 2QT9A 3EBPA 1J39A 1OJ7A 3FVRA 3P5SA 3SR0A 1UAGA 1H2EA 3EZFA 1G20E 1DBPA 1GNSA 3F3KA 4KOAA 5CA1B 5IUNC 1NW3A 3FSGD 1PL0A 2FQ1A 2TECE 3B85A 4ILEA 3FLAA 2AZMA 1ZS9A 3AUUA 4WLFA 3HRIA 3K1AA 3U7IA 4B2YA 1FFXB 3S3TA 2FR8A 1KZ6A 1B4DA 4X63A 1DWUA 4B75A 5K8IA 1I51A 5DJ5A 8LDHA 2EGUA 1V26A 5SV2A 5C0OE 5TEWA 2ZAMA 3RHFA 4EQZA 2YQZA 1KP9A 1ZK4A 4LV5B 2QM0A 1KBQA 2HRZA 4UU1A 3FNBA 2PBLA 4MIYA 4U1RA 4PXYA 4IHJB 3KKKA 3TR5A 4LI3X 3A6EA 3SXPA 2IPLA 5HRCA 2D06A 2WNHA 2H4YA 1WZ2A 1AGXA 4M1ZA 3IQFA 1PVDA 2GZDA 2QT0A 2J0EA 2WTEA 3NIFB 2OHVA 1BCRA 3L0DA 3ZHXA 4UARA 1CPYA 1E79D 1V37A 2IW1A 4FCTA 3AFOA 4P54A 4LYJA 1C7FA 2C82A 3HKCB 3LBHA 4R1TA 5CTAA 3QKRB 4E5UA 4JP2A 1KOJA 1C9YA 2YZNA 3CY6A 3NDPA 2O4UX 7GPBA 1F06A 1BG6A 4MWDA 2NO4A 2HMTA 1GAXA 4XYLA 1OZAA 3BQNB 1A7UA 3FDIA 1JKMA 3QGMA 3W2GA 5EIXA 3J7AC 4JJ8A 5LCXA 1ACJA 4U6NA 1AVTA 4TTIA 4PTZA 3WC4A 4P5EA 3WNQA 5FNZA 2PQ6A 5G1OA 2NU9B 2FEMA 4Z0HO 2CJFA 1NF2A 3WLLA 2XTMA 1N2ZA 3PQ6A 3G5TA 1YS9A 3CKMA 1XN1A 2FMFA 4F56A 4ZEVA 3SD7A 3W6PA 1JDJA 1EG7A 2EX4A 4O6VA 2I4RA 3LX6A 3C8UA 4KU4A 4LKRA 2PVSA 5G40A 3U0BA 3U09A 1LWOA 3JPYA 1C14A 2JFOA 2ZK7A 3ONFA 2HCRA 1VZ2A 4J6FA 3KETA 2X0JA 1XLTC 3IAEA 1EUCB 1RWBA 3SZGA 4RFVA 1P7ZA 3O83A 5K99A 4LGCA 2VWHA 1Y6FA 4ESVA 3FYDA 5CU7A 3A0UA 1E61A 1Z2OX 1E2QA 4B46A 4QTTB 4H1HA 4NEQA 3BL8A 3ETJA 4DNPA 3HNRA 2VQ3A 2VP0A 1MZVA 5E4YA 4DTCA 4TYPA 4E2XA 1E1YA 4A82A 2B3TA 1X39A 2PO5A 1K27A 2YINC 2C8JA 2YN0A 3EG5A 3ORQA 1EK2A 2F1IA 1SBHA 1UBRS 5KX5B 1E1QA 4Q3LA 4PO3X 2GYUA 5ICGA 1NZDA 2Q5FA 3HDHA 4PGFA 4WKGA 3BMNA 4YECA 5HIKA 2NP6A 1XTPA 3QBJA 2WG1A 5TC4A 3EVFA 4FHGA 3W4KA 3JARA 1NQVA 4LNUA 5EIBD 1P5HA 1RYEA 3H11A 1IBSA 5DLYA 4QHYA 3CMCO 1HZJA 1U7UA 5GZ6A 4UZEA 1F4LA 3OETA 4PYOA 1FP6A 3L0CA 4FJ1A 3TIGA 4AJJA 1JMYA 2QN8A 2UYYA 2ONJA 1N5LA 5A2GA 4MKIA 3M1YA 1QIIA 4G1FA 1VA5A 5DBEX 5FFMA 5EE9A 1W5EA 4BGIA 1FBNA 4REMA 3NDBB 4E5YA 1IPHA 3DAFA 1A71A 3B9QA 1GDHA 2IPXA 1JAXA 4M22A 4C3UA 2X8LA 4ZYVA 5IH3A 5JYEA 2VZ8A 5EIHA 3QVVA 3K96A 1QQAA 4P3OA 4CQLB 1LI7A 3K30A 1Z39A 3C3JA 3GMSA 5E2BA 1CLEA 1X2BA 1R9JA 2JFFA 3GJ6A 3S99A 4LYFA 5L9AA 1PG2A 3NAQA 4GS5A 3JQGB 5AKIA 3T7KA 2H4HA 1FU4A 2WA1A 4TUYA 5F3RA 2D59A 3P2IA 5K9ZA 2JKZA 4M76B 2YWEA 3WLIA 3AVOA 3MT8A 4CG2A 2NP7A 2J7KA 3DWGA 3F78A 1U5AA