2Z9CA

The crystal structure of azor (azoreductase) from escherichia coli: azor in complex with dicoumarol
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
200
structure length
197
Chain Sequence
SKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALRAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FMN-dependent NADH-azoreductase
publication title Expansion of Substrate Specificity and Catalytic Mechanism of Azoreductase by X-ray Crystallography and Site-directed Mutagenesis
pubmed doi rcsb
source organism Escherichia coli
total genus 74
structure length 197
sequence length 200
ec nomenclature ec 1.7.1.6: Azobenzene reductase.
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2z9cA00
1T0IA 3LCMA 2W5UA 1CZUA 4U7HA 4GQIA 3OVMA 3QFCA 4QOFA 3NHWA 4QOIA 5LJIA 5EMNA 4C0WA 4LTDA 4DILA 4LAFA 2X2OA 2WC1A 3QFRA 2XODA 4ZVMA 4ZVKA 2FZVA 3G5MA 3F6RA 2QR2A 3O73A 5F12A 3HLYA 1WSBA 2FOXA 1FLAA 1CZHA 3NFRA 3NHRA 2RG1A 5ULLA 4N9QA 2OHHA 4H6PA 3OJXA 4Y7CA 3OX1A 2FX2A 3GFRA 2M6SA 4YAOA 2QX6A 3F6SA 3OWHA 1XYVA 2QWXA 2KLBA 1YOBA 1DXQA 3N39C 1AHNA 5A4KA 4Y9UA 2FCRA 2Z9CA 3HR4A 4DY4A 3F90A 4BMOB 1VMEA 5F4BA 1XYYA 2FZ5A 1OBOA 5NLLA 4ZVNA 1ZX1A 3FNIA 5B3KA 4QOGA 1C7EA 2M6RA 1AG9A 3SVLA 1H69A 3D7NA 4QOHA 2HNAA 3ESXA 3N3AC 1RLJA 1BVYF 2GSWA 1QR2A 2ZKIA 2Z9DA 1CZOA 1KBOA 2MT9A 5EA2A 3R6WA 4F8YA 1J9GA 5FUQA 1YCFA 2BMVA 5LMCA 1QBGA 3UXEA 5LVAA 3NHUA 3U7RA 1AKVA 3ESYA 3NLLA 3B6MA 3KLBA 3W7AA 2Q62A 3OX2A 2QX9A 1F4PA 1J8QA 4PTZA 1FLVA 1XT6A 3GFQA 4FX2A 3L9XA 2N1MA 2FLVA 2Z98A 1AKQA 4CETA 1FLNA 1CZRA 1H66A 5LBTA 3FJOA 5BUCA 5LBUA 1AMOA 3NHLA 1YRHA 1CZKA 2FVXA 1C7FA 3ESZA 1ZWKA 2QMYA 1AKUA 2Z9BA 5LLDA 3FW1A 1OBVA 3B6JA 1GG5A 1WSWA 3TZBA 3ZHOA 1FTGA 4U7FA 1FVXA 3TEMA 4YALA 3OX3A 1E5DA 3HA2A 2MTBA 1FX1A 4YAWA 2OHJA 4ZVLA 4XDGA 3KAQA 4ESEA 4YQEA 3OJWA 4LA4A 3P0RA 3FX2A 3NHPA 1TLLA 4XDHA 3GFSA 3O2NA 1TIKA 2R96A 1SQSA 1T5BA 2BF4A 4C0XA 3NHJA 2OHIA 5EAIA 1ZWLA 3UXHA 3EYWA 1AZLA 4NLLA 5F51A 2AMJA 2HNBA 4D02A 1BU5A 4NULA 1YDGA 3S2YA 3B6KA 5JROA 2BN4A 2F1OA 2A5LA 3KEGA 4LTMA 3GAMA 4BMPB 1D4AA 4OXXA 2Q9UA 4QOJA 4C14A 3OWXA 4GR9A 3L9WA 4FGKA 3KAPA 4U7GA 4YAFA 1NNI1 3RPEA 4FGLA 4M0CA 3ES9A 1I1OA 6NULA 3NHSA 1V4BA 5TGZA 1X77A 4ICIA 2BPOA 2OYSA 3JSXA 3W77A 1QRDA 1QHEA 3EDOA 3N3BC 5FA6A 4H2DA 2QX4A 1SG0A 2X2PA 4S24A 1FUEA 1XI2A 1YCHA 2ARKA 4J8PA 1DX9A 2V9CA 3QE2A 1AKWA 1OFVA 2HPVA 2QX8A 3F2VA 1CZNA 1DXOA 4LTNA 4C76A 4HS4A 2FDXA 2FAXA 5FX2A 3W78A 3NHKA 1AKTA 4R81A 3FVWA 2KQUA 2MOKA 4FGJA 1D04A 1CZLA 4QOEA 2BZSA 5NULA 1JA1A 1FLDA 4GI5A 1YCGA 3NHYA 4YAUA 3NHFA 2QMZA 4N65A 1J9EA 4CF6A 1JA0A 2V5VA 3B6IA 3U7IA 2R97A 1KBQA 3K20A 4PU0A 2V5UA 4DIKA 1RCFA 1B1CA 1RTTA 4QODA 2B3DA 1D03A 2MWMA 3TE7A 1J9ZA 4N82A 3K1YA 4PTYA 1YKGA 5B3LA 4Y9RA 2XOEA 5LJLA 1RLIA 3LT5A 4HEQA 2D5IA 1AKRA 3W79A
chains in the Genus database with same CATH superfamily
3MOGA 2I6GA 4GMFA 4LYYA 1V1RA 4UBLA 3A1CA 3DCIA 1DMRA 4Y2QA 3OU2A 3L4SO 1FDVA 5H7XA 2XT9A 1G3RA 3WRVA 1S2LA 2YV3A 2WY2D 1K6EA 4Q12A 3FSGA 4PAWA 2X6RA 4ZT4A 4YMLA 2NTEA 4RTSA 2W8BB 3NHZA 1U0GA 4CIVA 5IW8A 3DOJA 4AURA 2OFWA 1SO8A 2FPKA 4HZUA 3ONNA 4MDFA 4MQ5A 5DN6A 2D59A 4KR7A 2YC2C 2EWMA 3K9NA 3RIHA 4HDRB 4GW3A 3Q41A 5AK5A 1IEVA 5KHAA 1LPNA 1BCSA 1SKBA 3N1UA 3AKZA 5DNEA 1ZISA 5EXEA 2OLKA 5IBPA 4MO9A 1T5DX 2XF2A 3JZDA 2QTTA 5IVKA 4AZWA 3I4CA 1G8JA 1V8BA 3E27A 3R3YA 4LRSB 4ZVMA 3TAUA 3UAVA 1ZHOA 4PSCA 2D1SA 4GBGA 4B5KA 2YH2A 4P3OA 4PO3X 2QYHA 2GCPA 3FB1A 5HCNA 3QK7A 4RMJA 3R76A 1DBRA 1JAXA 3O73A 1KOFA 4MQBA 4Q9DA 2FOXA 1B23P 3AP3A 1T26A 3NRBA 3C3CA 4LXUA 4D5GA 3TOXA 4Y0AA 4CIDA 2XUJA 1I6MA 3DF9A 2J9GA 2WMOB 3CIOA 4FSDA 4WVLA 4QUHA 1UBNA 4CIAA 3FTNA 5AVXA 1NXTA 2Q6VA 2YASA 4DABA 3K0BA 1EGHA 1T9BA 3JQ9A 4FFDA 5ALKA 5A1JA 1P1BA 1X42A 4M0PA 3OX1A 5KNCH 4DJFC 2GAAA 1NJFA 3ML1A 2GD2A 5EE3A 1Q95A 2J4DA 2MSKA 3AG5A 3ZTYA 2NNLD 3V8EA 4A10A 1OPXA 3TTSA 3UJ6A 1KO5A 3G79A 3NBXX 1DX6A 1P6QA 3HFSA 1A5BB 3VZSA 3LC2O 5DCLA 5JE8A 1ZQ1A 1E4EA 1XP8A 1QFSA 2XDQB 4L0MA 5KOHB 2HN9A 1DWPA 3Q6IA 4JKOA 2HU7A 1WVMA 2ZZNA 1O08A 2IITA 1ZH0A 4UU1A 2E48A 2IXAA 2VR1A 5LZ8A 4Q6BA 1ZXBA 4B9EA 1JWLA 2D1FA 3ZDEA 5DX8A 4Q3NA 3OM8A 1RABA 3R0VA 2AFRA 1ORVA 3ADBA 2NO9A 2D8AA 4JJ4A 5FBWB 3TLGB 4N0PA 1W88A 3M2TA 1NVWQ 1R9NA 1DIAA 3PIDA 3P9ZA 1IOZA 1PW7A 4L6AA 2ONKA 4QQFA 4C7OB 4Y1FA 3RYHA 3WIDA 3BEDA 4R4JA 2P9TA 2XKAA 1PLKA 1R4MB 2V45A 3TJZA 3MNFA 3NNNA 3KLPX 5J1TB 1YE8A 5DEIA 4ENUA 3DL4A 2VJBA 4B3BA 1IHUA 3RTDA 4ACAA 3ZKAA 1WCYA 2XNDD 1GRVA 1NU6A 5IDXA 1CLUA 1UDWA 2AMFA 2BMEA 2LZ0A 1SUDA 3A1UA 1H22A 1J25A 3HU2A 4PVDA 5K3SA 1SVOA 3TB6A 1YO6A 3MUNA 4A8JC 3H04A 2FMKA 2WWWA 4GYJA 4K9SA 1ZJZA 2VXCA 4RV9A 1WG8A 1BX0A 2WYIA 4DA6A 3S8YA 3FCEA 2JBAB 5FUXA 4YRZA 1VIAA 5ECDA 3V1KA 4DEXA 4GEKA 1ZNXA 3DL0A 2OP0A 2IL1A 1K8RA 3JQCA 4WVFA 5JNWA 2IC5A 2L19A 1F8GA 3CVOA 3DBHA 4JJ7A 3WICA 4NMMA 2PKQP 4X94A 3RUHA 4CM4A 3WA6A 2YZGA 2AF4C 4I1VA 3IC5A 5M5BA 3NTOA 4YGXB 2Y0DA 3WLNA 2HUNA 3G8YA 2GFQA 3KXKA 5ENVA 3OIYA 2QVXX 1E3JA 5CTAA 4BV9A 3TIGA 3R9WA 4CT0A 3UAOA 2GCOA 2GZ3A 4UNNA 2CVFA 3Q0EA 2DUMA 5CCDA 5EKXA 1SN7A 3FRHA 5KEIA 3MINA 3H19A 1TF2A 3IDAA 3ZQ4A 3W5CA 3UXEA 1N2BA 4NWIA 1JJVA 1GGFA 2JEYA 2WTXA 2XVAA 3NHUA 3O1LA 1C2TA 3ODGA 4KE6A 2AZTA 2X0RA 4OXRA 3U7RA 4R98A 3UFBA 1MB3A 4NP6A 3NXKA 3GQBA 3I2IA 3OICA 4YAGA 1QFXA 2Z30A 3DEJA 2KI5A 2HMAA 2ZATA 3WJAA 5BOVA 4DC9A 1TYAE 4K9LA 1H93A 3WAJA 1DP4A 1T43A 1YMUA 2WKQA 4NBSA 2AVDA 5F2OA 1U9CA 1RNLA 2FG5A 2VDOB 4DCPA 3VYRB 1CP2A 3D5QA 2JGAA 2ATCA 3IDFA 2R4QA 3DT6A 1ZD4A 3VPAA 4OQQA 4RCYA 3JPWA 5DW0A 3HQ4O 3CS3A 1KI7A 2JC3A 2VZ8A 3JYQA 3K1ZA 1XRQA 5KYUA 2JFXA 4P80A 4A7PA 5CBKA 1O5OA 3PF8A 2Y05A 3RSSA 3Q7QA 3O9ZA 3BYZA 1GTSA 3L04A 2EFJA 4TTSA 5A4MS 4N7BA 2IYUA 2W70A 3DS8A 2YWRA 2R00C 2GTIA 1LF5A 2ON6A 1H23A 2AYZA 1AQJA 1NW7A 4AKTA 1JG6A 2JATA 1R0WA 1J7KA 2HIHA 2YV1A 4JLNA 3AKYA 4GLJA 1Z5GA 1Y9EA 3IVCA 5BMOA 4TRRA 2H0QA 3RHTA 2OXCA 4BLQA 4K03A 4Q4AB 2P1DA 2G1UA 1UJMA 1KVUA 4ZMRA 1I2BA 2BGLA 2H00A 3ZU3A 2F8TA 1D4OA 1K88A 4NU6A 3JD1A 5HRAA 3ZH2A 1MB9A 4UHJA 1DKUA 3AESB 2JH8A 1U2DA 3VTKA 3V8MA 4RPJA 3BZUA 2ZAMA 4BLRA 1JMKC 4HX5A 1K3TA 2GBLC 2FB9A 2PRKA 2OAGA 1S7GA 2JFOA 4AUMA 1JX6A 1MPXA 2JGJA 4FUQA 1OBVA 5EP4A 3A11A 6ADHA 3EIEA 4L72A 1V5WA 2H8GA 2PQ0A 2C77A 1IOWA 3N59A 4J0DA 2D06A 4PTLA 1N2EA 4BCCA 1EX6A 5HPYB 5M7EA 1EJ2A 1S3SA 3LGAA 1I3KA 1BS9A 1OW3B 4ZCMA 4GZLA 5IUNC 1KWKA 1V7PC 3M1IA 1V9SA 4I0WB 4X1OA 4BMDA 2Q8NA 2HU5A 1CTQA 1IZYA 2NZJA 1XD2B 3LJKA 1FNBA 3BM5A 1USWA 5TF0A 1G5IA 3AP2A 2NSDA 2YJGA 2R6DA 4OHBA 1QP8A 5T8KA 4WECA 1YC5A 4KXUA 3T41A 3KP1A 3WQQA 1OI2A 1YTUA 3IYLW 4HNQA 2G5PA 1AHHA 3NH9A 3CMCO 1WKCA 3TQFA 1JQBA 2FPPA 4J0JA 3RADC 3B82A 2HU8A 3ZWQA 5KTMA 3VR4A 4BKQA 4B3FX 5MFPA 3ZGLA 2I71A 1E0SA 4YMIA 5KVAA 3FBGA 4MAAA 1DJNA 2V7PA 4Q3EA 3VKWA 3NHAA 4R1PA 4B3RB 4B82A 3AVYA 1FFEA 1VHJA 2DFPA 2FSVA 3LC7O 3EUWA 3OKAA 4YJFB 1T9AA 2YUIA 2B98A 3NHPA 4I3GA 1SURA 1AXRA 1RE1A 1O8CA 2P78A 1G20E 3ZBTA 2UAGA 5K0BA 2DQSA 3E7XA 3R5KA 1UBEA 5BWOA 4M9SA 1C8KA 5EIFA 4ZYXA 1NIPA 5C5DA 1RI4A 5K6RA 1U7TA 4S1TA 3GMDA 2W0SA 1K1EA 2IXGA 5EAIA 1W36C 3NJRA 1JIIA 2PZJA 4RSHA 4EBBA 4C7BA 5JJ5A 2WJHA 3IUMA 3I8XA 4XRRA 2VDRB 3U7JA 4MP6A 2ENWA 4WNCA 3QXCA 4OIMA 1ZNWA 2R751 5JAHA 3QSYA 1I4LD 5KTRA 3OA0A 3BB4A 2HQRA 1Y6QA 3LA8A 4K7JA 4DA7A 4OB7A 2C98A 4BFUA 3EGWA 5EVCA 3OZAA 3QKRB 4QO7A 5BV8A 1Z4JA 3D64A 1I4EB 2I76A 2VWGA 1QOQB 4QULA 1LPSA 5EWMA 1WXHA 4I2NA 3GIDA 4CMAA 1EUCA 1XTJA 3GCDA 3FWPA 1HFEL 3RNLA 3ZNNA 1K6XA 2R6HA 3WBBA 5MN6A 5ALPA 1MG5A 1XO1A 1N4AA 3OBIA 3O8NA 4GKBA 3UHJA 2GM4A 1KEEA 5HS4A 3WOVA 4F1JA 4X3OA 4LHWA 2CVZA 3GMIA 4BMPB 1KAMA 5JRDS 1VMAA 2ZRGA 1M66A 3DE3X 4GOXA 1TQ2A 3I30X 4GDFA 5A2GA 1F3OA 3O90A 1FQOA 3TG8A 1H8HA 4CCYA 2X9VA 4RULA 2OENG 1M2NA 1NVEA 2LW7A 3WB0A 3K16A 2AC2A 3BOSA 1H8EA 4C7KA 4M2LA 3AEUB 1PV1A 1CEXA 3HB7A 3HG7A 3NO4A 1JG4A 1QFMA 3HKEB 4IJVA 2X8BA 1F2UA 3CEAA 4JASB 4KUGA 3GLIA 3ZN2A 2JGRA 1P5RA 3UTCA 1XLVA 3L7KA 1EQAA 1S3IA 4ID9A 3I2KA 4JQOA 1RXSA 3M3HA 2JIZA 4HVTA 4F4HA 4N12A 3PQFA 1NULA 2OR3A 1V3VA 1E5TA 2ZK7A 4PE5B 2XZLA 2EP7A 2NVBA 2XZDA 2RAPA 1MB0A 2VSOA 1VPTA 3WIVA 3UC9A 5FEUA 1M75A 5TVKA 2Y0CA 3SBOA 1WXDA 3MHPA 1D1PA 3D7MA 4AJHA 3HNPA 5FOVA 2GBPA 3MG9A 1CUWA 1PFVA 4Q37A 2B1QA 2V1XA 3TJMA 3HNOA 4BFXA 4ND8A 2DF8A 2BPOA 3PA8A 2IY8A 5I7HA 1QVZA 2QTLA 3QWAA 5DNUA 2GZMA 3F7TA 1RYHA 2C4TA 2VUTA 5C34B 3LH5A 2UYGA 1K8ZB 4J0GA 4MUYA 1XLTA 1RP7A 4RGVA 1FNSA 4LSMA 5AIAA 4UE3S 3RAEC 5FTKA 4KN6A 3QY0A 1I6KA 1RWBA 1RT9A 3OTOB 1FJGB 3HV0A 3ZQUA 4D25A 4KZPA 1WDKA 3CQ9A 4XD7A 1PWYE 1KAGA 2HO5A 2JFFA 2QVYX 3PXCX 1J0CA 3ROQA 1YR2A 4CM7A 4PZPA 4EI9A 3GJ7A 4GP7A 4OFWA 3DMDA 1GL6A 3OPMA 3CLRC 4GF5A 3D7KA 4JIGA 4YDSA 3ENNA 4IUCS 3R8XA 2XWPA 5AKXA 4Y2TA 5HS6A 2D54A 4JP8A 1HOTA 1ZD5A 1EB9A 3GW8A 3I6BA 3H99A 4OQNA 2PKCA 1XXHA 5DM0A 4F84A 5LOVF 2R7LA 4QPZA 1MC5A 2ZG6A 3ZWYA 2JGIA 3O93A 5FQOA 4IDHA 1SXJC 3JWEA 5J2UB 1GIAA 3NRJA 5JMOA 2NO7A 2AJ8A 1PTJA 1NU8A 4AN4A 1BMDA 1O95C 2YXBA 4JLVA 2GK3A 3COPA 4DNXA 4XVUA 3R23A 3MK31 5BO5A 1CUEA 1D5WA 4Q82A 3C3KA 4PV7A 1BA3A 2C92A 3SJZA 3IPLA 3ORHA 1CUHA 4KREA 1JH8A 3H7IA 3S2EA 4CEIA 2XITA 3AHCA 2ZJ4A 3IP8A 1VMKA 2YNMD 2W11A 4OGFA 4FHZA 4AAYA 4CKCA 4DYVA 4FP9A 3V48A 1Z4KA 3AINA 4UBJA 5KX5B 4XCXA 2JGDA 1RCTE 5BV7A 4JGGA 4YDHB 2NO6A 4U1RA 1OZGA 5J43A 5DLYA 2HKIA 1EA5A 4GX1A 1TJ4A 1CE8B 2OA0A 1V39A 3FPGA 3LP5A 4LBYA 3HJTA 5DB4A 1KFKB 1XTPA 3L49A 3PEUA 3CVVA 1KWGA 4P83A 3DLPX 4GI5A 1TVCA 1X1BA 4BJ6A 5EWJA 1VDZA 1XQ6A 3R7FA 2NTVA 1W36D 3A14A 5EIWA 3SIRA 1E2MA 2IXEA 1NW6A 1NYRA 1NUAA 3I1YA 1X8LA 2H5JA 4RBNA 3VAYA 3GC6A 4KZKA 4TMFA 4D98A 2PL3A 4YAUA 4KR6A 3I5YA 3OOYA 4A9AA 1AS0A 1HYGA 3DBRA 1CEEA 1OV6A 1DDGA 5K4AA 1KS9A 2DJ5A 3WLRA 5CDGA 2GJ9A 2WABA 1K6JA 2XUFA 5EHXA 3TSZA 3MOSA 3OZUA 4H60A 4PRYA 4YT4A 3IQZA 5REQB 4AJ2A 1QYXA 1XG5A 1DXYA 4G3XA 3TQOA 2Y1WA 4EO4A 1TF5A 1G63A 1UJ2A 5AVSA 3DQQA 3V4PB 2SNIE 2V6IA 3PXAA 1JPNA 1N9GB 2AWNA 5CVTA 1M2HA 4MDHA 1ULTA 3KJIA 3DHVA 4OHUA 1E0AA 2CMFA 1YK1A 5BPHA 5C35A 2DKFA 3K20A 5CBPB 3G8CA 3KKOA 1VCMA 2XE6A 3LOPA 3E5NA 4JL8A 2V5UA 5BVHB 4Q1EA 1SOMA 4QODA 4R7TA 2F43B 2WMYA 1UZLA 5AIBA 1F8UA 5JMWA 3PUXA 4Y2JA 3VTZA 1RZ3A 2G9RA 1Z13A 2RI6A 2YC4C 1V35A 1XCLA 2Q1YA 4KK4A 5DEOA 4BVKA 4N82A 4DVGA 4E5UA 5G0VA 1R64A 3MN1A 2DSTA 3SI7A 4UOEA 2I22A 1YKGA 4C5AA 5JALA 1ZLXA 1IY8A 4KYUA 1FOEB 2FPWA 2A59A 4UOZA 5C7OO 2XBMA 4YR7A 2PWPA 2Q50A 1ORIA 4URFA 3EZLA 1EVYA 4E1VA 5BV1A 2QPTA 2Q3JA 1E4VA 2VPWA 4HATA 1XZCA 2HF7A 4LCEA 1TLTA 4H3SA 5F4ZA 4ZT7A 3UHAA 4BQNA 4HEQA 1LNZA 1TA0A 3FFWA 5HEKA 4CF3A 3HCPA 4DHEA 3UV7A 1MH1A 4O1IA 2H4HA 3IAXA 3W9SA 1TAUA 1XMVA 1ZN8A 1CB7A 4H27A 5CDTA 1W76A 5FOWA 5GJVC 4MIEA 5ESDA 1FPQA 3AI2A 2CHEA 5L6LB 1K75A 4YV2A 2VF4X 4YO7A 5EKUA 1HQYE 1C3LA 3DKKA 5LUBA 3TQSA 5EUCA 1KRWA 3DAOA 1PS8A 4Y6RA 3K0SA 3QH4A 4MCJA 1P1HA 5BSRA 3PKIA 1HK7A 3QSGA 3FSJX 5COBA 4DMRA 1LJLA 2EOAA 3IODA 1RDFA 3KK0A 1KJWA 3R20A 5BT8A 5J63A 4AWBA 3GXBA 4O33A 1QF7A 3EVFA 3JW8A 1E3WA 4ARAA 2WC1A 2R8BA 1H2YA 2VSFA 4FWBA 1AOXA 3F2IA 4HAOA 3WK5A 3KX2A 5GVRA 2A9PA 4JHLA 4WZAE 5K3FA 2EKQA 3MT7A 1E3SA 4FMBB 3R7DA 4DKXA 3PWZA 4M0MA 3TIVA 3HLYA 3PUZA 4FCWA 3UATA 1KH2A 1GZ3A 2I1LA 2H3HA 2IZ7A 2X3UA 2W37A 3UWKA 1ZA2A 2X5OA 3IDSA 4HEJA 4OP1A 4WZBB 4C05A 1SXJD 1S2OA 2I4RA 4UEJA 5EXPA 3LMKA 3P9QA 2OYCA 1OLOA 5EG5A 5EP1A 1PJAA 1U3TA 3TDNA 3OSUA 4C7XA 5JQWA 1N5KA 2L17A 4MV0A 2WYHA 2PS0A 1ZKMA 1O95D 3E61A 4EFNA 2WT8A 2FSPA 4DZRA 2VYQA 3QGMA 2FEWB 1P5JA 3PCRB 4TXLA 3F73A 3U4MA 4B6RA 4H77A 5J9FA 4IDQA 1PZXA 3N2GB 4A8HA 3ID6C 4O2AF 5LZ9A 3TLMA 1LLUA 1RQNA 1N8SA 3I6IA 5JTTA 2NYAA 1Q57A 2RGRA 3ZGXA 4H18A 5MGNA 1XDBA 1L8QA 4NK4A 3CZPA 4LGVA 4Z51A 1A9RA 2ZYDA 4CL2A 5K8VA 5DSZA 1PGPA 1WKVA 1Q14A 1G9XA 2OMKA 3DE7X 4KBFA 3WQHA 1U28C 3M5DA 5EMLA 5A4DA 3GMTA 3G23A 2JL1A 1W2HA 4I3FA 4KAAA 3HUTA 5C8YF 1BA2A 2PTGA 3ANXA 4G0OA 3AR7A 3ZCVA 2QJRA 1QRAA 2XNCA 1FU4A 1QANA 4EK9A 4O4IB 1JHXA 2OQRA 2PRYA 1RRKA 3I8OA 3NBQA 4L27A 5DW3A 3KFLA 5A0FA 3I6MA 5JI2E 2ZIZA 2AFIA 2JH3A 1NC1A 1JEDA 3IIMA 1ZM2A 4DMMA 2ZJOA 1F9EA 3C15C 2PL9A 4AJJA 1DAKA 1H2EA 1PK7A 3B20A 4HYQA 3R75A 1FZTA 1VLVA 1BMTA 5CK5A 4CL0A 1GL3A 4M46A 1R6UA 3SG0A 3GIWA 4XGKA 3RJTA 4DLTA 5EZSA 3LZ6A 3RC1A 3HFRA 5E38A 3GLVA 3A05A 3TBHA 3ZHQA 4CKXA 2C2HA 1SB9A 1X94A 3GAAA 4PRLA 3RREA 4HVLA 2O8NA 1IPFA 3A4TA 2HDHA 3F71A 5HQ3B 1ECJA 1HL7A 3E4DA 4WV3A 3TTXA 2IEGA 1OROA 1W4AA 2FN3A 4D8TA 1U02A 4EYSA 1ZD3A 5GIOE 4HWRA 4DSUA 5JCOA 3CH5A 5LPNA 2BFMA 3SVLA 4XDZA 1UQTA 4QOHA 1WMFA 2ZB4A 3F3YA 3OURA 2J59A 5AOBA 3S68A 1UKEA 2QTHA 1WZ2A 2FWAA 2PLWA 1UPXA 1P6UA 3MWEB 3VR6H 3BREA 1G21B 2VDVE 3W8RA 1JHMA 4J1TA 1QG6A 1EK6A 5IHXA 2A5FA 2H2AA 2IYQA 1PR2A 4EYKA 2VXOA 2HJVA 3RS2A 1RTKA 2VP3A 4JK3A 1V8PA 2JLYA 1NJ5A 5KMGA 4X8OA 4D3DA 2R68A 4YRLA 5LMZA 2SBTA 4BQFA 1LWNA 3IEUA 3FPKA 4B32A 1NDQA 1Z07A 2VATA 2POCA 3HU5A 1WBBA 4ER5A 2VBCA 1JZSA 3JQBA 1BD4A 1KZGB 4RH1A 2VUIB 1ZA1A 2B35A 2ZYWX 1U99A 3UF0A 2FQXA 2FPGA 5L7YA 2K7ZA 3K1AB 3O4RA 5AVJA 1M34E 1LU9A 1M8PA 3B6MA 1C9KA 1N0IA 3KLBA 3L6DA 3S27A 1JSRA 3L4BA 2C0CA 4AT1A 1QU3A 3DMPA 1KEZA 3JAWB 2KWIA 3A6GA 2JRCA 2ZXEA 2P4SA 2IYXA 3KYCB 1KI6B 4MR9A 2Q62A 3FKSA 5KINB 4WBNA 1Z8HA 3LUHA 1Y3BE 2DHCA 2W9XA 4QJBA 2QI9F 1N3IA 4P5EA 2YW2A 2XVMA 3WZLA 3ICWA 3U3MA 3Q7SA 2D5CA 4WACA 3RIGA 3ZE8A 4JBWA 1LSUA 4DXAA 2Q3BA 3CX4A 3QNWA 3GRPA 5TPZA 1UAAA 1RQ7A 6LDHA 4MK4A 5BWLA 4OA5A 3NBZC 1UJBA 4MYTA 1DPFA 4PPYA 2XB8A 5LBIA 1U3DA 4KR0A 4G4JA 1ENZA 3BQNB 1MO6A 4B87A 3HN2A 2GA9A 1FU7A 1RM5A 4NX2A 2HGZA 2NN3C 4F56A 3ZD8A 2GM5A 3BXFA 4BUCA 2ZTVA 1SXGA 2X4GA 4B5LA 5F35A 1UMCA 2PR2A 1JQKA 4HDMB 3PITA 4J3FA 3KT3A 2HSDA 3KSMA 3VBCA 5TE9A 5JQGF 3B52X 3ZU2A 2EZ9A 4HJRA 2Y1DA 4JLSA 4F9GA 1CC1S 3F5FA 1EGQA 5ESXA 2C2XA 4GICA 3DLHA 2RFLA 1U1DA 3CISA 4IVQA 2BFFB 1N7HA 2WJAA 3ESZA 4OFXA 1RJEA 3IEMA 3WAGA 1NWHA 1N78A 3HSKA 3M4XA 2VP0A 1AKUA 1KAHA 5KQRA 1MU0A 4A8PA 2PUJA 4UFPA 3OZCA 1VI6A 4IHJB 4G0VA 1I32A 4J9VA 3Q10A 3FVVA 1P0PA 3HY4A 1XVIA 2J7PD 2GEKA 2FK7A 2QN6A 1PFUA 3Q7IA 4GZMA 3AF4A 1L4MA 1CQJA 1N5OX 4QFDA 2JS7A 1EP1B 3RROA 4WD3A 3UB2A 1SVUA 2V55B 5KHOC 1LBEA 4OK5A 3I23A 4MQUA 1IBKB 2XQFA 3AIKA 621PA 3V7FA 2PUEA 1U80A 4BO9A 2CLDX 4OLFA 2PVCA 3N76A 2OPBA 4OL0A 3GCXA 3JARA 4U5XA 1AO0A 5KOYA 3FUUA 4HWGA 4MLCA 2A0XA 1SWVA 1QTNA 3V4LA 1DO8A 1RXYA 2DWQA 4R0MA 5BP7A 2E5LB 1FDTA 1XZFA 2C03A 3F4BA 2D1TA 2FFRA 4HNAA 3GD5A 3KAQA 3L77A 3OFNA 1QGYA 3H4MA 5HOQA 1FP4A 1CUJA 2BOVA 3MAJA 3CG4A 5G1PA 2FE1A 3EASA 1KPGA 2H1WA 2ZITA 1FW6A 3JD2A 1BDMA 5AFSA 2DBYA 1VBNA 2ATIA 3C70A 1DRUA 3JYOA 3PTZA 1F2TB 3IUSA 5G02A 3SJAA 4GQBA 2BEVA 3LO5A 4N5DA 3TL6A 4MJXA 2QIPA 1UBGA 3FYCA 3NT4A 2WNIA 2VDWA 3DUFA 3JALB 2IZ5A 4S1PA 1MXFA 2QNBA 4R1QA 2IF2A 3EJWA 2VZ0A 2ZWIA 1PG5A 5EZ5A 1JFFA 3IMCA 5DRYA 3KYIB 3VX4A 3SJUA 1YFKA 2XA9A 1II8A 4HO1X 4CF4A 5KTTA 1JVBA 2A1UB 5CG1A 2OO5A 1NR1A 2ZRMA 3AJAA 3OKFA 4JBLA 2VA8A 2X7HA 3H3FA 1DX4A 1K0FA 1KGSA 1V0JA 1RRPA 1SBCA 3QPUA 4I4TB 3V2UA 4CF5A 4D9CA 2IOQA 5FDFA 1XKTA 4ON9A 1SU6A 2ZUDA 3I12A 5CK4A 4ZCRA 2P79A 2BF7A 4M8LA 5FXMA 1FX0B 2V7UA 2WA1A 5EE1A 2IJGX 5P8WA 1KVSA 2YHIB 4LFCB 4DPKA 2QP9X 2O2XA 4RMHA 3JR3A 3A6LA 2UZ0A 1X7HA 2XMRA 3II6X 4X5OA 1L5LA 3S2YA 5J3JA 1V2GA 1ZH4A 3T4EA 1N2HA 1EVZA 3R7WA 3ZHZA 1NLMA 3JWIA 3QLVC 3GLHA 3QVMA 1RLOA 2ZT5A 3TCNA 1LLCA 3KEGA 1DQZA 3WYEA 5B6IA 2GKGA 1ZSNA 4TZ0A 1L8OA 1H3FA 3W06A 3X43A 3ZI7A 2ZSUA 4L8GA 3OFVA 1VQ1A 4DQLA 3I45A 3LVBA 4H1HA 3M6UA 1JVSA 4KGXA 4OMUA 3W8FA 3ITDA 1WETA 1W29A 2YY6A 4TRNA 1ES9A 4EZIA 2P9JA 4RA9A 3K70B 2XQGA 1I2CA 3WHKA 5D6NA 4FPXA 1ONNA 4ZODA 2A4MA 5ISMA 2JAWA 5CB4B 4J91A 2J5KA 4MGIR 4Q1FA 4R8RA 1NUTA 1W44A 4H4EA 2XE8A 2GKSA 2HSZA 4D4GA 2WYVA 3EIXA 1TEZA 1XN1A 2QLNA 4FYXA 4IGFA 5FI1B 1DUIA 1LFAA 4RABA 3BGSA 3QBTA 1PZHA 1GPBA 3JYHA 4QPDA 3ZS8A 3DO6A 2JFHA 3ROMA 1XVLA 2NQ8A 4HTFB 5J47A 1YVEI 1TAQA 2OO7A 3STHA 3DVAB 3NRCA 4B2IA 2HPHA 1GCGA 4MQLA 1Z5NA 2PZKA 4ECEA 2IZOA 4ZIRA 3T9BA 1YJAA 1LQTA 1M2VB 1NIJA 2RHOA 3GROA 4QTUB 5DN6D 3LU1A 4PR3A 1TMOA 3COWA 4L4SA 3KM0A 1VM6A 5A5FA 2NZXA 3DKRA 2ZANA 521PA 2A9RA 3WB2A 3S81A 1AS3A 1OJ7A 4NE9A 2OYSA 1I7PA 1T34A 1XDZA 2IYZA 3GRKA 3W05A 5C37A 1B8UA 2VN8A 5DGXA 3IT0A 2GAOA 3JWPA 5K3DA 4EJ0A 2CW5A 3PDWA 3AXTA 4G25A 13PKA 1VSVA 5FULA 2AEFA 1NNEA 2P7HA 2WAXA 2EV9A 1YBVA 2IYSA 3MJEA 3TW4A 3L92A 3PDCA 4BLPA 1EM6A 3FPSA 4Q93A 2X2PA 2ZI4A 5SYNA 2M1ZA 4UZEA 3OM1A 4JL6A 4EAAA 1FUEA 1TUBB 2O3UA 3L8CA 1T6ZA 1E2PA 1P9NA 4KYTA 3KUCA 1MJFA 4WEQA 1EFHA 1ONOA 4I55B 1WUIS 3LF1A 1GUDA 1GZUA 4NESA 4LF9B 3RYCA 3RC7A 3UENA 4QXQA 1AQUA 1RZRA 3ESRA 3R8CA 1C3OB 2NXWA 3IV9A 3ND7A 3WKDA 5JRJA 2BFCB 1TJPB 2ZKLA 3GDWA 1OI7A 2QENA 3GBSA 4IIJB 2HA5A 3HKCA 3FSEA 1KI4A 4OK3A 3L6BA 2J0UB 2KE5A 4HAWA 5KYYA 1SCAA 4PZDA 3ZHCA 5HUHA 2YRFA 3D6JA 2SKDA 5CIQA 1J5EB 5IUKC 1F06A 1Z7YA 1IQUA 1U2RA 2XWBF 3PSHA 3EZNA 4ARZB 2NP7A 1TVKA 2X58A 2YVAA 2ZRJA 3OZBA 4A91A 1P3JA 1HTWA 1FMTA 4R81A 3FKJA 2MR5A 2FEOA 3JZFA 4ZYVA 1H2XA 3FOWA 3LBIA 4P3KA 2BIFA 4IHAA 5AVQA 2YKGA 1FSPA 4NOMA 3OOWA 2IU3A 3D8UA 3GDHA 1PR9A 1BAPA 3A1TA 2QN9A 3ZOKA 3H2KA 4DRYA 4HDNB 4N39A 4I5GA 5IARA 3UMJA 3EZYA 2CL0X 4H16A 5CM8B 3PXDA 3H6KA 1KMHA 3DT9A 1G8FA 5LKRA 1N6OA 5DBGA 5I9SA 2GNOA 1FE8A 4U39A 2OK8A 4DA0A 4MRPA 3OCVA 1I7DA 4L73A 2JFUA 4LRWA 4WTOA 1HLGA 3UOAB 3NOQA 4IG4A 1W85A 2ILVA 4QICA 2B9EA 1WBJB 2NU6B 3EDCA 4UXIA 4RKRA 2QM8A 3ITEA 4L15A 3VKUA 1DIHA 1DC3A 1RYZA 2XDYA 1HEUA 4J4HA 4DA9A 2I67A 2ZI6A 3QV1A 4U2DA 4BO7A 4L5CA 1WXXA 4KC0A 5JPCA 1UDRA 1NN3A 1QE3A 4WFIA 2FH5B 4JP1A 3DZGA 3H11A 2IYTA 2CSUA 3L7IA 3PEVA 4QTTB 3BRQA 4BFTA 1UXHA 3QUBA 3H2IA 4CL8A 1M73E 5COAA 3W2EA 1A9PA 3GZNA 1U1GA 2GRJA 3QVXA 5HA5A 4P2BA 1KQNA 1RBYA 1YSCA 2KS6A 2ZJ7A 3AQ4A 1M6VB 2QM0A 2XQIA 5C53B 1GQFA 2KMLA 2R6GA 3PC2A 4O4JB 3I3SR 4POAA 3F9IA 3OCZA 4N6OA 3T7IA 3TIIA 4QAQA 1WV1A 2Z43A 1NVGA 3MPUA 2NV2B 2DLCX 4RTQA 2V9PA 4ZO6A 1VB3A 2PUGA 5AW1A 3DDSA 4J0HA 3ZWVA 2MWMA 2WKRA 1E8NA 4J3JA 4O2BF 3VOTA 1XZLA 4DLWA 2H1VA 5FBRB 1J9ZA 5FNVF 1R8XA 3KTFA 4ZO8A 2QAGC 1WDWB 1SRQA 4L28A 2Q6IA 3ZIAD 4CXMA 2R6CA 3RJ5A 1RJWA 3Q7EA 2HJSA 3UJHA 5MGBA 1NLYA 2F3TA 3CW9A 3KKZA 3ZVRA 4BY9E 2GI4A 4IFTA 4MV3A 4J0EA 4FZ5A 4LKRA 5I9TA 1CYEA 1UOOA 2PV7A 3LT5A 4CODB 1OC4A 1P80A 3PHHA 4LZOA 3IOBA 3WO1A 1V16A 3DE5X 2XB6A 2IHKA 3LV8A 3FETA 4KDEA 4CNBA 2C8KA 1Z2DA 2Q2OA 3CVJA 4W9NC 4RMGA 3LCMA 4ZA2A 3KETA 2JLUA 4PC1A 5EQDA 1H9AA 4QGSA 4GQIA 5JDIA 3EEBA 1REQB 3UJ3X 2N9UA 4B8ZA 3AUKA 3P9NA 3QFCA 2VP6A 4UATA 4AYXA 4F91B 3LW7A 4YREA 5M29A 3SSAA 3A9TA 4NMWA 3BXPA 3HH8A 4B1FA 2PEZA 1HM5A 4L02A 2ZIXB 2YWXA 3ESDA 3MCTA 2DY1A 4DADA 2VS1A 2HIGA 3L1HA 2QMUA 2HV8A 1NBME 4HK4A 2G83A 1ZPDA 2CUKA 3F7NA 4Y67A 3CLHA 3ZKWA 4EW6A 3VDRA 4LTDA 4ZARA 1YA6A 5E1DA 2B4YA 2G8LA 2ZBVA 4CKWA 3JVIA 1RWQA 5EJIA 2E5FA 1UT5A 5ICEA 4UM8B 3X2FA 2FPXA 2BM9A 2P6OA 3IQHX 4HB3A 4U02A 3PIIA 1WZUA 4P3XA 8AT1A 4ARCA 5IABA 2P2SA 4FT2A 4DT1A 3HR7A 3G2NA 2WFLB 2RHBA 2W2OA 3JZIA 4ER0A 1OYWA 2IZ6A 3OO1A 4AKHA 2QL9A 1HURA 4ZOLF 4TMWA 4FFLA 3EEOA 2RK6A 2UUAB 1JIQA 4JUDX 2QTWB 3L41A 4MB6A 4HLDA 2CLKB 2HWXA 3X44A 2V98A 3W90A 2R0QC 4Q3AA 1IXKA 2CXUA 1FFCA 4YRBA 1T15A 4MA0A 5AHWA 3RWMB 1S9DA 5C3MA 4Y2XA 2FV8A 3EGCA 5GZ3A 5IZCC 5ELMA 2FUKA 1Z4MA 1E1CA 1EXVA 3HYRA 3PUYA 3TR0A 3AVUA 1TI7A 1E9EA 2BFEB 2H4FA 4KSYA 5IC6A 1IQPA 2RSLA 4EATA 3W5UA 5SYAA 5CB0A 2V1UA 3QOFA 1UCFA 4TVKA 3FLAA 5ALZA 5E9WA 3AKEA 4EKDA 3KPYA 1F4VA 3PNLA 2JAOA 2C7BA 2ZBGA 2N75A 4MV6A 3U3ZA 5KX5F 3HBFA 4YWJA 5HMLA 1CY2A 3F6CA 4LVOA 5H82A 3RIMA 3SC3A 4LXXA 4MDEA 2J09A 3SZLA 2X8JA 1UMDB 2BW0A 4I1YA 2BISA 3DOEA 1H0RA 5CVUA 3T5CA 2CXNA 1L1RA 4BO4A 2BRUA 4GWGA 5C1OA 2I29A 2P27A 1LUAA 1FFHA 3KB8A 4DIOA 5HKKD 1VI5A 3QM1A 1UC5B 4YJDA 2VPTA 1MN6A 3EFOA 3NH6A 1H1DA 5B4VA 4Q47A 2I8LA 2GVZC 2HPZA 3BTSA 4C6HA 3AMVA 2ASVA 4CNQA 1A4IA 3LS2A 2QN3A 4JT2A 3U13A 4D9FA 4EIWA 5FHRA 3OKPA 3R6DA 2WUFA 5ALRA 5IC4A 1K89A 1XZPA 1CVRA 1M0SA 3TOSA 2OESA 1W5BA 1QQBA 3TMYA 2GK7A 1GHTA 4PAMA 1EGAA 3EZ9A 3HJBA 2VJLA 3CURA 1Z4QA 4URXR 2F17A 5JZOA 3LNCA 2N3ZA 5DWQA 2Z3VA 3RYFB 5FLXA 3D3WB 2HA2A 4G2NA 1O6BA 1XTUA 3D7NA 4FYWA 4IYJA 1XDWA 4BZPA 2H48A 3PUHA 3BTOA 3E15A 1UWCA 4PGGA 4PYMA 4ZQFA 4WDQA 5AM0A 4JI8B 4M86A 4Q3CA 3W6OA 4DSZA 3R44A 1PGJA 3BMXA 2XYQA 1Z06A 1EE1A 1SULA 2Z9DA 4BMVA 1NFQA 4KYVA 4Q03A 1I5OA 1E63A 1HFKA 5IDWA 2NYRA 4X92A 1Z35A 2DH5A 2L42A 2CLSA 2FEAA 4E32A 1J4AA 5GVSA 1QH8A 4MCHA 2DPYA 4BATA 2HCFA 3Q7PA 5JXIA 1HDOA 4A5OA 1GQYA 3WMWA 1KSHA 4A16A 4TV9A 1H8HD 2RHMA 3O7MA 3L7AA 3PT9A 5C8XA 3KR1A 1OYVA 3LWNA 1BE6A 3TM5A 4ZGWA 3LI2A 1GN8A 1QHXA 3P0IA 4ZPJA 4O3MA 3CE6A 1NE2A 2WIJA 3IBFA 4UAGA 2D5LA 3KKKA 3M3DA 1XGKA 1X13A 3C5WP 3K0AA 1FRFS 4TV8B 4RIEA 5E4YA 2X4DA 3LWZA 1G42A 3VZPA 1XZMA 1BEUB 4ZCTA 3BGVA 1N1EA 1P77A 3MWGA 4RVGA 1SGWA 4A92A 3QIAA 5ARBA 2FETA 3GOHA 4XH9B 5IASA 1A9TA 2O05A 1QKKA 3TF5A 4RCVA 4NENA 5EIHA 1EFPB 4LSGA 4BYMA 2ZBFA 5JH7B 5K09A 5DTRA 3HB5X 3BIXA 2O07A 1RI3A 4R8KA 1KJ9A 4W5TA 1KU0A 4MRMA 5A3RA 2P90A 4W5JA 1ZD1A 2IUFA 3P94A 2FG6C 1EP3B 1EAMA 4RGQA 1JDJA 3O2SB 4QT4A 1YS1X 2Q45A 3WGVA 2SHKA 1RAEA 4PS1A 5AW5A 1ZN9A 2Q6LA 1KBZA 4IRUB 4ZO7A 2FLVA 3HUEA 4BQEA 2JANA 1P31A 4JC5A 1K4YA 1ACLA 3DLCA 2OM2A 3ZZMA 2OORC 1SIWA 2NPIA 2P65A 2H2IA 1Z5PA 3CZ4A 1T9HA 3JWGA 5HQTA 2X5JO 2YFHA 2QTNA 4NPAA 3IKMB 3STWA 3HBLA 3D2AA 1A71A 3HXQA 2UYHA 4KG7A 5CNKA 4LQCA 3WB9A 1QQAA 1X7DA 4YJ3A 1EFTA 5EHIA 4EPWA 4LDAA 1IMOA 4Q7EA 5BQ3A 3OQNA 1R6BX 1BXKA 3BHMA 4XD7D 4IJKA 4OJTA 1A9YA 3DOOA 3AIIA 1BW9B 3TCKA 2Y1FA 4ND1A 4C01A 1GNLA 1AMOA 3P1JA 3GGDA 2AJBA 4OGGA 5H1YA 3KZCA 1UBUS 4E2XA 4A5SA 3TQIA 4HNUA 3AVXA 1C7FA 5HMMA 3QPCA 5BMVB 1PHRA 4BP8A 3H8VA 3QX3A 4B81A 4RL6A 2LVBA 2VAVA 3DEYX 1U8FO 3A6HA 2PG3A 1E2HA 3N0VA 2REBA 3DDHA 1XBTA 5JC8A 3OQMA 3B60A 1GQRA 2OBXA 3AUYA 3B6JA 3H9GA 3O26A 2UU9B 4UVDA 2RBGA 5KTKA 3NTLA 3ROXA 4CKBA 3E84A 2YWDA 1Y3DE 2GWHA 5AH0A 1SWWA 1FFXA 2YQZA 4R1UA 1E1RD 1UK7A 4DCCA 1VG0B 5CFZA 2EBUA 3OQIB 2HDOA 1J0XO 4UC0A 5A6SA 4IV5A 3KTAB 3AERA 3L0IB 3OPVA 2Z83A 3I1FA 3LBNA 3V1MA 5JSUA 4LF7B 3R41A 5CJ2A 1M1XB 1QYWA 5IKPA 5IS2A 3DBOB 1YZFA 1YH3A 2PBZA 4IJUA 5LXTA 9ATCA 3HVHA 4M1MA 3IE1A 4O4IF 5H5JA 3TPZA 1U2ZA 1MMFB 3PX3A 4ZVLA 2XMZA 3D3KA 2FX3A 4OSOA 3SYLA 4KWIA 4G9EA 2HSWA 1BKSB 2V4MA 2C54A 4AZTA 1TEVA 4DSTA 1E9DA 4BZQA 2IHUA 1I1NA 4MKZA 1ESDA 2GLUA 4J43A 1C9JA 3G7SA 2YJNA 4Z1OA 3BSSA 2R65A 4AQYB 1YZNA 3ZJVA 3QU5A 1XKLA 5EMJA 4V0RA 1QHHA 2Q41A 2R7NA 5B53A 2O3JA 1CQXA 2O50A 4BCBA 1I0IA 1K66A 4G4GA 1DO2A 4QUIA 2GXUA 3MTAA 5B6PA 3C3PA 1KETA 1ZH8A 1YI1A 4KN8A 4JEUA 4PICA 4TL6A 3A26A 3H17A 5THXA 3G8AA 3KELA 2B8NA 5K01A 1XWIA 3HB4X 4I5DA 2P9FA 5EFZA 3L05A 5FQNA 3KSAC 1PV2A 1BVUA 4WN3A 3ZEIA 1FYDA 1YOVA 1G3UA 4A0FA 4H35A 1FDWA 3D9QX 4TLBA 5CA0F 4Q02A 3IEXA 2YIDA 5ES4B 7ADHA 4JLKA 3GT0A 5A9SB 1ZK0A 3B6KA 1WY7A 1L5HB 1DZ3A 1N6HA 2Q5LA 5EXXA 2RKBA 3UKDA 4KXMA 4OD0A 4FNOA 3OZTA 1ITZA 1KRHA 2DFNA 4K9PA 3TRHA 1X0VA 3BXXA 1XJ0A 5HKLA 2VYCA 2ZS9A 4X7MA 2OHFA 3IQXA 4NCAA 1Y5MA 3ZJ5A 4IKEA 1IVYA 1U9IA 1I80A 1P0CA 1G0NA 3A1EA 1UM9A 2EVWX 3EEIA 1ISHA 2XY4A 1ADGA 3H4VA 1N0HA 1E1YA 2WD7B 1RJDA 4FGKA 3SM9A 1XTZA 1EHCA 3QPAA 2GN6A 3IGFA 3LLSA 3IVXA 4L8FA 5CW2A 5DHUA 4QPNA 5I8ZA 2P67A 2X42A 1PHPA 3DE4X 2QTVA 1SOVA 1NNI1 2YRXA 4FVTA 1ZBQA 4J2OA 1KARA 5AXCA 2D6FA 2TMGA 4LWQA 1T5TA 1UKVY 3NBAA 3L7YA 1BDJA 4NECA 1MZVA 3B7GA 5HCIA 3U3OA 4AQDA 2PGLA 3MUEA 1Z0JA 3RJZA 3GK3A 4CUZA 1LDNA 4E70A 4AKGA 3KKQA 1IPHA 1WW3A 2NSLA 5DCUA 1NJ2A 3AVPA 1S8NA 4JR0A 1G291 4MW2A 3RRNA 2R8ZA 4BHTA 2C5LA 4C43A 3G7NA 5KJ6A 2FW8A 3W5VA 4MS1B 3X1DA 1AM4D 1VRWA 1P2DA 3GGGA 4WBSA 3GUCA 1JLMA 4NY1A 1A50B 1JEEA 4PSAA 3BRCA 3ICQB 1GRRA 4XIJA 3R24A 2DERA 2B8JA 3S1AB 2PCLA 4TUYB 4GI1A 1PEAA 1JR3E 2BELA 1XCMA 1U5AA 3UK7A 1ELOA 1ESEA 3RSQA 4DZTA 1PUXA 4NONA 3KBOA 2Z2YA 4QC2A 3H2JA 4DC1A 5M04A 3WWDA 3DWGA 2EP5A 4ZT3A 4Q6WA 3WHLA 4NMHA 1GGMA 3X1YA 3AFOA 3PXBA 3QHPA 4NEHB 4Q7MB 4AFNA 4F4IA 1Z15A 4M38A 5B1YA 1VHTA 3N2KB 3EZ6A 4LQLA 1DFHA 4IJQA 4XIIA 1K7YA 5GTDA 3PWSA 4DQ0A 4EHFA 3DV0B 1E89A 3G2MA 3AGQA 1C7ZA 3ETJA 2B5OA 3RG8A 3EEQA 2FZLA 3DFIA 1YCHA 3A04A 4EUSA 2VXBA 4ENQA 2PZ8A 1VXOA 4I6EA 1PZNA 2V9CA 4L9RA 2KBFA 3MLAA 5F9FA 3F5DA 3GELA 2XYGA 5J4KA 1X0XA 3PJRA 4HQFA 2FQYA 3AF0A 4UNIA 1DXOA 1NASA 4DWJA 4ZDIA 2ERCA 1IBMB 1GPYA 3UT6A 4EEKA 2ETVA 5AKIA 1R0RE 3BGDA 2PLRA 4W5HA 1U3VA 4D81A 4DUPA 1FRNA 4JLDA 1C8LA 1FUKA 4MUNA 1U7HA 3UHOA 1K86A 2CNDA 4L3OA 2MINB 1R15A 2HJWA 5K99A 3KUDA 1TQ4A 5L3ZA 2CCJA 5BWMA 3KDAA 2E4UA 3JASB 2IOYA 2IYWA 1P1IA 2C20A 4GD3Q 2GCNA 2C5GA 4PLVA 2D2FA 2PX6A 2WUDA 3BJMA 1G8SA 4ZEXA 1JSXA 4E4YA 5JC1A 2WV9A 1EPUA 4QOEA 3BMCA 1YT5A 2PU5A 4YUVA 2QAJA 5NULA 4TS9A 1JA1A 1F6BA 1NE7A 1DRJA 3PRHA 4UASA 4JB0A 4YLYA 2XKKA 4BB6A 1PEKE 3KR0A 1EVQA 1QS0A 2RC6A 3VC1A 5DTMA 1KAEA 1M7GA 1P19A 3WLEA 5BNWA 4NAVA 4R01A 3I5UA 5FF9A 1I3LA 4B17A 2IY9A 5K0FA 3H9BA 5LZ7A 3IERA 4NCKA 2APJA 1Y4AE 1IN8A 1LX7A 1YGYA 2I66A 3GV0A 5AESA 5HIKA 4RD6A 3E3MA 4ZRNA 3F5QA 3GT7A 4PAOA 1GXSB 3B13B 2C78A 4IGKA 3A1FA 3M49A 2HC9A 5DNAA 5HF6A 5IKXA 3VNBA 1U0OC 4M9CA 3K6SB 3R3SA 4FFOA 4LW8A 2GPWA 4QA9A 4ME6A 5GONB 2ZSBA 3EF3A 3O1HB 4C1NA 1CNFA 1YONA 3R3WA 2WHQA 5KNBD 3TL3A 1VIYA 3WLJA 1UBTS 2ZJ2A 4WFJA 4Z9YA 1ZIYA 1VYHA 3GFFA 4KNWA 4YX9A 1XQ9A 1XZNA 3ADDA 2G67A 8ABPA 1IRIA 4D8XA 3QX7A 2JZOA 1TVMA 3G1UA 3PFFA 4OM7A 2DVMA 5DHTA 2LDBA 4C2TA 1L7OA 3R6GA 4EYGA 2LBPA 4XOUA 2GK4A 4LC9A 4BNYA 4ETWA 3FZGA 4GO1A 5FWAA 3V46A 2XGOA 3WRXA 2B0JA 1VJCA 5HUQA 4DNOA 2DR2A 1D7AA 5IN4A 5KYXA 2CZCA 1MLDA 5ED4A 1ILWA 5DXAA 5CB4F 4UREA 1FU8A 3HWSA 1WABA 3GPBA 4UD6A 4Y9RA 3ZY4A 2WB4A 4JDUA 1N6PA 4WCFC 1JKFA 4DDKA 3HP7A 2AG6A 3JD3A 1HR0B 1M2KA 1AH2A 1E1QD 2EXXA 2HWWA 2QQGA 1FA9A 2EJWA 1E7SA 1WNTA 3OEWA 3D43A 1OXBB 3S3TA 1YQUA 3WDSA 2GERA 1LPOA 3KKPA 4G26A 1N7IA 4LYFA 5DHAA 2W6QA 1U0SY 2JCBA 5BSTA 1YKFA 3RV3A 4ID3A 3SKVA 1AB5A 3T3NA 3LE8A 4B7CA 3AR4A 2WU0A 2XI4A 1V8OA 4HAUA 4P31A 1HI9A 5F76A 1FZQA 4MWOA 4Y6LA 2W6OA 4LWPA 3O3CA 4JIMA 5JPIA 2W2MA 5G4KA 1I01A 4IDOA 3A1VA 4HRXA 4XFKA 3DAHA 2QIOA 4KH1A 2EW8A 3DOUA 2G4CA 2L69A 2P9HA 3HDHA 721PA 4E5NA 2AK3A 5FTJA 2VJKA 4W99A 3WQRA 5JZBA 1KEKA 1QLWA 3UT5A 3PNPA 3SJ7A 2ZOSA 5KNDH 1BXGA 1O9HA 2JHPA 2PO7A 4GBMA 5E8JA 1NV9A 3LT0A 3K2BA 4Q34A 3M2PA 3HU3A 1K7XB 4FN5A 4JYAB 1Y5LA 4I1RA 4KO1S 5CH8A 1FDUA 3OESA 1HETA 2FRXA 1E2KA 3KUUA 2QQEA 4TQUS 3C3XA 1UP6A 2AKEA 4JBHA 4XARA 2WYOA 2DAPA 1G20B 3IO5A 4MVJE 4Z0TA 1KE2A 4JYCA 1M33A 3H5OA 3LPCA 5DYWA 3FD8A 1P8AA 2WSYB 1J20A 4BNHA 3VDXA 3TGPA 4YUWA 4PCUA 1RMTA 3L82B 3P9SA 2V65A 3VDMA 3IKLA 4E15A 5B7GA 4RHCA 1VLQA 4JSTA 6REQA 3EGIA 1EM8B 3I0NA 5JEEA 1G60A 1VL5A 1AO3A 1Z74A 3INGA 1H5NA 1NVMB 1PP4A 1RCUA 4IUBS 4TPKA 3SBEA 2GASA 4IQ4A 4OH1A 2GJ8A 1H1LB 3SYMA 3U9LA 2BVNA 1IB6A 4NOKA 1JHUA 1U7UA 4JUAA 1CF2O 2VAMA 4MQEB 4PWYA 4RY9A 4R84A 4YUYA 1E6KA 1KI9A 4X93A 3V7UA 4DF3A 3E5HA 3VR2A 4RKYA 3Q1LA 4ZEWA 3QLUC 4WKBA 2FCRA 3F67A 3GVCA 4RVDA 1NUUA 5E7IA 3T1NA 3VC7A 4HUJA 3WOHA 2Z56A 3HJAA 4Z8YA 2Z9CA 3SK0A 3OTQA 3U48A 2HTFA 1PR3A 3OFJA 2BTQB 4PLPA 2I7CA 3ZLTA 3OFND 5FWYA 1LLQA 4N54A 2PUBA 2E82A 2ZB7A 2XA1A 3KVRA 1EHYA 5C8ZA 1VE1A 2IPNA 2UZIR 2VHEA 1KC3A 1U4SA 4H1WA 1E32A 4QG3A 3I62A 1R4NA 3TYXA 2W90A 1X74A 2WWXA 3L07A 3CRRA 4L5IA 4ZYZA 4MS4B 4M9RA 3TRFA 2CFCA 4KXLA 3RAGA 3THYB 1WPQA 3L0BA 2CLMB 3ROEA 3WWCA 2DTEA 2I7XA 2W6ID 1XD9A 4RHXA 5AJTA 2GD6A 1EK0A 4NFLA 4CTJA 1GUYA 3DXFA 2B25A 1QZXA 4ZZ1A 1IDOA 3AUXA 1YU9A 3LTNC 5HFAA 1W30A 4WOKA 4BO3A 2PCJA 3HBAA 2Z5GA 1K68A 5BRAA 2ZU0C 3RIXA 1SZPA 4ENVA 1RLJA 1C0IA 4B4VA 4FILA 4E5YA 3THWA 1U5BA 4UEKA 1NW4A 3HXKA 1IZ9A 1Q1AA 4JS0A 2VP2A 3PYXA 2NIPA 1OLSB 1S2GA 4CIWA 4NHEA 1LK5A 1YUNA 3QFTA 2X15A 2D0OB 1E7YA 4QGGA 4F12A 5IBCA 2JLQA 4Z86A 4DQDA 2WJVA 1DBVO 1J22A 4YT5A 1NM5C 2VTEA 3PYMA 4KWTA 4U4AA 1QTIA 3RTCA 3NJ8A 4LEIA 2B1GA 4Z9BA 3RU9A 2XHEA 3VGPA 2EBFX 3AEXA 3DZ8A 5EGNA 3MWDB 4F96A 5KU1A 4YUAA 4IJ6A 4YRMA 1Q92A 3TPCA 4QBHA 1S2IA 1BWSA 3UXMA 2Q0HA 1N2IA 2F48A 3I9OA 5CVDA 4ZT2A 4D0RA 1DIBA 4JGIA 1Z7BA 1PBNA 1YRQA 1DV2A 3DXXA 3ESYA 4D42A 1OFTA 1FUYB 5K3BA 4DDMA 5CAEA 1K63A 3N2NA 3JYNA 3HYSA 5FEMA 4EMUA 3QVOA 4PLHA 3EDQA 4F9FA 2ZUVA 2I34A 5E2IA 5I7OA 1ZRMA 4NEGA 2VYNA 3QHQA 5JAQA 4PYQA 1SCBA 2R1TA 3R7LA 3TZCA 4GX2A 1F4PA 2GEFA 3EXHA 1TGVA 2ZJYA 4IDFA 4W6ZA 2B6NA 2WEKA 5EYPA 1ZHHA 5AM5A 3ZDBA 3QYAA 3PT5A 4OAPA 4YMHA 1LC3A 4QXRA 1NY5A 4OB8A 3FNFA 5TXGA 2Z08A 1L7AA 1GAQA 3IVGA 4HGPA 1BHO1 3L9XA 3N0RA 1OPRA 1Y1SA 3AR5A 3PPWA 4C29A 5H8WA 1ISMA 4G41A 4FOSA 5EN4A 1A82A 3K6KA 3SCZA 1SM4A 2AI3A 5ECWA 2ZW9A 1EQUA 3I72A 3V3TA 2Q5JA 1CS4C 4KFCA 4K6CA 4MUHA 1OT3A 2NNWB 5LBTA 3P9KA 4BEBA 1IY1A 2QZ9A 1WZNA 2DB3A 4JN6B 2DFTA 1ADBA 3ET4A 5FYQA 1R88A 3HZOA 5EXTA 3W1EA 1M2OB 1LY1A 2OBFA 1ZK3A 2PV0A 1PSZA 3C6KA 4MYSA 1HLPA 1V6CA 3ECCA 1E9RA 1DLIA 3I01M 3LY5A 1DC8A 4FOTA 1Z5UA 3P9XA 5JBQA 4DKJA 2WWYA 3M6IA 4I66A 5JAZA 2JI9A 1OXVA 4AJEA 5EJGA 2QZ4A 2QBYB 3MTJA 4H31A 3GD7A 2OT3B 4Q15A 4B73A 3CXUA 2QW1A 1IN5A 2WWRA 1TQ8A 4LZJA 2C59A 3G2JA 4YCJA 3VU9A 2PX4A 2ODBA 3WP0A 1DFIA 4AECA 5JAIA 5KTOA 3FI9A 2CDRA 1Q74A 5TMBA 1E7RA 1J07A 1J09A 2I1WA 4OJQA 5D7BA 3SIWA 1HMYA 1TECE 3JZMA 2ZPUA 3KU1A 4E5SA 5A0VA 3KL2A 2FOLA 1SQ6A 3AWIA 1YK0A 4X1IA 5DYIA 2B83A 5LWQA 1NG1A 1T2AA 4GBJA 1GU1A 3VPFA 1RWMA 4RJTA 2BC9A 3DPUA 3A9WA 3PHBE 1TT5A 3WYNA 3D4BA 2IPLA 2CKDA 4FFRA 1CR2A 1H85A 2MTBA 5H9VA 1J23A 2C94A 3STUA 2QDXA 2ZYGA 2NXJA 3FHOA 2P8SA 3MS7A 3WHPA 3ZEAA 5HW0A 1V5IA 2DT8A 4G4IA 4OJNA 4UMDA 3AUJB 3MRTA 5E6RA 2AFVA 2G9QA 2FW7A 3LX6A 4ND4A 4IICA 4QLAA 4BZZA 2VTVA 4FS3A 3UN1A 3C6ZA 2QE7A 4Y2GA 2CE7A 3M70A 4GFDA 4AMYA 1WB5A 3OJWA 5DISB 1JJ7A 2C04A 2QU8A 5ALUA 4F2WA 3TLKA 3HUUA 1SUBA 1JU9A 3BJIC 2EZTA 3O8OA 2EC5A 5GV8A 2CFSA 1V8FA 3Q7TA 1SPXA 3AC0A 1QK3A 1XCGB 2WFMA 4DJEC 2Z1NA 3VJLA 4TN1A 4H4CA 4KI7A 2H31A 1G18A 1A4RA 2HCJB 1TOAA 1T5BA 5LOVA 1GP2A 3UJPA 3GO4A 3LLCA 3UG7A 4UTVA 3ZZNA 3SSOA 2W0MA 3EXEA 1S7CA 3H05A 4EY8A 4MWZA 1VL2A 1U1IA 3LP6A 3A1DA 3LYHA 4EYEA 1CF9A 4PLWA 4AC9A 4K6OA 3F8TA 3GH3A 4K86A 1TO1E 2QUIA 1EVLA 2E1RA 3KRTA 3UUWA 1IAQA 1ZRSA 1CQIA 2Y1KA 1Y5NA 2WWIA 2HBYA 1W49A 4L7QA 2WSBA 4AKIA 2WVAA 5LZ2A 1DBSA 5AKKA 2VJNA 3NVMB 5ADWA 4PXYA 8ADHA 3EVNA 2H3EA 5I4CA 4XEUA 5FTWA 3ZUPA 2XOKD 3F3MA 3SXUA 1Y1PA 5AM4A 3ZIUA 4R2MA 4S35A 1H3EA 4M83A 4AL4A 4S3MA 1US8A 4J2HA 1JDSA 1KJIA 4S2EA 1YMVA 3SEFA 4PM4A 3ABSB 4WZAB 3VPGA 4AP5A 1Q17A 4ZAFA 2YIJA 3AVTA 3E8XA 3DTVB 2ZTSA 3IO3A 3TIFA 1TYEB 4AZ0A 4QGHA 5LQRA 3RSCA 4D4KA 5JANA 1ZVVA 1T1RA 5E1MA 4YMWA 5CX1B 2O4CA 2IPAB 1X7WA 3OSZA 3NVKI 3PNOA 2H7XA 5C7IO 1VPVA 2OQIA 4TV8F 3RYIB 1JR4A 5LR6A 3K09C 4KMOA 3U60B 3DSRA 5DASA 5DHPA 3HA3A 2JJ1A 1R0XA 1KPIA 2RJNA 3IQGX 4H3HB 1D0SA 4BNNA 1NBMD 1Y80A 1DTWA 1OAOA 1X8KA 2WU3A 3G59A 3KQVA 1D2EA 3NC4A 2JFBA 1G4UR 4OA8A 1Z6XA 5KYKA 1JIKA 2NUBA 1ZJJA 2NVUB 3A4YA 1JE1A 1EE9A 2I6XA 3M4NA 2IUTA 5ALDA 4ZWNA 2W22A 3CVXA 2PS1A 1OJLA 3DZDA 4BVBA 1EESA 1EWRA 2C57A 2OE2A 1NUPA 4IX9A 2M32A 3FWYA 1GCOA 3GEEA 4C6SA 4CMGA 1TM2A 2EQ5A 2XSZA 2IBSA 2P5TB 1S2MA 2NUPA 2O8CA 1SBYA 4BNZA 1VMDA 3K0EA 3LXXA 4QQNA 4Y2HA 1SU7A 1FL9A 2AHRA 2I2XB 1X77A 1N75A 1PU2A 3DB2A 1SVNA 1W0JA 4FN4A 4YFVA 3QE4A 4DN6A 1ZNZA 1JG1A 5DBOA 3PQ5A 3OCWA 4QFMA 2O8DB 1HDIA 3NALA 2ZBEA 4BC0A 2R6JA 1W8IA 5A05A 3SZUA 3PD1A 4RM3A 5JS2A 1AXGA 5JMTA 1GNRA 4UU7A 3SVZA 4RFSB 3ZIDA 4PAGA 3KKNA 2C00A 4WMLA 4LHSA 4Y9TA 5AKJA 4RDXA 3AOEA 1JXQA 3FYUA 1CUYA 5IDVA 1PS9A 4FFSA 1V5FA 2E4WA 3FZEA 5K0SA 3JQAD 3A2LA 4PZZA 3JAMA 4BXOA 2RIRA 5D87A 1NSFA 1DE0A 4OI0A 3L5OA 1TIBA 4XQ0A 1MENA 2AI2A 2CLFB 5IT9A 1LA2A 1GA6A 2P5UA 2P2LA 3M4JA 2QSUA 2ZP1A 2QX8A 4FGSA 1C7IA 1R0LA 1Z6YA 3CX8A 1ONPA 3ACCA 2RJOA 4B8WA 4URWR 1FC0A 3THXA 2Q3EA 3F74A 4JBNA 4ZICA 4TYWA 2J1LA 3D6HA 3HPQA 1VG9B 1RBMA 1GV1A 1K4MA 2C82A 3WJ1A 1GM5A 2QN7A 4DR3B 2C0QA 5EJ5A 4KACA 5TNXA 5F5XA 4R68A 1E77A 1W46A 5JSZA 1KDPA 3DBLA 3VTAA 1T3HA 2RARA 2CL5A 5EWLA 5J5CA 3VR5D 4F86A 2A92A 5KDDA 3I6QA 1N92A 4WWHA 5GIPE 3M6XA 3N07A 2DUNA 2YXLA 1HNNA 3CRMA 1ZLYA 3BWCA 4MQFB 2OCXA 5C4MA 1GEEA 1QQTA 4US0R 4RLQA 3RFFA 1DBPA 1GDTA 2RH9B 3EVTA 4EFMA 1XAJA 2R1UA 1G19A 4LQDA 4B7UA 3FNEA 1NPDA 2YV4A 2XB4A 3MS2A 2OLJA 3H2SA 4RPCA 5C4IA 1MUUA 1WHTB 2E18A 3PDIA 4LRUA 1NBAA 4R9NA 3I2HA 1SJ9A 1XEXB 1G98A 1NYQA 2PPVA 2WBLC 3NHYA 4Z3KA 5CITA 5AW2A 4GH5A 3NMUF 1QYIA 4IM7A 3UO8B 3DO5A 3FJ1A 3VHXA 1LI7A 4L8WB 3FPAA 5ICMA 3BMOA 5TB5A 4DV5B 4MVJG 4O2AA 5ICCA 2FQQA 1NMSA 4KBGA 5IWCA 1TUIA 3JAKB 2FP3A 1YI0A 2J6HA 3U19A 2VQ6A 3E1SA 5LQNA 3BE5A 4KWEA 1EFLA 5EJ9A 2ECOA 3KB1A 1MABA 3G2KA 4NPHA 5FP0A 2AJCA 2FN7A 1UFQA 4GPEA 5EZ6B 3H0EA 4AO7A 1W5TA 1ST3A 1KP3A 1VGRA 3IXMA 5C8YA 4ZVPA 1UK8A 1EQ2A 2ODAA 2P9GA 3N05A 4DIKA 3PHCA 3QVGB 4R05A 1VG8A 4Z7JA 4CLDA 1K97A 1Z63A 5JQGA 4KQ1A 3W2TA 2HV9A 3OLCX 1P4JA 5JO9A 2PQ2A 3F97A 2OY0A 3IBYA 4HRAA 3TE7A 5JDCA 1DHRA 3AFHA 5FJIA 4UMEA 1PX2A 4C03A 2M9MA 4KFTA 2PXXA 4NBKA 2WILA 3EZXA 5DXFA 2V0GA 1AZTA 2J9ZB 3FF4A 2EGHA 2PJUA 1N25A 3M81A 4A36A 3D3QA 4I46A 1E79A 3D3NA 3DNPA 3NNDA 3RVJA 2ZLBA 2ZROA 2Q2NA 1T9GS 3I9NA 3H5RA 4Y2SA 1E5LA 4F4DA 5CFQA 4G8DA 3BH7A 4Q4HB 4GXQA 1DRWA 5FWNA 3CTMA 1RR6A 4XTCS 5HG0A 4EI8A 1SCQA 1M1NB 3ZCQA 2XNSA 5DZSA 2C4MA 2HA6A 4EJSA 3GNSA 1ODTC 4I4LA 1OI3A 3OVMA 1QU2A 2JBWA 1KFCB 2PD6A 3UJ7A 1LBSA 4PG5A 1JMVA 1XCPA 7MHTA 1KORA 2VHCA 2H7YA 4JNKA 3L7BA 3FNGA 3PGMA 4CHGA 3U7QB 4CMEC 1JKJA 2XUOA 4J7CA 1J1ZA 2BI8A 1I8TA 2VH5R 1CX9B 1K7SN 2I2WA 3QUAA 2YMPA 4QQRA 1TDJA 3CH7A 3I76A 4B84A 1CY7A 2DBZA 4L5YA 1SKMA 4CV1A 2EBHX 4OMDA 2V7EA 3BE4A 3IALA 4PC6A 3WL4A 4BWFB 3DWIA 5J58A 2OVFA 2IIBA 1E5XA 1OYOA 1SR8A 3AB8A 4NG4A 4QTYA 2CJXA 2O7RA 3KAKA 1QIGA 4RJLA 2E37A 2UUOA 4WGFA 2VKTA 3P4UA 4EG6A 1C8VB 3ZE0B 3G89A 3NCTA 3CEHA 4DRXA 1VSQA 1A7KA 4HN9A 3ZY6A 1T1EA 2NGRA 1ZJ6A 1VJGA 2QOEA 4KGZA 4RV5A 5KSYA 1KEUA 5INTA 2YRWA 4QBTA 5J1SB 5JWRA 3ONDA 5E4JA 1WPGA 1XZHA 3G9QA 1A9ZA 3MTBA 3OJCA 4QUJA 2E89A 3NTUA 1AV6A 1P45A 3LT1A 2OG1A 4II3A 4KE9A 5D84A 5AO9A 1YR6A 4U2FA 2VJOA 1O8BA 3RVLA 2CXQA 3DZBA 2AMVA 2CJPA 3A31A 4M9UA 2W8BA 5FTMA 2OQVA 1HE1C 1YWGO 4DM4A 4F38A 1D07A 4R8SA 4B7ZA 4WUTA 3HGTA 2NU7B 2I2DA 3SFTA 3EPLA 2VF5X 1XEFA 3KQTA 1MW9X 1KHHA 3C6QA 3B1WA 1XYVA 2IHVA 1QJ4A 3SIPA 3HO8A 2X77A 1NTRA 2GYYA 4LFAB 4UFNA 1W4CA 2XIQA 2NUAB 2YWGA 3MGBA 4YBZA 2RKOA 5TQVA 1P2TA 4W5OA 2P41A 3QE9Y 2PIAA 3VAAA 2GZRA 3WIOA 4EKIA 5K0NA 3VC3A 3WXMA 2VQ3A 3CLUC 2YYAA 3BTUA 4LJYA 1QAQA 1Z68A 1TJ5A 2G28A 4BO8A 5JS1A 1GN9A 1IEWA 2WINI 3EPPA 3ZV4A 3H1GA 1T8WA 1XZIA 4XGIA 2VHYA 3PWKA 3WO0A 1EH5A 2FZCA 4QQ8A 3CZMA 4HXFB 2LTAA 3KLNA 5DK6A 2H4YA 3V4FA 2P9CA 5TLSA 4ZAXA 5JCJA 4TKLA 1P1RA 2FZ4A 3DD1A 1WEHA 3ND8A 4I99A 4IKPA 4HEA6 1ESMA 4X1YA 2JI7A 2V7GA 3HMQA 4R1OA 1NXXA 3Q2OA 3WLOA 3AETA 4DWVA 1WM1A 4QE3A 2B0CA 4CV3A 2QT0A 1ZVMA 3MBOA 3ESAA 4UZSA 2H1IA 3ZU4A 2DM6A 4H7HA 2A1TS 4IV8A 1MFPA 4K1XA 4WCFB 3VPSA 5DI3B 1VKOA 5AW9A 3T8YA 1NMYA 4CN9A 1H2FA 1MIHA 3A9RA 1AG9A 2CLCX 2WF6A 3EXFB 1RQRA 1I5EA 1TPYA 2Q49A 3B2NA 5D00A 4MUEA 4L3WA 2BMFA 2A84A 4YAKA 1UAYA 1E96A 4Z0PA 5KOHA 1NOIA 4IHQA 1MRNA 1UJCA 2ZKIA 2GESA 1T0HB 3I9V1 1N5IA 1KO7A 3LUAA 5CLJA 1P7WA 4FFPA 5FFNA 3ZTTA 5TARA 4DQUA 4IOMA 5E4TA 5FUBA 1B26A 1MDFA 4LI0A 4NFSA 4YRIA 2Q21A 4V03A 3D2BA 3PR1A 3STYA 2GA8A 4IOJA 3D8SA 3F8WA 1BFDA 1TT7A 3TLGA 3FRJA 3ZJYA 1IMJA 1Q1ZA 5J4LA 4A2QA 3GLHE 3ZWWA 4G1MB 4CM8B 2O2GA 4C7OA 5IXSA 1TQHA 5F21A 2V6FA 3N58A 5C8DA 1N7JA 3GVHA 3FTCA 1CUDA 1QOZA 5D86A 3LO8A 1QH1A 2LKCA 2A0WA 3KWJA 3NUGA 4LMRA 3Q3GE 4UM7A 4MA4A 2QY9A 2CNWA 2WP0A 1LW7A 2WWTA 4TWAA 2JFYA 3EAQA 1NC3A 5I48A 7AT1A 1DNPA 1T9CA 1QCYA 1EXMA 4J6FA 1SQFA 1Y1QA 1I7NA 4RHEA 4RMIA 1MVOA 4AROA 4YCLA 5AQ1A 1QO0A 1N1GA 1NMQA 3RVSA 3SHTA 3PDJA 4DBZA 3DDOA 4B46A 3DLTA 3TBFA 5CEEA 4A6DA 2ZYIA 1JR3D 1X1TA 4BLSA 2AXPA 3OX2A 1PL8A 3QF4B 1J42A 1BDBA 1V3QE 1W73A 3F9RA 4Y8VA 5ALFA 1YBHA 1QH9A 4UQPA 3FMPB 3QP9A 4PFSA 4MPTA 4MWBA 4TLEA 4PANA 5HCUA 4F3TA 2XNKA 1UXIA 2GLTA 2P6NA 3NEAA 3QOWA 5HR5A 4GXRA 4OMCA 4FX2A 4QPCA 1KHTA 2NZ8A 2VK1A 4QATA 4N0QA 1NKSA 2IH5A 1MAAA 1IG0A 2UVPA 5LLTA 2B4RO 3K0CC 4L78A 5IM4F 3VZCA 3HY3A 1E1DA 5BSGA 1N2SA 1RRFA 1BDIA 1NYTA 3CLSD 3VPCA 3VO2A 1D5CA 1ORDA 1P2BA 4KQCA 3CLKA 1B76A 5F7XA 2JGLA 3KT6A 5A7FA 4XQGA 1DOAA 4S1VA 3R5HA 3RQSA 2O0LA 1LRJA 4OX9B 4CEHB 3EDMA 4KWHA 2YBEA 1E1KA 4UVIA 4M0FA 3DMNA 3G0DA 2CNKA 3C5CA 1P4RA 2XBUA 1EUDB 4CTMA 1L7PA 2NO4A 3O94A 1NBOA 4GYKA 4CQMA 1DCKA 3ETDA 2O2SA 4QXOA 4XSHA 1Z2CA 1Z17A 3GA7A 4U6QA 1Y6RA 2CUZA 3JVEA 4U7PB 1ZO8A 5E7JA 2IV2X 1HDEA 1JSCA 3PRJA 1TZCA 3I53A 1W5EA 4FQ8A 2XZTA 3D31A 5IVHA 1GOTA 3KU4A 1NQWA 2IHJA 4AUEA 4V1CI 2ZRNA 5JY1A 1CUUA 1XLWA 3RKUA 4BNJA 3W7BA 3BUSA 1GG5A 1P75A 3HEBA 3HN7A 3OD1A 4B4UA 5IH7A 1C41A 1FTGA 4LECA 4D9GA 5FBVB 2X2EA 3Q4GA 4Z3DA 4I50F 3GUZA 3CLUD 5JI3E 4GVLA 4ZMBA 4M1OA 3FCUB 1GPJA 4W7SA 3WRYA 1SHZA 3P4YA 4R1MA 4BNDA 4M6WA 4LYAA 4X84A 3BDAA 4KQ6A 4MYUA 4R9SA 5BN5B 2I4IA 3UWSA 4HZIA 2BUAA 5F33A 1SBZA 3E2IA 1UBSB 1XZDA 4O29A 2D7DA 4RHUA 2IU6A 3KQQA 3LSTA 4K6KA 4WIAA 4C0AC 3T0GA 3T7EA 3FAZA 2O8BB 2XW6A 4HSEA 1JSLA 4C2AA 2H7CA 4YT2A 1WU8A 2EIXA 2X6TA 4W82A 5BYKA 1AC5A 1N6KA 1UWVA 2HLPA 3RK1A 1EDBA 3S2GA 1KVQA 1G7CA 4KR3A 4NV3A 1RPAA 2JEZA 3IL2A 1HO3A 1R5BA 1RJ9B 4P22A 1HNZB 5DDIP 2Z4TA 2P35A 3FF1A 3CO5A 3IMGA 4W8GA 3FOAA 1ZINA 2CT8A 2AE2A 4CCWA 3L8DA 2CZGA 1W581 2C3YA 1SXIA 4REMA 1L3IA 1QIJA 4TSFA 2QU7A 3DZHA 5JVDB 4E33A 3IFSA 5DNCA 4JI0B 3OJFA 1CIJA 3NGLA 2OB2A 2X86A 3OU6A 1KI8A 3FZQA 3D8RA 3PGXA 4WK4B 3W9UA 3WAKA 3E22B 3UXHA 2PE5A 2E21A 2ET6A 1XD2A 3CF6R 3TLJA 3BA1A 3N6VA 3OLQA 2GEJA 5JS6A 1C14A 5ER9A 4B9AA 3L0PA 1N5LA 2E4VA 4HAZA 1Z0FA 3N28A 2O8CB 1FDOA 1KYVA 4Q9KA 3EMVA 1BEEA 4S0ZA 2KBEA 5C18A 4QYWA 1H2RS 1GY8A 1G8YA 2HXGA 2I4MA 3NTXA 4N3BA 2INGX 3UKJA 5A03A 5MDHA 3V1LA 4QDXA 3B36A 5BW6B 3V5NA 1B93A 4WOCA 1CVLA 1KO1A 4B6SA 4D4IA 3BD7A 4O1HA 4OXXA 4E51A 2QMQA 4GKKB 1JAHA 3NGMA 2WJ3A 1KRXA 1R6VA 5KSZA 3IRUA 4WLVA 4UMVA 4BNVA 4U7DA 2I3AA 2PT7A 1YQDA 4W1PA 4EEZA 1PDWA 2FPIB 2GARA 2ID9A 1OASA 2W6JA 2ZI3A 4PSUA 3QPVA 2FPMA 4YMSA 4ZV7A 1HFJA 2PKXA 5AK6A 1VP3A 3D1VA 4ER6A 3HJRA 2AJLI 1QXSA 4Z99A 4EY7A 5IJ9B 4FOPA 1OGYA 1W0KD 2D13A 1AN9A 3EVEA 3O8QA 1VSBA 2WIKA 4HDQB 3RE1A 1UDAA 4FSXA 2II6A 5ABPA 4YP1A 3GGCA 3JPYA 2J07A 2QL7A 1P6XA 1Q16A 5EIOA 1JFRA 1D4ZA 1XPJA 2ZWMA 4JOCA 4REQB 4BVFA 1QCCA 1YR3A 3JQAB 1VE6A 1OXMA 3ZWDA 2QS9A 4L0DA 3BICA 1PFYA 1G4AE 1IHYA 2IW1A 4MUGA 4BN4A 3TQCA 3ESBA 1XQWA 2GBIA 4PGMA 2HXYA 3SX4A 4HQRA 2QP4A 3PC4A 5EJMA 2X2FA 3N8HA 5G3YA 2HA7A 1FVFA 1WZIA 2W6PA 4BGVA 2HPAA 3GAFA 5HK8A 4EZEA 4RTNA 1UPBA 4O2BA 3EXAA 4CT5A 2OKCA 3LQQA 2AUTA 2LKDA 3P2EA 3FUWA 2XXBA 5AP9A 1ZONA 5FNVA 3UUGA 3VPXA 4EGFA 1AQIA 4INPA 1IU9A 5FIUA 1N77A 2N0SA 1QJCA 4K9OA 5KVQA 3W9YA 4EHJA 1YJ8A 3HKEA 4PS0A 4E31A 5CCBA 4EITA 5JV5A 1SG0A 4GSLA 3RW9A 3VAZA 3FLBA 3R9XA 2IHBA 3LKVA 1BWPA 2PZAA 4DXHA 3VC2A 4ZVOA 5IG2A 3HRIA 2LCIA 1ZMRA 1JBQA 2WUGA 4YN3A 1QVRA 4CKEA 2CXSA 4WJLA 3NEPX 2A94A 4D8VA 2ARKA 1CG6A 2CMGA 4KTTE 2TRSB 1PNOA 4QVGA 3ELUA 2HL6A 1VGVA 1ZU5A 1P4GA 2I6QA 1XCOA 2SICE 5ESWA 4CMIB 1CZNA 3NUZA 1GFWA 2OGZA 4C76A 5FBZA 2B82A 1Y1TA 3KJEA 2IZ1A 1PNVA 2BJVA 1T8TA 3QVTA 2DEUA 1NXPA 2I3BA 3GJXC 2NSJA 3IP3A 3WC4A 3WNBA 1A2QA 1M8KA 1T36B 2I2FA 2CVQA 3L40A 4WOPA 1DAGA 1YJXA 3UCXA 3M9WA 3S70A 1QV9A 5KZMB 3HFGA 3WGTA 4KVGA 1OH7A 1AY0A 5HDQA 5HP4A 3QTBA 3WV5A 4FX5A 1DKOA 3V32A 3VR2D 1RW4A 1YVDA 4KPFC 1VZ2A 2AMYA 3HA5A 3PQ4A 4QXAA 4PXSA 1CZLA 1C1YA 5EQTA 1L1QA 2LCQA 2RGBA 2QRQA 2VHVA 4H6XA 4JB8A 5AD1A 4KXWA 3PR3A 1PJBA 1P7PA 2BH9A 2R1ZA 3RK4A 2F2TA 4RCZA 1NLFA 1DKLA 4PSKA 3T5PA 1KMCA 4R9UC 4AF7A 4P7KA 1I94B 1TKRA 3LUDA 3CZ5A 5JIBA 1VPLA 4JWKA 4GL2A 5LA6F 3IT3A 5IT4A 1MORA 1YCGA 1F0NA 1WPXA 1VE9A 1Z8FA 2FVYA 2YQ5A 1GPH1 1ESZA 3P2JA 4QELA 2OZKA 4OGKA 3T34A 4RTLA 2NPFA 3UV3A 5KTSA 4LGYA 1U04A 1YF3A 4A6EA 2Q7DA 3BE8A 2BMAA 2Q3MA 2WHYA 4ERNA 1XR3A 3NHFA 2YZ2A 1BXZA 4KFSA 4P3NA 5I7UA 1KU6A 3B9RA 1OVGA 5CT9A 1C1XB 4ZI5A 3S2SA 3S5JA 3AF6A 4C2UA 3EMDA 4OMFG 5C4GB 4BNFA 1MTOA 2Z2XA 3LUFA 1FYWA 1EP2B 1XTRA 3QKSA 2PUDA 1RHUA 2ZYHA 2O7NA 3B6IA 1TVEA 3C8DA 3PFGA 3TW6A 4EJFA 3HBNA 1T1JA 1KYWA 2OHOA 4NDNE 1CK4A 4OQLA 4FXOA 1NUQA 3DR5A 1TK9A 1MHTA 3B7PA 3GLUA 4S1OA 3X3HA 4UJ3A 2PBFA 1Q6YA 2F62A 5K03A 5KX5A 3BJZA 1HV8A 2EL7A 2JH9A 4W9MC 2WUEA 4XR9A 5C32A 1KMIY 3CSDA 4LRTB 3T1VA 3KV3O 4ENWA 1U2GC 2J32A 2QSYA 1X14A 1TD9A 3EARA 3QFSA 1RTTA 2LR0A 5FFFA 3C6MA 4EA9A 1AT1A 1X70A 4CW7A 5IAAA 4OHXA 1KZ1A 3BWXA 1E62A 3COSA 1VI2A 2B3DA 4QM6A 5ER6A 3OF2A 4JBXA 4BQSA 1F8YA 3INRA 3P2MA 3PQDA 4KOAA 4D74A 2I3ZA 3CJQA 3CONA 1VCIA 1W9HA 1XMIA 2OOSA 3KXPA 4L22A 2QRGA 4ZAYA 5A9TA 2FRDC 1RLIA 3BEOA 4X6YA 3UWDA 5E3HA 4PYKA 4P34A 1I13A 3ENZA 1P61B 2VTBB 5HZGA 1HE5A 3GZTB 4FDUA 2IELA 3GLGE 2GHTA 2A2ZA 5K7SA 2JASA 4LMBA 4Q1CA 3J7AC 1KI1A 2G40A 4KK3A 3WLTA 5L45A 1IUOA 1AKRA 3LSYA 4LZNA 5EHNA 1VBKA 1WCIB 1JEQA 2O1XA 5REQA 4DOMA 4EY5A 3O8RA 1ZESA 3N0TA 5JXGA 2XUQA 3IMFA 1K5DA 3HDYA 1N9GA 1TMYA 2F9FA 3U26A 2VTKA 1VHQA 3VVMA 3GJZA 4UAVA 4AIIA 4BO6A 4GZ6A 1FRVA 4LRYA 2FW9A 4QOIA 3ZBQA 1ARZA 3CT4A 3E18A 5EZYB 9LDBA 4QBGB 1COWD 2GPNA 3DMTC 4NJMB 1G59A