2Z9CA

The crystal structure of azor (azoreductase) from escherichia coli: azor in complex with dicoumarol
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
200
structure length
197
Chain Sequence
SKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALRAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expansion of Substrate Specificity and Catalytic Mechanism of Azoreductase by X-ray Crystallography and Site-directed Mutagenesis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords FMN-dependent NADH-azoreductase
total genus 74
structure length 197
sequence length 200
ec nomenclature ec 1.7.1.6: Azobenzene reductase.
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2z9cA00
1JA1A 2D5IA 2HNBA 2HNAA 4C0WA 1AKTA 1QR2A 3B6JA 5F4BA 1FLDA 4R81A 1C7FA 3F2VA 3NHRA 1CZKA 3KEGA 3OJWA 2OYSA 1T5BA 3NHFA 4GI5A 3ESZA 4YAUA 4N9QA 2MTBA 4H6PA 4QOGA 1YOBA 1NNI1 3OJXA 4C76A 4NLLA 2XOEA 1CZLA 1F4PA 1FLVA 2QX9A 4OXXA 3S2YA 5FUQA 5LJIA 1KBQA 3FJOA 4U7FA 5BUCA 2Z98A 1CZNA 1J8QA 1SG0A 4BMOB 4ESEA 1DX9A 5NULA 4C14A 1AKWA 1J9GA 3NHWA 3UXHA 2AMJA 1AZLA 1OFVA 2A5LA 1AKUA 1E5DA 3OX3A 1J9ZA 1D4AA 2M6RA 4XDGA 3B6IA 2QX4A 3FX2A 3NFRA 5ULLA 4DIKA 2OHJA 1FLAA 3TEMA 2FZ5A 2BF4A 4M0CA 4QOHA 1AKVA 2RG1A 2V5UA 3FVWA 1OBOA 2QWXA 1ZWLA 3KAPA 4GR9A 4QOEA 1RLJA 1YKGA 4U7HA 3R6WA 2V5VA 3OVMA 6NULA 1H66A 2MOKA 4N82A 1OBVA 1YRHA 3G5MA 4Y9RA 4FGLA 2FOXA 2BPOA 3EDOA 1CZUA 4YALA 4ZVLA 4QODA 3RPEA 3UXEA 3W77A 2F1OA 2MT9A 1XYYA 2FDXA 4U7GA 3HA2A 3TE7A 2OHHA 5NLLA 4H2DA 1QHEA 5FA6A 1XT6A 2QR2A 2QX8A 4PTYA 3FNIA 4DY4A 1GG5A 1D04A 1ZX1A 3N3BC 4YQEA 4F8YA 3ESYA 3KLBA 1FLNA 2Q62A 3TZBA 1T0IA 3U7IA 1J9EA 4J8PA 3W78A 5B3KA 2HPVA 1FVXA 1QRDA 2B3DA 2FAXA 2Z9DA 1RCFA 1DXQA 2X2OA 3NHKA 4LTNA 5LJLA 1TIKA 2MWMA 3GFRA 3HLYA 3NLLA 4ZVMA 2XODA 5F12A 3B6KA 4XDHA 3D7NA 3O73A 4FX2A 4FGJA 1FTGA 3HR4A 1AG9A 1D03A 2V9CA 3NHYA 2BN4A 4Y7CA 1YCGA 3B6MA 3LT5A 1CZRA 3NHUA 4DILA 4YAWA 5EA2A 3NHLA 1AKRA 4CETA 1B1CA 3F6RA 3L9WA 2Q9UA 3NHSA 4QOIA 4YAOA 2X2PA 2GSWA 2FZVA 1RTTA 4LTDA 5LMCA 2FX2A 2Z9BA 4LTMA 1AMOA 1FX1A 2M6SA 3QE2A 3GFSA 3O2NA 3QFCA 5LBUA 2BZSA 5F51A 3ZHOA 3K1YA 4NULA 5JROA 3ES9A 1JA0A 1TLLA 1AHNA 2QMYA 3LCMA 3N3AC 1RLIA 1FUEA 2N1MA 3OWHA 3QFRA 3W79A 4CF6A 3F90A 4N65A 1C7EA 3OX2A 2KLBA 3K20A 5EMNA 4ICIA 3KAQA 1YCFA 2FCRA 4GQIA 2FLVA 1X77A 3OX1A 2R97A 3EYWA 4LA4A 4Y9UA 1SQSA 3SVLA 4FGKA 2BMVA 2QX6A 3NHJA 1I1OA 3P0RA 5B3LA 2QMZA 4BMPB 4HS4A 5FX2A 2OHIA 2R96A 5LVAA 1WSBA 3NHPA 5LBTA 2Z9CA 2ARKA 1H69A 2WC1A 1ZWKA 3GFQA 4D02A 4LAFA 3N39C 4PTZA 5LLDA 3L9XA 1KBOA 3F6SA 1VMEA 1XI2A 3OWXA 1XYVA 1WSWA 3JSXA 1BVYF 1CZHA 3FW1A 2KQUA 5TGZA 1BU5A 4C0XA 1AKQA 4ZVKA 1V4BA 4QOJA 5A4KA 3U7RA 4PU0A 1YDGA 4QOFA 4ZVNA 3W7AA 1DXOA 4S24A 2FVXA 4YAFA 5EAIA 1YCHA 3ESXA 3GAMA 4HEQA 1CZOA 2ZKIA 2W5UA 1QBGA
chains in the Genus database with same CATH superfamily
2PL3A 4GAEA 2I22A 2NM0A 2QJWA 3INYA 1BXZA 5CH3A 3ZHTA 3D8NA 3LO8A 4WH0A 4IDDA 3Q8KA 1O77A 1QYDA 4ZVPA 2HADA 3O75A 1HMPA 4OOEA 1LVUA 4MVJG 5IUJC 2VBCA 3K15A 1Z2AA 3PPXA 3FI0A 5T4FA 1LDBA 2H16A 1R8QA 3S55A 3QKSA 1M6EX 3GBVA 4IOMA 5J4VA 3TLGB 5CH5A 3MWKA 4X1YA 3LX5A 4IDQA 4IQFA 1W0CA 2ORED 4P2GA 2PLWA 3C3BA 2ZRNA 4GF5A 4CUJA 1CJTC 4DLKA 4G8JA 4NVRA 3TOVA 5IF3A 2BBWA 1CY8A 4RVUA 4X61A 4MRPA 3W3AA 1NXPA 3TTSA 2PSJA 1RIFA 2Y93A 2QTVB 4QFDA 1J07A 4HY3A 5KS2A 1XZPA 3AO0B 1T5DX 2A6PA 1CY4A 2CNWD 4QXAA 1W4LA 3TIGA 1K8YB 4PY2A 1C41A 4HNQA 1AM4D 1R0ZA 1WZNA 1GNQA 3T9DA 1DKNA 5ALZA 3UXEA 3VC3A 1BWPA 1XALA 2H5IA 2B9VA 2AW5A 2VC2B 3FKQA 3KSDO 1TAHA 1CJSA 3ASVA 4EGSA 1XT6A 5F98A 4L22A 1F6BA 3OJEA 2PUCA 1FFDA 4MCIA 3AHGA 1YUMA 4O4LA 1DI0A 1UIRA 1QVWA 1ST2A 1WPGA 4N3AA 1M1YA 3UM9A 2NO4A 2DPXA 4L5YA 3GEDA 2Q6OA 3DXFA 1WTCA 4TL7A 4X7RA 2AMFA 1T8WA 2VHUA 1JIJA 1G4UR 1TKCA 2HHLA 3ENQA 3KEFA 3BTOA 5F35A 2DXIA 2RGCA 1T34A 1BG6A 2RHRA 1JU3A 3ZXXA 3NT2A 4BFZA 3NHUA 2HZBA 4HDQB 1UPAA 1Z0IA 5HCNA 3EXG2 3ZHUA 4LVOA 3BD6A 2FZWA 5M29A 3A06A 2NAPA 3NDJA 3ACBA 4NZNA 5T7BA 2JJ2D 5B6JA 2B4QA 3LV8A 4BVFA 3ZLVA 1V37A 5FLKA 5IC6A 3V8RA 1SMKA 5K01A 1AHNA 2FUG6 3DQPA 1N1DA 3KL4A 3Q40A 1LQ2A 3SJBA 3D2LA 3AIKA 2IXTA 2BMJA 3GZNA 3R6GA 3VPSA 1ZUWA 1Q20A 4X5OA 3SM3A 1S8AA 3ZIAA 4KFUA 4HYYA 1MX3A 1ZAKA 4OKSA 4AROA 3G82C 4P81A 1WA5A 3P9NA 2JAXA 1TJYA 5EZ5A 1F38A 1U3UA 2V7QD 3WBFA 2OGTA 4BNDA 3DL7A 3OPVA 1CJUC 5DLPA 1N8NA 3AZPA 4Z3OA 3E03A 3A6KA 4EBBA 1GV1A 1WV0A 3EMKA 2A88A 3B5EA 5DCWA 5TPWA 2PD6A 3WGNA 1Y1RA 1XEXA 2OGUA 1TC1A 1LQUA 2FPPB 2R00A 4NESA 4C6SA 1CX9B 3NRCA 2JFZA 3O7WA 4G5OA 1DAGA 4MS4A 2V7QA 1ZNZA 3ZK9A 1RCTE 2F1HA 3PITA 4HNVA 4GW3A 4NNOA 3HTXA 3BH6A 4MIOA 4PW0A 2P9HA 4ZRMA 4DCJA 5JZSA 4B2IA 1JQ3A 2G9ZA 5LQCA 4H1TA 1PJQA 5GM1A 1U2RA 5CDYA 4G4IA 2XTNA 1G5HA 4OG2A 5HZHA 1DGQA 4GI2A 2BEUB 3B6JA 2ZQYA 4IZOA 3MQ2A 1XB2A 3WRXC 1SBYA 3OY7A 3SXUB 3TTUA 4DIMA 3DP9A 2C1EA 1YBAA 2ZP1A 4F8JA 1JIQA 5EZYF 2WF8A 5J5VA 3AFOA 3UV6A 5KTSA 3UAXA 1F4PA 1RVDA 2FMXA 1VE3A 1A2OA 2DQKA 4RH3A 4E5NA 3GLKA 4U2CA 3URMA 1T3HA 4L0MA 3KQHA 1U99A 1AKWA 1RDFA 3LK7A 1A4UA 3VKVA 5TMPA 3IUNA 4FJ2A 4HWRA 1MGPA 4XXHA 4HUJA 1NRXA 2XWBF 1YC5A 3AUFA 1PZXA 2YC2C 4NK5A 2PQ6A 5GJVC 3AUXA 4WFIA 4OSPA 3UKDA 3BWEA 3PUXA 1R8YA 3ITNA 4DQXA 4R05A 2XVZA 1ISPA 5JYDA 1KZ7B 1ZXLA 2XCOA 1HE3A 2QUKA 3VBCA 5K3CA 2V5VA 3IULA 4RZIA 4N39A 3V1UA 1XK7A 1NT2A 2WI8A 3CEJA 3NWPA 4M1OA 5K99A 2P4SA 1RW4A 3VZBA 4QUGA 4Y1FA 4D9GA 1LDYA 3H18A 4JJEA 3KZNA 4Q24A 1ZH2A 3LQ1A 1HDZA 3CLVA 1Y8AA 4U2DA 4OXQA 1NZJA 4W1QA 3GPIA 2P3LA 2B78A 4YQEA 1OLUB 3V8PA 1BDJA 2WLSA 2ATCA 2IUEA 1R5BA 1XSEA 2M1XA 3EWAA 3M4JA 2CYCA 4P3OA 5GZ6A 4KR6A 5IJ0A 2W6CX 2NVWA 1FEZA 2Z5FA 2BE9A 1Z6XA 5DBHX 4QQ8A 4RTLA 2ZB2A 2B8WA 2YMMA 4CR8A 1D03A 4DBLE 1RD4A 2P5SA 5IMBA 4U5QA 4ENVA 3FFAA 4FDVA 1L5WA 3PPYA 2G0TA 2IW1A 1P44A 4GPEA 3E58A 1PZMA 4EEKA 3SEQA 4DR7B 3MZ0A 3SNKA 1L6IA 4FJ1A 1WXQA 5JBNA 3QX3A 1G5FA 1XHEA 4F9FA 3TUIC 5LBIA 3OOEA 1T8RA 3DXXA 1SIOA 2XE4A 1ST3A 2JGKA 1E2BA 4P0TA 1KDTA 4IQGA 2HC9A 4KH1A 4B3TB 4WEOA 4FW9A 5SZJA 4KGZA 2VK2A 2XRZA 2PUGA 1O58A 2J0EA 3AINA 3MJ4A 2D4HA 4B71A 1G42A 1D3AA 3LVFO 5KOHA 2J30A 1SCKA 2J09A 4TZKA 4HEJA 5A03A 4MLPA 2OGZA 2QQEA 2WVJA 4K87A 4D9HA 4DUGA 2WSIA 4RK5A 4CIAA 1PT6A 4KKXB 1CUBA 2XNKA 5DX8A 1GTG1 3BJMA 3I1YA 4WOJA 5I9MA 2UZAA 2ZDQA 1RQNA 4HX5A 3A10A 4BVJA 3K6SB 2WUGA 2EFEB 1QORA 2B4AA 3ZDFA 4MUAA 4BNMA 1WSWA 2XB4A 3NVMB 2FFRA 2WAOA 4GO1A 4E1AA 2MYUA 3L84A 2VJBA 2ENWA 5DEOA 1VLQA 2C84A 1ND5A 1B0UA 1T6XA 2G1KA 4GOOD 2QZSA 5GVRA 4S24A 4JLVA 2WYWA 3TS1A 3ZK7A 1FJXA 5DNYB 5BWOA 3E35A 3KDSE 5AKYA 2AEEA 4A8JA 3FOFC 1JAHA 1AUVA 2AV6A 3ZWWA 1T6BY 4FE3A 5EQFA 5AWFC 4LE0A 5HF5A 4WY8A 5CEEA 2HF2A 1JQKA 4FYVA 1KP9A 2Q4EA 3KT6A 3PDIB 4O0LA 1AS2A 1WB4A 1GPYA 5DCLA 1TO6A 2PUTA 2WG0A 1XC7A 5LQUA 4ENTA 3TLJA 3I23A 1DAIA 2C5EA 3LT0A 1CIJA 1GZ3A 1C7IA 2R6ZA 3I09A 5I4KA 3RJZA 2SBTA 1PWZA 1DX9A 1JG2A 1OWMA 1X7WB 4LX8A 1E6UA 1W5FA 1I9GA 3FPSA 1JR3A 2C82A 2RAUA 4DXAA 5EMMA 1Z4PX 2CW5A 2QVGA 3S1LA 4HB3A 5J4YA 4KK4A 4LW8A 2V1XA 1JAZA 1W1UA 3ECCA 5TQJA 1DG9A 1OPXA 2HO5A 2ODTX 2XWSA 2YHBA 3QWAA 5EY5B 1YE5A 4Z9XA 2QN8A 2UYOA 3HWRA 1WOYA 3TG2A 1TTTA 2BKVA 4K6CA 3OLXA 5HE9A 1VKHA 1W4BA 5IAKA 2QTVA 3DHEA 4BDTA 3W77A 1IZ9A 4FE7A 4W99A 1XGKA 3JAKB 1BA3A 2WU1A 3IBCA 4KG7A 5HMMA 1GITA 4EA9A 2F1IA 5CM9C 4D4JA 4ZCPA 2H5EA 4FHFA 1QHHB 3AF1A 5AUOB 1GARA 3K5WA 4LRQA 4NYMR 2BWJA 4UHCA 2HJ9A 3OZDA 3N0TA 3B1YA 3DZBA 4NPCA 4CM4B 3EZ9A 2IQ5A 4XB1A 1LDGA 1X70A 3Q2KA 3L0PA 4LTNA 1SVUA 1JLSA 4XVCA 1JG3A 1ZUNA 2XSZA 4L5CA 1PZGA 3QF4A 2EXXA 4N8SA 1F17A 3ZH9B 3NHYA 2OCKA 2YWGA 1KTIA 3V97A 1I1HA 4RTOA 8LDHA 3EVBA 4XUCA 1JI0A 3KWMA 2VT3A 2QM8A 4NPHA 4LTMA 4QRDA 1LV7A 2GAJA 3LDHA 4BO4A 4DRXB 3VH1A 4IH4A 1VPWA 1E9RA 1CJMA 1ZZGA 2CNDA 1VSVA 3DLCA 3FR7A 1WVIA 2PLNA 2EKLA 3GVXA 3NKFA 3PS9A 4FI3F 1R0YA 4RLQA 4Z86A 5E8RA 3FPBA 1NW4A 1CPYA 3TTYA 1G21B 1PEDA 1N57A 2BI8A 2FPIA 3BQNB 1Q19A 3K9WA 3SZRA 3ZWYA 2WHQA 3R7WB 3F7TA 4F72A 1OFUA 3CLUD 4UPVA 3ZD9A 3H65A 5GJWC 1J0CA 1Q12A 1SG6A 1Y48E 3B1FA 3ELBA 4ZMRA 1SO8A 4IWNA 1C1XB 4RY8A 3L7KA 1VI6A 1C3OB 2VHCA 2XXBA 2A35A 1GHTA 4ZOLF 5L9AA 1T8UA 4IKPA 3OLWA 1RZRA 1ZJ4A 5J5CA 3UPDA 2ZCJA 3SKYA 3TZCA 5L7WA 4UNIA 4D92A 3F4KA 5J3JA 3JR3A 4TKZA 2H8KA 4BZWA 1KF0A 1TUGA 5KDLA 2O1EA 3G5TA 2EOAA 4IJKA 1G8GA 4DNOA 1LTQA 1V5GA 3H9GA 1TJ4A 2CMKA 3EZYA 4KQ6A 3R4VA 4A3SA 4OLFA 2E4AA 4QQKA 3B53X 4QRIA 1NIPA 5THKA 1NKTA 3DVAA 4RJLA 2XF2A 1AKTA 2JAHA 3TQIA 4NXNB 3TQHA 3CF6R 4OGFA 4L2IB 4XPIB 1N9KA 1V1RA 3W1WA 1K0UA 2BJWA 3IV9A 2GAAA 5E0KB 3D6HA 2WP8J 4F5WA 7REQA 4W8GA 2YUTA 1F9AA 5B1IA 4EUHA 1Y81A 2ZIWB 1T4CA 5FPTA 3U1VA 1YBHA 4R71A 1EU1A 1RJWA 3DCNA 3ACCA 3C8MA 4WUTA 1WKVA 2HDHA 3QVWA 2ZI5A 1FMTA 1ZIYA 3MBKA 3A9SA 4I9UA 5IBQA 4QJIA 3V4SA 3RTBA 3O4GA 2QAGB 1LPMA 2ZUUA 3DE5X 4KODA 4L7VA 4Q7KA 3ROPA 1EUCA 2HAEA 2GNOA 2BFFA 1NVTA 1DQZA 3BXZA 3EBOA 2AGVA 3L46A 4KQGA 5DMXA 1YDFA 2AJBA 5AKLA 4PG7A 4BNUA 5LQAA 9MHTA 1QJCA 3SK0A 4CQLA 3PZRA 4LPSA 1KEEA 8ATCA 3RGGA 3UGTA 2C61A 4D6YA 2I4MA 3UHAA 2AXEA 4DCNA 2AN5A 1SOAA 1R27A 3LG2A 5HFAA 5CNMA 2WHPB 5LMNB 4TMFA 5ALYA 3ETJA 3G9UA 3LC0A 4DM3A 1IWPB 3Q6MA 4GRDA 5IM5A 3FNQA 4N5DA 1GVHA 3C3XA 3CPJB 4OFXA 4P5DA 4F8YA 4OLBA 3KT0A 1B3BA 1MA3A 1JR2A 3A7EA 1PR2A 3IIKA 4CKWA 3O8QB 1QK5A 4KL8S 4PC6A 4ITVA 1RWBA 5K4AA 1U9CA 1XD8A 4K9PA 5JSUA 5MN6A 5HG0A 3KJHA 2ECPA 5IAAA 1OX6A 2Y2VA 4EIWA 2FUG1 2GEJA 4Z8XA 2R25B 1NN0A 2R7LA 3DHWC 1CY2A 1K6MA 4RPLA 5B4TA 1Z18A 1BKDR 3AU8A 5BN4B 1Q7TA 3LQ2A 3U3XA 2YDXA 2CXNA 2J5BA 2PBLA 1OB2A 3FVTA 1KFKB 3EY4A 4TL9A 2VH5R 5LZ7A 3EHEA 3GGCA 4RKEA 1D2EA 1KFBB 1NMEA 3RJMA 5TXGA 2II6A 3DFIA 3ZLTA 1S8FA 1MZVA 1J8VA 1AF7A 1U2SA 5B2ZA 2A5YB 1C1XA 1NW9B 1S2DA 2IU4A 3H5IA 1BXKA 3PL1A 3HRKA 4FDUA 3RAJA 2RGRA 4L9AA 1C30B 1IHYA 3WICA 2X41A 2MJLA 4YJDA 2JJQA 1UKCA 3H13A 3SJAA 2QRZA 2C54A 5EHZA 4Z54A 3GELA 4IDBA 1MBZA 1EQ2A 1U5BA 1XCPA 1XTVA 4MH0R 1RPTA 3TLMA 4MGYR 1T3LA 1C50A 4DLRA 2N42A 4KFCA 1JG6A 1XEAA 3I9V6 1QVVA 4ISBA 4LNAA 2RD2A 2BELA 2GHRA 2P4EA 4RO0A 1EFPB 2Q3EA 4N9WA 2CFIA 3BM5A 3H2ZA 3KXPA 4OQQA 2X9LA 2QP9X 3JU3A 1FSFA 1TYCA 1TGYA 1KFEB 1KYIA 2D3TA 3ND8A 3BZWA 3V8MA 3H0EA 4NNPA 2VJLA 4UTNA 3KQUA 3VC2A 1BU5A 2Q49A 4OKNA 1L4LA 3HBLA 4J3FA 2WUWE 5HTKA 3OA0A 2GJAA 4ZO8A 4Q1VA 2ZJOA 2GM3A 1RQXA 2J3EA 1X7YB 4KI0A 3VTFA 4B45A 2XZOA 3CHYA 4E2WA 4RDIA 2AH5A 1ACMA 1ZGAA 2F1RA 2Q6TA 2CBGA 4BO8A 2XX3A 5IFLA 1QHHA 2AC7A 3O4HA 4CV2A 1XF9A 2QTCA 2TMDA 2I7TA 3OM1A 1MABA 2C4HA 3MM4A 4M76B 5IHPA 2A1TR 5EKSA 3WLAA 2A1UA 3EARA 4X8OA 1E77A 3FGOA 4Y2PA 4PRLA 3PC6A 2QR5A 1QV9A 1F6WA 5B7QA 2PX0A 5F73A 2P11A 3EGEA 2ZR9A 3R8CA 2FSPA 2AC4A 1P1FA 3NTLA 4AD8A 5J1TB 1CJCA 1DTWB 4AAYA 4X24A 4ZREA 3PUHA 1ZRMA 1PNQA 3VDRA 4OFBA 4F2WA 2Z6AA 1KQOA 5ABPA 3C3CA 4NMMA 5DBGA 3F8WA 4AZTA 1XTJA 3RVNA 2VJNA 1MVLA 2RI0A 6GPBA 4UUAA 1D07A 1TB4A 3F3MA 3DTNA 4GR9A 2K2WA 2TYSB 3C6MA 4E4TA 4BUJA 4OIFA 4IF4A 1XQ1A 4KYVA 2B25A 5K3DA 4IUYA 3EUAA 1GOTA 1HMYA 1XXHE 2F1OA 3C6YA 4FUTA 4TMXA 4X8MA 1RWXA 5DGDA 3SSMA 4P35A 1DZIA 4LGCA 1JIKA 4MUEA 4ARIA 4AS2A 5E6RA 1QKJA 3MCWA 2IZOA 3V4PB 4GGOA 4P4UA 2ZT7A 3GRPA 4GOJA 4WLEA 4Q4AB 3WY9A 1PQWA 1CBUA 2I76A 2I1VB 2Z09A 2FPUA 3JY6A 4G5XA 4MVJH 4UBJA 4XUGB 2WJ4A 3GLTA 3SOZA 4QGSA 5C4IA 2ZIGA 1U5AA 3UAZA 5C8VA 2ZBGA 1XK6A 4QARA 3N8DA 2NGRA 4D82A 2PIAA 2ZVQX 1QH1B 3HG7A 2C4VA 2ROQA 3CPEA 1Q0SA 1AXRA 4TWAA 5CVEA 4MTLA 1D8AA 3LNCA 1ZGJA 4KN9S 1Z4LA 3A1DA 3RASA 1RXIA 1EDBA 2WLTA 1QUEA 1K6XA 3OD5A 2ZBQA 4J2HA 2QW8A 2WA1A 2H9IA 5JJ5A 3GLHE 1I94B 5DZSA 3SZUA 5KOYA 4AZ0B 3NBAA 4YH1A 3F78A 1WETA 3Q7RA 3IV7A 2A1UB 4A6PA 4Z4IA 1KDPA 4I2NA 1NW7A 2J3QA 2OUKA 1R9GA 1RKXA 3BWMA 5LXTF 4HGOA 2Z2IA 4DIDA 4Y9UA 3SQMA 1PJSA 4ZV9A 2PKCA 1CXZA 2C4MA 4DV3B 1W36C 2HW8A 2Y8EA 5IKXA 1XVIA 8ABPA 2BZ0A 5F2OA 1URPA 4PSUA 2OBBA 4IP0A 2A5GA 3AX6A 3GL9A 1E9FA 3OIWA 4XQ0A 2EJVA 3FKSD 1ODSA 3L9XA 1BKSB 2X6QA 3LUGA 5ALMA 4LFCB 3RVMA 3ZI0A 4HVCA 5CX1B 2QTZA 5JD4A 4IIDA 1M8FA 3R3SA 1K7CA 3PGA1 2VHXA 4ZVKA 1IN4A 5LMUB 3W7VA 1IVSA 1DAEA 1SCUB 1OC4A 2K87A 2WYVA 1HSZA 3DAFA 4XFDA 3J7TA 3BJZA 1RQ7A 1SVSA 3E8XA 4GPD1 4ZPJA 1UXKA 2Q28A 1HFEL 2NLOA 3JWJA 1R0LA 3O82A 4GMXA 4PBTA 1E4EA 4TTAA 4ZPXA 1KEZA 4ZOBA 4HC4A 4CU5A 4FFSA 4EJSC 2FSVA 3L2OB 4Y2SA 4D97A 4NRDA 2CE7A 5BNTA 2CK3A 1SKYB 1HZZC 1I32A 4MDHA 4LXGA 4G0VA 2OO3A 1BKYA 3WV5A 1A4IA 1G2OA 4JYMA 1XMPA 3W5SA 3FRHA 1ARZA 3MMPA 1PJ4A 4DHWA 1POXA 4EAAA 3RRFA 1J2TA 3FG9A 1DAOA 3HXTA 4I9HA 1QX4A 4NYJQ 4HB2A 1B74A 5E3IA 4DA7A 3KQYA 3OHSX 4ZXPA 1YMUA 1HG1A 2LKDA 5BQ3A 3DWGA 5L95A 1ULTA 2E4UA 4E2ZA 1B00A 4PNZA 5HRUA 1WU7A 2D2VA 1U9IA 3THSA 4D0RA 4A8HA 3TLXA 4C7XA 1F48A 1WABA 5WRFA 4Z4QA 1JMVA 4Q1AA 1N0IA 3WGIA 4DGQA 1COWA 3BC1A 3GJ4A 3M4NA 5AJHA 2Q7DA 3TE6A 4KO1S 4BJ3A 2JVIA 2R1VB 3M6VA 1YH3A 1W4AA 5E7MA 2AVNA 4E5VA 2E4WA 4QFBA 3HBNA 4YHBA 4QUIA 2MMCA 5FUMA 3N2GA 1X13A 2CVHA 2YHIB 4OHBA 1OMOA 1ZX1A 4RIEA 4R8SA 2BTEA 1OGJA 5LDGA 1E5LA 3SSAA 5I48A 4FPXA 1HDEA 4CZ2A 4OB6A 2PFGA 2HMAA 1Z4KA 1C0PA 4QXMA 1D2RA 1R00A 1T3SA 2Z5GA 2YXNA 4BHTA 4DLYA 4YXWD 2ISCA 2G4LA 4BNGA 1NSFA 2VJKA 2B2CA 3DAGA 4S2EA 3VMFA 2NP7A 1NKVA 2BFFB 1UKBA 1PWYE 4MPRA 5KQMA 3V3TA 4GDFA 4F4FA 1XRQA 2JAOA 5AKJA 1S2OA 2NYAA 4YRQA 4PGMA 1RI4A 1EE2A 4BNKA 1BJKA 4ZQHA 4E7OA 2Z8YA 3ZI4A 1PJAA 4G63A 1UODA 4TQ9A 5AVKA 4EK9A 3H04A 1QYXA 1YS1X 4XJXA 2PM8A 4HXFB 3O26A 5K3FA 3NXKA 2AXQA 7REQB 5I6DA 3RF6A 4A8JB 3SHVA 4IKEA 3FPGA 3QA9A 5T4HA 3U31A 3T5AA 3HJCA 4HUQA 3ROXA 4R8VA 3BA1A 2V65A 1V35A 1MU0A 1C4OA 4JJZA 5DT9A 4OMFG 5HQTA 4YN3A 4EDHA 3HLTA 1E1RA 3BSYA 3K8ZA 5B5SA 1SHZA 1KDRA 1H42A 1L7QA 1Q1QA 3HVUA 1VLHA 1Y3CE 2IF0A 2G0NA 3PGKA 2B4YA 4NSNA 1RZVA 4C1BA 3G5UA 3ZNQA 3V8VA 5CVUA 4PSDA 4FHDA 5M2QA 1QHSA 1XL1A 2XMSA 1XJWA 1H69A 2EX0A 2R8BA 1SOMA 1GR0A 3DL4A 1EPUA 3VSDA 4HGQA 3WSVA 1TZCA 4M4SA 4Q7EA 3VYWA 4M9QA 1CK4A 2AKEA 4B33A 3IP7A 4QBKA 2QU8A 1AKQA 2EC5A 5IBRA 2HCFA 4WN9A 1RJ9B 2FN4A 1DKUA 1MOQA 1FSZA 2VSQA 1T8TA 2VWPA 4YAFA 3H05A 1FU7A 3DZHA 3F46A 3LZ6A 2PK3A 3EVDA 3UAOA 4MI3A 1J1UA 4MWCA 1JWLA 5L6MB 1MENA 3IUBA 3A6FA 2IYUA 3O4VA 3ONDA 1D8TA 4JA2A 1BFKA 1S7CA 3BXXA 4FLFA 3RJ5A 1JLLA 4TLAA 1E5VA 5JJKA 1FP4B 2OG2A 3I6YA 4GMFA 4ZV7A 1VLMA 3OZEA 4WK0B 3S1SA 5I4IA 4U5XA 3T0IA 2IXGA 1FE8A 1GNLA 2AOTB 3A25A 5AM2A 2NYUA 1DMSA 2CEAA 3O90A 3CNBA 2EX4A 4R9SA 4REMA 3UWOA 4B4KA 4GPIB 1UWCA 2CYBA 1N5KA 1AZLA 1MC8A 1UBJS 2H1CA 1ZICA 3CRZA 4FYPA 5JAQA 3I6BA 1NC3A 1PFUA 3NAMA 3O5AA 3F96A 2GDJA 4M8LA 2OEPA 1AJEA 1RRPA 5EEGA 1FQOA 2WY2D 3WFJA 2FWNA 2XBMA 5ADWA 3BGOS 1D5WA 4Y1EA 5AHRA 3RE1A 2QLMA 3T4XA 1SXIA 5J2UF 1E6WA 3OPYI 1OBHA 4KHZA 4Y8VA 3KZMA 2NXCA 4FGSA 3W2HA 5BUZA 5LIPA 2EWMA 5AK4A 2FLWA 4ZOCA 4M38A 1INLA 1T0UA 1T1SA 2Z5VA 1IJKA 4IH9A 2Y4NA 4MUGA 4Y6GB 3V48A 2QTAA 4PCAA 1IDN1 1R64A 4DC0A 2CBXA 2PGJA 3H8VA 1PU2A 3PTAA 1M0EA 3WMWA 1VG0B 2F6RA 3CG0A 3L43A 5TX7A 2XDAA 3CM0A 5HKOA 1CRLA 1RYHA 2I67A 3E9YA 5T4BA 4YS6A 3TNJA 1FZTA 4QYIB 3VPBA 3ILSA 1CS0B 5ESRA 1SBQA 3DLAA 3NTOA 1XTTA 2X58A 5BP7A 3L0IB 4U9UA 1L5QA 4JLPA 2B8TA 3AHDA 3FYTA 5A6SA 3BTUA 2HCJB 4LBZA 1CUJA 5A7GA 3I2JA 5U1PA 3WMGA 5HSGA 2X42A 1IHUA 5ALFA 5AD1A 3T1YB 1T26A 4MYTA 1Z68A 3C5EA 5KJEA 2XMPA 5BXYA 3F6PA 3OZXA 3MF4A 2EYUA 2FX2A 4H3HB 2OO5A 5B3JA 2O8DA 1JZSA 2FKNA 2PRKA 4DSUA 2LW7A 5ALKA 1NBWB 4CMCA 3S0JA 4DLTA 1JHOA 5BSHA 1GEEA 2H7XA 2I4LA 2NZWA 3ENZA 3MWYW 5FWXB 2R62A 4AJKA 4Q02A 4IEFB 3HM9A 1IU9A 3GV0A 5A3RA 4Z7QB 4FNMA 2EGHA 2WIJA 3DKPA 3Q2OA 4DMKA 4FBLA 3L6CA 4MRRA 1L5MA 1NXXA 1XLVA 2J3HA 1SUFA 2V96A 1F12A 2YYYA 1TL7C 2YYSA 3DBLB 3MAAC 3IAFA 4GKAA 3M5CA 4H7PA 4FYIA 5DTJA 5KYYA 1H5QA 2R48A 1ZG3A 5KVCA 1FNSA 2PSDA 5KJ6A 1N6KA 4TVBA 1K5DA 1YB6A 1J4AA 2W6OA 4S1WA 1QFXA 3AHEA 2WT8A 2AF3C 2B30A 3GVHA 1AHPA 4Y2RA 3UK0A 2WJYA 1YULA 4CMIB 5CFNA 2M32A 3GHYA 3A3KA 3R5JA 3D54D 4YCDA 1HV8A 4GMHA 5F7ZA 4W6ZA 3NP9A 1XI2A 1Y80A 4MW4A 5DYWA 4B48A 4C4XA 5HMLA 1DJOA 4KZPA 1JVBA 1YB2A 3R6DA 4DVJA 4IEIA 3FWYA 1IN7A 1LI7A 3G5LA 4PO8A 1SZDA 2IYEA 3KKEA 4JELA 1G2PA 4NMLA 3PHIA 2UDPA 4E30A 1G291 3WKDA 2HR1A 4QM6A 1G6HA 1UBKS 1U2TA 3AJEA 2O23A 3GZNB 4L2IA 4XPIA 1EG7A 5C8YA 4D6PA 4KLNA 1Y9EA 3QPAA 2UYQA 1KEWA 2GBLC 1SXJE 3GCDA 1I6KA 2X3YA 4FEEA 1ZRNA 4PSVA 2XEDA 4V1CB 3BN3A 4YMLA 3ZGZA 3TIIA 2ZTHA 1BMTA 1LEHA 1TPZA 2BTOA 1ZD9A 2QY9A 1KWKA 1ZIDA 3OF3A 3HYCA 4KXLA 3E5RA 3KR0A 1QB8A 4II2A 2OK8A 4UASA 2PXXA 2O6LA 2EFDB 2A9JA 3QW2A 2I62A 2D7JA 4WOKA 2H9YA 3RGWS 4V0ME 3PP8A 1PSZA 4JQZA 2RKBA 4IGIA 1TA0A 4LYAA 1ZK3A 1PNTA 1LPOA 5IYZB 5FBVB 3GB9A 1ETHA 3NNNA 4EG5A 5FI0B 1O6FA 5IXSA 2XWJI 4FXPA 4O1HA 4CMHA 4YV2A 3SC6A 1Y6QA 1BTOA 5JDCA 1JP7A 3LDUA 1O0SA 1AA9A 2AI3A 3IDSA 1RLTA 3EPHA 1CUHA 1JPNA 3D8SA 1HBJA 4QICA 4GM0A 3PNVA 5DRYA 2A58A 4R3WA 2FN3A 1NTRA 4JKYA 5JPCA 2IUTA 4GMGA 2AWOA 2UUPA 3LECA 3MAJA 3NAQA 3E4CA 1L7VC 4NH0A 1BE1A 2YIJA 4BO1A 2PX3A 4GLJA 5L8VA 4OJYA 4ZHQB 4WZBA 3OMWA 3QOWA 3CUKA 4RZSA 2WFLA 2YJZA 1LSOA 3I2YX 4DN6A 3GQBB 3GUHA 1NHGA 3DEYX 4KACA 5FTJA 3EZFA 3K2BA 4LDQA 2UVPB 1GA4A 1S1MA 3B9PA 1EGMB 3PFBA 3SU8A 5HFJA 1OIVA 1U8AA 4NI5A 4RTSA 3G3EA 1P1KA 3PD7A 2XOKD 4ZD6A 5DIZA 2ZW9A 2OZKA 4DQVA 1EEHA 3R9XB 4M36A 1HKHA 3X2EA 2C3MA 4JX9A 2EHDA 2ZB8A 3QEJA 4X63A 1QOZA 3CYFA 3HJUA 3ABRB 3RAGA 3RC7A 5KTMA 1FMFA 4ZCMA 3PX3A 5GAJA 5DN6A 1CJVC 4X8HA 2ZBEA 1UIMA 1ADBA 4PRYA 4TYQA 1TK2A 2FE1A 1G8AA 1ULAA 2HIGA 3W6UA 1QTIA 3SSOA 4YT8A 4D46A 3RHZA 3SN6A 5FTMA 1JV2B 4GNRA 1YMVA 1L8AA 1I1QB 2WUVA 2XA2A 4R9VA 2JJ2A 2VHWA 1NQVA 1VIYA 3BXOA 3O3OB 2QVBA 4CQMB 4YJ2A 5AVVA 1IL0A 3O47A 1EP9A 1W4RA 1JSXA 3HB7A 4M0EA 5JXGA 1OKKA 4RQAA 1QF6A 2PCLA 3RUAA 4NBUA 4BAZA 1WWKA 3P9YA 3Q1KA 4OU5A 1IFXA 4JHXA 2H1HA 1XVVA 2GHQA 3AWIA 2IV7A 3IVCA 3U3OA 1O96A 1GU1A 3MXTA 1EWYA 3MJEA 3Q7TA 4FFVA 3MT0A 1KVSA 1GTVA 3LNTA 3QFHA 3VR4A 1MR3F 5L45A 5EJAA 3K6SA 1IXZA 3EPJA 2XR1A 2EP7A 4C0XA 3I39X 4HOYA 2XT6A 3V2GA 1NA5A 1Y7IA 5CCXA 1EFRA 1KS2A 2GAOA 4Y67A 4RVCA 4ZANA 2IEAA 3AC0A 3RWMB 1F7UA 2QZZA 3FCYA 1WR8A 1M2GA 3KV3O 4Z9AA 5ADVA 4UXIA 1H2BA 2MSNA 4LWOA 1XD2A 4LJLA 3MS2A 4L6AA 4TKUA 2DFLA 2ZJ5A 1U02A 4E21A 1IEXA 2HQRA 2I3ZA 2FX3A 3AR6A 1BA2A 1GNPA 3D3WA 3G17A 2WWGA 4RVFA 2H2GA 3ROTA 5AFSA 3KM0A 3FB4A 1H2EA 4HLNA 3GN1A 3TR0A 2C8VA 4L8FA 4X93A 3AEYA 3EBPA 1Z37A 4R69A 5CRIA 4DV2B 4YRFA 3GMIA 1QCYA 1Z4JA 4QGAA 4UBKA 2ZZKA 4XE5A 2NP6A 1OASA 5NULA 3E5NA 3WISA 3QUBA 2QROA 3EULA 1W35A 1N6OA 4YI5A 1N1GA 1O5OA 4Q3DA 1X8XA 1ZITA 4WK4B 3L4EA 1ECLA 3OEHD 1B6RA 4TT8A 3DEHA 2A7XA 1FTQA 3G7NA 3NRBA 4BO0A 3U7GA 3TLYA 3INNA 3ZHXA 4UMVA 2HDOA 2ZIFA 5CBPA 3K4PA 2OV6A 5AJVB 4M8SA 4BQNA 5JBQA 1IBCA 1X1AA 1W52X 1NMXA 2PYZA 4QDKA 4DRYA 1JT9A 1O6GA 2ENUA 4KYTA 1APBA 5H83A 3CRMA 1PZEA 2TMYA 3L7OA 2CV1A 2JCVA 2IPOA 5EJ5A 4YALA 2SNIE 1N3BA 1PQPA 2HL6A 5CLHA 2HXSA 3WLPA 4KN5A 1Y3AA 1SQGA 2A1TS 1MOZA 4EGJA 2ZU6A 2F43B 1G18A 2PH7A 4E6EA 4BS9A 1M1XB 3VNSA 1XDGA 1MEEA 2NIPA 2XTAA 3PC8C 3BWYA 3WB9A 2YCLA 4ZC8A 3DMYA 3E1SA 3TVYA 1LDNA 3INRA 3THWA 4JQSA 2DUUA 4ISCA 3FHOA 3IQEA 2NXNA 5REQA 1OLXB 3HKBB 3MJCA 4P4SA 3VX3A 1C8VB 4JLUA 4Q3BA 2CJPA 2O3SA 3EFHA 4O4HB 3KTAB 5FP0A 3A9CA 3H2JA 2LDBA 1MF7A 1XN1A 2AC2A 3LVQE 3HDGA 1OFIA 2A9FA 2R2AA 3UN1A 3LTNC 2JHFA 3P9XA 4HGRA 4LFAB 1N5JA 2OD9A 3BB4A 3BRCA 4GI7A 3FTCA 4JASB 5HK9A 3AJ9A 2G06A 1UBUS 2ZBFA 1R9JA 4OYHA 1EX9A 1UOOA 3BWVA 3D4PA 2EBFX 3IEPA 3L6DA 4NONA 2VXYA 4OO3A 3WE7A 1NAHA 3U19A 4EHHA 2E49A 2HBRA 2KM1A 4TV9F 3K32A 3TFQA 2VXBA 3Q9NA 4GU5A 1CQIA 1DRWA 1O9HA 3G1UA 2P9GA 1UM9A 3P2KA 1L5KA 4J1TC 4N65A 4Q7JB 1B23P 4DDMA 1M2KA 4KUHA 2JLRA 2V0CA 1VKNA 1OXTA 1QZXA 3ODPA 4RDCA 4ILKA 1H3FA 4B7XA 3DB2A 4R1SA 3VPCA 3FNFA 1QRSA 5EP2A 4WZBB 4QLOA 1EFRD 1XRJA 4NV0A 5B37A 3VOAA 2IXBA 3EN0A 3AVWA 3DNFA 4WKNA 3L0BA 4Y98A 3P45A 1F06A 4B3RB 4H7DA 2I8LA 4G97A 3TFWA 1BXRA 4BLRA 3N8IA 1ZM9A 3PUIA 4FMPA 4IVNA 3S28A 1GDDA 4D8UA 3FSRA 2CL6X 5JMOA 4AM8A 5BSWA 2HMSA 1FX0A 3MGGA 5CB4F 5KREA 4ZVTA 4LGYA 3T1QA 3VU1A 1MT3A 2MDTA 4O2BF 1OH8A 3LX6A 1O9BA 3NFYA 1R4NA 3ASUA 1M7GA 5KTPA 4LOJA 5G0VA 4QJ4A 4C9BA 2AMYA 1UXOA 1XP5A 2H4ZA 3R0JA 1PRYA 4AJLA 4ZAXA 3ZU3A 1OTYA 2W98A 2YWXA 3R77A 4GWKA 2YRWA 4YJHB 1QIEA 2FDCA 3FBWA 1DPFA 1L0BA 3MILA 4MI9A 3STWA 1G20E 5ICSA 2IZ1A 4Q01A 1XWWA 2AJLI 5IDYA 1N8SA 2IZ5A 4GXRA 2C2MA 3L49A 4OAPA 2NZ2A 3NRJA 1JU4A 3F6BX 4JUCA 4PIPA 4FONA 5FAKA 3KR9A 5J4KA 3BMOB 2CXQA 3RRNA 1VL1A 3V9AA 1X74A 1XEXB 2QPOA 2WV9A 3AP2A 5IJXA 3G6KA 5LUAA 2WZCA 1MX5A 3HYSA 4RCYA 5G02A 4HDMB 1CB7A 3T3IA 1JB9A 1Q6YA 2ONZA 2NZXA 3H5WA 3CWZA 4LK2A 1AX9A 3VC1A 2VO1A 3PPWA 2V5UA 4K0KB 4UM5A 1UDRA 3IDQA 4MQ5A 1L5NA 3JYPA 2QSYA 1KMIY 2C7RA 1VG9B 3F6CA 1E7MA 4BLQA 1JR3D 2E3JA 3S27A 4DCMA 1XDZA 1GKYA 4BV3A 4J0DA 1CF4A 3FPEA 3OJCA 1K27A 2EJBA 3I3OA 2GBLA 2NSHA 2ONYA 2VJYA 1LX7A 2FXVA 1SCAA 1KAQA 2REBA 3V8NA 1XZMA 4LS3A 4BC0A 1AGNA 4DSOA 3WAKA 3QVTA 1ODCA 1P5RA 4IUCS 3T1HB 4PC7A 5G4LA 5I4BA 2VHTA 3IQIX 1N7HA 2Y1WA 3JYLA 2XMRA 1PR4A 3ZWBA 2GBPA 3PXGA 5K0EA 3WRYC 2GETA 2DRIA 1OZHA 1M2NA 3GFTA 1TO1E 4X41A 5BVGB 5LJLA 2JEZA 1VPVA 3CINA 3JQ6A 1AMUA 1JZTA 3S1AB 4FOLA 1BWRA 4MCAA 4TLBA 3L4JA 4AN4A 1IUKA 1U7DA 3F97A 2V6JA 2ZYDA 4GLOA 5CLLA 4MWGA 3OZ7A 3A3YA 4S0ZA 1EI9A 3OIDA 1RTKA 2JFQA 3D02A 3MMSA 3Q87B 3C74A 4IDGA 4F45A 1XCOA 2C8LA 4NOKA 3D59A 4RHEA 4NARA 2EU8A 1PK9A 1KNQA 1JJ7A 1I5EA 4DUGD 1OIXA 1EP2B 2Z8XA 2YJ6A 3CX8A 2C7OA 1GT91 1XU7A 2VDRB 2WM8A 2FFJA 4RHCA 2JAQA 4BU0A 5BQXA 3Q41A 3WK5A 3IH5A 2X0EA 5BW4A 5JPIA 3DTYA 2Y66A 3AR3A 4FGKA 1XLWA 4QXRA 5ALTA 3H1PA 5A9TA 3UW3A 3B6EA 5DM70 2C5HA 3C5VA 3I6ZA 2BCGY 1DG3A 3KB1A 2JLZA 1XLTA 1Y3FE 2RI6A 2REQA 2Y0PA 2BSXA 3ZY3A 5HCIA 3PRJA 1VPTA 1IB0A 4UU1A 1SC6A 1VSQA 2VBFA 3CJQA 2OC9A 3CZ5A 5AKZA 2XZDA 4YK7A 1CQWA 2KYRA 1VJ1A 3IPXA 1ANKA 4JI0B 2R60A 3P71T 4F12A 1L8QA 3UMJA 3PK0A 4L74A 2V9ZA 2CXHA 1A2QA 4V0KA 4QEZA 5JECA 1U3FA 2C96A 2GRUA 2PZFA 5D00A 5EXTA 2J4FA 4X1KB 5HM8A 4F5ZA 3HCCA 4KW7A 5AW1A 2CJWB 3C97A 1T1JA 1S0UA 1H2WA 4MV1A 1K8QA 4XOIA 3TMAA 4C6TA 2PMEA 3QVMA 3CVVA 1HPLA 2FN8A 1F2UB 2GGSA 1US8B 3ZE7A 1G60A 4JYPA 2HJVA 4M49A 4TN1A 3QMMA 3LC7O 3CBGA 3C41J 4PZZA 3V7WA 2F3PA 4RFLA 1XV5A 4JN6B 4DE5A 1KMCA 2R6AA 3AY6A 2AHRA 4ZO6A 5B1EA 3WGGA 4DR3B 2QX9A 3N59A 4R1MA 3WJ2A 2EERA 4NS4A 1JEQA 1CUVA 1XMSA 1PD0A 3PLNA 1CQJB 4M0PA 3W34A 4BNTA 2GFIA 1NW5A 1P29A 3QX7A 4I46A 5EI5A 4CE6A 2ZYRA 3WAGA 4BEJA 3PEWA 3ITEA 5L3VA 3HJNA 1RQRA 2BEKA 4H35A 3EIUA 3NWEA 3G9XA 1BE8A 1E9SA 1K75A 2ABWA 3CF0A 2H48A 4W7HA 1Z73A 1AKVA 3D6AA 3AW9A 5JZBA 2PUFA 1KHHA 3GGGA 1Z13A 2Y99A 2F2TA 2YICA 5BR8B 1JYEA 3G5MA 1UFVA 2XQKA 3B1KA 1FYVA 4G07A 3T3GA 1Q1EA 3BTVA 3S3TA 1M7HA 4OIMA 5IXJA 1P5HA 4I36A 3DMRA 3RV3A 3ZK8A 3OAAA 5KVVA 4HVLA 2P6OA 4HH4A 3CNEA 2G8LA 2Q5FA 1FLNA 2Q62A 4MXDA 2V4UA 5DGTA 1E79D 3RSZA 2VKQA 1NI3A 1ZEJA 2GXUA 4CHGA 1RPJA 1M5TA 2XTJA 2O3TA 3NHKA 1DXQA 3DF9A 5H82A 3M81A 2YS6A 2JLSA 3ICWA 4Q48A 3BCRA 3O4FA 1YK1A 1ZN9A 1TMOA 2VCHA 4TGLA 3UCXA 3TMKA 2VUSA 3IERA 1WZCA 2WHPA 1LSUA 3NOOA 2AIRA 2DG2A 3R5SA 1XD2B 2WWVD 3VHQA 4K9KA 5IJ9A 1T6ZA 1BVRA 4M2LA 1U2QA 4DIBA 3GJZA 3N53A 3GGPA 4DR1B 3QFCA 4WBSA 1I6WA 4K9DA 1PGNA 2HHHB 4ID9A 3MT7A 5E9WA 1NJ5A 4BY9E 1WMSA 3CU5A 4DDTA 4EVQA 1K97A 4ICIA 4TMKA 4JU9A 5EL0A 5FV7A 3OZTA 1EBUA 1JBKA 3K4QA 4O1MA 4R1QA 4GOND 4C01A 4H15A 1E1KA 1GR1A 4EWLA 4Z49A 3RSQA 2IRWA 4D9KA 3ABOB 4CMBA 1PZFA 1T2DA 5LWQA 4S05A 4AJOA 2BEWA 1LPAB 3M4ZA 1SA0B 2A78A 3BAFA 5HZGA 2P6UA 2W2TA 4TSFA 2HF7A 1PT8A 1I3KA 4XUDA 3MEQA 3PGJA 2G6BA 3LE8A 1I2ZA 1UC8A 3ANLA 3LKVA 5EZSA 4E5MA 1K3TA 2I6XA 4GC9A 4I55A 5H80A 1NXVA 1MJGM 5LYYA 4ZK6A 3MB5A 3ZI7A 3BJIC 4ZU1X 3T4UA 2WDZA 2GEKA 1FDTA 4AF7A 4B40A 1E0AA 2HMVA 2ZJ0A 3RIGA 1T5HX 2E37A 5JS6A 4P3KA 2Q4RA 4YCJA 4BQQA 3H2HA 4Y0NA 1WBBA 1GP2A 1DC6A 4YLGA 2DBVO 3AUTA 1D4OA 3SWWA 4E5UA 3IHTA 4NFHA 1EP1B 5C1OA 4GOMD 1J0DA 4Z6KA 4B3GA 2HLNA 3CG4A 1P3JA 3H84A 4BBPA 2BGKA 3QLEA 5KWIA 1E66A 4IIJF 2C31A 4ROSA 3RSOA 1M6WA 3KAJA 3UWMA 1I7QB 2DF8A 3DBIA 3LHIA 3R24A 1CY7A 2Y1EA 1JBEA 1EM6A 2ZSIA 4HO1X 2Q3LA 2GCOB 1IONA 2I2FA 3F4BA 3AVOA 3PFKA 2NTEA 4I08A 1SOUA 3QOXA 4JDPA 3EX7C 1LWNA 4YEDA 1VBMA 7MHTA 1LDEA 4PGGA 3IE2A 5KC9A 5CA0A 3DAYA 4OMCA 2FTKE 3PR1A 1XA4A 3UIEA 1WB5A 5E9JA 1MNQA 1RKVA 2GAFA 3D31A 4LHWA 1E1QD 1CR6A 1C4XA 4OXIA 2FMIA 3TGLA 3QVUA 3NWBA 3DTVD 1JXAA 2EL9A 4NYIR 1RXUA 1RAAA 1FVOA 1YUBA 2APJA 5H7XA 3WK6A 1NVDA 1MPXA 1U1CA 1LLUA 4N0MA 1IY9A 4DMCA 2CHFA 1Y0BA 4KREA 1IUPA 2AS0A 3RSHA 3W2TA 4K03A 5CLFA 1RC1A 2IHTA 2WZQA 1UBMS 1YA8A 2DTXA 3BXGA 1NF2A 1K5GA 3VR4H 4EMSA 3RHFA 1EZZA 1IUOA 3DE2X 2G1JA 2Y67A 3QYJA 2X40A 3TIXB 3VI3B 3E22B 1SXJC 3UVEA 4DB4A 3AI2A 3PU6A 2G80A 3F49S 3K09C 3PJEA 5JCOA 5DX1A 3GI1A 3DVQX 4UM7A 3NYRA 1QKKA 5BMVB 3U7FB 2CXRA 3C1TA 3DTVB 3NC1C 1WUKS 3I3SR 1B1CA 4L15A 1T5SA 3LCRA 3RG8A 4ZYWA 3LBYA 3R6TA 4BGEA 5C3UA 4JD5A 3TO5A 5I3CA 2HRCA 3RJ9A 2YXDA 1FYXA 4Y6SA 5CP8A 3MD9A 3UJ3X 1Z17A 4B7UA 3LCMA 1GKUB 3QVGB 1X7ZA 2X0JA 4L5JA 3DOOA 3T9FA 3T3EA 2C2BA 3WWOA 3ZKWA 2ZRAA 2XUJA 2X9VA 4LZJA 3DE3X 3Q5DA 3PC3A 4AKSA 1O57A 1TMKA 2XYRA 5HNKA 4YHHB 1RMQA 1E9DA 4EYOA 3OE1A 1G16A 1OSNA 1SQSA 3A4VA 3VPXA 5HGJA 3P0HA 4B3SB 4LF9B 4JNCA 4L5AA 3FZQA 5EIBD 2I71A 1IATA 3Q9LA 3D3WB 4XFJA 3R9IA 4EYSA 2OFXA 3PQ5A 4H7HA 2R96A 4IDHA 3ZPXA 4DJJA 2QT1A 3A3PA 1IY1A 4NV3A 2PL1A 3I5YA 4JOCA 3W4JA 3SQLA 3W8RA 3E9DA 3OCUA 4AUMA 2C88A 3RARA 1MXHA 2ZOSA 2A3NA 5DOZA 4G5GA 1TNDA 1SB9A 1XYVA 1YRWA 1ULHA 4HPJB 3F7OA 5JO9A 4AW9A 2FPLA 5ITZB 1GAEO 4FC6A 5FWXA 1IEWA 3AEQB 4TROA 3AR7A 1W88B 5A5GA 3B1JA 5I51A 4PU0A 1KP2A 2Y1KA 1SCDA 4RZUA 1YOVA 1JEEA 3TQFA 1N33B 2QUBA 2RC5A 4JR1A 2WJZB 3HBJA 3QWFA 1E4OA 2GKGA 5B1YA 1DT3A 1JKMA 1SWVA 1UL1X 3GDOA 4J91A 2ETVA 4NCNA 1X87A 1T5BA 3WIVA 1I0ZA 4Y2XA 5KX5F 1OTXA 3AUAA 2J0UA 1JWAB 3OIGA 5IBPA 1V9LA 4JY7A 1RZ3A 1T0PA 3I8XA 5KYVA 5KOHB 4CTKA 1PJ3A 4KX3A 4ZGWA 3KQNA 1ISFA 2GPJA 3CN9A 4RJTA 3IUMA 3I6IA 3M3HA 4KLZA 5HKAA 2FHSA 1JJVA 2KHZA 1E2QA 2P8JA 3DTVA 3IPCA 3OESA 3QNWA 5LCXA 4A91A 4CG1A 3LQKA 4D41A 2VTBB 3E3OA 2A0UA 1BWQA 1HFKA 5CXSA 4BYMA 4E08A 3CLTD 1N2EA 1VKOA 3DO5A 4EW2A 1JQJC 1P5JA 1RR6A 2MYNA 2AA3A 2XUAA 4Q1EA 1T1IA 1J8YF 5ICEA 2JLYA 4HXEB 4UATA 5CPBA 2AKAB 2BGLA 4MW5A 1X80A 1C9JA 4M0FA 4N82A 3TDNA 4ADSG 3OH8A 4HDNB 4XKJA 1Q77A 2D54A 4KN6A 2HU2A 1PT9A 1GPKA 3PD1A 4M8NE 1R6DA 2C2ZA 3WFIA 5KSYA 1JDPA 1R12A 2C2GA 1O1YA 3CVXA 2AE1A 4F7WA 2C1ZA 1I36A 3NU1A 2A3RA 2ZUDA 3H1EA 5G0TA 1WKCA 4K86A 4BMNA 3N8KA 1WP9A 1TQ8A 3OTOB 2R5NA 4M6WA 3FMIA 1M0TA 2UZ1A 2RGNC 3U4MA 1COZA 1U0OC 1SVOA 4JB2A 3COVA 5CFRA 4PYNA 1I80A 2CV2A 2ECOA 4GYWA 3FHCB 4NZ9A 3UAVA 2MR6A 4WCFB 3KC2A 5EXEA 3CXUA 1QZ3A 1AK1A 4QTTB 5EA2A 5LYJB 2DJIA 4LXQA 4B0OA 1PK8A 4LOKA 2B2NA 3KXLA 3SCZA 5K0JA 3DOUA 5LMCA 5A4JA 2EWVA 2QB5A 3OKCA 4J4BA 5HQJA 2HEGA 2YYAA 1TKBA 3CRRA 2COKA 1U63A 4PV7A 2JI4A 3E18A 4DJ5X 4CF6A 2LNDA 1ENYA 5HILA 1TM1E 4BZXA 5K0SA 3AKEA 1Q14A 3UMBA 1OI4A 2PV7A 4Z9YA 5EQDA 5IP5A 4I4CA 5LNK1 2QQ0A 4FN5A 2IXAA 4R9NA 1Z0JA 3CRQA 3K0AB 3WWZA 4AO6A 4UEWA 1E5QA 1EWKA 3GA5A 4OOFA 1LPSA 4UQLA 3TIFA 1ZEMA 3C24A 1SQFA 2QX6A 2X5NA 3ESRA 5LQNA 4DUYB 2Q3BA 3RFCA 3H1BA 1MW9X 5LQDA 3PFHA 4N7JA 4ARZA 5TSDA 3CNQS 4TXLA 1O0CA 1YRYE 1ZZEA 2PVSA 4YAIA 3PPVA 3K9FC 4MEBA 2G09A 4MW1A 3KU4A 1Z56C 4WKBA 3ME5A 2O2HA 3PDCA 2WVHA 1RMYA 4KMSA 2R85A 1E18A 1ZMTA 3B7WA 3ZY6A 4AZVA 1L4UA 2OCBA 1SBCA 5J4LA 3PEYA 1MRSA 3RSLA 1Z5WA 5TEWA 4O2RA 2DHEA 2YVUA 1X92A 5FJIA 4Q9LA 3FSEA 3WRYA 2QRJA 1FUIA 4EG3A 1RQLA 3I2GA 2GXQA 3R3XA 3QNMA 1ZRSA 5ETJA 2FZKA 3TMYA 4BMDA 3I6MA 2FLKA 1UPBA 3DOFA 4BNZA 4MIKA 4YMWA 2X9QA 4PLZA 3DMFA 3D7SA 3MJFA 3R3JA 2YW9A 5G0UA 2C4UA 4ZMBA 1DJPA 1AUXA 1Y8CA 1EUDB 3HYLA 4FYHA 4FCTA 4MKIA 4OV6B 1O95C 2ZTMA 3BMCB 4P84A 2D5BA 2WYHA 5J43A 3AVVA 5LJIA 7ABPA 5JU6A 2IY7A 2P68A 2HTFA 2C8JA 3CWQA 4TT3A 4WNIA 5M7EA 3BWDD 1E3TA 4A36A 3IUQA 1ZGHA 2WAAA 2VQFB 3QFSA 1Z7GA 2BR5A 1J56A 1HORA 2RHOA 3TPFA 2QLNA 1AKUA 1B73A 1PJRA 3PUJA 1A7JA 1VIMA 1OVGA 3R5TA 4FX5A 4Q3AA 4RUKA 4WCDA 4D44A 3MMXA 3BZBA 3NIFB 3AKDA 1TF5A 3LUBA 1XZCA 2NVUB 3FROA 2Q1TA 5BUSA 4DA4A 1WZUA 3OCYA 2J7PD 4IR7A 1MAAA 4TTPA 2EX1A 3UPUA 5B4VA 1YHZA 2FF5A 4L76A 4OGKA 4ND3A 1K98A 1DTWA 1FDRA 3E3MA 1WXDA 4KSCA 1NPDA 2QMEA 3HH8A 5TQ0A 4G01B 3WNZA 4WASA 1NR5A 5K0BA 3E23A 3V4OA 1VXRA 4BWVA 5ELMA 3HU1A 3AB7A 3PG5A 3HO6A 1KJQA 3PYLA 1MAVA 3KYCB 4G41A 4LMPA 4WQMA 3JQQA 2I66A 1QHGA 2GASA 1O6CA 2V58A 2G63A 2I7DA 1LBQA 3JAWA 4JEMA 1COWD 2WD7A 4X7MA 5JS7A 1Y6FA 3FMOB 3FZYA 3ON5A 3U3JA 2ECKA 2FMKA 3I4LA 1SZCA 1TVMA 2DETA 3JV7A 3G9QA 2GEUA 1V8BA 3M6AA 4LUCA 3W2FA 1HO3A 4HQRA 4N01A 5ALOA 4C21A 4DLNA 3G8YA 2JFPA 3B1XA 3H75A 1OI7A 1GGMA 4W5HA 1QX3A 4S12A 3U7QB 2HHCA 4HH0A 4OI1A 4DDVA 7ADHA 2JBAB 2GHTA 2R2GA 1R3DA 3GF4A 3RBXA 3GLGA 5EMHA 3LSTA 4J9UE 2DQ4A 2GXSA 3NAGA 4H3SA 2EJUA 4PG5A 1B6GA 3CVJA 4Q18A 4D3YA 5ITVA 4HNRA 4NULA 3PFIA 2FMTA 1US8A 1JEAA 1ZD3A 2WICA 2XJ9A 1CS4C 2IYVA 3KDPA 3OWHA 5CX1A 2ZTUA 2PL5A 3K5IA 1Z88A 5K0TA 4C5BA 4MMZB 4X1IA 4CLDA 2X77A 4EB8A 1A96A 1S2LA 2O7RA 1UJNA 2Z08A 3UHJA 2I7CA 5JYEA 4LZAA 2FWPA 5ILGA 1IXYA 1EWQA 1TU3A 4O29A 4PRKA 4XAQA 1QO9A 1N92A 2AG6A 2PGOA 1AKMA 2Z6UA 4BOYA 3GNTA 4L6IA 3DW1X 1AUQA 1RAEA 1TW2A 2JD0A 1Z6AA 4RXMA 3VSBA 4RM2A 2FEKA 2LCIA 3DEKA 4NMHA 1KBOA 1QAMA 4YNBA 5CURA 1M6NA 1RQ2A 1QOQB 1LJ8A 1Y8QB 5K3OA 4KTVE 5KX5A 1ZC3A 3CR8A 4IVPA 5BVHA 5LN1A 4GLFA 2YZKA 1AO0A 2C5FA 3MUNA 3B7GA 3M9LA 3QY0A 3DAHA 4YVFA 4BYGA 1SK8A 3G85A 1NXSA 3ZV7A 3U0VA 5JAHA 5LMZA 4RPJA 1VSTA 2GZ2A 3IVGA 4WUVA 1MO5A 1T1RA 2Y0CA 1IK4A 4IHQA 1UOQA 3DJYA 4CKEA 1PG5A 4G81A 5TPZA 3A6DA 1RLOA 2GRAA 3A04A 1NJ6A 4DCOA 3K0EA 3ZJ5A 1U28C 4XRRA 1SXJB 1I8TA 3QEMA 2ZIEA 1RAFA 4YRRA 1G4HA 2ZRFA 5KMGB 3NHFA 4DLXA 1M34A 3OZGA 4XSGA 5DPMA 1II8B 5A6VA 3FGZA 3KE8A 3MSXA 3KHTA 1W30A 4IV5A 1Z63A 1HNWB 3PRYA 3SR4A 5EFOA 1U65A 3CLKA 4MUYA 1DAFA 2X8WA 2ZJ3A 1PYGA 1UQRA 2B1RA 2XIQA 3HZZA 3JVVA 4MQEB 5I7AA 1ZGGA 2TRSB 3DL0A 1II9A 2DUMA 1PF7E 1UMCA 2E5WA 3N05A 1JFFB 1TZKA 1L4HA 2A67A 2AMJA 4LCEA 4O8CA 4PAGA 4V3BA 3REQB 5DHRA 4B7AA 1GGHA 1X8JA 1DT5A 2C9OA 2WK1A 2ZAIA 3DR5A 2C9YA 3H9UA 3OM0A 2C2XA 2QX4A 4G2NA 4RSHA 4ENUA 1J22A 4PG6A 1H4QA 3HC7A 4YBZA 3LCJA 1RPZA 1N6NA 4L85A 4LYGA 4RDHA 3E82A 1MB0A 3IAHA 4OUKX 1P4JA 4LYEA 4C7BA 4F3KA 1OBOA 2V6GA 5IABA 1KGSA 1W5SA 3RG2A 4GX0A 4BFUA 1OZFA 4MPDA 5EIOA 3STYA 1T3ZA 2NNLD 1UEIA 1JDTA 2UUOA 1ODTC 2NADA 4PPFA 1PR6A 3CZ9A 3PIDA 3QJ5A 3QW4B 5H68A 2DWPA 2FGJA 4M55A 1OTHA 3EVTA 3L4BC 5F23A 4Y7DA 1U7OA 4W63A 3PQ3A 2PVPA 3UCFA 3GUZA 4JP8A 3T5MA 4C05A 4DR6B 3GXBA 1KH1A 4CBVA 1HTTA 1L4EA 2D8MA 3WMRA 1Y4ZA 3KLBA 1H2YA 2WNIA 2MSCB 3KTOA 4M9SA 4YUZA 4XJSA 1JHDA 4HB4A 2AFIA 1LZKA 5CEFA 1P91A 5KTYA 3NHMA 3QLUA 4FX2A 5F7JA 4BATA 4H16A 3HACA 1XTZA 4ZYLA 1NSTA 2EEZA 4MW0A 1WSAA 2TECE 2IUYA 4IS2A 4QPCA 5JFTA 5FBHA 1XNGA 4E1BA 5JAUA 1M2JA 3SFTA 3U16A 5A5EA 4QOIA 5EVJA 3WNVA 1UBSB 3HB1A 3N6VA 3TWOA 4R1LA 2XJ4A 3WGLA 1NI4B 3LGSA 3ND6A 3MTJA 5C5CA 3UAYA 1JE0A 3MOSA 4RV5A 4HQ6A 4RPGA 1GFIA 1IBSA 3TZ6A 2Z83A 2ZRIA 3OUZA 1A8UA 4L5BA 1Q1GA 4MUHA 4YP5A 1HH4A 2QL5A 2NU8B 3HU3A 4F84A 1TO2E 5DI3B 4A5SA 4N41A 4OA8A 4Y1RB 5FHRA 3KAQA 1IH8A 4QM7A 3DS8A 1IMJA 2P5TB 3CRVA 4G65A 4JLAA 2AX4A 4I8XA 1B16A 4NOMA 4QTXA 1VLJA 2HLHA 3RUFA 3I62A 1L9XA 1OOEA 2WWRA 3A4TA 1CU1A 1W1WA 3CUTA 4M99A 2WV7A 3E6AA 1OAKA 4CN8A 4KWIA 3ZWPA 3O8LA 3QV1A 2VUTA 3NBYC 3DHVA 4X00A 3HB4X 3OQ1A 3ZQKA 3EFOB 3J7AC 1PJ8A 4QG7A 3ZTWA 3RFTA 4MJ3A 1MAUA 2KW5A 1G8HA 1LVGA 1E3QA 4ITRC 4Y2TA 1LA2A 3HFSA 4RMHA 2BMAA 1UPXA 5AK5A 1RABA 1I7NA 4KQMA 3AVTA 5B4UA 3U3DA 5D3MA 4P3XA 1WF6A 2EW2A 1GPDG 2X14A 1MAWA 1WPQA 3I9FA 3KJXA 4QSHA 2DR0A 1TEZA 4CEJB 2IOYA 3FCSB 2HA6A 1K2WA 5KSOA 4G85A 2OYCA 1BWSA 1SEPA 2C77A 4CHTA 3K31A 4JBLA 4EA7A 5CA1B 1OT5A 1DAKA 1FBTA 3Q10A 1AGYA 2X5XA 3UT5B 1FF9A 2PUHA 4DM7A 2BC9A 2CZGA 4IOKA 5CU7A 4KVAA 5AXBA 3BREA 4C76A 5K8JB 1S2IA 4H59A 5HJEA 3L41A 2G08A 1H0KA 1TJ3A 1WKBA 4HAWA 5AW8A 1M0WA 2GD0A 3BE5A 3D4BA 1YZYA 3BK2A 4MGHA 3D0KA 1J9GA 4UBNA 3WWPA 3ZGOA 1VRCA 1A9OA 3FPLA 4U00A 2R4QA 3ZLUA 1IMOA 1II0A 2NVBA 2RGXA 1K66A 1L5OA 2P62A 4PX5A 1RFLA 1RQGA 2GZAA 5EIFA 2NUTA 4PZUA 2CL7X 2PWYA 2O8EB 4BV9A 4U7DA 4CCYA 3LLCA 1KVUA 2VA9A 3G8AA 4QFMA 3FLAA 2ZXEA 1W2HA 2RONA 5BWLA 5BMVF 1ZCFA 1NHWA 2PZAA 4YCCA 3D2CA 2VK8A 4BRUA 1IEVA 4Q3CA 4OB8A 2X19A 4X85A 2DT8A 1IOVA 3QQ5A 2HM7A 2XV1A 3OQ6A 1W88A 4AY6A 3AG6A 4FW8A 4IXMA 1WVGA 5AKIA 5JD6A 4MYUA 5ERXA 2WQ7A 4HZGA 3D43A 3IR6A 4B3XA 1F0NA 1JPUA 3RIMA 3FD8A 4LKOA 1BQ3A 4LDRA 2G5PA 3EUWA 2JEYA 1NXTA 1DEXA 4TTSA 3NW9A 3T94A 3VPGA 1JFFA 3REQA 5DNUA 1N77A 4WKPA 3ETLA 1Z35A 2O5EA 1NNLA 2MYPA 4MS1B 1VZ3A 1PK7A 2IYYA 4B1FA 3OQMA 3Q3JB 2PUWA 3REGA 1G6OA 3GRYA 3WB2A 2WWXA 1FYFA 1P3DA 1SVMA 1HI9A 4GSLA 4EJFA 6PFKA 1YR6A 3NBQA 2QAJA 2KLHA 1MTZA 1GYRA 4PWZA 2QQ5A 1FDWA 1JDBB 1P9LA 3CH7A 5ALXA 1NN1A 4MITA 5BQFA 4CCAA 1TCCA 1YZUA 4QGBA 4DG5A 2PRSA 3IMEA 1AV7A 1VB5A 2ET6A 4BB9A 3INGA 1JT2A 3WGHA 2DM6A 3SZ3A 4LXHA 4RBNA 1SXPA 1HR0B 4P5EA 1N6RA 4X71A 4EX7A 1Q7CA 2PYDA 3JZMA 3K6JA 1WW8A 1Q44A 2WMYA 4EPWA 4Q1BA 1GZUA 4I14A 2Q7OE 1E0KA 2NTNA 3MIIA 4ZQGA 3T7IA 4ZDWA 2EKQA 4MKZA 3SQDA 4F85A 3LUPA 2GLTA 2JJMA 1NR1A 4KQKA 2J07A 1HQYE 3P9PA 2KI5A 1U3VA 3R7WA 3O2SB 4BV2A 3SIWA 3SHTA 1QVZA 1EFTA 1RPNA 1TDJA 2V9PA 2WTNA 4RMJA 2PUAA 5K2OA 2BUBA 1P9NA 2X4GA 3C15C 3HY4A 4S1NA 2PNJA 1JJFA 3RABA 3M6MD 2GOYA 1XTUA 1I2DA 2ZRQA 2IELA 1TADA 2HMYB 1MOSA 1VC2A 5C80A 1R15A 4XEUA 3RS7A 2QZJA 2ZKIA 2Q2VA 3NIBA 4B80A 2CMHA 3RSGA 2QYSA 3CA8A 3OJLA 4YRAA 4INAA 3H4TA 3OJWA 5HM6A 2VJOA 3KKZA 3WLLA 5C7YA 1ZP6A 3T99A 1PJCA 3W6PA 3UV7A 4KR0A 3M3PA 2XQVA 3EB9A 4MR9A 1GDHA 3T6KA 3C8DA 3W5HA 4H6PA 5L7TA 4CPDA 3G79A 3K9BA 5EWJB 4YQZA 4QTYA 1OZAA 5FUQA 3X44A 3WO0A 2GFQA 2KMLA 2PKWA 3JQRA 1ZCBA 1SAYA 2CDNA 4OREX 3HVJA 3WLIA 4DQUA 1G8PA 3W90A 1J7JA 2WDPA 4JB0A 2FPGB 3DCJA 3PEFA 5AKKA 4ZV4A 3L6BA 1YI1A 4G5SA 3UJPA 4ZDJA 4RLHA 1BS9A 2OCIA 1JHZA 4Y2UA 1IBKB 4L51A 1W9MA 3I01A 4KYUA 1S96A 2GF2A 1JI3A 2CVPA 4IRUB 4ARUA 1NVVR 2BM1A 3AJAA 3LUJA 2CUTA 1P2BA 1H8ED 1Q83A 5CGZA 1CUYA 1P2GA 4RYLA 3RYHA 3PEEA 2FW7A 2JIRA 1PNOA 3A1TA 4ZARA 3WZLA 5E6UB 2H1OA 4ANFA 4UNSA 3A9VA 2OZPA 3X1XA 1U28A 2ID4A 4CEHA 3QLVA 4CF4A 3GJRA 4I3GA 5CW1A 4YV1A 1D4ZA 1T43A 1T9HA 5KWJA 3COPA 2QT0A 4GM1A 3GEGA 2B1JA 3JYQA 3THYA 4FNGA 2W0SA 4D43A 1I4WA 3HYRA 4C7OA 1WJGA 2GF0A 2FPKA 1EFCA 1OAOA 4DR2B 1QMPA 2VQ3A 3BB1A 1BE0A 5E7JA 4JBXA 3SBDA 3Q3CA 3UA4A 4EY6A 1WLYA 1C0EA 2Q21A 1GCUA 4L8WB 4QA9A 1FNNA 2OXEA 3CLSD 4R0MA 3PDIA 5K4GA 2JARA 4D96A 2R7NA 2XCTB 1P4AA 3EMVA 3Q0TA 2V1UA 4CFSA 4C3VA 3K70D 1CEYA 1I14A 2MINB 1E3SA 2QM7A 2VP0A 3F6RA 4NBLA 4YP6A 5IK2D 1ORIA 4BRWA 4ZI7F 4BNXA 3V34A 2FEPA 2E4YA 4IYJA 1GD1O 3PQ8A 1SM4A 1IM8A 4B9EA 1B2LA 3AV0B 4L08A 4N0PA 2A0WA 2PS3A 3GIWA 3NEPX 1QFYA 3U3MA 1AK2A 2HWUA 3GMSA 3LP5A 5F4ZA 4ZVUA 2J87A 5LXTB 3RK4A 2DLCX 3P8ZA 4BN5A 2YV1A 3GU3A 4MVXA 3UJAA 4W9MC 1T4CB 4EPYA 3RF7A 3VU9B 3RWBA 3KPWA 2JHCA 3P9ZA 3DEFA 2CLEB 1DKPA 1KJYA 1VMKA 1Z5GA 2O3UA 1I1OA 2O8VA 3A1UA 3EQ8A 4N6OA 10MHA 3TQRA 3CRNA 4X66B 3SF0A 5JCPA 2J9RA 4A0GA 1J20A 4DMFA 4IIJB 4JI8B 1Z0UA 2TMKA 4NDNE 1QIJA 4AMBA 3ZD8A 1MHPA 2XHZA 3QLUC 4OUDA 3PI7A 1AV6A 2WFMA 4G4GA 1LBEA 3FETA 4Z3DA 5BYJA 2F4VB 2NUBA 3HRHA 4FFNA 3HGTA 4KP7A 2C42A 1YVRA 2CVFA 4XLZA 4C88A 3HVIA 1UXJA 1QP8A 2HBYA 4YBRA 4EATA 2BGWA 4N0EA 5C31A 1ADGA 1LCIA 4C4AA 3DGEC 4Z51A 1GNSA 3D3JA 3PXXA 1OAAA 2WOJA 3KHUA 3QKRB 1H1DA 1KAHA 3WL5A 1GCOA 1IULA 3I4FA 3UWKA 4XUEA 3UYLA 4D80A 5DBOA 1LPBB 2AR7A 3PJFA 3FTPA 5HIAA 2JW5A 5AK6A 3GWZA 3L77A 3OF5A 5DH9A 4ESOA 5BV2P 4YREA 1O94A 2GERA 1DXYA 2ZSUA 1JGTA 5EHIA 3OJXA 3FR8A 2H08A 3K2QA 4LE1A 2MCFA 3ZCTA 3PJDA 2G25A 2J4DA 1K6IA 4O2AA 1J00A 2RCNA 3N76A 1OXBB 5F1PA 5LYJA 5HW0A 2HJRA 5IJ0B 2PR2A 2HSGA 5BUCA 4PPNA 3KOUA 2L0XA 4CIYA 3K0SA 3GNQA 3RBZA 5JJIA 1CSEE 3RVOA 3ZDCA 4E32A 4CM1A 4UPDA 5LPNA 3OX3A 2SHKA 1J2YA 1DEAA 5JAIA 1SKBA 3TL6A 2QNRA 3FX2A 3GC6A 4QUEA 1I5RA 2OAQ1 5EP3A 3N28A 5A2GA 5BT9A 5JBIA 1ZVMA 4JLJA 2W43A 3AY3A 1GYQA 2WJGA 3QEOA 4KK3A 4HWSA 3FPHA 4UUNA 1TQHA 2XZTA 3WYDA 5JNWA 1B6SA 3M89A 4LQCA 4OXRA 4QPDA 1BS1A 1CERA 1W46A 2P3SA 4BEVA 4KDEA 2XUQA 3LU1A 3MGCA 4CM6A 1YR1A 4FFDA 3GPLA 3TX6A 4GG1A 2VJMA 2OYRA 5A5DA 1OA1A 2FPGA 3N74A 2QOEA 3VVCA 2J9YB 1KAGA 1PL7A 3KPVA 4L3OA 1PJBA 4X1YB 1SHUX 5NLLA 4O4JA 2ACEA 2VHZA 1JTEA 3IRUA 3NTXA 3BRWA 5CVTA 4E7PA 2WF6A 4K81B 1TTPB 4L3WA 3G2NA 1H6BA 2WJVA 4PN7A 4JYBA 3RFFA 1GLNA 3DYVA 4EI9A 4ZN6A 3LJKA 3NJ8A 1RFGE 4LJRA 5FLEX 1TUEA 4WSOA 3ZHQA 3ZWAA 1L4NA 3H1FA 4BNIA 4F5YA 2FF7A 4AMZA 1SUBA 1TJ5A 3H9QA 1NBAA 3R20A 1USVA 3K35A 4COOA 2VYCA 3I0ZA 3TRHA 2IUFA 4XX0A 2DE0X 3V4ZA 4ZAYA 3O1IC 5DRTA 5KOIA 3IGFA 4IZHA 4BP8A 4KAFA 5IM4F 1KE1A 2IE0A 2CN1A 4NHEA 4MKXA 4B46A 5CK5A 3FDZA 1Q3KA 4ZRDA 3NGMA 3QV2A 3WB0A 1XJ5A 2XY4A 1Q3HA 2ZYVX 2INGX 1IZZA 4MS4B 1PVVA 2CYAA 5LOVF 4Q21A 1Q15A 4DLAA 2FPRA 2VBIA 3C6BA 2FPPA 4TKVB 4A7PA 2BFCB 2B0CA 5EERA 2QVYX 1ZCJA 5K05A 1E1CB 1SHJA 1VBFA 3T35A 2DFTA 2GESA 3I0NA 1U4NA 1BNCA 2C0CA 2GEVA 2Z30A 5KHLB 1ZLYA 2FSVC 4AZ3A 1EHCA 2FB9A 4KIUA 2X7JA 3NORA 4R1OA 5CD9A 3J81k 1VI2A 2XUIA 3BSFA 3I9JA 3OUUA 4EBFA 1VFNA 2GB4A 1GKIA 3L01A 1Z6PA 3HR7A 4YCBA 2WF9A 5P8WA 1BVUA 4IDAA 5FPQA 4HAOA 3SE7A 1U8XX 4A23A 3NKVA 4US0R 4D4LA 3L4BA 2PIDA 2Z43A 2ASVA 4KE9A 1KMMA 1Z06A 4I8IA 3HXOA 3PHCA 4XB6B 521PA 3NIDB 4MWZA 5M5BA 4JWKA 1V4BA 4E5PA 4OUDB 1QC5A 3BMXA 4JOBA 5B53A 3WYNA 4ZDIA 2XADA 5ES3A 4FFPA 3IDFA 5JH7F 2VN8A 3P52A 3U4CA 1Q1BA 1G2IA 3S68A 3C98A 4HTFB 4LF4B 2QTLA 3B6MA 1VA4A 4BBAA 3E1KA 4D0SA 1KZ4A 4IOLA 1DX4A 3ADDA 2VKTA 4D5EA 3CN7A 5IXYA 3FDXA 3O3NB 1LLQA 3ZVKA 4MW7A 5CGQB 1WEKA 2HT1A 4PHFA 1PLKA 1P17A 5C7IO 2C0PA 2YYZA 5IWAB 4P3PA 1RJEA 1FLVA 3BH0A 4EHNA 1T2CA 4QC2A 4C07A 3SQNA 1T5IA 1EXVA 3VKGA 4D3XA 3OEWA 3AFIA 3S2EA 3VTKA 3LFHA 2P9EA 4GWLA 4N12A 4DAEA 2G4CA 4GUAA 1PHRA 3HMKA 3CZRA 1D4AA 2M6RA 3AIMA 4F2HA 1V39A 2O52A 1E69A 4EHIA 1GXSB 1I3LA 1QE0A 3ND9A 3WQHA 3AF4A 3NOVA 2C3YA 2BHSA 5ELLA 3CLHA 3QKIA 1Y3BE 1W0JA 4JT2A 1T8SA 4L73A 4M7RA 1TA4A 3G49A 1U8FO 4WA7A 4DADA 2FNAA 3D8TA 2HWKA 3BCSA 4URZR 2ODAA 3TSWA 2PHZA 4C78A 4DY6A 5A02A 1JU9A 2C97A 2LGJA 2Y77A 3PJGA 3PUYA 3IDOA 5JSKA 5DWDA 2IWHA 3TR6A 4BL5A 5JDIA 4MHTA 2YV4A 4H3VA 2D13A 4YFYA 5I01A 1FX0B 2PNFA 3HKCB 1A9RA 2HT6A 3NCHA 3VI4B 1NW8A 1E2GA 2WD8A 1IUNA 2P9TA 4JVMA 4LF6B 2ISSD 1EK0A 4R16A 3H1TA 3N6XA 4H27A 1LLCA 2WTBA 821PA 1V2HE 2QYTA 3LC1O 4O4JB 4S2UA 4QJ5A 4H18A 3E9MA 2QQGA 5DNEA 2GCOA 3KXKA 5AVQA 5BQ5A 3QGMA 3NHLA 4UU8A 4PR3A 3MGAA 1OHHA 3CY6A 4OQZA 3F6YA 1UM8A 1XRSB 4RA6A 3DD1A 4K9OA 3JWHA 4J1NA 4P53A 4LTDA 2HV8A 4OCZA 2YXEA 1SC9A 3LLUA 5ADUS 3K73O 3N8GA 4KB5A 4NNJA 4ZHQA 2YY7A 2A9PA 3JZIA 4JI1B 5A62A 1KI3A 3QJGA 2PQ0A 4FINA 3OQBA 3QLVC 4FT2A 3R7BA 4F6RB 3X3HA 3CCBA 1FSPA 1JKFA 1OHHD 2KLBA 2WKPA 1CNMA 1EH5A 2VUHB 1TVKB 3DE6X 5K6AC 2X8JB 3TRKA 2LPMA 4BIMA 3TCNA 1KGDA 4BX3A 2PX5A 1PUXA 4PYRA 4M37A 3HN7A 1TQ6A 1CYEA 3OC0A 4YCMA 1KXZA 1KAEA 1DBWA 1FFGA 3PA8A 4OXNA 1T9DA 1UMDA 2IVZA 4QL3A 4GPBA 3GLSA 3AGPA 1QNLA 4YP9A 2DCMA 2AG0A 4IXTA 2WZBA 1NP3A 5K0NA 4PANA 4Y18A 3WP1B 3Q8XB 5KKNB 2DQSA 2ZYIA 1YHYA 3PHBE 3CT6A 5C52B 4R40A 3KKKA 5LUBA 1KZ9A 1ESCA 4J3NA 4IS3A 4BQEA 1OILA 3EA4A 4RK0A 3IPRA 2UZ0A 1N2JA 5CDGA 2P7IA 3JYHA 5KZMB 2O7QA 4KNYA 4BKQA 2IHNA 1SCQA 5C8YF 1YB5A 3KE9A 4Q6BA 1YDGA 2EZ8A 2H1VA 4MUXA 1HYHA 5T8KC 4EHBA 3FGNA 5KNCD 4UHDA 1ZK0A 1YAHA 4K26A 2JJYA 3VV3A 4E88A 2D5CA 3NHRA 1UZNA 3KEGA 1IBLB 2ZCVA 4G1UC 1OWPA 3O38A 3FUCA 1SBIA 4BO7A 1LRJA 1CR2A 3FXAA 1DOHA 4HDOB 5DE3A 2ZRLA 3VH4A 2Y1DA 3CBQA 4FLMA 1ZVVA 1A5BB 3OCWA 1V8OA 2HMWA 5JH7B 1RAIA 3K0FA 2YWEA 4P4LA 4QDTA 8ADHA 2Y0DA 3NNSA 2CCKA 5EGNA 1QIMA 1RAGA 2C78A 1NYLA 2PLFA 4IHJF 4UARA 4X91A 3WBKA 3ZCRA 5I4CA 3E27A 3PE4A 3TNDA 3IEUA 4UHHA 4XYMA 3GP8A 3LOUA 3BVPA 2JZCA 1A95A 4YO7A 2J45A 1O5TA 5LZ2A 1UPUA 1H1TA 1BCRA 3JD3A 1Z2CA 3JTEA 1DAPA 3IBYA 3MJDA 2ST1A 5AHWA 3OHMA 3DBRB 1BCSB 1NQAO 4MQ6A 4XR4A 4KX5A 4BDSA 4EJ0A 4BRZA 4YGXB 1BHQ1 2HQBA 4U4AA 4TYWA 3A0RB 1FIUA 2X3FA 4YIHA 1OH7A 4LV5B 1NXQA 4M9CA 4BN4A 1FYWA 3VR5H 1MG5A 1D2NA 1OC2A 2OHFA 5ER9A 2X86A 3OMLA 3KYIB 5IT5A 5KPDA 1NMZA 2H1SA 3T1TA 3LBAA 2O8DB 4XCXA 3VNBA 1DIHA 1UBEA 3ANSA 4ZT4A 2R6FA 4BTVA 4LOHA 4UFPA 4BGDA 3IUYA 5G3YA 3L0DA 2AK2A 2QZPA 4IHAA 1R3UA 3AY7A 4Q9IA 4DV4B 3WIDA 2Q9CA 4HX2A 4I6JA 3PNOA 3VOSA 3AI7A 5IN5A 1G8MA 2VEDA 5I7WA 1POWA 3KNZA 3U7EB 2NQ8A 1L7PA 5FH9A 5MFPA 3WDKA 1DQSA 3L9WA 2HA5A 3L1VA 4INPA 1XZFA 4NE9A 1IJFA 2JCBA 3LGAA 1WXHA 2JI6A 1Z16A 3VYVA 3T9BA 1VA5A 3KG2A 4RCZA 4G0UA 3GCXA 1KEPA 2ZS7A 2VDVE 3L6RA 1GTL1 3AEKB 2OWEA 4QPPA 3RREA 3ZU2A 2RK4A 2OCXA 4IWXA 2VFAA 4Z0PA 3RAPR 3OQNA 1PJZA 1U1GA 1F2VA 3BJEA 2ADMA 4RAOA 3EY9A 3TM4A 1E0JA 4FB4A 3C5CA 1MLDA 3MS4A 3DV0B 3LY8A 3EVGA 3A1EA 4MI1A 4OHRA 1LLFA 4QEKA 1VIAA 4QOHA 4ZVOA 5DBFA 2IZ6A 3D1LA 3G0DA 3LRPA 1QIDA 4QELA 4I4TF 3TR5A 3UFBA 1R6TA 2YWRA 1ODKA 1G17A 4X62B 5THXA 5GVSA 2JFXA 3E7WA 2IYFA 3L0YA 4WCVA 1NVBA 1HDOA 3NO4A 1H94A 1UMKA 2GS9A 3C7AA 2A7QA 3B2NA 2AQ8A 1XN4A 3E7PA 4XH9B 2FHPA 4ONEA 3SXJA 1U7WA 4AJPA 3K16A 3TD6A 5CT4A 4MKHA 4Y0VA 4WN3A 1L7AA 1R5JA 2PGNA 4RHFA 5SYAA 4JC0A 4NFLA 2F67A 4KOEC 1KDZA 1FNBA 2BFEB 2IYOA 3ICEA 2YY5A 2BGGA 1NG9A 3AK4A 3V46A 1AN9A 4O4IB 1E3IA 1UC4B