1T5BA

Structural genomics, a protein from salmonella typhimurium similar to e. coli acyl carrier protein phosphodiesterase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
201
structure length
199
Chain Sequence
b'MSKVLVLKSSILAGYSQSGQLTDYFIEQWREKHVADEITVRDLAANPVPVLDGELVGAMRDAPLTPRQQDALALSDELIAELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGITFRYTEKGPEGLVTGKRAVVLSSRGGIHKDTPTDLIAPYLKVFLGFIGITDVNFVFAEGIAYGPEVAAKAQADAKAAIDSVVAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein phosphodiesterase
publication title 1.4 A crystal structure of a protein from Salmonella typhimurium similar to E. coli acyl carrier protein phosphodiesterase
rcsb
source organism Salmonella typhimurium
molecule tags Hydrolase
total genus 74
structure length 199
sequence length 201
chains with identical sequence B
ec nomenclature ec 3.1.4.14: [Acyl-carrier-protein] phosphodiesterase.
pdb deposition date 2004-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1t5bA00
2HNAA 3ESZA 4PTYA 1KBQA 2V9CA 3W77A 4GI5A 1SQSA 4U7GA 5FUQA 2FDXA 2Z98A 1BU5A 1RCFA 4ZVMA 4LAFA 2QMZA 4FGJA 3O73A 1YDGA 5LBTA 2FVXA 3OJWA 2MWMA 2GSWA 1GG5A 5LLDA 1OFVA 1CZRA 2HNBA 2QR2A 4C0XA 2WC1A 1J9ZA 4H6PA 4C14A 5B3KA 1CZHA 2XOEA 5F4BA 1E5DA 1AKRA 1AG9A 1YCFA 1V4BA 4ZVKA 5LMCA 5LVAA 2MOKA 3OJXA 1AZLA 5LJIA 1J9EA 3N39C 2FZVA 1WSBA 2ZKIA 1ZWKA 5LJLA 2BPOA 4N82A 4QOIA 1FVXA 2FZ5A 3FVWA 4HS4A 3TZBA 3O2NA 3B6MA 5EAIA 2V5VA 2QX9A 3QE2A 1T0IA 2BN4A 1DXQA 3GFRA 3SVLA 2FLVA 3GAMA 2M6SA 1JA0A 2N1MA 3L9XA 2MT9A 4J8PA 5F12A 1QRDA 1RTTA 3JSXA 4F8YA 4NULA 4XDGA 3ESYA 2RG1A 2Z9CA 4LTDA 1DXOA 3NHYA 3OX2A 3NHRA 4Y9RA 4XDHA 3NHJA 3OVMA 4Y9UA 3D7NA 1YRHA 3FX2A 3KLBA 2A5LA 4LA4A 1QR2A 1ZWLA 2QX6A 4Y7CA 5BUCA 2Q62A 2QMYA 1X77A 1OBOA 1XT6A 1WSWA 1XYYA 3L9WA 3HA2A 1AKWA 4M0CA 1FLNA 4ESEA 1RLJA 3P0RA 4H2DA 4QOEA 3W7AA 1FTGA 3GFQA 2FOXA 1T5BA 4PU0A 3NHUA 3OWHA 2KQUA 1H69A 4DY4A 3ES9A 4DIKA 1B1CA 3W78A 4R81A 3W79A 1SG0A 1NNI1 3NHFA 1CZNA 1H66A 3G5MA 3NFRA 3OX3A 4NLLA 1RLIA 4ZVLA 1FX1A 2HPVA 3NHWA 2FCRA 3NHKA 1CZOA 2AMJA 1CZUA 3NHLA 4YQEA 2W5UA 2R97A 3N3BC 1FLVA 5LBUA 5ULLA 2KLBA 3NLLA 5NLLA 3UXEA 4CETA 4YAUA 4N9QA 4HEQA 3F6SA 1FUEA 3UXHA 4C0WA 4S24A 4YAOA 2QWXA 3R6WA 1AMOA 2FAXA 3QFCA 5FX2A 3F2VA 4FGLA 2Z9BA 3TEMA 1OBVA 1XI2A 2ARKA 3U7IA 4GQIA 2B3DA 4C76A 1DX9A 3K1YA 1VMEA 4FX2A 3FNIA 1JA1A 1CZLA 2D5IA 1KBOA 1TLLA 3TE7A 2FX2A 4YAWA 3NHPA 1CZKA 2BZSA 5JROA 4YAFA 2OHJA 3B6IA 3N3AC 5F51A 2XODA 4LTNA 1AKQA 2Z9DA 5FA6A 1ZX1A 4QOHA 3NHSA 4ZVNA 1D03A 1YKGA 1AKTA 5A4KA 2X2PA 2OHIA 2Q9UA 3LCMA 1YOBA 1YCHA 3LT5A 3B6JA 2M6RA 1C7FA 3KEGA 2R96A 1D04A 5EMNA 3QFRA 1D4AA 2QX8A 1XYVA 3HLYA 2MTBA 4GR9A 3U7RA 4QOGA 1TIKA 1QHEA 2V5UA 3F6RA 2F1OA 3KAPA 3FJOA 1AKVA 4PTZA 4BMOB 3OX1A 4QOJA 1BVYF 3RPEA 1F4PA 6NULA 2BF4A 4U7FA 2BMVA 3EYWA 4FGKA 2QX4A 4QODA 3ESXA 1AHNA 1FLDA 4OXXA 4N65A 3GFSA 4U7HA 5NULA 5EA2A 2OYSA 4D02A 4YALA 4BMPB 3FW1A 1YCGA 4LTMA 1J8QA 2X2OA 3HR4A 3F90A 3OWXA 3B6KA 1C7EA 3EDOA 3KAQA 2OHHA 1J9GA 3S2YA 1I1OA 1AKUA 5TGZA 5B3LA 3K20A 3ZHOA 4QOFA 4DILA 1QBGA 1FLAA 4CF6A 4ICIA
chains in the Genus database with same CATH superfamily
2Z5LA 5I7AA 5KI6A 1A3CA 4ID9A 3FTNA 2WAAA 3ZZMA 4Z0HO 1J09A 1LI4A 3RNLA 5EJIA 2CLSA 4YMTA 3A1VA 4MV1A 3ZZ1A 1TZBA 2PLWA 1Z16A 2P2DA 3A3OA 2JIDA 4FJ1A 4ZP1A 5JYBA 1ND5A 1RWXA 1RFGE 3F47A 4ZVQA 2R6DA 4YAIA 1R0SA 3GH3A 2XUPA 4F8EA 5KKNB 3VO1A 2GEKA 3L7KA 4K81B 3PHJA 5JVDB 4A8TA 1KR5A 2GBIA 3LKDA 2CMHA 4RZXA 2JCBA 3PDIA 4LJ7A 4IICA 3JQ9C 1QU2A 2HHLA 3VZCA 2Z58A 1JHPA 2BOVA 1L9XA 1NXPA 3M1AA 4FZ5A 2RB4A 4IJMA 4TVBA 1ZHOA 1VGVA 1CJSA 3NJ8A 3R7LA 2RARA 3FOZA 2DPXA 3GRCA 4WKPA 2CLHB 3M49A 5A4AA 3HB5X 2PRSA 2YH2A 1BXZA 1X6VA 4RX1A 2QMZA 2XNSA 3ANNA 4RW0A 4CIYA 1MV5A 4FGJA 4UBNA 3T1OA 3G2HA 5AUQA 2BJVA 3UMJA 3TQCA 3U4QB 3A9VA 3FROA 2XT6A 3T7DA 1XPJA 5BOSA 2AW5A 2QLMA 4PC2A 3HP1A 5FUYA 1Z6AA 3SIWA 3ELYA 4KQCA 4PX9A 1ORTA 1TM1E 4RYDA 1GPJA 4FT4A 1Y5NA 3HCDA 1KZHA 2O8BB 1OAOC 2UZ1A 2CYBA 4N3CA 3TQFA 4ENSA 5FUWA 1GYQA 2AJTA 2WJWA 3BS4A 2G77B 3WLEA 5U4QA 4DNQA 5BN3B 2VNHA 1DJMA 2OV3A 4MEAA 1IXSB 5FR2A 2C20A 5DJ5A 3N53A 4G4JA 4PZUA 1OFGA 1AIPA 3ZLVA 3WBJA 3H1GA 2F1JA 3WNCA 1JI0A 4JJKA 5KTPA 5LXTB 4BP3A 2YS7A 1ZL0A 4YCCA 4C4PA 2ZLBA 2II6A 4YBRA 3PHGA 4QBHA 1C3XA 3U3ZA 4BNJA 5DNYB 3LOPA 3N28A 2A9PA 1HX7A 3K1AA 5JI3E 3GLUA 4X20A 1DBSA 1S5PA 4FFNA 3PQ3A 1PG0A 3DWGA 4Q5IA 1HOTA 4EKEA 3CZMA 3IVXA 4TT3D 2YQ4A 1TVMA 2Q5LA 1UWVA 3VU9B 1ZJ6A 2HWKA 1SCUB 3WLPA 2AR0A 5B7NA 4GZ6A 3GOHA 2SCUB 2Q5JA 3OPYA 1X0XA 1W1UA 2XDYA 1UXKA 3AR9A 3EVEA 4XXHA 4YMUA 1PK9A 1TK2A 1PJSA 5H68A 3STHA 3O3NB 4I9HA 3A9WA 2IYVA 4G8BA 1AM4D 2ZDQA 3FDIA 1YC2A 1ZWKA 4AY4A 4A5OA 3I2HA 4JJIA 1E0AA 4NU6A 1P5HA 2QTWB 2LD4A 2POQX 4IV8A 4LYHA 4YMHA 5JMTA 3ESBA 3DBOB 2D2IA 3VNVA 3ROPA 2BONA 1XEWX 3B20A 3C6KA 3WJ7A 4HNVA 2QLLA 5JASA 1Z75A 1COWA 2GEUA 2GN6A 4BV2A 4NK4A 4JLOA 5D1NA 4HPWA 1I2MA 2E9SA 2R1TA 4R6XA 2ILTA 3DGEC 4MLZA 2ZTSA 1FFCA 3CX6A 2Z8XA 3LF2A 4R84A 4IQ0A 4GF5A 4IMJB 1Z2OX 4M36A 3DNMA 4U0KA 2XCOA 5KX5A 2JAWA 1FRVA 1JG2A 3PNQA 4RHUA 1RM4A 1Z74A 1V47A 2D5BA 2J9GA 1LDNA 3FH0A 3HVIA 4IVNA 4J91A 3QEMA 1LBTA 8ADHA 1JDBB 1OD6A 1WSDA 3LQ4A 5DGCA 3BMNA 1LS1A 1JA0A 1PJ3A 3HP7A 4KQGA 4EELA 5CX4A 4EG8A 1FNMA 2VJDA 1Y4AE 3UV6A 4P4SB 3Q7QA 3HJBA 3ZH2A 1QPBA 3ROFA 3LFUA 4FCCA 1OJ7A 2JGAA 5A7FA 1K5GA 2G70A 1VMAA 4P5DA 1KYYA 4QLBA 5K8JB 2DTXA 4IZIA 3JQ8B 3HA3A 4B47A 1W36B 1Q77A 1GG8A 1X7ZA 3IR6A 3WA6A 2C7QA 1QOQB 1B7GO 5T6MA 5I51A 2I2DA 4FFLA 3VAZA 1OH8A 1SVSA 4H18A 1KI7A 4AP9A 4HSEA 2PUBA 1XMIA 2GWRA 1QZTA 4QTZA 4ZZ0A 3TSYA 2BEVB 4ZANA 4GXTA 4AAYA 2P79A 4NFYA 4RTLA 3N2ZB 5IBCA 4X71A 2W6IA 4X6XA 4OK6A 5LWQA 2H59A 1JEQB 2Q21A 2YFKA 3BDIA 3L6RA 1QCYA 1WXDA 4QUJA 3VAYA 3QBVA 2CNOA 1YRHA 4KX3A 1FP4A 3D2BA 3MFQA 4B3XA 4DE5A 4J94A 1MXFA 3U7EB 2GAIA 3C7KA 1KRXA 2YWEA 4TX1A 1NULA 4DLRA 3CVYA 2BMWA 4RABA 4WK0B 4PHGA 1AH2A 3F49S 2J87A 4JFAA 1GNSA 3PFCA 1QIFA 2C9DA 4ZYYA 2YHUA 3RVLA 3T95A 4WCFB 1NMXA 1WHSB 3GA0A 4UM9B 4LF5B 1SHLA 2R7NA 1CF9A 4EB6B 3J80A 1T9DA 1QP0A 1U9IC 2CFTA 3DH0A 1SFRA 1NNLA 3NIDB 2P77A 3O94A 2FEWB 2R6R1 3U5ZB 4WZBA 5ECDA 3QPWA 1RR6A 2JAXA 4CM5A 3WL6A 2AHOA 3M2TA 4NBNA 3IURA 1PHRA 4U5XA 5KNDH 3EG9B 2P67A 3UG7A 4XGKA 4G24A 4JYZA 3IKJA 1JFFA 2YJGA 3LT1A 1HE5A 2A14A 3KV3O 3NCTA 4V2IA 2HSJA 3ZGNA 3ICWA 3R3WA 5J40A 5KHOC 1QIDA 1JAIA 3HRHA 3IAHA 4CQLA 2B9VA 1RWVA 2QRKA 4N1AA 1RQPA 3O03A 3Q1LA 1NQVA 3SKXA 1HG0A 5FOXA 1AMNA 3NTOA 4L27A 1J24A 1DQZA 1EE2A 1UXIA 2CNLA 1J42A 1NYLA 2PPLA 2VOJA 4ISCA 4JVNA 4PSKA 3BIXA 4DQVA 3MBOA 3FGPA 1YJCA 3UAVA 2DBVO 5AHOA 3V34A 1TEZA 3L84A 1Y1KE 1D7OA 5JZSA 3TW8A 5D1HA 4RK0A 3JZMA 4IIVA 1DJNA 3H87A 4YJFB 3RYIB 4UXJA 1GPKA 2OO5C 3LOQA 3QE3A 5THXA 2O4UX 4TKLA 1N2BA 5HFNA 4NU8X 3SBDA 5L3QA 2Q4OA 4W7HA 1VKOA 4KQWA 5G3ZA 5IDYA 1VPTA 3WV5A 4GRIA 3IR5A 2WWVD 3BXPA 3RC2A 2O2XA 2GPNA 3KWFA 4UEJA 1W9HA 4Q7EA 4FB5A 4UHCA 1ORHA 4QSHA 2FF7A 3A4TA 4MW5A 3IP8A 3ZIDA 5A1TA 4YCLA 5I9TA 4DV2B 5F9MA 2O7NA 4LS3A 3KEFA 4OMUA 3IDZA 5H70A 5CT6A 4C7VA 1T9GS 2QN7A 4HDNA 3NLLA 2NTEA 2ZT6A 3MWEB 5CJPA 1SWVA 3Q41A 4MR7B 4NAVA 4BDSA 2WVHA 2G82A 2R44A 1HM5A 1O87A 1P2DA 1L5LA 1PX2A 4GLFA 1T4CA 1ZC4A 1FNDA 4ZK2A 2OHFA 1PWHA 4ZVRA 2Y1LA 4Z1MA 3IQEA 1SHUX 3UWPA 2R6AA 5CM2Z 1FNCA 2XMPA 5J2TB 2VH1A 5EUCA 2QAJA 2QORA 4TXHA 5DTMA 3T0FA 4DYHA 4Q19A 4N0MA 3WNBA 4EI2A 3PF9A 3EXEB 3PGA1 3AIKA 1WBDA 2VNAA 4MQEA 1UBSB 4RV5A 1WZ2A 2V7BA 2F59A 5TC4A 1SUWA 4EGQA 3FZEA 3ANYB 5SYNA 1UPFA 5E7QA 2H54A 1GUBA 5CA0B 5I5EA 1UBCA 4KQ6A 3D3QA 3KQNA 3DZBA 4ZO4A 4UFOA 4Z86A 2ZE6A 2QIOA 1T6NA 4EK9A 4Q4CA 3UWKA 3G8CA 2XRYA 3ICVA 4JZKA 4O3MA 3DL0A 3IA2A 1LRJA 4GQIA 2XQKA 3U7IA 3PHLA 5DZSA 1EFPB 1ZAYA 2B3DA 1IPFA 2XZPA 2VH2A 3B51X 1YR6A 4G0QA 3PVZA 4RU1A 2P6UA 1P45A 3GLGE 4U2BA 1CJMA 1TI7A 5BRNA 2A5JA 1JNYA 1T43A 3GZNB 3T41A 1CSEE 2PGDA 4DUGD 1Y6QA 2V7PA 4B7XA 4ALLA 3QMWA 1I7SB 2ZSHA 3OQHA 1BWQA 5LQRA 2UYHA 2ZBDA 1Z5WA 3WL8A 2WM3A 4YXWA 2QTLA 3K73O 2CZGA 2NSJA 3R5SA 4R51A 1CV2A 4ZQBA 3N0VA 4MQ4A 4EHHA 3ASUA 1T1GA 4A4DA 1NSFA 2P5YA 3GLKA 5DYWA 2IH2A 3VYRB 2I4IA 2FDCA 5LB2A 3FGNA 2X13A 1J1ZA 3ACDA 5INTA 2BKAA 4OYRA 1PWYE 4OYLA 5BNIA 3FVQA 4RKFA 1XTVA 1QVZA 2C1ZA 1Y6RA 4MPPA 1J4AA 2P3QA 1TCUA 1D09A 2X1LA 1UJCA 3WLOA 1R5BA 1H6CA 3BBLA 3WLAA 4E46A 3KSAC 4B3GA 1SVNA 2EF1A 2HU2A 3FI9A 5JJCA 1U63A 4KR3A 4NFHA 2WD9A 3B3FA 2OCLA 2VTEA 1YOBA 3EFEA 4AY3A 3DLPX 3PDJA 1ICIA 1KU6A 3ICEA 2DKNA 1XZJA 1NKVA 1T0PA 1KVRA 5CXSA 3T99A 5EFZA 1DCKA 5D7NA 3TZEA 3GNQA 5CFLA 2JHPA 2VZEA 3G9TA 4I99A 2AEEA 3ZHBA 3JPYA 3AI1A 1Y37A 4HL6A 4E51A 3CX7A 2BRUA 2QD3A 3U3RA 2XKKA 3DAHA 1JQ3A 1KEEB 3HR8A 3VNSA 1NF3A 4TROA 5FWYA 5KSOA 3E4CA 5A2QA 3EY9A 5IVIA 5B1EA 4G67A 3S6JA 1JHAA 5CBKA 3FNFA 1EFRA 3MYRA 4MVJI 1ILWA 3REQB 1U2GC 3OUZA 2PO5A 2Q3CA 4QDOA 4NG5A 3DMGA 1XYGA 5TY0A 3SX2A 4QKQA 1Q0RA 1Z9BA 2FU5C 1S3FA 5DF1A 4I3GA 2AXEA 1WE2A 1SHJA 1SB8A 3HPRA 1UDWA 1UDXA 2BGUA 3V1UA 2HO4A 3LY7A 2KMLA 1QCDA 5DK6A 4QDUA 5IRCD 2DBQA 1K66A 2HBQA 2VYCA 3F8TA 1K8ZB 3KAPA 3FJOA 1RJFA 4MWTA 4Z9XA 5BN1A 1GKYA 4MPRA 2BMAA 5LQAA 3ZDAA 4KKVA 1A88A 4QU8A 3WO0A 3TJZA 3D6TB 3VNBA 1MC5A 4ZVOA 4H08A 2I29A 5BSUA 4LE0A 3GOQA 3ABRB 1GTSA 4M8SA 3I30X 1N36B 1JG7A 4MKHA 4IIFA 4MWCA 3I6YA 4WFJA 1BD4A 3E3MA 2HSWA 3GHHA 1KK1A 2PKQP 1VB3A 1ZUHA 3ZIUA 3RAFC 2Z2ZA 4BC1A 3UOGA 5D84A 1M3SA 5FT9A 3UXMA 4BVAA 1M5TA 1ZC3A 1WPGA 2EKZA 4I3FA 1NVVR 5CT8A 1E3WA 3S44A 3BEOA 1E63A 1II8B 2EOAA 5AVTA 4I4LA 2ZU0C 4PS1A 4IXMA 3GDWA 3VH3A 3OOHA 4E1BA 3R74A 3CVUA 2V3VA 4KI7A 3LYHA 4MPDA 2O2ZA 1A50B 1GZ4A 1ZJ4A 4R2HA 4IYJA 3WFJA 4BNDB 3PI7A 4KQXA 3TFQA 4ZDKA 2CDRA 4KODA 1JB9A 2DT8A 3IPXA 3KOZA 4QFMA 4DCOA 3R9WA 1UK8A 5H0IA 4CQMA 2P91A 2JGLA 1FRZA 3RS3A 4LNUB 4DC1A 2ZWVA 4B3TB 2I4OA 1A5SB 3LZCA 3PITA 2IP1A 3CNQS 3FMFA 1CE8A 1A9XA 3BQNB 1EESA 3Q3IA 2RGDA 3KHTA 4R8SA 1FSPA 4FYVA 1UK7A 1CS0B 2DFTA 3Q7SA 4O3FA 3C3DA 5FPQA 1RBZA 2K7FA 1G2IA 4IM7A 1QONA 3EC2A 4XFKA 5JANA 4R54A 3GP5A 4IO1A 2DFVA 5HA5A 4AO6A 2QQGA 1YDHA 3ESDA 2F3QA 4HAXA 5A5DA 1NW7A 1ST2A 1QS0B 3EEQA 3EGEA 3EK2A 3MGKA 4IEEA 4R2JA 3S2YA 3SYRA 1AUQA 4P54A 3WZLA 3WWZA 3UJCA 3VHXA 1W5FA 2HBRA 3FVTA 2DHDA 5AI9A 3TRJA 3D2LA 2OUIA 4RXMA 2PT5A 1JG3A 4UDYX 3DTVA 5K3FB 4B79A 1EUDA 2MYTA 3DVLA 3IQGX 4CN9A 4F06A 2VAVA 4RTKA 2P2ZA 4WASA 4DQKA 1U98A 3LO5A 3OFNA 4DIMA 4PZDA 4LF9B 5E9AA 1OTHA 3BWXA 5AKYA 4JI2B 4R83A 3AF1A 4Y2XA 1G17A 3MINB 2GO7A 2RJNA 4D79A 1G4HA 2RI0A 2E4YA 2FPKA 1DO2A 3CH5A 4FKZA 4R8MA 4RGVA 4ZT6A 4E5SA 3KOWA 5B58T 5BSGA 4JBGA 5HVNA 5JNUA 4OHYA 5SY4A 4L3VA 1CNEA 5CDTA 1J06A 3L6EA 4GGMX 2QB5A 1HWYA 1MENA 2Q2WA 3D59A 3I04A 5EMLA 3K0FB 4MS1A 2V3WA 3TF5A 1QZUA 2JK1A 4FMCB 3GWZA 4FCVA 3ZWBA 5FPYA 2JH9A 4HCJA 1W1IA 2PRYA 2R3SA 4G6ZA 1SOVA 2QUJA 3AFOA 4FDTA 4X5OA 2B98A 1XZDA 5FBHA 4X8HA 4XR4A 3TQSA 5C8VA 2ID7A 3LP8A 3UF0A 2XVMA 4ME6A 4CFSA 3R41A 4L28A 2CBXA 4NE2A 3EPPA 5JAOA 2WKQA 1DC3A 2J7PD 1W0JA 3K0HA 4UVDA 4YRDA 3B2QA 1KY4A 3MT8A 1O96A 2WA2A 2ZCUA 1ZSNA 5IKOA 1UMCB 3NM4A 4GM4A 3LOUA 1T5LA 1OKKD 1OGYA 3C5VA 5CFNA 3CX4A 3DFUA 2JDIA 4D8VA 3TLAA 4BQIA 1JLLB 2QM0A 4MPJA 2XWSA 2XMBA 1J2YA 3KHUA 1U7OA 2G08A 3ZGZA 2D7CA 1EK1A 2BCJQ 4J0GA 3OKFA 2ZYDA 4Q1VA 3EEBA 6GPBA 1N7HA 4DM4A 5LLDA 4W9MC 1RYDA 2I78A 1X8LA 2AOTB 3HKDB 3I28A 1K88A 1CERA 1UP7A 4OJKA 1LZLA 1INLA 1QQTA 1GEEA 4I1VA 4AO7A 2EFYA 3QX9A 4B4KA 4BLOA 2B69A 3ISTA 1GCIA 4Q6WA 5AT1A 1GZVA 1Z34A 3ZE2B 3R75A 4X3CA 3NW9A 2GESA 3RJ5A 1RHJA 4B9AA 1Y1SA 3ZEAA 1UXGA 2EWWA 2A5FA 4ND3A 1B0UA 3F9IA 2CFRA 4RNCA 3T9FA 4K26A 4Y9TA 3EFBA 3IBTA 5HJ7A 1HL7A 3PFIA 5IKMA 1EFDN 4MA4A 3PJGA 5CNKA 4OM8A 1H94A 1QG4A 2YFHA 4MCJA 4HAZA 2QMOA 4CKBB 3PX7A 3T1VA 4DA9A 2H7XA 2O8VA 4JL6A 4CL0A 4KXXA 3FUXA 4OOEA 4ZV7A 1KHHA 2Q6OA 2AK3A 1HYHA 4JU8A 3EULA 1IB0A 3PUKA 1I4EB 4BMZA 4EYOA 2BR4A 3A28A 4NPAA 3QI2A 4MJXA 4B17A 3VR2A 4X60A 4LZLA 2HDOA 2RHWA 4UEKA 4ESHA 4GEKA 1ZOLA 2ID4A 4Q02A 4ZYXA 2IOYA 4NMXB 5A9RA 5HJ5A 3FF1A 5D8DA 1IIBA 2QVYX 4JLWA 2QVBA 2QD4A 3X1XA 4X1OA 4CKEB 3WGIA 4KLAA 3G5AA 4ZIRA 3OEYA 3EZFA 3GBVA 4HQOA 1Z6QA 3IJPA 4WJZA 3SHFA 3HBMA 2C59A 4O59O 4DV4B 1FFEA 4Z99A 1W6RA 4M55A 5K0BA 1YMVA 3ZVNA 3L4SO 1QQ5A 3ZCTA 1Z08A 4ND6A 1C3OA 1Z88A 3IIMA 1OXTA 4J1QA 4D97A 5JY1A 3OPQA 2B1JA 1ODSA 2GPAA 4US0R 2BELA 5H80A 3AV3A 4CMIB 4E5NA 5D51S 4MWSA 2X8BA 4ETMA 5BYAA 3D5EA 1N7GA 1Y7TA 3FLAA 2X1MA 3B9BA 4FOTA 1G5QA 4KR9A 5MFZA 4WOPA 4ZT5A 5DNVA 5HF6A 5C35A 1E8DA 1WS6A 2I2AA 1FUKA 5FFNA 1KEZA 1CYEA 1MB9A 1VCIA 4UW9A 1PLKA 1OHHA 1IY1A 1NOJA 1NJ8A 1XF9A 4NYIR 4YVFA 4FK8A 3LG2A 1C30B 2NZVG 5HKAA 1WPRA 3KTOA 2MINA 3RIXA 2AN1A 3EGCA 1PGPA 3FYHA 4PONA 2I8LA 4HUQB 2OB1A 3PP8A 5A62A 3ABOB 1NDQA 1PNVA 1TKAA 2C7BA 1Q5PA 4U5QA 5DHTA 3EVCA 2O2GA 1VJ5A 3FNGA 2VDNB 3JS5A 2WUEA 4HXFB 2A5DA 2H4FA 4JR1A 2JKVA 2VSXA 2Z9CA 3NG1A 5HMMA 3QW4B 3TCKA 5HHTA 1X9IA 2J07A 4HGYA 5A5VA 1EP1B 3O38A 4M3NA 2GX6A 1GKUB 5ER9A 4QUBA 3QLEA 1XQXA 3FDZA 3BGIA 1L8QA 4JJZA 3FPBA 1QJCA 1GKIA 1SUEA 4QBGB 5C8ZA 3C3XA 2Z5VA 3NAQA 1AU9A 2WOOA 1UANA 3UMYA 3N76A 3BK1A 2R00C 3V7YA 1CUCA 4BIMA 1DS6A 2OBMA 2CHVA 1H22A 2X5JO 3GLTA 4MRMB 4OXYA 3NKVA 4QXAA 4Y9UA 5G1OA 3RGWS 5KJ1A 4BZQA 3FX2A 2FRDA 1T3LA 3AR7A 2PV7A 3JQ6A 3WR5A 4JLKA 4LA4A 1J7JA 1R12A 1JFLA 1XZAA 1KDTA 1C1XA 2UDPA 1MQSA 2YW9A 3RF7A 3JQAA 1V9CA 1XHEA 2A5GA 5K45A 4OA8A 1IM5A 2O0JA 4A1OA 3OKAA 4BVJA 5CA1B 2YZGA 3OCJA 2RGEA 4TV9F 5KOIA 4ARVA 3T5CA 2XXBA 4V0RA 1WUJS 2FPSA 2VYQA 1AKWA 3JQEA 3RVOA 3QU4A 1YZQA 1CJVC 1QFSA 1V8PA 3HH8A 1UBRS 1NVWQ 3TLMA 3KU4A 1Y9AA 2V59A 3A1FA 4RACA 4ZI2A 2JAHA 2WBLC 3G2LA 1RP1A 1ZMBA 2AUTA 1C0EA 4JSYA 1V9SA 2IYRA 5TPWA 4DLAA 5JCPA 4UJ5A 2CJWA 2FN3A 4B2LA 3DHYA 1AO0A 3Q7IA 5E3HA 2DQZA 2Q2OA 2Q1UA 2HDHA 1WETA 1RQRA 5E7IA 2F67A 5FI5A 1BE1A 5BP7A 3A4YA 5LKAA 2HN9A 4CEHB 1IZ8A 3FYUC 2XIJA 1NNUA 2L69A 1Y7IA 2O3SA 3ZCQA 3BJMA 4DLLA 1M0EA 4D4KA 2IHNA 1GCUA 3BRSA 4H1TA 1FPMA 3LIPA 2IFTA 4YXFA 1QGUB 4G4SO 5BRJA 1YQWA 3GLGA 4UCXA 4Y2UA 3O47A 1O0BA 1U8YA 4F3NA 2YNMC 3ANMA 3S2IA 2ZXFA 4A2WA 2FX3A 4YQYA 3W79A 3TLGA 4F56A 1IUOA 2NO5A 2WPDA 4KTTE 4KWIA 4LC9A 4Q4JA 3G8BA 3SZLA 5B2EA 3GAZA 5GONA 5B4VA 1ZM9A 4LC0A 1HETA 1Z38A 2PYZA 4HNGA 4JHXA 1SIUA 3N74A 4KDEA 2CB9A 4PYOA 4YMSA 1CUBA 1EG7A 3EEOA 2HNKA 1FMFA 3RFCA 3ZDQA 3WJAA 3WS7A 5PGMA 1QIMA 3JATA 4FKBA 3O8QA 1Q20A 3EGXB 4HVAA 5F21A 4TZKA 4L8LA 1GARA 1K7XB 1H8EA 4LOIA 5BT9A 1JS1X 4BJ1A 2XV1A 4EHNA 4LMBA 4Q1FA 1Y48E 2JIRA 1XKLA 2IF2A 5HW0A 5F33A 4EQ6A 1P0FA 1P3DA 1Q2XA 2JCGA 3KU1A 5E2AA 1NJGA 1OZGA 3F4LA 3MOSA 4YV7A 3OIVA 1C1DA 2OM6A 5IMSA 2JZNA 1WEKA 3JY6A 3TDKA 2DUUA 1E1DA 4RF3A 4JBNA 5FV7A 1L4UA 4D3ZA 5LWHA 1A2BA 1NVGA 1V35A 2J5XA 4H59A 3T38A 1ADGA 2OR3A 3GD5A 3P2KA 2G1PA 3LRTA 3WIDA 1SUBA 2QUAA 2VAXA 4KFUA 3TFOA 4JXXA 2FPIB 3PNPA 1U2QA 2ZW9A 4K9PA 5FTKA 2RCYA 3NQ41 1VG8A 3LQQA 4D8TA 2J9FA 3IAS6 2I8CA 5DCLA 4JI1B 1KMCA 1X7DA 4DCUA 4CKZA 2LW7A 5K99A 2CLCX 1H4SA 1TU3A 3D0OA 4S24A 5ALJA 1O94A 4ZOAA 3ZX4A 2JGDB 1L1FA 3VO8A 4FUQA 2WSMA 4B43A 3CSSA 1JMKC 3E8SA 1Z2AA 3AC0A 3HQ4O 3IQXA 4G1BA 2CXHA 4HBZA 3RAJA 1E60A 3WLRA 3DFIA 1BRTA 5K3EA 2V4ZA 4I3HA 1T5DX 4BUZA 4OG2A 2Z9BA 2NQTA 1D2RA 2YBDA 3S27A 3T1YB 1HKUA 4C7OB 4IX9A 3B7WA 4RLSA 4TZTA 4OJQA 4BVBA 3MJDA 4WNYA 4Y2QA 4L5JA 1IVYA 5AVQA 5C4MA 3I4FA 1NV8A 3ETJA 3CIOA 2B61A 5H1YA 2XD9A 2F1HA 3UYLA 1VL1A 2I3AA 2NZYA 2XVXA 2HUPA 3DMPA 4FDVA 3C7TA 3RS0A 4Y2JA 3NDPA 1UF9A 1Z4NA 1WLSA 3BILA 3GFBA 1V95A 5E38A 1PZXA 1EI9A 1XBTA 4QEKA 5I01A 4RH1A 2P3OA 3COYA 3DKRA 4U2CA 1HA3A 4X85A 1GPWB 2IZ7A 4OFZA 4RPHA 3SHOA 1R0ZA 2PLFA 4C05A 3WGVA 1FP2A 3HCOA 4CHTA 1NVEA 1VBFA 1KEVA 3JYNA 3JAKB 4N7RA 4CDNA 1JA1A 3IBFA 1ZNZA 1UDAA 2FEKA 3FDFA 3TE7A 3I1YA 3A10A 4K87A 4EY8A 3AK4A 1EXWA 2O14A 4FHFA 4KZPA 3CKLA 1NV9A 1TT7A 3P5SA 5HKLA 1RJEA 2KB0A 1GZDA 2ADFA 2I71A 3B52X 4UMVA 3IR7A 1SKBA 4I1RA 5FPKA 4TMFA 3DLIA 2O3UA 4FFOA 4BNVA 1CX9B 3LGAA 3HXOA 4UUBA 1AF4A 4PZ0A 1QAOA 4WJLA 5ETJA 3L04A 3RVRA 2O7VA 5JH7B 3AF4A 1EA5A 4OHOA 4RY8A 4GSLA 3LWZA 3MT7A 5E0KB 2VXCA 3F73A 2OFOA 2YYAA 1BEZA 3GA5A 5K05A 4FFRA 5IKEA 3OTHA 4ZOEA 1RYBA 5FUXA 4BU0A 2ZJYA 5J1SB 3VNAA 2QP9X 5CNIA 1PF7E 1W35A 2E3JA 4Y1EA 3AEZA 4TN1A 5BWCA 1DCMA 1JJIA 1AOXA 1OA0A 2Q6IA 3LP5A 1RKQA 1E0SA 4GMHA 4IJQA 5AXCA 1DBIA 2OENG 5BSEA 3M4ZA 1KSFX 5P21A 2PS1A 3NTXA 5AM5A 1JIXA 2BI8A 1WB6A 4L7VA 4YJHB 2CNWA 1NDUA 4URHA 2F8MA 2VCEA 1V37A 1XMSA 5GGXA 3UGJA 3AVWA 2WWXA 2ZT5A 2HA2A 2Q29A 1M6VB 3KSMA 5ALKA 5L7YA 2OD9A 4UDOA 2ONYA 4WZAE 1J5PA 3KKNA 1X9HA 2MYPA 2QTZA 2YUTA 4C7JA 2A30A 2HY7A 1HZZA 1GTG1 2BDEA 1WLYA 1EFTA 3AEXA 4RA6B 5CFPA 3DLHA 3K4HA 4YMLA 5DCWA 2A78A 1LD3A 3WK4A 1G8YA 1E7QA 3C1UA 1SY7A 3PXCX 4AJ4A 4W5TA 9ATCA 1GZSA 1TUBA 3BSYA 1NJ1A 3K09C 5ECGC 1R1DA 4HB3A 4K03A 4PEVA 3C3EA 3E9NA 3F5DA 4RD0A 8OHMA 2V5UA 3T1TA 3NWOA 4B4DA 2BKUA 3WL3A 2BGMA 2X42A 5C32A 1L7XA 4NCNA 4JI6B 3C98A 5JAQA 3RODA 3TNLA 4BBAA 3N5KA 4XX1A 1H2XA 3LVFO 4BNWA 2IYWA 5LU8A 1JPJA 2QT1A 1GG9A 1CUYA 2QPTA 1S2NA 1U0OC 3NGXA 5H81A 3SMVA 1G3QA 1JVSA 2B78A 1VBNA 1O54A 4Y0AA 1QORA 5WRFA 3PTLA 1W85A 1X2EA 5HCNA 1DC6A 1M8JA 3QA9A 3M0EA 1UMDB 2FPPA 2QW0X 5JAIA 2HW8A 1R2QA 3MTBA 1Y0BA 1T3SA 4ACAA 4CLEA 2FVYA 5MGNA 3ZU5A 3ESXA 4OMDA 3IALA 1M6WA 4HYQA 5EKUA 4TN5A 4LI0A 5GONF 2PAFA 1D6SA 3AM1A 1KAMA 4YBZA 3U44B 4JQYA 5EJFA 3EF3A 2FN9A 3OE1A 3A32A 2V0CA 3D6NB 3PGKA 3NRJA 4IHJA 4R0MA 1NXWA 1A9YA 1UPUA 5AK4A 5U9CA 4JCCA 1PR0A 3EGWA 5LZ4A 2BKLA 3U5TA 1VXRA 1ZD2P 2GFQA 1FP6A 1KYWA 3IELA 4Y1RB 3L7AA 5TARA 1ZOPA 4JUFA 5HS4A 4DV3B 2PDAA 3UT6A 2NU8B 1COWD 2X2OA 5A5EA 3A37A 2H11A 1D1QA 4H17A 4S2EA 4BMYA 3ET4A 1QH1B 3L4JA 1D2EA 2IYZA 5ALDA 3BL5A 1C7EA 3DLCA 3OJOA 1WOMA 1AXRA 5I8PA 1PWZA 1VCHA 4W5JA 3AVVA 3BERA 3RW9A 5AW4A 3OPYI 4DJJA 1CDDA 3IUJA 1U4NA 3W05A 2Q07A 4E94A 2XCTB 1I1OA 1MO3A 2EX4A 5DX1A 3AP1A 3Q7PA 3ZJVA 1AY0A 1I32A 4IS3A 4G2NA 3ISJA 2GF2A 1K2WA 2X0NA 3JQDA 4DLTA 3DDUA 1NKTA 1ODFA 2IYUA 4BQOA 2D06A 3AGPA 3W5HA 4X1IA 4DWJA 2DXIA 3DHWC 2RJ3A 2BCEA 2ZUCA 4UUAA 4OJTA 2JFUA 3G1WA 2WJAA 4QVIA 4C7KA 4F2WA 3RGGA 4Z4FA 2I6XA 2ZJZA 3ZJ4A 4TZ6A 2Y0PA 5F2KA 4KBGA 3T35A 3I39X 4G4IA 4LYJA 4BEVA 5B53A 1B93A 4TTQA 4MTCA 2N46A 3SN6A 2E7ZA 1NYRA 3A25A 3E8MA 5AJZA 1SUFA 4IOJA 5E4JA 3FE2A 2V9CA 2DHEA 3ZD9A 4FI3F 2EJBA 1HDYA 1X7YB 2PQ2A 2Q1YA 2Z1MA 3MBIA 3NEYA 4UNPA 3RTGA 3SC6A 2W6ID 4AJJA 5JALA 2X7XA 1Z4JA 3OMXA 2YW2A 1CEYA 2H2DA 1KRWA 1NUTA 1XDWA 4QTXA 4C29A 2IY7A 2VSNA 3QXHA 2QU7A 3TK1A 2YWJA 4BQSA 4F6CA 1ZCBA 1N8NA 4RXTA 5CGZA 3BQ9A 4CV1A 1SD5A 4PVCA 5JY6A 4MDFA 2EGUA 3CPSA 4WJKB 3ASVA 4IDDA 4MGKR 4QAJA 3OP1A 1UT6A 3BIWA 4GMGA 2WSSA 4MUYA 4XDYA 3DZCA 4D9JA 1R16A 1M2HA 2PANA 3AR6A 4XQGA 1AZSC 5A4FS 4DV6B 3C70A 4RS3A 1SXJE 1YE8A 2GN2A 1F17A 5HSGA 5JECA 4G0VA 1Z7YA 3WAKA 3RFUA 3WMWA 3MM4A 5AKEA 2YMLA 3A9UA 1UOOA 2XVYA 5LQSA 3QVJA 1R88A 1PNTA 1SJ9A 4CGZA 3UG6A 1H5NA 1SCIA 2ZSBA 3DZJA 2C9OA 3JTEA 5EZ6B 4D80A 2PX0A 1VI5A 4FMDF 4FBGA 1TW2A 3MAAC 5F5XA 4PLHA 1YQEA 4H6XA 1YACA 4CMHA 1UC8A 1UFOA 3RK0A 5JISA 4DCMA 1OFUX 1TAQA 2EX1A 3R0XA 1UPAA 2PS0A 2AK2A 2IIPA 3FPGA 1N6LA 3P2OA 1K9SA 1UINA 3RT9A 2Q2QA 2AMVA 1EVYA 3E22B 1EB9A 1FQKA 2C54A 2OKCA 4KQEA 1T9HA 1WB4A 4EPRA 4IFTA 5DWVA 5F4BA 2Y1XA 4TLMB 4BDTA 4EPXA 1SAYA 4LZNA 2NYAA 5CYFA 2W70A 1CFZA 4UAVA 1M2VA 4FR0A 1Y5IA 4QUDA 5LMCA 4OAPA 1DC4A 2RHMA 4M8LA 3TH5A 2FPGA 4CF5A 2Q2NA 7REQB 1E3LA 1H3EA 3EOBI 1HEIA 3E82A 4NDNE 5FI0B 1JU9A 1WU7A 3AV0B 4OKNA 4P31A 1EG2A 4IQ4A 2VAPA 4B74A 4BTLA 4OHFA 1U2SA 3D1JA 4TLAA 4CI9A 3C5CA 2C5BA 5EIXA 3ZE0B 3WICA 1FUIA 1WABA 3DE2X 3QVGA 1H85A 1NVMB 3M2PA 2O48X 4ML3A 4Q3DA 5CK4A 4E11A 4CPDA 1IAQA 2HQBA 1EUCA 1EFCA 1LC0A 2HPAA 5KYVA 3WSWA 2EP8A 3WLSA 3PX3A 4BNLA 5M04A 2CC2A 1TW3A 1HGXA 1XPUA 3ZBQA 5AUNB 5DGDA 1ZQ1A 2VDVE 4IG9A 7ADHA 3CVWA 4DV1B 3OQJA 4LZJA 3URKA 1IK4A 5B6JA 1UZNA 1ID1A 3OKPA 3TI9A 3OJ0A 5DXAA 4JB3A 3K4QA 2BMDA 1V6SA 4CF4A 1A7KA 4MOWA 1LI7A 1S7CA 2FW9A 3PEYA 1XRLA 3JVEA 2ZRIA 3A3KA 5EUMA 4B6GA 4M1MA 3M5CA 4PBRA 1GTZA 2OHOA 3ZW8A 5FO1A 3JALB 4JN6B 4JQOA 4UU0A 2GZ1A 4LYFA 4Z1MD 3KYJB 5DHFA 3FB4A 3PGLA 3PJEA 3SI7A 4JT8A 4KACA 1IB6A 3VOTA 1RYNA 4IUBS 4V0ME 3SQXA 4M0UA 4WUVA 3C7AA 4WGFA 1EAMA 2JIOA 4R9VA 5C80A 4J07A 5FADA 3W5SA 3GMSA 1X15A 4RPLA 1D4ZA 1KMMA 1H4VB 3T7IA 1Y9EA 4CDRA 1XXHE 1AK2A 2REXB 4NULA 5AI0A 4CKWB 4WLUA 3NEPX 4CM8A 3ONFA 5SYAA 2AZDA 4WY2A 4ZAWA 2C8VA 2IU4A 1RLOA 4S1WA 5E6RB 2IEYA 3RRBA 4Z1OA 4FYIA 1UFVA 3Q0IA 4PPYA 5FLEX 2X0FA 1U6JA 5EMMA 3ZHCA 3T5MA 1SZCA 4Z4IA 4FHCA 3PC4A 4HWPA 3NHRA 5DIFA 3G2KA 1GSAA 4OCZA 3MJSA 3NDJA 1T1JA 2POCA 3L0IB 3JR7A 4WGGA 1V8FA 3J81k 1Z4MA 4ZYWA 2HSEA 1CPYA 1JFRA 1YBVA 3R5JA 2AC7A 3ELUA 1KKUA 1XVVA 2AXNA 3R3JA 1NN0A 2AZXA 1LF0A 4BLSA 1IHUA 1AB5A 4HPXB 2VOEA 1NP3A 3R7SA 3ZVKA 1JAHA 1RQGA 1ULHA 3P9KA 1Q3TA 5I7UA 4UBJA 3UYKA 4YXWD 4GRAA 4WBNB 3M7IA 3OZGA 1OWOA 5B5SA 5LUAA 3GJ6A 3TEFA 2JLCA 4PR3A 1ZZGA 2I1WA 3BE6A 3NYWA 4LHSA 4MULA 2XGJA 4AECA 3U48A 4BC0A 1Q95A 4D45A 3L82B 1B8VA 3E15A 2JJ2D 4X0EA 5JR3A 1JW9B 5AWFC 3OLXA 4AS1A 3M6LA 4JK3A 5EC8A 1MEJA 1QTIA 5IJZA 1KIAA 1NI3A 1FQOA 4WXHA 2GFHA 3DV9A 3MS2A 3EGIA 1SKYE 2BJWA 4JT9A 4MUJA 4NRDA 3AUFA 5DISB 1Z2NX 1QNFA 2HWYA 4L9WA 4KWEA 4MP3A 1CYDA 3S5JA 1QHIA 4CMKA 2IXGA 4FHEA 1WO8A 3BAFA 3I62A 4Q3OA 4WNCA 3WQQA 4DQDA 5JXWA 2VK2A 4MUXA 1VL0A 4IVRA 1E6KA 2C98A 2PX5A 3KZMA 4BX2A 2Z6VA 2A88A 2AEJA 2ZRPA 3K05A 2PX8A 3E3NA 4UM7A 1II0A 3U3MA 1YDMA 4AX8A 1D5CA 3SYMA 4BKMA 4H4CA 1E2UA 3QFSA 4ZCSA 2PU7A 2IW3A 4H31A 4LYYA 4TMTA 4YWJA 2IF0A 3ZDYB 1NUQA 3H2HA 1G2QA 2QAGB 3TOXA 2C04A 2BGRA 3HJHA 3VR5H 1Q0TA 3C6MA 3H6KA 3AL2A 1EFRD 1NMZA 3CE6A 3I1FA 4GT1A 521PA 4CL3A 4D74A 3ZWXA 4BTEA 4N48A 2BRUC 4HO1X 2DBYA 2GCNA 4AJ1A 2AJBA 4DR5B 4ZJYA 2AT1A 4YAJA 1CZNA 3TQRA 1H66A 2I7CA 1M73E 1ZA2A 5IM5A 1ZR4A 4OV6B 4OFWA 3KETA 3KEQA 1ZXBA 5LIPA 3DZDA 2EFEB 4Q34A 1NWHA 1Q57A 2FZWA 3AF2A 1Y6JA 1JV2B 2HRDA 2L18A 2PAAA 3UFXB 1MF7A 4M1ZA 1ULBA 1JEYB 4PLYA 1Z35A 1RJ9A 2CXOA 2ENWA 1DP4A 1MOSA 1UBTS 3NHWA 3V4SA 3VQTA 3ZXUB 4B5KA 1XG5A 1TZJA 3KR9A 1L5HA 4P7FA 4NBTA 4YPFA 1ZRNA 4J49A 4NF2A 4CRWB 1PQYA 2GVNA 2BD0A 3MYYA 3S7ZA 3F3MA 4LFBB 3NHLA 4Z54A 4QQKA 1KVTA 3DBLA 4H3HB 3H04A 5IHPA 1D0SA 3RVJA 5GINE 3N8KA 3MVEA 4Y67A 3OU7A 2AJLI 1D1SA 5FOUA 4KUGA 5KWSA 5CM8B 3T4UA 1KAHA 5HG0A 1LDYA 3ZWDA 3QBTA 3H7IA 1P1FA 4HGRA 4HP8A 2QRNA 4DMHA 4K88A 4EVRA 3L7CA 3WJ1A 2RKWA 2ZBVA 1RAAA 4GXRA 4QYMA 4MUAA 3UXEA 1T25A 3W4JA 4AZ3B 3DEHA 2ZUSA 3CPHA 2JFQA 1JZTA 1S89A 4CMJA 3SQDA 3EF0A 1P2FA 3CSUA 2XWQA 3FUTA 3IAS1 2V6BA 1NONA 5H3HA 5DGXA 2QT0A 5A9TA 4DYDA 1B6GA 2CFSA 1I7NA 2NO4A 3DVAA 4RKRA 5DMHA 3ZEIA 5DP2A 4EB8A 1UQTA 3C6QA 3L40A 4L4XA 4DWWA 1TVKB 5TDHA 1AMOA 4CQMD 2I7VA 3QOXA 2VPPA 2VPQA 1L1QA 1DEOA 1XEXA 4HXGA 1ZP6A 1P7VA 1Y82A 3IDFA 2V0GA 1NQUA 1FVHA 1OWLA 1WV0A 1ZM7A 3N87A 3TS1A 3WGZA 3GLIE 1P3JA 4AQYB 2PCLA 3THWB 1OBVA 2WQ6A 1PJZA 2CDAA 4RK4A 3K2BA 1K7SN 4EO7A 3JWPA 4RA9A 2XOKD 3MERA 1P60A 4LWZA 3AVTA 2NYUA 2P90A 5DM1A 1GUFA 1SMKA 3ZZUA 5J59A 2B4TO 2JFOA 4ZRMA 3K0SA 4M89A 2K2QB 3LSTA 3A2LA 5LYJB 5CUQA 2I7XA 1QCCA 4I46A 3SQWA 2BGJA 2JLQA 1R6TA 1GA6A 3MGGA 4WFKA 4HMQA 4QOSA 2H5EA 1AGXA 1L4BA 2H9YA 4QUGA 4QVGA 4ND4A 3DTVD 1A4XA 1OA1A 2Q4DA 3E18A 1Q7EA 3HEMA 2C3MA 4KX5A 1IOVA 1DG1G 1P5ZB 2F62A 4F5EA 1Y6FA 3UJPA 1E2DA 3VVCA 4JZYA 1BHJA 2IRWA 5D2CA 3GDGA 4YUVA 3A06A 4R71A 1VYTA 4H7JA 3UKJA 1GCGA 3OFND 4E4TA 2RFLA 2X76A 2VK8A 1KDVA 3D3WA 3O84A 2XODA 2GLTA 4M1QA 1G16A 4KV9A 5H3CA 4AZSA 2ZBUA 3ZK8A 3KQSA 4DC9A 5KBYA 2I55A 4W5OA 1ZX1A 2AI3A 1Z4QA 3KJIA 3DOHA 3STTA 1TIBA 5KTOA 4DC0A 1DKRA 4US2R 2XEXA 1YKGA 1G20E 2FUG6 2ZIZA 3O0TA 4KQIA 4X1KB 1E2KA 2J3LA 2JIZA 3X1YA 3D6JA 3K2QA 1VKNA 2XB4A 2C95A 2FQWA 2GPSA 1B3RA 2H7CA 3A0RB 5G0TA 1KSJA 3GUUA 4HDSA 2G5GX 3P27A 3UHPA 1X1RA 1GUYA 4MVJM 3QX3A 1CY1A 2Q5EA 2RGAA 3AERB 4I4TF 3K9WA 2H9AA 4R1PA 2VVTA 2H5IA 3A6DA 5E8JA 1RI2A 5GVRA 4LRQA 3F7TA 1A9SA 3OC0A 3S29A 4HQFA 5FPTA 3KQMA 1W0JD 2E0IA 4GPZA 1S3IA 4MJ3A 4PLZA 4CGYA 5EGNA 3WGJA 1BVHA 1T5HX 1ZJZA 4ZFNA 4U02A 1OBHA 2JDID 5ALNA 1UWKA 5KOJB 1LC3A 3K8QA 4YI5A 1VMIA 3BD9A 3UGTA 3QSYA 3GEBA 1ZAKA 3NEJA 5JEEA 1S3GA 1N6KA 1QHEA 2LR0A 2OBBA 4XFDA 3ULKA 4PAMA 4RIIA 3RADC 1PI3A 4UU7A 2QV7A 4KHPB 1R64A 3B89A 3BKXA 3KQHA 1U7PA 4NS4A 3ZDEA 1X19A 3FYUB 3EIXA 3PPVA 4H7IA 1KWKA 4Q18A 4EZBA 1WPXA 5AMXA 5EGSA 1BVYF 2H4YA 2VP5A 4KLCA 3OPVA 1FTWA 1XIVA 1P9NA 2FTKE 4HYYA 3DDSA 1R0WA 4G23A 1I8TA 1Q0SA 3DZGA 3U7JA 1X7XA 1ODCA 4YJ2B 2ONJA 3ELDA 4BFSA 3QBDA 5KX5F 3WWPA 1QM5A 3R3ZA 1L7QA 1N6IA 4ZDWA 3MFYA 3I52A 3KZOA 3PLAE 1LEHA 4PGFA 4A82A 3ZHVA 3HBAA 3I6QA 4G81A 4JJ6A 4QQFA 1D7AA 2BFEB 1U3FA 2IXBA 4PIVA 2GFIA 1XB2A 3Q3JB 4FVTA 3FHCB 1E2EA 1Z4LA 4J2HA 1LTKA 1GQRA 1T9AA 1W8IA 4R1UA 4DSNA 5K4AA 4ZCTA 3OTIA 2LBPA 2PZMA 1XPOA 5KNDA 3R8FA 1RS0A 4FZRA 1BD3A 3O2JA 5E4TA 1U2PA 4B0OA 4DABA 3VR2D 4MV7A 4MV3A 4OFBA 1F14A 3ILSA 6LDHA 4BNMA 5I9LA 1DBQA 4RJLA 3ZNPA 1F6WA 2P0AA 5C37A 3NVAA 5T6BA 1UJNA 5KOHB 2I8AA 3EIEA 2PZAA 5CYGA 3BWYA 4KK3A 4G8CA 1KMHB 3LZDA 1CR0A 4LHWA 1YTLA 5FTWA 4KITB 4KWTA 5LP6A 4YDQA 1RMYA 3A1UA 3ECAA 1VDMA 4IGKA 1C2TA 2VDWA 3AUXA 5BO5A 1KJIA 4RJIA 3VHLB 1V5FA 4BFLA 1YFZA 2QG9A 4NZPA 5D01A 4I55B 1K97A 2I65A 4RMJA 1ADFA 1FXWA 4F7WA 2P65A 2N1BA 4MH0R 4ND7A 5EG5A 1G21B 3RUCA 3B3GA 5F4ZA 2D7JA 1IZ7A 1Z12A 2O3JA 3BE8A 3DNPA 4ZQFA 2O2EA 2WSLA 4DWVA 1PX0A 4LHYA 4J0CA 2GOYA 1ST3A 4NECA 4YP9A 4UTNA 1JXMA 1LPOA 3QVLA 1UADA 4HTAA 4I9UA 4MIEA 4CLHA 3BUSA 4DR4B 5KEIA 3FCAA 5CFOA 3VJLA 4QOFA 1OHHD 2QRPA 1JHVA 2NUAB 1OH7A 1M34B 2XH8A 1VG0B 1LK7A 4ICIA 4WACA 2E1PA 3O8BA 3OO0A 5T4BA 3UV3A 3QELB 2ZYIA 4MV6A 3QFFA 4RTRA 2GYVA 4IF4A 4M37A 2FSFA 1NLZA 2H08A 2ZUUA 4O2AF 1ZGBA 3W3ZB 2NQ2C 4LOAA 2CXTA 4D98A 2C5HA 3KXKA 3OZSA 1E5TA 4ZALA 3S1AB 3SS8A 1L7NA 4ZYLA 4ZK6A 5JV5A 2H2IA 2QN3A 3FYTA 3I9KA 5TQ0A 2AQHA 3D3JA 1IRXA 1U6IA 3K35A 4QJBA 2JCYA 4TVOA 1BW9A 4H0NA 2RK3A 3ME5A 2D1SA 1ZVMA 4HNAB 3W6ZA 4YYEA 3SIRA 1CUVA 5EVJA 4GI5A 1P4JA 1ESEA 1LA2A 2JI9A 4RHEA 4MSUA 2WQ7A 5E3IA 3BB4A 2ZWAA 1ZEJA 1I10A 1OLXB 2ZPAA 3AR8A 3E5NA 3DDWA 1T8TA 1X7GA 4KP7A 2FHPA 3NO4A 1AQ6A 1FF9A 4XLTA 3TLEA 3EMDA 3LXRA 1BU5A 4NU5A 4XSVA 3DL4A 1VLHA 2NADA 3H2ZA 1J2JA 1L4FA 3Q1KA 4XJVA 1BN7A 1EA7A 3JQAD 4YN3A 2FFJA 4CM4A 4WECA 5BSKA 4YMWA 5JAZA 3OY7A 4W5RA 1JTVA 2FRDC 5H16A 2GETA 4R1SA 2JB9A 1IXZA 1G42A 4QT0A 3LW7A 2YXBA 5IKXA 3TFWA 1IG0A 3LT0A 1L4KA 1L8XA 1XMJA 3KCQA 1CQXA 1HORA 1YZFA 1KDRA 2GXQA 2J41A 2IEGA 1XELA 2VATA 2XGSA 3Q15C 2XTZA 2C1EA 1JQAA 5CR9A 5TX7A 1N33B 2EHJA 1KSGA 1WQ1R 1M74A 1VZ2A 3FJYA 1WL8A 2OY0A 3RJTA 5K5EA 5JPDA 3RU9A 2AE2A 1K6EA 1UZLA 1GGFA 1L1EA 2IPNA 4OGWA 4E1AA 3N7TA 3L0YA 3OQOA 3IMGA 3IA7A 3HY6A 2BYTA 2I54A 3DAPA 5BV0A 1YU9A 1N78A 1J90A 1F0NA 1UPBA 2D74A 1YV9A 3PDIB 3F3YA 5CLJA 2G04A 4HQNA 1XZ8A 4YJKA 3GUCA 1LTHR 1IEXA 3WI7A 5GMOA 4E12A 2QR2A 5K6RA 2XJ9A 4LOKA 3QWAA 3S99A 3WDMA 1Y80A 4YYZA 3UZUA 2Q3DA 4RZSA 2WHEA 3EZ6A 3ZQJA 4IFBA 4MZXA 4C2UA 1DPGA 2OXIA 4X8OA 1CZHA 3PR3A 3UXYA 4DXDA 3A7DA 2QNRA 1VJ1A 4C6RA 3SE0A 3OQVA 1EP9A 2ZITA 1AKRA 4BQRA 4NV1A 4UE3S 3VSAA 1XLVA 3H5RA 4N5IX 3DW3X 5JAUA 1M2NA 1II9A 1T3ZA 2FSVA 1UBOS 2XKJE 2ZI9A 5CJ2A 1KI1A 2EP5A 2H3HA 2J3IA 2DPLA 5DW3A 3MOIA 3ROQA 2COKA 2WPDD 3VO2A 3G0OA 5BOSB 1WXEA 1N9ZA 3CUWA 1DTSA 4IIHA 2J3MA 1RZRD 2WAMA 2XB2A 1DAPA 1WP9A 3WLHA 2PGIA 4NOLA 1N4DA 2UZ1B 1WSBA 1EXDA 2FR1A 1YL5A 5ALRA 2WUFA 4U3JA 3KL4A 1P7YA 2GCPA 4YRCA 3LUAA 4DHEA 3ZH9B 1PO7A 1H8ED 1JWLA 5FJIA 2Q5OA 2LUOA 3IKMB 1BJRE 1XL1A 4HDKA 4U4AA 1ZJ5A 3OTOB 2GDJA 3HU3A 5COQA 1RBQA 1A8PA 1EJ6A 1UXJA 2XUAA 4XIYA 4QOIA 2E5FA 4MVJH 3WBKA 4D41A 4UUPA 1JQDA 2PXHA 5EQDA 1ZMOA 1PR1A 1GRCA 1IN7A 1V1MA 2AFHE 3K1AB 1HNWB 2IHYA 4X20B 3CF0A 3TTXA 1ZY2A 2P40A 4B3FX 2GEDA 3B1VA 3O9MA 4JSTA 1JHQA 4EX6A 5CURA 4Q24A 1KPHA 2ODAA 1KI3A 1US8A 1YS7A 3DKIA 4C4RA 2XHEA 3K6KA 1N1DA 4BMVA 3AJRA 5K0EA 2B3TA 2P9TA 4J1NA 1QF7A 3OPYB 4LJAA 2XZDA 2RGXA 3DPIA 4MKRA 4OXNA 4HLNA 2VEDA 4WK2B 1FFYA 1O1YA 1L3CA 1O94D 1XVTA 2L82A 2O3RA 3IH5A 4J1TA 2V6GA 4NVRA 2MIIA 3EG5A 2H31A 4PGMA 4JROA 2ZSJA 5T41A 2UUCB 3ROMA 1ZKDA 4GOOD 1WTAA 3EWAA 2N1MA 4RVFA 1UPXA 4YEDA 4ENQA 3O4IA 4C7BA 3AFHA 2WSIA 1VE1A 1O94C 4PLPA 5LP6F 4KV7A 2G80A 5K6AA 2ZM6B 4F3YA 3K94A 2NPIA 4GBGA 2RGGA 5ALXA 4YT2A 2ZI4A 3HY4A 3U16A 4UTPA 4LISA 2CV1A 1TK3A 3QHAA 1FXWF 5F9HA 3UAZA 4HLQB 2W7TA 3NT5A 1DXOA 3P0JA 4YRRA 1ZM2A 2WF9A 3ZOZA 2P9JA 1YH3A 2R1TB 4R2MA 4AVYA 3LDFA 2F6RA 3OX2A 3SQLA 4GI2A 2G63A 3S28A 1HL3A 1SU4A 1SBYA 2D7DA 4M8KA 4U2GA 4DMRA 5KX5B 4IIXA 4MUEA 2IIBA 3OZTA 4DLWA 3NHJA 3EH1A 3SAJA 3G88A 3VKHA 4II2A 2WTUA 3B1JA 3KJQA 1V3TA 2J6BA 1RRVA 4TOIA 3J81A 4J1SA 5TMEA 3QEMB 1M6EX 3BHMA 1E79A 2HK6A 3PV0A 1C0IA 1LX6A 4LHVA 3RHSA 3BMNB 4JGBA 2A58A 1IM8A 2F4NA 4IIUA 3SSMA 2C3OA 4ZEWA 4I2VA 1A76A 1G6OA 2QJTA 3DM9B 3BZWA 4NX2A 3TZLA 1X77A 2GAAA 3LTEA 5BWNA 4NCHA 2ILVA 3USES 3PQEA 1GIAA 3WTBA 2C7RA 1HXHA 2QKYA 1O3YA 1WXIA 3JV7A 4DLPA 2CUZA 2PD4A 1X7ZB 4X44A 1GUDA 3AP2A 4BY9E 4OGKA 2H2AA 3N2EA 3WGHA 1Q6YA 4DLSA 9GPBA 5K8CA 1DGQA 4HDAA 1G9XA 2DB3A 2PLNA 3DXFA 4QOEA 3DOCA 5CB0A 5IFKA 2V0NA 3LWNA 3OZAA 5IT5A 5K0TA 4ARUA 3UEOA 2FB9A 3LUJA 1K7YA 1IFXA 1FTGA 3IE0A 2B30A 2FZEA 2GM3A 2WZCA 3C3WA 1Q11A 1VIAA 2IH5A 2OTCA 4NAHA 5DLPA 1FMJA 1XLWA 1T5BA 2CNWD 1L7VC 4ND2A 3T7SA 2J5QA 4DAEA 4LF7B 3RVPA 1THMA 1T36A 1Z26A 1FP1D 1FP4B 1JEJA 4G0ZA 3F46A 3JX9A 4RGBA 3P97A 1ADJA 3EBPA 3NRCA 2D13A 4FX5A 1YA8A 1X7HA 3OLQA 2IQ5A 4Q4DA 4B3MB 3HJUA 4QGHA 1M2GA 5IH3A 4FD3A 1VL6A 1N1EA 3LCJA 2NSLA 3PU6A 4JS0A 5SY9A 3I64A 3ZTYA 4W5WA 5K0CA 3NT4A 4BLTA 4QTYA 1J2UA 5FUVA 3OHPA 3WISA 2XB6A 1HDZA 2WB2A 3B53X 1WD5A 4ISBA 4DB2A 2EKLA 3OX3A 1HZZC 1M1ZA 5DNCA 1GPAA 3D8TA 2X4DA 3R5FA 4WZBB 1FIUA 4CQNA 4NARA 2ZZMA 4C0JA 4EW6A 5MHTA 4P2BA 4ZCMA 1D5WA 2AC4A 4S1TA 5AK3A 3V3TA 3CPEA 4G1MB 2JATA 4ZOLA 4Z8YA 3ESAA 1JFFB 1FP7A 2WWGA 1F8YA 4KXQA 1CZOA 1ADCA 1C81A 3SVZA 3L79A 3TEJA 4AG5A 3HNOA 2M6LA 2KJQA 1AZWA 1WKBA 1G20A 4CQLB 1V5WA 1ZI8A 1E3EA 1V4NA 2YXEA 4KAJA 3CZ5A 3OLWA 2H5LA 3TMYA 2NU7A 4DW8A 5CVUA 1FDWA 4ZGBA 2RDMA 1Q0HA 3T3IA 4YREA 1C7ZA 3LX4A 4HH0A 1DDGA 1K6XA 1VL8A 4Y6OA 4Q7MB 2WFMA 3OQBA 3L6BA 1I4LD 1QIJA 4AKTA 4EP1A 3CJQA 4YCNA 3EFOA 2QSZA 3TW8B 5EHNA 5CEFA 3FMGA 4RQAA 3TKYA 3VX4A 4A7PA 2HRQA 1XO1A 3P1JA 3F6SA 1Q44A 3A31A 3A3NA 3PWSA 5KYYA 3LDHA 3KT8A 4R1TA 3H8SA 2XKBA 1BE8A 3CTMA 3L46A 5JZOA 5BQXA 5ALFA 1H5QA 5JWRA 5L3QB 1LQUA 4PICA 2Y77A 5DNDA 4GAEA 2O1XA 4ARZA 4QM6A 1QPZA 1OI4A 2R9VA 1Y3FE 4FGLA 5H02A 1CDEA 4NHEA 1IWPB 1KQGA 3H11A 5LQNA 1HNXB 4BNZA 1IC6A 3NTLA 3HGTA 3V6MA 2ZBGA 4NONA 3RHFA 3TB4A 1CLUA 3L0DA 4PG5A 3IP1A 3VYSB 4FINA 4CLDA 3HM9A 4COOA 1GR0A 3MPUA 2DPMA 2XJ4A 3F1KA 1KE1A 1JIUA 2XE8A 1DEXA 3ZBUA 1TKRA 2QRZA 4HDNB 2PT7A 3OIDA 3I73A 3EWIA 1ZCFA 1G8JA 1FDUA 3NTRA 4LDPA 1T4CB 2QLNA 4F71A 1WDTA 3DR3A 3KZKA 2QBYA 4E33A 2CE2X 2L0XA 3S4YA 4AF7A 2WJPA 1M2JA 1R9MA 4BGDA 2NQ8A 3PPYA 3SFTA 4I2NA 1RXIA 1O89A 2ZAIA 2EERA 4L51A 1GFZA 3SJBA 4Q7LA 1Q6ZA 3W3AA 2AFRA 3VVMA 5F51A 4D46A 5AVSA 4LTNA 5FV4A 4ED9A 4ERXA 3RSQA 4OMCA 1MVLA 2PKQO 3O0DA 3ZWPA 4IEFB 2TSYB 1ISRA 1JU3A 1RKXA 2CL7X 2YIVX 3PICA 4PZZA 2FKAA 4CM1A 5KZMB 4Y8VA 5J5VA 4ZQIA 2FUG1 2R5FA 2PKYX 1D03A 4GPAA 1BDMA 3HKCA 4LYAA 4NOJA 2QRUA 2HU8A 4YH1A 1LW6E 2BKXA 2WK1A 1MD9A 1PFKA 4A15A 5LQKA 1YVPA 2ZB8A 2GVZC 1G0NA 3KSRA 5F5NA 5T4HA 3ZCSA 1L4LA 3WL4A 4UTRA 4YMGA 4QRHA 2WPNA 4CTNA 4WXPA 3SP1A 3P2MA 1JAZA 3IEPA 4INJA 2AKEA 2GRJA 3WHIA 3KVNA 3L7IA 2Q9UA 2VUIB 1W34A 2LWIA 4IRUB 1ODTC 1T9BA 1Z7WA 4IDGA 4C78A 2CNDA 1GGNA 5AI8A 3VOSA 2NG1A 4UAGA 1XPRA 3R0JA 3HO6A 3S68A 2GK3A 3TNYA 2PZEA 3Q0TA 4QDTA 3WSVA 2WSSD 4DLXA 3IQZA 3PFGA 4LGYA 4EY6A 2FPWA 3UCEA 4YI3A 3BD8A 5CFMA 3VYTB 2YRXA 4B6SA 1JJVA 2PH5A 4XWYA 1IH8A 2CLLB 3EDQA 2XAUA 1QGAA 4UNNA 3DYIA 1E1MA 2ZETA 2QJRA 2BZGA 1KK3A 1YQDA 2E55A 4XUCA 1JZQA 3B5JA 3OIGA 3U4GA 4RD6A 3U3XA 3RKUA 1YZVA 4EJFA 4KDFA 1JXOA 3WOVA 4A1FA 3HJRA 4ETNA 1R5JA 3TCXB 1U8CB 1U65A 4G1CA 4F84A 3URMA 1XV5A 5CAEA 3CLSD 4RJ2A 3ZWWA 1I7PA 2F1OA 4C7MA 4CHGA 2QTTA 3AY7A 3DXXA 3KR2A 3WB1A 2HK9A 3KOXA 2R8ZA 3HGQA 3ZZ0A 3FPEA 2YWRA 3GEGA 1TLFA 1I6WA 3PDUA 3SICE 2KBFA 3TNDA 5CFQA 4GM0A 2X8WA 5G1NA 4RSHA 1TZ2A 5K0LA 3BH6A 3BMOA 4HRYA 3CLSC 2J6CA 4G9BA 4ZXFA 3CLTD 5D3MA 1C14A 4L8WB 1ZU4A 3D7RA 1T4BA 2VA8A 3K9QO 4IVPA 4P93A 4UCFA 1GXSA 2V7XA 1YI0A 4RFSA 3TN7A 2EX0A 4MUMA 4FQ8A 2ZVQX 1AN0A 3ABQB 1K06A 2JLAA 2YC2C 4MW4A 3K6SA 2XCQA 4QODA 1L8OA 5ALTA 5FWYB 4MIYA 4KMOA 2XZOA 3MTAA 2ZBPA 3GXOA 4EA8A 3UBTA 2NACA 2V97A 2PTHA 4G1UC 4NJOA 1XCJA 1NMSA 4Z7JA 2DAPA 4DVJA 2WV9A 1R8SA 5JCJA 3IO3A 2ZJAA 4XEHA 4CF7A 1P5RA 5T4FA 2OYSA 5EHIA 5F78A 3MCWA 3B9RA 3S55A 4EIWA 8AT1A 4QAQA 4ZOLF 4R69A 4NNJA 3R2JA 3MAGA 4X54A 4MUNA 4NSNA 5HUHA 1HYBA 4L15A 4WXYB 3BICA 2O20A 4OH7A 1QRRA 3QUQA 4DG8A 1AK1A 5DLYA 5LLTA 4B6OA 3LU1A 3V4ZA 5CB8A 2HU7A 1W4RA 2J0EA 2CVFA 5FJJA 2ZANA 5AM0A 3OC6A 3M6FA 5AD1A 1T9ZA 1PTJA 3F90A 4FEYA 5BW4A 2VJBA 4P7GA 1VE3A 3L6CA 3PKZA 4RTJA 3HA5A 5KNCH 3ETCA 4CL8A 4K1LA 2XVAA 4QDZA 1PLJA 4LY3A 5HIAA 3ZVLA 1KZ7B 3A9CA 1E3WB 2WT9A 1TAHA 2WKWA 1WP4A 3VA7A 4KLRA 3HDTA 1J9GA 5IXYA 1XP5A 2SKCA 1YD7A 4F72A 1KNXA 3MTQA 2Q9CA 3D0KA 4X65B 3QU2A 4PZPA 1I4TD 2ZRLA 3K20A 4KG7A 2IYSA 3DYVA 2HYIC 1YBAA 3L8ZA 3AF3A 1B6TA 4LXQA 2HCRA 3C5WP 5AW7A 4MGYR 2HDNB 3L7DA 4HLDA 4DT1A 1IDN1 1NJSA 3P7MA 4UARA 2E1RA 5AM2A 3U0BA 4CQMB 1C8LA 1RXEA 2EFJA 2COEA 3CZ9A 3V7WA 4MYSA 5DN6A 5AR1A 3Q6NA 3H19A 1AVTA 2JC3A 2BM9A 3DWEX 1I0IA 1M1YE 1A9XB 1CE8B 2X77A 3FVRA 1KBQA 1V5IA 2EYQA 3PUVA 5HIKA 4KXWA 1T1SA 2FMUA 3ZE1B 2IS2A 4L4SA 1O0CA 1ATIA 2WE7A 2QL5A 2VNKA 1X94A 4BKOA 5CDSA 4J3FA 6REQA 1QB7A 1QKIA 1H1DA 1UOEA 2PMFA 2Q45A 4US1R 2P2LA 3ANXA 3LK7A 4UD2A 4UULA 2G9NA 4BLWA 4F2DA 1BEEA 3K9CA 2MSDB 4DG9A 2Z5FA 2P4UA 3AIOA 3G13A 3MGCA 2VXYA 5TJ9A 4EA9A 1A72A 2VLIA 4ZGWA 3VHXB 2AFHA 3FCUB 3TTYA 3IIIA 4XM0A 4E7PA 2YVUA 2GK4A 4OY3A 1LJ8A 3RWMB 3HN6A 3P9XA 3MT9A 3DTVB 5M29A 1EUDB 4LBZA 1F3LA 4WBXC 2C5AA 2NU9A 2FPUA 1HI9A 3OFJA 2H1WA 1JSRA 2WT8A 1N2HA 4L8FA 4L08A 1LF5A 1H2YA 4X6UA 2ZIGA 4E15A 4YS6A 4XUGB 1S9HA 3L7YA 2F1KA 5KJEA 5EP2A 4TMXA 3ZNNA 2AEFA 4BZWA 3EPLA 3OLZA 4M21A 1EHCA 2OOKA 1VKHA 4HT3B 3I5YA 4DB4A 2O5EA 5LXTF 2EU8A 1SELA 4OLFA 3T3HA 4QGGA 2UZIR 4NBWA 1GG5A 3HJCA 1SBCA 2B5VA 4KGXA 3DE4X 2UYQA 4JC0A 2UYGA 1QGZA 1NASA 2WD7A 2LKCA 1KEUA 2Q50A 2IPMA 1YAJA 4Q16A 5DOZA 1K98A 2OILA 3DE6X 3HABA 5C1PA 2FJ0A 4MS1B 3FWPA 1TJPB 3DHVA 4XWAA 2FP4A 2JAPA 4QIHA 3WYFA 4N76A 2C4NA 5K2OA 5H4GA 1OOEA 3CX8A 1YZKA 4CEIA 1VA5A 2FZGA 2H52A 2Y1CA 3H2YA 3JVUA 4G26A 1E5DA 4NJMB 4ZA2A 1H6DA 2QQEA 4B81A 1R50A 3D7SA 4D25A 2X8JA 3AXTA 3LGSA 1P1JA 2E4XA 1RAGA 4OXIA 4DR2B 3RIMA 1PEAA 2DULA 2P7IA 3I9LA 1O96B 5ARBA 4JVMA 3ONEA 1CUGA 2FZ4A 1ZVJA 3DBVO 2HC9A 4Q9NA 5FUBA 4K86A 3UMRA 1ZISA 3B5IA 4IIBA 3CEJA 4QO7A 1GLNA 4RUKA 4TPKA 3N0WA 1U9CA 4V02A 3MRTA 3WZMA 3SYTA 1C4OA 2RGNA 1E6EA 1NTOA 1PG5A 1VLJA 1IL0A 2I22A 2XI4A 1G5RA 1J97A 1NTRA 4KRGA 2EZ8A 3ROGA 5D00A 3W5UA 1RKBA 1R4AA 2XQJA 4N8DA 4X45A 2IYLD 4TT8A 5E2IA 4TYPA 2UZ3A 2IE8A 1OASA 1C0PA 2QR3A 2YASA 4FYPA 4FZVA 4LV5B 4MUFA 5JQGA 1BE0A 4H0FA 2JGEA 4L0MA 3TZBA 3D9QX 3WIOA 2OZKA 4XCVA 5KSYA 2GEFA 2LIPA 4EY7A 2XZLA 2ZR7A 3JYQA 1PYGA 2G1UA 4GI7A 1R00A 1V4VA 3BE5A 3OTGA 1FNBA 1UFKA 3D4IA 5EAIA 2EBUA 1MQAA 2P4HX 2QI9C 3BREA 3KFVA 5ED0A 2NXCA 2V5VA 2EJUA 3FYDA 5EQFA 3FUVA 5GP1A 4QPCA 3IGFA 1HMPA 3TIVA 4KPUA 4YQZA 2AYXA 4RJKA 3K0AB 4AD8A 3NVKI 3CSDA 3UHAA 3GFRA 4JI3B 2EZUA 4YASA 1BGWA 1QLWA 2DY1A 4P3OA 1G19A 3AZPA 1BX3A 1TE2A 2XCLA 1ORIA 4FZ3A 1E1RA 3I6ZA 1RAFA 3OTWA 2VI5A 2HO5A 4BYGA 1I2CA 2VJOA 4C0KA 4LDRA 5EE9A 4ZIRB 2VQ6A 3DOOA 4DNPA 5FBRB 1WZUA 4CKYA 4PHHA 1K86A 1KKLA 3KUUA 1HPLA 2YXNA 1RQ2A 5F7JA 3U3DA 3K8YA 4KVGA 1Z5GA 1ZICA 3QW2A 4TKMA 2PBLA 3ZGVA 2AA3A 2HPHA 4X3OA 4F5WA 1C3OB 3INYA 4OIFA 1DARA 2A0WA 1U9ZA 3TO5A 2HB6A 2QN9A 2O0KA 4XDHA 2CHEA 2Y3IA 3CNLA 3I37X 3MTDA 1G41A 2LV8A 3AIMA 1LQ2A 4KAAA 2F7SA 2YVQA 3PNLA 5HQJA 4BHTA 2RGBA 4DDHA 4IMPA 2I4MA 3G0IA 3S40A 4DM7A 1GM5A 1W2GA 4WN3A 5EL0A 1OWMA 3ZV4A 3TXYA 2J3KA 1RQNA 2GMWA 2LCFA 1JT9A 3HCCA 3PIDA 5L7WA 1QC5A 2V1UA 2J6HA 3GGGA 4A0FA 4GNKA 4I8XA 3H0CA 4OB7A 1LH0A 2JLSA 5JZ9A 3CF4G 4MEJA 4LXHA 3ZG6A 4M53A 3UUGA 2MINB 1O9GA 2H18A 2Q1SA 2Q1TA 3KR1A 4OQMA 3MTGA 4B84A 1FU4A 2NVOA 4W1QA 2DH6A 3EW9A 1RFLA 3IP9A 1NJ6A 1R7RA 1W4BA 2PVPA 1K08A 3FDXA 3IP3A 4WK4B 4EG0A 4F92B 1XLTC 3QBJA 4M0CA 1DL5A 1F51E 4BNNA 1ZK1A 4A0RA 5D86A 4GG1A 2JIZD 4ATNA 1ZLYA 1QLHA 1UM8A 3JWEA 3LUHA 4BJHB 4DTIA 2WZBA 1DUIA 2BH9A 4YCJA 1CR1A 1GL3A 3FDZB 2W2VA 3E3AA 4JJ4A 4OHWA 3ROEA 2W2QA 3OFVA 4DR3B 1FYEA 3Q7RA 3RUHA 5AW0A 5FTJA 2YBEA 5U1PA 3RJZA 3ZI0A 4CFYA 2QTMA 1YZLA 1KQ3A 2ZYGA 3IB3A 4E6PA 4M9ZA 1FDTA 1E62A 3OE7A 2JFXA 1A7AA 4DIKA 3JWIA 3HYNA 1E4YA 4AF6A 1C1XB 3H5TA 3ZD6A 4OSPA 4WBNA 3JQAB 1T8RA 2ASVA 4MLCA 1DQSA 2FMFA 4A03A 3OY2A 1RYEA 5DHQA 5F7ZA 3VI3B 4ZEMA 2ADOA 4Y9DA 4C0LA 5I4KA 2HL6A 3HXPA 2C0CA 1F9AA 2VQSA 4QC2A 1Z13A 2AW3A 2V54A 4MV0A 4IUCS 4AWXA 2DWPA 4EJ2A 3WYNA 1UZMA 2V7TA 3GLFA 5CEJA 3LBYA 1NI4A 4M99A 1QO9A 4YB8A 4AKGA 1MZVA 1IZ9A 1COZA 2VP9A 3D8SA 3IUEA 4P34A 2B92A 2ZXEA 5TPWB 3VSEA 2WTNA 4IV0A 4XQ9A 3PCRB 3VPSA 1N0IA 2CJWB 3LHSA 1UJMA 4DA8A 2V3CC 1IBRA 1JDJA 2QM3A 1BGXT 2IHTA 4G5HA 4QEZA 4RLHA 4B40A 1K7CA 4GUDA 5KS2A 2PSDA 1QV6A 1UK6A 1XJ0A 3NBQA 4BRWA 3ZBTA 5DPMA 2CE7A 1A27A 1IHXA 3BVPA 4C06A 2VQEB 4UAUA 4V39A 3H1EA 5J2TF 3TRHA 4IH9A 5LBUA 4EKNB 4NV0A 2WIFA 3CB4A 3ZW9A 2B4RO 4TLDA 4RNDB 4OP3A 3KKMA 8LDHA 3GLGB 2WMDA 1EP3B 1CEXA 3EZ7A 2IYFA 2BBOA 4L78A 3PC8A 3WKAA 1MV8A 1CDZA 2XLCA 1L4EA 1ZW1A 2WM8A 2PH7A 5FWDA 5KNDD 3PFHA 1IBSA 1WKCA 1A2QA 3DMNA 3TLGB 3SJZA 1BJKA 2ACEA 1G0OA 4Q4JB 3O9VA 3NATA 3O1JC 4M60A 1QXSA 1UBNA 2EIXA 2ZKLA 3MS7A 5GONB 4RTPA 1J2TA 5CA0F 4PAGA 1ZGAA 2DPYA 3NETA 3FSRA 3U3OA 4MV8A 1TYDE 4C89A 1JE0A 3DC7A 3JATB 3FPKA 1NUAA 3O8QB 4OAOA 1YU6A 2F3SA 3F2VA 4Z4GA 3H65A 2VF8A 3DB2A 1DB3A 1R3DA 3FSGA 4UTZA 1U1DA 1KAGA 2G6TA 1O8BA 2XNCA 5CB4A 3RARA 4JASB 2DBRA 3SSOA 1N8SA 1ONPA 2R8XA 2Z8ZA 4GMFA 4OL9A 5JQGF 2WHRA 4N3BA 1KAQA 3LYUA 2BHSA 4M7OA 2Y93A 3CUVA 4HVTA 4X00A 4ZRNA 4EQ6B 5BWOA 1H9BA 3PQCA 5EP3A 3OQMA 1X8XA 1PGQA 4TSFA 2JLXA 1C1DB 1Y8CA 4LV8B 4Q21A 4CNQA 4LXYA 2QY6A 2HFJA 3KOOA 3UWMA 2PE5A 2PG3A 1RRKA 1G66A 3F6CA 3WYAA 1I7QB 1MORA 3GT0A 1ONBA 4OI4A 4XQ0A 4UDXX 3TMAA 2HOQA 4Z4QA 3ZJUA 4F97A 3R40A 2Q7DA 1YF3A 3QKWA 4GPIB 5JNTA 1XNQB 5K3DA 3HCAA 1TEHA 2IYNA 2J9FB 3KL2A 3OT4A 1XA3A 1E9DA 2ZG6A 3IT2A 3C41J 4B3DA 4PXAA 1I6MA 3TLJA 3KT0A 4PFKA 4RD4A 4TSKA 1NR1A 1Z8DA 2CYAA 4JLJA 4ZAYA 4RIHA 2AEMA 3WFZA 3K9GA 1Z2PX 4DLUA 2C1XA 3KB8A 5IUNC 4E0BA 1PV2A 3GJXC 4WNAA 2CT8A 2ICAA 1Q7TA 2YJNA 4OOFA 4AROA 4UHKA 3SIPA 1FDVA 1JSLA 2IBMA 3VNQA 1U0GA 1T3GA 1M6NA 4HDOB 2W2MA 3NALA 4EB0A 3GLQA 1XAIA 2KHZA 2YWBA 1A96A 2CVHA 1VBMA 2YOGA 1L7EA 2BGTA 1G5PA 4RMNA 3R3UA 3WTCA 1APBA 3EWSA 3RDPA 1YUMA 2WP8J 1Z5PA 3TVTA 4FP9A 3H8JA 2IUTA 4M0MA 1QAQA 3W8RA 1EU1A 1SOAA 2UVDA 3MWGA 1IXRC 5DXJA 3TTUA 4ENRA 4QG7A 1C7FA 1X39A 1G5FA 4WLNA 1KJ8A 3G89A 4K9MA 4CU2A 1W9MA 1HLDA 4W7IA 3PSHA 2PSSA 1JHMA 4LX8A 4MR8A 5ALQA 5A3QA 3CNHA 1L5GB 1NOIA 3GPBA 1OW3B 3UAXA 5FBZA 1SUAA 2NP7A 1NL3A 3DEJA 4KVFA 2C84A 3OM9A 4RZUA 2GQ0A 1PSDA 4Y1FA 1DBWA 1L5SA 2ZYHA 4B4OA 5JTUA 3U61B 1PJAA 1XEWY 4FHDA 2GCEA 5EIHA 3WB0A 3AB8A 2ZI7A 1E2NA 1Z56C 4CF3A 4K6MA 2OBFA 4M9RA 3T15A 1R8YA 3F6RA 4Q3NA 3JZAA 1BH2A 3E9ZA 3SX4A 4KPYA 4EJ0A 1D6MA 4QVKA 2FA9A 3QVXA 1M1YA 3RS7A 2JGJA 3RPEA 3PDWA 1JDTA 1XVLA 5CDUA 3RVDA 1KQOA 1TTPB 1XZGA 2EFDB 4MUBA 3X1DA 1QTRA 3HB4X 3VC7A 4C03A 1PNRA 2RBEA 1JALA 4A0GA 4IRXA 3MELA 4FLFA 3O75A 1J2EA 2HM7A 2JD1A 4OGGA 4R8VA 1KDZA 2ZPUA 1CUXA 4GX5A 1ZSVA 3DL7A 1CUEA 1VKJA 4CM6A 1R6UA 5FAKA 2B2XA 2Y2UA 2NSHA 2V45A 3MRSA 3P9QA 1RYFA 3GFSA 4LRSB 3LAWA 4MNTA 2XB9A 1O9HA 4D81A 1RRPA 1U11A 1TUIA 1U28A 2JH3A 4QYWA 2XRMA 1ZH0A 2FSVC 3K5IA 4YDHB 1RXUA 2OZEA 2ZRHA 1WNFA 4R7TA 5DM0A 5HCIA 1BXGA 1PEKE 2EGGA 1TUBB 1E66A 4MKIA 1TU4A 3AZQA 4A36A 1WUKS 4TTAA 1DEKA 3PA8A 3WXMA 2V9ZA 5IU6A 4BUJA 1MX5A 4YJGA 4N3NA 2C9YA 1RHUA 2GNAA 4CJXA 5AJYA 3A05A 1KK0A 2PQ6A 3C8HA 3Q5GA 4NDZA 1OU4A 4R01A 3SDSA 2NXEA 1BNCA 1TKCA 1NBOA 2OCIA 3LF1A 3PUXA 4BV8A 5J4HA 1PGOA 3ZKWA 4GEGA 4P22A 2R8PA 3DOJA 2CEKA 1GNQA 5EJGA 3PXXA 5C3MA 3V4RA 4F4JA 2YMQA 3PVSA 1W85B 3AESA 3VR5A 3WKCA 1C7IA 2FRVA 2AS0A 2BFNA 1C4XA 2J3QA 2QR5A 2VBIA 4EJ6A 5BV7A 3IDSA 1XDZA 2FPPB 4EFDA 4JYAB 5IBPA 1J6UA 1QG0A 3AY6A 1NAHA 1Y1TA 1GNTA 1LPNA 3EDOA 3GLVA 3QUAA 4HJRA 4TUYA 4ZV9A 3H5NA 3ANSA 4C01A 1QIKA 4CIBA 3D6VA 1R8XA 2G36A 3FZGA 4PZAA 4E32A 1CFJA 2X0IA 2YQZA 3SVTA 4BXOA 1P0CA 1YS6A 4LVNA 4RS4A 1IIRA 5KYXA 1C29B 3MOGA 3UUWA 3FPCA 1R6BX 2OFPA 5HBRA 4B8WA 5IAEA 1U0LA 1JBQA 2ZP1A 1LPPA 8GPBA 2Z4RA 3LE8A 1U2EA 1B4DA 2D3TA 3RFTA 4J1TC 4BO8A 4YHHB 3L1IA 3EUWA 4FQ5A 3RVSA 5ES3A 1TYZA 4H15A 1DIBA 5DBHX 2VFAA 4Y6RA 5HE9A 3RRJA 4FOPA 4AJHA 2XVZA 3JQ9A 3BCHA 3P9ZA 1A04A 2IYXA 4NICA 3ZGLA 2D8MA 3GMDA 5FWXA 3W5BA 1GADO 1L6IA 3BHNA 1KDPA 2R8EA 2VRCA 1BKDR 2WHXA 3AY0A 3FCSB 2IK8A 4RKWA 3WLKX 5E2BA 2G7MC 5J23A 5K6AC 2WKPA 4AW9A 5DTJA 4YRJA 3RBAA 4GOJA 2W6PA 3DXYA 3CKKA 3IQDB 2HBYA 5KYWA 5FBLB 2X86A 3DZHA 4XEUA 4QQRA 4YRMA 4YY3B 4URFA 2F9LA 2NUPA 3FRIA 1PZHA 2JBAA 5DNEA 3V9PA 2XYRA 3HU2A 2JD2A 3F2IA 3NDRA 3SKYA 1NU6A 1L5VA 1YVEI 4FDLA 2FFHA 2EV9A 1E79D 2FZLA 2IVZA 2PNFA 2EHDA 2C96A 2VHZA 3IRVA 3HY3A 3O92A 4P98A 1L5YA 5YASA 3SQOA 3SZRA 3VUEA 3ZTTA 2BZ1A 5GVSA 1XVUA 3EXHC 3JRXA 1RWWA 1LNQA 1OZHA 4OBBA