1T5BA

Structural genomics, a protein from salmonella typhimurium similar to e. coli acyl carrier protein phosphodiesterase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
201
structure length
199
Chain Sequence
MSKVLVLKSSILAGYSQSGQLTDYFIEQWREKHVADEITVRDLAANPVPVLDGELVGAMRDAPLTPRQQDALALSDELIAELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGITFRYTEKGPEGLVTGKRAVVLSSRGGIHKDTPTDLIAPYLKVFLGFIGITDVNFVFAEGIAYGPEVAAKAQADAKAAIDSVVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Acyl carrier protein phosphodiesterase
publication title 1.4 A crystal structure of a protein from Salmonella typhimurium similar to E. coli acyl carrier protein phosphodiesterase
rcsb
source organism Salmonella typhimurium
total genus 74
structure length 199
sequence length 201
chains with identical sequence B
ec nomenclature ec 3.1.4.14: [Acyl-carrier-protein] phosphodiesterase.
pdb deposition date 2004-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1t5bA00
1QBGA 2Z9BA 4LA4A 1FX1A 4FGJA 1FLAA 3QFRA 1V4BA 2F1OA 4FGKA 3LCMA 5B3KA 5EMNA 1AG9A 2MOKA 3O2NA 4NLLA 4C76A 4FGLA 1AKTA 1VMEA 1KBQA 3TE7A 1D04A 2MWMA 1F4PA 4YAFA 4PTZA 1TLLA 3P0RA 1CZUA 4J8PA 3ZHOA 1RLIA 3R6WA 1XI2A 4ZVMA 5LLDA 4HS4A 3GFSA 3HR4A 2HNAA 3OX1A 3KAQA 2QX8A 1RLJA 2FAXA 3NHLA 4F8YA 1OFVA 2OHHA 4DY4A 2FDXA 1YCFA 1CZRA 3B6IA 1AKVA 4NULA 4BMPB 4QOIA 3F90A 4ZVKA 4YAOA 2QR2A 1YCHA 4R81A 3NFRA 3D7NA 2X2OA 3ESZA 1NNI1 1T0IA 4QOEA 4QOJA 1JA0A 4QODA 1WSWA 4U7FA 1I1OA 3ESYA 4S24A 1YOBA 4LTDA 4C14A 2XOEA 1X77A 3NHYA 1YCGA 5EAIA 1FTGA 1WSBA 6NULA 3HLYA 4LTMA 4QOGA 1DX9A 3EYWA 3FJOA 3OWXA 1XT6A 1CZHA 2A5LA 3OVMA 2OHJA 4Y7CA 4ZVLA 2Z9CA 1AKRA 4YQEA 1ZWKA 1YRHA 5LJIA 1TIKA 4H2DA 3NHJA 3KAPA 3W7AA 2V5UA 3OJXA 4FX2A 4N82A 4CF6A 1B1CA 3QFCA 1AKUA 3UXHA 4YAWA 3S2YA 3U7RA 2OHIA 2MT9A 4DIKA 2FZ5A 5LJLA 2QX4A 1BU5A 5FA6A 1XYYA 3NHRA 1ZWLA 2QX6A 2ARKA 1YKGA 3G5MA 1OBVA 3NHSA 1J8QA 2X2PA 2R96A 3F2VA 4YAUA 1AKQA 4GI5A 4LAFA 1RTTA 5LMCA 4GQIA 4C0XA 1J9ZA 2Q62A 5TGZA 2MTBA 1FLVA 2QWXA 5JROA 2QMZA 1SQSA 1DXOA 2M6SA 1CZNA 1FVXA 2V9CA 1FUEA 5ULLA 5F12A 4YALA 2FVXA 4D02A 3UXEA 1BVYF 5NULA 1FLNA 4XDHA 3EDOA 2BN4A 4U7GA 1ZX1A 2M6RA 3B6KA 4BMOB 4Y9UA 2FLVA 2FCRA 4ZVNA 3NHWA 1J9EA 3B6MA 4U7HA 2AMJA 2BMVA 2B3DA 3RPEA 5F51A 3L9WA 4ESEA 4CETA 1AZLA 3KEGA 1AHNA 1GG5A 3SVLA 4XDGA 1AMOA 1KBOA 3W77A 3GFQA 2BF4A 4QOFA 1QHEA 2HPVA 3NHFA 2RG1A 3KLBA 3W78A 5F4BA 4QOHA 2FZVA 3HA2A 1YDGA 3F6RA 1E5DA 2GSWA 3O73A 2D5IA 1XYVA 1QRDA 5FUQA 1DXQA 4HEQA 3NLLA 2ZKIA 2QX9A 4Y9RA 3OJWA 4DILA 3NHKA 2Q9UA 3FW1A 3TZBA 3ES9A 3JSXA 1H69A 1D03A 3F6SA 2N1MA 4LTNA 3FNIA 2KLBA 4PU0A 1J9GA 5FX2A 4C0WA 1JA1A 3TEMA 1RCFA 3N39C 1FLDA 2BZSA 4H6PA 4ICIA 5NLLA 3L9XA 1OBOA 3NHPA 3ESXA 2Z98A 3K1YA 2W5UA 2Z9DA 4N65A 1CZLA 2WC1A 5LBUA 1CZKA 3K20A 2HNBA 1T5BA 1AKWA 5A4KA 1SG0A 3W79A 3FVWA 3OX3A 1QR2A 4OXXA 4PTYA 1H66A 5LVAA 2FOXA 3OWHA 2KQUA 3N3BC 2BPOA 3B6JA 3QE2A 3NHUA 5BUCA 2QMYA 2FX2A 1D4AA 5EA2A 3OX2A 5B3LA 4N9QA 2XODA 3U7IA 5LBTA 1CZOA 2V5VA 3LT5A 4GR9A 1C7EA 2OYSA 2R97A 3GFRA 3N3AC 3FX2A 4M0CA 1C7FA 3GAMA
chains in the Genus database with same CATH superfamily
4KTVE 1Q6YA 2H08A 1VLZA 3IAEA 5ESWA 1U65A 1FS5A 3WGIA 4EG5A 5FFNA 4BHTA 5BRAA 5A0FA 2ZANA 4HWSA 3GGSA 1GR1A 3PI6A 2JLVA 3OMWA 2FP4B 2R6FA 1HTBA 4X3OA 5A4JA 2IHYA 3HU1A 3QU9A 4OJYA 3O4VA 3RANA 3H11B 3L6RA 5ALKA 5EJEA 1NQVA 1PAUA 1SHTX 1FMCA 4UZSA 5JAHA 3AG5A 3ZDXB 3RC8A 3V2GA 5LB4A 1FU4A 4KLNA 2B4TO 3TFWA 4HWTA 1JEAA 3IEKA 5KREA 5K2OA 2HCTA 2HCBA 4IUBS 1PR9A 1QRAA 4JROA 4ZJPA 2Q6OA 3NP9A 4DBZA 3PG5A 1KDYA 4MVXA 1ADJA 2WYOA 1KRWA 4G0WA 5JSYA 2HTEA 2F8SA 1CERA 1B93A 3VJRA 3MFQA 3NEPX 3HZHA 3LI2A 2NYUA 3VV3A 3WBBA 1GWNA 2XUDA 2Y6UA 3TCXB 3QWIA 4MW7A 1U2SA 1VMEA 3K9GA 1DC6A 4MVJG 1XWFA 4J3NA 1AUXA 2JRLA 1F17A 2AJTA 1U9IA 3OHSX 4EG0A 3H8WA 3IT2A 5BQ5A 3ZCRA 3TR6A 4ZV9A 1YMUA 5JWOA 5KNDH 3DDUA 2AUTA 5PGMA 1GUZA 1YQEA 3RYFA 2PRZA 3L1HA 5CT6A 3W6PA 3X43A 2DC1A 1YD7A 2P79A 2WW8A 3FJ1A 4V03A 1EESA 5D87A 1E4VA 3ZHOA 4DTCA 3GB9A 4MO2A 1J2RA 1XI2A 2Q49A 5BWNA 3KHTA 2O0MA 1K8QA 3A70A 4BY9E 3B3GA 3ZV4A 3LBYA 2ZBVA 4HRVA 1TMKA 3IV7A 3OZGA 4HNSA 1RR6A 3OX1A 4DNOA 5JALA 1NLMA 3DAYA 2Q7OE 2YWEA 2FCAA 1QWOA 1ESDA 1WW8A 2OT3B 2ZUWA 4LECA 4XWYA 2QYHA 1F8YA 4ZZ2A 2HEIA 2C61A 1G5TA 3NEJA 3R24A 4RVDA 4RYDA 4O8CA 4DHEA 1C8LA 3GP3A 2NP7A 3L04A 3DZDA 3GCXA 3MIIA 4BBZA 1JG7A 1U7UA 4O8ZA 3QXJA 1OLUA 1EWQA 1AQYA 2PS3A 1NVUQ 2QJTA 2WSBA 5I7WA 5JRJA 1EXVA 2GKSA 1CR4A 5H70A 3AGQA 3BS4A 4M7OA 3EH1A 2FOLA 2IE8A 4RZUA 4P38A 1SU7A 2ZSKA 5LQJA 4Z4IA 1Q50A 3ETHA 3GRZA 4BQFA 2VG8A 3PXXA 3SFTA 3R7NA 4D4MA 4JFAA 4AYXA 5HIMA 1ZK0A 4KV9A 1N7IA 4ZCTA 3ETLA 5H9WA 3AF5A 4WXEA 1G7SA 1JLKA 4H15A 1D0IA 5IZCC 1YO6A 2UUPA 3QW2A 4LGMA 5DYIA 4KX3A 4MARA 3ENZA 4LOAA 5FT9A 3VHXA 2G76A 5B55A 4BYGA 2W2PA 2IW3A 4WGGA 3VQTA 4Z9FA 4ASUD 5LYYA 2CNBA 2WWVD 4RV5A 1V1MB 3PE6A 2VJAA 4WN3A 4WXHA 1T1RA 2OMEA 4K2AA 2DR0A 1HE3A 3AIOA 4UAJA 4ZO9A 2HXSA 4C30A 1M6WA 3AVPA 1DFIA 3GH1A 4JNKA 2VJYA 4DMLA 4E94A 2QGFA 3N9IA 4DQKA 4IYRA 5GJCA 1YAJA 2JFFA 3NETA 3T41A 2BBTA 3OU6A 4RL4A 4XYBA 3LQ2A 3Q7SA 3TOCA 4FI3C 5DSTA 2OD2A 3IRVA 3T0IA 3ZXXA 4OYRA 3U09A 1NZDA 5CD1A 3QP9A 4MWZA 2ZB7A 4NNJA 5IJ0B 2FR1A 3HE3A 3LT2A 2AT1A 4DA7A 3KZCA 4M0PA 4RKRA 3RU9A 1P73A 1M10A 2XUIA 4INJA 4QVGA 1JR6A 1PEDA 3QVWA 3FKSA 1CD5A 1WKVA 3UBMA 1IHYA 3ZV3A 3MB5A 4NCKA 1WUIS 2B94A 3ULKA 3MCTA 1C0IA 2UVPA 2BIFA 3NVMB 2UZAA 2BSAA 1XRNA 5G4LA 3ZQ6A 3QE9Y 2QGNA 4ER5A 4F2HA 3PLAE 1XZNA 1MIOB 4ENPA 5CAEA 3JQ8A 2WT8A 4C14A 5EERA 4RJTA 2DRIA 3U3KA 3O74A 3X1JA 4WXMA 2C9OA 3B3AA 4PGMA 4MROA 4OP2A 3TD9A 1CY8A 2QJFA 1HG1A 3G2IA 5EAIA 1WRBA 3UH0A 3O75A 4B6PA 4BVGA 3FYUC 3C3WA 3RWOA 4E5NA 4II2A 1X8XA 5CGQB 2PBLA 1KWGA 4JENA 3FM9A 5F2NA 2DEUA 1KEPA 1Z34A 4BE9A 4FOSA 2JJ1D 3SBOA 1EFTA 3SFVA 2VDVE 2VC2B 4BO2A 1TRKA 3DYBA 4CU5A 4LF8B 3ZCSA 2VDWB 4RD1A 3HXQA 4Q15A 5T67A 4BKOA 2DPLA 1V1JA 1DJNA 2W6ID 3TBFA 3KPJA 3VC1A 4BLRA 3FJOA 2QRVB 4CIWA 1XT6A 3VKHA 2FWBA 3ASUA 4MRRA 2AMLA 4KOAA 4MCHA 1GPNA 1X74A 1AY0A 2EHDA 4TKUA 4H27A 3QG5A 3UUFA 4K9QA 3B2NA 1AB6A 3ZOZA 1HXHA 1JSXA 1KS2A 2C42A 1UXGA 2W2XA 4JQSA 1E6CA 4MUMA 4YQEA 3ROFA 1T8TA 1Z4LA 1ZN7A 2QUIA 2WF6A 3G2MA 3NBYC 2CL7X 4I6EA 1PJQA 3NZEA 5DM1A 4EM6A 3AEKB 1CQJB 3KXDA 2ZT8A 1QH8B 2P65A 4R2IA 2F3QA 1W4CA 3NG1A 1HQKA 1U7ZA 3CUYA 1COWA 4DJDC 1NNEA 4BNHA 4KR7A 2BGRA 3QVGB 4I5IA 1JFTA 1PK7A 3Q10A 5L40A 3CWZA 3D6NB 3LFTA 1SVIA 4M49A 4XM2A 3RG2A 2E85A 2A5JA 1E1RA 4FX2A 4PYRA 4YP9A 3U4QB 5HE9A 3NMUF 4W5RA 1DAKA 1KZGB 3O0DA 2D3WA 3IFSA 1XD2B 3U9TA 2B78A 4CF6A 5JLJA 1B1CA 5AJUA 4OLAA 1UJMA 1UM9A 2RGXA 4BX9A 4DV5B 3RLIA 3TSWA 1W2WB 3OM1A 5A06A 5LA6B 3ROZA 3SY8A 3GJ8A 4ALMA 1BQ4A 2BY4A 2P9QA 4R0NA 1TM5E 2RG7A 2E18A 4ED9A 2VK1A 3E9MA 4ZYTA 3ICOA 5F73A 3UAVA 3I5AA 4HLQB 2QZZA 3T3EA 4YY3B 2P6RA 1Z7YA 3ZIDA 1XYYA 1Z7WA 5JDIC 1JSCA 1OBFO 3EFBA 3OP4A 2HMSA 3CF4A 1CQXA 1J09A 5C9ZA 1H2AS 3TZ6A 4B3XA 3D7RA 3A6EA 221PA 4WKNA 2BSQA 4BNNA 3QKSB 5A2QA 2IOFA 2EBFX 2XB2A 1NJFA 3KQMA 9MHTA 1TNDA 1BW9B 2YY5A 1H8HA 1AKQA 4H1WA 4IYJA 1BCSA 2DUUA 1JVNA 1F12A 4REQA 3BWVA 2FMUA 4J7XA 2ZSUA 3ICCA 3C1TA 3T7KA 4BO1A 4K5QA 4UPDA 1JHRA 1KJNA 3ZLTA 4P3KA 2J1LA 4W5QA 1N7HA 2A5FA 2JC3A 3EMBA 2ZZNA 4K86A 3ETJA 1PK9A 1J42A 1M83A 2O23A 4M8SA 4DEVA 2POQX 1KZ1A 3E9NA 4CMAA 4NABA 3L8HA 5HKKD 1L6IA 3FCOA 5DBHX 4CLHA 2WIGA 3K9HA 3U3OA 3EASA 3VVLA 5KO2A 4LPSA 4EUNA 1DO2A 4MUKA 1NTRA 1KDPA 3LP6A 2OZPA 3C3PA 1GQYA 3HVIA 4FOPA 1XMVA 4HEHA 4KQGA 4L02A 2B8JA 4MV3A 3CW2A 3JQAB 4IIJF 4X44A 2J48A 4KR0A 2VH1A 4H7HA 3ZQJA 5K6AA 4YJKA 4DV4B 5JNRA 1EP3B 1FUEA 3O8LA 1BGVA 3FH0A 3T1QA 4BS9A 5ULLA 4L57A 4QGGA 5LM3A 2HHHB 1SC3A 3FOWA 5ELMA 1QPBA 1E99A 2PL1A 2FN4A 3WK5A 5TVKA 2Q3MA 3KVYA 2ZBFA 3I39X 2ONZA 2DF8A 2WHPA 1RE0A 1SVMA 3IVXA 4HAXA 4Z7NB 1XLTA 1QGUB 1Z6XA 1ZLYA 2JIDA 1WBJB 1DBPA 1ZX1A 4I50B 1Y6QA 2IU3A 4G0OA 3WLFA 2FPUA 4J4TA 5CEFA 5IKMA 5K0SA 2OGTA 3AR8A 3O3CA 4ILKA 4TUYB 1M2WA 2GCOA 2TMGA 4XX1A 2H9AA 2FLVA 2WINI 3W9UA 2PKQP 3YASA 1D2GA 3QPUA 1ZP6A 1HK7A 4GOND 4CL3A 3VAZA 5JJKA 4ZGGA 1NTOA 5EMHA 4ZC8A 4IIBA 2CNLA 3GLGE 3P2MA 1UPTA 1ZVMA 4XUDA 5F51A 5GWXA 4NMMA 3V4SA 5ALLA 4PPYA 2Y66A 1ZINA 1NRIA 1QV7A 2HSWA 3ZLVA 4F2PA 4GG1A 4OAQA 2GBGA 4DOMA 4A6EA 1EDOA 3DOEA 3EIOA 1PEYA 1SHJA 4Z0NA 2I4LA 4J0HA 2XUOA 3CV3A 2KHZA 4EJ2A 4X8LA 1BGXT 5TB5A 4D9KA 4OI0A 3VBCA 4LIPD 1DMSA 4XDGA 3UAYA 4EG7A 5F3WB 1SCBA 2QAGB 3OJFA 5BSHA 1C1YA 5FR2A 3VO2A 2E7ZA 4HYQA 4C6TB 2WU0A 2C2GA 2X8JB 1QHEA 2L2QA 1E58A 3M6LA 1NW9B 1FB5A 3O03A 5HMLA 2C0QA 3TKLA 1SXGA 3TXXA 4HUQB 4X6XA 3DAPA 1OLSB 5AVYA 2XQJA 2OYRA 4NEHB 5TEVA 5CITA 2P6PA 2QU7A 3AVOA 3HGTA 2PMFA 4TV9B 4ZRNA 1L9KA 5ALTA 3VU1A 4BMDA 4XVUA 1SKUA 4DMHA 2V7UA 3A9VA 2CUTA 3JWPA 4U9UA 4HY3A 4DSAA 4OKNA 1W1WA 2W93A 4W5OA 4K1LA 1G8YA 1UWLA 1O87A 3HWRA 3WNCA 5BN3B 1A8QA 2ZT7A 2VYCA 3T1OA 1DQRA 2ZBRA 4RZSA 1Q0SA 2DECA 1S02A 5GJVC 4X61A 1I2BA 3KELA 3ED5A 3R6DA 3IAFA 2E4XA 1WMEA 1AVTA 2C82A 4YAGA 3GT4A 3PWSA 3ZUGA 3AR7A 3VX3A 3M6AA 5JANA 1HV8A 1HZZA 1LDNA 3HJFA 2FG5A 2W8BB 3NB0A 3P26A 1PZFA 4DILA 3FVQA 4KG7A 1SUDA 2WM3A 4KITB 4RTOA 3INRA 2D8AA 4UHDA 2FHPA 4LRTB 4KGZA 5A4DA 1S9HA 1BKSB 4N7RA 1TF5A 5LUAA 1IVSA 4JYBA 2C7RA 4ZARA 1I0LA 3PXDA 2PKXA 1LDYA 1P1RA 1QYDA 1YQWA 4P08A 1FMTA 2WOJA 4PX5A 3WMRA 1JJBA 3PVSA 3EDQA 8ABPA 1QRSA 1JQKA 3OKAA 5AXBA 2IWHA 3EHEA 4L27A 5SICE 5HQ3B 5GVRA 2PSHA 4CDGA 3N86A 4BKRA 4JYAB 5IT9A 1M1YA 2Y0CA 5D5QA 3IOBA 4TKVB 2I1WA 2XWPA 3CZ4A 3FIUA 2EP7A 3ASZA 3I6YA 4AC9A 5LCXA 3DTVB 1DKLA 2RMKA 1J07A 1ELOA 2P2CA 3KB8A 4KQCA 1VE1A 4OO3A 4E32A 2XLCA 3AVTA 1O95D 1M2HA 2Z5GA 2IITA 3MIZA 4NZYA 3E27A 4ZEVA 1J23A 1MDBA 1MQAA 2NV2B 2R1TA 2NT4A 2Q3JA 3E15A 2XDYA 3TRIA 3W8DA 4ZZ0A 1NJ6A 3SM9A 3SJBA 1FYXA 4WOCA 1W35A 2HIMA 5D6NA 3GUVA 1CQPA 4ICIA 1ZCFA 4EIWA 4JLUA 3AONB 5TPWB 1EDBA 3W3AH 5I9LA 3UKOA 2O7NA 1RHRA 1YQGA 3PUJA 1PLJA 4A92A 3DT9A 2NG1A 2ATXA 2CZQA 2W5UA 3EVBA 2LKCA 2OVBA 1PG0A 1BO6A 3EXHB 4BEJA 4DE5A 3AI3A 3N8GA 3AFOA 4X63A 3KB6A 2GXQA 3DD1A 2ANBA 5ELLA 3SQOA 2BE7A 4OMDA 4F8EA 4OBWA 4B4OA 4C7XA 5LQKA 2J32A 4JI1B 1ZD5A 4BUCA 1W73A 5IFKA 4JVLA 3CURA 3AL2A 3E9RA 2PH1A 3ER6A 4INAA 1VCNA 3CT4A 1I3LA 3DBVO 3MWKA 1E9VA 2ZTUA 2DYKA 1KIMA 4DCUA 4D2IA 2ZJ4A 2NZXA 2VWPA 3G2JA 3ZTYA 3A2MA 2Q29A 1QSGA 2G80A 1KOJA 2WUGA 3BFKA 3HYNA 3G6WA 4TTIA 3DHEA 4JLDA 1KEUA 4OXNA 4PTLA 3VR5D 1MF7A 5FOUA 1HL7A 1K5DA 2ZJ3A 3O4IA 2DUNA 1BGWA 3IX7A 5AM1A 4FLMA 3AFGA 3H2IA 3NTVA 4F60A 2H5LA 2I65A 3CX8A 2Y2UA 4I5DA 5ALYA 3REGA 1XA0A 5YASA 4LQ4A 3OZRA 3ZVRA 3V3TA 4EF5A 1H93A 3L7IA 4I9FA 4BV9A 3U5ZB 5CEJA 4NK5A 4DPMA 3N59A 4Y2TA 1PZHA 3RS2A 1WCV1 2K7ZA 4N6GA 1OXMA 4KPGA 1WVGA 3GD7A 2ZB2A 2FQ1A 3OIUA 4CYMA 3FD8A 2OC4A 4UU1A 1W9HA 1ITZA 4QQ8A 2I6TA 2IYOA 1DWQA 4OX9B 3RSFA 1L0BA 1PN3A 4N6NA 4MOWA 2QPTA 3EQ7A 4D56A 2Q4RA 4I3GA 3QEOA 3RKSA 1WD7A 1RS0A 2PGXA 3ZU5A 1AN0A 2NLOA 4BMNA 1XR3A 4C6HA 4C22A 4RTPA 1OI7A 2HN9A 3GT7A 3GJ7A 3GZJA 2M32A 1QE5A 3H13A 4TN1A 1UDRA 2OR3A 3HR7A 4HX5A 5T4BA 1OX5A 2QSJA 4PM4A 2OV4A 2BFFA 2X0KA 4U8HA 3MPOA 1G5IA 3NBKA 4EW3A 2G1PA 1CDZA 1H9CA 1Q74A 1UPBA 2NXJA 4WY2A 4AQYB 3PGJA 5CHEA 3WVNA 1VYUA 4DXHA 1P8AA 1GKLA 1E1DA 3DWGA 8MHTA 5KTPA 4O1HA 3P4UA 1N2CA 2OB1A 2JH8A 4FGJA 1X2BA 3WWEA 4U6SA 2P2SA 3E9DA 1ZMBA 3B3JA 5FI3A 4MKGA 4MUYA 1IXKA 2C04A 3GJSA 2GF0A 2R68A 1R00A 1XGKA 3KKPA 4MR7A 4MYRA 4RS4A 2HU5A 3MQ2A 4M8LA 2VQEB 3FY4A 1NLUA 3DDZX 4JCOA 4QKQA 4OBXA 4M1KA 2X8BA 1JYFA 2V97A 4NCJA 4DDWA 2ID4A 1ZONA 5J2TA 3PEVA 1K3UB 1UEIA 2XE8A 2JCXA 3Q2OA 3U44A 3DW1X 3KFXA 1RZRD 4C4YA 1Y80A 5HWSA 3T1YB 3R7WA 1A9OA 1NVAA 3IQGX 4IFBA 1OQAA 4LWPA 3EZ2A 4NECA 4IFIA 4O3MA 5IDQA 1MH9A 2BP7A 1B00A 2P2YA 4HQ0A 1R4MA 1MUUA 2YBEA 4IDQA 4JP3A 4RXUA 5M3BA 1SM4A 4TTQA 3B12A 3WJ2A 1OWMA 4NARA 1SWVA 4LJLA 1ZOSA 3S6JA 1ZK4A 1T24A 2JI8A 2PX0A 4W6QA 5EEHA 4MS4A 1Z0UA 3WGLA 1ECCA 1KOGA 4NH0A 2P30A 4DCVA 3IOEA 1T0UA 2Z58A 1X0XA 2PWPA 1MABB 4PAGA 2NU9B 3SM3A 1IOVA 3I72A 2CXOA 5LLDA 1BXGB 5CK4A 5MN5A 3GFSA 3P2JA 4EG4A 2IT1A 3OPXA 4F84A 4JJ4A 1RHKA 3IMFA 2EOAA 4CMIB 5ADHA 3OE7D 5CH5A 4IBOA 4H0FA 5F76A 5HOEA 5BVGA 2DFLA 2YIJA 4ATNA 1SEPA 2QX8A 4NK4A 3N5KA 3JATA 2GASA 4YMWA 2KBFA 1JFLA 4PXSA 3PITA 1NMZA 3WIBA 4E4RA 2XA9A 4I19A 2BR3A 4E09A 4BX8A 3BE4A 4HWPA 1Q92A 4Q5IA 2HRDA 2ZE6A 3Q1LA 4V24A 4UNIA 5SZHB 3R7LA 5B6IA 2ZT6A 2YL2A 5CX1B 5HK8A 2II6A 3D64A 3NVDA 1O4WA 1J06A 1MFZA 1X9HA 4IGFA 4KPUB 3QA3E 5E3IA 4PXYA 4PRZA 4UE6A 3LJKA 4V2IA 1Z0SA 1PF7E 4H3HB 2QVXX 3ROMA 1OPXA 3KKNA 3HKCB 2JD2A 3EXG1 1X1DA 1CX9B 3HDHA 3NAMA 3LM8A 4ZT4A 5KYVA 4A10A 5IHPA 2J0EA 4D3ZA 5J2TF 4PZEA 2ZBDA 4IIUA 4U6QA 1M3SA 1IN8A 3NI2A 4PN7A 3X44A 2BFDA 1HE4A 5DBFA 2VLBA 3HJAA 3I01A 1K92A 5B37A 5EJ6A 5KWJA 1UUFA 2HBYA 4Q4JB 3NFRA 3C39A 3UCFA 1BWQA 4MKZA 4U0JA 4Z4QA 3JYOA 2QLMA 2IHUA 3K0CA 3T1NA 1DP4A 4P7JA 3RFXA 1M1YE 1DQNA 4Z4GA 4E7OA 4RWEA 2MYNA 2HR1A 3UAZA 3ZW7A 1Q7CA 3D2BA 4LJ4A 3UF0A 3I42A 2A1TS 3GBPA 4KQ1A 1XUOA 4JJ7A 4FJ1A 5MN4A 1K08A 4HAIA 2BGLA 1X1AA 2V55B 3TLAA 1AZSC 3OCVA 2SCUA 3SN6A 1WCIA 4H35A 4Q3EA 4F1KA 3BZBA 1L7EA 1X13A 3FMIA 3JASB 1ZH2A 2AFHB 2X4IA 1T43A 1W2GA 4ZKEA 4KRYA 3TLJA 2BGNA 2JJ2A 1H1LB 4HNVA 1JIXA 5BQPA 3VDRA 1DG9A 4GKVA 1OI2A 4FSHA 3NR2A 4QOSA 4C0SA 2L17A 4JDPA 1J0DA 1EGMB 1T1JA 2IHVA 2P0EA 5CNKA 2GAAA 4HSGA 1LNZA 3ZDZB 1Z45A 2PSJA 4C3OB 4HJRA 4G37A 3LX5A 5CURA 4D4KA 4G8DA 2R0QC 2QTTA 2HQRA 1QPGA 4M8IA 4IZIA 4YROA 1N1MA 3GFFA 3DBLA 1N32B 3HCCA 3KRTA 3LOUA 3PLRA 4LS3A 5AKYA 4CQJA 4CKEA 2ZSDA 1X80B 2I4IA 2WJ4A 3CZCA 2WUEA 2DU8A 5D7BA 2B92A 3L4KA 3CNNA 5EJ9A 3UJPA 4ABTA 2X2FA 3GEIA 4QDXA 1O03A 4WD3A 1N2BA 2JLBA 3MB8A 4YMHA 4Q66C 4B5LA 5CYOA 5JC1A 4FDUA 4KODA 4P36A 4G24A 2A0XA 2CXUA 1BS2A 4JLKA 4OHRA 3MILA 4KTTE 1M2FA 1DCFA 3UH1A 5B57C 3VNUA 3U7JA 4RQUA 5KCZA 4MW4A 4Y2HA 4IR7A 4NYMQ 3OWXA 3C6YA 2BDTA 1A9XB 5U4QA 2XXJA 2R00C 3RAPR 3VR6H 5PNTA 5AVQA 2DJIA 2HF9A 1PZXA 4DEYA 1IN4A 3CWQA 1AJEA 3H9JA 4HT3B 1RWNA 5L3SA 2XIQA 2V7QA 4Q7LA 4DRXA 3GLFA 3BD6A 2CFIA 3DCYA 4PG6A 3IGFA 1WS6A 3NRJA 1AA6A 1YRHA 2BMFA 1PKEA 2VDJA 3GVXA 3MT9A 3MS7A 5JASA 1Y6FA 1XNQB 4AURA 5FULA 3GDFA 3E23A 1UJCA 2OV8A 2WM8A 1FF9A 3UJ9A 4LWQA 5AKEA 3S81A 2V0NA 3DVAB 2VRNA 1E5LA 2PO7A 4GC9A 3RREA 2Y1FA 4AZSA 4J16C 2RAPA 3OICA 3LF2A 3UO8B 1U8AA 3IB6A 5KDLA 5FB3A 1IDN1 3RC1A 4IRUB 3JAKB 4I5FA 3LP8A 1CUEA 3FMOB 2AKAB 4TRRA 2M6LA 2ZYVX 2VUHB 1EFLA 1LNQA 1HDGO 1QFSA 3GXBA 1VGQA 4J76A 2WMYA 3OJXA 3GY0A 4K03A 1ZI6A 3I73A 3ND5A 2PMKA 4LRSB 3QEBZ 1YVUA 1IQUA 5BV7A 5JO0A 5A5FA 2P5SA 3B9BA 1LPNA 3W7VA 2EKQA 2VNSA 4RK6A 3HZRA 3C43A 1NFRA 5EP2A 1ODSA 4DIKA 4ZV4A 1F4VA 4OHVA 4EMSA 1N2CE 3WLPA 3QEAZ 3NHMA 1WZCA 3QIAA 4YPOA 1ISHA 4DL9A 3EARA 1BVUA 4DA8A 5G3ZA 1NOIA 3N53A 1XQYA 5EOVA 5G0VA 1P1HA 3DV2A 5TQ0B 2F17A 1KR2A 1HFWA 1PIWA 3AR3A 4GOOD 3N0VA 3OEED 5LQNA 3EEOA 5CR9A 2D0IA 1E9EA 1QS0B 3F6EX 3PDIB 5K1ZA 4KBYA 5AO9A 5K3AA 4B87A 5FI5A 1NF3A 1OYYA 2CN1A 4BFVA 4CCAA 5AWFC 2ODAA 2RHBA 3MRVA 4JUFA 5A4IS 2KSQA 2Z2JA 4GI5A 1U8TA 1LTQA 4QNMA 3W2IA 5CXSA 5ICGA 2X5KO 3A9TA 1QHHA 1XRRA 1HY3A 2P9BA 3KTOA 3QUCA 4LAFA 2MCFA 2I33A 1L4NA 2P9HA 3DZFA 4A73A 3KOYA 3CEAA 1P4JA 2QN9A 4RQBA 3RRYA 5JZOA 2BKVA 4BZZA 1KFEB 3ZD7A 3SC2B 1RQRA 2IEAA 1PDOA 3PR3A 4RPIA 4DLRA 2B0CA 4QYTA 3UPUA 3GAFA 3U4DA 3G2QA 3M89A 5I8PA 1EBFA 1GTJ1 1T0JB 1Z8NA 3QVMA 1FIUA 1BYUA 4TKZA 1Z63A 3RHTA 4H08A 1NBMA 5LP6C 3THYA 2Q7XA 3VOTA 1DWPA 1KPHA 4UTXA 3D8UA 4O2BB 2EJWA 2WT4A 3DVRX 4M9ZA 4MV8A 1VKOA 2YQ4A 5EIXA 4AICA 1XRJA 3N6XA 1I10A 1MO5A 2GTHA 2Y67A 5FOQA 2JLRA 3IO5A 4RFLA 4OQZA 4ROTA 4EJ0A 3PUIA 4IV5A 4EY6A 1A4RA 2I1QA 1HWYA 2FP3A 4N3AA 1BFUA 1O97C 1S3FA 3IAM6 4BFLA 2JB9A 3MGCA 3BMQB 1SZDA 3TD6A 2HI0A 4A3SA 3DGEC 3QVOA 2BN4A 1ZC4A 3MAJA 3N6VA 4FYWA 4LI3X 2XYPA 5FAKA 1GZ3A 1ZD9A 3D54D 1NI4B 2ZI7A 2FZ4A 4PAQA 1RLMA 2XNDD 1TYEB 1F1JA 2OHFA 1XRSB 1OILA 4RM3A 4Z9YA 3ZWWA 2H65A 4AG5A 3HEAA 4B47A 3FAZA 3NDBB 1EP1B 5P21A 3NHWA 1EHIA 1YRQA 3L6DA 2NUAB 3T3DA 3VDXA 3LP5A 3V1UA 4U7HA 4RTRA 3GRFA 4B7AA 3KQUA 3SJUA 5JMWA 1W0KA 4JXXA 3N6RA 5SY9A 3OQBA 4WK4B 2XZDA 2PQMA 4X6YA 3G82C 2SICE 4N7BA 4RPJA 1ZD1A 5G0TA 5EJ8A 3OOYA 4GXTA 2XVMA 4OK6A 2WJVA 4ZI5A 1CUYA 1TEHA 1X1QA 5HRAA 2WJHA 4OYYA 2WMOB 4TLLB 4QRIA 3HR8A 4I99A 1LDMA 4AG3A 3ZTWA 1U2DC 3EH2A 1JFSA 1LI7A 3IELA 3IBSA 3TWOA 4AJ9A 2ZITA 4HEA6 1CUBA 2PYDA 4JUAA 4KCGA 3UYLA 4PZCA 2X41A 2JVJA 4XI9A 3O2JA 5EG5A 1ULTA 3FLEA 1INLA 1N2GA 1T4GA 1V16A 2AD1A 2WP0A 2V6JA 3P4XA 4HDNA 1KWKA 4RVGA 5I3CA 1YB1A 3PC2A 4GKBA 1PQ4A 5KC8A 3GLTA 3JTMA 4P3PA 1EUQA 1Y6RA 1TIPA 3FWHA 4P31A 4RFSB 3MD9A 2RDMA 3HWX1 3SEQA 1I5OA 2P1DA 3L77A 2CBGA 3QUQA 3W6UA 4D9IA 2X1HA 7MDHA 4CEHB 3C5EA 3NBZC 2BGGA 3IP9A 2Y4OA 3C3XA 3Q6MA 1RJDA 5G4KB 3HA2A 3PQEA 1UMBB 4MQUA 3U48A 4N41A 1TU4A 4D99A 1OASA 5HZMA 4H1TA 3UJ6A 2ATEA 1NXXA 4OJKA 2TYSB 4Q93A 2QTVB 3FYHA 3E03A 1ST2A 4JX8A 1WOYA 5CLHA 2HQ1A 4KK4A 3LRXA 3PGMA 1MAUA 1MB2A 4QJ3A 4LHZA 4MUJA 3SNKA 3DR3A 4PCLA 1T36B 4WN9B 1RKQA 5AM0A 3WIEA 5AUPB 5KNCA 2HJWA 4X62B 4GLLA 4TS9A 3LXUX 4MSUA 3T7IA 2YBDA 2RK4A 3C3JA 4IM7A 1Q91A 2O5RA 1O9BA 1R9JA 2ZOSA 2H5IA 3ZW9A 4UTZA 2L19A 4GZMA 3VR4D 4FYIA 1GA1A 4KE8A 1HRDA 3OZTA 4J0FA 3RRJA 3DHYA 3R5KA 2YQZA 4WK0B 3WWDA 3ABRB 5DTIA 1NPDA 3BXEA 4UM9D 3X1ZA 1DG1G 2VT2A 4FKZA 4N0QA 3TIFA 3MCZA 2YMMA 4KFSA 3ZV7A 5K3EA 1U9IC 2Y1KA 2ZXEA 5EQJB 5GZ6A 4WFKA 2JANA 2BT4A 2VXOA 4OHBA 1L4EA 3I9JA 2XI4A 3GLFE 3WLEA 2REQB 1UDXA 1KEWA 2HO5A 1EE9A 4ND4A 4Q9KA 5DYTA 2LGJA 3I2HA 3N2KA 4PY2A 2B8TA 2BEWA 4PBRA 3JWGA 3BXFA 3PPIA 1G18A 2VSFA 3BRWD 2FPLA 3DMYA 2C2OA 2J4FA 3CRVA 2BZSA 2OO7A 4W1SA 4FFSA 4BO8A 1ACMA 3Q88A 2KI5A 3A6FA 5GVSA 4UUOA 1OBOA 5E1DA 4XJSA 3FUTA 1L1FA 4WNAB 3EZXA 4GMFA 4DEXA 1GQRA 2PUBA 4NTZA 4RSGA 3EXEB 5ER6A 3UPTA 4EPTA 1EINA 2ZRFA 2O48X 3H1FA 1FQWA 1A9QA 1DOZA 1FVFA 4PQEA 3ORFA 4RADA 4HWRA 2F3TA 5KS2A 1W6RA 4C07A 3O4FA 3LDAA 2HYDA 4MVJI 3IPXA 1U8ZA 4R7GA 2QEQA 3MQFA 1U3UA 3K9LA 3JTEA 1QIEA 4OI1A 3P9NA 1T5HX 3KJEA 4UD6A 1XD8A 4UVGA 5B4UA 3K0AB 4CF3A 3FJYA 1M33A 1XZLA 2A30A 3H9UA 1P1KA 4ZAFA 2P0AA 4PTYA 2BHRA 3K3PA 2IDJA 4B6RA 4FYKA 3DZJA 1D1PA 5IZ4A 3I3OA 2IJGX 4X20B 4W5TA 5EIFA 4RA9B 3O8OA 5HIAA 2XE6A 1MAWA 2CJWB 3OO1A 4DANA 2RD2A 3V4RA 1GRVA 4RTSA 4MITA 2UUCB 4CEIB 2I6UA 3ZD6A 1A9RA 1V95A 1W0JA 3IBTA 1ISMA 4QXMA 1KE1A 4EI8A 2P9CA 3OFJA 3COVA 4IVQA 3SZOA 1B8OA 4ETMA 2IUEA 3FTNA 2FN7A 3KZ1E 4OK5A 4AO8A 1PTJA 2QVBA 5HSGA 1ZIYA 2QTLA 5LZ2A 2P9GA 3BCSA 4MGKR 1VIVA 4R6XA 4RUKA 1G4AE 1SQGA 4KVAA 1JTFA 2GZHA 1OU4A 4D0SA 2CXQA 4G8BA 2HJ9A 2A1TR 3DOJA 3V4LA 1JEYA 2ZJ0A 3DHWC 4ENSA 3NTUA 4L8GA 1A0OA 1AOXA 4B17A 3PX2A 3ESDA 3LL7A 4I4CA 2QRZA 4QDTA 2C9MA 1JG6A 1GGFA 2H07A 1HE8B 1X1CA 1NMQA 3Q7RA 4FC6A 5K8UA 4Z5XA 1NBME 1I1NA 4JCCA 2VJNA 1U8XX 1OI4A 5LBIA 3UFXB 3AIIA 3DZCA 1RPNA 4AJHA 3GAMA 1HMYA 3BXOA 5I4IA 3C5WP 5FUXA 1XO1A 3PLNA 1VA5A 2WIJA 4JI4B 2OZLA 4PZLA 2J6BA 3HYCA 3A1UA 1TKAA 2Z9BA 5KYXA 1EQ2A 1SAYA 2B9EA 1UMKA 3C8HA 3L6BA 3QKTA 3ROKA 4B09A 3KJNA 3EBOA 4E5VA 4HDKB 4AG6A 4IHKA 4IDGA 1EZZA 3EDYA 4MV1A 4K6HA 4BB5A 2E89A 2BGJA 4L8FA 3RFVA 1VCHA 2DT8A 1MQ9A 2P77A 3EXFB 4ND1A 1R0WA 2JFWA 4QX6A 3OQIA 2EKDA 2VLIA 2YASA 3I9OA 3VZSA 3MWFA 1I14A 1NC3A 3QFFA 1QVWA 4ZOLB 5JCPA 1WPRA 1CS4C 1JAYA 2I8AA 2OPBA 2PV7A 3SFZA 1W8IA 3PXUA 2QP9X 5INTA 1KEEA 4GUDA 2GFIA 3HZOA 4XEUA 5FORA 1EU1A 4IHAA 1FNCA 2PHZA 1HTTA 1PW7A 4U0KA 4M1TA 4RNDB 1RNLA 1ADFA 1WJGA 3DYVA 3H8SA 4O6VA 5FL7A 3ZGLA 2FPGA 3ZWNA 5AKIA 2ZRAA 8ADHA 1IQRA 2R4UA 4GYWA 4PC6A 5KX5A 3DHVA 3OQPA 1USVA 1LRLA 2FPPA 2PGOA 5JMTA 3TL6A 3PJEA 1PYDA 1XOIA 3NC0C 1U3GA 3MWDB 1N8SA 2XZOA 3KD2A 4GR4A 1KBQA 3KEFA 4OUDB 2XQFA 3KJIA 4ZEWA 1NOJA 2HA0A 2VUSA 3PNQA 5ALFA 4XYEA 3VVMA 3VPGA 4ZOQI 5EYPA 1AKMA 2R8BA 3IQZA 3E58A 1G8KA 5JUWA 3HM9A 1RFLA 4W5JA 2FLWA 4OJTA 5DLYA 4D6YA 3T6KA 3G1UA 1YMVA 1U6JA 1M7GA 2IP2A 3S2ZA 1H9AA 1SOVA 1T5SA 1YR2A 4G1CA 3DMTA 3ONEA 3DO6A 5EKDA 1MJGM 2CMKA 4C04A 2HLPA 1MX5A 5GTDA 4N3NA 3W5VA 4QLOA 4MVJA 3UTCA 3WO0A 1XHFA 1VXOA 3PT9A 4HMQA 4DLAA 4F9GA 4PR0A 3SC6A 6PFKA 3OTGA 3EMVA 1BYIA 3S27A 1QRTA 1PL6A 1XFDA 2HK8A 3FSGA 3GJ5A 2G28A 1MAAA 4H18A 3UT6A 2OHXA 3X2SA 4F2WA 1THMA 2PT7A 5AKJA 2FFQA 4XJTA 1GPAA 2ZJ5A 2YV5A 4ND6A 2FRDC 5C53B 1OT3A 3O92A 4AROA 4WNCA 3KLOA 2PL5A 4RZIA 4DZRA 4MTLA 3I9NA 4NULA 2MSCB 3CQ9A 1TUIA 3ZZNA 5D8DA 4HATA 4UCWA 5ERXA 4A8JB 1AM4D 1FX0B 1LJ8A 1ONBA 5FUYA 2GD6A 1PJ2A 4D9MA 2XV1A 1QG4A 1M54A 4EO9A 4H59A 4WLOA 1PS9A 5AXDA 5ESXA 3FWPA 4IO0A 2GLUA 4O4HF 4DG8A 3HP1A 3MMZA 3U9LA 4ZZ3A 3AYXB 2QKYA 1KARA 1GAQA 4X3PA 4AZVA 3NM5A 1BDIA 5KKAA 4P7BA 5I3ZA 3O1HB 1D1SA 2A4KA 1T0IA 2PGJA 3HI4A 1S4MA 4P32A 4N9WA 3KWMA 3GNLA 4QOEA 2OXRA 4TMXA 1JW9B 3LFHA 5TQVA 2H06A 4KEAA 1H2WA 1DIBA 2OFFA 3SZGA 1Z3CA 2C0PA 3FPLA 4FCCA 3Q7QA 2AXQA 2BDEA 1GQ2A 3BUSA 3G5TA 4MWCA 4QULA 4ALLA 1QOZA 4BO0A 4ZTUB 4BPBA 4EHKA 5HTOA 4RHUA 2PFGA 3TVDA 3U7QB 1FNDA 3IJRA 3L1VA 3O3OB 1PHPA 1TZCA 5FV4A 3RIEA 4YK7A 1YU9A 1MOPA 2Z8XA 4RWZA 3PGLA 4AMZA 2B1QA 4EGCB 1J25A 3UT0A 1DFHA 4M76B 4MO9A 5CA0B 3BBPA 1CDEA 3HJCA 3G9QA 1R4ZA 2XMCA 4MVJF 4BB9A 3TJMA 3O7WA 5CDSA 3KL2A 3KU4A 4X64B 3ESRA 4J0IA 5IUNC 5LIRA 1ODTC 4YCNA 1T10A 3D3EA 2XOEA 3AI7A 1D8TA 1XLTC 1K88A 1M76A 2F8MA 4UBNA 3GGPA 5AUQA 1LF5A 1X2EA 2H5JA 4KU4A 5AHOA 1RAFA 3HVHA 1IPFA 2PUJA 2BM8A 3OUZA 2BM0A 4XIYA 4Y2VA 1NFFA 2B1RA 5TGDA 5KDOA 2IV3A 3TRDA 1FJXA 1JLRA 1GLGA 4UOZA 1CRQA 2O52A 3HK2A 1IXSB 2YJNA 4IIHA 4F2GA 3WGVA 2ID8A 4IFTA 3RS8A 1S8OA 1VP3A 1ZLXA 5G1NA 3TUIC 4URUR 3HLYA 1LQ2A 2R6GA 4MRVA 4K1XA 3R8CA 4CKBB 2B98A 3F96A 3IPYA 2PSFA 2EIXA 3LTEA 1ODLA 2FSFA 3LC7O 1FC0A 4FU0A 4OQDA 1KY2A 4FFPA 2LBPA 4HQ6A 4Q7KA 4HS9A 2EZ9A 1YI0A 4EENA 2E4AA 1KO8A 1JVSA 4BFSA 1HUQA 1BWSA 4DLUA 3TR5A 5LLTA 1PBNA 2FPIA 4GIBA 4O4IB 4YGYA 4GR5A 4HNRA 4BQPA 4MR9B 2O8NA 4GWKA 5BR4A 3D0QA 3KETA 3RS7A 1NM5A 1R88A 1UFKA 2QT0A 1MEJA 3Q6IA 2GPYA 3TAHA 3WLLA 5JCJA 1ZVVA 1NW4A 3CJRA 3M6VA 2YDYA 1AUVA 1NXTA 2ZXFA 1KH2A 3BCHA 1Q0QA 3GZ4A 3TLCA 2ZQ5A 2I4OA 3H9EO 1UKVY 4K6FA 5AQEA 3LD9A 5DI9A 3ILSA 5AKHA 4DW8A 4KBGA 4F2DA 1KK3A 2N9UA 3DR5A 4YJ2B 1K66A 2O0LA 2RHOA 3UHPA 1ZCZA 1P0CA 2F55A 1C9NA 2VNIA 2Y68A 3BWMA 4B8YA 1P0FA 4QHTA 3JZIA 3UJ8A 1O77A 3VR2A 3WTBA 3ZHSA 2CJFA 2J7PD 1CYEA 1M5RA 3TLXA 1C30A 2Z2KA 3ZGXA 3E70C 3CNLA 3LLSA 1SKMA 2I1VB 4NHEA 4ZT3A 3P0HA 4MR8A 6ABPA 4XFJA 3CLHA 1R18A 1K4MA 5E9WA 1YH3A 4BVKA 4HNTA 5C37A 3MELA 5FBQB 4MIKA 1R4NA 4R6WA 1NP3A 2HOQA 3FNRA 3PD0A 3A3NA 4PNZA 3RT7A 4MWGA 4Q47A 1C7JA 1Z6TA 2VJBA 3DE6X 1HZZC 1KHTA 4EFLA 2JGDA 4YI3A 2DPGA 2AZDA 3M5WA 2WFLB 1RC0A 4D81A 3H5RA 3RSHA 2YWBA 2YMLA 1HMPA 1J0XO 2Y0EA 2GAFA 2FE4A 3FNEA 3IBGA 4B71A 3EF0A 1CJUC 5HIIA 1JBKA 4DMUB 2GJKA 3E9EA 1H22A 1OBVA 5IAJA 2XMPA 1JEOA 3RK0A 2OILA 3FUXA 5HW0A 1WVIA 2OCGA 1TA4A 4EJ6A 1G291 2AJ8A 4RANA 3AEQA 4HNAB 5TS3A 4B79A 5K3OA 1FA9A 3GL9A 3LYHA 3S4YA 4Y3UA 4ZN6A 4BASA 2I22A 3GWZA 3S29A 2AHOA 3VOBA 1BX1A 2X22A 1DIAA 3PGKA 2WU3A 3SKVA 1PT6A 4EGJA 4IDNA 5J5CA 3CLTD 3FPBA 5EHNA 3ZWKA 4F11A 1J7KA 3I0NA 3IPCA 1L5ZA 1UBNA 4OM7A 2O50A 4WZAB 3RVQA 3KYCA 1DQPA 4Y1EA 1OH7A 2K87A 3HKEB 3VVBA 3JD2A 4QDUA 7MHTA 1KJZA 3C3KA 4OAOA 5TGZA 3V8RA 3WL3A 4ER6A 1TA9A 3EY4A 1LDEA 2OECA 3BQNB 3GCWA 4II3A 4UQPA 2QN8A 4B45A 1KAGA 4R1OA 1ZRMA 1H2FA 1SPXA 2XF8A 4IKPA 2ZVJA 1KK1A 3LCJA 4HFMA 2RGYA 3QXCA 1MGOA 4OMCA 2V9CA 4RV9A 1WXDA 1FP1D 1L3CA 4C2UA 5BV8A 3QKIA 2MINA 1UC9A 3L7MA 1J2YA 4RIEA 3ZNPA 1ZKDA 3UEOA 4BGEA 1BJKA 1Y7PA 5G0SA 1BN7A 3KS9A 3KC2A 1GTSA 4QAJA 4NONA 2JGMA 3DPUA 1ONSA 3KT0A 3N74A 3AMVA 4XDHA 1ZGCA 4U7GA 2PWYA 1TF7A 5GIPE 3IB3A 4L72A 1K7SN 1ESCA 2CHVA 1XPJA 3B6KA 4HUJA 1B1AA 2A0YA 2H1CA 3GVCA 4BMOB 3SJ7A 4NR0A 3OZIA 5J9FA 3THSA 1UKAA 2NUBA 2EARA 5C5DA 3AFNA 4JT9A 5DX8A 3HN6A 4LMRA 2QVZX 3D0KA 3KQKA 2OSVA 2AMJA 2RK6A 2Z4TA 2YZMA 3UAWA 1GQSA 1MKYA 1GTG1 5IMBA 1LBEA 1SC4A 1T1SA 3BMCB 2FEXA 5DIZA 2XQIA 1U3FA 2GBLA 3PPVA 1NATA 3FSEA 4TQUS 1IM2A 4H31A 4Y2XA 2UXDB 5JZBA 5HF5A 1T4DA 1IQ0A 3FVTA 1AHNA 2PO5A 1GG5A 4S1TA 2R79A 4XEHA 1N0WA 4K9RA 4IJVA 4MDFA 4RK4A 3N8DA 4OHXA 3C85A 3T9EA 4DUYB 4ZRMA 3KD3A 1M6HA 1XX6A 2JK1A 3ANNA 3C74A 3ENKA 1Z6GA 5E4TA 2MMCA 3T9BA 5L53A 2IS2A 3VJKA 1QFMA 1M72A 1LEHA 1TF2A 2VP3A 3D6VA 4JP8A 1XMPA 3D4IA 3ZDFA 3QWAA 2YXNA 4L08A 4BEWA 4IWNA 3BEDA 3HU2A 4HVTA 1BQ3A 2XCLA 2RH5A 5K45A 4DBLE 1P7VA 2XCQA 1U0HC 5AR1A 1E4EA 1Q5PA 5L51A 3MOSA 3GN1A 1OZHA 2RKBA 1SIOA 3ZZTA 4ACAA 1RADA 3BB1A 3EEIA 2D5IA 3O73A 5C8YF 2HWKA 2NO7A 3N28A 4RPGA 4ZVSA 1QG6A 4LMPA 3K70D 1GPH1 1CUJA 1L5HB 3E81A 4M98A 1CETA 3ITDA 4COOA 1GZ7A 3N87A 1AF4A 1FNBA 2TECE 4G1UC 2X9NA 3RYIB 3NAGA 4R41A 3PRJA 2F2TA 5DVZA 4C06A 2J0UA 3ZGNA 1MJ5A 4REMA 3VYRB 3VVCA 3DDSA 4IX9A 5K0JA 3OBBA 1B0PA 1K1EA 3O4RA 2PRIA 1WZEA 3ZDAA 1NVBA 4QPZA 4DLLA 4TMWA 3DBIA 1R16A 2AB0A 3WKBA 3TW0A 3OKFA 3HGQA 4ABYA 2V6IA 4K9OA 3LYUA 5EE9A 1QQAA 1CY0A 4JR0A 1QZTA 1ZG3A 2V7BA 1IJKA 1FMLA 4BVFA 3KSDO 5DM2A 5KWVA 2WYVA 1FFXB 2HIHA 2RFLA 3JYPA 3M82A 5FI0B 2VSNA 4OHFA 1FBTA 1SURA 3JD1A 4K9DA 1JKJA 2Z6VA 1DKUA 5AKZA 4QAQA 4QUKA 4DIOA 4OHYA 1YC2A 2A92A 2Y1XA 4MI3A 1F6BA 1QV6A 2GTIA 1JA1A 1AKYA 2C2BA 3W3ZB 5LYJB 1LSOA 4Y7DA 4Y6LA 1ZVKA 4EQZA 3CUEF 2HA4A 1GEGA 1JR3D 3R4VA 5EZYA 2C5FA 1R8JA 1RYEA 3KLMX 3OZDA 2JI7A 4MYCA 2O3RA 5T4FA 4CM1A 1D4OA 3RV3A 4D8TA 2JLYA 1A4XA 4EHDA 1MMFB 2YMQA 4L3WA 5TX7A 2RHHA 3WNZA 2H1IA 2IU4A 1ZU4A 5JSZB 4LJ5A 1ZW6A 3O1LA 2AQIA 4F4DA 3VNQA 1Y8AA 4PYNA 1QAMA 3DPSA 3PQ6A 4C4AA 1P91A 3U1BA 2FSVC 1SKYB 3EGDA 4GVPA 5KJFA 3FPFA 4AJIA 1ENPA 2WWIA 3BQMB 3HCNA 3IDSA 2FWRA 3NWEA 1N57A 5IJWA 5F9HA 3COSA 3OLYA 1GYQA 1SEVA 1PD0A 3P0IA 5K4AA 4IDBA 1TFUA 1VIAA 3I8OA 3MUOA 3P4YA 3RUFA 4BNKA 5HUJA 2Z6QA 3FSRA 1HDEA 4FOTA 1JSRA 2YNMA 5D5PA 2G9NA 3AJ8A 5EJGA 3ZHQA 1D7OA 4WKGA 5IH3A 1T8RA 1YIDA 4YMUA 3K6RA 2DVMA 3MTJA 1YHYA 2G67A 5IXJA 5F78A 2ZBPA 1V45E 3TD2A 5I7HA 4MLPA 1MTOA 1G3RA 4M55A 1TXGA 3K0CC 5E1MA 4Q00A 1A8SA 1M34A 3H11A 3GOQA 1Y63A 4XIGS 3TGLA 3EOZA 1NF2A 2O8CB 1CY7A 5CM2Z 4ER7A 1WDMA 3KM0A 2WSSA 2RHCA 5JMPA 4Y9TA 1C0EA 4S12A 1IZZA 1U2RA 2MSEB 3V8EA 5TLSA 4MV4A 4P92A 3RRNA 2TRSB 1IJEA 3KXKA 2C7BA 1KO4A 2GRJA 3KZOA 4JLBA 2VJKA 2N1BA 3USZA 2KWIA 1PT8A 1WV0A 1WHTB 3QW4B 2IXGA 4MQ4A 5JXHA 2IP1A 1K4KA 1NGSA 1T6YA 3E7FA 4O33A 3RVJA 4DA4A 2SNIE 1DT3A 1M8FA 2V7XA 2V5VA 1YF3A 4A0FA 4TZ0A 3Q15C 5BSFA 4GRDA 4R83A 3MWEB 1KI3A 4ZQCB 1V25A 3EISA 3P96A 3UJHA 4RHTA 4E2ZA 1VG9B 4HFJA 3T38A 1E2UA 5G02A 1KJIA 1X8KA 1M66A 2QI9C 4HZUA 2IOFK 3H5IA 1VJ1A 4M2LA 4PGHA 3A27A 1FRNA 2CVZA 4WFIA 5BN5B 4YUVA 3BSFA 3R23A 5HZHA 4BVHA 4OH1A 4XDZA 3JWHA 1BWRA 2I9KA 3BN3A 1C8KA 3A1WA 1NF9A 2EKPA 4XAQA 3UUWA 1XJ5A 2RI6A 1L1RA 1SIWA 2O07A 4FGWA 4E15A 3VR0A 5DP1A 4JKYA 1KFBB 4AW9A 4RIHA 1NXVA 2ONJA 3EZ6A 3QSGA 4F72A 2DLNA 3U2QA 2V6GA 2QQGA 2EDCA 2O2JA 4M1OA 1G98A 2OBYA 4H60A 1XZCA 3SKXA 4KXUA 1EFDN 3A1SA 2I4NA 2LCFA 1E20A 2C9DA 3D8TA 3DMRA 1I2AA 1IY9A 2IHJA 3GP5A 3JXEA 1J2UA 3O2NA 4KR6A 2O5CA 1RQGA 3GRUA 3UXMA 3VPDA 4JT4A 3PU6A 1PZMA 3V46A 2P9TA 1KH1A 3VM6A 4DNQA 3G3EA 3LPCA 3DDCA 5DNAA 4FIDA 4M0EA 4AUEA 1H6DA 4D4LA 3C4VA 4K0KB 3DW3X 5EHXA 1SHLA 4H1UA 3UAGA 4OX9Y 1NQWA 3OMLA 4B5KA 3C3AA 3MSXA 2HQOA 3L93A 4PHTA 4YJHA 621PA 3QHQA 1X9GA 1N9GA 4IIVA 4KXVA 1F4PA 3LH5A 2GZSA 3ME5A 5BW5A 5IJ9B 3VPBA 4J0DA 4JP1A 3KALA 1SCUB 5FBWB 2WKWA 3QKWA 4B3CA 3R4CA 3K5WA 5CVUA 3I2IA 2BMJA 3EW7A 1U7WA 3P0RA 1C3JA 1CWUA 2LE0A 1EAYA 1NJSA 2XMBA 3G0CA 4ZVVA 5TGTA 3QM1A 2X0NA 4G0YA 1MCZA 3QVXA 1WW2A 2JGFA 4KWTA 1Y8QB 2B35A 2H2IA 3GX1A 5TMBA 4Q3KA 5G2OA 1JKMA 1KJJA 2HNAA 3ZU6A 4Q3CA 3WIUA 3K70C 5AM2A 1QTNA 1ZMOA 2QF7A 3M4ZA 5AW7A 5F98A 1HI9A 2NOAA 1SXPA 1OAOC 3H17A 4X95A 4A23A 4G1EB 5CVTA 1UFQA 3EY9A 5IJ0A 4OAPA 4G0NA 4FWTA 1XCGB 1UBKS 3VHRA 1R6BX 1Z5NA 2WHEA 3D4PA 4MLDA 2IXEA 2FDXA 2G4CA 1IN6A 5DT2A 2Q5EA 5IEJA 3D7MA 3RH0A 1T9DA 3LHFA 1E2IA 1B8UA 2O7RA 5T6MA 1T6NA 3W8EA 4ARSA 5G53C 1F5NA 1PJZA 4MCJA 3AESB 5H4GA 3EGXA 1MIOA 5KNDD 3IHKA 5J40A 4P4NA 1E60A 4HGOA 3Q8KA 3KPYA 2F8TA 1GFWA 5IH7A 1KK2A 1RQNA 1NSYA 3X1XA 3TDKA 2E5LB 4KREA 3B5IA 2FI1A 3BPSA 2IZZA 1GIAA 2LUOA 5BUSA 3UB2A 5KJ6A 4I1YA 2PQ2A 2PMEA 3K1ZA 2NXCA 4LRWA 3HDTA 1XZ8A 2XHZA 1QDUA 3Q5EA 1R66A 4NJEA 2YWGA 4R81A 1CNEA 1ZQ1A 4FJ0A 3UHOA 3WMGA 1E64A 4R4JA 3WWOA 4D4GA 3A4MA 5IF3A 2P68A 1NXWA 3RU3A 4YMGA 1LLCA 1HLGA 4QDJA 4QTTB 3UK2A 1T5IA 3T7DA 5HTKA 1Q1AA 3IEXA 1WNTA 2XWBF 4IF6A 2BZ0A 1FDUA 1KXZA 1NVGA 3D31A 3EK2A 1FPQA 5CB4F 5ADWA 5JADA 3PTAA 2VDWA 2C7QA 3OMXA 5D2CA 3MCWA 4EY7A 1V4VA 2YMPA 1K27A 1W34A 2FTKE 4BB0A 3JQQA 2QRVA 4Q21A 3P9ZA 4DLKA 2YFKA 1XTBA 4EPXA 4B6JA 3A3OA 1RZUA 3AUSA 3N07A 4FVTA 5A71A 5IKEA 5HILA 2RCNA 2OBFA 3PUZA 4JLWA 3LA6A 5F64A 5JXGA 2WDPA 1QC5B 3IAM1 1MQ8B 1I1OA 3KKOA 1UWKA 3OF5A 3M6WA 1OTXA 3VNVA 2ZATA 1Q1NA 1T3LA 2JAHA 2WUFA 3SJAA 1HC7A 1Y3AA 2O2CA 3H19A 2I7DA 4BPRA 7ABPA 2HYIC 4K9NA 1TQ8A 3AEKA 3LOPA 5KVVA 5COAA 1NURA 1TDJA 4AO6A 2WWXA 3GGDA 2VRCA 1QE3A 5U1PA 5A5DA 1JDJA 3BXGA 1GNRA 1WHSB 4P0TA 3HRIA 3FR7A 3VDQA 4MYDA 4O5AA 4CV3A 4LHXA 3QVGA 1CUZA 2QTAA 2YJZA 4HH3C 2Z3VA 4ZV7A 4AO7A 1WSDA 1Y3IA 2IYWA 1E0JA 1IN7A 3B7PA 3F97A 3HO8A 3HN2A 1NX6A 2XA1A 5EPEA 3NIDB 2GI4A 3U4QA 1OVMA 5ALMA 2JAWA 4G84A 2V0CA 4PCVA 5JDCA 1XD2A 3KUDA 3HXTA 4CL2A 4Z0HO 5GZ1A 3QKUA 4RQAA 3MCVA 3WMFA 3M0EA 5AHKA 4QOGA 4KE7A 1QQTA 3EPPA 4OHUA 4HEA1 1VE6A 1G60A 3H3FA 5CT8A 4JA2A 3PV0A 3IUEA 5CVVA 1M34E 1QGDA 2A67A 3BDVA 1YQDA 1K7EB 1I7DA 1C41A 4MRNA 1V37A 2OHJA 2DPMA 1P1CA 2QN6A 1E32A 3C6ZA 3C45A 2Z9CA 2I29A 2B5OA 3DMNA 2AS0A 1E9SA 1UAGA 3STHA 4RMJA 4ZVPA 1TCCA 4IWYA 3W5JA 3EWAA 5JVDB 1NR5A 4GI7A 1Q1GA 1MXHA 1JEEA 1ZUIA 1NNLA 1BW9A 1VE9A 2F4NA 3CN9A 5I45A 2E4ZA 4BOYA 5LD2C 1USIA 4PSKA 4YVFA 1JG2A 2IPXA 2Z04A 4DYDA 1D8AA 1HYGA 1YFKA 2W6PA 3EC7A 1AK9A 1U5AA 4EUEA 4LZWA 3OM0A 3E2MA 1G3QA 4AZWA 3PEEA 4OOFA 1D2CA 1EGAA 5IAKA 3UNXA 3QRWA 4HVCA 2HA7A 4M7WA 4L8LA 4QBFA 4TLCA 4N7MA 1II0A 4F4UA 4ZYZA 2VSOA 3UGTA 3S2SA 1KAQA 5CYPA 1UFVA 1ZK3A 2D0DA 3AI1A 1PT5A 4QJBA 4Y2SA 3VH4A 1FRFS 4QTUB 3BMXA 5IANA 3VKWA 3U4HA 5LJLA 3JQAA 4LHWA 4CMGA 2IPMA 3K92A 4QJ5A 1JDBC 2D2VA 4TX1A 1DXHA 2GNAA 1Z4MA 2I6FA 4FXOA 4C7BA 3WQRA 4DTIA 1DZ3A 1PVOA 1XVTA 4YV2A 2BFEB 4LQDA 1QJ4A 3IHTA 4AMYA 1DADA 3P2EA 1FFAA 3WGQA 3DV9A 3WV5A 5GONA 4DCMA 1RP7A 3KOXA 2QGZA 1K3FA 1M1UA 1Q0LA 4J1QA 3LX6A 4F96A 2FGKA 2V74B 5IT5A 5K09A 3J81A 1SHZA 4EARA 4RK7A 2R6AA 2AG8A 4I1PA 1MO3A 4H1VA 4TUYA 1I2DA 1P0QA 5BV1A 2QN2A 3N2IA 2D54A 1AD2A 1CRZA 3CO0S 4BQNA 5DHFA 1J4AA 6GPBA 3HSYA 3TOXA 1FP7A 4EJFA 3PC3A 4IMJB 3PX7A 2W4IA 1RI4A 5FYDA 1WQ1R 3VYWA 1UPUA 1GQOA 2DPXA 1I4DD 2XYVA 3BD8A 1DC4A 1JHMA 1A5SB 4MCAA 2V6BA 1E61A 1F38A 2Q7DA 2Y9MB 1VIYA 3UFBA 3WHLA 4OBEA 3H87A 2ZAOA 3CKLA 5D86A 4BP8A 5KBYA 2W83A 2UYCA 2V8BA 1VHWA 2V7EA 4N18A 5K03A 2ZS7A 4U00A 2EZ8A 4V0QA 2RB5A 2QAGA 5FPSA 1RHJA 3UA3A 4DRYA 3IMCA 1ZQ9A 3ELBA 4C6TA 2Q5HA 2XKAA 1L5WA 4RENA 1L7DA 2J4DA 4YALA 3T8YA 4ZIRB 4GYYA 2VJCA 2BEUB 5JHHB 4HUQA 2J9ZB 2IYXA 5DGIA 1OLSA 1YE3A 4UBJA 2ENWA 4GL2A 2JEOA 2HF7A 1R8YA 3ORQA 5GADl 2OFPA 3MCAA 2R60A 2AWNA 5CFRA 3FLAA 1ZJ6A 4LGVA 3NTRA 1SQFA 4UFNA 2EFJA 3ZXUB 2REOA 1J2EA 1DDIA 2YJTD 2YWHA 4FILA 5BN3A 5JJCA 3AIMA 4FD2A 2ZR8A 5GONF 4WA8A 1E79D 2J3KA 2IBTA 3D43A 1JEQB 1OA0A 2ASEA 1I24A 2QRJA 3BGDA 2YYSA 4Z86A 4ESHA 4ESEA 5G3YA 4PYKA 3OQMA 1AH2A 2B4YA 1OT5A 1XZFA 2FW7A 2NZJA 2RGNA 4PS0A 4WACA 2W8BA 1ZCBA 1BE8A 3R3YA 1WXHA 4DADA 2IEGA 3BIFA 4DYHA 3L41A 2JCGA 5BV2P 3VYTB 2ZI6A 4YGXB 3EYAA 3OSUA 3K96A 4X6LA 1YNOA 4YMIA 1W44A 2DWUA 3BHMA 3QMPA 4BCDA 3CRNA 1ATIA 5C7OO 3NPMA 3R5TA 2DUJA 1RAHA 4LZLA 4ZODA 3A25A 3H1BA 3PFHA 3L06A 5HZKA 3CR3C 2XSZA 4UXHA 1MV5A 5HQ3A 5KNBH 1CR2A 1NC1A 1M1ZA 1V47A 1E9CA 1QHFA 4RDCA 3BX1A 4WDQA 5CUQA 3BCRA 5AK5A 4ZEOA 4DJEC 4E6PA 2XE4A 2YWRA 3D1JA 1CUAA 2ZWAA 3AKYA 2YV3A 3DTVA 3OF2A 1UT5A 4WBNB 1T0PA 1G42A 1K2VN 3ACCA 3PNPA 1J2TA 4EWLA 4ILEA 3H6GA 4L6IA 3AU9A 4XPZA 1CUFA 5K8VA 4D3DA 2ACVA 1Z0ZA 3FI0A 4FYHA 1KP2A 2OO5A 3A1EA 2XZTA 1J8YF 1JKFA 4B0OA 1BS1A 3ROXA 5B36A 3EN0A 3B51X 3DT8A 4NCNA 2ZK7A 4PCAA 5TPWA 3UXYA 2LTAA 3JR7A 4YDHB 5FBKA 2JKYA 3G2OA 2J3LA 1T6XA 3EXHA 4TS4A 4DQXA 3RTBA 4YR7A 2ECOA 2ZKIA 3COYA 1HT1E 2VF2A 4WK6A 5D1NA 5CDFA 3LPDA 4ITUA 5SY6A 3SVZA 4YWHA 2QSZA 3NHKA 2R84A 1F3OA 3BORA 5AW0A 1OV4A 1KVSA 4PZZA 2P4UA 4YIKA 5BOVA 1KE2A 2HDHA 3HEBA 4DPKA 1MD9A 3BWYA 3ZWMA 5ES3A 1PW5A 3TOZA 2HRQA 4HAOA 1DO0A 3O8DA 5TR9A 1I32A 3L8FA 2CJPA 4V0MA 2I2XB 3PPYA 4LYGA 5IAOA 2OEPA 2I3ZA 2UZ3A 4P5EA 3DEZA 1SBYA 2CWDA 3ABIA 4PPFA 2FVYA 4N5MA 4AJPA 3M4YA 1RPTA 2B4RO 3L05A 1T8PA 3MTDA 3O91A 1Z0DA 4A1OA 5IC5A 2DHCA 3Q40A 1A9YA 2WJ6A 4OQEA 3M1AA 1N36B 4B8WA 1PSDA 5CK5A 1NR7A 1FEZA 5KHAA 5JT1A 4I4LA 1VBFA 1ZW1A 4JB8A 2J5KA 1QIIA 3DMTC 4I5GA 4LX0A 4CM8B 5AVUA 3T7AA 2OBLA 3CX7A 1JAIA 4H6PA 1EZ1A 2R8RA 3C1AA 2GZ1A 2VWGA 3WRVA 1P31A 2W22A 1DUSA 2X7JA 1YZGA 5IWCA 1DBSA 1X7XB 2H1HA 3ESXA 1CR6A 4OD0A 1RKXA 5SZIA 1L5FA 1XTUA 3UWKA 1Z6QA 2HWXA 4TTVA 5P8WA 3ZZUA 3MJVA 4ZDWA 1GNQA 3NT5A 4CJXA 3RS3A 1HNZB 2C78A 4CNBA 4ZC1A 1AXEA 3QQPA 1NPTO 2VDLB 3FR8A 4LEIA 4P81A 3OO0A 1YZYA 3UMBA 1M2NA 1PUJA 1ONNA 4D6XA 2C5EA 5KYNA 3G8BA 4WESA 5K6RA 1DKQA 1ZICA 2W4MA 1TTQB 3A6PC 1NN0A 3A1NA 5IAEA 3RYFB 2FWJA 3SQWA 1LBHA 4I0WB 4FW9A 2G6BA 1ZSYA 1VHJA 3PDCA 4L3OA 4Y9SA 3UYKA 2P7IA 2HMWA 1W1IA 5F35A 2R7MA 4L75A 2OGWA 1A9ZA 3ZHTA 4TYNA 1DHTA 1QZUA 3U7EB 1LS6A 3REQB 4A5SA 3EQ8A 1SJ9A 1QRRA 1V8ZA 4ZYYA 2NQ8A 3W3AD 1BKDR 3D3JA 1BFKA 1WULS 4NBTA 4OFWA 4X7PA 4ESVA 4HFRA 2JFGA 1N25A 4DDUA 4JZYA 1F0PA 2QY6A 3R9IA 3ST7A 3OX2A 2XUPA 1B4DA 4KGDA 5BR8B 3LUPA 1VG1A 3IKVA 4XLLA 5C7IO 2HPAA 3QMVA 4JVMA 5K05A 3GLIB 2Q1WA 1L5SA 3ILYA 4FNAA 4W1QA 2A9RA 2I5PO 4JL6A 3LX4A 4BJ6A 2HPZA 3NV9A 2GFQA 4I55A 4MYHA 4LSGA 3TLGB 4LN1A 4DBLC 3QUTA 2XECA 4OXRA 2EHJA 5B7NA 2GB4A 3HY3A 3RC9A 5KQMA 3WE7A 1RXVA 4RKQA 1LK5A 1GL6A 2WHYA 3PCXA 2F3UA 1YQUA 2OXFA 2R4TA 5ED4A 4Q9IA 1JT9A 4B4VA 2GEJA 3LUKA 3AIKA 1MABA 2ES4A 1E2MA 4Q3BA 1XVAA 1BXGA 1UJ6A 4JBIA 2A0FA 4YS6A 1Q12A 2XZPA 1OLOA 5CFMA 1KEVA 4GMHA 4CMIA 1NX9A 2PFKA 2ZJ1A 5E95A 2R11A 2AG6A 3TYXA 1Y3HA 2E4WA 4U02A 3JCZA 3DWEX 3GT0A 2RHRA 2ESRA 4MK4A 1RZ3A 2F1OA 2NVWA 1RKUA 4FGKA 5EESA 3PD7A 5KAPA 4R8RA 4WKCA 4E2FA 3VZCA 5FLKA 3WNBA 3KOOA 3NWBA 1JIQA 5EMNA 1I94B 1U4OA 4OPMA 4B2PA 4G8CA 4DUGD 4FDAA 2AVDA 4TYQA 4UNPA 4M87A 5EP1A 1XEWX 3SBDA 3TQFA 4R71A 4Z4HA 3QUSA 1FFBA 2FLKA 2O3QA 4OLHA 1IIBA 1Y37A 2NXWA 3T4XA 5CA1F 1OFTA 1V9CA 3D6TB 5CX1A 3RC2A 4UEKA 3KOZA 4JT2A 1NM5C 1Z26A 1RC1A 4ZPJA 4N01A 5AHWA 3CVJA 1TRHA 2FW8A 4KPUA 5CAEB 3W9BA 5ICSA 3IR6A 1A7AA 4C87A 1NBIA 4Q3AA 1JJIA 3HKCA 3TLYA 2CBXA 4AJOA 2XYGA 1WCWA 3CNOA 4C01A 5KYYB 2BISA 2E4UA 2ZSEA 5KTRA 4D8YA 1S6YA 1QO0A 2VPWA 1GAEO 6YASA 3TNDA 1Y4AE 7ADHA 4TGLA 1YR7A 2ISCA 2ZU6A 1PR1A 4Q4JA 5AXAA 1PNRA 1CZUA 2KBEA 3BDAA 4NRDA 5CX4A 5F33A 2QZPA 4H77A 1WB6A 4I55F 1DC7A 1G16A 4GAEA 2BLNA 2ZRKA 5CVEA 1SU6A 1XAIA 3PENA 1QLHA 3EPRA 3KEOA 2YIVX 4V0LA 5D51S 2JZCA 3AY0A 4J91A 4JYMA 1YQXA 4LCJA 5AP9A 1E9AA 1K9VF 3L7LA 3LUGA 1C5KA 3AHDA 3PDHA 4WOKA 4EB8A 3SR4A 2ZCJA 2EFDB 1P4AA 4TL7A 1N33B 1YVPA 2J87A 3TM5A 4LY6A 3ER9A 3JASA 1U3WA 3K0SA 2AFHA 4OQ4A 5JIBA 1WXIA 3H16A 4E5PA 2UDPA 1H1LA 5G1OA 4F7WA 5IK2D 5BRJA 1Q57A 1LPPA 3KQOA 4RPKA 4TPKA 4UTNA 2B3TA 4HQOA 4KYTA 1EX1A 2VDMB 2R8OA 1XTQA 1GFSA 4TTSA 1VPVA 2VK8A 4DWVA 1A77A 2IUSA 2LZ0A 2V9PA 4MHTA 1T25A 5AKLA 3PWKA 2NO1A 3JWEA 4J6EA 3LCCA 5FX2A 4KR3A 1HT3A 4JWKA 2WWRA 1Y48E 1JPUA 1LTHR 3FA2A 1T3TA 4EYOA 1JH8A 1TAUA 2G4LA 3IVMA 1Y98A 4X1YB 2AI1A 1G7TA 4IIJB 4OHZA 4TRNA 4KLAA 1CSEE 4M1EA 3VGPA 3I92A 4KW7A 4UCQA 1ID1A 2DUMA 3D2LA 4V1CI 2NAFA 1PL0A 2I8CA 2IVZA 4RPLA 1UM9B 1E0DA 3QPBA 5GV7A 1FQOA 2V65A 1JI3A 2HJGA 3NS7A 3ORRA 4NESA 4QGFA 4BFCA 4JJ8A 4LDAA 1RC8A 4EVRA 3EUWA 2VHEA 3CM0A 5IULC 4DC1A 1LLDA 4B2LA 3BTSA 1F2TB 5BSGA 1SKQA 4PFKA 3EZLA 3LKVA 4HLUC 2NU6A 5CIWA 3HP4A 1U7DA 4MW1A 4V0SA 4L3VA 2WU4A 5J4VA 2JFPA 1Z8HA 3AM5A 2I67A 3ANSA 4KIUA 4RFVA 4LY0A 1W36D 2PT6A 2ZLBA 1XA4A 5LU9A 3FZEA 1EJBA 4C5CA 3D4LA 1F8XA 2J9FB 3PKZA 2AQ8A 5LUBA 1QF6A 3A3KA 3NIBA 1ZSVA 1BD3A 3DVAA 2AN5A 4Y98A 1H4VB 2YVKA 1DBVO 4YT8A 4REQB 3N76A 2HJVA 1RWPA 4PFSA 3TTYA 1FL9A 3SXPA 2PD6A 3Q41A 4GICA 4AS2A 3JAKA 4MH0R 4MVCA 4OIMA 2GCIA 3FFTA 4N3GA 4XQEA 2P27A 3ZE9A 4LWZA 4OXKA 3HI6A 2R47A 1Q0RA 4NMLA 4WNYA 4YRIA 8GPBA 1G59A 4ENWA 4P82A 5M29A 1Y0BA 4Q0MA 2L42A 1S3GA 2VSXA 5FADA 1U5BA 1TECE 4P0QB 5EIBD 3WNDA 1V1RA 2JLXA 3TUZC 4NBLA 4DR3B 4L0DA 2CXNA 5I7VA 2CV0A 1SC9A 3F67A 1EUZA 1ZKMA 2GBLC 2TMDA 3HCRA 2B1GA 5C34B 1MT3A 2KLHA 3B9QA 3NTXA 3UVEA 4C2TA 4GQBA 2DY1A 4LXXA 5AOAA 1DRVA 1J8VA 1K0UA 2Q4TA 4JITA 4TLDA 1NQTA 3QF4A 3WHKA 3RRMA 2W6QA 3VJMA 3X1KA 1E2KA 1QK4A 3VTAA 4A9AA 3O6VA 1QX3A 4FFVA 1F7VA 1GGJA 4XPIB 5E6SB 1FTNA 2PWAA 3CVOA 3TG2A 5TQ0A 4R1LA 3CF6R 3OLVA 3QNMA 4J1TA 1PGQA 1QS0A 1L4UA 3INNA 3P9KA 1BDBA 3CMCO 3HXPA 1DEHA 1VMKA 3I09A 4IH9A 3NUGA 2OESA 4CT4B 5I7SA 5KTKA 5KSZA 1OW3B 1UZNA 4GXRA 4G4SP 3RVMA 4DIDA 3PPXA 4V3CA 2BHTA 1WV1A 3IEMA 3MF4A 5F1YA 3WAKA 4ES6A 2EJBA 2X5JO 2JD0A 3V8QA 5B7GA 1KR5A 5E2AA 3RS5A 3VNAA 4TT8A 3K73O 1PKXA 4HYYA 1EI9A 5D3ZA 3KUCA 2XJ4A 3KBBA 3O8QA 4BP9A 2FF5A 1O5TA 4WECA 1PQPA 5T7BA 1P5RA 3VR6D 1KZ7B 2ZR9A 1SK8A 9GPBA 1V9LA 2RKWA 1FTWA 1NW7A 1UR5A 1XQ1A 1YNSA 3EWNA 1VL8A 5KOIA 2G7MC 3BSSA 3KHKA 2ZRPA 3AHHA 3D3NA 3EFHA 3VMMA 1EVIA 2CMFA 3L5OA 3PNYA 2PSSA 4O2BA 4QNRA 3I04A 2DFDA 3KV3O 3WKEA 4I8XA 2D59A 4CR7A 1U8FO 2IEYA 4L73A 5E4FA 2QUAA 3JRWA 5B1HA 3IPLA 4UBIA 1FTQA 2BFWA 3H7AA 1C9MA 1ND5A 5K3CA 1UBJS 3F4LA 3BMQA 2GYWA 1Y1SA 4BNMA 1QOPB 1VJDA 3WA6A 5DNVA 1X7YA 4RA6A 1WAMA 4YUYA 3C1UA 3P9SA 3U31A 2NPOA 2HHCA 3ZCQA 4CDMA 5LU8A 3QNUA 1N34B 4KN9S 4B75A 2G0NA 2GJ8A 5BT8A 4M1WA 5CVDA 4UARA 3RVBA 3BOSA 4EEZA 1R74A 1YB5A 3A1FA 3QU7A 2Q2NA 5ALSA 1DUIA 1TMYA 3BH0A 3R6LA 1N8NA 4RVSA 1G20B 1JR2A 5HX7A 1PO7A 4HAVA 2QUKA 3IULA 2ZI9A 2CXTA 2GK7A 4ERXA 1U99A 4EO7A 1VKHA 1CT9A 2QTHA 4C43A 1F3LA 1Z13A 4E1VA 4AQ7A 1AV6A 4E4TA 1T91A 5BYAA 2PIAA 2JFVA 1ULSA 1Q83A 4IQGA 5CH8A 2JKVA 3M3DA 3WDKA 4LXGA 2PX3A 3ER8A 4EVSA 1NPYA 3GPIA 4ZCMA 2IF2A 3Q11A 1YR1A 3WJ7A 3C5CA 4Y2RA 2CVFA 3PHHA 1LRJA 4EL0A 3OZCA 4BNWA 3PSAA 5JZMA 3DCNA 3D4NA 2JFXA 4RKWA 3K09A 3LUFA 5CVCA 4O1MA 3UXEA 4D02A 4DA6A 5JATA 1OXTA 4RFSA 1COZA 2YNMC 4CV1A 3KJFA 4QXAA 2AFHE 1TK9A 2P1ZA 1R0BA 3W5HA 3WYCA 5IKPA 4QGBA 1L3IA 3EDOA 1SG6A 4R9VA 3NEYA 1L4MA 4D1YA 1OKKD 3DOCA 5G4KA 3V7WA 4TYYA 2NIPA 1JQAA 4ER3A 3H84A 2YZKA 3UGKA 4R9SA 4QU9A 4DNPA 2F90A 2PUDA 5IVIA 3QXXA 2PZMA 1WW3A 2ANCA 4D9GA 4JLPA 5J1SB 1H9BA 3UMGA 1T9GR 4HXEB 1V6AA 2ZBEA 3PCTA 3EE6A 4C4SA 1T36A 4JBWA 1E1QA 1PJRA 1WF3A 3LYAA 1JAZA 3OAAA 2XX3A 4ZQIA 3KE9A 3WYFA 5F9FA 2VQDA 4G9GA 1UQRA 2R7NA 3LQKA 4AIIA 2WF9A 3DMHA 3RVRA 1G5FA 1UQTA 3AP2A 3IRUA 3NVKI 4WKBA 3CR7A 3EVZA 1K5HA 4LY9A 7AT1A 2OSBA 1ESMA 3C48A 3FHJA 4UTOA 2OA0A 2JAPA 2PKCA 1P60A 3IAS6 2WJZB 5I51A 1H4SA 4DXAA 2YKGA 2JLQA 4QBHA 2WU8A 4OUKX 1IXRC 2LKDA 4EJSB 3GFQA 3QMWA 2BF4A 4WA7A 4JI6B 4JBNA 4ZICA 2QTWB 1BCRA 4LJ7A 5AI5A 1OZFA 3DXFA 4QT0A 3GEHA 1M1NA 1EP2B 2OG2A 3CCCA 1KMNA 4M9XA 1RRGA 4NATA 3DF9A 1BQEA 1I3MA 1TU0A 2G5CA 5JD4A 2MSNA 3OD1A 1ESNA 2H48A 3AHGA 4GMXA 1QCZA 3SDZA 1EDEA 3TKAA 5AIBA 2LIVA 3TZCA 5KSWB 3AR2A 5CJJA 5FBHA 4FEYA 4CIVA 3E8XA 1B8PA 3MK31 3ADDA 1N6OA 4HH4A 3OZFA 1CRPA 4K88A 1KNXA 2XNHA 2GK4A 2JF0A 1C1XA 3KQWA 3QY9A 4W7SA 3RABA 2IYPA 3T12A 3W8FA 4YXFA 1W29A 4L5IA 2X86A 2PEYA 4DMKA 5L7WA 1R27A 4FZ5A 1YHZA 4MNTA 4ZWNA 1DXQA 3I5XA 4P7GA 4WNAA 4QBKA 2B6HA 5E8RA 1HDYA 3EXEA 1T35A 2HO4A 1UPAA 4O2AF 1Q2UA 1XTZA 2HW8A 2J5BA 3EAGA 3EW9A 2CF5A 1B43A 2O14A 4MLCA 3LXMA 3PNMA 3MXOA 4CQLA 2GPJA 5BNFA 1ZSNA 3SYNA 1U3TA 3L8GA 5LDGA 1NDUA 3WZMA 2X4LA 2VZ0A 1Z0IA 1DAHA 3OESA 4LXQA 4PQYA 3GDOA 3GAZA 3QX9A 3IPRA 4LV8B 4ONEA 4YT4A 4CG3A 3EVTA 5GQSA 4E2WA 2A7QA 2UYYA 2BFFB 1X7DA 2N1MA 3K0AA 4OB7A 2HMAA 2ZQZA 4HCJA 2QW8A 2Q6VA 4KKVA 4YRZA 3OPQA 2YINC 4AY3A 3P5BA 1YRAA 2BFOA 4FX5A 1XZHA 4GNRA 4X20A 3WGGA 3GD5A 3KQQA 1KI9A 1N2CB 2JGAA 3FZYA 3LT4A 2FZLA 5G1PA 3EPHA 2ZE7A 3DMGA 4ZYWA 3ZGVA 1WBDA 5ITSA 1P61B 2YV2A 4QU5A 1H2RS 4CLDA 2TS1A 4CEIA 2Z8YA 4J0CA 1L8XA 5JDIA 2XTJA 4IEIA 1XRLA 3V4ZA 1DJOA 1Q1ZA 3ZYCA 1KI2A 2BM1A 1ZJ5A 1Z4OA 2VP6A 3CONA 5EMJA 4ARVA 2LP4Y 4EGSA 3N2EA 3GCGA 3RM3A 3RS4A 1P5JA 2W37A 5J2TB 4JS0A 4RLFA 1YZKA 4CDRA 4F85A 1G6HA 2B2NA 4IIDA 2Z9DA 4BLUA 3LDFA 4G9BA 3PUYA 4X5OA 2PZKA 2OG1A 4TVOA 3E05A 4BKPA 3H2YA 3WICA 4RTKA 5K3BA 4C78A 1TJ3A 3AXSA 4C3UA 1EZ4A 3G9TA 3KSRA 3BHIA 4WT7A 5JAIA 3OOWA 3P2YA 3CH7A 4GBGA 2X8WA 5FQNA 4UMEA 2VHJA 3FI9A 3LK6A 4IUCS 3TFQA 5HJ2A 3I23A 3USES 1XXHB 3IUNA 2PX5A 4LQLA 1H8ED 1HDOA 1AQNA 1QRUA 4F9TA 1WG8A 3RFUA 3D7KA 3FVWA 3VPHA 4TMTA 4ZVUA 1SELA 1ZI9A 3WISA 5I9NA 3AZPA 2VT3A 3MYRA 2DHEA 3PPWA 2VHYA 4OXQA 4Y2UA 5CDTA 8ATCA 4BWFB 1JRLA 1G17A 4HWGA 4M0LA 1CLEA 1R8QA 4HDKA 1EA5A 1QIFA 4KWHA 2DUWA 3P52A 4J43A 4JQYA 1EEHA 3UWSA 1NW3A 4MS3A 1WCXA 3N3BC 3VUFA 4EYEA 2BPOA 4JEIA 1TPZA 2GMWA 4LOKA 3RFFA 1BH2A 1P2TA 4PFQA 3GP8A 1LFDB 2PN1A 3MPUA 5FLEX 4CMEA 3W04A 5C4IA 1A3CA 3RJZA 1A8UA 3LPAA 2QR5A 3EGIA 4DBVO 4I7EA 2ZTLA 3VO1A 3VU8A 1WA5A 1JXAA 3OLCX 3FFWA 3QUBA 3QVVA 1NYQA 2ISSD 1W94A 1ULZA 4IQ8A 3K9WA 3LGAA 4X41A 4QM7A 2I6XA 2Y05A 5GY7A 4EI7A 2IS6A 3C4QA 1BMFD 3MWDA 3QOYA 4M0CA 3RE1A 4ALIA 1AGPA 4OUDA 4N5LA 4WLFA 5I7FA 1ISJA 2HAEA 4JJAA 4RVFA 2X77A 2IPAB 2PZ8A 5DNEA 4QQFA 3A9RA 2AI3A 1XEWY 2PXAA 1QQ6A 2EW8A 4FFOA 4HXYA 4PPQA 1T2EA 1E6UA 3PEFA 4F21A 4QQNA 4UUAA 4YRLA 2JLUA