1T5BA

Structural genomics, a protein from salmonella typhimurium similar to e. coli acyl carrier protein phosphodiesterase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
201
structure length
199
Chain Sequence
MSKVLVLKSSILAGYSQSGQLTDYFIEQWREKHVADEITVRDLAANPVPVLDGELVGAMRDAPLTPRQQDALALSDELIAELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGITFRYTEKGPEGLVTGKRAVVLSSRGGIHKDTPTDLIAPYLKVFLGFIGITDVNFVFAEGIAYGPEVAAKAQADAKAAIDSVVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein phosphodiesterase
publication title 1.4 A crystal structure of a protein from Salmonella typhimurium similar to E. coli acyl carrier protein phosphodiesterase
rcsb
source organism Salmonella typhimurium
molecule tags Hydrolase
total genus 74
structure length 199
sequence length 201
chains with identical sequence B
ec nomenclature ec 3.1.4.14: [Acyl-carrier-protein] phosphodiesterase.
pdb deposition date 2004-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1t5bA00
2QR2A 4R81A 2AMJA 4DY4A 1BVYF 2Q9UA 1J9ZA 4Y9RA 3OWHA 1H66A 4QOIA 4U7GA 2R96A 1FUEA 3QFCA 1TLLA 3TE7A 3QFRA 3SVLA 1WSBA 1AKRA 4U7FA 2MWMA 4YQEA 2BF4A 2V5UA 4ZVMA 3B6KA 4M0CA 1XYVA 3W79A 1ZX1A 3EYWA 1C7EA 3RPEA 1FLNA 1QHEA 2M6SA 5F51A 1AMOA 3OJWA 1X77A 3NHFA 4XDHA 2FVXA 1QBGA 5EAIA 3FX2A 2R97A 4GI5A 4YAFA 1XYYA 3W78A 2BZSA 3OJXA 3B6MA 3D7NA 3KAPA 5NLLA 3ESZA 5LVAA 3N3BC 1WSWA 1OFVA 1D4AA 3HLYA 1FX1A 3LT5A 5TGZA 2FZVA 1VMEA 4LTNA 4DILA 2OHHA 3OX3A 2QX9A 1QRDA 3GFSA 1FLDA 2KQUA 4C0XA 3FVWA 1AKTA 2D5IA 1ZWLA 4XDGA 1CZOA 2V9CA 3W7AA 6NULA 2RG1A 1XT6A 2A5LA 3B6JA 1DXQA 1BU5A 3NHKA 1CZNA 1CZRA 4ZVLA 3NHWA 3NHRA 2M6RA 5FX2A 4Y7CA 3EDOA 3S2YA 3TZBA 3KAQA 3U7RA 2BN4A 1D03A 4HEQA 1F4PA 2V5VA 2Z9DA 1AG9A 4Y9UA 3UXEA 2FCRA 2OYSA 4QODA 1YKGA 4U7HA 2F1OA 2HNAA 2HNBA 3OX1A 3ESXA 5ULLA 2FLVA 4YAUA 1CZLA 3HR4A 4ZVNA 4FX2A 3NFRA 2W5UA 3R6WA 4H6PA 5LBTA 3K20A 1AZLA 3NHPA 1NNI1 3NHYA 3F6RA 3GAMA 4BMPB 1YRHA 4HS4A 3G5MA 1SG0A 4C14A 1RTTA 3NHJA 3P0RA 1CZKA 3ZHOA 2B3DA 2WC1A 3F6SA 1J9GA 4ICIA 3OWXA 5LJLA 1DXOA 5EMNA 1AKUA 3NHLA 3OX2A 4LTDA 2MT9A 3W77A 4J8PA 2OHIA 3TEMA 1H69A 4N9QA 3NLLA 1JA1A 2XOEA 1SQSA 1AKQA 1AHNA 3N3AC 2ZKIA 4DIKA 4YAOA 2FDXA 4F8YA 3NHUA 3FJOA 4ZVKA 2BMVA 4CETA 3O2NA 2QWXA 3JSXA 4NULA 1V4BA 2FX2A 1RCFA 1YCGA 3KLBA 1FTGA 4LAFA 1OBOA 4BMOB 4CF6A 2GSWA 5LBUA 1GG5A 1J8QA 2FOXA 4OXXA 1T0IA 2N1MA 4QOGA 4ESEA 4S24A 1OBVA 4PTZA 5EA2A 2MTBA 1FLAA 3L9WA 3KEGA 1YCHA 1ZWKA 2QX6A 3N39C 1YCFA 3O73A 4GR9A 3B6IA 2MOKA 1J9EA 3QE2A 5BUCA 3U7IA 4LTMA 2X2PA 3GFRA 1TIKA 1B1CA 1AKVA 5FA6A 4N82A 5JROA 2FAXA 1KBOA 1YOBA 2XODA 1CZHA 1KBQA 4D02A 4C76A 4QOEA 5F4BA 2KLBA 1QR2A 4QOFA 2Z9CA 1I1OA 4H2DA 1YDGA 4NLLA 5LMCA 2X2OA 3ES9A 3LCMA 1XI2A 4FGKA 5A4KA 3UXHA 1FLVA 5F12A 1T5BA 3HA2A 3F2VA 2QX4A 1E5DA 2QMYA 2ARKA 5B3LA 2Q62A 3F90A 4QOJA 3L9XA 1RLJA 2QX8A 1CZUA 1DX9A 4FGJA 3FW1A 4PTYA 2OHJA 1C7FA 1RLIA 2FZ5A 3OVMA 4QOHA 3K1YA 2Z98A 4C0WA 3ESYA 4LA4A 5FUQA 2BPOA 2HPVA 3FNIA 2QMZA 5NULA 1FVXA 4PU0A 4FGLA 3GFQA 5LLDA 4GQIA 5LJIA 4N65A 1JA0A 2Z9BA 5B3KA 1AKWA 4YALA 3NHSA 1D04A 4YAWA
chains in the Genus database with same CATH superfamily
3AF4A 4B6GA 2PD4A 3L7DA 3URKA 1EIWA 3R5KA 4JHLA 5CVUA 4BWGA 2AMJA 3BMNA 4HYTA 4CM4B 4UTNA 1JFFA 4JA0A 1TVKA 4INJA 4Y9DA 1ZN2A 3LUFA 1JQ3A 5DNUA 1XPRA 1E9VA 5HVNA 4WE3A 4LRWA 1ARZA 2OK7A 5BNFA 4O1IA 1LBQA 1NFFA 1R0RE 1JLMA 1QIIA 2B7BA 4FQ8A 4FUTA 2XXJA 5A9SB 5F98A 1XTSA 1R6UA 2QQ5A 2VXOA 1TM2A 5KWEA 1XD8A 1KJZA 4HAXA 4MINA 3LW7A 4K6FA 4QO8A 4Z53A 1HE8B 1Y8ZA 4H1VA 3DAYA 1XOIA 4AUEA 1W52X 4ZI5A 2PR7A 1TDJA 2BMEA 3LLSA 4IJ6A 1L3CA 4ZDKA 1P3Y1 4Q3DA 2CEAA 1Z2CA 1U5BB 3R0IA 2AFHE 2PK3A 4ARZA 1MT0A 2H1VA 4Q21A 1CQIA 3PDIA 1L5FA 1KHHA 2GZMA 2PVPA 4AI6A 3C6ZA 1K7YA 2Y1OA 3ZCXA 1J2YA 3A4NA 4IFTA 3TNDA 5JAZA 5CCEA 1PR0A 2GAOA 5HKAA 2JIRA 3E22A 3SIRA 3WADA 2H85A 3GVHA 4PICA 5JH7B 5JOQA 1IXRC 1L4MA 3ABRB 2F3PA 3KXPA 1B0PA 1QLHA 1SC4A 2O8DA 5AK0A 3RREA 4S05A 3EWSA 3LT4A 4DQ0A 7ADHA 5DHQA 2FP4A 5GZ3A 2P1RA 2VNAA 1QBGA 1Y7PA 5KOJA 1EGMB 2YR0A 4RFVA 4OHWA 4LDNA 1L7XA 2NPOA 4EHAA 2PQ6A 4BQNA 1RWNA 1JYEA 3QU7A 4HGNA 2GJ4A 2JJ1D 1NR7A 3ELYA 4G6ZA 4HX2A 4UPDA 1BXRA 3A1VA 3DHYA 1N0HA 5JYCA 3LY7A 2FN4A 1PW7A 4RA6A 2PH7A 3V1NA 5TMDA 1RJDA 2QR3A 4ILKA 2XXAB 2I6UA 3GGCA 3NI2A 3IR6A 4LJSA 5DNWA 3P8ZA 3EF0A 2R6FA 3RJTA 4REOA 3K5WA 3THSA 3CZRA 4WXRA 1E1CA 4EHHA 2PMCA 4XI9A 2ST1A 5FR2A 3OPQA 4LTNA 4UULA 4DLSA 4F9FA 3OX3A 2R7KA 3K8QA 4EW1A 3MPOA 4B3GA 2AI3A 2XOKA 3WRYC 2OY0A 3GVCA 3NU1A 2WJVA 4EKIA 1J49A 1XX6A 1NLFA 2OBFA 3SS9X 3VOTA 2NNLD 1J06A 3B12A 3L04A 5GWXA 2OXIA 5IT0A 1NQAO 3GDHA 1D1PA 3OT4A 4XQ0A 4ZQBA 4DA7A 1JYSA 1M2JA 5DGXA 2F55A 3R3VA 3HZRA 3V46A 1H94A 2HJ9A 3UJHA 5EIBD 1TMGE 3R3JA 1LSSA 3INGA 3F5DA 5EYPA 4UAUA 2O57A 3WY9A 1NBMD 3QG5A 3E8XA 5BSMA 3WGHA 1Z25A 4BJ6A 2UZ1B 3RYIB 2GTHA 2O59A 2Z08A 4IWYA 2JJ8A 2Y2UA 4JEMA 2DBYA 2HA5A 2M9MA 3WHPA 4C0HA 4R2WA 4F4UA 4PN3A 3AI2A 4HTAA 4JLAA 3QU9A 1R0CA 6CHYA 2OFFA 1Z37A 5IX8A 2MR6A 4RDXA 2I91A 4KE8A 4ZD6A 1AU9A 1K97A 4LOLA 4EEKA 1FW8A 1D7AA 1XAGA 1I9CA 2R8PA 4U2BA 3T4UA 5HXAA 2C2ZA 3H05A 4BO8A 1QG4A 2MSNA 5FORA 4URYR 2W2KB 3T1QA 1T1JA 3ZV6A 2QQFA 1R9NA 3KYCA 5CA0B 4AURA 4EKGA 2HF9A 3U3DA 3WB1A 2F67A 5E0KB 1P7VA 4TLEA 3G17A 3ZU6A 1MZPA 3LKDA 3QW4B 4YRRA 4D79A 1W7AA 3MS4A 3CEPB 2ECOA 4ZEVA 3VNQA 2ZSUA 3EW7A 3E70C 1HOTA 5GOTA 3PJDA 2IHZA 1M1UA 5KWSA 4M1QA 3G2JA 1T9KA 5C1DA 3T7KA 4C0LA 5CLFA 5FX2A 2D2EA 4ZQGA 5JDCC 4AJJA 5CB4B 1N2IA 1R16A 1TPYA 3HUEA 2C5HA 2CL5A 3ESRA 3FPHA 3OU2A 3QOYA 4PG7A 4GXRA 2WEKA 1B8VA 2Y4OA 2Z8ZA 4J6FA 4K9NA 1D2AA 2NX2A 3U7RA 1HZZA 4PLWA 5H16A 4OREX 2GPTA 4UTRA 2AR9A 3SX4A 1F4PA 2A4MA 3OQPA 2JZCA 4KCGA 4QWMA 3RYFB 4D9HA 1RBQA 1AF7A 2LTAA 4UEQA 4UBOA 1ONBA 3KK0A 3IIJA 2D7DA 2FB9A 4L4XA 6GPBA 3FF4A 1PNQA 3CCCA 3N6RA 3QEMB 2P9GA 2YHAA 1KS9A 1L4GA 1UBUS 1WUYA 1WW2A 4LNUB 3ZG6A 2GM9A 2CLKB 2AE2A 3OG9A 2EVWX 1CUHA 2G80A 2GK4A 3OM0A 4HZUB 4RELA 5E7MA 3GD5A 2IU0A 3U09A 4CQNA 1OX6A 1ILEA 4M0LA 3KM0A 1UBCA 1MCZA 3DMRA 3MCZA 2HWXA 2O2SA 3AJEA 3R5FA 4AT1A 3H1AA 2NU8B 1F3OA 5CGQB 3F2IA 4KUEA 4LS3A 1DXHA 1EB9A 1EE2A 3WYCA 2GBLC 2PMFA 5A0VA 4OBXA 4NEGA 5LZ7A 5I47A 3EXHC 2VXBA 5DLEA 2YZGA 3ITDA 4MGKR 3T4XA 1TEVA 1TMYA 2W2OA 2WBLC 1G8SA 2W7TA 3N76A 4TMVA 4IY1A 5FNVB 2HB6A 2HQBA 3JASA 2VCEA 2ZI9A 5JO9A 3FPLA 2H3HA 1O0CA 5TV2A 2W5UA 2D74A 5CNKA 4DIUA 2JLQA 4DV2B 1JH9A 2HQSA 4IGAA 4D74A 4UARA 4F6CA 2RB5A 4DSNA 2MMCA 3O1HB 2NV0A 4L8YA 3IOCA 4IHQA 2AB0A 3VC2A 2Y76A 1E64A 4J1TC 5KZMB 1B1AA 3BJRA 5FD8A 4QGGA 3UWSA 1IMJA 3DB2A 3T9DA 5HSGA 4U2DA 4N41A 2VT3A 5CM2Z 4URWR 1K8ZB 1R2QA 5EKDA 2GH1A 2I34A 2RE8A 1X8XA 3BT7A 5KSYA 5AKIA 4CTKA 1C3JA 1KTVA 2BFCB 3THRA 5CB8A 4RY2A 2JLWA 2MHCA 3QV1A 3BSYA 1W85B 3WC4A 4DDHA 4IZHA 5MGBA 3ESCA 2FR8A 2PLWA 4DAEA 4L08A 4IMPA 1ZFNA 3GZNA 4AKHA 2EFYA 4TOIA 1QG2A 2FEAA 3EFBA 1G8KA 4D9NA 3E9EA 3MGGA 1P6QA 1XAIA 3R7SA 2CB9A 1M6VA 3L7YA 5FWXB 2O8FA 1OB5A 5K2OA 1ONNA 1VE1A 3SDZA 4WA8A 3JXEA 2SICE 2B3DA 1ITZA 2WVAA 3CX3A 3ON5A 4B6QA 4OSPA 4NCAA 5I7SA 4NVRA 1HDRA 1B16A 1USVA 1UXJA 1O4WA 2BGRA 4MR9B 3EMKA 3HRKA 1Q74A 4RKWA 4EVRA 3L8HA 2JGLA 3NHLA 1L5HB 2CV0A 1K1EA 3DDUA 2WKSA 3TDKA 1BAPA 3M89A 1F5SA 1E5XA 3TQHA 3BDVA 2GBFA 4HRYA 3WL8A 2DWPA 2FW9A 3GJXC 2JDIA 5H02A 2C0CA 3IV6A 1FUIA 4W8HA 1E3QA 1Q0LA 2IP4A 2XJ4A 4CKEB 4BXOB 1CK4A 4YRZA 4A8JC 4IGFA 1LCIA 1FYEA 1BCSB 3VUFA 1JEOA 1XZMA 1JA1A 4F5YA 4JYBA 5IF3A 4XE5A 1GEEA 4V0ME 3PI7A 1DIBA 4JJAA 4WCFB 2L17A 1JSLA 2B35A 3DBLB 4ZAFA 5JEDA 4W5OA 3L41A 2AFHA 4U2FA 4UUAA 3V8RA 3ZDEA 1E4VA 3VKHA 3WR5A 4OF4A 1NRXA 4PRZA 3D4PA 2VDLB 3BCSA 3G9UA 1X9GA 5H80A 4NMWA 4C05A 2I55A 3IAEA 2O8BA 3II6X 3WL7A 2HCTA 4ALNA 1KPGA 5IKEA 4YPOA 5JJ5A 1OIWA 4Z0TA 3FJOA 1L9XA 2WIFA 3AEQA 4IIHA 5HIIA 2NO9A 3ADBA 2PUVA 1JJVA 4QRIA 5I01A 1G0NA 5JXHA 1QQ7A 2E4ZA 3ZZ1A 1YI1A 2BFWA 2IUEA 4J29A 1CUBA 1H3FA 1XP5A 3LUKA 4GWLA 4O4HF 1N6PA 1YCGA 3SX0A 3L4SO 4HLUC 5D3ZA 1PX0A 2GQ0A 1EPUA 2O2GA 4JKOA 4MARA 2X8JA 4XIIA 3WLHA 3ZEAA 1I3OA 5FR1A 4MQMA 4KQIA 1G4AE 2JLCA 1UK8A 2NNWB 2AJLI 3CSSA 5AW5A 4B3SB 1NIPA 4HUTA 2AC4A 4RESA 2BE7A 2M1XA 4IV0A 1AIPA 2ZE8A 1I51A 2F7SA 3DNMA 4TTPA 3EDMA 1CJMA 1NW3A 3ZWOA 4O25A 2P2SA 1M5RA 1WKBA 2IZ7A 3PGVA 2PGNA 4BLPA 1K7FB 1GG5A 2OCYC 1Y9DA 5IVPA 2WF8A 1OAAA 4OYLA 1T5TA 1RYDA 2YVLA 2X4GA 2ONJA 4A5OA 3T06B 1KI6B 2AD5A 3RNLA 3PRJA 2W90A 1IRXA 3G2QA 3ETHA 2HC9A 1OBVA 3ORRA 5EA2A 3AK4A 5I9MA 4TS9A 4CM6A 5B7NA 4N3BA 3MFQA 3W9UA 5BVGB 3BMOB 1JI3A 5EQDA 1DV1A 2EFCB 2PVSA 2OPHA 3S2UA 3JATA 4AWXA 2AN4A 2FSFA 1D2RA 4M0UA 4PHHA 3W3AH 4DLPA 2PM8A 2PGLA 1DQYA 3EVZA 3O83A 2LUOA 4KR0A 5JHGB 4JBGA 3KKQA 2PL1A 3I2GA 3TLCA 3ET5A 2Z4RA 3B3FA 4O2AB 4B6JA 2ZYHA 3LT1A 1NM5A 1R8XA 1NT2A 1R6BX 1KO4A 3P71T 4KQGA 5H3LA 1H22A 3RBVA 3M83A 4Y18A 5TPWB 1I36A 1H0RA 1RHJA 3X1ZA 5F3WB 1AKVA 3MQ2A 3IRUA 4MRPA 2BJHA 1EVQA 1OILA 4M1EA 5FA6A 3V00A 3UATA 1UM9B 3AWIA 4KR2A 4CN9A 4GL2A 5I4IA 4IQ0A 3AG5A 2I80A 4OQ4A 5GJWC 1XUOA 5AHOA 1NNUA 4RFLA 5IBRA 3NXKA 3UT6A 1ZCBA 2VP9A 1KZ6A 2BGGA 5CAEA 2E21A 5IUKC 4E6EA 4Q7EA 2O8EA 3GT3A 3OCJA 4HZIA 5D84A 3DZKA 4YAIA 5IUNC 3TB6A 4CKCA 2G1PA 4G37A 2QSYA 1G55A 3D0QA 3F1KA 4HDSB 5BUZA 1BHJA 3TNYA 1BMDA 1P4JA 4QOEA 4TKVB 4DYDA 2GPYA 1BXGB 3PFGA 2JFYA 4Y6QA 3DLAA 4WESA 1XXHA 4HDRA 4XCQA 2ZRDA 3RS2A 3VYWA 4C3VA 4C5AA 5JAMA 1ZJJA 3I3SR 3E9DA 2AN9A 2R47A 2LZ0A 3BK1A 3EIWA 3LTEA 3MTIA 3T7AA 1F9EA 2FV8A 3LYAA 1KS2A 4YJ2A 1RPZA 3ANXA 3R5JA 2QMQA 3FKSD 4PINA 3VPHA 2V7BA 1XDDA 2FUG6 4FT2A 4HNSA 5JYEA 1L1QA 3DV0B 3PICA 3FWNA 4L7QA 3I42A 4WZZA 3RS9A 1DTSA 1HQCA 4Q9KA 3Q98A 2O7SA 5D8DA 1SVUA 2AHOA 2W6OA 4MAAA 1RXEA 3KQOA 4Y2VA 3GR6A 5TPZA 4HDAA 2P0EA 4MS1A 1JKXA 1H0SA 4LRYA 5IC6A 1M9NA 2ZUUA 3BSSA 4DCSA 1FUYB 1HT0A 5EP3A 4O4LF 2ZR7A 4PXAA 4ZQIA 2DB3A 3SIWA 5KINB 4TT3A 4ZGWA 3PWTA 4JB3A 4EPRA 1C41A 2W2LA 1BU8A 2Z2KA 4WLEA 1NVEA 3DFZA 1Z73A 5C7LO 3TLYA 1SH7A 1M0EA 5AHWA 4RGVA 1Y3DE 1QCDA 3R3HA 2H57A 3NGLA 3UCEA 3CH6A 4Z51A 3EZ7A 3H9UA 4BLVA 5AUNB 5EJMA 4HVLA 4Z4FA 2D1TA 2Q3HA 4ZT2A 4BBJA 4JK3A 2Q6LA 4P4GA 3DA8A 3A4YA 3UKJA 3ZU3A 3ABZA 2QKYA 1TT7A 1LLCA 4JJ6A 3SVTA 4IH1A 1VDMA 4L6IA 5KNBH 3D8RA 4EB6A 1PI3A 3K1YA 1FFGA 3ECSA 3AEYA 2Q50A 1DEHA 1W0KD 3RSQA 2W22A 3U61B 1D2GA 2JFGA 4TWAA 1GQYA 2IXGA 3L6BA 2BPOA 2WYUA 4G24A 3HYLA 4N5MA 3FNIA 2OYCA 3TQIA 1O4VA 1PRYA 1TD9A 2NU7B 2VJNA 3BMCB 5BT8A 5J43A 3FOZA 1NUUA 4KDRA 1JDNA 2NZUG 4FGLA 4D4HA 3KVNA 5LQNA 2V7QA 3PHCA 2OXEA 1CF2O 3CUUA 1L4FA 4FNMA 4H7JA 5IBPA 4CRWB 1CF4A 3TTWA 2B8EA 4N65A 1VXRA 3IIEA 1PQUA 1JEYA 2WWXA 4IHJB 4GS5A 3LUDA 3ZLVA 4KW7A 2OUIA 1NQOA 5U9CA 3RD5A 1JP7A 1OGIA 4HGQA 4BVAA 4H7EA 3C24A 1SVOA 5JQGA 5K0CA 3A4LA 3F9RA 2QR2A 4V3BA 4MZXA 5CT9A 4BVBA 1P6UA 2CE7A 2IHBA 2EKQA 3G6WA 2VP3A 3ZZTA 1QMGA 2OB1A 3BXOA 1D1SA 1QUEA 1XFDA 5GJCA 5JSFA 2Q2OA 1ZA1A 3O75A 5EVCA 3AESA 3WJ1A 1G1AA 5FDFA 2WPNA 1BWRA 1M75A 4I6GA 1N0UA 4Q9NA 1J21A 3WHIA 1A9ZA 4EY8A 5KB3A 5FA8A 3KT3A 4KXFB 1T29A 2D5LA 4ZQHA 4EO9A 1G2QA 2ZRNA 4G85A 3EVCA 4BNXA 2FN9A 4IV5A 1EUZA 4PS1A 5DN9A 1F0PA 3DO5A 1E2DA 2EKZA 3L8ZA 2ZIEA 2ENUA 2LNDA 1FTSA 4FCVA 3OQOA 2V1XA 3X0DA 1ZS9A 4TMYA 4WJZA 4N5HX 4C29A 1UFQA 4V0MA 2CXUA 2WPDA 1E1RD 3V5NA 3EXG1 3SJCA 1G8PA 3I04A 4P4SB 3B1JA 3CJQA 2HDHA 3MMNA 4ZOLF 5EXPA 4AZ0A 5T8KA 4IIEA 1GCGA 2BCEA 5BYBA 4DWJA 4Q4DA 2MWMA 4EL5A 2QQEA 1G20B 1YFZA 1NBWB 1AQUA 1XNHA 1Z3IX 3A1NA 4FMCB 1KZ7B 4KP7A 1V5EA 5CX1B 5FTNA 3VZSA 4JT8A 1URPA 3HSKA 5C34B 1VB3A 2ORIA 3WWCA 2RH4A 2JARA 4F86A 1C7EA 1T91A 2AG8A 2YYAA 4DTCA 3PUWA 4X1OA 3AU9A 1B7GO 3HVRA 3QXSA 4R1NA 3HXOA 1J42A 3EA4A 1AMOA 2UVDA 3TVYA 4JXJA 4GX5A 4XX0B 4P4UA 2J4CA 3JARA 4RV4A 2WWYA 1K7CA 3Q12A 4KO2S 3PQFA 4WLUA 3STYA 5COAA 3TAUA 3H5LA 3QLVA 2UUPA 1IJFA 2W58A 3A3OA 2Z5LA 2XCQA 3BDIA 1YTLA 3CB2A 3LVQE 1UPUA 2IIQA 4FHFA 3U7QA 1TM1E 1TB4A 3U6KA 2H1OA 1U0JA 3DBVO 4KJZA 4MDHA 4DR1B 3HLYA 3DCYA 3PXEA 1YHYA 3W0LB 3JQ7B 3GG9A 3N28A 1ZU4A 4M76B 3EGXA 4JUCA 1PBTA 4FMBB 3K9FC 3N8DA 1VMEA 2HU2A 3DUWA 1YCDA 4G5FA 4KHZA 3AL3A 3MK31 1GPJA 4KQ6A 2J9RA 3WDSA 4B48A 1GTSA 1EWVA 2COKA 4K46A 2Q6VA 4D41A 2Z2IA 1TKCA 1P1JA 1OYOA 1C4XA 3U5TA 2D5AA 2UVQA 3B3GA 4GUAA 5GZ1A 8ATCA 2BH2A 2B8TA 5FTJA 1QTNA 1YWGO 1QCCA 3QOWA 4GPD1 2PUBA 1AXGA 3TSCA 1VCOA 1W4CA 4CR8A 1IRIA 4PZUA 4P4NA 4CKBB 4LDRA 1UP7A 3K0HA 1E62A 3ISVA 2FTKE 4ROTA 2C98A 1E3TA 3RS3A 2A1UB 2EIHA 1PL0A 2QU8A 4HDKA 3SZUA 1C1XB 4XH9B 1VI2A 4D6XA 1SIOA 5KYYB 4HWSA 3PX3A 4XUGB 5DNEA 1XLTC 1U1CA 3CPEA 2WHPA 3IUMA 3FBGA 1G3MA 3ND6A 4RHXA 4UVHA 3NBUA 1NLUA 4IINA 2WG2A 2RG1A 5TQ0A 4X1YA 5DH9A 4A6XA 4AJLA 3NTOA 4KC0A 4G41A 4CMBA 1W4BA 3OU7A 1EDBA 3GUYA 3HB9A 4RVOA 1I4WA 5EP1A 4CJXA 4DREA 1KOGA 2Q29A 3DT6A 2CBZA 3QITA 1DBPA 2J7KA 2QD3A 3L8CA 1HY3A 4BVKA 5JCOC 1NW6A 5CEFA 1KQFA 3QU2A 3RAPR 3KPUA 4W63A 4B09A 5A4AA 1T9ZA 4XQEA 3TH5A 1X70A 2OBMA 2R1VA 4LHXA 4YASA 3UK0A 3OZGA 3GEIA 5A3RA 1BVUA 4MI9A 1DNPA 2YV2A 4X84A 1TK3A 3KYJB 1WR8A 2ZYDA 5G1OA 4BQIA 4M53A 5HJ5A 3MJDA 4RD2A 4BPRA 4RY9A 5DDIP 2N46A 2ONZA 4I55F 1T8SA 3T7DA 5JISA 4ENWA 5JLAA 5JAPA 3PVZA 3V6MA 3GU3A 4LHEA 5DHPA 5L8VA 4OL9A 3WAGA 5K0EA 2ZJ5A 1UDXA 1CD5A 1ECCA 5FLXA 1H23A 4BMVA 3DCNA 3B78A 3ONFA 3KXIA 4PYOA 3TAHA 4REQB 2C3OA 5IHPA 2IZZA 1E9RA 2G7MC 2M6KA 1UBFA 3KSMA 3MRVA 4FYIA 3GF4A 4PZPA 3VTZA 3LUPA 4BKPA 1LLQA 4B3HA 3JQBA 5GV8A 2PH3A 1K8RA 1XLVA 2C8KA 2P4HX 4H9GA 4I1YA 4ZAZA 1T9GS 2XCLA 4XX1A 5JVDF 2Q5QA 2NO7A 5SZKB 2ZDGA 3V2GA 4DMMA 2CXTA 1AMNA 1NMEA 5CT6A 1YI8A 2NV6A 2C7BA 1EZ1A 1TD1A 2J9YB 2SKDA 1T1EA 1U9IA 3OJLA 4JV5B 3HVJA 4DIDA 2D62A 4PNZA 1UZMA 1G3IA 1Z8HA 2C82A 1C3LA 2DC1A 2IKSA 3QMMA 2V4UA 2B99A 4WL0A 3LC0A 4PNEA 1JAYA 3E3LA 3QE3A 3B2EA 2QZ4A 5DIZA 4URFA 5A7HA 2ET6A 1I0ZA 3DTVB 3OX1A 4NCXA 3UC5A 2RKWA 3DZFA 4PQYA 4ZT3A 3T12A 4A23A 1X7DA 3SOPA 4C4SA 3SM9A 5COBA 2AUTA 3PCXA 4LXXA 3PGJA 1Z7GA 1ONOA 5JCJA 4O02B 3C3YA 2CDNA 4LJ6A 1R12A 1UZLA 1Y5IA 3C41J 3FXAA 3ZPXA 4UCFA 1OW3B 4WSOA 5FBHA 1I3MA 4OL0A 3Q40A 4TWBA 5L3QB 1EP1B 1GA1A 2ACWA 4RPLA 3ONDA 5JNLA 1GPKA 1FP7A 2NO5A 1A8UA 1FNSA 1ZN8A 3EG9A 4LYJA 4PO9A 2A59A 1MKYA 5EHQA 3V3KA 4JWTA 3PQ8A 1MGPA 4G07A 1P4RA 5DLDA 4L0CA 4NU8X 3G8CA 4PIPA 3NHMA 5BWCA 1KIFA 1NT4A 3OZSA 1HORA 3VH4A 5LOVF 2W6JA 1T36B 3ZU5A 2XWQA 3WA6A 1XALA 1MJHA 1LVGA 4KFRA 3HCOA 4AF8A 3P4XA 1A1VA 1MJGA 4I1UA 4GRDA 5EWJA 5HILA 2P8JA 2VDUE 3W3AA 4N3AA 3CT6A 5K8TA 4WERA 4IX1A 2WJIA 3P96A 2VF7A 2X9LA 1A5AB 1QRAA 1RKUA 4RFSA 4O4JF 2ZQYA 3VAYA 2IELA 3DYVA 4WVLA 4B3FX 3OF5A 4F11A 1D0IA 1E6MA 1LS1A 2XWSA 1U3WA 2ILVA 5G0UA 4GLJA 2NUPA 1YNSA 3F78A 3HKBA 4MV8A 1A72A 4LY0A 1FSSA 1EH5A 2DGDA 3KWLA 4GX0A 3TTYA 2CFRA 3IE2A 3JYHA 2O6LA 3AR2A 3QMVA 1VL0A 4I4CA 5GJVC 3T99A 4BP3A 4QM7A 2Z4SA 2C2BA 5L53A 3AI1A 2FZLA 1P2BA 2LDXA 1DZ3A 4MJXA 3RASA 2I66A 3TEFA 2Y1EA 3NKLA 4YY3B 4OFXA 1UKCA 2B92A 4Y8VA 1VFNA 1NXVA 3I2IA 1SHUX 5AO9A 3WNCA 2PQMA 3DCJA 4WPGA 4QGHA 4D7AA 1R0WA 4D9KA 1FFYA 1RRVA 2DCUA 3RUCA 4DJEC 5JD5A 4RDCA 4F5ZA 2EEPA 3L1IA 2LKCA 4BIIA 1HFEL 2JFVA 3P9PA 4KR9A 4HP8A 1GUBA 2PSJA 1X74A 3SQOA 1G6KA 3NEYA 4N9QA 3WLTA 1IM2A 3Q0EA 4IVPA 2Q0HA 4BMYA 3H18A 1SXJB 3ETCA 5CTJA 4BCBA 4QT0A 3CPJB 4R54A 4YREA 3A28A 3MUEA 2QDKA 1OZFA 1BJTA 1AKQA 4QEDA 3M3DA 1IUKA 3AP3A 1I33A 3GH3A 2HDOA 1BZYA 2XUQA 2GA9A 3V8QA 2XW6A 3AR9A 3HFRA 2E89A 2FN7A 3K4PA 1XKTA 4DABA 3HGTA 1G19A 2VH2A 3CV3A 3HVKA 4IG9A 4MAMA 1WVGA 3V1UA 4LF7B 1RSZA 4HGZA 5E2AA 2XUPA 2VJMA 4OXRA 1C4WA 2QZZA 2F43A 5EFZA 5JG7A 5FOXA 2J5KA 3UAGA 2EJVA 2HV8A 4OKNA 3W8FA 4DLBA 1QGDA 4JWKA 2A3NA 4LBZA 1NY5A 1IWPB 2VKTA 4QDJA 4C4AA 5A4DA 1V4BA 3SNKA 2VQ3A 3GY0A 1FFDA 2FKAA 3TMKA 3LM8A 3FWYA 1GVHA 4BZXA 1E7SA 4HQKA 5EHNA 3K1ZA 2Q4EA 5C0OE 1A7AA 1FNNA 1M1ZA 4AROA 4AY4A 1UBKS 4PNHA 2OR3A 4W1PA 4FGZA 2FMHA 5CBKA 3R5HA 2XNDA 5DM60 5BSGA 1Z36A 4YX9A 5E9JA 1NVMB 3ND8A 3WLAA 4BEJA 1THGA 4PFQA 3RUAA 1CUGA 2WWGA 1ZVMA 5KNBA 1IB6A 2ZRCA 3CEAA 4IDAA 1WHTA 4ENQA 2AR7A 2OQIA 5DSXA 4MIYA 4D56A 4OJTA 1BFDA 1BDMA 1J23A 2PKEA 3K71B 3MUOA 4TKMA 2NYRA 1TW2A 2GPAA 5B2EA 4JZYA 3KVVA 1IPFA 3DR3A 3QVWA 3PUHA 1OCEA 1SBTA 1Y1KE 2J8ZA 3F74A 1DRWA 3LQQA 1U9CA 1Z2OX 4AYXA 4POOA 3PS9A 5EY5B 2IW3A 3L7MA 1QYCA 4KB5A 4C7MA 3KKEA 1G8HA 5EJ4A 1XLUA 1FLAA 4C78A 1ZK2A 4CM9A 1VIAA 2CLOB 2JJQA 3CLTD 1CDDA 3QFFA 1D2EA 4IJUA 2CJWA 6LDHA 2ASVA 4RQTA 2VPPA 2QX6A 1L5RA 3ZVLA 3UEOA 2JW5A 3PEUA 1EFHA 1O9HA 1YCFA 4Y1RA 5D7NA 2Q46A 3C4JA 3T35A 4W1SA 4YEDA 2IL1A 3IOBA 3TIXB 4EATA 1PG5A 3EY4A 3OM1A 4MLPA 1PJSA 3EW9A 3AERB 2V6GA 1JJFA 1ZNQO 4ZYWA 1ECFA 1MO6A 1WU7A 2CUNA 1FTQA 4ACBA 2Q5JA 2WIJA 4LISA 3TN7A 3MWKA 3IVMA 2OA0A 3RIHA 2H9YA 1XO1A 2AX3A 4DLTA 3X1XA 2VI5A 3RV4A 3W6ZA 2GZAA 4QNMA 4TMTA 3FCXA 1QVAA 3GCDA 4JIGA 5HF9A 4B8WA 2ZVDA 4GYJA 4FB5A 3D4BA 3AOEA 3DFIA 4KKXB 2NXWA 2X9QA 3KOXA 5BP7A 2K2QB 2E4WA 1T1RA 3OKAA 5B1YA 2Z5GA 3OIUA 4C5CA 1F6BA 1W6UA 4FFBA 2J3QA 4AYWA 3FB4A 3KZKA 4RM2A 5LQJA 4EUNA 1MQ9A 1G8JA 1JQJC 4H3SA 4MQBA 3IVGA 4OJYA 4U4AA 1EFVB 2QR5A 2BKXA 2Y1GA 3TQSA 2X7HA 4NNOA 2JAUA 3OLZA 3C15C 1QJ4A 1Z0ZA 4YUZA 5B36A 5BR8B 4KQCA 5KREA 1P5ZB 2C7GA 4FYYA 1XZQA 4G26A 1IK4A 1LTQA 1QIMA 1U8FO 2JS7A 4B34A 1ZIXA 2J85A 5C8VA 3T9BA 5KYTA 1GZ3A 1QH0A 3O4HA 4LQCA 3LDFA 2W4MA 1K6MA 5DT2A 2IUFA 2OM6A 3LPMA 1U0HC 5AUPB 2AFIE 1BOFA 2YVUA 1NSYA 2XY4A 2Y66A 3IP1A 3EEFA 4UFOA 4B3DA 1RVV1 3MUFA 821PA 5LQRA 1Q19A 1XZEA 4LVNA 5EWLB 3MAAC 4I4TA 1TA4A 5BNWA 3TL2A 1Z2EA 1NQXA 3FTCA 4YMSA 5BSEA 3TOVA 3NB0A 4ER0A 5C32A 3QEKA 1GTRA 1H3EA 2Q1UA 2Q6OA 2PRJA 1Q1BA 1DO2A 3HDYA 4Y9TA 2WJWA 4UPEA 4I1PA 1HURA 4HDCA 1QF9A 1MP0A 1CYDA 1N2BA 1VSBA 2G70A 2AZDA 2FSHA 2XVMA 5AICA 5KBYA 3MTEA 4D99A 3AW9A 3C3AA 4PTYA 1Y5LA 4FKBA 3ZR4B 5IVDA 4KXQA 3KB8A 2JFPA 1SUBA 4JI7B 4DR4B 1EVLA 1FSZA 1NF8A 2Y77A 3ZUPA 4Z1OA 4YQFA 5CCBA 1K63A 2AQ8A 4RD6A 5L40A 2XUZA 4K8OA 3MXTA 1C9YA 1W5TA 4WN9A 2VS1A 2J0UB 4OOEA 1FVOA 3A0RB 1LSUA 3SZGA 4DC1A 3JYQA 4DMGA 2D5CA 5EIHA 3DO6A 5DM1A 3G5LA 4F9EA 4Q18A 2QN2A 2PU5A 4LF8B 1ST2A 3ESBA 3LQ1A 5CLHA 2QLJA 3TZLA 1EA7A 4NECA 4NDAA 1NXOA 4RCZA 5JCPA 1XQ9A 2QRJA 5MHTA 1E6LA 2DETA 2WTNA 1NF3A 3EIHA 3M81A 1UFRA 3OOSA 3QXHA 3TS1A 2GZ3A 4OK3A 3RRJA 1ZCAA 4ZO4A 1ECPA 1N7GA 2R65A 2CJYA 2A5DA 1FFAA 3G5AA 3IELA 3NO4A 2XMZA 1XQYA 2NUAB 4YJHA 2A0KA 1H2YA 5EE9A 1OXSC 1VBNA 2OO5A 1RWOA 3J80A 5BNTA 1BO6A 4W9MC 4I1RA 4LMRA 3B82A 3HCBA 3OY2A 1R9JA 1G42A 1N5DA 4HLDA 2OOSA 5GQSA 2YMQA 2E1PA 3FNHA 4QBIA 4S1WA 4YRPA 3SGLA 3UMJA 3W6NA 2DR2A 1POWA 2POQX 3BUSA 3CUTA 1JNXX 2ZP1A 3F8SA 3U13A 1ORIA 3K30A 5AVVA 4BWVA 4N18A 4A26A 4E5PA 3VDQA 2WNHA 4ERXA 1V6AA 5BN3A 2GBGA 2HHJA 1IY0A 1T24A 2I1VB 2RGGA 1Z0JA 3Q7RA 5KX5B 1RJWA 2Q5EA 3EPPA 3GLFE 4YRJA 1V47A 3C5CA 1GZ4A 3WRXA 5C8YB 1LBIA 1JG2A 1KJYA 3JD2A 4MDFA 3JD0A 3GROA 5DM4A 1Z5PA 4Q19A 4U2EA 3IURA 3WRVA 1UOPA 1ZMRA 3THYA 1U3FA 2HDNB 4NBWA 3TB4A 1JQAA 5BSFA 2ESRA 3T52A 3FR8A 3WFIA 3M1AA 3GI1A 1CUUA 3TWOA 2OGUA 3C48A 1GILA 2O06A 2QNBA 3EXIA 4TROA 1FY2A 5TNXA 1FMFA 4P7KA 2EX0A 4LF9B 5FO0A 5SY6A 3G7NA 5CCXA 1PW5A 5JNUA 3JAWA 4WZBA 5DM2A 3PPVA 3B13B 4TYMA 4ZCRA 1AF4A 1OAKA 1C4OA 4FFWA 3HU5A 1EM8A 5A1JA 3TSYA 1SKAA 3IQHX 1ENZA 3UW1A 3FHJA 1UKZA 2IZ1A 3Q2OA 1JLRA 4XUEA 4EJ6A 1XPOA 1OLUA 1VE5A 4Z8XA 2PWAA 1JWAB 1U2DC 3HEBA 3L8DA 4LGYA 1BA2A 1WDWB 1YXMA 2RHDA 3CGWA 3OQBA 4CM7A 5KPJA 5FL3A 1QRSA 1PR6A 4RSGA 1IG3A 3H8JA 3RC1A 3TZCA 3L06A 1ORDA 4R1TA 5JZBA 4ZGBA 1OFTA 3ORFA 4XDHA 2FVXA 1M6NA 1YK1A 3MVEA 4INPA 1JG7A 4MUXA 3OJXA 1T4MA 3B6MA 4FFDA 1UK7A 1D6MA 3HBAA 5H0IA 1WOMA 5JZOA 2ZSEA 4FI3C 2R1TA 4LPKA 4C89A 3KUCA 3E6AA 2QRUA 4LECA 4WZAA 4LQDA 5KDLA 1SU8A 5TJHA 5DM70 4AQYB 4JYZA 3ZDQA 3KVYA 3ONVA 5DHAA 5HG0A 1F8FA 2HBQA 2J1LA 1T3ZA 2ZAOA 5K0FA 4AIRA 1KMIY 3RIEA 3JPYA 4KMSA 4QPCA 4MPDA 4NZOA 1UT5A 1ZOPA 2HSEA 4OUKX 1E79A 2AR0A 4TLDA 3W2HA 3ITEA 1HQDA 2IIVA 3NP9A 2D0PB 1Y8RB 5D5QA 5BW4A 1YRWA 4PZDA 3EFHA 3ETLA 3AVUA 2YBEA 4Q4HB 3KHKA 1VBKA 2CUZA 4OAOA 1VP3A 4Z9BA 1XD2A 3BE8A 5G0WA 3FAKA 4EKNB 4FSXA 3TW8B 1KARA 1L5YA 2C4WA 2PYDA 3DE7X 4C4XA 1Z0SA 1ZWLA 1LI4A 2XYPA 3G88A 1C30A 2C7PA 3CZAA 1XZIA 3UOGA 1EBBA 5FB3A 1J2JA 2IYSA 4TVSA 3VYVA 3ICVA 1H8HA 1X9HA 3IUQA 3ZH2A 1Z5VA 1QX4A 4C6HA 2J5QA 1GGJA 1N6OA 4KQKA 1V1MA 5BW8A 5IMSA 5MDHA 2KM1A 3MF4A 3A2MA 4G9EA 4RDIA 2DFNA 4Y6RA 4DR7B 1EDOA 3A3KA 4HCJA 4ZYUA 4LPSA 2G0TA 5A62A 2LW7A 2WP8J 3UH1A 5LPNA 3R24A 1WXIA 2B8NA 2A2ZA 2VDQB 1NDQA 4Q5IA 4KDFA 5CBPA 1KMHA 1VMAA 3W1WA 3KKKA 2F1RA 4DJAA 4DNFA 3N0VA 2CLFB 1OR8A 3B3AA 1NTRA 3NX4A 4GIBA 4URXR 2GXUA 1PX2A 3WX0A 5HRUA 1NMYA 1TJ5A 1EFPA 1LBSA 2MSKA 1NWHA 5EGSA 3U3RA 4Q6BA 2LXNA 2E1RA 3OLCX 1MNAA 1DC4A 1VECA 2H7YA 2VP0A 1M2OB 4KQ9A 4YH1A 5GGXA 3S7TA 3O47A 2P9BA 4JLBA 3A58B 3AQIA 2CLSA 2C54A 4K03A 5ALEA 4UUOA 5ALRA 1DCTA 4K8RB 2Z43A 1M67A 1P8JA 4K3UA 3L5KA 4L5BA 5L3VA 5I7WA 2QJFA 4L75A 4NWIA 3VPSA 3KZOA 2I4IA 1M6WA 1QAQA 1OH6A 4GH5A 1TU0A 3KXKA 3R4VA 3S1AB 5HF5A 3K70D 4TYYA 1CUYA 1Q7CA 1N3LA 3FGZA 3CNOA 1YKSA 4R05A 1FYDA 3OPYB 1PZFA 3TM4A 3TZBA 3BICA 1YE8A 3KOUA 3IL2A 5DSZA 4P86A 2PBFA 2JBAA 3EIFA 5AW0A 1G8AA 3H1TA 4L5IA 4X24A 4Z0HO 2ZI3A 4ZI7B 2VQDA 3ZE9A 1KYQA 1SJ9A 3E4DA 1NRJB 5FADA 2Z9DA 3EGDB 4YRTA 4MUGA 3DWIA 1PR3A 3ZKAA 4DBLC 4UFNA 3HBFA 2AK2A 4BX2A 4QODA 1YKGA 2WDZA 2VLIA 3BTOA 1ZUD1 1AQIA 2HA7A 2SCUB 4M7RA 2RHOA 3N6XA 3SC2B 5F2EA 2BEWB 3U1VA 2DLCX 4TQ9A 1MOZA 2IHJA 3OBIA 4MKZA 1Z12A 3F7MA 4KAAA 5DNAA 1YTUA 4YR7A 5EHZA 3H5AA 1WY7A 4YLEA 3DDZX 4BFLA 3ZD7A 3UMRA 1E3SA 2Z30A 4XTRA 1JF8A 5AD1A 4W5TA 2JEZA 1M7HA 3HCDA 5JBNA 2K2WA 5DU2A 3F5QA 2J9XB 3NQ41 4QUDA 5K05A 4KPYA 1G3UA 2UYQA 3ZNNA 1JI0A 3RR2A 4B47A 1Y80A 3CVUA 2IYYA 4Q3CA 4ZALA 4NKRA 4RCYA 4X00A 3EXEA 3K8ZA 1XWFA 2RHRA 2YASA 3K05A 5DXAA 4HFRA 2YDXA 2ZRBA 2RH5A 1AZLA 3F1LA 3LXXA 5AK5A 4JKIA 3JQQA 2CCKA 3OCVA 4JVOA 2GN2A 4QPJC 2AN1A 3I9FA 2Q41A 1ND6A 1WBBA 5IXSA 4O8CA 4XPZA 3BULA 3SICE 2VF4X 3SQDA 2UUCB 3B1KA 1MN6A 2WFZA 1K5HA 2X42A 3L49A 4PS0A 2AW5A 1P80A 2B4KA 2XKAA 3AT1A 3IUEA 3IUJA 3PUXA 4LZJA 4MVJI 3VU8A 2XRFA 1JHOA 3NW9A 4EG1A 2XVXA 3NDRA 2PJRA 2FFHA 5P21A 1G5RA 4ZZIA 3MS2A 2WF6A 2IU6A 2Q1SA 3FMPB 4P8RA 1PL6A 1V3QE 3NONA 1JBQA 3PDUA 3SQXA 1WXDA 4QULA 1U28A 3UT5A 1PDVA 1I14A 1XTJA 3V1YA 4GMKA 3DZCA 2Q5IA 1BD3A 5AESA 4JMLA 8AT1A 1JPUA 1KP9A 3K3PA 3NPAA 4UDXX 2PGAA 2PO5A 3KCNA 4P6VF 4RY8A 4EG7A 1QHGA 1Q20A 3DBHA 2JLVA 4NSNA 1XU7A 4NBVA 1Y5RA 2ZBUA 1DI0A 3DUFA 1GKYA 3K72B 1WAMA 3CFYA 1P73A 1E2KA 3ILVA 4R2IA 5F1OA 1ODFA 1C9EA 1NJ6A 1ZMBA 4EG6A 2ZUEA 3HB7A 2RARA 3L0IB 5FA5A 4V2UA 3VTAA 1XQ1A 2XGJA 1THMA 5LDDC 5B1SA 3ZH9B 2C94A 3LZDA 2NSYA 4D4GA 1CYEA 2I1QA 2OHIA 2VDOB 4OH1A 5E1DA 2W2TA 4Q6WA 3DOHA 3QEBZ 3R3XA 4OQNA 3O4GA 3SSNA 5JUWA 1T2AA 2VSOA 5DYWA 5IH3A 2OQVA 4L8FA 4D9BA 5F35A 3I9NA 1UMBB 1QC5A 2J33A 1BMQA 2VDWA 4O0MA 3UK2A 3MWEB 4BLRA 4YMLA 2OL4A 3PUIA 4X6XA 3W2IA 2PT9A 4KK4A 4ZV7A 3W4JA 2QROA 3WI7A 5CPFA 4B32A 4CMJA 1CHNA 4HNVA 4IVQA 2D13A 1RI1A 2IIBA 3I9JA 3JV7A 4KAJA 1EWQA 1PT8A 2QJWA 2ZUDA 3IUYA 5ERXA 2F9LA 4WI1A 4DJTA 3LXUX 2FPGB 2XITA 1YV9A 3IT1A 3DLPX 5HIAA 2BC9A 2X4IA 3VAZA 4ARVA 1JEQB 2FSPA 2XZDA 3KFVA 3I6ZA 5DNVA 1IDOA 1F38A 5H83A 5T4HA 3EQ7A 4MKIA 4K2HA 3WBJA 4NZYA 1ANKA 1E99A 2IDJA 4MP3A 4B75A 5K0ZA 5EESA 4ZTZB 3TNJA 1D9ZA 1HSZA 4ZN6A 3TW6A 4RK7A 4GVXA 1DAGA 5FHRA 1YZNA 2H92A 4H15A 4A16A 4LDQA 3H99A 3GEEA 3T9AA 4NULA 3VX3A 4EQ6B 1WXHA 2FX2A 1KIMA 2GDZA 4B6SA 1VLLA 4YP0A 2ADOA 3GMTA 5IASA 4URHA 3CA8A 1B2LA 2G5CA 1WE2A 1KDVA 3OCUA 2N47A 4GYKA 4UDYX 1C9JA 1VHTA 4JBXA 4URZR 2OCKA 3BE4A 3E61A 4II3A 1OV4A 1UF9A 4CTNA 3I76A 3E9MA 4KUHA 4EP1A 3D4LA 3AR4A 5HR5A 1GIAA 3TFQA 2YN0A 5LBUA 3IOYA 4GPZA 1A8PA 1SBYA 3OZVA 3V4SA 4FZRA 2OV8A 5EQJB 4HMOA 2G0NA 1W2HA 2CKDA 2ZE5A 2AIRA 1W0JA 1O89A 1YC2A 3H8SA 5HPYB 3U37A 3U4MA 2QW1A 4QKQA 5HGXA 5EE3A 4A03A 1Q1QA 5DBIA 3RU9A 5JXGA 1JSZA 3OO0A 4FI3F 3WKDA 4J07A 2YFQA 3GT0A 3IO3A 4ESEA 2AUMA 1Z18A 2WVHA 4PTZA 1X1SA 4C06A 1A1SA 3F67A 5JNRA 5K6AC 1F5NA 1KR2A 2YJ6A 2G5GX 4OLFA 1SXPA 1S1MA 2RAUA 3HDTA 3WGZA 4E5DA 3F4BA 2XMQA 2YY5A 4FZJA 2WRZA 5CLIA 3K73O 3WK6A 4MYHA 1YQ9A 4NARA 4C4YA 4NXNB 2PCLA 4F96A 4OXNA 4WGGA 4MW7A 4HQNA 4O4HA 4TRRA 1COWA 2JIZD 2PMEA 1QZ3A 1J0DA 1J9EA 3CE6A 3OZFA 4P34A 4R9RA 3KE9A 3PC8C 1U0TA 5FWNA 3T1OA 1JECA 1YKFA 3WIEA 5IJZA 1I7DA 3QUBA 5TMEA 1YRBA 4YXWD 3JSAA 5D3QA 3QPAA 5JSZA 2JLZA 5DWDA 1UUFA 1Z9BA 2E4UA 1B1CA 1M1YA 4BQOA 1Q3TA 1EDDA 1X7WA 3JVEA 4GSYA 1L0BA 3DEIA 4U5XA 3IJRA 3O9MA 3EBOA 2BGTA 3TO5A 2ZB4A 2RAFA 3LX8A 4LHWA 3FMOB 3L8FA 1EFRD 4NYMR 1E2QA 3FPJA 3TDNA 2BTEA 4HNGA 4I5DA 4CMIA 5JPDA 1HETA 5E7IA 5KU1A 2XODA 1IFXA 4TUYF 4OMCA 3SBEA 5KSPA 1WO8A 1Z88A 3AR5A 3G82C 5CA1B 4FEEA 4CKZA 1V7CA 2EHDA 3LBFA 3WNBA 1JIJA 3WBKA 1N6IA 3R5TA 3PPIA 4I8XA 4D2IA 4DNOA 3K92A 2WKWA 2A0YA 2QRKA 2RI6A 5CJJA 5EIBC 3E1KA 3LBIA 1Y7HA 3ZDYB 4OHBA 3S68A 2ZUBA 4Z4IA 1QP7A 3USCS 3FRJA 4WEOA 5LBIA 3PTZA 2AK3A 2P6OA 2VPQA 2SNIE 3IDOA 3WGOA 5EZYB 3FOEC 3D3KA 4CZ2A 5HHTA 4J43A 3QNMA 2I3BA 3LH5A 3WRYA 4OB7A 2RDMA 4K88A 4BFUA 4BWFB 2AN5A 4ZAYA 1IIRA 2AS0A 2WZQA 4IIFA 3BBLA 3KOOA 1M0TA 4V03A 3D3WA 1VSUA 2W2VA 3OPYI 4EY5A 3GFVA 3H5TA 3K1AA 1PT7A 3LO5A 2QMYA 3PGXA 4L9RA 2C83A 2J6CA 4HPWA 1IEVA 4TYWA 4XJSA 3IQFA 1FNMA 1C0EA 1IULA 4UATA 3GEMA 1KDYA 3RVOA 2NO4A 4YUVA 1GNRA 1T35A 1YR3A 3I6IA 5G41A 5LQSA 3ZVMA 3CG0A 2PWPA 5BSUA 3EH2A 5E6SA 1OTYA 4NDNE 1XEXB 3SU8A 3EOZA 5B4TA 5K6TA 1MOQA 5FUXA 4FGJA 4DPLA 1VKOA 3U1BA 5ALNA 4JAVC 3PIRA 4DQVA 1Y8QA 5L7WA 2FDCA 3QEJA 3DM5A 2FZ5A 2Y27A 3LFTA 1ZZGA 5EC8A 5HUJA 4GKKB 4JOQA 4MW1A 3RROA 1S89A 1L4KA 1E9SA 4A0RA 1Z26A 3FFBA 1I6MA 1M2FA 2G25A 3MBOA 2HA6A 2QAJA 4FT4A 4O33A 4I3HA 3ESYA 3GGSA 3N2GB 2ODPA 5JC8A 4UTVA 2XTNA 2Y1KA 1E7YA 4PCLA 4R2HA 2RI1A 3NCTA 2HPHA 3PWKA 2J31A 4N8SA 4PRYA 5AIBA 3WA7A 3SLKA 5A3JA 1EEHA 1HWYA 2OCBA 4PU0A 5CM9C 4NBLA 5JDCA 2QY9A 4QDXA 4OK6A 4RVUA 3V1TC 1XZ8A 1ESCA 3KPYA 3HWRA 1Y3BE 2XYQA 4K6OA 4Q24A 5TVKA 1W8IA 3T8YA 4DUPA 4QGSA 4JLWA 3MG9A 1OT3A 2X9GA 3H3FA 3L8MA 3LC2O 1O94D 2O9JA 3VISA 4X45A 1EWYA 5I7EA 2WD7B 3S27A 4I81A 4XPIB 3R0ZA 4O4LA 5JAOA 5LIRA 1AOXA 3IALA 2C0PA 1MABB 1JEEA 1BXZA 3M3HA 1P62B 4I50B 1G8MA 1PHPA 1Z7WA 4DSAA 1X86B 3UUWA 1EI9A 2NN3C 1C8LA 2VWGA 3N7TA 1LDEA 4IOKA 5A5EA 1QFYA 3VO1A 2XB8A 2EGGA 3SIPA 3G85A 4DQXA 4MJ3A 1PFVA 3BF8A 3KU4A 2VRWA 5IS2A 4ZVQA 2YHIB 3EUFA 4MR8A 1RD4A 2NP6A 1LXCA 1KDOA 1MC1A 2R6GA 4PXYA 4B3JA 4KFCA 2Y68A 1B76A 1IWOA 3F5MA 2GBLA 2XB4A 4KG7A 2XQKA 3LV8A 4HO1X 2MSWA 3EXHA 4M7OA 4CG0A 3FCYA 2DWQA 3BF7A 3EVDA 4G65A 1QFSA 3QFRA 3WLNA 4E32A 1TAGA 4PSVA 4RDHA 4E11A 5LIPA 4YS6A 3WQBA 3H2ZA 1ZZEA 1S2IA 4XYLA 2EW8A 2C2KA 2RKOA 3V8MA 4CM8A 2DKNA 5I5EA 1SVNA 4LXTA 2PVCA 2O3TA 3R6GA 4L5CA 3B2NA 1YR2A 3W8EA 4YQEA 4PLZA 2RHBA 4BCDA 3EEYA 3OC0A 3Q8XB 1Z4LA 4J1TA 3SEAA 2DSNA 5HZMA 5CCDA 1KOLA 3T94A 3M5WA 4XLTA 2COEA 3HPQA 4M9ZA 2JHPA 2X76A 2V6MA 1Y3HA 3QIVA 4OIFA 5E4FA 1BTOA 4EFDA 2ATIA 1AHHA 2C57A 2A0UA 2JFUA 2WAYA 3ZXSA 4CFZA 4E2XA 1JFRA 1E77A 2O2CA 3BJZA 2NU9B 2CLMB 3STUA 3R2JA 4E5YA 1S96A 2YKGA 1SR8A 2RJOA 4GPIB 5AW3A 4FGSA 4HRXA 5HE8A 1Y6FA 2BTQB 3OECA 2CMKA 1XZJA 4PLFA 2CNNA 4YUWA 1F6DA 5DTJA 4OBEA 1YMQA 5G4KA 3LK7A 1GPLA 2W48A 3TCXB 4BN0A 2C5FA 2C3YA 2IPMA 3VRHA 1L4YA 2HMVA 4YXFA 1R8SA 2XUOA 2NYAA 2PR2A 1NUQA 4KGZA 4P33A 5J4LA 4JP5A 3QVXA 2I6XA 3GNLA 4D1YA 1TYDE 1J1UA 1IVNA 2R11A 2QRMA 4PZYA 4NY1A 2EQ5A 2YHSA 3BMNB 2FZVA 3HFSA 2BGNA 1YUNA 1JFFB 1FFXA 1NXQA 1X15A 5ESRA 3RE1A 5EE0A 4A2QA 1J1ZA 2AYXA 1A4RA 1MTOA 2W6PA 1T0HB 3VPFA 1XZLA 2HM7A 2GKOA 4ZOLA 4BFWA 2WSSA 2C97A 1W2WB 3AHIA 4YCDA 1SY7A 5JQWA 2AXQA 2B7CA 3TPCA 5FF9A 3DXXA 2OC9A 1QRDA 1JB9A 3O21A 4NYJR 5A7FA 3IAAA 1OI2A 2JJYA 3R3YA 4PC2A 1X7ZA 5JI2E 4RIIA 2YRWA 4ZHQF 1A7KA 2QV0A 4C0XA 1KJNA 1Y8AA 3CIFA 1GWNA 1YR8A 2NZVG 4A8JA 2CDAA 4YONB 4E5NA 3EISA 1JA9A 1PV1A 3DDSA 5JXIA 2MSDB 4MPRA 3P0EA 3NBQA 4XDGA 2QQGA 5IJWA 4JOBA 4O2BB 1PSWA 3F6EX 1EXVA 1YL6A 3WYBA 4X44A 3TUJC 2QENA 2BHTA 2F1IA 4GZ3A 3PGKA 1GQRA 5DIFA 4ARZB 4M1KA 1CQIB 1MQAA 3PDIB 1RHKA 5I7VA 1XT6A 2BFDA 3H9QA 2R7MA 1XDUA 3HBLA 2O50A 3L82B 4HLCA 4NICA 4WRRA 1WZUA 1XAHA 2OLKA 2QVXX 3FLMA 1N5KA 1ZA2A 4NZZA 4PQRA 5D2CA 5DW0A 3ZXUB 4EYOA 1A8SA 3VAAA 1JLLA 1GCIA 1DX6A 4FQ7A 1Q12A 4BYGA 4HYYA 1KKMA 4QYIB 1R3UA 3PVCA 4OLJA 1KI4A 2REBA 5HUQA 2O8DB 1QVRA 1MO3A 3INYA 3SP1A 3I72A 2O14A 2UAGA 2CFCA 1CZNA 2FP4B 3A6EA 3P5BA 4OMUA 4NNJA 2JBHA 4RO0A 5KOJB 3EDRA 3K0SA 2FK7A 3CKYA 2J3LA 1DE0A 3SFVA 2DBZA 1QZXA 4WUTA 1U0BB 1QYRA 1SVKA 3HP1A 3M2PA 1RPJA 4ER3A 5B58C 4NBNA 3CLUD 4H1UA 4NABA 4IS2A 5FOTA 1LPSA 3ZBTA 2QEQA 2FETA 3RS0A 2J3DA 4C07A 1P5JA 3GELA 4HLUA 1ZM7A 4PLVA 1T0BA 3WGMA 4RA6B 4CKYA 4XB6B 4WJLA 4MRMA 5F5XA 4F92B 2M6RA 3U3OA 3FSJX 1DCMA 2P79A 1UWKA 1F06A 1XL0A 4RWEA 2X0EA 2X0FA 2KB0A 4BNNA 4JH0A 3ZQ4A 3WV4A 1NUTA 2B6NA 4ARUA 2PZGA 3BGWA 4D45A 1E1CB 2REQA 2YXLA 4HS9A 1P0FA 1AURA 2ZIAA 4LQLA 4DVJA 2WB2A 1NF9A 2JGDB 2RK4A 5IM5A 3ZKWB 3HZOA 3HUDA 4RNCA 3MOSA 4RWZA 5E6UA 5FXMA 4J4BA 2ZQZA 1GQFA 3HADA 4K9QA 3TMAA 2QLLA 3I8OA 3JZAA 5FOUA 3NANA 4MB0A 4TQGA 4JA2A 7MHTA 4ZOAA 5IDQA 3UXEA 3BRSA 3ABIA 3DE4X 4MP8A 1BJRE 5EMJA 1WA5A 1KFCB 1U8TA 3ILSA 4JELA 5CIYA 4TM7A 2WUEA 3RHZA 4FBGA 1ECGA 5FYQA 1TI7A 1DBQA 3M6UA 1CUCA 3NHZA 4I99A 4NCJA 2CVOA 5TF0A 5EYPB 3IEKA 3GFFA 4FFOA 3QVKA 1SULA 2FMTA 1K8QA 1PN3A 2M6LA 2ZIZA 4JQZA 3IFSA 1VKHA 1VQ1A 3NGMA 4K0KB 3G0DA 2VJAA 1RXSA 5SY4A 3VV3A 1VHDA 2FN3A 3CW8X 4X20A 1E59A 1FRFS 1G6Q1 5KTOA 4I55A 3MT8A 1A77A 1UFVA 2W11A 3DMTC 2RGXA 3HG7A 3PHLA 4UCQA 5SYMA 1KJ9A 1IHDA 3AUAA 2B5OA 4MICA 4R1PA 4OH7A 4XVCA 4DB2A 1W25A 1N9KA 1ZC4A 1Q91A 4X41A 1TAUA 1VL2A 3KQSA 3OPVA 5HKKD 3AFMA 4IIDA 4QHSA 4G09A 2PXXA 2QUAA 2Y9PB 2CWDA 2FYTA 5DXFA 3HDHA 4L1KA 5JVDA 2GNAA 4Y6SA 4CLHA 3IDZA 2O20A 1L7PA 3WG9A 4LOHA 4UTXA 4DXHA 1EDZA 3O8OB 4N01A 5FLKA 1Q57A 4RJTA 4DNPA 3MLBA 1PU2A 2D3WA 2CSUA 1U8AA 5JATA 4F7WA 1X1CA 3AUSA 4C21A 4CLDA 1ZRNA 5FUVA 5LM3A 2ID8A 1RI4A 5DF1A 3HV2A 1D2MA 2GASA 1JMYA 3O91A 4F8JA 1DOHA 1K6XA 4DPMA 2PQ0A 3G3EA 1SHLA 3DCIA 5JXWA 4DUZB 1FS6A 3I9MA 3KYBA 2Y92A 4UBIA 5ARCA 4RKRA 2PUAA 4JJEA 3FTFA 3OQ1A 3AILA 2WTBA 1U4SA 4HBZA 1IUNA 4BU0A 3A26A 2YXBA 1CZKA 4EUKA 2PZAA 1OUMA 1XU4A 3GX1A 4UAGA 3HM2A 1OXVA 3H5OA 4YRQA 3BEDA 4U7DA 2KE5A 5HFNA 5M29A 4EJ2A 4ICIA 3OWXA 1E8MA 1XMVA 4JJZA 1DADA 2V3CC 1XTUA 5DGTA 1MU0A 1IZ0A 2RJ3A 3EH1A 3DMDA 2PV0A 1RP7A 2O7VA 3D2LA 2VH1A 3M9WA 5KNLA 4EB0A 2GJ9A 1SM4A 2WJHA 3RAGA 1TAQA 3NYIA 1JIIA 5EPEA 2WJPA 3NBZC 4JZKA 1XL1A 3ER8A 4X8OA 4CIXA 3ENKA 3PXCX 3C5EA 2EERA 4A92A 2UKDA 5LQMA 1ZXXA 1IY2A 1JR3E 2VDNB 3CSUA 3GOHA 2B0CA 2O3JA 1ZN7A 2LDBA 4LWZA 4R9NA 4GZLA 5FRDA 3LWNA 3KB1A 3TEMA 3KBBA 1J1IA 1DIRA 2VTBA 3JVDA 5B4VA 3FTDA 5LOVA 1D4OA 3JASB 5EQTA 1Y42X 3PRKE 4ZVTA 1G16A 2ZWAA 1HTBA 1CQXA 3RI3A 3GDGA 4GI2A 1T10A 4EW2A 1H93A 4EPVA 2EBFX 5LMNB 2ORWA 3QHPA 5JZ9A 2HUPA 5EHGA 1L5NA 1UPBA 2BVNA 2QRNA 2XMBA 4C0QC 3GLIE 1NR5A 1BD4A 2D2VA 3AF6A 3V7WA 1JEAA 1DDGA 4O4JA 4DM7A 3L4BC 3REQA 5TE9A 1CIVA 4QU9A 2IZ5A 3AUJB 5BQOA 4BVEA 5JJLA 1LC3A 5IK2D 1P39A 3A9VA 4KYUA 1PUIA 2R3SA 4WNCA 1FP6A 1E2HA 2PRIA 3M1LA 5ILQA 1WCYA 2FDXA 1QYDA 2FZ4A 1PIWA 2AOXA 3H4TA 4QUBA 2EZ9A 4MIOA 3KOZA 4OJKA 1JDTA 3DAFA 3LYHA 3GZNB 1JKIA 5BQXA 1UJ5A 1Z4QA 3W1EA 3PE3A 4QXAA 4ZZ3A 5CVEA 4EEZA 4IGKA 1QH1A 3BIFA 3W5JA 5HBRA 2G28A 4JY7A 3T7EA 4AMYA 4RH0A 2FCAA 5FT9A 3A6LA 1UC8A 2GK6A 2H7VA 2PTGA 1I4OA 1O9GA 2PT7A 5FBZA 4P36A 3LZCA 3P2EA 4X61A 1C0LA 3KWJA 3PI6A 4N6OA 4MYTA 1JZQA 1XN4A 3CVJA 4X95A 5CIQA 4GP6A 1G4UR 4E2ZA 1AGXA 1RXIA 1X38A 2HKIA 3G9TA 4NIMA 1H8HD 4R1MA 3D59A 5DASA 5IC5A 5AM1A 3IAHA 3DHEA 2HY7A 2HA3A 3TBHA 3SEFA 1PVDA 3SR3A 3ZWAA 1EGHA 3NS7A 3RRXA 3URMA 3A4MA 9LDTA 5TMPA 1RZRA 2G63A 1J33A 2WFAA 2Z2JA 2B36A 3D2CA 2FFJA 2HIMA 4ZYYA 5JADA 5K03A 2FNAA 3U81A 1OI3A 3C16C 3L92A 2XD9A 4ZA2A 4EPTA 1TO2E 2L0XA 3GG2A 3RFTA 5JAIA 4HEJA 2V7TA 3MWDB 4RK0A 2G08A 3FIJA 1TA9A 4Q9DA 2WW8A 4XGNA 1AQYA 1W5SA 3Q7EA 2JCSA 1TM3E 2GS9A 2YHBA 2YQ4A 5JRDS 2P11A 3ENQA 3BERA 4U00A 1EAMA 5JRJA 5M04A 2HI0A 2B5VA 2OZKA 1O97D 2I6QA 2ZIXA 2DFLA 4HGYA 2RAPA 4N39A 3SS7X 2PKCA 1A96A 4L6AA 5IM4F 3E5RA 1ATIA 2GXQA 4J3JA 2XHEA 1DAKA 3DYBA 2D5BA 5LZ8A 1BX1A 2OWEA 2OBYA 2FPIA 4GSLA 1CUIA 3PQDA 1E7QA 4GYYA 1X1BA 4Q82A 2GUWA 4BCCA 5HS4A 4GR9A 5JNTA 5JR3A 4OHYA 4KZKA 3ONNA 4KRYA 2O8BB 1PKEA 1QWSA 4L16A 3WDKA 3BVPA 4ZK2A 1N1EA 1IUPA 3DXFA 1ID8A 1RTKA 3AEQB 3HA3A 3A6DA 4RC9A 4RZXA 4XVQA 3WL3A 1A4IA 1GUAA 2Y0EA 1IY1A 3OEED 2ZYIA 3QENA 4G1VA 3UJ6A 3D7LA 3I1YA 3MWGA 1TJPB 3DYIA 1ZW1A 3E1GA 2BR3A 3HEMA 1K7SN 3MWFA 1KYTA 3PKJA 4I9NA 4M46A 4V39A 1ZOSA 4AJEA 4D9FA 3E0XA 4GKVA 5IAKA 3DL4A 4AYTA 4NESA 4OXYA 5FBWB 4ZTUB 1NVUQ 1UWCA 1QVZA 5H82A 4WHMA 2JIQA 2P7HA 4PYRA 3NVAA 1ZI9A 4LCEA 4KXNA 1WQ3A 1KRHA 5IRCD 4R5MA 2A57A 1ZEMA 1KI2A 2D1RA 3K0AA 1EINA 2AOUA 5C2JB 3NM4A 4V2IA 4OYRA 4M0MA 3RU2A 1V39A 4FEYA 4E4RA 3HDGA 5E3IA 2Q5OA 3KV1A 2ZR9A 3NUZA 2P6RA 5DHFA 3RFVA 4GL4A 2X2OA 5CFPA 4JN6B 2CY0A 1CY6A 1XI2A 5H8WA 5KOHB 1X0VA 3RV3A 4EHFA 3ZVRA 1MX3A 2E9SA 4O6VA 1WJGA 2GJ8A 1PFUA 4QNRA 5M3BA 1A71A 1OX5A 2J46A 4GMXA 2D06A 3IP7A 1H0KA 1NA5A 2EGHA 3O94A 3P2IA 2CN1A 3DAHA 4TVOA 3RUPA 5BRJA 1MDBA 1DG3A 2R8XA 2XXBA 4JHXA 4I4LA 4KWCA 1I3LA 1E5DA 1WP4A 2BFAA 3JATB 3OZIA 3T1HB 1LLFA 5TX7A 4RVHA 3OQNA 5IAGA 4C6TA 1ETHA 2BLNA 4F6LA 3CURA 4E30A 4WBNF 2OZLA 3R3ZA 2PEZA 1XLTA 3AZQA 2X7XA 1QB7A 5JMTA 3LPAA 3WGLA 2V65A 3WLOA 4PSCA 2BP7A 2H11A 2QE7A 5F73A 1XPJA 2DCMA 2I9PA 5FPYA 1M72A 4IG4A 2OV1A 1H2BA 1Z63A 3H0CA 4Y1EA 1Y3AA 2OHJA 1VKNA 2V9PA 1QQ6A 1NV8A 2QN7A 3ADKA 2A78A 2EG9A 3IO5A 4GT1A 4GX1A 4QQRA 1C7QA 2BKUA 1UDBA 2WB4A 2ZXFA 3A6KA 4UMDA 1EWKA 1FRNA 2R7NA 2ZYVX 3L0BA 3OIDA 2NSLA 2VBCA 5T57A 2R2AA 4YYZA 2ZI5A 1MGOA 1P17A 4DLRA 2SECE 4W5JA 1K5GA 2ZATA 3K9GA 4V0OA 3SMVA 3W6UA 2XCRB 2Q6KA 3KBOA 3L07A 4HLNA 2AV6A 5CAEB 4GVPA 1Q6ZA 4MWZA 2O8EB 1WTCA 1EGAA 4E5UA 4GXNA 3C1UA 1E2GA 4CKCB 4H31A 4Z8YA 2IDMA 1ZNYA 2QE6A 3B5JA 4Q00A 3UOAB 2C4UA 1EP9A 1JHPA 2KJQA 2QW8A 4GECA 4NMMA 5J9FA 1R00A 1UJMA 2WT9A 3B85A 4HATA 3RVNA 4LE2A 4WESB 1XXHB 4WFQA 3LFUA 2PX2A 1XLWA 3N5KA 4UBJA 2HOQA 1M8JA 4KX5A 3TDMA 2QRLA 3ZWKA 2XAUA 4AS2A 1C50A 2AG0A 1P7CA 3R0XA 4NS4A 2EQBA 5CX4A 5DBHX 3R75A 5K0JA 2IPLA 4AUMA 5IPFA 2F48A 3VJKA 4P83A 3L0YA 3TE6A 5JNSA 4IHKA 3GRRA 4YJ2B 3L6RA 1FNBA 3CINA 1AKWA 2FY8A 3M5CA 5TS2A 3ID6C 3H6KA 3KRTA 2R85A 3VOSA 2FZGA 4DC0A 4M1OA 2JJ2D 3ZWQA 1MA0A 4YALA 1PZMA 3QLEA 1G5TA 1D04A 2DQZA 2Z3WA 3GFTA 3TTVA 4O08A 3OE5A 4UFPA 2WOJA 1TPZA 2ZPUA 2G06A 1FFWA 2OSVA 3QKSA 3F96A 3W9BA 4PN7A 3FBTA 2BMWA 4MS1B 4WY2A 4M2LA 3H2KA 2O5CA 5CR9A 3B38A 3UJCA 2CYBA 2GWHA 4BP1A 2Q9UA 1QHYA 3GW8A 1JR3A 1X39A 1XRSB 1U6JA 1R5BA 1KYXA 2C29D 2WJ3A 3V4VB 4CNBA 5ADVA 3RRBA 1V7PC 5K3SA 1PL7A 1MEEA 2GRAA 1DJNA 3L8YA 2R96A 3AVPA 3BTSA 4JASB 5ALOA 5I51A 1IYZA 4IH9A 3SE7A 4RS4A 2B21A 4KFUA 3LDGA 2EFDB 3BCHA 4QJ5A 4R3WA 4Z9XA 3WKBA 2VAXA 3QNWA 1AD2A 1T5LA 1Z5NA 1NQWA 1VGQA 1EVYA 2YJNA 3KS9A 5TS3A 4EB6B 2BF4A 3AKDA 1J2UA 2FW7A 2VSXA 1EWRA 1ORRA 1S0UA 1CNMA 3BB3A 4XDZA 3RS4A 3ETNA 4E88A 4EHLA 3P26A 4XQ9A 1T8UA 2Z3ZA 3SBXA 1DBSA 5IVKA 8OHMA 5T3UA 1JDUA 3MYRA 3RKSA 3B51X 2OO7A 2ADFA 4JITA 3DPIA 4PPGA 1ISPA 2B3TA 2IU3A 3DE0X 3BWMA 5CM8B 1GRVA 2AEFA 1EK2A 1E5LA 16PKA 1YD7A 2AVDA 1ODTC 4M8IA 2JI8A 4BRWA 1AXEA 1NW7A 2Q3CA 4KACA 1NW4A 4AO8A 1NDUA 1I3NA 4UMEA 3ZIAA 4X66B 3QM1A 2P41A 4RU1A 3GPDG 3H9BA 4YN3A 5HIMA 1JEYB 4MVJM 1SVLA 1W47A 5L4SA 3HVIA 1O95D 4ZO7A 3RT7A 3Q0IA 3QYJA 3FSGD 5D3KA 5LVAA 5JQGB 4UM7A 3GQVA 3KV3O 1G98A 1TCAA 4Q4JB 4NK5A 2KBFA 1UPXA 1SG6A 3DNPA 3LT5A 2KX7A 1DAEA 2HXSA 3NH6A 3HB5X 4BKRA 1V45E 4WBSA 4AJ1A 1EUYA 3C7AA 1COWD 3GQBA 3E3AA 3TINA 1O03A 2X0DA 3VR1A 5JH7F 1RC8A 1GPNA 4E03A 3AESB 3VZRA 5IKMA 1KQOA 221PA 3L43A 1J7JA 3L79A 3NAMA 4L72A 3RT9A 1P0QA 3GLHA 3SWWA 3G79A 1SHTX 1BYIA 1V25A 3EC1A 3N2ZB 3OPNA 4J16C 3SX2A 2Z57A 3NYRA 1IBKB 1JE1A 1ZUNA 3ZN2A 2QRZA 1NUHA 3FCSB 1SB8A 4LRTB 1WB6A 2RG7A 3FNRA 2ECQA 5CDSA 1QUFA 2AG1A 1W4AA 4ARAA 2J9FA 5CW1A 5IYZB 1U2GC 3AUFA 3M5PA 4CQMB 3IPCA 2AOTB 2VK8A 2EQAA 2PXAA 3DFFA 4LKOA 3L18A 4MUNA 2X58A 4PG4A 5GONF 4AB1A 4D6PA 3VPGA 3G2OA 3OURA 3DTNA 1BIFA 1LSOA 3LRPA 1SD2A 2YJ5A 1NG1A 1PE0A 2GHRA 3LWZA 3IR5A 3CPSA 4G8DA 5FBLB 3GL9A 3K6SA 2AD1A 2V9CA 4HDMA 4U7PB 1KPIA 3LOUA 1JAIA 1O6GA 1BXKA 3SMQA 1S2LA 2ZE7A 5HM8A 3B6JA 3NJ4A 5E38A 2G9VA 1MA3A 1U3GA 4EHJA 3L0PA 1EU1A 4HQOA 2OHVA 4N3CA 4LZWA 4CCYA 5AVSA 2HF8A 3OUTA 1DC6A 2PA3A 3A6PC 4FLEA 4G0VA 2CJFA 2X3UA 1Y89A 4NNPA 3TFWA 5GVSA 1P5FA 5BY2A 5CLGA 3LWDA 4ZVLA 121PA 4I5EA 3A3NA 3FDJA 4EF4A 5FL7D 5T3YA 1RZUA 4OU4A 4RF4A 1PSZA 4IJMA 4D8UA 3BAZA 4HAVA 4EEXA 1E2BA 1ISFA 3U7QB 2X23A 4NYIR 4ZKEA 3ST7A 4G0ZA 5AJTA 4UZSA 2CXSA 3C3JA 2WSYB 5TC4A 1QFZA 5B6IA 5AW1A 5L4NA 5KMGA 3EGXB 1T2VA 1I10A 2BFPA 4V1CA 5MN5A 1XVAA 1VPDA 1MW9X 4YT4A 3EVAA 1SGWA 1CUWA 3H13A 4K05A 3TJMA 1QP0A 3S0JA 2LVBA 4HEQA 1ZEJA 3EWNA 5K4HA 3EVTA 3HCPA 3ODGA 3R7LA 4BLQA 1V7QA 4P3KA 4TXMA 2H5IA 3FUVA 3HXTA 4OGLA 4UQPA 1C9NA 1Z7BA 4PE5B 2P9YA 3EZ6A 1RAHA 1W4ZA 3H1GA 4TWJA 1TJ4A 3BWBA 5AVOA 4ZO9A 5KKAA 4XRGA 5IANA 1YDHA 3MZ0A 1Q11A 5DI3A 3KVRA 2XX3A 3AEZA 1PFYA 3D3QA 3P2MA 3Q7IA 4MGHA 5AM4A 5G0SA 5SY9A 1FYVA 4X3CA 4MCAA 4MW0A 4J3FA 4F4FA 4ECEA 2XQGA 3IPLA 3S1LA 3FZQA 3EXAA 4N0MA 4NMHA 4NH0A 2P4SA 1TOAA 2XQJA 1E3EA 1M8KA 1X7GA 2F4NA 3I32A 2EKDA 1VE6A 1NVXQ 2HK8A 2OCGA 1ZD8A 2QUKA 5C9ZA 4K9PA 5HM6A 5ITZA 1A2BA 2YYYA 5TQ0B 4W8OA 4X1YB 4DLZA 4YAUA 1WZNA 4DV3B 4TMFA 3Q3GE 5FI5A 1BGXT 2B78A 2GAIA 4Z0PA 3IAFA 2Y71A 2J6BA 2ZITA 3VVMA 3ENWA 1QK4A 2ZRGA 3CF6R 3SXUA 1YACA 3BREA 1ENYA 1O77A 3FLBA 5LD2C 1JFTA 2HIHA 8ABPA 3FUXA 4M37A 3A70A 4MGEA 2R1VB 4N7BA 2OHXA 1HNXB 1LQ2A 4L07A 1ZJ4A 1QRTA 3E0QA 4BLWA 4TZ0A 1U7XA 1TNDA 2E4YA 3ZD6A 4FTWA 3ZHTA 5A06A 3Q41A 3NJ8A 3LS2A 4BNIA 2QNIA 4EI8A 4ETWA 4LOKA 1CW2B 4W5QA 4R9SA 4E2FA 3I4CA 1HYQA 1ZINA 1SN7A 3N5CA 3NALA 2YC4C 3UV6A 2Q3MA 4RJ2A 2WK1A 2Z6UA 1DDIA 3UMSA 4X1KA 3RJZA 4AG6A 1U1GA 3PK0A 1ZLXA 3K32A 1A9OA 2W2QA 4N6GA 1L9KA 2AXPA 1AN0A 5ALJA 1E3DA 2K7FA 3E27A 5FNVF 1M74A 5CDYA 1Y34E 2TMGA 1UBOS 3PC3A 1LBTA 4BO3A 2B30A 3B9BA 1UBLS 3DE3X 4FS8A 4Y2QA 4C08A 4GEGA 1U65A 2QM0A 3M33A 3P0RA 4KMOA 2PSSA 1BHQ1 4RQAA 4UVEA 2HLPA 2DPMA 4Y2HA 4HOYA 3ZGVA 1JHVA 2FWAA 3CZCA 3F6SA 4JLOA 1YL5A 5BMOA 3E9RA 4EENA 3SJUA 3SKXA 2EATA 1J90A 2O8NA 5CVDA 3IV7A 4LTDA 4WXHA 2MT9A 2ZB2A 3QE4A 4N5DA 4UXJA 5LP6C 3V8BA 3TRJA 4YMVA 1WVMA 4MEJA 4PGHA 4B82A 3R41A 4ENUA 4PZ0A 4KMMA 3NYQA 3QUQA 1W88A 2XE8A 4PC1A 3HH8A 1I1NA 5A4MS 3A6JA 2Q4RA 4J7AA 4WDQA 4HQLA 5CVTA 3ZHXA 1UDCA 1OOEA 2Q9BA 5J5AA 3BZBA 4PO8A 3D4IA 4ARSA 3PQ3A 2NWQA 3ND5A 4MCHA 3A9WA 1Z62A 3PUYA 4KYTA 4TVBA 2C7OA 2IQ5A 1YZGA 1GTMA 3SYMA 1SKQA 4XWOA 3PENA 3OKPA 2H1SA 5GP1A 4ESVA 4B45A 3T3EA 2HRBA 4FIZA 4RIHA 2F8TA 3RW9A 3FMIA 1EDEA 1SHKA 3PWSA 4JBIA 4OFZA 1M54A 2GCIA 3K9LA 3KX2A 3OQ6A 2AA3A 2GEVA 3A37A 3CISA 3D4NA 4U0JA 1HTWA 1K2WA 1DC5A 2XUJA 3BEOA 4R2KA 2ZVPX 4DW8A 4XUCA 5BUQA 3HL0A 4LV5B 2ISSD 1MIOB 2PH5A 1K98A 2O3UA 2A9QA 3U4QA 3RS5A 1SEVA 3P9ZA 3AF1A 4B3MB 2XZLA 3GMDA 2QTMA 2PYIA 1R0SA 3NOXA 1LEHA 3NT4A 3AVVA 4CLOA 2FPUA 3GA0A 1GUYA 3HA7A 2FG5A 5DBGA 3ROKA 3CH5A 2JKYA 3KEFA 4L76A 3AY0A 5JO0A 1R8JA 4PX3A 4RFSB 1Z29A 1YB6A 4R16A 3GOQA 3JSXA 3KUKA 1H05A 3DLIA 3F49S 4I1OA 2YOHA 3T3NA 2Y6VA 1VHQA 4IJQA 2I9KA 1CJKC 4RGQA 2NUPB 3HYSA 5GTDA 3HKBB 2ZRJA 3JCZA 4I1SA 1MAWA 1N3BA 1U9JA 4OATA 4AAYA 2Q6IA 2WF5A 4CG2A 2DFPA 1U5CA 1TE2A 3EF3A 1GEGA 1BGWA 1G63A 1OBOA 2PL3A 3ZWCA 2FR1A 3GCWA 3TFOA 4UE2A 2DFVA 5KSZA 3FJYA 1E2NA 2Z0MA 3BFKA 1MENA 3ANSA 3VNUA 1U9ZA 1TRKA 2DTXA 2EZ4A 4FDVA 1DIGA 1DQPA 2ATXA 3CE9A 1ISHA 1F2UA 3A4TA 3CUKA 3OEHD 2BL4A 1C8VB 2YWDA 4ZWNA 1G6HA 3EQZA 3AG6A 5HFJA 4K1LA 1J5PA 1QVVA 3CZQA 4UTOA 5CU7A 3VGJA 4F8EA 3B9RA 4WLOA 2YC2C 3QXCA 2FPOA 4MYCA 2XQIA 3FPEA 1K2VN 1LH0A 3SHVA 1I6KA 3VR2D 4GLBA 3OKFA 2HLNA 1CEEA 3E2IA 4S24A 1NVGA 3D6FA 2Q5HA 2ZYSA 4PAGA 5EN4A 4BNKA 5BR4A 3NV9A 4R1QA 5C31A 1ZH0A 3TPZA 1RI5A 1SOVA 1JG3A 3CZ9A 3Q6MA 4TS4A 4BUJA 1DFHA 3EULA 4H4CA 3NBMA 1ZWKA 3UJAA 2I3AA 3AJRA 4D4LA 2VH5R 2R6HA 3N39C 2DHDA 1ZNXA 3IE0A 2JIPA 5BN5B 1ISGA 2PSFA 1XKQA 5C5DA 8LDHA 2YH2A 4QUJA 2JGNA 1GY8A 4D4MA 2EJBA 3SNHA 3JY6A 1DUSA 2LBPA 2IE8A 1LPNA 4QDUA 5AW4A 3LY9A 4NE2A 2XMDA 3RFFA 4B8YA 3OQMA 1Z16A 2FG7C 2F43B 2WG1A 4RSHA 5AHRA 5DYYA 2C3MA 5FPHA 1GLGA 1U2DA 1KWGA 3D31A 4ZVVA 1W36D 2ZUCA 1WXEA 1XJWA 3UM9A 3GFRA 2EWMA 4OFBA 1QRRA 1JIXA 2ZJBA 3U7JA 5B2FA 2IXEA 4YFVA 4GBED 1ODCA 3AEUA 4IEEA 2VLBA 1CLUA 1IEQA 1L7AA 2RGDA 2X19A 2ZJAA 3K6JA 4ZCLA 2X0KA 5DULA 2Y9MB 3RRYA 2O1EA 1J2EA 2G1JA 3MT9A 3QMWA 3GO4A 3C1OA 5HF8A 521PA 2QD4A 4IQ8A 3S2SA 4CV2A 5KIAA 1WDTA 4TXJA 2GYWA 3P32A 3OWOA 4CL3A 3DWFA 1DEOA 2P91A 1F0NA 2I2WA 4X85A 4YO7A 2R9VA 3TEJA 3RUIA 1CZHA 1I2BA 1QTIA 1FX0A 5CVJA 4JQSA 4UOZA 3LPLA 2FWMX 4ZDWA 3T7SA 4DUGA 4AK9A 3R9XB 1K0FA 1X19A 2WIGA 3GNQA 1Y37A 4EHNA 2JFHA 4OJQA 4BFSA 4ZICA 3KR1A 5B7QA 1GKLA 1M5UA 1XKLA 2HEGA 4B33A 1R0LA 3UKDA 3ZU2A 2FF5A 3ZI0A 4BC0A 5D1NA 3SFTA 1X7HA 2PKYX 3F98A 3JQAA 4IXTA 4DLWA 4ZVPA 4QPDA 3N7AA 4KVGA 2V0GA 1VMIA 3BXPA 5DN6A 1PNVA 4RZ2A 4IP0A 4JOSA 4MUAA 5AXCA 3W6OA 3Q5GA 3PITA 3L3BA 2B1IA 1N0IA 3UK1A 3WXBA 4BX3A 3STTA 3QPCA 3ECAA 4HF7A 2CD9A 3DQPA 3NETA 1YR1A 2CJWB 3BIXA 4BO4A 2GEJA 4CWAA 4MUYA 3NDBB 2WILA 4B6FA 2BSXA 3V4FA 2XMSA 6REQA 4ER6A 4Y1RB 2XKJE 1KJ8A 1V5GA 2FPKA 5JTUA 1GO2A 3WB9A 1SD5A 3O3NB 5IJ9A 3HY3A 5KYUA 2X5XA 1N1DA 2CFTA 3DL0A 5ARDA 3X2FA 4HV4A 4IFBA 1IOVA 4M99A 4Z4HA 5E7QA 4JI4B 1Z06A 2J7PA 1NLYA 2AFRA 1GKKA 4R1SA 3HXLA