4HO1X

The crystal structure of haemophilus influenzae o-acetylserine sulfhydrylase at 1.85a resolution
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
310
structure length
309
Chain Sequence
AIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVCRIGANMVWQAEKDGTLTKGKEIVDATSGNTGIALAYVAAARGYKITLTMPETMSLERKRLLCGLGVNLVLTEGAKGMKGAIAKAEEIVASDPSRYVMLKQFENPANPQIHRETTGPEIWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDLSIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSASERYLSTALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Cysteine synthase
publication title The Crystal structure of Haemophilus influenzae O-acetylserine sulfhydrylase at 1.85A resolution
rcsb
source organism Haemophilus influenzae
total genus 118
structure length 309
sequence length 310
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2012-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ho1X01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ho1X02
2Q3DA 1QOQB 4D99A 2O2EA 1BEUB 4L27A 1WKVA 5HBGA 5DW3A 5J5VA 4L0DA 1P5JA 4NU8X 1UIMA 3AEYA 3VBEA 2EFYA 5CGQB 1E5XA 4H27A 3FGPA 4D9KA 2TSYB 3TBHA 5CVCA 3PR2B 4D9IA 1K7EB 2RHGB 4D9GA 4HN4B 4D9EA 2CLKB 4L3VA 3PC2A 5KZMB 1J0DA 1V8ZA 3IQIX 2CLFB 5D87A 1V71A 3L6CA 4Y6GB 1TTQB 1TZKA 1WTCA 1O58A 2TRSB 1K3UB 2J9YB 5DBHX 1TTPB 2ZSJA 4D96A 1FUYB 4D97A 4HPJB 4D9CA 1A5SB 2RKBA 2J9XB 1J0AA 4LMBA 5JJCA 1OASA 2Q3CA 3V7NA 1K8XB 3SS7X 5DW0A 5I6DA 1C9DB 5KINB 1TDJA 1J0BA 2EGUA 1KFBB 5E0KB 4D9FA 2BHTA 4D8UA 3T4PA 1KFJB 4L28A 1D6SA 4HPXB 2WSYB 4JBLA 3VSDA 4D9BA 1VE1A 5C3UA 4ZU6X 2TYSB 1UINA 3SPXA 2C2BA 2GN2A 2ISQA 2PQMA 4AECA 1A5AB 2V03A 5IXJA 3PC4A 5D84A 3VSCA 4D92A 4WX2B 2JC3A 1TZMA 2CLLB 1CW2B 5B55A 4AIRA 2CLOB 2CLMB 4ZU1X 3X44A 2J9ZB 2ECOA 2O2JA 1TZJA 1BKSB 1X1QA 1Y7LA 4JBNA 5BW6B 5I7WA 5T6MA 5IWCA 3AEXA 1C8VB 5DVZA 4I1YA 4OREX 5I7OA 1Z7YA 4QYSA 3IAUA 2C2GA 5I7AA 3L6RA 2RH9B 2D1FA 1TYZA 4F4FA 5B36A 1Z7WA 3FCAA 1KFEB 4PCUA 4D9MA 5JISA 2ECQA 5I7HA 1K8YB 1PWEA 1TZ2A 3PC3A 3HMKA 1WDWB 3BM5A 3DKIA 3R0ZA 2ZR8A 2GN1A 3VSAA 5I7RA 1A5BB 1M54A 1KL7A 1WBJB 4OFXA 1CX9B 4KKXB 2DH6A 3RR2A 3ZEIA 3CEPB 1VB3A 1TJPB 1K8ZB 4LMAA 2CLHB 4IL5A 3VC3A 2GN0A 5J43A 3IQHX 4COOA 1V7CA 4ZQCB 1UBSB 3DWIA 1C29B 4HO1X 2ZPUA 1J0EA 1K7FB 1KFCB 1F2DA 5B53A 1K7XB 3DWGA 4HT3B 2CLEB 2Q3BA 5D85A 2CLIB 1J0CA 3R0XA 1JBQA 5B1IA 1A50B 1FCJA 2BHSA 1VE5A 3IQGX 1RQXA 5IW8A 3X43A 4D9NA 4LI3X 5D86A 5EY5B 4XUGB 5B1HA 4D8TA 3SS9X 1QOPB 3L6BA 1PWHA 5DBEX 4NEGA 4D8WA 2DH5A 1KFKB 5B3AA
chains in the Genus database with same CATH superfamily
3G2MA 3KV1A 4XIIA 2MSCB 1X2EA 3DJYA 5DXFA 4UTPA 1DAHA 5KTOA 2PH5A 2EKQA 1YCFA 1NOIA 2RJNA 4JJFA 3E2IA 4N0DA 3PNPA 3UT5A 2QRHA 3HXLA 4LWOA 1P31A 1XHFA 2WICA 2REQA 4URUR 1WVGA 1Q7BA 4AY6A 4LZPA 4JDUA 5BMVA 1R5NA 2GHQA 5JT1A 1OYOA 1DKQA 1XEXB 2C5BA 2ZUDA 1WXDA 4WN9A 2C03A 4JVLA 4C07A 1DOZA 2K7FA 1S6YA 4I50F 4CMGA 4FW8A 1EQ2A 3HSYA 4Q3DA 2Z6UA 4HGQA 1D1PA 4EEZA 4KE8A 4RACA 5E6SB 2GZ3A 3K9FC 2WV9A 3HJHA 3D8HA 2P9TA 3VKHA 3MCVA 1G63A 4Q7QA 1EX6A 3BMOB 4DVGA 4ACAA 4BQEA 4KITB 3NTOA 1RIIA 3K0CC 5EKSA 2JBHA 1SB8A 5KWVA 1YB7A 9GPBA 5AJXA 4B5LA 3F5MA 2QM0A 3T3DA 3NFRA 1G6HA 3GDWA 3KSDO 5DKFA 2X3UA 4NZNA 4D8UA 4RJIA 2QAGC 4B2PA 4NJEA 1CZKA 2OR3A 1R0BA 3PHHA 3L1KA 2O3JA 1NAHA 4TMWA 1YB6A 4GHWA 1WSDA 4Q0MA 3ZG6A 4AECA 3CVVA 3PIRA 4W8GA 4CVNA 1GFWA 3ZK7A 1JLRA 4EH1A 1J23A 4AZWA 1HX7A 1DU4A 4PQGA 3ER8A 3NORA 1YCHA 4OOEA 4UTXA 4QJ5A 5EJFA 1P73A 3CIOA 3NO4A 1AMUA 4XQ0A 3SC2A 4NBWA 2P2SA 3BFXA 5JDIA 2XT0A 3EX7C 4UMFA 1ZD4A 2GF2A 3T41A 1PS9A 3ZE7A 4BVHA 3KEFA 1NMXA 1OZGA 1P8JA 1ZJZA 4G5QA 5JNWA 3LBIA 2RH9B 2PKQO 5TSDA 1NF8A 2RGUA 2UV8A 2P0YA 3H2KA 1CEYA 1PLKA 1IQPA 4R1UA 2ZRPA 3WV5A 4Q3OA 1CJMA 4UE6A 4NG5A 3ISJA 1JN0A 4FSXA 2FETA 3L7IA 3ORRA 1U8CB 2J0VA 4WLEA 4DV2B 3WGHA 4QBKA 2NZJA 3LFHA 2PZBA 3LQ1A 4IQGA 5EQDA 2OGUA 3DBRB 5KDOA 3C4JA 1DI0A 5JE8A 2XNKA 1UK9A 3EGXB 5JAOA 1U5CA 2NSJA 2V6IA 1H4SA 3F9CA 4QQRA 1LI4A 1MC8A 1F8GA 1PZHA 2KHZA 3WGLA 1R8QA 1KP2A 4QUIA 5FBQB 2O2IA 3A4MA 5AKEA 4EX6A 3N2ZB 3QOFA 3L7MA 4IG4A 5DTJA 3SDSA 2VYND 3WOVA 1IUOA 4IQ0A 1G1MA 4WKBA 2X8LA 4KPYA 3JQ7A 2R8ZA 3LUBA 4PINA 3GJRA 3V4VB 4UAGA 2IUTA 5JV5A 5IM4F 5DB4A 5IBPA 3O26A 3GD7A 3K53A 2LCFA 1OE0A 2C2MA 4BTLA 6Q21A 4ZT6A 3WAJA 4S1PA 2GVZC 3Q7SA 5KYNA 5FL7A 1ZVMA 1CUUA 1EE9A 2V97A 3ITEA 4L9WA 3E9EA 2YN0A 4RD6A 5IBQA 2PFGA 1JFTA 4ENUA 5LXTF 2VVTA 1KZYC 2DTEA 2YYSA 3BXFA 5DH9A 1IG0A 3QLJA 2SNIE 2NXNA 3CGGA 4PO9A 4CBVA 4KNVA 1F60A 3CY6A 4BMVA 3IPLA 4DLRA 2FW6A 3IL2A 1YVDA 2E21A 2J59A 3H2SA 2DBQA 4ND2A 3MK31 1MGOA 3I0ZA 4IILA 2CYCA 2WUVA 2OZPA 2NU6A 2GDZA 1NXVA 2ZVPX 4YVFA 3AESB 3OMLA 1EWTA 1P77A 1MN6A 3FLEA 1RSZA 1WHTB 2UZAA 3QVLA 4PTYA 4PZLA 4NZMA 4IG9A 4R1LA 3KYCA 4WLVA 4Q48A 5AKZA 5BQ3A 5J23A 2FJUA 1DMSA 5DGIA 3LYHA 4EG3A 1CQXA 2JHAA 3OAAD 5I9IA 3I53A 4B3DA 3TSOA 1P9WA 3FDJA 4UVEA 1NSYA 2G07A 1C9YA 2JIMA 4IV5A 3Q1KA 3D7KA 5DHPA 3R5JA 2J0SA 3BMCA 1QIMA 2AK3A 3BRWA 3TQSA 5JJCA 2KM1A 3PB3A 1SXJE 2NZXA 4TMVA 4CEIA 2IF2A 1EEHA 3FWHA 1Z2CA 4OTZA 5K0LA 3FFAA 4FLMA 3RJTA 2O6LA 4E0BA 4KLAA 3OZBA 1T2DA 4DXDA 3I2YX 1R0WA 3EWAA 4QVKA 1AQJA 2VHEA 2J3QA 4EG7A 1GJRA 1DFHA 4MP6A 3ACDA 3MD0A 2GN2A 3PNSA 5ED0A 1MTOA 3OE4A 3BKXA 3ZQKA 1NA5A 4MGHA 1ODKA 4HGPA 2Q4RA 4CV3A 4MVJH 4BGEA 1RXEA 1M2GA 4ZKDA 1FTYA 2Q9UA 5CW2A 3EARA 1PJ8A 1BD3A 1ZKDA 2B36A 2KPOA 3F90A 2VFAA 2Q1UA 4UHKA 4BNKA 4PIMA 4B32A 1PNTA 2X2EA 4RGQA 4NRDA 1VLVA 2VTVA 1D4OA 2LR0A 1LV7A 4D9MA 4IHAA 2VZEA 5AUQA 1ENOA 4NMXB 1Y8RB 3VNUA 3VR2A 4QEKA 3A36A 1U3GA 3EBOA 3I04M 1ESNA 4X84A 3D0RA 3NUZA 2EHJA 4CR7A 2C8JA 4QATA 3WYDA 4GZ5A 3NGXA 1IQRA 3QU7A 2VK4A 4WNYA 3RV4A 2V7WA 3SLGA 1S2DA 2VUIB 1EFCA 2LRHA 4IRMA 4MJXA 1FP2A 3C6XA 4EPRA 4F4DA 1R6DA 3E23A 3GCZA 3JQPA 4F7WA 1A71A 1DZ3A 4TM7A 2HMAA 5K6RA 3D4BA 1JIIA 3W4KA 5CFOA 2W8ZA 4YYZA 4DMLA 3IO3A 3GGOA 5KYUB 3L07A 4BZZA 3GH3A 1LGYA 3E81A 3QPBA 3AM1A 1A04A 3O9VA 4LRQA 5EIEA 1HWYA 5LOVB 3MT0A 1NI3A 1HYBA 3ZHQA 3GLRA 5BN4A 1JBQA 1USKA 4WFQA 5CFNA 5JYCA 2AN9A 4DSNA 1GKUB 1O6GA 5HG0A 4ND7A 2RK4A 2YFHA 3VR6D 5JZBA 5CJ2A 4MUNA 4P7FA 1Q22A 3DM9B 4P0TA 3W90A 5K3FA 1R0XA 4D8WA 1GN9A 2XEDA 2ZYTX 1UKBA 1RLTA 4GYKA 4AO8A 2P9BA 4QPCA 5F76A 4Q9KA 4BC1A 2H57A 4DJ5X 2OGZA 3UJ9A 1JKJA 5B1YA 1D6MA 3GP3A 4OCZA 2E55A 2PRYA 4MOWA 5DW3A 4AF6A 5ECDA 3GEHA 3H42B 1A9XB 2GEUA 2EW2A 5SY4A 4ETWA 5A4KA 2VS1A 4KO4S 3O4FA 2QMYA 4OI4A 3SR3A 5ESDA 2JFVA 3I72A 1RYDA 3ZDCA 5AYVA 4DCTA 1MC4A 3FIUA 2MSLA 1Y3FE 4PZPA 2CK3A 4E09A 5K4AA 4PVCA 2ZS8A 1RXSA 2PTHA 4FFNA 1CP3A 5AI8A 3DR3A 1F9AA 1MPXA 1WUHS 3LE8A 3KLPX 3NC1C 2HJSA 1SVNA 4OL9A 2D0PB 3TRFA 1VLZA 3PNLA 4L5BA 4E22A 1PL7A 5EJ6A 3EVTA 1OW3B 3RQSA 1QTQA 4AF8A 4LK3A 1YDEA 2UZ3A 4UDNA 4F92B 2Z5LA 2DLNA 4UPDA 3DKKA 2QRLA 1VRWA 2F3PA 3PTZA 4K03A 3R44A 3JARB 1U8FO 4PX3A 4K9LA 3R7SA 1CYEA 1T5BA 4MLPA 2DQSA 1EBBA 1BN6A 1DX6A 1JH8A 1TM2A 2TYSB 2VNIA 3Q0TA 4QUBA 3A9UA 3CZCA 5SZIA 4DF3A 2J9RA 1GCIA 4KI7A 2V03A 4R69A 4FEYA 5FBRB 4TVOA 1PWYE 1RWWA 1US8B 2BGWA 3M9WA 1YR3A 2C94A 1RM3A 5TX7A 2WFMA 1DHRA 2ZE8A 1TU4A 1PFWA 4D45A 3GCDA 1S2GA 1S2IA 3AI2A 4BNZA 3FZYA 4KJZA 4IJKA 3ZLTA 4OREX 4RKRA 4NZ9A 1PQPA 1LTKA 1W46A 4X65B 1SIWA 3ZY4A 2CJWA 3P9XA 4BB6A 1YHZA 2ZXUA 3KQLA 2KMLA 2R85A 2A7QA 3WKEA 3TG8A 4QICA 3HMQA 2ZSDA 4A2WA 1COWD 2ZRIA 3M5CA 1LS6A 3PWZA 2ARKA 3GF4A 1XX6A 5KWEA 2Z6QA 1U99A 5EYPB 2HU2A 4QELA 2BTOA 2P9JA 4OH1A 3G59A 4AJNA 4NWIA 2J46A 1FDRA 5ECYA 1Y8ZA 3COPA 3V7YA 1TQDA 2V58A 1NR7A 2ZETA 3H18A 2NSYA 2NG1A 2YZMA 3NDPA 1GTMA 3OFNA 3UJ6A 4A8JA 5I4BA 4CM9D 1W0JA 2H29A 4KPEC 2CXHA 3TKYA 2A5JA 2CE2X 4JBYA 3ZHUA 5JO9A 5H1YA 1M6NA 1XLTA 2VJDA 1TCVA 4HO1X 5K0NA 1BFUA 2E5WA 9MHTA 3RYCB 3AR7A 3T7EA 3G49A 2ZOSA 3UO8B 1G3MA 1EP1B 3PHCA 4QTUB 2O23A 3CTMA 4EHDA 4B2IA 3JRXA 3UF0A 3FI0A 2ZUTA 1H69A 3QOWA 4NOLA 1EH5A 3ORSA 4J90A 4OQZA 4C4RA 1NJ1A 4YV0A 4QWWA 2YVLA 1GOTA 3VR3D 5DSTA 3LGSA 4A0QA 4CIDA 4GOOD 3DAGA 4C7BA 3PUZA 2QN1A 3AR2A 3D6HA 4JT9A 5HCIA 1R6BX 1XLWA 5IT0A 5AW8A 1XZDA 3QY0A 1CY0A 5HYVA 4QOGA 5LZ4A 1SKQA 3HBLA 5EIOA 2XOXA 1ZISA 1WZEA 2X5XA 2UZ0A 3UXHA 3B5JA 1BEUB 3G5TA 5FNVF 4PU0A 4EGFA 2KX7A 3QLTA 3HYSA 1G6Q1 4MLDA 3F1KA 1N3IA 2IU6A 3GNTA 3V8MA 1OTXA 2QENA 3V42A 1Y9JA 2E6UX 1WRBA 3FWNA 1FXWA 3K9LA 3NH9A 4LWZA 2FZKA 1CY8A 4B3IA 3I2HA 5JALA 1RHJA 1KSJA 2Q5QA 4ARUA 6CHYA 2D74A 4OQLA 3UFXB 5KHLB 2CEKA 2XBLA 2AN4A 4UQLA 1EM8A 5JWOA 2FQXA 3I0NA 4HHEA 4P7BA 1XWIA 3MTGA 4ZA2A 3ENVA 4MWZA 1P5ZB 1ZONA 2DE0X 1HL7A 5F78A 3TFWA 1FIUA 1NQVA 3A1UA 4M8LA 2NU7B 3JWHA 2P9GA 1WB6A 3AP1A 4BNIA 3C1TA 1W75A 1O58A 3CPSA 1ZGGA 2H4YA 2TS1A 2P8JA 3AVQA 3I9JA 1WJGA 4IHJB 3CLTD 3K94A 5FO0A 1XEFA 4LJYA 4V3BA 1NBME 1XXHA 3PKZA 3QBDA 1J0AA 4L15A 3HN6A 3CT4A 1OASA 1S0UA 2JVIA 1RWXA 1ZXXA 2WB4A 3ZNOA 4RVSA 1CE8A 4Q1AA 1Q0HA 4YJGB 5TPWB 1ISRA 3HDGA 3QF7A 1I6WA 4F2PA 2BCJQ 1L5NA 3S2SA 4JJGA 3VR4D 1ND5A 4S3MA 2PS1A 4CEJB 4GC5A 1QUFA 1DC7A 2V7BA 3I9LA 3WGTA 2QD2A 5ES3A 1W93A 4KQJA 2UZIR 2AH5A 3AK4A 1DTWB 2ZT6A 1J5EB 3RGGA 3IVMA 3HVIA 1Q91A 2HF7A 5D84A 1RLMA 2D1SA 1R6TA 1QG6A 4LA4A 3SI7A 2IS4A 3LL7A 1ODTC 3FAZA 1C3EA 3EULA 4Z3KA 3BSYA 4FD3A 3RVBA 2AUNA 1FUUA 2FR8C 4MVJA 2GF0A 2O50A 3EXEA 2H0AA 3CLVA 2JIPA 1JJIA 4AZ3A 3ED1A 1X94A 3WGUA 1SQFA 1VL1A 4OPMA 5B6IA 4II2A 5IUKC 3SNHA 4HB0A 1KEEB 4IIYA 2RGRA 3IUNA 2XD4A 3GPIA 3DZGA 1OFTA 2CF6A 5LKAA 2VDLB 1KL7A 5TPZA 3SX4A 1VECA 2XB6A 1QCYA 2ZXEA 1KVSA 2PUEA 1FZQA 4QYXA 2GXQA 3U7QA 4I8IA 4RGYA 2CHQA 1P8AA 3NWJA 3HUTA 2VPZA 3WO1A 4GG1A 4FOSA 4D4MA 3PDUA 1FRNA 1U0RA 3ZHYA 3AU9A 4UNQA 1ZCBA 4F96A 2C3PA 4ZQCB 1N9GA 4ONEA 4F2DA 3BE5A 3H5OA 4G0XA 3N87A 1G8JA 1YJAA 5JVDA 3HM9A 4DIBA 1Y48E 5TVKA 1AN9A 4WL0A 3U7HB 5LU8A 2GHRA 2CGEA 4D81A 1FEZA 1XBTA 4J0IA 3UKOA 1TYBE 3R0QA 4LN1A 3IILA 4ZYYA 2RGWA 3DM5A 4WDQA 3KFXA 1MGPA 2VXBA 4QRIA 5JASA 1V7ZA 2FZ5A 3DKVA 1O95C 2CJFA 1JU3A 4URVR 4DIKA 4PX2A 4M98A 3ZOKA 4C0XA 3D7RA 1E8DA 1E1QD 1FC0A 4HX9A 3T0GA 2E87A 5M5BA 3A6LA 4BQIA 5K01A 3VHRA 2QV7A 3VZQA 3ESXA 2IYVA 3E3MA 1SN7A 2MU1A 2XF2A 1DAEA 1JLLB 3M6MD 2GM9A 1FP1D 1OV4A 2A0XA 2BSQA 4I55B 2O3QA 1UIRA 4XB2A 3VU0A 3R8FA 4M7OA 3NGLA 4A7PA 1V4NA 4QOEA 3MJVA 3FPFA 3UAYA 4MQUA 1I4DD 5THKA 4JFAA 5IKXA 4MB6A 4Z4HA 3PRYA 2V96A 3DLTA 2G0AA 2IU0A 3VYTB 4LKRA 1SUIA 3NXKA 3C5EA 2VJQA 3DZHA 3EG9A 2A7XA 2B6NA 3DCIA 5K99A 1OH8A 2XX3A 2DY0A 2MINB 4NXMB 3OETA 1WMFA 1EM6A 3HZHA 3ETLA 3UUWA 2VDOB 3ANTA 3CC8A 1U6KA 1RWBA 3W3ZB 2DWOA 3DZCA 1KFBB 3GEBA 2WNIA 4NG4A 4ENWA 4CJXA 2WSYB 3EW9A 3H5AA 4JLSA 2VDVE 3L41A 3VC1A 3ZLUA 3JATA 4FMPA 1L4UA 4J2TA 3RC2A 3O8OB 4CDNA 1JQLB 1NJ6A 1EK2A 2VP2A 2ZP1A 1PFGA 3UW3A 2I6UA 4X54A 5E3HA 1GG9A 4QO7A 4IKPA 2YMLA 3SQOA 3SVZA 4A8TA 3V8QA 5C5CA 2BN4A 1J42A 2BDUA 2ACKA 4Y2YA 3M5WA 5G0UA 1LDNA 1XJ0A 4WX2B 1A8SA 2A0WA 2AQHA 3K31A 2Q41A 1CUCA 3DMRA 5FD8A 4L57A 2XA2A 5I9LA 3BPSA 1SIOA 4F60A 1PLJA 1TVKA 2EFEB 2NXJA 1C2TA 3BIXA 3ETHA 2GTIA 4WCFA 4II7A 3TECE 3T3NA 4MKHA 1PT6A 4AS2A 4HQ6A 4K9QA 1SZCA 3V2UA 4CODB 5AFSA 4MAMA 1YA4A 1AVTA 3PS9A 3WBFA 1FFSA 2JH8A 3N76A 1PFUA 3DUFB 1LF5A 4I9GA 3RO7A 3HL0A 4D74A 5L4SA 1E79A 1QGYA 1USWA 2V4ZA 2ZJYA 5TGDA 2GZDA 2OGSA 2AOTB 1CHDA 2WUFA 3ANYB 2GNPA 1MEJA 4L7VA 1KRWA 2O5EA 3F97A 2GB4A 3IQEA 1MB4A 3X0DA 4R9UC 1HDOA 1XTKA 2BT4A 5DN6D 3HFGA 3UWPA 3U19A 2ZULA 4YC7A 4ZN6A 1MQAA 2FCRA 3U3ZA 2GSWA 3DFIA 2ID8A 5IAJA 1ECJA 3MS7A 5FUMA 1PEYA 4IXNA 1ORIA 3QEJA 3MAGA 3GY0A 3R0VA 2P6PA 4NBVA 1E2HA 1LH0A 4O2AA 5DU2A 2NMVA 1X7WA 4C87A 1UBEA 3IJEB 4DY6A 3M3DA 2DCMA 3MWLA 3NIGB 3LRXA 5CCDA 4INAA 3AC0A 2W6ZA 2Y76A 4L4XA 2CMDA 3BWMA 3OKAA 4YAEA 1G7RA 1T5IA 5K6TA 4XD7A 1TJYA 2BGRA 3NIDB 5AHRA 1YR8A 4KXUA 5JXIA 4CM8B 3M4YA 3ZNPA 4D3FA 1VYVA 2I03A 1EGHA 1MOPA 1XTRA 4AROA 2JLSA 4KPUB 4HS4A 1T91A 4EJMA 2CJXA 2HF2A 3OQOA 2ONJA 3CRRA 4L1KA 4YJ2B 5DHQA 2BI7A 3ROKA 3M89A 1GQ2A 4MQ4A 4RJKA 2AHRA 1EINA 4QUEA 3EFOA 4A27A 3MB5A 2JAXA 2RIPA 1MRSA 1NVGA 2HNAA 2YUIA 1FY2A 4PNPA 3TKLA 3FLMA 1XRLA 2R6HA 1X70A 4E2WA 1H2RS 2VWHA 5TS3A 2SKCA 3NBMA 1AHIA 1DAKA 4LHEA 4QGHA 3EFBA 4A0SA 2OD2A 1DOHA 1NNUA 2XITA 2G0TA 3K9CA 3GXBA 3B3QA 3M6XA 4NS1A 4ZRMA 3SYKA 2YHSA 2AZTA 1JGTA 4NK4A 2VQ6A 2ZAOA 4K9KA 3HJUA 3NJ4A 5JMWA 2RE8A 3DLHA 1GNVA 3OSZA 4YJFA 4R9RA 3IQIX 3L84A 5DHFA 3ROGA 2Q45A 3WQQA 1U2GC 2ZUUA 1PKEA 2OLKA 4KQ9A 4CM7A 3GC6A 3WWOA 3H16A 3DXFA 1HZZC 3LO5A 4QRDA 1FXSA 3HJAA 3BL5A 1SK8A 3D9QX 3G23A 3RUAA 2IFTA 1KEKA 1U7OA 2RKBA 4A5OA 1CY6A 2DP4E 3V4RA 1MP0A 1IZYA 3I01M 2UKDA 2ZI7A 2FWBA 1Z7GA 1XTPA 2W4MA 2XVXA 1DFIA 2NXWA 3NTRA 4KSCA 1NVUQ 1OC4A 4MB2A 4LGYA 4W6ZA 5JPDA 4IW3B 3P52A 3LQYA 3EXIB 3N53A 4WGFA 2HEGA 5EIHA 5HUHA 4IO1A 2XIQA 4PGMA 4RA9A 2EJWA 4OIFA 4GWLA 4Q82A 4TZTA 5KTYA 1FMCA 3B1FA 3DT8A 4RU1A 2VNHA 3V1KA 4Q1EA 5T7BA 3OIGA 1G2OA 4DNPA 1M1XB 4CMCA 5AW0A 5LP6A 4P3NA 1JWAB 4FILA 2FPKA 3W1WA 2C5FA 1TZMA 2HBYA 3STXA 2RC5A 3PD0A 4LX0A 5CIWA 4ZI2A 3NI2A 3KZCA 1N2CB 4K8OA 2ZRCA 3BZBA 1H85A 2HLDA 1ESMA 1WXHA 3WQSB 2J0UA 3USES 4S2EA 3HKCA 3CNOA 2B4TO 5IWCA 2WZDA 5ABPA 3F5QA 3GQBA 3WRWA 2IE8A 3RWMB 4M8IA 3P19A 2UXBB 3PDCA 5D8DA 3C4VA 5J40A 2XOEA 1NUUA 5B36A 1KFEB 1IL0A 5BSUA 1CLUA 1FDSA 1XPOA 1USIA 1DARA 2IL1A 4Q1DA 1CS0A 5TNXA 1VQ1A 1YKGA 2GLXA 2H11A 4HGYA 1NLZA 1F6WA 5I3CA 5F9HA 4U6NA 4OHYA 4BEJA 2W6PA 1LPNA 1JQBA 2OLEA 2AMFA 2GEVA 4HUQB 4R7ZA 4W1SA 5F9MA 3ZEIA 4QPZA 4QNRA 1QANA 3ZUPA 5KNLA 1NQOA 4Z4IA 1IVNA 2JJ2A 3EOZA 4R1SA 4TTVA 1RFLA 2FNAA 1V96A 2CE7A 4TLMB 2EP5A 1U90A 2OMKA 4X97A 5LN1A 1RBMA 3EXFA 1FQOA 3HLTA 5C8VA 3ITNA 1WO8A 1UKYA 2QM7A 3QY9A 2WPDA 2XB2A 1NY5A 2PGAA 4XI9A 2ZB8A 2FEPA 2OQ2A 4F5EA 4Q5IA 3RRFA 3EGCA 4QUDA 4YYEA 4DLKA 2F43B 9LDTA 1MRNA 4G37A 2VTKA 4CIAA 1OV6A 4FS8A 4HEJA 1CJTC 1VI2A 3ZWVA 3GG9A 4B0OA 2AFVA 3PXCX 5DBEX 4HX2A 2ZIVB 2CF5A 2NZ8A 4B1FA 1NN5A 4MEBA 3CLRC 1RZRD 2H0RA 1XCPA 1KDTA 4TTAA 1P7CA 1W29A 2AWNA 2BUBA 2BUAA 3LX6A 1NT4A 4EHKA 3OCJA 3K6JA 4DLNA 3WQHA 3O9ZA 4HUJA 1VE3A 2X8JA 3FMGA 4PYIA 4RHTA 4DWOA 4V1CA 5HKKD 3W3AH 3WGZA 4NCNA 3FTFA 4JSTA 4KX3A 4NARA 2O8FA 3NKVA 4UDOA 2OQVA 1RW4A 4Y1RB 3AYXB 3HLYA 3CO0S 1QR6A 3Q6NA 3AW9A 1ZBDA 4RSRA 3ROZA 1I13A 4YRNA 3VVBA 1T2CA 1UBCA 3VZDA 4JVSB 4RTOA 2RHGB 2Y1LA 1LB1B 3LC2O 1IEXA 2AR9A 2OAQ1 3SCZA 3LWNA 1XDBA 2WJPA 2NU9A 3Q8XB 2AWOA 3HA3A 4MV3A 1KE2A 1IY8A 2J3KA 4WXPA 4TSKA 4MS4A 4L6CA 4RPKA 3JVIA 3KR2A 5LMZA 3KC2A 2BGGA 1PHRA 2RI0A 3IMCA 1GU7A 2JGJA 2Q2QA 2C07A 3LUCA 1I4OA 1PR2A 3NIFB 3PQDA 4IKEA 4UUPA 4BEBA 4AKSA 2F67A 4OQEA 4C08A 5IVHA 1PFVA 1RI2A 3KCNA 3TZLA 5AHKA 1OHHD 1XDUA 3WNZA 3HI4A 1L7RA 2BBTA 3LCJA 2HMWA 2OVFA 1YL5A 4AG5A 4CG2A 3VR5D 5BV1A 1QH9A 2M32A 3DO8A 3R6WA 4LJ4A 3BB4A 3I04A 1PK7A 3OHMA 1D09A 3GFPA 4DHWA 1F7UA 1H5UA 4W9NC 3OPQA 3WGMA 1Z06A 4C0LA 4AQ7A 4IH9A 3R76A 2QTWB 3I0MA 3QVJA 3FHCB 4JQZA 3CNQS 3OQIB 4YFVA 3TB4A 4C7KA 5ELXA 1P61B 4BFZA 4IBOA 3KT0A 1E3QA 1X92A 1EFKA 1JHUA 2FFHA 4AIIA 2CBGA 4JR0A 1SCQA 3UCEA 4BMSA 3PPYA 5C4MA 5J2UF 4XYGA 4R4JA 2WHPA 5HQ3B 5REQB 5JFTA 4LBVA 1GFZA 4NE2A 5EMNA 4GX0A 4W5NA 2OBYA 4UFNA 1FW6A 2RGCA 3AH8A 2YZ7A 4BN5A 4G8DA 3DL2A 5C4IA 4LYEA 4Y2VA 2H06A 3G5AA 5AI6A 1Z0UA 3HY6A 3U1TA 1VE7A 1KR5A 1A5TA 4QDKA 4ZVUA 4MR7A 3QFSA 2B30A 3L01A 3NHPA 4IRUB 4KQXA 5AVTA 3G5MA 1OUMA 4XZ3A 4UVIA 1C7QA 2CMHA 2P2NA 2QAGA 3LOPA 4REOA 3I6MA 2VKTA 3QMVA 1U8ZA 5M29A 4LNUA 3UTDA 3UT0A 2B8JA 1W4AA 1VA5A 2JCBA 1U04A 3DOFA 3K35A 4TV9B 3ZHCA 1N8SA 2B37A 2XZTA 4P86A 1RBQA 2PN1A 5ITVA 5AJZA 2GLUA 3AI3A 3M7IA 1PJ3A 3SF0A 1GG5A 3ONFA 1OH5A 4HYEA 4PLGA 4TVKA 1CETA 1N4DA 1UPTA 5EHQA 3SOPA 3ZKWA 2BC9A 2EL9A 5SY6A 3W5HA 2X42A 4OB7A 3QG5A 1C8KA 1Y63A 3I6IA 5CM2Z 3QEKA 2ZATA 2CNDA 3H1EA 4S05A 4X62B 2G70A 2RIRA 3ESZA 3UBTA 1G38A 2LWIA 2I5PO 1LQUA 1Z5WA 2XB8A 4Q3NA 5BR7A 1VE5A 5IW8A 3L0YA 3ZZ1A 1RHMA 4YP6A 1OVGA 4WBNF 3CZPA 5BW4A 1NXTA 3QVWA 3CB2A 4PO3X 4F1JA 3VYWA 1NYLA 2OD9A 2GZSA 1BOOA 4ASUD 4D6YA 1JI3A 5FPKA 1BU8A 2VZ9A 4ZVMA 2EG5A 4JQOA 3U4HA 4RX1A 1A7KA 1HORA 3L40A 1S3IA 2QUBA 2E7ZA 3DLAA 5F1PA 2E48A 4A0RA 1MJNA 4IKOA 2Q1TA 3NGMA 4D0SA 3F4BA 3Q8KA 1ADFA 1CEXA 1DAPA 4RK0A 2UUAB 2BCGY 2WJGA 4Y18A 4LZJA 3RYHA 1ZNQO 1E0DA 1OX5A 3RKSA 4AS3A 4DXHA 3BF8A 1E7WA 5ALRA 4P5EA 2Y9PB 4UZFA 4DQ0A 4YRFA 2R8BA 4D98A 4D9GA 4GOLD 4HWPA 1KI2A 3O1IC 4NCHA 3W8NA 1M1UA 3OOYA 4N3CA 4MX8A 3ZDXB 4HZUB 3F8SA 3K0FB 2HMYB 1L7AA 1JKIA 3HU5A 4DBZA 3JYHA 1SXJB 2OHFA 3TZHA 4P81A 1E1DA 2A1IA 3RKUA 1M8GA 2X9VA 3EZYA 2BW0A 3AVOA 3EZNA 3QJ5A 4HRAA 4MW0A 4M46A 1IUPA 3UQYS 3GBPA 4DJFC 3COJA 5AESA 4WKCA 3G8BA 3S44A 2NV2B 3U3XA 5TQJA 1WZNA 3VA7A 4JU8A 4RXTA 4B73A 3LSYA 3VAZA 4W1QA 1G8AA 3FB1A 1T36B 2ZB7A 4BLQA 2FP4B 2XBMA 2ZRNA 4GIBA 3UTCA 2H7CA 3CTPA 4OUDB 3RK0A 1GG2A 5IC6A 2ZK7A 4DA6A 3LLCA 1VL0A 2CLMB 3D64A 2GN8A 1GRNA 2HGSA 3OJFA 5DF1A 4AG3A 3F4KA 3K09C 1X1QA 1PJQA 3T8YA 4F1WA 5C8ZA 2ZFUA 3F6YA 4HRYA 5ENDA 2P1RA 2I34A 2P0AA 5HIMA 4R2LA 5HTKA 3SYMA 4BQFA 5LP1A 3N5CA 3OOSA 4CKWB 3RAJA 2MSDB 1XZKA 4W5TA 3KZMA 3TUZC 4YCJA 4N0EA 2PUWA 1FJXA 4G5OA 2BP7A 3IR7A 4G5YA 1DAOA 3MJCA 1WUKS 4G5FA 4N47A 1AXGA 1XJWA 4B3JA 4Z54A 5CFRA 1AJEA 3NYRA 1JDNA 1GNPA 1QGUA 1TGVA 2GM4A 3O47A 1HF3A 2M1XA 1VJ5A 2XUZA 4TQ9A 3FVQA 4TRRA 4TUYB 4ZT4A 4CNQA 4QTTB 4F9FA 1O6ZA 2GXAA 1PZFA 5FUVA 3TM4A 1D9XA 4EB8A 3WWPA 2OYSA 4MIYA 3R3VA 2QSJA 4BNTA 3N2GB 4RV5A 2LCIA 2VT2A 3T0IA 3KKQA 4GXNA 2WAAA 1BROA 1FRQA 4CETA 1YB4A 1JR2A 2C5AA 3HWSA 3FR7A 3W1EA 3EMVA 3AW8A 4J3NA 3IDZA 4CN9A 1Q14A 4WV3A 3CJRA 5IZ4A 1K7SN 1C50A 4HDOB 1ACLA 2HIMA 4IJWA 2XCQA 4YECA 1RKVA 3H7AA 5E4FA 3FUXA 4B43A 1CDOA 1M75A 2NV0A 2REQB 1J5XA 1T6ZA 4MYDA 5T4HA 2YDYA 4YCSA 8OHMA 3C1OA 3GEDA 3RS0A 4LTMA 5BYBA 5FEUA 1G8MA 2MHCA 1KQOA 4LZNA 3TLZA 3I6YA 3IAS1 1K97A 1PFKA 4IQFA 1KYYA 3AILA 1P1HA 2FQYA 2X2OA 2IV2X 5DN9A 5HF8A 4FGKA 4WFKA 4NU8X 2P5TB 2UYGA 3C3WA 4JQYA 5DGDA 4YY3B 1GLGA 1NN1A 4EA6A 4ZYVA 3RJ5A 4HNSA 4NBTA 1XL1A 3WAKA 3A28A 1MEEA 1OXTA 1VRCA 1W96A 2PLNA 3W3AA 2CHVA 1DNPA 1WP4A 3AF1A 3QXXA 3KJNA 1UAYA 4IZ6A 5AQ1A 3O8RA 3CX3A 2CNWD 4QECA 1T8SA 1JHDA 3R3YA 2JLYA 1DADA 2YX1A 1ZD8A 3R7AA 4EX7A 3SZ3A 1RC8A 3BL8A 3A37A 2L2QA 4J1NA 4CKBA 3K9NA 2IH2A 2PEYA 3QVMA 2NWQA 3RYFA 3LX5A 1A82A 1K3UB 4TTIA 5FOXA 4CUKA 5K0SA 3CVUA 1WDKA 6ABPA 2BGUA 1XYVA 4GEGA 4RD0A 4D9CA 4CGZA 1JIXA 3QW4B 2DWPA 4RCYA 4KNYA 4FCCA 3OUUA 1J2TA 1XOIA 3O3OB 5C8DA 2ZUCA 5HF5A 2A0KA 2E82A 4N39A 1KQPA 3FXAA 2VDPB 1GPMA 3S5UA 1JR3D 2D1YA 1RI3A 1HETA 1TFUA 5CIYA 2ZBPA 3ELDA 4CQNA 1XRSB 4J1TC 1RRPA 4ZGWA 5B12A 1W4ZA 2AXQA 2YJTD 2C42A 3GPCA 4MI3A 1BZYA 4OKNA 1V9LA 1KYTA 3MXTA 3RU7A 1CFJA 1ZMXA 2EZUA 3QMMA 3STYA 4MR9B 4FOTA 4MV0A 1XU9A 4OOFA 5E8RA 2IZOA 1R12A 3KJQA 4JV5B 5DYNA 4KDCA 2CL5A 4X8MA 4XWKA 3IURA 4DJJA 3HKDA 3ZU4A 1EB8A 4CM4A 1JG7A 1K66A 4KH0A 2WJ3A 3NOQA 1TU3A 4UUBA 4WASA 4O0MA 1VLMA 5FFNA 3CM0A 4MUIA 4LE2A 3AKZA 3NM5A 4X20B 1BW9B 4DC9A 1N1EA 5REQA 2B9EA 1OX4B 1P2BA 2AXEA 1B26A 3T1OA 4JLVA 4PLPA 1O89A 4YFYA 5J2TA 4B6EA 3FGOA 3IUMA 5GOTA 4HN9A 5JNSA 5FF9A 1H1LB 4FZRA 2BEWB 3VO1A 1CX9B 3Q3HA 2JI9A 1EVZA 1ZD2P 1CP2A 3LV8A 4HEQA 4OV6B 5F1KA 4RH1A 4BMXA 4BMZA 4U7DA 4KREA 1UR5A 2P91A 4H7IA 1SVLA 1FSZA 2PUVA 1J56A 2JVKA 4ZQIA 3UNXA 5J43A 1E4EA 4O0LA 1HKHA 1VGVA 3MINA 4TV8F 1ZIXA 2HY7A 3LA8A 3PQEA 4P4NA 2G17A 2HA0A 4DMGA 4YMLA 1R9MA 3HFJA 4JLMA 1RLJA 4JCCA 3N6VA 1W1IA 2XMZA 1QG2A 1A50B 3AF6A 2XUHA 3AR9A 2Y99A 5EP2A 3RIMA 4YUZA 5K7SA 5C51B 1P62B 5JTTA 1PWZA 3PXDA 5BQ5A 2IXEA 5LBUA 1E3DA 3BXEA 3C3BA 4JWTA 4Z7NB 2G1PA 5JADA 5DGHA 3UA4A 1UBFA 3S5JA 4DQVA 4JXJA 4K9PA 4DV5B 3QKTA 4UEOA 3DVRX 4L73A 1F2UB 2B7CA 3E70C 1E9VA 1QK3A 3AWDA 3DMGA 3MWKA 5L4LA 3CW2A 4KK4A 1KZ4A 5A5VA 1OB5A 3LLVA 3S81A 4POOA 2PWZA 3EXAA 3GELA 4MKZA 3LLSA 1WR8A 4JB8A 3DE6X 4UJ5A 1GPYA 3QV1A 4MS1B 3VXKA 4ZCSA 3ANSA 5AI5A 2IK8A 4G0OA 4G56A 2QN2A 1IN4A 2PUHA 5KJ6A 3DJFA 4A23A 1B8OA 2ZTHA 3GLHA 4KMMA 1UOOA 1R4MB 3BMCB 5EVJA 5CBPB 4ZMRA 3LUFA 4RGBA 4UU7A 1TJ4A 4K81B 3NDRA 1GTVA 3MRXA 3DPUA 3LCMA 4O08A 1Y81A 3TAUA 4IPTA 4DLPA 2ZRBA 1TZCA 5KSZA 2JAHA 4XA8A 5EESA 5ALLA 4C1NA 1DAFA 1TTPB 3O1HB 4IDBA 5EUBA 5HILA 721PA 1OFUA 3SFVA 4M0PA 4RVGA 3IP6A 4AVYA 1SK9A 4NCXA 3FHLA 3ORFA 4WINA 1E6EA 4UZSA 1AHPA 4KNWA 3I4FA 3UT6A 3IV6A 4KLRA 1YI1A 2PVPA 4LRTB 4PZYA 1IJBA 1N8KA 1RYHA 3GI1A 1IPEA 1WZ2A 2EAUA 2XXBA 3KOUA 4U02A 3OY2A 3NWPA 4KWCA 2AEEA 2WMOB 1G8PA 3G7SA 4XXHA 3THOA 3WGJA 2YXLA 3HUDA 4QYIB 2N1MA 1UPBA 1P9RA 4X60A 5CDTA 1SCBA 4NPAA 1I30A 3E9CA 4QNMA 2VRBA 1G20E 1JYSA 1DWQA 4RFSB 1L0BA 3LMKA 1Z47A 2HFJA 3WFZA 4ZJPA 1VPDA 3U3OA 7MDHA 4QJ4A 3N86A 1SXPA 4AB1A 2WAYA 1JTEA 3N70A 4QOFA 3HY4A 3PHIA 4IDCA 2Y71A 5ICEA 3KD2A 1JX6A 1GHTA 1D3AA 2PLFA 2OCDA 3DMNA 1OCEA 4I0WB 3BL6A 3IVCA 3RBAA 1YQGA 3DCJA 2Z3ZA 4LF4B 1ZW1A 1ZUNA 4KX5A 4TYQA 3IBTA 1BYIA 5JAUA 2ZR8A 4F97A 4NOJA 2CVOA 3QBJA 5T64A 3EGOA 1X14A 3T1YB 1B7GO 5HA5A 5DCWA 1J2JA 2NZVG 2OBLA 2XEXA 2ZQ5A 4LC1A 4NSNA 4AKTA 3BWCA 4C2AA 2UUOA 1NFRA 5BWBA 4DUZB 5ALGA 4M4SA 3K0AB 1LNQA 4BP3A 4C6HA 4N3BA 2XDQA 1JU9A 3EVBA 4UBLA 4BFXA 3UKDA 5ITZA 1F8YA 3PQCA 3DMFA 3P0FA 3K3PA 3L06A 2ZJ7A 4IL5A 4DCJA 4EYQA 2Y27A 1YJ5A 3CB4A 4Z4GA 1ZNWA 2UVDA 1J8FA 3A6FA 2BGMA 1H8ED 4JJIA 4C3OB 1EZ4A 5GJBA 1CNEA 1OT3A 3C3AA 4OB8A 4B79A 3GMSA 2YOFA 1S1MA 2R4UA 1QCDA 4WADA 3FJYA 3OTQA 3Q9SA 3NRJA 2LIPA 2F1HA 3CUEF 3GJSA 2C2KA 3ZBUA 3LECA 1M9NA 1C80A 4FSHA 3MWFA 1QTNA 4HB2A 2XW6A 2ZQZA 2ZU6A 4RPJA 5EPOA 3LZCA 2O5CA 2AB0A 4QVGA 3UH0A 1L5QA 1EKXA 2GCIA 4RQBA 3BIWA 1PJBA 2PZAA 2C8LA 4EPYA 2VCYA 2H0QA 3L8EA 1KAGA 2Q50A 2Y1WA 3TW4A 4XSGA 3T7AA 5AOVA 3TLCA 1HDYA 1N1GA 1G3RA 2BEJA 3EPJA 3QKSA 3SBDA 1R4NA 1WXWA 4CM5A 2A5GA 4CEHA 3I01A 1F51E 2J6CA 3G0HA 2CFIA 3UAGA 2FPGB 3GDGA 1SHJA 4ZCQA 3MT8A 1FX0A 4P32A 1KE1A 2C1XA 2O54A 3K4HA 2Z3VA 2CXTA 1VHLA 5JANA 3FRJA 4M0FA 1M1NB 3OU6A 5KTTA 1BDHA 1ZOOA 4AKEA 4GEKA 2ZSFA 1M6YA 3RS2A 1BE6A 5TMEA 4ZAGA 4MDHA 4D9KA 2CXSA 2WAMA 1D7OA 4E46A 1C1HA 4A8PA 5AK0A 1HR0B 1OXKB 2B8NA 2CCKA 1MX3A 4CL0A 1PT8A 1AQIA 5H70A 4F93B 2R6CA 5IHPA 2WE8A 2F3UA 1BMFD 5CLQA 3TVTA 1JAYA 5KZMB 1SU8A 3KKPA 3C15C 3L0IB 3L7JA 4YLYA 2HFKA 2V45A 3ND5A 5GMOA 3UAWA 3X1WA 3IKTA 2YWFA 1TLLA 2RI1A 5I7FA 3CVYA 2FPIA 4O4IA 2TRSB 4CLOA 2E1RA 7MHTA 1O95A 2WSBA 2J9YB 4NEHB 4A92A 4N7MA 4S24A 4YAWA 5JSKA 2NU8A 2QX8A 2Z30A 3GJ0A 4K6FA 4R40A 4X64B 1A8UA 1WPGA 4UHEA 1ZICA 4N82A 5DULA 1VKOA 1W25A 4AWAA 4WOPA 3VHXB 4OBBA 1AHHA 2CXOA 1G5QA 3LKDA 3ZVNA 2QE7D 1ZITA 2CZGA 5IZCC 2O6HA 1UPCA 4X1YB 5TS2A 1QORA 4CMEA 4EARA 4M1TA 2D13A 1EAMA 2XVAA 1IZ9A 1Z8DA 1VFPA 5D3MA 4B6PA 5MHTA 4BE7B 2Y67A 1LPAB 4H3VA 4MQ5A 1ZN8A 3VJMA 2R6DA 1XDGA 4KAJA 3U4AA 2FFAA 2ZUVA 4YJKA 4HFNA 5HRUA 3O92A 1O6FA 3T9BA 4O3MA 2QLNA 3S2ZA 3KRTA 3W2IA 2HK9A 5I7VA 3REGA 2BPOA 1MHPA 3AP3A 4Y2SA 5DYGA 3VDMA 1EFPB 3E9NA 4ED9A 4B6RA 4C2UA 1KS2A 4OX9Y 2Q0HA 3IAUA 3FGNA 4A0HA 1P45A 4DCSA 2XY4A 4UNSA 3FUUA 1E4YA 2C2HA 1YBAA 2B8TA 2XQFA 1SUAA 1Z7WA 4P82A 4GI2A 1W88A 3IA7A 4Y67A 1GPAA 4FYVA 4A8JB 3OA2A 4ZOAA 4ER6A 1TEXA 3PC8A 4U2GA 2Z1NA 1J6UA 3TYXA 1ULSA 2O7VA 5KTMA 1C1XB 1D03A 1NQWA 3E84A 1X8LA 1E18A 4DZZA 2O05A 3Q2KA 4N12A 5FOSA 3S2EA 5HOEA 1MEOA 3P4UA 1WMEA 2BKVA 1VJ1A 4HG2A 1LNZA 1SFRA 3H8JA 3EEIA 3CNLA 2QMUA 4DBLE 3PJRA 1IHYA 2QTGA 3KQQA 2VUHB 4XDHA 2DFVA 1RLUA 5TY0A 4Q3AA 2QRZA 1DCKA 3GMDA 2WYWA 1FFHA 3BQMB 2E85A 4CTNA 1MJFA 1YK0A 4QFBA 3OQJA 2PMFA 1SUCA 3NYIA 4O4JA 4J9UE 2I99A 1TPZA 2XB4A 2I71A 2ZIGA 3DMTA 4NYJQ 5BT9A 2BGNA 1DBSA 2N75A 1UBMS 3WFIA 3FLAA 5JSHA 4ZTZB 3GLVA 2EBWA 2FF7A 3Q3IA 2Q21A 2CUKA 1P91A 2O7RA 1LU9A 1FF9A 2ZIUB 3NEPX 3RC8A 2O8EA 2MMCA 3LVQE 4JJ4A 3GEGA 3WGIA 2C9DA 3BH7A 3NHRA 5A71A 3A58B 1A9SA 2ENWA 4DG8A 1WX1A 4CUZA 1U0LA 3QV2A 4J4BA 2YFYA 3INRA 5IAGA 1QBKC 5KYYA 2ZJ3A 5TB5A 3AEQB 5BT8A 3CUVA 3LJKA 3SIXA 3E82A 2VWGA 2QT1A 1TX4B 3C8DA 3D0KA 3VNSA 3ZW9A 1O0SA 2B3TA 4K6KA 1VHJA 1E2MA 4YXWA 4OK3A 3R0IA 3RARA 4NXNB 1AB6A 4QLOA 1RXIA 3WDKA 5FPHA 2EERA 4DSZA 1DRUA 3JALA 4YQZA 4J8PA 3L1JA 1OT5A 3GRVA 3JAKB 4DNXA 2DHRA 3SSNA 5JRDS 1A9YA 1SCUA 4M0EA 1NVAA 1GRRA 3IERA 2Q49A 3IPRA 5CVDA 2HXYA 1ARZA 3SKVA 4KEAA 2QZ9A 2Y3IA 2AXNA 4FU0A 3DF7A 4TLEA 2FMTA 3UPUA 1KDOA 1LDBA 2H9AA 5FHRA 3FHOA 4NBRA 4DA8A 1FSGA 3E2PA 3D0QA 8LDHA 2J5RA 1YVPA 3IQXA 3H4IA 1QYCA 1NR5A 2VXYA 3A1NA 1W4BA 3QKIA 4F5ZA 3EPKA 3U62A 1FJ2A 3JVDA 4UU8A 3KDPA 4HQFA 5CMLA 3WLQA 2GN4A 1O3YA 1FPQA 4BVGA 1N0WA 2O5RA 3PEVA 4LCJA 4LDQA 5EIWA 1ORVA 4AY4A 3ZQJA 5KDDA 2YMQA 3FCXA 4NFLA 3F5DA 3WYBA 1YJ8A 2JIBA 1BS9A 2R62A 2YUTA 3EXEB 3ND7A 1OAOA 5CA0F 3FKSA 3AMVA 1PQ4A 4UFPA 1SZPA 5L6MB 1SUBA 4BGIA 1RQRA 3L6UA 2PVCA 4Q37A 2GKGA 2QTBA 1E6LA 2PZKA 1ZUHA 3F9RA 5SV2A 1L9XA 1A72A 1KETA 1L5HB 3OF2A 1TZJA 2NZWA 4M76B 1N34B 1SXQA 3KOOA 2N47A 1Y82A 4ND8B 1I94B 4O1HA 4QYSA 1TJ3A 1XCOA 2GNAA 4B17A 3HYNA 1KKLA 4TPKA 1KI6A 4BQPA 1MMFB 3U3KA 1W85B 1NIJA 1DJMA 4HWSA 4PANA 1Y9EA 1TZ2A 1BMDA 4PLHA 2PJDA 3A1DA 4RLQA 3V32A 3C3KA 4AN4A 4BFWA 5CDSA 1LRJA 4PHHA 2E89A 2YXNA 3MMZA 2IUUA 3A9VA 2XA9A 4MRPA 1R10A 2Q6TA 4E2YA 3VDQA 4C0HA 4CL8A 2Z8YM 2KYRA 3ESAA 1KPGA 1TA0A 5AI9A 3SQWA 1H94A 4AYXA 1J21A 1HT0A 4ZJYA 1QFXA 1GTRA 5JVDB 4G4IA 2G1KA 1JIJA 5JQGA 2E6KA 3LXXA 1P29A 3RFFA 2WJ4A 4YMGA 1CRPA 2C5GA 4RVFA 4KXNA 5C1IA 3E27A 3OZXA 3RPEA 1KO1A 3AM5A 1II8A 4F4JA 3KETA 4GM1A 1XZIA 4FIZA 3IAHA 1SBQA 2REXB 2YOHA 1CF4A 1DJNA 2CLIB 1UZAA 2YL2A 4WXYB 4BKOA 4BP9A 4IOLA 1PGQA 2Y8EA 3LW7A 4FGSA 4HQOA 3STHA 1LKZA 1H9BA 2AI3A 1DJPA 1RYFA 2W22A 1LF0A 3FOCA 3GD5A 5LQKA 3GZJA 5DM1A 2CHUA 5D1NA 5EY5B 3QQPA 3L1HA 1Q0SA 1AQUA 1TW3A 3VYRB 1M1YA 4KN6A 1NXSA 3T95A 3EVDA 5A0FA 4GBGA 1AKVA 3CXRA 4XVCA 4OY3A 3ZY6A 1H4TA 2PKYX 1JF8A 1GTG1 4GT1A 1BA3A 3TPCA 3BF7A 5F7JA 2A9FA 4XX0A 3QVXA 2IKQA 1T9HA 3V48A 3KQUA 1RLOA 1YIOA 3Q0IA 5EINA 1BEZA 1DFGA 1VL5A 3EDRA 3M6UA 3DB1A 2H1CA 4R3NA 2BGKA 5CDGA 2YNMA 1Y3DE 1JHRA 3W7VA 3QNUA 2EKPA 2OXCA 2HSEA 3LOUA 2XVYA 5L6LB 2CFTA 1BNCA 1E5QA 2ZVJA 2E9SA 2V7VA 1EX7A 1TU0A 1Q50A 1X80A 2RBGA 3IIMA 4MUJA 3KAPA 5E7JA 4D9EA 4DC0A 4XD2A 5B1DA 3U4QA 4V0QA 1IZ0A 1J9EA 3W9YA 2OBMA 4BU0A 1GEEA 1KGDA 4WN3A 4D4GA 5JIBA 3L8HA 5FBWB 3ZI0A 1Z7EA 1HEUA 3SBEA 3ADCA 1VYUA 2OZVA 3DP7A 3ZWPA 1PNVA 4Z4FA 1Y98A 1ZGAA 3I92A 4ZALA 3IJPA 1YSCA 4MPPA 2GK4A 2PXCA 3CR7A 2ZSAA 1BMQA 1DBPA 2ZRKA 3GJQA 3PFWO 2AL7A 1N5JA 2G09A 1RBYA 3CF6R 3DHYA 4QWMA 5K8LA 2DQZA 3S1AB 4FN4A 2SBTA 5MFZA 3F2VA 3GLIB 2I4MA 4EJ0A 3EH2A 3RT7A 1XCGB 3D4NA 5CX1A 3WWDA 2ZTLA 2HHJA 2P65A 2XMDA 4P33A 3ZDZB 4Q9NA 4BO2A 3B51X 1T26A 5E6RA 4R1NA 4UTNA 2IOFA 4BX2A 1VHTA 2OL4A 1XC7A 3HS3A 4GMGA 5BSRA 5LBTA 4AJ1A 4A36A 4LK2A 4OKSA 1AQ6A 1P3Y1 1XCMA 2AOUA 1Q1NA 4K6HA 2W4IA 2ZZMA 3CPHA 4YAOA 2Z09A 2UYOA 2JAPA 1CV2A 4X71A 1OYYA 2OFWA 1EEXB 5DE3A 4L6IA 2NNLD 4BNGA 1FOEB 1SEVA 1YRQA 1ZDMA 5LA6A 1RHUA 3EOAI 2X15A 1R8JA 4P0PB 1XD2B 5CDUA 2EIHA 5FEMA 2P6UA 5AW9A 1JEQB 1PNOA 2NXEA 3IRVA 2Y77A 4RK5A 1EBFA 4N5DA 1LJ8A 5K3DA 1P4JA 3O3CA 1X7WB 4AYWA 1REQA 4QGFA 3KPUA 4W9NA 5M3BA 2XQGA 1Y3AA 1THTA 5IYZF 2K87A 1G291 3QKRB 4I1PA 2OCIA 4I50B 3GRAA 2R5WA 4HLNA 3NEYA 5IDVA 1L7NA 2Y0CA 3CCBA 3KQPA 1O94D 3GNLA 4MPJA 4P22A 2AYYA 5K03A 2WFAA 3O6VA 1Z73A 5EUMA 4RSHA 4RDXA 3DOHA 1L8AA 4LDJA 2I80A 4WESB 4HMOA 4ZARA 2FW7A 3NQ41 2QV0A 3CEHA 1XA3A 4HEHA 3KSBC 4Q4DA 1N5IA 3E6AA 2Z4RA 4CMBA 4EKNB 1YZGA 2I6XA 3UJBA 4DANA 1LPBB 1IJKA 1PHPA 5I9TA 4BEVA 1E1CA 5IJ9A 1F1JA 1IY0A 3EFOB 3SSOA 4LRYA 2CY0A 3G0OA 2Q3LA 1ZHFA 4AI6A 4EI9A 4RETA 3ZWBA 4WUTA 1P81A 2QTTA 1V4BA 1PWHA 3G2NA 2NO7A 3KYIB 5BYAA 1WA5A 4R68A 1XVAA 5A4IS 3RRYA 3GEEA 2G71A 1W5TA 3ONEA 4RENA 2OHVA 1GKLA 4EUKA 1ULUA 1FBTA 2IHUA 2VDRB 2AFHA 1Z83A 1HDIA 2D1RA 4A2CA 4DV4B 1EHCA 2WF7A 3BQ9A 3CVXA 1L7MA 4CLHA 2HV8A 5CVUA 4YRTA 2IX9A 4YJFB 2CL7X 5L4NA 1P1RA 1X1CA 3LOQA 1T3TA 3OX2A 4WMLA 4E33A 1AH2A 4GO1A 1AGXA 2FKNA 4E5SA 1SVKA 3LW8A 5K3CA 3JQ8A 1JU4A 5EAIA 3FPSA 2IHJA 2QTZA 2VNSA 3PTLA 4KFRA 2MTBA 4PYJA 3RS7A 4HNVA 5KB3A 3AJEA 5ESRA 4DIEA 1IZZA 2FQQA 2ZRDA 4RLFA 1Z35A 1YACA 2C7RA 2IY9A 3AKDA 4OJYA 1XQXA 3WKDA 3A04A 4L95C 1ZCJA 5JCXA 1JEEA 2JL1A 3JSXA 1C9NA 2FZLA 1I0LA 3OCCA 4Y9UA 1NUSA 3IE1A 1EDOA 3N0WA 4UVHA 4BBAA 2OV1A 3NCHA 1P1JA 3GLUA 5HW0A 1UPUA 2JH9A 4OQNA 2FK7A 2J9XB 2GPBA 2WWHA 3DUWA 2UXCB 1T9AA 1P2VA 1Y80A 3LTNC 5LP6B 1NJ8A 1SD5A 3H1TA 2BMEA 2WWXA 4FT4A 5LQRA 1IVYA 3KT8A 4EABA 4ZEOA 1EFRD 1HTWA 2BZGA 2DUWA 5SYNA 3V1MA 2RHJA 1MFZA 3NHAA 2G4LA 2IOFK 3RRBA 2PLWA 4YP7A 4B7CA 5HJEA 3MTEA 3X1DA 2VZ0A 4PAQA 3HLKA 5KVVA 1GVHA 1KH2A 2J0UB 1CQWA 1BXRA 4JU9A 3D7NA 4ZI7F 5HJ7A 4FQ8A 1TAUA 2ZG6A 1N2OA 3PC4A 4PGGA 3HDQA 4AD8A 1D5WA 1L7OA 1T4CB 5DRTA 3RRNA 4E1VA 2OECA 1PX2A 5CT5A 3NBZC 1UQTA 5JAZA 1OU0A 5DNVA 4EYSA 3P2MA 1RADA 4GR9A 4HAVA 2MT9A 3F7NA 1MABB 4MWOA 4PSAA 1X3SA 3AP2A 3CBGA 1U0BB 2XWSA 2AJCA 1SVMA 1NU8A 3JZFA 2IGBA 1M2OA 2PKRA 2BMDA 1UKZA 4FYMA 4G01B 4AFNA 5LXTB 2I0FA 5F3RA 2F48A 1DDIA 2QMOA 5AUNB 2I9KA 1K2WA 2AE2A 4KXLA 3AUAA 3RWBA 4EQZA 3W8RA 3BM5A 2J7PA 1CYDA 3A4YA 3TNFA 1WLSA 3EN0A 3EXFB 3P97A 4MVWA 3IB3A 4PZ0A 1SKUA 2WSIA 3GBSA 4XQGA 3SU8A 4DA0A 2WJYA 4DDWA 1NI4B 2EJUA 2W2KB 3BGVA 3U3MA 1PJSA 1U9IA 3H2JA 6GPBA 1QU2A 2AV6A 2WP8J 2GM5A 4M1SA 2O9JA 2HBRA 5FBLB 1JE1A 3VPGA 1Z6ZA 1FFXB 1U8XX 4Y0AA 4UHFA 3L2OB 5K6AC 2EARA 1F0YA 1KVRA 1JJAA 5KVQA 2HD4A 4HWGA 3TOXA 1DIAA 3ZLVA 3IOMA 4URHA 3DL0A 4BO0A 3NFYA 1QAOA 4DSTA 3KUDA 4CF3A 1LZLA 4IJMA 5KPJA 2HLHA 1KJIA 3B9PA 3QVUA 1WPRA 4P6VF 3SAJA 3IIEA 3UQZA 1KYIA 3K1ZA 5CB4F 2O0JA 3WO0A 3ZD6A 2MR6A 1TM1E 2ZDQA 2FY8A 3GJTA 3NKLA 4PLTA 2E37A 3RTBA 2WTAA 2CZCA 2RGYA 2ATVA 3JWIA 4HDMA 4LJ7A 2ODNA 4O4HF 1DCMA 4NENA 4V1CB 2HPVA 4QBIA 2GARA 3MCAA 1KMHB 2O8FB 2BL4A 1RM5A 4DYVA 2Y66A 3KKZA 5JSQA 2JGKA 3KL2A 1L4HA 3Q7TA 1NP3A 1TD1A 5BSHA 3PNKA 3VHQA 1W8IA 1N6LA 2WJZB 4U7JA 4E31A 5JC8A 3FCOA 3QEMB 4EGSA 3CBQA 2C4VA 4GRAA 1L7VC 3RRMA 4EJFA 4BDSA 4RVDA 4CT0A 1E8MA 1QHIA 2VAVA 2YQ5A 1JJBA 3Q6IA 3QLUC 1W9MA 2OO5A 5CH8A 4B6OA 4M0LA 1AUOA 1W0JD 5F52A 5KKNB 2QUZA 4BLTA 3DA8A 3MRTA 1P72A 3WYAA 2P69A 2WU8A 1MB9A 2Y92A 4H3HB 1XF9A 3EPHA 5EXEA 1CZNA 1JNXX 1I33A 3RV3A 3F9IA 4L78A 4ANFA 3LTEA 3CGWA 5AD1A 2E4ZA 2XODA 2G06A 5COQA 3GFQA 3EEFA 3RAPR 1Z16A 1XDWA 3C8ZA 2MIIA 4BFYA 3JPYA 2X1LA 2DBZA 2Y1FA 3H5RA 1QFMA 1H5NA 1Y0BA 1XG5A 3A2MA 3EB9A 3HXPA 4EP1A 1FYDA 3H6HA 3NAGA 3A1WA 2ZQYA 3BD8A 5JSUA 2MDTA 3ZJYA 4P4SA 1UFOA 2G9ZA 1T3GA 4X66B 1NHGA 2EL7A 3OE7A 2AOXA 4D9HA 3K05A 3GPBA 3H2YA 1M8JA 1XJ5A 2PMDA 3GJ4A 4I5GA 2Z6VA 3LGXA 2XIJA 4O4LA 1KSGA 1ZMBA 3A6DA 3ABOB 3NBKA 4WKNA 2HQ1A 3AR4A 4U39A 3SK0A 3W78A 5KOJA 5ISMA 4HGOA 4B40A 3TFQA 4ND1A 4KSYA 4MR7B 4Q18A 1LW7A 5B7QA 1ZOPA 3IAAA 4ENTA 3BYZA 1UAGA 4EZBA 1Z29A 3HR4A 1I2ZA 4YAJA 3UPTA 5EQJB 2QAGB 5I7OA 2ANCA 1ZUIA 1JIUA 2BFOA 2M9MA 2SKDA 3T3IA 4D57A 5D7BA 1Z0SA 2G4CA 4RORA 4DDTA 3SBXA 2GA9A 1ZL0A 3DBIA 2YQZA 2G9RA 3MTQA 3IOYA 2PBLA 3MWEA 1ANKA 2ZJZA 4KO1S 4X6XA 3ISTA 2WKRA 3WKAA 3ZYZA 3PPXA 3IVXA 3U44A 1IBKB 1FP4A 1A9RA 4MW4A 1ENYA 1WG8A 3AY0A 3ZKWB 2ZRFA 3ZNQA 1EZZA 4R9NA 4FGJA 1NDHA 1NRXA 5LB2A 2ZYWX 2XH8A 4MRRA 1QGED 2EJTA 3BXPA 4EYEA 3PWTA 3KZOA 2HBZA 1MO4A 2P4EA 1QGAA 1UMBB 1WUYA 4INZA 3TRHA 3E5HA 1T4DA 3WLKX 3WX0A 4E3ZA 3FNRA 1UBSB 1T8RA 2ZIXA 3DEKA 4V0ME 1L6IA 3SHVA 3TX2A 4GQAA 5BUSA 3SS8A 3B8HA 3MS4A 1GT91 4I6EA 1NQ5A 1M8PA 4BC0A 2ZYSA 1H3NA 1XPJA 4OK5A 5AVKA 5LWQA 5MFPA 1YDMA 4BNVA 3O95A 2B8WA 5ERYA 3O4GA 5SZJA 2V4MA 4MS3A 4NEGA 2Q5IA 2JHPA 1FFWA 5HCNA 1RPJA 5COAA 4OGWA 1ZKMA 2GJSA 2Z57A 2OZKA 2QR3A 3CZ9A 4Q4JA 2C59A 3DEYX 2LNDA 1X38A 2XKJE 1IB0A 4C7MA 5L8VA 4EPVA 3EXG1 1ZPDA 1CEQA 1UP7A 1Z88A 3II6X 4G89A 4JY7A 4RK4A 4Z7OB 1X1TA 1HSZA 4NULA 4P4LA 4M6WA 2XE7A 3ERCA 4CTKA 1P2SA 1C41A 4GZ6A 2R6FA 4UBMA 5CAEB 2WD9A 1IHDA 5AIBA 2IW3A 1KDVA 1W9HA 4MJ3A 4EA7A 4QX6A 4QBFA 2OB2A 3LX4A 2PJRA 1D4AA 3K32A 4LNHA 3UB4A 2QW0X 2R2AA 2WY2D 3R5HA 1I2AA 3VR6H 5K0ZA 5KQGA 2PT6A 4JVMA 3VISA 1AQNA 2ORWA 2J9FA 4UQPA 3TE7A 3PU6A 4R2JA 4ISBA 1HNZB 4KZKA 3EEQA 4DRYA 5B7PA 4RO0A 1JJVA 1V11A 2EXXA 2NXCA 3RSFA 1WHSB 4DJDC 4YDQA 2BHRA 4CF7A 2ODQA 2R6JA 4Y30A 1TQ6A 5D3QA 5EPEA 3O4IA 3VO9A 2RHTA 1UK8A 3KOYA 5F4ZA 2HRQA 1G20B 2X19A 1T43A 2VF4X 3C6ZA 4EFLA 1RTKA 3AVTA 1A5AB 2VHYA 3ZKAA 4DLYA 3SHWA 1PJCA 1KI1A 1UDCA 2VSOA 3TNYA 1BCSB 2N3ZA 2E5FA 4MV8A 4YONB 1NWHA 4QA9A 1PEKE 3IB6A 1U11A 1PGJA 1KHTA 5KCZA 3SHTA 1NM5C 2QD3A 4Q9DA 5CXUA 4AZTA 4PLFA 3QXCA 4CR8A 1N36B 1U0OC 4M9QA 1SCDA 2PZMA 4FFWA 4DA9A 3USCS 3QK7A 3FCEA 1XIVA 1BKYA 4LXTA 3LIIA 4L74A 1H2WA 3ZJ5A 3QF4A 4QDOA 3F1LA 1XYYA 3PIDA 1JAHA 4R6XA 2PKQP 1X13A 5FNVB 5IJAA 4OU4A 4ESOA 1BGXT 4BFCA 4UOZA 3ROTA 4M9CA 4PLWA 5AM3A 1RCFA 2QXYA 5ERXA 5B6PA 2W2OA 1JAZA 3NZEA 1I7LA 1YU6A 1KMQA 2ZIFA 1PTJA 4RH0A 1B73A 3OLWA 2PWAA 3W8EA 4RV4A 2IITA 3D6UA 1YIDA 4NS4A 2HU7A 3IDFA 4Y6OA 2V7QD 3H84A 2WLSA 4JA2A 3T5BA 1XZ8A 4DMFA 2ST1A 4NMMA 2AFIE 3I5XA 1SA0A 4WOKA 4R5HA 3QFTA 4KPFC 1PVVA 3ILHA 3BAFA 3BIFA 3R9WA 1BE8A 2QRJA 1OI7A 3A4IA 5EP1A 3TIFA 3ZLJA 3OUZA 5D85A 2LKCA 5DASA 5K2OA 2ZB3A 2WQ6A 3KQKA 4Z0PA 1YNSA 2CZQA 2FF5A 4ZXPA 5LJLA 2H16A 3WYGA 5A2QA 4NPHA 2I2DA 2QN9A 1ZX1A 1LA2A 1RXWA 1LSJA 4PZUA 5G1OA 3OKPA 4CKXA 4DJAA 1E79D 2ZR7A 3G2IA 4FFOA 4QODA 1RRKA 1X1DA 2IYXA 1NW5A 1E5LA 3IALA 4PPFA 4MGIR 3RRZA 3LDAA 5FBHA 4W8HA 5FFFA 3RUPA 3WK6A 4RD1A 1P1CA 2IPMA 3DE1X 4LWQA 4YTEA 3QW2A 4K9DA 4HRVA 3TXXA 1XZHA 3RUFA 1UIMA 4M37A 3BE6A 1J39A 2OC4A 2J09A 2DVMA 2ZB2A 3L93A 3N8NA 4Y2HA 5ALWA 3OD5A 3TNJA 2NUBA 4H27A 1P4RA 2FV8A 2CKMA 3IEUA 3MJEA 1KP9A 1FMTA 2LW7A 3NOXA 3P9PA 1ODSA 4IJVA 3NBXX 2A6PA 1RE0A 1T5OA 3ZZ0A 4D9IA 2M6LA 1OPXA 1DC3A 3PEEA 3B1XA 4DM4A 4P7GA 1V47A 2CWWA 3KXIA 1W87A 2L18A 1ZNYA 2V8OA 2H1OA 3V33A 2JBAB 2VYNA 4AKIA 2DPYA 3BXOA 4F2GA 2HCTA 4CQMA 5E3JA 4BMYA 3THWB 4A2QA 3KPYA 2XMCA 3KVYA 2WP0A 5DRYA 2PKEA 2YHIA 3SKXA 2C0QA 1XDZA 4U4AA 3TL2A 3GHYA 3DDZX 5JR3A 1D2MA 4YEDA 4YV2A 4RZ2A 1RQPA 3RFVA 3SC4A 4RMNA 4B3BA 3DEJA 2A92A 1FW8A 2IYAA 3QPWA 1QR2A 2E4AA 4IGEA 1T2FA 1X19A 1WCV1 4GX2A 1BFDA 4LKOA 1TA4A 4W82A 6PFKA 2Z8YA 4W6QA 5LYJA 4NYIQ 4U2DA 3DMHA 3PGXA 4QLBA 3HKDB 4LV5B 4JYZA 1RRVA 4EB6B 4L75A 1VZ3A 4DRXA 1QBGA 2NIPA 3WIEA 1PDOA 4ZIRA 4M49A 2XZOA 4BNNA 1UJMA 2I1LA 2WSSA 2ZBFA 3G9TA 2BLNA 1Q1ZA 1N2JA 3UJ3X 3F67A 5CITA 1OZFA 2YJZA 2JCSA 4KR3A 1Z7BA 4DDUA 3HGQA 4FYIA 3OAAA 1ML4A 2QLMA 2VNAA 1LJUA 4ARAA 1SMKA 2VH2A 4QU9A 4F04A 4RDIA 4ZVPA 4D6PA 3DL7A 4LJ8A 3UHJA 4DDVA 2JAOA 3F71A 1ZA1A 2GN1A 1V3TA 2VF8A 1MJGM 2VPXA 2AHOA 5GM2A 1T8WA 3OE1A 4GPBA 1LPMA 5IZCA 2D2FA 2PH3A 4YMSA 1LK0A 4MIEA 1NBEA 3FPLA 3Q2OA 3JAMA 3IC5A 4AL4A 2C54A 1I0ZA 1UDXA 2A9VA 5GIOE 3U1VA 5LZ8A 4P2GA 2LD4A 1E2EA 1YVUA 4RK7A 5IK2D 3Q10A 2GJ9A 2QI9C 3LUDA 2YY6A 2Z1MA 2CUZA 3TLXA 1KQFA 2R5NA 2A9PA 3P94A 4AJJA 4Q03A 1YDHA 2YZ2A 4F38A 4DLXA 5BVGB 4A3SA 3EHEA 5LU9A 3F5FA 1E2LA 2FXVA 3I9V1 2BFCB 3GFFA 2UUPA 3R20A 4JC5A 4PPYA 3IP1A 1H2FA 2ZBEA 4MAAA 4ZV7A 1QYWA 1CVRA 1GUYA 2Z2IA 2HHLA 5FOVA 2HM7A 4R41A 3VSBA 2Q28A 2GYYA 4MWGA 1JG4A 1N2SA 1TEVA 2X0IA 3FSEA 4NP6A 1ODCA 4NV1A 4RELA 4WBXC 4XYMA 4TLDA 5H82A 1E2GA 3PPWA 5BYKA 1MT3A 4GBJA 1QOQB 3ILVA 1NVVQ 1P44A 1PNRA 1ONPA 3DW1X 3LY9A 4ZQGA 3P71T 3L9XA 3AU8A 4OYRA 1VKNA 1MQ9A 3D4OA 4PVDA 3GLHB 2GWRA 4NK5A 4FFPA 3SFTA 4FKZA 1N0IA 1RPNA 2C1ZA 1KJ9A 4G3XA 3FTNA 5HMLA 2JJ2D 4GPAA 4QJBA 5BOVA 4QFCA 4ZEXA 4L22A 2X4DA 2ZRJA 3QIVA 3QJYA 1K08A 4HF7A 1R5OA 2CNNA 2NUAB 1NPDA 3KTDA 4I99A 2HK7A 4MQFB 3PJDA 1VMEA 3V4FA 4G0YA 2OVBA 2WHRA 3KHSA 3AOEC 5SICE 4YNBA 3ZWXA 2JD2A 2ZSBA 3QU2A 2WDPA 1VRVA 3AJ9A 4FDTA 2VPPA 1OBHA 3ACBA 1ZH8A 2EFGA 4AZ0A 1WXFA 3KBBA 1J07A 1NVFA 1VCHA 4A91A 1DT5A 3OCZA 3NAMA 3PI6A 3LT2A 1BO6A 4NFHA 2PUCA 3VR6A 3V7NA 3MILA 4BWGA 1S01A 1W73A 1L5MA 2XAUA 5H3CA 5LUBA 2YS7A 1QV6A 1YKSA 3ES9A 3GAFA 3ZVMA 2ZJOA 5KOHA 5IEJA 1ZI9A 2B82A 3P0HA 1DRVA 2XYQA 3GCGA 3MBIA 3IOEA 1BH2A 3L02A 2IHVA 1Z6QA 4QQNA 5EIBD 2WUEA 1SOVA 1L5YA 3RK1A 2D7DA 1TLTA 2V9CA 4F3YA 2I33A 3HVUA 2OBBA 3WA7A 3D4LA 1KK0A 4ZT3A 4II3A 4H7EA 4UTZA 4O2RA 5CFQA 1NOKA 1V95A 3KCQA 3M6WA 4BO5A 5HRAA 2G6TA 3UAOA 4GR4A 1RAAA 3MLEA 3EIWA 3THYB 1Y4UA 4EPTA 2C2GA 2I1WA 4X61A 1IPFA 3H4TA 4DR1B 2GRUA 3LHDA 4ZVKA 4AUNA 3F0TA 2WNHA 3C3PA 3WC4A 1QXSA 2JFWA 1R4ZA 3ANLA 3VZSA 5TT0A 3E8MA 2HWKA 3ADDA 4FFMA 3CO5A 2DR0A 2ATEA 5AKHA 3H86A 4E4YA 4G36A 3UK2A 5GQSA 2FPXA 4RTLA 1FYFA 4BNJA 1YNOA 1H05A 3H87A 1P1BA 4WZBB 4IQ4A 1GM5A 4ARIA 1AKRA 1R64A 1ZIPA 2RKOA 4MYSA 3DXZA 3E3OA 2XYVA 1AKUA 1Z2EA 4A6DA 4UPEA 1RFGE 3A8TA 4TLAA 3V8PA 1N2GA 4RBNA 2HF9A 3S70A 3HKEA 1LV8A 4W4TA 2HTEA 4WDRA 3VR0A 1RXCA 3GLTA 5JU6A 2IUEA 4B82A 1Q92A 4I4NA 1V1JA 4TLBA 4BE4A 5CM9C 3ZI7A 2DLCX 3NB0A 3OJEA 4X8HA 3S40A 3TZBA 1NXPA 5LQNA 3AR5A 3HBJA 4KFTA 3CPEA 4X44A 4B8WA 5K8TA 2AKEA 1J5PA 4PSKA 4RFVA 1R37A 1MOSA 1TFRA 3LO8A 2QBYA 1XZNA 3HCEA 5DPMA 1XMXA 1ZU4A 4DM7A 4CEHB 3LF1A 3E7XA 3DDSA 3KPVA 2QSZA 2GEJA 4DQUA 2BKUA 4Q9JA 2I3GA 2H8GA 4JR2A 1I32A 2YV1A 4JUFA 3UJPA 2J30A 2A9OA 1PU2A 3M1LA 4KRXA 3RC7A 3K9HA 1ECPA 4DBVO 3G8YA 3OF5A 1XU7A 4BV9A 2EYUA 2Z83A 2C4HA 4L8WB 4FS3A 3I9V6 4UE3S 4ZVNA 3BHNA 4L6AA 2A33A 3MD9A 5AVQA 1WXGA 3L0ZA 1DE0A 1GV1A 2VWQA 2JLBA 2PL9A 1E2UA 3B20A 2Z8ZA 3LYUA 3A31A 3O8QA 1IXKA 1LQTA 2EJBA 2ZYRA 4MP8A 1KRHA 4HC4A 5CH5A 3H05A 1ESEA 3HYLA 2WQ7A 4IUDS 5EUQB 4CM9A 3WZ2A 4O4IB 1YZTA 3KYDB 4RPLA 3JSAA 3U6KA 2JIQA 5M2QA 4R8VA 1ISMA 4TS4A 4HLUA 3RNOA 3CSDA 2FG7C 2INGX 4Z51A 4G0WA 1KC1A 4IIJA 4Q21A 1G60A 4YCMA 5JZMA 1DAMA 3MYRA 1QLHA 1QNLA 1X7ZA 2ZTSA 3OA0A 4FR5A 4L5JA 4BAGA 4QBTA 1Z4LA 4ID9A 3MJFA 4MWSA 2JCYA 3SJAA 3TDKA 1RWPA 2PQ2A 4DHEA 1R0SA 1Q16A 2BUCA 4GLLA 1Y1RA 4KQGA 4GMXA 1P1IA 4JP3A 1UZMA 1F7VA 4GSLA 2V3WA 1ECLA 1NULA 3I28A 4AKGA 3OZEA 1ADCA 1X15A 2ZBGA 3A0UA 2FPRA 1KERA 5F64A 1QF7A 2QI9F 1RM4A 3DT6A 4WFIA 3VFDA 1JKMA 1U7HA 1FMLA 4FD2A 3ZD7A 2P6OA 3CVWA 1HDEA 1NXWA 2C2BA 2YIVX 3D7SA 3HZZA 3V8EA 3M81A 4AULA 4OXNA 4ZGGA 2K4MA 1YR7A 4HNUA 3AI1A 1WBDA 4CCSA 4HNAA 2OEPA 3ZJUA 1G7TA 4S1VA 3ESDA 2WD7B 1J4AA 1NRWA 1WLYA 3B2NA 1U0SY 4TKVB 2AR7A 5HKLA 1W88B 3KWJA 5FLKA 3WBKA 4AIRA 4DILA 1ZR2A 2WJVA 1CBUA 4O63O 5F4BA 4X8OA 3FFTA 2X0DA 1Q77A 4JP5A 3W5SA 1X77A 1K6EA 5C5EA 5EI5A 4BMOB 4DFDA 4DMKA 3W77A 1G18A 3Q9UA 3QYPA 3UIEA 3DGFC 5DMHA 1XJCA 4FB5A 3LLMA 1ZM9A 3LS2A 4FOPA 4C30A 5JNUA 3KAKA 4XW2A 2Z9CA 4K40A 5F12A 1F8FA 1KI7A 1K8YB 2A1UA 1M66A 3FUVA 2IZ5A 2NTVA 1ZP6A 4X7RA 4YREA 2GLTA 4J4HA 5FA6A 3WNBA 3QXJA 3BH6A 4MR8A 2ODEA 3MQ4A 4K6CA 3THSA 2YCLA 5ADWA 4MDEA 3AF4A 3FHJA 2IPNA 4RIIA 3ZH9B 1DDOA 3CEPB 4O4JB 5KDLA 3AIKA 3CEAA 4AYTA 4V1CI 3SC3A 1NTOA 4BB9A 2UDPA 4D79A 1O7JA 2VDWA 3N2NA 2AA3A 2NUPA 1LEHA 1Y6FA 5TEVA 3U09A 3L4JA 2H4WA 5F21A 4FC6A 1T2VA 1A2OA 3F6BX 3C3EA 1P4AA 2FW1A 2GN9A 2WUWE 3IELA 5BQXA 3OX4A 5I9NA 5EXTA 1C30B 4ZAWA 1WOMA 3DWGA 3TZKA 5JHHB 5BN5B 4I81A 3PUJA 4G0PA 4C5BA 4ZZ0A 2QTMA 3A05A 3RUEA 3PQ2A 4BXOB 2CUTA 3AHEA 2VZLA 1XTTA 4U7TB 5LZ9A 1T25A 5E4TA 1MOQA 2ZWOA 3BFKA 3PYLA 4K28A 3AGPA 3CQ9A 4MNTA 1V2GA 3G89A 5EXDA 3I12A 5DWVA 1YRBA 3KFLA 5F33A 4V24A 3UUEA 5BXYA 1TCAA 4PFJA 3RFXA 5IJ0B 1XEXA 4PC2A 1ZIDA 4BB0A 2WU3A 3ZXYA 2D2VA 3FB4A 4RAOA 3D6JA 3MSCA 2X23A 5THQA 3WICA 4A9AA 4OMUA 1IC6A 3KU1A 4LV8B 2R84A 4F4IA 2R8XA 1KMIY 1KJ8A 3FRHA 4LJ6A 3ZHZA 5E6SA 5J2UB 2IVFA 4IOKA 1I8TA 4I1UA 1UFKA 3IQWA 5HVNA 3BMOA 2BMJA 2OTCA 3QWBA 3SWWA 4IJQA 3PUXA 1XTZA 4F56A 3TDNA 1JQ5A 1N5OX 1SCJA 1XNHA 4ZYWA 4A4DA 2OLJA 4JELA 3HRKA 3HEAA 3HM2A 1D1TA 2QXTA 4KR0A 4R71A 1OXBB 1PL8A 1RM0A 1YK1A 4Q02A 3TNDA 1DSSG 1LBSA 1MVOA 1SU4A 1IN1A 2DG2A 1HQKA 1GYRA 3HR8A 1C81A 1D07A 3RS3A 1A9PA 4XIYA 3IXLA 2YC2C 3QXGA 3PGVA 3IKVA 1X8XA 1B16A 1HYQA 1OMOA 4QHYA 3K71B 3UV3A 2JKYA 2UYCA 2BM8A 3SS7X 1NLYA 1L6RA 4RAQA 1XNRB 1F3OA 1UT6A 3IPAA 3DXXA 4N3AA 1F12A 1ZK4A 4UXIA 4C3UA 4B4VA 1BJKA 1GZDA 1NMSA 3MB8A 2GRAA 3PNVA 4E5DA 3K2QA 4W5QA 2PMBA 5KKCA 1PD0A 4O3FA 4DIFA 1QX3A 2JK1A 1DDGA 3BULA 3URKA 1PYOA 3KKKA 2WC1A 1V0JA 3F96A 3PLRA 4AG6A 2HSWA 2L42A 3CMCO 3GLGE 4YRBA 1KI6B 2Q29A 5AOCA 5AJVB 2AKYA 3OQHA 3P27A 1NDQA 4HB3A 2PO5A 5BR8B 3RC9A 1E6CA 2DWUA 4WBNB 2FMXA 4KQ6A 3T5TA 1SKYE 4PGFA 2IIQA 2J6BA 2EBUA 2VC2B 3Q5GA 2Z2JA 2R1TB 5GM1A 5A6VA 4Y2PA 3DBRA 3KALA 1JYFA 1NY6A 2WJJA 1PJRA 3EGXA 2HDHA 2VT7A 4OL0A 1XMQB 5IVDA 1OVMA 3W1VA 1YQWA 3QE4A 2IPXA 3HN7A 3U37A 1B00A 3OSUA 4J6FA 1LX6A 5KREA 4B44A 4M9RA 3CX6A 5J5AA 3VR5H 1RRFA 2HC9A 5HS6A 4OHWA 2XCOA 4OQQA 1YR9A 1L3IA 1XI2A 1HA3A 4R31A 2P4QA 2IXGA 4NICA 5FI1B 1KAQA 5GJCA 5H4HA 3A6HA 3L0SA 4UATA 4PLCA 1ORRA 2B2NA 3QP9A 3GPDG 1OWPA 2BFMA 2OWDA 5L7TA 2ET6A 1X8JA 4C04A 4RVHA 2JEYA 3EVGA 4KIFA 4NCJA 3FOAA 3IH5A 1M1YB 2JJ8A 2YXBA 3FBWA 1NVWQ 1FU8A 5AW1A 1DX4A 2EKDA 2ODTX 4KE7A 3I2FA 3WB9A 1EGVB 2QWXA 1R9NA 3L43A 2XWPA 1QIFA 2B69A 2V59A 5ED4A 5DLYA 1FCJA 1U5BA 2D4AA 2HSZA 3CS3A 1QQ6A 3QU5A 4J6EA 4MUBA 2R8OA 4DCVA 1NL3A 4X5OA 1P17A 4HEA6 4U6SA 3CN9A 4XX0B 4POAA 1XVLA 1SZDA 2Q6OA 4ZC8A 4DLVA 1Q0TA 1TEZA 1M6HA 2WKPA 1JEDA 5FV7A 4ZFNA 2IKSA 3AESA 3NIWA 4PWZA 5CNMA 1JDJA 3PT5A 4BX8A 2IYYA 5H59A 5CG2A 4PCLA 1XRPA 1WHTA 2ZBUA 3IEIA 3G6KA 1RXUA 3DMDA 4D99A 2GK7A 2AVNA 3TLYA 1UXJA 2QSUA 3AY3A 2R7LA 4L5CA 2IS2A 1X80B 2GAOA 3GT3A 5K6AA 2GEKA 2UUCB 1M2HA 5DN6A 2YBDA 4HBGA 3GJ6A 1XQ6A 1PJZA 5FA5A 3TPZA 1D2CA 4KQ2A 1E9CA 4PLZA 2OHXA 5C7IO 2QU7A 2M6SA 2PD4A 1EK5A 4LRSB 4M8SA 1SRQA 5A4MS 4CW7A 1ZESA 5CD9A 4QZVA 2GESA 5K3OA 4NONA 5HEKA 2VQFB 1J9GA 4HQRA 1QFSA 4BNHA 3WZMA 2JGDA 1E4OA 1K27A 4H7KA 2GBIA 4MEAA 4MITA 1I3MA 1WU7A 1FFEA 2YASA 3FM9A 1C7RA 2I2WA 2NQ8A 1WUIS 4HLCA 5HHTA 4HAOA 3U5TA 1IN7A 3DB2A 3CVOA 1OSNA 1A8IA 4QU5A 3SQDA 5F2NA 3B13B 1HZJA 4FNOA 1OREA 1SBNE 3ELBA 3TE6A 4ER7A 5I5EA 1EGAA 1BCRA 2Q3HA 4NCIA 121PA 1JE0A