4HO1X

The crystal structure of haemophilus influenzae o-acetylserine sulfhydrylase at 1.85a resolution
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
310
structure length
309
Chain Sequence
AIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVCRIGANMVWQAEKDGTLTKGKEIVDATSGNTGIALAYVAAARGYKITLTMPETMSLERKRLLCGLGVNLVLTEGAKGMKGAIAKAEEIVASDPSRYVMLKQFENPANPQIHRETTGPEIWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDLSIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSASERYLSTALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine synthase
publication title The Crystal structure of Haemophilus influenzae O-acetylserine sulfhydrylase at 1.85A resolution
rcsb
source organism Haemophilus influenzae
molecule tags Transferase
total genus 118
structure length 309
sequence length 310
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2012-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ho1X01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ho1X02
1J0DA 3VC3A 3VSAA 5J43A 1JBQA 1PWEA 2RHGB 4ZQCB 4D9FA 1CW2B 2CLMB 3SS7X 2J9ZB 1VE1A 5DW0A 1TZJA 5D86A 2EGUA 5B36A 1UBSB 4LMAA 2ECQA 5D85A 4D9BA 3L6BA 2CLLB 1KFJB 2PQMA 5KZMB 1BKSB 1V71A 4D96A 1K3UB 2ZR8A 4NU8X 1Z7WA 4I1YA 5J5VA 1VB3A 3SS9X 4JBLA 1FUYB 4HO1X 3IQIX 2ZSJA 5B3AA 4D9IA 1TTPB 2J9XB 5IXJA 4L27A 2DH6A 3AEYA 4ZU6X 2CLHB 5B1HA 1A50B 2TYSB 3L6RA 4Y6GB 1J0EA 3T4PA 2J9YB 2CLFB 3V7NA 1E5XA 1KFBB 1J0BA 3PC4A 1UIMA 5C3UA 4D9MA 1TZ2A 5CGQB 3DKIA 2V03A 5DW3A 2CLOB 4D8TA 1KFEB 2CLIB 4AECA 4D9CA 1O58A 1K7EB 1K7XB 4HPXB 2Q3DA 3PR2B 1TZMA 2ZPUA 1QOPB 4KKXB 4L28A 5I7WA 3BM5A 3DWGA 4D9EA 2D1FA 2O2EA 1C9DB 4LI3X 4OREX 2BHSA 1J0CA 4NEGA 2GN1A 2TRSB 4PCUA 3VSDA 1P5JA 1KFCB 4D9NA 4D99A 4L0DA 1TJPB 2GN0A 3TBHA 1C8VB 2ECOA 3VBEA 4AIRA 5IWCA 2O2JA 1M54A 3FCAA 1Z7YA 3R0ZA 1CX9B 2TSYB 2RKBA 2BHTA 5EY5B 5IW8A 4JBNA 1A5SB 3R0XA 4QYSA 1FCJA 5JISA 1X1QA 1RQXA 3X43A 4OFXA 3IAUA 3IQGX 3SPXA 2C2BA 1D6SA 5B53A 4D9GA 4F4FA 5T6MA 1BEUB 4ZU1X 1F2DA 2ISQA 4D8WA 1OASA 2CLKB 3PC3A 2GN2A 4HPJB 1WDWB 3PC2A 4LMBA 4D92A 1TDJA 2EFYA 3L6CA 1WBJB 2Q3BA 4H27A 2RH9B 1C29B 1Y7LA 1VE5A 1KFKB 5D84A 5I7AA 4L3VA 5I7HA 5B1IA 2JC3A 1K7FB 3CEPB 5I6DA 5DBHX 1TZKA 1A5AB 5DBEX 5DVZA 5I7OA 4D8UA 2WSYB 3IQHX 5B55A 1PWHA 1WTCA 1K8YB 1WKVA 5D87A 4XUGB 4WX2B 3RR2A 5I7RA 4HN4B 4COOA 4HT3B 1K8ZB 1UINA 4D97A 3FGPA 4D9KA 2C2GA 1TYZA 1V8ZA 2Q3CA 4IL5A 2CLEB 1QOQB 3DWIA 3VSCA 5JJCA 5HBGA 3HMKA 1A5BB 2DH5A 5CVCA 5BW6B 3X44A 3ZEIA 5E0KB 1KL7A 3AEXA 1V7CA 5KINB 1J0AA 1TTQB 1K8XB
chains in the Genus database with same CATH superfamily
2CJYA 3O1JC 5J43A 3Q3GE 4ZEOA 4EBBA 2A7QA 2FSVA 2AOTB 4NWIA 4H0NA 4HJRA 1K5DA 3TRDA 4E32A 1JF8A 1IHYA 4OXRA 5ALFA 3WBFA 1BXKA 3ZBQA 2W8BA 1RI2A 1IG0A 4ZCMA 3DOIA 3UWMA 3WQBA 2C3PA 1X8LA 2Y4OA 5KX5A 1YVRA 4EFDA 2ZYSA 4MR7A 2ZIWB 4MUAA 1VIAA 2ODQA 2Q28A 2WHPA 5E95A 3CVYA 2IOQA 3OFND 3B51X 4HG2A 4MS4B 4NBRA 2QLBA 4RDXA 1WQ4A 1X1RA 3KJGA 4ZOLF 1NI4A 1BOOA 1WETA 1XVIA 4PX9A 4FB4A 3LBHA 4I3GA 1WBBA 2AH5A 3LY8A 3HXQA 1BDIA 1ZNQO 2QYOA 4C0BA 2ONCA 3KKOA 3OPXA 4XM2A 3PD1A 4IHAA 3ADCA 1FDVA 1U8YA 2BM1A 4QOIA 3C3XA 2PS9A 1OIXA 4Q4AA 1XU4A 5JSKA 2JFWA 1Y3HA 1U4NA 4IIYA 1NVDA 2YNMC 2ZYRA 4FZRA 2O57A 1P5FA 3ZE9A 1L8LA 4A7PA 1FK8A 2V7VA 2QLMA 2VATA 4GPIB 1FU8A 4GX0A 4TPKA 3WB2A 1JX6A 1RLIA 1KS9A 2Q3DA 2ZE6A 4B7AA 3ELDA 2ZG6A 2JGFA 3K31A 3QMVA 4UAGA 3KFXA 4B81A 2R751 2AMVA 2C4HA 1OU0A 3OZIA 2N9UA 3R41A 1KFCB 4ZZ3A 4MQMA 1SXJE 3RRFA 2YJGA 4UHJA 3ZGLA 1D07A 4D8XA 3VYUB 4O4HF 2ZZKA 1LPNA 1ZIOA 3C85A 1QIDA 4JHXA 4PS1A 2LIVA 1CUGA 4XJSA 4DLRA 1IOWA 5AKLA 1J22A 2H9AA 4EG4A 3KYBA 4YQEA 2JAXA 5EWJB 3WWYA 1RXUA 1X86B 2X6QA 3EJ6A 3P32A 4Q7LA 1GD1O 3Q2OA 4V0KA 5HILA 2IKSA 5KDDA 1P62B 5JV5A 3PNYA 4RM2A 4PNEA 1TCAA 2INGX 1E2MA 1EKXA 4GS5A 3V3KA 4YC7A 2HJRA 1E2UA 4D9GA 1E2DA 4C88A 2EHDA 5JD3A 3BHMA 2WIDA 4DG9A 4DS3A 2Q6TA 5IDXA 5PNTA 1GAXA 2ISQA 4QNMA 3I01M 1WXDA 5EWMB 4CMHA 4M55A 3QSGA 4Z5XA 2J33A 2I4RA 2FWRA 3SXJA 1IONA 3EVZA 1YBMA 4TWAA 2JFXA 3NHUA 1QHXA 1KFKB 1VSUA 2PH3A 3S8YA 1W4BA 1B76A 5L3QA 2GTHA 4B3GA 2ZTSA 3TLGA 3IXMA 4IILA 2G8NA 3GYGA 3JQ7B 4NONA 1U65A 3DMGA 5BV0A 4I46A 5C3MA 2P62A 3AC0A 2IIQA 1N5MA 1UMCA 2X5JO 3HZRA 5DM60 2P9JA 4YP5A 2BJVA 2RSLA 2L82A 2R5FA 4WK0B 1UKEA 3KCNA 3ETGA 1W5SA 2BR5A 5FTMA 2GF2A 1LSJA 2ABWA 3PX2A 2DETA 4FNGA 3OUZA 1QQ7A 2GPBA 4PAOA 4HDSB 4NEHB 1QYVA 4RHXA 4FI3C 3UWOA 2JGKA 1JR6A 1J5PA 1E7YA 1RXIA 5D5PA 5EJAA 1DOZA 1VJ1A 3HKEB 1QPGA 3FDIA 3R7BA 4BB0A 4DIBA 5ICCA 1NBAA 2II6A 3SS7X 2OQIA 2WUFA 2WKSA 4MUGA 3PSHA 4CBVA 5BQXA 1F8FA 5AWFC 5I8WA 1KY4A 3FOAA 3EXHA 4P33A 3TIGA 3I2GA 4UM8B 5B3LA 4FDVA 4AY4A 4OK5A 3RTBA 1KZ7B 4Q37A 4NBTA 4OMDA 2JEOA 2VRCD 1IUOA 4X71A 1WUIS 2KWIA 3D7KA 4EO7A 4WNAA 2HYIC 2OCYC 1UBJS 1T2NA 3BGSA 4G4SO 1NBMA 5AJWA 3ZHQA 5CPBA 3OT1A 1EJ0A 1GCOA 3HJBA 1T24A 1XYYA 1LB1B 3IPRA 3M4YA 4NMMA 2XB4A 4Z4FA 5L9AA 3F5FA 5EXPA 3M49A 2GN8A 3WBKA 4UHDA 1W30A 1XG5A 2FRDA 2H8KA 4OD0A 2O8CB 1TC2A 5B1DA 3OCWA 3ZCUA 4JI7B 5SYNA 5TV2A 3MINB 3WIUA 3GAMA 4G97A 2HREA 4C0XA 1F06A 3D5TA 3MAJA 1V3UA 2UYQA 4ZT2A 2FUKA 3M6XA 3O1LA 3UM9A 5E6RB 4QAQA 2AC4A 2QTWB 1T9DA 2BKVA 4TS1A 4KQ6A 2G0NA 5LSAA 2WP0A 4CQJA 3BK1A 4O4JB 1WMBA 4N49A 3GEBA 5KC9A 2ZRGA 2RE8A 1LPSA 1H2ZA 2PQ0A 4H6PA 2V8BA 3OPQA 1BXGB 3LOQA 1BMDA 1KI1A 2DKNA 3FTQA 2IGBA 4RHFA 1I7LA 4C43A 4LWZA 1X7ZB 4MJ3A 3MT7A 2XCTB 1WWKA 1N6OA 3VPXA 1U1EA 1Y9AA 2IGTA 4J16C 3SNKA 1HE4A 1GQRA 3LLVA 1X7YB 1ULTA 5L40A 3L07A 5D3QA 2J5BA 2YINC 4I36A 2Z9CA 1H2XA 2NUAA 2NVUB 3HRKA 1A88A 4FMDB 4PYOA 4UEJA 2Q4TA 3ONVA 4RHTA 4D0GA 5EYPA 2JK1A 2YQ5A 3CEJA 3RS8A 6AT1A 5JFGA 2QRQA 3H8SA 3FNRA 3KPUA 1DBRA 2ETVA 1ZA1A 2W6ZA 4J4TA 4K6GA 5ALQA 1YL6A 1PK8A 5CVEA 2FMIA 1IM5A 1J25A 3BS4A 5F1KA 2JLVA 3D2BA 1V5GA 4CM4B 4EKYA 1DSSG 1E5QA 2W2MA 2X42A 3IPXA 4B7ZA 3CUTA 4BO4A 5JPDA 3ZNPA 5CG2A 4EUHA 1A5AB 4O3MA 3AY0A 3JWEA 4QOHA 2IYAA 2POCA 5LN1A 1CNEA 2JLQA 4QL3A 1CE8A 3O2NA 4M0DA 5FTNA 3PDHA 1DMRA 2H0RA 2C5GA 2WMDA 4TUYB 5TVKA 2WLTA 2NN3C 5CR9A 1OAAA 3DNFA 3STTA 3GIWA 3HDGA 1F1BA 4MVJA 4P7BA 4DLBA 4Q47A 3IYLW 1YJBA 2J87A 4JXZA 3OM1A 1T35A 3QIVA 4NCNA 3MTEA 2A59A 4WOCA 4Z9YA 1H05A 1KL7A 3BRCA 2MSEB 4TSFD 4TWIA 2HSDA 5K0LA 3K0HA 3GJ7A 1ODIA 1JR2A 1V0JA 5F7JA 3T1YB 2IXGA 4H3VA 3NZEA 1C7FA 4YROA 2W43A 4Y2GA 2MDTA 1JDZA 1TM7E 5IHXA 3UK7A 4GRAA 2W4QA 1GZ7A 3ZS9A 3RYHA 1D7AA 4CEHA 3T15A 4R1NA 4DLKA 1TT7A 3ADBA 4EHJA 3G2NA 1S0UA 1KVSA 1NTOA 1K89A 1NOIA 1SH7A 4RVCA 5DK6A 2HHLA 2PX6A 2ZR8A 2I9KA 5JWRA 5JCZA 2PRJA 1ODLA 3D1JA 3QG1A 3X3HA 4DCOA 4YJFB 1SXHA 2OHHA 1A8IA 2R4QA 4DQ0A 1C1DB 2K4MA 5B1SA 4GYKA 3A1EA 1G2IA 3T1NA 4AQYB 2CXQA 1KJIA 1SVLA 1PJ4A 2JFBA 1JQKA 3GB9A 1JR3E 3H9CA 5F7OA 4JJ8A 3AHGA 1YIAA 1KI3A 2C03A 3EFEA 2Q5FA 3NR2A 1WUHS 2YXLA 3BSYA 4ID9A 2O2XA 1PJLA 2I7DA 2EKPA 5C8ZA 3TW6A 2OV3A 1CWUA 1KFBB 3T5PA 2FE4A 2FJUA 3H13A 3H16A 5G3YA 1YZTA 5GOZA 4WLOA 3M6LA 4JQCA 2AZXA 2GNAA 1O4VA 2WYUA 2JDID 5EKSA 1P7YA 1ZKDA 3K9WA 4M0LA 2G6TA 3D64A 4XPIA 5DOVA 3O8CA 4HLUC 4AJNA 1UMKA 2OBLA 1D7OA 1M34A 1S5PA 4LXUA 5BV2P 1S8NA 4CGYA 4QJ3A 2I78A 3F98A 4JBXA 1OC2A 2A6PA 2VHJA 4KX5A 2OZEA 4PPYA 1P75A 3NAMA 4M76B 1T6ZA 2ODBA 2ZIUB 3FCUB 3HDVA 2IV7A 3TQSA 2QN9A 1NVUQ 3GUVA 2VK4A 1GKYA 3A3NA 4OQYA 4XCVA 1NQUA 1TLLA 2RJOA 5FTJA 3ROEA 3TQQA 5BXYA 3GLIE 1WXXA 1JDVA 1E58A 2W5UA 2IW1A 3UO8B 3QW2A 1E6UA 1TIPA 2FPPA 3GP8A 3TNFA 1IHOA 3SYTA 2VXYA 1I0ZA 3JW8A 4DT1A 5JFTA 4TM8A 3JD2A 4HQ6A 5HHTA 4ZYUA 4FJ1A 4PZCA 4DMLA 1R0YA 5FI1B 4IHQA 3HGQA 2X58A 1QHFA 3CX4A 2ZYAA 3IA7A 2WD7B 2G40A 1X0VA 4HMQA 4X94A 1WBJB 2PL9A 2XD4A 3HLKA 3PP8A 3OM0A 4KLNA 4Q7EA 4F1JA 5KOHA 5J23A 4M83A 5BPHA 3K70D 1VE5A 2ZPTX 4M1ZA 1DDGA 4NK5A 2H2DA 4P5PA 1N77A 2GCNA 2BV3A 3ZGZA 4JFRA 2EFDB 2J7PA 4LGCA 5CIWA 1MPXA 1RZ3A 3ROQA 3UKDA 5HQJA 5J9FA 1XZMA 3WL4A 3AQ4A 4L1KA 3HJFA 2YMMA 4I8XA 1U2EA 1EFUA 1AA9A 2FEMA 3L05A 3AVYA 2Z2XA 3H83A 4C06A 4W5QA 4BKOA 4YUZA 1JE0A 5FWYB 1QZ3A 3O47A 4I5EA 1KI6B 3MOSA 4KN5A 3S2EA 1BD4A 3U7QB 1P19A 5FB3A 5K3SA 1OHHA 3X2EA 3AEQA 4AYTA 1JXOA 4KPFC 5I7RA 2WHXA 5TT1A 3BT7A 3CE6A 3WLIA 5FOUA 3IAXA 1GQOA 3KK0A 2CLEB 5A03A 4E6PA 2DQZA 1Z15A 5LP6B 2G0TA 2BFBA 4G9EA 1O9HA 4C0LA 4MSUA 3WB0A 4ZO6A 3ZHUA 1TTQB 4UNPA 3VNUA 1GPKA 1TGVA 4E3ZA 3FOEC 2AHRA 1PEYA 1M74A 2JVIA 5M34A 3QVOA 4K0KB 1Y48E 5IJ0A 3TQIA 5AM0A 5KJCA 3KQSA 2ZSKA 2ZXFA 1T9ZA 1KJZA 2C99A 2GJSA 4G36A 4X63A 1OLSA 1I4DD 3A6DA 1PZMA 2H2FA 4LMAA 5A5DA 3N9IA 3D3KA 1KFJB 3EZ9A 1VHDA 4QXOA 2RB4A 1LPMA 4HX5A 3H3XA 2QPOA 3DAHA 2O2YA 3RABA 1EGAA 1I4OA 1OFGA 3AR3A 4FLEA 5DM0A 1E4VA 4JOQA 4DIEA 1TMOA 1LVUA 1OD6A 1RBYA 3FUCA 4S24A 3WHIA 3AB8A 3LGSA 1YK1A 7GPBA 4G0NA 4CU5A 2EIHA 3BILA 1T5DX 1RHQA 3AMVA 3KSZO 3LUPA 4HAUA 4UUPA 2WYIA 4WLUA 4XASA 3GLHB 4RF2A 5JAOA 2HRRA 3I5MA 5EZQA 4GYJA 2YZ2A 4DZTA 3BMOB 3RSGA 4EELA 2X0EA 4ZOBA 3PX3A 5DHPA 4DR6B 2QX4A 3I9KA 4G23A 5T3UA 4YPVA 1XCMA 4NCXA 5GAJA 2XCSB 1EGQA 3BKWA 4RK1A 3V4LA 4XRGA 2OK7A 4OFBA 3RJTA 1HBJA 4M1QA 1N1MA 1FP7A 2X22A 1C14A 5FWXA 1RRFA 1Y7HA 2O19A 1NMXA 3F2IA 3HYCA 2RDMA 4DV5B 1PVVA 1XOIA 2GDJA 3BSWA 3NYRA 1EBUA 3OJOA 4M6WA 3SC2A 5C8YA 2VPWA 4P3NA 1WKCA 5EZSA 1R0XA 1RPNA 3PA8A 1ST3A 4AIRA 1QVWA 3DE2X 1CR0A 3WFIA 3WHKA 4GYWA 1LD3A 1QMGA 3N2KA 2C3MA 4N9QA 4S1TA 3ZDFA 3QA3E 4L8GA 1RCUA 2ZAIA 3ZZ0A 2H1HA 1NVXQ 2P4SA 3SKXA 3P9KA 3K5PA 5ALOA 1ULHA 3OAAA 3BXPA 3EA5A 1WSWA 3X1XA 4AKSA 4B8WA 4CEIB 1GOTA 3TKLA 3TIXB 2HXSA 4JI5B 3AY3A 3HG7A 1TD9A 1WY7A 4FGJA 4ZU1X 2WAXA 2HT6A 1FXSA 3EAQA 2Q3FA 3L8ZA 3IT3A 1CRZA 2RHDA 4GH5A 2BJHA 4Q9IA 2WTMA 3OVMA 3ZTTA 2GEUA 1Q0PA 1P9NA 3GFTA 1D1TA 2I87A 2XRFA 3DOEA 2CDBA 3SC6A 5BORA 1U1CA 1YE3A 3KDSE 1SXPA 3I92A 2ZSFA 1AKVA 3OQVA 3MJ4A 5CX1A 3FY4A 1OVMA 1YQDA 1DIOB 1EZZA 1P7VA 1CJSA 2O8FA 1ZI8A 1CERA 1F2TA 1NONA 1O6GA 1V6SA 1ZGZA 2AG8A 3HDTA 5DVZA 3R7NA 5I7OA 4JYPA 4O5AA 3IDOA 2WIAA 1Z28A 4P2GA 1P1RA 5KJFA 4L2IA 1PJTA 4W63A 5K51A 3R8FA 4WEQA 1A9TA 4DZRA 5IUKC 4DQLA 3PPYA 5JNVA 3R7DA 1T9HA 2ZU0C 3JD3A 5EXSA 3TKYA 4IXWA 1TYZA 3ASVA 2TMKA 4MX8A 3D4NA 3EPRA 1VZ2A 4IUBS 2OCIA 4V0OA 5IAOA 1CUSA 1KO5A 1CUZA 3V9AA 4X20A 2Q6VA 2NU6A 3M6MD 3QEMA 3QKSA 3DBLA 3QIAA 5BN4B 4BVGA 2G07A 4TVBA 3VR4A 1XXLA 1YB6A 3WDMA 4G4JA 1ZOOA 1WD7A 2NUPB 3AF3A 5BQ3A 1FF9A 4RPCA 4YRLA 4NYJQ 5KBYA 5CTAA 1DX4A 1H85A 3JAKA 3N05A 1DFGA 1NAHA 2BGTA 3OD1A 5CXSA 5REQB 4MV1A 3SXUB 4DBZA 1YA8A 4FS8A 2HSEA 4LYYA 2QGNA 4MR9B 4G1BA 2QZSA 1VZ3A 4MQFB 1PVOA 3DBRB 2PKQP 1DAFA 5FQNA 1NW6A 5JPIA 4XYMA 4IDFA 2QJTA 3KKQA 1H42A 2JJQA 1KK2A 2NU7B 4I9GA 4E1BA 2PO7A 4RPIA 3IQIX 3DCIA 3ORHA 4EA8A 3F1KA 1RYZA 4N76A 1QANA 3BFJA 3P9PA 2D2VA 5JNLA 4Q3NA 4AN1A 3EIEA 3QYJA 3ZBPA 3I5XA 2ZJBA 1UODA 1GCAA 4H4CA 1CS0A 4JT9A 1D6NA 3E7FA 2DG2A 1GUAA 3I32A 1Z7BA 1E69A 2FOXA 5JRDS 1U0TA 1AOXA 2L18A 3RM3A 3IP6A 4Z3KA 1YRHA 5KHOC 2EBWA 1L1QA 3RSOA 2W2LD 5CT6A 1YZKA 4HQ0A 2H3EA 1T4BA 4LCJA 4QHSA 2AUTA 4O29A 4WSOA 5EJMA 2HIAA 3DKIA 3HA7A 3ZY2A 621PA 5HSGA 5KNCD 2AOVA 4DPKA 4BJ3A 1RWOA 1Y4UA 2PJDA 2QVGA 1EUDB 1KYZA 4O2LA 5EE5B 2AJCA 3DDHA 4YMGA 1PG5A 1PS9A 2GHTA 4L28A 5A2GA 4JV5B 4R9NA 4C7MA 1CQXA 4QIHA 1KWKA 3VH1A 1GQSA 5B7QA 1ZUNB 3W9YA 4EY8A 5KYGA 3CZ5A 5JAZA 4ZEMA 2PUDA 2PZBA 3FFBA 4DOMA 1SIWA 3BCSA 2ZJFA 4IX1A 3MTQA 4L7QA 2M1ZA 2QORA 1HMYA 2DY1A 3C6XA 4J1SA 4NAUA 1O0CA 1UUFA 4HSGA 1NLUA 1SQ0A 1TGYA 2QTMA 3I37X 1QHEA 1XTBA 1ZM7A 5KTKA 3BVPA 2Y6UA 3ETDA 3NM4A 1IBRA 1Z47A 3GEEA 2LCQA 4A36A 1PHPA 1G8HA 3QBTA 2PX8A 2R6R1 1AO0A 3L7BA 3PQDA 1JYSA 1YDHA 4TXMA 1I2DA 2QGZA 4NI5A 4BFTA 2OV6A 4LWPA 1T8UA 2QR2A 5JO0A 5DDIP 3HKDB 1A98A 1QONA 1SG9A 1XVTA 2B4RO 4UEOA 3V8BA 4ENWA 1WF3A 3FFWA 3IR7A 4YT2A 3U3MA 4BPBA 1Y6GA 2PD3A 2AFHB 3QKUA 1Q19A 2OZPA 3E6AA 4M1EA 2ODTX 2HCJB 3ND8A 4TKUA 4DFDA 1VRCA 1SC6A 1DQNA 2H4ZA 4GM1A 2OGTA 5EJ6A 4A2CA 3PIDA 5B12A 3AL3A 1C0EA 3G2QA 4RTPA 1OF1A 1G21B 3GGGA 1ZR4A 2J30A 1YT5A 4JYMA 4BFUA 3PJGA 5B58C 1GV1A 1OU4A 2HNAA 2Q6KA 2QPTA 4B40A 4Q3CA 3H4TA 4XDYA 1CJTC 3OQOA 1U3WA 3FHOA 2I7VA 1R0ZA 2VEDA 4TM7A 4G0YA 5GONA 4U2CA 5GV8A 3ZK9A 3FTCA 1LXCA 2Y1GA 2W6OA 3IPLA 3VOBA 5JH7F 3ONWA 4R3NA 5BYBA 2DUNA 3A1WA 1GJRA 3BHNA 3SFVA 3QVXA 3QOXA 2VQEB 5BNFA 1CP2A 5EJ2A 3CZQA 4AM8A 5BQFA 1EXDA 1QH8B 3I1JA 4B4OA 1JDJA 1T26A 2H07A 1DEOA 4N5HX 4UVEA 3KZKA 3K0KA 5CH8A 4YUWA 1F9AA 1VE6A 4TMXA 1PQPA 3MCWA 3IE1A 4RD1A 2VDJA 4BZQA 3BF7A 1MHTA 4KR3A 2OBBA 4YP1A 4ZKEA 3UAXA 2CMHA 3NP7A 2FPRA 5T3YA 4ARSA 1GT6A 2BR4A 3EGVA 1CZLA 5DM70 2RHOA 3CR8A 5ELXA 3EW7A 3KQVA 5ALUA 2WYVA 1I2MA 3BBPA 2PS0A 3ENWA 3C70A 1HTWA 3E9NA 1F4LA 1PFGA 1E2JA 1G7TA 4TTPA 1GVNB 5CCXA 3D4BA 4NJOA 4G8JA 3RRJA 1XEAA 1MUUA 1DAMA 1R6XA 4L6IA 4YUXA 1LVHA 4PCLA 4KYTA 1IHDA 1RC0A 3LX5A 4OI4A 4QTZA 2O4UX 4WFJA 3VKUA 4E1AA 3W3ZB 2G1AA 3AF2A 4R1UA 4MVXA 5TF0A 1KI4A 4FP9A 2WUGA 4YHBA 1BX0A 1XR3A 1DJLA 1U2QA 1XZJA 2GVDC 4MAAA 5JAPA 4AKGA 1L4HA 2WIBA 3HB0A 2ZJ3A 4HH4A 1CR2A 3PCTA 3MT0A 5E6UB 3AUYA 2PA3A 3EFOB 2DU8A 4TRNA 4Q6BA 1R4NA 4A0QA 4AZWA 4UCXA 1B8NA 4BQFA 2XXAB 2GZAA 5KTNA 3B12A 3UA3A 2O0MA 4DNOA 2F1JA 2WBLC 2PMKA 4EH1A 3PX7A 4KYIB 3U9LA 1ZDMA 1OJ7A 5DBGA 1TZMA 1LPPA 1E5TA 1GY8A 3OFNA 2ZUTA 2ORYA 2X2FA 3AFOA 4FJ2A 1G5PA 1C3OA 3UC9A 1QPBA 2D13A 4XX1A 5A62A 2OHVA 3S8EA 4L3WA 1Q5PA 3B1ZA 2DECA 3HDYA 3W7VA 4FINA 4ZOLA 5HUJA 3F6CA 1MB2A 3GLFE 1ISHA 4Y0NA 3N8NA 1NZFA 4TQGA 5TMDA 4KV9A 1IU9A 1WMAA 1AXEA 2FLKA 3QK7A 5EESA 5U4QA 3CMCO 3AV0B 3PR1A 2IEYA 3EXFA 4MV0A 5JMWA 4QUKA 4DEXA 4JMPA 3JARB 1HYHA 2CHUA 4XSHA 4JOSA 3KETA 1KZ4A 2BDUA 5D6NA 1OASA 3OZBA 3G2KA 4U6SA 4D2IA 4EUNA 4TTJA 1G5RA 2P40A 2VQSA 5KO2A 3TZLA 1TDJA 3HHPA 3CSDA 4QPNA 1U31A 1E9SA 1RYEA 4KYVA 3AK4A 3ND7A 5CDFE 4YAEA 4JU9A 1E3WA 4CG2A 3HWWA 5EC8A 4HXEB 2OBYA 3UCEA 3TW4A 1DHRA 1WV0A 2C83A 2FP4B 3E81A 3R3JA 2ZYDA 4O4HA 3ZI4A 2JK0A 4M4SA 3BXZA 2XTAA 1US8B 1LI7A 5KNDH 3OCZA 2O05A 2FH5B 2VLIA 2KSQA 2PX0A 1IJEA 3OTIA 3BA1A 2QPLA 2QHXA 2PL3A 5FNZA 4EY3A 3FCSB 1A1VA 3U48A 2RMKA 3QJYA 2FF5A 2DWPA 1ZXXA 4R5MA 4LOAA 2VAXA 3QPDA 4RABA 3LRXA 2R6CA 4YUAA 3MWDA 5KAMA 1Y3BE 1ZNZA 3FF1A 4GPBA 2P75A 4N1AA 4ND5A 4TWRA 4I66A 2NO1A 2P0YA 2PMWB 3PEEA 4LQDA 4EL5A 3DL0A 4K9KA 3QHPA 2RC6A 1OXUA 3B9PA 3LPNA 5HE9A 1GL7A 1FVXA 3OEHD 1AK2A 1IXZA 4LE1A 5JY6A 1YNOA 3WB9A 3EH1A 2XAUA 4KWEA 1FNSA 4RELA 1XYVA 3LLMA 2Q6LA 4JJ4A 1EU1A 4QU9A 1V1MB 3BK2A 5K3FB 4YIHA 4X3OA 4WN9B 3GPBA 2RBGA 1P29A 2VUTA 5JE8A 1CUEA 2ZS7A 1K98A 1K86A 4GL2A 3K20A 4UTPA 4WZBA 1IY1A 2FMHA 5I7FA 1DTWB 3MFYA 1G3QA 4UD2A 2ZTLA 1NU8A 1ZIXA 3ZW7A 3C6KA 4FSDA 1T1GA 5E8JA 2GYUA 5EFOA 3C3JA 3R3XA 1ANKA 1U9CA 2WYWA 5F2EA 2VJMB 4KE8A 2QUKA 2X0RA 1VJRA 4EKIA 5EWLA 3CLRD 5AW9A 2D7CA 5SZKB 3H8VA 1DJPA 2Q46A 3U16A 3HLTA 2OGZA 2H54A 3A26A 1HDRA 4UDNA 1A7AA 4KYUA 1XBTA 2BF7A 4HF7A 1U94A 4P7KA 2BFEA 2IOFK 5KI6A 4MS3B 4GMKA 3K0AB 4P3KA 3BERA 4AZVA 3AZPA 3RVOA 3AI2A 5A4JA 3I1FA 1W6UA 1RIFA 2NV6A 3ROXA 1PFKA 3AUUA 2VRCA 2D1SA 4QODA 1OGIA 4A0GA 4H7JA 2IH4A 1JI0A 3SJBA 3OIWA 1YR3A 3ZOKA 4PPFA 3T9BA 5DXFA 4KO8A 4EZBA 1MP0A 1F0PA 5ILQA 3P9RA 5BMVB 1LJ8A 3B48A 2Q1UA 1R74A 1F0NA 2J0QA 2TSYB 1ZK0A 3A1NA 1KHTA 1MIOA 3FIUA 3T41A 4D4JA 4DQXA 1Y4SA 1P2VA 1EQ2A 3GJ6A 3I8SA 4OB8A 3ZGOA 4AG5A 1CZNA 1UKZA 1WHTA 1S9HA 1WOMA 3FTDA 1UR5A 2JCGA 2HWYA 2OESA 1GPDG 2QD4A 1XCJA 4MUXA 2W6ID 3IO5A 1I0LA 4BNGA 4RJTA 3LYHA 3LA8A 1VECA 3P2JA 1RQGA 2F3SA 1LSOA 1JU4A 2A86A 4HGOA 3AESB 1KQOA 4HWRA 5HCUA 5U1PA 1I4EB 1IN1A 3O74A 1W47A 5TQJA 3IEMA 2IZOA 2PL1A 5ALMA 3A37A 4URVR 1PJCA 4JVOA 4JGIA 3VR5D 1AZWA 3ZE0B 2ZIAA 3GPIA 3RK0A 2R8EA 4HDAA 1TL7C 4LCBA 3WQHA 3R7WB 3QXJA 5HUQA 1PR9A 3O4RA 4IIUA 5LP6C 2BTEA 4G4SP 4CWAA 4KNYA 2Q6IA 1KO1A 3EMKA 3JQPA 3JU3A 2QRZA 3L8CA 2GYWA 2P2NA 1I14A 2NO9A 2RK4A 2J07A 2VP5A 2WSYB 3JQAB 3SSOA 3SEQA 2XE6A 3FPEA 3H17A 4MV8A 3VDRA 5K20A 1EFPB 4RXTA 2HEIA 1GCGA 1B1CA 2F59A 5CP8A 4DR5B 1DQSA 3IQDB 4FCCA 1OX4A 4OF4A 3M3PA 2BFFA 1WDMA 4FT4A 1AQYA 3U39A 1TLTA 4AJJA 3MWEA 4AZ3B 3LT2A 5EGNA 1TMKA 2QOEA 3UJNA 2DE0X 3L8MA 3LUHA 3RS9A 5DNCA 3MMZA 1NC1A 2EU8A 2ZRBA 3OSZA 4WESA 1P7CA 1TO1E 3IJ5A 3NAZA 1Z45A 1R5BA 1GKKA 2CN1A 4X95A 3NHSA 3DC2A 5F4ZA 5LQAA 1G291 3C1AA 3TG8A 4F5YA 2CFIA 5LL6P 3DVAB 3TG2A 4JWKA 4GGPA 1NURA 1JB9A 1S89A 1C9EA 2NAFA 4AS1A 3PCXA 4LG1A 3M4JA 4LNAA 4M53A 5EQTA 4NZYA 3TIIA 4BGDA 2XNKA 2PT5A 2XGMA 3TRJA 5LOVF 2HA4A 4D3YA 4ZCLA 4MUKA 2WE7A 4YX9A 5EIBC 4CLRA 4EITA 2PX4A 3U3XA 2JCBA 3D6AA 2ZANA 4ND3A 4TSFA 3U3RA 3X1JA 4J0KA 2LZ0A 4Y6GB 1XZPA 5AVKA 3H6GA 1ZONA 3T7RA 3D4LA 3M7IA 3CPJB 2MMCA 1W5EA 2XUIA 4HZUB 2X6TA 4YRIA 2EERA 1HZZA 4KSYA 4YQFA 1SO8A 2H5IA 5A4KA 4MJ7A 3UHJA 3L5OA 4Q7QA 2H9IA 2NTNA 3L0CA 3OPYA 4UE6A 3TH5A 4A15A 1EWYA 2NO4A 16PKA 2V7UA 1B41A 3IDSA 1E9FA 1MDFA 1Q6ZA 3M2PA 4MUYA 2HFKA 3RB8A 3V1NA 4TTTS 3DZIA 1KEUA 1VE7A 2JD0A 1DLIA 5FO0A 5CDGA 2BZ0A 1JIJA 2JD1A 2ZQ5A 4MKFA 4C6SA 1BGVA 3QEAZ 1ZN2A 3BXOA 1EWRA 3AJRA 3CN9A 2XWSA 3D8RA 4MWZA 1OILA 4PLWA 4X7BA 4HQFA 5DHRA 3N2YA 1CX9B 3E1GA 2O8VA 3I39X 1L4BA 3MWJA 1I1OA 4IXTA 4FXPA 4LTDA 4EVRA 3ABQB 2PYZA 3L7OA 5C0OE 5A5EA 3ETEA 1MQAA 3IT2A 1J42A 1CUJA 5A3VA 3QKWA 1H4TA 3AR8A 3TRHA 1R37A 5JBQA 2ADFA 4HAXA 4JR2A 1GPAA 1EX6A 1RFGE 2VN8A 3DQQA 1XCOA 3Q9LA 3Q8MA 3UXHA 5TGDA 4LRXA 1PR2A 2XY4A 7REQA 5EVJA 2GJKA 1PUXA 1QHGA 1ZCAA 2IU0A 3TAHA 2M1XA 4NRDA 1YFLA 4PLCA 3NM5A 1SUCA 3SBXA 2E2WA 3TRKA 1WEHA 4MH0R 2O2GA 2X4IA 4A6EA 4A8HA 4K05A 3K4QA 2ILVA 4CCWA 2HM7A 4YBZA 3AVTA 4DLYA 3D8UA 3BHJA 3G2JA 2ZI5A 1PQYA 4LNUA 2QT0A 4OGWA 5FX2A 3K0BA 3AVWA 3EGXB 1HE8B 4A4DA 2AZ4A 4TMYA 5DCLA 2I1WA 4HP8A 2A5LA 2HJVA 3FYUB 4FIDA 3TOSA 2GM9A 3E3NA 4C6TA 1T9GS 2I8CA 2HRDA 3MWGA 4DYHA 4F9TA 3LYLA 4MPTA 2HLPA 3GFFA 2QX6A 4HBGA 4LOKA 2Q0SA 5PGMA 5HCIA 4FGUA 1Q7EA 3PGLA 4B45A 2WB2A 3B78A 3RYTC 1ZI9A 4HZGA 4NNOA 1S2MA 3OF5A 4DMFA 4V1CB 1EFDN 1ST2A 1R0BA 3OFSA 3X1KA 1SQ6A 1CIPA 4RCVA 1PD0A 2I4NA 5AVSA 1EI9A 3PC8C 3GDHA 4LY0A 1AKQA 5IUJC 2X9QA 3I62A 2QROA 3OE5A 3H2IA 3NALA 4QGAA 4NZMA 3KSUA 4REQB 3Q2KA 3R24A 4KH1A 5IP5A 2F8MA 3UXMA 6CHYA 1W1IA 2QMEA 2VDRB 1BIFA 3LQRA 4D74A 4Z1OA 3NTXA 1VKJA 1Q1ZA 2WEKA 5C1BA 1ZW1A 2B9EA 1QZUA 2VJLA 2XDQB 4O4IB 3WS7A 3GQBB 5AKYA 1BGXT 1KJWA 3BGWA 2ZWIA 3WGZA 2VDLB 2WR8A 1JG3A 1ZD5A 1GILA 1N8NA 2VDNB 4CLOB 3M9WA 3QITA 2VHEA 3B1VA 1GTJ1 2BM9A 4LKRA 2QD1A 1F12A 1QGED 4CT5A 3R7AA 1IWPB 4WASA 1QS0A 2Y77A 1KP3A 3PYXA 1WXQA 2NYAA 4II7A 3P97A 2C1EA 3R5TA 4OXQA 3UGJA 3BRSA 2LXNA 5IM4F 2ZR7A 4OQLA 4RH3A 4IS3A 5KYXB 4Y1EA 1N3IA 3P4YA 1GUDA 4XQEA 1ODKA 3FPKA 4Q3DA 4FZ5A 3ZGYA 2OE2A 4YT8A 3GRRA 1QRDA 2MIIA 2C54A 4W5HA 1ADJA 2A1TS 4ZJZA 3V1YA 3Q4GA 4ERNA 3FMGA 5KAPA 1CY8A 1GTZA 2P9BA 4YJHA 3KJQA 1VCIA 4B6EA 2ZIXB 3FR8A 2OL4A 3E27A 3Q0IA 1K4KA 4GC9A 3EAGA 3L2OB 1NOJA 4WIAA 2VPYA 1C7EA 3E9DA 4YLEA 3VZDA 4EJMA 3GYBA 1NWCA 3H2HA 3T8YA 1ZR2A 2H18A 2VHXA 3FPCA 3FSEA 3FTPA 1ZGJA 3MYRA 4KVZA 3EQ2A 4YN3A 3K73O 3TD9A 3IEXA 4Q34A 1LTHR 4YCJA 3SOPA 2JGAA 4WTOA 3S7TA 4OJMX 3L8YA 1E94E 2FMTA 5ECDA 4CR6A 5EY5B 2WU3A 3EF3A 2YBDA 3JAWB 4MKXA 3I6QA 3H5VA 3M89A 4AMBA 3V3TA 4OHWA 2GZ1A 2ZEJA 4LJ7A 5ALWA 5A9TA 3NXKA 1ZAKA 4QBTA 1JG2A 2GFQA 1GQFA 2Y2UA 3SGLA 3U26A 4DMCA 1MB3A 1Z4JA 2UVQA 2ZJ6A 1EDDA 1JHVA 2ZS8A 5CT5A 4BO6A 1GYPA 1V4NA 4EGQA 2R8PA 4PXAA 5T8KA 2IPOA 4CKCA 1DOAA 2YCLA 4H6WA 2OCGA 5JROA 4JLKA 1SUEA 3HKCA 4JLNA 3RVMA 1Z34A 3CJTA 1ULAA 1I4WA 2XKJE 4PGHA 4AZTA 1IK4A 2QXUA 1ZH4A 2ZJAA 2JI9A 4G8CA 4WINA 2DQ4A 4IJMA 4HNVA 3QP9A 5KYVA 4M0EA 4EPTA 1BROA 2YXBA 3AUTA 3PUJA 3DEJA 3UGTA 3FAKA 1WDTA 2AOWA 3FCXA 4L72A 3RVBA 1BFKA 3D7NA 5GGXA 3SY8A 3J7TA 4DRYA 4F6RA 2BFCB 4U02A 5LIRA 3P7MA 2NNLD 1GNQA 4K81B 2PV7A 3HCBA 1NE2A 3VKVA 4BP1A 4ZCSA 4F2HA 3FJOA 1OFIA 1WM1A 1OXXK 1Y1KE 5CVCA 1U81A 2MHCA 2NZ8A 3B1JA 5LR6A 2VDPB 1YGPA 1S3SA 3GI1A 3PZRA 5ALYA 1C0LA 3AIIA 4TXJA 4B3IA 5BRAA 4UBIA 1GPH1 4FMBB 4V0SA 1QH1A 3TTYA 1NVBA 1XDSA 3C39A 1DC5A 4V0NA 1Z0ZA 2WG0A 3MMPA 1WPXA 1KZGB 4KIFA 1CD5A 1E2NA 5DMXA 1JZSA 5HQ3B 4FEGA 2IPLA 4PSDA 1UKVY 2AX4A 2Q45A 5G0UA 4LXTA 4KVAA 4Y6PA 3TZHA 3PHJA 2PBZA 3TTUA 4BFWA 1OZFA 4B80A 4RM3A 3GUZA 1FQKA 3I2JA 4ARIA 1XD2B 1DAGA 3KTFA 3VC2A 3R77A 3MJDA 4CDRA 1E99A 4GPAA 1QIGA 1D8AA 5TY0A 1KK1A 1PVDA 3DUFA 4BQEA 3AERA 3SMQA 4QRIA 4OAQA 1T6XA 3K6JA 1ZUHA 2VNHA 5EJEA 2OO3A 4GPZA 5J2TA 2DHRA 4M8LA 3DLTA 4MVWA 4G63A 2Q9CA 3R7SA 4BP9A 1NHWA 1BDHA 3WKCA 1JSXA 4YO7A 4F8JA 1SQFA 5ALXA 4MQEA 2FQXA 1UDAA 2V03A 3R09A 2R25B 4D8VA 1CB7A 1T9BA 1VSQA 1MG5A 4C3VA 5JVDB 5HZKA 3MQ4A 4R3UC 4TL6A 1QRSA 3RYFB 2BEUA 4PRLA 4B0OA 1MQSA 4PSVA 1AKYA 1L5YA 3D5EA 2UYYA 4H2DA 5A71A 2VQ3A 2FA9A 5DASA 4TKMA 4MLDA 4I1VA 2Q0HA 1IMJA 1AN0A 2BN4A 5JSFA 2PM8A 1Y9ZA 5JMTA 1SVMA 3GZJA 2CXHA 4NHEA 4OHPA 1EH5A 4AICA 1Y1LA 3FKJA 2P9FA 3PT9A 2Q2VA 2B21A 4BNIA 1YQGA 1E2PA 1V7ZA 3JQ9C 5THKA 4K9OA 1WLSA 3HU3A 3T5CA 5FWNA 5KYYA 1XRRA 2Y2VA 4DUZB 4M21A 2YRXA 2W2LA 5H3CA 3VNSA 5ITVA 1WXEA 5FI0B 4ZIRA 5FPPA 3B6KA 1FBTA 2FSHA 2R8YA 3CR7A 3O4JA 5CJPA 3MJEA 4ONEA 3PSAA 3VOAA 1UWCA 5HRCA 2AE1A 1B6GA 3KELA 1LC0A 4LPSA 3ACBA 2AXPA 4NOMA 3UG7A 3LUGA 4JN6B 5CDUA 4CW7A 1Z6QA 3ANYB 4EI9A 2J45A 3HA2A 2QG9A 3G2HA 4G5HA 4H16A 5CVJA 1EXMA 4YS6A 4U8HA 3ZDYB 1T0IA 5HBRA 2Z0MA 5JXJA 1Y34E 2JAQA 4RY2A 3RHFA 5H3LA 1J70A 1PJ3A 2J9FA 1L7RA 2NXWA 4DYVA 4Z1MD 1ML3A 3F8SA 1T29A 4KN9S 4RTRA 3EEIA 2WIFA 4JVLA 4L0MA 4DPMA 5AM5A 4JR0A 1V7QA 3IELA 2GBGA 2HNKA 3O1IC 4Z2YA 3TAUA 3T9EA 4K3UA 3BWCA 3FPFA 4HUQB 2EGGA 2C61A 1J2RA 2PAFA 3L0SA 2IP2A 3E2PA 3R0VA 3SP1A 1G2QA 4X1IA 3WFJA 4PZUA 5LVAA 1RPJA 2C2MA 2YVAA 3DP7A 3JQBA 1ZGCA 2V7WA 1BFDA 2IUUA 2NIPA 4ZDWA 3T9DA 2ZULA 4MS1A 1ZH8A 3ONNA 4MO9A 2D5CA 1YCHA 2TECE 3NANA 1MMFB 2IXDA 4G0ZA 1AQ6A 2BDEA 2RHBA 3U3KA 1JE1A 1EFAA 4B3SB 1FSSA 2JFUA 1ORTA 3GU3A 4S12A 5HF8A 2HJHA 4R81A 2ZCVA 3B85A 1IC6A 1N3BA 4LX0A 4OA5A 2W8BB 1UBKS 1XTPA 2JIZD 3BICA 1C9MA 4Q9HA 4KR9A 1PWZA 1JYFA 3LDUA 4WUVA 4BKRA 3EXAA 3QXSA 4LE2A 3NIDB 3UMRA 1THMA 2B7BA 3TOZA 5TB5A 5KX5B 4PRKA 1HYGA 4MR7B 1BRMA 1PAUA 1PN3A 2ZI9A 1M0WA 4FZJA 4RAOA 2GT1A 4IINA 5JH7A 4GXRA 4RZ3A 3IP1A 3L0IB 4RWEA 4R01A 1EK6A 5J2UF 3SKYA 4DA8A 1NI4B 3MD9A 3QY0A 1D4ZA 4KIUA 3RAPR 3E7WA 3L18A 1T3ZA 2A94A 1PT9A 3PFKA 4H4EA 5GOTA 4CDGA 3PA6A 5ULLA 3C6BA 1UIMA 3CRW1 3NBMA 4XGNA 1B0PA 1KJYA 3NIBA 4K6CA 2E5FA 3HNPA 1ZGBA 3OZ7A 8OHMA 3GJZA 3QV1A 1QAOA 4JELA 3GJ4A 4Q4AB 1MJNA 4YAOA 2D00A 4AECA 4BXOA 3HXLA 3CRRA 4GL4A 3HSSA 5AI4A 3R76A 3IJPA 4EHAA 3VPCA 5E7JA 4Z7JA 2OP1A 4J1QA 1K06A 2ZQZA 2A67A 3D6UA 3KLPX 3A58B 2NP6A 4PCAA 1KSGA 4AKTA 3EFBA 3ZHOA 1BX3A 1MXFA 2SICE 1OY1A 1V4VA 2HA0A 2YV3A 2Z09A 3OQ1A 4L0DA 1O9BA 3JS5A 1M7GA 4M7WA 1B73A 4ZAYA 3RUPA 4LDAA 2G72A 2R1VA 3SAJA 3EXIA 1BS1A 4E5SA 1MJGM 1OT5A 4J43A 2P2ZA 5ALTA 1JECA 1ND6A 4HI0E 1Z4MA 3TR6A 2JF0A 2XJ9A 4J6EA 5EJ9A 4DHWA 3ZNNA 1CQZA 2X40A 2Z98A 1O95A 1YQWA 2Q5HA 5ENVA 3JTMA 5CAEA 1CF9A 4GPEA 5GVSA 2NYVA 2CWWA 3HP7A 3VPBA 4E94A 1DBSA 2A5JA 1HDGO 2H92A 2R86A 3CX7A 3O31A 4IKEA 3BZBA 3H7AA 4JDUA 2QN8A 2ZSAA 3BF8A 4JQOA 4KZKA 4MEBA 5IAKA 3TQOA 1JQ3A 2Y3IA 2PUWA 3K8YA 2WWXA 1KPHA 2C8JA 4IYJA 1RHKA 3D43A 3G1TA 1T8SA 4LX8A 4G9GA 1JEOA 4X0EA 4B6FA 4BMNA 3ZCXA 4BVHA 4M37A 4QFDA 1R1DA 1P9LA 1E6WA 5JRJA 1HL3A 1XDGA 3TYXA 3ZCPA 5K8VA 1K66A 1NW9B 4DEVA 1W581 3SLRA 1OGYA 3ZH2A 5L3QB 1EUYA 1GVHA 3SZGA 2GEKA 1IUNA 4Q21A 2IZ5A 2Y76A 2AFIE 3O4VA 1EGMB 1DIGA 3CO5A 1ENOA 1OX6A 1FZQA 1QTQA 4PG5A 1I1HA 1T0JB 3W5HA 1R0RE 2RG1A 4JKOA 2VAMA 1UMCB 2ZTVA 2O4CA 1IJKA 2E82A 4N5IX 5JWOA 1ZBQA 2IYXA 3BMNA 4IIBA 4M86A 4TV9A 2XH8A 5AQEA 4N9WA 1P33A 1UOEA 2W00A 2YJ6A 3IDQA 2GPAA 3U4GA 3ZEIA 2XT6A 3RAEC 5BSTA 1PZNA 4B4KA 1KZ1A 4KGZA 4MCAA 5D1NA 2IY7A 5BUZA 2A92A 3VSAA 4BLTA 3KUKA 4FFRA 4PU0A 1X70A 1XQ1A 1Y6QA 2W4MA 3A1TA 2XT9A 3UJ7A 2NG1A 4LHYA 4CETA 1BZYA 1UBGA 3O9ZA 1V39A 3SJAA 4FWBA 3I28A 1EB8A 1M2NA 2VJOA 1A27A 5K01A 3GDOA 5BUCA 3EXHB 1X3LA 3GLHE 2VKQA 3CURA 3KHTA 1W46A 9ABPA 1WXGA 3I4FA 1ONPA 1S6YA 3GVXA 5EZYA 4K9PA 4DA0A 4OJQA 4KMSA 1LBSA 2HK9A 3QBDA 1TEXA 2WZCA 1EVEA 2NTYC 1SVKA 2ONKA 3OT1B 2WJ6A 3E61A 3E9CA 3EOBI 5IDQA 4UTVA 1UDBA 2BCGY 1PBTA 4M99A 3NWPA 3RSZA 1QUEA 1HE5A 2WQZA 4ZJYA 2CLFB 3C1OA 4HFRA 2EJVA 2VYCA 2X15A 3B2EA 1N7IA 4OJNA 4I9UA 4R9RA 3W5CA 2A4MA 4FX5A 2W0MA 4GG1A 2C96A 3G1UA 2G70A 3ZYZA 2OA0A 3GC6A 3Q1KA 1VLQA 3PR2B 4HDKA 2CXSA 4BMDA 2GTIA 2GUGA 3N0WA 4YAUA 1U8ZA 1ZN8A 1GNVA 2G9VA 4LXQA 2G08A 2W6QA 3PQ2A 2QM3A 2XSZD 3GEHA 3CA8A 4HS4A 2JKYA 3HEMA 4D25A 2V6FA 3CCCA 5AICA 1I01A 1ZEMA 4G4IA 1XQ6A 2H5EA 5TARA 4BNVA 4BVAA 2DULA 3I73A 3R9WA 1IPFA 4NBUA 1GLGA 1DE0A 2OAP1 5BN5A 1TK3A 1EUZA 4QT0A 4FYHA 3SZLA 3D54D 4EG3A 1OWPA 2CZQA 5F21A 1XLWA 1QC5A 2VDUE 5FHQA 2C2BA 1RXEA 1QP4A 4J0IA 4XA8A 2IZ1A 1OA1A 3CLUC 1Y3IA 5ELMA 2Z2IA 3HJHA 1QG4A 1H6BA 4M8IA 2NUAB 1QSGA 3K1ZA 1KDOA 3IT0A 4TYNA 1OX5A 5E6SB 4ENPA 2UKDA 4AKEA 3WB1A 5JSUA 1PL6A 4BV2A 2VK1A 4F2WA 1WXIA 4PCVA 3LCMA 4NU6A 4B2YA 1JHXA 3KAJA 3O90A 5AW6A 3EVTA 1FMFA 2BGUA 1Y7LA 1DEAA 2C4UA 1BJTA 1B15A 1J24A 1TF2A 2F62A 3FYUC 3R7LA 4JLJA 3K3PA 5B1IA 4ITVA 4EI8A 3LUFA 2B2XA 3OZGA 3HTXA 2C9DA 4OLAA 4D9HA 1PZHA 3UB2A 5DBHX 1M72A 3IQXA 3ZN2A 1PW7A 1MZPA 1SKYE 4V0MA 1VI2A 1GL9B 4A23A 2EJUA 3K9NA 5HGJA 1Z75A 3TPFA 1O1YA 2W6IA 1WR8A 3IAAA 3N86A 4D4HA 3T3OA 2FWBA 1CE8B 1T3TA 4DDKA 4J1TA 3WWEA 3TECE 4RL6A 5K4HA 1YGYA 1E2EA 2FGJA 3L3BA 3REOA 5F2NA 2C07A 2PIDA 4MO2A 3SE7A 2C7QA 3LY7A 1K7CA 1Z0JA 4JFAA 1J9EA 1UPCA 3NBKA 1E2HA 2ZQYA 3K0CC 4MW9A 2C82A 3MTAA 4WQMA 4L5CA 1GZ5A 2VJYA 5ALIA 4BAGA 3CKYA 2HK8A 3DEZA 3IUYA 3HXPA 3V32A 3VR5A 3JTEA 1LKZA 1SCQA 3CKLA 4RDHA 3OBIA 4LJKA 3VH2A 3WJ1A 2AK3A 3B52X 1W0KD 5DN9A 1RR6A 3A11A 4LJ6A 1FEZA 3LO5A 3NYIA 4UE3S 1F8UA 3QBVA 4OGLA 1Y9DA 4O25A 4CCSA 4KQJA 3WGYA 5AK6A 1JLSA 2OSVA 1ZMXA 2HBRA 4FX2A 4CEHB 5SZHB 2BM8A 3RYHB 5K0CA 3I3SR 1YQEA 4CLDA 3QELA 3QLUA 1KEKA 4WW0A 3WK7A 4HTAA 3TB6A 4DV6B 1A0OA 1C4WA 5JADA 1K5HA 2Q49A 1BE0A 3V1UA 2C9BA 3RHZA 4UTOA 1CJUC 4WOKA 1N2EA 3RLIA 3VSBA 5AYVA 3BSSA 4UTXA 2WJGA 4YGYA 1L3CA 1WCYA 3VZCA 3N07A 3S70A 1WUTA 4D6XA 4GWLA 5B2EA 1PDVA 4FHCA 1Z37A 4IQGA 4K6OA 4JROA 4E21A 1V9SA 1LDGA 4IM7A 4PAMA 3RU7A 1KKLA 1IN6A 3EUFA 4BRSA 3MWYW 2RGXA 4GOKA 5KWIA 3OC6A 3BCRA 4UU1A 1OLUA 2PDAA 2ZT8A 3G0DA 1AGXA 1WCIA 3GA5A 3UAZA 1NG9A 3DMYA 5HMMA 2CB0A 1ZINA 4C4AA 4XPIB 3U2QA 3EW9A 5LQRA 1M34B 2J3QA 2WHQA 3DLPX 1KAQA 3QPWA 1UEJA 4A8JC 4EHIA 4AY6A 2GM4A 3P5BA 3EUEA 4CKEA 2ZLBA 5LOVA 3W77A 4ATNA 2QG6A 1MKYA 1OH5A 3U44A 4NFHA 4CIAA 1ZU4A 2WF8A 4BMPB 3NIFB 4XGIA 4IDQA 1Y6RA 1DBVO 3GPDG 3MBKA 4HXGA 2F8SA 4Y1RB 2NVBA 2X0JA 4RFVA 2UXDB 5C8DA 3JVIA 1Z5WA 1K8RA 2CFOA 2FPPB 3BH6A 3CIFA 3DFIA 5T6MA 1AKWA 3IERA 4JLUA 4Y7CA 4BFXA 2RCYA 2RI1A 1U3FA 4X84A 1MCZA 5TQ2A 3SDBA 2QTZA 1G21E 3QF4A 3UAYA 3I4LA 3ADOA 5ECYA 4K9RA 4BO7A 4K26A 2Q4RA 4KDRA 3D59A 3WAGA 1B43A 1R12A 2H17A 1CEXA 3H4MA 3KAPA 4HLDA 2HO4A 1WAMA 4BLVA 5JBNA 3OTGA 5AVVA 3G5UA 4NG5A 4XB1A 1RIIA 5AXCA 3COWA 1OUMA 4F4HA 3VYSB 1NATA 1AA6A 3PPIA 3W04A 1XCGB 1ZM2A 3M6VA 4AJLA 3HU1A 3K09A 5IC5A 4GXTA 2QTAA 3KKLA 1RE1A 1PTJA 5CNMA 5AP9A 5JXHA 3THXB 2EFHB 1DPFA 2NM0A 1YKFA 3NOOA 3KJNA 4NMXB 3R0IA 1VI5A 2XCOA 3ZQUA 1L5HB 1W44A 1PTKA 3CZ4A 1JEYB 4J3JA 1GPMA 1K8ZB 2ZJYA 2QQEA 3AI7A 1XZQA 4CV0A 1RE0A 4CMEC 2GOYA 3GDGA 4H3SA 5DTMA 3AEQB 2V8OA 3TCKA 4OJKA 3ZWBA 4ARCA 2I4MA 3RT1A 3WOVA 4BQNA 3BFXA 3FLAA 2ZWPA 3B1WA 3SC3A 1K5PA 3PT5A 5TMPA 3C3DA 3CTPA 3HDQA 5L3SA 1Q3TA 2JJ8A 3OZFA 4P32A 4B7XA 2OCBA 1K4YA 2ALJA 3DVSX 1H6AA 4Y6SA 3QE9Y 2PCJA 1XO1A 4JUFA 4N3BA 5LYYA 1JHRA 3DF9A 3F74A 2UZAA 4DILA 3AFHA 3HB1A 2IHKA 5FJJA 3KZCA 4CL0A 3IEKA 1UFRA 2PLNA 3E84A 3R8CA 1GG5A 4HJXA 1OLSB 4NS1A 3AP3A 5DWDA 1AV6A 5HKKA 1X7XA 3DE5X 3HWRA 4JUCA 5DYYA 5TGTA 4JY7A 2RHTA 1W4CA 4UPEA 3OX3A 4I50A 2V97A 1FUYB 2BGKA 2RGGA 2I1VB 3K05A 2CMGA 3TN7A 3OUTA 2DB3A 3FYCA 2CJWA 3L4JA 2W2OA 3CNEA 2OGUA 2SBTA 5FUBA 1HQCA 2V59A 3LCVB 3CLHA 2WSSD 4OGGA 3ZW9A 4BFLA 4ENSA 3L8GA 3LSYA 2BGRA 3BQ9A 2EL9A 2X5KO 3PR3A 2GS9A 3HB5X 4URHA 4A9AA 4DLWA 3D6HA 4XLZA 3A8TA 2PZEA 1AUQA 2MU1A 3MBIA 1Z2AA 4LOHA 4MV3A 4KBGA 4QUJA 4TLAA 4XM0A 5DI9A 2CSXA 1WP9A 4PLYA 2YY5A 1I6MA 2KQUA 2WT4A 1M8FA 4O63O 5FUXA 4KXUA 2BFMA 4KR6A 1YE8A 2OB1A 1Z0AA 1M6NA 3NQ41 5DNEA 1Q3KA 1LV8A 3ABZA 1VL6A 3CEMA 3ZWAA 1X1EA 4EA9A 1VFPA 3ZJUA 2ID4A 3DZKA 4ZREA 2R8BA 2XW6A 2IYSA 3B8EA 1J2TA 1X1SA 1RD4A 2NTVA 4B33A 1M2GA 1RSZA 3WNDA 3PD7A 3SC2B 3AP2A 5C8YB 4DA4A 4G86A 2KB0A 2HF8A 4OYYA 4YGXB 5KYUA 4QLAA 1K5GA 3C3PA 5LWQA 1L4KA 4ZGGA 4FD3A 1OFUX 3N2KB 5BT9A 5DLEA 4FN4A 5IM4A 4HY3A 1XVAA 5LZ8A 4J03A 1NLFA 3Q72A 4CIYA 1H8HD 1OI7A 4YUVA 4YR9A 1KJ8A 4WBSA 4YCSA 2C58A 1O54A 2ZZMA 1U99A 5H9VA 2WQ6A 2IFTA 2V3WA 2GJAA 4LPKA 2UZ1A 5CB4B 4CN8A 3M5PA 2QYSA 3FOZA 1RLUA 1BGWA 2KHZA 1FVOA 3KEFA 5K99A 3GRZA 3TOXA 4BX2A 5IMSA 1GAWA 2IPNA 1ZFNA 3EWSA 4EG8A 3ER9A 1AGRA 1Y9EA 3OIGA 2MSLA 3B7GA 4I1RA 4RPKA 1L2TA 4GBED 5ALPA 3G2LA 4J7CA 3K2EA 3NH9A 3WYAA 4AG6A 3BJZA 2C3UA 3DD5A 1YZHA 1SUDA 1V5IA 4LDNA 4WECA 4U0JA 3IXLA 3DD1A 4JJ6A 4TWJA 3ZZMA 1U6KA 3PVSA 4CZ2A 5CX1B 2V7QD 1UBOS 2F8TA 3FI0A 4J4HA 4ESVA 4F12A 4ZVQA 2O8FB 1F2TB 5E9WA 3A1DA 4CNBA 5F1YA 1UPTA 1D4OA 2FPGA 3FNIA 3HJRA 3MGCA 5FKJA 4L2IB 2EQAA 4MHTA 4F93B 1GYRA 4RCYA 3OECA 2FSVC 3PB3A 1V2HE 2YV5A 3H11B 3Q8XB 1Q50A 2IHBA 3E03A 3QU9A 2VHUA 5HBGA 1CJBA 1AU9A 4IV5A 4MRVA 4IWYA 2H4JA 2G9ZA 2IUTA 3K9LA 4NXNB 1A7KA 1BCSA 2XE7A 4X20B 1Y1TA 3S2ZA 2QRGA 3E22A 3QUQA 3QEMB 1FLAA 2EAUA 4I19A 5AHWA 4BVFA 3DBLB 1K27A 2X0DA 2JJMA 2W4IA 1YJAA 1TKCA 2BW0A 1ECGA 1W96A 2GPNA 1YA4A 2VF5X 3P0HA 4G8DA 3FGZA 3SE0A 3TZKA 1J49A 2ECFA 4CL3A 3DFUA 2F1OA 4UBJA 5J47A 5GJCA 1PU2A 2RKOA 2HO5A 4MUHA 3W6ZA 1Z2EA 4M8KA 1DV1A 1XL1A 3PUYA 3OZAA 5E38A 6GPBA 1QGDA 3TIFA 2GHRA 1NT2A 2N75A 4UMVA 2Z4RA 3DG9A 3NOXA 1H2RS 2G1UA 4LF9B 1UKBA 3HACA 5KDLA 1TTPB 5TF4A 5I48A 3GT0A 3TEJA 3G8CA 3RF6A 2PV0A 1EG7A 1K3TA 4MGZR 3AU8A 3L7JA 5AHKA 5LUAA 1KORA 1ZYUA 2VF8A 3DDCA 4K03A 4UXJA 2ZDQA 4YQZA 5LKAA 1PV4A 1NN1A 1QU3A 3A27A 3AUFA 4MVCA 1CS0B 4MTLA 2RHMA 2DLDA 1M1YA 1RI5A 2H0AA 1NUAA 1KH1A 1QNLA 4EUSA 1LWOA 3HYSA 5BP7A 2ZWOA 3ILYA 4NE7A 1RXWA 5JLJA 1PWXA 2CFRA 2KYRA 2ZT6A 3FWNA 4WY2A 1L5NA 3WK5A 1TVCA 3F5QA 1H0RA 4RH1A 2AFVA 3AI3A 1RXYA 3BDAA 4R05A 1GA1A 4IQ8A 3ANNA 4QUIA 5KTRA 3B6IA 3BEDA 1VPVA 3L4EA 3WWZA 3DFKA 4YMHA 4NEGA 4AD8A 1PBNA 1P5JA 2G09A 4KCGA 4D42A 1AHNA 3IBSA 1GT91 4MUNA 1A3CA 1EP9A 4X6XA 2W2TA 4UTNA 2XVYA 1V4BA 1BRTA 4FCTA 4P4LA 1CPYA 1HI9A 1JZQA 1ZX1A 1OLOA 3T3HA 4ZMBA 5CG1A 2JH8A 1L5LA 3UB3A 1K6MA 1NN5A 2ZWAA 3W6UA 2W93A 4YT5A 1SMKA 4W99A 3OZSA 4R2LA 2I6TA 2CE2X 3MWFA 4TS9A 3AYXB 4ERXA 5K45A 2C2XA 4RORA 3IOBA 3OHMA 4FSHA 3SHTA 4C1NA 2ZB3A 5C7OO 5IMBA 1Q2XA 1JG7A 2WFLA 3Q7TA 4PAQA 3ZJ5A 1GGVA 1Z7EA 1E77A 2AJ8A 3FBGA 2KS6A 4MVJG 2BHRA 4UKDA 2YIMA 1WXHA 5FFNA 4D92A 5CLFA 1HFKA 2YWRA 1QGOA 3DEAA 3OJLA 4KSCA 4B7UA 5FLYA 3S68A 5AOCA 2XYGA 1PGQA 4BZPA 2QM8A 3RWBA 3COJA 1RWKA 1NMEA 4YQYA 1R8QA 3UPDA 1Y4DE 4TKUB 1EK2A 4ZV9A 3IBFA 2Y99A 2JC3A 3TJZA 4C1BA 3HJCA 1HWYA 6ABPA 2DUJA 1HQKA 4W9NC 4XQCA 1ZXLA 3B8HA 4YDRA 3HR7A 4LZAA 3U1TA 4N48A 1B6RA 5DCYA 2WF5A 2B83A 1LBEA 3LK7A 1RRVA 3PPVA 3CLTC 1UXGA 3I23A 4GPD1 2C3OA 4S1WA 4EY7A 3QSYA 1L7PA 3TK1A 1RABA 2PQ2A 2YMQA 2FTKE 3DFZA 4R51A 3RFCA 3UNXA 4FCVA 3AVQA 3HYLA 5GONB 4YJ3F 1ORIA 2KI5A 1X7DA 1IOLA 1YJQA 4US1R 1HC7A 2AV6A 2G4LA 4GUAA 2VTEA 2D1RA 5THXA 4UZEA 5JNUA 3MMNA 3E0XA 4UCFA 5IVKA 2X1VA 2QUAA 4M1WA 3JQFA 5AVZA 3WDLA 3AEXA 4HXYA 5DT2A 3EXHC 4KX3A 4KUHA 3TQFA 2AI3A 2D1TA 3U7FB 2O1XA 1OXVA 1NBEA 2QP9X 1REQA 3DLHA 1E18A 3VPDA 3GMTA 2GK6A 3HKBA 3UKOA 3GJYA 4BNWA 3JQGA 3FPJA 1WRBA 2BF4A 2W0SA 2O14A 5CM2Z 1E1KA 1XZBA 1JEQA 1RP7A 2E37A 3PQ4A 3O21A 5D86A 4PRYA 4Z1MA 1ECBA 4D9BA 4BWVA 5KOJA 1W8IA 5AOVA 3QVGA 3HM2A 1YFJA 5B6JA 4PNHA 3CRVA 1R8SA 2MOKA 2IYPA 2FRDC 2I71A 2FV8A 2REQA 2ZI6A 2ZYIA 1XMJA 3FB4A 4IDGA 4DCPA 1DRUA 3EMDA 2PYIA 1ZXBA 1O6FA 1UWLA 3IILA 3L7DA 3BGOS 3MGGA 3TLZA 5HOQA 3GUUA 1XVLA 4IDPA 4W1QA 3IUNA 1GUFA 2GD6A 4XTRA 4EYKA 2NU8A 4NBSA 5CT8A 3ZIUA 3OE4A 5K6TA 2I2AA 4DJFC 1B2LA 2B61A 3B5IA 2G7MC 5ED0A 4IXMA 3WGMA 2BZSA 4MRNA 1NJ6A 1P0FA 2PWAA 3DTVD 3FFAA 4R7GA 4JNKA 4R2XA 2CSUA 3BYZA 3FDFA 5CD9A 1UL1X 4WY8A 1UFOA 2H7VA 2V9CA 1KERA 4JP8A 1L5GB 4AO7A 4QKQA 3LUDA 3J80A 2GESA 2P9CA 4C2UA 1BKDR 3AEZA 1CUYA 1R4NB 3KBOA 4JLSA 1LPBB 3SR3A 2BE7A 4AFNA 4DSAA 2EEPA 1CY1A 1ICEA 2JIZA 4WCFA 2OC9A 3PLAE 1USUA 3KSMA 2P1RA 2OAEA 2QGFA 4RZIA 3H5AA 1SULA 3QVMA 1CFZA 5BWCA 5C5IA 2Q3LA 2QM7A 1AMNA 2YN0A 2YOFA 4PHHA 1D2AA 4QJ5A 2VJQA 1WVMA 3QMMA 5E1BA 4URYR 1TF7A 1RAFA 1C3OB 3RC7A 3T4EA 3B5EA 3HPQA 2ZJ0A 3S4YA 4B1FA 5J2UA 2QN3A 3ESRA 3Q0EA 4L8YA 3EWIA 3AVOA 2EG9A 1HG0A 1S7CA 1E96A 4UBLA 1NZJA 3LOPA 4ZOLB 4YPFA 5IW8A 3U0VA 4X8HA 3VAYA 2ZAYA 2IS2A 4BGIA 4OJYA 3RDPA 2PJUA 2ICAA 5EUCA 1DEHA 2BMDA 1EGVB 3BDVA 3D6MA 5JDIA 2NXNA 3AEUA 4IDCA 3EXFB 1BVRA 1F2DA 3W1VA 1CY7A 1XF1A 1G59A 4BO8A 2PUBA 1XQYA 2X9GA 5ISMA 4UAUA 3QX3A 1SHUX 2FR8C 4QA9A 1WDWB 3UJBA 1UXOA 1ZQ9A 3MUOA 9LDTA 1ISRA 4NBVA 2PTHA 3SWWA 4CMJA 1W87A 4EO4A 3DBHA 4LJYA 4PHTA 4RKYA 2FEXA 1T4CA 4RIEA 1PR5A 1ZUD1 2QP4A 2R00A 2R85A 3WVNA 1J07A 5HKOA 1E3WB 2D4AA 4CKWA 5DHSA 1ULUA 1Q84A 4NL4H 2O3QA 3P71T 4ZHQA 2B8EA 1Z0UA 2DUUA 2J4CA 3G8AA 4O4HB 1MX5A 1TQ4A 1YBFA 3GDWA 3H04A 3KVVA 4GR4A 1OROA 3NRJA 2OO5A 3ZDBA 3VKHA 1NR7A 2IW3A 1NBWB 2FZ5A 3GCZA 3BG5A 3SBOA 3QUAA 2HWKA 2QBYB 2H1OA 1SHKA 3EPPA 5D51S 5GM1A 4IHJF 4NMLA 1CUDA 1QUFA 2A88A 4R1MA 3CH4B 4U2BA 2XLCA 2QQ5A 3RBVA 3NUQA 4YECA 3K9GA 4AY5A 3QLJA 1R3DA 3MWDB 5AUQA 1VL0A 1OFTA 4QUEA 3WGGA 4YFVA 4F4DA 1XELA 3GRYA 1DADA 3SHFA 1RZUA 2YFQA 2R7KA 1JBQA 1H3NA 2ILTA 2QEQA 4O6VA 4Q48A 3SFZA 1L8OA 4ETIA 3ST7A 2C5SA 1NVKA 1OXKB 3BQNB 3MAAC 2AEJA 4NCBA 4DMUB 3HM9A 3OA2A 1WMFA 1WXWA 1PHRA 1T8WA 2XR1A 3A2MA 4M0PA 3SM3A 2RAPA 1QX4A 3ORYA 4QDXA 2WV9A 4RKRA 1SZPA 1PNOA 5CJJA 1WG8A 3HK2A 4BJ5A 3DQPA 4FYMA 1V3QE 4OUDB 3G2MA 4C4YA 1QDEA 3I2HA 4V39A 1Q74A 4IQ4A 3NCTA 2A9OA 2B3TA 2YIDA 3B3FA 3GIDA 2AYXA 2ID7A 4WZBB 2P6MA 4TXLA 3A9UA 3WGJA 1UC5B 3V8MA 5IN4A 2ZOSA 1SGWA 2J67A 2ORVA 3RTCA 3LKDA 5IYZF 2I54A 5DP2A 4NZOA 2PZJA 2R6FA 1O89A 2QTFA 1R66A 4R2HA 1JR3D 3DKKA 1RJWA 1OV4A 1B8UA 1V48A 2YR0A 3G88A 3RFUA 4ZJPA 3RJ9A 4FW9A 4NMWA 1SOUA 3LUCA 5EWLB 5CT4A 2QN6A 2I7TA 3FXAA 2QMZA 3NBQA 1PFVA 3T1QA 5JOQA 1AF7A 5DXJA 4XVHA 2JIDA 2ACKA 2QAIA 2BFEB 2GI4A 4HLNA 1VSTA 5KKNB 4MIOA 2WMNB 3VZSA 1K6EA 5H3HA 4I1SA 1PX0A 1QVRA 1TQHA 1Z5NA 1Q7TA 5DBOA 3RTAA 2IX3A 2WSIA 3GEIA 1WW2A 4G0OA 3WRYA 5CEEA 2V45A 4FBGA 2WWVD 2IIPA 1C7JA 5CMLA 3PHCA 4WKGA 5CGZA 3LP8A 4BGEA 1SURA 4OV6B 4BKUA 3DV2A 1QLWA 2J0EA 1MIOB 3ANLA 3AR4A 3NWEA 3DKRA 3G8YA 4R98A 1EVZA 4MGEA 4OKSA 3AILA 2P7IA 3CKKA 3EY9A 1WHTB 3X1ZA 1P44A 3OP4A 2ATEA 1GG2A 2HCFA 4EKGA 1Z25A 2BKXA 2IYZA 1Z88A 3STUA 4KXFB 3SQLA 1G7SA 3NJ4A 2HIMA 3DZCA 2MSNA 1HEUA 2UVDA 5BW8A 2Y66A 3UENA 3M5CA 1ONSA 1IOVA 2ZJ5A 4JB3A 3NKLA 4TKZA 2R96A 3WA7A 2HN9A 3TMKA 2EDAA 4MEAA 5J3JA 1XFAA 1KXZA 2IEIA 3ITKA 2HLHA 3CX3A 1V8FA 2B35A 3OSUA 3FNEA 2WRZA 4I3HA 1LS1A 3CUKA 3JD1A 4R0VA 1G20A 2BWJA 2GAJA 1BXRA 1AQLA 2J4FA 4Q3LA 4UUQA 1PK9A 5MHTA 4TMZA 4WKOA 3EBPA 3F47A 3HBAA 1ES9A 1XRNA 4NENA 1G8SA 1BFUA 3H97A 4ND1A 5LMUB 4JBYA 4N82A 4QRHA 4ND6A 4FNOA 1OX4B 4NZPA 3ILXA 1NI5A 3HVUA 5EIOA 2IOYA 4WXRA 3TTSA 4BX9A 2BFFB 2ECPA 2JHFA 3MJTA 4UXHA 1G7RA 3NEAA 5IH7A 5C5DA 1G64A 4IRMA 4Q1CA 2E48A 3JZDA 5CFQA 2EDCA 2GNPA 1DCMA 2ZJ1A 4P35A 3TDKA 4F86A 2VA8A 1TZJA 3GZNB 5BSMA 2LGJA 5A02A 4WESB 2YVKA 3E0QA 2Z9BA 3THOA 3WKDA 2DSTA 1J20A 2QI9F 4J3FA 3WMGA 4O8ZA 5KMGA 2BKUA 2J3JA 1G8PA 2XZLA 5DLYA 3DTNA 1Z2PX 4N4AA 1M7BA 4HR7A 4BTLA 5CBPA 2CVPA 2G04A 2R44A 3IV7A 4KV7A 1Z39A 5AI0A 4N40A 5DX1A 1NNEA 5IZCA 1NE7A 2C7RA 2GZDA 4QUGA 4KXWA 1DCTA 2GEBA 2EVWX 4QQKA 4A0HA 1OIVA 4DCUA 3C87A 1IY9A 1V11A 1M1ZA 1BH6A 4CLRB 3BWBA 1XA0A 1C2YA 2XUJA 4JS0A 1C8LA 3KVRA 1NFRA 1ATIA 1W0KA 2X0KA 1AUOA 3KWJA 4KMRA 2LBPA 2NO6A 3OCUA 5KCZA 2O50A 4X9XA 4DY4A 4HVTA 3LF2A 4FGSA 1RM0A 5HDQA 4HQOA 5KQGA 4QBKA 4W5TA 1TKRA 2GASA 3HBLA 3OPYB 2X7HA 1XN4A 3A6JA 4RGQA 1FB5A 3PLRA 4QYWA 4Q24A 3AWIA 4B9EA 4CKXA 3TBHA 1MOPA 2IIBA 3PHBE 3NKFA 4R2JA 1PEDA 2OHOA 3N0XA 2ORIA 2BBWA 2A0KA 3RVSA 3RU9A 4G67A 4Z4EA 4X7RA 4YAFA 3I3OA 1RI4A 5IS2A 1M2WA 1U2SA 4P5DA 5KWJA 3T52A 5I8PA 3NRBA 2GM3A 2YWJA 2NTJA 3BTVA 3NU1A 1JJ7A 1CR4A 1L3IA 2BIFA 1RJEA 2YFYA 3AINA 4YP7A 4HYYA 5LP1A 2V0CA 1K0FA 3JVUA 4BLUA 3H1PA 1TA4A 3UMMA 1U7PA 3D8NA 3Q10A 3HO1A 1UWVA 3P1JA 1CP3A 1EYZA 1XEXA 2DPYA 2E87A 4PANA 3TM4A 3Q6IA 7REQB 1MN6A 2IYUA 1T6NA 3M70A 1Z6TA 3PIRA 4X3CA 5AKGA 1DRKA 1OOEA 2QY6A 4OX9Y 1JKJA 2Q5OA 4DC0A 2WNHA 4YRAA 1P2FA 1N33B 3BFVA 3B6JA 3EAFA 1MH1A 1XQ9A 1JSZA 1LS6A 3EA4A 3HS3A 3L02A 4L4YA 1P1BA 5ILOA 1M5RA 4MGIR 1OH7A 2WINI 2LPMA 4DARA 2WNIA 3L8FA 1PWHA 1RHRA 2E4AA 2QRUA 2F67A 2CEKA 4ZI7F 4BDTA 3C5HA 4FEEA 4LNUB 3UYKA 4XXHA 3O91A 4KXMA 1Z06A 2BGJA 2NSYA 2VDWA 4JJGA 3MERA 1QKIA 2Z8ZA 4BX8A 5IEBA 3S27A 3O8RA 1NUSA 2QTRA 3G89A 1N6RA 1O9GA 3A28A 4NPAA 2XIQA 4RIFA 3N6RA 1A4IA 1ENPA 2A1IA 3FPSA 5KPDA 3GJ5A 1VG0B 1EDOA 4FQ8A 5JQGF 3BB4A 4G07A 3BDIA 4C0QC 4Z7OB 5I4KA 2X5NA 2HMTA 4FFMA 4AO6A 1AUPA 4AWBA 4ECAA 3RSLA 3KB2A 2G4CA 4I9HA 1JIUA 1VMIA 5LBTA 3WJ2A 2OFXA 1HZJA 2MSCB 4KIWA 1DRJA 5CYPA 3JWIA 3PE3A 3RIXA 2UZ3A 1DEXA 4DLPA 2EZ4A 4E5VA 4FOSA 4E11A 1L4YA 3JQQA 2ASEA 2FJ0A 4LHWA 4EK9A 1CCWA 1FSGA 3IULA 5DJ5A 721PA 2F9FA 4KOAA 2CMFA 2PT7A 4FD2A 4HO1X 4LY9A 3V4FA 1CLUA 2YV4A 2YWEA 4BRUA 4OG2A 4RZXA 4WFIA 5FYQA 3NVKI 3PFIA 1BMFD 1J8VA 3PTZA 1O97D 1CG6A 5C81A 5CVUA 3EQ8A 4C7BA 1KAGA 2Y1KA 3IS3A 3AEYA 1H23A 1KYTA 3GEMA 3CC8A 4FYPA 3LWBA 4TQ9A 5KQMA 3HGTA 1QS0B 1OE0A 3AUAA 3TUJC 2XMRA 3GUYA 3Q3EA 3DBOB 4B8YA 5JXGA 3NBFA 2MR5A 3RVJA 1PJBA 4Z0NA 4HDNA 5TIIA 1UQUA 4MHOA 5DW3A 4N0PA 1ZESA 3FPGA 1JA0A 4PC7A 5IKMA 1N4DA 1JJVA 3NGXA 4B7CA 1Z0KA 3Q6MA 4ZTZB 1P4RA 3G9QA 2EZ8A 1G8MA 2A9VA 3AUJB 2E6UX 2CJXA 3HN6A 4NJEA 1ACJA 1L7XA 1ZK3A 4JJ7A 4Y0VA 3RREA 4MI9A 5JHGB 4YJHB 2DM6A 1HNZB 2X9LA 5B3JA 4KQIA 2UVPA 4DMRA 2EQ5A 1L7VC 2G5PA 4H7IA 1N2SA 1PJ8A 2VC2B 2L42A 2A0UA 1IAQA 2WSSA 3T06B 2HNBA 5G1NA 1SN7A 3UQZA 4TTVA 1X1DA 2C2ZA 1SA0B 5M3BA 3BMQB 3UB4A 2PH5A 3FI9A 3BMXA 2UV8A 2FEOA 4IMRA 4WKPA 3MTDA 3C41J 1R4MA 1PO7A 2ID8A 3CVUA 1HL7A 3VQTA 2Z8YM 2VJKA 2X8AA 4RZHA 2M6LA 3KT3A 5GZ3A 2XQFA 4IIHA 5DNYB 4RTLA 2MYPA 3TMAA 2Z08A 3UMBA 4BNFA 3FD8A 3U4HA 1XK7A 5KTYA 1CUXA 4IJKA 2IV2X 1NX6A 8AT1A 2EZTA 2W58A 1H0HA 3FBTA 2UDPA 3ANSA 4CKCB 1N6HA 3DOJA 2P3LA 2CXNA 2I9PA 2ZRMA 3HKCB 4GMDA 3AQIA 3RNLA 4E0BA 2XNHA 1VYHA 3EMBA 1QVVA 1WOYA 3WA6A 1VTKA 1Q83A 3GFGA 2X9VA 3HBFA 1XTQA 3ABSB 4AAYA 4BVBA 2XD9A 3JYOA 3SQMA 3EF0A 1P9OA 1PJQA 1U28A 2O2SA 1DFHA 4NPHA 2RAVA 1YRQA 5IHPA 3B3AA 3H84A 4UHKA 4UHFA 3TLMA 1H8HA 1VKOA 5FA6A 5LYJF 5MF6A 1NYQA 5LA6F 3IIJA 3H9QA 4F6RB 2IHZA 4XWOA 4D9KA 3W79A 4F45A 1Z4QA 1IIRA 1R0CA 1CUAA 1CSEE 5JQWA 4YRJA 121PA 4G26A 4Q82A 3D3EA 1E4OA 4FWIB 4JVSB 2QXTA 3IAEA 4H7KA 1A72A 3UWPA 4NZZA 3KT0A 3T7CA 4PYNA 1Y63A 2JKVA 5EXXA 1JAHA 2PEZA 3FCYA 1H9BA 2AR7A 4LV8B 1QV6A 4FI3F 1EXWA 4INAA 2ZRAA 5I3ZA 2GPTA 1JL3A 1QTNA 3WV4A 1C9KA 5CVVA 1QH1B 3KYIB 4GI3A 4MXDA 1ISGA 3PNKA 4CM8A 3UUGA 1QVZA 1U6IA 2QWXA 2V7QA 4D41A 3UFXA 1YR6A 1FYEA 3CONA 4MQ6A 1U1FA 3AWDA 1RJGA 2NT3A 3FAZA 3KKZA 3WG9A 3D7LA 1DO2A 4R4JA 4TS4A 4HQRA 3PEUA 1VG1A 1UXIA 3L8HA 4MUMA 2A9RA 1WULS 1UJCA 3O4FA 5HOEA 3PKIA 2JAUA 3G9UA 2YRWA 3TQHA 3ICPA 1X7WA 4IVNA 3VNBA 3EC7A 4B3XA 4EMTA 5SY9A 1YDWA 2W6MA 1XDBA 2QV0A 4YV7A 2C2OA 4NU5A 1SKMA 1XZFA 4OU5A 1KZYC 4IKOA 1RYHA 1A69A 2WJHA 2AG1A 2AN4A 3AERB 1IVSA 3LD9A 4O0MA 4MPRA 1NKSA 4D81A 5CXXA 1QXSA 3RUEA 1EA5A 5B4UA 3D2AA 5J2TB 2IXTA 1G17A 1TW3A 2DHQA 3ZE6A 2R66A 4QELA 2DFPA 4HVLA 2EARA 1BN6A 2H29A 2WJ3A 4FONA 4L85A 3DE4X 4JODA 5UKDA 5C4IA 1PR0A 4YJ2F 4MQEB 2W6CX 4ZVKA 1CY2A 2G9UA 3FMOB 4RSRA 3S28A 3EXG2 4EEXA 3P9IA 1WTAA 2VZLA 1WU7A 1UDCA 4D9NA 4J0CA 2O2CA 3E8MA 1C8VB 4PVDA 4HB2A 3VKFA 1X7GA 4WCDA 3WGVA 4BYMA 3JZIA 2P11A 1JP7A 4LXGA 5AK5A 2EF0A 3OCCA 2PVSA 4DL9A 4HYQA 1P77A 4Y6LA 1RQRA 3JD4A 1XRJA 2ECKA 3RIGA 2D06A 3LZ6A 1ZWLA 1A5SB 1FP4A 2Q5CA 3A9RA 3BB3A 3KKEA 4L5BA 3TVTA 2VP4A 3E9RA 1ZGAA 1KI8A 2AI2A 1BN7A 3QX8A 4JGBA 4UXIA 5IJWA 5M5BA 4Q66C 5KYYB 1BMTA 2WF7A 2DLNA 4H35A 3KVNA 4FQ5A 4ZYWA 5CPFA 1A9XA 1EFHA 2G1KA 3WLHA 2BD0A 1A8PA 5DK4A 4EBFA 1NIPA 1AM4D 1FC0A 3K2IA 1NQXA 3NAGA 5E9JA 4ZIRB 4KEAA 3NATA 3UTCA 1QK4A 5AT1A 3T7TA 4YRDA 4Z4HA 1YU9A 2O2IA 1Z4NA 3R2JA 4MR8A 5HZGA 2VSYA 2OZVA 3DGEC 2AX3A 1AD2A 4L8WB 3QW4B 3TI9A 2H6EA 1DCKA 2CHQA 2XWPA 3GA0A 1E7QA 3QHAA 3H19A 3DT6A 2QM0A 2AC7A 3IP8A 3Q98A 3W9SA 2R8ZA 3ZHBA 1ZOLA 2OMKA 4TMVA 3LLUA 4JYZA 4S1VA 4OKIA 1U8FO 3F9RA 4QVKA 1X9GA 4JBWA 5LQSA 5TPWB 3FPLA 4QWMA 1QE0A 3RQIA 4KE7A 4FLFA 1E9VA 2B4AA 3B60A 4N7MA 3C7KA 4KXNA 5CNIA 5GV7A 4KQEA 2PXHA 2PJZA 4L50A 4CV1A 4HEHA 1JFVA 4M9RA 3U1VA 5LQJA 4P3XA 4BPRA 2AXQA 3P2EA 3BEOA 1EBFA 3VI3B 1PP4A 3HVKA 4U9IS 4C03A 3MUEA 4AX4A 4CVNA 2FB9A 1XD8A 3A4LA 4B9AA 4BE7B 3H5TA 1FDOA 5HIJA 3WBJA 4L76A 4ZT3A 3TLKA 1K7YA 4MS1B 1G60A 3C6YA 2HQBA 6ADHA 4LRTB 4LVCA 1PI3A 5KEIA 3KFVA 2OM6A 3JZFA 1BSVA 1N2ZA 2JFGA 1U8CB 2A9QA 4K2HA 5JCJD 2DUMA 5LZ4A 5DTEA 3RFVA 3U4MA 2I65A 1RT9A 1GAQA 4EJFA 2QMOA 1JJBA 1G8KA 5JZMA 2RONA 4IP0A 3E70C 2UUOA 3KUUA 3S29A 1I33A 1WD5A 3GT4A 3ICQB 4YJ3A 4FMCB 1UPUA 1I5OA 4TLLB 1RRCA 2JEYA 2YDYA 1O08A 3HLYA 5JH7B 1L4MA 1MT3A 3KX2A 4MWEA 3STWA 4Z7NB 2RB5A 1W8DA 4XEHA 2ATIA 5KJEA 5B4VA 3LBNA 5K0EA 1H5QA 3NI2A 4PHCA 2AIRA 4RW0A 5EERA 4MP8A 1UMDA 4L5JA 3V8VA 3VUEA 2J5XA 1M6YA 5FDFA 5I45A 1VPEA 3A7DA 4D3XA 1RWWA 1M34E 2XUQA 2JAPA 5IJXA 3HVR