4URFA

Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
248
structure length
248
Chain Sequence
b'MLLEGKTALVTGAGNGIGRTIALTYAAEGANVVVSDISDEWGRETLALIEGKGGKAVFQHADTAHPEDHDELIAAAKRAFGRLDIACNNAGISGEFTPTAETTDAQWQRVIGINLSGVFYGVRAQIRAMLETGGGAIVNISSIAGQIGIEGITPYTAAKHGVVGLTKTVAWEYGSKGIRINSVGPAFINTTLVQNVPLETRRQLEQMHALRRLGETEEVANLVAWLSSDKASFVTGSYYAVDGGYLAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLOHEXANOL DEHYDROGENASE
publication title Molecular Genetic and Crystal Structural Analysis of 1-(4-Hydroxyphenyl)-Ethanol Dehydrogenase from 'Aromatoleum Aromaticum' Ebn1.
pubmed doi rcsb
source organism Aromatoleum aromaticum ebn1
molecule tags Oxidoreductase
total genus 99
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 1.1.1.311: (S)-1-phenylethanol dehydrogenase.
pdb deposition date 2014-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4urfA00
3C3XA 2YV2A 2QRLA 2PNFA 4PLPA 3V2HA 3Q6IA 1MUUA 1UZNA 1ZK1A 5F21A 3GMDA 3I9JA 5A3JA 2HAEA 4LSMA 5JCXA 2VZ8A 4QO8A 1EQUA 1GFSA 1EDZA 1HSZA 3A4VA 3NYWA 2ZIZA 4UEKA 4LCEA 1IHYA 4EUEA 5EMHA 5TRTA 3QWAA 2AG5A 4Z9FA 4B4WA 3PWSA 2HJSA 4CLDA 2ZB4A 1BDMA 1I5RA 2OUIA 4IBOA 5U9CA 4BKPA 3I4CA 1LSSA 2WMDA 3WLEA 2RH8A 1PZEA 2NVBA 3TF5A 1I3LA 3GHHA 3IDSA 3WGHA 5HTOA 2ZJ1A 3F4BA 2BKAA 1YB5A 2WE8A 3GVCA 3NDJA 4MIOA 3DBRA 1YL5A 4W6ZA 1SNYA 4BO3A 1PJLA 3N58A 1XYGA 2P68A 3R6DA 2BI7A 3G3EA 4YT8A 2Y0CA 3MJSA 4M1QA 4WK6A 4WCFA 3PFFA 3FPCA 1YRLA 1I24A 1YJ8A 2BFAA 4CMIA 5ILOA 1XQ1A 2J3KA 4E5MA 3QQPA 4KTTE 3W4IA 4BNUA 1WXDA 1HZJA 6LDHA 5C3MA 5IDXA 3S2IA 1T2EA 1GYPA 2P2SA 4IZHA 3ROPA 5A5FA 3E82A 3JQ8B 1OAAA 4FD3A 3TZKA 5JAQA 1DRVA 4HWKA 4Y67A 1IUKA 2ZTMA 1VSUA 1A4UA 1H6BA 3GEGA 1VKOA 3GMSA 1P9LA 1GZ6A 2ZK7A 4GLLA 2W98A 4WUVA 3WDSA 3OEWA 2P4QA 4B7UA 2FR8A 1ZK0A 1H94A 2PD4A 4IDDA 4QUKA 4IJKA 3S8MA 1LSJA 3MTGA 1W0CA 2J5QA 2VYNA 3LC7O 5TT0A 3WYEA 1ID1A 2AG8A 4XKJA 2IZ0A 3G1UA 2NQ8A 3VPGA 4AJ4A 4TVOA 1PGQA 3ZV6A 3VTZA 3KYDB 4JXKA 1GUZA 4UVHA 4RVDA 1PQUA 4NU6A 1P1RA 1OMOA 3F4LA 4Z0PA 1H2HA 1BGVA 3GH3A 1TVEA 2H6EA 2UV8A 4B79A 4E5KA 2X23A 4UEOA 3IOYA 3OHSX 1SOWA 1DPGA 3FRJA 2UYYA 3RBXA 3JD3A 4BO4A 3ROMA 4U6QA 4CM3A 4R4JA 4CR7A 2FPGA 3V1UA 1PJ3A 4RZHA 3D5TA 2Q2WA 4TKMA 2OBYA 2Y68A 1LI4A 2QYTA 4FS3A 3ICPA 4BNGA 5AQ1A 1BXKA 3QVTA 5G4LA 3KTDA 3WSVA 1O95A 1FDWA 3WFJA 5BNFA 1TT7A 4OIMA 4TVBA 3LVFO 2XF8A 3VAZA 4E12A 3Q11A 1A71A 1YQDA 4J9VA 3JQAA 1K2WA 5CDYA 1ISJA 2DT5A 1DOHA 1XU9A 4PRLA 1IPEA 1P0FA 2O3QA 5DP1A 4JNKA 1PZFA 1NR7A 5B1YA 3TOXA 3E8XA 2G1UA 5ES3A 4CUKA 3KVOA 4Y6PA 2V6FA 3GOHA 3OJFA 4BO7A 3L6EA 3D3EA 2DFDA 1E5LA 1KY4A 4ZQGA 5KJCA 3NKLA 4E2WA 3EVNA 4NNJA 4BS9A 5MDHA 4H7PA 1GUYA 1UP4A 1GEEA 3CZMA 1EZ4A 3PJEA 3VOSA 1J0XO 1TLTA 1Z82A 2Q2QA 3HN7A 5AOVA 1R4NB 2FZWA 3NTOA 1DXYA 4LVCA 5JAZA 5F1KA 2GZ2A 4WEQA 3QY9A 5A3VA 2AQHA 3WIDA 4FC6A 2E48A 1RWBA 2DFVA 4KUEA 4J0EA 3LT4A 4YBZA 4CLRB 3BZUA 1QORA 2UUPA 3MJCA 3U09A 3WMXA 3ZWBA 5A9SB 2PD3A 1N1GA 5CDTA 1N7GA 3QE3A 4MOWA 2GDZA 2VNSA 5EESA 5L7WA 3IJRA 4DPMA 2I67A 1YL7A 2PKQP 1P1JA 2J3JA 4DMLA 4YJFB 2I99A 3B70A 2VHVA 1ENPA 1PQWA 5T64A 5BSHA 2HK8A 1PR3A 3UHAA 1FDUA 1BXGB 1LU9A 3OFSA 1E6UA 4Q3BA 1WVGA 1XCBA 2O3JA 4GPD1 4TRJA 2PA3A 2YY7A 1VRWA 3IIEA 4FFOA 3UH1A 3O8QA 3WBFA 4I5EA 1E1NA 2D2IA 2WD8A 2NTJA 4WLUA 4KWIA 3C1OA 2CMDA 3WOHA 1UDAA 5EPOA 4BO2A 1DEHA 4ZJUA 1UXHA 5I7EA 4KWHA 3TZQA 2NWQA 2Y66A 4FR5A 4XX0A 4CLOA 2YYYA 1X7GA 3Q9UA 1HE5A 4AJIA 1PTJA 1E92A 5F5NA 2I3GA 3WG9A 4XYEA 3QLJA 2I65A 5K9ZA 1RM3A 2C2YA 4KOAA 4E30A 2YV3A 4F6LA 4ZQHA 3PYMA 3W4JA 3FN4A 3NTQA 2Q99A 2WM3A 2Z5LA 3H9GA 4J4BA 1QMGA 3HDQA 3SBOA 3E9NA 5I7SA 3GAFA 3ST7A 1ENOA 2X22A 4MO2A 1V35A 1E3WB 1N8KA 2FZEA 7ADHA 4ZQEA 5KIAA 4BNTA 1CETA 1FK8A 2QYSA 1LSOA 2JFFA 3WGZA 2AEMA 1C0IA 1WWKA 1ZEJA 2D1YA 2ZYAA 4XD2A 1UR5A 3HDJA 4IS3A 4TRMA 4XQEA 2X0NA 3H5NA 3BHJA 4PLTA 1RM0A 4XA8A 1X13A 4R9RA 2H9IA 5B4UA 1O94A 4QX6A 3UICA 2DPGA 1NPDA 4II2A 2ZB7A 1IYZA 5FI3A 1XA0A 4TZTA 1T26A 3PWKA 3GRKA 3AOEC 2WTBA 4O63O 3DHYA 3JD4A 1H6AA 3RVDA 5L53A 4O0LA 4AL4A 2OO5A 4TQGA 4O59O 5G4KA 5ER6A 3Q9NA 1ZMTA 5TQVA 2YJZA 2OXIA 3KLPX 1B16A 1V3TA 2AQ8A 1PGPA 3Q2IA 1QRRA 4IMPA 4I5FA 4N18A 3PYXA 3FHLA 4GX0A 4CPDA 1QP8A 1SC6A 4Z9XA 5L7TA 4EEXA 1A9ZA 1DSSG 2ZATA 3B1FA 4Z9YA 1YWGO 2X86A 4DPKA 4CQMD 3GEMA 3ANNA 3HHPA 3QSGA 2HMTA 5TF4A 2X4GA 1GUFA 3IP3A 3BMCB 1ZXBA 3FWNA 1PZHA 3R3JA 2E37A 3OETA 3G49A 4W99A 3QP9A 3ZV4A 2VHXA 4JP2A 1I3NA 3M2TA 2O7SA 1L1FA 1P44A 4JLWA 5THQA 3ZWOA 1R0LA 2JFGA 3H6KA 5DOZA 2ET6A 3JYQA 5CDUA 4JJGA 5U1PA 5AXDA 1LNQA 1KVTA 1MFZA 2JAHA 3LK7A 4QXMA 2B0JA 1Y6JA 3FNFA 4URFA 3GLQA 2DQ4A 5FFFA 2C82A 2PGLA 3DBLB 5JPIA 5HM8A 1EK5A 1GADO 3GA0A 3GHYA 3QHAA 1CQJA 1UZMA 4IIUA 1DFHA 3BMQA 4IJUA 3UF0A 3WBBA 4R5HA 4F3YA 3ZV3A 1K3TA 5CDSA 5ER9A 4BGUA 3GNTA 2PGDA 2XPCA 1CQIA 1R15A 1XIVA 3ZI0A 4KTVE 3UVEA 5G0TA 1KVRA 1N7HA 1LTHR 1Y9AA 2Z95A 4R41A 2CNBA 3ETEA 1I01A 3H9JA 3PJFA 4RLHA 4W9NC 5DBIA 1I36A 1JKIA 3GZNB 1X15A 4Y6SA 4IDEA 2FP4A 4ALJA 1EFLA 4CM4A 2VRCA 4FFLA 3SLKA 4AJHA 1ENZA 1LRKA 4DXHA 4P38A 4ALIA 4EI2A 2P9EA 4J2OA 4KDEA 4XGKA 1F8GA 1YL6A 1DIBA 3AM4A 3SEFA 4G65A 2XAAA 3TNLA 4UEJA 4W4TA 4DBZA 4YT4A 1YJQA 3ZHXA 1C0LA 1Z73A 1HDOA 4DC1A 2YHIA 3V2UA 1T1SA 1C3VA 3PJGA 4JN6B 5A9SA 2VUUA 1GV1A 5K6AC 2QRKA 4NBWA 3ZGYA 3IP1A 1WDLA 1IL0A 3E9QA 1LJ8A 5CFZA 4E33A 1F8FA 2CDCA 4ZU3A 2F00A 4NFSA 3B1JA 3WWYA 3DOCA 4JK3A 3MEQA 1U1IA 4OXYA 2O4UX 4RORA 1BXGA 3TZHA 4J1TA 4CMKA 3SLGA 2AEJA 3IL2A 2Y0DA 2O2SA 3O9ZA 3MOGA 1GEGA 2EHDA 4EUFA 4RVSA 1MB4A 1NP3A 1EVJA 4LRSB 4RZIA 4JP3A 4CMGA 2BH9A 4DLAA 5IDQA 2GNAA 3CTMA 1NM5A 4GVLA 4R9SA 5KKCA 1LDNA 4Q3EA 1VKNA 1QLJA 1YQGA 2Y0EA 3ZWPA 4DUPA 2HJRA 1AXEA 1WW8A 1KY5A 2O48X 3K96A 2Q49A 3I23A 3WYBA 3GQVA 3DAGA 3FBGA 3K9QO 3PYLA 1DIRA 4L8VA 4GKBA 3U4IA 4WGGA 2B69A 4BB6A 4IIVA 2GASA 4E2YA 1HDXA 1B26A 1LDEA 3FBTA 3KO8A 3MJEA 3NEPX 4HNGA 1O9BA 4PLHA 4UAGA 5H81A 1YE3A 1GYRA 4NBTA 3GG9A 2O3SA 3V2GA 4IQ8A 1DAOA 3EGOA 4LMPA 2CF6A 3GN1A 3NT4A 3EZLA 5AYVA 4RF5A 4WASA 1UXKA 5TT1A 5A03A 3HSKA 3S2GA 3DBRB 4OGWA 4R3NA 5KJ1A 1NWCA 1PU2A 5ADHA 1JWAB 3TFOA 3OA2A 4WCFB 2NVUA 4H3VA 5JAMA 2BMAA 3H4VA 4M86A 4CMIB 1OC2A 4Y6RA 4QEDA 4DA9A 3VVCA 1VJ1A 2BI8A 4CMAA 1ZVMA 4Q39A 3C24A 2X9VA 3G79A 4L4RA 3AUTA 5EERA 2AE2A 3MZ0A 2GUGA 2HKIA 4IUYA 4HFRA 2VRCD 2ZB8A 2VOJA 1TT5A 2PH5A 3SX2A 2X9GA 4KP7A 1WAMA 1H5QA 2D5AA 5LDHA 3O26A 5J23A 4B4OA 5KWEA 1PWZA 3I6IA 5T8KC 1WDMA 1A7KA 2ZTVA 4YVFA 3PHIA 1DHRA 3Q1LA 1ZUD1 1JU9A 2Q50A 4AFNA 3R0IA 4U6SA 1I0ZA 3DMTC 1NQOA 3TZCA 1JW9B 4EDFA 1YBAA 4CUZA 2V65A 4PLFA 2Q46A 5IF3A 2W2LA 4K6CA 1C1DA 1Y9EA 3QW2A 4IDGA 1DAPA 1ZMOA 1RPNA 1OBFO 3PHJA 4CMCA 4W82A 1XWFA 2RBEA 1U2GA 2Q4EA 3HB4X 2JAPA 1R16A 3PHGA 4IS2A 3WS7A 4Z3KA 4KMSA 3ROQA 3X2FA 2DAPA 2I76A 3ONFA 3ZWYA 5L40A 3RC2A 1D4FA 3DO5A 1E6WA 3MCVA 2NUAA 5CPBA 4D79A 4F6CA 4NH4A 4BVAA 1XU7A 3BTVA 4BQRA 4ROSA 4RGBA 4XDYA 1NWHA 5CG1A 5ITWA 1NPTO 3TZ6A 1NX6A 1HZZA 4XDZA 2FR0A 3LC2O 1EVZA 2F1KA 4UULA 4HNHA 3VZPA 3IJPA 3ROKA 1HE4A 5KCZA 4TRNA 2Y1GA 4RPHA 1QYDA 1NHGA 1ADFA 4PG8A 1ADBA 3B20A 4RPKA 5L4SA 4J4TA 5BSGA 2HMVA 2I5PO 2R6JA 2Y05A 4FB5A 5JYDA 4AJOA 2IYPA 3AOEA 3H3JA 4IDFA 1HYEA 3GZNA 1Z7EA 4NJMA 1GU7A 4DIBA 3HJAA 4JBHA 4TMFA 2W2KA 4WEOA 2HDHA 1V6AA 3N74A 2HQ1A 1NVMB 1VL8A 1W4ZA 3AW9A 4RL6A 1YXMA 2VHYA 1FMCA 3S2EA 4OM8A 1NTOA 2VTDA 3TPCA 1MXFA 4XYGA 3K8ZA 1GPJA 9LDTA 4B4VA 1PQPA 2EEZA 1FXSA 2EJVA 4XJSA 4EJ6A 3Q3CA 4I1IA 1BRMA 1CEQA 4RDHA 2A92A 1A9YA 4IZIA 3DAFA 3COSA 3E5MA 2CDAA 2Q1SA 1P45A 1DJQA 4E13A 3ZH2A 3P5SA 1X0XA 3BMNA 3NUGA 5JY1A 5H82A 1DRUA 4CM7A 4K1LA 3GFBA 4RVUA 4LCJA 4S3MA 3F3SA 5BSEA 4K6FA 4IMRA 1SBYA 4FCCA 1PX0A 4INAA 4CQLA 1N9GA 3CZRA 4CQMB 3VDRA 4W7HA 1HLPA 1P1FA 4BKQA 2EW2A 3VPFA 2EP5A 4BB5A 4BO9A 1LA2A 4FFMA 4LK3A 3GDOA 4MP3A 3OSUA 4OQYA 3FF4A 4IGEA 3UCEA 4BL5A 4DL9A 1C0PA 3SVTA 2Y1CA 5KKAA 2W2LD 3ZHYA 1H9AA 1B15A 4ONEA 3WJ7A 4BNFA 4IM7A 1QYWA 1R12A 1V0JA 4Q3DA 2DUWA 3TDKA 3VPHA 4CLHA 2AEFA 4LMRA 4ALLA 3L77A 3IUPA 4AJEA 3O8QB 4BNIA 4A03A 3S1LA 3WQQA 3MWDB 2D5CA 3AI1A 5AXCA 4ZA2A 4W9NA 2BF7A 4UVEA 5KVQA 3PZRA 1VE9A 1Y5MA 4WE3A 4ZRMA 2CVZA 3K2BA 4NU5A 1QLHA 5CEJA 4XCVA 4XR4A 1UDCA 4BNLA 4DLLA 3M1LA 4NK4A 2IRWA 3A9WA 4GI2A 4CLOB 3QWFA 3FCOA 1BTOA 2X0RA 4B4UA 5BQFA 3NX4A 3JQ7B 3EUWA 3PQFA 2EIHA 1DC4A 1Q2XA 1JKJA 3RAJA 4CMEC 2BFMA 2DBQA 4L75A 2YZ7A 4CLXA 3PDUA 3CSDA 5BR7A 2CDBA 1BDBA 4ZQFA 5K6AA 1Z75A 5C37A 2NLOA 3D3WA 5FWNA 4U8GA 4N5LA 4FBGA 3WIEA 3L9WA 4L76A 1QYCA 5CP8A 4YB8A 3I52A 3L9XA 1ISGA 1S7CA 1DBVO 3NDIA 1XSEA 1FDSA 1D7OA 2ZTUA 1EEHA 1HTBA 3DOJA 4RLSA 2XOXA 3ZDFA 4Q9NA 1E7SA 3RUAA 3ADOA 2GN8A 4KZPA 4DIOA 3O38A 5I8ZA 1HE3A 5CAEA 2QX7A 5IG2A 2AE1A 3VKVA 2DTDA 3V1YA 3QWHA 5DOVA 2AMFA 1ZNQO 1CERA 4RVGA 4AJLA 1IY8A 2AQKA 3O03A 3RUIA 4PGFA 4MINA 3P2OA 2CSUA 4MVJF 5A4DA 2TMDA 4PG6A 2Y1EA 2OZPA 5G4KB 2NU6A 3UXYA 2C2XA 2QZZA 3JQEA 2Y67A 3ASVA 1Y8RA 1YS4A 2O3UA 2OGUA 4IJVA 3OJLA 3KHUA 2ZYGA 4QTZA 4OOEA 4CL3A 3CPSA 2G0TA 4E2XA 3OECA 1X1TA 1R4MA 2QW8A 3DZIA 3ZWWA 5CPFA 4CODB 1XG5A 2YV1A 3CMCO 2BGKA 4OSPA 4PLWA 4IY1A 1ZFNA 1B0AA 3VDQA 2FMUA 1AGNA 1R37A 1T25A 4HXYA 4DREA 3GFGA 4E2ZA 8LDHA 1ML3A 2Y1DA 5IN5A 4OMUA 3BMOA 1K89A 3EMKA 4XYLA 3WQSB 4J91A 4ZGWA 1N5DA 3FPLA 2EGGA 1LEHA 3C1TA 4ND4A 4BGEA 3KEOA 3ZW8A 3KEQA 3GVPA 3OM9A 3PTZA 1SB9A 3SJ7A 1LRLA 4NJOA 1M67A 3ZNNA 3H2SA 4BNZA 5B4VA 5KJ6A 3DDNA 4ZD6A 1JWBB 5L4LA 2OP1A 3MOIA 2G5CA 2R2GA 2EKLA 1B8UA 4FJ2A 4GX2A 3UOGA 5BSFA 4WOKA 3JQFC 2YFQA 3W6UA 3NDRA 2RCYA 2NM0A 4YTEA 3BMQB 4OKIA 3W1VA 4EW6A 3AY3A 3GGOA 4GX5A 3PLNA 2Q1TA 3UCFA 5JNLA 3T4XA 1N1EA 3KSDO 5T8KA 2QQ5A 4P4GA 3BHIA 1GPDG 3GZ4A 4I9NA 5EQFA 1PL8A 1SO8A 3U3XA 1U8FO 5L51A 2GZ1A 1DHTA 2A94A 4BIIA 4J0FA 1B14A 4N5NA 3DMTA 1DLJA 1M66A 2WYWA 4JBGA 4NBUA 2TMGA 2Q2VA 2O2YA 1WDKA 1I2BA 1ZW1A 4J6FA 1MG0A 1Y7TA 1ZSYA 4CM4B 4EZBA 4GGOA 3HDYA 3EHEA 1MGOA 4DRYA 5F5LA 5TNXA 3RKRA 4D0SA 2EG9A 4E5PA 3D7LA 3W8FA 3ZHBA 4EGFA 2CZCA 4XIJA 1J6UA 3KV3O 2YHIB 4R1UA 4BGIA 3EZYA 2G76A 3VPSA 4YRBA 1EBFA 1JA9A 1CF2O 1P77A 1HDYA 4BHTA 2CUKA 4EJ0A 2NNLD 3LT0A 4RF4A 3F47A 3GVIA 3VH3A 4CQMA 2PZJA 4YQZA 2CD9A 3PDJA 2WDZA 3ZWVA 3ZZNA 2GZ3A 4LRTB 1CIVA 4MVJH 5JC1A 1G1AA 3Q0EA 1HETA 4GGPA 2QRJA 1TA4A 1EVYA 5IDYA 1YKFA 3BYZA 2C5EA 1Z74A 3GGPA 1NBOA 1K6XA 5JCJA 4BO6A 1ZKMA 3C7DB 1LXCA 1E0DA 4DVJA 2BGMA 1PJ2A 2ZYDA 3GY0A 2J8ZA 1MFPA 3ITDA 2NADA 2J5KA 4E5YA 2GD1O 1ISHA 5JXWA 4YR9A 1UP7A 3H5RA 1Y1PA 2Q3EA 1VJTA 5IDWA 3FTNA 3K2EA 1EUDA 2WEKA 4YA6A 3QWBA 2QHXA 3DZGA 2X5KO 1KVSA 3SC4A 1I3MA 5FEUA 3JQ7A 2FPIA 1A5ZA 1E3LA 3HUDA 3A06A 2IYOA 4RPJA 1V8BA 1LLDA 3D1LA 4JJIA 2HO5A 3JQCA 4L0QA 4NG5A 4AG3A 4BV9A 4A73A 3CMMA 3P2YA 2PD6A 4I08A 3ZN2A 4F45A 4AVYA 2C5AA 2OFPA 4MIYA 1M6WA 2FSSA 3CKYA 3D4OA 4GVXA 5A05A 3DZFA 2BFOA 2PGJA 1GZ3A 4TKLA 2D3TA 3OIDA 4FFPA 2BGLA 3G17A 2D4AA 3VC7A 1HYGA 3QVSA 1GAEO 3ONDA 2P9GA 1IZ9A 3IAHA 3LF2A 2NVUB 4J7XA 1EBUA 2J3IA 1LDYA 3BXXA 4DWVA 3L07A 3PIIA 1P31A 1SMKA 1DDOA 4RV9A 4PLYA 5DBFA 3ZWAA 1RYEA 1X0VA 5JLAA 3WR5A 3I4FA 5IFLA 4R16A 1TT5B 3KYBA 2PFGA 4DYVA 3JCZA 3PHHA 1GQ2A 5C7LO 2OMEA 4YWJA 1NFRA 1LDBA 4AJKA 3CXRA 2HK9A 1IB6A 2GGSA 4XJTA 4O5OA 5IN4A 2NSDA 3LLVA 3PI7A 3UAGA 1NQ5A 5DCWA 3RQSA 1X7DA 4YYZA 1HL3A 4IQGA 2IDZA 3GVHA 4J90A 3UCXA 1IHXA 4OXNA 4RJTA 3P19A 4YT5A 4NZ9A 3LQFA 1ZEMA 4UVIA 2VQ3A 3WQRA 3C1AA 1C1DB 1GQYA 4I5DA 2V6BA 3S55A 4CMEA 2UAGA 1JVBA 2CF5A 1JKFA 4UVGA 2DC1A 5I8WA 2ZJ0A 3WTCA 4QSMA 5HA5A 3AFMA 3QRWA 5JCJD 3GF4A 5EJ2A 4BMSA 1HRDA 1PGNA 2P5YA 2FOIA 4UUOA 1N2SA 4ID9A 1ULUA 3H7AA 1WZIA 3DTTA 3DB2A 3RSHA 3BAZA 2DU8A 4L9RA 3QWIA 3LC1O 4CM6A 3LDHA 3NAQA 5KJEA 3DBHA 3TN7A 4NHEA 1V3UA 3DOOA 3RUEA 2A9FA 4QQRA 4RQTA 5EN4A 1ENYA 4HBGA 1BG6A 4XRRA 3RCBA 4WOJA 4D3DA 4DYDA 2NV6A 2GN4A 4WNIA 4BNMA 2X5JO 4BNHA 3JTMA 4R1TA 3HZZA 4E0BA 1PGJA 3EW7A 4CMBA 3VZRA 1DIGA 1QV7A 4J4HA 1QKIA 3G0OA 3WGIA 1SPXA 5JDCC 4NJMB 3S2FA 2BD0A 4MDHA 2NU7A 3H9EO 4Z0TA 3PVZA 2C20A 2W2KB 1BMDA 2PKRA 1E77A 1H0KA 2EGHA 1F14A 3A1NA 4L74A 3ZHZA 3WGTA 4BV8A 1FDTA 3E18A 4HX5A 3OICA 3H8VA 2QIOA 1OC4A 2R00C 1UAYA 3TL2A 5BNIA 5CDGA 1NNUA 4EUHA 5B12A 4QT0A 4WJZA 2AW5A 3RC7A 5IAAA 2I66A 2HSDA 2OP0A 4CM8A 1LQUA 3AM5A 3JQGA 3I3OA 5L95A 2NTNA 3H5AA 3L4BC 1QSGA 2LDXA 1PSDA 5FF9A 3BMNB 4PLGA 1GDHA 5H83A 3ZNPA 3L6OO 5JS6A 3TWOA 3HWRA 4CMJA 1PGOA 1BVRA 3WSWA 1IPFA 2C29D 3NRCA 1EE2A 4YPOA 2EJWA 4MKZA 3IS3A 3OJ0A 4CQLB 1Y81A 4PZCA 1ARZA 4GMGA 5ICMA 1MLDA 1N9GB 1UZLA 1JLLA 3OP4A 1UAGA 4B3IA 1B8PA 2AHRA 3JQFA 4HUJA 2IODA 3CH6A 3RWBA 1LLCA 2VN8A 3U49A 3F1LA 1E7MA 5AVOA 5ITVA 3IC5A 2HMSA 4GSKA 4CR8A 1CRWG 2Y1FA 3ZU5A 2SCUA 5A02A 5TJHA 2C7VA 3KUXA 2X9NA 5A06A 3ORFA 1VL6A 4FPXA 4E6PA 1DIAA 3C8MA 4GLOA 4GWKA 3TL3A 1UJMA 1ZCJA 1XHLA 2AQIA 4FQ8A 3NT2A 1ISMA 1C1XA 5LDGA 2HRZA 2VCYA 1YOVA 4E31A 3KLMX 1N92A 4X54A 4BNXA 5KVVA 3WNQA 4GSLA 3KSZO 1YDWA 1A72A 3AI3A 5JE8A 3E5RA 4OAQA 3GDFA 2JCYA 4H15A 1ONOA 4BNNA 1P0CA 3VZQA 2V6MA 4I9HA 1ISFA 3CEAA 3SJUA 1NPYA 1YBVA 3MJ4A 4IDCA 5JO0A 3AOGA 1VI2A 4M8SA 1SEVA 3WNVA 4AJNA 1L7EA 1O0SA 4RDIA 3JQ9C 3LU1A 2GF2A 2H1SA 3QVOA 3D3WB 4I5GA 1PR9A 3NJ8A 4PG7A 5THKA 3FR8A 5BNTA 4IJWA 4FOOA 1P3DA 2C0CA 2X0IA 3AK4A 3PFWO 2IE0A 2ZB3A 1LX6A 3DFZA 3U9LA 4K9DA 2UVDA 1LDGA 2QG4A 1H2BA 4P8RA 4WKGA 3GNSA 1YQXA 2HMWA 2VT3A 4XB2A 1QXSA 1JDJA 1C14A 3W8EA 3HADA 5HWSA 1AHHA 4TRRA 4J43A 4YDRA 4CV1A 1PJBA 2ZCVA 4Z0HO 1WMAA 5ENVA 5COQA 1YB4A 2EKPA 4JCOA 1YB1A 4M49A 5DULA 1I33A 4EITA 4YRDA 5EQDA 2VUTA 1R0KA 2VYVD 3F1KA 1LDMA 2EWMA 4ZICA 4ALMA 1ZK4A 5JC8A 4YJGA 2NVWA 2I9PA 4YJHB 3TQHA 3QVWA 4GQAA 3RC1A 1D3AA 3F9IA 1J5PA 1SEPA 5TIIA 1GCUA 1Y8RB 2PH3A 2HK7A 3PWZA 4MKXA 2Q4BA 2C07A 4DQXA 5JAIA 2P91A 3DZJA 3KBOA 1ZSNA 2BRUA 4BMNA 3K92A 2J3HA 1R4MB 1HEUA 4GAEA 4U0KA 2B35A 3AFNA 4JROA 2Q1UA 1BSVA 3RUHA 5T57A 5CEEA 4U0JA 1JVSA 4WLOA 2FRDA 4I8XA 3KSUA 3MJVA 4BOYA 1TI7A 3GG2A 3EDMA 1HWYA 4GH5A 3DQPA 1KC1A 3BMOB 4R1SA 3QVXA 5ICSA 2GPTA 2Z1MA 3VH1A 1NHWA 4UVDA 4ALKA 4CV3A 4J49A 2RH4A 3UGKA 3JQDA 2LDBA 1T24A 1Q0LA 2VT2A 2P5UA 1KETA 2H63A 2HCTA 3FR7A 2X5OA 4DQUA 4J9UE 3ETGA 2W90A 5GZ3A 1ULSA 1LQTA 4LN1A 3X2EA 3UUWA 4GKVA 3JYPA 2X1HA 5JMPA 3RBZA 1E1LA 3LZ6A 2YUTA 2VWQA 4DQVA 2JJYA 2PWZA 4ZHSA 1EK6A 4OJNA 3SXPA 2NQTA 2GYYA 4FN4A 3TRIA 3VPXA 2ILTA 3E03A 1FJHA 2X6TA 4HFNA 3T7CA 3V5NA 2EV9A 5IXYA 2JCVA 1T4DA 5JBIA 1JTVA 5C7OO 1DLIA 4DIFA 3H2ZA 4RPLA 1A4IA 5KVSA 4TROA 4A2CA 5EIOA 3GPIA 3NGLA 3OIGA 5BT9A 3ITKA 3LSYA 3I9MA 5G0SA 3UW3A 4WLFA 1XQ6A 2A4KA 1YO6A 2IZ1A 3RC9A 3OIFA 4PLCA 2FSVA 3BTOA 3DHNA 3IMFA 4RO0A 4KQXA 5A1TA 3F5SA 1DFIA 1P1KA 4YAJA 3ASUA 4D41A 1LLUA 5JW6A 2J5RA 3FSRA 2OORA 3JQ6A 4FJ0A 2AXQA 4J7CA 3R1IA 3ZU2A 4D42A 2B4QA 1OFGA 2J6IA 2ZKLA 2WE7A 2GCGA 1XDWA 4M55A 1SAYA 2P4HX 4D3SA 4Z3DA 5I9LA 1H9BA 5DCYA 2XXJA 3PJDA 5L45A 5JFOA 2DTEA 2IEDA 5DDIP 3BTUA 1W73A 2JCXA 2FN7A 1MP0A 2FR1A 2OBNA 3WMWA 4R68A 4Y9DA 3OEYA 3ABIA 3JQBC 3PGJA 5LCXA 4E4YA 3JSAA 1U4SA 4A5OA 5K0ZA 3PLRA 2DLDA 1V9LA 4C4OA 3O4RA 1XR3A 4O6VA 3ENNA 2B5WA 4XWYA 5CHEA 1XEAA 1IOLA 1DC5A 1U3TA 5HS4A 1GY8A 4B7CA 4H16A 5JDCA 1Q7GA 5FI5A 3DONA 4FIZA 4F46A 5TLSA 2DKNA 4UREA 4D3FA 4WNCA 3I6QA 2POQX 4A26A 4JJFA 4TWRA 2G17A 4P4LA 2R00A 1U3WA 4YT2A 2B36A 3B6ZA 2YW9A 5IZCC 1SOVA 1U2DA 3RUFA 4E3ZA 1IZ0A 2I3AA 2PKQO 3JYNA 4P4NA 4N54A 1AXGA 2O3RA 1GYQA 5L4NA 1P33A 3MWEB 3OJOA 4PFJA 2ZCUA 2PTGA 1O6ZA 2JD1A 1ADGA 1SCUA 3L4BA 1KOLA 4BQPA 1R66A 1U3UA 4CV2A 1Q0HA 3M6IA 4NK5A 3W4KA 4ALNA 1GCOA 1E3JA 5CEFA 2WD7A 4BO1A 1LC0A 1RYDA 3INTA 2NTVA 3ZW9A 2EF1A 1OI7A 3OQ6A 3HFGA 4YAKA 3QA9A 1IE3A 3WB9A 4GMFA 4BO0A 5GZ1A 4XGNA 4OHUA 1PS8A 1U7HA 3IKVA 4QFCA 4D0RA 3DHEA 1JQBA 4WECA 4XIYA 3D4NA 3D5QA 4CLEA 1Q0QA 3Q2KA 3JV7A 5COAA 3AI2A 3ZV5A 4HV4A 3K5PA 8ADHA 1BWSA 4YJHA 1T2DA 2PK3A 1X1EA 3FTPA 1P1HA 1B3RA 4IGFA 3HQ4O 1O89A 1ZZEA 4DLBA 3PGXA 3VH4A 3D64A 4B3HA 3G1TA 4RCVA 2GERA 3U62A 3GUYA 1UXJA 1I32A 3OJEA 3WJAA 4XB1A 2JD2A 2XXBA 3OBBA 1EFKA 2C7GA 2QZ9A 1BW9B 3NT5A 1Z7BA 4RVFA 3V8BA 2W8ZA 4QECA 4XZ3A 2RHRA 2BLLA 5JMWA 1ORRA 2VNAA 2B4RO 5DZSA 4D43A 5G0UA 2W4QA 3K30A 4HY3A 3NJ4A 5C7IO 4AJPA 3JQ9A 4NQZA 3FNEA 2JHGA 1YBMA 3DZKA 4OH1A 1NAIA 2CVQA 4A7PA 1NAHA 4ND1A 1CDOA 1EUZA 2BHLA 1A27A 3AUUA 3RASA 3HN2A 2D59A 3M1AA 2YQ5A 4WPGA 4FDAA 3DC2A 3GDGA 1W8DA 2HUNA 3RJ9A 3ZWXA 1RM4A 5G0VA 1X7HA 3C7CB 1GV0A 4IINA 5DN9A 3FNHA 3DBHB 1ZK3A 4MP8A 3RFVA 4QFDA 4ZN6A 4CM5A 5KOIA 1TXGA 1Y8QA 1HKUA 3VTFA 4A27A 1J4AA 4J16A 4PRKA 1XLTA 2PZKA 5C5IA 5IJZA 1VM6A 1H93A 3V1TC 3FI9A 5T67A 4EYEA 1MV8A 1E1KA 3DBVO 1E1MA 5F3RA 1KVUA 1U5CA 4C7KA 4PIVA 1UP6A 3AJRA 1KEPA 4A10A 2DVMA 1WMBA 4ILKA 4R51A 5AXAA 2PY6A 1MXHA 2Z1NA 3GAZA 1KIFA 2HLPA 4R5MA 4WCDA 4EJMA 5JDIC 2X7HA 2PV7A 3QV1A 1DC6A 4NBRA 5KTKA 1U5AA 4MIEA 1A7AA 2CY0A 2NU8A 2DBZA 4FC7A 2NU9A 3D0OA 3D4PA 2OOSA 3FD8A 4JIGA 4G5HA 5U4QA 2PR2A 1EMDA 1QG6A 3ETDA 1XELA 1WP4A 4ZRNA 4DGSA 4PZEA 5JO9A 1DIHA 1VJ0A 4CM8B 3I9KA 2DBVO 3JQGB 4MP6A 4KDFA 3T7EA 4RPGA 3VKUA 5TSDA 5GMOA 1ZJYA 5G2OA 1VL0A 5MGBA 1KERA 4DBVO 1ADCA 1HE2A 4G81A 1I8TA 3RUCA 3WGGA 1TB4A 2A35A 3PQEA 5TGDA 1M6HA 2DBRA 4NR0A 1JN0A 2DM6A 2JFHA 1HF3A 1K5HA 3UN1A 1RKXA 5GZ6A 4XQGA 1HLDA 3PPIA 3QIVA 3I9OA 2VZ0A 3TJRA 4PG5A 3BIOA 2GR9A 4DPLA 1JAXA 4BNWA 3WICA 2VYND 1E3IA 4GL4A 5I9MA 3TOZA 1EE9A 3H9QA 5JY6A 4NPCA 2I6TA 1W6UA 1QYVA 2ZTLA 1NVGA 4R69A 1EUCA 3KB6A 4LVUA 3CUKA 1D1SA 3M2PA 4OYRA 1P74A 1PS0A 3GK3A 1GQQA 4ZVVA 5KJFA 2UDPA 1Q1NA 1PL6A 4Q3AA 3LYLA 4BO8A 4U5QA 1BVUA 1C1XB 1KC3A 2H5LA 5TJ9A 1NFFA 1YOVB 4TZKA 4UUMA 4D44A 3U4HA 4KUGA 2EW8A 4E21A 2JD0A 4L73A 2VWHA 2YHUA 3WGOA 2JL1A 4PVCA 4YAIA 1P1IA 5T6BA 1XGKA 2C54A 3IKTA 3PZBA 1JAYA 1BXZA 3MTJA 4XRGA 5KNLA 2DUUA 1U9JA 2PZLA 3RD5A 3RJ5A 4CM9A 1V3VA 1YONA 4Z6KA 1ZJZA 2RIRA 3AY6A 1VLLA 3STHA 3HB5X 2JKVA 5DF1A 3NTRA 4DC0A 4EBFA 2WYVA 1I2ZA 5HBRA 5DNAA 3DZBA 4J3FA 4J1NA 3JQAD 3A28A 1VC2A 1NR1A 3C7AA 3JD0A 3RUDA 1FF9A 3EVTA 5L3ZA 4MVJI 3H3FA 5TS3A 7MDHA 2V6GA 3L0DA 2FPPA 4XQCA 4PZDA 1CYDA 3JQBA 1E7YA 4OSOA 1HDRA 4YJDA 4BNYA 6ADHA 3KYCB 3VHRA 4YAEA 4MVJG 4RVHA 1D8AA 4XR9A 2E82A 2E4AA 1WNTA 3FWZA 5HRUA 1MX3A 3JQ8A 4J1SA 5I9NA 5DCUA 1Z45A 4XYMA 5B37A 1PJQA 4MJLA 4Y8VA 3WXBA 1HXHA 4GBJA 4HP8A 1AE1A 3CINA 3DMYA 3RROA 3TFQA 1WLYA 4MVJE 4NBVA 3UKOA 3H9UA 1ZXLA 1DFGA 3HNPA 4TSKA 4FFNA 4OO3A 5GY7A 1K0UA 1BW9A 1HYHA 4YJGB 3T4EA 4FJ1A 1GTMA 3I9NA 1MC5A 1Y5RA 3VZSA 4JQCA 3PEFA 5IZCA 1IULA 3ULKA 3U4DA 5I7FA 2CFCA 4RF3A 3KYDA 3GN2A 1T2CA 2Q45A 2VZ9A 3CE6A 1HDZA 4Q3CA 3EY4A 4U7WA 4AJJA 3KM0A 4R3WA 2X0JA 4NDNE 4D45A 3ZU4A 1E7QA 3WFIA 3PXXA 5DBGA 3ZCXA 3AUAA 1QV6A 1I2CA 1TEHA 1VSVA 3KOUA 4NI5A 4YAGA 4P22A 3AM3A 4J7UA 2HU2A 4PVDA 1E3SA 3K6JA 5LC1A 4C7JA 1LBEA 5JSFA 2VRBA 2Y93A 1LLQA 1NVTA 1PJCA 4AJ1A 4W7IA 3PK0A 1LC3A 1LSUA 3DAPA 3PIDA 2Q1WA 5I7VA 1Q7BA 4FGWA 3AY7A 3L6DA 3ZNQA 3OA0A 5EINA 4BUCA 3I9LA 1SZJG 1KS9A 3EK2A 1MC4A 1DRWA 2B4TO 4D7AA 3E48A 3K31A 1F06A 4CM9D 3BHMA 1ZSVA 1I10A 2O7QA 1I3KA 3DZHA 3ONEA 3OQBA 5IZ4A 1AHIA 1AN9A 3KRTA 1R0SA 2HMUA 3NGXA 5DT9A 2VYVA 4G2NA 1R4NA 3F6YA 2GN9A 5T5QA 3SC6A 4BKOA 1K6JA 4XEHA 1B3BA 1KEVA 1OZAA 4BNJA 4JX8A 1DC3A 1SB8A 4S1VA 2C59A 3RI3A 4HKTA 4A0SA 3WGYA 1B8VA 4RF2A 4OL9A 4JGBA 4CLRA 1EDOA 2B5VA 1XKQA 3VVBA 3UFXA 1F0YA 2B37A 1DB3A 4KQWA 3I83A 3DXFA 1EVIA 3WGQA 4ND2A 4CV0A 2B83A 1KBZA 3LLSA 3RFXA 2X8LA 1E7RA 1E5QA 3ZWNA 4PLZA 4WCFC 4DTIA 4OOFA 1E3EA 5CG2A 3OQ1A 2YDYA 4II3A 4XYBA 5A04A 3HFSA 3H65A 3DL2A 4MVJA 4R01A 3GPDG 1ISIA 4CJXA 1HT0A 3F5QA 4IXTA 2YQ4A 4L4XA 4YJFA 4JBIA 1NYTA 3RFTA 3E9MA 4YCAA 2Y1OA 2IXAA 3C85A 1ZK2A 3LT2A 3WYCA 2VWGA 2GRAA 3ANMA 3AU8A 1VPDA 3P7MA 1B7GO 1PEDA 4R54A 4OQZA 4BGVA 2AA3A 1MG5A 4DMMA 4FFRA 1S6YA 1NQAO 3EAGA 3RBVA 5JDIA 3DR3A 1HSOA 1Q7CA 3RKUA 5A5EA 2D0IA 2D8AA 2VHWA 2Y99A 3ON5A 4GX1A 3KXDA 3I5MA 4UUNA 3OH8A 4NMHA 3GRPA 2EKQA 1QR6A 4K26A 1F17A 1T1RA 1YGYA 4NIMA 4L4SA 4XGIA 1EQ2A 4WLNA 1ONPA 3GC6A 3JYLA 4M87A 4UUPA 1PJ4A 3OF2A 1NASA 1KEWA 1M76A 1LRJA 1WZEA 1O5IA 2OHXA 3INGA 3KZVA 4OKNA 1GZ4A 4O1MA 4N7RA 2IEBA 5F1PA 3AU9A 4I9UA 3E1KA 1U8XX 2UUOA 2VWPA 3LT1A 4IQ0A 4NFHA 1C0KA 4QO7A 4IXWA 2WD7B 5HS6A 1E3WA 1H6CA 1ZBQA 1ZH8A 5G0WA 3KYCA 4Y98A 4EEZA 2G82A 4FGSA 2O3TA 3N7UA 1BHSA 3NV9A 4KUHA 4WLEA 4IDAA 1D1TA 4B8WA 5B4TA 3FNGA 3JD1A 3ZWMA 1QYXA 3I1JA 3IUSA 4YXFA 3PP8A 5A9RA 1R6DA 1T4BA 1DJNA 3GR6A 3QJ5A 4M54A 1HDCA 9LDBA 1OOEA 4LGVA 1GR0A 1L7DA 4ITUA 3GUCA 1LUAA 4PLVA 2ZQZA 3MJTA 1WPQA 3B1KA 3RIHA 2ZQYA 3ZU3A 1UDBA 1MA0A 1ONNA 4GWGA 3RU7A 2RHCA 3AUSA 1T2AA 3L4SO 1O8CA 2VHZA 3EC7A 1YH3A 4MVJM 2OL4A 2YFHA 3HG7A 5A9TA 3CIFA 1NFQA 3PQDA 4J1QA 4CUJA 4ZQBA 3ENKA 4PN3A 3GVXA 2WWRA 1G0OA 1RM5A 1Z6ZA 4FW8A 3GGGA 3GNQA 2E49A 3IQDB 2HRBA 4YACA 1PJSA 1E7WA 1RJWA 4BMVA 3ICCA 4E32A 4MVJD 4LW8A 3ZNOA 4N5MA 3U0BA 2V7PA 3EYWA 3BMCA 3W8DA 3HE3A 4ND3A 1CWUA 4IPTA 3TSCA 3ZWCA 1X14A 4B7XA 3VH2A 2VTEA 2DTXA 1KYQA 2PZMA 4PG4A 3AWDA 3F46A 1PWXA 5ILGA 3JD2A 3K73O 4BKUA 2VUSA 1NXQA 3GEDA 3OMLA 2BFPA 2O4CA 1F12A 1PS9A 5AXBA 4BNKA 2FHSA 3R3SA 5JYEA 5TX7A 1DO8A 4Q3NA 3DEYX 4AJ2A 1HDGO 2GO1A 3WX0A 2FY8A 4MKRA 3INRA 3DWFA 3DBLA 1CJCA 4XQ9A 5DP2A 3U4CA 1Y8QB 1U4OA 3A14A 1H6DA 1KVQA 3JYOA 5EL0A 4CMHA 2IXBA 1FDVA 3DFUA 1G0NA 2BELA 3ANLA 4PCVA 1B2LA 4B8ZA 2EXXA 4ND5A 2WSBA 1UH5A 1I30A 1GD1O 4LISA 3JQAB 2PLAA 4J2HA 2RAFA 4MVJP 1YDEA 4RQUA 3BA1A 4K28A 4MPDA 1U3VA 2P9CA 4FOSA 1G6KA 2GSDA 2YDXA 1J49A 5TC4A 1K6IA 2VOEA 4BNVA 4HFMA 3KETA 4BKRA 2GLXA 5FYDA 3E6AA 3PRJA 1PJTA 4FSHA 2CVOA 5KVCA 5L9AA 4D46A 4HFJA 4CM1A 4YEDA 3WLFA 4HADA 2IZZA 1UUFA 2WJPA 4CR6A 1AUPA 2GN6A 5ENDA 4E5NA 1T2FA 1UXIA 2FWMX 2WYUA 2DPHA 4LSWA 1U28A 4B3JA 5IXSA 3LF1A 5L7YA 1ZIDA 4CL8A 1M2WA 1U7TA 1YVEI 4WLVA 1E6EA 3W6ZA 4OXKA 3HDHA 2EP7A 2EERA 1NQTA 3WTBA 1PZGA 2NACA 4YQYA 1GL3A 1KEUA 3WWZA 3BTSA 3U5TA 2O50A 5F1OA 5COBA 4IDBA 3RU9A 1UXGA 3ADPA 1PIWA 1ZO8A 2O23A 3DTYA 4NFYA 4R1NA 1PL7A 3GT0A 4M89A 2X58A 2E6UX 3PHLA 4YRAA 2JHFA 4ESOA 1M75A 4AICA 4BO5A
chains in the Genus database with same CATH superfamily
3ET4A 1E2FA 4F2DA 3PNQA 2YV2A 3Q3HA 1XNGA 4RKFA 4OJTA 3PVSA 4YECA 4CN8A 1OH8A 1UEIA 2CLEB 1MUUA 4TM7A 3C45A 4B31A 5E7MA 5IKMA 1A9QA 4DAOA 4LSMA 5JCXA 1FSSA 1Q7EA 1LTKA 1MB0A 3A4YA 4G24A 3P94A 4JX9A 1ZD3A 4N9QA 4TMZA 5AI4A 1GFSA 4HAWA 1HSZA 3A4VA 3UENA 2FWBA 4JA0A 1XCJA 1WXWA 4O33A 4PNHA 3THYB 1A9TA 3GLRA 1UKCA 1B41A 3ISJA 1KIAA 1QPZA 1U04A 1IHYA 4EUEA 3K09C 3VR4A 3QWAA 2G06A 4B45A 4LWQA 2AG5A 4ZC8A 2Z4TA 4MW9A 3CLUC 3D3NA 3H11B 4QM6A 1PV1A 1A77A 3PWSA 2ZYUX 1EP9A 3N39C 1OASA 5E3JA 5AVJA 4F5ZA 2C7PA 2PBZA 1FRVA 2OUIA 5U9CA 3Q8LA 1LPSA 3QUTA 1WUTA 3ICQB 3H8JA 4NG4A 1FYDA 3IVXA 2ZSHA 2XWQA 3I4CA 1LSSA 2WMDA 2X9QA 2NVBA 3HCPA 4KZKA 4CTMA 3OX1A 1I3LA 2JIMA 3AG5A 3GHHA 3IDSA 3WGHA 2ZJ1A 2QE7D 3QXXA 4NXMB 2WE8A 2OTCA 1H2FA 1NRIA 2C42A 3J7TA 4MIOA 4OD0A 4E7PA 1CY7A 1XNJA 2W7TA 3N58A 3SLRA 3MB5A 1CBUA 3G3EA 4M1QA 5EPUA 3N9IA 3CVUA 2DUJA 2G9VA 5EJ4A 3CF2A 4CW7A 3EPHA 4WDRA 3GLGB 3CYFA 1A4XA 1BNCA 4CMIA 5AKKA 1JG4A 1E2JA 3ORSA 3OTQA 4D1YA 2J3KA 5FWXB 5B53A 5K8TA 1PJRA 4RFVA 1Z0FA 2NO0A 4PC6A 4BNUA 1M8PA 2ATXA 3CRRA 2OD7A 3HUFA 4WK0B 4AXBA 6LDHA 3BB3A 2O8EA 3FVRA 1J8DA 2W6OA 1T2EA 3QUBA 4WBXC 4DRZA 2AX4A 1ZH4A 2P2SA 1VXOA 2R8RA 4IZHA 3VDMA 3E82A 5A5FA 4V1CA 3FPEA 5AW2A 5JHHB 1T9AA 1W93A 2YWXA 1DRVA 1Q0PA 1UOEA 3ZG6A 3EUAA 1IUKA 2ZTMA 1AS0A 4UAJA 2QRVA 2LBPA 1TJ3A 1VKOA 3B8HA 2QAIA 1HG1A 2WP0A 8ABPA 1M8KA 1RTTA 3T38A 3DLBA 4WUVA 2D7DA 2OD2A 1ZONA 3A6KA 2B3TA 2P4QA 3C87A 2FR8A 3FNRA 4LHVA 4LV5B 1AT1A 5FI1B 3DFIA 3RK4A 4EO9A 1TCVA 2IDJA 1WPXA 2NPIA 3N8IA 1EX9A 1JPUA 5E4TA 2J5QA 1T6NA 3KOXA 4A92A 2YKGA 1NBEA 1ID1A 1HTWA 2IZ0A 3PC8C 2DR2A 3ZLUA 3LZCA 4E46A 1K8RA 2HDNB 1KQ3A 2EFGA 1OXVA 5E7IA 5LD2C 3ZV6A 3AERA 2GCNA 1F20A 3P2JA 4UDOA 4Z0PA 2A5DA 3H4TA 5EJ6A 4B79A 1RSZA 5LWQA 4MROA 4X8HA 3IOYA 3OHSX 1VSTA 1P7YA 2QK4A 1DPGA 2LIPA 4BV3A 3RBXA 2QAGA 3JD3A 4BO4A 4R4JA 2C00A 4KR6A 1RHUA 2ZRPA 2W8BA 5FTLA 1KOGA 3V1UA 4IKPA 4MS4B 3RWOA 4A1FA 4D26A 1NU6A 1W29A 2P40A 3CWZA 4RZHA 3DUFA 3AC0A 4HF7A 2Y68A 4HXGA 2DLCX 3L1KA 4FFWA 4I14A 4ZT3A 2GTIA 2QYTA 1MC1A 1TCBA 4FS3A 3ICPA 4BNGA 5AQ1A 2H1LA 3AG6A 3CH7A 5E7QA 3WYGA 4DLZA 1PW5A 5G4LA 3KTDA 4CEIB 1RLTA 4LJ6A 2PRSA 1W5FA 1J2TA 3CF0A 3QBTA 3QUAA 3O2JA 4JU8A 1L8QA 1YZUA 4UTRA 1XZNA 1XV5A 2XF8A 4LXXA 1KL7A 2R84A 4IJ5A 3VAZA 3WLKX 2ZYVX 1N3IA 4F71A 1GT6A 3STXA 3AR4A 2LD4A 1N5LA 1QB8A 2WUEA 3CRZA 1ECLA 1U2ZA 3HKCB 1RRPA 1OQAA 3O2SB 3ZIAA 1OAKA 2NUPA 3ED5A 2O0KA 1IC6A 4DCSA 3A4IA 3E8XA 4B3GA 5ES3A 1SCKA 1DEOA 1I5EA 3S29A 2J9XB 2JAXA 1F2UB 4IFTA 3FYTA 5T4FA 3DMGA 4JT2A 2V6FA 1N0HA 3OJFA 4HAVA 1L5GB 4M1WA 3X1XA 3JARA 4ZQGA 5KJCA 3MGCA 1N1DA 1AC5A 4NNJA 1XX6A 4H7PA 1RI2A 1VCOA 2YIMA 4ZCTA 1QGUA 3EGEA 1O2DA 3GEBA 3M6XA 4L8WB 1J06A 1EZ4A 2CHUA 4AD8A 3T7TA 1FB5A 2X2OA 3ZDQA 5FWYA 2O6LA 1AKVA 3PDCA 3PVCA 3T3OA 5BMVB 5CB4A 4PQYA 3LHKA 2BE7A 2E48A 1RWBA 1ND6A 4KUEA 3NWOA 5IXJA 4WK4B 5C8YF 2J3LA 3UFXB 4DA7A 1MOSA 1PRYA 3HUUA 1MDBA 4XM0A 3VJKA 1P5FA 1M5TA 4C1BA 4Z51A 3Q6NA 2PD3A 2QG6A 3WLAA 1VPWA 2NO9A 3JZMA 1T1EA 3GRZA 1JG6A 1T9GS 4KBFA 2GDZA 4PAWA 5HF8A 1NW7A 1I7LA 1TMGE 2JASA 3IJRA 2ODWA 2OBMA 4DPMA 4D9FA 2WM8A 4D4IA 4B3MB 1U7DA 3VKWA 2MT9A 3OTGA 3OZIA 5I51A 3ISVA 1EK0A 4QAQA 2I99A 3B70A 2VHVA 3KPYA 3CT4A 4JBXA 4IIDA 4QGFA 4Z53A 4Z7OB 1OX4B 3U1BA 3EXIB 1FDUA 4OGKA 2ZREA 4MJ3A 1E6UA 3O8OB 2O3JA 4DG5A 3JX9A 1E2NA 2EBUA 4ENRA 4XJVA 1I1OA 4FFOA 2QXUA 4FWIB 1SVIA 4DDUA 2HCRA 3ITNA 3K35A 3GLVA 1C3JA 1WXHA 1ADYA 1RXUA 2XMCA 1W36D 1SQFA 2QD5A 3RRJA 1Y9JA 1NLFA 5D86A 1KH3A 5JQGF 4R2WA 1NT4A 2QGFA 4KWIA 3F4KA 2QTVA 5JI2E 1UDAA 1N7JA 1OIXA 4WK2B 1DUVG 2I33A 1L5VA 5I48A 3WLQA 4ZJUA 4KWHA 1Z4KA 4UM8B 3PLAE 1SJ9A 4L5BA 3N2YA 2EC5A 2XNSA 3IR6A 2FUCA 1G41A 4D8WA 4FR5A 4CLOA 3RLFA 1DKMA 1E8DA 1X7GA 2DOKA 4G6ZA 4Q6BA 3UBTA 3R3WA 1IU9A 1M34A 3M3DA 1MEEA 4KR0A 4P54A 1U5BA 1NVKA 3KCQA 4UMDA 3TMKA 3GARA 4XSGA 1JBKA 2I3GA 4DNOA 4L6CA 1D0IA 4N3NA 5K9ZA 5G40A 4KOAA 3WGMA 4F6LA 2A0UA 1JYSA 1ZA1A 3OD1A 3PYMA 3IDFA 2ZBPA 3FN4A 4ZQHA 4BN0A 4PYJA 4PE5B 2WF7A 4FMBB 2H17A 4DKXA 4XGRA 2VKTA 5MFZA 2IUEA 1EK2A 2J9YB 1DEKA 3F6CA 4IJQA 1QMGA 2XCUA 3N8DA 3UAWA 2WD9A 3R7WB 1V41E 3GAFA 4NEHB 5LP1A 5BYJA 1IXRC 1TKAA 4PS1A 2OCYC 1E3WB 3OU7A 3IXLA 3PR2B 1JEQA 1X2EA 2YN0A 3GGCA 3IPXA 1J0DA 2FZGA 3OZCA 2H06A 3VMFA 4BNTA 4D9MA 4EHDA 4ZI7F 1HZZC 1AUVA 4FOPA 4YV1A 3C3KA 3WGZA 1WB6A 2EZ4A 1WWKA 3C70A 3HBFA 4Q9HA 5HM6A 1ZEJA 1RR6A 3GFTA 3DJYA 3HDJA 3PIRA 4TRMA 3HWX1 3LBFA 4XQEA 2OFFA 4TZ0A 2X0NA 3H5NA 3SBXA 3UB4A 1ABEA 1FA9A 1ZI6A 3T3NA 2ZPTX 1QIHA 5K0NA 2HBYA 3C5VA 1PUIA 1BVHA 1VB5A 1O94A 5D7NA 4UZEA 2DPGA 1NPDA 3M8KA 4KEAA 2ZB7A 5FI3A 4IP0A 2BM9A 4TZTA 5J47A 2IYVA 3F7TA 2WSSD 3GRKA 5EIBC 3L7MA 3JD4A 1K4KA 1H6AA 1UZAA 2PXXA 2Z3ZA 4BLUA 4AL4A 4A8JB 2OO5A 1KPHA 4O59O 3QUQA 5I7AA 3WIBA 3EVEA 4LXGA 4MB0A 2YJZA 4DNQA 2QTAA 4IEIA 4P7BA 1PGPA 3EMVA 1DCMA 2EZ8A 4N18A 3S2UA 4JI7B 2YL2A 4BNDB 5KWSA 3ZV7A 1QP8A 4H1WA 1W0KD 3BKXA 3MWFA 2XCRB 1UEXC 3BKWA 4K87A 4Q4JB 2PSEA 4HYTA 3ZDBA 1WE2A 1OFTA 2AFVA 5EZYF 4IWYA 3FUXA 4CQMD 2JJ1D 3GEMA 1RJ9B 3HHPA 3QSGA 1PT9A 3PL5A 4FDVA 4EQ6B 3AEKB 4HH1A 2CDRA 2A84A 3Q7PA 3QLVA 5THXA 1EDBA 3FWNA 3S1AB 1KK3A 4RHXA 2FSGA 4IAOA 2E37A 3VR5H 3OETA 4BATA 2BR5A 4W99A 5FBZA 4KB5A 1E2IA 1C4OA 1D1QA 1EXNA 1EWKA 4YP1A 5J5AA 1C9YA 3U7QB 3PR3A 4KI7A 3PPXA 4JP2A 4Z4GA 4F9EA 3M2TA 4P3OA 4MUMA 5THQA 1QH8B 3NBYC 3ZWOA 3PUJA 1Q0TA 3I2JA 4HBZA 4LEIA 4OGLA 1T3GA 4OH7A 5U1PA 5AXDA 4JLKA 1FQWA 3RAEC 3T5TA 3QPUA 4D6PA 2B0JA 3M9XA 4XDGA 4MW4A 2Q62A 5H4HA 4KPEC 3IDAA 1N6PA 3NO4A 1J8YF 2I4LA 3QFFA 2E89A 5FFFA 1TU4A 3ZHYA 5HM8A 2H0QA 3UAVA 1MZPA 4YRJA 1JQLB 3GA0A 1G3RA 3GHYA 1AB5A 2ZT7A 2CHEA 3EIWA 1DFHA 4P08A 1D4AA 3G6WA 3L7AA 3VTKA 4KVGA 1SA0B 4BGUA 3K0FB 2IW3A 4YAFA 3WK8A 5BN3A 4E03A 1DWPA 3IKJA 1XIVA 1YB7A 2WAOA 2ACWA 2Q0XA 4MHOA 3EYAA 3ZI0A 5G0TA 4JI3B 1KVRA 5HILA 4MS1B 4C7OB 4RTPA 3RKSA 4W5OA 3VV3A 4F1JA 4C4SA 1LTHR 2HT6A 3ER6A 4RMGA 4OBBA 1X87A 2HB6A 3PJFA 2RGEA 4W9NC 1I7QB 3ESXA 2ZE5A 4V0RA 2JAUA 2PYZA 4IDEA 5A3SA 1EFLA 1M1NB 1PWHA 2FLVA 4YJ2B 1YIDA 3MWKA 4FFLA 1JG1A 4FTWA 1QQ6A 3EH2A 4B3BA 3RSOA 4DAEA 2WUDA 2FK7A 4IIJF 4V0SA 4WQMA 1KE1A 1IRIA 4WZBB 1CD5A 3AM4A 2J3EA 1WCXA 3NZEA 4UEJA 1I80A 1Z4JA 5CU7A 3G2QA 4LS3A 4KH0A 1OH7A 3ZHXA 4OI2A 3RDPA 4ZYWA 3BVPA 1NN5A 3O0DA 5CTJA 1N0UA 5DMHA 1AMUA 1T1SA 1C3VA 2O2JA 3TQIA 4ZDJA 2Q0SA 3PJGA 1Z47A 3SD7A 3V4VB 5M04A 2XB6A 3PJRA 3STTA 4QLBA 2R7KA 2QRKA 4HNAA 3T54A 1P3JA 4GI1A 1X70A 3WB1A 1T5OA 5EMKA 1LJ8A 4L0DA 4MA4A 4CIAA 3BT7A 1DKRA 4DWJA 2HLNA 2C7BA 3OBIA 1RWPA 4KFRA 4B2LA 1D5CA 3PITA 3D0QA 4FDLA 1WZCA 3NH6A 1FPQA 4A9AA 4L28A 3D2BA 4OXYA 1T3HA 3EXIA 1A2BA 2FFAA 4WV3A 2AEJA 4OHPA 4CU2A 1ZS9A 4TL8A 2ACKA 5ERYA 2VCEA 2FUKA 4ZP1A 4X0EA 5F77A 3I05A 1NI5A 2FU5C 3EPLA 4EG7A 4KMOA 2V5AA 4IX9A 2BH9A 2DR0A 3KP1A 4DLAA 1ESZA 3CNNA 5AW5A 1XU4A 1Y4SA 2R96A 4LZJA 4Q12A 3ZGZA 3CTMA 4BDSA 1JIVA 1WXIA 1NP6A 4OP1A 3PEEA 5KUTA 4P34A 1LDNA 2B7BA 1DQSA 2X0EA 1U0EA 1YQGA 3B82A 2F9LA 4MITA 3W7BA 2PUCA 2B2NA 2FQWA 1WW8A 3UEOA 4IDHA 4HAIA 2L19A 1O9GA 1KY5A 4QBIA 5HQ3A 3K96A 3VR3D 4CTNA 3DXYA 1AZTA 3WYBA 4F8EA 4D6YA 3FBGA 2UXCB 1H8ED 1ZRHA 3LUFA 3N2KA 3PRKE 3G8DA 3U4IA 5D8DA 1SQ5A 1E9AA 2R4UA 1X94A 2RJOA 2ZXUA 2B69A 3FTQA 2EQBA 3BL5A 3QKUA 2FTKE 1UQRA 3CXUA 1B26A 3WZLA 3S2SA 1UM9B 3KO8A 5K8VA 4PLHA 1CW2B 2O52A 3ROXA 1G19A 1GYRA 3WGJA 2VQDA 4Q21A 1BS2A 5CUQA 1MW8X 4LWZA 1DZIA 4PGHA 4ARZA 4IQ8A 4QRDA 4GP9A 3EGOA 4X3CA 2CF6A 3ESDA 2XBUA 3GN1A 3NT4A 2ZI6A 3HRIA 5BYBA 1OBHA 2HBZA 1VI5A 4G9GA 4HOYA 5SICE 7AT1A 4DR5B 4QC2A 5A03A 4AMZA 4C21A 3U2QA 1QFMA 3RRBA 1ZUIA 1SKYB 1BMTA 2KE5A 4FNMA 1PDWA 1WX1A 1N6HA 1A8HA 1JWAB 5ADHA 3TFOA 3OT1A 2NVUA 3BGIA 4WSOA 5F7ZA 1UBGA 3WLPA 3H4VA 2ST1A 3BD8A 3HA3A 5AW6A 3BRSA 1T8TA 4QEDA 3U4QA 4UPVA 3AKDA 1ZVMA 3C24A 3G79A 1L7BA 4L4RA 5EERA 3FWPA 5JANA 5DLQC 3FPJA 4EW2A 2GUGA 3QG5A 2CJYA 4NL4H 4IUYA 1R0WA 2AJCA 2W6ID 3BERA 2VOJA 5IEBA 4DUZB 4JHXA 2X9GA 2AZDA 2IU6A 1N75A 4DMUB 1IJKA 2Q6LA 3K70B 2EARA 4YQEA 3WB0A 2PWAA 3ZQ6A 2D5AA 3NC0C 3HR8A 4R83A 1SU8A 1N8NA 3O26A 4DJDC 3L93A 5J23A 1NJ1A 5E95A 3QEJA 1A1SA 2N42A 2ZM6B 1V1JA 4BNDA 1KY3A 4F91B 1WDMA 1P2DA 1QIEA 4O4JB 3P27A 4CBVA 3OTOB 3H05A 5FEMA 2WRZA 4OFWA 1AKRA 4V0KA 5BR4A 3ZTWA 1XRQA 2Q50A 2QL9A 2AYYA 3HKDB 2C2OA 1OGIA 3R0IA 4GF5A 2ASVA 4U6SA 4ZAWA 5KREA 5EJ9A 1I0ZA 1I2DA 4FKMA 4GP6A 2OK7A 4N03A 5EJEA 4N9WA 4CUZA 4Y6LA 1MO3A 4PLFA 5KNCA 3S1AA 2CHQA 3TJZA 4URXR 4O25A 4K6CA 3PPVA 1Y9EA 3QW2A 1NSTA 3OEHD 1ZMOA 1PKXA 4FSDA 1S3GA 4BFWA 1N36B 3PHJA 3UGJA 4W82A 1U2GA 1E6LA 3WS7A 1QPBA 2PGIA 4L50A 2R5FA 3X2FA 1TJPB 2IA5A 1JPNA 2FPKA 1D4FA 2ZW9A 1LV7A 1H4QA 2NUAA 1N6IA 2VO1A 4QTXA 4NH4A 2FXIA 4BVAA 3DD1A 2IGBA 3BTVA 2TECE 5K03A 1WB9A 4HTAA 5MN5A 1D2GA 3RM3A 5CG1A 4P32A 1U3DA 1Q12A 5K6RA 4R2IA 1F6BA 3KWJA 5K8LA 4COOA 4ER6A 1CNEA 4PXSA 4HNVA 4PHGA 4QASA 4RV5A 2F1KA 1UPTA 2RBGA 2WSMA 3N0RA 3C4QA 5J58A 1CDZA 3KKEA 4CHGA 3IJPA 1IY9A 1HE4A 1BX1A 1KDOA 1QYDA 1ADFA 4Q7MB 3CUVA 4HDSA 4ER7A 3I0NA 4RPKA 1N34B 5CT5A 5L4SA 1Y6GA 5K20A 3SQDA 3FCSB 2HN9A 2ACEA 5IYZA 4FX2A 1T9HA 5G3YA 1T8SA 2ID7A 3BWYA 4Q5IA 4ZOCA 2V8BA 1Z38A 2II6A 2H48A 3OZRA 5LA6A 1YHNA 3PQ8A 5JI3E 4IDFA 1HYEA 4BZWA 4BQEA 1IM8A 4FP9A 2R66A 3LOQA 4ZO8A 1A5AB 3VU0A 2VTKA 1OYYA 1SVWA 3O5AA 2VRWA 2DG2A 4G85A 1T5SA 5FO0A 3UV7A 2W2KA 1O96A 4YV7A 3ZJ4A 1S4QA 3CFYA 1UDWA 2ETVA 3WLMA 5IAJA 4EHBA 5CFNA 3VISA 3WK4A 2VSNA 3QX9A 1G7SA 4RL6A 4WZAB 1XDGA 3OWOA 4RU1A 5IUJC 4XDHA 1M2FA 2H2DA 1M1YE 2VHYA 3S2EA 3U3ZA 1RS0A 1NTOA 3BFJA 3T52A 3NHFA 2WKPA 2I2AA 2OWEA 4KHZA 4Z2YA 5KDLA 1LW7A 2K7ZA 3IBCA 5AW1A 3K8ZA 1GPJA 9LDTA 5KX5F 2KM1A 2OKGA 2XB2A 2EEZA 2EJVA 4EJ6A 1ZD1A 3Q3CA 4FXPA 4RDHA 3TLGA 1YBFA 4GW3A 1W4BA 3UY4A 5ISMA 3NVKI 1E4VA 1HDIA 5E1MA 3Q8MA 1VCNA 2IEIA 5IMBA 3RU3A 3HKBB 3C3JA 2ECOA 1JKXA 4WUTA 4M3NA 3FHJA 4CM7A 3I01M 1JIIA 3R5XA 1GR1A 2G72A 3RE1A 3ZDCA 3ZK8A 4BPBA 3IBTA 4IMRA 3ILSA 1JHPA 4JJAA 4KVAA 2QLFA 4MDYA 3UFBA 1PX0A 2C77A 2FZ4A 4PRZA 2JDID 3CZRA 3GP8A 4B0OA 3MRTA 3VDRA 2BMEA 1HLPA 3N05A 3NTLA 2A14A 2R4QA 1REQB 4BO9A 3SF0A 5C1OA 2NAPA 5LMNB 1IWOA 3QXSA 6AT1A 2SKDA 5D3MA 1S2GA 2V4ZA 3K72B 4IGEA 1NG1A 1YQ9A 1C0PA 1GPBA 1WU8A 2J0VA 2PPVA 2V7BA 2VJDA 1GCIA 1K75A 2W2LD 1PSZA 2Y1CA 4ONEA 1XCOA 3QFSA 2H00A 3SHVA 4BNFA 3CU5A 3M70A 4NBSA 1R8SA 1V0JA 1F8UA 4ZTBA 1W85B 2ZKIA 2AEFA 3HB9A 1KU0A 5C3UA 3SNHA 1NOIA 2L82A 3GT7A 3MF4A 4JB2A 3O8QB 3OI7A 5D7BA 2J5BA 2VLBA 3WQQA 4O4HF 2PUHA 1L5SA 4RDXA 3ZOZA 5IWCA 2BF7A 5SZKB 4WE3A 1G7RA 4NU5A 1KJQA 4QOJA 3VNSA 2OXTA 4XCVA 4XW2A 4DUYB 5E2BA 1L5KA 1Y6QA 1ZNXA 3M1LA 3NIDB 4NK4A 1E6CA 2IPMA 1SHUX 3A9WA 4OUKX 5FJJA 3ZHOA 1H2YA 4ZI5A 2WHYA 2W2PA 1BTOA 2JAQA 2X0RA 4B4UA 1XZGA 4X93A 3F6SA 4F4DA 3GLHA 3JQ7B 3OLXA 1DC4A 4TUYF 2JI6A 3RAJA 1V8FA 2BFMA 4DLVA 2YZ7A 2AN3A 1KAEA 1GUAA 2DHCA 5KC8A 4KQ1A 5BR7A 4UQLA 1BDBA 3UOAB 1CUFA 2ZU0C 4RABA 4DG9A 2DX7A 2LWIA 3SX0A 4ENSA 5C37A 5KTRA 3AESA 2G1KA 4MA5A 3OPYI 1RBZA 3L9WA 1QYCA 2AOVA 3O1IC 3QGMA 3NM6B 5CP8A 3I52A 4FOTA 1QFZA 3L9XA 4D56A 1Y63A 1ISGA 2ZT6A 2D5LA 3KFLA 1B6TA 1P2GA 4RLQA 4BQNA 3NDIA 3EZGA 1NVBA 3ICVA 4Z7NB 1XI2A 5GPBA 1VL2A 2YXNA 4FUQA 3OAAD 4QUEA 3NBAA 4BBJA 3C3MA 1KTVA 1O97C 3DOJA 4FE4A 1RLUA 1V2GA 2XOXA 3SQOA 3LV8A 1NA5A 10MHA 4DKJA 3DV0B 3JZAA 1H65A 2GN8A 5D5HA 1FPMA 4I1VA 2B20A 1X19A 3COZA 3TINA 3WZ2A 1W30A 1X8KA 5I8ZA 1J8MF 5IG2A 5JFGA 2AE1A 4ENVA 5ALWA 2DTDA 1H05A 2XDYA 3CJRA 3M6WA 1WULS 1BS1A 1IFXA 1JQJC 2AMFA 1ZNQO 3V1YA 3HKDA 4XFJA 3V00A 5K0FA 2WHQA 4A4DA 2YBDA 1ZMXA 1IXKA 3D6HA 3P2OA 4HNSA 3FX2A 3AUJB 4RA9B 3WYNA 2CSUA 2ONZA 4ZARA 2TMDA 2B1JA 1U02A 3WLIA 4RM2A 5LOVA 3MQFA 5GWXA 1HR0B 3UXYA 4EJ2A 2FLWA 1P18A 2FSIA 2R79A 1HORA 1KZ9A 1MH9A 1R88A 2Q6VA 3GL9A 4AMVA 2ZTSA 3O94A 6PFKA 1F9AA 1RE1A 1YR2A 2E4ZA 2OGUA 2ZR9A 3EDOA 3KHUA 3OJLA 4IJVA 5A4FS 4B3CA 5DGHA 3N0VA 4CL3A 2AOUB 5ALLA 4XIGS 5FR2A 5H9WA 4TYWA 3UJ8A 5C35A 4DTCA 1X1TA 3ZWWA 1Q0ZA 1Y5LA 1LCIA 3ECCA 5CPFA 1J2RA 1XG5A 3CR7A 2M1XA 2VATA 4HD8A 4BFZA 5FOWA 3LVRE 2XYGA 4BMCA 2FPUA 4QM7A 1B0AA 1R37A 2P67A 3VO2A 1NQXA 4IMJB 3GFGA 3EPJA 4RNDB 3GJ8A 1A50B 4D2IA 2VCHA 5IN5A 2OG1A 3BMOA 2HCJB 2JFWA 3H4IA 5ALZA 5KNBH 3S44A 1KGSA 4YK7A 1GG9A 4ND4A 4ED9A 4DZTA 1XDDA 4EMTA 1RI4A 5JXIA 3RLIA 3OM9A 5AKXA 1RW4A 1SB9A 2CXQA 1IDN1 2EQAA 3COVA 4HB3A 4EMBA 4US2R 5IT4A 3WA7A 1M67A 3ZNNA 2MSNA 4CIBA 4MKGA 5KHLB 1BFKA 3MLAA 5TE9A 1SC1A 4QBKA 5DBHX 1R6VA 3RARA 4CGYA 3C16C 3SBEA 3UOGA 4GX2A 4IR7A 4BFSA 4X92A 5BSFA 2W93A 1FVHA 3ZKAA 3F6BX 5HKLA 4YWHA 2NNWB 4HTFA 5KSOA 4O3MA 3PUHA 1X80B 2NM0A 4RGQA 4UBJA 2N1MA 4G97A 3W1VA 1ST3A 4GX5A 4QVIA 1P5ZB 4KQEA 5EMLA 1BZYA 1I9GA 3THSA 1KNXA 4FDTA 4W9RA 5T8KA 5JNSA 2PGXA 3FYSA 1C2YA 1GPDG 3OLVA 3GZ4A 5L51A 1RMTA 3FKQA 2DFTA 3HCOA 2QMHA 1YRQA 2V9PA 1B14A 3KHSA 3DMTA 2Z09A 1M66A 2WYWA 4J0FA 4KODA 4MLCA 2TMGA 3VC2A 3ZWDA 5AVSA 4GM4A 2O2YA 2GKSA 3O4JA 3R77A 2FP4B 3FA2A 4ARIA 5CMLA 4RD3A 5F51A 3SEQA 2Z5VA 3RV4A 2F3PA 3HDYA 5IARA 2QX9A 3LWDA 4A8PA 4MWZA 2B1GA 2J9FA 2GYWA 4RDCA 3FMVA 5F5LA 3PICA 4L5JA 4F9TA 4D0SA 5KWIA 2G63A 1QAQA 2O9JA 3FG9A 5LR6A 3BCUA 2Q2NA 1ML4A 1SQ6A 1J6UA 3PNKA 4M0FA 1UBNA 4X8LA 4ZMSA 4IF4A 3EUEA 2UYHA 3EZYA 4YRBA 1E9RA 4YO7A 1P77A 3NBFA 1GZ5A 4BHTA 1D09A 5BO5A 3KSAC 4HN4B 4EJ0A 5KYXA 2VR1A 5FPHA 1RYNA 1E2KA 1A8QA 1QDUA 3KG2A 5BN5B 2PZJA 2WPDA 5E0KB 2WAAA 4YQZA 1NLZA 1CY1A 4JXZA 3ZWVA 3ZZNA 3MUFA 3M1IA 2VPWA 3A0RB 1V8ZA 3DHWC 4TGLA 1NW4A 4AMBA 5EIEA 4P82A 1Y6RA 4UEQA 1HETA 2OC4A 2ZSDA 3IPCA 1YKFA 1E4OA 3O9VA 4A1OA 4IIHA 1YE8A 1RI3A 4EA6A 1MOPA 4YRSA 2VZLA 1D2EA 4HATA 2QNRA 5JD4A 2EBWA 4KWTA 3L6UA 3FNBA 1ZKMA 3MPUA 3C7DB 3OZUA 1UKYA 3TEMA 4BO6A 1PV2A 5D01A 2I2BA 4MW5A 2PUTA 4ZAZA 2W4MA 1XMIA 3VMMA 5DXJA 2IF0A 2RGAA 2J8ZA 4TYYA 3VGPA 3DVQX 5EGNA 3ITDA 3WKEA 3E3NA 5TARA 1FRFS 2NADA 2QPLA 2QSUA 3DH0A 1PCXA 3P0RA 4JUBA 3GAAA 3KQSA 3GT4A 3T5BA 3TVDA 1UP7A 1OJ7A 4YR9A 2JFUA 1FU7A 3PKZA 1E2MA 4DHEA 2QBYB 4AI6A 5IDWA 2IK8A 1GG2A 3JWEA 2WM9B 2WEKA 4YA6A 4QDOA 4XTRA 3DZGA 1DAIA 2FFBA 5JDIC 1I3MA 3ZTYA 3JQ7A 1DC8A 1QH1B 1K06A 1Z7YA 3HUDA 4PAMA 3KELA 4I7EA 4BE9A 1EAMA 3TZLA 3SKYA 3D1LA 2JGLA 4QG3A 2HO5A 5I45A 2NP7A 2JZOA 4IIXA 4C89A 4PGGA 1OLUA 1WHTB 4BZZA 3D7SA 4EHNA 2ZRKA 3HWWA 3EWIA 3CF4G 2BRUC 1OHHA 4HDMA 3P2YA 4CFYA 3ZN2A 4PIPA 3V7FA 1JZSA 4OIFA 4AAYA 2C5AA 3IV9A 1WL8A 4MIYA 2PA0A 3VU9A 2CLSA 2FSSA 2ZXFA 3D4OA 1LTQA 2OAEA 2PVPA 2ZWIA 1S2NA 1WP9A 5DPMA 3B3FA 4BWVA 3A4LA 4FFPA 3FMIA 2D4AA 2XEDA 4IGIA 2YZMA 3EN0A 5JFTA 3T5AA 1KI2A 2WJ4A 2ZR8A 2XCQA 3ONDA 3T12A 1OROA 1ECFA 3EZNA 1J7KA 4F97A 2REQA 2P9GA 4ZYLA 5JJKA 1MPXA 3X3HA 2MDTA 2YNMC 4AUNA 1VBFA 1UBFA 1LDYA 1DT5A 2JEZA 2PZAA 3EUFA 4G1FA 1KWKA 4DWVA 4HG2A 2HW8A 4LMAA 2Q3DA 1J42A 2QNBA 4NCBA 2IYTA 3T3EA 3K15A 4B6FA 4H7DA 2RIPA 3AJ9A 3KQMA 3O2NA 4DV0B 1QCZA 2GOYA 3JCZA 3PHHA 3KVVA 1DQYA 4MW0A 3TBHA 1LDBA 1UK6A 1X1DA 3K0AA 1FUIA 3T7KA 3ZC3A 1YQTA 1POXA 2DWOA 1K8XB 1IB6A 1V1RA 2EWVA 4U2BA 4YRFA 1FW8A 2IUFA 2GN1A 3G8AA 3HNRA 3LUJA 2NSDA 3PGA1 3PI7A 1RZVA 2H7XA 3M3HA 4W1QA 1KARA 3U4GA 2DE0X 4WN3A 2JJQA 3B6KA 4QOEA 5DCWA 5ALJA 1P61B 1ESDA 4RA6B 2FEAA 4EPTA 4RV4A 4Y0VA 3UCXA 1BWQA 2XDWA 5CM8B 5A7GA 4E15A 4F5DA 3GAMA 4NZ9A 1MNAA 4UVIA 2VQ3A 3OZVA 2V59A 4LZNA 1X7ZB 2MSEB 3C1AA 4EIWA 1C1DB 4INJA 1GQYA 5BWOA 2V6BA 3UJBA 1XKXA 3UK7A 2Z3VA 2VQEB 2J32A 4UM9D 4C6RA 1JFRA 3PBKA 2KLBA 5ABPA 2BMJA 3UWDA 1WSDA 4I4NA 4QSMA 1RYYA 5K3AA 1JHDA 3K0KA 2QX6A 3QRWA 5JCJD 3KNZA 4PZ0A 2YXBA 4BMSA 4WGFA 1YUBA 1PGNA 1S2MA 3ZZ1A 1MRSA 3BWXA 1RC1A 4ID9A 3GPCA 1NJ6A 2GBGA 2ZANA 1WZIA 1YRAA 3OF3A 2XGSA 3DB2A 3RSHA 3IA7A 1FUUA 3BAZA 4DJAA 2DU8A 4EKYA 3QWIA 4CM6A 4D3ZA 3LDHA 5LVAA 1G5QA 1V5EA 3NAQA 1V4VA 2PE5A 1UL1X 4EFDA 4XD7D 3CUUA 5ECGC 3IDZA 5KJEA 3FJ1A 4M60A 2QT0A 3AZOA 3B78A 5KEIA 3ZVMA 3BC1A 1GRCA 3A6PC 3DOOA 1L5RA 4HLNA 3G2IA 1PV4A 4WBNB 4B5KA 4KRXA 3UOWA 3NDPA 4DLNA 3MHTA 1SG9A 2QN7A 2BW0A 4HBGA 1BG6A 2ZU6A 3RCBA 4D3DA 4DYDA 3REQB 4N49A 3ZY3A 4MGKR 4HXEB 4BNHA 1GNSA 1N2XA 1B8OA 4H3KB 5FFMA 3GRAA 1ZD9A 3HA2A 3IELA 3BB4A 1JYFA 4TMYA 2BPOA 2WAXA 3MGAA 4QYMA 1J2JA 3G0OA 1RWKA 4U8HA 3DD5A 5BW8A 2W22A 1SPXA 4NJMB 3UJDA 4B48A 3M5PA 2NU7A 3MBIA 4GUAA 4MWTA 4OLHA 3ZKWB 2ZUSA 3GD5A 4OBEA 3RTAA 5M2QA 2PU5A 4L3OA 2JLCA 3BMXA 3QQ5A 2O06A 5L8VA 1ZGCA 2CFIA 2B98A 5FQOA 3D6MA 1T0UA 1RJFA 3C3CA 5DTEA 3OE7A 2XKAA 3RWMB 3TL2A 4EFNA 2BM0A 3UANA 5CDGA 1CUSA 1KYVA 1Z13A 3ZS9A 4TVKA 5IAAA 4S0XA 3VUFA 1NNEA 3K05A 5EZSA 3LXRA 3N86A 3U80A 5EE9A 4S2EA 5BN5A 3JQGA 2QR3A 3ZLVA 3HB0A 4XOIA 3I3OA 2F4NA 2BEWA 2NUTB 5ADVA 4BTVA 5L95A 3H5AA 1T8WA 2LDXA 5D3QA 1SOMA 1UWVA 4L8FA 1ZITA 1GQFA 3CLSC 2HCBA 3KQUA 3ZNPA 3Q12A 4WFIA 4LCBA 3TWOA 3A70A 3B60A 5GAJA 1JDPA 2C5LA 3VR2D 2BZSA 4D4HA 3WSWA 1F9EA 2PMCA 2C29D 3NRCA 4W5TA 1WIWA 1N5OX 2WTAA 3AF3A 3WNDA 1C81A 4ESEA 3OJ0A 1KEZA 4M8KA 4PZCA 1ARZA 1SD5A 4GMGA 1UZLA 3SZOA 1MOZA 1T4GA 2GEBA 4QELA 1JLLA 2J4DA 2QI9F 3OP4A 3ZI7A 4XWWA 2IBSA 3EEFA 4B3IA 1DRJA 3V4ZA 1B8PA 1LWNA 5ITZB 3AHHA 3JQFA 3NRBA 3S1SA 3Q7RA 1JNXX 1DRKA 2JI7A 4HUJA 4MJ7A 2IVFA 3RVBA 3TXAA 4YCMA 5JJ5A 3CH6A 3AV0B 3QYAA 4YHHB 1U0NA 1TQ2A 4KE6A 1FP6A 3M33A 2W9XA 3K9GA 3OLQA 4A16A 1E7MA 3LDUA 5AVOA 3IC5A 5F3DA 1UDXA 4ZGBA 2C83A 2XZLA 1DTSA 5HJEA 4LJ5A 1L4NA 3O8RA 5BSWA 3B89A 4OG2A 5I9IA 1CVRA 2BUCA 1G9XA 3KOZA 4WFJA 3KJGA 2RHHA 3THOA 3VXKA 4WJKB 1DIAA 1SBIA 1DEAA 3C8MA 4GLOA 3GRFA 1LKZA 5DU2A 3N8KA 1UJMA 1ZCJA 1XHLA 3KHKA 3OM0A 4FQ8A 1BD4A 2QXTA 3L8CA 1A9XA 1C1XA 1KR2A 4KAJA 3DC7A 3VR4H 4OLAA 4E31A 1R3UA 3BXOA 5HUHA 4V39A 1T34A 2HNKA 2Q5OA 4Y1RA 5FLKA 2PZGA 5K8JB 4IIYA 2XT9A 4F4HA 4YMWA 2XZOA 2F2TA 1KAQA 3KSZO 4KX3A 4YFVA 3SXJA 1ZR4A 1XB2A 2XGMA 3GWGA 4YREA 3GUHA 3PE4A 5JE8A 4OAQA 4B6JA 5IS2A 3GDFA 2JCYA 4H15A 3I2FA 1EXMA 1SXJA 4L5CA 3V6LA 4I9HA 4PQRA 4IDCA 3MJ4A 2V7WA 3RF6A 2XNDD 4UNRA 2OM2A 4X8OA 1VI2A 3WNVA 2FRVA 1IRXA 1L7EA 4RDIA 2ZSBA 4OUDB 1CJBA 4CGZA 3LU1A 2OVBA 3TRKA 2BEJA 2QYHA 1XZJA 4HZIA 4OMFG 5WRFA 3NJ8A 2ZOSA 3PE6A 4PG7A 1S2IA 5JZVA 4HAUA 3TE6A 2QUJA 1P3DA 4D3YA 4DSNA 1DTEA 2X0IA 1RPZA 3PFWO 1Q0RA 2D8MA 3PFIA 4DF3A 1FTNA 3DFZA 1KJ9A 1HYQA 2IYSA 4LI3X 1LDGA 1ZUWA 2GEVA 2QG4A 4P81A 1Z33A 2AMLA 3MJFA 3NI2A 4OA8A 4BJ1A 5CB4F 1NW5A 4J3JA 2QT1A 1YQXA 2ZBFA 4XB2A 3KZCA 2EWWA 2VKQA 1AM4D 2PIAA 3A1UA 3I4LA 4OM7A 4TS4A 2R8PA 4TRRA 1OXXK 4YDRA 1KYXA 5JS2A 5IASA 5K05A 1T1JA 2YR0A 2XQJA 4M49A 2XCIA 4X9XA 3WYAA 1E3MA 1CXZA 3AIMA 5CAEB 2E4VA 3DF9A 3MD9A 4FZ3A 5CIWA 3RYHB 2RGWA 4P3PA 5A5VA 4UFOA 1QMPA 3RHTA 3F1KA 4IF6A 1LDMA 1G2QA 4ZICA 1RWMA 3LP5A 1SU4A 4RENA 1R8QA 3VHQA 2PMFA 3LSTA 4NMMA 5F9HA 4YJGA 3MILA 1YZQA 4MQ6A 1E9SA 2QVGA 3U7IA 1WQ1R 4YJHB 3GMIA 2CWDA 3KL4A 3QNUA 3KSBC 2XMZA 3UK0A 1DAFA 1H8HA 2F1HA 4R1MA 4ZDWA 1SEPA 1KKLA 1NZDA 3RK1A 3ROTA 5JZMA 3P1JA 2JBWA 1KP2A 4LHXA 2PH3A 5JXHA 4UU0A 1RNLA 4KQMA 4C0WA 1VLVA 2F3QA 3C3PA 3H97A 4CCYB 2P91A 4HRAA 2W42A 2GAAA 2EFJA 4Z9BA 4BMNA 4C01A 4CFSA 4UNSA 4F4CA 4EHAA 4HAZA 5EJMA 1G8AA 1JB9A 3TZEA 1HEUA 2ZJOA 4OXRA 2B35A 3E3OA 4PX2A 2Q1UA 1N0VC 1QIGA 3L0YA 4YXWA 5T57A 1H4TA 4GG1A 4B6QA 5BVGB 4U0JA 4BEJA 1BEEA 2FRDA 3FDFA 3DMHA 1NF2A 3MJVA 4I8XA 3ERCA 1CUYA 1GLVA 2V9CA 1JJ7A 1GNQA 2B5OA 5ICSA 3IH5A 5JAOA 2Z1MA 4Z4FA 2ZJ6A 5IFKA 1WTCA 3IPAA 4UVDA 1YS1X 4CV3A 1IQRA 1RRMA 1Q19A 1RI1A 1SK9A 1NVAA 3N75A 4ZT4A 3EAFA 3CB4A 1KDTA 2E4WA 4OK3A 2VT2A 3L92A 4JXJA 2B6HA 4KIGA 3TD9A 1QVWA 5EUQB 4DQUA