4URFA

Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
248
structure length
248
Chain Sequence
MLLEGKTALVTGAGNGIGRTIALTYAAEGANVVVSDISDEWGRETLALIEGKGGKAVFQHADTAHPEDHDELIAAAKRAFGRLDIACNNAGISGEFTPTAETTDAQWQRVIGINLSGVFYGVRAQIRAMLETGGGAIVNISSIAGQIGIEGITPYTAAKHGVVGLTKTVAWEYGSKGIRINSVGPAFINTTLVQNVPLETRRQLEQMHALRRLGETEEVANLVAWLSSDKASFVTGSYYAVDGGYLAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CYCLOHEXANOL DEHYDROGENASE
publication title Molecular Genetic and Crystal Structural Analysis of 1-(4-Hydroxyphenyl)-Ethanol Dehydrogenase from 'Aromatoleum Aromaticum' Ebn1.
pubmed doi rcsb
source organism Aromatoleum aromaticum ebn1
total genus 99
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 1.1.1.311: (S)-1-phenylethanol dehydrogenase.
pdb deposition date 2014-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4urfA00
2DPGA 5TLSA 5IZCC 1TT7A 2NQTA 4YT8A 1SNYA 1YQGA 3BAZA 2X5JO 2HQ1A 1ID1A 4CV3A 4JGBA 2PKQP 3BZUA 4PLCA 2Y0DA 3KV3O 3WB9A 4EITA 4DIBA 1PZFA 3HHPA 2VQ3A 2Y1GA 4P4GA 5L4NA 4DQUA 2PK3A 2Q1SA 3UGKA 3DXFA 3Q11A 4W82A 4E32A 3TFOA 4JJFA 2UV8A 3FBGA 3I23A 3KEQA 4PN3A 4R01A 3Q9UA 1ZUD1 2W2KB 4I9HA 3ZNPA 4AJJA 4EYEA 1J6UA 5I9MA 3H3JA 1M75A 1B8VA 1VL8A 3SLGA 2V7PA 5EJ2A 3MJSA 2CZCA 1R4MB 2NTJA 4BQPA 4BKPA 2PZJA 3ZWXA 2F1KA 3G1TA 4DPMA 2WJPA 5L45A 1NR1A 4RF4A 2O3SA 1ZXLA 3E8XA 3SBOA 3ZHZA 1B8PA 2QG4A 1C0IA 5ER9A 3ANLA 4DLBA 1O94A 4EJMA 4A2CA 5CDGA 2CDCA 1MC4A 1U1IA 2RAFA 3RKRA 4M49A 1ENZA 3R1IA 4TRNA 4YAEA 2O3JA 3H9EO 1HDZA 1BXGA 1KC3A 1DPGA 2B4RO 4R5MA 4AJEA 4WE3A 5JW6A 4NI5A 5JLAA 3I3OA 4MIOA 4FGWA 3IJRA 3KBOA 4W6ZA 3WR5A 5DOZA 1UZNA 3HQ4O 1J49A 5L95A 4Y6PA 3RIHA 4Z0TA 3SLKA 5HA5A 2CDAA 1N2SA 2NSDA 3P5SA 1X0XA 3I9NA 5IXYA 2VWGA 3CZMA 3V1YA 4NJMB 3AOEA 2SCUA 4H16A 1HYHA 4CL3A 1PZEA 3GZ4A 1HT0A 5G4KA 1T1RA 2ZTMA 5L51A 5U4QA 5JO9A 3A1NA 3GY0A 4YXFA 3IP1A 4E6PA 2GN6A 1R15A 3HB5X 3OQ6A 2ZJ1A 4QX6A 3WGZA 4AJ1A 2J8ZA 2PD3A 1CJCA 3INRA 1XDWA 1Z6ZA 4MKRA 3DZJA 3VPXA 4CV1A 4E12A 2ZB8A 3AU8A 3JSAA 1N8KA 2BFPA 4PLHA 1PSDA 1NNUA 2HKIA 2OO5A 3WBBA 4J6FA 3TZKA 4XQ9A 1HLPA 3KOUA 3WICA 4MVJP 4AL4A 4CM9D 3W8DA 3QJ5A 3V2UA 4TKMA 2AG5A 3K2EA 3ITDA 4OOFA 6ADHA 1OC4A 4CQLB 3ZWBA 3X2FA 3FRJA 5EERA 3JQ7B 5IDQA 3T4EA 1ZBQA 2O4UX 1GV1A 2X0NA 3OBBA 4KUGA 3PDUA 1QKIA 1AE1A 3UVEA 1WZEA 4LGVA 5F1KA 3PHLA 4KWHA 2DBZA 1PZHA 2BI8A 4IJKA 4YCAA 1NYTA 1I3LA 3I9LA 3L4BA 4J49A 5AOVA 1FDTA 3JQAD 2AE1A 4BNMA 4BUCA 1PX0A 4WCFC 4GI2A 2AQIA 2H9IA 3E9NA 1XHLA 5I7VA 4L74A 4GMFA 2E49A 4JROA 5ITVA 1AXEA 3ZWCA 3HUDA 1AHIA 1CF2O 4KQXA 1YO6A 4PG7A 3JD1A 5DN9A 3GRPA 4BV8A 1QR6A 3ZNNA 3D64A 4EJ6A 4DA9A 1BG6A 1I32A 2DPHA 3PJGA 1HDOA 1KEUA 2VOJA 3WOHA 4M54A 2AXQA 2EJWA 2NUAA 5ENDA 4N7RA 1NPTO 4YAJA 5L7WA 4YJFA 3OIDA 1ZMOA 5HRUA 3CH6A 3V5NA 4FW8A 1E6WA 3WS7A 3PWZA 3IAHA 4QECA 5TRTA 3UICA 1GZ3A 3NV9A 2HMVA 1LDMA 1NFQA 1PS8A 3LC2O 4BGEA 1C0LA 4YAGA 5ICSA 3QWBA 4RF5A 2D1YA 4BNIA 1KVQA 2C07A 2NVWA 2ZATA 5JMWA 4QQRA 1MGOA 4RO0A 3TOXA 1XSEA 3PLRA 3H5AA 3C3XA 2JAHA 1TXGA 4QTZA 4R68A 3T7CA 3UAGA 4HBGA 4OH1A 3ZWWA 1EUZA 1F0YA 2XAAA 4JJIA 1KVRA 4ZQHA 1PTJA 1WW8A 3V2HA 1JWAB 4K28A 2RCYA 1YH3A 4IGEA 2C7VA 2DLDA 2RIRA 3ULKA 1EBFA 4I5EA 4BIIA 1EFLA 4DRYA 1E7SA 1HE4A 3GVXA 2BGKA 1OC2A 3LT4A 3OF2A 5EQDA 4XWYA 1P1FA 2Y1CA 3QWIA 3MOIA 4R3WA 1OBFO 3ICPA 1E1NA 1WAMA 5L3ZA 1YL6A 4XCVA 3EVTA 1LLQA 4HFJA 1KBZA 1DFIA 2VYVA 3WGQA 1SAYA 2R00A 1GZ4A 2D5CA 3G1UA 4PG8A 2JHGA 4JCOA 3RU9A 4WJZA 3F3SA 2NM0A 4YJDA 3GGPA 3TZQA 3OA2A 5IXSA 5JFOA 1XU7A 4IMRA 1K6IA 4WNIA 3TDKA 5K6AA 3TFQA 2YUTA 4FFNA 2PY6A 3G0OA 4OMUA 3X2EA 4CUKA 4AJOA 1KY5A 1QLHA 4CLRB 4QT0A 1P1HA 4DYDA 2GLXA 2D8AA 3G79A 3WMWA 2OP0A 2DBVO 1VKOA 2DVMA 4U0KA 4J1QA 4NHEA 4F6CA 2Q1UA 3FTPA 3ONEA 4B8ZA 2F00A 3ROPA 2AMFA 1QYWA 1HXHA 1KYQA 1VL6A 1KC1A 5JC1A 1H6AA 3I6QA 5BSEA 1NAHA 3VZPA 2VN8A 1CQJA 2Y1DA 3AUAA 2Y0EA 3S55A 3IKVA 1HEUA 1KEWA 3L6EA 7ADHA 3WSWA 4XJSA 2VWPA 4GVXA 3UW3A 5BSHA 2PTGA 3I6IA 3RAJA 3N74A 1KEVA 4EZBA 1FF9A 3ICCA 4DBZA 4O6VA 1A9ZA 1HF3A 4P4NA 1D7OA 1GADO 1Q1NA 4XQCA 3A06A 1C14A 4YJHB 2PA3A 4BNVA 2EWMA 1DIBA 3EVNA 4J4TA 4OO3A 3ZU4A 1NVTA 2I66A 4HFNA 1FDVA 1LC0A 4OM8A 2HDHA 3GZNA 3EHEA 2X9VA 3OIGA 1EBUA 1GL3A 3DMTC 5B4VA 3MJEA 9LDTA 2BKAA 4BO7A 3WG9A 4WCDA 3JQ8B 4PLGA 5DOVA 1N7GA 1ZNQO 2P91A 1N9GB 2EGHA 5BNTA 4D3DA 1E7RA 1H6CA 2QRKA 3M1AA 4W7HA 3L0DA 2X0RA 1V35A 4BO0A 1RJWA 1RYEA 4FGSA 5DULA 4IXTA 1B16A 2GDZA 1E5QA 3UFXA 1LRLA 4GSKA 4LVCA 2GYYA 4ILKA 4M89A 2NLOA 1Z82A 4FCCA 4GGOA 1P1JA 4E4YA 5KVVA 3ZWNA 2VHXA 2IZ1A 4IDFA 1RYDA 1NQTA 1GV0A 2PZLA 5CG2A 4DPLA 3B1JA 4RGBA 4I5FA 2P9GA 3QQPA 4FQ8A 4IJUA 2AHRA 4XQGA 4YB8A 1WP4A 4M87A 4E5NA 3ZW8A 2P5UA 2EJVA 3DZFA 4ZGWA 1DIGA 2NVUB 4YA6A 3LU1A 4TVBA 5G0SA 3H7AA 3PVZA 3AOEC 4I9NA 1SB9A 4XGIA 1M2WA 4D3SA 2W98A 2Y66A 4HY3A 1ZH8A 5LCXA 4YT2A 1I3KA 3LC7O 4IIUA 3S2IA 4D41A 5JCJA 1A4UA 1Q2XA 2YHIB 1DXYA 3I9OA 3OETA 3DB2A 3JYQA 3N7UA 4MVJG 4E0BA 4DC0A 2HMTA 3HADA 1DFHA 3NDIA 4UULA 4RVDA 4TWRA 1P0FA 2YQ5A 2HSDA 3CUKA 2ZCUA 2PKQO 4J7XA 1NR7A 4ZD6A 4XKJA 3W4JA 4H7PA 3DAPA 3R3SA 1W0CA 1K2WA 4N5NA 3WGIA 1GDHA 3DWFA 3K96A 3B6ZA 4IINA 2NU7A 2Z95A 4OXNA 1YBAA 4TSKA 3PGXA 5KVCA 5U9CA 1E7WA 4EEZA 4PG5A 2BFMA 4MKZA 4XIJA 4YVFA 4CODB 2AQKA 2VHWA 4R51A 3RBVA 1T4BA 1TT5B 4GL4A 3F5SA 1JAXA 3ONFA 4BOYA 3DZIA 3MTJA 3PWSA 1M6WA 2X5KO 3QWFA 1C1XB 1YWGO 3OJ0A 4L4RA 3BMNB 1P1KA 3WNQA 2W90A 3CEAA 1NWHA 4DMLA 3H3FA 3SVTA 3Q6IA 3EK2A 1Z7BA 3RUEA 5DBGA 4RCVA 3ETDA 4B3IA 1AN9A 3IKTA 3H65A 4IIVA 3HDQA 4OOEA 3PJEA 5K9ZA 1IHXA 2HRZA 1PIWA 5MDHA 1LSSA 1ZJYA 3WX0A 4LSMA 2OXIA 1AHHA 5JPIA 1DC4A 2B35A 2Y1FA 4XYMA 4FFOA 4NBWA 1ZK1A 1R6DA 3ITKA 4DTIA 1ZW1A 1Y9AA 4P38A 3IIEA 4HNGA 4F46A 4RDIA 3DBLB 4FB5A 2G1UA 4WPGA 4A0SA 3GEGA 4J9UE 1PU2A 1WNTA 4OQZA 3WGOA 2EXXA 1E7QA 2QYTA 1GD1O 3GRKA 4O0LA 4K26A 4B4OA 4J43A 5HTOA 3QHAA 4GKBA 2FZWA 4RVGA 2GCGA 3D7LA 4BB6A 3EW7A 2Q50A 4XQEA 4IJWA 3K30A 2DTEA 3JQFC 5IZ4A 3QV1A 4DREA 2VNSA 3AI1A 3G3EA 2CVQA 4DUPA 4IBOA 3ABIA 1SEPA 3PK0A 1LQUA 5DT9A 1PJCA 3DBHA 1PWZA 3L07A 1DAOA 1XLTA 5GMOA 3K92A 4GX2A 1DLIA 2Q2WA 3VH2A 1P1RA 1FDSA 2RHRA 4GAEA 5H83A 1LDNA 4YACA 4H3VA 1QP8A 3TOZA 1T25A 2W2KA 1PEDA 3CXRA 1KERA 1GQQA 4BL5A 2HU2A 4EUEA 2HUNA 1U5AA 3EZYA 3RFTA 1R4MA 3RFXA 1Z73A 1X0VA 3P2YA 3MJVA 2R00C 3F47A 5TQVA 4JLWA 5FWNA 3SX2A 2LDBA 2P68A 1H6BA 1WMAA 4BO5A 1N1EA 1YB5A 2V65A 1I36A 2Q1WA 6LDHA 4AJKA 5TJ9A 5K6AC 3PTZA 4FS3A 4A10A 4WECA 1H9AA 1Y5RA 3C8MA 4AICA 2O2SA 4ZVVA 2HMUA 2VWQA 4ID9A 5KKAA 3EZLA 4UVHA 2Q2QA 2R6JA 4YRDA 4K6FA 2G82A 3GPIA 5BQFA 3O9ZA 1O9BA 2CSUA 3AM3A 4CMIA 3KSUA 3ANMA 4CR6A 4BKRA 3KYCA 2BH9A 3PZBA 3HDHA 3RD5A 5CP8A 2WYUA 1X7DA 4N5LA 1I2ZA 4CMCA 4R9RA 1LI4A 1P3DA 1ZSNA 3BTSA 4N54A 2BFAA 4U0JA 1BVUA 5JE8A 3GEDA 4JNKA 3RUDA 4DGSA 4R9SA 3GLQA 4HFRA 3UUWA 1GYPA 1U4OA 1YKFA 3ENKA 4CUJA 4CLXA 4ALMA 3OICA 1VM6A 4CM1A 4E2XA 2ZKLA 1YBMA 3V1UA 1ZFNA 3BMQB 4BKOA 4ESOA 3TF5A 2EERA 3JD2A 3QLJA 3WIEA 1ISGA 3VPSA 5L4LA 1YGYA 3D3WB 2A9FA 1ONNA 2UUPA 2WTBA 1DJQA 4J1NA 1Q0QA 4PLWA 1PJ4A 1MXHA 4L75A 1E1MA 4DIFA 3PLNA 3LQFA 3C1OA 3QW2A 1XWFA 4L8VA 2JD2A 2FP4A 2OL4A 2PZKA 1WZIA 5F5NA 1NXQA 3R3JA 2EP7A 3GA0A 1X14A 1XR3A 4JN6B 3SEFA 4BNLA 4O59O 2D2IA 3JQGB 1HTBA 2JD1A 3O4RA 3W4KA 5CDYA 1KS9A 4UVDA 1P33A 2C59A 2EG9A 5C7IO 5KWEA 3QWAA 4URFA 1I2CA 3AUTA 5EMHA 3U4DA 4TZKA 3RC9A 2PWZA 5L53A 5LC1A 3VOSA 5JDIA 4NFHA 4GSLA 3E82A 3HE3A 2WD7B 1G6KA 4GPD1 1OOEA 2ZYAA 2RH8A 2O23A 3WSVA 1AXGA 2AG8A 2Q4BA 2OHXA 3ZZNA 5JC8A 4KTTE 1V8BA 2UDPA 5T57A 1DHRA 1ADBA 5A3VA 4B3JA 4U5QA 1PJ3A 4MOWA 4EBFA 3RKUA 1YVEI 2FSVA 4L73A 5L4SA 1PJBA 2VWHA 2VYND 2GO1A 3GFGA 3HZZA 4MKXA 4NBRA 4CJXA 4CLOB 4FBGA 1PL7A 3ENNA 2O3UA 4D44A 4OYRA 4HADA 8LDHA 2IXAA 2XF8A 3DEYX 4BKQA 1GCUA 2IODA 2C54A 5AXAA 2JJYA 2YYYA 3VPGA 3DAFA 4TROA 3H2SA 4CL8A 1LXCA 3CSDA 3FPLA 4OKNA 4PG6A 1P31A 3LVFO 5IDXA 2DKNA 4J2HA 4RLHA 1YXMA 2HO5A 3DQPA 3EC7A 4RQTA 1U8FO 3ADPA 4RORA 1EK5A 4FR5A 2BI7A 4JK3A 2JCYA 2VZ8A 4ZU3A 1E3SA 2D59A 2J3HA 5EESA 5A5FA 3WIDA 3DMTA 4XDZA 3OJEA 1IPFA 3EAGA 4TZTA 3WQRA 3SC6A 3ST7A 4MVJE 3K5PA 3O03A 4JBGA 1XKQA 2I3AA 4BNTA 2GN4A 3WJ7A 5GZ3A 1KVSA 3VPHA 4ALJA 3CPSA 1GPJA 1E7MA 1QV7A 5JAIA 2PGJA 2Y93A 1MFZA 4OKIA 4XGKA 5TSDA 4CMHA 1FK8A 3H2ZA 3EY4A 5TS3A 4WLUA 4A5OA 3VC7A 2PH5A 3FNFA 4KZPA 3I1JA 4E13A 2DM6A 4NR0A 2IE0A 3V2GA 3RC7A 1A72A 3DDNA 2PGLA 1C0KA 4BNGA 4XYBA 3I9KA 2VT2A 2YY7A 4OHUA 4YQYA 2CMDA 3PHJA 1I5RA 1DLJA 2I65A 2O7SA 4D0SA 4L0QA 1JVSA 5A02A 1PGOA 3L4SO 4I5GA 4CMEA 3CMMA 3Q2KA 1W73A 4PLFA 1DRUA 3JD3A 3WGHA 1IOLA 1LTHR 1X1TA 3FD8A 2QW8A 3IUSA 2PKRA 1BRMA 4CQMA 3EGOA 1G0OA 4CM9A 4IDGA 4IPTA 3P7MA 1A7AA 1GUYA 4RPHA 3VHRA 1DHTA 4FC7A 3PYLA 5DP1A 4CM8A 4MVJD 2D0IA 3FR7A 2VHVA 3ZHBA 3BTOA 3NRCA 1UP4A 4WKGA 4KTVE 1R0LA 1UP6A 5AXBA 5KNLA 3R0IA 2EV9A 4R1UA 1ISFA 1XU9A 3CTMA 3AM4A 4IQ8A 1F06A 1YB1A 1QORA 4E21A 2GZ2A 5IAAA 2HK7A 4CPDA 3JQAA 2G5CA 2XXBA 3KYDB 2NTNA 2PD4A 2J3JA 3PWKA 3WXBA 1X7HA 5LDHA 5J23A 4ZRMA 4WGGA 1C0PA 4RF3A 1BSVA 2NU6A 3FN4A 3F1LA 4NJOA 4B8WA 2QRJA 3FNHA 4G5HA 2W8ZA 4CM6A 1ZK0A 3AM5A 4YAIA 1H5QA 2JAPA 3D1LA 1EQ2A 2UUOA 3D5TA 1LUAA 1E6EA 4ITUA 4J7UA 4LK3A 1PWXA 4DPKA 5A06A 4JP3A 5KKCA 2AW5A 3NJ4A 3GGGA 1KETA 5I7FA 1T2AA 4YJHA 3B1FA 1EDZA 1O0SA 3DC2A 3Q9NA 4LVUA 3DHYA 3QSGA 1UR5A 3GAFA 3ZWMA 4AVYA 3ZN2A 1SEVA 3F46A 3I83A 5JY1A 4CMGA 3WNVA 5A4DA 3N58A 5I9NA 1WDLA 5A03A 3DFUA 3P2OA 2WE8A 3KRTA 1QYXA 4E2YA 1VKNA 1UDAA 3LLSA 1SBYA 4FFMA 3U09A 2X8LA 4XEHA 5JO0A 2FR8A 4XYGA 5HBRA 3DO5A 4IJVA 3QRWA 4GH5A 3VH3A 4NK4A 5CPFA 1DAPA 2AEJA 3JYOA 4J16A 2PZMA 3C7CB 4JXKA 4ND4A 5A05A 1M66A 1X13A 3OSUA 4WK6A 4BO6A 1NHGA 4GWGA 4EW6A 3O26A 1RPNA 4UVIA 2OBYA 2EP5A 2DC1A 1A5ZA 1DC6A 3WYBA 1U7TA 3RUHA 3DBRB 5AQ1A 1GPDG 2OUIA 3KZVA 3RQSA 1CRWG 1CETA 3E03A 4HV4A 5I7EA 3VH1A 1YOVA 1IB6A 4TVOA 1R0KA 1V3TA 1YS4A 1GZ6A 4MVJF 4PCVA 4RDHA 3W1VA 3NAQA 4J4BA 1LBEA 3WWZA 4EDFA 3FWNA 2V6GA 1Y7TA 1K6XA 3JQFA 3UN1A 4DWVA 4EGFA 4YTEA 1TI7A 1KY4A 1I33A 4HUJA 2XPCA 3BMCB 4ND1A 2NVUA 4PZDA 5A04A 4NBVA 1CEQA 3IMFA 3H8VA 4ALNA 2Z1MA 3GVIA 3PI7A 4Z0HO 1O6ZA 3ZNOA 1SMKA 5C37A 1Z74A 5ADHA 4MVJH 4YBZA 3IP3A 3OM9A 5H81A 2E6UX 4B3HA 2VUSA 4KQWA 1EE2A 3LC1O 4PG4A 1EMDA 5AVOA 3JQCA 5B4UA 2GZ1A 1B7GO 3M6IA 3TSCA 4NIMA 4QUKA 4FOSA 4FFRA 3WYEA 1P74A 3LT2A 3A9WA 1U2DA 2HK9A 1HE3A 2A94A 2O3TA 5COBA 5EL0A 5A3JA 5B12A 1A9YA 5BR7A 4FIZA 4XYEA 5T8KC 1LRJA 5EPOA 1ADGA 4IS2A 3F1KA 4XDYA 5F1PA 4O63O 1ZXBA 1R4NB 2EEZA 4U6QA 2WDZA 1XQ1A 1A7KA 5ENVA 1RM3A 1HZJA 4D0RA 1LU9A 4K6CA 4B4WA 4D42A 2JHFA 5JDIC 4Z9XA 4UAGA 2O3QA 1HE5A 5F1OA 1MUUA 3NKLA 3RC1A 3GC6A 4ZJUA 1L7DA 2VRCD 3FNGA 4AJLA 5G4KB 3Q2IA 1XELA 4GLLA 1RWBA 1R16A 4HP8A 3ZU2A 3BA1A 2GN8A 5BSGA 4RF2A 2Y1OA 2Y0CA 2IXBA 1MG0A 1XQ6A 5IN4A 1CDOA 3KETA 1F8FA 1DC5A 1N1GA 1T2EA 3ANNA 2FPIA 3SJUA 3UH1A 3WQSB 2HK8A 4UEKA 4KP7A 3GVPA 1P44A 2DTDA 1EVZA 1MV8A 4II2A 1LC3A 3RC2A 1E3LA 3O8QB 4RJTA 4E33A 4Q3AA 4CLEA 2B4TO 2OZPA 1VJ1A 3HDJA 2VYVD 1GYRA 1N5DA 1NASA 3KXDA 4RZHA 4C7JA 1I10A 3DR3A 4A26A 1MB4A 1UXGA 2E4AA 4Z9YA 1FXSA 1IUKA 4IDCA 4RVSA 2PV7A 3DBLA 5THQA 4ND3A 2DBRA 4RVFA 1LDBA 2HJSA 4NFSA 1Z75A 1ENYA 2ZK7A 1Y8QA 3FHLA 3PQFA 4LN1A 2ET6A 4BNJA 1O89A 2X23A 3OIFA 1TEHA 3Q3CA 5JYEA 1Y8RA 5CEEA 3UOGA 5KOIA 2BF7A 4UUNA 2NTVA 3TJRA 4BKUA 2VT3A 3GUYA 1DOHA 1YB4A 1W8DA 1LQTA 1A27A 2I3GA 4DBVO 2W4QA 1SOVA 3ADOA 4CM4B 1ISJA 4UUOA 3HN7A 4YQZA 2ZIZA 3B70A 3GAZA 4ZRNA 1DDOA 1T1SA 1NBOA 2C7GA 2ZJ0A 4Z3DA 3I5MA 5JDCC 3LDHA 2Q99A 2GERA 3E5MA 5A9SA 3NTRA 3ORFA 2H63A 4HKTA 1T24A 3DZGA 4CMEC 3QWHA 4I5DA 4OIMA 4WLVA 5ES3A 1I01A 4YR9A 4MP3A 3UCXA 2Q46A 4BMVA 1KVTA 1GEEA 2P4QA 4BO3A 3FCOA 2VTDA 3QVTA 2LDXA 3E1KA 2CFCA 1YBVA 4B7CA 1SCUA 4PVCA 1QXSA 2FZEA 3LZ6A 1B8UA 1PS0A 4IDBA 2FR0A 3NT5A 2VHYA 2FN7A 4J0EA 2X4GA 2E48A 3GDGA 3OEWA 4KDFA 1L1FA 1IPEA 1I0ZA 2EKQA 4KMSA 4JJGA 1DIAA 1UXKA 5KVQA 4JQCA 1BTOA 3TZCA 4NZ9A 4D3FA 2DT5A 3WLEA 4Y98A 1KEPA 4U8GA 3GHHA 4BO8A 3WDSA 3VTZA 3NDRA 4TMFA 1B15A 1PZGA 2DFDA 3D4PA 1XEAA 3EMKA 3RJ5A 5I8ZA 4BGIA 2GSDA 1I30A 1YL7A 5HS4A 1K0UA 1IULA 4M1QA 1P77A 2J5RA 4NFYA 4PLPA 3WTCA 2HLPA 1GUFA 2X6TA 2ZB7A 4JBIA 4W7IA 1YRLA 4G81A 2GASA 5I8WA 5B37A 4GKVA 3RJ9A 1HYGA 4A7PA 4CUZA 3LT1A 1T2CA 4OSPA 3T4XA 3HFSA 3JCZA 3RI3A 2JL1A 3PQEA 1ZO8A 1XG5A 4RPGA 4RPJA 1F17A 3ZW9A 1ENOA 3D3WA 4QFCA 2P5YA 1D3AA 1ONOA 4QO7A 4BHTA 1Y9EA 3WFJA 2ZTUA 5IDWA 3VH4A 4HXYA 4J0FA 4DL9A 4WUVA 5GY7A 4PFJA 1YQXA 3OQ1A 3IQDB 3LT0A 3TZHA 4BNXA 4UVGA 1WMBA 3OHSX 5TJHA 2CUKA 4M8SA 5IN5A 4BNZA 3QVXA 1GAEO 4AJNA 1JKJA 1ZJZA 1BHSA 1HRDA 4NK5A 5TX7A 1X7GA 1JTVA 2X1HA 3COSA 5DCWA 4FN4A 2NU9A 4Q3CA 4GBJA 2O7QA 2WYWA 4I8XA 1O8CA 5TT0A 3KLPX 1VRWA 2ZB3A 4IZIA 1WLYA 3VVBA 2WMDA 3WGTA 5KCZA 2IDZA 1H94A 3HSKA 4MO2A 2OGUA 4PZEA 1M6HA 4RPKA 3RWBA 4O1MA 1NTOA 4YDRA 3ZI0A 5KTKA 2QQ5A 4WEOA 3S8MA 3ZV5A 4IDAA 8ADHA 4D43A 5KJ6A 4Q9NA 5CDTA 1B3RA 4Q3DA 2QHXA 4MVJI 3GZNB 5ILOA 4BGUA 2RHCA 2NNLD 3WWYA 1E3IA 4BNYA 1PGJA 4IXWA 1NFFA 1BW9B 2GR9A 1DBVO 2YFHA 3GT0A 4KUHA 3WQQA 2NWQA 3ZHYA 1J5PA 1H9BA 5KJCA 2GF2A 1LNQA 3BMOB 3EUWA 2EIHA 3VZQA 3NT2A 3MZ0A 2EW2A 4WOKA 1U9JA 3P19A 4YPOA 1P1IA 3K31A 1PQWA 4FJ0A 3SC4A 1E6UA 3EYWA 4PIVA 1SB8A 2BMAA 4KOAA 1VLLA 1HLDA 4R69A 5TIIA 5DCYA 4Q3NA 1LLDA 3VZSA 3GH3A 1JLLA 2VHZA 3NTQA 4NBTA 2FPGA 5G0WA 5BT9A 1DRWA 4PLVA 1QSGA 3GFBA 4P8RA 1CYDA 1B3BA 4ZQGA 2UAGA 4J90A 2CF6A 4ALLA 2B37A 1H2HA 4CV2A 1V0JA 3A28A 4K1LA 1D4FA 1B14A 2FR1A 3KO8A 4II3A 1Q7CA 3E6AA 1HETA 3L77A 2FOIA 4FD3A 2GNAA 3PIIA 4QFDA 3STHA 4RL6A 4MPDA 5AYVA 3BIOA 1R12A 3VDRA 2DAPA 3AJRA 4TKLA 1Q0LA 3S2GA 5A9TA 1T4DA 2QIOA 2NADA 3FSRA 2GUGA 4C4OA 1VI2A 3NTOA 4FPXA 3TRIA 4B7UA 3RBXA 4W99A 2G0TA 1GYQA 5G0VA 5IF3A 3C24A 3PXXA 3LF2A 5CEFA 4I1IA 4LMPA 2GD1O 1FJHA 3GOHA 3ZWYA 2HCTA 3H9UA 2B0JA 1ZVMA 2X9GA 3HJAA 2G76A 4WNCA 4BMNA 2TMDA 2TMGA 3AI2A 2JD0A 1MP0A 2HJRA 3U5TA 4B4VA 3KTDA 3ZWVA 1PJTA 3NEPX 1HE2A 1NAIA 4NJMA 1LJ8A 2Y1EA 4FC6A 1VE9A 4KUEA 1OMOA 3ON5A 4LCJA 1ZSVA 3VTFA 3RASA 1QV6A 3DOCA 1ONPA 1UZLA 4AG3A 1RM5A 1HL3A 2H6EA 1ADCA 3GDFA 3GEMA 3TQHA 4KWIA 5DZSA 1EUDA 1XA0A 1Z45A 2Q4EA 3H4VA 3Q1LA 3W8FA 3JQDA 3LSYA 4QO8A 2NQ8A 4YEDA 3VZRA 2A92A 1CQIA 1ZKMA 4Y9DA 2FHSA 3JD0A 2BD0A 5T8KA 4PZCA 1P45A 1U3UA 2J6IA 2PNFA 2JFGA 3KSDO 1O5IA 2W2LD 1V3VA 4J91A 4YJGB 4BNUA 4K9DA 2ZYGA 1X15A 4RVUA 1BDMA 5CDSA 4Q3BA 1JU9A 4PLYA 3GMDA 2IYPA 2VYNA 4Q3EA 3PEFA 4CR7A 1QLJA 3SJ7A 4CQLA 3IDSA 2O50A 1PQUA 2NACA 2DFVA 2ZQZA 4RPLA 4E5YA 3JQ7A 3PFWO 1C1DB 1X1EA 5C7OO 3FI9A 3PJFA 4PVDA 3ZV4A 1T26A 1C3VA 4AJ2A 3S2FA 1SC6A 4DLLA 1K89A 3W8EA 1JW9B 2VZ0A 3PHGA 1JKFA 5EIOA 3JYLA 3AFMA 1EK6A 3OA0A 3C1AA 3JQEA 4U7WA 1WXDA 2V6BA 3AI3A 3D0OA 4JBHA 4EEXA 4JX8A 3JQ9C 3Q0EA 1DEHA 4XGNA 3FTNA 3ONDA 2C2YA 2G17A 1NPYA 4PRLA 4JP2A 3QIVA 1HYEA 4R1NA 3KLMX 4DQXA 4D79A 1U2GA 1IZ0A 5CHEA 3ZGYA 3GUCA 3U4HA 3D5QA 1VL0A 2QRLA 3GPDG 2WWRA 3GVHA 2VUTA 4DQVA 2B36A 5GZ1A 2I76A 2NVBA 5JSFA 1H0KA 3QVOA 2ZB4A 3L6OO 1PJ2A 1PGQA 3MEQA 5MGBA 4YRAA 3DBHB 1R0SA 1L7EA 5IJZA 4HX5A 4CM7A 4LRSB 1HDXA 3G17A 4YT4A 3DBRA 1NQ5A 1GTMA 1YJQA 4J7CA 3MJ4A 1ZCJA 2OFPA 1QG6A 1EFKA 1QYCA 3NGXA 4BO1A 2B69A 1Y6JA 3GNTA 2A35A 4R3NA 5AXCA 2BGMA 1U5CA 3INGA 4FJ1A 1LLCA 4QXMA 3DL2A 4RZIA 5A9RA 5JNLA 3S2EA 2X0IA 2C82A 3PQDA 3FWZA 3JQ6A 3D3EA 3RCBA 4JIGA 3L9XA 3PGJA 3VAZA 3FR8A 3V8BA 2EF1A 1FDUA 4WCFB 3U49A 3BMCA 2P4HX 2P9CA 5JCXA 4A27A 2E37A 3VPFA 4BO2A 2DUUA 2J5QA 1Q0HA 1AGNA 2X0JA 5CPBA 5KJ1A 3WMXA 1HSOA 3B1KA 4MVJA 5HWSA 1IHYA 4IQ0A 4TRRA 1B2LA 1J4AA 3RUAA 1JAYA 5JDCA 1HKUA 2IZZA 1NHWA 3TWOA 1PJSA 1TA4A 3QE3A 2I5PO 3U4CA 5JMPA 2UYYA 3PDJA 4CMIB 1PS9A 2AE2A 3HFGA 1U7HA 2V6FA 3VVCA 5JXWA 1OI7A 1ZZEA 3E5RA 3HNPA 3KYCB 3OEYA 1IZ9A 4NPCA 4E2WA 2X58A 4BNFA 1EVIA 1ZK3A 4S1VA 3NDJA 3NX4A 1ZMTA 1R4NA 4YYZA 3TL2A 2VCYA 4NH4A 3AWDA 2HMSA 1D1SA 5COQA 1GR0A 1U8XX 1RKXA 3RUFA 4PRKA 4CLRA 2WD8A 2GRAA 2QYSA 4EJ0A 3R6DA 1W4ZA 3AY6A 1ENPA 2JFHA 1ISIA 3U4IA 3AOGA 3OQBA 3VDQA 1E92A 3BHIA 1LDEA 3ETEA 3DHNA 3ASUA 1S6YA 2RBEA 4WLNA 3JYPA 1QYDA 4CMKA 3KYBA 1YQDA 3KUXA 4Z3KA 1PR3A 3NT4A 4FJ2A 3BTUA 3E9MA 2WM3A 1OZAA 5FI3A 4CV0A 5F21A 3I4FA 3PFFA 1EQUA 3GK3A 4J2OA 4E3ZA 5HS6A 3ROMA 1F12A 1J0XO 4OL9A 1SO8A 1MC5A 5DBFA 2VRBA 2Q45A 4ONEA 4Q39A 3OP4A 3O8QA 1E3WB 1GCOA 5DDIP 3ROKA 5ITWA 1MFPA 5CEJA 1DJNA 3AU9A 4CQMD 3ZH2A 4LSWA 1FMCA 3IS3A 2BLLA 4J4HA 3H9GA 4R4JA 2BELA 3LK7A 4XYLA 1I8TA 3MTGA 4ND2A 3JQBC 2YHUA 4UUMA 2R2GA 4IMPA 1MG5A 1SPXA 4OXKA 1XYGA 3JQ8A 1M76A 1N7HA 2V6MA 1N9GA 3A4VA 5DBIA 3I9MA 1ARZA 3CZRA 5IFLA 2JKVA 4NNJA 4PLTA 1D1TA 4CM3A 4FFLA 2B5WA 3QY9A 1O95A 4XIYA 1EVJA 3DBVO 4A03A 4BMSA 3GR6A 1DO8A 2I67A 2POQX 4CMJA 3AUSA 4RLSA 4DVJA 3GVCA 3NGLA 4ZN6A 4UEJA 1BXKA 3MJCA 4IUYA 4WLOA 4CLDA 4CM4A 4F6LA 4W9NC 1T2FA 1HDCA 1YDWA 2YW9A 2DQ4A 3O38A 4A73A 2H1SA 3PHIA 3NYWA 4N18A 1VC2A 1MX3A 3TL3A 2CF5A 2BFOA 3RU7A 3GF4A 2A4KA 3M1LA 2Q3EA 1NVMB 2D5AA 3RVDA 1KIFA 3INTA 5C3MA 4I08A 3U62A 2FRDA 4WLFA 4DC1A 4YAKA 1U3WA 1ISHA 1KVUA 3AFNA 3GGOA 3FNEA 4IQGA 1H2BA 4PLZA 4LRTB 3QVWA 3DAGA 5T67A 1UDBA 2YHIA 4BV9A 1G1AA 3B20A 2O48X 2Q1TA 3GMSA 2YFQA 3KSZO 4WASA 3GNSA 3C7DB 4LMRA 4WOJA 1BXGB 4UVEA 5A5EA 2X86A 1E1KA 2I99A 3WLFA 3DOJA 4ALIA 4ZHSA 1CWUA 1LSUA 5G4LA 2J3KA 2VRCA 2X7HA 2P9EA 1ADFA 1QYVA 4RVHA 2ZTLA 5L7YA 1P0CA 3M2TA 3AK4A 4UUPA 4Z9FA 3ROQA 1GU7A 3JD4A 3WYCA 4GMGA 4GX0A 1E3JA 1XIVA 5TGDA 1EDOA 4XD2A 4ZQEA 4YWJA 2PD6A 2X5OA 2Y67A 1JDJA 1E77A 3U0BA 2B83A 3HB4X 4N5MA 1UXHA 3KM0A 1UP7A 2X22A 1LSJA 2YJZA 4Y6RA 1JN0A 1GUZA 4MVJM 4BNNA 1PL6A 1TT5A 5K0ZA 1N92A 1NX6A 4MIYA 3E18A 4NMHA 4M55A 1WPQA 3UXYA 4CM5A 3F9IA 4TRJA 2J3IA 1U3TA 4CQMB 2YV3A 1DFGA 1C1XA 3DZHA 4XRRA 3BMNA 1H93A 5GZ6A 4G2NA 4CM8B 1U4SA 1GY8A 5HM8A 1HWYA 1IYZA 4OJNA 1H6DA 1QRRA 2OOSA 3OFSA 4LW8A 1ML3A 1HDYA 3E9QA 4AJPA 3K8ZA 3KVOA 5JY6A 2IYOA 1YE3A 1P9LA 1BXZA 1K6JA 3OJOA 1E1LA 3CE6A 2Z1NA 3PIDA 1LRKA 1A4IA 2PGDA 3JTMA 2PLAA 3GG9A 1GQYA 1NWCA 1XCBA 1IL0A 5F3RA 4FSHA 5KIAA 3JQAB 1ZK4A 2EGGA 2YQ4A 4IY1A 2Y99A 4L9RA 2FMUA 3HG7A 2D3TA 2JCVA 4ZICA 5DCUA 1VSVA 3PHHA 2CD9A 4HFMA 5T6BA 1CIVA 1I2BA 1Q7GA 4UEOA 3BHJA 3GDOA 4ZQFA 5IG2A 3DTTA 1PGPA 4XB1A 3ZV3A 2Q2VA 2BRUA 4GX5A 2DBQA 3H9QA 4WLEA 3C1TA 2C2XA 4ROSA 2X9NA 3E48A 5EINA 3DMYA 4CR8A 4HWKA 4TRMA 2WSBA 1HSZA 1WDKA 3A14A 3BTVA 3DZKA 4R1SA 1EUCA 1PQPA 4KDEA 1PJQA 3W6ZA 1Z7EA 1E5LA 2NV6A 4NU6A 1ORRA 1BW9A 1HDGO 3DZBA 1VPDA 3TN7A 2ZQYA 2OMEA 3F4LA 4GWKA 1W6UA 3ZU3A 5L7TA 5FI5A 1DC3A 2IEBA 2YDYA 3IJPA 4IDEA 1PR9A 2VZ9A 4OQYA 3BMOA 1UXIA 3CINA 4DXHA 3TZ6A 3GN1A 3GQVA 4Y8VA 2AA3A 5FEUA 2GN9A 4B7XA 1UAYA 1UXJA 4Y6SA 4YJFB 1ZEMA 3W6UA 5C7LO 4BNWA 3LYLA 2EKLA 2Q49A 2YZ7A 3AY7A 2OORA 1YOVB 3JV7A 3JQ9A 2C5AA 5C5IA 4QSMA 3MOGA 5KJFA 3I4CA 4BQRA 4ALKA 2QZZA 4E5KA 2OBNA 3PYXA 5TF4A 1PGNA 1TLTA 4DYVA 5KJEA 3ZNQA 3WJAA 4EI2A 4E30A 3GN2A 1Y81A 1KOLA 1LEHA 1Y5MA 7MDHA 5IZCA 4MJLA 1MA0A 2DUWA 3CMCO 3BYZA 4NQZA 4R41A 4R54A 2XXJA 1BMDA 3PP8A 2EW8A 4EUHA 4J1SA 5G2OA 5B1YA 3ZV6A 3CKYA 1UUFA 4IM7A 4HNHA 1B0AA 4AJHA 4O5OA 4BO9A 4E31A 4IGFA 4Z6KA 5L40A 3PPIA 3WBFA 3RUIA 3VKVA 5I9LA 4IZHA 4Y67A 3ZHXA 3I52A 3AY3A 1DIRA 2CY0A 3D4OA 3K9QO 4R1TA 2DU8A 4LCEA 4Z0PA 1K5HA 4D45A 4MDHA 5EQFA 2BGLA 4NBUA 3RROA 3NUGA 4BNKA 3PJDA 1RM4A 1ZIDA 3H5RA 3K73O 1ZK2A 3FF4A 2AQHA 2GZ3A 4L4XA 4OGWA 5LDGA 4XRGA 3ASVA 3L9WA 1BGVA 2VUUA 1TVEA 1YONA 1EVYA 4MP8A 2RH4A 4IDDA 3HWRA 4BB5A 1JWBB 4BS9A 3IL2A 2IRWA 3RUCA 3BMQA 1A71A 3DHEA 5TT1A 5JCJD 1I3NA 4EUFA 2PFGA 4R16A 4DIOA 1EZ4A 4FDAA 2VNAA 3IOYA 3HDYA 3GNQA 3H5NA 1XGKA 5BNIA 4J1TA 4G65A 3OMLA 2O2YA 5DP2A 1ULUA 2YV1A 3WGGA 5B4TA 1NQAO 4CMBA 4B79A 2EHDA 1E0DA 4S3MA 4P22A 4RQUA 4IS3A 2Y68A 2PR2A 2AQ8A 4NG5A 4YJGA 3L4BC 3JQGA 3KHUA 1I24A 1RM0A 4TQGA 4BNHA 3ZWPA 4U6SA 4E5MA 2O4CA 1DB3A 2ZCVA 1UAGA 4XX0A 3V1TC 3ZCXA 3C85A 3M2PA 4FOOA 4ZA2A 4DMMA 2OP1A 3F5QA 5COAA 4OAQA 4YT5A 4DLAA 2JCXA 4GX1A 4BO4A 3UF0A 2WD7A 3UCEA 1TB4A 1PL8A 2HAEA 1I3MA 3PYMA 1C1DA 1LX6A 4I9UA 1DSSG 1MLDA 1Q7BA 4OXYA 3MWEB 4GQAA 2CVOA 4D7AA 5BNFA 2C0CA 5A1TA 5BSFA 1EE9A 2J5KA 5T64A 4M86A 3U9LA 1GFSA 3RSHA 4P4LA 3SXPA 2GGSA 1ZEJA 4RV9A 5TC4A 3W4IA 1D8AA 2C29D 1R66A 1Y8QB 3EDMA 1V6AA 5I7SA 1SOWA 5ILGA 3I9JA 1NPDA 3ZWAA 5JAQA 4CLOA 1UH5A 1Y8RB 2D4AA 2C5EA 3OJLA 1VSUA 1HDRA 2E82A 3DFZA 4INAA 5FF9A 1ZSYA 5T5QA 4PGFA 3L6DA 1JA9A 2P2SA 5KVSA 1SZJG 3QP9A 1V9LA 4XZ3A 3GHYA 2PH3A 3HN2A 3QA9A 5EN4A 4F3YA 1B26A 1IY8A 4X54A 2HMWA 1MXFA 2QX7A 3D4NA 5F5LA 1YL5A 2JFFA 2I6TA 4ND5A 5TNXA 2FY8A 1BDBA 3UHAA 2AEFA 5CG1A 3LF1A 3AW9A 3JQBA 4H15A 2FWMX 1WDMA 3F4BA 4CMAA 1HZZA 3MCVA 4UREA 3U3XA 3DONA 1T2DA 3C7AA 3BXXA 3KB6A 5JAZA 4MINA 5CFZA 3G49A 4XJTA 2FSSA 4YRBA 5A9SB 2ZTVA 1NP3A 1K3TA 1U28A 1NQOA 3S1LA 3MWDB 5ICMA 4XA8A 3UCFA 1G0NA 1EEHA 1LDGA 4AFNA 2O3RA 1BWSA 3K2BA 4GLOA 4WCFA 1VJ0A 4J3FA 3VKUA 2B5VA 1AUPA 5FYDA 4XR9A 4L4SA 4F45A 2HRBA 4W9NA 1WWKA 3T7EA 5U1PA 2WYVA 2VOEA 4W4TA 3ZDFA 1OAAA 4OSOA 3F6YA 4BVAA 3WFIA 1F14A 2Y05A 1YJ8A 3ZU5A 5CAEA 2GPTA 5JYDA 1WVGA 4BGVA 3FPCA 4WEQA 3H9JA 2YDXA 4NU5A 3UKOA 4E2ZA 1S7CA 1M67A 3JYNA 1GQ2A 4GVLA 5H82A 2W2LA 4GGPA 2C20A 1ULSA 5IDYA 2CNBA 3OJFA 5AXDA 1VJTA 1UJMA 4QEDA 1IE3A 3FBTA 2H5LA 5JAMA 1U3VA 4XB2A 3NJ8A 3ZWOA 2XOXA 1Y1PA 4FFPA 1JVBA 3OECA 4C7KA 2YV2A 2I9PA 2VTEA 5G0UA 2WEKA 4R5HA 4AJ4A 3MJTA 4MP6A 1DRVA 1NM5A 1JQBA 5JBIA 4CLHA 3DOOA 1NVGA 3GG2A 1F8GA 1FDWA 1LSOA 1BVRA 1OFGA 4L76A 3RFVA 2BHLA 3QVSA 3OH8A 4NDNE 2DTXA 5FFFA 4AJIA 4B4UA 3DTYA 5G0TA 1V3UA 2CDBA 3KYDA 1ISMA 1NFRA 3TPCA 4D46A 3RBZA 1LLUA 3TNLA 5DNAA 1DIHA 2ZYDA 9LDBA 1LDYA 1LA2A 2AEMA 3CIFA 3PZRA 3H6KA 1UZMA 2Z5LA 3PRJA 3IC5A 4E5PA 2CVZA 3ETGA 1YDEA 3IUPA 1PJLA 5CDUA 1E3WA 3WGYA 2ILTA 1JKIA 2IEDA 3LLVA 3AUUA 2B4QA 3WTBA 1E3EA 3K6JA 5ER6A 3KEOA 1QMGA 2NU8A 2WE7A 2UVDA 4LISA 4XR4A 2EKPA 5DF1A 1UDCA 2QZ9A 5THKA 1E7YA 5L9AA 5JS6A 1CERA 1R37A 3BHMA 4MIEA 4J9VA 4ZQBA 2FPPA 2IZ0A 1GEGA
chains in the Genus database with same CATH superfamily
1RC0A 1Z22A 2DPGA 2X0DA 3IXMA 4YRFA 2EDAA 5TLSA 4K3UA 5IZCC 3FPJA 2VF7A 3ZXUB 5C4MA 1YQGA 2A1TS 3BAZA 1FPQA 4C88A 1E6LA 1L9XA 4BX9A 2J4DA 3B1YA 3P9XA 3HPQA 5JASA 3HI4A 4EITA 4DR2B 1L5KA 3AETA 3Q40A 3HHPA 2RKOA 1LX7A 5E2AA 4JUBA 1HYBA 5C80A 3U7EB 4YHBA 2Q1SA 4RELA 3UGKA 4PHHA 4DQUA 5BV2P 1I7SB 1XJ0A 4TL6A 2DR3A 4E32A 2UV8A 2EAUA 3WKBA 5A5DA 2QP3A 2RHHA 3KEQA 4PN3A 4LV5B 3USZA 1SR8A 3N39C 4YMHA 4C6SA 4BTLA 3OF5A 3ZVNA 5ED0A 3UA4A 1YIDA 3T3OA 3KJFA 1RLJA 2VT6A 221PA 1XCJA 5CT4A 5I9MA 4RMIA 1ORWA 3CUEF 2Z43A 1B8VA 1ND5A 4G1FA 4UU0A 4GW3A 4Y2SA 2V7PA 4UBIA 5EJ2A 4PC7A 1G5RA 2CZCA 3M5DA 1R4MB 4QOJA 3VR3D 4BRSA 2J5BA 2BH2A 4BKPA 2PZJA 2XMPA 4DJFC 4HYYA 5LD2B 1X8KA 2BGNA 3A1UA 4QE3A 4XVQA 1LVUA 1E5DA 3PFHA 5L45A 2XB6A 5B57C 2XCQA 4ZALA 4Q9DA 1MABA 1UEIA 4BASA 3FHOA 1L5SA 3FYUA 5ULLA 1XZQA 5IJ9A 2ZI3A 4B31A 2JB9A 3DDUA 1V71A 1FUYB 2IQ5A 1JGTA 4P3PA 3AM1A 2G4LA 1CUDA 4KN6A 5C8ZA 5DPMA 5K0SA 3CG0A 3FB4A 3E9EA 4TRNA 4YAEA 1XRLA 2BGGA 1K9VF 2D2FA 2QMEA 2XKAA 1NN5A 1JG2A 3EASA 1YRBA 1F7VA 1SC3A 3STYA 3FZGA 3I3OA 4TLBA 5I51A 2JVIA 1PDVA 2VXOA 4AI6A 3P71T 2RB5A 3DF9A 3KFXA 4IO1A 1L3BA 3IALA 2CL0X 4MW9A 3WR5A 4J7AA 4UFPA 2MWMA 1FIUA 1JL3A 1KMCA 2GRUA 1UBHS 4TLDA 4B71A 4EVSA 3OQOA 1LZKA 5ALGA 2GB4A 3JAWA 4M37A 2Y71A 1TM1E 2PUJA 1TMOA 4BCCA 3ZXYA 1R1DA 5IBRA 2F9FA 5H4GA 1EJ0A 2HHAA 1LW7A 2OKGA 2P9TA 5FQOA 4ER5A 2PSFA 2VWGA 2YJ6A 1TFRA 3E81A 3RS8A 1ODJA 3VR2D 4NEQA 1DELA 4X95A 4H16A 3W5UA 1QE3A 4MPJA 2OV6A 1SXGA 3MOSA 5J4HA 5JQWA 2OZEA 5FTWA 4NENB 1VE1A 5G4KA 1T1RA 2ZTMA 3COZA 4AM8A 3G5TA 4F3NA 3CT6A 1W88A 5JXGA 2EFEB 2Z3ZA 3UMCA 2VPIA 1UPTA 4IQFA 4X94A 3MIIA 2PE5A 4F3KA 3L05A 4QX6A 4FNOA 3I0NA 4AJ1A 5KBYA 1WF3A 1CQIB 4MW6A 1ZL0A 1FFGA 2DZDA 2OCBA 3P2JA 3RPEA 3INRA 1XDWA 1RJGA 5FNZA 1HLGA 1I5EA 3VPXA 1P5JA 4CV1A 3QITA 3ND9A 5REQA 2PTHA 3TR5A 4P54A 1JWLA 1N8KA 3GRYA 1QUFA 4PLHA 2OLKA 1OXXK 4FZ3A 1NNUA 2OO5A 4D4IA 5KWJA 1CUEA 3L46A 1YFJA 1F1BA 1HLPA 4XQ9A 4LPKA 3WICA 4MVJP 4CM9D 2ODTX 4M9XA 3QJ5A 3K2EA 2OBLA 4FHGA 1U65A 4OLAA 2K7FA 4PGGA 3EWNA 2YMLA 1EGMB 1FYWA 2C4KA 1Y5NA 3P4UA 3VSDA 3GJRA 1CRPA 4TKUB 1XE3A 3ZWBA 2OM6A 3FRJA 5C51B 4C4OA 5B2EA 4ODIA 3JQ7B 2VF5X 3A4YA 1UKBA 4KQ6A 5IDQA 1HZZC 2QB5A 3D8BA 4BLTA 4E51A 3CSSA 4I4NA 1SULA 3OBBA 3HSSA 3PTLA 4P35A 3OBIA 1IQUA 2B6NA 4RY9A 2R9VA 1SWWA 1AE1A 3PVSA 5F1KA 5L3SB 3KQHA 1IEXA 2DBZA 2EZ4A 4KWHA 1T9CA 3ZK9A 2KLHA 1QCDA 1I3LA 1ISSA 1K68A 1QNLA 2IUUA 1JFLA 3TLGA 3L4BA 1XTPA 4ZHQB 1C2TA 4Y2JA 3JQAD 4LCBA 4ZOLA 3GRAA 2PT6A 4ZTBA 3I2IA 3P9CA 1R6VA 1SCIA 2AQIA 2JIBA 4MGKR 4F4DA 3CG4A 1XHLA 1AKMA 1KQ3A 5CJJA 1PG2A 2I7XA 4MQFA 2OB1A 1HEIA 1KJWA 3HUDA 4TGLA 1WUHS 1XKLA 1CDDA 3O4VA 4YDQA 3JD1A 2ZDGA 3TRKA 1QR6A 1WBJB 4IIHA 3D64A 4S1NA 4N47A 3SSMA 3KZKA 1WSBA 4RHYA 1I32A 4WKCA 4IWXA 5C34B 5CA0F 3LDUA 1XO1A 1HDOA 2JIPA 4NAVA 4MVWA 2C4TA 4F1WA 1S8NA 1UM9B 1ZRHA 3UW1A 3AVPA 1L4UA 4KKVA 1MNQA 5JZVA 4A16A 2AXQA 2IIPA 4KU4A 1K88A 4YAJA 3ZCSA 3WZMA 4FLMA 2F4VB 3IAUA 3OIDA 1ZMOA 5EZYF 3H04A 1BMFD 4RV5A 5LWHA 1KOJA 3Q8LA 1MB2A 1C0EA 2H4YA 1PQ4A 1JYSA 1XJQA 3NHFA 2OXCA 1SU7A 4E09A 4IUCS 4Q37A 2GH1A 3UICA 2W2OA 2ZTHA 1GZ3A 1R64A 4BGEA 1PS8A 3LFUA 2QUKA 3SXJA 1E61A 2INGX 3DAHA 3WO1A 4CTMA 1WKBA 5I4CA 1YR7A 3IAM1 4BNIA 1L5ZA 2C2WA 2LGJA 5GQSA 1G5PA 5WRFA 1L4NA 1C81A 4HSGA 3CRW1 2ABWA 2QYOA 1MGOA 1A9OA 3THSA 3UXMA 2FW6A 5I3CA 1XC7A 3H5AA 3UOAB 3OVMA 4I1SA 1QQ7A 4JGIA 4QU5A 2V7XA 4R68A 1QRTA 3UAGA 4C4SA 4OH1A 2OZLB 4UD2A 3VYSB 3ZZ1A 1XDDA 2GYUA 3BGWA 1MVOA 2VEDA 1ND6A 4TX1A 2FLKA 5GP1A 1WW8A 3EB9A 3K6RA 2RHJA 1E0SA 3V2HA 2RCYA 1YH3A 1VYVA 2X3UA 3PT9A 3ULKA 1EBFA 3LPMA 4BAZA 3ZCPA 4BIIA 4CNBA 1KIMA 4DRYA 3OZFA 2YIDA 3R3WA 2BGKA 1OC2A 4R9VA 1JTEA 3OF2A 4RKRA 1E3TA 2ERCA 4QICA 4XWYA 5JG7A 5DO9A 1NX9A 1P1FA 2Y1CA 4YROA 4L50A 1OBFO 1D2CA 3ICPA 4EUSA 3CNLA 5TQ0B 3JWGA 1MIOB 1GPKA 3WP1B 1KO7A 3IDZA 5DVZA 3OTQA 3PUVA 4IW3B 3EVTA 1LLQA 2ZU6A 1PKEA 2AI1A 4IKPA 1QO0A 5SY4A 1E2HA 3UTDA 4BVKA 5BYKA 1SAYA 2R00A 2D5CA 3CLKA 5K0TA 1OSNA 3QFFA 4URVR 4A0QA 3TZQA 1UAAA 1LB1B 3GGPA 3CZAA 2IXDA 3OA2A 1RC8A 5D00A 1VDMA 2IIVA 4D1YA 1ZUNB 2QP4A 4HN2A 1TUIA 2I62A 3L1VA 4DG9A 4PC1A 3F8TA 3TDKA 5K6AA 3LOPA 4L57A 2IYEA 1RQ7A 4OMUA 1QFSA 3X2EA 2MINA 2WIGA 2XEDA 1KY5A 4LJ6A 4X65B 1DC8A 2CUTA 2HV8A 4BXOB 4U2FA 4JY7A 3QVGB 2BUCA 1QLHA 3ECCA 4ADSG 1MTZA 3VI4B 4DYDA 4ZOBA 2GLXA 1DEXA 3WMWA 4RZXA 2OP0A 3CNBA 3GLFE 3G8YA 2CT8A 4U0KA 2GILA 2P2YA 2ZPTX 5KDOA 1CS0A 2IXGA 2ARKA 4NHEA 1NKTA 2FZGA 2M98A 3BB1A 3VJRA 1RRMA 3OZSA 2D4HA 2VSOA 5FWYB 2WUGA 1HXHA 1KYQA 1VL6A 2FSVC 2FWPA 5JC1A 3BH7A 2I71A 1S0UA 4CEHA 1Y1KE 2QUHA 4HTAA 3VZPA 2X5XA 1IVYA 3A58B 1U1GA 3PNBA 1CY4A 1D5WA 1IBKB 3SQNA 1LW6E 1P2VA 2XDWA 3WBKA 3D3NA 3OY2A 3UW3A 4D4HA 2VHCA 2BFBA 4M1TA 4HMQA 3TJMA 2G4VA 1M6NA 4AZ3B 4ZREA 2ZJ7A 2R8XA 5E3JA 4EZBA 1KDTA 4O6VA 1O96B 2P69A 3LKBA 3PR3A 3HLYA 4DV6B 3B9PA 4NMMA 1DS6A 1JLSA 3IR5A 4NP6A 3ZIAA 4BQIA 3HACA 2NXNA 2JNWA 1KFCB 1NBMA 1UDXA 2CUZA 3IXQA 1EHYA 4BNVA 5C8XA 3KOOA 3EVNA 3EIUA 5M5BA 2X1VA 4J4TA 1L4FA 4OO3A 4BAUA 1FDVA 3HI6A 4I4TF 3DVRX 4KNVA 3AKDA 5I01A 1KK1A 1LC0A 3IDFA 4TV9F 3T8YA 1WUIS 4HDNB 1EBUA 1QIIA 5B4VA 1HNXB 1IFXA 5JADA 3AONB 3TOVA 1JEAA 3JQ8B 4R7GA 4IIJF 1N7GA 2YYZA 3ZDDA 1N0HA 1ZBDA 3R44A 1X77A 3FSEA 1WY7A 3RV3A 4R81A 3KU4A 4Y1RB 2XY4A 3DGEC 5DK4A 4HN4B 4U3JB 1L0BA 4F85A 2P1DA 4TXJA 1L3IA 1RYEA 2JLWA 3FKSA 5D7BA 5DULA 4D2IA 2IQIA 3URMA 3S2SA 3UFXA 5JVDA 1SXPA 2PEZA 1Q3TA 4IVPA 5JH7F 4AS2A 3D2CA 5BVGB 2IHBA 4F3TA 4UTVA 4FCCA 1WW2A 4HO1X 1C7JA 2JK0A 3MFYA 1RYDA 1NQTA 3LX6A 4KRGA 4LF9B 1UK7A 3EYAA 1ATZA 5AJHA 1QO7A 1NUPA 3FOEC 4FYXA 1J0AA 5EIBC 1XA3A 3HB0A 4G37A 2AHRA 4D25A 3G2LA 3I5YA 2EJVA 3DZFA 1RI4A 1FMFA 2BEJA 1ZXXA 1PR2A 1PV2A 3I39X 4K9MA 4P4TA 3H7AA 3HJUA 4P36A 2B7BA 1FFCA 3AHDA 1CUJA 4QDTA 2HO4A 2VP4A 2A5JA 1XZGA 1DBQA 2R6FA 3HZRA 4JDUA 2VF4X 3EQZA 3OE4A 3B7PA 3AKZA 1ZVQA 3LC7O 5CM2Z 3S2IA 4D41A 4CQNA 4LF8B 1QTNA 1A4UA 1Q2XA 2YHIB 3KSRA 3PC4A 4POOA 1WB9A 3OETA 3JYQA 1N7IA 2A0XA 2ZBPA 3HADA 1IQPA 2W37A 1YS9A 3ET4A 1H66A 3E3NA 2HNBA 4RVDA 4TWRA 3SZGA 4YREA 1IWBB 4BE7B 4LTDA 1HK7A 4OK3A 3CUKA 3AJ8A 2GJSA 2Q1YA 3N0RA 4TS9A 3E23A 4ASUA 1NR7A 2W0MA 3RARA 3S1SA 1BCSA 4BC1A 3K96A 3B6ZA 5ALOA 3E2MA 1MJNA 4V2IA 4RK6A 1RFLA 1LI7A 2BFMA 3FDIA 9MHTA 3IUMA 3TDNA 4TT3D 3KALA 1UPFA 4MUMA 2VHWA 4CFYA 1DVRA 2WJ3A 3E3MA 4R51A 5FUVA 1W47A 2ZI4A 4ZZ2A 1TT5B 5ELLA 3BFXA 4BOYA 2WHEA 5LB2A 1RZUA 4JYCA 1HDIA 5DJ5A 5ALUA 4BC0A 5AUNB 4LF5B 1MORA 2BFNA 3TXYA 1AJEA 1M6WA 3UV3A 5FULA 4L4RA 4BP9A 5IFKA 1NVUQ 3O4HA 2EDCA 1PG5A 3OE7A 2QAGB 4DDMA 3R75A 3M3HA 3EBPA 3H3FA 1KMHB 1UZUA 2PPLA 3F98A 3SYRA 3RUEA 5A4MS 2FCRA 4KYVA 4UHHA 3T6KA 1IUPA 3VPDA 2YZMA 1WS6A 3MB8A 4QPJC 1A8HA 4TS4A 4KPEC 4J75A 1CU1A 1DKLA 5FOWA 3HDQA 4I3FA 3T5TA 5K5EA 5KHLB 1T13A 2Y4NA 2BP7A 3HP7A 5FJIA 1S4QA 5MDHA 4GI1A 1OFTA 3DBIA 3HVUA 2GEUA 5KYGA 2FA9A 4CYMA 5CBPA 2IWHA 1ZWKA 1XZFA 2ZYSA 1DC4A 3SHVA 5FEMA 2B35A 4XYMA 2IX9A 4LG1A 1ITZA 3GRUA 3KZNA 3VU3A 5F7ZA 3HCPA 1Y9AA 3ND5A 4P38A 1AQIA 3LWBA 4U9UA 1SBCA 4FB5A 3GEGA 1LCIA 5D3MA 4J9UE 1DARA 3GJXC 1UBCA 1WNTA 2F3PA 1Z29A 4BRZA 1MVLA 1E7QA 1PZXA 3B5JA 3GRKA 3MIZA 2A9JA 4J43A 3OX2A 2CXSA 1T0PA 3LVQE 5FPHA 3OCJA 3WJ2A 1JJVA 4LZLA 4XQEA 1I6MA 3E61A 1E1DA 5K0CA 4AX8A 2BIFA 5KOYA 4FYMA 3CNQS 3GB9A 1XEFA 1XD8A 3EISA 4ARUA 1TTTA 2EZUA 5DNDA 1W7AA 3QNMA 2R5WA 2Y76A 3L1JA 4G9BA 5IVHA 3OZGA 4PEVA 3DBHA 1CUVA 1T4CA 2IS1A 1YKSA 1Q0TA 1JDBB 1PWZA 2QYHA 3T9AA 2L18A 3C7TA 4B6QA 4CIWA 4FNGA 3K92A 2F67A 1DLIA 5CYPA 3T7IA 2Q2WA 1BHQ1 1D8TA 4EPTA 4X8OA 1R5NA 5JCOA 1RXIA 2UUAB 4O29A 4GDMA 1AS3A 1W581 3OWXA 3M89A 4JI2B 2IIQA 2W6OA 3DL0A 3D31A 3LL4A 2C99A 1PBNA 2A0UA 1GLNA 3CXRA 4MGEA 2JIZD 3IT2A 2ZB2A 1KERA 5HK9A 1GQQA 4TYQA 2G5GX 2BWJA 3N75A 5AR1A 1ORDA 1J8FA 4O08A 5D6OA 1NATA 1Q6YA 4L15A 2GAOA 1F2DA 2HHCA 3EZYA 1MKYA 1R4MA 3GRZA 1NV8A 3ZGXA 1X0VA 5LLTA 3UJNA 1IM2A 1Z5OA 5FFNA 3SX2A 2KE5A 1H6BA 3R7WA 2BHSA 3PXGA 3D3QA 2H5EA 1YB5A 2V65A 1S4MA 4N3GA 2XSZA 3G6WA 4CF3A 4F96A 1XZPA 2Q1WA 4FIDA 5I6DA 4JUIA 4JLBA 4JC8A 4F84A 5JNWA 3W2EA 1FTWA 3WK5A 1E8DA 4LV8B 4ZVVA 1RZRA 4DDHA 3OFJA 2A9PA 1J2EA 3WXMA 4GLJA 2F8SA 4LWOA 3EZLA 4Q82A 4UVHA 2R6JA 5AOAA 2A5LA 5ALLA 421PA 3O9ZA 5DNCA 1OGYA 3AM3A 4AW9A 4C7OB 4G1MB 1P2DA 3U37A 4LF7B 1P18A 1N1DA 5A7FA 3HCBA 1GITA 1MJFA 4I3GA 2Q28A 3PZBA 3RD5A 1FUUA 3JWEA 4FYHA 3SEZA 3VHLB 3BJRA 1I2ZA 4H1VA 4R9RA 1P3DA 1ZSNA 4N54A 2P65A 5KEIA 1P61B 4JS0A 1MOPA 2V8BA 3GEDA 4DGSA 1F2TB 1FFHA 2QRVB 3G0DA 4YIHA 3GLQA 4HFRA 3BJIC 1GYPA 3IAS1 4B3DA 3ENKA 2TMKA 1N2GA 3MTEA 3OZBA 1GPWB 4HYQA 4LQCA 4CUJA 3A0UA 1VM6A 3EVCA 3Q85A 4H0CA 1YBMA 3V1UA 4AG5A 2IP4A 2PS3A 3BMQB 4BKOA 4ESOA 3KR2A 3QLVA 3P9SA 3GZJA 1H3FA 1P2UA 1SBNE 5L4LA 2ZJ8A 5CLGA 1TLFA 3TW6A 1D04A 2NO5A 3U3JA 2UUPA 2WY2D 2PS9A 3CVVA 3BD8A 2FFBA 2XVMA 2DJIA 2V0CA 5ANRB 1W8IA 1H22A 1N5KA 3F8WA 4TYPA 4XM0A 4EPXA 5C2JB 2H1HA 3G0GA 2HDNB 3RRXA 1SGWA 2HCFA 3EOBI 3NM5A 3VM6A 5T3UA 1JDZA 5A6VA 4M8IA 2P7IA 2PZKA 4O4HA 3W5BA 1EQAA 4BP1A 1Z08A 1P17A 4X8MA 1XB2A 4AKTA 4JN6B 4AY4A 4J8PA 2QPOA 3ZK8A 3PQ8A 5CDYA 3TQTA 3V8MA 3AH8A 4RS4A 4F8JA 4LBZA 2PX5A 4UVDA 4AAYA 4EB8A 3RVPA 3K20A 2C59A 4JJEA 4KAAA 3HYCA 3FB1A 2VYQA 4L3VA 2CNKA 3QWAA 3AUTA 5DI3B 4UM9B 2R6GA 4TZKA 3RRNA 2PWZA 3HYLA 3NEYA 5L53A 2OK7A 4TKUA 3VOSA 2B98A 1AHNA 2IOFA 3E82A 3N8GA 1TCCA 5DM0A 5CCDA 2PUWA 2FMFA 3FUUA 1X9HA 3GLHB 2C1XA 3L0IB 2O23A 4MEJA 5IEBA 4HLQB 1S9HA 2P6OA 4L9AA 4OXRA 3O3MB 3WSVA 2DXIA 3F74A 4M7WA 1VJGA 2HQRA 1MEEA 4JWTA 1W36D 1JHZA 2GFIA 5JC8A 4KTTE 2UDPA 1PT6A 5HOEA 5J43A 4F91B 1O03A 5EVJA 3K16A 1D6MA 1XTRA 4WKPA 1P4RA 3WB2A 3UKJA 4ZJYA 3P8ZA 2PCLA 4V1CI 2HU5A 1RHKA 4ZHQA 3P2KA 3VU1A 4D8YA 1N5IA 2JZCA 1ANKA 3AEXA 2UZ1A 5BV8A 3IKMB 1NC1A 2B3TA 2Y2UA 4QVKA 1PVOA 1XYYA 2BJVA 3AJEA 4UC0A 1D6SA 1NZDA 1RLMA 1PL7A 2XWSA 4CLOB 4CJXA 2P40A 1X86B 3DM5A 3K1JA 1CR0A 4UM7A 1KARA 2IXAA 2X8JA 2KWIA 2Q0QA 4Q12A 1DWUA 1FX0A 4QDXA 4DSUA 2C54A 3QVVA 2JJYA 2YYYA 3LWDA 2I6QA 4I55B 4TROA 3VPGA 3WC4A 1LXCA 3CF2A 3FPLA 3IBGA 3LI2A 4OKNA 1P31A 1KFBB 3BH6A 3M83A 4P2BA 1N77A 3GL9A 1FA9A 3EC7A 4GZ6A 1CIJA 2Q6OA 1BAPA 4RQTA 5SY9A 5BXYA 4ZVKA 1SUIA 3ADPA 3EXEB 1EK5A 4YAWA 2JCYA 4O2RA 5IMSA 2J3HA 4DDWA 1RYZA 2W2TA 1VG1A 3ILVA 1YULA 5FI1B 4WQMA 3VVMA 3WIDA 1QWSA 3DVSX 4EO4A 4RABA 5JAHA 3E27A 3UBTA 5AW3A 2VJQA 4KXFB 3SC6A 1KE1A 2XCOA 3IPXA 2ODQA 3FTDA 3K5PA 5LQCA 3U4QA 4LVNA 3WRXA 1T9KA 1W4BA 4TTIA 4TMZA 2GN4A 1CUUA 3L7MA 1JF8A 4K7JA 3VPHA 4ALJA 4DA7A 3TL6A 4FMCB 3WV5A 5CA0A 2HWYA 3R7LA 4AYXA 3SR3A 3I5XA 1JR2A 3BWDD 4C21A 1V95A 4Z4EA 5JAIA 3NNSA 3RLIA 4OQPA 2G77B 2Y93A 2XCRB 4OA8A 2KJQA 4DJAA 2JJ1A 1FK8A 3H2ZA 4IF6A 4Y9UA 2GS9A 1E2PA 2EZTA 3T95A 5IHPA 1K7SN 4HDKB 5EZYA 3EDQA 4H1TA 4WLUA 3HY3A 4CBVA 4YRKA 1WXQA 4RM2A 1G6OA 2P3QA 1J20A 3E1SA 3I1JA 4OYYA 3SFVA 3Q6NA 4QM7A 2BT4A 1JT2A 3DDNA 5CAEB 1T6NA 4RGQA 2IOYA 4YQYA 2FDCA 2CMDA 2MSEB 4ND8A 1I5RA 2I1LA 2JAOA 5E4TA 3M6XA 5HRCA 2NVOA 4D0SA 5TQ0A 4LQDA 2AKAB 1N2CB 2A3RA 1OX4B 2YNMA 3AINA 1IOWA 2KQUA 2CL6X 3DTVA 2P4SA 4H08A 4PLFA 4ZI2A 2ALJA 4RY2A 1YOBA 1M1XB 1XMSA 2DCMA 4P5DA 3QBJA 4ZC8A 1HI9A 4D3ZA 1X1TA 3FD8A 3AR3A 1D4AA 1NI5A 1CNEA 1G42A 2J1LA 4HATA 1BRMA 1NU6A 2H16A 1KR2A 3KIPA 4MMXB 1X7YA 2J32A 3EEYA 1MF7A 2ADOA 3EGOA 4Q03A 4UOZA 1X1AA 3NHMA 1DRJA 1GUYA 4OFBA 3KTAB 2Q9AA 4GSYA 4U7HA 4PRZA 2W6ID 5D86A 2PVSA 3P9NA 1ORHA 1SUWA 3E58A 5LQJA 4RMGA 4EB6A 3DE3X 5AM3A 3KWJA 2QVBA 2VJMA 3MFQA 3RJTA 3GP8A 3IX7A 5CDFA 4D02A 3QVGA 1U0TA 5KNLA 3NO4A 3OOWA 1KJNA 1M2JA 3SG0A 2EV9A 2BEVB 2JA1A 1XU9A 5FNVB 4YR7A 3CTMA 1GG8A 1O5TA 2GN0A 3PU6A 3OE5A 1E9SA 1NJSA 1DINA 4IQ8A 2NO7A 1YB1A 4B6JA 5KTPA 2GZ2A 4CIXA 3TO5A 1KSJA 2XXBA 2A5GA 2BE7A 1EESA 4OHVA 3PWKA 4OI0A 3IXLA 1X7HA 2ZE5A 4LYEA 2CLCX 4GP7A 5E7MA 2ZWPA 2QP9X 4G0YA 3FN4A 1A04A 3F1LA 1XZ8A 5CUQA 1ZD2P 2BDUA 3CX3A 4N8DA 2OYSA 2ZIUB 3OEHA 5F1YA 2F6RA 2R48A 3SNHA 5J58A 2ZLBA 4Z4FA 2QRNA 1HC7A 4HI0E 3RHSA 1UJNA 2VCHA 2J9YB 3AR4A 3TEFA 4Q16A 2X41A 4YJKA 1HA3A 1Z0DA 3O2JA 3VJLA 1XDBA 1Q91A 3EVBA 2ADFA 2ZBGA 3KZMA 4MQ5A 5IBCA 5A06A 1Q95A 3I6MA 3MD0A 3NJ4A 1PVDA 1QH9A 4ZAXA 3UYLA 5MN6A 3DT8A 1L5GB 5TF0A 1O0SA 5I4BA 4LVUA 3FFTA 4AVYA 3ZN2A 1SUSA 3IMGA 4JT8A 4QYXA 5JY1A 5FLEX 3TM4A 4I4IA 4GRIA 4EB0A 3D8SA 1NP6A 2VPXA 4FX2A 3KRTA 5AKIA 5GV8A 3SK0A 4BQFA 1UDAA 2FPPB 2GLTA 3ML1A 4IJ6A 4UJ3A 1AGRA 2X8LA 4XWGA 5DM2A 1BE6A 4EKYA 3NQ41 1O6GA 4IJVA 3LLUA 4NK4A 2JLRA 1DAPA 1D2RA 1T0JB 2H2HA 3JYOA 5IAOA 1HDEA 2PZMA 4KBFA 4JXKA 4Y1RA 2B3DA 5FTKA 3D8HA 3G2IA 4I50A 4GWGA 4NCXA 3FDJA 4DIDA 4IHKA 4KVGA 5TY0A 1W48A 1IZZA 3WYBA 1FP7A 4MVCA 2CBZA 4P5EA 3RTBA 5IM4F 1XUOA 3G0HA 3FPSA 4TSRA 1GPDG 1SWVA 3KZVA 4YJ2F 4YXWA 1PRYA 1A4XA 2HX1A 3RQSA 3ICOA 1JR3E 1CETA 4LRWA 5I7EA 5JT1A 1YOVA 1IB6A 3IVRA 4RSMA 2UZAA 1R0KA 3CURA 1S01A 2B1JA 2PYZA 3UJ3X 4IIJA 3BRWA 4F1JA 3W1VA 4J4BA 1VKRA 2ZSJA 4LY3A 3PIRA 2GTPA 3NW9A 1Y7LA 4HCJA 1CJVC 1DKRA 4IG9A 4EDFA 5ADUS 2V6GA 3JQFA 3PKZA 1MX9A 4MI3A 5BMVB 2BHNA 4WXYB 1WMEA 3EMBA 5DXAA 4ACBA 1YZVA 4ND1A 4HUJA 1VCNA 4R8LA 2OB2A 4PZDA 4B33A 2PMKA 4ER6A 1A76A 2VHTA 3O4IA 4YS6A 1QAQA 4KQMA 5JH7A 3RT1A 5AW0A 3I2HA 2NO4A 4C7XA 1T5SA 3AY0A 3VNAA 2DQKA 4P34A 4QOHA 1SMKA 2X9QA 1TZCA 4G5QA 4LHZA 5CJPA 5ADHA 6ABPA 1PG0A 2XYVA 2BVNA 1EJ2A 5P21A 3SQLA 4CG2A 5IEJA 4YBZA 2HW8A 4IMIB 3IP3A 4QYTA 1XRMA 3MTDA 5FP0A 5KC9A 1YBHA 1EMDA 3EVEA 3L84A 3EGEA 4PX9A 2FN9A 2ZFUA 1A7UA 2P75A 3Q2OA 1N4DA 3VAYA 2KB0A 2QBYB 1D0SA 2OCAA 4CFZA 2BUBA 2H1LA 1ZINA 2OESA 3ZS8A 1B8NA 5LA6F 3ZEAA 1IHDA 4ATNA 3WYEA 1P74A 1RXVA 3CNEA 4ISCA 1DTWA 5EL0A 4LOLA 1QAMA 4Y2RA 1JFVA 4IHJB 3GXOA 4FIZA 2DBYA 4L5IA 4F5YA 4IS2A 3TXXA 4BYGA 3F6SA 1JLRA 3F1KA 4Y6LA 1ZIOA 3H2KA 3HCCA 1ZXBA 1R8YA 3JRXA 3MSCA 4P7KA 3HXKA 2EEZA 4JR1A 1JG6A 1L6RA 2HU8A 1FTNA 4U2KA 1QFXA 4G5OA 4KMMA 1KQGA 5SYAA 4C08A 2GVDC 4S04A 1NONA 5KQMA 1K27A 4Y6QA 4CRWB 2ZVDA 4OVKA 4LI3X 2HY7A 2JHFA 2RARA 2X7JA 2YVAA 4UAGA 4BEJA 1NUUA 1HE5A 1T3ZA 2O3QA 2BGWA 3LVRE 3C4VA 1MUUA 3K9LA 4EMSA 3GC6A 1L7DA 4AJLA 2QMYA 3G68A 1T35A 5BPFA 2FX3A 3FKJA 4QOSA 5CYOA 3IB6A 3JZMA 3WRYC 1PWYE 3QTLA 1E6CA 4CG0A 1NVVQ 4Y2QA 3LS2A 4C4PA 1Z0ZA 5AW4A 1KMHA 1MG0A 1QK5A 4TTAA 1AUQA 3A11A 4RHXA 1FMJA 5IN4A 3AF2A 2OCPA 4TUYB 2NPOA 1E8NA 3ANNA 3WLTA 2FPIA 3B2NA 3UH1A 4KRFA 5JJLA 4Q0MA 2HK8A 1KZ1A 4L8GA 5E1MA 3G0BA 2Z6AA 3RC2A 4YRGA 1LC3A 3U80A 2HMYB 1STOA 2ISCA 1DQZA 3O8QB 4UTZA 5B58T 2OZPA 3HDJA 4N3NA 3CLSC 1GYRA 2JDIA 3QKUA 3AG5A 1MB3A 1ZH4A 1NASA 1SHJA 2Y1WA 3HB9A 4J3JA 4MVYA 4MA0A 5T3YA 1I10A 5EKUA 1DKOA 3DR3A 3RUPA 3DEAA 2OSVA 1MB4A 1UXGA 4GOJA 3P9QA 3OEEA 1JHOA 2R1TA 2BPOA 1YI8A 1GLGA 1FXSA 3B8EA 2H3HA 5FA5A 3LCMA 2CV2A 2HHJA 1W34A 3GNLA 4DLUA 3O93A 2DBRA 1D0IA 1FUKA 2X42A 4L85A 4RVFA 5CFRA 2ZREA 4EGAA 4MI9A 1UPCA 5J59A 1E62A 3RVLA 1P4HA 1Y8QA 2WM9B 5EZ5A 5EP3A 3TNYA 4EHIA 4DXAA 3ZIDA 1ZR2A 2X23A 3OIFA 1IJFA 1M74A 5CEEA 1KAQA 4URZR 3V8RA 3TJRA 3NIGB 2WB2A 1NOIA 1EDEA 3GUYA 4H0NA 3NWPA 3DC7A 2IYYA 3IOBA 1L4GA 1UWKA 1GNSA 1YB4A 1A27A 1G3QA 1H42A 4KPGA 1E5VA 1Z83A 2NSHA 5CLIA 5AJTA 1ISJA 3V55A 3RVMA 4Y1GA 4YQZA 1HFKA 2PGIA 2PX6A 1DMRA 2DWQA 2M6KA 2GHQA 3BRSA 2GA9A 4EKEA 1DDOA 2JGJA 1NYQA 3K53A 4FI3C 5BNWA 1NBOA 2BJWA 2ZJ0A 4QXAA 1IY0A 4JKOA 5KPDA 1XCPA 2QNRA 4MR9A 4QLOA 5TARA 4H6VA 1GCGA 4QIHA 4UNIA 5AVVA 3D6NB 2XQGA 3K32A 4M8NE 5EP1A 5EPEA 1PUJA 5A9SA 5M2QA 3UMMA 2P78A 4MW4A 2EP8A 5FB3A 1S2OA 2CD7A 3HYTA 3HWX1 3VC2A 1AB6A 4R1QA 4FP9A 4OIMA 3OX4A 3U2QA 5ES3A 4H4EA 4OQEA 2CLSA 4PSUA 1Q1EA 1QIEA 3MINB 3RYCA 1Z2OX 3UOWA 2NZYA 2A9KA 4YR9A 3ROPA 1XP5A 5BOVA 3JATA 1CX9B 1GEEA 3EN0A 4Q01A 4RZUA 4MQUA 3L3BA 4WFKA 4BO3A 3Q8KA 3UMJA 1R6BX 3ZVMA 4FCTA 4DCTA 1HKHA 4MV9A 2QUAA 1YBVA 2H00A 2WF8A 3MILA 5GJWC 2PMCA 4B7CA 3EQ6A 5JYCA 3ADCA 1QXSA 2FZEA 1GHTA 1B8UA 4FDVA 2BTQB 2GO7A 4KHZA 1Q1BA 4ZO4A 4F1KA 3FKSD 3TNJA 2H31A 4WXPA 4PS1A 2X4GA 2JLZA 3D8UA 4LZPA 4K9PA 4HNQA 4H60A 2XX3A 3L4KA 1FUIA 3FI0A 1RKUA 2I91A 2EKQA 4KPYA 3R40A 1DIAA 4JJGA 4M0KA 1CUBA 2WVJA 3LL7A 4C7OA 3RNOA 3KQSA 4KXMA 3WLEA 4GBMA 5TPZA 1KEPA 2IGTA 3WK7A 4PYOA 4BRUA 3G8DA 3UV6A 1AGPA 4TMFA 4JUDX 2E4UA 1KK3A 3I9V1 4JH0A 2QR5A 3RJ5A 1C29B 1FL9A 2DFDA 1CLUA 4KIWA 1IQ0A 5I8ZA 2JBAA 2QG6A 3L8HA 4B0OA 2UYCA 1I30A 2QGFA 3GP3A 1YL7A 3L8YA 3VNSA 3MS2A 4PLPA 5KUTA 5LP6B 1G8AA 5CGZA 2QL5A 2C5SA 2QRVA 1BXRB 3R3VA 4KQIA 5J4LA 3C8DA 4TQUS 1T8RA 3EEBA 4JBIA 3I6YA 3QHPA 3GJSA 4HUTA 1YRLA 2AFHB 3LO8A 1WDTA 3IULA 5K3BA 1HYGA 1LGYA 1Z68A 5FLKA 1O1YA 4PQGA 4URUR 2R44A 4A23A 3T4XA 2OE2A 4QQFA 5LOVB 3TQCA 1CQWA 9ABPA 1QTQA 2JL1A 1ZO8A 2D0DA 4V0MA 3UHFA 3QU7A 4ZMRA 1VG0B 4J0GA 1KBQA 1SJ9A 2E18A 2H17A 2LKDA 2R87A 3AI7A 3EGWA 1KKUA 3LFHA 3WFJA 1Y4DE 1NBIA 2I3ZA 4QSHA 4DL9A 1H69A 1XHFA 2XKBA 4P3NA 4OATA 4ASUD 1YQXA 4HGQA 2X2PA 4WN9B 5ILQA 5DGDA 2WFAA 4UVGA 2O7VA 2XKJE 1XD2B 2GD0A 4DNOA 4OI1A 1CE8B 2VBIA 4Q1BA 3SDSA 2ZJFA 1YDGA 4ZIRB 1MO2A 1C1YA 1UBSB 2DUJA 3O2NA 2WF5A 3DOHA 3QJGA 1BHSA 1HRDA 3VX4A 1ESZA 2ZUDA 4WFQA 1NC3A 1MZVA 2H4JA 5TX7A 2BN4A 1JTVA 2IYXA 4JJ6A 3NBUA 4MXDA 1PT8A 2FLWA 2RHTA 2MTBA 1FLDA 2JJ2D 3ENZA 2ZB3A 3AESA 3EMVA 4QELA 1SHUX 4A6XA 5KCZA 2IDZA 2Q7XA 1TCBA 2RK6A 2BBTA 4X90A 4DZRA 1B6TA 2YWEA 3QYJA 5CVDA 2GFHA 4JFAA 4UCFA 5FOUA 3RVOA 3REGA 2CL7X 3TQOA 3OE7D 4GFDA 4QYWA 2QQ5A 1VMEA 1T15A 4N65A 5IJAA 4NEHB 3H9BA 5DB4A 6NULA 5EUMA 1NXOA 1RWOA 5ILOA 1P5FA 4MVJI 3DNPA 4D9FA 2B1GA 2QTTA 3QX8A 4BGUA 5H8WA 3HDGA 5EJ7A 2XB8A 1E3IA 3WWYA 1IWPB 4IXWA 1PW7A 1MVNA 4MMZB 2OQRA 2EBWA 2EJUA 3RC8A 2IXFA 2OAEA 4KUHA 2CVPA 3ZHYA 5I7HA 2XXAB 2Q3MA 3KFLA 1J5PA 2AC4A 4FDTA 1H9BA 2EQ5A 2ZYRA 4BB9A 2KW5A 2GF2A 1LNQA 3BMOB 1RW4A 4X60A 4HGPA 1F4LA 3HGTA 2YOGA 4P7FA 3VZQA 4RKFA 1SELA 4WOKA 5AVTA 5ALWA 3ZE2B 1P1IA 4YPOA 2WKRA 4FJ0A 5HF8A 4NCNA 1YMQA 3EYWA 4R1MA 5F9HA 1SB8A 1VPEA 3EQ8A 2F3QA 4KOAA 4MKIA 1Y1LA 4BLSA 2I2FA 4WKOA 3NTXA 5LJIA 1JLLA 2VNKA 4NCHA 1UT5A 3EXEA 3NTQA 4NBTA 4P0TA 5CT6A 2TMYA 4AZVA 5JWHA 1GTJ1 1NW9B 4EARA 4ZK6A 4C03A 1Q7TA 2ZOSA 4MUJA 1B3BA 3LBAA 4MUHA 3D59A 1ZMXA 2CF6A 3ILSA 1FFEA 3IEIA 1B93A 1NOKA 3NIFB 2BF4A 2B37A 1Z4IA 4GXQA 1XU4A 3PGA1 3AGPA 4K1LA 1PWEA 5HQTA 1B14A 2WZQA 3G0CA 2JH8A 4FYKA 3TZBA 1T3SA 1Q7CA 3E6AA 1UBEA 1LJLA 3G0IA 3L77A 2FOIA 4FD3A 1GSHA 2GNAA 3OTGA 1CNFA 5AI4A 4UXHA 2L17A 4QFDA 1LZLA 1XQYA 3FVWA 4MR7B 5AYVA 4LEIA 1IG3A 1BJTA 1GGMA 2X2EA 2XUJA 2GHTA 3AJRA 3E84A 4FXOA 3VDRA 1Q0LA 2Q27A 4PZZA 3VMFA 2YOHA 5TGZA 2NADA 1YVPA 4V03A 3FSRA 5J2TA 3QF4A 4IIEA 5EEGA 2EBUA 3AFIA 4HDKA 3RBXA 1EUQA 1GYQA 1XXHB 5G0VA 5IF3A 1HORA 3PXXA 4D9EA 2YX1A 5J5AA 4LMPA 3K0FA 3GCDA 4Y6OA 3ZH9B 1NBHA 1TZBA 4OYHA 2G7MC 3HJAA 4DLNA 4CF7A 1FP6A 3RIEA 4MGIR 4NCKA 3MGGA 2XV1A 2TMDA 3F2IA 2GK6A 1ZU5A 4MPPA 5F51A 3RVJA 1V5FA 4B46A 3KTDA 5CFOA 1OVGA 1H0HA 2WJZB 3ZWVA 2R0QC 1Z4NA 1JZSA 3NEPX 4RU1A 1CJMA 1HE2A 1GDTA 4UE6A 3EH2A 1Y89A 1OX4A 1KR5A 4II7A 4XUCA 2I2XB 5IC6A 5KREA 1VE9A 4TMYA 2DRIA 2RGNC 4DDTA 1TM5E 4M88A 3PFIA 2GCNA 1ZSVA 4HAVA 3CM0A 1XZHA 3VR5H 4CF5A 4ZEOA 4DRZA 4WTOA 3TG2A 2IOFK 2XCSB 1UZLA 1VP3A 1K1EA 1UBTS 4TL8A 4B1FA 4M9UA 3A6EA 4D4JA 2GYWA 3GDFA 4DKJA 2WJ4A 1XA0A 3KXKA 4YH1A 2IYUA 3LSYA 1OFVA 2JLXA 2NQ8A 1XVUA 2VUIB 1KDOA 1O4VA 1FYDA 2SKCA 3VZRA 2A30A 2F3RA 4FX5A 3BZWA 4Y9DA 4LDRA 3B60A 1WW3A 3EC2A 2IU4A 2J6IA 2PNFA 5ESXA 4YPVA 4J91A 1GILA 5AHRA 3R2JA 3VR0A 4JWKA 1JQKA 3ASZA 5AM5A 1Z26A 2NG1A 3JWPA 1P7CA 1FLAA