4URFA

Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
248
structure length
248
Chain Sequence
MLLEGKTALVTGAGNGIGRTIALTYAAEGANVVVSDISDEWGRETLALIEGKGGKAVFQHADTAHPEDHDELIAAAKRAFGRLDIACNNAGISGEFTPTAETTDAQWQRVIGINLSGVFYGVRAQIRAMLETGGGAIVNISSIAGQIGIEGITPYTAAKHGVVGLTKTVAWEYGSKGIRINSVGPAFINTTLVQNVPLETRRQLEQMHALRRLGETEEVANLVAWLSSDKASFVTGSYYAVDGGYLAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLOHEXANOL DEHYDROGENASE
publication title Molecular Genetic and Crystal Structural Analysis of 1-(4-Hydroxyphenyl)-Ethanol Dehydrogenase from 'Aromatoleum Aromaticum' Ebn1.
pubmed doi rcsb
source organism Aromatoleum aromaticum ebn1
molecule tags Oxidoreductase
total genus 99
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 1.1.1.311: (S)-1-phenylethanol dehydrogenase.
pdb deposition date 2014-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4urfA00
4YYZA 4RJTA 2GCGA 3QA9A 5L4NA 2FPIA 4BNIA 1WAMA 1NPDA 2C0CA 1OBFO 4XJSA 3OHSX 2AEMA 2GUGA 1XDWA 3DBHA 5TT1A 4BNWA 4KZPA 2CY0A 2ZJ1A 1I01A 4Q3BA 1CQJA 3KEOA 3NRCA 1YBMA 4YT4A 3N58A 2HAEA 4KDFA 4RZHA 1E6EA 3ONEA 4TRNA 2IXBA 2J3KA 2VYNA 3D4OA 4N5NA 1PQPA 4RVDA 1R66A 1A7AA 3ZU4A 1ZSYA 3AK4A 1Y5RA 1XU9A 3C3XA 4IPTA 3G17A 5GMOA 2FR1A 3HDJA 3JQDA 1ISMA 2Z1MA 1KVSA 2Y1EA 1YVEI 5THKA 3PK0A 3JQAA 5L51A 2C7VA 4XRRA 4GKBA 3DAFA 3FRJA 1TI7A 4Y8VA 3ZV3A 3FBGA 4YRAA 1D7OA 1PGNA 1DC6A 3FWZA 1BTOA 4OH1A 1VL8A 1E6WA 1M2WA 1ADGA 5L4SA 4AJPA 3E5RA 3EY4A 4LGVA 2X4GA 4IQ0A 4CM3A 4AVYA 2VWGA 1EQ2A 2NNLD 4CM5A 2X86A 2GSDA 2OORA 5AYVA 4GGPA 3P7MA 4DMLA 3QY9A 4KDEA 3ETGA 4IINA 2DVMA 5BSFA 5A03A 3WG9A 4K28A 4ZQGA 2LDXA 3WLEA 2BFMA 4JK3A 3GNSA 3WNQA 3C7AA 5CPBA 2P5YA 1JVBA 4NJMB 3JD0A 3IIEA 1GCOA 2CVQA 4LISA 4LW8A 2CDAA 2WTBA 1LNQA 4BL5A 1AUPA 3QIVA 2AA3A 2P68A 5F1KA 3ZWBA 3ST7A 3T7CA 1N7HA 3IDSA 4YAIA 2EWMA 4OQYA 3DC2A 1WPQA 1XEAA 4Q39A 1I5RA 4CL8A 3BMQB 2Z1NA 3O8QA 4J7XA 5JCXA 3ANMA 2NUAA 4XR4A 5C7LO 5TT0A 3F3SA 3VDRA 4F45A 1PS8A 2GDZA 3GUCA 4W9NA 1T24A 3RU9A 3DZJA 4FFOA 1DIBA 4EI2A 5LC1A 3PXXA 4HADA 3E18A 5C37A 1YQGA 2R2GA 2DBRA 5B4UA 5A3VA 3NT5A 4E2XA 4MDHA 4BNFA 2ZQZA 4R51A 4XIJA 4YQYA 4R1NA 3I9OA 3ROQA 3NGLA 3WGIA 1OMOA 1TA4A 4RPKA 3RUIA 3WQQA 4MIEA 1P1KA 1LLDA 1E1NA 1DLJA 2UUOA 3A9WA 4AJIA 4DVJA 4LVUA 2FZWA 4BO3A 2CVZA 4XKJA 4J4BA 3WQRA 2EF1A 1UZLA 3AFMA 1NAHA 5EINA 2D3TA 5HM8A 4I5FA 4YRBA 2E37A 1XHLA 1WNTA 1EFLA 4NQZA 1BSVA 2O7SA 4CM6A 1I3NA 3PYXA 4NPCA 1Y5MA 4DYDA 4MKRA 2FOIA 3ZWAA 2C5EA 1DIAA 3V1TC 4AJOA 3FNFA 4JJGA 2GN8A 5DBIA 6ADHA 3AJRA 5DCYA 2EG9A 2YY7A 4ONEA 5L9AA 1UZNA 3PHLA 3EW7A 2P9GA 2VTEA 3VZSA 2PKRA 3VTZA 4F6CA 3S2IA 1LRJA 4H3VA 5DF1A 2PZLA 3L9XA 4WOKA 2A9FA 1Y6JA 5A05A 4DBVO 3OEYA 4QX6A 3ZH2A 4E5KA 2TMDA 5IZCA 2NTNA 1LQUA 4MPDA 4U6SA 3VPGA 1QYWA 4G5HA 3L4SO 4M8SA 3G3EA 3BYZA 2O4UX 3HNPA 3KSDO 5HS6A 3LLVA 2RH8A 5A3JA 3RFTA 3C85A 3OFSA 5IFLA 3W4JA 3PFWO 4PG4A 1EFKA 1C1XB 2X9VA 1KIFA 3I9JA 3RBXA 2NVUB 4QTZA 7MDHA 4BV9A 3W4IA 5CHEA 1CERA 4ND4A 4GKVA 4IUYA 1N5DA 1WW8A 2IDZA 3PHGA 4WCFA 4EYEA 2VUUA 3ADOA 3Q11A 3DEYX 4II2A 5I8WA 3WDSA 5JBIA 3GH3A 3W6UA 1I2ZA 2DT5A 3WFJA 3GAFA 1ADBA 5ILOA 4XJTA 1Q0LA 3AOGA 3DBLA 1R0SA 2W2KA 3EYWA 1LC0A 5HBRA 3SLKA 1ZJYA 4AJNA 4G65A 3ZWYA 4AG3A 2P4QA 5I9LA 4PRKA 3WB9A 3JQEA 2ET6A 1D3AA 4CM8A 1E3SA 3G1UA 2VHYA 1YL5A 1SO8A 1SB9A 1J4AA 3CE6A 3KLMX 3P2YA 3VTFA 1H2HA 2IEDA 3I23A 5A5EA 3DQPA 4PG5A 1C0KA 2CDCA 3HJAA 2PH3A 4YA6A 3WMXA 1ISIA 2OXIA 4EUHA 1I3KA 3MTGA 3NUGA 4UUNA 1ZO8A 4TZKA 1CWUA 1HE2A 1OOEA 3KHUA 4DC1A 1OAAA 3PP8A 1ZK1A 1DHTA 1P31A 3CTMA 5HS4A 3EK2A 2FSVA 2VHWA 3C8MA 2W2LA 4TRMA 3AM4A 3H5RA 1GAEO 1UZMA 3OQBA 2QIOA 3MJ4A 3GQVA 5G4KB 5B1YA 1ARZA 2ZB7A 3QJ5A 3PIIA 1NVGA 1O94A 3N74A 1QYXA 5JDCA 5DBFA 3SLGA 1I3MA 2BRUA 1U3UA 2HSDA 4YRDA 3DWFA 2FY8A 3GG2A 4YQZA 1G0NA 5TQVA 4CMIA 1Z45A 2HK9A 5GZ6A 1ZEMA 2OBYA 1E7WA 4ITUA 3NTOA 3W6ZA 3WXBA 1ORRA 1V6AA 3MWEB 2FR8A 4E6PA 1V3UA 1ZCJA 4DYVA 4XGKA 1RWBA 3OETA 2WWRA 4XQCA 1VL6A 3QWAA 5DCWA 3IJPA 4B7CA 2BFAA 1SZJG 4BVAA 4DPMA 3NKLA 1GPDG 1LQTA 2CUKA 3EAGA 1ZKMA 2EIHA 1BVRA 1AGNA 4DREA 3RKUA 1FDVA 1LA2A 3ZWMA 1M75A 1E3WB 3ASVA 1P3DA 5DOVA 4DQUA 3NDJA 1BMDA 1NQOA 1ZW1A 5ER6A 3VZPA 4ALNA 4S1VA 2NQTA 1EBUA 1XYGA 1XU7A 1SOVA 1BW9B 2GYYA 3DMYA 2FR0A 3BMOB 2CSUA 3WBFA 4NIMA 4WPGA 3VKVA 1DB3A 4QFCA 1ZMOA 1IOLA 2POQX 4R5MA 4CLRB 1W0CA 2Y1GA 5COAA 5IJZA 2R00C 3I9MA 1D1TA 3OM9A 4P22A 1I10A 3DO5A 2EP5A 5BSGA 2V6FA 2EHDA 3V2UA 3LT2A 4GL4A 4M54A 5A9RA 3FI9A 4CM4B 3ZNNA 2AW5A 4FJ2A 3TL3A 3OJOA 5JO0A 1HE5A 2F1KA 3TN7A 4F3YA 4P4NA 5TNXA 1MC4A 4AJ2A 3GVIA 5CFZA 2D5AA 1Y7TA 2FZEA 2QG4A 5TJ9A 4II3A 4YJHB 4E33A 2H1SA 3TRIA 1UXJA 2QYSA 3K92A 4MVJD 3P19A 3GEDA 1GZ3A 5KJ1A 2CDBA 2HU2A 4XYGA 3AW9A 4CUKA 4PG8A 4E5YA 3D3WB 4FDAA 4UEJA 2I5PO 1XR3A 5G0VA 3DBRA 1WWKA 4ZGWA 1I2CA 1KS9A 1CIVA 5FI5A 1M6HA 5I7VA 4ROSA 3WYBA 4ZU3A 3RI3A 1B7GO 1K2WA 1PJCA 1T2AA 3WGGA 5B4TA 4BNKA 1JN0A 4E5MA 1LDYA 2E6UX 3HB5X 3AI1A 1H6AA 1PEDA 1PGJA 1HRDA 3S2GA 3D0OA 2B36A 1GV1A 2ZIZA 3JQ7B 4PN3A 3FNEA 1L7DA 4B7XA 5EL0A 3RUHA 4Y67A 3TFOA 5IAAA 3F46A 4J16A 1LBEA 5KVSA 4M86A 4A73A 1KBZA 2HLPA 4QECA 4U7WA 4DIOA 1T2DA 4YWJA 1SNYA 1YBVA 3M1LA 3F5SA 4CLOB 4GX1A 3GAZA 1NQTA 5T67A 3GY0A 4CJXA 1H5QA 1DSSG 4GX0A 1PL6A 3RC7A 2VYVD 3KO8A 2J5KA 2X9GA 3MCVA 4HV4A 3DL2A 1NFRA 4L8VA 1DFGA 1P1IA 1Y8QB 3AY6A 4XGNA 1NAIA 2J3HA 5K0ZA 3GLQA 4PLVA 3RUCA 4B4WA 3FHLA 4CQLA 3V5NA 3FTNA 3AUTA 2CFCA 1BG6A 2Q4EA 4WLVA 1PJ2A 2J5RA 3ENKA 1VJ0A 2HKIA 1XKQA 3PDJA 1SCUA 2PK3A 4BOYA 3Q3CA 3IS3A 2JAHA 4CM9D 3TNLA 1C3VA 1HKUA 2V6GA 1YBAA 2A4KA 2O3JA 4L73A 2ZYAA 4BO4A 4OKIA 4AJJA 4AJ4A 1P9LA 4PLHA 1PSDA 1W4ZA 2GN9A 4HFJA 4R41A 5A9SB 1VI2A 1TT5A 4NBVA 2X23A 3PHIA 4YT2A 3A06A 2DPHA 1I24A 4IQGA 1HDRA 5BSHA 4AJLA 4B8WA 4MP8A 1DDOA 2PD3A 2UDPA 1FDTA 4JJFA 4L74A 4F6LA 1U4OA 2WEKA 3GUYA 4FQ8A 4O5OA 5B12A 1MG5A 4A26A 2HCTA 1PWZA 4WNCA 1EUZA 1O9BA 3WOHA 3PWZA 5JC8A 1N2SA 4X54A 5HRUA 3WGYA 3HB4X 2X58A 1DC3A 4R9SA 4TRJA 5DULA 4ALIA 4NMHA 3IMFA 4MINA 4NHEA 3KYDB 1MV8A 3UGKA 1P74A 4J2OA 4XEHA 2C5AA 1KETA 1QYVA 2I99A 6LDHA 3H2ZA 3TZKA 4UUMA 5L7WA 1DIHA 1V0JA 3V1UA 4L9RA 1ML3A 3SEFA 5U1PA 3B1JA 1K6XA 4QT0A 2WSBA 3WX0A 2Y1OA 2I66A 5DP2A 1M66A 2I6TA 4XR9A 3GPDG 1N9GB 4YVFA 4F46A 3ICPA 4N5MA 3RROA 4U0KA 3NEPX 4Q3DA 1NHWA 1XIVA 2I67A 4CR6A 4DA9A 4YR9A 5IF3A 3B1KA 3TZ6A 2B5WA 2EW2A 4L76A 4RORA 1B15A 4KOAA 3LK7A 3VH3A 4R3WA 4CV2A 3ZHZA 2JKVA 3CMCO 1U7TA 1BDMA 1UAYA 1FK8A 2IEBA 3BTVA 4EGFA 4J1NA 4YJGA 4CMEC 1H9BA 3Q2IA 4BNZA 1XCBA 1PZEA 3G49A 4A10A 1O89A 2E4AA 1VE9A 3E9QA 4XIYA 2YZ7A 5DZSA 1OFGA 3SC6A 1JU9A 2J3IA 2WYUA 3AY7A 3H5AA 4GH5A 3ZN2A 4FN4A 5KKAA 3PGJA 2GPTA 3BMNB 4EUFA 1UDAA 4EJ6A 4MVJM 3L6DA 5JE8A 3B1FA 3WGHA 3OQ6A 2OHXA 5AXCA 3WIDA 3RC1A 2IYOA 3MJTA 3FN4A 4G81A 3PHJA 2NLOA 3PWKA 4RPGA 4M1QA 1BXKA 4UUPA 1N1EA 2J5QA 1PR9A 4OL9A 4B7UA 4E12A 3L77A 2GF2A 1HDZA 4EITA 1DXYA 2AG5A 1R37A 2P91A 2RCYA 1WDKA 2O3RA 3U4IA 4EEZA 1U5AA 1C1DA 2P9CA 1HLPA 1H0KA 9LDTA 1JW9B 2YDXA 2VHXA 5KWEA 3S1LA 1WZIA 3A4VA 1GPJA 3JQCA 3S8MA 3GOHA 3TSCA 4FIZA 4B3JA 4G2NA 4HP8A 3NYWA 3H9UA 3Q2KA 1QXSA 1SEVA 3DHNA 3F4LA 4IDFA 3A14A 3DOCA 4K6CA 2I3GA 2RBEA 3PDUA 2W4QA 2R00A 5F1PA 4NBRA 5JAMA 3R3JA 4FBGA 3EZYA 1TEHA 4NR0A 4Z6KA 1AHIA 1JKIA 3U9LA 4RGBA 4TROA 5A02A 1ZUD1 1S7CA 3COSA 3E1KA 3FPCA 1YB1A 2IZ1A 4Q3EA 1LLCA 1YB5A 4Z9YA 4A5OA 1DIGA 1D8AA 5EMHA 5T57A 4BKUA 1LEHA 8LDHA 4E13A 1EVZA 3H9JA 4KTVE 1GZ4A 2H63A 5DBGA 3NJ8A 1PJTA 5CPFA 4DC0A 4CM1A 2Y05A 2WD8A 4LK3A 3C1AA 2J6IA 1CRWG 1I2BA 2VRBA 2DUUA 2Q2QA 4RO0A 4CLXA 4KUHA 4CMGA 2NU7A 1YL6A 5KJ6A 5TX7A 3UH1A 4RF2A 3X2FA 3LYLA 3NDIA 3U49A 1ADCA 3EDMA 1LLUA 1GEGA 3HN7A 4U8GA 4GX5A 1X0XA 3H9GA 4BQRA 1DBVO 1QR6A 1G0OA 4NU6A 4IGFA 1HLDA 2DTDA 3BXXA 3OIFA 3T4XA 1GU7A 3UCXA 1JAYA 3P2OA 1E7RA 2O4CA 3CPSA 3PWSA 1H9AA 3KYCA 2C2XA 3GGGA 5ICMA 2D4AA 4RPLA 3WYCA 3RBZA 2CD9A 2Y1CA 4GLLA 4URFA 2HJSA 1CETA 3D3EA 2I3AA 1Q7CA 1MFPA 1VLLA 1ZK4A 2BH9A 4DMMA 5T64A 5CG1A 4J6FA 5F5NA 4HNGA 4JXKA 2X0RA 1KC3A 5DDIP 3M2TA 4M55A 1N1GA 4DPLA 1GUFA 4PLTA 2Q45A 4AFNA 3CH6A 3PHHA 3VVBA 4BS9A 4CUJA 4E2ZA 2YHIA 3U3XA 2JHFA 4UREA 1Y9EA 3PRJA 4TRRA 4XB1A 4DLBA 4J49A 4CM7A 4MVJH 1HSOA 1X7DA 2RH4A 3QWIA 3ZI0A 1QRRA 5IDWA 4ZD6A 1LUAA 2PKQO 4WASA 1Q7GA 4Y6SA 3JYPA 5COQA 1HTBA 2NU6A 1YJQA 4RVSA 4IM7A 1QYCA 2B0JA 4NI5A 2DBVO 3CKYA 2CMDA 3LT0A 2A92A 1KEUA 3RAJA 4B3HA 4MOWA 3GT0A 4RQTA 4HFRA 3QWBA 2GASA 2AG8A 1DJQA 1ZH8A 2DPGA 3DZIA 3PQDA 1RYDA 3DTTA 3FF4A 4JBIA 3QVWA 3W4KA 4FOSA 4HUJA 4E5NA 3ETDA 2O2YA 3RFXA 3NT4A 3QVSA 4D3FA 3RSHA 4WCDA 4CQMA 5F1OA 1R4NB 2VZ0A 1CF2O 1BHSA 2HDHA 4FSHA 1X7HA 1U3TA 2ZCVA 1PU2A 2NVBA 4R3NA 3ON5A 4I8XA 1ENYA 3WBBA 5TLSA 3JQFC 4CMBA 4RVHA 1P33A 1ZXBA 3H4VA 3TZHA 4R5HA 1U2DA 2J8ZA 3I9LA 2QW8A 1KEVA 1ZJZA 2YV3A 2JCVA 5KNLA 3RD5A 4U0JA 3V2GA 1YJ8A 4ZJUA 4JQCA 4A0SA 3VVCA 1IULA 4B79A 1BXGA 1YOVB 2VWPA 2PZKA 2JD1A 3D5QA 3I9KA 4WECA 3H3JA 5JYEA 3BMCB 5AVOA 2HMUA 1A71A 4ND5A 4YAKA 2B5VA 1ZEJA 3TF5A 4BO9A 2X9NA 4EZBA 3UICA 2H6EA 1SAYA 4NDNE 1PX0A 4ALJA 1U28A 4XYMA 2NV6A 4BO5A 3DDNA 3NAQA 1IB6A 3VPHA 2J3JA 3OP4A 5H81A 1IPFA 3QP9A 4WNIA 2HRZA 4PLCA 5I7EA 1NVTA 3PPIA 3GHHA 4I9NA 1DFHA 3ZWXA 3DBHB 5TRTA 2PY6A 4B8ZA 2ZB8A 3L07A 5ES3A 2Y67A 4Q3CA 1LSJA 4CMEA 2IODA 4CMJA 4OHUA 1B3RA 2XXBA 3DMTC 3VPXA 5IXYA 3S2EA 2PZJA 3IAHA 2VUTA 4Q9NA 3L0DA 1WMBA 2ZTVA 4HBGA 1UP4A 3I52A 4BGVA 1NPTO 3OA0A 4A7PA 1MA0A 1LRKA 4J4HA 1GCUA 3BHIA 3JQ8A 3EVTA 3R6DA 2AE2A 4IDEA 4R54A 3JQAB 3ZNQA 3PTZA 4ALKA 3H9EO 2YQ5A 3PZRA 3V8BA 2WJPA 3UXYA 2UV8A 4JNKA 2WE8A 2IYPA 1H6CA 5FWNA 3ZZNA 1U8XX 1HZZA 3AI3A 1MXFA 1H6BA 2PD4A 1SPXA 1U3VA 4IZIA 5A4DA 5JY6A 1DHRA 2ZTUA 4WKGA 2GERA 2Q2VA 1U9JA 1WDMA 4IJUA 4K26A 5ILGA 1GADO 3AOEC 4NBWA 2QYTA 1EDZA 4Z0PA 2V6BA 1LX6A 3KSUA 4RPHA 4PLYA 3GG9A 3S55A 3ORFA 3PYLA 4NK4A 2Y0EA 1V3TA 4FPXA 2PTGA 5THQA 3GVCA 3BIOA 2GRAA 5CDYA 5LDGA 4MVJE 3CXRA 2VRCA 3AM5A 2X7HA 3DZKA 5TIIA 1R0LA 1G6KA 4K6FA 5LDHA 3GMDA 1P0CA 3FTPA 3UCFA 4I5GA 1W6UA 1UP7A 3M2PA 2Q1SA 4UVDA 4WLFA 4YPOA 3E9MA 4FW8A 3OA2A 1UR5A 1NR1A 1V9LA 3GDGA 4YTEA 2NVWA 3O8QB 3PYMA 3UN1A 1GYRA 1VJTA 3QHAA 3I6QA 3HDYA 2FWMX 4GPD1 1H93A 4TZTA 4IMPA 1T26A 1QV6A 1P1FA 1UAGA 3OIGA 3BZUA 2VUSA 4IMRA 3KYBA 1KEPA 4BGIA 1HYGA 3IOYA 1GZ6A 3ZV4A 4H7PA 3NJ4A 4ND3A 3EHEA 3OJ0A 1ENZA 2BGMA 3K5PA 2BI7A 2B4TO 3LF2A 3A1NA 3F4BA 5AQ1A 2BGLA 4BNHA 4I5EA 3WJAA 4CLDA 1VPDA 4KQXA 1HE4A 1YE3A 3HE3A 4W82A 3RUEA 5HWSA 4E30A 2X0JA 1ISJA 2O3TA 3INTA 1NR7A 4MVJI 4R01A 5GY7A 1D1SA 1YL7A 3ZCXA 2Y0DA 1ZSNA 3I4FA 3HN2A 1E3LA 1Z7BA 3FR8A 4A03A 1K89A 2VWHA 1KERA 3E48A 3VH2A 3OIDA 3QV1A 2GZ2A 4N18A 5CEJA 4FJ0A 1YRLA 3FPLA 4IS3A 1E7QA 5K6AC 2NTVA 2AEFA 1GEEA 4RF3A 3GFGA 2B69A 4E31A 2AQIA 4MVJP 1YKFA 4BGEA 4PLPA 4IDAA 3RC9A 1S6YA 3UHAA 3PJEA 4ZICA 5IG2A 2A35A 3DOOA 2ZCUA 3GEMA 1F14A 1ULUA 3CEAA 3TZQA 1Z73A 4OQZA 4BB6A 4D44A 1OI7A 4EEXA 3AUUA 2BD0A 5JY1A 4YCAA 5JCJD 1TVEA 2WD7A 2QZ9A 4TSKA 4EDFA 4RZIA 2IZ0A 1NFQA 4FFMA 4CV3A 3GEGA 3D1LA 1UXHA 3VPSA 4UVIA 1UP6A 4ESOA 5JPIA 3PQFA 3Q9UA 3JV7A 3Q9NA 3VHRA 1H6DA 1PZFA 3HADA 5L3ZA 1QKIA 5B37A 1XWFA 4WCFB 2EKLA 2AQ8A 1X7GA 2O3QA 1NBOA 2ZATA 2GD1O 2B83A 4GMGA 4M49A 2OZPA 4OOEA 3C24A 4JROA 1HT0A 3PJGA 5GZ1A 1F8GA 3GRKA 4DL9A 4YJFA 4IIUA 1EUCA 3AWDA 3ROPA 1ISHA 3DBLB 4BB5A 2W2KB 1V3VA 1M76A 1KC1A 2JL1A 3HZZA 4NFSA 2FPPA 4CM8B 2EERA 2ZK7A 1EE2A 4BNGA 1LSSA 1MB4A 1B16A 2EXXA 1HXHA 4BNLA 4MVJF 3D4NA 2BFPA 1BWSA 1NPYA 1CYDA 5I7SA 1I8TA 3IUPA 3F6YA 4YAGA 2BLLA 4Z9FA 2NWQA 2V6MA 3K2EA 2AEJA 4ZQHA 3RC2A 3JQFA 4RVGA 1EQUA 2PGJA 1X0VA 5IN4A 3VPFA 4LSWA 2O50A 4OM8A 4GQAA 3JQGA 3GN1A 3GZNA 4FFRA 2X22A 1JTVA 1C0IA 2JFGA 4I08A 4PRLA 4XYBA 3IQDB 2D5CA 5I8ZA 1G1AA 2HUNA 1Y8RA 2QRLA 4WEOA 4XWYA 1AXEA 2Q1TA 2VCYA 2VHVA 4B4UA 2VYND 4R16A 4GAEA 2PR2A 4CMIB 5BQFA 3HFSA 4DTIA 3B20A 1DRWA 4P38A 5A9TA 2PLAA 4WLEA 2GO1A 2G5CA 1E3IA 9LDBA 2YHUA 4TVOA 4PG7A 1MFZA 3ZHXA 3DHYA 4NU5A 4XRGA 1SEPA 3IL2A 3ZW9A 3JQAD 2AQKA 3H8VA 3TPCA 3ZGYA 1MC5A 1YWGO 4JBHA 1BDBA 5IXSA 2YV1A 3E82A 4YB8A 2XAAA 2V7PA 1ONNA 1YGYA 2DFDA 1BRMA 8ADHA 2PD6A 4RF5A 3DMTA 5KVVA 4A27A 2AQHA 1BGVA 3WGTA 3VAZA 4BNJA 3PZBA 4ZHSA 1A5ZA 5GZ3A 3KTDA 4IXTA 3WMWA 3DXFA 2XOXA 2HJRA 3K9QO 2OP1A 1P1HA 1P1JA 2GNAA 1Z74A 2HK8A 3TWOA 4LMPA 3MWDB 3EZLA 2VZ9A 4IDBA 4IJKA 4NH4A 2HO5A 3RUDA 4WOJA 2PKQP 3MJSA 1R4MA 1WMAA 2QRJA 2DBZA 5EPOA 4E3ZA 1C0PA 4BQPA 2FPGA 4R69A 2B4RO 1A72A 4BMVA 2PH5A 4HX5A 3ZHBA 2BMAA 4DRYA 1FDSA 2DBQA 1AXGA 2G82A 2DAPA 3D5TA 2JHGA 1MXHA 4FC6A 4QEDA 4PLGA 3VH4A 3O38A 4J1QA 2NU8A 3NV9A 2VHZA 3SVTA 1Z6ZA 2B35A 1DOHA 3B6ZA 3M1AA 5EQDA 3UVEA 5FFFA 1OZAA 3W1VA 2O23A 3ZU5A 3JYQA 4PGFA 1O0SA 5FF9A 2I65A 4NFYA 4UUOA 2ZB4A 4DXHA 3AOEA 1KY4A 1P77A 4INAA 4NJOA 1E5QA 4QO7A 1A7KA 3DAPA 1GD1O 1N8KA 3DBRB 1Q2XA 4HXYA 4NBTA 1NTOA 3ENNA 1HE3A 2ZYGA 3LU1A 1AHHA 4JLWA 3SXPA 3DZFA 1O6ZA 4BO1A 4RPJA 1J0XO 1JDJA 2YQ4A 1O95A 2BKAA 2H5LA 3GRPA 4I5DA 4HY3A 4Z9XA 4RL6A 3M6IA 4BMSA 4BO2A 4DIFA 3JD4A 3NGXA 1HYEA 4HWKA 4B3IA 1GDHA 4BHTA 4IJVA 1PS0A 1VKOA 5G0WA 4CUZA 3PQEA 3PFFA 3PJDA 1Q7BA 1HDXA 1LRLA 4XA8A 1RJWA 2EW8A 3I1JA 3GZ4A 3MOIA 3ZWNA 1NASA 1JKJA 4Q3NA 2NU9A 3FCOA 3GVXA 2EKPA 5TJHA 4J9UE 4MJLA 2YDYA 1GV0A 3QWFA 5EERA 3MJEA 4GBJA 1IHXA 3OICA 3H65A 1HL3A 3E5MA 2GGSA 5C3MA 1DFIA 3HQ4O 2X8LA 4CMAA 4JJIA 4XCVA 2D2IA 1U5CA 1NP3A 5DN9A 3ICCA 1I32A 1VRWA 4XZ3A 3K8ZA 4GLOA 3H6KA 2UVDA 4BO0A 5F3RA 5TGDA 1XQ6A 1A4IA 2B4QA 3ITKA 3ZNPA 4GGOA 4LVCA 5KOIA 3I9NA 1ISFA 4CQLB 4IJWA 4D43A 3LDHA 3ABIA 3FD8A 3WS7A 4J9VA 1CDOA 1T4BA 4ZRMA 5IN5A 4YT5A 1LLQA 5MGBA 3OH8A 3IUSA 4ID9A 4IY1A 5CDUA 4N5LA 3JQBC 1B8UA 1A27A 1SMKA 5JDIC 1HDGO 2FMUA 3QWHA 3U62A 3P5SA 5K6AA 1PGQA 1CQIA 4ILKA 3V2HA 3WSWA 3KM0A 4LRTB 2B37A 4K9DA 4TKLA 4DPKA 5EN4A 2VT3A 3I5MA 1E1MA 5JAQA 1JKFA 2Q2WA 4QUKA 1AE1A 1TT5B 1MLDA 3U5TA 4BNMA 1JWAB 1Z75A 5CP8A 3HG7A 1NVMB 4CLHA 5JYDA 3C1OA 2UUPA 5A06A 1KVTA 2OL4A 2ZTMA 3E6AA 4JX8A 3F1KA 3GPIA 2GN4A 1NFFA 2OUIA 3U4HA 4BNXA 4BNYA 3VKUA 2ZB3A 1LSOA 1M6WA 1MG0A 5KKCA 3QVTA 1X14A 3R1IA 2OFPA 4CODB 3DFZA 3INGA 5H83A 3RCBA 5G0SA 4BKOA 2Q49A 4ZRNA 1LXCA 1E1LA 4TQGA 4MVJG 3OEWA 4D7AA 1ZZEA 1Q0QA 1K0UA 2A94A 3JYLA 4R1UA 2IXAA 3CZRA 2PNFA 1DRUA 4ALLA 4CR7A 1YONA 4Y98A 3MJCA 5CAEA 1O8CA 1HF3A 4C7KA 3ONDA 3D4PA 5CDSA 3KEQA 1PZGA 5TS3A 4J0FA 1NHGA 3GNTA 3INRA 1IZ0A 2P9EA 2W2LD 1VKNA 3I3OA 5K9ZA 2EKQA 3KSZO 2RHCA 2Z95A 1ULSA 4J43A 2FP4A 2QX7A 1FDWA 5ADHA 1N92A 1H2BA 5IDYA 2DUWA 2EEZA 4OKNA 1TT7A 2EGGA 3PIDA 4NJMA 4ND2A 5AXDA 1IY8A 4BKPA 1HWYA 1LSUA 4CLEA 5CG2A 4YJGB 4R1SA 5JO9A 3U4CA 3WTCA 2PV7A 5DCUA 1VM6A 1F8FA 3L4BC 2EGHA 1KY5A 3IKVA 4AL4A 1ZNQO 3QSGA 1E0DA 2X5KO 4BNTA 1HDOA 1W8DA 1DC5A 2G76A 4FFPA 3RVDA 2HMTA 2DM6A 4JIGA 3O26A 3QLJA 2V65A 3BMQA 3JTMA 4MVJA 3TJRA 1YB4A 2OBNA 3AU8A 4LN1A 4D3SA 1F12A 4DLAA 4W4TA 2NADA 4KUGA 2OGUA 5JDCC 1IPEA 1F06A 3GFBA 3KUXA 4CV0A 1GYPA 2LDBA 1VSVA 1ZK3A 2OO5A 2Q3EA 3L6OO 3FNGA 2DU8A 2O3SA 3MEQA 4PLZA 4YBZA 1UXIA 1MP0A 4MP3A 1TB4A 2WDZA 4Z0TA 4I9UA 4MKXA 3SX2A 2OP0A 5G0UA 2DQ4A 5FEUA 3PJFA 2D8AA 5KVCA 1PR3A 3ZNOA 2BELA 4R9RA 1C1DB 1K6IA 1P0FA 1WZEA 2E49A 5JW6A 1FMCA 2W8ZA 4Y6RA 3RIHA 2W98A 5T8KC 4FOOA 3S2FA 4DBZA 5JXWA 3RJ9A 1WP4A 3GMSA 3ZWVA 4AJKA 4PZDA 1PJ4A 3E03A 4M87A 4PCVA 4GX2A 5JAZA 1U3WA 4OXYA 3WGQA 4J7UA 2C54A 1VC2A 2C59A 2VYVA 3ONFA 3GHYA 4HFNA 2Q50A 4RV9A 3GVPA 4B4OA 1U2GA 4O1MA 3HHPA 4PZEA 1GY8A 4E21A 1T4DA 4Y6PA 1RYEA 4D41A 1ZSVA 1I30A 2PFGA 4J90A 3WLFA 4HNHA 3L6EA 3UKOA 1R15A 2GN6A 1RM3A 3CMMA 3SC4A 5JAIA 2FN7A 5L40A 4FFNA 3PEFA 5C5IA 1HSZA 4RVUA 4IXWA 3G0OA 1MGOA 3TOXA 4CM9A 3KVOA 4Z3DA 1DO8A 5ITWA 5KCZA 1SB8A 1C1XA 1DEHA 1EE9A 2YV2A 1RM0A 2DFVA 2NVUA 4IDGA 1E7SA 1BXZA 3DTYA 3RUFA 4M89A 3EMKA 3LLSA 3A28A 3V1YA 1DC4A 4W7HA 2UYYA 3E9NA 1NXQA 3CIFA 3HWRA 1U7HA 3GR6A 5KJEA 4BV8A 3PI7A 1XSEA 2C7GA 2FSSA 3LSYA 3QQPA 1X1EA 1EVIA 4KTTE 5ENVA 2HMSA 2Y1FA 4GSLA 1A9ZA 1PJLA 4H16A 3ITDA 1LDEA 4WLUA 1UDBA 4OXNA 1T2EA 3O4RA 3IJRA 4LMRA 4MIOA 3CINA 3KYCB 2BI8A 3K96A 4FFLA 3F5QA 4L4RA 1U1IA 2RIRA 2HRBA 4ALMA 1JA9A 4UEKA 3AI2A 4JP2A 3U4DA 1E77A 3Q1LA 5JSFA 1YO6A 2VT2A 4UVHA 4AJHA 3JD3A 3K73O 1N7GA 3HDQA 4DWVA 1RKXA 1YDEA 3T7EA 1DPGA 1NNUA 4GVXA 3QW2A 2BFOA 4PG6A 4UEOA 4WLOA 3WR5A 3PGXA 4DQXA 4LCEA 5BNFA 3TZCA 3LT1A 4PFJA 1C14A 4OMUA 4RLHA 3U0BA 1ZK0A 4EUEA 1B0AA 1ID1A 1CEQA 1PS9A 3NTQA 4W99A 3BTOA 3JSAA 3OQ1A 3RBVA 2Q1UA 2YHIB 1HDYA 4CPDA 3I4CA 1Z7EA 4CMCA 1QORA 2Q46A 1EVJA 4YT8A 1PL8A 1C0LA 2XXJA 5G2OA 3RJ5A 1WLYA 5HTOA 1NYTA 3D64A 3KV3O 5G4KA 2H9IA 2DC1A 5DOZA 5EESA 4AJ1A 2Y99A 1QSGA 3W8DA 1PZHA 5BR7A 4Q3AA 3H2SA 2C20A 3C7DB 1WXDA 1YS4A 3O03A 1DAOA 3JQBA 5JDIA 2JJYA 4NZ9A 2OOSA 2VWQA 5JS6A 1K3TA 4KWIA 4JBGA 4DQVA 3G1TA 4R4JA 2C29D 4GWKA 3QE3A 3WWYA 1FXSA 1UXGA 3BHJA 4E5PA 5CDGA 3GGOA 3W8EA 4CQMB 3RUAA 5LCXA 2VN8A 4KQWA 1PJ3A 2NACA 4NK5A 1E3WA 3DBVO 3GNQA 2UAGA 1PGOA 2O7QA 2VOEA 1XQ1A 1UDCA 3QVXA 3GGPA 2Y68A 3JQ9C 4J7CA 3AUSA 3BAZA 1BW9A 3BHMA 3F1LA 3MJVA 1TXGA 3U09A 4FJ1A 3VZRA 3BMOA 2TMGA 4PVCA 4NNJA 2JFHA 4N7RA 1Y81A 3PVZA 4CLRA 1M67A 4P8RA 5BNTA 2DKNA 1LI4A 1ENOA 3AM3A 4YACA 2ZJ0A 2PGLA 2EJVA 2NSDA 5KIAA 1E3EA 1BXGB 2WM3A 4J1TA 3ZU2A 3HFGA 4CM4A 3WQSB 3BA1A 1HDCA 2G0TA 1PGPA 4C7JA 1UJMA 4LCJA 3KLPX 5AXBA 3I6IA 1JWBB 5TF4A 5I7FA 2G17A 4ZQFA 1GYQA 4WUVA 5L7YA 1FF9A 2Y93A 1L7EA 3CSDA 1DLIA 2FRDA 4YJHA 1UUFA 1KOLA 1FJHA 4BNNA 3HUDA 3R0IA 1ZXLA 4RDIA 4O59O 4BGUA 4BKRA 3ANNA 4IZHA 2VQ3A 3ROKA 1JAXA 2GZ3A 4HFMA 4OOFA 1ONPA 4XD2A 4OSOA 5EIOA 2JD2A 4XB2A 3D3WA 4K1LA 1HZJA 1PJQA 3RQSA 3G79A 4BMNA 3DZHA 4TKMA 1J5PA 2GZ1A 1F17A 5A1TA 1QMGA 4XDYA 3L4BA 1ONOA 2DTEA 1B3BA 2CZCA 3GDFA 3N7UA 7ADHA 2PWZA 5DT9A 3AU9A 3JQ7A 1L1FA 4OO3A 2VNAA 3MZ0A 1Q0HA 1E92A 1J6UA 5COBA 5JNLA 2HQ1A 3CZMA 1DIRA 4NFHA 1X13A 4BO7A 4KUEA 4IDDA 2ZKLA 4OAQA 3E8XA 3JQ8B 3IKTA 4FGWA 2VZ8A 4JGBA 5U9CA 3DZGA 3ZWWA 1R0KA 4KMSA 3OMLA 1GUYA 2O48X 4BUCA 4ZQBA 4CLOA 4XYLA 3WYEA 4FCCA 4PLFA 3GN2A 1B8PA 1B8VA 1RM5A 2XF8A 2ZTLA 3KB6A 2EV9A 4H15A 3VDQA 3FNHA 3LC7O 5MDHA 4E4YA 4LSMA 2YUTA 4PZCA 4AJEA 1OC2A 4EBFA 5IDXA 3I83A 4CMHA 1Y8QA 4RF4A 4GWGA 4MP6A 3NTRA 3WTBA 1IHYA 3OBBA 4RLSA 1EBFA 4D45A 1T25A 4R68A 4BKQA 1Z82A 4YJDA 5B4VA 4MO2A 1PQWA 5I9MA 2EJWA 3WGZA 3AFNA 3LC1O 4Y9DA 4WJZA 4O63O 4I1IA 1KVUA 5T8KA 5FYDA 4ND1A 4YAJA 5IZ4A 2DLDA 2QQ5A 1NM5A 2X5OA 3IP3A 2P4HX 2PA3A 3OSUA 1GL3A 5FI3A 4I9HA 5A04A 3TOZA 5KVQA 3DB2A 4NG5A 1YDWA 3ZDFA 3JD1A 1BVUA 3DHEA 2E48A 1VSUA 5BSEA 3PLNA 1R6DA 4WEQA 5HA5A 1K5HA 3JQ6A 4A2CA 3OJFA 1JQBA 5A9SA 2RHRA 4QQRA 4XGIA 4YDRA 3TDKA 1R12A 4TWRA 3MOGA 5EQFA 3TQHA 4WLNA 3VC7A 5BT9A 3ZWCA 4TVBA 2IZZA 3HSKA 3ZHYA 1EMDA 3ANLA 5DP1A 1KVQA 4EJ0A 3CUKA 2NTJA 1I3LA 3FSRA 4IGEA 1X1TA 2SCUA 4J91A 4E0BA 1SBYA 2Y66A 3LF1A 5ITVA 1XELA 1FDUA 4IBOA 4MIYA 3RKRA 5L53A 4XQGA 3WFIA 4DLLA 4ZQEA 4YEDA 2ZYDA 3UOGA 4XQ9A 3RASA 1NQAO 2G1UA 3TL2A 1GTMA 1X15A 4LRSB 5L4LA 1MX3A 1E5LA 1E6UA 3ZWPA 4O0LA 3KYDA 3GDOA 5F21A 2RAFA 1ISGA 4FS3A 4XYEA 4E2WA 4FB5A 5C7OO 2ILTA 2QRKA 3K2BA 2PZMA 4GVLA 5JFOA 1PL7A 3VOSA 4CMKA 1LJ8A 4IIVA 3WJ7A 1OC4A 1T2CA 1EDOA 4RCVA 1N9GA 4CV1A 5DNAA 2VTDA 4YAEA 1GQQA 4O6VA 4OSPA 1Y9AA 4KWHA 3NDRA 5EJ2A 5AXAA 3DFUA 1T2FA 2O3UA 3KZVA 3F9IA 4BNUA 1YQXA 2WYVA 4RVFA 2AMFA 2Q99A 4RDHA 2CNBA 3UFXA 1QV7A 1DJNA 3OECA 5CEFA 2IE0A 3AUAA 1Y1PA 3R3SA 3D7LA 2HK7A 3DONA 1H94A 3K31A 2BGKA 2WD7B 5IDQA 2WE7A 2I76A 4P4GA 1A4UA 4QSMA 2JCYA 4IQ8A 2HMWA 2DTXA 4CR8A 1P1RA 3BMNA 3LQFA 4CQMD 3H7AA 4Z0HO 1TLTA 3VZQA 3JCZA 4BIIA 1AN9A 4DIBA 3SJUA 2QZZA 3C1TA 2E82A 4JP3A 1W73A 1K6JA 2Z5LA 1P44A 3QVOA 3T4EA 3EGOA 3MTJA 4D42A 3ULKA 4YJFB 1XA0A 2BHLA 3RWBA 3WSVA 3IC5A 1QG6A 5L95A 1LDMA 5U4QA 3GC6A 1CJCA 4B4VA 1LDBA 3GK3A 4UVEA 5J23A 1I33A 1E7MA 4JN6B 1F0YA 5F5LA 1YXMA 3DAGA 4L4XA 5ICSA 1T1RA 2FHSA 3AY3A 4XQEA 2YFQA 5A5FA 3KRTA 4UAGA 2O2SA 5KTKA 3FWNA 2VNSA 3TFQA 3VH1A 2AXQA 4P4LA 3LVFO 4IDCA 4E32A 4D0SA 3SBOA 4L4SA 3ZW8A 3DR3A 3JQ9A 3ZV6A 5I9NA 3UF0A 3WICA 1GUZA 4BO6A 4D3DA 4QO8A 2C2YA 1WVGA 3NX4A 1B14A 3JQGB 1IYZA 3GZNB 3OJEA 2VOJA 2PGDA 3GF4A 3RFVA 3DZBA 2Y0CA 1SOWA 3Q0EA 4QFDA 4N54A 4TMFA 3H9QA 4WGGA 1HETA 1E1KA 1Y8RB 4EJMA 3K30A 5JMWA 1Q1NA 4MKZA 4PLWA 4W9NC 1HYHA 2WMDA 4FC7A 2GR9A 2Q4BA 3ZWOA 1KVRA 4OIMA 3JD2A 5T6BA 1EK5A 2CVOA 3WIEA 4S3MA 4D0RA 4C4OA 1V8BA 4PIVA 2QHXA 3LC2O 2D0IA 1ADFA 3EUWA 3STHA 4L75A 3BTUA 2JAPA 1QP8A 4WK6A 2X5JO 4FR5A 3UUWA 1RPNA 2NQ8A 2JD0A 4D79A 4JCOA 3ADPA 1YH3A 3LT4A 3K6JA 4XX0A 2C07A 1GFSA 5G4LA 4GSKA 4IS2A 4AICA 2X6TA 3H3FA 3W8FA 4XDZA 1ZIDA 2BF7A 4QXMA 3NT2A 3C7CB 1B2LA 3QRWA 3IP1A 2AHRA 3GA0A 3FR7A 4BO8A 1LDGA 2X0NA 1ZK2A 2D1YA 1I0ZA 4J4TA 3BTSA 3ZU3A 2XPCA 2W90A 1EVYA 5KJCA 1RM4A 3EC7A 5TC4A 3L9WA 1XLTA 2CF5A 4W7IA 1B26A 4OGWA 5BNIA 2X1HA 1R4MB 1QLJA 1LU9A 5G0TA 1O5IA 4HKTA 5CDTA 4RQUA 2VRCD 1PIWA 3SJ7A 5IZCC 4FD3A 1HEUA 1PJSA 3ZV5A 1SC6A 1GQYA 4DUPA 1EUDA 2WYWA 1R16A 1GQ2A 1PTJA 3FBTA 5JC1A 1WDLA 3KOUA 4U5QA 3JYNA 1LTHR 2EP7A 4EW6A 3HDHA 3KBOA 5KJFA 3KXDA 4WE3A 4KP7A 4NBUA 1UXKA 3H5NA 2C82A 2YW9A 1IZ9A 1E7YA 1DRVA 3PLRA 4R1TA 1XGKA 2ZQYA 1NWCA 3Q6IA 4CL3A 1EZ4A 3WWZA 3GVHA 5JMPA 4WCFC 2Y1DA 1J49A 2JFFA 2YJZA 1NX6A 4YXFA 1ZMTA 3LZ6A 4D46A 2CF6A 4W6ZA 1T1SA 4DGSA 4J2HA 4PVDA 1P45A 3OJLA 5JCJA 2F00A 5L7TA 1D4FA 2GLXA 4OJNA 4J3FA 1IE3A 1DAPA 3F47A 1IUKA 1JLLA 5H82A 4OXKA 3ETEA 5ENDA 4Z3KA 4UULA 2YYYA 1U8FO 4BNVA 1R4NA 3UAGA 1JVSA 1E3JA 1EEHA 1KYQA 3OF2A 1QYDA 1NWHA 2HMVA 3RU7A 4ZN6A 1LDNA 3UCEA 3X2EA 2JCXA 5TSDA 1A9YA 1ZFNA 1V35A 1UH5A 4ZA2A 4ZVVA 3WGOA 4E2YA 5AOVA 2YFHA 1ZBQA 1KEWA 4J0EA 5JLAA 2D59A 5C7IO 1VL0A 3KETA 2P5UA 1EK6A 3JYOA 3ASUA 2Q1WA 1IL0A 1QLHA 1VJ1A 2I9PA 2P2SA 5L45A 1U4SA 1YOVA 1ENPA 1GR0A 2NM0A 3WNVA 4UVGA 3B70A 1LC3A 4GI2A 2X0IA 3BMCA 5T5QA 3ROMA 4L0QA 2AE1A 4GMFA 1PQUA 3DOJA 1PWXA 2R6JA 4OYRA 1PJBA 3UW3A 3O9ZA 2OMEA 3EVNA 1NQ5A 1MUUA 1YQDA 2IRWA 1ZVMA 4U6QA 4FGSA 1I36A 4J1SA 1XG5A 5ER9A 5CEEA
chains in the Genus database with same CATH superfamily
2GZHA 2YNMC 4FKZA 3GLFE 1K3FA 3GELA 2XYRA 4JLJA 4UDYX 4TV8A 5L4NA 1M2HA 2X42A 3RS4A 1WAMA 2H08A 2BFDA 1NPDA 3I73A 2F3RA 1P2TA 1O4VA 4XJSA 3ZK8A 1VOTA 4EPVA 4BNWA 3DBHA 4LNHA 1RZ3A 4OV6B 4PC1A 4CCWA 3FOAA 1EK2A 2ZJ1A 1I01A 4B8YA 5LP1A 5IJAA 4M2LA 4H7JA 2BFWA 3OOJA 2FUEA 3NRCA 4X1KB 3LZCA 3RS8A 4MRVA 2A0UA 1E9RA 3KVVA 4RZHA 4TRNA 1EE1A 2J3KA 1WS6A 4RVDA 5JCOA 2ZETA 2A59A 3CRZA 2ZM6B 1ULHA 3O91A 2IYNA 2P78A 1N9ZA 1OSNA 4HLQB 4OU5A 1QE5A 4LJSA 3ED1A 3ROFA 2QOEA 4QU8A 3R6WA 3DDZX 1Z38A 2XTMA 3K7EA 2HMYB 1OX6A 4FS8A 4FQ7A 1ISMA 2Z1MA 4KXQA 4V0QA 3L6CA 1UOOA 1YVEI 3DNFA 5THKA 3PK0A 3OZGA 4GECA 4EZEA 4RDXA 4QREA 1YJXA 2IZ7A 3DAFA 3FRJA 3PX3A 4IO0A 2XB8A 4UHKA 1L4FA 4ND8B 4U02A 1JHPA 1JV2B 5DHUA 4CYMA 3FWZA 4JLNA 4FYPA 1H3EA 1ADGA 1MB2A 4C7VA 4F71A 5L4SA 3CXUA 2NMVA 3T7AA 1NSFA 1HO3A 3H1BA 5CX4A 2GMWA 1RE0A 4QXQA 5CFRA 5TPZA 1IM2A 1BQ4A 2BDEA 2Z57A 2ORYA 4F91B 2GSDA 2ZUDA 1M72A 1P7PA 4DMLA 4DR1B 2X0DA 2DFLA 5A03A 5ED0A 4FOPA 4X63A 1EUYA 4K28A 2I6XA 4Q9IA 3WLEA 2JGEA 1NT4A 4JK3A 1F9AA 3GNSA 4YJ3B 4OVKA 1C2TA 2GA9A 3E22B 3WNQA 2WSMA 2GBLA 5LIRA 1ABEA 3MVEA 1F4PA 2CVQA 3PD1A 4HX9A 4LISA 5DGXA 3TRJA 5JJLA 3IUJA 5K45A 4Z86A 3TI9A 5KYKA 1VDMA 1ZM7A 5L8VA 1DBWA 1QWSA 1ZCAA 4IIDA 3K1AA 1SOAA 1AUPA 3PL5A 1GTJ1 4KLNA 2AA3A 5F1KA 4QDUA 7YASA 3ZWBA 4M60A 1KZYC 4R8MA 3TAHA 4UHFA 1MABA 1N2BA 1HGXA 1WPQA 1PSZA 2WI8A 3H11A 1C2YA 5DIFA 2PUGA 4AMZA 4WXPA 4WY2A 1ZJ4A 3O8QA 4ARUA 4TT3D 3ANMA 1WDTA 3KVRA 4G01B 2OXRA 4ZVRA 5A7HA 4C3ZA 5C7LO 1NUUA 1BDIA 3VDRA 4F45A 2ZVDA 3O94A 2O0LA 2VF5X 2G09A 2CB0A 4L5IA 1T24A 2EGUA 2FX3A 2C42A 5GONF 3RAGA 3GLSA 2QPTA 3LBAA 4EGAA 3OMXA 5LC1A 3DD5A 4HADA 3E18A 1OILA 4JCCA 3ILYA 3W5DA 1ADJA 2IW3A 2J6CA 1YUMA 3CURA 3KAJA 3Q98A 1UWVA 1WMDA 1ID8A 2ZQZA 3F5MA 3BH7A 3DA8A 4OHRA 4LF9B 4I4TF 4HAYA 1MQAA 2C0PA 3EXEB 1BMFD 3URKA 3I9OA 3OZXA 7GPBA 2HQRA 2WM9B 3ZXSA 3KZXA 3RUIA 4AMBA 5EUMA 1ST3A 5L3QA 1P1KA 1WY5A 1A8IA 3ZEIA 1JJIA 1P19A 4LDZA 1PR6A 5BOSB 4LV8B 3D2LA 1SC4A 3RHSA 1AKNA 5KB3A 4ZC1A 3VNVA 4RZ2A 3UXEA 4EYKA 5AM0A 2ZRJA 1FU8A 1RAEA 2EF1A 5HM8A 4S0XA 3PF8A 2CK3A 1XHLA 2E37A 2R1ZA 2YC4C 1DNPA 3M70A 1EWYA 1WNTA 1JKXA 2Q29A 2VK4A 3L7AA 1I3OA 4NICA 3QXCA 3C4VA 3LV8A 4NPCA 1WZUA 5AM5A 5EIBD 1U0TA 2JGDA 3G0CA 1JAIA 3BJIC 4N48A 2D13A 4MZXA 3ER8A 2ZE5A 1P39A 4KQMA 1P4RA 4TMTA 3M9LA 3R5HA 3UMRA 3IQGX 4UDOA 3ER6A 6ADHA 4N39A 1J2EA 4DT1B 2ASEA 4ONEA 2ONZA 2AFRA 3E9EA 3PNBA 3SG0A 3SZRA 4E7PA 5BW5A 1L4BA 2E5LB 4L15A 3EW7A 3U17A 2VTEA 4B6SA 4F6CA 2ZUCA 4FCVA 1IWOA 4PC7A 3S2IA 3VTZA 1SUWA 3ZHSA 1VXOA 2J9YB 2CJXA 3Q4GA 4H0NA 1Y6JA 3V3TA 1M6VA 5A05A 2QUJA 2JVJA 3QHQA 1X1AA 4JXZA 1R3DA 3D2AA 4PINA 3TNJA 2SHKA 4E5KA 5ES4B 3EXHB 2ZRGA 3T35A 4U6SA 4MPDA 3QYJA 3VPGA 3G3EA 5FUWA 3TS1A 3BYZA 3EVAA 4D5GA 3HNPA 3KSDO 3LLVA 3V1KA 2FWBA 2JASA 2OFOA 1DX9A 2P0YA 3KFVA 3QVGB 1F4LA 3GUVA 3DTVA 1MOQA 3OFSA 4A23A 4WIAA 1RFLA 3W4JA 3PFWO 1ESNA 4KJXA 3IBCA 1UWCA 5I6DA 1QO0A 2ZR0A 1PG0A 3SJCA 1KEEB 2Z56A 2WB2A 1FU7A 1H8HA 1KIFA 5A1JA 2HTFA 4QTZA 4EUKA 3HXQA 4H59A 2WJZB 2IHTA 3VHQA 5EGSA 5AK5A 3LG2A 4C5BA 4MUGA 2NP6A 3GBVA 2VUUA 2J46A 2QUKA 5E4YA 2NUPA 4LZZA 2H5JA 4FXOA 5EZYB 3WDSA 4DNFA 5HRCA 2QXTA 4QQFA 1X7YB 2QTGA 4UU7A 5AW5A 1CUUA 4GR5A 4QQKA 2BCJQ 1FZTA 3T99A 1GCIA 5FBVB 5HBRA 1UDRA 4KE8A 1VA5A 3VR4A 4AO6A 4PRKA 3RIMA 2C7BA 3RRNA 2W6MA 4FHDA 2WM8A 2WWVD 3TKYA 1SO8A 3KLMX 1Z2EA 2A0WA 4ICIA 1OFUX 5A5EA 1NJ1A 1GTSA 4Q4CA 2ZT7A 2XDQA 1JHYA 3FVRA 1K86A 3RQIA 4IEFB 1C0KA 1J2RA 1UKAA 3OZBA 4NL4H 4URUR 4P3PA 4LQLA 2DQYA 1QO9A 3GA7A 4KPUA 2UXDB 1CY1A 2HH9A 4F38A 3WMXA 4ZCIA 5I47A 1B23P 3PE6A 4EUHA 3D1JA 1NJ8A 1H4SA 3K70D 4WOPA 3T7JA 1H2YA 1U8ZA 5IKMA 4BRWA 4P4TA 4TZKA 1HE2A 4X6YA 1XYYA 3KHUA 4DC1A 2PSHA 4CKZA 1T4MA 1U90A 3PXDA 1M8GA 3EK2A 2F55A 2FSVA 3IUEA 1N5MA 3PUKA 4TRMA 1TMYA 2GPBA 2ZBPA 3NVDA 1RXSA 3FY4A 4LYGA 3GQVA 4KWTA 4MPJA 1ZGGA 5FAKA 4MUJA 2G36A 1WCIB 1ARZA 3QJ5A 3PIIA 1NVGA 2X6RA 3QYAA 5AR1A 5GVSA 1UBTS 5DBFA 4M6WB 2BRUA 2HSDA 3HEAA 5KYNA 3DWFA 2VL7A 3GG2A 4XXHA 3TTTA 4CMIA 5KNCA 1Z45A 2HK9A 2KX7A 1ZEMA 3B2EA 4R2KA 5DHSA 821PA 4DWWA 3KVNA 3B3GA 3OG9A 4F7WA 1ORRA 1V6AA 4P0PB 1V3UA 2O5EA 4FTWA 1JPVA 3IIJA 2ZZKA 3DYBA 3BE6A 4XQCA 1YZUA 3UOAB 3ZY3A 3R8FA 4UBNA 1REQA 3IJPA 2Y76A 3M6VA 5CXXA 3EAGA 5BWBA 4KR3A 1K4KA 2YC2C 3B2QA 4DREA 3USES 4QM7A 1TZMA 1J22A 1WDWB 2LIPA 2NAFA 3GRZA 4P5PA 1FDVA 4ARZA 3P9RA 4G09A 4KEAA 4K6MA 1E3WB 1P3DA 3LS2A 3MN1A 4LFCB 3WIVA 1JR3A 1E1QD 3F49S 1NQOA 3VZPA 4DV7B 2WTXA 4IDHA 2XWSA 4UOQA 3O3CA 5FTNA 2QVBA 2O0HA 1JFRA 1BW9B 2GBIA 3LUJA 3WYFA 1T13A 3BMOB 2O52A 4GC9A 3REQA 4D9IA 2P11A 2QD1A 1ZMOA 3AYZB 1RXUA 3JY6A 4B5KA 3KJQA 4UUAA 4JFAA 3TSZA 4BAUA 1D1TA 3ZE8A 1SBTA 1YAHA 1JQ5A 4S2UA 2HJVA 4UUQA 3KSAC 5AK4A 1OLXB 3M5WA 4TM7A 2F3PA 3UK1A 4Q4JB 3HP4A 1NW3A 4UDXX 6REQA 5SZKB 1K5GA 2AW5A 1CU1A 3HBAA 3GLIE 1HE5A 2RHHA 2XZPA 5T4EA 4F3YA 1XPRA 4MMYB 1MC4A 2W37A 5AOBA 3IKJA 5CFZA 4D1YA 2QR2A 4HR7A 2GRJA 3VYTB 3ZBPA 5C2JB 4II3A 2AKYA 1P2VA 4ZYYA 3WI7A 4C05A 3D6MA 1VI6A 4IG9A 1UXJA 5GM2A 4UW9A 1V11A 2P1ZA 5IUKC 5BYKA 3K09A 5E7JA 4KPGA 2RB4A 3DGEC 3MCZA 1G20E 1OLOA 4MUAA 3VFDA 3QUAA 2OHVA 1X1CA 2PU5A 4XYGA 1P6QA 2PH7A 2ZIFA 4LX0A 5CIWA 3IULA 4CUKA 2CNOA 1UMCB 1CLUA 3TFWA 1TW3A 1B00A 1I2CA 4RK5A 4ZGWA 1CIVA 3SNKA 3F98A 3N0RA 4IZ6A 1K97A 3F6BX 1NLYA 1PJCA 2IY8A 1DAKA 1T2AA 1J9ZA 2QLMA 4K9SA 4LE1A 4BNKA 3IILA 2IBSA 1NI4A 4J0IA 1XP8A 4ZT4A 4YCCA 4C4XA 1OD6A 2BSAA 2E6UX 3DJFA 3MMSA 3QX3A 5JS1A 1H6AA 1PEDA 5F9FA 3F9CA 1NL3A 2Y8EA 1E9DA 3PSAA 3D0OA 2B36A 1GV1A 1LJLA 2ZIZA 4JA0A 5BQPA 3USCS 4PN3A 2BTEA 5IYZB 2D0OB 1Z7WA 3WL6A 1IY9A 2VEDA 221PA 1QIKA 5MFPA 3A1SA 1LBEA 3O93A 2C4NA 1P61B 1JG3A 3GOQA 4BECA 4NYIQ 2H16A 3W7VA 121PA 4JKYA 2W6JD 2VJLA 4YWJA 4M8IA 3EG9A 3ZJYA 4BKMA 4ENUA 5LD2B 4BWFB 4AY2A 1E3QA 5A4FS 2IYXA 2ZDQA 4RTPA 2F4VB 2Q5LA 3NS7A 4OFWA 4JEIA 3RC3A 3EGDB 3GAZA 5IAOA 3EXIA 2FDCA 1TEVA 2P0AA 3SAJA 2NTEA 2I2WA 5T6MA 2PWPA 3O82A 1DFGA 5GP1A 4F5DA 1CTQA 1MTZA 3NBYC 4LRQA 3AY6A 3CVWA 1AS2A 3HXMA 4KPYA 4TZ0A 1NAIA 1W59A 3ESXA 3GLQA 2QLNA 3RUCA 1T5BA 4CQLA 3FJ1A 3ZGVA 4CG3A 4D74A 5EP1A 1J97A 1S5PA 3AUTA 2CFCA 3IIKA 1BG6A 1MHTA 1PJ2A 2HCFA 2QQEA 3FCAA 3USZA 4IEEA 4DEVA 1UOEA 3I39X 3IDZA 4X62B 3F8TA 2HRRA 2PK3A 1CUDA 1VIDA 4BOYA 1Y34E 2OR3A 3A6HA 3CJQA 3D8BA 3FFBA 2YIVX 3Q3CA 2JAHA 1D2RA 1OLUA 3GCGA 4FMCB 3EGVA 2FXVA 1C3VA 3EDOA 4IDPA 1SVOA 5ENVA 1IXZA 4D2IA 5EIXA 2O3JA 3F9RA 3SIRA 1PK9A 3V7UA 3K9LA 4JEMA 4OKIA 4X94A 4BO4A 1Y7LA 4MUFA 4DIKA 1XZEA 1RU3A 4PLHA 1CY6A 4HLUA 2XIJA 4HFJA 4AQ7A 5LOVB 4R41A 5A9SB 4WA8A 4DRXA 1C4WA 1NV9A 1D4OA 2I6QA 2Z3ZA 2GD0A 3ICVA 3PTLA 3P2JA 4UTNA 3CLSC 3HXLA 4ZOLF 1KR2A 2EJCA 3A06A 4B0OA 1I24A 2OLEA 1MQ8B 4AJLA 1SKYB 4HGQA 2YWBA 2OCKA 2P40A 3EVEA 1DDOA 1PFYA 4MEAA 4LJLA 3Q6MA 4IH4A 1J0AA 2ZAMA 4F3TA 2WEKA 4ZYLA 4Q1BA 3VZCA 4PHHA 4XWAA 3R9IA 2SCUB 4A26A 1UDXA 1UKCA 2QGFA 3RTDA 1H0RA 4NCHA 1VIMA 3I30X 1LLFA 1M2VA 3IP9A 4K9NA 4F97A 1J00A 2EX0A 2I1QA 4RZQA 4WZAB 4FINA 4JV5B 1EFCA 1EFVB 1N2SA 3SSAA 4MVWA 5HRUA 2J3LA 1VHDA 1WB4A 5JNSA 3HACA 3AF6A 1KDRA 2R1TB 2GOYA 4TRJA 4ALIA 1W9MA 4ZKDA 2VBCA 1GRVA 1C7RA 1V7ZA 3OE5A 2FE1A 4MINA 3BSWA 2H8KA 1WD5A 2NZJA 4J2OA 5HUJA 1DO2A 2I99A 2A30A 2P35A 3TZKA 2WF9A 4J8PA 1DIHA 1IY1A 3ZVLA 1XQXA 3JSXA 3UWSA 2GXAA 4D9CA 3IALA 5U1PA 1ZGJA 3AKDA 2WSBA 4QT0A 3S27A 1U28C 2XUIA 3RVBA 3UG6A 5FOQA 5JFGA 4NEHB 1SCJA 4KQIA 2I6TA 1X19A 4BZXA 3GPDG 2X4DA 4B6PA 1G9XA 4F46A 1ORWA 4N5MA 1S2OA 2DJIA 3GQBB 2JANA 5PGMA 2G07A 1XIVA 2KWIA 2PEZA 4CR6A 3N0VA 5D3MA 4YR9A 2BBTA 5TPWA 4KOAA 1R3UA 3AH8A 2BOVA 2GKSA 1RWKA 2Q3CA 1ZXXA 1KH2A 3EJ6A 3L8HA 5CVVA 2HK6A 1FYXA 2JKVA 1JG7A 2IEBA 2ZJAA 1FK8A 1X94A 3BB1A 1J9EA 5AJWA 3ZDQA 1JNYA 4IV5A 4RNDB 3DZ8A 1O0BA 1Q16A 4BNZA 3KVYA 1ZUIA 1E9CA 3RFUA 3U9SA 1ZD3A 3V55A 4I50B 3ETJA 1YRBA 2AD5A 1O89A 1WETA 1VE9A 3E9QA 3SC6A 2WV7A 2VF4X 1OFGA 4P08A 1XVTA 1PE0A 4LZJA 1BE1A 3PGJA 3BMNB 1L5MA 2CXTA 2OBXA 4NU0A 1DG1G 4WH0A 2H1LA 2FSPA 4MVJM 1JS1X 1ZC4A 4QM6A 3L6DA 1KFBB 4BMCA 3GPBA 1JIIA 1C1HA 2EEPA 2OHXA 3ONWA 4E09A 1T8SA 4QPZA 3R5KA 4JC0A 1MB3A 1JHQA 2BE7A 1J8VA 2ZVQX 4HAVA 3CT4A 4CNQA 4YHBA 4RPGA 4OI2A 3F2IA 4HQKA 3EZNA 4U2BA 3A9TA 4ZO7A 2Q5HA 5AWFC 5FL7D 2J5QA 3EXFA 4B85A 4B7UA 1J0CA 1B8NA 2ID4A 1QTIA 2BSXA 1TE2A 2ZWAA 3HVUA 3L6UA 2QNBA 2CMGA 2NQ2C 2GF2A 3B53X 3R7NA 4EITA 1DXYA 1JEAA 2HSEA 2AG5A 1R37A 4TLEA 2VDMB 3ESZA 3W3AA 2EBUA 4EEZA 4B3BA 1U5AA 2P9CA 1HLPA 4B33A 3T5AA 3CZ4A 1CS0B 3DMFA 3FHJA 4C89A 2CFTA 2XITA 5KWEA 1WZIA 5CU7A 5C7YA 4ECAA 3GX1A 5IFKA 1TKAA 1GPJA 2K4MA 4HN9A 5A62A 1KU0A 3JQCA 3QPCA 2XVXA 4ZKEA 4DNXA 1BEUB 4MS3B 2O2JA 4BBPA 2WPDD 4KREA 1JSZA 1NLZA 3DDWA 3GH1A 4QDXA 4BE7B 2RIPA 2IYQA 3A4LA 3MS7A 4OHCA 5LQJA 4JSRA 3RNOA 1UWLA 2RBEA 5JHHB 1PFUA 3ZH9B 4KQJA 3QFSA 2R00A 1J24A 2W22A 1V26A 4L8WB 4N8SA 3KZ1E 2OCIA 3R3JA 4UOEA 1N2ZA 1XE3A 3EZYA 1K66A 3SSOA 3T3DA 4F96A 3EA0A 5EVCA 5B55A 3VA7A 2FZVA 1JKIA 2V4MA 3AMVA 4TROA 1JYEA 4U7TB 2P9FA 1J8MF 1PR1A 3FA2A 4I9GA 3FPCA 4HB3A 4JP8A 2IZ1A 3FNBA 4A5OA 5A7FA 3ES9A 4L7VA 5EMHA 1AK2A 5T57A 4ASUA 2G1KA 2H8GA 1NQWA 3LXXA 1GZ4A 1UJNA 1P5HA 2H63A 2WU0A 4AMYA 3FHTA 2H48A 1QVZA 2NZ8A 4FGUA 1OFIA 4IZOA 1TIPA 2N42A 1PP4A 5JBNA 4CEIB 2J6IA 2QAIA 1I2BA 4RTQA 3S44A 2DUUA 3L1VA 3PNLA 4CLXA 3MT0A 1XNRB 5FL3A 2JAWA 2YVAA 5TX7A 2JEOA 4Q7JB 2H7YA 4RF2A 4Y6GB 1M6EX 5KVAA 1GEGA 4ZAZA 4X71A 4XUGB 1UEXC 4U8GA 4GX5A 1AGXA 1X0XA 3GLGE 3QELA 1TZCA 3FLEA 3M8KA 1G0OA 1OKKA 3AYXB 4OI0A 4L5CA 3OPQA 4GOND 3BXXA 4DLXA 3OIFA 3T4XA 1TA9A 3P2OA 4LI3X 2BR3A 3UO8B 1SQ5A 2WWYA 3MM4A 4X00A 2HFJA 4TS1A 1ZD8A 3D3QA 4BTVA 5KQMA 3KP1A 5H16A 1CZLA 3BF8A 3GGGA 1G3UA 3ADDA 3EIOA 3QTTA 1XTQA 4CEHA 4C43A 3EZ9A 2FOLA 2IPNA 4X44A 5AVSA 1CETA 1OW3B 4KB5A 3PUZA 3O4FA 2BHNA 3UGJA 1Q7CA 3ETHA 4NC9A 2MOKA 3T5TA 3OT4A 3THXB 3QVVA 2MDTA 2ZI7A 2LR0A 5F5NA 3GXBA 3OQIA 2VFAA 1VKJA 1N25A 1EFAA 3QE4A 3DHVA 5AW4A 2OVBA 3WE7A 1QH1B 1E4VA 2VSNA 3CH6A 3NOOA 4REQB 3RJTA 3W7AA 4WXYB 4YNBA 4BS9A 3VPDA 1N2OA 1P75A 1ZX1A 3OPVA 1MT0A 4E2ZA 2HA0A 4F3RA 2AOXA 5IJ0B 1QGYA 4J49A 5IM4A 3QWIA 3LY8A 3A3OA 4NWIA 2GWHA 1GGKA 3FJYA 4WV3A 3CO5A 4HNQA 1ORDA 3G9QA 1S8AA 1QX3A 4U2KA 3MK31 3RVSA 1HTBA 1FPQA 2A1IA 1Z47A 3MSCA 5ALWA 3EMDA 3T5DA 4ITVA 4NI5A 3T3IA 4GP7A 1QRTA 3JZDA 2JFOA 2C5FA 4S1OA 5H5JA 1RE1A 1WRBA 1R6TA 3HKCA 3ME5A 3LT0A 2A92A 4FYWA 5F35A 4C1BA 1Y33E 5BWNA 3NMUF 4RM3A 3IB3A 3W5JA 5B3JA 1K0FA 1VMIA 2NUBA 2DPGA 2DWOA 4KCGA 1NVVR 5EMMA 1LJUA 1ORVA 1RYDA 4G6ZA 5JG7A 5KI6A 3IP6A 3TNYA 4GFDA 3QVWA 4G0ZA 4HUJA 4CFZA 2O2YA 3RFXA 2OBBA 5JADA 1E2KA 1ZG3A 4WCDA 3AFGA 2VZ0A 3MF4A 1QIDA 3IE1A 3HRKA 1Z68A 2HDHA 4MCJA 4AYXA 4RHTA 2G6TA 5EE5B 1CZRA 2B34A 2V4ZA 2ZBGA 3ON5A 4I8XA 9GPBA 5TLSA 1UOQA 3D4LA 3TM4A 2W2TA 2QVXX 4PYMA 1KP2A 1ZXBA 2A3RA 2NW6A 4O4IF 3IPYA 3PD7A 1D03A 1U2DA 2GSWA 2J8ZA 3H4IA 1KEVA 3I9LA 4GUAA 1CDEA 4ZVNA 3TLGB 3WL5A 1XRRA 1RRCA 1NBWB 3U6KA 1Q3HA 2C94A 4BDSA 1OH8A 3N8GA 2Q2NA 4JQCA 1I4OA 3A1TA 1RQLA 2Z2IA 2BR4A 3NBFA 4MWSA 4B79A 1BXGA 1YOVB 3L0CA 5AUPB 2B30A 2PZKA 2Z08A 2HF2A 3I9KA 1T3LA 1V4NA 4R7TA 4DHEA 3OZIA 1A2QA 1IHDA 3BMCB 3ESCA 1NY5A 2HMUA 3KV1A 3GL9A 3CKLA 4PR0A 2XNKA 3JTEA 1UC8A 4M21A 4TLLB 5C5CA 1FW6A 3W2EA 3TQIA 3C3JA 4BO9A 1E3MA 1G4HA 4W5NA 1BGXT 4HGNA 4GO1A 4MRMA 3UICA 2H6EA 4NDNE 2WIKA 4QDTA 3PEUA 4M8KA 5JXHA 3U4QA 1VLMA 3KHSA 1FTYA 4GP9A 3T12A 2SBTA 1DOAA 2OWDA 3ACCA 1P2UA 3EASA 4NZYA 3FWYA 4MGKR 1CW2B 2FPIB 4P84A 4WNIA 3QP9A 4LTNA 1Z4QA 3W2TA 5I7EA 1S96A 4RE5A 3P9SA 1NVTA 2JKYA 1R5BA 1Z8FA 3GHHA 3TQOA 3NU1A 3U44A 4HDSA 4NXNB 2XNDA 4C0XA 1F20A 1E2GA 2PY6A 3LDUA 4U2CA 2C5HA 3SGLA 2I87A 2Y67A 3C8UA 3FB4A 2BBSA 1P7CA 1CQJB 1GG5A 4Q3CA 4QDOA 3S1AB 1B3RA 3DMTC 4O02B 5BV2P 5IXYA 5K0EA 3S2EA 1G20A 2IC5A 2PUDA 3NM5A 1GVHA 2VUTA 2G7MC 1U7ZA 2ZTVA 3AV3A 3R5TA 4HBGA 3V1NA 3WGNA 3UW1A 2GLTA 3O7MA 1V1MA 4WTOA 2OCXA 3KELA 2A7QA 1NXXA 4M0EA 4X9XA 3VHXB 2XVZA 1MA0A 1S8OA 1GCUA 3BHIA 3R6DA 4PU0A 4QDKA 5G41A 1QFSA 5AKLA 4TTSA 3H9EO 2R7KA 4NV3A 3V8BA 5JQGF 2WJPA 4C4TA 3AHFA 1ZVKA 2WE8A 3QX8A 4H9GA 4JNKA 5FNVA 1CNEA 3GJ4A 3W79A 4ZODA 1H6CA 2NXCA 1CQZA 4R9NA 2O5VA 3X1YA 1U3CA 2N1BA 3KJFA 1K8RA 1NXPA 2P6NA 4AS3A 1Y9DA 1HZZA 2WB4A 2ONCA 3N1UA 4PW0A 5HZHA 3AXSA 1JFFA 5B7NA 4ZYXA 1H6BA 4MX8A 1OFUA 1SPXA 1OFVA 3PQ6A 4L78A 1M1YB 5EIBC 2I6UA 2RHTA 1G3IA 3Q41A 2ZTUA 4GPAA 4FONA 1RQPA 2WQ7A 2G8LA 4DCJA 2Q2VA 1WDMA 1OV6A 3OE7D 1QP0A 4YCSA 3GLVA 3AVYA 1OXSC 3KQPA 1XNGA 2SKDA 3FAKA 1GADO 3R3XA 5HF6A 3QUTA 3R7LA 2I4OA 2ECPA 1WF3A 2RGWA 1LX6A 1DC7A 2ERCA 4KGXA 5ECGC 4DLNA 3FM9A 3ORFA 1GPUA 1TEXA 3AW8A 2P8JA 4FPXA 1RTKA 1SKQA 2BWJA 3AR6A 2EL9A 5D51S 4MVJE 2D0DA 3U5ZB 4HAWA 2E1PA 5IWAB 3DZKA 1CUVA 2VQDA 5TIIA 1PLJA 2JGJA 1CJSA 5LDHA 2YCLA 5AOAA 3HVRA 1QRUA 4N76A 3WLLA 2H2FA 1DWQA 2BJWA 1YA8A 1E2UA 4I5GA 5CJJA 1W6UA 2ATXA 4CW7A 1WR8A 1YB7A 2NO6A 3VSBA 5TEVA 2NV2B 4O2BA 2CFSA 2Q1SA 4FGZA 4OHKA 4UVDA 5ARDA 3E9MA 4QKQA 4ZHQA 2O1SA 4Y9TA 2YJ5A 3AHEA 5JECA 2O57A 3EZGA 3FFWA 1XXHE 3LOUA 1CUBA 3UN1A 3PYMA 2XLCA 2NUAB 4D9BA 3I6QA 4JKOA 1N9KA 2FWMX 1WSWA 4GPD1 4LYJA 4N5IX 1BCSA 1FS5A 3MPOA 4KVFA 1K3UB 1AQLA 4TZTA 1JIUA 5E38A 1UAGA 4HCJA 2B7CA 1J25A 3MINA 4KR7A 3LUPA 3IOYA 1GZ6A 2IQ5A 2XMBA 3ZV4A 4JI4B 2ZSIA 1NNI1 3AESB 2WJGA 4UCQA 2QM8A 5FBHA 2BI7A 4IUDS 3A3NA 4LNAA 2IV3A 3TLJA 4CLDA 1VPDA 2VRNA 4LRXA 3ZCRA 1B93A 2GPAA 3HJHA 3MTDA 3RU3A 5KTSA 1E79D 1HE4A 5KMGB 3HE3A 1W76A 2QN8A 3LWBA 3RUEA 5HWSA 3SCZA 4MCAA 5HVNA 3JASA 2LE0A 4UQPA 1VBKA 2WJ6A 4V0RA 1ISJA 2JI6A 3KKEA 4TXJA 1V41E 1NR7A 2B3TA 1D1SA 2Y0DA 1QFJA 2O6HA 3R5SA 3DFKA 2WT8A 1N34B 3A6ZA 2UUBB 2PXXA 3KYJB 4ZQIA 4FFWA 1JFLA 1IQPA 3BN3A 5AM3A 2C9DA 2G67A 2EQ5A 4W1SA 4F56A 4FDUA 1N7JA 2BJHA 2FZKA 2JGNA 1E7QA 1MJ5A 3CKMA 5K6AC 3K70C 4NX2A 4BQOA 2WRZA 4D4KA 2AEFA 4HGRA 4RF3A 5K3DA 5HBGA 5G02A 3GGCA 2AQIA 4OK5A 3D43A 1YKFA 3AB3A 1L4YA 1XCPA 4E1BA 4IDAA 7AT1A 1ZM3A 1PFWA 3UHAA 3PJEA 1MC1A 2WSSA 3I2FA 4BWVA 1GLNA 1GGHA 2DWPA 2GFHA 3QBTA 1IOZA 3TLMA 1X74A 4ZICA 1WCXA 5CBPB 3K35A 1WZNA 3JWGA 3ABRB 4RHXA 2PLWA 1PDOA 2O07A 3HJFA 1CJUC 1KXJA 2F1JA 4NY1A 2IH5A 3BERA 2L42A 2QRVA 3VU9A 1N33B 3RS7A 3AUUA 1SU6A 4BWYA 3GT3A 5JY1A 2DKOA 2DPXA 2TSYB 4YCAA 5CURA 4HNVA 5BPFA 3GFFA 4N6OA 1ECJA 1TVEA 2IZ0A 3IX7A 4FFMA 4ER6A 3UGQA 5HNKA 2JGLA 1VRCA 2V7EA 3GEGA 1Z4PX 3D1LA 3EGXA 2XY4A 1Q0PA 3OUUA 2VJDA 4JP5A 2GEUA 4OI4A 4P98A 4BJHB 1QKKA 2PKCA 5A4KA 2VTBA 2JLSA 721PA 5AKIA 1DAIA 1C50A 1VG0B 3M4YA 3FHCB 4QATA 4RQAA 5CT5A 1Z8NA 3A0RB 4ESOA 2R1VA 1FW8A 2WU3A 2ZB2A 1EDBA 3GAMA 3PQFA 4GM0A 3JV7A 3UMSA 2V5AA 1I80A 3LH5A 1Y1KE 5L3ZA 3UB3A 2H07A 2QROA 1Y1LA 1HYQA 2QE7A 5F23A 2OV4A 3VKWA 4PSCA 2P75A 2JFQA 3DEIA 1KEKA 2CN1A 4MYRA 4ZO9A 4QYIA 3SE0A 2PX8A 4YJFA 3DMRA 4IIUA 2UU9B 1C8LA 2ETVA 3DO6A 1ISHA 1GRRA 3DBLB 3PI6A 1PD0A 2Q0SA 3WB2A 4BB5A 1L5HA 4EDHA 4YMGA 4BEJA 3OQPA 3KPUA 1M9NA 5AK3A 5DRTA 5IJXA 1PEKE 2B4KA 4DLYA 2UZ1A 1UKYA 2FPPA 4H27A 3FIJA 4NARA 1EE2A 1K7XB 1LSSA 5KNDD 4Q9KA 4AKHA 3QH4A 4P7KA 1HXHA 2O0KA 3NWOA 2C2GA 4DNPA 2J7KA 4B47A 2BFPA 4C5AA 3IPAA 2GTIA 3KDAA 1Z2DA 1F6BA 2BTQB 1NPYA 1QHXA 2X8WA 3PITA 2B99A 1RJEA 1I8TA 2QU7A 3FCCA 4YAGA 4S24A 3TLAA 4J03A 5AVQA 1CVRA 2HRDA 4ZQHA 5E4JA 3VU1A 3JQFA 1GZ5A 5GVRA 4MV1A 4BQQA 3UXHA 1B42A 1QZUA 3L6RA 2O50A 1WNFA 4OM8A 2L17A 4NZZA 3Q5EA 3W3ZB 2EFEB 2P6MA 4FFRA 2ZRLA 2X22A 4MWEA 3H19A 2CFOA 4C6SA 4EI9A 1QIIA 4TWBA 4I08A 1X9GA 5JZBA 3EEOA 3KK0A 1P3JA 1QPBA 2P30A 7ABPA 3IUBA 3PX2A 1AS0A 1HM5A 2H51A 2HUNA 4MYHA 3OI7A 2YR0A 4MS4B 1VL5A 1XZFA 4XWYA 1G5PA 3BC1A 2VCYA 2QJTA 1KAGA 2EQAA 4Q9DA 1U4NA 2RGNC 4OTZA 2N47A 4GAEA 2PR2A 1JLHA 3CW9A 5BQFA 2ZBEA 4W8HA 4TUYF 4MW0A 3U7EB 4JY7A 3RS5A 1RACA 3N8NA 3QBJA 5A9TA 4CKWA 2GAFA 1MIOB 3WL8A 5FA5A 4B46A 2A1TR 3ZHXA 4CKBA 1SEPA 1YFJA 3DS8A 2G9QA 2D7JA 3NB0A 2X3YA 4IVPA 5I5GA 4B6FA 2AXNA 4CDGA 1QFMA 5KWSA 1RPJA 3FCXA 4X8LA 1YWGO 2CL7X 3M3DA 3V6MA 4WBNA 5BT8A 2GXSA 3LA6A 3AKZA 1OZGA 2XBMA 4BCDA 2YV1A 4YB8A 2AFHB 5CLHA 1AS3A 1YGYA 2DFDA 5BNZA 3IP7A 4PYOA 5E2AA 4A91A 3A6LA 3T7DA 2GUWA 4RF5A 5KVVA 3PFIA 4J0DA 5TPZD 2DECA 3SF0A 4ZDJA 2UVPA 5JVDB 4ZHSA 1EFRA 5K2MA 1MO5A 4HBZA 1ACJA 2CLEB 2REOA 2WWXA 2XOXA 2ZPTX 3IHKA 3IT2A 5FWYB 4YP9A 3QKTA 5SY9A 4D6XA 2OHIA 3ILVA 2O54A 1OE0A 2XMDA 4LMPA 3HCDA 4NMLA 4DM3A 3QEJA 3I9FA 2ZJ5A 4IJKA 4R8KA 3HL0A 4D56A 2ZWVA 3B78A 2OQ2A 2PKQP 3RUDA 1YV9A 1G5IA 3K0KA 1N4AA 3T1QA 3AETA 5KSWB 1UC9A 5B53A 2I6FA 4Y7DA 4BMVA 2EKZA 4JELA 1A72A 3HR7A 3QFRA 2IBMA 1QANA 4M76B 4Y2GA 2WQ6A 4YH1A 3K16A 2DBQA 4GQBA 5CLQA 5LUAA 1EEXB 5FR1A 1MXHA 1UEJA 4QEDA 4QLOA 4PLGA 3VH4A 5K8UA 3WHKA 4EG5A 2H2WA 1BFKA 2AX3A 4KE9A 2RHOA 4KQEA 4QDZA 3LX4A 1VHQA 2VHZA 4BP1A 1DOHA 5C0OE 5CCXA 3R7WA 3KOOA 1Y9JA 3W1VA 2WNIA 3PQ5A 4UKDA 3ZU5A 2APJA 2HPHA 2V0CA 1UFQA 3TZEA 2XKKA 2AJ8A 3VR6A 3WRXC 3HHEA 4D3ZA 4Z7OB 5I7OA 3L6BA 3KTOA 4LDAA 4UUOA 1R9GA 2ZB4A 2Q0QA 3AOEA 3ZG6A 1A69A 4NJOA 4QO7A 1E5QA 1DZIA 2O8FB 3SX0A 1HG0A 4NBTA 2FDRA 3KQWA 5ARBA 4OBXA 1S2IA 5IABA 4XPZA 1XX6A 3GJQA 3ZDCA 1HE3A 4S35A 3L7JA 3LO5A 2DR0A 4HS4A 1Z0FA 3DZFA 3A25A 2EBFX 4RPJA 4IFTA 4RSHA 1EVQA 2VDUE 1SHLA 2YQ4A 4HRAA 1O95A 2BKAA 2AMJA 2O1EA 2OUKA 4HY3A 3LRXA 4QTUB 4RL6A 4KBGA 4BMSA 3GLHE 4DIFA 4YCLA 2CWDA 2JAOA 5JH7F 3CEMA 4K9KA 1R0BA 1UK8A 3HA5A 4L5AA 4AP9A 2HREA 5DNEA 1CEXA 1L2TA 1CB0A 2WWIA 3DLPX 1R8JA 3KX2A 1JEOA 1TVKB 1KIMA 3RC8A 4X64B 4R8LA 3IA7A 4KNWA 2RGXA 1OWLA 3HO6A 3MOIA 4HLCA 2QXUA 4D92A 1P7WA 1JKJA 5D3ZA 2JIZA 1XF9A 2CK3D 2IU3A 4B6OA 3FCOA 3LPCA 1P1BA 2EKPA 1NZFA 2GHTA 1OV4A 4HDKA 4JC5A 1GPKA 4OQMA 5K51A 2O7NA 4MJLA 4EKDA 1VJ5A 4B31A 1PNQA 3NHPA 4GBJA 3BDIA 2J3MA 4CKCA 3SMVA 4FYHA 3N2KB 5BVHB 2GGSA 1IJKA 2TRSB 1VHWA 1XVLA 3HQ4O 5LBTA 2XUAA 1F2TA 5C3MA 1Q5PA 1DJPA 1DI0A 2Y4OA 1HR0B 5DN9A 1NP3A 1R0XA 2Q3HA 1I32A 1VRWA 2X8AA 4XZ3A 4GLOA 3PUHA 4PSKA 5HEKA 2X13A 2UVDA 2BEKA 4OQFA 4EQZA 2GX6A 1GCGA 1A0OA 1XRMA 1A4IA 4N0QA 5CX1B 1KMNA 5TARA 4I1RA 2QTMA 3QHPA 1ISFA 3EIXA 1H4VB 3FWPA 4IJWA 4E08A 3IAAA 3MYYA 3N8DA 3ABIA 3KL4A 2BW0A 4NLLA 5ESDA 1CDOA 1T4BA 1KI9A 4IIYA 4D98A 2FMKA 4M7OA 2C92A 2YVKA 3IUSA 4XIGS 2V96A 5EJGA 1JHOA 5CDUA 3LY7A 5JEEA 4HPXB 1LF5A 3V1MA 1AO3A 1GGJA 2E4YA 1SMKA 1A27A 3G89A 3DTVD 3MGCA 5K0TA 1NU6A 1U65A 3QUSA 3UC5A 5J2UA 4YALA 1QO0D 3R0QA 4R1PA 2FX5A 4Q7MB 5DHRA 2G5GX 3NIDB 3KM0A 3AY0A 4TL6A 1RS0A 5F52A 1GITA 1F8UA 3UTCA 1QCYA 4KFCA 2QX6A 1K8QA 1FQOA 4X8MA 3KPJA 4RH0A 1C29B 3GARA 3P9XA 1MQSA 1RMYA 3BXZA 4I5IA 4LYDA 1CRPA 1JKFA 4QUKA 2D1QA 3VNAA 4P9NA 1XTTA 1TT5B 2Q9CA 2PCJA 1MLDA 3FVVA 2IH4A 1HQDA 1J8DA 2PR7A 3RRZA 1JWAB 3R41A 1Z75A 5CP8A 3ITEA 3HG7A 4XAQA 1NVMB 5H3CA 1AKWA 2R8RA 4LXHA 2XX3A 3NNSA 5JYDA 4OU4A 4DF3A 4DQ0A 5KTNA 4YR7A 2RARA 2YMQA 1NRIA 1NN1A 3E6AA 1PDWA 4FMBB 4RK0A 2HJWA 1NFFA 1TM7E 2WFLA 4FSDA 3VR4D 5H4GA 2XE7A 1KI4A 3CTPA 3NGMA 4NG4A 3CKKA 4LYAA 4G0VA 3KC2A 1MPXA 3VO8A 1MT3A 5C4GB 1MG0A 3MJFA 1X14A 3SIPA 2OFPA 1HX7A 3M3HA 1VYTA 4OAOA 5ERGB 3DFZA 1SUAA 3RCBA 4BYMA 5BV1A 5DX1A 4EO4A 3D0QA 3JATA 2I9KA 1H5NA 1SN7A 1E1LA 2VKTA 3ISVA 4QPPA 2ECQA 3OEED 5ICFA 4LFAB 2EATA 1WF6A 1Q0QA 3GXOA 3PNYA 5CH8A 4D8TA 3PUXA 2ZRHA 1Q7RA 2A94A 3MILA 4A6DA 2WTUA 4OKSA 4BZZA 4EUSA 5LDDC 4FNMA 1DRUA 2A5GA 1YONA 3A27A 4JJ8A 2J3EA 4TGLA 2KQUA 1O8CA 3BH6A 1HF3A 5HFAA 5CAEA 5JD5A 5E3HA 3GFPA 1PZGA 5TS3A 1JI0A 3TQQA 2P8SA 4LVNA 3KU4A 1IZ0A 4L8YA 2P9EA 5CA1F 1HT1E 3VKHA 2PYZA 3GZJA 5K9ZA 5JNVA