2IQIA

Crystal structure of protein xcc0632 from xanthomonas campestris, pfam duf330
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
178
structure length
173
Chain Sequence
ATIYAPTVRVTPNPAWPQVSWQLLVAKPSAARIIDSPRINVRPTPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVARISDYKLAIDVRRFESDYAGQSLPAATIELNAKLLHSSDQRVVASRTFTVARPSSSTDTAAVAAAFEQALTQVTTELVGWTLITGQQDSQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein XCC0632
publication title Crystal structure of hypothetical protein XCC0632 from Xanthomonas campestris pv. campestris
rcsb
source organism Xanthomonas campestris pv. campestris
total genus 49
structure length 173
sequence length 178
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03886 ABC_trans_aux ABC-type transport auxiliary lipoprotein component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10610 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ABC-type transport auxiliary lipoprotein component 2iqiA00
2IQIA 3W1EA 2MIIA 4HRVA
chains in the Genus database with same CATH superfamily
1R0RE 1Y6QA 2XVAA 3ZOKA 4JQOA 3H5OA 2H59A 4RJJA 1L8AA 2FWPA 3GFGA 1BZYA 2QQGA 3OQIB 1YK1A 3DOOA 2A9QA 1OW3B 3AI3A 1NLFA 4G81A 3FMFA 4Q4HA 4INPA 3ZQJA 4Z3KA 3U1BA 1IZZA 3WLFA 2OHHA 4LW8A 5AVWA 1GSIA 4J0FA 2WU1A 3D2CA 3R3WA 3W5IA 1VECA 2FDXA 3K20A 3LOQA 4A2CA 2NWQA 1L7AA 2D5LA 1D2MA 1T8YA 4IVQA 3UPDA 3W1VA 5HYVA 5F98A 3EQZA 1HYEA 3DEAA 2SCUB 3HJTA 2NO0A 2GARA 4V03A 4V0KA 4CM9D 5KDDA 2A35A 3IUPA 1C3VA 2UU9B 5D1HA 4K8OA 3NC1C 2YIVX 5AOBA 5AOAA 3ASVA 1ND6A 3RBVA 4PPGA 5CDTA 5KREA 2WTUA 4ZCIA 1R10A 1R3DA 1YNOA 2PPLA 2XMCA 3CR8A 2GZ1A 3EODA 1CHDA 4GM1A 3SYLA 1W52X 3MWLA 1CEYA 2N0SA 1VTKA 2RC5A 2YFQA 3NPAA 1PWXA 1S1CA 2DPLA 1QG4A 3AF3A 4OGWA 4TSKA 4YN3A 3AI2A 1X1RA 2EC5A 4D43A 4IJMA 1U5BA 2PAAA 2VHXA 4B9AA 2OD2A 3ZIAA 5A3VA 3THYA 2PT7A 4MGYR 5JSHA 4H6PA 5GIOE 3HB5X 1U2DC 1LSSA 4LECA 2ZBVA 4AECA 4UBLA 4BUCA 1ZOPA 1WVGA 4RV9A 4D92A 1HQCA 2PX6A 4DRYA 1FMCA 3HS3A 3HHEA 1LXCA 3IUBA 4BS9A 1IULA 1EG7A 1GXSA 4MYRA 2ZIEA 5HNKA 2OFXA 1D1PA 2G72A 4F9FA 3OJCA 1YZKA 4P3KA 3CN7A 4YLGA 3OLVA 1ZH8A 4TL6A 4ARIA 3AESA 3GGPA 3NHLA 2XYPA 1GA6A 3U5ZB 1HT2E 2XDAA 1CR6A 3GAZA 4UCXA 5MHTA 5KWVA 2OFOA 1W0KD 3Q8KA 2CKDA 3G3EA 7GPBA 2RI6A 2WZQA 1OZ0A 5LD2B 3EZXA 3MOGA 4KR7A 1HF3A 1U1IA 2PKYX 3MBIA 4MYDA 5DRTA 1H23A 3DDZX 4YUAA 5HIIA 2GZ3A 5BSMA 2YNMD 1Z7YA 2C92A 3GFVA 3LC1O 5K8UA 2ZQZA 1KEEB 1ND5A 2OP0A 2OORA 4OJNA 2H0QA 1M76A 4DJEC 3GL9A 4E5YA 4EYEA 5DWDA 3LUAA 3ENVA 1J0CA 4IIFA 3M6VA 3ZZNA 2CK3A 3SP1A 4AFNA 2QL5A 1P2BA 3EQ6A 5FD8A 4IAOA 4AULA 3S40A 2ACVA 4D9EA 1FP4A 2O0JA 3UJ9A 4MAAA 3PLNA 3X2SA 4IDNA 1PV1A 3PDJA 5E2IA 4AX8A 5LQSA 4IJKA 3RJZA 4CCSA 3OIUA 3RYCA 1IONA 1JEEA 1PKXA 1RMYA 2YMPA 3P97A 1NUAA 1KC3A 4KMMA 4KQFA 5DASA 4B5LA 4DJJA 5LR6A 3EXEA 4K0RA 3FYUB 3KPYA 4RCZA 3BC1A 1ECGA 3BWYA 2O0KA 3JAWB 2NUTB 3NEJA 2FOLA 3NTLA 5JEDA 5AP9A 4C4PA 1USVA 2OMEA 1NUSA 3IULA 4XARA 2KB0A 3X1WA 2C03A 2Y0BA 4YJHA 4BV2A 1TU0A 1USGA 2QRHA 3ZG6A 4DTCA 1Z35A 2FPRA 5UKDA 3I0NA 3ZXYA 1GG2A 4IDAA 1NC1A 4QU5A 4XUEA 1DNPA 5CT8A 2RJOA 5GGXA 2EF1A 5AM2A 5JS7A 1T0IA 3K5WA 1GDTA 1U3WA 4MGKR 2CE7A 1VPTA 1ZCAA 2HD4A 3KWMA 5JS2A 1VHTA 4DLUA 3U7QB 5A0TA 4UCWA 3QPVA 1Q95A 4NWIA 3RIHA 4XYBA 1W5BA 4PPYA 1YBVA 1VBNA 2GBFA 3FCSB 1MD9A 5EZ5A 4DQLA 2YV4A 5JCZA 1YS1X 1PJLA 2VUIB 3A4MA 3N2YA 4H3KB 4IRMA 4KR0A 3GDOA 4J0JA 2QP9X 4RV5A 4MW0A 2VNAA 4D3XA 5CA1F 3DTVA 4D6YA 4DDVA 1W44A 3TQHA 4YVFA 3FPFA 1D2RA 1GSHA 2VP4A 1RQ7A 3PE6A 4L4XA 3ZWOA 2GPSA 9LDTA 4EA9A 2NO5A 4KI7A 3BWVA 4PSDA 1U2QA 5BSVA 1PD0A 3PRHA 3HC7A 5JO0A 4ZAZA 5D6NA 1B0UA 2A14A 4JB3A 2OHGA 1PG2A 4O2AB 3CF0A 2N47A 3H6GA 2HYDA 4Y1EA 4AMVA 4JMLA 3QFRA 3P1JA 1V8FA 2DR0A 1T8WA 1RE1A 2AN3A 3N70A 3N8NA 2DHCA 3VH1A 3SQXA 2GD1O 4BBPA 1CF4A 1X15A 2JHAA 3TIGA 4PN7A 1OT3A 1DG9A 1OWMA 2B98A 5I9NA 5KTRA 2BMDA 4FD2A 1KI1A 1BWSA 1C9EA 1T5IA 3CEMA 3E22A 3QV1A 5K8CA 4GNRA 2HFJA 5F9HA 3PXBA 5JWOA 2JLCA 3WLJA 1CUUA 1MRNA 1RLUA 2B4AA 2EP7A 4R98A 4RABA 5JDCA 4ZOLF 3SXJA 4CIWA 1KVRA 3PGLA 4M0LA 3AY6A 5I7HA 1K3TA 3L6DA 1E9DA 4RKYA 3PF8A 3ZWQA 4E6EA 3U44B 2D5IA 2WUFA 4G0OA 4DMCA 3JQ7B 1IHDA 4ZZ0A 2C5SA 1TLFA 2I67A 1KAEA 3A9UA 4I5FA 4MQEB 2O50A 4YAWA 1P6QA 1XDDA 3VKGA 4P86A 1RM4A 1LLDA 4TKVA 3NEYA 3WB2A 3W6PA 1FS5A 2JBAB 5A4JA 2I8LA 2UVPB 3T06B 4L4ZA 5D3ZA 2X9GA 1EUDB 4BEJA 3WLIA 4E32A 1QFMA 1ZGAA 1F4LA 4NZ9A 4QOHA 1JYFA 3C3WA 4M1WA 2OZKA 3GEHA 2XGJA 4NZZA 2ADMA 1LGYA 2GZSA 2OC9A 4FHDA 1AXEA 1P1BA 1WXXA 3UAYA 3KQKA 3F5DA 2VJBA 1J4AA 1FTNA 1LX6A 5FQNA 3EIFA 1A4UA 1VOTA 2IZ7A 3AUUA 4TM8A 3BERA 3VJKA 1ISIA 1X38A 3DWEX 1N2CA 1QGUB 2XYGA 4MKHA 5CFOA 2Z5LA 3NFYA 1PJAA 2DLNA 4U8HA 4OHRA 4WZ6A 4IW3B 1Q22A 3V1LA 5CLJA 1NXOA 1NP3A 4Q47A 1JMYA 1XP8A 2B7CA 3ZYCA 2D2VA 3QHAA 2A5DA 4M22A 2HK6A 4RFLA 1ZM4A 3HCOA 4KDEA 3KYBA 3G85A 4TSRA 1UP4A 2XUAA 3I8XA 4HGRA 4IJ5A 1WZNA 2UZ3A 4Y6RA 4EWLA 2PV7A 3PFWO 4BLUA 2XKBA 5T6MA 3DMNA 4BAZA 4EEZA 2HPHA 1GQFA 5IPFA 4BNTA 3NBFA 1EUZA 4FLMA 6PFKA 2H6EA 1N4AA 4MTLA 5ALVA 1J1UA 3PJGA 3K35A 3OD1A 4RK7A 5COQA 3KAKA 2VBGA 1I7SB 7AT1A 2A9RA 3D3NA 4N1AA 4IHJF 1T29A 4ZVUA 5B3KA 5B5SA 2XECA 1ZFNA 1TVMA 4FFBA 3GA5A 2DTDA 3LYLA 2VYVD 3GJQA 2BELA 4Q48A 2GEKA 3K0CC 4FX2A 5T8KC 3RVLA 3SZLA 3V32A 4D4GA 4LK2A 2R7AA 4DDTA 3DFKA 4CV2A 1QHYA 3D7LA 2F43A 5A7HA 5K8VA 1P1KA 3E3AA 5AUNB 1BROA 2CDNA 3WL5A 1XQ9A 4QWWA 5B57C 1L4HA 1LBEA 1VFPA 2NYVA 3IAS6 4URFA 2IYWA 2WHEA 5E6RB 2Q28A 4CM7A 4CEHA 2XMDA 1JTFA 1JR6A 3WNQA 4TVSA 1C4WA 2NOAA 2R4TA 1JL3A 2F9FA 1DQSA 3H42B 3BZBA 1KK2A 3OQVA 5BN3A 3Q15C 3RS7A 2HDOA 3AFIA 3NVKI 3W4IA 1PE0A 1TM3E 1ECCA 1KIFA 2IY9A 3BCSA 3I2JA 3QBEA 5JOQA 4DPMA 3Q2IA 1K6MA 2BYTA 1FJHA 2WQ7A 2GF2A 1IUOA 1WXHA 3ROPA 1OC2A 1A7UA 1NLYA 3FNFA 1JJBA 3QENA 4NPHA 5FWAA 4F06A 2J4DA 5GIPE 3OIFA 4GWGA 3PD7A 1XTBA 3Q72A 1G2OA 1HC7A 2WABA 5G40A 4JLAA 1BDIA 3CHYA 2ZI9A 5LP6C 1W30A 3DV0A 3LUDA 3T3MB 4RHEA 2P4SA 4L4SA 3FB1A 3VNVA 1YJBA 2QT1A 4AS3A 4UTPA 4NDNE 4CCYB 4O4JF 4ZT7A 4R0VA 3U4HA 3P9KA 1NM5A 1D03A 1UJCA 3RCBA 3T9FA 3EGWA 3I53A 1EB8A 5E1DA 4FOPA 3VYUB 2EZUA 2CMDA 4HLNA 4PWYA 4WZAB 1AY0A 4JNKA 2RKOA 1AMNA 3NH9A 4A8TA 4MK4A 3A6FA 1C3OA 4WESB 2IDKA 2FVYA 2ZTMA 2DSTA 4U7HA 3B9RA 1GTZA 3SAJA 3VNQA 3TDNA 1REQA 2ZRFA 2Z4TA 1CU1A 4MRSA 2GFHA 1SK8A 3R40A 3WWDA 2GCEA 1K0FA 2H08A 5CA0B 1K27A 1TAHA 3B5EA 4G4SP 1NLZA 1XMJA 3OJWA 4KQ6A 4BNXA 4BPRA 3THXA 3W8EA 2DYKA 1YHNA 1A7AA 1ECJA 2ZJBA 3DVAA 4YYZA 3K32A 3H2BA 4IVNA 2NVUB 5EAIA 1KMHA 2GHTA 2ZB7A 3MMPA 4NS1A 3B6IA 1QAOA 3TRDA 3UM9A 3IEVA 1P2TA 3VHQA 2C96A 1VSQA 2YV3A 4OUKX 2XCQA 3FW1A 3T3DA 4A03A 1A8IA 4P33A 5EIWA 3SFVA 1KBOA 3QEBZ 2OV6A 5A5DA 3H2KA 3KC2A 3M6AA 5ALIA 3IBSA 2X6TA 5JPIA 3G9QA 4K9KA 4NAVA 1C2TA 2G63A 2J45A 2M98A 1PG5A 2PUVA 1SA0A 2DFLA 3A9SA 3FJYA 3ID6C 4KRYA 4MW2A 4BX3A 2I6GA 4PHHA 4Q1EA 4N12A 1W34A 4PFKA 4RK4A 3DZGA 5LYJA 3T3EA 3GGOA 2IQ5A 2RK3A 3LQQA 1BEEA 5LFAA 4V0RA 1J22A 4WLOA 2C00A 1KRHA 1PL6A 4HV4A 1LZKA 1YWGO 3K9QO 2OAGA 5JXHA 4KWEA 1J2YA 1CV2A 1E20A 2A0FA 1Z2OX 3LDGA 3NV9A 4XKJA 1N0VC 1VBMA 3BWMA 4JEHA 4OHCA 5FKJA 4BVGA 4JLWA 4Z4GA 4FWBA 5EZQA 5FUMA 4S1TA 2VP0A 3WTCA 1N4DA 1UWLA 2HXSA 3FRHA 3ZY3A 2J3QA 4HP8A 2Q3HA 3BFVA 4DBZA 1ZOIA 4R9NA 3UFBA 1FTQA 4DF3A 1KEZA 1SJ9A 2NVWA 1V35A 4OGGA 3ZU2A 4AJJA 3X1JA 4BDSA 3E9RA 4ZI7B 2ZAIA 2ZAOA 3ISVA 1R0SA 1MAHA 1DAFA 3U0VA 1HZJA 3KUUA 4UOQA 3AVWA 2O8FB 2IE8A 4NCNA 4X1IA 4YRZA 4Q3AA 2F1IA 2CLMB 1EZ4A 1FSFA 1M75A 2DKNA 3K0FA 2BGWA 1IQ0A 1QHEA 2H29A 2J33A 4A9AA 1M6WA 1P7VA 3FGNA 2WJVA 2QENA 2FFJA 4RZSA 4GKAA 1SN7A 3H1GA 2IUUA 3K6SA 3BMXA 3G02A 1KMNA 2CJWA 3HY3A 3QEOA 5THKA 3TN7A 3WIBA 4ER0A 5A4MS 1QK3A 1D1QA 1YCGA 2GZAA 4Y0VA 2H52A 4B7XA 4CKCA 1XA0A 1KPHA 2AMYA 4FE3A 1QLWA 1QM5A 4JFAA 3RYFA 6NULA 3IE2A 5LKAA 4D46A 3PQEA 3SQWA 3JQEA 4M87A 5HCNA 2PGOA 2YRFA 4RA9A 1E9VA 2A1TR 2RGUA 4IYJA 5AO9A 5T41A 3RUPA 2Q50A 3MCAA 2BBOA 3QSGA 5FT9A 4E5PA 4HFRA 1XRSB 4E5SA 3C70A 3HCPA 1WULS 1Q0QA 2ZUBA 3UV7A 3E2PA 2IU3A 4MLZA 5F3RA 4D8YA 2EARA 1J9EA 5LA6A 5EP1A 1LLFA 3WSWA 2ZKLA 1Z6YA 4P3XA 4TQUS 1T5BA 3PXGA 3ORHA 5JCPA 2C84A 2PRJA 4IKEA 3B20A 5KDOA 4NK5A 2A6PA 4FB4A 3GJ8A 1XLTC 1ADJA 3CRMA 3KB1A 1EAMA 4MUMA 4PAGA 4YJ2B 4ZO8A 5C53B 4F8EA 1A4XA 2FKNA 2G40A 1J70A 1LPBB 1SBCA 1UAGA 5AHOA 2OCBA 3IPXA 5TPZD 5BSWA 5KTOA 3SBEA 1V8PA 2JNWA 5F1PA 2NO6A 2PTHA 1AS0A 1W0CA 2Z08A 3CMMA 2Q5JA 2ZJOA 5KVVA 1TEVA 2QSJA 1YCDA 1TMOA 2GD2A 1F2VA 4H7DA 1MC4A 1PT7A 1CPYA 4OKIA 3HDGA 1RYHA 3FR7A 1IPEA 2QWXA 1GGFA 3N8IA 3VZBA 4AZ3B 4EJSB 2X8LA 3MUFA 2XCSB 3AR5A 4HH1A 5LQNA 2HA0A 2O8EB 4W9NC 5HW0A 3RBXA 4F9TA 3NRJA 4Y1GA 2AMLA 2JGDB 3PFFA 4GMGA 2C8VA 5CEEA 1V5EA 3HU2A 5L7WA 4CT4B 4YJ3F 1RXCA 2XZDA 1QFXA 2HCJB 2R1TA 2WPDA 3FFBA 4PX9A 5FNVF 2DCMA 4LJAA 4JJIA 5HJ2A 2NU7B 3CY6A 4LC1A 3EF0A 4M2LA 2X22A 4YV2A 1XKLA 2VZ0A 4C29A 3D8HA 3I3SR 1OKKD 3WHLA 4PHCA 1E1RA 4Z53A 1UMKA 4R9VA 4O4HB 3CX3A 1SU8A 3EPLA 5BVHA 4AB1A 1D2NA 2XQJA 3ZNPA 1V96A 2G8NA 4RH0A 1U0GA 4EPRA 3RJ5A 1GL6A 2WAYA 1LQTA 3H5VA 1AZTA 5JAPA 1U3TA 3WP0A 4L9AA 5LC1A 3K0KA 4WOPA 1X1DA 2E7ZA 1XN1A 4GOMD 1S8AA 1SB8A 4MKXA 1KMIY 1GKKA 1SXIA 2JEYA 2OBBA 2IV7A 2AJCA 2QX7A 4WCFC 1EXWA 4Z4HA 5C1OA 5EMMA 5L3RA 4RQTA 1PK7A 1VJDA 4MHSA 4RORA 1I4LD 1EIZA 3KKKA 1IM2A 3JR7A 5ALUA 5SYAA 4ND6A 3L8EA 3V9PA 5BQ3A 1XMQB 1P75A 2G9QA 1SNYA 4XPZA 3PHIA 4QJBA 4QUGA 1RXSA 1UBUS 2HK7A 2J3IA 3DGFC 1L5KA 2BFAA 3INRA 4TTVA 5HQJA 4CBVA 2EGGA 1Z68A 1HKHA 2R8PA 2ZXUA 2CXOA 1JB1A 1AXRA 2H1HA 1LH0A 1QORA 3ROQA 3GCZA 2I4MA 3I2HA 1EM8A 1QZUA 1H42A 3F6BX 3I1IA 1XVUA 1KOJA 4Y2RA 3RWMB 2IODA 3S1AA 1ZUD1 4ZAWA 3EA5A 3A6HA 4K2HA 3T5AA 4Y2VA 1ADGA 2ZB4A 4E12A 2A9VA 4CRWB 4F45A 2VATA 1ZNZA 1IHUA 1KKUA 3JR3A 3M49A 4GXNA 3EOZA 2TS1A 2HSWA 4NYJR 2V65A 5HQ3B 1A2QA 1NYQA 1HO3A 4O2RA 1A8HA 2E4ZA 5DNEA 2PHZA 3LUJA 3EWAA 5EE1A 5ILQA 2OSVA 3WGHA 3ZCSA 1IN1A 5BV7A 2VJLA 3ITDA 5A6SB 4B4UA 1LEHA 3WWYA 4ZOQI 1ZCBA 2B83A 5K0FA 1GUDA 2QRNA 4CN9A 3PI7A 5DTJA 4MGZR 2WIJA 2XBLA 3BWDD 5JSZA 4CQJA 1SU7A 2M6SA 2AV6A 2DR3A 2NTVA 4B7UA 3IIMA 2P91A 4NOJA 3ZHSA 2MTBA 1B8VA 2IVZA 3AM4A 4HKTA 3O83A 3SOPA 2HMAA 3JQGA 4R3UC 4LY3A 1XHLA 4KO1S 3ODGA 4GGMX 4EJ2A 1NOJA 4PNPA 1L8LA 2HADA 2NAFA 5KVSA 1ILWA 1SKUA 2PX3A 4HGZA 4BQFA 5K3CA 1VGVA 4MVJE 4RTNA 1CT9A 4QYSA 4CM8A 1O4WA 3OE7D 1L4GA 1T1EA 2AXNA 1KL7A 3BL5A 2XUFA 4CQNA 3KX2A 2HH9A 3KQVA 3IESA 3KVVA 1QVZA 4F1JA 1BWPA 2Z8ZA 3PUHA 3HSYA 4U2KA 4ZTUB 3NYQA 3TI9A 3BMCB 1CQWA 1P33A 2ZIUB 2KYRA 4XD7D 1YFJA 1RFLA 4R81A 1TLTA 1RJ9A 1UZLA 3RG2A 2VJDA 4QXRA 4JP8A 4QQ8A 4CT0A 3IKJA 1FK8A 2NPFA 1Y8RB 3Q7PA 3A4LA 4FYIA 5A3SA 4OK6A 3SDSA 2W4MA 2VJNA 3BA1A 4J2OA 2H1FA 1FP7A 1RFGE 3ANNA 4IWYA 1AIPA 4OO3A 1S96A 4CQMB 1XTJA 1PBTA 1MQSA 4F4DA 1IUNA 1AUVA 3CVXA 2GNAA 4JKYA 4KEAA 4ZQFA 4LKOA 3ZH2A 1P91A 4MMYB 1BKYA 5KX5A 1L1QA 1UMDB 2I78A 2XGSA 1UP6A 2IL1A 2DQYA 4OQQA 2AFVA 4MRNA 1JKJA 2V7QD 3IEKA 1QH8A 3R6LA 2NZJA 3GVPA 4UEJA 3VTZA 5CT6A 3RFVA 3ZCQA 4ZKDA 1R16A 4RZQA 2DGDA 4DPKA 3MYYA 1Q11A 4XCXA 3GNQA 3GB9A 5HIMA 4B7AA 4MPPA 1RQRA 4ZEVA 3BMNB 1ST2A 3GGSA 4IQ0A 4KHZA 1YR7A 1SXPA 1QU3A 1QJCA 2IDMA 2V7UA 4BNHA 3M33A 1DE0A 2W2LA 3IOMA 2VNIA 1IEXA 4BNFA 5J4VA 3MTIA 4JAVC 1M33A 4NL4H 5EMKA 4FFVA 1BXZA 1H3FA 2H9YA 2C4TA 3FNRA 4I1UA 1U2PA 2WIGA 3PI6A 3EWNA 3HB1A 4PNHA 2FPOA 3JZFA 4GG1A 4Q3LA 1JHUA 1Y48E 2EX4A 3G59A 4UKDA 3I05A 3H2SA 4IQ4A 4EB3A 5BSTA 4EKGA 3AP2A 5EXSA 1C0IA 4TV8B 2NMVA 1O97D 4PLCA 1U02A 3EHDA 4HAZA 4Q4HB 3SMVA 4GMXA 1UQRA 2BCEA 1JIJA 2WJGA 3ABQB 1MB9A 3KZNA 4WN9A 2IS6A 3EBPA 2NZWA 1W2GA 3LWBA 4L78A 1TQDA 1VLQA 1PW5A 3DC7A 5GJCA 4M1TA 3DB2A 2X0FA 2P2CA 4O2BB 4TSFD 4D0NA 5AVQA 1AKRA 1WXQA 4XQCA 1NKSA 2QXTA 2OBMA 3TNFA 1KI6A 2WW8A 1GCGA 5GP1A 1NUHA 3BZUA 1JVNA 2XA1A 1VMDA 4ESHA 4DCJA 2ZUDA 4G8CA 1QH1A 3TSZA 4EA6A 2JFPA 4AJHA 1FLAA 2OCDA 1IN7A 3NTOA 4KUHA 3PQ8A 2H17A 1HNNA 4LWQA 3N53A 2HF2A 3IBGA 1S01A 3MB8A 4G65A 3EG9B 2X0EA 1DKQA 4B85A 4NNOA 2HRRA 1L5LA 2JLWA 3JASB 2VR1A 3QFFA 1K63A 4WN3A 3REFA 3UJPA 3RSQA 3QMPA 2P9FA 4KXLA 3UUGA 1CS4C 1T34A 1VIDA 4PBTA 1TGYA 2ACKA 3L9WA 3EQ7A 4FT2A 3G2IA 3UQYS 2EWVA 3THYB 1CDOA 2DBQA 3KL4A 4D8TA 4D9FA 4YMLA 3BGWA 4QELA 1NU8A 1R8QA 4AJEA 1OLXB 4E09A 7MDHA 3OD5A 2V7WA 3LOPA 2GT1A 3RRNA 2DJ5A 2ZBDA 2G04A 4G56A 4LF8B 2HFKA 1NV8A 1QHXA 4WK0B 1YB6A 3MILA 5ALHA 3DE6X 4DLNA 3L06A 4CMKA 2Y27A 1XZLA 3H75A 4QJ4A 1C7JA 1RBZA 2AW5A 1AK9A 3ZCXA 1RM5A 3AESB 3GUVA 3GT3A 3BGVA 4UBNA 1V1MB 2OHVA 1QCZA 2WJZB 5KYTA 1KKMA 3VR2D 3RPEA 1LC0A 2VUSA 1JB9A 1UZAA 3DEZA 4ZI7A 5BR4A 5JAHA 4NH0A 1OLUB 2YN4A 1K68A 1S9HA 1YE5A 3EFOA 5GONF 1UBFA 3ZV5A 3LBAA 3GLRA 3NLLA 2B78A 3IP5A 3GJRA 3NKFA 5CAEA 5AOCA 3F8WA 2RJ3A 4Y2JA 5MN6A 4GWKA 1N2BA 1M2KA 1YZNA 1W2WB 1YKSA 5EUBA 721PA 3RVKA 3DXYA 5BRAA 1RWBA 3PFHA 3R77A 1JMVA 4D9MA 4FMDB 1K0UA 1R0WA 5E0OA 4TUYB 1DKRA 5CIYA 4ZHSA 1AKTA 5C52B 2ARKA 4NBKA 1NQOA 1OIVA 1Z39A 4MUHA 4BZXA 3CZ4A 1HL7A 3C1TA 5ALKA 3LWNA 3C97A 4WFKA 4E30A 3DZHA 2BFFB 2WU3A 3DONA 4MVJD 2Q1SA 4C1NA 3P94A 5C1BA 3OP4A 4NBUA 1Z0KA 1MO4A 5EQDA 3S70A 1K75A 2Z30A 3EXEB 4HGNA 5LJLA 3O3CA 4FONA 3VGPA 1T6XA 1YB7A 3CSDA 3OIGA 5ADWA 5EE9A 1SHTX 4MCHA 2X8BA 2WUGA 4NZMA 4PFQA 2OGSA 2PZFA 3GEDA 1U9ZA 5AKYA 3SJAA 2JI9A 1HR0B 2J9FB 5AJZA 4DG9A 4FC6A 5HS6A 2G25A 5E8JA 1YDGA 2DQ4A 3BRWA 3MXOA 4CZ2A 1UC8A 1GLGA 1J39A 4QPJC 1BX0A 2Y1WA 2H31A 3QU7A 1ZGCA 2AMFA 4RFSA 3I0ZA 2XQIA 4I4TA 3KE9A 4KL8S 4WNCA 3ROTA 1NXQA 3C2QA 2Q9UA 2O3RA 2BPOA 2YWEA 4JJKA 1SKYB 4ZU1X 5B4UA 5J5VA 4B47A 2UZ1A 3FYDA 2I4LA 4CG1A 1GU1A 1JDVA 1KDZA 1CY2A 3NVDA 1HEUA 4OXRA 1GAWA 4R8SA 1GV0A 1Z7BA 4EHDA 3JCZA 4EOGA 2AX3A 1DT3A 4IIJA 2VHVA 1MR3F 3LFUA 2ATVA 2CNWA 2CXQA 3O9ZA 3D7RA 4KAFA 5DW3A 2NZ2A 3R44A 4JELA 4LDNA 2HSDA 2ZM5A 1TD1A 1XF9A 1WBDA 3B2QA 1CEXA 1NJ1A 3ETLA 3R8FA 3GRFA 3O1LA 1ZH4A 2FUNB 1VB3A 3NNSA 4JBLA 1QMPA 1JR3A 4I55F 4MA0A 3TLGB 2CBXA 1DXYA 3KWJA 1FUUA 1I1HA 1NAIA 1V6AA 1YJCA 3RG8A 3Q0TA 2ZIFA 3CLSD 4MKIA 1AQ6A 5D7BA 5FOUA 2JW5A 3I23A 1XU4A 4UFNA 2ZVQX 1XD2B 1QH0A 3MC1A 4FWTA 2DUJA 2PS1A 3WOVA 4F6RB 4UHEA 5ALSA 3OLQA 2LKDA 2FPLA 2NYUA 5JSQA 5JAOA 1M6VA 4FBMA 2PLFA 3FBWA 2I8AA 5TT0A 2VRWA 1R9MA 4KQCA 1UJ6A 2CFSA 4OBXA 4IDOA 4TWIA 5JI3E 2LV8A 3ORRA 1NVDA 2IZ1A 4C4TA 3L8YA 3G2HA 4IJQA 2GN8A 1QZ3A 3O26A 4MR9A 5GVRA 3A3PA 2XOXA 2IH2A 3KUCA 3Q7QA 5LYYA 3Q2KA 2V4ZA 4GPTA 4QUAA 2O3TA 3ROMA 9MHTA 2QN2A 1FFYA 3IR7A 4U9UA 4KU4A 1YFLA 2VQEB 3D6JA 1YMQA 2NZXA 2Z6VA 2I4NA 1RZVA 1TPZA 2BZSA 4H9GA 4AXBA 5TX7A 4ZJZA 5EKSA 3LPDA 5DCYA 4OHOA 4KQ2A 3RHTA 1RWNA 3V48A 5FV7A 1N6OA 2DG2A 3A4YA 4RACA 5CCDA 3U4CA 3RANA 3T5PA 1E3IA 1O95C 3I2GA 3Q7TA 3QWBA 4FQ8A 5BWNA 3ITEA 1C7FA 2PZJA 3W3ZB 1DMRA 2FX5A 2XUPA 2XUGA 2O4UX 1ESNA 2DVMA 3LH5A 2C7BA 3TRJA 4PY2A 4IUYA 1LBTA 4PQFA 1FFXB 1BOOA 1LLQA 2Q1UA 3R24A 2E5WA 1V5WA 5DLPA 4C78A 3U7HB 5AJYA 2OTCA 3WO0A 2QROA 1C41A 1OMOA 3EEIA 4CDMA 1NPDA 3AINA 4URXR 1ATZA 1ZK4A 4HZUB 4J07A 2HRZA 2RGEA 2WVGA 4CYMA 4IP0A 4QKQA 5JPDA 2VUTA 2X9QA 3WHKA 4JSYA 3THWA 4G1UC 2AJLI 1J99A 3QE2A 4ZYVA 1NVAA 5F73A 3LC2O 4HN9A 1H4TA 2ZYTX 4Y9SA 5DHQA 1CWUA 3JTMA 4A2PA 3Q9NA 1M34B 5JWRA 4F86A 4TGLA 3WS7A 1BYUA 1JNYA 3BIOA 5IF9A 4FFBB 1FVOA 3DBHB 4I6JA 2WUEA 4IMPA 1RKXA 4MR8A 4YXWA 4FEYA 4ZI3A 1YZUA 2BFWA 4H3VA 3KK0A 1ATIA 3H7AA 1TQ2A 2EP5A 3HGMA 4J1TC 1YQXA 4LMBA 3RV4A 4YP0A 3D6FA 4GZ5A 4C5CA 1KOGA 3CLRC 4V0SA 3VDMA 2C5AA 4CEHB 1MGPA 5DEIA 4IWNA 2OOKA 1F6BA 2HA6A 1P39A 1N92A 3KV3O 3W9BA 1WDWB 3HKBA 3VU1A 3FH0A 2PM8A 3NO4A 4BB5A 5A2QA 1JE0A 5IKOA 1G98A 4LMPA 3WB9A 5BN3B 1SCKA 1IH8A 2VKQA 3H5AA 2JIDA 4WBXC 5BUQA 1PGOA 5F1OA 2P9YA 1GAJA 3UOWA 1FTWA 5ECDA 1QOPB 3PXUA 5AW9A 4D26A 3DHYA 3EC1A 3F67A 4M36A 1FU8A 1H1DA 3ETCA 4QQRA 5DDIP 3UT5B 2H1RA 1P5JA 5AW5A 4HB0A 2F4VB 3I9V1 1VIAA 3RC3A 1F7UA 2OV3A 2H0RA 4JQYA 4DCUA 3S27A 5FWXB 3PHJA 1LJUA 3LYAA 5E6SB 4KACA 3SGLA 2CLDX 1MC8A 1FDTA 2CT8A 4GSLA 4R4JA 4KJZA 4MITA 4HTFB 4X61A 1J0DA 4FSHA 1I94B 2YINC 2WB4A 2RSLA 2CUNA 3E9ZA 2G83A 3HL4A 1XDUA 3RREA 2AOTB 2OHOA 1JBQA 1P1IA 1SKBA 2WP8J 1RAIA 3NVAA 3OU7A 3AR2A 4DY6A 2AUMA 1A96A 2JHGA 4TM7A 4YCCA 4FLFA 4MYTA 3VH2A 4CIBA 4KBYA 4HI0E 1W4LA 3FVRA 2VI5A 3RVQA 4TTTS 2Y1DA 2PKWA 3SY8A 5BMOA 4EGSA 3EHEA 5CR9A 3I76A 3FHTA 2Y99A 4P3YA 3MOIA 3ZUPA 4KHPB 1GG8A 4DLRA 4YT2A 1C3OB 2B2NA 4J8PA 4O0MA 4G5FA 3ZNOA 2IXBA 5IRCD 3F9RA 2N3ZA 4X41A 1CUHA 2ZB3A 3DF7A 4MV5A 2IXDA 4JBNA 4A10A 5KOIA 2JDIA 3V1NA 1TK3A 1VE7A 1Z88A 1ZC3A 2QSYA 3OZEA 4P1ZA 4CCWA 3EEOA 1T4MA 2QUHA 2SKCA 2WKRA 4IJUA 3WLPA 4EG7A 4QFDA 1QHSA 5I51A 2RH8A 5FPSA 3THXB 1HFJA 4ER6A 2PTGA 3CEPB 3ROZA 5JXJA 1LVGA 2FG6C 3GYGA 3U0BA 2BI7A 2RI0A 3WNCA 1PTJC 2D1RA 2XQFA 2IVFA 4UJ5A 2AN1A 2PPVA 4S35A 4QM7A 1W93A 5J2UB 3TBKA 4B73A 4J3JA 4Q9AA 1U7PA 3LPMA 3H2IA 1JDNA 1P4RA 2N42A 1XXHA 4RJIA 4C2BA 4DR6B 5AKGA 3TEJA 2A0KA 3CKLA 4R2IA 4YRTA 5DOVA 5TQ0A 4F2DA 1VXOA 2A2ZA 2QAGB 4LS3A 2QS9A 2GWRA 4PTLA 5LYJB 3ESCA 5ALRA 1B7GO 5CFNA 3OJLA 1BDMA 1BNCA 3INTA 1E9EA 3ABOB 2X9LA 3ACBA 3LQKA 5A9SB 2FPPB 3UXYA 4QE3A 3W9YA 1Y6FA 1YAHA 4QNMA 1I4OA 4RJ2A 1QH9A 3IKMB 1WDMA 3A25A 5CTJA 2HMWA 3MTAA 1O9HA 2C2ZA 4V0ME 3H9QA 2EX1A 3F2IA 3TO5A 1JEQA 4LVCA 1E3LA 1NXWA 221PA 3N8HA 3HB0A 4HDKB 5IBPA 5C81A 4LF6B 3EW9A 2J7PA 4XE5A 2ZRCA 5DIZA 3WV5A 1H8HD 1DLIA 5CDFA 3KELA 2IPMA 4DNXA 4TMYA 4NHEA 1MX1A 2NUBA 4G5HA 3OPVA 4RNDB 3A1VA 4QTUB 3TAXA 4DMKA 3W5AA 4L8GA 5BYJA 1KSFX 3ZJYA 2IU0A 1UF9A 1J24A 4L6CA 4XWWA 1NNLA 4TQGA 5F3DA 1KO4A 3ZYZA 1I14A 3T4EA 3VJMA 2ZYAA 4MCAA 1RQLA 3C16C 4TWZA 2ZBQA 4Z6KA 3SHTA 2Z3WA 3RS5A 3T5TA 1FTSA 1UJ5A 1Y81A 1ZQ9A 3LT5A 1EI9A 1KQGA 3RRJA 2PGAA 1JDSA 3K6SB 4P0TA 1TW3A 1PYOA 4M1QA 2FN9A 1ACMA 3IE0A 3DZ8A 4MW1A 4LA4A 4FM9A 3OZDA 4E33A 1OWPA 3F5FA 3MXTA 1C3JA 2AWNA 4Y2QA 1DRKA 1KH2A 3I9FA 2CFRA 5IULC 1Q57A 1BVHA 3VPFA 3UMCA 1H0HA 3GFOA 4OD0A 2F62A 2Y0CA 3GV0A 4ND5A 2ZIXA 3L7NA 1KEVA 3SE7A 2WD8A 1H2AS 3PDIA 5DI3B 2PXXA 3UJAA 2OZPA 3ZVMA 3WMFA 4AZWA 1WB9A 3QTTA 1U0RA 3BBPA 3IAM6 2WM3A 1U3CA 1U90A 3P2YA 5HUQA 3KSDO 1P62B 1V3QE 2OT3B 2V03A 2ZTLA 3PA8A 5I7SA 1ICEA 1E3WB 3I92A 5C4GB 1CLUA 1HLFA 2BFMA 2C4NA 4IYRA 1XNRB 4HNAB 5IU6A 1JEAA 1ID1A 1K8XB 4LYHA 4NU8X 5EJ2A 3RTAA 1IJKA 1K08A 1LQUA 5HGJA 4L02A 3SN6A 1TCBA 2CYCA 5IC4A 2P0AA 1XJQA 4G37A 3G5LA 3D7MA 3CVYA 4DEXA 1QSGA 1O9GA 1DTEA 2PXHA 3ELWA 4J4TA 4JGGA 3NUGA 4RA6A 1N6NA 4JYCA 4IUBS 2ST1A 1Z9BA 4AROA 3RVRA 3T52A 4ASUD 4NCBA 3EASA 4C6TA 2LPMA 1R4ZA 3KQWA 5JSKA 3G49A 4DG8A 2QM0A 1HDRA 1WD5A 3I58A 4FVTA 4W7SA 1X19A 1SVUA 4QJIA 3ZE7A 1VPLA 4Y1FA 3HNRA 5JC1A 5JJIA 1JIQA 4H1UA 4YRCA 1CQIA 4DV4B 1XL1A 2FFAA 1KY2A 4PX5A 5FBHA 4OFBA 4ITRC 4EVIA 2RBEA 3KQNA 3WRXA 1JSLA 3A31A 3T5BA 1KQFA 1LU9A 1PNOA 1Q74A 3CZCA 5TY0A 1UBHS 4IMIB 3DT9A 5K3AA 1I24A 2R47A 4RDHA 4ISCA 3EAFA 3SIRA 4MCJA 3SVLA 2R2GA 5IWCA 5HJEA 3G8BA 1RSZA 2RG7A 1NVWQ 2UUPA 1L5HA 2FWBA 1Y37A 4QGSA 1K7CA 2WILA 3BXXA 3GOQA 5DJ5A 3LV8A 2HJSA 3NP9A 4CU5A 1FSSA 2OCIA 3BWBA 4LDRA 4CI0B 5BVHB 3OFSA 5EIBD 4DT1A 3STXA 5C80A 4MHTA 2Z2ZA 2QNBA 2JS7A 2PZBA 4PVDA 4DLXA 5BT8A 5CXUA 3KQHA 1PSZA 5F2NA 5AI9A 5B7NA 3SK0A 1V16A 5L6LB 4G4JA 1RYMA 1Z34A 2Q6VA 3QFCA 4ZPJA 3QVKA 2V3WA 3G5AA 4R1UA 2PQMA 1CUAA 1RXEA 3ENKA 4S1NA 5G3ZA 4A0RA 3QF4A 5BRJA 4K81B 2FF7A 2G1UA 1SQ5A 2F00A 1G4AE 3DW3X 4L28A 3CPJB 1D2CA 2WV7A 3I45A 4DKXA 2VTBA 3TKYA 2OXCA 4WTOA 3GFTA 3ZI0A 5GMOA 2Q5FA 2WD9A 3F3KA 3B48A 2FMUA 2FW7A 4Q7LA 3WQQA 2VXOA 5C8ZA 1AB5A 5TF0A 2WQ6A 1S4MA 5TJ9A 2ENWA 2QV0A 1U0SY 2C2WA 1X2EA 2I7XA 4K9NA 1YFKA 3QWFA 4HUQB 5CPBA 2R8YA 1UJNA 4LE2A 4UAVA 5B1SA 4CLXA 5KNDA 1E2DA 5IJ9A 2HW8A 1P7WA 3ES9A 5FFFA 3ILYA 3DDHA 4XM1A 2IH5A 2MSCB 3ANXA 3J7AC 2CBZA 1L5ZA 4YV1A 4JYZA 2WM8A 2OGZA 5F33A 1IG3A 1JIVA 1NLUA 1CUDA 4XYMA 3WDMA 3H9EO 3AH8A 4JJGA 5ESDA 2CFCA 2ZBGA 3U39A 5JSZB 5CTAA 3B2NA 3EJWA 5FBZA 4QAQA 5H1YA 2J0UA 4ZT4A 4K05A 3K53A 4C6HA 4Y0NA 3ZZTA 1FNDA 3PL1A 3PUWA 5G4LA 3QGMA 5JQWA 4C01A 4OTZA 5JQGF 4EHFA 2A5LA 2X3UA 4CMEA 1P17A 1Z3CA 2QSUA 3IDOA 3COSA 4V0LA 3W05A 4FDVA 3ORSA 4LHWA 1L9XA 3HV2A 2GB4A 1QTQA 4S0ZA 3HO1A 3HBJA 2ZSAA 5LXTF 7YASA 1SY7A 2ZZKA 3ZY2A 3M6LA 3EVAA 1BEZA 1NJ6A 1UWCA 1VI2A 3U9LA 2Y8EA 2ZJYA 4XUGB 2VZEA 2Q49A 3OAAA 1RJ9B 3KLNA 1Y9EA 2Z0MA 3WYEA 5CDHA 3J81k 4PZLA 2DE0X 1U1CA 3U7GA 3PEYA 1GSAA 4ID3A 3VDNB 3W1EA 1OXSC 2RG1A 3S8MA 4Q12A 4W4TA 5J59A 1VCHA 3IH5A 3FPSA 4LXHA 4ZEWA 3WWZA 5CFZA 2VL7A 3GAAA 1VJGA 2PA3A 5IAOA 4D3ZA 2VDQB 4QOIA 3I32A 2F7SA 3ECSA 3L02A 4H15A 4GYKA 4JYBA 4WCDA 3VPGA 5L7TA 4O4LA 4NEGA 4G89A 5CNMA 3GLGE 4JLNA 3BSFA 5KOJA 3L1VA 3I4CA 1G8PA 3WE7A 1QIHA 2I7CA 3OPMA 4F60A 3QKRA 1UKBA 1FFCA 1O6ZA 2NNWB 1FX1A 1NU6A 2OK8A 4F21A 1MJGM 2F8LA 1E1KA 2E49A 4NMWA 2AFIA 1AF7A 2OP1A 5K3OA 3ND6A 5BYKA 3B85A 4WKGA 3K9LA 1SUFA 3QVTA 4FFOA 5DISB 2HZBA 4C07A 3BJRA 4DDWA 1M72A 3Q98A 3UGQA 1SCUA 1SWVA 4LHVA 3LY9A 3U7IA 2C7OA 1MJGA 3KEFA 1QIFA 4MB2A 1RMQA 3JQAA 4M9RA 1R12A 4NDZA 3WRWA 4MWBA 4AO6A 5EIXA 3FUWA 1A5ZA 1Q21A 1T5OA 3L05A 3W34A 2AFHB 1QTNA 2IYYA 2YNMC 2YWDA 3ZDZB 1OSNA 1SHLA 1W0JD 2BKLA 2F17A 4WN9B 3F97A 1S4QA 4URZR 3TFQA 3WK6A 4EGQA 2FX2A 2A9JA 2D54A 3JALB 1YA8A 3HY4A 2GTPA 2IZOA 4WZBA 1IUPA 2WYOA 3QNWA 3W5HA 4UOEA 4D0SA 1L4BA 2Y6UA 3EGXA 2W6IA 2Z5GA 3TKLA 2AR9A 5MGBA 1CJTC 1KU6A 3KZXA 3ZQUA 1S8OA 3CTMA 4MHOA 3M9XA 1G3UA 2YWHA 2DZDA 5IDWA 2IZ6A 2F1JA 4X8MA 1N5JA 1PNTA 3LCUA 3DQPA 5K8JB 5GQSA 3B9BA 4N3CA 1NMEA 1ZHFA 2XZPA 1XK7A 2ONKA 1Q84A 3DT6A 4O8CA 4B4KA 4CLDA 3EY9A 1Z4LA 1JI0A 1YBMA 1ZH0A 3TZCA 2CLEB 2BF4A 3OX3A 1THZA 4UZEA 1SVWA 5AXAA 2V6MA 2R0QC 5DT2A 4OBWA 4YO8A 4EATA 1FFSA 2F2TA 4ZGWA 1DXHA 2PSJA 3C6MA 1LI7A 4JVNA 4L50A 4MVJF 3D4PA 3P9CA 3Q9LA 1QRAA 4HDSB 4WI1A 1Z08A 3H1TA 4XWKA 1V71A 4BP8A 2V9PA 4TX1A 4S1WA 3FVVA 5KU7A 1GGJA 3OQ1A 3AU8A 4RLFA 2C31A 3DL7A 4I8IA 5AVYA 1QRRA 1JEDA 2HA5A 5IYZB 5AJVB 2AYXA 5EC8A 1YRAA 4MWCA 3MMNA 2VJYA 4PBRA 5D3MB 2RHRA 5G1NA 5FWYB 1CUFA 1DO8A 4OQFA 4RL4A 3T4PA 4WA7A 2IITA 2LDXA 2CHFA 4ENRA 5CCXA 5BURA 4XPIA 4ZYTA 1HE1C 2XB4A 4PYQA 3EGIA 3UB2A 5CEJA 4PSAA 5BR8B 1IQPA 3KLOA 1YIDA 2VF4X 2R85A 3HJCA 5D84A 5KSZA 5F2EA 2BM9A 3UPUA 1ITZA 3QPUA 2E89A 2YRXA 3F47A 1H9BA 3DAOA 5AI4A 5EWJB 5BVGB 4PGMA 4LYFA 5K99A 1P9NA 3ZCVA 3OEED 2ZYDA 2GEUA 4OAPA 4FMCB 2PZKA 1YL6A 3W5BA 2XB2A 4NU6A 5AKKA 2V8OA 4MWZA 4CR6A 5AKHA 5DNCA 5AKEA 5KSOA 1DJPA 4YALA 4W8GA 4EK9A 1KHTA 3DV2A 1CRQA 3HM9A 3ZCUA 1MCZA 4DQ0A 1YSCA 3AKDA 3PDWA 2QX8A 3BAZA 1DIGA 4B7ZA 4E13A 1ADYA 1L6IA 1RKUA 2RAUA 3KTAA 4HUJA 4M54A 4TTJA 1GL7A 1H05A 1PZHA 1SUDA 3FLMA 1X1AA 4N3BA 3CBGA 2WYIA 4MO9A 3SLKA 4I1RA 3D9QX 1T10A 3QV2A 2ZYHA 2C3MA 4GP9A 4OXQA 1ZGBA 4OI4A 3GRKA 2YVQA 4JLVA 2BGNA 3FDJA 2BJHA 4UEOA 3QHPA 3BL8A 4Y6LA 4YJFA 3VR6H 1YKFA 3FTNA 4MUAA 3IUJA 5EPUA 5KKAA 2R44A 3U3JA 3H2GA 3UVEA 1EBBA 2MSEB 1TVKB 5B1HA 1RWVA 5I7AA 4NNJA 3EXG1 2JPDA 5KYUA 2B8TA 3DEIA 1T25A 2ZANA 4A26A 4C7OA 1N3BA 3G2KA 4WUTA 6ABPA 4RHCA 4FGUA 4ZQBA 2O3JA 3P9SA 1PS8A 2QSZA 2P6MA 3MFYA 4MLPA 2XDYA 1HRKA 3TQFA 1OXXK 4ENTA 2R6AA 5LDGA 3RIEA 1DX6A 2QTCA 5I7VA 4JSTA 1XR3A 2O54A 4K6FA 4V24A 3K6RA 2IK8A 1XCBA 2W2MA 5AM0A 3U3DA 1JAXA 4OF4A 2JCVA 4MQFA 3EZLA 4GEKA 5IKXA 1WMEA 1FFBA 2DERA 3VZCA 3UHFA 1J56A 1WIWA 1FUEA 1DQNA 1XZCA 1T5HX 3FGOA 1E2HA 3VO2A 2B0JA 1E77A 3CLUD 4QTXA 3PX7A 1E1CA 3HJAA 1Y5IA 3IGFA 2PXCA 5DCUA 5FTLA 2PUDA 5JCXA 4YTEA 1J6UA 1MC5A 1A5TA 2Z1DA 2KLHA 1JQJC 3DOIA 3PSHA 4P7KA 2AG8A 3I83A 3T7KA 3UQZA 1EWYA 4KDCA 2X5JO 4N5IX 3Q3EA 2J6BA 3IQDB 3R5HA 2WAXA 4KLZA 4IEFB 4G0QA 3WGYA 2ABWA 3C3YA 4B3CA 3TPZA 1AQYA 3Q6MA 4BMNA 2OKCA 4IUCS 3TBFA 4XJTA 4MDFA 1UZMA 3DAGA 4WNAA 1RHRA 2EKBA 3CRRA 2EL7A 2BZ1A 1FVFA 1F9EA 4MV0A 1ZLXA 4JZKA 4NZOA 4C43A 2BDTA 2EKLA 3G7NA 1Y6ZA 2VQFB 3OX2A 3T3IA 3CO5A 4LGYA 1R4AA 1OYOA 4RUKA 3ABZA 4DCTA 3TMYA 2CUKA 4HDMB 5HTOA 4CU2A 2FXVA 3A58B 3HBFA 2GYWA 4C7XA 1LVUA 1FNCA 2GN2A 2WIFA 1ADBA 1OI7A 2X4GA 4QOGA 3B3QA 2V0GA 3S7TA 1G63A 2JLYA 5FPYA 3NIWA 1DAIA 5LP6B 2H1IA 3M4ZA 4H35A 1GPWB 2Q3CA 4LX8A 4YCLA 3SS9X 1Y9AA 4L6IA 3OC0A 3WL3A 3ECAA 3H4VA 1QRDA 3NPMA 3SCZA 3TE7A 5KYXB 1PHRA 3K96A 5CFRA 1QANA 1WLYA 2UZ0A 2X0NA 1CG6A 3B78A 2ILTA 4QBHA 3BDIA 3V8QA 5JV5A 1KI9A 3U17A 3GN2A 1MB3A 1Q7RA 3IOBA 3UT6A 1P8AA 2GVZC 4RZHA 3PNVA 3B2EA 3C4QA 5K0ZA 1GZUA 4XLLA 3U9TA 3HDVA 4US0R 4JBXA 5A3RA 4GI1A 4RVHA 2DWQA 1Z8HA 2YVLA 4CNBA 1T24A 1GL9B 4UBMA 2O2XA 4EA7A 3HACA 2EWMA 2TMKA 2WD7A 3F4BA 2NV0A 2PVPA 1M6EX 1W48A 1M1NA 1IE3A 2EKDA 4PLYA 1C30A 4U63A 2PO5A 1VJRA 3THWB 1GNRA 3DKVA 4IM7A 3LOUA 4AZSA 2QTAA 4IQGA 1M0WA 3BILA 4R8RA 3V1TC 1B26A 2FSHA 4TLEA 3KBBA 1SHJA 4HAUA 3Q7EA 3AVXA 4IVPA 1QS0B 3DVRX 1UJ2A 3FBGA 3OP1A 2YYAA 4DV3B 1SXQA 1XZPA 3IRUA 3TSCA 5DSZA 2OV8A 4F93B 3CZRA 1YE8A 1Z37A 4A7PA 5JATA 2WDPA 3FCCA 3MINA 3KE8A 2VF8A 4DV0B 5BW5A 1D5CA 3X1DA 3LUPA 4DZZA 1OBVA 5I9LA 3NOVA 2DKOA 4R68A 5TE9A 5JNUA 3GEGA 1V11B 3ZD9A 3L4BA 2C7PA 2ZSFA 2BVNA 2ZR0A 1MA3A 5G0VA 5U4XA 1Y4SA 4DM4A 1UEIA 1WW2A 3MGKA 2DPMA 2FUEA 3HGTA 3SQNA 1PWYE 3EGDB 4G41A 5K0EA 4AWAA 3A2MA 2GLTA 5JXWA 2FE1A 1O77A 2CJPA 3IAS1 4RTJA 4BMSA 4HNGA 1Y98A 2EJBA 4C21A 3JTEA 3WDKA 1M5UA 4IGFA 1ISSA 2DX7A 3AEKA 4G5RA 2ZWPA 3M34A 4F11A 4RK6A 5A7FA 5JARA 5L95A 1OUMA 4RZ3A 3NP7A 4N03A 5HK8A 2H1SA 2P2GA 1CUIA 1SEPA 3G7UA 1MHTA 2PKEA 3G9TA 3RGGA 4QUEA 2C3YA 2LCQA 1PNVA 4WKNA 2ORWA 2JFUA 3ZIDA 1KO5A 4E2ZA 4UPDA 5DFAA 1W96A 1NRIA 2JJ8A 3QUAA 4I1OA 2I3DA 1H2RS 4P58A 2J5QA 3ORFA 3SNHA 4EMTA 1EGAA 1RBQA 2XAUA 3AOEA 2WIDA 3GU3A 2G9UA 1I3CA 3HXMA 3URMA 1V8BA 3M4JA 1XTUA 3WBBA 4AYWA 3C3PA 3IV7A 4Z9BA 4CETA 1XJ5A 1P2FA 3QM1A 4FDUA 4RWZA 4PZEA 3ZHRA 1E1YA 1XKXA 3CCFA 5B1EA 1ZAKA 5LQAA 4LTMA 4ZC1A 4JJ7A 4R2WA 4TMVA 2HTEA 1X86B 1LX7A 4X5OA 3TVTA 5C8DA 2D5BA 2WMNB 1A5AB 5IARA 4GXRA 1TD9A 2IWRA 3HEBA 1EA7A 2HEIA 4HD8A 3G0BA 1M1UA 2CCJA 5E7JA 5JBNA 4M89A 3CWZA 5G1OA 2C7QA 5FJJA 2NSJA 1O2DA 1EP1B 1N2CE 3ZIAD 4QATA 1OXMA 1DUSA 3PRYA 2P9TA 3H8WA 4ZAFA 3PEFA 5CMLA 5BV8A 3O95A 2YWFA 1JIXA 3FPBA 4FE4A 4I5DA 3HXLA 3HVHA 4Z7NB 2XOKA 4XFJA 1U8TA 3O47A 5SICE 5KTTA 4FUQA 4G4SO 1ZK3A 3TLKA 4OB7A 5A71A 5IJZA 2QRQA 2C2GA 2W22A 3TPFA 3MJDA 4C6RA 1GT6A 4Z5XA 3NYRA 4LBVA 2IT1A 4EHNA 1JECA 3EPRA 2AK3A 5A0VA 1XPOA 3SLGA 2GH1A 3B89A 2QG9A 3LY8A 4ILEA 3NHPA 4QU8A 3WTBA 3FRJA 5HK9A 2Z09A 3MFQA 2CVHA 1E5DA 1I3LA 4BQEA 3TMKA 4INOA 4WLVA 2Q0HA 3K8OE 2DUMA 4RESA 1P4JA 1R64A 3AHJA 4B45A 4ROTA 4NCIA 2BMFA 2VCYA 3DE2X 3KYDA 4EM6A 4C06A 1CFJA 2ZZNA 1A7KA 2GKSA 2Z2JA 3D4OA 4TS1A 1W7AA 5HMMA 1RJGA 5DLYA 3EVCA 2VKTA 4GYYA 4LC0A 4IV8A 4UHDA 4WT7A 5BMVB 1KAMA 2CK3D 3SKXA 1MJ5A 1ZWKA 1WY5A 1D0IA 3PRKE 5H82A 2VDUE 3B8EA 3MIZA 1Z0UA 3B8HA 5DW0A 2ZATA 3IALA 1E32A 4KXYA 1JEQB 1K5PA 2QN7A 3B53X 3TLYA 3P0IA 4WY2A 4PHTA 5KKNB 2WTAA 3G0DA 4KG7A 4QDKA 4EYSA 3I61A 5ITZA 3T8YA 2HF9A 1T5SA 2CNLA 3TDMA 3U3KA 1YZVA 5K6TA 3BCHA 2H16A 4BNWA 3DZFA 4PRYA 3CVUA 1TDJA 2H65A 1N2SA 4UTOA 4MYUA 1H8ED 3CJRA 5DCLA 2QJOA 1SC1A 5DWQA 4E70A 1T8UA 1ECLA 3N8GA 4M1EA 1PR2A 3F74A 2OZLA 1ZHOA 1RI4A 3H17A 2ZB8A 4BVEA 4R51A 3O2JA 1U0OC 3AR9A 3N2ZB 1R8SA 2NT4A 4FJ1A 4IXWA 2OAP1 2K6GA 4JN6B 1ODSA 4G9GA 1I2CA 1DIHA 4AMUA 5BWLA 1DEOA 4RVCA 4TTQA 3AF6A 1ZQ1A 4CGZA 2GXSA 2QE7D 5CFQA 2BGKA 3T38A 4L73A 4CM1A 4GW3A 4G36A 2ZIXB 2EFCB 3IO5A 3R5FA 1VGQA 3GJZA 1M6YA 3B1ZA 3PDIB 3AI7A 4F04A 2A94A 1U7XA 4A6EA 1AUXA 3ZK9A 5ANRB 3ZC3A 2XJ9A 4TKMA 5KQLA 2WU4A 5EJIA 4BWFB 2P35A 3N9IA 1E62A 3DTVD 3I30X 3VPHA 1TMGE 1VE5A 1XEXB 1BDBA 1U2SA 2CLLB 3P26A 2WU8A 5A4DA 2A1TS 1B1CA 1F8UA 2D8AA 5HFNA 4CKXA 2XMSA 1ZX1A 4PPNA 5CGZA 2O8BA 1UL1X 3HYNA 1JFRA 2ADOA 2CD9A 2R68A 2ZXEA 1EHIA 3LLMA 4HVAA 5FUBA 2ZGVA 3TPCA 4FPXA 2VN8A 1IZ8A 3FWKA 4AS1A 4ZU6X 3GY0A 2Q2VA 2DTEA 5BSRA 1QFZA 2JK1A 2ZTSA 2RHOA 2QJTA 1SQ6A 5G0WA 1ARZA 3HFJA 3TOSA 1UEXC 2EJTA 4DAOA 4RA6B 2VP6A 3TQSA 5EKDA 1X0VA 2GJKA 3O90A 2Z2IA 5DHFA 5EIFA 1Z26A 1KYZA 5BYBA 3R7FA 7ABPA 1OH5A 3DBIA 5K3SA 2JLQA 1EDEA 1RQNA 1UBJS 2BMVA 4H6WA 4XDYA 5AHRA 4BN4A 4EKYA 5EJ8A 4DUYB 3DS8A 1GADO 4F6CA 2WT8A 1HTBA 4JLSA 4WDRA 2G1PA 1CJSA 3AWDA 4QQNA 2EVWX 1OZFA 4LQ4A 1WCWA 4RGQA 4Q9IA 3DO8A 5EZYF 4P83A 3Q6IA 3UHOA 5BP7A 1WTAA 1P19A 4QUJA 2VTDA 1Q91A 2YW2A 3Q9UA 1QGED 5DBHX 3ND9A 4RTKA 4B3SB 2P8JA 2B99A 1TZ2A 1WXDA 2DBYA 4DUGA 4J91A 2OWEA 2Q3BA 2ZW9A 3EUWA 3VJLA 4UAJA 4YXFA 4DRZA 3QQ5A 4Q5IA 1TEHA 4NZYA 1FZQA 2RBGA 5IJWA 2QTVA 4QA9A 2ZRQA 1LFDB 2QDXA 4MVJI 1GFIA 1X7ZA 2JA1A 3A4NA 3MSCA 1ODKA 1XU9A 1NW8A 3NQ41 1W4BA 4KPUA 4P4SA 4X8LA 3V55A 4EJFA 5LZ4A 4X8OA 1XDSA 2XCTB 3C98A 1X1CA 1E2FA 3WKDA 4A2WA 1C7RA 1ZOSA 1KFEB 2XB9A 3TXAA 2K5UA 4O4IB 4I4CA 3KZCA 3LGXA 3U5TA 1FP6A 3NHYA 3G13A 1G2QA 1GLNA 1HYGA 3PS9A 4NV0A 1OX4A 3QELB 4MJLA 5HPYB 2HXYA 4I36A 3IXMA 1B42A 1X9GA 2GAFA 2ZREA 1XDBA 2V74B 3JQQA 4LJSA 4M0EA 1SVMA 4OQMA 1SRQA 2VJAA 5JANA 5IZCA 1H6CA 1KDTA 3AP3A 3CPSA 3MTDA 4M0MA 1DX9A 4LF4B 5FRDA 3KLMX 2H2DA 1KKLA 3H5RA 1IHXA 3JD1A 2GJSA 4GMDA 1WUKS 2AZMA 2VTBB 3GVHA 4UJ3A 4IX9A 5LB4A 3V7NA 1NOKA 5ETJA 3VAZA 1FBTA 1N1GA 1PBNA 4R31A 2GJAA 2XKJE 2N46A 3H4TA 3FTEA 3HVRA 1G1MA 2VPTA 3WKAA 1GQSA 1I51A 5AJTA 1N0HA 5G53C 3SF8A 4JXKA 4N47A 3N39C 1T3GA 2JEZA 5IBRA 2GASA 3NTXA 4R6WA 1TNDA 2O07A 4BVBA 2TMDA 3H84A 5KWEA 5CHYA 1GM5A 4NRDA 3I9JA 1KI2A 1Q19A 1YK0A 1Y8CA 1GCUA 4QDTA 5ELMA 5IJ9B 2GKGA 2AEEA 5LOVA 2KS6A 2XWSA 3NBAA 3NNDA 3PQ2A 3HVIA 4JITA 4EH1A 1HLDA 5FPHA 3J80A 4F2PA 1JEYA 3K05A 4NFHA 1DBPA 4L3WA 2GERA 3JATA 5AXCA 1DKNA 1GRCA 1XRNA 2QI9F 5FOWA 2YY6A 4F3NA 4ES6A 5CVJA 3AVUA 5AW7A 5KWSA 2ZE6A 1UBMS 1M8KA 5KYYB 1Q0RA 1OYWA 4KWIA 2GCGA 1L4KA 3SG0A 3HWX1 3OF5A 2J0UB 3R0IA 1EWRA 1FDVA 5CA0F 1O97C 1KGDA 2QF7A 1SBYA 2I22A 2WTBA 3GLHA 2ZI3A 3KJIA 3PEEA 3L1IA 4HAYA 5BR7A 1LDYA 1B74A 3UNXA 3KETA 4AKHA 3OUUA 2AJDA 2IX3A 3D31A 1EVEA 1TTQB 5FNZA 4EPTA 3HXTA 1LDBA 4HATA 4CMBA 5EZ6B 2VDPB 1C8LA 3RD5A 4UMDA 2IUYA 2J9ZB 1V1JA 2V3CC 2HJWA 3QIAA 5EP2A 3BM5A 3D4LA 4OGFA 3UK7A 4GO1A 4DAEA 1LTHR 2R8EA 1DBRA 5CB4B 1USKA 3E3OA 2M6RA 3EW7A 1GTG1 3GVIA 4OUDA 4Q1AA 5K3FB 2A78A 1F9AA 2PNFA 3DE4X 4RE6A 5JRDS 4UHFA 2N75A 4OY3A 1ZXLA 4FD3A 1E0JA 2YN2A 4FS3A 4J2TA 2YTZA 2GZHA 4JC4A 5K9ZA 3SQLA 4BXOB 2PUHA 2CNDA 3IEXA 4Q3CA 4X93A 4HQFA 5FH9A 3WZLA 1WCYA 5AOVA 4TS4A 1ACLA 3IIKA 3PGJA 4K9LA 2V3VA 2VP9A 3H2YA 5KYVA 1NW7A 3SZOA 1EVIA 1PL8A 1NBOA 4B5KA 3GF4A 1G7TA 1R50A 3DEJA 3L7KA 3OPNA 5FBQB 3I9KA 2VJOA 4O63O 1CEQA 3T9AA 4CGYA 5EFOA 2I76A 3QWHA 3A1FA 3FMPB 2E4XA 1W47A 1XZHA 1P80A 1OC4A 3DDUA 2W8BA 2QVXX 4MARA 4E3ZA 5JTTA 5EYPB 4ZI7F 3GCWA 4AQ7A 4QSMA 3UOGA 1QTRA 4PRZA 1W9MA 1OPXA 4ESVA 3CJQA 4DBLC 3DLBA 3W6OA 2AFIB 3L7IA 4XSHA 3TM4A 2CHVA 3SX0A 3BE8A 4Z0TA 4ND8A 4YFYA 4FOOA 4BASA 4EBBA 1AKUA 5IH3A 4B8WA 2WHQA 3VHRA 3BIFA 4BO5A 3QY9A 4JGIA 1Z6GA 5IH7A 3U60B 1TLLA 2ROQA 4C03A 4OX9B 1HE5A 1THTA 3ITNA 5ULLA 5ARDA 4BNIA 4DARA 1JFTA 5PNTA 2XIJA 3RIXA 4MYHA 3SC3A 1NDUA 1P5ZB 2PZMA 4R41A 3ZV4A 1ABFA 1MC1A 3WADA 1TCVA 4ZQEA 4IG4A 4JEUA 3EVBA 1P29A 3OTWA 1C4OA 2LCFA 3F8SA 3VYRB 2HMYB 3DO5A 3OCZA 2VEDA 3L43A 1MN6A 2FPGB 5EZSA 3RWOA 3OBBA 4ONEA 4NABA 2C7VA 2K2QB 3PUKA 1HZZC 3HUUA 1T9CA 5C1IA 1SFRA 4F46A 1HE4A 2QRZA 4WFJA 4DWJA 3JY6A 3HWWA 4JH0A 5CX4A 4AW9A 5AK4A 1I6MA 2KLBA 1AA9A 3HCFA 4DCPA 4W5QA 1V47A 1IRIA 5E4FA 1IXRC 1FNBA 2B5OA 2D7CA 2J4FA 1U28A 4FS8A 4GBGA 3RS9A 3OQOA 4QUIA 1P2UA 5EWMB 2O6HA 3ML1A 3KT8A 2WWVD 3AUFA 1OI3A 4MGHA 1CLEA 4E31A 1XJWA 1HI9A 1JXMA 3C7AA 1R88A 1GDDA 4ND1A 3ZWXA 1XSEA 1G3QA 3LO5A 4N0PA 2IBSA 1RC0A 4LDAA 1VA5A 2K2WA 1CZRA 3BE6A 1B3BA 4R1NA 3UAWA 1AKNA 4ZDIA 4QG3A 3U9SA 1HL3A 3VUFA 2FEOA 2HMSA 5L7YA 4EEKA 4JOSA 2V0CA 2WFLA 2V7XA 2UUCB 2F3TA 4YPFA 3ZVLA 4ZK2A 4Q1CA 3UV3A 2D06A 3D4BA 1RWWA 4RNCA 1XCJA 3WQSB 5IC6A 5I5EA 2FTKE 1RI2A 4LZJA 3PX3A 4Q9DA 5JMWA 1G9SA 3UBTA 1UP7A 4OMUA 1KYIA 2H2WA 4X1KA 4DXHA 1QUEA 2RH9B 3HO8A 3G8YA 4BFLA 2VT3A 3OCWA 2WAOA 2QNIA 4UPVA 4YCJA 4LV5B 3IBCA 1VHQA 4BRSA 3NTQA 4RWEA 1DCKA 3ZD6A 4MIEA 2JBWA 4IH4A 1I8TA 2O2JA 3G7SA 4DZTA 2G36A 2QRGA 5HVNA 3RR2A 5FBVB 4XPIB 5AXBA 2JATA 2V5UA 1JV2B 1P0CA 4C4XA 4ZOLB 1NW9B 4JXZA 2C58A 2X41A 1ZUIA 4OQEA 4X7BA 3AKZA 1LRKA 1E0DA 3H2JA 4TV9A 5FQOA 1JPVA 2Q21A 3MUEA 4UHBA 1I7PA 5IXJA 1XNQB 3TEFA 1YZHA 1ZWLA 2I91A 1ISFA 1GP2A 2RFLA 3FN4A 3L4SO 5BN4B 5KNBH 2J5XA 1LS1A 3BRSA 4KV9A 4NYIQ 2VDWB 1RAHA 5AVOA 1U11A 2WPNA 4QJ5A 1QDUA 5DKFA 3MERA 4QEZA 1OBCA 3A36A 4YP1A 1JLLB 3KJNA 1JDJA 3CLSC 4HMQA 4YBZA 1MJHA 2OCLA 5B55A 5C4IA 1BHQ1 4ZI2A 3KXKA 4DLPA 1EWTA 3LXUX 3AHIA 1F60A 2YVAA 3REGA 4Z7OB 4P3OA 3H8JA 1J00A 1U8CB 1VPEA 2ZVJA 3DBLA 3FIUA 3WWCA 4BLRA 1G8JA 2AEFA 4MIOA 1KDVA 1H4QA 2XT6A 2KX7A 2W98A 3HMKA 4RW0A 4F7WA 2Q1XA 1HE2A 2O2HA 4RZ2A 4NU5A 3MWKA 5SZIA 5I9BA 3RUEA 1FIUA 5LPNA 1JNXX 1E5LA 3QK7A 2C20A 4TVBA 3UAGA 3KL2A 1PUJA 3OZRA 3KZVA 4NJMA 3SHWA 4TMKA 2I6UA 3QUTA 1FBNA 1A76A 5CYOA 5ECWA 2C4KA 5H02A 4KQHA 2BP7A 3AV0B 3OFJA 5J3JA 3HP4A 1N33B 2X6QA 3QXCA 1M6HA 4BQQA 1Q3TA 3A11A 1S0UA 1UXGA 3GQBB 1TJ5A 5EGNA 3WRVA 5U1PA 3KSMA 3Q0EA 5B4VA 5AUOB 5EHXA 4OJMX 2HKIA 3TRHA 2FA9A 3ZKWA 3W8DA 2WPDD 1JU3A 1DL5A 4D5GA 3MWEB 1Q20A 4XWTA 1OXUA 3UYLA 4GNKA 2B3DA 5H4HA 1G21A 1VSVA 2K7FA 4LUCA 1V39A 4U6NA 5EMNA 3FYSA 2DECA 4TYMA 3RKSA 2P40A 3P9XA 1Q0PA 1E1RD 1R7RA 3W4KA 1PVVA 4JCCA 4HNRA 2O2EA 5BR1A 5LZ8A 1F8YA 3QBVA 2Z6AA 2R6FA 1YJXA 5JAIA 2A0UA 5KNCH 3NWPA 4MWGA 2ID7A 2DF8A 3AL0C 4GKVA 3U3ZA 3MGCA 4NIMA 4XVCA 3RIMA 1FUYB 2WZCA 5IABA 2PXAA 3QYJA 3E8XA 2HRDA 1P6XA 3KYCA 5DLDA 3URKA 4EITA 4B34A 2X0JA 2E1PA 3CO0S 4F9EA 3TZ6A 2HLPA 1JZTA 2P2SA 2HT1A 4M8LA 1PJ2A 1OPRA 1QR6A 1YTLA 2JFNA 1CVRA 1EESA 4D99A 4GQBA 4CKBB 4OLFA 3CSSA 3EXIB 4H3HB 5EI5A 1ISPA 1HMYA 1NWHA 1VHJA 3IRVA 3WGZA 1L7QA 1DFGA 1VM6A 3T12A 4AURA 1N2JA 3O4VA 1XQYA 3MJVA 1F14A 4X94A 4OX9Y 2ERXA 3I01M 3GVXA 4GGPA 1Y9ZA 4P3NA 3LP6A 4XSVA 4Z9XA 4A0SA 4H1WA 3C6ZA 1ZOOA 4KQXA 1PUXA 3AJEA 1N6KA 4Q4LA 2XLCA 1SZDA 4RC9A 2ZYWX 2COEA 4D8XA 5BMVA 1OAAA 3V4RA 5AHWA 1N78A 2CE2X 2VJQA 4P5DA 4V38A 2P7IA 5JJKA 2ECQA 3TQQA 1SUIA 1NATA 2PL3A 4FFRA 5EJFA 4ZCTA 5B64A 3I01A 4LI3X 1EQUA 1Y3BE 1SXHA 2D1YA 4DFDA 1U65A 3FUVA 4YWJA 4XXHA 3JAMA 3A9CA 3ADCA 2IBMA 1IEQA 3W6UA 1NUQA 3AQ4A 3QLVA 5CFLA 1EXNA 1XZGA 2I65A 3HVKA 3HWSA 2E37A 3QKSA 4DVJA 1FS4A 2EWWA 3L7JA 1VIMA 4NEQA 1LK7A 1GV1A 2I9PA 3PICA 4DJTA 3ZXXA 2E82A 2BFBB 2WHPA 3ZWCA 3EEQA 3RHZA 5LL6P 2NTJA 4G1VA 1BVYF 1IY1A 5I45A 1DIBA 3V8RA 1E2PA 3LX4A 3NHFA 3O0DA 3IPRA 4FKBA 4TRMA 4DY4A 1UANA 3QE3A 1I6KA 3EAQA 1G5QA 2OOSA 3ZWKA 4L07A 3K0SA 3NIFB 4KE7A 3BULA 4J7XA 4I99A 1G6KA 1UPXA 1YBAA 1JU9A 3EZ7A 1EEXB 5I8PA 2FU5C 1SVIA 5HBRA 4LXUA 4PYNA 1QP7A 4TV8F 2ZJ1A 2DCUA 1U2GC 3KFLA 3HVJA 1PJ3A 3KZMA 1J0XO 3JQ8A 3QMMA 2XZOA 1M2FA 2MMCA 4J4HA 3PK0A 4R6XA 4RSMA 1XT6A 3A9RA 2GPTA 1F8GA 1M1NB 3SQMA 2WUDA 3VBEA 1WMDA 3P9ZA 4DNFA 2DBZA 1EFHA 4TT8A 4Q3BA 5DHRA 2XUJA 3B1FA 3KXDA 1KIMA 1Z36A 2NG1A 1UC5B 5FOQA 7ADHA 2J67A 3LUFA 4JVSB 4MRVA 1ZAYA 4QLAA 1WKCA 2WLTA 1PVDA 2JANA 3OECA 1XZ8A 1XHEA 5E1MA 3GO4A 3VYSB 4WVFA 3UAXA 5JDIC 5JNWA 1MBZA 1ZC4A 4KPGA 1TCAA 2OZVA 2PKRA 1ZH2A 3HE3A 4HWOA 4J0GA 4UULA 1WLSA 3ZEAA 3V42A 4QFCA 4QT4A 4DLTA 4EFMA 3C3EA 3NBXX 3BIWA 4PC1A 4CEJA 2NSYA 2EU8A 3EIUA 4HQKA 4DNOA 2WIKA 4BMVA 2GVNA 1DC7A 2Y0DA 3E5RA 3OOSA 3Q1LA 3COYA 4HLQB 1Y8AA 1RRVA 2ATCA 3ZD8A 5JH7A 3C14C 1SGWA 2W2LD 2ZUSA 3KEOA 4FWIB 1JR3E 1KY3A 1NZFA 1MO3A 2QKYA 5MN5A 1RI5A 2L19A 3CLVA 3I4FA 1R5BA 4DW8A 4EHKA 1XYVA 2P5SA 5J2TA 2CCGA 5LD2C 3OT4A 3KWFA 3ANYB 3HG7A 3SEZA 3AEKB 1D6JA 2GLUA 3C3MA 3ZXSA 5AXDA 1NSFA 4FX5A 4IKOA 4JMPA 5E2AA 4CF6A 3FOAA 4F5EA 4WOKA 2Y68A 5EL0A 1AOXA 4XSGA 1T4CB 2NU9B 3O38A 2J0EA 5EG5A 2HY7A 3JD3A 4DNQA 4EUKA 2ID9A 2R6JA 1GZVA 2Q8QA 3IV9A 5AM1A 1XZAA 2HV8A 4L0QA 3A6DA 2R7MA 1Y5MA 1EDOA 4LXXA 3A70A 3NRBA 1F7VA 1R3UA 1T3TA 1VSTA 2Q4EA 5EUMA 5F2OA 2VTVA 1M73E 3TJMA 1QP0A 4M1YA 4YIHA 2WY2D 2PIDA 1N32B 1CD5A 1Z4IA 3C85A 4PFJA 1SCQA 1Q1AA 1TYBE 1KYWA 1C3LA 5JNTA 4OFZA 4QWMA 2ZT8A 4YDSA 1K9SA 4XA8A 4FMDF 5FOXA 2ZIZA 1EKXA 1QPGA 2GHQA 3AT1A 4IL5A 4GXQA 2JD2A 1B1AA 3L49A 1RI3A 3MB5A 4U7TB 5CH5A 5B3JA 2QTBA 4OQYA 4G07A 4R2LA 4E3WA 1WBJB 3ZHTA 4JB2A 4N5HX 1I0IA 3EN0A 2JG3A 2I62A 2C9ZA 3QX8A 1E4EA 2P0YA 2QX4A 3KPUA 1T2UA 3AM5A 4C4AA 3UXMA 3UWSA 4PCLA 1ZD3A 1Z4MA 1JJ7A 1W9HA 3KFXA 4HFNA 3V7UA 1J2JA 2FPWA 2VJKA 1I4TD 2XBUA 1YUBA 2O0HA 3OIYA 4Q1BA 2I2XB 3GCGA 4ML3A 1CJVC 4UCQA 1U9CA 3TDKA 2YIDA 2ZUUA 4HVCA 5KU1A 2VUUA 2CUTA 3QTLA 4P5EA 2QUZA 2DULA 1VCMA 1Y3CE 4EY6A 2LCIA 5B1YA 3HH8A 1RZRA 1N8TA 1WHTA 4YDQA 3FVWA 1XB2A 4ITVA 1LTKA 1H2XA 1U7HA 4BX8A 1D07A 4MV8A 2BFCA 4ZO6A 4G1FA 3LSTA 2FP4B 1U8EA 4UOZA 5EVJA 4OYHA 1KK0A 5KVAA 4ZDJA 3HLTA 5KNLA 3JQBA 4IPTA 3IHLA 821PA 4QU0A 3SLRA 4E6PA 3CPEA 4G5OA 3KYDB 4HDNB 2FX3A 2FETA 4JP1A 1WCV1 5HS4A 2JAUA 3A7EA 4JQCA 2OLKA 2J48A 4K1XA 4KVGA 3Q10A 4CIAA 5CVEA 1YHZA 2AQ8A 3E7FA 1I13A 1U1DA 3UGTA 4MICA 4ZGBA 3U3RA 4ZWNA 1RMTA 2REQA 1DWOA 2H0AA 1UR5A 4XIGS 3FVQA 1TO2E 2WWTA 2QM8A 1NPTO 4WPGA 2QL7A 4JIGA 4O08A 2D0OB 4Q02A 3QVWA 4XASA 3L8DA 4JB0A 2BONA 4L4RA 1NVMB 4E4RA 1RYYA 1VJTA 4MI3A 1JLHA 1NMSA 4GI3A 4KP7A 4X7MA 3VR1A 5IHXA 1KI3A 2Z43A 3ZDFA 3WBFA 8ATCA 5KO2A 1LPPA 1T8SA 2ZSJA 3FRIA 1TQHA 2AXQA 1DKPA 1YGYA 3KQTA 3E61A 4U6QA 2FW6A 3HA7A 3MCUA 4DGQA 4JWTA 3UICA 4DILA 2GGSA 2LIPA 3IT3A 3IXQA 4AJOA 1EXDA 2LDBA 1JVBA 4K87A 5CLIA 1BO6A 1DO2A 1QGOA 3BRWD 4IRUB 3U1TA 1SHUX 4G2NA 3ELDA 4WIAA 5BWBA 3SVTA 3IBYA 1CIJA 1J1ZA 1HDCA 2Q8PA 3JXEA 4XOIA 3T0IA 1RQ2A 3VOBA 2ZIVB 1GPDG 4YECA 2ATXA 2OBNA 4F96A 2ZUVA 1HDOA 4JNCA 2X8AA 1M2OA 1THMA 2XNSA 4RGYA 3UN1A 1DEHA 4MKZA 2M1ZA 1QP4A 1MOSA 3WAJA 3JS5A 1NL3A 2O48X 3O73A 2IYZA 4FDAA 4JR2A 5EHGA 4KYIB 5GOZA 4YO7A 1LNSA 3E1SA 4BV8A 3OSUA 1JP7A 1OR8A 3DE5X 1PQUA 3GA0A 4IHAA 1AZSC 4FUTA 2CNWD 1V7PC 2O05A 3QXJA 3W9SA 4U39A 1WABA 1CIVA 1Z16A 4KE9A 1X7YB 2W71A 4ZO4A 4BJ5A 1A71A 4K6OA 4R7GA 3HXKA 2YXNA 1I1OA 3GN1A 3TQTA 3ZR4B 4TYWA 3WLOA 1YR1A 4WOCA 4Y6SA 1C1DB 2VHTA 3UWPA 3UMYA 4FDTA 1XRPA 4EDHA 1JR3D 4C04A 1E2BA 3INNA 8GPBA 3K15A 2N1BA 1Q0SA 3NGMA 2FXIA 1G4HA 1XLWA 1M1XB 1VLZA 1JYEA 4KIJA 4PGAA 3RTBA 3CVWA 2CNOA 1AUOA 1OFVA 4M55A 5TQJA 1ULAA 1EWQA 2F3PA 2NXCA 4NC9A 1KZ6A 1B2LA 2CF5A 2WA1A 2XMPA 3K73O 5ALWA 1L8XA 5C37A 2IYQA 3QPWA 4GR4A 4RO0A 5GZ3A 5G1PA 3SZRA 1EK0A 3WLKX 1DJMA 1TAUA 5FIUA 1TM7E 2CB9A 4AUEA 1OJ7A 3KR2A 3Q8LA 2BT4A 1F8XA 2RONA 3TWOA 1XPRA 3PNSA 1M2WA 2H8GA 1XXHE 4GI5A 4E5NA 3KJQA 4M1MA 5AQ1A 2PX8A 1ABEA 4FHGA 1TUGA 3UIEA 3RS3A 5E2BA 1FSPA 1NRJB 3N6XA 4C4OA 4EI9A 2FFQA 3AEUA 6CHYA 4RHXA 4G24A 3VSDA 3KM0A 3RRMA 5K0BA 2JRLA 3KV1A 4GH5A 3TCXB 4ZYLA 1G42A 3CV3A 1AA6A 2Q6KA 1GLVA 2QTVB 3PE4A 3UANA 2BSAA 4NAHA 2VLBA 1PJ8A 2NYRA 4KPUB 1V5GA 1N3IA 2ZBUA 4LVNA 2GR9A 2RAVA 3IAHA 3UUWA 2IA5A 4LY9A 4XTCS 2WKWA 1QBGA 2OENG 4LMRA 1KZHA 1Z8DA 5KSPA 3CH7A 2W2KA 4OJKA 1UMCA 1VSBA 3V8EA 5DM4A 1IIRA 4EI2A 1YDWA 3Q8XB 1JPUA 3D5TA 5DE3A 3ZDRA 4R01A 3IEIA 4E22A 2GM9A 1JSZA 2QTNA 3HCRA 3KOXA 1TM5E 3CUSA 4QICA 3ZZUA 4BKQA 1PLLA 1SCJA 1ZY2A 5CDFE 1PKEA 3E48A 5SYMA 2LD4A 2IYPA 1JYSA 3ZGYA 4LF5B 4ECEA 4A6XA 2JGIA 2XDQB 1DU4A 2C4MA 3FXAA 3DAPA 1M2JA 3V1KA 3COJA 5HA5A 4IXTA 4LCBA 1LZLA 5B37A 3SC2A 3AK4A 5THXA 4B6FA 2NXNA 4HVLA 1IWOA 1CZKA 1O8CA 3E0XA 5DBGA 1WAMA 5GOTA 1Y8QB 4JJAA 1FUKA 3G2QA 3INGA 3DBRB 5HUJA 4TKZA 3KSAC 3GLFA 4K9SA 4C0HA 1BTOA 1KBZA 4JV5B 1JZSA 3DEHA 5T64A 1EX6A 1FMLA 2ZJZA 3WLAA 1YIOA 1LA2A 2GSWA 1LNQA 1Y42X 2GXUA 1CUEA 2VWGA 4ZV9A 4YLYA 2UAGA 4Y2XA 4BECA 2ZWOA 4JLPA 4COOA 1UBLS 1YI8A 4EENA 4DV2B 2OGUA 3LT1A 3UWDA 1A4RA 1ZJ6A 4L0CA 3RK1A 1VKNA 3O4GA 4YXWD 2FN8A 1ZESA 3AFMA 4G8DA 1U0JA 4B83A 1E98A 2CEAA 3BT7A 2IXAA 1G7CA 2JIZA 1O1YA 1SUAA 3BJMA 3OZIA 4S1OA 3WGVA 1LDGA 3P9NA 4HOYA 4MS3B 3TTUA 3MLEA 2ACEA 2X40A 2K7ZA 1XZQA 4Z4IA 1K66A 3ESRA 4B3DA 3QVLA 3O7MA 1T5LA 3FGZA 2COUA 3P5SA 3I28A 4X95A 3VU9A 4ZYUA 1OD6A 1IN6A 3DHVA 4LHYA 3SNKA 4NX2A 3K2EA 1NVFA 4YR7A 5KSWB 4A82A 4FOSA 1GU0A 2NV6A 4HWPA 2WWIA 3LDFA 1IY2A 3Q11A 4LCEA 4ON9A 2C9MA 4L4UA 2ZQ5A 5BSUA 2P6RA 2XMRA 4HEA1 2CV2A 2RK4A 5TIIA 1J25A 1M54A 3FOFC 3FX2A 1JPNA 1ECBA 3PKJA 4UHJA 3T7IA 4XIJA 2HZ7A 1J0EA 2GK6A 5TNXA 2E5FA 2OZEA 2X5OA 3D8UA 4OUDB 5DMXA 5F7ZA 5GV8A 5K4HA 1NOIA 4EFDA 2VHCA 2Z2YA 3MMZA 2P4EA 4INAA 4DDMA 4YMUA 3UGJA 1CS0B 4LPSA 4Q15A 1GPJA 2J5RA 5LYJF 2HA3A 3LQYA 4WERA 1IVSA 1ULZA 5T4HA 1IXYA 1ML3A 1Z6ZA 2VP3A 1A1VA 4KO2S 5BN5B 3V8BA 5BUZA 4DGSA 2KPOA 1GSOA 4LEIA 3AHFA 3D4NA 1E3JA 2Q0SA 3GMDA 3IQIX 2PJZA 4ER7A 1WDKA 4JL6A 3MQ2A 4W8HA 1SBQA 5A2GA 3JZAA 1ZN2A 4U0JA 1FFEA 3W77A 4I50B 2IXFA 1THGA 1E8MA 1YONA 2B1IA 5GONB 3IL2A 3LT2A 2B1GA 5KYYA 4HJXA 1FSGA 3LY7A 3FAKA 4DC1A 2B1RA 2FZLA 3U56A 2F1RA 3RS4A 3VX3A 3IQEA 1FXUA 5EIOA 3HFGA 1XDWA 4E11A 3QXSA 2HJRA 4S1PA 2O8DA 1RVDA 3CUVA 1WQ4A 4M6WA 4BY9E 3WYNA 5D51S 1JQKA 1SQSA 4H60A 4W7IA 3R7WA 4R40A 3RUIA 4B3JA 1QOZA 1TTPB 4WXHA 3IVAA 5FCDA 5C1PA 1SKAA 3RU3A 1TF5A 3RJ9A 4TMWA 2Q45A 2E4VA 1X1TA 1AV7A 1YZQA 1JSCA 1Z13A 4MA4A 5CITA 2EBUA 4ZAXA 5KVQA 3I0MA 1EWVA 3IB3A 1DGQA 3FNQA 3SX2A 3JPWA 4NJEA 1GPMA 4B3IA 4LXQA 2WSYB 2SKEA 2O19A 4BLPA 4FIDA 1KEPA 3WKEA 3PTZA 5CX1A 4CM3A 4YRMA 2AIRA 4JX8A 3K3PA 2BHNA 2VNSA 3IT0A 3RVDA 3GJXC 1P72A 3BCUA 5LUBA 2GEFA 3IP6A 3EMVA 3GGCA 2HMUA 2YOGA 4M0DA 4EQ6A 1HDXA 1RDFA 4TYQA 3WSVA 1AK1A 3C5VA 2BEUA 4U2FA 4I8DA 2B34A 1W6RA 3A3OA 3L93A 5E9AA 1GEGA 1TIBA 4PC6A 4OAQA 1JBEA 4IDCA 3HUFA 1ORTA 1XTTA 3DMTC 4JQZA 5E4TA 5LA6F 3PR2B 3KT6A 3PUVA 4KBFA 4RQAA 2O52A 3N0RA 4HADA 4D1YA 5K09A 3GEEA 3G5MA 4MW6A 3HP7A 3K1AA 3O6VA 3O4IA 3UG6A 1G5IA 1TM4E 3RVOA 4DQDA 4L8YA 2H2GA 4JI0B 2P9CA 2J7PD 3CQ9A 2PRYA 4NCJA 3UZUA 3WMWA 1D8AA 3NHAA 3O0TA 1DXOA 1K9VF 1PJSA 4RGVA 2O5CA 3BBLA 1SHZA