2IQIA

Crystal structure of protein xcc0632 from xanthomonas campestris, pfam duf330
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
178
structure length
173
Chain Sequence
ATIYAPTVRVTPNPAWPQVSWQLLVAKPSAARIIDSPRINVRPTPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVARISDYKLAIDVRRFESDYAGQSLPAATIELNAKLLHSSDQRVVASRTFTVARPSSSTDTAAVAAAFEQALTQVTTELVGWTLITGQQDSQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein XCC0632
publication title Crystal structure of hypothetical protein XCC0632 from Xanthomonas campestris pv. campestris
rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Structural genomics, unknown function
total genus 49
structure length 173
sequence length 178
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03886 ABC_trans_aux ABC-type transport auxiliary lipoprotein component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10610 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ABC-type transport auxiliary lipoprotein component 2iqiA00
2MIIA 3W1EA 2IQIA 4HRVA
chains in the Genus database with same CATH superfamily
3S40A 5EHIA 1U99A 4NCXA 3BHIA 4GVLA 4O1IA 1GR0A 2ZXEA 1QM5A 4AS1A 1WTAA 3KLPX 1KSFX 4QG7A 3SJBA 1NUQA 1E9RA 2O3TA 1D4AA 3RTAA 2GAOA 3KOWA 3L0IB 2DLDA 4Q9LA 2IYFA 2M2IA 1QCZA 2RAPA 4ZDKA 2EBWA 4ZAVA 2PX5A 2PL3A 4DHWA 1J42A 4YAIA 3PDHA 3WJAA 4AJ2A 1HNXB 5JYEA 4RY9A 1ZSVA 5JCZA 1U7HA 4WESA 4CETA 3SEAA 4C2UA 1EYZA 3DOIA 1H23A 3S44A 1C4XA 1NT4A 2HRCA 3L7CA 4RLSA 3P9KA 2BKLA 4C76A 1KAOA 2I71A 5DWQA 2XVZA 2QP4A 2PZAA 1DC3A 1JGTA 1N3LA 1Z5ZA 3LO8A 4HDOB 2CVPA 1QGDA 3BZWA 4L8WB 5CNKA 2PMEA 3WLEA 2GO1A 5A06A 3SC6A 5SYNA 1CQJB 1VCOA 4FSDA 2G70A 1PHRA 3X2FA 3PGA1 2VRCD 1AUXA 4I14A 3V8MA 4Q5IA 4WFJA 3D0OA 4U39A 3UMFA 4D80A 1BEUB 1FNMA 1X0XA 2IX9A 5CT9A 4N7JA 3DVSX 5G4KA 2UZ4A 3CF4A 1GLGA 5J2UF 1EPUA 1Q74A 5F1PA 1TYEB 2GWRA 4WNYA 3UJBA 4RJTA 5JXJA 3CNOA 4EWLA 3WRYA 2XADA 1FRFS 3C0KA 1PWEA 4ZIRB 4CLXA 3O7MA 1HE3A 2C3MA 4WUTA 5EXDA 5C46F 5L45A 1FDTA 1LQ2A 5J9FA 1DWQA 2JJ2D 3ZJUA 1GFZA 2YN2A 1JEJA 5T64A 2L82A 2AXEA 1A5TA 3EY9A 2NP7A 1UXJA 2O0LA 1LLDA 3PYMA 4RLFA 3WLRA 5IM4F 3JW8A 2OEPA 2P9TA 4JP5A 4TROA 3OSUA 4JZKA 3NWOA 3FCUB 3WNBA 4B81A 5I8PA 1E3MA 1K3TA 2FY8A 3FB4A 3HG7A 2DP4E 4HQKA 5EJIA 4RS4A 4PHHA 1CS0B 3OT4A 1FP2A 1WXXA 6REQA 2GN0A 3Q0IA 2F3QA 4FHFA 2OFWA 2CL7X 3DD5A 4K6FA 1C4WA 1Y8ZA 3GVPA 4OOEA 1YE8A 1Y3BE 2ODPA 3KZVA 2O6HA 1M74A 4G1UC 5JMOA 1ZH6A 5JJLA 1FMCA 3ZZNA 3DMGA 2H2IA 4P3OA 1JKFA 4GMGA 5JCOC 1AS3A 1OLUB 2DT8A 4EK9A 5CFMA 3AOGA 3CW2A 3HCOA 5JNVA 1RLIA 1I4LD 3T5GA 5ICGA 2G4VA 5FUVA 2CGEA 4QGHA 2BFEB 3QJGA 2Q3JA 1W5EA 4R40A 4WK6A 5JWHA 3UPDA 3KJXA 1PQ4A 4DGSA 4EGCB 3AIMA 1C81A 1UQTA 1Y42X 4UTXA 3AHGA 5CX1A 4R8RA 1G59A 5E6UA 1NBWB 1J1IA 3KHUA 2ACKA 2XQFA 3SXUA 4KVAA 5A3QA 3IELA 1JAZA 4AU1A 1I9GA 1F4VA 2AFIB 2IYRA 1YHZA 2Q21A 4P3XA 4YRFA 3VKVA 4DWOA 4Q3CA 3BJMA 4HLNA 1EFAA 3OCXA 3MWDB 2ZBQA 1XMJA 1EUQA 3PE3A 1EJBA 1ORWA 2AT1A 2XCQA 3L1HA 3UHAA 4ZYXA 5A62A 5SICE 4CM3A 4HP8A 2ZJ3A 3AH8A 3KETA 1RJDA 2VP9A 1HY3A 1KGDA 3COYA 1XAGA 3GRKA 5EP3A 3LP8A 5JTUA 4A9AA 2WP0A 3FOEC 4KPYA 3WLSA 1V2GA 4S24A 2LR0A 2Z09A 3DFMA 5LUAA 1XZBA 1T43A 1CFZA 1XCMA 2F9LA 4HH1A 4LBVA 2UZ1A 2PRKA 3FNIA 2CKDA 1OA0A 3BH6A 4FDTA 4NBWA 4XH9B 1GT6A 4ZZ2A 3FXAA 4PWYA 2QRNA 2QE7D 3GPCA 5G1OA 3N8IA 4NY1A 4DCVA 3ZS8A 4NESA 1U7TA 3W8RA 2G5PA 1QX4A 2ZYWX 4X1KA 1RJFA 1Q14A 4G07A 4TSFD 1QFJA 4JLWA 2PX2A 4JVOA 1RQNA 4EP1A 2W2QA 1MG0A 4IXWA 5B2FA 2ZUBA 2R5NA 3ET5A 1P7WA 2X1MA 4YK7A 3H5TA 4AZ3A 1Z56C 2X15A 4HUJA 4RH1A 4ZCTA 1MOSA 4BNJA 5DASA 4DIFA 1XNRB 1A5BB 4K87A 5COQA 2ZT5A 3WLOA 2ZKLA 1M0TA 1QZ3A 1US8B 2BEWA 3IYLW 1EFVA 2Y05A 1W5TA 3ETEA 3Q1KA 2FMFA 1HTTA 3ROTA 5E1BA 4B48A 3HKDA 5C53B 3IUPA 1ZO8A 1NVKA 4BBZA 2YXBA 4PYRA 4YCAA 1YZTA 1N5RA 3QY9A 4J7XA 4JCCA 4Q4HB 1ZZGA 4DNQA 1NG1A 3CUEF 5BQFA 3SF8B 1CR4A 4FI3C 1RLUA 2OCDA 4BNTA 4PYKA 2C77A 2LCFA 4HPJB 4J0EA 4MK4A 3AKYA 2X58A 1XLWA 3FKJA 3NV7A 4X44A 5HBGA 4DBVO 1Q6YA 3NJ4A 4L5JA 2IU0A 3UH1A 3VPFA 5DB4A 4DC0A 5HUHA 1Z2NX 1H6DA 3CQ9A 5KAMA 3DDZX 5HUJA 1A04A 1DC7A 2BKUA 1P73A 4MGZR 4PICA 3T34A 1DAHA 5DH9A 3ENVA 5JAZA 1SBHA 4YT5A 1AKQA 1QZXA 2WSSA 4WXRA 1B6RA 1CS4C 4Y7DA 3TKLA 5LP6A 2IIVA 1IBLB 2HA2A 1ZEJA 3V1LA 2QTLA 1HFEL 2OAGA 1NP7A 4C4TA 4CLRB 1JDNA 2H8KA 2QRHA 4Q1EA 5E0OA 4D79A 3Q88A 3R7BA 5LLSA 3TXYA 1YBVA 2YINC 4CEIB 3K4PA 1QOZA 1NZJA 1YK0A 1OX4A 4P32A 3KEMA 4XASA 1DZIA 2VA8A 3VPGA 3DV0A 4Y6LA 1DPFA 1SQGA 1KAHA 2YV3A 3RYIA 3HV2A 3WGGA 1OAKA 3EIFA 2O3SA 4L50A 1SKAA 3IP6A 3MT8A 1RLTA 3H9JA 3L6RA 4IX1A 4AMUA 5JQGB 3K2IA 2XD9A 3CO5A 2P9GA 1KMHB 3PHLA 4OBBA 4XVUA 4C0AC 1IVNA 1Z2CA 1PGOA 5I7WA 2PKEA 2ADMA 3KZOA 1XTKA 3IDOA 2VJDA 1HYBA 3ADDA 1YDMA 4CFYA 1VA5A 4TQ9A 1E5TA 4UJ3A 1FSGA 3FHOA 1KI1A 1TAHA 1DRUA 3G59A 1V8OA 2XCTB 1XYVA 2LTAA 1D2AA 2YMPA 3L06A 3QYFA 4R1TA 3L79A 2QG9A 4AKTA 1W9MA 4C7OA 3DOFA 5KQPA 4B3DA 3C6ZA 4YUXA 4C2TA 5CB8A 1R88A 3R7AA 1NF8A 1HKHA 3E7WA 1T9GR 1MQ8B 4E12A 3DC7A 2QNBA 1SHTX 1JALA 1Y1LA 5H82A 5E4FA 4CF7A 1NR5A 1OFGA 5ED0A 3SVTA 2H5LA 5KYVA 1VIVA 3CZ9A 5KQMA 2I80A 3UW1A 1RAEA 3H1TA 1MJGM 1TDJA 2CLDX 3VR6A 4YQFA 1KJIA 1OFTA 1VE5A 5J5CA 4LXTA 5FNZA 1FZQA 2ZSAA 3ZX4A 4E03A 4JV5B 2HWWA 1V26A 5CH8A 5G0VA 2R2GA 4KBYA 4DLNA 3C5CA 4KREA 1J00A 5ERYA 3IQXA 2GILA 3BH7A 2VYVD 2I78A 2UVPA 1XTQA 4II3A 1KFKB 1OFUX 3S68A 4BVBA 4M36A 1A2KC 1NM5C 1XU7A 2WF6A 2ZI9A 1L8OA 1ZL0A 3KX2A 4OL0A 1U2PA 5DGXA 1LC0A 1E79A 4RK0A 3OE7A 1IPFA 2FFQA 3F6RA 2NVWA 3P9QA 4M7PA 1G55A 4F6CA 1MZPA 1VBMA 2A7XA 3FTQA 4K6CA 3T5CA 3U0BA 4COKA 2JDID 4NCBA 5EWMA 1XOIA 5C5CA 4M1YA 3RK4A 3CLUC 1T5HX 4RKQA 1XMVA 3ZBQA 1GGMA 3BK1A 1ZD4A 3ER6A 4FR0A 4B6FA 4DQKA 1A5SB 5IVIA 5KS2A 1TW3A 1FP4B 3EXIA 2OA0A 2OYSA 2JAHA 4A16A 1H69A 3PPXA 1MDFA 4P4GA 4TZ6A 3PRJA 3UYLA 3CYFA 4G3XA 1IXKA 3I9NA 4RIIA 4UNNA 4UE6A 4EG4A 1EP1B 3QVMA 1ULZA 3RGGA 1YQXA 1X80B 4RSRA 3UJDA 3G5MA 2REQA 2H59A 3BXPA 3LVRE 2C0CA 4M1TA 4NWIA 2VH2A 2IUTA 5J5VA 2B4RO 4MQBA 1DCFA 2XMDA 1C8BA 1KXJA 3B1YA 4JJ6A 1VI2A 1PSWA 2AFVA 1B6SA 4ESHA 1JSZA 3KFXA 3PHIA 4TYWA 1A8QA 1UBHS 2DSNA 5EIEA 4OHFA 1EXMA 2JLZA 1BH2A 4Z0PA 1FL9A 3BTOA 4D0GA 2WD9A 3EVEA 4FDUA 3NBXX 1N4DA 4F3CA 1WU8A 3P2EA 2F90A 5A4IS 2CVOA 3PVZA 4I36A 4CG3A 4X85A 3CTMA 5JT1A 1BEZA 2CY0A 4UEJA 5AW2A 2C00A 2GYVA 4H3SA 3DWIA 2I4IA 1Z8HA 2P6MA 3AEQB 4RQUA 4US0R 4IX9A 2G1KA 1F6BA 3GDFA 5FPPA 1S2LA 3KL4A 3KLBA 1S8FA 1Z6YA 3OZIA 1IDOA 4TTRA 5HK9A 4TXLA 1PJAA 3Q6IA 1N1GA 2F17A 2LBPA 2NADA 1V95A 2G9QA 1ZOSA 3NT2A 1PBNA 3N86A 3TMYA 3UOGA 1P7PA 3Q6MA 3MGCA 4P3PA 4URFA 3MIZA 4N3GA 4AS2A 3W2IA 1ECFA 1NR1A 4Q9HA 1UK7A 3M9XA 3OZXA 5A4FS 3O3MB 1TM1E 2D00A 3PA6A 2X4GA 1CQJA 1FRZA 1KI3A 4CV0A 4N5HX 2OV2A 1H2YA 1ZHHA 4DR2B 2IP2A 1DUSA 1E1KA 3EN0A 3LCJA 1NTRA 2D4HA 4WK2B 3NBKA 2WEKA 4BKPA 3GBVA 3KALA 1QJCA 4AYTA 1HURA 4H0CA 4BLQA 4X6UA 4Q3EA 4U4AA 5F73A 2P30A 5IDYA 1ZD5A 4HZUB 4PVDA 2P6UA 1GNVA 1LX6A 3BTVA 1K0FA 4ZIRA 1C8KA 1PKEA 3PXAA 3NTLA 1OI2A 4FB4A 5IKEA 2NYRA 3HSKA 1D03A 1ZOPA 2PRSA 2HKIA 3UMYA 2IYUA 4I5FA 4RBNA 4F1KA 2AR9A 3L0ZA 5KREA 3MUEA 3GEPA 4KO1S 4KO8A 5BSUA 3FNFA 4DCJA 3CRMA 4UHKA 1O97D 3GT4A 1YUMA 4IF6A 2G88A 2B98A 1JQ5A 3QOYA 4RPGA 4KQGA 3LUJA 4RPJA 2AR7A 1CS0A 1UAGA 3QTBA 4LHEA 4LI3X 3V8VA 3U49A 1AGRA 1SVUA 2FZEA 4ZVMA 2YMLA 3C41J 4DXHA 3KK0A 1P2SA 4W7SA 2H4ZA 1PV2A 5DULA 3UWOA 3E7FA 3ZU4A 3DTVA 3IV7A 2P4UA 4YI5A 1HL7A 1XDGA 1UDBA 2WFZA 4PYLA 3WFIA 1QHEA 4OFWA 5KCMA 3N8HA 3U3MA 3VJLA 1VMAA 4G5OA 1SC3A 2D1TA 2J3KA 2P8SA 4HXYA 5K99A 4ZC8A 2FH5B 4UXHA 4XQGA 4WJZA 4B75A 3KR1A 3PIIA 1OLUA 1U7ZA 5IFKA 1N8KA 4PTLA 5GMOA 4EFLA 2I7XA 4QDZA 2BFEA 3L7AA 2DE0X 2VUUA 1C7JA 1DPGA 1AUPA 2GJSA 3HJTA 3KR2A 2CFRA 2R8PA 2ZPAA 4KXFB 3RUPA 1QIFA 1P80A 3DKKA 2D3WA 3L8ZA 4ZOAA 2VRBA 1CERA 1VJGA 5EWLB 2GM9A 1E64A 1QHYA 4V2UA 3BGWA 2AFIA 4AG5A 4MIEA 4PZ0A 1GR1A 4RE5A 4DDKA 3D1VA 4W63A 4YCCA 2WMDA 4EB0A 1X7HA 3RIXA 2G0TA 4JLJA 4QFMA 3CKLA 1GNPA 2GBLA 4LY3A 4WSOA 4EENA 3AF6A 2JLCA 2Y76A 1KBQA 2A5JA 5A4JA 3V4VB 3J80A 4JASB 3ANLA 1KWKA 4OYLA 5ISMA 1E5LA 2P3QA 3NR2A 3PXDA 1IJFA 1Z5WA 4ZAZA 3ESYA 1P9RA 2AZDA 4MMYB 3ETGA 2OV3A 3DZ8A 3JYPA 3WWEA 5ENDA 5EVJA 2EATA 2OLEA 3WMFA 2FPKA 1VP3A 2IU4A 3ULKA 3KJHA 3QBEA 4R05A 1ZSNA 4ABYA 1LSSA 3GRVA 3JVIA 4LSGA 3G8BA 3PPVA 4ZHQB 3EULA 3I45A 3JU3A 1U9IC 4C29A 3EQ9A 4U1RA 4YRDA 4ZQFA 1OXVA 4BJHB 4AAYA 1I10A 1AJEA 2YBDA 1G9TA 4I19A 3NVDA 1FQJA 4NS4A 2GN1A 1HL3A 4NBRA 4BATA 5JD6A 2QUKA 4R7GA 3ZGZA 3PXXA 4QUJA 3U9LA 1G8JA 3W3AA 1ADBA 2BJWA 2HXGA 2GEVA 2HU5A 1RR6A 2I8CA 2P1ZA 3HWSA 4WOBA 2UXCB 3QU9A 2GK4A 3Q3VA 2G1UA 3WGQA 5FWNA 1BA3A 3V1YA 5D1NA 3T3IA 2IGBA 2OBYA 3LFHA 1T9KA 3W8DA 1EM8B 1T0BA 2Y1LA 5BT8A 5HX7A 2P2GA 4E5NA 2L17A 2PSFA 1KYTA 2F00A 5F52A 2JGDB 1US8A 3P9YA 4P7KA 1JBKA 3WA6A 3IXMA 1ISFA 3WBFA 1WB4A 2AGVA 3KOXA 1ZKDA 3LXUX 3HEAA 3NZEA 3QJ5A 2COUA 1SB8A 3AERB 1PDVA 3I2HA 4AC9A 3VR5D 1V8DA 3CNLA 5CHEA 1I5EA 3A14A 3PIDA 4CDNA 1N2JA 1SM4A 1T5BA 2AD1A 5EKDA 1N7GA 4Q4HA 3RVBA 5CPFA 3S2YA 4FLFA 3EWIA 3I1FA 1PWHA 2XV1A 1LH0A 2VXOA 1G16A 3SF8A 2OSVA 2HRQA 5DBFA 2X86A 3BGDA 3ROFA 3OTHA 4CT4B 4ZREA 4ECAA 3H11B 1SKBA 1PI3A 1X92A 3LQQA 3M9WA 4KV7A 4M22A 4PO8A 4RTNA 4N5LA 2EQAA 4UCXA 5H8WA 1XMOB 1DBSA 4BVEA 2C4HA 3NC0C 3RIHA 4HEA6 1YFLA 1BW9A 3PV0A 4KO4S 2EJBA 4C4PA 7YASA 1SUAA 2IW3A 1SG9A 3GDOA 1U02A 1DC6A 2HIGA 2OQIA 3F6BX 1U28C 3U7JA 4TYMA 3FNBA 5JO0A 3R7FA 2W58A 1BX3A 2NSYA 3LX8A 4HKTA 4N48A 2BY4A 4DLXA 3CX8A 2WABA 1JMVA 2I1VB 2ZBEA 3HCCA 1X7WB 5ALNA 4RZSA 4AS3A 4QT4A 3S0JA 1EX9A 1FLVA 2CDAA 3F74A 5L7WA 1LPBB 4CEIA 1L7AA 1UWCA 1UXOA 3AHIA 4HYYA 2VP6A 3LYHA 1SUCA 3BIOA 3JV7A 3T95A 1L1RA 2ECQA 2RHMA 4NEGA 5JZBA 2B92A 3QUQA 5L4LA 2JFUA 5JQGA 1V6AA 1CUHA 3GYGA 1KMHA 2CXPA 2IHYA 4EX6A 2R7LA 2HV8A 4MS1A 2FCAA 3STHA 3WZLA 2XGSA 3O83A 4EARA 4DIBA 3I6QA 1QVWA 3QX8A 4PNPA 3O4RA 3S8MA 1YZYA 1FMFA 1AUOA 3DOCA 3VO9A 4E46A 3WK6A 4ZEXA 3X3HA 1B6GA 4EHLA 5CB6A 1GZVA 4G37A 3FWZA 3WAGA 3E18A 4CDRA 3OIDA 1HFWA 2QSJA 2I33A 4JUBA 3T0IA 1UBTS 3HVUA 1JILA 1XRSB 3IBTA 1F0YA 1GRQA 1TJYA 1THGA 4WXEA 2X9LA 3MB8A 3EUAA 3U44B 3ZVNA 1I94B 1GN8A 2X2PA 1LSUA 3OUZA 4Y2RA 4O6VA 1CVLA 2D1YA 2Y9PB 2R6AA 2CCJA 1EA5A 1YRAA 1FVHA 1RIIA 2ATEA 3T38A 4FM9A 1J8FA 4DEYA 3KOOA 3L18A 2OGTA 4TVBA 4DRXB 4CW7A 1YZLA 3UBMA 1XMQB 3B8HA 4RQBA 3DCYA 3GGSA 3IRUA 5JH7A 2G36A 2JZNA 1Z62A 4OX9Y 1YONA 1DBWA 5EKUA 3LFTA 1QE0A 1YL6A 4U7WA 3U3ZA 1NXOA 2QA5A 1PVOA 3DZBA 1D1PA 2PWYA 4L8FA 3ZU2A 3T9AA 4UASA 2VZ8A 3U1VA 1AD2A 2AYYA 3A6HA 2QX7A 3K09A 4I1SA 3ZK7A 1J2JA 1O57A 2BR4A 2O0MA 2GCPA 3DZGA 1C29B 1GGFA 1E4YA 1DAEA 4M1QA 1EAYA 1DIGA 1G4UR 2WWGA 4Q7EA 1DIHA 2V9ZA 1VIMA 4UNQA 2VEOA 3VYWA 3W5AA 4QUAA 3MJCA 1MH9A 3IP7A 3BCUA 5FQOA 2J4DA 2KM1A 3ZWXA 3U7IA 4F2WA 2CL5A 1IQUA 1B16A 3WQHA 2FMUA 4H77A 2EDCA 3VKFA 3MOGA 3UHFA 1A2BA 4U6NA 1PNQA 1ZNWA 2J59A 2NV2B 3B6EA 3CCBA 2NM0A 2EU8A 5T57A 1FP4A 4ZYWA 1QIMA 4NH4A 3D3JA 4RWEA 3T12A 1PL8A 3LOUA 4DLTA 3C7DB 3CIOA 1NUPA 1P60A 3ETJA 4UBOA 4FOLA 2WIDA 2DH5A 1CQPA 4YDHB 1X80A 2TMYA 3W8FA 1N1DA 4M98A 4URYR 2NTJA 5GOTA 5ADVA 4TV8F 1O0BA 3ZHSA 1T8YA 3H2HA 5JNUA 1RWNA 4P33A 4GSYA 3E9CA 5IYZF 3K5PA 3SBOA 5A04A 2G09A 2MR6A 2CZQA 4TS3A 4EECA 3N2EA 3ZV5A 4DMGA 1GQ2A 3HDHA 4OGLA 1XPRA 1BKSB 1N78A 4KWIA 1JTVA 4LV5B 2N47A 3EEIA 4OH7A 1IZ0A 3LGAA 4FZRA 3QWFA 3AR6A 4U9IS 3DFIA 3U80A 4YAKA 3GIWA 3EVAA 3KQSA 3ON5A 4PZZA 4INJA 4NJOA 5C37A 3AHEA 1C7ZA 4UCQA 4GUAA 5DN9A 5LQRA 3VSBA 1DUIA 3OF2A 1NJ2A 4OAQA 3B78A 4D9MA 1AKTA 4GPTA 2BMJA 3NLLA 3IMEA 3QHPA 3G3EA 1ZW1A 3AEQA 3QKIA 1DXQA 2WNHA 3FCCA 1ZY2A 1RS0A 4NS1A 2QJFA 3SEQA 4CUZA 2XHEA 3BAZA 2XNCA 2ZVDA 3KWMA 1B00A 1A7KA 1A8PA 1II8B 1KJJA 1NBHA 1RQXA 2X41A 3NHKA 2PT5A 4UOQA 4INPA 4B46A 4PQYA 3QBTA 3PC2A 3T0GA 4MGEA 1I01A 2C7OA 2PNFA 2VDJA 5DTEA 1GTZA 2WQ6A 3LL7A 1H4SA 1E69A 1PJ2A 3MK31 4N01A 1KEVA 2QD3A 4QDOA 1TZMA 4FZVA 4C3OB 2XTMA 2NXEA 4XDGA 1SZDA 1REQB 4LEIA 2ZANA 3TUZC 5BSKA 4H6XA 2NO7A 2XUPA 5CXUA 2JAUA 4MWSA 3DJYA 1GJRA 1NW7A 4MJ7A 4O8CA 4OHPA 3ELWA 4DV5B 3B85A 5ECDA 1M1XB 2Q6LA 3H65A 5FEUA 2NPFA 2QJTA 3EZ7A 5ER6A 4ZANA 4QNNA 1EFDN 4RFVA 5F5NA 2ONYA 1JLLB 2R6GA 4KAAA 3UGTA 3CRQA 1IHOA 2VNKA 3DDNA 3TLJA 4LNAA 3ROZA 1PFKA 3D6TB 5A0VA 4G1FA 3KOUA 1Z22A 3OPNA 4O4IF 4JGIA 1AB6A 4RHYA 5JNSA 2LCIA 3DEIA 2BFFB 4KWHA 1DLJA 4DM4A 1GPMA 1KO5A 1MAVA 4WZAA 3LKDA 5G0SA 3IVRA 3JAKB 3WIVA 1WF3A 8OHMA 3MHTA 5F5XA 1XN4A 2OFFA 1ZR4A 3BM5A 1TCBA 2QRLA 2VXYA 3DCJA 1FQWA 3I0ZA 4E32A 1QYIA 2QLMA 3CKMA 4O2LA 5IH7A 2FFJA 3V7FA 1BIFA 4JI3B 3FMPB 3C3AA 3SFZA 3FFBA 4L9RA 4S1WA 5AT1A 2GPAA 4KX3A 5JU6A 4GX0A 1H4TA 5JAUA 1BJTA 4MHOA 3VR6H 1NVMB 4EABA 4BUZA 3TJZA 1LJ8A 4K7JA 4RD0A 1OB2A 5FPTA 1NDUA 2OCBA 2ZXFA 3GK3A 1QIEA 3HGQA 1JDBC 4QJ5A 2C96A 1ZD8A 2W4MA 3TRKA 1MA0A 2CK3A 2Q41A 4HDAA 3ZH2A 1KFBB 3VOTA 3VV3A 2VK1A 3MAGA 2JLUA 4R3NA 1BC5A 1BVUA 1IY9A 2IYOA 2O2YA 2OGWA 2XA2A 1HNWB 2V54A 2IEDA 3MEQA 3ZHCA 5LQSA 1B0UA 2CCKA 4QRDA 4DIUA 2C5LA 1P45A 2OMKA 4HNGA 3OE1A 5EWLA 4LC0A 4E7PA 3GR6A 3B1JA 1XELA 1K88A 2NTYC 4KQFA 1ILEA 1NUSA 3ZBPA 3GZNB 1OASA 4K6GA 4YALA 1B23P 1MW9X 2QRQA 1EB8A 1E32A 4NMHA 5E38A 3COJA 1U1GA 2MDTA 4PV7A 5AVSA 1T6BY 3PFKA 3PHHA 4NBNA 3OHMA 3W77A 3T3GA 2CL6X 4CL2A 1USWA 2WIGA 4NCIA 2I7VA 4AZ0B 4D44A 4M54A 4OY3A 3V4RA 2O5EA 4D9FA 3NDBB 1V5FA 1DKUA 2DKOA 2RARA 4U3JB 4YRCA 3TQIA 4HDRB 2MYUA 4DTCA 1IB0A 3VUFA 5F4BA 4HLUC 5I7FA 2JC3A 4BBAA 4ZHQA 1VXRA 2DU8A 4U7FA 2Z1DA 4W5WA 4DJFC 4YLEA 1QK4A 1E8DA 4G5FA 4QLAA 4RS3A 3OKAA 121PA 3UA3A 3T4XA 5A4MS 4ZVTA 3LZCA 3B8EA 1R0RE 3LOPA 4JYZA 1K6JA 3DKVA 2X5NA 2Z8XA 1HOTA 5JZSA 3BYZA 4DUPA 5JXGA 4B82A 2XZPA 4JC4A 3IA2A 1KHHA 2JJ1D 1W29A 1U3VA 1RYNA 1FCJA 2GH1A 2WKSA 2WYVA 2JH9A 4OK3A 1L7DA 1IXYA 1GPKA 1G7RA 3UG7A 1EM8A 3FNGA 5GJCA 1UOEA 3Q2OA 1O95A 2V7TA 3DO8A 3IPCA 2YHAA 3Q3JB 4RYDA 1YIOA 2JGDA 2WVJA 3IMCA 2J7PA 3PUKA 5LXTB 4QGAA 4TTQA 3WBKA 2OCAA 3THXA 3M4ZA 1IEWA 1U7XA 3ZVLA 3HKBB 3AERA 3O7WA 3RC9A 5I9LA 1MXFA 4CE6A 1UC8A 3A1EA 2X0EA 4D4MA 1CXZA 3VR3A 2DEUA 4ZHQF 1AU9A 1J9ZA 2GJ9A 1NOIA 2ZBPA 4JL5A 4NCKA 2JIZD 1LXCA 4ZVRA 3K9GA 2XB9A 3MZ0A 3Q7SA 1CCWA 1O03A 4O2AB 2GETA 2V55B 3ZIDA 2EQ5A 1GNRA 4BWVA 3B2QA 4N1AA 3V2IA 5HIMA 2YMQA 3EUWA 5HYVA 3GXBA 3H11A 1ACMA 2ZBFA 1FFDA 4C4AA 4IH9A 3BXXA 1M72A 2HCRA 1UBNA 4YFVA 3R8FA 3FYUC 3LBIA 2B1GA 1QV9A 1VECA 1XVUA 2G06A 3P27A 5IBCA 5LJIA 1AQUA 2DQYA 3WAJA 1WSWA 4R1SA 5EJ6A 1G19A 4UTVA 4E2FA 2JFNA 1KHTA 3LWNA 2JK1A 4DPMA 4BO1A 1SJ9A 1XALA 2F64A 1UEIA 3TS1A 1M75A 1SVNA 1Y3IA 4JT9A 4A2WA 2JGEA 1LC3A 1VG0B 4Q3DA 3YASA 1X7WA 4KQMA 4FSHA 5D7BA 3AKZA 1IAQA 1K68A 3S99A 4B83A 1W93A 3K6RA 2ATCA 3NAQA 3S8YA 5DHUA 5ECGC 2SKCA 3Q7IA 2W90A 1X14A 2JJQA 3RI3A 4R0MA 3MTGA 4LDPA 4OHWA 4EI7A 2NU9B 5LLDA 5F9FA 2C9YA 1U81A 2FJ0A 2DUWA 2J9RA 4K28A 3OZSA 1XZGA 1TLTA 4M1ZA 3E9EA 5JD5A 3RRNA 3PVSA 5K8VA 1ZGHA 2G9RA 2C2BA 4MVYA 2FEKA 4P08A 2EP8A 4H7DA 1YOVA 1BJKA 3DJFA 4LHXA 3N5KA 3I5XA 3FVTA 4JJ4A 1BMFD 3QTLA 1FLNA 4XQ0A 4C88A 5DW0A 1FW6A 4ML3A 3TUJC 3HDTA 1PR6A 3UXHA 4MQMA 4WFIA 1FRQA 1EESA 1K66A 2A9QA 3RSFA 1G66A 1ZRNA 2X40A 3DBVO 3DV2A 3NDJA 3UAVA 1D6NA 3BILA 5AKXA 1CP2A 3VYRB 5CA0F 1K2WA 2J5KA 3ENWA 1MTOA 3SQDA 5H4HA 2G3YA 2BMWA 2VPPA 3DAHA 3EDYA 3SZUA 3ZWYA 5C8XA 2ZTVA 3P0IA 4WA7A 3EIXA 1WB6A 1E89A 1JBEA 5HE9A 2D2VA 3AL2A 1U31A 3ABOB 5DT9A 1GTMA 2KPOA 3NM4A 1Z82A 5D5HA 1YMVA 2QXYA 3QPWA 4ZAWA 5LJLA 4E08A 2PUVA 5B53A 1XP8A 2VZLA 4FHGA 3KKZA 1UKCA 1Q11A 5CLQA 2Z9CA 2Q99A 2ZS9A 2P6NA 2PA0A 1PT6A 2X3YA 1J5EB 1VG1A 1H8EA 4XOUA 4RIEA 3VDQA 4CYMA 3ANNA 2H9YA 2X5JO 3MTAA 2OO5A 3CBGA 2OBMA 3K1AB 4OXQA 4P5PA 4QXAA 5CUQA 5F76A 5JFGA 3UGJA 5FPKA 1WPQA 4OI4A 4YMVA 5KKAA 5AW6A 4QJ3A 1E5XA 5IG2A 3NHBA 2QM8A 1NPYA 2R6FA 4J4TA 4RIHA 1E6LA 2RH8A 8ATCA 1V1RB 3I92A 3ODPA 3OZRA 1DT5A 3W3AH 5DYGA 3GUYA 3SG0A 2ETXA 1YJ8A 2ZPUA 4ZARA 3VPBA 3DE5X 1OTYA 2C1ZA 1FP7A 4IDAA 5JWOA 5AW5A 1FFEA 2WQZA 5EHXA 2DETA 2LKCA 1P5JA 3VDXA 2FUG1 4EHBA 3LUPA 4G0QA 3SQWA 2V03A 1TC1A 5D8DA 2OHHA 3W4JA 1DQRA 2DR0A 2NO9A 1PGJA 1D4ZA 2FPUA 1O77A 1RZ3A 1DBPA 2FSSA 2X22A 3F5SA 1O94D 3L41A 4H6PA 5IP5A 4JA2A 4EPTA 4ARCA 3RUIA 2RGGA 4HX5A 3IDQA 5HQTA 1L5NA 1G1AA 1TKCA 2BKEA 2XI4A 2YUTA 4IUYA 1PR5A 3HEBA 3JWEA 1NJFA 4KO3S 4OKSA 1JEDA 3T7TA 5LFAA 2W4IA 1LVUA 5EA2A 4FOTA 4N12A 3ZHBA 2AR0A 4V03A 1C1YA 1U4NA 2ISQA 1N0VC 4LNUB 3BIJA 4BMNA 3WGLA 1NU6A 2ZWPA 4U0KA 4UZEA 5GWXA 1IK6A 4LSZA 4PG7A 1RP7A 4M1MA 1JI3A 5EL0A 4B4WA 3QLUC 1Z4PX 1C1DB 1Q0PA 4J4BA 2O8DB 2F1OA 1L7VC 1LDYA 2KLBA 3OQMA 4BB5A 4OQZA 1LRLA 3ESDA 5D3ZA 3ZHZA 3G0IA 4C20A 2GYYA 4JUFA 1II8A 3WJ2A 3TG2A 4C0HA 3R9WA 2DQKA 2J4FA 2WTAA 4X54A 4R01A 1KC3A 1GQFA 3RS8A 3MTQA 2JB9A 2AJCA 1IZ9A 2HWYA 1VJCA 3RSHA 2QU8A 2BTQB 3G1WA 2PHZA 1OREA 4PF1A 5DHRA 4DA6A 1UIRA 2FYTA 4HEJA 4D4JA 3ILXA 1TOAA 1A8UA 2VKTA 5CLFA 1REQA 4IJQA 3JWIA 1ESNA 2V7XA 4H7KA 3WICA 3DULA 1FFCA 3IAM6 3K1ZA 2V7UA 4GOJA 3ZKAA 2YXNA 3BG5A 2AJ8A 3QLTA 1MRZA 1XKXA 2ATXA 3QWAA 5EQJB 4CU2A 5IEJA 1GPBA 4XFDA 4JOQA 1K6IA 1PVVA 1Z29A 2XCIA 3U37A 3V5NA 4V2IA 2W98A 3KUKA 1P8AA 1JLLA 2OHVA 2FVYA 5HFAA 3ZY4A 1GTG1 5L7YA 5CG2A 4OQNA 5IARA 1XEFA 4GECA 3VAYA 1TYDE 2R6HA 3WZ2A 2BFFA 1MJ5A 2VZEA 3KLOA 1HZJA 4YMIA 2WMOB 1G8KA 4M8KA 3JAKA 4WINA 2XH8A 4EJ6A 4LMRA 3DE6X 1J0AA 5JROA 2RHCA 1DG3A 5AVTA 3KDAA 3VTKA 4ANFA 5JDIA 2ZUEA 3HVIA 2HDOA 3HB5X 3C1UA 4PHFA 2B7BA 3SR3A 2QGFA 2IIPA 3NEAA 4AROA 5C3UA 3SJAA 3KEGA 2W6PA 1YBMA 5ALXA 1KU0A 1DLIA 1X15A 2QLLA 1E96A 4RD6A 4UTZA 2ECFA 2WLTA 1AG9A 2QP3A 4UVDA 5BT9A 2SECE 3BORA 3TJMA 4CIBA 1NQWA 4CKZA 1GEGA 4MICA 3WYBA 1E9CA 2QN6A 3CWCA 4ESVA 2HUPA 3JVEA 4HNRA 4NC9A 4TKVB 4N9QA 4D7AA 5JSZB 4QM6A 3GCZA 4P5DA 5GJWC 3C16C 3CF0A 3DFUA 1I13A 4R1OA 3UXEA 3B52X 4ND5A 1QTQA 3O2NA 3AHHA 4HUQB 4HV4A 4FDVA 4KPFC 1DIRA 1U6JA 4C6TB 5ILOA 2PV0A 3T41A 3ACDA 3UXYA 3GAAA 5DOVA 4ND3A 3EC1A 3C3XA 3P0HA 5LA6F 2OPHA 2IXEA 1DI0A 4I4IA 5KDDA 2AMYA 2P11A 1X74A 2R751 2XB6A 1T2DA 2VBGA 3G0GA 3GFSA 1U8UA 3GZNA 4FFDA 5BNFA 3WRWA 1NAHA 4PC6A 3ONWA 2ZWOA 4M1EA 4RL4A 1MQAA 3CR7A 4BO3A 4HXEB 4TKLA 4CR6A 4UNIA 3Q0EA 3A4NA 2K5UA 3EC2A 4R68A 4Y9UA 4G9EA 4NARA 1YWGO 2YNMD 3TNYA 2FR8C 1RI5A 3KL2A 2ZIZA 1XF9A 1L4UA 2QL7A 2YYSA 3OMWA 3P2JA 4HDRA 3MQ4A 4L72A 4U3JA 5BSGA 3TOVA 3BGSA 4OVKA 1NXSA 2OV8A 3FRIA 3I3OA 4HQ6A 2HEIA 4PONA 5J2TB 3UAOA 2HJGA 4B4KA 1N2GA 2VG8A 4G0NA 1PYGA 2WBLC 3TLYA 1NSTA 3NOQA 3KFLA 3ODGA 1T2VA 4RMJA 4P82A 2QYHA 3X43A 3AFNA 3EEFA 5K5EA 3AVYA 1KO4A 4AN1A 4KVFA 1NNSA 4JLOA 9MHTA 2CDRA 2AE2A 2ZYDA 4RNCA 1YNOA 1OXUA 1XZKA 2Q4OA 3G2KA 3O3CA 4PRLA 2B1QA 5BWCA 5LOVA 2IU3A 1DO2A 2MIIA 2ZRKA 3HUUA 3NBZC 2Y1XA 4DBZA 1P7VA 3GRZA 1IWOA 3OCCA 3D2CA 1CB0A 3QUTA 3GW8A 4JU8A 3TMKA 3FPFA 3DDCA 1T5SA 4CG2A 2IEBA 1GLNA 5ESDA 5BN1A 2PANA 1G17A 1Q2XA 1IN4A 1TMKA 1ZDMA 1KYQA 2C7VA 2E4WA 2Q49A 3FDIA 4X3CA 3ZN2A 5H0IA 2CXNA 4CWAA 5LXTA 2DUUA 3L9WA 4HLDA 3BQNB 4UHDA 5IBPA 3FVVA 1XTUA 4ISBA 1HK7A 1ZLYA 5LIPA 3WGZA 5ITZA 4QULA 3HKBA 2YFYA 4KNVA 3TI9A 1LV8A 5E7QA 1GPYA 4AZSA 2IS4A 3CMMA 5L3SB 4ALLA 5M04A 4OKNA 1H8HA 3WL3A 4L95C 3TSWA 5KYUB 2ROQA 3EA4A 1FXUA 2PEZA 4P84A 3BWCA 4IYRA 3H2IA 1TO6A 1Z5GA 4O2AA 2WT8A 3GJSA 1R74A 5E9AA 2WJAA 1L2TA 4KQEA 1YQ9A 2APJA 3AX6A 4GU5A 4BAZA 4MW2A 3T1TA 3ZDRA 4DV4B 5KTOA 2A3NA 2H65A 4IVRA 1W5SA 4JMPA 5DHQA 3G0BA 5MGNA 5B57C 1EG7A 2FWNA 2P35A 2VYND 1HT2E 2QZ9A 1U9CA 4QQ8A 1NI5A 4BS9A 3FKSA 5A4KA 1Q22A 3IC5A 4GR9A 3GN2A 5G02A 1Q92A 2Q6TA 2NTEA 1B43A 1TE2A 2AG0A 2PMBA 5DM0A 5FYDA 3MILA 3KQKA 3F4LA 3KSZO 2V3WA 4KACA 5EYPB 1GG8A 1BNCA 1HPLA 1STOA 4P4NA 4QGBA 2PO7A 3DV9A 3JQ7B 4XOIA 3VZBA 4DDWA 4DV7B 1UXHA 3KAJA 4IWNA 4DB2A 5IDQA 1XHEA 2AIRA 4JB8A 1R0XA 4V0SA 3TLMA 5AJHA 3H97A 3LTEA 1OYOA 4WY2A 4X62B 4RADA 3RW9A 4G5QA 4F85A 1GZUA 3AIKA 1CEXA 3ZE9A 1OKKD 4HEQA 5H3HA 4WBNF 3O8RA 4G0UA 1N5MA 2W71A 4OTZA 1LI4A 2WPDA 2ZIVB 5T4HA 1G8MA 2A4KA 2BR3A 5C5DA 4RHXA 1BGVA 3ESQA 4DPKA 4XIGS 4E1VA 4N0EA 5M5BA 1BFKA 1PJ8A 1XUOA 4U5QA 2IV3A 2FZVA 4Z9YA 3HJBA 2R8OA 3NBUA 4UHFA 3GJ8A 2ZSJA 4FS3A 5J4LA 2DPMA 4AURA 3T1QA 5JVDA 3EZ9A 4E5UA 4ENWA 4L07A 2GOYA 1DV2A 1I4DD 1RXSA 1M7HA 2CXHA 4LQDA 5ALPA 2KYRA 4F9GA 4LBZA 4M9SA 5CCXA 5BQOA 3FNEA 2IHNA 5HHTA 1QXSA 1NN0A 5B4TA 2VQSA 3ZWBA 3KTAB 1GCIA 3M81A 3EAGA 3G88A 3KSUA 3V1KA 4KBFA 5ALTA 4F8EA 1ISRA 3AR8A 2P62A 6Q21A 4DIEA 1P0FA 1TM3E 1WDTA 3F67A 1HETA 3SMVA 2IYSA 5FBRB 3STWA 4G84A 3ROPA 4L73A 4JJIA 1K8XB 2GN9A 1B4DA 3IURA 5J4HA 3BE4A 4OLJA 2CVQA 4UM9B 5AXAA 1QPBA 3N2YA 4NYMR 2FK7A 1C30B 1Z8DA 3OMXA 1YDGA 1QK5A 1SPXA 1YL7A 4OGKA 4B2YA 3PC4A 4PXAA 1BRMA 2GB4A 2QZPA 2YJ4A 4K3UA 5DU2A 4A3SA 4KITB 2FSIA 5J5AA 4N47A 2P6PA 7AT1A 1T1JA 1DJOA 1GLVA 3T54A 2A0KA 3K0SA 4OMDA 4PGAA 3RJMA 3K1AA 1H4VB 2KS6A 1KQFA 4BQSA 1VLLA 1ENPA 4PBSA 3WDKA 1UBOS 2VPYA 2ZJ2A 4FFVA 1AH2A 2QSZA 2O5CA 2WSLA 1NQUA 4CKCB 1U8CB 4G5SA 2E21A 2F9FA 4XWWA 2PQMA 4L57A 3OEHD 2C9BA 1V1RA 4Q9IA 2FETA 2ZYSA 1QUEA 4RCYA 1JJ7A 3SCZA 2NW6A 1CUFA 1AHNA 3AJEA 3IDSA 4OI2A 4S12A 3MLAA 4I1RA 2VHJA 3IPYA 3O1HB 4KGDA 3ZJTA 3UN1A 1YF3A 1N6IA 3ADCA 4EW1A 3OU6A 1P6XA 3KD3A 4M0DA 4JB0A 4D9BA 4KXWA 3OOEA 3U4GA 2ACEA 1J20A 1U7DA 3MRTA 2GM5A 3V4OA 1PT5A 5G4LA 5TF0A 5FPHA 2MHCA 4I4TA 4V3CA 1EWYA 2V6GA 3A3OA 2SICE 1ND6A 4LWQA 2BBWA 4MA4A 2OV6A 3OPMA 3J7AC 3TQCA 1SGWA 1E7RA 2RB5A 4AVYA 4MRNA 3T7JA 2H57A 4OU4A 3CR3C 3S7ZA 4EW2A 3FLBA 4OREX 2I67A 1YKGA 1DJNA 4C4ZA 3WO0A 2IYTA 2O2HA 4LNUA 1EE2A 3HDVA 4HMPA 4U5XA 4Z4GA 5A7HA 1NVAA 1Y3HA 3GJ3A 3FGOA 1XD2B 3GUVA 1XK7A 5E2IA 1Z9BA 1U2RA 1WKCA 2BM8A 1MT3A 2REOA 1OGIA 3AILA 4MW9A 4BFZA 4ENTA 3FTNA 5HF9A 1C1DA 3VNQA 1CDZA 4DANA 4J49A 5AM4A 2O8DA 4X8OA 3B60A 3VDMA 2F59A 3O8NA 1D4FA 1YB5A 4MV6A 2KBEA 3PLAE 3NHUA 1M76A 1IBKB 3IUMA 3SC3A 3NVMB 4H4DA 1Z83A 3DTTA 3KUXA 3H9BA 3A3PA 2BRUA 2EZ8A 3VPDA 4BMDA 4ALJA 2VCHA 3WYNA 2NT4A 3EGWA 1G4HA 1XL1A 2BTQA 4INOA 1PLLA 2MR5A 4FNGA 4J1TC 5GJVC 3RD5A 3PD0A 2CFCA 1UZNA 4CLHA 2ODEA 3R24A 1U3UA 4KO2S 4MVJE 3QE2A 4TQAA 4WPGA 1K0UA 1TTPB 1YC2A 3O73A 1JQBA 1MENA 1S7CA 1MJFA 1HLGA 1V4VA 3B48A 3DUFB 3R77A 5KSPA 3L6UA 1HI9A 2P4QA 4JYCA 4JC8A 3ICVA 1RVV1 3WYFA 5HXAA 1YCDA 3HCBA 4Z86A 4AMZA 5IUJC 4W9MC 1QJ4A 10MHA 4LX8A 1UJ4A 2D1FA 2FTKE 4B84A 1GSAA 1S4MA 1C7FA 4WY8A 3AR4A 1CZOA 1F2UB 1NN3A 1UBUS 3LNTA 4IDQA 4BLRA 5I51A 3HYTA 1C8VB 3W1EA 3FHCB 2HA5A 3EXHB 4O5OA 1SBQA 1Z7BA 4P8RA 4DDUA 4ASUA 2C4MA 3NHSA 1RIFA 4BKQA 3CO0S 2OPBA 1WL8A 2OB1A 3N7AA 3SLRA 1O8CA 4Q34A 2HJHA 1JBQA 4JX9A 1RAGA 4I66A 1AM4D 1EBFA 2YVQA 1NHGA 1NMXA 1XDWA 2XOEA 3TR6A 3LV8A 5CXQA 3HCEA 4FP9A 4XJXA 3ETCA 1QU3A 4XYBA 4H7PA 2ZT6A 1Z0KA 4IDBA 2FWIA 5AK3A 2EJWA 4C0KA 3AP2A 3ZWPA 1MIOB 3TCNA 2GEBA 2GYWA 2X8JB 1F2DA 4IXNA 4D9JA 1NG9A 1DG9A 1R0SA 3HFGA 3M5PA 4DIMA 5CA1F 1AQYA 4X63A 2IE8A 2OAP1 2DH6A 1PEKE 3V4FA 1Z35A 4OH1A 3ND9A 3QI2A 3QVXA 3FYSA 1EVIA 2O3RA 1Y6FA 4DCTA 5I9SA 3DWFA 3QPCA 3W2HA 2OM2A 1E2KA 3H9QA 1PLJA 4O08A 3EVTA 4PGHA 2C4WA 1UIMA 1KY3A 3HNPA 1HT0A 4EVRA 4TKVA 4EAAA 2YZNA 5LLTA 3FPJA 4TQGA 5H4GA 1X7XB 4LZJA 4HFRA 2QBYB 2CNOA 2E3JA 4KIFA 4BVLA 4FOOA 5E3JA 1VSTA 4HUQA 4P80A 3NP9A 4C6TA 4UHHA 2UVDA 4ZVNA 2WE8A 1GD1O 3VMMA 4EZEA 3CVOA 1JAXA 1FVOA 2W83A 4CODB 1CIPA 5A2QA 3HZZA 1YZUA 2P5SA 3GJRA 1YMQA 1KZ1A 4J4HA 3KT8A 5A0FA 2R11A 5LWHA 1TD1A 3HVKA 1GAJA 4PFSA 3IQDB 3LOQA 1JKJB 2H7VA 2PM8A 3CHYA 4YP0A 1UZLA 4MYUA 1OH8A 3H5OA 3VR2A 4ZDJA 4ZT2A 3P2KA 1C80A 1BMTA 1GNQA 1NUAA 2W2XA 1R3UA 1VCNA 3HTXA 1H2RS 1TMOA 4FYYA 3T1VA 3H2KA 5IZCC 4UUQA 1JSLA 1Q50A 1XLUA 1XXHB 2AJDA 1VG8A 1KE2A 1GG5A 4MB2A 3T06B 4CM5A 5KYKA 1XQYA 1JIUA 3FOFC 1KVUA 3MD9A 1QONA 1FDOA 1XGKA 2I4OA 2AV6A 3U3RA 4MA0A 5J2TA 3EF0A 5AI9A 4BO4A 1DMSA 4R9UC 3L49A 5J1TB 4NE9A 3VTAA 3MMXA 3TTVA 5JCJD 1T5LA 2X6QA 4EW6A 3OCWA 3EC7A 1EG2A 1RBYA 3RYHB 2YICA 2XWPA 5EIFA 5C1BA 1VPDA 1J0XO 1DFIA 1SHZA 2I6UA 3AXSA 2FWBA 2O0KA 3U61B 3R7WB 2IV2X 2BBSA 2M6RA 1R5OA 4LIPD 3UO8B 1RRCA 3R5SA 1YU6A 3L84A 4PC2A 3TGPA 1W36D 4DQXA 2UUBB 3Q5DA 4DM3A 2HMUA 4IXMA 3HJNA 4WXMA 3OPYB 1ES9A 2HBRA 4MVJA 3GJ5A 1PAUA 1VA4A 3GUCA 2VJPA 1F2VA 3DMRA 5EUCA 2WM8A 3ICWA 3UOAB 1VCHA 5AW3A 3FGZA 1KJQA 2QAGB 3KKLA 4ZU3A 1T91A 1E3IA 5FTMA 2WINI 2JVJA 3F3SA 5MFPA 4TMTA 5L3SA 5LQCA 4NLLA 1F6WA 5J2TF 5KYUA 3UW3A 3V1NA 3P71T 1GUAA 3QVGA 5G0WA 2O5RA 1VQ1A 2C5SA 3NTRA 3RPEA 5IAEA 4C0SA 1V8ZA 1KS2A 5TQVA 1SQFA 2QNRA 1UWLA 3MMSA 3GGGA 3PXEA 2YWBA 5K0LA 3K96A 1JJFA 1WD7A 1WCIB 3RROA 1DJLA 1QGOA 2FWPA 3PCRB 1XTSA 3K20A 2P9JA 1YR6A 3BSFA 3F97A 2EZ4A 3CV3A 5GM1A 3UMJA 3WRXC 1U1DA 4FGUA 1DDGA 2ZU6A 2PSHA 3RBZA 3ZQ6A 2Z57A 2Q5FA 4OP1A 1DC4A 1JA9A 1OGYA 5KHAA 1EJ2A 1P3JA 3LHDA 1VPLA 4IIXA 4K2HA 3W6NA 3WOVA 3QLEA 4B3FX 2LE0A 4P4UA 1JPVA 3FN4A 1Q7CA 4W5NA 4R5MA 3LT4A 3PHJA 2J31A 5EYPA 5G0TA 5TMDA 3NNNA 5JJCA 1COWD 4DR6B 5CLGA 2CJFA 3TDMA 3OQNA 1IFXA 4Q4CA 1A9QA 1XEAA 2OSBA 1PS8A 3JWHA 2TYSB 3QF7A 1X1SA 3Q85A 4HS9A 3MGBA 3U40A 4Q1FA 1U0GA 3IB6A 5KZMB 3UMBA 3FPCA 1Z45A 3LGSA 5F7ZA 2Q46A 2P9CA 4RH0A 2ENWA 2IPOA 2Q6VA 2VEDA 3COWA 3IVMA 3BMXA 5HQJA 5ULLA 5KX5A 1DG1G 4MUFA 3AI7A 5TIIA 3Q6NA 5EQDA 4BNMA 3U6KA 2ST1A 5GADl 3PJRA 4YQYA 3S2GA 3WK9A 2ZB8A 1T2FA 2ZE7A 2VPTA 4XGIA 3KB8A 3LAWA 3WTCA 4C43A 1EU1A 4PYNA 4D5EA 2B37A 2EWVA 3JAWB 4ZV4A 1QQ6A 3LC2O 1PJSA 4E33A 5HZHA 1BWPA 1GPH1 1TJNA 1WTCA 2JPDA 3UVEA 1WD5A 1E2IA 1NGSA 2QB5A 2WY2D 4ZEWA 2OHOA 2VNSA 3KTAA 4Y6SA 1T0PA 2XYPA 4KMRA 1XDSA 2JBAB 5EPUA 3KLNA 2EZ9A 4N76A 1IY1A 2I66A 4MKRA 2WC1A 4M1SA 3EASA 3KQPA 5DGCA 1DSSG 4M9RA 2IPNA 2XQVA 2IPMA 1J0BA 4HI0E 5FADA 1BD3A 3OICA 4I81A 1R4ZA 5KTSA 3JY6A 3SDSA 3OESA 2NSDA 1PUJA 3WYGA 4AFNA 5ARBA 4I55F 2D1SA 2ZTLA 3TPFA 3U4AA 1FMJA 3V4SA 5BPHA 2IE0A 4TMKA 1C30A 1H2XA 1DELA 2XSZA 1Y9AA 1YRQA 1WMDA 4CKBA 2P3OA 4DL9A 4HDSB 3S4YA 1OHHA 1PHPA 4C1BA 4K26A 1YVPA 4KV9A 1PG2A 5DTRA 1T4GA 1DCMA 1VL6A 1WX1A 2H08A 2PH5A 2JCBA 2J6HA 3OOWA 3TEFA 4JI0B 1RDFA 2FR0A 4A82A 5IJ0B 2PGLA 3BXGA 3STVA 3SJUA 2GESA 4DZRA 2Z1MA 4R8MA 4FT4A 4WN3A 2Q4DA 2WSIA 3EWSA 1TZJA 1E5VA 1TMYA 3IUQA 1CUBA 4CKCA 3F6EX 2B3DA 2NGRA 1S7GA 4OSPA 4PRKA 2PZ8A 3SDBA 2PD6A 3AG6A 3ENQA 4AJKA 3H5LA 1EHYA 5KVCA 3TCKA 1D7OA 5JSYA 4LC1A 3HJUA 4YRPA 2XF2A 1OROA 3NFRA 1RWVA 2Q07A 5GZ3A 3PGXA 1DCTA 1E6MA 3W5DA 5DX1A 1Y1PA 2VTBA 5EEGA 3W9UA 1YHNA 1X94A 1SOMA 4HGPA 2FLKA 2JHAA 2NU8B 3PTLA 5DM60 5TVKA 1JLHA 3HKEB 4GEKA 2GNOA 1NV8A 2I9PA 2PL9A 2PMFA 2HOQA 4B34A 5AW1A 2Q2OA 3LY9A 5G41A 4EQ6B 2VH1A 1DX9A 5FJIA 4PG4A 1SC4A 5IXSA 5GV7A 4B3CA 3U39A 1XPUA 2Z95A 1VLMA 4DG5A 5CB0A 3BJIC 1G8PA 4WI1A 2QTVB 3IIJA 1N0IA 2Y8EA 2C7BA 5HKLA 2BKXA 3IIKA 2YYYA 1CUGA 3F7MA 4MYCA 1J2UA 2H1FA 2BAGA 3DZHA 4PR0A 2H0AA 4IS3A 4U7JA 4YP1A 2CC2A 3S55A 3I28A 2C57A 1A2QA 1XXHE 1ZVMA 3OUUA 2JA2A 3IR5A 4OP3A 3UMSA 3OU7A 3B3QA 4PGMA 5AM1A 4OIMA 4AJOA 1XD2A 3ABRB 1ENYA 2J33A 4IDEA 4M7OA 2AZ4A 2XUGA 3BWBA 2C9MA 3DE0X 3T7EA 3EEBA 2GD1O 2RGBA 1R5JA 2WAXA 3V55A 1MX1A 3LLCA 2Q1YA 3LPAA 3DD1A 3P4YA 5H59A 3RFUA 3HL4A 3OIGA 2PGXA 3OIWA 4WT7A 4D97A 2Y4NA 2FQQA 4LJ7A 4KPGA 2BFOA 1N8NA 5C31A 5TT1A 5B58C 2PUCA 2WMNB 2YS7A 2OCIA 3B3GA 1K6EA 2ES4A 2F3SA 3O31A 3RVRA 3FNRA 5CTJA 4RGVA 3ZV4A 1G9SA 4TTPA 1BGWA 1RBZA 1USGA 2EJVA 2X14A 3W7VA 3LXRA 1A9PA 3T99A 1JQDA 4WX2B 2Z56A 5DW3A 4EG8A 2OYCA 4LF6B 4MLZA 4UULA 1ZH4A 1CZNA 1WBBA 2G8NA 1LI7A 1N32B 2OUIA 5ER9A 1JKIA 4XLTA 1JHMA 2PIAA 2X77A 3K35A 4IGKA 2CFSA 4RYLA 5C1IA 5AQEA 1MORA 5CDUA 2XBLA 2C59A 1SBNE 3LT0A 1MU0A 3WZMA 5I7HA 2WF9A 2ZE6A 4K9MA 5C1DA 2CUNA 1JVSA 3GEEA 3NOOA 3UJHA 4YR9A 4YAUA 5AKJA 4QQRA 4B6JA 4IR7A 5DCYA 2Z2IA 3LK7A 4BP3A 4KOAA 4C0WA 1IY0A 4CMEC 4KYUA 3FOAA 2IXGA 1JSRA 2D0PB 3C85A 4JLMA 4MKXA 1I2CA 2VSQA 3S70A 1Q21A 3AKDA 1IHPA 1T24A 3CEPB 1P6QA 2MWMA 1GCUA 3VU9B 3F98A 3SS8A 4BEWA 4DR3B 1VG9B 1WOYA 3COZA 1K4MA 4PWZA 3SLKA 2QZJA 4F7WA 1KYYA 1N6LA 2WMYA 2A84A 5BWMA 1TUBB 2QVLA 3B1KA 5IN4A 1MIOA 1DJPA 2VTKA 2X8JA 4YASA 3K0CC 1K6MA 1XAJA 3S29A 1I6LA 3KO8A 4JJ7A 4RVHA 4O2BB 2NPOA 3ZEIA 1TAUA 3RLFA 4H7EA 3RNOA 3R5KA 2CFTA 2QW1A 4O1MA 1QP7A 4IIJB 2NV6A 3CLVA 3V2GA 2V7PA 2VATA 3FKQA 4H08A 3BMQB 4F71A 4D5GA 4FE3A 1XG5A 1AK1A 2N75A 5ALOA 3R7SA 5KOHA 4LJRA 2CF5A 3NBYC 1E1RA 2GCGA 1YQWA 3USZA 1OJ7A 3HU5A 4ZT6A 1KZYC 1V8PA 2NSHA 1AZTA 3K9WA 1X7XA 3LCCA 2PU7A 3KPYA 2JAQA 3N70A 4MVXA 4WASA 5B3LA 1Q1QA 1OIXA 1S2OA 3CRW1 1G5PA 1V6SA 2F3PA 2PBLA 3KHSA 2VHZA 2A59A 1BX0A 4B5LA 4TT8A 1LNSA 1X8XA 3K9QO 4DT1B 3C5HA 4DYDA 4GOKA 1C3XA 2XIQA 3LL4A 4GWLA 1FUEA 3MJVA 3VH2A 3TAXA 4D81A 3IGFA 1VOTA 4H3HB 1EX6A 4JJ8A 4B85A 2E55A 1JQAA 2A78A 2YWJA 1JKJA 4IUBS 4X00A 2XZLA 4WLNA 3ADPA 2ZUWA 3GMSA 4GPAA 1X1RA 4PO9A 3TD9A 3VBEA 3UMGA 3GLFB 2W42A 3ZHQA 2KI5A 4RKEA 1X1BA 1L7EA 1M2VB 4YRAA 2ZR0A 3QYPA 5TJ9A 4D3DA 4DV6B 4HRVA 2JFYA 3FWHA 2H1CA 2RGWA 1DRKA 1QKJA 3JQAD 1ZVQA 3HRIA 2GBPA 3LP6A 4LZLA 4FQ8A 5EP2A 3ZNNA 3PDCA 3ROXA 5JYCA 1D8TA 1QVVA 2Y1KA 3RFCA 3ROKA 1VDZA 4XWYA 3I8XA 4EJFA 1P2VA 4P7GA 1UT6A 2XZOA 4BBPA 2RE8A 3LX5A 1VZ2A 3MPOA 3FWYA 4CM7A 2YYZA 5ICCA 3N75A 3QXGA 3BQ9A 4ODIA 5C8YB 3TG8A 3T3EA 3RYHA 1JH9A 2AKEA 3ANTA 3R74A 1D0IA 1EWRA 1HDIA 1DEHA 1MLDA 3C3YA 3E4CA 1TU3A 4GX2A 4YBZA 2ZUVA 3FVQA 4BZZA 2IPLA 4WZBB 3AVUA 1P39A 2L69A 1BH6A 1V45E 3DYVA 4HAYA 3GX1A 3K6KA 4ZVSA 3R7WA 4K86A 3BWDD 3NB0A 4HRAA 2FPLA 3KJQA 2EZTA 1BGXT 1J49A 4F6LA 4UVHA 3KR0A 1ZMTA 1W2GA 2FGKA 2BW0A 2FP4B 2ZUTA 3GPLA 1AX9A 2Z58A 2RAFA 4ZO4A 3OPYA 3NM6B 2F1IA 1Q6ZA 3H1PA 2YASA 1YDFA 3UJ7A 1K8RA 4OHCA 3VX4A 4DW8A 4HX9A 5H9WA 1UKVY 3ICPA 1K7CA 4AJJA 2QAGA 3B89A 1D7AA 1PD0A 3LLVA 4G65A 4QYMA 1RPNA 1I32A 3O93A 4TXMA 5ESWA 4L4ZA 4L15A 2JVKA 3U16A 3BSWA 1E7QA 1N2ZA 2XDAA 3EEYA 3FLEA 4LZAA 4G5HA 1PZHA 3UK0A 4OBEA 5KYXB 3UEOA 3B6JA 1UT5A 2J8ZA 2V9CA 1YFKA 5F3DA 5DF1A 4BEJA 3FPHA 2D4AA 1NJSA 2OXIA 3QUAA 3K94A 2ZIWB 3TN7A 3EH1A 4GLFA 5JDCC 3SPXA 2V96A 1WCIA 1I2MA 1TCCA 1A4XA 1F14A 3AO0B 5FHQA 5IT0A 1A7UA 3OJEA 1KJ9A 5CT4A 1V96A 1R8JA 1W8IA 1T15A 1V7CA 4IFTA 3BOSA 4L3OA 4KIJA 3R3YA 4LOKA 1Q0RA 2JLSA 5SZJA 3UJ6A 1O58A 4ENRA 1V8FA 2WTBA 4JGBA 4HYEA 4ARAA 2WUGA 3I32A 4IEEA 4Y3UA 2X6TA 2I2WA 1NKTA 3DZFA 1RYBA 4RDHA 5A5GA 2IHUA 1BE8A 1F2TB 1XKTA 3BE8A 4XAQA 5CCDA 3RU7A 2BJHA 1H85A 1OI4A 2GEJA 2WU0A 3IDAA 2XXAB 3T3OA 2HMVA 4L27A 4AX8A 1GRVA 4U02A 3OF3A 7ADHA 4M38A 3QX7A 4MV3A 3ZZMA 3R3WA 3VISA 2V6BA 3OIFA 1GGEA 5K0CA 3R9KA 2IYZA 2Y1DA 3I5YA 3UGQA 2W43A 1HDRA 2B83A 4FILA 1U2QA 3L07A 1CSEE 3UJAA 1OU0A 4ETIA 2OZLB 2FXIA 1T8TA 2GX6A 3BAFA 4J43A 2ZGVA 3QVSA 1RYHA 2BZ0A 2XQJA 3JPYA 3M82A 4EY3A 1GKKA 1QV6A 3SYRA 1U3FA 2E4YA 1R66A 2PEYA 4X5OA 1EWKA 2FU5C 1MR3F 3CUSA 1XWWA 3BZBA 3OECA 1QIGA 2J32A 3N8NA 4AKIA 1LBEA 4LYGA 3L01A 2GRJA 2O1EA 3GF4A 5DP2A 1SIUA 2QROA 3EZFA 4KIWA 1R5BA 1Y4SA 2BVNA 3JAWA 4I9NA 2JJYA 3Q98A 3TZLA 2BGLA 3WLQA 1O96B 4GS5A 4AXXA 2Q27A 4EI2A 5FBLB 3R7LA 1RW4A 3I4CA 4FFNA 1SQSA 4MXDA 1PJ3A 3EDOA 4U2BA 2B82A 2W2NA 3IR7A 1W0KD 4FWIB 2JBAA 3L5OA 4LRSB 3DE2X 1T9HA 3SGLA 5C4IA 4G8BA 5GP1A 2EKBA 3L7NA 1P62B 1V9LA 4R1MA 1D1SA 2C8LA 4XTCS 1E2QA 3DHWC 3O4FA 4GE3A 1NJ1A 1Z0UA 5EXSA 2H1WA 3A37A 2Q5HA 3FCOA 3ZD7A 3EUFA 1D1QA 1B0PA 4CNBA 2ZUFA 1Z6XA 3TNLA 5FULA 3L8DA 5LUBA 1ZVVA 4A03A 1FUKA 1I7DA 5I5GA 3SHFA 4EYOA 4QICA 4B1FA 1WHTB 2NUBA 5BNZA 2P7IA 1NJ5A 1VMDA 4EPYA 2WYWA 4HDSA 3KQLA 3RUDA 4F4FA 1DDIA 1Y98A 1YU9A 2XZDA 4GKBA 4DV3B 1S5PA 1Z0ZA 2IPXA 3H86A 3KG2A 1R4AA 3R0VA 4LYYA 5CYPA 5EXPA 4B79A 2FZKA 3CXUA 5CBPB 3SU8A 5SV2A 1I2DA 2OY0A 3M6LA 4OFZA 1QYDA 2G83A 4QUDA 4FUTA 5IJ0A 3K5HA 5ALFA 1EXDA 3IE1A 2PIDA 1S9DA 4HCJA 5FBZA 1TRHA 3C48A 4JLVA 2WRZA 3TXAA 1WJGA 1RZVA 4YLYA 3HXOA 1CF9A 2WZCA 4JLSA 5ALYA 2DECA 2FN9A 4JP2A 3DFFA 2QM3A 1EFRA 2D0DA 2NXCA 4GGPA 3HM9A 5DBGA 1ONPA 1QKKA 3HXKA 5AXDA 4KDRA 4WCFB 5JSHA 3F1KA 3ITNA 2JGAA 3P9XA 1NN1A 2OLJA 3VKUA 2Y27A 4D6PA 3ZCVA 4MVJH 1NRJB 2VVTA 3D8NA 3DXZA 3HKEA 3EPKA 4KR3A 2GD6A 3FSEA 4V0NA 4PC7A 3DMYA 4F5WA 3SEFA 3PENA 4EQ6A 2V3VA 2PL5A 1GL9B 3DLAA 5JEEA 1ADFA 1FE8A 1I8TA 3RT1A 2FLVA 4EG7A 3T8YA 5KTRA 3GLFE 1OBHA 1Y6QA 5CIYA 1EE1A 4DQLA 2VH5R 5C18A 4RM3A 4BVKA 2QTVA 3PE6A 4GD3Q 4I9UA 2X8LA 4E51A 4BO5A 5JHGB 2ECKA 1OY1A 3ZYCA 4HBGA 2DM6A 1WKBA 1UKZA 2BFNA 4KQHA 3ZWVA 4IUDS 3TOXA 2I3BA 3HI6A 3HR8A 1NBOA 4G6ZA 4MUKA 4ETMA 5KYTA 1K06A 4DUGA 3MB5A 1O97C 1U1CA 2VQ3A 3CH6A 2CD7A 3LKVA 2WIAA 2YQZA 4BZXA 1H9BA 5L9AA 3N0RA 3DTNA 3NP7A 1JU3A 5K3EA 5JJBA 3HBNA 2PLAA 2I2FA 2QTRA 2VPWA 3OAAD 2AN3A 1WPGA 3IOYA 3N6VA 1UBLS 3OOSA 4GO1A 3RWBA 3ZXYA 3LPLA 1I2ZA 4TRRA 2ZITA 1I1OA 5JI3E 1JDSA 2HK8A 4DYHA 3KPUA 4QHTA 2GMWA 1ILWA 1F8FA 3MS4A 4R2XA 1B8VA 4BGVA 5A4AA 5L40A 4KSBA 1Z5PA 1P17A 3H7IA 4CIVA 2VNIA 3A7EA 3HYNA 3PRYA 4RZ2A 5HF5A 3SWWA 4KXMA 1R8XA 3PZRA 1U3CA 1GUDA 4IOMA 1Q7GA 3F6PA 4L08A 2FA9A 4M8LA 4O4JF 4A73A 4B4UA 3W8EA 5KBYA 3N6XA 4ENSA 5KVVA 1KQNA 2RKBA 1KK2A 4CMCA 2EEZA 2GK3A 4J3FA 4OQQA 3SP1A 3GH1A 1DX4A 2H11A 1Z25A 5CDGA 1D8AA 3FCXA 2EFCB 1Y81A 2D7JA 1YMUA 1Y5IA 2R85A 4M99A 4AWAA 1RBQA 2OHXA 1T4BA 3G0OA 3GVCA 3HFRA 4UBNA 5AM2A 1E6KA 1GEEA 3OJWA 5DDIP 3F9RA 4FX2A 3IDFA 1FNCA 2QRZA 3O1IC 3TB6A 2MOKA 1X70A 3C70A 3WGUA 4CTMA 4YIHA 3QNUA 4XKJA 3VU9A 3IEIA 4IJWA 4ZALA 2H1HA 4I3HA 4F96A 4NBTA 1GGKA 3WA7A 2I4NA 1HYQA 1WW2A 3ANSA 2F6RA 3N3BC 3OEYA 4DREA 3OQOA 3CUWA 4PBTA 4M4SA 1ZD2P 3ZI7A 3E35A 1TUBA 2A86A 4Y9RA 4EO9A 4KIUA 4ZJZA 5KVQA 4ENUA 3JAMA 2AOUB 1DADA 1B74A 2XNDD 4FKBA 5AW0A 4O2BA 3J81k 2RGRA 3DZCA 3AR7A 3K0FB 2COKA 5EE0A 2B9VA 2OO3A 3CEHA 4MQEB 2ZDHA 4K9SA 5I3CA 4DVJA 2M6LA 1HQCA 3ZCXA 4IIJA 3RQSA 4EEXA 2FF7A 2HTEA 3GVXA 5M34A 3H17A 2QUBA 2DFDA 3G2HA 1CEYA 5AJUA 1UC9A 3B5IA 3PGMA 1RZUA 4YONB 2Z6VA 3LECA 1KBOA 5FHRA 2HK9A 2FZCA 4BRSA 5JR3A 5C3MA 3H1BA 3HCFA 3L7OA 2KJQA 3PUXA 4HDCA 4E4YA 4E2YA 2O06A 4QPPA 3JQGB 7GPBA 4HNVA 2JBWA 1DT3A 4NAVA 4DT1A 5A7GA 1YRBA 3W1VA 4NV3A 3L0PA 4NJMB 2RGEA 2RGNC 3EG5A 3KT0A 1O6BA 1FRNA 1G2QA 1TGVA 1DTSA 2BHRA 2BP7B 2GDZA 2HGZA 2QRUA 1CIVA 2XWJI 4FLEA 3LH5A 4IP0A 4OJTA 5DGTA 2E18A 2I87A 3T3PB 1TZ2A 1M2VA 3MGGA 5FDFA 2NZ2A 2XT6A 3RUHA 5HK8A 4C08A 2GSWA 2HI0A 1VJ5A 2AE1A 4XD7A 4BIIA 1KO8A 4JI2B 3QW4B 2QENA 1SK9A 3D6FA 2GCOB 3AF0A 3G23A 4E5KA 4JQCA 4CM4B 2V1XA 1T10A 2E5FA 3BBPA 1M8KA 5ALEA 5I4IA 2O1WA 3M89A 2JLRA 2W11A 1N3BA 5DTMA 2VRNA 3O8OA 3PR2B 5C8YA 1WKVA 3K70B 1L5HB 4IKEA 3JQ9C 3UK1A 2J08A 4OFBA 3GYBA 4S1NA 3VTFA 2QQGA 4GKVA 5E4TA 2Z8YM 4IXDA 1GWNA 3KZMA 2F8TA 4AO6A 2QV0A 4H3KB 2GSDA 4C78A 3HL0A 2H4FA 4WZBA 1QLJA 4F7DA 5HRAA 1K08A 5ADUS 2BFBB 2QVXX 2ORWA 1Y48E 5I45A 2FQXA 3CCFA 2E0IA 1UMCB 3I8SA 2FP4A 4TTVA 5CB4F 2JI7A 5LR6A 2GJAA 3DNFA 4TLBA 5DN6A 4UW9A 4AG6A 4EHAA 4OX9B 2HIAA 3EXG2 1UEJA 2WV9A 4PZPA 4F8JA 1GPJA 2XLBA 4ZVPA 3A1UA 3MWEB 4MARA 3H2ZA 3RYCB 3GGCA 1ULTA 4GNKA 5I7OA 2ZSEA 1MJGA 5FL3A 3WOHA 1MEOA 1EUYA 5AOVA 1T35A 4KFTA 1Y9JA 4GR5A 2PQ2A 3X1JA 2PRJA 1VE7A 1E5DA 3Q3HA 5IAGA 1NF3A 2OWDA 2UAGA 1OIVA 1WF6A 4IJMA 4O4LB 4M1KA 1T34A 4XIIA 5SYAA 4YYZA 4KR7A 2GVDC 4J16C 3GFOA 4YV2A 1QF9A 2DY0A 2PTGA 3G0CA 5FQNA 1RHKA 5DBOA 5LZ7A 3L92A 3JQRA 3WGHA 3I6ZA 3IPXA 4G0ZA 2F3RA 2H17A 4EDFA 4RANA 2ZWAA 3N8DA 3AI3A 4KLZA 5CG1A 5I7VA 3HDYA 1QHNA 4FTWA 1CHDA 1N2EA 3K05A 4ITUA 4TV9F 3UFBA 4NG4A 2OFOA 2WJVA 4LOIA 2KQUA 1TQHA 1ZM7A 1TVEA 3CE9A 2W8BB 3FPKA 4MI9A 2E4VA 4WDRA 1Z18A 2VP5A 3JYHA 4KMSA 4YO7A 3Q7EA 1F2TA 4IAOA 5K0JA 4LY0A 2CZCA 2DB3A 1B1CA 1ISPA 5EQFA 5AJYA 3W2EA 5K8UA 4HZGA 3GCWA 2F9MA 3CX4A 2VK2A 4R9RA 3VR4D 4ZJYA 4EGSA 3I9KA 1KQGA 4Z9AA 2QHXA 4N49A 1SIBE 1LRJA 3PR1A 4GZMA 5JQWA 2PXXA 3O6VA 1ZA1A 3WQRA 1U3TA 1RKUA 5KYNA 1P77A 2J30A 1FTWA 1WCV1 2PK3A 3SJ7A 1WW8A 1U63A 5CMLA 1NVEA 2PPVA 1Z5OA 4DR4B 2CNWD 3DLPX 2QRVB 2NO1A 1WMBA 4MHSA 3RLIA 2O1XA 1XLTC 1KORA 2JARA 3BC1A 3ES9A 3GB9A 2R25B 3ITDA 5EMLA 4DM7A 1H9CA 3IP9A 1NW9B 2QPTA 1KI2A 5P8WA 5DEIA 2WP8J 2QU7A 1N34B 3U9TA 2NZWA 1R64A 1BWRA 3KFVA 2JD2A 4I5GA 2QKYA 1E3JA 5DEOA 5AM5A 3TZKA 1C5KA 1LVHA 2E4XA 2JGMA 1J99A 1T6YA 2YH2A 3IUNA 1W73A 1W5FA 2P0YA 1O96A 4XUEA 3NAZA 3QXSA 1R6XA 2M6KA 4WCVA 1SXJB 1QR2A 2PX8A 3BMCB 4ID3A 1EZ1A 3NWBA 3OM9A 1YVEI 1BXZA 1AIPA 4MWCA 3THYB 4TYQA 4EYSA 4ZMRA 2IUYA 3DT6A 3DAOA 4L5YA 3H05A 2YL2A 3DYBA 3QZUA 2B4QA 4ROSA 1KYVA 3BSSA 2QTWB 3I9MA 2Q5EA 4IYJA 5EZ5A 4D6XA 2VYFA 4DZZA 4EOGA 1T0HB 3EDCA 4CJXA 4QAJA 5EAIA 1LEHA 1WCYA 4ERXA 2NAFA 1EEHA 1XCPA 3KYDB 3OJFA 1U98A 1L4KA 4OK6A 3WKBA 4R98A 3PKIA 2QRMA 2Z2XA 1WHTA 4RAQA 3SQMA 1Y9DA 3A1VA 1WS6A 2ZAOA 4MV4A 3O8CA 1FX0B 1Y37A 2DCUA 4FKMA 2WJJA 4X7BA 4UAGA 5JPCA 2A9FA 2A94A 4OATA 1ZI8A 4QU0A 3FUTA 2GDJA 1J8DA 3BKXA 4GI5A 4QJIA 2P40A 5ALQA 5CBPA 2J5QA 5D00A 1SCIA 5TX7A 1ZMRA 4I99A 1NT2A 4Y6OA 4BV2A 4J3NA 1C3EA 4IGEA 3QBJA 4X1IA 4DV2B 4M8NE 2IDMA 3H87A 1RFGE 3PG5A 4BNWA 1UM9B 3VX3A 4KHZA 1MW8X 4MQ6A 1F0PA 5AVVA 5K0TA 1YS9A 1U6IA 2W2VA 1MB9A 2IDKA 2OCLA 2LUOA 2PJZA 2ZQZA 1TJ5A 1UCFA 4HPWA 2ZT7A 5FOVA 1OWMA 4JA0A 3GH3A 3MT0A 3N59A 4BLOA 5LBTA 4F8YA 1L6IA 5ITZB 1K27A 1W5BA 3G2NA 1JPJA 1PWZA 3BVPA 2ZIAA 2VI5A 4LKOA 1ZUNB 1T4DA 2R44A 2P4EA 1JWBB 3ECSA 1XZPA 1VHLA 4XB1A 1A82A 2WA1A 3G0DA 5CDYA 1SHJA 2PLNA 2V4UA 4ZKDA 4HHEA 1GZ3A 1QORA 3DDOA 4YJ2B 2AA3A 2G71A 3TRDA 3EGDB 1YS2X 4HGYA 1DRWA 1AUVA 1XMIA 2EKPA 3AHCA 4LQCA 5DBHX 4B7ZA 1F06A 3G2PA 1XJWA 1OJLA 4CL0A 1ZK4A 3GFBA 3W5HA 2NP6A 3FTPA 2ZWMA 2DCMA 1XBTA 1IULA 3U0VA 1M1YB 1L7QA 3FSJX 3RCBA 2GN6A 4AZWA 3I9OA 1YRHA 4PGFA 2ZQYA 1AXRA 4ZODA 4EI9A 5LQJA 1ESMA 4PN3A 3DR3A 4GI1A 1VLHA 3L4KA 5JH7F 4GQBA 4LVCA 2AHOA 3D59A 4P6VF 4LSMA 4OQ4A 2JA1A 2C3OA 2XTJA 3VI4B 1CFJA 1TRKA 4IIYA 1MT0A 2E2WA 2G76A 1YIDA 2HQOA 5JSUA 2I6FA 5HJ2A 3VU8A 3AONB 5TPZD 2BLNA 3UICA 4IZHA 3CKKA 2WKQA 2PY6A 4YJDA 4MAFA 3DOHA 4Z0HO 5K6AA 1ISMA 1ZJYA 4R2LA 5HGXA 3BFXA 2CV1A 4P34A 3TTTA 3ZY5A 2IV7A 3M49A 2Q0QA 4TS1A 4AT1A 1AQ6A 2B0JA 2L2QA 1QCYA 5DX8A 5GAJA 4PRZA 1YJXA 4MRPA 4A0GA 3P0EA 4ZOCA 1SVKA 3O1JC 4YBRA 2XPCA 4RY2A 1HF3A 1YZNA 4BPBA 2HJWA 3FCEA 1I0IA 2VF4X 2YC4C 2Z5VA 3DVRX 4UTOA 2WB4A 3NI2A 2WNSA 5L3RA 1JQEA 4WD3A 3PL1A 4L3WA 3OJCA 4TVSA 2H1IA 2QRPA 3BD8A 4KWEA 4BLWA 1CZHA 3UFXB 3M2TA 3UOWA 4E3WA 1CR2A 3NEJA 4REQB 2OXFA 2WYHA 1G8AA 3F6SA 4W7HA 1RLJA 4JITA 3EARA 3IV6A 3R6TA 1QVZA 1N9GB 3MPUA 4R31A 3IIMA 4WIAA 2RG7A 4HB3A 5BWNA 4O3MA 4KLAA 4KVZA 3ZYZA 4E5MA 3Q1LA 4HNAB 1XZJA 1SCAA 4MKZA 2RMKA 1FPMA 4L0CA 3H9CA 1BD4A 1H22A 3F78A 3CZRA 4RK4A 3G85A 2FOLA 4MVWA 5G3YA 5DI3B 1YFZA 1A69A 5TE9A 3UZUA 2MJLA 4YJHB 3V42A 4XVCA 4B45A 3I05A 4Z2AA 2PPLA 1P2BA 4Q3BA 2QLNA 3EX7C 1G6KA 1QZZA 4OAOA 2HCJB 2IF2A 2EW1A 2POCA 2YZ7A 4TWIA 1KJ8A 3C8UA 4Y0NA 1NXPA 1ZLXA 3C3DA 3OCYA 3V8PA 3NAGA 2ZRGA 3N8KA 3HFJA 5BR1A 5BXYA 4MIKA 4UAUA 3BS4A 1HXHA 2H3HA 1AC5A 2LKDA 4E6PA 2WJ4A 1C0LA 2RGXA 2DF8A 2X2FA 2AOUA 5TV2A 3TIVA 4XX1A 5K7SA 1R1DA 2G17A 3NX4A 4D02A 3K0FA 5I5EA 4MQEA 1RPAA 2HDWA 4GP7A 3A6ZA 3DM5A 4N7BA 1WOMA 5EIHA 1W1IA 2PWPA 3PQ6A 1YDHA 1J4AA 1XYYA 2ZWVA 3F96A 4P5EA 4QNRA 4DNOA 5HPYB 1BE1A 1OC4A 2YCBA 5DGDA 3W2TA 4C6RA 2FQWA 3IILA 1B8NA 4A0QA 2PUAA 4F38A 2IY8A 1NJGA 2IQIA 1GSOA 4XGNA 4J94A 3G2LA 3VZQA 5DHFA 2XMBA 3L3BA 4L76A 3MLEA 2WWRA 1RMQA 2G07A 2J9ZB 3CY6A 4WK0B 3JQGA 1SBZA 5FBKA 1UOPA 2ZCJA 3WHLA 2CZGA 2PUJA 1FXSA 1NLFA 1JXOA 4E31A 1L7MA 5KQRA 3K9NA 1SHUX 2EGGA 3F8SA 4WK4B 4Y2HA 3JCZA 3L6CA 4NJMA 1VPEA 5PGMA 4N0MA 3TR0A 3VU3A 2A5LA 2BP7A 1TUEA 4MR8A 5AMXA 4CQLA 1GA4A 1E1LA 1Y3AA 4LJLA 3TMAA 3ROQA 2H2DA 4NK4A 2RIPA 3CR8A 1MJHA 3DVAB 2ZUCA 2HK7A 4MYHA 1M2FA 3GVHA 2FJUA 2GZ3A 3PWTA 4MEAA 4EY6A 1SIOA 2JRCA 5K09A 5LIRA 3ONFA 5LP1A 4YJFA 2WF8A 4AJ1A 4J0HA 3QKRB 3HH8A 3KTFA 1G1MA 1KNQA 3I4LA 1QHGA 1BEEA 1BXGB 2GCOA 2H9IA 2O07A 3LRPA 3HP4A 3ILHA 4KZKA 3L6OO 2A5GA 4BMVA 1QWSA 2G9VA 4CM4A 1KVRA 4LE1A 4UEQA 2JFVA 1DRJA 3MCUA 3I12A 4LJKA 2C5FA 2I6GA 1UBKS 1SVWA 4OMUA 1Q7EA 2AMLA 1B1AA 1B0ZA 1H0KA 2BDTA 3MCWA 5FBHA 2A9PA 4MVJI 4B74A 4TSKA 1JSCA 1FYVA 1L5HA 1XTIA 1Y7IA 3D4NA 3HYCA 2EXXA 1UPTA 4MS4B 5AW9A 1DC5A 3TPZA 1B8OA 3EPHA 4IIFA 1ZI9A 4DLUA 3PQ3A 3H3FA 4PCUA 1J25A 2BFBA 2M1ZA 1GG9A 3D3QA 1WSBA 1YTLA 3I42A 3P97A 3RV3A 3RUAA 4JKIA 5JC8A 1UMCA 4FGSA 3MJ4A 4FR5A 4DOMA 3LQ1A 2A7QA 4BNDB 4EATA 1K6XA 2DLCX 3KVYA 1L0BA 4U9HS 1J0DA 4RPCA 3KT6A 2WM2A 3W6OA 1L7RA 1N6OA 2XVAA 3ZXIA 1EFHA 5EZ6B 4FFRA 5FOSA 1ENZA 4U2DA 2H5JA 3MWEA 4LJ8A 3PSHA 3RYCA 4UDYX 4X65B 1TZKA 5DXFA 5HUQA 3HRHA 2H00A 1JAHA 2WJ3A 5K1ZA 4AYXA 3PUJA 3PUIA 4FMDB 5A2GA 4Y18A 5FWXB 3LDAA 2EBHX 3T5DA 4F3NA 3PEVA 1PR3A 1DFHA 4O4LA 4P2GA 1ZOLA 2HMYB 3AB7A 1QKIA 4FGJA 1UDCA 5K3BA 3IOMA 3UG6A 3WQSB 3HGMA 1UEXC 3FMFA 4BQRA 4DSUA 3UKDA 4FK8A 4XJSA 3RGWS 2X5OA 5DMHA 4RZ3A 3SY8A 1AUQA 2CNNA 3WE7A 3EEQA 2FEPA 1LWNA 1P5ZB 3HY3A 4IMRA 5CTAA 1UF9A 3CRNA 4A0RA 2VAMA 1ZGAA 4PC3A 4I1PA 3VC7A 3H2JA 3HB4X 2FCRA 3S2ZA 5LMZA 4BP1A 4X66B 1G8SA 3LMKA 4WLOA 2W8BA 2XW6A 3C43A 3ZDAA 1TK3A 3OFNA 4GG1A 2CFIA 5J1SB 2WSYB 3PZBA 4K6KA 1E9EA 4XX0B 4LA4A 3L4EA 1PBTA 1XP5A 3BGIA 4WBSA 5DNWA 3RWMB 3TRIA 2OK7A 2A0FA 4H9GA 521PA 3C3PA 1WBJB 4FQ5A 4JCOA 4ZKEA 3S1LA 4V0KA 1YV9A 4PFKA 3ZJYA 3VUEA 1V41E 3R44A 4AF8A 1Z4QA 1Z6ZA 1X77A 2BFDB 2ZIEA 3RJ9A 4B3SB 3DHVA 4F56A 1Z4NA 4A8HA 1YHYA 2IOHA 4DJJA 4ESOA 3BT7A 1ULSA 1XN1A 2AWOA 4YRNA 1U2DC 4O4LF 2H63A 3ET4A 1ATIA 1YASA 2GCNA 3F1LA 5DFAA 1F4PA 2QRVA 3GFQA 1KK0A 3PFHA 4WADA 4WKGA 5GQSA 2P9FA 4F86A 2CNDA 4S2UA 3KJGA 2XX3A 3ND5A 4HJXA 5T4EA 4XWTA 3C8DA 5JG7A 3B70A 1P1RA 1N2CB 1W6RA 1XRRA 2QTMA 3FFTA 4JWKA 5THXA 3AEZA 2Q8NA 1E1DA 1X42A 2GTPA 3PFBA 3ADKA 4N40A 2CMHA 4QLBA 1H3NA 1VJRA 1XJ0A 2HADA 3WTBA 2FWMX 2OHJA 3TQRA 2R6JA 4J0JA 1P1JA 2YIMA 5HQ3B 1SXJA 5AUOB 3BMCA 2F48A 4DG8A 1EVQA 4IKOA 2ZBGA 3QTTA 4XQEA 4URZR 3THYA 3IAS1 2E4UA 2ZE5A 3KYJB 1EFKA 1LLFA 3D6VA 5DNEA 3TQOA 3CVJA 3N7UA 1WXWA 2UV8A 5KNBA 4IINA