2IQIA

Crystal structure of protein xcc0632 from xanthomonas campestris, pfam duf330
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
178
structure length
173
Chain Sequence
ATIYAPTVRVTPNPAWPQVSWQLLVAKPSAARIIDSPRINVRPTPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVARISDYKLAIDVRRFESDYAGQSLPAATIELNAKLLHSSDQRVVASRTFTVARPSSSTDTAAVAAAFEQALTQVTTELVGWTLITGQQDSQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein XCC0632 from Xanthomonas campestris pv. campestris
rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein XCC0632
total genus 49
structure length 173
sequence length 178
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03886 ABC_trans_aux ABC-type transport auxiliary lipoprotein component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10610 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ABC-type transport auxiliary lipoprotein component 2iqiA00
4HRVA 2IQIA 2MIIA 3W1EA
chains in the Genus database with same CATH superfamily
3WGIA 4ANFA 3AB8A 3GFVA 2IHTA 3W5AA 3VJRA 1QBGA 3C6ZA 4O0LA 4R41A 4W5HA 3L01A 2WJHA 5IJXA 1JYFA 3R6DA 1KO5A 5BV2P 4H4DA 3ZNOA 4RVUA 1MTZA 1XCLA 3HA5A 1R12A 4CEJA 3SSMA 1P4AA 3EQZA 5EMLA 3ZD6A 3KYCA 3FLEA 4RY9A 4GKAA 3UYLA 5HQ3B 1W6UA 2QR5A 5EEGA 2JGFA 2WA2A 1YQEA 3ZWPA 2G9QA 3O2QB 1E2NA 1Z06A 3AM5A 2OC4A 1SGWA 3DFZA 3E35A 3QY9A 4ASUD 5C8YA 1TK9A 3QUAA 2LPMA 4MW4A 4DLRA 4BO7A 4CEHB 5JROA 2WSYB 1NA5A 4N18A 1CX9B 3ETJA 2ZIVB 4NBLA 3LP6A 2F3TA 2Z8XA 1GSHA 1I1QB 1G3MA 3CF4G 3RVBA 5EIFA 4CDRA 3H5WA 3I61A 2B7LA 3THRA 1SBNE 4MJ3A 4Z0HO 4B4WA 2V3CC 4MJ7A 5EJ4A 1CYDA 4AP9A 3TLCA 3MBOA 1DKNA 3LRXA 4NYIR 3SVLA 3KPYA 4KQKA 1GL6A 4BB0A 4N5DA 2DWOA 2C58A 2AXPA 2QDKA 4JLDA 2IY9A 4P7KA 1NUUA 1UPUA 3QM1A 1XJWA 3DFUA 1ZW1A 1Z6QA 2FZCA 3GRKA 2N46A 4QNNA 4RE6A 2GCGA 1V16B 3F6SA 2JA2A 2GAIA 4OFWA 4K0RA 4X8LA 5JT1A 1NI5A 1AS0A 3KPUA 5TEVA 4KRGA 2KE5A 4PZEA 3EZ9A 1RLOA 3FZGA 1OY1A 3BFJA 2PX2A 2A0WA 2VH2A 2Z4TA 1U8EA 3GEPA 1BX0A 3OTGA 1LS6A 3TWOA 1HG1A 1JR3D 2RHRA 3DPIA 1BD3A 4IVNA 4YAJA 1BRMA 2CSUA 3I5UA 3B3FA 4FKMA 2XXAB 2D1FA 4B8ZA 2DCMA 3QKSA 3WB1A 3PTAA 3SQMA 3DFIA 5BOVA 2GS9A 4EM6A 4NE9A 3R7WB 3S1AB 1TU4A 1M8PA 3GAAA 2AYZA 3H87A 3OEYA 4FNGA 5DSTA 5GM1A 1VBFA 4BRWA 5K8VA 1YBHA 3QMPA 1YR2A 4H17A 3CUYA 3QBTA 5KYWA 4ZYUA 2QX4A 2CW5A 2RH8A 1OGYA 3PGLA 5AM1A 3RVDA 2DUWA 1CQIB 1ZH0A 2O3QA 3PPWA 4MQUA 3O8LA 4O4JA 4WFKA 1YR1A 2WP8J 2AJCA 3EY9A 3QJ5A 4X60A 4CTJA 3Q7PA 1KEKA 3V6MA 1AB6A 5ETJA 1N4AA 1QC5A 4C1BA 2XA9A 1P5RA 5EZ5A 1Z7EA 5EHGA 2AFHA 1LBQA 2DP4E 1SUWA 1ZBDA 4Q3AA 1G3IA 4YMGA 2P6RA 2HIGA 3L02A 2JD2A 3LFUA 4ZXFA 4NFLA 3HBLA 4EGSA 3C15C 1X8XA 1N57A 5JDCC 3E84A 3QP9A 3KHTA 2HLDD 2R7AA 4DKXA 4ALJA 3EEBA 1KEUA 4HPWA 1OAOC 1W5TA 3C74A 1N1EA 3LQQA 5JFGA 3IP9A 1CHDA 1U5BB 1P8AA 2WDPA 2ZBUA 3WKDA 1UDAA 3LCCA 4D8WA 1YACA 1K8XB 5IKEA 2YHIB 1RFGE 2Z4RA 4MVJG 4PTLA 3ZYZA 4FWTA 4GQBA 2IEGA 4EY7A 3NT4A 3DBOB 4F2GA 3OF3A 2WAXA 2ECPA 3DWIA 3FUTA 1JP7A 2VOJA 1KH1A 2VUHB 3ELWA 1BRTA 3K0AB 1JF8A 4MDYA 5FYQA 2CDRA 3GVCA 4CBVA 1U0SY 3S5JA 5GY7A 2P79A 1PS0A 3AR3A 5TB5A 4US2R 3SBEA 1G8HA 4DLLA 1TVMA 1W36D 3WIBA 2GQ0A 2IHKA 16PKA 4UHDA 2H2FA 5DCUA 3ZCPA 5F1OA 4AIRA 1OBVA 1QO9A 5EPOA 2OSVA 5DCYA 3K5IA 4N7BA 4NARA 3A9SA 3H9CA 2PNFA 4CIYA 5FEMA 2WU1A 4UUNA 4ZEXA 8AT1A 4D3SA 4MRNA 1EA5A 1F8GA 721PA 3RUHA 3VU3A 1QH8B 5GMOA 4JY7A 4PLTA 2V03A 4CR7A 3G2IA 4Q4JA 4QULA 3ZVMA 3NM5A 1DBWA 2G5CA 4GRDA 1I9GA 3DV9A 1JJAA 4NBKA 4DDVA 1OT5A 4QYMA 1UL1X 2ZVPX 4WKPA 2NUAA 3SS8A 3OU7A 4NIMA 2AJDA 3QELB 2C9BA 4Q4JB 3WQBA 1Z2OX 2R7KA 4Q7KA 1JEYB 1XJCA 4ZO9A 3COVA 3L0YA 3S1SA 4NCJA 3R6TA 5J2UF 4PGMA 1J9EA 3LW8A 3UH1A 1NKTA 4MDFA 1P3Y1 3BMQA 2W9XA 3RSZA 3HJHA 1J06A 3TEFA 3HP1A 1YL5A 5J4YA 4JT8A 2G6BA 4Y1EA 4LTDA 2CXNA 5DLEA 4V0KA 4E5KA 1U6KA 2FQXA 1QP8A 4P7FA 1R4NA 2H8GA 3BL6A 3I2JA 2I7DA 3D6TB 2Y0EA 1N9ZA 4JUBA 1JXOA 3RUFA 3UQZA 1PL8A 1YOBA 3PHGA 1T0BA 1C7FA 2BFCA 1H1LB 3IV6A 3K0AA 4XB2A 2JKYA 2VZ9A 5ARCA 5AW8A 1L9KA 2PUHA 2FMUA 2FMIA 4DIKA 3DT9A 1NFFA 3KTDA 4R98A 2A7QA 2Q1SA 1RRPA 3LLSA 3M2TA 4K1LA 1VBMA 3OZFA 2R11A 3R6GA 1ZGHA 3RC7A 3IUQA 4D74A 4MRMA 3OZCA 2XQIA 4UEQA 3RV3A 4HX9A 2P6NA 3BRQA 3SEFA 2X14A 3U3KA 4F4HA 4QQNA 5DLDA 1N77A 1BN7A 3Q8XB 3H1TA 1H4VB 4TLBA 2HA7A 3LFHA 3FYSA 3RSFA 4RF2A 2XV1A 1BE8A 1KIFA 1V8DA 2HXYA 1YZNA 3PC8C 1L5GB 4ZYTA 3WYBA 4BO3A 1FJGB 2IDKA 2QNBA 2CJPA 2PH7A 1BJRE 3VKFA 1F0NA 1QC5B 1W581 5AICA 2RHJA 1YBMA 4FNOA 1YNOA 3OCJA 3UUFA 2I4TA 4L57A 1V2HE 3DLAA 3LJKA 5BSEA 3BDIA 2MIIA 3THOA 2WJGA 4BE4A 4E30A 4IO0A 3B7WA 3D8BA 1DWOA 3M4YA 1EHIA 4O2RA 5G3ZA 3ADDA 1C4KA 4HFJA 3ZWBA 1JHUA 3AHHA 3FNBA 5B55A 2W70A 1DZ3A 2L2QA 3PHLA 1RWKA 4E94A 3ST7A 3I2HA 2V97A 2NU8A 1EXVA 3SXPA 4AFNA 5HK9A 2HQBA 4NSNA 1ISRA 2O2DA 2PZEA 2O5CA 1WCXA 2IGTA 4HEJA 1ZDMA 2DUNA 2WQ7A 4WNYA 1YMQA 1Z88A 1B41A 2GTIA 2QYTA 5CA0A 4UQLA 3H2JA 5EE1A 1M2GA 4YAEA 1P4SA 1TD9A 1AN9A 1DHRA 3L06A 4LZAA 2P2SA 1CV2A 1VL5A 4KTVE 1ZI9A 1YKFA 4XJVA 5D5PA 5IT9A 4U5XA 3WQHA 2NO0A 3KD3A 1XVLA 4LHEA 4AUNA 4Q7JB 2FEWB 4F7WA 2IZ7A 2GESA 3GYBA 3HJNA 5M3BA 2JI6A 5CPFA 1EK6A 1FLAA 1TM7E 4LE2A 3FI9A 2AC4A 4JT9A 2IH4A 2BFPA 3CX7A 4YT2A 1YC2A 1VJRA 4WFIA 3SD7A 1MQ8B 5HCNA 4DWOA 7ABPA 3I58A 3BFVA 1H1DA 1QB8A 4DEYA 4EY3A 1MG0A 3F6EX 3VU9B 4ZMBA 3ZEIA 4IGKA 1RLUA 4MUJA 3FHJA 1U0OC 3CWCA 1I4DD 2XIQA 4WPGA 3D81A 1LSUA 3LVQE 4TWZA 4OP1A 5E7QA 3VTKA 1GQOA 3OM8A 3ZBPA 2AN5A 1CNEA 3C7AA 4MR7B 4RH3A 4WXMA 4YV0A 5JZSA 3PFFA 3UV7A 1QV7A 2BR4A 2X9GA 3R09A 4DT1B 4CEHA 2C4VA 3C1UA 4K28A 3IMEA 4EPYA 1RC1A 4PYNA 4CM9A 5DHFA 3PJRA 1U04A 3MAJA 3ZHOA 4OJKA 3U19A 2AG8A 2H0QA 3B6IA 3DLIA 3EXG1 2FEOA 3H99A 4MWEA 2IRWA 3ONVA 4ND3A 3VH2A 4EJSC 5KNDA 4Z4QA 2AOXA 4EGAA 1XF9A 2QVLA 1NR7A 3HN6A 5CU7A 2HO4A 4CEJB 4MW2A 1W88B 2ZB3A 3BJIC 3ZCUA 3AOGA 5JS1A 5ALXA 3UWDA 4UXJA 3VR4D 3T38A 3LDUA 4KLZA 3A3PA 4X20B 1PQWA 1IY9A 5SICE 1OIWA 5AVRA 1KPGA 2EG9A 3IOEA 4M1WA 4QECA 3Q11A 1D5WA 1ESZA 1ZIYA 1EG7A 4XIYA 1GNTA 1PLJA 4ZVRA 3ZUGA 5KWIA 4QUAA 2C3UA 1JR3A 2BDTA 4ISBA 4PLPA 4ENVA 3ITEA 1XGKA 4EHAA 4DMCA 3L43A 3DTNA 2X7XA 1EYZA 2GN1A 1SUCA 3AR2A 5KQMA 3N2KB 1TU3A 2UXCB 3CG4A 1IHXA 1E1NA 5P21A 4BQNA 4FHFA 4KLCA 3KQSA 1OTYA 3C1TA 5C52B 1EUZA 3K53A 3A6DA 5CGQB 4NZYA 2ZJZA 3MB5A 5ENZA 1CSEE 2EKPA 2F90A 5DV9A 3L4BA 4LRYA 1XALA 1D4AA 3L8HA 4AN0A 2VQFB 1UBFA 1YI1A 2P9YA 3NMUF 9MHTA 2QZZA 1TECE 1P9WA 4CG3A 2COUA 3COYA 1DOAA 1U9IC 3R3UA 4TKLA 5AP9A 3WADA 2FG7C 4XDZA 5AW9A 3T15A 5CFZA 4DV4B 4Y0NA 4WGFA 5CYPA 3AUAA 3OQNA 3U7GA 1T9HA 3V1LA 4BMNA 4IIXA 4O4JF 4P5DA 5T64A 5KNDH 1A96A 3QHAA 3U9LA 5K0LA 4ZI7B 1JKJB 3SR4A 5A6VA 2AWNA 3FCYA 4Z9YA 5J63A 5JADA 3THYA 3FTCA 1EM8B 2ADOA 2NMVA 4M7PA 4REMA 3ASZA 3GJ8A 4NE2A 1EFVB 1W2GA 1ZISA 1N9KA 3CONA 5IAKA 5CCDA 2ZZMA 4QUBA 3WNBA 4Z7OB 3JD3A 2JGKA 4WVFA 1G0OA 3H1FA 3ZE1B 4J0CA 3NYQA 2NVBA 2G88A 2IYRA 4M53A 4OMFG 3A10A 2ZJ3A 2NVUB 1NE7A 1PJLA 1HL7A 1SUAA 2CHGA 2FWNA 3MJTA 4EBBA 4BVKA 3G2NA 4RKWA 5AESA 1FRQA 1FS5A 1Z4JA 3CEJA 3D7KA 4LFCB 2BEVA 4TXHA 2PXHA 4NYMR 1PUJA 4CM3A 3GFPA 1XWIA 4OK3A 4P4SB 5J58A 2R47A 4TWBA 5GAJA 3KJXA 4IWXA 2DQSA 1Q0LA 2JCYA 3IXLA 4KYTA 4AICA 4F1WA 4RM2A 3PWZA 2I71A 1IU9A 2R00A 4D46A 4D57A 1K7YA 4XEUA 1CY6A 2G9NA 1PT8A 1RQLA 1O6CA 3QU9A 5AXBA 1WVMA 2J0UA 4HXYA 1XAIA 4HGQA 1PK7A 3Q3IA 1JIVA 1R0LA 3RNOA 3RADC 2PLWA 5BOSA 1LW6E 5CX1B 1XMXA 3PYXA 2I9PA 1G5RA 1T2CA 5ALMA 5CB4B 1Z33A 4WE3A 5I9SA 3U4GA 1YB1A 4H15A 4BRZA 3W05A 1ECGA 3AI1A 3DAPA 1GGJA 2DKFA 4GEGA 4NG4A 4UHBA 4ZVUA 2GZDA 3MWDB 3SBXA 1BHO1 2DBYA 4K88A 4G5OA 2Q4TA 3RU7A 1N75A 2PKEA 3ZY3A 1P9RA 3G8YA 3TPFA 3HU2A 5IF3A 3LF2A 3GU3A 2JATA 4YMIA 1KEEA 3NC4A 4RTMA 1WOYA 3SVZA 1LX7A 2V0CA 1EVLA 2D4HA 1LRKA 2HGSA 5KNCH 1L5HB 3QXJA 1B8UA 2EOAA 2FN9A 3AUUA 3N3BC 5EP1A 2X4GA 1W4ZA 1VYHA 4HNAB 7YASA 1I33A 2XWJI 1EU1A 2XCRB 1MPTA 4ZGBA 1PN3A 4G1FA 3RJ5A 3G6KA 1IONA 2OUIA 4HJRA 2IS6A 4HUQA 2ETXA 3WBJA 4B0OA 1AC5A 4QWWA 4OX9Y 1AK9A 3NBXX 4GZMA 4U7TB 2IZZA 5FPSA 4KQCA 2W71A 1SIOA 4KZPA 5K03A 1A9XA 4XVUA 1CD5A 5CW2A 3H83A 2NYRA 1W5SA 3OETA 3A6ZA 1GNPA 2O3UA 3MWEA 3LPNA 1EXNA 4HYQA 5DWQA 4BFVA 3IIKA 1EHYA 1A5ZA 1SQ5A 1KDRA 1XZEA 1GUFA 3VHXA 2HPZA 1P3JA 5JV5A 3FF1A 2Q7XA 2R25B 4G63A 3W4IA 3RS8A 1GPWB 3L8FA 2W6CX 4G85A 3QEBZ 1ZOPA 3LZDA 4R0NA 1MW8X 4J43A 5L51A 1X8KA 4EG1A 1JN0A 3B60A 3PUJA 3RE1A 1HQYE 3N6RA 4OXKA 4DTIA 5LIPA 1NV8A 4PIPA 4AKIA 1YS2X 3SQOA 1M2JA 1Z7WA 2I22A 2VI5A 3GZ4A 4OLJA 1GAWA 2J08A 4F11A 1G4UR 1U28A 5LMNB 2QJWA 2AD5A 2BONA 2C29D 1W93A 3D1VA 4MS4A 4OHVA 3VR2D 4YDHB 4DKJA 4AZSA 2A1UB 2XTMA 3BPSA 1DE0A 1U9JA 1VP3A 3N7AA 2NV0A 1CS0A 3D6JA 3DE6X 3ZC3A 1K6IA 3DXZA 1QYRA 1SQGA 3S29A 1MO2A 2DRIA 1MOQA 1Q6ZA 6PFKA 5FOVA 4V2IA 3P9IA 2GVZC 3PICA 4DQLA 2ZSUA 1EFRA 1Y9ZA 4I14A 2B2NA 3AMVA 2WG2A 2RHTA 3ZE0B 2UUAB 2WWGA 4OJMX 2Q6VA 2CMHA 3EXHB 1EZ4A 2O05A 2WNIA 3K1JA 4RLFA 3WYCA 5FTKA 2VP3A 3EXEB 4NFHA 4FP9A 3SPXA 2YYYA 3MJFA 4J75A 4LOLA 1K97A 4S1VA 1UJ5A 1YFZA 2B8TA 2HLHA 3PE4A 2VYND 4RIIA 4PZYA 3EB9A 2M6SA 4GWKA 2HJVA 1V48A 5GIPE 1UK8A 2D0IA 4X66B 4ZCIA 3A2KA 2BFBB 2GI4A 3BB4A 1G66A 4JJIA 4UCWA 3TSCA 4B40A 5GONF 1PGNA 2M2IA 2F8TA 3D3EA 1LPSA 4M0EA 4RD1A 3V80A 3TGWA 2WOOA 3H16A 3GLTA 3OIWA 1I1NA 2PX4A 3L4BC 3T4EA 5JD4A 1NRXA 1KJJA 4A27A 1PQ4A 4PSDA 3R9IA 3VMFA 2H1FA 2HUPA 4DR5B 3E53A 3EXFA 3AP3A 4G0PA 1JMYA 2G70A 2P2DA 1HE1C 1REQB 1SHKA 2B6HA 4FYJA 3SNHA 5ITSA 1FFBA 2QLNA 3OZRA 4RJ2A 5ESWA 3CNEA 2IVFA 4EJ2A 2BZSA 4PRKA 1GZ6A 1CQPA 1ODLA 4G0XA 2ODNA 1Z26A 4HAVA 4MLPA 2D2EA 2P62A 2XQJA 4ZCPA 1BFUA 3F8SA 1X80A 4MICA 3QFRA 4RF3A 4CHTA 5I7HA 4E1BA 3IOYA 1C9EA 1S7CA 5E1BA 3KOUA 4PRZA 2RHDA 3H3FA 4B5KA 5ECDA 1DEHA 1ULBA 3C3JA 1JKMA 3JYQA 4AMBA 4NBRA 3TNYA 1HEYA 1GN8A 1QGAA 4ZI7A 3KKQA 2WWRA 3PGJA 3UJNA 2CB0A 4KLAA 4UOEA 5G0VA 2G6TA 1NVVR 3V4FA 3A4TA 3O4VA 2NSHA 4CKZA 2JZCA 4KWHA 2OILA 5KJEA 2H17A 5B36A 2QLTA 4IUCS 5AI9A 3BKWA 1N92A 5F76A 5DULA 1WZEA 1Y9AA 1TYBE 3K6RA 3OQIA 1IN4A 5IJ0A 3P9YA 4X8OA 1L3CA 1AK1A 1RP1A 3D3WA 1U2RA 3QUBA 4KACA 2GUGA 3OLXA 1DRUA 1K3FA 1OBHA 1Y5LA 3MLEA 1XRRA 4W9NC 3HR4A 4X5OA 4JOQA 1QIEA 2HLNA 3FR7A 3ND8A 4DXHA 3WBFA 4ZCMA 4G0UA 4OH1A 3SWWA 3CC8A 4CM7A 4D9KA 3QZUA 3EARA 1ZWLA 3PB3A 4MYTA 3U56A 4XRGA 1QHEA 2C9OA 5ARDA 1OJ7A 3SM3A 2W4QA 1TJ4A 3GDWA 2EX0A 5JPIA 4PX3A 4FB4A 4BEBA 4EDFA 1MF7A 2J6BA 2ZFUA 1A1VA 3R2JA 1TM3E 3QOFA 2I2XB 3H2IA 4ZANA 3FJOA 4YRSA 4RD2A 5JAUA 4K2HA 1C1XA 4QBGB 3N2EA 1ZVQA 3BE6A 1GPYA 1K5PA 3HB1A 5CUQA 4HCJA 1V1MA 4W1PA 3FGPA 2QBYA 5JVDB 2IEBA 3UT5B 1XHFA 5LLDA 3IILA 5IDVA 4D4LA 1PD1A 1YAHA 3NOVA 4DG9A 4UNRA 4DV3B 3VPSA 4KQWA 2YNMA 5DX8A 4R4JA 1GXSA 5I48A 2WMNB 3NUZA 3RWOA 5ALRA 1JNYA 3EASA 1NJGA 3VA7A 1QUEA 1XMIA 1QRTA 4NEHB 1G5PA 2B36A 1BWQA 4NJEA 3AHIA 1C7ZA 4JYAB 3O8RA 1KNXA 3UUEA 3AZOA 5A7FA 1YWGO 4AYXA 1TLTA 1K63A 1NDHA 2C2MA 2YZKA 3COZA 3IQZA 4Q9KA 2W58A 1XFAA 4JEHA 5F4ZA 3M5WA 3EGDA 4DMLA 1G2IA 4DLBA 3JY6A 4NCBA 5DHRA 3QVJA 1ECCA 2AUNA 2H2WA 1N34B 2EFYA 5AKKA 2BM0A 4KR0A 2FN7A 2H0RA 2JGJA 1AQYA 2P2NA 4KWEA 2QB5A 3M3PA 3V4ZA 2VL7A 2W22A 3CR7A 3LHSA 4ND8B 3RHFA 2VTEA 4C0WA 4BNLA 5E3HA 1KF0A 1IZZA 3FNIA 2C57A 5INTA 2WUDA 2ADMA 1K2VN 2C2WA 1AV7A 3U80A 3A6FA 1E1CA 4XRRA 1K9SA 1UWVA 2EW2A 4FGZA 3SR3A 2CE7A 3H7AA 3ZCSA 1Y37A 5CA0B 4OK6A 1FXUA 2O1SA 4UQPA 4B17A 1AQUA 1E58A 1R8SA 1Z5OA 3PZBA 4ZTZB 4YBRA 3NUGA 2PIAA 5DHAA 3TD9A 2QN2A 1LLCA 2JGEA 4HP8A 4L22A 1V11B 2CJWA 3QF4B 1CEXA 2CUTA 1M1YA 1W48A 1XA0A 3U5ZB 1SVKA 3VPDA 3QU2A 1VKZA 4C6HA 1G291 3VHRA 1QOPB 1ILWA 3JQ6A 1AX9A 3D4NA 4GSLA 4R83A 4QYWA 2J3DA 4J16A 5GJCA 1N5OX 2W42A 1EWTA 4A5SA 2VDPB 4F4IA 1TK2A 3CGWA 4PYQA 1Z62A 5HK8A 3HRIA 1W0JD 1PR6A 2FK8A 3D6VA 4J0JA 5LZ7A 1FDSA 3ZZ0A 1ULTA 2CJYA 2WKRA 3B2QA 4ZPXA 4M1OA 8LDHA 5KS2A 1I7QB 5JNRA 3WDMA 3KVYA 4H6XA 1IPHA 1XRPA 4GICA 4W5JA 4DYHA 1P33A 1ZMOA 1H2ZA 1RADA 1PJSA 5BQFA 2JGNA 2IPXA 1ADJA 2NU9A 2ZYVX 1K68A 1BJKA 4Y2SA 2X9NA 4Q3EA 1WNTA 3EJ6A 4G2TA 1ODCA 4KSBA 4EBFA 2DE0X 1T1SA 4WKOA 1IN1A 4JYMA 4KGXA 3DM9B 3M9XA 4GVXA 2JH3A 1DLIA 3QYPA 5AXDA 3P2YA 3UMFA 1GU7A 4BDTA 3DULA 4YNBA 3VO2A 1ORTA 2LXNA 1W2HA 3H9QA 3IXQA 4LC1A 3OJEA 1DJPA 5L7WA 1IB0A 4JVMA 3G17A 1KTIA 2ESRA 4QLAA 2ZE5A 1Y6RA 2IYFA 1AJEA 1QYCA 1GV1A 2D5AA 3FWKA 3EZLA 3MRVA 4QFMA 4LF5B 1SY7A 2HYDA 4W5QA 3FTEA 1WKBA 3RTBA 3W2FA 1P2FA 4HX2A 2UYGA 4BFXA 4Z1MD 3LHDA 2Q8PA 3PXBA 2HFKA 2OORC 4BMPB 1XHEA 2AXNA 5E4FA 2PR2A 3QBVA 4LNUB 4D96A 5C5DA 2PQ0A 2QD2A 1KRHA 1UMKA 4HDRB 1OAKA 3GJ6A 5HUHA 3FVVA 1CZRA 1E2JA 3I2GA 3I2YX 1IATA 2CSXA 2GCPA 3IQIX 5HCUA 2JJ8A 2I1LA 2PT7A 2BBSA 3U4QB 5JXGA 2HFJA 1LU9A 1GZ7A 5KCZA 4QGBA 4H0CA 1E4OA 1JFFB 1M2EA 4HEA1 5LLTA 4YRJA 5LA6B 3KSAC 2BEJA 5LMZA 4KLNA 4MVJE 2O8FB 3G9XA 5I4IA 4IJVA 5K3DA 5FOSA 4AXBA 2TRSB 4C4RA 5KWJA 1XYYA 3I45A 1XCBA 4FFMA 4KH0A 4P81A 1V7PC 3X3HA 1EQUA 1PHRA 1NYLA 2G08A 1IE3A 3GJSA 4ZQBA 3O8DA 5BSWA 1RYHA 3UGKA 2Z1DA 3PHBE 5JG7A 1JTEA 3F98A 7MDHA 1U3UA 4W8HA 3R40A 1E20A 4ILEA 3PWKA 4XIJA 4A6XA 3BMCB 1TAHA 4IGIA 4EHIA 1I94B 2FLWA 1TEVA 2NAFA 1WP4A 1L5FA 2X6QA 1T4DA 4KPEC 1JILA 2P9HA 2XOKA 3HBNA 2IIQA 5ICMA 3PXEA 4CQMA 5I7WA 4HUTA 2LW7A 1T8UA 2IYWA 4BVLA 4FCWA 4WACA 2DR3A 4N12A 4DR3B 2D3WA 4DMHA 1FTWA 1I2BA 4RO0A 4YV2A 4Q4AA 2R86A 3ETEA 4BB9A 2PT9A 2ZWAA 3AW9A 3FUUA 3KZMA 4FFVA 4IJWA 4HSGA 1J7JA 3GX1A 5KQRA 2Q28A 3HYNA 3AOEA 4FONA 2W48A 3AGQA 3HFSA 3WLTA 2HT6A 4XWKA 1SB8A 3LBIA 4BASA 1NZFA 4IAOA 2X3YA 4LDPA 2O8CB 5AHXA 1RMQA 3B20A 2HPAA 3GJTA 1EWQA 1T43A 3EFEA 5G41A 5J43A 4HDQB 5LN1A 2XGMA 2VHWA 1CQJA 3UK7A 1QF9A 1W44A 2IYZA 3CX3A 2NZXA 1QK5A 1U6JA 2WVAA 3RHZA 4MS1B 3EZXA 3OUZA 3K9NA 5JY6A 3QX9A 3UXEA 2GYVA 3FDZA 3ZOZA 5KCMA 2YICA 1OMOA 1H3FA 1P8JA 3HS3A 2W2MA 1WUKS 4J6EA 3WRXA 1KVRA 4NTZA 5FWYA 2X0EA 1ULSA 4FLEA 2UZAA 2GXSA 3CO0S 3HN7A 4LSWA 5MDHA 2Q4BA 4E5UA 4DPKA 1XU4A 2PS3A 3H17A 2XBUA 3NTRA 4RZSA 5HZHA 3H9JA 1X38A 4BDSA 4K2AA 3S1AA 4BO8A 4FYYA 1DIHA 1E3DA 1Z35A 2GR9A 3MTEA 1PD0A 3DYVA 1P18A 3RRXA 1WWKA 2NO6A 3NEAA 1XWWA 3UK0A 4A0HA 4LHZA 4YRNA 1QPZA 4E5DA 2GMWA 2PV7A 4DG5A 1CZNA 2AL7A 1B16A 5BMVF 4NFYA 2QSUA 4YP6A 2R8BA 2BMAA 3ZGVA 1NVWQ 1YUBA 3VRHA 4DB2A 1CJUC 4GP9A 3CT6A 3IP5A 3Q7IA 1T25A 1JNXX 2EEZA 2QAGC 1PCXA 3IVRA 5AW2A 2Y0BA 3HP4A 1KGDA 1EE2A 3FFXA 1A9RA 1JPJA 5EE0A 2PKQP 3RW9A 3Q3JB 1I6KA 4JI5B 5AVQA 2ZEJA 4ZQEA 3K70D 4I5IA 4C7VA 2JLAA 3ELBA 3EEOA 2B1RA 3PQCA 5F5XA 5TV2A 3TVTA 2A0UA 3I05A 4KV9A 1RT9A 3P32A 4QRHA 1NE2A 5HGXA 2BM9A 1V45E 2OLJA 2XD4A 4QPJC 2BM8A 4IMRA 2QEQA 3K1YA 4P0TA 3ZY4A 1CVLA 2EKDA 2FR0A 3AL0C 2CUNA 1KR2A 1WCYA 3CNOA 5HQJA 5A2GA 4FQ5A 4R1NA 3ILHA 4PR0A 4JGGA 4RVNA 4YC7A 1C41A 4D43A 5L3SB 4KIFA 3KJZA 3RFUA 4BNNA 5AVTA 5JISA 3GOQA 4XLTA 4LY0A 3RVJA 1T8SA 1NVDA 4AWAA 4QBFA 4RLSA 1GFSA 2WM9B 4ND5A 3CCBA 1V25A 5CAEB 4EB8A 2GJ9A 1GAJA 2OHFA 4GBJA 4W7HA 1LDBA 3BJEA 1A4UA 1T8YA 2E89A 2ID8A 2JLBA 1Q2UA 2Q6TA 3JQ9C 4LZJA 1VI5A 4QYSA 4Z99A 1NT2A 1SELA 2VDWB 4RZ3A 4DIUA 2R4TA 2DHQA 3H7IA 3C70A 3STTA 4IV0A 4ENSA 2I7VA 4F3YA 4Y2RA 4FBMA 4ZI2A 2P9TA 4IX9A 2WPDA 3SXUB 4FVTA 4ZOEA 2FH5B 3HDTA 4DCNA 5CJPA 5TVKA 4CT5A 2OVFA 1HZJA 3QW2A 1TO1E 3H5VA 1XD9A 3R5TA 5D3MA 4LX8A 4CL3A 4IX1A 2Z4SA 1E2KA 1ULAA 2DFPA 1N2ZA 2IXFA 2UKDA 3A4LA 4LOKA 1MZVA 2B78A 2WHXA 4M8LA 4PEVA 4UMDA 3HY6A 4KH1A 4KWTA 3BEDA 3O94A 3W1WA 4CM5A 5A1TA 5ICFA 4D5EA 1XTRA 1SIWA 1ZMXA 2Q21A 5F1YA 5FL3A 5LCXA 5JZ9A 3LL7A 3X1MA 5KYXA 3AESB 1KI6A 3ETNA 4M7WA 2BJVA 1LV8A 1N5RA 1X42A 3BHNA 2AQHA 1YGPA 2I67A 2Y9MB 3GZJA 3T7TA 3HUDA 1DMSA 4MPTA 1UXOA 2NUPB 4GXTA 4CKBB 2XCSB 1SXJC 4CR8A 2AHOA 4OI0A 3ADOA 2UAGA 2JGRA 4HYYA 1V96A 2XGGA 4WERA 3WK6A 1SVLA 3UENA 1LTKA 4GBMA 4UCXA 5A9SA 1WHTB 3BXOA 3O5AA 3SZLA 4M2LA 1ZOIA 3TI7A 1TRHA 4R2MA 3NBAA 2NTVA 2O2IA 3MXOA 3V7FA 1AMNA 2IH5A 3T1YB 2VTVA 4BFWA 1F9EA 3R3JA 2VBFA 1SK8A 5A4IS 2JVJA 5J9FA 3JZAA 3CKYA 2IYPA 2YYSA 4RD0A 1D6SA 4BJ5A 3PDWA 4DLXA 1CF4A 3SZRA 4LNUA 1M8JA 4GWGA 3MOGA 5J3JA 1S3SA 3TOZA 3VZSA 1NBHA 3T7EA 4BFCA 3HJFA 1A7KA 3OWXA 4X62B 4PPGA 3G0DA 2OOKA 5JEEA 2HA4A 1YJ5A 2V65A 4PXSA 1O5OA 1CETA 1Z2EA 1ZQ1A 4P33A 1Z82A 1DWUA 3E2MA 4N39A 5E3IA 4JIGA 4JBYA 4N8DA 4EITA 2IUEA 1OASA 1WMEA 2DTEA 1OOEA 3WKBA 5K0ZA 4KWCA 2DB3A 2R6DA 2QN1A 1DKOA 1EFRD 5KOIA 3CVYA 3VQTA 2ZI5A 4B2YA 4K46A 1NUAA 1UEIA 1XMPA 1I0ZA 2QUZA 1ZONA 5TPWA 2IFTA 3CSUA 1G20A 3OQ1A 5K51A 1ZVKA 3P1JA 2NQ8A 4GNKA 4CWAA 2W6PA 4DYDA 2YR0A 3L40A 2X0DA 5LNK1 3W5BA 3GJXC 2WUGA 2DSNA 3W5CA 2Y1DA 3R3SA 1J99A 2NXWA 4BQPA 1HNWB 3ZYCA 4L75A 3DT6A 4ERXA 3CM0A 1IBSA 1ACJA 2VAMA 2AMVA 1KBZA 3G1TA 1VXOA 3BULA 1D2AA 2CGEA 1GAQA 3CB4A 3HR7A 3WHLA 4G5YA 4NMWA 2XYGA 1IDN1 3JQFC 4QNMA 5DHPA 1GRQA 2GAOA 1NP7A 5DNWA 5EJ2A 4PNEA 1R4ZA 2V8BA 4IQ4A 5G1PA 3WK8A 5JNWA 4I9FA 1Z6AA 1XVVA 3FYUA 4CF5A 2Q0SA 1JAIA 5HF6A 3O8CA 3BQNB 1IBKB 4YP7A 1BE1A 4UNSA 1G19A 2A9KA 3VPGA 1O95C 3HO8A 4OBWA 1IK6A 1S2LA 1E9BA 1SA0B 1TIBA 1PI3A 1TYEB 4UAGA 3ZEAA 4DTCA 3LZCA 4OLFA 3UJ7A 1N2SA 4FWIB 3KDAA 3HPQA 3IE2A 1KJQA 3CF4A 1DOHA 4UUQA 1TK3A 2CJWB 2OPHA 2WAYA 4B1FA 3CHYA 3CUUA 1R0KA 1T1IA 2BZ0A 4Y2GA 3QOWA 1I1OA 1K98A 3DMTC 5ESDA 4ZALA 1NFRA 4ER6A 1HQDA 2XSZD 4DCSA 4YGYA 2TS1A 1SVNA 1C3JA 2C95A 2R97A 3DXFA 1YDEA 4FFPA 3ZGOA 1C3XA 2WV7A 3KJNA 1JSXA 4HEA6 2V6BA 4Q16A 2QN3A 3JD0A 3ESYA 4E1VA 2BDUA 2AS0A 1YDMA 1UBUS 2QY9A 4HJXA 4EPWA 1IZYA 4HVLA 5K01A 2N47A 2FR1A 4UM9D 2I2AA 2NO4A 3S5UA 3VKVA 4DJJA 1CEYA 1YIOA 3R7AA 4KQMA 3S6JA 3TXXA 3VO8A 5IM4A 3VDXA 2BFAA 4F8EA 5AJZA 2IT1A 2C3MA 2ODEA 1UIRA 2G9RA 5BV0A 4O25A 3THWA 2D7DA 4GSKA 3T3MB 4HEHA 2QD1A 1ND5A 1DL5A 4P3NA 1GZ4A 4I4LA 4PFQA 2NV6A 4RK6A 3SCZA 1Q1GA 1XQ1A 4L2IA 2ZT8A 1W5EA 1DKUA 2OCXA 4XSGA 3LT5A 3ND5A 2BGMA 3TINA 3ZWDA 3PA6A 3FCOA 4CL0A 3OJCA 4G1UC 4EYSA 1TPZA 1VIDA 1Z07A 3R1IA 3GT4A 2QVBA 3MCWA 4MQBA 5C8DA 5E6RA 1VECA 1KI2A 2J3MA 3EIFA 5ALYA 4XQ0A 2GZMA 1RI5A 1ZCFA 3Q40A 3QFHA 1T0JB 3UWKA 4TQGA 1NTRA 5JEDA 1LLUA 2P1RA 2X5KO 5EY5B 4FHEA 4Z1OA 1BWPA 1MV5A 1QFSA 1U3WA 4PXYA 3RS4A 4BZQA 3R7DA 2JI7A 2GERA 5C8ZA 4JFAA 2R85A 5T3YA 1ZGZA 5C7LO 4A6DA 4QG7A 1T1JA 4AZ3A 1VXRA 3AOEC 4HB3A 2JIQA 3O9ZA 4QJBA 1Y8ZA 4AJOA 3HBJA 2WMYA 4NE7A 1EJBA 5KHOC 5DGCA 1YE5A 4HWTA 4JXKA 3PL5A 4LZNA 2OSBA 3IVAA 3TDNA 2I91A 2BW0A 2VHVA 1PWXA 4Z3KA 3AM4A 3VZDA 1J97A 1A9QA 1G3UA 3BXPA 3Q8KA 1AY0A 1ODJA 3D43A 4F5WA 4AS1A 3Q3EA 5JMOA 3TYXA 3QVGB 3GGGA 4U5QA 1V3UA 5DW3A 3VYVA 1Q57A 2G71A 4ND2A 4N5NA 5FLKA 3QVXA 4UUBA 2EQ5A 5A4JA 1M76A 5KYNA 2B82A 2A1IA 4MI9A 1RAFA 4UM9B 5JCXA 1IPFA 4LJ7A 1RHJA 1S8AA 4BO0A 4DDKA 1RCTE 1KZGB 3IKJA 2JCXA 2UYCA 2QYHA 1IWOA 2BGRA 3HG7A 4OYYA 1LPAB 5DM2A 1HDRA 2FW6A 4HY3A 4NENB 3SEAA 4HWGA 4R6XA 1OX4A 4TMTA 4F6RB 4TXLA 4YAUA 3RBAA 1MAAA 5CVJA 2FEAA 3BIJA 5FUQA 2OFOA 2YC2C 1GGKA 4O8ZA 2WLSA 3DYIA 1P2UA 3H3XA 4F6RA 1ID8A 5EXTA 4BFZA 3KVRA 3OPXA 3PF9A 3Q7SA 1OI2A 3T7DA 2QD5A 2VK8A 4YAIA 1A88A 2X9VA 3NVAA 4M0LA 4Z1MA 1SCIA 2JC3A 1WDKA 2ZTSA 4K26A 4WRRA 2PQ6A 1FUUA 2FWPA 3DTVA 3H2KA 4JEUA 3HVHA 5K1ZA 1T9BA 3WLRA 1J09A 4OKNA 4ILKA 1NURA 2DT5A 3P2EA 4JA2A 5G40A 2DCUA 3WLMA 4YJFB 1T6ZA 3EEFA 3AU8A 3KVNA 2XBLA 2Z1NA 1XB2A 4ZI7F 1TF5A 1XO1A 2JIMA 3GFRA 2W6ID 1GWNA 5KX5F 2O20A 3KT0A 3H18A 4OATA 2B34A 3NNNA 4EKYA 4OHMA 1T8RA 1WLSA 2H3EA 2MTBA 5IJ9B 5HBGA 1GLVA 1N0UA 4I5DA 1B26A 2CVOA 4G67A 4YEDA 5TMEA 2AC7A 4LJKA 2OKGA 4H16A 5F3DA 2IWHA 1CYEA 1KK3A 4MX8A 5FRDA 2DBRA 4A73A 4E07A 3PRKE 2R4UA 3MUOA 5B1SA 2ATEA 1BO6A 2VPIA 4GPBA 4MEBA 6GPBA 2HDOA 3CLSC 3HQ4O 3AT1A 2VHTA 1P29A 5F2EA 2VQEB 2R1UA 2OHOA 4JYCA 3ER8A 2DBZA 3NM6B 4WGGA 3GJ7A 1DT3A 2J07A 3FVWA 4JBNA 4K9DA 3RS7A 2C00A 4IH4A 4LBZA 4DJ5X 2AEFA 1BS9A 2FEMA 2H2IA 1VCMA 2VAPA 3I0NA 2X41A 4H1UA 4JCOA 2QVXX 4NS4A 3EXHA 4EK9A 3OTWA 1A2KC 1YU6A 4DM4A 1DXHA 1PV4A 1U2QA 1UQTA 1AKQA 1E3WB 2OD7A 4L6IA 3U4CA 4YLYA 4HQ6A 3T3IA 2QTAA 1F6BA 5FFMA 1ZGCA 4X9XA 3VSAA 3RLFA 3VVLA 3WGQA 4BNYA 2I7XA 1I3OA 2C4KA 3MS4A 4AUMA 4JUCA 4BJ6A 1GQSA 3NIGB 2IPMA 1QFJA 4KSCA 2IOQA 2AEEA 3ZE9A 5J4VA 2Y66A 1T5DX 4LBWA 3W78A 1XXHB 3GRCA 4KOAA 4L2IB 4BPRA 2EKBA 4M7RA 3QE9Y 5IRCD 2B1IA 1T24A 2B4TO 3M6VA 1UMDB 3EIEA 4MVYA 5BSUA 5I47A 5E9JA 2XMSA 4XCVA 4GLBA 3H5LA 4NBSA 1JU9A 1XZLA 1DAMA 3OC6A 1D1QA 3OX3A 3P7MA 1KA9H 4YUWA 3IA2A 1UC8A 1SU4A 1H05A 3HCEA 4MQ6A 4LE0A 1PL7A 1XCJA 3VHXB 4D8VA 3V7YA 2I65A 3VOBA 4WXYB 1GPNA 4X91A 1GGNA 1C50A 2IX9A 4N47A 3FFAA 4RPJA 3TSZA 5ADHA 3LX8A 2DLCX 1GHTA 2FPWA 3RGGA 4WOCA 1WMBA 4KREA 3QBDA 1Z25A 2RKWA 2JPDA 4P1ZA 2QY6A 3VU1A 2VXCA 1UM8A 1R64A 3FM9A 1LH0A 5IC4A 1RXYA 4G86A 4HUQB 1YCDA 4IHKA 4TMVA 5EZQA 3NAZA 2QTVA 4G23A 3ZHBA 1TCBA 1XTVA 2EQAA 4TWJA 4B3RB 3VO9A 3B9BA 1X1QA 2GWRA 3IPXA 4I4CA 2HB6A 1FP4B 1GEEA 1S89A 1SZCA 3E1SA 2WKPA 3E7WA 4WJZA 1YQDA 4Q03A 2C5EA 4FYPA 2WNSA 2X58A 3LP5A 4WIAA 2AKYA 1CULC 2I78A 2XECA 3B48A 1IJBA 4Q34A 2GCOA 5DB4A 1P0CA 1YA8A 3K3PA 1PGJA 3TL2A 3WK7A 3F0TA 3DO8A 5G2OA 1LTHR 3QY0A 4XQGA 5AXCA 5A2QA 4BPBA 1QYXA 3EG9B 2ZCVA 4ZYWA 3FBTA 3I0MA 3RS5A 1ULZA 2WABA 2YFYA 3O8QA 3OUTA 3PPXA 4N6OA 1ZAKA 3NJRA 3UC9A 1VMKA 2A35A 2IZ6A 2G0NA 1G41A 1M2HA 3UTDA 5JAQA 5JD5A 2JD1A 2Q45A 4UHEA 1E2LA 3G2JA 3MRSA 2ZBQA 3U0BA 3NDIA 2BGIA 4D80A 1W36C 4B3SB 1NW9B 2JD0A 5B4VA 2CXSA 1UBEA 5JJ5A 1PYDA 1O0SA 1SEPA 5ULLA 5BOSB 1SU8A 3LS2A 1HT0A 2QVZX 2C94A 1OBFO 3BMNB 4BZZA 5FAXA 3SJZA 2Z6UA 4P5EA 1TJNA 1UKYA 2RB5A 1QGUB 3DBLA 2AR0A 2WILA 2E9SA 3EWIA 3QSGA 4I50F 4JLNA 3FNEA 3M82A 3N8NA 1QH1A 5LA6F 4OM8A 1WD7A 3VSBA 1XZGA 5BVHB 4QA9A 3BG5A 3GH1A 1ZLXA 3CEAA 1WDLA 5FTWA 1O1YA 3VI4B 4F2WA 2C7RA 3ORRA 4DWJA 2ZB7A 1IL0A 2CF6A 1LWNA 1NRIA 5LB4A 2KBEA 4TRRA 4O3MA 1JQBA 1UC5B 1WV0A 2Q4OA 5KB3A 1ARZA 2JFUA 2XCUA 2G83A 1NXSA 521PA 2GPAA 4D9EA 5HM6A 4I36A 1UQRA 5FNVF 3HWSA 3IOCA 3SZMA 5IBCA 4HX5A 2J4FA 2NV2B 5K6AA 2IYEA 1VG9B 1P1KA 2ZS9A 3TBFA 3IERA 1O3YA 1YQTA 3FMOB 4EO9A 4OI4A 3P4YA 2QM7A 3MQFA 4IXDA 1U8YA 2BGTA 4TTIA 2GXAA 5CTAA 3LT0A 2FTKE 2PBFA 2RI0A 4HFRA 2LUOA 1KIMA 2XHEA 1AG9A 1CJMA 2A1TR 2I99A 4ML3A 4D9MA 5I7UA 3L92A 1EK0A 2PXXA 3M7IA 1U0GA 4FJ1A 2A9PA 3FFBA 1JTFA 5L3VA 4FMDB 5C3UA 2FEKA 5A0TA 1L7EA 2UVQA 4ETNA 2Q49A 1B0AA 3WKCA 3L7LA 3BMXA 2QZPA 2R8RA 3NH9A 1QHGA 5IMSA 1KFEB 3E82A 2J1LA 4ABYA 1KRWA 1URPA 1P5HA 2VHZA 2Z6VA 1R37A 2C9CA 1U0JA 4CI0B 4EEZA 1BHJA 3PD1A 4HMPA 2XOXA 4G0YA 4G5RA 1Y4DE 2ZJ7A 5ERYA 2QQEA 2QX8A 4OIFA 4DV1B 3THWB 3ZGLA 2I6UA 3V9AA 1A04A 1XAJA 4O4HB 1YFJA 3HDJA 5C0OE 4WJLA 2O7VA 5DYYA 5KNBH 3WL6A 4N41A 4B9AA 4Q7MB 5EESA 3WA6A 5GJBA 3RTEA 3KX2A 2GJSA 2PGOA 3RT9A 3ENWA 3ILXA 4UVIA 2P5YA 3S2FA 2KQUA 1ZMBA 4Z4EA 2MYUA 3QQPA 2Q46A 2OL4A 4KQEA 1KSGA 3MLBA 4PS1A 2Q6KA 2I33A 2IIPA 1Q1EA 1K27A 2C4NA 2FG5A 2RB4A 4AC9A 4L9SA 4D44A 1SC3A 4OBXA 4MDHA 2G40A 1YHNA 4IJMA 4UFOA 3SG0A 1H9CA 1JHZA 1ZD2P 1NXVA 3DDUA 3GN1A 3UANA 2QN7A 2AA3A 1C30B 3NVDA 3VPBA 5BN4A 5JH7A 1I4OA 3O91A 2LCFA 3JD2A 5ALOA 3RVLA 3RWMB 2LCIA 2W43A 4AIIA 4DDWA 2NXCA 4QO7A 1FSPA 2VSYA 3AVPA 3D59A 4YRGA 1EB8A 2J6IA 2O2YA 3IBFA 4YCJA 5K9ZA 5IM4F 1JWLA 1QIIA 1Y6JA 2XUKA 1P61B 1EA7A 4ZGGA 3TD2A 1GDHA 2AI3A 1Q2XA 1H0RA 4PSVA 2XW6A 2ONYA 1STOA 2VT3A 3JQ9A 3KOMA 2JAPA 3BL8A 3ZWKA 1YRLA 2G77B 4C0KA 1XP5A 4N65A 2O8EA 4B47A 3GDHA 1IQRA 3X1JA 3ZI7A 2NZYA 1D5CA 1JQLB 5EKDA 4CQMD 1S3FA 1A7JA 2A4KA 3CB2A 3HC7A 4RHCA 5KQPA 3HFRA 1ZVJA 1KMNA 3FUCA 3ONEA 4QTUB 2IUSA 1CDDA 1ZHOA 2EF0A 3WLJA 4F45A 2ISQA 1ZL0A 3LGXA 3KEGA 1CB7A 1R5JA 4RFSB 1U5CA 1OLXA 2P3OA 1D6JA 3LUGA 3Q7QA 1KVQA 2ZDGA 4G01B 2LV8A 1QK3A 4KP7A 1MDFA 3VVMA 5TPWB 3ZJ5A 4DR7B 1KL7A 4IWNA 1YA6A 3E8XA 1M6EX 4MVJH 1OREA 2EWVA 4HAOA 4TKUA 2YUTA 2I76A 5DTJA 1R6DA 2DAPA 3OPQA 4RFLA 5CVEA 1GZDA 1Z9BA 3DHYA 4OQYA 3RK0A 2C1ZA 1L4LA 1XTIA 2X4LA 3BGVA 1R0RE 3BJMA 5HUJA 2EDCA 2FJPA 4RY2A 1VDZA 2GM3A 1O89A 5CB6A 3NIBA 1OUMA 1RBQA 3I9FA 3IEVA 4OQFA 4LF4B 2MSCB 2P77A 1RJFA 4ZK2A 3EDQA 5DK4A 3I8OA 2IPNA 3K2QA 4LF8B 4DCGA 1YVPA 1TKRA 5E3JA 1L4KA 5TNXA 3TW6A 1C8KA 3E18A 3BXHA 5THQA 3HJTA 2QQFA 1HOTA 5FWYB 3GUCA 2Q0QA 4DARA 3L8GA 4RMIA 4A8JB 3K4HA 1I0IA 4NJMA 1VRCA 3UIEA 4L9WA 3HJUA 2H2DA 2JIZA 1U2TA 4FMBB 3ORHA 5EA2A 3E61A 3REFA 3WP0A 4NH0A 1X7XB 4YPOA 5CA0F 1VYTA 5JYBA 4RMHA 1M54A 2FUKA 4PZCA 2BZ1A 4RTSA 3ICOA 3TAHA 2AZTA 4QOFA 1H0HA 4DSNA 2E5WA 4NU5A 1DO2A 4QTYA 1WCV1 4HLUC 2VPQA 1OZHA 1XVAA 3E70C 5AUOB 4CHGA 2ZPAA 1CDEA 5K5EA 5CH3A 5AM5A 1L1EA 2OO7A 4QDJA 1NYTA 1GKYA 2RHLA 3E3MA 1COWD 3MWKA 4K9NA 2HHAA 1DAPA 2AMFA 3FIJA 3LIIA 3FBWA 1T2EA 1IWPB 1P19A 1SVWA 1YV9A 3BRWD 2OXEA 4MIEA 4PVCA 4Q00A 1SWWA 2ENUA 4X1KA 1V1RA 3KXLA 1H6BA 1RYDA 1HDIA 3GPIA 4O1HA 4X0EA 2JGLA 3TZKA 1XCGB 1UXGA 3ZCRA 4IICA 2PLRA 5DW0A 2PL3A 4CU5A 3A8TA 5EJ6A 1V41E 3ZDCA 2H4HA 1ESNA 2BGJA 2J6HA 3NDJA 5AO9A 3L93A 2WT9A 1Z45A 1NQVA 4LRQA 2OCAA 3GLSA 1MAWA 2ZSAA 5K3FB 1Z8DA 1N5MA 4GDFA 1WXHA 4KOEC 5CEEA 1LF0A 4TM7A 2I2DA 4MPPA 2NSLA 2OZKA 4EX6A 4IYRA 2PTGA 3WISA 5A7GA 3ZD9A 1GGMA 3UICA 1ZJ6A 3LQ2A 3Q5GA 3R74A 4AZ0B 2WICA 1GILA 1JXQA 1P3DA 4RV9A 5FUBA 3GUHA 1TQ6A 2BN4A 1W4LA 3FGOA 4CM1A 2G1KA 5KPDA 4KHPB 4A15A 2WJ4A 2I87A 2RONA 1N2XA 5EP2A 2FMTA 3B9PA 1NRWA 1LLQA 2QUAA 4NJMB 3RVSA 5AQ1A 1E2HA 1JIUA 1FYWA 2OCDA 1DOZA 2SECE 3GVPA 3JARB 2GHQA 3LGSA 1T1GA 1T4GA 5TF0A 4MYHA 1RJDA 3TZHA 4Q12A 3ZHYA 4DM3A 3QEMA 1ODIA 4HFMA 4P3XA 4D45A 5ALVA 5IWCA 3UJ9A 4FC6A 1PKXA 3PTLA 4FE7A 1L8QA 3M0EA 1HQKA 1PE0A 4KRXA 1U8UA 4AJPA 1AKNA 3VV3A 4K3VA 3EW9A 3FOCA 4BNIA 1U81A 4XCQA 4EJSB 4PSKA 2HSEA 3GR6A 3FOFC 3FPKA 2OHVA 1F20A 4R9RA 4YV1A 5A4MS 3NKVA 2PCJA 2DLNA 1M5TA 2XLBA 1QRAA 3T35A 3NC1C 4GKVA 1XLUA 1OI4A 2QMQA 4YJ3B 2WTXA 1QR6A 2JFFA 4P36A 1K75A 3L4KA 2BMJA 5EMNA 1YFLA 3EA4A 3AJ9A 4KXWA 3LT1A 1NV9A 2VTBB 2RHHA 4M9UA 3EQ9A 4N5LA 1N2EA 1C0EA 1RHKA 2V1XA 3C97A 1XR3A 4RFSA 1WD5A 2HRQA 5DBOA 2Q6OA 4D9JA 1YSCA 2NU9B 5AVUA 5FBQB 3GP3A 1CQZA 3E9ZA 4M9XA 5AHWA 2I80A 3JYHA 1N0IA 2IJGX 3N5CA 3DEHA 4BWGA 1VLVA 3E8SA 4HLDA 4JHLA 5AR1A 1H9AA 1VIVA 2AJBA 1BOFA 1P2VA 4N1AA 2F67A 4KX5A 3TE6A 4GI1A 4HL6A 5AH0A 3OIYA 4ZT7A 3CH7A 2GZSA 4HSEA 4NBNA 2MSKA 4F4FA 2AFHB 1T1RA 1NWCA 2J9FB 4JKOA 1FUYB 4CUKA 5SZIA 1JHPA 1P0IA 3K94A 1C3VA 5FEUA 3A05A 3HKDB 5FTJA 4P93A 3QEAZ 4H1HA 2XCLA 4HGZA 2ORWA 1ZGJA 1N5JA 2DGDA 4JNKA 4BQSA 5IPFA 1I5OA 2V0NA 2X3FA 4A8HA 5BWOA 2QP3A 1C30A 3BWMA 4NOJA 4O0MA 4Q4CA 4LZZA 4E21A 5FX2A 2CLOB 2P30A 1AB5A 2BKEA 1MIOA 4N03A 2A9FA 2IIVA 2HK8A 2JCSA 3BF8A 4Y6GB 1W19A 2K4MA 1J1IA 1GLNA 1ZG3A 2Q5HA 1VE5A 3KYIB 3LDGA 1VCOA 1W0KD 1YULA 3RLIA 3RPEA 4YLEA 3GA7A 5B6JA 5ES3A 1MHTA 2ZIXA 5E9QA 3PFHA 3U31A 4ED9A 4BATA 3OJFA 3V2HA 1G3RA 1TEHA 5DM60 2X0IA 4TMWA 3G8CA 4YUVA 3MM4A 1R50A 4H77A 2ASEA 4KW7A 3VHQA 5AUNB 1O5IA 2HBYA 5JQGF 4U39A 1JFTA 4UAJA 1UJ4A 4JVSB 3SC3A 2L17A 5KTOA 1C0LA 2GN8A 2F1IA 2WUEA 3H4VA 1LDNA 4L6CA 4X3CA 4JB0A 3RVOA 3RYCA 1QSGA 3A4YA 1YOVB 4AB1A 1E0KA 2ZI7A 3RTCA 1PWHA 4Q9JA 2CVZA 3ZTYA 3GJ3A 4O3FA 3LKDA 4XIGS 5ALJA 1PGQA 3PJDA 5DMHA 3WB9A 4R1MA 3SNKA 1AK2A 1CFZA 3I9LA 4Q9LA 4XE5A 4MLCA 2OESA 1HNZB 4EKEA 4A5OA 3B51X 1E1RD 3ONWA 1E6CA 4KXMA 3RIXA 3HLKA 4OHZA 1M2OB 1RFLA 4XOIA 1M8KA 1NNUA 1B2RA 1HT3A 1X86B 5DKFA 5FPPA 2GVNA 1GPAA 1K7SN 4MWCA 3LWNA 3U44A 2H11A 3ODGA 4DL9A 2WIFA 1CUFA 4N49A 2FZVA 4WY5A 3VM6A 4PWZA 4YRQA 4F60A 3FPGA 3ZX4A 3IUJA 5KYKA 1SPBS 1KVUA 3STXA 3UNXA 3EPRA 1JQDA 1VGRA 4JR1A 3QVUA 1C1XB 3AEYA 4DGQA 4F85A 2ZJ1A 3PC6A 4FJ0A 4AQYB 2FDCA 1QNFA 1QZTA 1NVEA 3P94A 2FJUA 5BW8A 1PR1A 5ALTA 4DMRA 4FGLA 2CMKA 1S2OA 4TTPA 5FOWA 1O8BA 1UK7A 2REQA 5LIRA 1MO6A 2VBIA 1WG8A 3PLNA 2YUIA 4K9RA 4RWEA 4BY9E 1D8TA 1H6CA 1LK7A 3OZEA 4P54A 4MQFB 4YXFA 2AZMA 3S70A 5L4NA 1G5FA 3HGMA 5FTNA 4ALKA 4IDHA 3DBLB 2P35A 3U26A 1RPJA 4JSRA 1L2TA 4QSHA 2JLZA 1P2DA 2XNCA 2ERXA 4V1CA 2ZBEA 4RZ2A 4TKVB 3WO0A 5JUWA 3Q0TA 5E38A 3P0EA 3TMAA 4OSEA 3DEZA 5LQAA 5FQNA 3E03A 2AWOA 3A27A 3TTSA 3IS3A 2A5FA 2XTAA 1I3CA 2CDAA 2QS9A 4JITA 3A7EA 2H5IA 3H8JA 4LTMA 5TVGA 1RZVA 1A8PA 3IJEB 4URZR 2G8LA 3C85A 4JI7B 4BU0A 5K4AA 1XFDA 2P2GA 3K2EA 3KQPA 4HWPA 4XWTA 2Q1TA 3R3XA 4WX2B 5LP6A 3HMQA 4LJ4A 1LQUA 2XQKA 3CTPA 5M5BA 2XODA 1CC1S 2GHRA 3O8QB 1Y5IA 2E1RA 1GTZA 2G04A 3QLJA 5IAJA 2V45A 2ZRMA 4MCHA 1DC8A 5KNCA 4MWSA 5HQTA 1J0AA 1KYXA 2RHWA 2LCQA 5JASA 4LC9A 4CF7A 2HF2A 1X1BA 2IXEA 3FZEA 2YXNA 2D1YA 2GSWA 3K9LA 3TUZC 1LVGA 3TRKA 4LXHA 4XX0B 3OP1A 4GQAA 3TW0A 4JSTA 1COWA 1VJ5A 2CLEB 1WZIA 3H5IA 4Y6QA 3D7NA 2GF0A 2ZVJA 3TGPA 1RBYA 4OB7A 5CLIA 2FMHA 5DBGA 1JI0A 5F64A 4BEJA 3WMXA 3U6BA 1HQCA 2XUAA 3R0QA 4HQFA 2JFHA 3HEBA 1CS4C 2XWQA 4O59O 3F5SA 3R7NA 4M89A 3AUFA 2WNHA 3P20A 3IURA 3PX2A 1NHWA 2Y1KA 3DH0A 4DG8A 2XMBA 2DPHA 3M4XA 4Y6LA 5K3OA 4FSDA 5I45A 1X7YB 1CJKC 1RYMA 4FC7A 1S1MA 3PFCA 4RPGA 3MMPA 4MSUA 5FA6A 3TQFA 3HLYA 4B3IA 3KR2A 1GNQA 2HPVA 3TG8A 1RHUA 2ADFA 3ZWMA 2GCNA 3K92A 4BVHA 3SJUA 5IHXA 1MQ9A 3SLKA 1X1RA 1A97A 1HI9A 3R77A 3WYEA 4PNZA 3IBYA 3BGDA 4IDQA 3A9UA 5D3QA 2O2ZA 3HJGA 4GS5A 3WK4A 3G2KA 3SP1A 2O7SA 1HMYA 2FW9A 3HWWA 3VR5A 3ZHCA 3COSA 2GPYA 2SCUA 421PA 2NAPA 2PGDA 1ORIA 4CV1A 2W8ZA 3BAZA 3C98A 4QUEA 4F0JA 3QXCA 3S2YA 2I1WA 1QG0A 1GFWA 2Q2QA 3AFIA 4HB2A 5A5DA 1TC2A 4ALNA 1J20A 1TFUA 1KKUA 3FDJA 4LAFA 2YTZA 3WL4A 1JU3A 1COZA 3MTJA 5FPTA 4ER7A 4B76A 1LNZA 5JCOC 4GYJA 1OZFA 1QHHB 2PX3A 2PKXA 3U3MA 1LPMA 3ZWYA 4DV7B 2V0GA 4NR0A 3D2LA 4JXXA 2H9YA 3H4TA 1ENYA 1ACLA 4Z0TA 3MBIA 5B53A 2Y0PA 1G2PA 3GGCA 3OLQA 2QW0X 3T7SA 3RTDA 4HZUB 3P2OA 3A32A 1JG1A 2F1KA 2V3WA 3BQMB 2Y6VA 2X0JA 3BTUA 4N40A 1TMKA 1Y48E 3DLHA 1NQWA 2Q3DA 3HR8A 3NHFA 3CEMA 3GNQA 4IY1A 4R7TA 2WE7A 4B6FA 1Y4ZA 5U4QA 2GF2A 2O8DB 5HZKA 2RHMA 3A06A 3HYRA 2IV2X 5E1MA 4WZBA 3NGMA 2QVGA 4HC4A 3NG1A 5CP8A 2YS6A 4O2BF 3UPUA 4QYXA 4E51A 5I3ZA 4BKPA 3N0XA 2W2VA 5DOZA 2BELA 4ALMA 1MOSA 4RK1A 3CVUA 4YMLA 1PL6A 3D3KA 1EVKA 1CLEA 2PG3A 4TVKA 3RQIA 3S68A 5REQB 3OPYA 1QGOA 3H3JA 1CUXA 5DM1A 3N2IA 4JYPA 4H0FA 2IOFA 5T8KC 3ZZTA 3GCDA 4FYXA 3I2FA 3K5HA 1TO6A 2H92A 3UHPA 3I5XA 3D0KA 2YZ7A 2FHSA 4MKXA 5ESXA 3N75A 5C31A 1KZ4A 5L3QA 1E94E 3TSOA 3EGIA 1NWHA 2OTCA 1P73A 4QOJA 3WYDA 3EQ6A 5CLQA 2QRVB 3T0GA 5HTOA 2BTQB 5HWSA 4M22A 3FN4A 5BPFA 5IUNC 3EF0A 3KFLA 1NVAA 4XWAA 1ZUNB 2GN9A 3WG9A 2M6KA 3V8EA 3CE9A 4UVDA 4R2WA 3CXRA 2XUPA 4DDMA 5AVOA 4XTCS 1EDBA 4G0MA 4GGOA 4ZT2A 5IVIA 4D42A 1YASA 1IY2A 8GPBA 5LQRA 3OX4A 3W5IA 4OQLA 4OVKA 4WLFA 1WLYA 3MZ0A 1KYYA 3P9QA 4IQ0A 4KXUA 2REXB 1TT5B 1FFAA 3FIUA 3GRZA 2ZAYA 3MJHA 4NENA 5I8PA 4LISA 2B9VA 4Y30A 1MGOA 3RVQA 2YWFA 3OZTA 1L8XA 1X80B 2QU8A 4JC4A 4QDKA 3A4VA 3C4JA 1EFHA 4RAOA 3HJAA 3VNVA 5C1BA 4CU2A 5KJ1A 3L7AA 4JEMA 3U6KA 1R15A 5E4TA 5BVGA 3PK0A 3W3AH 4MINA 1BW9B 1J1ZA 5KOJA 1FSGA 4RELA 2VWHA 2AJ8A 5IYZB 1CIVA 2H9IA 1A2OA 4MJXA 4P6VF 1AKRA 2J87A 5JLAA 3AL3A 5BQXA 5KNDD 1FDUA 1ISGA 2CJFA 2PYIA 4K03A 5IK2A 3JARA 3U2QA 1T0UA 4GC9A 5JOQA 2HYIC 1JIXA 1YDHA 1L1QA 1W0JA 2G25A 1SVUA 5T3UA 4DA6A 4Z4FA 1PGOA 1Z75A 3D64A 2GD0A 3Q15C 3MIZA 5FBWB 4ERNA 1WSAA 3SKYA 5LNK6 4R1QA 5CVVA 3WL5A 3G6WA 4RDHA 4TZ0A 3H2HA 5H3CA 1FBTA 3CLRD 4RHEA 1FIUA 1TVKB 4JL6A 4YO7A 4ZQGA 2JK1A 2R9VA 1U7HA 1W96A 2IPAB 1TYAE 2GBCA 2AKEA 2ROQA 4FMCB 4U7GA 1P7WA 3BXXA 3HNPA 2OCLA 4KAXA 5AJUA 4U8GA 3WJAA 5CH8A 3IQEA 3BILA 1AXEA 2A4MA 2JFWA 3OBIA 1XTUA 2XCOA 1QIDA 2XUGA 5LYJA 4D8TA 5LVAA 3GPLA 1ST2A 3VPCA 2E37A 1GPH1 1M1NA 4EG4A 2C5FA 1C1YA 1XMVA 2ZBFA 4OJQA 3R7LA 1M72A 1KS9A 3CBGA 5HGJA 1AH2A 3MTGA 3RREA 3AB7A 4YONB 1HTBA 1UP6A 1ZCJA 2F6RA 1Y82A 2Y68A 1P1FA 3OKCA 4MULA 1GD1O 5TQJA 4EY4A 4IINA 1QRDA 5EWJB 1WQ4A 3C16C 3RANA 1RZ3A 1EX7A 5EZYA 3EQ2A 2XGSA 3CKLA 1OTHA 4PAQA 1W85A 4PICA 4REQB 5I6DA 1KS2A 1KYTA 1Q6YA 3JQQA 1UFVA 5DEOA 2C0QA 3O4FA 4XR9A 1PNOA 4GR4A 4XUGB 4WK2B 4LC0A 1K92A 1AM4D 3ZR4B 1U11A 2DU8A 2C2BA 4WK6A 3DCIA 1MCZA 5EJMA 1KXJA 2AEJA 3GP8A 2I55A 2P9JA 3GXOA 3MAGA 4KXYA 4CF6A 2H4JA 1QQTA 4ZGWA 1YQWA 3O9MA 5D6OA 2YN2A 1I5RA 2R7LA 4LXIA 1QVVA 4XGRA 5C8XA 5CMLA 3N2KA 2ODQA 2QUKA 3OOEA 4KXFB 4ZYYA 3PL1A 1V7QA 2QZ4A 2XUFA 3NIWA 4QFDA 4DUPA 4J7UA 1DQNA 1NL3A 1TQ4A 4P7BA 5CW1A 3RFXA 1XD8A 3QSYA 1QCDA 2BGNA 2OZLB 3KQTA 1A9XB 3RB8A 4GI3A 5H80A 4AJLA 2YNMD 1RYYA 2OECA 4Y8VA 1YC5A 1NBEA 3RG2A 1GUZA 4B5LA 1U7PA 2YV4A 2XI4A 1M75A 1GQFA 2I5PO 2QRQA 4CKYA 1B1AA 2ATIA 2C97A 1EX6A 2J41A 2IEAA 3K4PA 4UCQA 1NR5A 4H3HB 4B83A 1Q50A 4ECAA 1NW3A 4C0LA 1L5VA 5CD9A 3T9BA 4C4AA 2H57A 4IUBS 4KPUA 3V4RA 4AY4A 5EG5A 1IHOA 5EVCA 2NZ2A 1XMSA 3ZBQA 1HETA 5H4GA 4CV3A 2H48A 3K0FB 4TTAA 5IDXA 3UM9A 1XLTC 1D1SA 1CDOA 1DAEA 5JBNA 2P8JA 1TKAA 2GO1A 2ORIA 2UXDB 1S5PA 1ONSA 2YVAA 4IGEA 4MUYA 3SE7A 3VOSA 1ACMA 2QNIA 1FVXA 1YAJA 2RAPA 3TLAA 2H7VA 2D3TA 1E6WA 1GVHA 4LWOA 4MKRA 3I6ZA 1IFXA 1JU4A 1N6KA 1VZ3A 1XAGA 4KQHA 1PR5A 4PFKA 1ZD8A 3A9WA 3ITDA 3ABIA 1TXGA 2QN8A 1YL7A 3PRYA 3GMIA 4TQUS 1K8QA 1G8FA 4KO2S 5AI0A 2CK3D 1JA0A 2ZI4A 3HNOA 3MAAC 4GOJA 1BAPA 2GEJA 4FOPA 4R8SA 3G82C 3KLPX 1Q84A 2PX6A 1A7AA 3KPWA 3K70C 3HADA 1D6MA 5L7YA 3KSUA 3O2JA 3CRQA 4ZQHA 5GVRA 3H1BA 3OIUA 1JX6A 2EWWA 4BNTA 5CEFA 1UANA 3CH5A 3C43A 3TTTA 1LBEA 3OX1A 1KO1A 3S44A 1A7UA 1OGJA 4WFQA 4CCSA 1E7QA 2DF8A 1I01A 4UU7A 3JWGA 1ZC4A 4YI5A 1UBJS 4JUAA 1HL3A 1ZOLA 4QM6A 5BT8A 4R84A 3T3EA 4YRCA 3EVGA 3WLHA 3URMA 1GCUA 2G5PA 2VF2A 2YMMA 4MUEA 4YMHA 2OFFA 3KQWA 4RHTA 3LG2A 3PEEA 3OAAD 4OQEA 2J6CA 3LTEA 4I1VA 3WLLA 4BFUA 3DL2A 5TPZD 1MIHA 5EQDA 4NZPA 3O4RA 2VDLB 1G8SA 2VEOA 1NXWA 4JBXA 5D3ZA 5IMBA 1D0IA 4ESEA 3W6UA 1F4LA 2AZ4A 2CFIA 2JJ2D 4J1QA 2O1XA 4U9UA 4BFYA 5EZYF 3CWZA 4QATA 3OFKA 2GTPA 1QE5A 1DGQA 4RSHA 3DAFA 4YYZA 4BO9A 4MWDA 4D98A 1QPGA 2Y4NA 1DXYA 1QO7A 3GV0A 1V5FA 3IDSA 4Q1EA 5FIUA 1RQ2A 3VYRB 1I3MA 3GYGA 5JXJA 2MOKA 5AI5A 4WZZA 3OE7A 3WWCA 1U65A 1J2TA 2RC6A 3MRXA 5EIHA 1RRVA 3C87A 3SF8B 3DZ8A 5ELLA 2O5EA 2GAJA 5T41A 4OA5A 3ICCA 4A03A 1QNLA 3QWHA 3VDMA 1TADA 4HQKA 4P5PA 4J1TC 2CHUA 3A0RB 2NZJA 4AG6A 4DIBA 4YUYA 1N5DA 2ZBRA 3P19A 4JK3A 3MK31 5C5IA 3I72A 1XYVA 2JIRA 3OM0A 1FRZA 4Y1FA 5AJYA 1K3UB 1MOZA 1QLWA 3WGUA 5CEJA 1AHPA 1SXJE 1A5SB 1FDOA 1G5IA 2REBA 4I08A 1QYIA 3GA0A 3KL4A 4FFNA 4XD7A 2A8YA 5G1NA 1SXJD 2BFMA 4YCDA 2FK7A 5HCIA 1BVYF 4COKA 2CXUA 3BSWA 3FAKA 2O57A 1AA6A 1GNSA 1OBCA 4FZ5A 3HE3A 1NMYA 2I3DA 5H9VA 5K3SA 3W7BA 3SIPA 4R1SA 4C6TB 1PK8A 3UN1A 1MQSA 2CE2X 3H65A 5F7OA 1VYUA 1GTVA 4D9GA 1XXLA 3V1NA 5EQFA 1QF6A 5PGMA 3FETA 4HRVA 5SZHB 1V5WA 2VYFA 1L7DA 2X9LA 1FUEA 5E4YA 4JC5A 4DM7A 1U31A 1PBNA 4FGUA 4K40A 5CH5A 1RRKA 1LXCA 2GBGA 3DT8A 3HUEA 5HKLA 3TNLA 1JDJA 4S1TA 1JVSA 5A9TA 3IMGA 4C6SA 4R5MA 1J42A 3LPDA 5ICSA 4C3UA 1F8UA 5C35A 2VDUE 1J9GA 1TVKA 2FKNA 1M2WA 3L7JA 3PIIA 1XNQB 1DG1G 2FUNB 3QELA 3AGPA 2ZXFA 1O77A 4RVFA 1XRLA 2ZYTX 2XRFA 2I4LA 2IIBA 5B37A 2I4NA 2VN8A 3ZCVA 3NHPA 4ND7A 4EO7A 1MAHA 4NULA 2O07A 1R9GA 1Z08A 2HN9A 2Z9BA 3B9QA 3Q1LA 5JNLA 2ID4A 4WCFB 1ODSA 1RXCA 1QH8A 4IRUB 4B80A 2FR8C 4MR7A 5CB8A 4LYJA 3SLGA 4PWYA 1A8HA 4JLVA 3GBVA 1E2IA 1Z2DA 2CL6X 1Q19A 5D3KA 4BNDA 2ZIZA 4BVJA 1T9KA 3A1NA 4Q6BA 1UM9A 4C2UA 1KZ9A 3PJGA 4J7CA 3ESAA 1W4RA 4X44A 2OYCA 3SMVA 1VLHA 1SCAA 3GGOA 3C6KA 4TM8A 4E5YA 3I23A 4UPVA 4BQFA 4ZOQI 1C9MA 2JF0A 3TRJA 3WAJA 2JS7A 2RJ3A 1Z6TA 2C8KA 1P5FA 3LPAA 3ZK8A 3ECCA 1NJ6A 1T8TA 5LU8A 2XMCA 1TT7A 3KOWA 4FMDF 3F2IA 1QKJA 3O03A 4US1R 2ISSD 5DBIA 1G6Q1 4ENTA 4L78A 4UBIA 3GUVA 3O83A 1P5JA 1C3EA 4G5FA 5HW0A 3TJRA 1KI9A 1K6EA 4CLDA 2VTKA 4EHHA 4OXYA 5FFFA 3LTNC 3BXZA 1O95D 4L5YA 4ADSG 1ZRMA 1MUUA 4G81A 2QTLA 4GM4A 2QSJA 2IKQA 2NWQA 3RRBA 3UK1A 4O4HF 5F77A 5IAEA 4MVXA 4CKXA 4DA9A 5LJIA 4D3ZA 2Q9CA 4H6VA 4RDCA 4X6LA 1NJ8A 3UC5A 3U60B 2MR6A 2OMKA 5LB2A 1BMQA 1LSJA 4RSGA 3GP5A 5EQTA 2AOTB 2J9ZB 1A9OA 1LSOA 2NZVG 5EPEA 2IP4A 1SH7A 1ULHA 1J8MF 3ROQA 3MN1A 4N54A 5KTNA 3H1PA 2HRDA 4FOTA 3ACBA 3IA7A 3N7TA 2H06A 2PX5A 4RCZA 1BNCA 1ODFA 2C2GA 2GN2A 2BRUA 1CQJB 3DMNA 3U0VA 4JLBA 4BYMA 5AW3A 5IVPA 3E3AA 1VSUA 1XE3A 1E5TA 2DT8A 1PP4A 3K0SA 4OL9A 4IH9A 5DDIP 5HVNA 1Q7GA 1QE3A 2HSJA 2J0VA 5DHSA 3RYIB 4A0FA 5FH9A 1NUTA 2DPGA 4PHHA 2ZGVA 1PWYE 3CINA 4EEKA 5KJFA 1UODA 3MD0A 1FFYA 3QVMA 2YWEA 3B1YA 5CXSA 5LP6F 2HTEA 4EUEA 1F4PA 2EJTA 1Q7RA 2JL1A 2VQ3A 2W4MA 4TS9A 4G09A 2J5RA 1MJHA 5EFZA 2XXAA 2ZTLA 1XZKA 2JLYA 4Q4AB 5LWQA 1U0BB 2PUWA 3PSAA 1NX9A 1R7RA 2ZT5A 2R62A 1VTKA 3C3XA 5AW6A 1FPQA 3HI4A 4NH4A 3TJZA 1EESA 2F3UA 2HZBA 1EVQA 5FLEX 3ZDYB 3CBQA 3USZA 4BNJA 2YVUA 4WINA 1QV9A 2Z0MA 3Q98A 1TCVA 3T9DA 4PG4A 8ATCA 1W29A 4KX3A 3SX4A 1NBIA 4JVOA 3ADKA 3JR7A 3OH8A 1R4NB 4TVSA 1GG5A 3H0CA 2B2XA 3CMCO 5DISB 1U2DA 1EEXB 5BO5A 5K2MA 4B34A 1RLIA 2W83A 3DCJA 3VR4H 1GPDG 1UKZA 1E3EA 1CUCA 2B21A 2G1JA 2OEPA 3FAZA 3NATA 4M1MA 3BMQB 2HCBA 2J3EA 2YQ5A 5TRTA 1CKEA 1GGVA 5ALEA 4M38A 1L1RA 3HL0A 1DMRA 3LBAA 1G16A 1IBRA 1LLFA 2R1VB 4MEJA 3KZXA 4BEWA 3WRXC 4L16A 4PO9A 5IN5A 2X1MA 1D7OA 1VJCA 3AR4A 4P4LA 3VISA 2DKOA 1BCSA 5LUBA 1QG2A 1WF3A 4C05A 4WAUA 4BN5A 3U4QA 1X92A 3UB2A 1Z0JA 1ZN8A 4B33A 1Z4IA 3R5FA 1FRFS 2WIGA 2AE1A 1KK0A 4WLUA 4HDMA 2J0EA 1WR8A 4ZT6A 3K1AA 1PHPA 1H4QA 1P7VA 2QYOA 4OXNA 4EUKA 4M8NE 4HS4A 1DRKA 1OLUA 1C7RA 1X7YA 1G5TA 2XIJA 5AHKA 3OURA 3T8YA 1FNBA 1PSZA 2G4CA 3EGVA 3KELA 3NETA 3OSZA 3PKZA 5CT6A 1D6NA 1XG5A 4MKIA 3QLTA 1RTTA 4GX0A 5KX5B 1QANA 4BRSA 1QOQB 3HCRA 1AMUA 3K6SB 1JEQB 3W2EA 4HDKA 3C3BA 2VQ6A 3F6YA 6Q21A 5EMJA 5H9WA 3OFNA 4Q7EA 4EHBA 4YRMA 1WZ2A 3V1YA 1G9SA 5H82A 3SZOA 4ZYXA 4I4NA 1DS6A 1H69A 3KB1A 2V5UA 2GDJA 2P0EA 3QFTA 4AY5A 3OWOA 5A05A 3LNTA 3TBHA 2OE2A 5JC8A 1P81A 4GMGA 2OCBA 4E14A 1Z3IX 4IOLA 2H5JA 3A14A 4RZIA 2PSEA 1CF9A 2F8LA 1ZN2A 1WUHS 2ZWPA 3HV0A 4FLFA 2MJLA 3GAFA 2CYBA 2JJ1D 4LKOA 3O1IC 2PSJA 2VCHA 3W8NA 1PUXA 5AFSA 1UZLA 5EIOA 4RUKA 4C7BA 4NMHA 1S6YA 3WNQA 5KWSA 1U28C 3V97A 2ZJ8A 1ZK1A 4RQTA 2BI7A 3AEQA 5FORA 2FFHA 1R18A 2XMRA 4PYIA 5IDYA 5FULA 1WV1A 3SKXA 3K0CC 3PQ4A 1C1HA 4M1YA 4R0VA 4KITB 1V4VA 2R6FA 3IHWA 4BU1A 3IELA 3IT3A 4V1CB 3ETCA 1JPUA 3EISA 3OY7A 1D2CA 4DV0B 1I8TA 1DEKA 2BF7A 4GLFA 2UZ3A 2OAGA 2IXBA 3GEHA 3N05A 1WMAA 3RABA 1IXZA 5AK4A 3M3DA 1F3OA 4DCCA 2PA3A 2GZ3A 4KRFA 3IULA 2FXIA 1NF8A 3BE5A 1R00A 3D54D 4ISCA 4MI1A 1XMOB 4WZBB 4DMMA 4PX9A 1A4IA 3GRAA 2OCYC 3FPSA 4PZ9A 3DMHA 1W8IA 5LQSA 4JBLA 1SU7A 2CEAA 3OCVA 3BRWA 4R01A 1P91A 3NHBA 4H7IA 4ZHSA 3WMWA 2VPZA 2E4ZA 3R7BA 1IMOA 3BWEA 4FQ8A 4F9FA 2F8SA 2C7QA 1UP4A 1IN5A 3DCNA 1A71A 4URWR 1HC7A 4MW6A 3UMSA 2FPXA 3V4OA 1ZHFA 1RBMA 3FRJA 4OQXA 3UCFA 3DVRX 2O2EA 4EMTA 4WBNA 3IB6A 4QU5A 2OHGA 5D84A 4EHDA 5AKXA 4FU0A 3U44B 1H2EA 1RRGA 2HIAA 4PG8A 1MZPA 1PZGA 1ZO8A 1H5NA 2TMGA 4AKSA 2Z3ZA 3RYHB 2VVTA 4M1ZA 2BHNA 1CY8A 4GOOD 4YRPA 3CX4A 1UH5A 3TTYA 1O9GA 5H68A 2JLXA 4NV3A 3AZPA 3KKMA 4W4TA 2YIDA 2IP2A 3GH3A 3BD9A 1CHNA 1YOVA 2RAFA 3DZDA 4YJ2F 5MFPA 1BWSA 1NXOA 1WW2A 2ZJ4A 1L7XA 4PYKA 3BT7A 4RPIA 2SHKA 1Y7TA 2REOA 3IUYA 3LX5A 1AXGA 5AOBA 5LDGA 3SN6A 3ET5A 1CUZA 2ZRCA 3K73O 5IT4A 4P80A 3I92A 4YR7A 1M2VA 2G72A 1RPNA 1XKQA 3IHLA 3M6WA 1CP2A 1JZQA 5JCJA 2QSZA 2YJ4A 1WVIA 3DVLA 4U2KA 2VYNA 5BV8A 3LCMA 3S55A 4BFTA 3ZZNA 1G5HA 4YY3B 4KUGA 1ZH6A 1II8B 3A6KA 3OCWA 2HREA 1T4CA 2O3JA 2PL5A 4LHVA 3LNCA 2Q3BA 2I29A 2J5KA 1K7XB 2PV0A 3PT9A 4IL5A 1YS9A 4JVLA 4ZU6X 1BYIA 4QHTA 2O3TA 1HK7A 4G4JA 4S2UA 1NSFA 5A62A 3IH5A 5HJ2A 4HEQA 3X1DA 1HDGO 3UH0A 4AJ2A 4Z7QB 2H1SA 5EUBA 4K8OA 3RJ9A 4C6RA 1JLKA 3PZRA 2PBZA 2ZLBA 3OMLA 3BK2A 5BQ3A 1ZZEA 1GZHB 2VJQA 4WD3A 5AOAA 1SA0A 4FGJA 1HFWA 4XX0A 3ELUA 4C29A 1IUPA 1I14A 4LZOA 2HO5A 4WKGA 1F0YA 3HXMA 1JZSA 1ONNA 2AQIA 2IEZA 1TEXA 2AQKA 3TKLA 4EYKA 3LSTA 1D1PA 1WY5A 5AUPB 3LK7A 1A9PA 5EYPB 3OQMA 5KWVA 3L7YA 5FBKA 3DVAB 2NT4A 1Q22A 1VGVA 2OP0A 2HCTA 3HDQA 3JQEA 4RM3A 3QNWA 5U9CA 4BVEA 4RVCA 3KK0A 1V9CA 2WFAA 4M21A 4NNPA 3IEPA 4ZDKA 1R5NA 4MR8A 1N78A 4HRXA 4O2BA 2HA3A 4IF6A 4J94A 5CRIA 3UWSA 3OJWA 1AKEA 3H5AA 4M98A 3ED5A 3INYA 3SKVA 4JC8A 4QWMA 5LOVF 2PRSA 5CVCA 1YR6A 3HCPA 1IVSA 2NT3A 1JHOA 1A95A 2DHDA 2ZVDA 1WXIA 3F74A 4TUYB 5L6MB 5HS4A 2YV3A 4F5EA 3PX7A 4XLLA 3OSUA 3HABA 4OF4A 1JQ5A 1ZNWA 1TYZA 2GZRA 3F7OA 4NEGA 5G4KB 4J49A 4M1SA 3CH6A 1LDGA 3TLZA 4B9EA 4G3XA 1V71A 2RIPA 1CQWA 1JA1A 1FDRA 5I8WA 1NNEA 1PZXA 3AINA 3FVRA 4UPDA 3T1NA 1OFUX 1OCEA 3FFWA 1DC6A 2ZSEA 1RP7A 4YT5A 4JI6B 5ES4B 1MO3A 2HHJA 4BV3A 1KEZA 2R3SA 1OXUA 2XQFA 3IHKA 4JZKA 2XA2A 4M83A 4IG9A 3PCXA 3K9HA 4OMCA 5KAMA 4CIBA 5KVCA 2CFTA 2ZCUA 1T0IA 1XZBA 1K8YB 4MUAA 1Q0TA 2HL6A 3DXYA 1NI4A 3U81A 2DX7A 1AQJA 3EBOA 3G9ZA 5CT9A 3PQFA 4WXPA 5BR1A 4MKFA 4AYTA 2DFDA 2ZTHA 4KQFA 5HKBA 1MT3A 2K5UA 2DMRA 2FG6C 4X3OA 4O4LB 2HHHB 1VSQA 2E1PA 2EBFX 4UARA 5KNBA 4LF7B 1PR3A 4EF5A 4ZVPA 2EJVA 2YQ4A 4YXWD 2H4ZA 2KJQA 2V7WA 3G3EA 3K05A 4CFSA 5AKYA 3D8HA 3KLMX 2NQTA 1HKHA 2FKAA 1FU4A 4WOJA 4ZRDA 1HKUA 5FJIA 4CG0A 3WWYA 5A1JA 4QQFA 2P0AA 5BYKA 4HRYA 2BR5A 5KOHA 3Q6IA 4W1RA 3AERA 1GJRA 5FBHA 4KYIB 3U7EB 4QE3A 2ZSDA 4GU5A 2UUPA 4MIOA 1J23A 2ZE6A 2Q2NA 5EWLA 2BKLA 2BLNA 3L5OA 4NCXA 1AZLA 1VL0A 1YBVA 2HNBA 3NCTA 3PI7A 4FSHA 3UWPA 1BGXT 3ZQKA 5KJCA 3SICE 1THMA 3IT0A 3THXA 5DCWA 1QOZA 2QDXA 3MGBA 1KI8A 4NYJQ 2GZ2A 4HNRA 1T3SA 4L8LA 3D3JA 1WULS 1MJ5A 1QDUA 4M1QA 4OBEA 1KDZA 4YCSA 3TMKA 2CT8A 1SR8A 2B37A 3ABQB 4RIGA 2BL4A 4M54A 4X97A 3HPRA 4O5OA 4CM6A 4KVZA 1Y80A 1HLPA 1M66A 1WB6A 4MQEA 4B2LA 4LJ9A 3OQOA 1LC3A 1Z5VA 4QOGA 1W1UA 2FUG6 3MMNA 2R44A 4GVPA 2ZUBA 3VSCA 1DTWA 4CIXA 1M3SA 3ZVNA 3GHHA 4YO8A 4FMCF 4HHEA 1WRBA 4EYEA 2H1LA 3KYDA 2K7ZA 2N1BA 3Q9LA 4FE4A 1VDMA 4Q4DA 2FV8A 5JHHB 5F21A 3TW8A 2OBNA 4GFDA 5F98A 3KB8A 3K5PA 1AE1A 4L15A 2NGRA 4CTNA 3OE7D 3BFKA 3DZHA 2VQSA 5HNKA 3VNSA 3V2IA 2CHEA 3DBHB 1AKMA 1MNAA 4H1WA 4R9VA 2O9JA 3OLYA 4G89A 4WK0B 1J0CA 3PC8A 4EZBA 5DPMA 1WPXA 2BEUA 3OPYI 3L8EA 4XWOA 2B7CA 2QTMA 3PPIA 2ZQYA 5AKLA 3CUKA 1UBTS 4ZO8A 1OV4A 1V9SA 3GAZA 1E2MA 3IKVA