2IQIA

Crystal structure of protein xcc0632 from xanthomonas campestris, pfam duf330
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
178
structure length
173
Chain Sequence
ATIYAPTVRVTPNPAWPQVSWQLLVAKPSAARIIDSPRINVRPTPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVARISDYKLAIDVRRFESDYAGQSLPAATIELNAKLLHSSDQRVVASRTFTVARPSSSTDTAAVAAAFEQALTQVTTELVGWTLITGQQDSQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein XCC0632 from Xanthomonas campestris pv. campestris
rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein XCC0632
total genus 49
structure length 173
sequence length 178
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03886 ABC_trans_aux ABC-type transport auxiliary lipoprotein component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10610 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ABC-type transport auxiliary lipoprotein component 2iqiA00
2IQIA 2MIIA 3W1EA 4HRVA
chains in the Genus database with same CATH superfamily
1XVTA 3OUUA 5IXSA 3CPHA 1XZIA 2C31A 3ZZ1A 1XEXA 2WWVD 3R9XB 3AL0C 2PA0A 3HVIA 2AW5A 4E2XA 2QUAA 2AN3A 2GBPA 4UM5A 1BX3A 3W6OA 2ZXEA 3N0VA 2J3MA 2JAPA 4P36A 2WYHA 1KYVA 3A6LA 1U63A 5I3ZA 3RTEA 4K9NA 1CB7A 2PZBA 3PXUA 4EW6A 1YCGA 1NP6A 1D1PA 3DC2A 3QYJA 2CL0X 3U5TA 1BN6A 2XYPA 3HRKA 1XA0A 1H9AA 4NZOA 4BGDA 3SQWA 1DDGA 2W2NA 4PZLA 4UUAA 1ACLA 4ZT4A 1XMQB 1IXZA 2EBWA 3O38A 4WK2B 2Y9PB 4AKGA 3AETA 2BI4A 3NHZA 4OFWA 3S8YA 2ANCA 3VPCA 3H84A 2FLWA 4JT4A 3JPYA 5IDXA 5A6VA 1O5OA 3PG5A 4PLYA 1ZGGA 2W2TA 3I6YA 4R2KA 1MG5A 4WNYA 4CKEA 2NP6A 1QP7A 2HSZA 3ED5A 5A5GA 2GRUA 1GILA 5K0NA 2CEKA 1PR5A 1Y9EA 4M22A 1FEZA 3VGPA 4D8WA 1XHLA 1FMTA 4RNCA 4HNAA 5BN4B 4JVLA 2RB5A 1M1NB 4EY3A 3UWOA 1CEXA 1JR3E 3H1EA 1E2EA 2AEJA 2P1ZA 2IHVA 5LU9A 5BMVF 3BL6A 2JCYA 2HRBA 3ADOA 4PAWA 1K63A 2YQ5A 4KXWA 4GXQA 3WRYC 3WZMA 1W73A 3ZI0A 4MVJA 1UAAA 5HKOA 2DE0X 3JQBC 3LXXA 4LEIA 4K9KA 2E21A 2V98A 2C8VA 2Z9DA 4MKZA 1SBNE 5BWNA 5C35A 5C8VA 4HMOA 1S5PA 4E5SA 3TAXA 4M9RA 4MROA 2HMVA 3LUKA 1FSZA 4PGFA 1TQ8A 4JC0A 4DMFA 3ILYA 3FKSD 1ZWKA 4JP8A 1OFUA 4E6EA 4DPLA 1FXSA 3R8CA 1ZD9A 3OKFA 1P0PA 1DKOA 3HCNA 4OJNA 3I9OA 2I4TA 3NTRA 4HDNB 4ALKA 5B7GA 5AUQA 4PZAA 1S2DA 1T0PA 5EVCA 2W9XA 2WT4A 3FCAA 3NKFA 4L5AA 4WESA 1XWIA 3TW4A 3EXHB 4RHEA 4HZUA 1PSDA 3UGQA 2ZIUB 2DERA 4RDHA 2D1FA 4GR4A 3E3OA 4RM3A 3H5RA 2B2XA 2BJWA 1WSWA 3IULA 4GRIA 1XVLA 1BS9A 2QQ0A 1T29A 2QYSA 5BQOA 4WACA 3RW9A 3H2BA 5E6UA 4A36A 3NM5A 1E1RA 3GH3A 4JUFA 5AYVA 3H9GA 3TTTA 2NXJA 5JCPA 1SIUA 2C94A 2GPAA 4G5XA 2YHIB 4B6EA 2G36A 2A9FA 3MOIA 3IIEA 4MR7A 2ZU0C 3MJFA 3M6MD 3T7AA 3HP7A 5JE8A 1GRCA 1S89A 2OV4A 2I99A 2I7DA 4RIFA 3VTKA 1E9FA 1OTYA 2I5PO 3NBMA 4ZRMA 2Y0CA 1CJUC 1KYTA 2AKAB 1I14A 1KYWA 4EEZA 3NIGB 2WILA 4HXYA 4JU9A 4MRRA 4OP3A 3UCXA 4CMIB 1X80B 1Q6ZA 3L93A 3T3OA 3KQNA 3FPFA 1YQWA 5HFNA 1J0XO 1MRNA 1YI1A 5B55A 3PXCX 4M98A 2GAOA 2WDPA 1CQJB 3PA8A 3I9KA 1V41E 2CXSA 3MGGA 3TRDA 2PN1A 2WHPA 1T2AA 3X1XA 5KX5B 2I2XB 3EOAI 2L19A 5DTIA 4MVJF 1VJDA 1H8EA 3KKLA 3VPHA 2B1IA 5JY1A 3QX3A 1FDIA 1V11B 3CUWA 4G1UC 1ZSNA 1WB6A 1P61B 1QSGA 4ER0A 2K6GA 4I4LA 3E9MA 5ADVA 3UMYA 4B3GA 5IK2D 2A0XA 4ZCSA 1U0GA 2WMYA 2O5CA 4AZ0B 3TEMA 3GUYA 4U1RA 2EW1A 3ANSA 3HCFA 4WCVA 4C0BA 5B57C 2PUAA 1CIPA 1RABA 1UFQA 2VK2A 3JRNA 3O8OA 4I4CA 4KRXA 2ADOA 1X15A 3A1VA 3ET5A 4TS9A 2CZGA 3CWZA 3UENA 1FYVA 3PR2B 3FSEA 1G42A 4B6OA 1JLLB 4XPZA 2UVPB 3QUSA 5LD2C 1E9AA 3KVNA 2ZJ3A 3GFTA 4CL3A 3CVUA 1N6HA 4ZVNA 4TL7A 4P4LA 1BXGA 4GEKA 4L2IB 5DGIA 5TF4A 5BRAA 2I9KA 4C2TA 4L78A 2W2KB 2XOXA 3O83A 2X23A 2JGAA 1V25A 3WRYA 4YUWA 2AEFA 5TE9A 3N53A 2P2DA 3K92A 4JCCA 4MUGA 2YHBA 3LX6A 4WOBA 3S6JA 4BAGA 2GARA 1O4WA 1YB7A 3AJRA 4JC4A 4OQNA 3NAGA 4Z8YA 3VXKA 3B9PA 1JHYA 2DM6A 1NXWA 1C1YA 1JS1X 1NN3A 2D1RA 1PG5A 3KR9A 4L57A 5KTNA 3WFJA 1VPTA 3CLHA 3BZBA 2JI9A 1AKWA 1AN9A 4G67A 1ZW6A 5GAJA 5B36A 4LTMA 2C9YA 2I78A 1NZDA 4JGBA 3MT9A 1G8FA 4IIGA 3Q6MA 4NCNA 3VUFA 1QX4A 2OBBA 3ONFA 1P2BA 3BAZA 3A9WA 1WQ1R 3OZDA 3EMKA 1ODKA 2BE7A 2MTBA 2R4QA 1AA9A 1PLKA 3BGIA 2EJBA 3KTFA 3ASUA 5DF1A 4P7KA 3ZDEA 1ZESA 2QGZA 2DTEA 3N74A 4QUGA 2GNAA 3OFNA 3KDSE 1WSDA 2MSEB 1N6KA 2AXQA 1UP4A 5B1EA 1YGPA 2JJ2A 5E3JA 2EHDA 4EJSA 2IPAB 1T2UA 3NT5A 1JI0A 3O92A 2CDAA 3R5KA 1SO8A 5DHUA 1YJAA 5D3KA 1ECPA 3G7NA 5IM5A 2HYIC 5DWVA 1SVIA 1YV9A 2E6UX 4I46A 3L46A 4FI3F 4CMJA 4KQKA 4TKMA 4ZIRA 3CB4A 4CUJA 1REQB 1J8MF 4HGQA 1RDFA 2AGVA 1HUQA 3L4BC 3P9CA 3AF3A 3AEKB 5FPPA 5E1BA 1KO8A 3H2IA 2JI8A 3S55A 3M4JA 1K86A 2ZKLA 3TQCA 3UPTA 1T1JA 5A03A 1I4OA 1Z7EA 3Q3IA 1E7MA 1G4AE 2IHYA 2XPCA 4RZSA 3TD2A 3ONWA 1S6YA 4DY4A 3T38A 1N57A 2JHPA 3DMPA 4UUOA 5I45A 1GUBA 1C9YA 2BKXA 1GGNA 4FMDF 2WU8A 4RKRA 1JDJA 4WN3A 1ZOSA 1CK4A 2AZ4A 5AKGA 4BRSA 3ET4A 2H59A 4JGIA 4RCZA 3EW7A 1E63A 1I7DA 2KBEA 1KERA 2HMSA 1BX0A 4HQKA 4WOPA 3RBXA 5I01A 4RLSA 4WN9A 4I3HA 1CR6A 2H6EA 2ODPA 2PTGA 2W6PA 3KPVA 3KT3A 4IVRA 3TE6A 1B6RA 4L5CA 1KY2A 3CSUA 3H5WA 1L5YA 4JAVC 2EARA 2WLSA 3NYRA 5T8KA 5CK5A 1FX0B 1LK7A 4HYYA 5ALXA 3EGCA 5L4LA 1RQ2A 2OV1A 3JWEA 3ZLVA 4F8JA 2FLKA 3CRRA 5HUQA 2C1ZA 1QWSA 3Q3CA 3EFOB 4GPEA 4RKFA 3JYQA 1V39A 1RC8A 2JATA 4YROA 4QELA 1G6Q1 2WIJA 3ZOKA 4D7AA 2PZMA 4H77A 1CT9A 3TFOA 3VR4D 3EBLA 3P19A 1FUKA 4OB8A 4ILEA 4K9QA 4N5HX 2CJYA 5FYQA 3C3XA 2KE5A 4UBNA 2QYHA 3ZHUA 1I7QB 1XMVA 1V48A 2WSIA 5JXHA 1D07A 1S4MA 5CA0B 4M1TA 3RIGA 1PHPA 3AM1A 4HQ0A 3IE2A 3MXOA 3QWBA 5CVJA 1EQAA 3Q8WA 5A0TA 2OVBA 1GD1O 3JALA 4GE0A 2WY2D 4AMBA 2V7TA 1Y89A 2HA5A 3N2NA 3O4VA 2VQSA 3ESBA 1P9WA 2ZIXA 1DV1A 3FRJA 3IO3A 1NN5A 3HU2A 3OIGA 5B1IA 4BB5A 2FMFA 5DYNA 4CCYA 3AUKA 1CUXA 1NHGA 3ROQA 721PA 4IUYA 1U7OA 1DQZA 4ZYLA 2PYZA 4G9EA 3O4HA 1F8XA 2AC7A 2FEAA 2G1UA 5D3MA 1WCWA 4GKJB 3OM8A 4YRZA 2PUDA 2DU8A 4HKTA 1NR5A 5K3DA 1U3GA 2DBYA 1ZN7A 2PQ6A 3JQ9C 2XVXA 4G63A 4Q1DA 2XF2A 3EVGA 3RYIB 4GR9A 3SCZA 3X1JA 4PSAA 2J07A 3VR2A 1VIVA 1ZR2A 2EVWX 5TSDA 1YHZA 1KYXA 1NVVR 1EFVB 1GRNA 1Y7HA 3LSYA 4UU8A 3UC9A 3E03A 2GS9A 1DGQA 1FS6A 2ZUCA 2Z1DA 1I94B 3A8TA 1E2UA 1GUZA 1GUAA 3LS2A 4ZT3A 4J3NA 3CBGA 3KXLA 4V0QA 3SHWA 4DIFA 4QBTA 2QVXX 3IEKA 4HEJA 3EGOA 4B7UA 1LBHA 4CMGA 2Q2OA 3EGDA 5TQ2B 3FJOA 1PWZA 4QNMA 4V1CB 2A9VA 3OE1A 3I8SA 4QO7A 4EJSB 1F6DA 4I5GA 4MLZA 3RRMA 1DKUA 4YXWA 2XXJA 2CL6X 2DBQA 5EI5A 2V7QA 2JL1A 1GZHB 4ALIA 5HHTA 2X0JA 3GQVA 3MB8A 1D2CA 3MCWA 2O3TA 4K2HA 4PCAA 1JSCA 5JSKA 2GF9A 3OTIA 4RLFA 2SECE 3FOCA 3UPDA 1SXQA 4BY9E 2QYTA 3GJRA 2DF8A 4XFJA 3CS3A 4MP6A 1VBNA 3OU7A 1O8BA 3IO5A 2OLKA 2CNWD 5BW6B 4F71A 2Q9CA 1KYZA 3PNYA 1X8XA 3GD7A 4IQFA 4UBIA 2O7RA 3BEOA 1DQRA 2AVNA 4OLHA 4DNQA 4J0JA 4IX9A 4NOLA 5JS8A 5FADA 5F4BA 2WINI 3RS5A 4J7CA 3LSTA 2X4DA 4OAOA 1I0LA 2AT1A 4JFRA 3UN1A 1ZK1A 5FH9A 3K15A 4KAXA 5B3JA 4MVXA 4G5OA 4NZMA 2MCFA 1R5JA 1MMFB 3M1YA 3BWMA 1Z4KA 1KZ9A 4HN4B 3LF2A 4YT5A 4OHOA 2R1ZA 4LHEA 2VAWA 2BEUA 5D1NA 4NENA 3K70B 2EG5A 3L4KA 3S0JA 4R1SA 1KO4A 1GEEA 3GJQA 2NXCA 3NC0C 5DXAA 1KJ9A 1FRZA 4PANA 3KALA 2ZJ2A 4TKVB 4CI9A 1M6HA 2M32A 1G55A 3N0RA 2BJVA 2UDPA 2JZNA 1OH7A 2CXRA 4GG1A 2R44A 3PL1A 4CLRB 3STUA 1HSZA 4HLCA 4BKQA 1M2JA 1I2AA 1WUKS 2R84A 4CZ2A 1RJEA 4H6VA 2VUTA 1EM8B 1XDZA 2SKCA 1H2RS 3D8TA 1K7FB 2N1MA 3ZQ6A 3RV3A 1A95A 4K9MA 5B2EA 4Y1RA 4OKNA 2ZS8A 1II9A 1U0SY 5AVVA 3A0UA 3BE4A 2NT3A 3UCEA 1IB0A 2BMFA 5ILOA 3GIDA 2I7CA 2GLXA 1HG0A 2LVBA 4I14A 1YR9A 2A0YA 4JYZA 4LSWA 1TMYA 1GPH1 5HTKA 3CEAA 4C0SA 2EL9A 4YWJA 5ES4B 5DT9A 1UBCA 9ABPA 1GG5A 2A3NA 4HHEA 1PJCA 1W4LA 2ZJFA 4HYQA 3DAOA 2O9JA 2C82A 1GSAA 3UK1A 3EDCA 3LBHA 1JBEA 3AQ4A 1JAXA 1ZVVA 2FX2A 3CT6A 5D51S 1Y4ZA 4MLDA 4BFSA 4O4HF 1VPDA 4G0OA 5FPSA 1IL0A 3DE0X 4PU0A 4I6JA 3EUWA 3IOMA 1A27A 4JODA 4KNVA 2X1HA 4KUGA 3NMUF 1QS0B 3H1FA 3M49A 4DT1B 1ST3A 4R2MA 2G40A 3HBAA 2X2FA 1CUZA 1TZBA 2XGOA 3C6MA 3LAWA 1DAOA 2O1XA 1BU8A 4G86A 3VMMA 2E85A 1EAMA 1QGOA 3MZ0A 1ZNQO 3L4EA 1HFJA 3LUPA 5HWSA 1FUEA 5E9JA 1U3TA 2P9ZA 3R74A 4UAJA 1WXDA 3A2MA 4UNNA 1XR3A 5EN4A 5F5XA 1O6BA 4PYLA 4XWAA 5ICFA 2XUJA 2BCJQ 4A0QA 3U81A 3B9QA 4C7VA 2XA1A 1Q22A 3HA2A 4IG9A 4XTCS 4F60A 2QD4A 1P8JA 3L6DA 3MWFA 4MB0A 4PN7A 1SC4A 5T6BA 4JJ4A 4WKNA 1MX3A 2P2SA 1QRTA 2C4WA 3FRIA 1DCKA 2DRIA 4L22A 5IKPA 1YJBA 3TIVA 3SDBA 2RKWA 4PPFA 5DXFA 1NN0A 2XRMA 3FR7A 3L8ZA 4QULA 4QQ8A 3WNVA 5KVSA 3KQKA 3I2KA 1SCUB 4J94A 3WO1A 4CNBA 1QOPB 2P77A 2QN8A 3BWVA 2JAHA 1W4CA 1JDTA 3KHUA 2CLKB 4L8GA 4OL9A 4K05A 4ZD6A 2R47A 1M76A 4NEGA 4BEWA 2C5SA 1V8PA 5T7BA 4GX0A 1FLAA 4YC7A 3KYIB 2WFLB 5HKKD 4D9NA 3V3TA 4HRXA 3R6LA 4Z0HO 4B80A 1E4EA 4NENB 4Z4CA 1Q6YA 4FJ1A 1JG6A 4A6DA 1TUBA 1FTQA 2ZQYA 2CDBA 2RGCA 3EA4A 1W6RA 2X5JO 4EW2A 1JT2A 2DFTA 1BVUA 3RODA 3EH2A 1T36B 2ECQA 3FCCA 4D57A 1EE9A 1L7AA 1R6XA 1VB5A 2QW0X 1G7SA 1Y48E 1NX9A 3NBUA 2OGSA 3NW9A 3WRXC 4GP7A 2X8WA 3IT1A 1SWWA 5CD1A 2NLOA 3SBDA 2XDYA 1T8TA 1C3XA 1PR4A 2I80A 1CY2A 4M0DA 4DSNA 3BGOS 3ADCA 3U4MA 5FUVA 1OWNA 5I7HA 3A9TA 1G19A 3V2HA 2FZWA 1GAJA 2DKFA 1Z5GA 2ZI4A 3FPEA 2FRDA 4K9LA 5EFZA 2OYCA 4Z7JA 1CY6A 1ZXBA 3CB2A 4BO3A 5B30A 3CF6R 4EJ2A 3OQOA 1C9EA 4ZAVA 3DBVO 2FHPA 2QD5A 2ZWPA 3AY7A 4DV5B 1QH8A 2V03A 4ZXPA 3T7TA 2B30A 3PPYA 2X0FA 2Z30A 4WZ6A 1SELA 2Q5HA 3I1YA 4S1NA 2G1PA 1NBIA 2KPOA 1HTWA 3A6ZA 3WLLA 1TKCA 1U1DA 3SKVA 3WHPA 1F0PA 1WKBA 2H3HA 2HQSA 3FYTA 3A3YA 3WYEA 1P44A 2C4UA 2YXNA 1P9OA 4C21A 1OR8A 3TZEA 3ZIUA 3P8ZA 4MP8A 1MRSA 2XQIA 1IUPA 2W6ID 2VQFB 4C0QC 5HS4A 3N76A 3RI3A 3D4LA 1XO1A 3OKCA 4OKIA 4Z51A 1GGEA 4CTMA 5PGMA 1ZMOA 4OBWA 3ELUA 3ACDA 4BNWA 2RGAA 3AIKA 3ICWA 1DBQA 1OYVA 2V9PA 4RXUA 3V6MA 5LQMA 1H1TA 1SPXA 3HWSA 1JA0A 1ZP6A 2HA2A 1ZUHA 1WKVA 1PW7A 4O59O 5F7JA 3GEHA 3V7WA 3L1UA 1N2XA 2XR1A 3ZS9A 2PUHA 3ZV5A 1SXJB 3A4TA 4POAA 4XDZA 1L8XA 3OQ1A 3UCFA 3V4OA 5AW9A 1JQLB 1IBCA 3WDKA 4IGIA 2VTKA 1PT8A 1WBJB 3WB1A 4DHWA 1CSEE 2HUPA 4ZDJA 1R4MA 4HRVA 1VXOA 3QFCA 1GGMA 5REQB 3NWBA 3RSOA 5TS2A 4DAOA 5B6PA 1NIPA 1ZM2A 3MW8A 4K1LA 1NVDA 3PUHA 2LCFA 4IDOA 3ZXXA 2HC9A 1B8UA 3BAFA 3LYHA 1KOJA 1M6YA 2B35A 1EK0A 2ARKA 1PNTA 4QIHA 1EG2A 4NK5A 1SKBA 2AOWA 4GLFA 4Q7MB 1VRVA 2GB4A 4YUAA 2PIDA 3ANLA 1AQNA 4QBFA 3DZDA 5D00A 3T1TA 3TSCA 2ZBQA 4QWWA 5CA1F 3I2IA 5FOWA 3PFFA 5CDFE 2Z43A 1HYBA 4AF6A 3THXB 1O03A 4DLZA 2HL6A 1T13A 3B36A 3AGQA 3NXKA 4L8WB 2CBGA 2NNLD 4LJKA 1T4GA 1L4MA 3P9RA 2A5JA 4MHSA 4QEKA 4RZHA 5JFOA 5EIHA 3G0GA 4HGOA 5I48A 1F4VA 1H1DA 1L5FA 2XVAA 2OZVA 4EA8A 1P5FA 1TXGA 1MZVA 1VP9A 3GAFA 3Q7QA 4JLKA 3RHFA 5KYYA 4NEHB 4DIKA 1IWPB 1Y80A 1YULA 1LBIA 5MFZA 4YAOA 3WNBA 1TUBB 3FB4A 5FLYA 4GKKB 3L8CA 1IUKA 4XD7A 3SZGA 4XWWA 1UIMA 4PC6A 1J09A 4L72A 1ECGA 1YH3A 1PSWA 1WZIA 2I2FA 2YOGA 4QVGA 4XIIA 5JCOC 4H9GA 4KDFA 1RXUA 4EY8A 4EELA 4BBZA 4D4JA 4UHFA 1I1NA 3A31A 2IL1A 2FY8A 3VO1A 2I2CA 4JIGA 3FX2A 3CRQA 1QIMA 1L7OA 4M53A 3HV0A 5BXQC 3UA3A 1JSLA 1TM7E 3KD2A 4PY2A 3IEPA 1SBQA 3BMCB 2CLSA 3DVSX 5CVCA 3RM3A 3WMEA 1O3YA 3O7WA 4N5IX 3WLNA 4JOBA 1EBFA 1FQWA 2H4FA 2CW5A 2OENG 1W47A 1YJXA 3CX7A 3EAQA 3REQB 4F7WA 5ICGA 3T5GA 5ERXA 4DPKA 1QNFA 1K8QA 3OY7A 2P90A 3P9QA 2VDPB 4DN6A 2JLXA 1MA3A 4HLUC 2PYIA 2PLAA 4MITA 5BNTA 1IBLB 1N7HA 1W5SA 1N5RA 3AI1A 1ZGCA 3C3BA 1RXSA 3KZNA 4IV5A 1YDWA 2CWWA 2IOQA 4MDHA 2NZWA 1E8DA 1E7RA 2XZTA 3A14A 2QVCA 4CEHA 4BP9A 3EG9B 3OJXA 3Q41A 3ZLUA 2CHEA 4TTRA 5J4YA 5IZCC 2AI1A 5E1OA 4Y30A 2A59A 3MRTA 5JV5A 5F9HA 3P4XA 1YBVA 2V59A 1E4YA 3HNOA 3JATB 2VBIA 2O3SA 2VK8A 2V0GA 3D3JA 2QB5A 4IXWA 1HT3A 4K6CA 3ZZTA 4AD8A 5KYKA 4UW9A 1XJ0A 4MEBA 4E46A 4DV2B 1FJGB 3QKTA 4P81A 3AINA 4KVFA 4UUNA 4B73A 4ZQEA 4Y98A 1FJ2A 4EBFA 5D6OA 1LRJA 1SD2A 5CG1A 1QRSA 1MVNA 2DKOA 1WHTA 4J8PA 4BWYA 3FWKA 4IPTA 1KMIY 4NOKA 1JPUA 3CINA 1VJ1A 2J9RA 3L5KA 2D5IA 1I2ZA 1LEHA 3INRA 3L6BA 4NPHA 1A96A 3C6QA 5FFFA 5ELMA 2C7OA 1VKOA 1FL9A 1JEQB 3NRCA 4AFNA 1ML4A 4QC2A 3V6LA 5KDDA 3HZHA 5THXA 3B3QA 4MYCA 4PZPA 4Y6LA 3PGKA 3WKAA 1W5FA 1VI5A 3MMPA 5BOSA 1VBKA 2IYFA 2VAMA 3T94A 5KINB 1AB5A 5AVKA 3ZNQA 3ORYA 4C1NA 4B3RB 4L5IA 4FBMA 4DLXA 1ENPA 1G291 2FN8A 2V7QD 3K0CA 2PA3A 5IZ4A 1XQ9A 1GZ6A 2WD8A 2WPNA 5AOBA 2UXDB 2OEPA 4X8OA 3RRFA 3X44A 5C81A 4I3GA 5DNAA 4PG7A 2HWXA 1YB6A 3HY4A 2A67A 2BP7A 1U2DC 4GUDA 2ORWA 4M0FA 4TMKA 3A6GA 4X8LA 1K3FA 3VR5A 3ZE0B 3OQ6A 5HUHA 2XXAA 1LWOA 3LHIA 3RUCA 3HPRA 1RAAA 1VYUA 2F6RA 3M6IA 4MYUA 5EA2A 4AKIA 3UHFA 1WUJS 2C9BA 2GKGA 3NHRA 1YZYA 3QA3E 4LPKA 5HKLA 4A91A 3KTOA 4LNHA 1LLQA 1PEDA 3VDQA 4N41A 1NNEA 4YGXB 1TAHA 1JQ3A 4PO9A 3T1YB 5DLPA 3AUFA 1VHJA 2XCQA 4U6NA 1ZQ9A 2FRVA 2NU8A 1CV2A 3L4BA 3N7UA 3N70A 4XR4A 5ALZA 6AT1A 1H42A 4GOOD 4U7DA 3CZ5A 3OZEA 1E4VA 2AFHA 2EJUA 3PNVA 4EF6A 4QYMA 2PSFA 1K88A 3HYSA 1HO3A 3IGFA 5LQRA 3AESA 4TXLA 3P9SA 2XOKD 2JLSA 4ZC8A 1VLMA 1K8XB 3CW2A 1SWVA 2FZCA 2BH2A 5JD3A 5B6IA 2O54A 1SG0A 3M4NA 2J67A 4TKZA 2QEQA 1E1CA 4B3MB 2O19A 3EK2A 2AB0A 1FFWA 4WKBA 5BN5A 3EXEA 3QJ5A 2ILVA 3SJUA 3TBHA 2A9OA 2BZ1A 3NOVA 4GOLD 3TK1A 1M5TA 4BMYA 1QRAA 2FEOA 2VP5A 4OF4A 1YHNA 2D6FA 1AK9A 1M0WA 1MXFA 2C2ZA 2GPWA 2ZBFA 4D3ZA 5JCZA 3ZD7A 1XVVA 2TSYB 4BP8A 2EKPA 4LZWA 4ZYUA 1OU4A 2ZSJA 1JDSA 1LU9A 2VHEA 5K8IA 3WB0A 2ZCJA 3ZWBA 2PFSA 4EMUA 1UJMA 4Y2HA 5FNVF 3FLBA 5L95A 1JLRA 1LLDA 1C9MA 4RF3A 1NMSA 1W5AA 1BJTA 2B99A 2C9MA 3GNTA 4FYJA 1NYTA 4AJOA 5T57A 1ZM7A 3A6JA 4LF9B 3KOZA 2ICAA 2XDQB 4KIUA 5E9WA 5EE1A 4QWMA 5I47A 3FI9A 3TG2A 1FQJA 5BYAA 2IXTA 1EUDA 4Q15A 4X7MA 1CEQA 4HTAA 5DWQA 1BH6A 1JFFB 3STWA 3PQ4A 3GLVA 3BRWD 3D0KA 4JUAA 3JX9A 1E9EA 1GDDA 3V4RA 1PG0A 1SHTX 3C3JA 3ZE7A 1NXPA 3WWYA 2V97A 1DLJA 2OHHA 2Q0SA 5LIPA 2O2IA 3N1UA 5A5FA 1U0EA 5FRDA 1CU1A 1NNI1 3IUPA 2CV1A 1PF7E 3QMWA 5EPUA 5HBRA 2AFIE 4UXJA 3DONA 1ILEA 1MAHA 4Q3NA 4XRGA 1E32A 4DC9A 1TTPB 1U80A 3KJZA 1OTXA 4KN8A 4YUXA 4OLAA 1T5BA 2JRLA 2YXBA 1PFUA 3AEZA 1LKZA 2PAAA 4LYGA 1XTUA 2IPNA 2OXCA 3T4EA 3C7TA 4OX9B 1OV4A 2D5AA 3HYLA 4HZIA 2PS1A 1J07A 1XXHE 1A7KA 2GYYA 3ESYA 3GGPA 1W4RA 2CXNA 4KO1S 4NIMA 4NS4A 1RKQA 1YD7A 3UWKA 2FEKA 2PZLA 1DO0A 1Q16A 2BDUA 2WU4A 5G1OA 1FTYA 3LV8A 3WGQA 4COOA 3EFOA 3ZIDA 1AV7A 4JB0A 1PYOA 4XLTA 4AN4A 5IJZA 3EQ8A 1DJNA 1YB1A 2Z08A 3HKDB 4LDNA 4TWBA 1KQNA 1Z75A 3EPRA 3NKVA 4N7JA 4QATA 3HR7A 1HH4A 2LW7A 5HF5A 1R5NA 1SC3A 5I8ZA 1UJ6A 3HLYA 3FPAA 4M7PA 3WMGA 2IUTA 5DN6A 1ECFA 3CY6A 5IWAB 2NW6A 5DJ5A 2IYWA 2AW3A 1I7LA 2F1OA 2CK3D 1AX9A 2GM5A 4XGNA 3GDWA 2QRPA 3CWCA 3T7IA 3W1VA 3ENZA 3K0FA 4KMSA 1WMBA 4W9MC 1AKNA 2ON6A 3FD8A 3HO6A 1R6UA 4ARZB 1JG4A 1NJGA 2B8TA 3A9UA 5K6AC 4J90A 1JB1A 1H2WA 3E0XA 2BDEA 3EPLA 1E66A 2G5GX 4RHYA 5DT2A 4HH1A 4DIUA 1CUIA 2HBZA 4G97A 3IQDB 3PNBA 4AO8A 3HI4A 3QE9Y 2F9MA 1KGDA 1ZOIA 2NNWB 3ESCA 1TA0A 3O9VA 1AZWA 4LC0A 2F8SA 1ZEJA 4CN8A 1DTSA 2XE4A 1N2EA 2PSEA 3A2NA 3CX8A 4KNWA 4O4LF 4WUVA 4D92A 2JGJA 1WMDA 3LHFA 4D3FA 4MS1B 4PTZA 3ZN2A 1EVEA 1NW7A 2K5UA 3K9HA 3BIXA 1XZ8A 4MMZB 5FHRA 3WGJA 5CYGA 5K20A 4DQUA 3LPDA 1U8EA 2BFEA 3IKJA 3IJ5A 2HCJB 3EC2A 5HIMA 5CB8A 2L0XA 3NR2A 5CITA 2Q3DA 4MAFA 5HP4A 3OLZA 3PIRA 4UCWA 3A4MA 3ROKA 2ODWA 4U7FA 2VWHA 3ZWDA 4A10A 1BH2A 1L0BA 2NZVG 2WD7A 3FZQA 3SXJA 1C3JA 3QU4A 4MCHA 1P73A 3EVNA 5LZ9A 4ZPXA 1KI8A 4DW8A 4BMSA 1P17A 4X85A 1Z6TA 3HDQA 1JQBA 2H8KA 1YS1X 2I6QA 1EBBA 1OX6A 2CZQA 2O06A 2VYFA 5IT9A 4YP7A 2PMKA 4IJKA 2GPJA 4FDUA 4KKVA 4MO9A 1XN4A 5L7TA 5KNBH 1G20B 1KI7A 2XMGA 2ZE5A 3OZIA 4GC9A 3K1ZA 1A76A 3DDSA 4WA8A 3Q0IA 1MLDA 4FMBB 1ESZA 1LC0A 3ZWPA 1DBRA 4W7IA 1KK2A 5A4DA 4HNQA 3P27A 4CEIA 1VCNA 1Y4AE 4RH3A 3TXYA 3OFKA 1MPXA 2AK3A 2XITA 1H4VB 3VNBA 2V7WA 4YCSA 1PR0A 3CT4A 1WB5A 4EYOA 5BWMA 4HH4A 2YCLA 5IN4A 3R9XA 1Y7TA 4I0WB 1JECA 2GJAA 1T6NA 1T36A 4ND3A 4TSFD 1M8GA 4QYSA 2P41A 3VISA 1SZDA 3MEQA 3W4KA 4UZFA 2M6KA 4FS3A 2DQSA 3FB1A 5AD1A 4D26A 2B83A 4R8SA 1W34A 4DTIA 1RW4A 1QAOA 5FBKA 4DC0A 3CSDA 5JNUA 3AHEA 3KQHA 1TYZA 1MOZA 1ZBQA 2X13A 3R2JA 1LQTA 4R1UA 3W8NA 2V6GA 2NU8B 3R77A 2CXXA 1XKLA 1IULA 1JZQA 2P78A 3KB6A 5AUPB 1ISRA 3SSNA 3ASZA 1QOZA 1Z0DA 4B7AA 3JAKA 4L75A 1ZZGA 3M9LA 4YONB 2HPVA 2JGKA 2V7XA 4QODA 3MTBA 5FNZA 3WHIA 4D6YA 1N2ZA 2J59A 2RCNA 3ECAA 3W6ZA 3ZC3A 2J3DA 3LH5A 1OLSA 1YZTA 2PFGA 3P45A 4G1FA 1U7XA 2AG8A 4YREA 1CYEA 1ABBA 5HG0A 3PGLA 1T6BY 3KPWA 3JS5A 1MDBA 1NONA 2NYVA 2ZJ1A 4F85A 1WW8A 3WSWA 2HQRA 4B31A 3W3AH 3FPJA 3LYAA 3DNPA 3O8NA 1C3LA 3HB0A 2BFCA 2CWDA 1Z82A 1K2WA 3LKVA 2BBOA 5D01A 4RTMA 2BTOA 2OFXA 1KVSA 3VDNB 1U1GA 3KL4A 4L6IA 4K0KB 2NG1A 6PFKA 3F71A 4JLMA 2Y66A 5FA6A 3M2PA 1EVJA 4WH0A 4D42A 4IRXA 4YB8A 1I0IA 1KSJA 1Z35A 2NQ8A 3HEAA 3L8DA 3FWPA 3P1JA 3ZCXA 4URXR 2ZSFA 3FMGA 3AC0A 3L6EA 3RTCA 3LOPA 4OK5A 2NU9A 1Z4IA 2VNJA 2ZR7A 3EXG1 3PC8A 1W0CA 4XVHA 1XTZA 5JMOA 2ZRNA 1QK3A 1B14A 3CNBA 3W3AA 1DUSA 1FSFA 3EE6A 3QELB 3VPGA 1QFMA 3PPWA 3RYFB 3UFXA 4IQ0A 2V6MA 3FJ1A 3IRUA 1SFRA 2I9PA 1RLTA 4WCFB 5EMNA 3SFTA 3HCWA 2C3UA 4DGSA 3H13A 2H7CA 4L7QA 3WAJA 1J20A 3NHKA 3RRXA 4CT4B 3FYUA 3L6RA 1U11A 4JT8A 3T99A 4Z3DA 2CLLB 3AUYA 3BILA 1QS0A 3RKRA 5C1DA 4DA7A 3WV5A 2I3GA 1V6CA 3S1AA 3TKLA 3OO1A 4OJTA 1C0PA 2NV2B 4FM9A 3PFWO 3O31A 1XNGA 4QUHA 2A1UB 4QRIA 3GGOA 5ITZA 1HQCA 2FW9A 5AUOB 2WJJA 1EDBA 4BQOA 2QBYA 3E3LA 3LLVA 2Q5OA 2ZGVA 1J8FA 5JQGA 1TTTA 1M6VB 4RHXA 2PO5A 2WQZA 1L4LA 2BR5A 2O23A 4JJFA 5CIWA 4AF7A 4EFLA 1II8A 2PSDA 3NWPA 4IW3B 4OQFA 4WI1A 3EJ6A 2PKQP 4QFMA 3WLMA 3I12A 3ZE2B 4C6HA 1IN6A 1HE4A 2BEWA 2GDJA 3KWMA 4NYMQ 1P72A 5ICSA 1KJWA 2Q1TA 5JI3E 1KP2A 3ZU4A 1GKUB 1Z3IX 3NAQA 4WFKA 5F7XA 3E81A 5K3AA 2QP4A 1KPHA 1T3SA 4KDRA 3IVXA 1OI3A 5EIBC 1YO6A 2ES4A 2VSYA 3QE4A 4YY3B 4A6EA 3F3SA 2YQZA 3A9SA 3KT8A 5SYMA 3F1LA 1FE8A 1M7HA 2LDBA 4DXHA 5I7OA 4JNCA 2V96A 2AMYA 3OX4A 3VKHA 1RJFA 3MJDA 1C3EA 3UEOA 2FPOA 3L0DA 3L0ZA 1FLNA 4W9NC 4RXMA 3PC2A 4J6FA 4TT3A 4CR7A 3Q12A 3FMOB 2H0RA 2Q2QA 1ZYUA 3NRBA 4AQ7A 1D1TA 1NY6A 1YI8A 4DA6A 1K08A 3IEVA 2X4GA 2C2WA 2B78A 2V7VA 4I6GA 4P9NA 5F9FA 1SULA 3KWJA 3RK4A 2ONYA 2FGKA 1JAIA 3LKZA 3WLAA 1PFVA 4UKDA 4C4OA 4F6LA 2ZXUA 2H3EA 4TM7A 5A02A 3QK7A 3R0VA 3F9RA 3ORFA 4KR7A 5HIKA 1IWOA 4N6NA 1P3Y1 2XQFA 3RBZA 1PJTA 2JIRA 2REBA 5I4BA 1GR1A 1KQPA 3DDZX 2MSWA 3FDZB 3KOXA 3OZUA 4O4JB 4OATA 4DJTA 1NIJA 1GTSA 3L7IA 5KSZA 1V16A 3BSWA 4FMCB 1PKEA 2BT4A 3HABA 1N1MA 4HJRA 2YICA 2RGUA 2XDAA 2ZDGA 2DFDA 4RYDA 3LYUA 1JHDA 5DYIA 2HJWA 1EX7A 1S8NA 3NOXA 1X7YB 3ZWCA 1Q0QA 3Q11A 3DWEX 1Z0FA 4RL6A 5AWFC 1DIHA 2CJWB 1UXKA 4GX5A 4D82A 2A3RA 2D7JA 2VPQA 2Z8XA 4DCUA 2WUEA 3DOOA 3GVHA 1QDLB 5T64A 4EYGA 5FL3A 4MVCA 2KI5A 3V9AA 4TLEA 2AYXA 2W5UA 4ID3A 4P33A 5CFPA 1SUBA 2CLCX 1U1EA 4JBWA 1NBEA 2FP4A 4LRSB 3A1WA 3MTEA 3GF4A 1HV8A 4E13A 1T2FA 4IMRA 1RHRA 3WNQA 1UINA 3BD7A 3U6KA 2OVFA 4V03A 4UMVA 2V6FA 4RF4A 1XMSA 2IDKA 2CL5A 1WHTB 3NH9A 2GHQA 1YDFA 3TD6A 2O2HA 3VSEA 3REOA 1T5SA 3IUEA 4JCOA 4QRHA 2O1EA 4G2NA 1OBCA 4NNJA 1B6GA 3UW1A 3LU1A 1PCXA 3ZNNA 5AVQA 1M9NA 1SCKA 3SC6A 3WMWA 1RQNA 1UBLS 2L2QA 4QNRA 4WGFA 1XRJA 4LGVA 3PHIA 4K87A 2ZRAA 3A04A 4BEJA 3O2JA 2P35A 4OK3A 1VHQA 4TV8B 1IUOA 1XP8A 3H83A 5KNDA 4F11A 3WISA 2ZE6A 2AOTB 1KORA 4BFWA 1JVBA 2X1VA 1RZRD 4C89A 5AM2A 2YJGA 4GSKA 3EHDA 1GG9A 4OXKA 5ALYA 2IYPA 4WNIA 4J9UE 5LBIA 1I24A 1THGA 1ULUA 3OAAA 4XQ0A 3DPIA 4EHFA 5BRJA 1UL1X 4AJIA 1YASA 4ISCA 4YRTA 2ZSUA 3IUNA 2QRVB 2D5CA 1L3BA 2VDMB 5E4JA 4OREX 4WXMA 1UR5A 4C7JA 3B5EA 4DUZB 4PG8A 2O7VA 5KO2A 1C80A 3WFIA 4YDSA 4ZXFA 1P4GA 2UYQA 3OZRA 1TUIA 2VDJA 4FEGA 5AI9A 1AS0A 1XZEA 2OOKA 4EYQA 2YWRA 4EARA 5MN6A 3IRVA 1JHVA 2FKNA 5GJBA 3C8MA 1Z38A 3W6NA 3LD9A 2PSHA 1XZKA 5F3RA 1RAIA 1Z5OA 5CLQA 3P4YA 5BR1A 1DX6A 4RK4A 5GM2A 3NAMA 4ZU3A 1QG0A 2Z1MA 2G09A 2PEYA 3BFJA 1TD1A 2QAGA 1DUIA 1SQ5A 1PR3A 1HLGA 3FLAA 4DEXA 3IP6A 5C1PA 4ISBA 2J3IA 2G7MC 3OCYA 4MQMA 5ILGA 2Z4TA 4R84A 1UUFA 3G1TA 5FL7D 3I92A 3UJNA 1Q3HA 1ZBDA 2DR2A 2WG2A 3HEBA 3OPMA 3WKCA 1O94A 4BTVA 2JW5A 2JAXA 3ANYB 3ISVA 2VDUE 4Y9TA 7MHTA 1E9BA 4PF1A 4J0EA 1MG0A 4XI9A 4U8GA 4O3MA 4KWCA 5EGSA 1AM4D 4RWZA 3HKBB 4KPUA 5KVQA 4MZDA 2BMJA 3BWYA 4ZYTA 5ALTA 3FWNA 4E0BA 5T3UA 4J16A 1BNCA 1WXEA 3AOEC 4WBXC 2FEWB 4YFVA 1Y5IA 2QA5A 5C51B 1E3MA 2DQ4A 4LTNA 2NSJA 3D1VA 2WIFA 1E62A 1JIUA 1HLDA 1T4MA 1ZJZA 2XW6A 4ZZ2A 4B3IA 1N75A 1B7GO 1TKRA 1VE3A 1B26A 1KNXA 3BRCA 1MC1A 4E5NA 4Z7NB 5IDYA 4TYNA 1TMOA 2CNBA 2QX8A 4FGWA 1KDTA 4LKOA 4Q0MA 5EQFA 5KMGB 4R2IA 1SC9A 4FFSA 4OBEA 2ZT7A 4BMPB 2GD2A 2AHRA 2WTMA 3SHVA 4AKEA 3SSMA 4EEKA 1EAYA 4ENSA 1LSJA 5ESDA 5EHZA 1UBMS 4HAZA 1T8RA 2J9FB 2ZSEA 4H7JA 5EQJB 4EVIA 4V0KA 1UM9A 3V1LA 1ZGZA 3AI3A 3R6DA 3OWXA 5JT1A 2FXVA 4JU8A 1QIGA 1W35A 2EBUA 3BCUA 4HDCA 5JRJA 4DWJA 1FMJA 1X86B 3D5QA 3QHAA 5JZVA 1MKYA 2XMBA 3D4BA 4OMFG 1X6VA 4M99A 2GUWA 4XOIA 3FHLA 1P1RA 2KJQA 1Q1AA 2V4MA 2EWMA 4LRYA 3AR9A 3SJAA 3I9V1 3UV7A 4D9FA 3C39A 2ZTSA 4PLHA 1U8UA 1IHYA 2ZJ6A 3EXIB 1BKDR 4PQGA 2RBKA 2HBQA 3VBEA 2ANBA 1E2BA 1HF3A 2GPNA 3DE5X 4FBLA 4OAPA 2EAUA 5JUWA 1UK8A 1W85A 3FG9A 3ZK8A 1TJ4A 1VOTA 3EFEA 4KIWA 4YAUA 2IEGA 4J1TC 4QOFA 3WOHA 5FX2A 1SVKA 2B98A 1H94A 1XRLA 1XTPA 1KAHA 1PEAA 1W48A 2JJ1A 3DLIA 1TMKA 1PV2A 4PC7A 5AOVA 3VMFA 4ACAA 4KPFC 3GZTB 4MI3A 3O93A 5K8JB 5BVHA 2X5OA 3LGAA 5GY7A 4A1FA 4ER5A 3HN7A 3L7LA 5DX8A 5F9MA 3KZKA 4PSVA 1CQIA 4G0VA 3B6KA 3L2OB 3B9BA 5FDFA 1RRVA 1SVOA 1CJMA 4DADA 5KHLB 1V2HE 2C5GA 4RSMA 2MDTA 1UPBA 3G7UA 4O4JA 5AJVB 3QX7A 1UFRA 4MV6A 5GP1A 4NDNE 3P2YA 2VP2A 3SNHA 4MGYR 5AVUA 4OU4A 5LDHA 4UNPA 4KITB 5BN3B 2XE8A 3UXYA 3KDAA 1O0CA 2WSSA 3AFOA 3C14C 3JQ9A 1ATIA 2AEMA 2W90A 1KO1A 2QI9F 4K1XA 1ENYA 1T9HA 5DGCA 3ROMA 3V97A 3ICQB 1JHAA 4P4GA 4X7BA 3S4YA 3K5PA 3UW3A 5IPFA 3RH0A 3LVBA 1K68A 4LMAA 1L5LA 5MGNA 3K35A 3H65A 3DP7A 3JYPA 4R54A 4Z4EA 5GZ3A 1UKCA 5AQ1A 1GNPA 3KPUA 4QU5A 3W1WA 1N3YA 1V43A 3EZ2A 4TSFA 1KYIA 1E3EA 1XZDA 4RGBA 5LOVF 2JFYA 3QJGA 4GRAA 4YFYA 2ID8A 1WWKA 3ROXA 1VE5A 3RVDA 4B8ZA 4KNYA 3AB7A 1X1DA 4P32A 2E4UA 5EJ5A 2CNNA 4NU0A 2C8KA 2XWBF 3KJFA 4TRNA 2G67A 4K40A 4RWEA 4G5QA 4C1BA 4V1CI 2RGNA 4MQ5A 1AZLA 2WF6A 2R2AA 1UKAA 2V3WA 4NBTA 4AY6A 1M2GA 5ALKA 3QLUC 2QUKA 3EOBI 2W7TA 4I9FA 2ZBGA 2K7ZA 3D6UA 3GJ8A 3D9QX 4C4RA 1LSSA 1QU3A 1FFYA 2AR0A 4TTAA 2O8CB 1FRFS 4CM8B 2IXBA 1OB5A 1NTRA 3Q40A 1ZO8A 3OVMA 2X5KO 4HFJA 1VG1A 5EKTA 5BN3A 1KBZA 4PSUA 3V1UA 1PD0A 1ZUNA 2PT7A 4NOMA 3W3ZB 3ADBA 2OD9A 3I9V6 4LOLA 5GADl 3O03A 1BO6A 4E2YA 4TZ6A 1U5CA 2ZJ5A 4X9XA 5IZCA 2WKPA 2PBLA 1EPUA 5DXJA 1JQDA 4IVPA 4QXPA 4BX2A 2EX0A 4KWEA 5ALLA 4QDTA 1HFWA 2BTQB 3K0SA 2KX7A 1KVTA 1LY1A 1T9ZA 2QAIA 3I6BA 4OX9Y 3QF4A 3HBFA 1M6EX 4PRKA 3O4FA 5DBGA 3WGLA 4E1BA 3V5NA 3P9KA 3L49A 5DH9A 2CHGA 4M0MA 4N4AA 4BO6A 2QPTA 1AXEA 1MGOA 2BE9A 1WDLA 2DHDA 3MTIA 2ZIVB 3L02A 2HI0A 2R751 1SOWA 1ULZA 2AWNA 3G9QA 3V4VB 1JAZA 3KR2A 1EK2A 2RAUA 3CLSC 4R1MA 2OHGA 4NCHA 2GR9A 3TEFA 1E3QA 3ZHVA 4XD2A 3OICA 2PWPA 2DGDA 2BHTA 2PY6A 1I2BA 5BSEA 4EX7A 5AP9A 2IYSA 3A10A 4J76A 5BQ5A 5K3EA 3I4LA 4QSHA 3VPBA 2G82A 4C3OB 2Q5FA 1D6SA 2JKZA 5DM70 1EHCA 3V32A 3EIUA 1VHLA 2E87A 3I83A 1C7QA 3OQIA 1BHJA 1I9CA 2AOVA 3KXIA 1SBTA 1YZ3A 2VNIA 3H5LA 3N2IA 4JKIA 4ZRDA 4BQSA 5CA0A 4B3TB 4J0DA 1FVFA 3F3KA 1D2AA 1JHZA 2FN7A 2AEEA 3R6GA 1XJCA 1GUFA 1OI4A 1QG2A 1YQXA 3DE2X 3LM8A 3I09A 3BUSA 5MF6A 3FNBA 3PNQA 1TKAA 4RZXA 2QP3A 3KSRA 2DCMA 4IY1A 1G7RA 2R6JA 3IEMA 3GPLA 4BZZA 3ZV7A 3KUXA 4UQPA 3N6RA 2GN4A 2CUZA 3QV2A 4BQEA 4WESB 1DAEA 3VR2D 3VR4H 3KOMA 5KYXA 3TTVA 4LNUB 3WGKA 3CNQS 1QTNA 5ETJA 4QDOA 3LDUA 4YUYA 1MO5A 3CCCA 4NE2A 4OB6A 3AHIA 4M87A 2NYRA 3I64A 3RC7A 4RELA 3SHTA 2IUEA 3JD4A 3L18A 4RA9B 2HIGA 3ETEA 2GAJA 3UJ3X 1XPRA 1GU1A 3DZFA 3CRW1 2OP0A 1ID1A 1EI9A 2G17A 2G70A 1BC5A 1JR3D 4BMZA 5LP6F 3E22A 4QXAA 3H11B 1TYEB 2Z58A 1RP7A 4ZVVA 5ALEA 2FTKE 4TV9A 5JI2E 2YXPX 2W42A 2CSXA 4EGJA 1Q19A 1EIZA 1Y7IA 3JAKB 3OHSX 4IQGA 4QU8A 4DSOA 3PNSA 3C3CA 1YQGA 3NOQA 1YXMA 4YMTA 5AVRA 4YRFA 4K6OA 3HHPA 2YN0A 1K5HA 2YYZA 2Q4BA 3RG2A 1XF1A 3LIIA 4BQQA 3DB1A 5IM4F 1L4HA 3E61A 2I34A 5GONF 3U7RA 3B89A 4Z1MA 2WFAA 1XCJA 1JXAA 2CEAA 1GWNA 2IXGA 2QAGC 3BTUA 3QU9A 3HXTA 4JWTA 2H2FA 1TPZA 4UBLA 3IDSA 5CLGA 3TQOA 3HLKA 4Y6OA 1L9XA 4ZI7A 4OO3A 5H70A 3GLGB 1EVQA 3T5AA 5K2MA 1A7AA 3W2FA 4DCSA 4NCBA 2MYTA 2Z5LA 1LZKA 2CF5A 2PX5A 4QU0A 4RYLA 5LDDC 3SYKA 3NDBB 5ALRA 3O8QA 5A3RA 1TJ3A 2VDKB 2D1SA 1FVHA 2ZRGA 1F3LA 1OFHA 3EZGA 1OCEA 1WV0A 2EQBA 2I7XA 4LBZA 5AJWA 4IKEA 3GGDA 4OFXA 3T9CA 4H1WA 5AI6A 1XQ6A 1F7VA 2AQKA 4MWEA 2XT9A 3RK1A 2AFRA 1YC5A 2F3UA 2Q7XA 4DLYA 5JBQA 2H1RA 3ONEA 1N7JA 1AQUA 3HU5A 4N3CA 3RS3A 4EHDA 1AY0A 1GTL1 1CS0B 2J30A 3PPIA 4KOAA 5EP2A 1PJSA 5C4IA 2CB0A 3ZVMA 1WCXA 3EFHA 1UBEA 4FUTA 2PX8A 2XTJA 5JXIA 3H19A 5ERGB 4OI4A 1CUWA 4XEUA 2PLNA 3B52X 2NXNA 1QQAA 2TS1A 3NHPA 3OSUA 4TMYA 3DR5A 4DA9A 4MJLA 3TDKA 5ICMA 3OWHA 3LL7A 4Q1BA 1C0KA 2OCAA 1MJNA 1KDPA 1Z8HA 3P97A 4D0NA 2WHXA 2NO0A 2QMZA 2WFZA 2WHRA 2OPHA 4AX4A 3QJYA 1OMOA 3OIVA 1I3NA 5FOTA 3WA7A 2PUCA 3AR2A 2WA1A 1JIJA 2W8BB 3T3PB 4DRZA 2B20A 3CTPA 1YJ8A 3PQ3A 1BA3A 1DKMA 1KJIA 1G7CA 1SQFA 3BWXA 4IZIA 2C07A 1V3TA 2WZQA 4CUZA 5GPBA 5DEOA 3I6IA 1WW3A 2HY7A 4CF5A 2R8PA 4ZI7F 1N9GA 3RUEA 1NE2A 3TO5A 4I1SA 4BC0A 4RIHA 4BO0A 5KYXB 1KMCA 1N5LA 1HFKA 3Q7PA 4ZOLA 4YP5A 3LC1O 4JOCA 5JWHA 3DKKA 2WWRA 1XG5A 5AKZA 5GONA 5JAZA 1DLIA 1LPSA 1MX9A 2LWIA 2YDXA 4BTLA 4B3DA 1YK0A 1H9CA 1NKTA 1UZNA 3KSZO 1NFQA 3QFSA 2PR7A 3ZD9A 1PVOA 3QNMA 2NT4A 5EZYB 4EZBA 1R8SA 2OP1A 4UTRA 4LF8B 5EINA 4G9GA 1BDJA 3R5FA 1XQYA 2AJBA 3ZDYB 2Z5VA 3QGMA 3CNNA 1DG1G 1XZPA 1LRKA 4X93A 4N3BA 1EDEA 5JDIA 2QRLA 2C88A 3CZCA 3ST7A 2Q4OA 2JA1A 3I4FA 3PUWA 1PZXA 2NUTB 3KAJA 4PLPA 1U2SA 3EEQA 1ES9A 3DCJA 5JRDS 4DJJA 3ETDA 2OUKA 5KCMA 2WUVA 3CW9A 1NJ6A 4BASA 1YZFA 3FHCB 4Q1VA 2ASEA 4PYIA 1CY4A 3PTLA 1CZKA 1TF5A 2OMKA 3PX2A 4Q3EA 1JWLA 2CLMB 1WD5A 3INNA 4M8SA 5DDIP 3ABQB 3K09A 4LMRA 3L1IA 1AE1A 3K4HA 3W8RA 2E82A 2B1JA 3MRSA 4AG3A 2PANA 2P9TA 4EW3A 4AJHA 1ZIDA 1T5TA 1ZDMA 3FOBA 2XX3A 4M8IA 4UXIA 3GEMA 1FX1A 4DV0B 2WTAA 4PGHA 3WNDA 2A1TS 2HYDA 4LYJA 1FNSA 1DBWA 2DFLA 3W8DA 3D6VA 3ABOB 3CZQA 1XSEA 4TMFA 4DLLA 3RO7A 3KHTA 4OXXA 1JE0A 5AK5A 1H8HD 3O73A 4Q12A 4O2AF 1KE2A 1VQ1A 2BYTA 1ORDA 5L3VA 4ZCTA 5EY5B 1G5FA 5A9SA 4FOPA 4MDEA 4PHGA 2ZI5A 1QV7A 2WMDA 5E9AA 3M4ZA 3N39C 5FIUA 4C9BA 4YACA 1P1BA 1Z2DA 4I7EA 5HZMA 1CF2O 4DV4B 3HFJA 3E6AA 3K3PA 3WRXA 4M9XA 5K0GA 3FVVA 2WNIA 2X2PA 5JPDA 1EFHA 5LQKA 3N07A 5DE3A 3MWEA 1UXOA 1QO7A 2JJYA 5H16A 5LLDA 4LC1A 3SOZA 1I7SB 2D00A 4O6VA 4RTRA 4OFZA 4ND2A 4JSYA 5CLLA 4V39A 5LB4A 2NO1A 6ADHA 1WCYA 3P9YA 5H83A 3RRZA 1XZLA 2EZ9A 3OZTA 1J49A 1WULS 1XQWA 2AJ8A 1UM8A 2HT6A 4JL6A 4WW0A 1AIPA 3RB8A 2HJGA 4OAQA 4IF6A 3EIHA 2WJWA 1PFWA 3HHEA 2XUPA 2FF5A 2PNJA 5KQPA 2Q3BA 1TJNA 2J0SA 4N3AA 3BYZA 5IVDA 3AM3A 4TV9B 3K8QA 4HG2A 5IT4A 1OH6A 4WCFA 2XT6A 2BFOA 4ALMA 1A9XB 1NG9A 5LBTA 4X65B 2AFHE 1XZBA 2G9RA 2ZRHA 3L8FA 4PR3A 3D1JA 4LBYA 3VHLB 4ZYZA 3GXBA 4FFWA 1PK8A 2PBFA 4DC1A 1JMVA 4QO8A 4RQAA 2HIAA 3QFFA 4MUBA 2UYHA 2QZSA 4O0MA 5HCNA 4ZI5A 5DIFA 2YZKA 2DYKA 3RU3A 3CR8A 2GO7A 5T4FA 4N12A 3PRYA 1IN8A 2YV3A 2I4OA 2W6IA 1MC5A 5U4XA 5ITSA 4M1WA 5DLEA 1P7VA 3BIOA 1DPGA 1MB4A 2PCJA 3UGKA 3ZXIA 1U31A 5JS7A 2XCUA 4JLOA 4AY4A 3PF8A 4TQ9A 2XB4A 1E3DA 3I3OA 3QXJA 4Q24A 4BBJA 1II8B 2Q45A 2WMNB 3DE1X 4GXNA 2RAVA 4IICA 1MAAA 4QOGA 1O5IA 4UBKA 3D2CA 3TS1A 4HFMA 3HS3A 5TB5A 1TAGA 2A0WA 1Y1KE 2GILA 3FRHA 1XTIA 3WLRA 2D8MA 3LUGA 4KDCA 2A88A 1JJVA 3UXMA 2GD1O 4EMTA 3FGZA 1QM5A 1WU7A 3H17A 5KU1A 5H9VA 1TQDA 1CY8A 1Y6ZA 3J80A 5BV7A 2VF5X 1HRDA 2GVZC 1M2VB 2CBXA 4NR0A 3DBRA 4NZZA 3DH0A 4OXRA 1GZ4A 3R6TA 1BKSB 2YN4A 3WGGA 4URHA 2FR8A 4IIVA 3WGUA 3EXIA 3OEHA 2P30A 2LV8A 1NW5A 1U1CA 4GMGA 2P9QA 2RCYA 3LHSA 3DTNA 4IHJB 4MS1A 2C8LA 1WMFA 1X9GA 4MDYA 3DLTA 5KOJB 2VSNA 1D3AA 3PD1A 1WXHA 2QUHA 2YZ2A 2P9GA 2OMEA 3F5DA 3K6KA 2VOEA 1YT5A 3IESA 3OLQA 4GBED 4O4IB 4TWJA 4Q1FA 4BLOA 2UYCA 5G1NA 3HJFA 3LCMA 2IOFA 3CLTC 4OBXA 4X92A 3C24A 1PJQA 1S3SA 2YOHA 3NEJA 4QDUA 4QUEA 5JNRA 4L95C 4RAOA 3ESQA 1EHYA 3T1OA 4R0VA 2QVGA 4PFJA 1IVNA 4AKTA 1ZI6A 1DFIA 1QQ6A 5D86A 1ZIOA 4X64B 5EHNA 2HDNB 3L79A 1DO2A 5YASA 4EUNA 2OQVA 5FO0A 2FCAA 3NWEA 1E77A 5GINE 1SCAA 3EY9A 2CVHA 1NSFA 2EX4A 1D2GA 2YQ4A 3M2TA 1EWTA 2HLDD 4LRWA 4Y1RB 4YJDA 3SS8A 1COZA 1V6SA 2D5LA 3KU1A 4Q82A 1N33B 4PFKA 1EDDA 2C1XA 1I3LA 5H8WA 4KYTA 1R0XA 1RLOA 2AMFA 1OROA 3LQ2A 1C50A 2H16A 1YRYE 5CEEA 4PYKA 1FZQA 2HB6A 1QYDA 3P52A 1BRTA 4JJIA 3H2SA 2A5YB 6REQA 3K72B 1QHGA 1ZW1A 1L5ZA 2ATIA 1N9KA 3CUSA 1UC9A 3AF2A 2F1HA 4UTOA 2OCPA 4LXGA 2IUUA 5JSQA 3VPAA 4E5UA 2WYUA 3HR8A 1MOPA 2QNRA 4EW1A 3GELA 4MMYB 4M8KA 4ZARA 4XCQA 2C0QA 2QZZA 4JQSA 2KB0A 3AEQB 4HN9A 5BMOA 3OE7A 1IN7A 3GLSA 5DI9A 3MQFA 1XIVA 4FJ0A 2E4ZA 4GOJA 3NBQA 4BWVA 1ECJA 2AR7A 3HFSA 3DMHA 3I8OA 4X7PA 1OHHD 4MLCA 4MWOA 3LNTA 2ACWA 2Q2WA 3GEEA 3ITEA 1Z5PA 3DW3X 4FZRA 2JI7A 3WJAA 3WDMA 3GMIA 3JQQA 5DBIA 2OXIA 1EFAA 1M3SA 3KKEA 4UVHA 1NJFA 3E5NA 4GC5A 4MAAA 1ZY2A 3MMZA 3STYA 1AURA 1XX6A 2XTZA 5BO5A 3COZA 3PB3A 5I5EA 3DTVD 4NAUA 5FWNA 1FS4A 3ZCSA 3FAKA 5KWEA 1JFSA 1P7ZA 3IXLA 3WGNA 4C03A 3T9AA 1G1MA 2RH8A 2X9QA 2QX6A 3JYLA 3UQYS 2WUDA 3VOTA 1N0WA 5JDCA 1OPRA 2CE7A 3HDTA 3I5YA 5J5AA 1U28C 2XRFA 1GG2A 1R50A 2P3OA 4IJMA 1SU7A 2I8AA 2GOYA 3OBBA 3F47A 4GPZA 3TI9A 3W7AA 1JW9B 1SZPA 2HLPA 1UWKA 3LVRE 3HXOA 1SUIA 4IUBS 3AR6A 3I23A 4AULA 1NR1A 1JGTA 2YWHA 4RJ2A 1DEKA 1I32A 2B7CA 2QSYA 4OI0A 2C9CA 1YK1A 2E0IA 2IYXA 3EGWA 3ZDRA 1U0BB 2XD9A 4KXYA 3WDSA 1KBQA 1AXRA 4QD3A 2EC5A 1JE1A 1GPKA 1Q20A 3FPGA 4PWYA 2JA2A 4PCVA 4F5DA 1JSZA 4PRLA 2DBRA 5C8YA 2YYSA 1DC8A 3LT1A 3O4RA 1YL5A 3U4QA 1NVWQ 2DR0A 5CHYA 4BDSA 3X2SA 3H99A 4HADA 2MMCA 4DRYA 3FFTA 2WR8A 2IIBA 3B1VA 1VZ3A 3OOJA 5TPWA 2G83A 7MDHA 4P80A 3VDMA 2OY0A 5LJLA 2HCFA 2Q5IA 5HA5A 2QSUA 2VNAA 4G3XA 2QP9X 1L4EA 3H5AA 3F0TA 5EMKA 4YXFA 5JASA 1S96A 2IGBA 4N54A 1DJMA 1P5JA 3JQ8B 5C7OO 4IHQA 1WKCA 3HACA 1PG2A 3FETA 4QXRA 1SXHA 1I30A 4UXHA 4Y9SA 1S4QA 5DNEA 3OHPA 3JALB 1VL0A 3JQFC 4DCMA 4IOMA 2ZYHA 2DSNA 2JGFA 3K6JA 4LYFA 3RFFA 2MSCB 3RVQA 5TT0A 3F96A 4C43A 3L8MA 3PQ6A 3DFUA 2Q6IA 4L07A 1IN1A 1AQJA 2OGWA 2VG8A 3GPDG 3HP4A 4D0GA 3CLTD 5CT9A 1AOXA 5EJ7A 5B58T 1M34B 3CRZA 3I05A 1UMDB 3NDRA 4YRGA 5AVZA 1JXMA 3GARA 4GLJA 4Q3OA 3GAMA 1HTBA 3IL2A 1W0KD 4L2IA 4B4OA 3Q8LA 3MGBA 3PU6A 4WXEA 2CCGA 3UGTA 1I4EB 3SBEA 3NETA 1VRCA 2BGKA 4UCFA 4EH1A 1YA4A 4KXLA 4OV6B 4CFSA 2XCIA 3N86A 1OIXA 4QICA 1GL6A 4B7ZA 4CHTA 2XKJE 1FYXA 1Y5RA 3PS9A 4N0DA 4ZDKA 3D64A 5AKKA 4DDKA 4ZKDA 4ZAYA 2VPZA 2YH2A 4RVHA 3TB6A 4B32A 3AYXB 1JJIA 1N1DA 4OSOA 4YJGA 3DT6A 3PXBA 1YGYA 3GVCA 1GSHA 1IY8A 2R3SA 1QYVA 2BBSA 3BM5A 4WINA 4Z7QB 2VH5R 4EKGA 1PL0A 1UBFA 2C5FA 4TUYF 1SQSA 1WPXA 2FDRA 1N2CE 1ZISA 2Q1YA 2RGEA 4C08A 1QQ5A 1RJ9B 1C7ZA 3F46A 4BX9A 4N49A 4LYAA 3ZWWA 4FCCA 1DBVO 3BJRA 4JT9A 3TXAA 3OF5A 4RULA 2GZ3A 3B8EA 4D9KA 4H7HA 5L45A 1T9DA 4BV9A 3GN2A 3R4CA 1DP4A 4PYJA 5A62A 1A2OA 3BRWA 4GLBA 2FP4B 4KSBA 2H07A 1Z68A 2EYUA 1YS2X 4CQNA 3MJRA 4O2BF 3ZDXB 1WMAA 4XWTA 5LUAA 2IEBA 1FFDA 3QKRA 3RS2A 5LC1A 2H9AA 2ZYTX 1WPRA 1GFWA 4GI1A 3ITDA 4IWYA 5FI1B 4R0MA 1Y98A 5KTYA 1YFJA 1AHHA 4YJKA 3S7ZA 3EZNA 5AVOA 4X3OA 4Z86A 1ZJ6A 1NI4A 5CDSA 1W8DA 1WBDA 4MJ3A 2O0JA 2GWRA 3I62A 2QW8A 1QVWA 1RWNA 3WFZA 1LJLA 3KYCA 3D6AA 1Y3DE 1RPAA 5ER6A 3F3MA 4YAKA 4Q37A 3C3DA 1T4BA 3T3NA 4P92A 3QXSA 4Q03A 4KE7A 1JU3A 3GHHA 1K7EB 1OFIA 2B8WA 4WZAE 5DK6A 3S28A 5AVWA 5KTTA 1AUOA 1JXQA 1L8LA 5EXXA 3O90A 3TRIA 3ZZ0A 3FKJA 4Q4LA 1CVLA 5C8ZA 4CYMA 2NX2A 4EPTA 5BN5B 1RADA 3BGSA 1OPXA 2YY5A 4MR7B 1Z56C 1J2YA 5I7AA 5IABA 1ECBA 3AGPA 1BOFA 1TT7A 5JAIA 5LWQA 4WBSA 3EDMA 5TQ0B 3JW8A 1N3BA 2BFFA 3STVA 2GETA 1Y37A 2IV3A 2VAVA 5AJXA 1IG0A 2HQOA 4ZOLB 2IDJA 5I3CA 3UFXB 3TYXA 4P7FA 3TN7A 4B4UA 1SQGA 2MSLA 4L9AA 3QA9A 1IUNA 1Z12A 5CM9C 1GDTA 5G3YA 4IUDS 3ENNA 2VEDA 4P4SB 2NZ2A 5EYPA 8OHMA 3GA0A 3R3JA 1BKYA 4KQCA 3V7NA 4DMMA 4FR5A 1NN1A 3TLYA 2QR3A 4ZO9A 5ALIA 5K6RA 3CN7A 3K9LA 3OCUA 4XQ9A 3QI7A 2G77B 3R3XA 1VL5A 3NJ4A 3KXKA 2QHXA 4HNTA 2GFIA 3ZBTA 5EXDA 1V9CA 3BORA 1HT2E 1U0RA 1SN7A 1U2TA 1GUYA 1G4UR 3G8BA 4ENTA 3HVUA 5EJ2A 4FSDA 3V2UA 4MKFA 4WXPA 3WK5A 4R05A 1JKIA 4U7TB 3T5MA 3SE7A 3AVTA 1OX5A 2W2QA 1NJ1A 2ZRFA 3DA8A 2GD0A 3IPLA 2J0QA 2W6OA 2NM0A 5CNIA 1DKLA 3MD0A 1C8KA 1F2TA 4KO4S 4KC0A 1YE3A 2HF2A 2HJSA 3TTYA 5A2GA 3HM9A 4RK1A 2BFDA 2IP4A 1L5SA 2Q49A 4NYIR 5ALUA 2D54A 2YVQA 3LPMA 2E4VA 4JEUA 1WE2A 3MLEA 1QYWA 2DT5A 4PE5B 3B6MA 4X63A 1P4AA 4QECA 4WD3A 3ZVRA 2YTZA 4IDDA 1PDWA 2VHUA 4MWSA 1W9MA 5FOXA 1P9NA 2FETA 4I8IA 3SC2A 3TPFA 3WWDA 1RXCA 1BU5A 1V7ZA 2G0NA 4K03A 1CVRA 3E9DA 4ZA2A 3SZUA 1NBMD 1USWA 4QU9A 4IZ6A 3CNHA 5ALQA 2Q7OE 4BNYA 4EENA 3FPLA 5CDHA 5DMHA 1A88A 4Q9JA 2R9VA 1KFKB 1WF6A 3EF1A 2QROA 4Q7LA 5CDUA 2YMQA 1Q95A 1Z5UA 2AE1A 1WUYA 2PDAA 3HNPA 4K88A 3RJ5A 4B82A 4HNVA 5EJEA 4YCNA 1D09A 1V5GA 3QH4A 1OLUB 3OF2A 3KQTA 1TQ6A 3RBAA 3RFVA 4RETA 1SCUA 3N2KB 4FQ5A 1RJDA 4JKOA 1W96A 3QLVA 5IYZF 3A1NA 3KSMA 2PEZA 3DFFA 5HVNA 1W8IA 3UK2A 3R7LA 1JKXA 3I76A 3VJLA 1ZC3A 4NFYA 1F4PA 1FSSA 3LNCA 4LY3A 1VLZA 2I6TA 3N2LA 5JQGB 3GLFA 5CFMA 2QD1A 1TU4A 4Y6QA 1WR8A 1HY3A 4MYRA 3WGMA 2YFHA 4D3SA 4D3XA 4YCBA 5CH8A 2SNIE 2OFWA 4V3CA 4EKEA 4ERNA 1JLMA 1RJWA 2VP3A 4M89A 3MTDA 1EZ4A 4XR9A 5CH5A 4B74A 2CMDA 3LPCA 3GFPA 1Q5PA 4PX3A 4OHKA 5EIFA 1J5EB 1EIWA 2CJFA 4I5EA 4NXMB 3VR3A 4I1UA 3B5JA 3A2KA 4KN5A 2EJWA 3LC7O 4DRXB 3E8XA 5FPHA 3NTLA 1XCGB 2BMEA 1E6WA 3O3MB 1A2KC 1QGAA 3NXSA 3QXXA 4G36A 4A15A 3QHQA 1Z0KA 1ESDA 3V42A 3E27A 4MK4A 3MGKA 5KKCA 3FDFA 1P0CA 1R0YA 3G02A 2PMEA 5A4AA 1W6UA 5JH7F 4P4NA 1KMQA 4EZIA 1FPMA 2YBEA 2NXEA 4KWIA 4NFSA 4YAJA 4ZCPA 4ZEMA 3U1VA 5A4MS 5TV2A 3TLGA 3AVYA 2ZIXB 3GRPA 2QIPA 4M9SA 2EP5A 1L4YA 4X3CA 3M5CA 4BNVA 3PFHA 2DJIA 1VYHA 1SXGA 1EM6A 1V47A 1X7ZA 2VBGA 2VJNA 1NNUA 3N59A 4FR0A 4TPKA 4IFIA 4EDFA 1GQFA 3FCSB 3DAPA 3FN4A 3EQ9A 4M7RA 2IDZA 2V6IA 3WIUA 5TGTA 5KVCA 1WTCA 3JQ7B 1VKRA 1L7VC 4RZUA 1QXSA 2J1LA 4GMDA 1Q3KA 1LUAA 5JALA 4ZODA 3GDGA 1XMIA 2XF8A 3X2EA 3K31A 1VSUA 4R9SA 4CMCA 4ZHQB 4OG2A 2ZJAA 4INAA 1LGYA 1MN6A 4M1EA 5AHKA 4X95A 3DEFA 4A26A 3DOIA 1CQWA 5FBHA 2PGDA 3K2EA 1EH5A 1C3VA 3CM0A 3NDIA 1J5XA 4YV2A 4GMFA 3HUEA 2E55A 4AB1A 1FCJA 1O97D 2QLLA 4WKCA 4H0CA 3AVPA 5FLEX 3UJ9A 3PR1A 5JFGA 3SYLA 2BGUA 4WKOA 3V2IA 1MU0A 1TCVA 4ZAWA 4DQDA 1QH1B 4RPJA 3COJA 1T5IA 4HMQA 1H5QA 1GT91 1S2MA 1IOLA 3LCUA 4Y2TA 2H2IA 3KC2A 1Y9DA 2CMKA 1M72A 2EKBA 1W85B 1EX9A 1ZD5A 4HRYA 1ZJJA 1GCOA 1WY7A 3N2KA 4YAGA 1T5HX 4KFTA 3G0HA 2XAAA 4TLBA 4EX6A 2W6ZA 2XHZA 1YL6A 2YVUA 4HDMA 1XVIA 5CHEA 1V1RB 2D0IA 3IQHX 3TX2A 1OXXK 2WJZB 3DLAA 4KREA 2P5YA 2DHQA 4Q9HA 1IXSB 2LIVA 4XKJA 2WIBA 4I4TF 1A8IA 2VQEB 1QKKA 2CYCA 4JYAB 1HL7A 1P9RA 2WAOA 4CDMA 4EPVA 3MYRA 3UMMA 4O2BA 2AQ8A 2B1QA 1JYSA 2GN2A 4FGKA 3RYFA 4KPEC 2C5BA 4DAEA 2AFHB 3HJUA 5CVDA 4E6PA 4EITA 1THZA 1KOLA 2G4VA 4M1ZA 4NBUA 1R0BA 4KDEA 4PCLA 4KR2A 4TZ0A 1UOQA 3GRCA 3CH6A 5TARA 4ED9A 3WP1B 4DLNA 2X0KA 2M6RA 3FCOA 3ZI7A 1QE5A 2EKLA 1XCLA 1G5RA 1YDHA 3EA5A 3R3WA 5KQSA 4I4NA 2D1YA 2IIPA 3RBVA 3BOSA 4URUR 3F74A 2WYVA 1UK6A 3DAFA 3QKSA 2KS6A 3VPXA 4ADSG 1ZI9A 4CM3A 2XMCA 1WMEA 3EPPA 2YXDA 4N9WA 2G6BA 2YOFA 3ZJ4A 2B6HA 4ZOBA 2OZLB 3CKMA 2DP4E 3DSRA 4YJ3B 2CSUA 3NNDA 1LV7A 1RBYA 4M86A 1V5FA 1NVXQ 4J6EA 3SIRA 4UREA 3QOFA 2FDXA 2YV5A 2PPLA 1L1FA 4IUCS 4UPVA 4QT4A 2I2AA 3C4JA 4Z4GA 4OD0A 1L7QA 1H65A 1RXVA 4O5OA 3IR6A 4U5XA 4EY6A 1YHYA 1ILWA 1NLUA 1NRXA 1Q0PA 1ZRNA 2ESRA 2R6GA 2HNKA 2YY6A 2ZANA 3JRWA 4H7PA 2W37A 4IH1A 4KHZA 3N58A 1I3CA 4OLFA 5E9QA 2J41A 4AP9A 1ZCBA 1T35A 2HEIA 3PBKA 3SIWA 2W6QA 2X8LA 4BU0A 2BCEA 4C4YA 4NK4A 4DDVA 1VLVA 5ICCA 1JSRA 4QJ5A 5JMPA 1RYFA 5IC6A 3IOYA 2ZZMA 1FYFA 1U0OC 1KI6A 3OZFA 1PN3A 1FP7A 4E3ZA 2Y1WA 1U2GC 4W1SA 4ZKEA 5JR3A 2OHFA 4QGBA 2GZDA 4YALA 1ZKDA 5CFRA 4N0PA 2QN1A 4YMHA 2M9MA 2CUNA 2Z09A 4DDUA 5IH7A 4D3DA 2WB4A 4ZYWA 3DXXA 3UJDA 3HMKA 4RUKA 4DGQA 4CGYA 3UAXA 2F17A 2B7BA 3DCIA 5CPFA 1DWQA 4PRZA 2E3JA 4LECA 3BICA 2Q28A 3QX9A 5HS6A 4MJXA 5BYBA 4KR9A 3QPWA 1V0JA 5BQFA 4FX2A 1QZTA 3C3AA 1QR2A 5DOVA 3WGOA 4DCCA 4GMXA 2YHAA 4CLRA 1AGXA 3E9EA 1MF7A 1BRMA 3HL4A 4JX9A 5JPIA 3G59A 4UQLA 4D25A 2X3UA 1TX4B 5SY4A 1OQAA 4Q00A 2ZZKA 2G5TA 1KY4A 1OSNA 2ODBA 2YRXA 2ZJ8A 4G1VA 2YHIA 4PS0A 1T3GA 1RM4A 1O1YA 3RU7A 3HM2A 1XUOA 4LN1A 2XBMA 3KUCA 1L4NA 3TM5A 2VZ9A 2P9BA 1M1UA 4OGGA 5CVTA 3ZXYA 3LFTA 1YC2A 4TMVA 2UYOA 1K1EA 5KWJA 1KHTA 3FVQA 3KM0A 1D1QA 1MQSA 1YU9A 4P6VF 1EEXB 2P5UA 5ICEA 1LRLA 1Y9AA 2O20A 5CXXA 3E7FA 4UHDA 2WIDA 4PGMA 3RSGA 3P9XA 5E4YA 1KI4A 1WZUA 2C98A 3G17A 4MR8A 1Z0SA 4PZ0A 4A8PA 3E9NA 3LK7A 4RF2A 4JHLA 2PWZA 4OJKA 1UT8A 3BZWA 4IHJA 1PV4A 1VMKA 3PDWA 2XODA 4FN4A 2JBHA 2ZSKA 3L0IB 4MRVA 1EQ2A 2BR3A 1DBPA 4OQMA 3TOZA 3V8MA 1K0FA 5CG2A 4F3KA 1LSOA 3ZY4A 1U02A 4GP6A 3GXOA 5CFOA 3SZ3A 2YXLA 2JD0A 4ZU1X 2VH1A 2PKCA 3KOWA 4HNGA 1YMVA 2FPUA 1W581 3ZVLA 4EGCB 5B12A 4FIDA 1AQ6A 1EB9A 2F62A 1ECLA 4JIMA 4KJZA 4D2IA 2UUAB 4PGGA 5FTJA 3RKSA 4JC5A 5HKBA 2X4LA 4B35A 3DDOA 1YRHA 4YO7A 5DBHX 4PZ9A 3ZUPA 3ZE9A 1J8YF 2OGUA 3URKA 4O1HA 3HUUA 3K6SB 4G0XA 5FUYA 5FCDA 3VZDA 3ZY6A 3QPDA 2QAGB 2ZR9A 2JLCA 4HB4A 1TT5B 2BM8A 3PFIA 3JWGA 1DC5A 3WZ2A 3PGJA 4MWZA 3KEGA 1C7FA 1M34E 1XCPA 1D2EA 1WA5A 1ZK4A 4BLPA 4DWWA 3UWMA 2UZ4A 3ZGYA 5AM0A 1QANA 2A9JA 3EVFA 2ZTVA 1BGVA 2HSEA 2W6CX 3D6FA 5TVGA 6LDHA 1CDDA 5B3AA 1Y8CA 1HYGA 2GAAA 2W98A 4BNNA 4HQRA 4HVLA 2IS6A 2B37A 1ONNA 1LW6E 3I30X 3UOGA 1D4ZA 4RADA 4GZMA 4A8HA 4IINA 2OZEA 2AOUB 3IMCA 2C0CA 2POCA 3QX8A 1JG2A 4HQ6A 5EWMA 3ZLBA 1RACA 2OCKA 1J33A 3HKBA 4KPUB 1QFXA 3QBDA 2P79A 5AXBA 1EGQA 2VCYA 1J1UA 1MENA 4EZEA 4PC2A 5LA6F 3CJRA 1VC2A 1Y1QA 2IPXA 3M4XA 3C0KA 4NCIA 5ENZA 4TXJA 2WIGA 3A4NA 1CFZA 2JD2A 5D3MB 4DOMA 3G8DA 1HX7A 2VSQA 4RAQA 3E70C 4Q9NA 5C1OA 2XUIA 4TVSA 2VTEA 1ACMA 2HZ7A 4B76A 3OEYA 4CIAA 1L4KA 1XZAA 1JFLA 4W6ZA 1UXHA 1DMSA 2MR5A 1X7ZB 3PJGA 4HEA6 3S2IA 2FMHA 4AMUA 4DDTA 3C85A 4JJGA 3WVNA 1KBOA 1N8NA 5BV8A 1IQ0A 3DQZA 2DZDA 4UHCA 3M0EA 2H48A 4LXYA 2P1DA 5M7EA 4J0KA 3PLAE 2O52A 4B81A 1H2HA 3R7WA 4CDNA 5K09A 1OB2A 5I7VA 5KOJA 1TLFA 1EP9A 4WEQA 3PEYA 2NVBA 4Z0TA 2QVLA 3WWEA 4BLTA 4E2ZA 2RIPA 4U2BA 4ZPJA 2GXQA 3S2EA 4RFVA 3UV6A 1UP7A 2WICA 5CW1A 1ESCA 1FLDA 4QARA 4QPJC 4EUFA 2KW5A 1F8GA 3W34A 2JCBA 1XGKA 3R76A 5KSOA 3CJQA 5EUCA 4UC0A 4GM0A 2C04A 1OIWA 1P7PA 3AEXA 5FAKA 3O6VA 5EGNA 5FTNA 2B5WA 2YZ7A 2VSFA 2XUFA 3AP1A 4TS3A 2Q1XA 3LBYA 4KBYA 3UMJA 3FHOA 1IZ8A 1XEXB 4HWGA 3E23A 2FN9A 5A7HA 1NX6A 4F0JA 5L3SB 1J4AA 1XFAA 1GXSB 4Z9BA 3O47A 4XUDA 4NZNA 5FAXA 4PVDA 3ESZA 3QEJA 5KMGA 3V46A 3L7DA 3WYCA 1JHRA 4CKBB 1TAQA 5F23A 3L8YA 3UZUA 2OBLA 4GH5A 1FRNA 3SFVA 1IIRA 1KVQA 3B2NA 4MKXA 2PZFA 2ZSDA 4LJ9A 3DCNA 1HM5A 1YA8A 2XECA 3CIFA 2O3UA 2PX3A 3HUFA 4IILA 1HLPA 3R7WB 1H05A 1QB8A 1U8XX 3K70D 4G0ZA 1CD5A 1H2ZA 1YR6A 4X84A 3B1WA 1FMLA 1WNTA 5JAHA 5TXGA 3ZYZA 1G9SA 4DR6B 3E1KA 3U3ZA 3OLXA 4NATA 2FVXA 3BJIC 4LOIA 1JU4A 4LHZA 3AUXA 4I55B 3TECE 3TRJA 1N2BA 4G8JA 5M2QA 4U9HS 3T7EA 3K9FC 3RRYA 4GP9A 4PZZA 1NQTA 2CUTA 2F3TA 1NYLA 3KSDO 3QNWA 1EP3B 3EGXA 4LV5B 4C14A 1D6NA 1X42A 2RE8A 2CVOA 3UG6A 1P2FA 3NEYA 2PL9A 4HWOA 3GD5A 3LQ1A 3UB2A 1ZJWA 3A6EA 2JFNA 1XU7A 2BP7B 1IZ9A 2DWUA 4BV2A 3GZNA 5L3SA 2YJ6A 2D1TA 5BNZA 1M34A 1QMPA 3PHLA 3G5LA 4TRMA 5TMEA 2C54A 4WXHA 5F33A 5U1PA 5HTOA 2PV7A 2ZYIA 3M83A 1FLVA 3ENQA 2HH9A 3MG9A 1V8BA 1UOEA 4YRRA 4B44A 4QYXA 1ONOA 3LT4A 2GJSA 3CX4A 1IE3A 2AXPA 4S0ZA 4CQMD 3NHMA 3EEOA 4EAQA 4BO7A 1WP4A 2XCTB 4TM8A 4YIKA 4N0MA 2D3TA 1L5OA 1TCUA 1ZH2A 2IXFA 3GMSA 4HWRA 4Y2UA 5B2ZA 1DC4A 3R7DA 3RG8A 3V8VA 4NJMB 1Z4LA 3I5UA 1CUUA 3AF5A 2GFQA 2QRZA 3QPCA 4HDAA 5GOTA 2BKLA 4OQYA 3FMVA 3R7SA 2X1LA 3B1JA 3GC6A 1XALA 3IERA 2NYUA 3SEZA 4XB2A 1I5RA 4B5KA 1ZM4A 1YNSA 4G24A 1PVDA 4BQFA 4TYPA 5T67A 3GRFA 4YX9A 1C4XA 3GGGA 3BHIA 1TUGA 2G8NA 3BE8A 1O5TA 4R5MA 2BR4A 1E5XA 1N5JA 4Z2AA 4RX1A 4KXUA 4PEVA 3D8RA 2E48A 1SKAA 2B4KA 2EKQA 4UQOA 5H81A 3LA8A 1A0OA 1C9KA 1EZZA 3OPYA 1V3VA 3I2YX 5H68A 3AF1A 4F06A 4PHCA 5C3MA 1UPAA 1YNOA 1O6CA 3EUFA 4ND7A 5HRCA 5ALDA 1X0VA 1IJEA 3KZOA 3MINB 4ZO6A 3IP1A 3H4MA 2XSZA 5DTRA 2EIHA 3REGA 1FNMA 1VTKA 2ZR8A 3QBEA 4AN1A 3RSSA 1M2VA 1P7WA 4GFDA 4CM8A 1TOAA 1YOBA 3LUAA 2ECPA 1GNQA 1E0KA 1DT3A 1M2KA 1Z62A 3RUPA 4A0HA 2JLQA 3S1SA 3LE8A 3K2BA 2I7TA 2WWIA 5CFZA 3OY2A 3WK6A 1CQJA 1LJUA 2BI7A 4MINA 2QZ9A 3AKCA 2VZLA 2F8LA 4JKYA 4KG7A 2VUIB 4J49A 1ECCA 3OKAA 3U48A 2ZRKA 1P33A 3INGA 5CB4B 1Y4DE 1NF3A 3NGXA 2FK8A 3A1DA 3H2HA 1K06A 3H2KA 4X90A 5JD4A 4PHHA 2X1MA 4QUKA 5E4FA 1XYYA 1U3WA 4M0PA 3SNKA 2UVDA 2MOKA 2W2LA 3M3HA 2OTCA 4AG5A 3PE4A 1LS6A 4MVJE 3A4LA 4X1KA 4PIVA 1M7BA 3ETCA 4XIYA 3TVYA 2I3ZA 2FFQA 1Q7EA 1Z2PX 2OG2A 2QL9A 2BFFB 4Y1GA 3U2QA 4XZ3A 3IDZA 2BKVA 4YRMA 1YIAA 2Y1DA 1NQVA 5HK9A 2Y6VA 4F5ZA 2PLRA 5BYKA 3ND7A 1OVGA 5A7FA 1RQLA 4A6XA 4NF2A 4X8HA 2Z9BA 3CUYA 2OWEA 4V3BA 4XLLA 1ISGA 1RYDA 1OLXA 3C6YA 1TO1E 4F86A 3DPSA 8AT1A 4OH1A 1UPFA 4MGZR 3GCGA 4AVYA 5FFNA 4ZV7A 2DECA 2J4CA 5IHPA 1L5RA 2EJCA 2CFIA 4PG4A 3UOAB 1OGJA 1T9GR 3G1UA 4U00A 1QYCA 1M8FA 2DY0A 3P0EA 2EDCA 2Z57A 4QOIA 4ZVPA 3QIAA 4Y9DA 2FRXA 4ZEWA 1GAWA 2OORC 2ZT6A 1R16A 1YCHA 2OV6A 2J5QA 3DNMA 4B2PA 3MT7A 4PO1A 5BWCA 3J81k 3NBAA 3OZWA 4FWBA 1ADFA 2AI2A 4WXYB 4LHYA 5HQ3A 1HQKA 2HMYB 1XMXA 2W4IA 3I2FA 4KMMA 4B8WA 3PTAA 3ZHOA 3GEPA 2XQJA 1VPVA 1JHXA 2C7BA 2MSNA 4MRMB 3C1UA 3VYVA 3AOEA 3QVSA 4MVJM 1F9AA 3T5PA 3KZXA 1M6VA 1K4KA 3D8SA 1F1JA 1RYNA 2FWAA 3O2SB 4MTLA 3T1QA 2W43A 3NBXX 4DT1A 1CZLA 3IUMA 3NCTA 4YRLA 3VOAA 1R9JA 1O57A 1WX1A 2Z2ZA 4XFDA 4EUEA 4TS4A 1YFLA 1QLJA 3QITA 2VLBA 4N3NA 1SVNA 1M1NA 2B9EA 2DLCX 1OA1A 4J1QA 1NPYA 3RNOA 1ZHHA 2R97A 1D5CA 1SRRA 5C5CA 1NLZA 2OORA 2HA3A 3SM3A 1MAWA 5EJ6A 3ZWXA 1JVSA 3Q0TA 2ONJA 4Y0NA 1JR4A 2BF7A 5AKXA 2NV6A 3ED1A 1DNPA 3TOCA 2WSYB 3TZKA 3I9JA