2FG5A

Crystal structure of human rab31 in complex with a gtp analogue
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
165
structure length
165
Chain Sequence
IRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ras-related protein Rab-31
publication title Crystal structure of human RAB31 in complex with a GTP analogue
rcsb
source organism Homo sapiens
total genus 54
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fg5A00
3I32A 2RGGA 3BORA 2QMOA 4NZYA 5HKKD 3B1VA 2O8FA 3MJHA 2BCJQ 3CRRA 2DFKB 4L8GA 2CE2X 4BFYA 1Z0DA 1HT2E 4KFSA 4NONA 4Q9IA 3R8CA 1Z6TA 4C0AC 1PJRA 2ONKA 3B1XA 4CF7A 2J87A 4BUJA 3K0AB 2O8DB 3LBIA 1QHGA 1GWNA 1IONA 1X8JA 3AP1A 1QDEA 5JLJA 2VF8A 3UMSA 4D82A 3TE6A 4V02A 1E2GA 1JEEA 2G1JA 3ONWA 2NO9A 3UG7A 4RZ2A 3U6BA 3IQWA 4J0QA 5FL3A 2B8WA 4X8OA 4DLVA 3EZ9A 1Z6GA 1EXMA 2HF8A 3K53A 5KSOA 4UJ3A 5LD2B 4G5OA 4FCVA 4AYXA 3MFYA 5ELXA 1JALA 4RD6A 1G19A 1ZJ6A 1XCPA 1GKUB 2A5GA 4PO9A 5DIFA 1G3MA 1EX6A 3X1ZA 1CJUC 4C0HA 2WAYA 3KB1A 5J4LA 3K70B 4D0NA 4B2LA 1OPXA 2ZRBA 3P32A 2XB4A 3HP1A 4KFUA 4WXPA 4TZ0A 1II8B 1R4AA 5KO2A 3CH4B 4JVNA 2J0QA 1E9DA 2LKDA 4CEIB 1KNQA 3THXB 4DVGA 2WWFA 1H8HA 1ZCBA 2OXRA 4DLSA 2XITA 2IXFA 1E94E 2IS6A 1DS6A 3IIKA 3ICEA 1OFHA 3FKQA 1AS0A 2K5UA 2J7PD 1E1RA 3U7FB 4JJZA 3VR4A 4JL8A 4JVMA 3QF4A 4JS0A 4IFBA 5IHPA 5AJWA 2IS1A 4HAUA 1ZAKA 1NNEA 1W0JA 2J45A 4LV5B 3AF0A 3NEJA 4OHXA 3R9WA 3T35A 1W0KA 4XTCS 4GL2A 4OK5A 2FN4A 3CUEF 3KFVA 4HB2A 4Q7JB 2OUKA 4GNKA 4A82A 2F1IA 1N2CE 2Q9CA 2H57A 4HLCA 5E4FA 4N0EA 4HYYA 1ZM7A 2ZI6A 5EP3A 3RS5A 2O8FB 3GEEA 4H1UA 4QHYA 2R2AA 4RZUA 2B7CA 1VCIA 3OAAD 3LVQE 5L3RA 3EWSA 2ODBA 3NKVA 2JJ1D 1KSGA 1EWQA 4FWIB 5JS8A 4TLDA 2ERYA 3G82C 2W83A 1ZYUA 2CNWD 3B82A 3W3AA 1CJKC 2ODNA 2GEVA 4RZ3A 3B60A 5FTLA 1XCGB 4NHOA 3GJ5A 1W2GA 5CIQA 1EFCA 3RRZA 4DLWA 4KU4A 3I8SA 4PC6A 2OAP1 1SKYB 1OYWA 3FKSD 4YMSA 1MO6A 3I4LA 3UMRA 3PXGA 4NE2A 1TF2A 4KV9A 1TU4A 1IAQA 2VO1A 3W9YA 4A8JC 2UZIR 4RFVA 5GVSA 5FBLB 1SHZA 5CDFE 3TGPA 3TK1A 5KDLA 4I1OA 1UDWA 3LX8A 4U00A 5JSZA 1DO0A 3KQHA 1S9DA 3WMFA 1Q22A 2ZJZA 3V00A 3X1DA 4B3GA 2NO1A 2W2VA 3FFBA 1NLZA 4JLDA 3W5JA 1BOFA 4HI0E 2R6AA 1ONBA 4HB0A 2KE5A 1CR1A 5CDFA 1TQ2A 2GCPA 1ODFA 2P67A 3K70D 3LQRA 4JZKA 4HLUA 3LH5A 1L8QA 3VU9A 4E09A 2JLYA 1Z83A 1BKDR 1RRGA 3A1UA 4M1SA 4TMWA 5AUQA 1RIFA 1U98A 1W49A 4D0LB 1YZQA 2NG1A 4D4KA 1KMQA 1Z8FA 2XTMA 1M74A 5DE3A 5DI9A 2CCGA 3OZXA 1A4RA 4C0BA 1CEEA 3IGFA 4OHZA 1W4RA 3CR8A 1G9XA 1U0LA 3S1AB 3KJEA 3IHLA 4IFEA 5AUNB 1IN7A 1VIYA 2ZROA 4H1VA 5IDVA 2OAQ1 4BFWA 1XTRA 1W36C 2FH5B 2REXB 1Z47A 1U94A 4PSVA 4Q4JB 4ZKDA 4M9SA 3IIJA 4JYBA 3H84A 5JS7A 4QC2A 1IJFA 3I62A 2QG6A 3THOA 2ZAMA 2BCGY 4EPYA 2XX3A 3LAWA 4EKDA 2IX3A 1G7CA 3BIFA 5CYOA 3L0SA 3AF2A 1CIPA 1BS1A 3HWSA 4NU0A 4P4TA 4DSNA 2DR3A 3MSXA 2AD1A 5FUXA 5FOXA 1QBKC 5GJBA 4MUAA 1Q44A 2OLJA 1F60A 2ZYWX 2HLDA 5J5CA 4LHXA 1HQYE 2IYXA 5HZKA 3U44A 2ZREA 1S1CA 5HZHA 2REOA 1M7BA 3A4MA 3NTUA 3PITA 1QHIA 2ZJAA 3A1TA 1XZPA 2B8TA 2G9NA 3SBDA 4BLTA 2VIIA 2R8RA 2WKPA 2Z4RA 1LVGA 1KI6A 1SVLA 3GEIA 4ZDWA 4HSEA 2NGRA 1BO6A 3K8YA 4KBGA 4EUNA 5K8LA 2GJKA 3QKSB 2YINC 4RSGA 4AKEA 4Z8YA 3TSOA 4LHVA 4TLBA 3EPKA 1BMFA 1LB1B 4KYUA 1YZTA 5J4YA 1XD2A 4XSGA 1PUIA 3F8TA 3TW4A 3QIAA 1YZKA 2XSZA 5EUQB 2ZJ8A 1XMVA 1DELA 1R5BA 2IYLD 2FDCA 1D9ZA 4GFDA 5C1BA 1E2MA 1VG9B 2YOFA 4AWXA 1GM5A 5FBQB 2HT6A 4LJ4A 4FMCB 1ZNYA 1YZUA 1ZUIA 5J47A 4X8MA 3GP8A 2Q3FA 3QKRA 4B3FX 1E32A 3RYTC 3RVBA 3Q72A 3IILA 3KQUA 1TUIA 2ZE7A 3PEUA 3R7WB 2BV3A 4OL0A 1W1WA 3KUCA 4GSYA 4IEEA 4AIIA 3QKUA 1XJ0A 3I3SR 4OJKA 4US2R 5KSPA 3ETLA 5SZHB 1MR3F 4LUCA 2RGNA 5LB2A 1Z0IA 1GKYA 4M2LA 2V8OA 2CCKA 5FBVB 2H8KA 2JA1A 1AJEA 2Q9BA 2ZI3A 3A58B 1WB9A 1E99A 1K5DA 3QEJA 5DO9A 2ZJOA 1XXHB 2VP6A 3ADKA 3BERA 2YJTD 4D0GA 1U0HC 3TR5A 4DJTA 1Z0KA 2XJ9A 4WBSA 3K9LA 2IBMA 4DDWA 4JLKA 4DLRA 1XMIA 5CM8B 4BFXA 4Z51A 1KKMA 2JATA 3NBYC 3ZVNA 3EARA 4U5XA 3IHWA 2E1RA 5IT5A 4GOXA 3WP0A 4A0FA 1CRQA 2GXQA 4OJQA 3BRWD 2CMKA 2ODEA 1AZSC 2Y8EA 4C0JA 1P2VA 1HY3A 4LZZA 5L3QA 2VP2A 3BH7A 1XRJA 3PUYA 4BECA 2GAAA 3WXMA 3I5YA 3RLFA 5HCNA 4AC9A 3FHOA 3CH5A 4IHQA 4R98A 1JXOA 3LQQA 3BH0A 3EZFA 2GESA 1WP9A 1JPNA 2QM7A 5DN6D 3VR3A 2J0UB 1ZVQA 4TWZA 3LFUA 2FZ4A 3QSYA 3AKYA 4ZCLA 2JLZA 4B74A 4RVCA 2ZE6A 2ZS9A 1Z5ZA 2HJVA 2GDJA 3GJ6A 2V1UA 2DWQA 2GCNA 5BW8A 2QGNA 3D7MA 3BC1A 3AGPA 3TSWA 5J4KA 3KJGA 4LK2A 1N5JA 2B6HA 2VHJA 4P3YA 1R0ZA 1T5LA 4PZLA 1G7RA 3GJ8A 4I99A 4C3ZA 3ZD6A 2O8CA 5J4VA 4LV8B 1AIPA 5AUOB 1WRBA 2WWIA 4DCUA 3KDSE 5KOYA 1UPTA 2YHSA 5C4MA 3H4MA 1AQUA 2IYSA 1T3LA 2GNOA 2ZYVX 3U7EB 2HT1A 1JNYA 4UNPA 3UWKA 3SI7A 1HE1C 1EFRA 3WNBA 3NDPA 2GVZC 2BM1A 1P62B 2WSSD 4Q00A 4F4IA 1OF1A 1TL7C 5CIWA 3PEYA 2CL7X 2JDID 3CO5A 3MD0A 3MUFA 3OFNA 3GJ0A 4LHZA 5EZ5A 5H70A 3EPHA 3FYHA 4LBWA 1CF4A 3K9GA 1UJ2A 2NO0A 2WKQA 2PLRA 4Q21A 5FPHA 1NVWQ 1MT0A 2F3TA 5CJ2A 3KQLA 3U3RA 5FPYA 4ZCMA 1TUEA 1SXJE 3UKDA 4P31A 3TUZC 2IS2A 1KO8A 2PT5A 1E2QA 1AS2A 1JECA 4PSKA 3IDQA 5M04A 3CZPA 2QSYA 3AH8A 2Q3HA 2JIZA 2QT1A 4HAYA 1TEXA 3FOZA 4EQ6A 2F43B 2N42A 1MO5A 2QL6A 2ZRPA 3V4FA 1NVUQ 1KY3A 1H8EA 1WCV1 3HU3A 4GI7A 4NH0A 3RRMA 3WYAA 3BOSA 1SXJA 4KJZA 4BFSA 3IIMA 3B1ZA 2TMKA 4Q9KA 3CBQA 4JL5A 3THWB 2C9CA 2QP3A 1N0UA 8OHMA 2QE7A 5EE0A 3QG1A 1G3RA 2YKGA 1ZD8A 4KVGA 4XWKA 1E98A 5JCZA 3AVYA 3SJAA 4ASUA 1GNPA 2Z5FA 4CYMA 4O3MA 3X1XA 1OXSC 1GNQA 5EQTA 4C0SA 4XD7D 3GLHE 3CRVA 2PZFA 1Q12A 4L9WA 3ZYCA 3ZDQA 5EXTA 1G3UA 2UZ3A 1DAHA 2ZSEA 3T61A 5HKKA 2JJ2D 4ESHA 2VA8A 1VIAA 2RGEA 4IVQA 3GLHA 3NIBA 1BYUA 2WJGA 1NIJA 1N6OA 1RW4A 4KO8A 4AK9A 3MWKA 2P2LA 1L4YA 1FNMA 2IUSA 3L0OA 4Q4AB 2F55A 2XAUA 4AY2A 1G3QA 2WJHA 3PENA 2QBYB 3QVUA 2C5LA 5EE9A 4E5UA 2DYKA 4LOAA 4B3XA 1E4YA 3WMEA 3SN6A 2Z6VA 4BFZA 3WNDA 4Q9JA 2CL6X 2H17A 3KXIA 2ZJ5A 3CF6R 4UNSA 2XOKD 4MDFA 4URUR 2OV2A 5C4GB 1KSFX 1P72A 1ZUNB 3B1WA 4V0ME 2A5DA 1U90A 2I1VB 1XJQA 3GQBA 1FOEB 2KBFA 1GTVA 1G8FA 2PX3A 4FI3C 4M1TA 4RKFA 2AR7A 2GK6A 3EC2A 1R0WA 3GJ7A 2R62A 3BB4A 3QPVA 1D9XA 4OBEA 4OQNA 1RRPA 1R6BX 4LJYA 4E07A 1Z63A 3K09C 4V0MA 2Z83A 3WRXC 5TVKA 4QBGB 1VG1A 4GBMA 1DAKA 3KKQA 4B2IA 2GRJA 1F5NA 1JPJA 1OSNA 2GETA 2QENA 3RS3A 1KK3A 4TLEA 1YKSA 4Q1AA 2A30A 4TYNA 4HZUA 1GUAA 1SVSA 1X8KA 1M7GA 4NDZA 1E3MA 2VH5R 1Z0JA 1Z29A 1P4SA 2J7PA 2QQEA 2P6NA 1QVRA 3AVVA 3NC0C 2PCLA 5E7JA 4K46A 4QM6A 3AF1A 2J9RA 1II0A 2BKEA 1N0VC 2BDTA 1IHUA 4TZ6A 2EWVA 2ZETA 1QHHB 1OKKA 4P33A 4JIMA 3D31A 2YWGA 2ZU0C 5JJKA 1HT1E 3U5ZB 2FSGA 4HB4A 1E79D 2HXSA 4LJ7A 1OXXK 1RC8A 2QAGB 4A0RA 1OFTA 3LRPA 1P3JA 3OEHD 1UBCA 3HU1A 5D3MA 4D25A 1J8MF 4MGZR 1F48A 2IYWA 1NF3A 1TQ4A 3TSZA 1F2TA 1AGPA 1GP2A 1TX4B 2FGKA 4FCTA 1SHKA 3AP2A 3OAAA 4AYTA 1DADA 1GFIA 5KHOC 2JJ1A 3U61B 2OFOA 3DPUA 3T34A 4TT3D 5F9FA 3FGNA 4A8JB 3O8CA 3TLXA 2OILA 2Q0HA 3EIQA 3FMOB 3T1OA 3K0AA 2GA8A 2O8DA 1U99A 2F1JA 3FKSA 4A36A 2X1VA 2VP0A 2QI9C 5KNCA 4DDTA 5A0FA 3W6PA 3M0EA 1NY5A 1P9WA 2D7DA 3ZLJA 4G3XA 1FTSA 5JEEA 3VKGA 3SR0A 2IW3A 4LBYA 3BWDD 2O52A 5JHHB 2G77B 2H1LA 1BH2A 2WWXA 1OT3A 1ESNA 1Z2AA 1JAHA 4WVFA 2KI5A 2QEQA 3JVUA 4MA4A 4UXJA 4ABYA 4Q1CA 1LV7A 1XD9A 1NSTA 2WJYA 4FCWA 3LLMA 4HATA 4L9SA 3MRSA 2GTPA 2WWYA 3KFXA 2CJWB 3OEED 4P4UA 4CRWB 1VG8A 3LDAA 3NBZC 1II8A 2ZS7A 5TY0A 3T15A 2OEPA 4LJ9A 4RCYA 4WZ6A 3KTAB 4PZZA 4CEIA 3GPLA 3THXA 4MKHA 2W2XA 2DFNA 4JLNA 2H7VA 3QJYA 3EA5A 3K1JA 5IK2D 1ZD9A 4PPNA 3MJRA 3CWQA 3GLIB 3THYA 1J2JA 2G3YA 2AN9A 4ZDJA 2RHDA 1JQLB 3VR1A 5BYKA 1HA3A 1FQKA 2AL7A 4WIAA 4MH0R 2P0EA 3GJ4A 1JJVA 1KK1A 2C8VA 1ZU4A 2MMCA 3JZMA 2IYUA 3FPAA 1R8QA 3UG6A 1EFHA 3DKVA 2VTKA 4FW9A 2QUZA 1FZQA 3SYKA 5BN3A 2IS4A 2J41A 2ZJBA 3UIEA 2IYRA 5IRCD 1KDRA 3NH9A 2RCNA 1LS1A 2ZRAA 5FOVA 1ZIPA 2IYTA 1XPUA 3B5JA 3UPUA 4KAXA 2FFHA 2ZJ2A 3MLEA 1IN5A 2ZAOA 1ZM9A 4LCBA 4GOKA 3KJHA 1CRPA 3B9PA 1SKYE 3B8HA 2ZITA 4V0NA 2BMDA 1UKEA 4PO8A 4O2LA 4IOMA 4ACBA 3EZ6A 4HEJA 1SULA 4H9GA 5P21A 2JCSA 3SFVA 1E9FA 4Q48A 4MQBA 4A0HA 3GFPA 2ZSBA 3VAAA 4I1SA 4A2PA 1ZM4A 1N6RA 3C8UA 4U02A 3RAPR 1YR6A 4URWR 2BIFA 3T1QA 3NH6A 4ZI3A 2OFXA 3R9IA 1UF9A 1IBRA 4BE7B 3VNVA 3KKMA 1KI1A 3VR6A 3BJIC 4OK6A 2OCPA 4FINA 4KHZA 1F3OA 1OB5A 2REBA 2I4IA 2XTZA 4EJSC 1KSJA 1W46A 4MITA 3CLVA 2AWOA 2Z43A 4ARZB 5FOUA 1W2HA 1FP6A 2QRZA 4PHTA 1G5PA 4I1UA 4IKEA 4M9QA 3WNCA 3SEAA 1XU4A 3VR2A 3B2EA 2YWEA 4KCGA 1G6HA 5FFMA 4FMDF 4U7DA 4Q7MB 4RZXA 2P6UA 3SOPA 4YMTA 2WIAA 3AV0B 4K8OA 4PHHA 3UWOA 3E70C 3BB1A 1XMSA 2V9PA 3CRW1 4JBXA 4LRWA 2D4HA 1DAEA 3LX5A 2GZHA 4QGAA 4MYUA 3UANA 4DUGD 2NZ8A 4OKSA 4QHSA 4C4PA 1N6PA 2FOLA 3THYB 4MKGA 3HYTA 3QKTA 1W7AA 2YWHA 1G8YA 2ORIA 1VKJA 2IWHA 2BM0A 3TR0A 3TIFA 4A1FA 1W36D 1T3HA 4R7ZA 3SYNA 3FHCB 4FD2A 1GDDA 3SQXA 4UJ5A 4PX9A 2EFCB 4FN5A 1XEFA 3GEHA 4MUBA 1OHHA 3D6TB 3PQCA 3S1AA 3HPRA 3VNUA 4B6FA 2ECKA 4OYHA 4D4MA 2ZXUA 1RRFA 1E9AA 421PA 5FOSA 4B44A 1ETUA 1SVKA 2HJGA 3VHLB 4TSFD 3WMGA 1HURA 5BWMA 3KQNA 1XFAA 4Q4JA 2GKSA 4Q1DA 3RANA 2IF2A 1NBMD 1LS6A 4DZZA 4LYFA 1D8TA 3FFAA 4QOSA 2QROA 2JLUA 3OE7D 1SXJC 1WDTA 2VSXA 3AP3A 1XCMA 1E4VA 2PMKA 3B85A 2XZPA 1FMJA 2DWPA 1L7VC 2F1RA 1NLYA 2IC5A 3UMFA 3I5XA 1YRBA 2XNSA 1L2TA 2GXAA 1L4UA 3P4YA 1R8SA 1N5LA 2H18A 2IA5A 3EWAA 821PA 4URXR 1CU1A 2WJVA 4CVNA 4IVPA 3A4NA 1W44A 2O0JA 2R6DA 2QU8A 2ZSFA 3P4XA 1SVIA 1GNRA 1Q1BA 1N5KA 4TQ9A 1IXRC 3QKSA 4TMXA 1LTQA 5DN6A 3PEWA 5H68A 1WMSA 4IOLA 1KDPA 1XPRA 1P73A 1WA5A 2J59A 3O8BA 2ZEJA 2P5SA 5F2EA 2R6CA 4LC1A 4O2RA 1NLFA 5SZKB 4F91B 2CL0X 3NHAA 4L15A 2VSOA 3LWNA 4MYHA 1OFIA 4M1YA 1E0SA 5LBIA 3BD9A 2X2EA 3ZZUA 4PFSA 2V1XA 1R0XA 1ZUHA 1FL9A 2FPMA 2H5EA 3KUDA 5C2JB 2A78A 1X3SA 4M1OA 1IXSB 2BMJA 2MSEB 3R7WA 5FI1B 2ZRLA 1N6KA 2QSZA 4C0LA 2NO7A 3EXAA 2YV5A 3MMPA 3LW8A 2WSSA 4HDQB 4M21A 1YVDA 1N3BA 4GPTA 1XXHE 1XTIA 4FIDA 4JLPA 4YC7A 1UEJA 4B32A 2C78A 3GJXC 3U3OA 2EFHB 2X8AA 3VR5A 4DWJA 3OIVA 1G8GA 1A2KC 5G41A 1DG1G 4RY2A 4DXAA 5A5GA 4BGDA 4HAVA 1US8B 3DZDA 1QHYA 1E0JA 1XXHA 4DSTA 3B9QA 3W8NA 5AJZA 4RD3A 3QE0A 2I1QA 4B75A 1MH1A 2QQ0A 5DGXA 4F4JA 1C9KA 2VQSA 2FZLA 3PUXA 3VKHA 5JFGA 4NCHA 3K0CC 3SJCA 3KJIA 2XB2A 1ANKA 3CX8A 1RJ9B 3FB4A 1Z2CA 2FEMA 1M6NA 2GBLA 2XXAB 5FPSA 4NBSA 1KI4A 5FUYA 4QHTA 1N5IA 3ZVLA 2KWIA 5KPDA 1I2DA 1JBKA 2QN6A 1UKYA 3K0SA 4Q7KA 2ZI5A 2BOVA 1ZU5A 3IBGA 6Q21A 4AURA 4Z54A 3M6AA 4XD7A 4W5HA 1WXQA 3DHWC 4MRPA 4LBVA 4LJ5A 2AXNA 4ILEA 4YQFA 1XTJA 2J0UA 3LXXA 2GWHA 1T8TA 1DPFA 4EPTA 2IHBA 4Q9LA 5LPNA 1A2BA 1ZD1A 2JJ2A 2RB4A 3FDIA 2DFTA 4M0LA 1KGDA 2D62A 1NMXA 2ZIAA 3F5FA 2WBLC 4TTQA 1OB2A 1KJYA 5FTJA 3GLFB 1KI7A 5DYIA 3T1TA 1JJ7A 1COWD 1N6NA 2LCFA 3DOFA 3ND9A 2IEYA 1G16A 1KAOA 2W6ID 4Q5IA 3FVQA 4XVUA 1J8YF 4LJ6A 4BEJA 3ECCA 4IDHA 1DO2A 1GOTA 3ZGXA 2ATVA 3U7HB 3MGCA 3ZD7A 1OXVA 2BEKA 2BBWA 2EW1A 3RS0A 1KMHB 4QM7A 1P2UA 2XOKA 3VKWA 2CVHA 4PSAA 1NVVQ 1KI8A 2AKAB 2X19A 2D2FA 1KZGB 2P65A 3G0HA 1NMYA 3CX7A 2O5VA 4PXAA 4LYAA 3EPJA 3AF4A 1VYTA 3LLUA 3BFXA 4NYIQ 1X6VA 2BMFA 1GRQA 2QZ4A 3TMKA 3RNLA 3DO6A 2DHRA 2FPLA 3LBNA 4PC2A 4PPQA 1O87A 4CEJB 4N3NA 2OLKA 2ORVA 5DI3B 2J7KA 1TQ6A 4ZKEA 4F92B 2EU8A 4A2QA 5JMTA 4F7WA 4KSCA 1G291 5CB6A 1G7TA 5F98A 4JVLA 2VEDA 3ZJYA 1XEXB 2BWJA 4US0R 2C04A 2CHVA 1E1RD 3TUJC 4CDGA 1ZC4A 2WWWA 2BEJA 2WWGA 3TUIC 3WBKA 2YC4C 4TL6A 3HYRA 1EG7A 4CT4B 2F43A 2W0SA 4ZIRA 5B57C 1I4DD 1NKSA 2EVWX 4BPBA 2BBSA 2EQBA 2DFLA 3AVTA 3T5DA 3Q5EA 2W2TA 3AGQA 4QGFA 1W0KD 2V7QA 3KB2A 3THWA 1Q1ZA 5GJCA 3VX4A 5JJIA 4Q7LA 2RAPA 3IEUA 3VMFA 4QRHA 1N6HA 1VPLA 4LY6A 1G7SA 5GADl 2W0MA 2R44A 1E79A 1E2PA 1J99A 3QQ5A 3ZVRA 4HDCA 3O8RA 1DTSA 1JEDA 721PA 1Q57A 3OEHA 2DPXA 2AKYA 2GJAA 3EAQA 4C9BA 3LXRA 1TPZA 1G4UR 3CNLA 5D3QA 1MABA 4S35A 4QKQA 1CJMA 3GD7A 3WYFA 2AFHE 4ZCIA 4BQSA 4JLVA 2ZVPX 2ANCA 4BZPA 3CX6A 2H92A 2XJ4A 3BXZA 4D6PA 2HCJB 2ZTSA 3KQKA 1LW7A 5BN4A 1NSFA 1ZNWA 4TT3A 1W5TA 3DZ8A 4UNRA 1GSIA 2ZRKA 3A1VA 3NXSA 5K8IA 4Q4AA 3WHKA 4KITB 1FP7A 1P6XA 2OSBA 3EC1A 3WP1B 3HJNA 2QBYA 1Y3AA 1Z0AA 5JRJA 3EX7C 2IUUA 3BBPA 2YOHA 2HF9A 1QHSA 3PR1A 5FI0B 5KTYA 1YZGA 1JQJC 5A4JA 2FWRA 1Q1QA 3QPWA 4G5RA 4DDVA 4DLZA 4Q03A 3KKPA 1ZRHA 3N2EA 2WAXA 2ZYUX 5EP2A 1VYVA 2R9VA 2ZVQX 5HCIA 4II7A 2XGJA 5KSZA 2ZS8A 2PJRA 3ADBA 3CPHA 5FOWA 1JR6A 2CE7A 3QOFA 1P2SA 4MRSA 4UQOA 3ZS9A 2ZRFA 3T06B 5CITA 5AR1A 2ZI4A 2R6FA 1AN0A 1M34E 1Y63A 3BE4A 3G5UA 1D2EA 2EWWA 1SVOA 4LJAA 2JLXA 1UBFA 1NVVR 4TL9A 2PT7A 5LDDC 4GZMA 2NTYC 4R9UC 2RKOA 3U3KA 1NP6A 3OEEA 4MYTA 4TTRA 1DAIA 1KDTA 2EFGA 2QORA 2QMUA 2ERXA 4NYIR 2C77A 5DISB 3AVOA 2XNDA 4ZIRB 3J81k 2G1KA 2QGZA 2CHQA 4PAOA 3HR8A 1A7JA 1PVOA 4XSHA 3TJZA 2FSHA 5IK2A 4RCZA 4IEIA 1X1SA 2O8EB 2QT0A 3WHLA 1OH6A 1EESA 2WSMA 5E3HA 3IBYA 2W6JD 3RS2A 2F3RA 1OH8A 1A5TA 3P26A 3TQCA 2F6RA 1QHHA 1UADA 4HZIA 2KB0A 2CK3D 3SE0A 1T6NA 2QAGA 2C99A 4G5GA 4QXAA 5TB5A 2OBMA 3QXJA 4QNMA 5JHGB 1MABB 4DCNA 1KDOA 1S9HA 3CB4A 1UDXA 1RYFA 4O25A 2O0HA 4XOIA 3BK7A 3AUYA 4TN1A 4GZLA 1RVDA 1GRNA 2ZQ5A 4CIDA 4PC3A 2HUPA 3IUYA 1XD8A 4JLJA 4TQAA 1MOZA 5CLQA 1CBUA 2IYVA 4A2WA 2HYDA 1B0UA 3KKOA 5EP1A 4IW3B 4V0KA 3AKDA 1UBEA 2GILA 4A8JA 2ONJA 2O8BB 2D7CA 1T8UA 3Q5DA 3SDZA 2WPDD 4EJSB 4YDSA 1GZSA 4JT4A 1R5NA 3O47A 3EIHA 4FMBB 5AJXA 4LYHA 1FQJA 1FTNA 4QJ4A 4RJLA 4TTPA 1S96A 5FOTA 4HUTA 4B43A 4MRVA 5K8UA 1NIPA 1KK2A 4AG6A 2WKRA 3HR7A 2HXYA 4BFUA 1I4TD 1RFLA 2ANBA 3DL0A 5CLLA 2IYYA 2VBCA 5FL7D 2N46A 1E9BA 2RGBA 4YONB 2ZYTX 1RE0A 4DEYA 2WJJA 1X1RA 3PJRA 1D5CA 3Q85A 2Z4SA 5FUWA 3CONA 2A5YB 1J7KA 3ASZA 1YU9A 5DNYB 1UKVY 4JKIA 1XWIA 1Z0FA 2IL1A 4PAQA 3EIEA 2CVFA 4IJMA 2JLVA 1ELOA 2PJZA 4HLUC 2CJWA 4US1R 3GLIE 2YOGA 2OHFA 1D2NA 2FJUA 2IUTA 5BQ5A 4QBFA 3KTAA 1Z6AA 3A36A 5AJYA 1FX0B 3I73A 1T4GA 2IEZA 4DUGA 3CF2A 4F38A 5HE8A 2QA5A 5H1YA 5TV2A 2N1BA 5BN5A 2D2EA 3QEOA 3IQXA 2NQ2C 3ASYA 4Q4HB 4BFVA 4KI0A 4DC9A 1E0KA 2HEIA 4DIDA 4DCVA 5KNBA 3GLIA 3NVAA 4HLDA 1KI3A 4PTLA 4NCKA 3AB3A 5DH9A 4PR0A 1AQYA 2PEZA 4FMDB 2FSFA 3QG5A 1XP8A 4A92A 5L3SB 5HR5A 5KNDA 2AHOA 2ZRIA 4EPVA 2IHYA 4G01B 3AVXA 2J0VA 2JGNA 4IDQA 3E2IA 1EFTA 1P61B 2Z0MA 4MGIR 1WE2A 2OCYC 4R2HA 1F6BA 4JSYA 2DBYA 5AWFC 4B76A 5EZ6B 4YLGA 3LO5A 4B73A 3BB3A 3Q7QA 2B7BA 5E7IA 1ZC3A 4B35A 4TMVA 3OE7A 4DLYA 4QFMA 4JSTA 2EYQA 2IYZA 1W4BA 3CF0A 1LY1A 3EPLA 3KXKA 4TLAA 2CNWA 2FFAA 2X77A 2ZE5A 1P75A 4KBFA 1TF5A 4KLZA 2L0XA 3DMDA 4LX0A 2FF7A 4GDFA 1GG2A 2FA9A 1O3YA 1WBDA 3FMFA 2RGCA 4JLOA 4AKGA 1YQTA 2W00A 2FEOA 2FU5C 1NJGA 4RD1A 1CLUA 2R6GA 3C4JA 3OHMA 3KL4A 1I4LD 1IOZA 2P3SA 4TL8A 4URYR 5K8TA 4S2EA 1V43A 4Z1MD 3L43A 3SU8A 4B34A 1UFQA 3RWOA 2CXXA 4OQMA 1KYIA 2ZRMA 3I61A 4Q19A 4MDEA 2ZU6A 3I1FA 1UM8A 2CLDX 3E5HA 4QJ3A 3KXLA 4DLXA 2GF9A 3EW9A 3CRQA 3W3ZB 1TMKA 4JJKA 1P9NA 5G40A 2G0TA 1OIWA 1OH7A 2BBTA 1Q0UA 2ZSAA 3PFIA 4Q1FA 4AG5A 4WZBE 4ARZA 3CPJB 4OHYA 4TMKA 1ZM3A 2A5FA 3QVVA 1CS4C 3A6PC 1W5SA 2GCOB 1Q1EA 4O0MA 4Q66C 5AUPB 1E2IA 2GJ8A 4CW7A 3K0EA 4I81A 5EXPA 4PAMA 1E9CA 4TYWA 4ZPXA 2OFWA 4DRZA 3QBTA 2FGJA 1OYYA 1R10A 1ESMA 4E22A 5EE5B 2FX3A 1W36B 1Q3TA 4AI6A 1QHNA 3NBFA 4OHVA 2GF0A 1OV4A 2BKUA 2FMXA 4QG7A 4CEHB 3PIRA 2AXPA 1DEKA 4YMUA 3RSLA 1S0UA 3W34A 2RGNC 1M8PA 2PL3A 2VF7A 5FUVA 2CBZA 4C30A 4BRUA 4DHEA 2PH1A 4XVQA 2WV9A 5IF9A 2C2HA 4PQYA 4JBYA 1SXJD 3B6EA 4TYQA 1E9RA 2QTHA 3KX2A 4PZYA 4V0OA 3DMNA 2CLSA 5KSYA 3L2OB 1E2FA 2D3WA 1XF9A 2YZ2A 3AKCA 4RKEA 4YDHB 4ESVA 4V0LA 1IXZA 2OCBA 1U81A 3OF5A 2IWRA 1N0WA 1KO4A 4NYJQ 3CNOA 3P20A 1W47A 2DCUA 2F7SA 2G83A 1G20E 4QBIA 1IY1A 1HH4A 4D4JA 2OM2A 1Q20A 1G8HA 3KZ1E 1P60A 2X2FA 4YXWD 1NVXQ 4DCSA 5L8VA 1ZCAA 1G8PA 1KK0A 1KI9A 1G17A 2A5JA 1IN6A 3HU2A 5JI3E 3U4QA 3REGA 4DT1B 1Z08A 4Y0VA 3NDBB 1M7HA 4EPRA 4NKRA 1E96A 4QGHA 4P32A 1F2UB 2RGDA 3PVSA 1ZNXA 2PCJA 5EXXA 3FTQA 4LYJA 1G64A 4PC7A 2EYUA 1XTKA 1KSHA 3DDCA 3VTKA 3W6OA 1CR4A 1XMJA 1JR3D 2G88A 2IXEA 4MGKR 5TMPA 3ND8A 1II9A 2ZUDA 2C96A 2GHIA 2WIBA 1YE8A 2GK7A 3HPQA 1VTKA 1IQPA 4M22A 1COWA 2ZI9A 4NTZA 4W5JA 2W6IA 4A6XA 1YR8A 1JAIA 3IPYA 4FXPA 1NJFA 1VMAA 4GT1A 4OI1A 2WOOA 2OT3B 2QNRA 4W5WA 3CZQA 1DARA 3FHTA 3VQTA 2PLFA 4EAQA 3QXXA 1NMZA 5KUTA 1MRNA 2D74A 4LC0A 2G0NA 4I4LA 1K5GA 4HB3A 4DB2A 2BJWA 1UEIA 1E2EA 4L4UA 1W48A 2ZM5A 3M4YA 2VPPA 1RYHA 3RABA 3CWZA 2J1LA 1U9IA 2WJIA 3WY9A 4EFNA 4C7OA 2V3CC 1MO3A 1AM4D 2ZR9A 4JBWA 4DKXA 1KO5A 1MKYA 3NHBA 3B1YA 5G53C 3CW2A 4Q01A 2RMKA 1U8AA 1R7RA 4R2IA 2CHGA 3P1JA 4QJ5A 1X86B 5JBQA 3C41J 3W8RA 1GRRA 3UXMA 5B64A 2UKDA 2WM9B 4QGGA 1US8A 1OIXA 4GRAA 2W58A 1Z6YA 2A2ZA 4KXFB 4XIGS 3ZZTA 1LF5A 4HDOB 4JLBA 1CR0A 1RZ3A 1N25A 3U60B 4BRWA 3EASA 2B21A 1GKIA 3TNFA 5TDHA 3CR7A 3PCRB 1OKKD 1AK2A 3K0FB 4C2TA 3IO3A 2DB3A 221PA 3U6KA 3GLGB 1RJ9A 4DBLC 1KKLA 1VHTA 5FR2A 3MG9A 2DWOA 4L16A 1E2HA 2PZGA 1YR7A 2VHCA 3RS4A 2XXAA 4POAA 1OW3B 4OQLA 4ITRC 1NG1A 2FE4A 4M1KA 3U4QB 2WMOB 3FWYA 4JKYA 4HUQA 4NYJR 3H86A 1B23P 2ODWA 4NP6A 1E9SA 5DYGA 1QZXA 2BJVA 2J3EA 4I1VA 2QAGC 4IDOA 1U8YA 4RFSA 4Y0AA 5G3ZA 2F1HA 3W5IA 3GLFE 2RHMA 2G6BA 2YNMA 1G6OA 2JLQA 4MKIA 2WOJA 3GJ3A 3K9HA 1V5WA 5B2ZA 1T5IA 1K8RA 1AS3A 1BYIA 1IY0A 2XZOA 3UATA 1ZM2A 1GILA 1OXUA 4EIWA 5C18A 1TEVA 2YVUA 3GCGA 4UNQA 2JJ8A 5F9HA 1NKTA 2OXCA 3GLFA 4NYMQ 2JASA 2NZJA 2QY9A 3MWYW 4M1WA 2HYIC 1DVRA 3D8BA 3MAAC 4KVAA 1MO4A 3AVWA 3DKPA 1QHXA 4CGZA 4UKDA 5EUMA 3AM1A 1OJLA 2IT1A 2F9MA 4HAWA 5FTKA 1AKYA 1T0HB 4M9XA 4BEBA 4OQFA 1KMHA 1ZNZA 5E95A 4Z8XA 4BLOA 4LHWA 3BFVA 4PHGA 4BFTA 4ERNA 3K09A 2IXGA 3PEVA 5B30A 4C7OB 1YRAA 1E1QD 1M1YE 3V9PA 4CT5A 4YMVA 1FW6A 4R71A 4JLMA 1IN8A 2QPOA 3ZIAD 1GL9B 1DAFA 2JDIA 4DLTA 2GJ9A 2ZRCA 3QXHA 5AJVB 4GP6A 2OBLA 4PQRA 2WVJA 5H8WA 4PPGA 1Z6XA 5ANRB 3RRYA 4CEJA 3QNUA 3ZVMA 5DI3A 2ZE8A 2OBNA 4EFLA 4MKFA 5CYPA 2VL7A 3TH5A 1R2QA 3PUZA 3X2SA 1XEXA 4BLRA 1YJ5A 3QF4B 2A3RA 4ZO4A 1ZW6A 1WF3A 3JZAA 2NIPA 1T9HA 2QRNA 3R20A 1PUJA 1NY6A 3PUWA 2V4ZA 2VP5A 2E87A 3QY0A 5KU1A 1N6LA 2MSCB 1TF7A 4W7SA 4WZAE 5CM9C 2QTFA 4C0QC 1TADA 4AD8A 1FUUA 3MWJA 1Z06A 2FFBA 1C4OA 2W6JA 1MV5A 3LNCA 4KODA 4AKIA 5CB8A 3CPEA 1KIMA 1S3SA 2ATXA 2ZSDA 3H0KA 3N70A 1HUQA 1TU3A 2C9OA 4JVSB 4RD4A 3ZQ6A 4TYYA 4HUQB 1KJZA 2MSDB 3A1WA 4XWAA 3C15C 3I72A 5FBRB 3ZH9B 3LW7A 1FMLA 2CK3A 3QXCA 2KBEA 1NN1A 1XJCA 4RFSB 3NEYA 3SC3A 521PA 2OO7A 1WBBA 4X8LA 2J0SA 4XJXA 1KJWA 1TAGA 4B6EA 1XBTA 4A15A 4JLAA 1VCMA 3WBJA 1W4CA 3BAFA 4LPSA 1FFHA 2QP9X 2VYFA 2ZR0A 4E03A 2BMEA 4BLSA 1VECA 5JZVA 2MMGA 2QAJA 1CJVC 3HDTA 3RC3A 1G5RA 2ZJYA 3I92A 4N1AA 1KAGA 4XVRA 4DIEA 3ZQJA 1E6CA 2WPDA 4WA7A 3QI2A 4P0TA 2AX4A 4PANA 5E7MA 2FFQA 5JSZB 3KKNA 3DOEA 1GL7A 4X8HA 5FTNA 4C0KA 3CKLA 1EGAA 2ZRNA 4QBHA 4KFTA 1N6IA 4NYMR 1JI0A 4OI2A 1G41A 3VFDA 1G1MA 4Q1EA 4A0GA 1YHNA 4KLNA 3VU9B 3RHFA 4KFRA 3OIUA 5FL7A 5LD2C 4B3BA 4HAZA 4M1MA 2CLCX 3L0PA 3T12A 3H2YA 1HV8A 4NCIA 1A82A 2OCAA 1E69A 1H8HD 3WYGA 1TNDA 2HDNB 3SNHA 2LKCA 1SVMA 4ACAA 3IO5A 5GVRA 1S3GA 2ZR7A 1EK0A 5LB4A 3K70C 1A1VA 4MGYR 2NOAA 4K81B 4NL4H 2VRWA 4TMZA 4LHYA 1G21E 3LBHA 2ASEA 5JWOA 1KI2A 1XB2A 1Z28A 1Z07A 3N5CA 4CZ2A 2GJSA 4D80A 1OHHD 2GVDC 1W0JD 3NG1A 1NL3A 2IF0A 1SVWA 4XTRA 3UK6A 5KYKA 1NI3A 3EZ2A 1DOAA 2O8EA 1HYQA 2IK8A 2C95A 5DHAA 5TXGA 3LA6A 1VCOA 3QPUA 2AK3A 3OIWA 1GVNB 1TQDA 3FMIA 2QM8A 3C5CA 2GXUA 3AUXA 3L0IB 4ZDKA 3R8FA 4PQFA 4G5QA 3A1SA 2XTNA 4JT2A 1D6JA 3NC1C 2C9YA 1RPZA 1KY2A 2A9KA 3N2IA 2NPIA 2Q21A 2QPAA 4PHFA 4Q18A 2I3BA 4BLQA 4IOKA 3U44B 2JLRA 2FG5A 5G3YA 2PEYA 1PZNA 2OESA 4HLQB 1S2MA 3RDPA 3X1WA 1D2MA 1DBSA 4XH9B 5HE9A 4A4DA 1KI6B 3Q8XB 4IXMA 4JYCA 4ZDIA 4GOJA 1NRJB 2V6JA 1QG4A 1AA9A 1E2DA 4MRNA 2WHXA 1W4AA 1SKQA 4BASA 1P7CA 2BVNA 3TQFA 1AGRA 2O8BA 2O0KA 1XTSA 4WXRA 2NO6A 1XDBA 1NN0A 2ZI7A 4IVRA 3TAUA 3M1IA 1E2NA 4EJSA 1XD2B 4Q02A 2PZEA 4Z1MA 1DE0A 3IPXA 5DSZA 4URZR 2PX0A 2GXSA 1XEWX 3RS7A 1E2KA 5BXQC 3DM9B 2GEUA 1E9EA 3A8TA 5J4HA 1ZIOA 4B47A 4Q9HA 3V4RA 2RGAA 2VP9A 2ZUBA 1P5ZB 1MRSA 1WQ1R 1SQ5A 5DHFA 2Q3MA 3SJZA 4LJ8A 1PLKA 3QKRB 4YMWA 1CJTC 3BS4A 4BLPA 2AK2A 4NCJA 4B3CA 2P6RA 5EXSA 4D4LA 1SZPA 4M53A 2ZRDA 4UXIA 1U0JA 4BZXA 1AKEA 4M9ZA 2WWHA 1NG9A 4KYIB 2JEOA 3FE2A 1CULC 2J46A 3AQ4A 2HCBA 4LI0A 3H1TA 5FR1A 4F93B 1KO1A 1ZP6A 2BBOA 4TL7A 2B92A 4GMXA 5SZIA 1IM2A 2VSFA 2OZEA 1T0JB 4B71A 1FX0A 1EWRA 3TRFA 3SJBA 4DDUA 3O8DA 1U8ZA 3EG5A 3SBEA 5GJWC 1U9IC 4Q4HA 3U3MA 3AKEA 1K6MA 3QF7A 2GZAA 3CNNA 2D06A 3TVDA 1Q21A 4B2PA 1GL6A 621PA 5JCPA 1OIVA 1RKBA 2ZRHA 5L3SA 3ADCA 4D26A 1E2JA 4KSBA 3L82B 5JWRA 3OIYA 3BH6A 2A7QA 1VYUA 3C5HA 2KJQA 3QBVA 1VCNA 1JB1A 2AD5A 2VHQA 4PC1A 1LNZA 5HPYB 1S1MA 2VHUA 5EE1A 3RC8A 2HLDD 4DSUA 3TBKA 2Q9AA 5JI2E 4NMMA 3AVQA 4Q4LA 4N0DA 1KOFA 3L8ZA 3SZRA 2C03A 2ZRGA 3E1SA 3TVTA 3SS8A 4B3DA 5L3QB 4HAXA 3T1VA 1QVAA 1G3IA 4FMCF 5FPTA 3OESA 4WAUA 4XWOA 1CTQA 4IDNA 1P2TA 1C1YA 4TMTA 2PMDA 2XEXA 4OQXA 2HV8A 3SYLA 5JECA 1R0YA 2CEAA 1FUKA 1VHLA 3LVRE 1G18A 3Q3JB 4YXWA 1PLJA 5JEDA 5L3VA 3MCAA 4RD2A 1BMFD 1YR9A 4LBZA 1DG3A 1HQCA 1JR3E 1LF0A 3X1YA 2GZDA 1PLLA 4WOPA 2AWNA 1KZ7B 1UKZA 2XSZD 5DLQC 3BFKA 1OH5A 1Q3HA 4QL3A 1J70A 1OE0A 2O8CB 1GIAA 3VHXA 1XNJA 3IKJA 4LSGA 1JR3A 1QRAA 1T3SA 3PV0A 2GAOA 2Q6TA 3TAHA 2JLSA 4WW0A 4B48A 2V55B 3W90A 3NWJA 3U2QA 1Z22A 4OI4A 1U2RA 1E0AA 2ZANA 5UKDA 4G1UC 2OG2A 3AF3A 4DCTA 3EA0A 2GCOA 5B58C 3SQWA 4LDJA 1VDZA 3B7GA 1ZBDA 5JRZA 1GITA 3IEVA 1ZMXA 1XPOA 3DEFA 3VX3A 1RRCA 1OXTA 1CP2A 4TLCA 3AVUA 2JAQA 5EE3A 4EPWA 2GEDA 1VG0B 3EZ7A 3K9NA 4G0NA 1FPMA 1S4QA 4MYCA 3REFA 4PO1A 4LPKA 4CEHA 5JJLA 4AKHA 5SZJA 3D3QA 3PUVA 3WRYC 3U3JA 1NBME 3ZZ0A 3SHFA 2QMHA 4EFMA 121PA 1XX6A 3JVVA 5JWHA 4EQ6B 1QG2A 4RD0A 1OFUX 5KPJA 3LV8A 4C2UA 4TSFA 1T91A 4LV6A 1SXJB 3K0CA 4DEXA 5F3WB 1XZQA 1BIFA 4URVR 1KO7A 2P5TB 1HTWA 4LWZA 5CK5A 4DLUA 3A37A 3Q7PA 1NBMA 4EPXA 5BYJA 1Z3IX 4P4SA 2RGXA 2V7QD 3DM5A 3NBXX 2C98A 4ZV4A 4A6PA 2BHRA 2R65A 2VLIA 4OK3A 2QP4A 4L5BA 2WICA 4GP7A 3ZS8A 3PG5A 4FWTA 2WZQA 3CM0A 5TARA 4ON9A 4M4SA 1HEIA 2J5XA 3QENA 1IN4A 1CXZA 1JXMA 3GMTA 3CIOA 1P9RA 2GBLC 1KNXA 3ICQB 5CJPA 1UBGA 4TQUS 1LFDB 3AVPA 1FNNA 1YZLA 3FMPB 4NCNA 3SHWA 4G5SA 3GLHB 1IY2A 2EFDB 4TYPA 4MRRA 1DAGA 4DT1A 2YWFA 3MWLA 3TKLA 5EJEA 3R9XA 4NPHA 4Q47A 5FTMA 1F2UA 4BZQA 2QTVB 1CKEA 2WTUA 2E9SA 2QMEA 2RH5A 3SFZA 2YYZA 3C14C 1NN3A 3U7GA 1J90A 4UXHA 5FPKA 2H16A 2BC9A 5FBWB 1XEWY 4V03A 1X8LA 3DVLA 3I8XA 1UAAA 1EFUA 2WMNB 1R5OA 3T5GA 3TW8B 1H65A 4Q1BA 2ZRJA 2AFIE 1EFRD 1KHTA 1YZNA 4EDHA 4F4CA 2UVQA 2NMVA 3P27A 3QUSA 3CRMA 1I2MA 5FH9A 3LY5A 2XZLA 4LGMA 3OFND 2VP4A 2LWIA 4W9MC 2JLWA 4UNNA 3ADDA 2ORWA 5GJVC 3RSOA 4QNRA 5AK0A 3QXSA 5CK4A 5J40A 1TTTA 1E1QA 1XTQA 3W6NA 2FNAA 2FSIA 2OE2A 3C7KA 3ZIAA 2IYQA 1G4AE 1GAJA 2KSQA 3B78A 3GFOA 5EP4A 4IOJA 1HE8B 2QPTA 1IJEA 2CDNA 2FPKA 2FV8A 3BGWA 4GMDA 4HZUB 4B33A 2JIZD 2NPFA 2CCJA 5HTKA 1QF9A 2V6IA 2XNDD 4AYWA 3A4LA 3F3YA 1H8ED 1EX7A 1G5TA 1CR2A 3LD9A 3B13B 4A9AA 4BWYA 4IXNA 4DSOA 2ZUCA 5KDOA 4P4SB 1NN5A 2YC2C 1ZINA 3GLGE 2EFEB 3GFTA 1SGWA 2QE7D 3Q9LA 4D2IA 4OI0A 1S8FA 3RWMB 4OHWA 3AEZA 2PBRA 1M2OB 1AZTA 1E2LA 2F9LA 3F0TA 4M8NE 4ASUD 5C46F 4JMPA 1DAMA 2VHTA 3K0FA 2SHKA 2ZPTX 4JL6A 4DB4A 3GLGA 1KTVA 4PPFA 2V54A 5D3MB 4ZI2A 5KDDA 1OLOA 4D81A 4IRUB 3L8YA 1F2TB 3C16C 1PV4A 4IDPA 2DY1A 3RRNA
chains in the Genus database with same CATH superfamily
1WCYA 2D1RA 2RGGA 3BORA 3LU1A 4WT7A 3VDXA 1QV7A 2O8FA 4GR4A 3KIPA 1HT3A 3IV7A 5KOJB 1GLVA 3F9RA 4QOJA 5KYWB 1JX6A 3NETA 2B5VA 3JASA 4KFSA 4MUEA 4Q9IA 4C6TA 1PEKE 1PJRA 3C8ZA 3GLQA 1Q5PA 1W52X 4BUJA 2JGDA 5AVJA 3K0AB 3T9AA 2G04A 3TLEA 3LBIA 4QTZA 2IHTA 1IONA 4M0DA 2I0FA 3HU5A 3TIIA 2PUGA 3MILA 4D9GA 5KVAA 2G36A 4JOQA 3EVBA 1RWBA 2GD2A 1QP0A 4MMYB 5HP4A 4ZO8A 1T34A 4KGZA 1GXSA 1E2GA 1JEEA 1SBNE 2ZIWB 1R6TA 5A0TA 4LG1A 1O0BA 1RVV1 4RTLA 5T4FA 5FL3A 2VQFB 3OC6A 2H07A 4DR5B 1A04A 3EZ9A 1UBRS 4ZGGA 4G5OA 4FCVA 3ELYA 1MZVA 4QUEA 5LXTF 2RHHA 1G19A 4C2BA 2CZQA 2RI0A 5KQMA 4ZFNA 4PO9A 5DV9A 3DLTA 1Q95A 1GCAA 4QQNA 3EG9B 2OENG 1CEXA 5E6SA 3CNQS 3ZXUB 2GLXA 3QOWA 5HUJA 2WILA 1NW9B 3ELUA 4S0XA 4HN2A 3RW9A 4B2LA 1JHAA 4D0NA 4WXPA 1NV8A 1C3VA 4JJ7A 5IZCC 3LVFO 1YL6A 2A35A 3CH4B 4KRGA 4G63A 4UHKA 1E9DA 2VVTA 3UGJA 3EFEA 2AF3C 2O20A 4X1KB 3BDAA 3V7YA 3H2ZA 2IEIA 1PEAA 5BSHA 2O57A 1C41A 2Y9MB 1E94E 1FRFS 3B7WA 4E1AA 4CCYB 1UQRA 2FPIB 3MQFA 1YL7A 1NHGA 5D85A 2AX3A 2J7PD 1F4LA 3U7FB 3VR4A 4JL8A 5HQTA 1X70A 5CB0A 2VDQB 5K01A 4WFQA 2CZGA 2J9FB 4G9BA 3NW9A 4ZMBA 2H6EA 1O77A 4HAUA 1BDBA 2XZDA 2POCA 4OHXA 4ROSA 4AJPA 1YBVA 2HJWA 4JN6B 4ENSA 1WHTA 3DAYA 4MQFA 4P8RA 2GNPA 5BN3B 3CVUA 2C7PA 3AG6A 3QFHA 2EARA 1K92A 3KFVA 4X63A 1ZAYA 2OUKA 5IN5A 4GNKA 5KKCA 2F1IA 2P2GA 3MOGA 4DV5B 1LH0A 4Q05A 4HLCA 5E4FA 2ZI6A 4UEKA 3RS5A 2IP1A 3L7LA 1E4EB 1F06A 1ULAA 5KTPA 3WX0A 1P7VA 5AHWA 3X1MA 3HYLA 3LVQE 5I7RA 3EWSA 3HN6A 4RSHA 3ZOKA 3B3GA 1DTWB 1N2CA 4J4BA 1HRKA 1ZITA 3ER6A 4TLDA 2PLAA 1ZYUA 4XDGA 5JS8A 4RK1A 2Q27A 5AW8A 3HVRA 3PJEA 2D5BA 5DOVA 3D1LA 5IF3A 1F6DA 5AIAA 4NHOA 1LZKA 1M5UA 1WKBA 1EFCA 1HE2A 2OAP1 3WK9A 1X3LA 3N74A 2DXIA 1Y8RB 3SM9A 5KNCD 2A58A 1TF2A 1FVXA 1TMYA 1KARA 3OTGA 2H5IA 4JJEA 4KPEC 1IBKB 5DULA 3W9YA 2EXXA 2CDBA 1T0IA 3U9TA 3WYCA 3QOYA 4A27A 3BFJA 1JG3A 5JNVA 2FSSA 2EBFX 2P9GA 4XCXA 3SSOA 5FBLB 1SHZA 2KLBA 3TGPA 4K6KA 1JSXA 4BC0A 4CQMA 5IVHA 4U00A 1LWOA 2FPGB 1DBQA 3IB3A 3LUGA 3MF4A 4MV8A 4W6ZA 1M2VA 1FRZA 1P39A 1ZOLA 3NRJA 3X1DA 3TB4A 3LOUA 3UMGA 1GHTA 2H5JA 3OLWA 4JLDA 1BOFA 3PWTA 4WINA 2AG1A 1A8QA 2DPLA 4B0OA 5DBHX 3U16A 1CR1A 2G76A 4D3SA 4IO1A 4RFLA 1JFSA 2YIVX 3HDQA 4J2OA 1KYYA 4PVCA 3LC7O 4LECA 5FAKA 1OZFA 1TA9A 2A3NA 1ZK3A 3CEHA 4JNKA 3WTCA 3ETGA 5CFZA 2IPNA 3LH5A 3K2QA 4YJ3A 1Z83A 1BKDR 5DNEA 1J97A 3RSGA 2P9QA 3LIIA 3L02A 3WJ2A 4E2YA 1U98A 1R74A 3G6KA 5REQB 1F5SA 1D2GA 4OHCA 1YZQA 3AJEA 1KMQA 2NWQA 5DE3A 5DI9A 5ELLA 3WJAA 2F8MA 1BVRA 2ZWVA 3G13A 4PLWA 1HLGA 1QRRA 2HU8A 3UGQA 1Q3KA 3SX2A 7MHTA 3AI3A 4GI3A 4M98A 3U4AA 3CT6A 4R9RA 1YF3A 1BOOA 1NXXA 1KP9A 3DE7X 4H3HB 4CF3A 4H1VA 4R8LA 4G56A 4O1MA 4BFWA 2AIRA 2FH5B 2PUJA 4L6IA 5I8PA 1Z47A 2P9TA 1U94A 3O2NA 4Z9AA 3DDWA 3PHBE 5EQDA 4JYBA 2ASVA 1IBCA 3H84A 5IVDA 3D5QA 4QC2A 3L0DA 1QH9A 4FR5A 4I50F 5EJIA 3HUUA 2Q0QA 3WLPA 3HXLA 4PBSA 4CM7A 5F73A 1BS1A 4P4TA 3E9ZA 5IKXA 2H7CA 1IXKA 4P08A 1TJ3A 2AD1A 5FUXA 1Z38A 1FRNA 4BOYA 1DAOA 1B74A 3KD2A 1T5SA 4PG5A 1E6EA 2ZYWX 5J5CA 2IYXA 4OXRA 1DC4A 2WB4A 2B20A 2WD7B 4N01A 5HZHA 2REOA 4DV3B 1SHUX 5GGYA 1F7VA 5F4ZA 3UQZA 1QHIA 3KPUA 3WGIA 4RENA 1I4EB 3WSTA 4ZZIA 1DUIA 2VIIA 3IEKA 3SLGA 3ZLUA 3UWPA 2ATEA 2Z4RA 1H3EA 2Z08A 1FUEA 4FYVA 1B14A 4G4IA 2NGRA 4GRIA 4EWLA 1BO6A 4H6XA 4MVCA 1K06A 2J3QA 1L8AA 1NQTA 2YINC 3HO8A 3NAGA 1F9EA 2R97A 2GBGA 2D13A 4Z8YA 3PHJA 3MCWA 1SB9A 3QVWA 5ALVA 3RUCA 1MD9A 1N1EA 2P40A 1QQTA 1JR2A 3L40A 1N2HA 4I6JA 3TBHA 4TS9A 1WNTA 2P2SA 3EOBI 1GPWB 5GPBA 3ND7A 4MPTA 2D8MA 3D6HA 1A76A 2NSJA 2ZJ8A 1X9HA 3DE4X 1XK7A 4INAA 4OGKA 1GTG1 3W5SA 2XHEA 5FDFA 3CVYA 1VG9B 2YOFA 3STTA 3I2JA 4EECA 4EHAA 4PGHA 1POXA 3E23A 3RUHA 5FBQB 5TPWB 5LYJF 3DGFC 1U6IA 1YZUA 5GWXA 5U9CA 1ZLXA 4ESEA 3WK6A 2HFJA 2YY6A 3LY7A 4MUNA 4B3FX 4C4TA 4C89A 3R0IA 3MTQA 5EJ7A 3RVBA 1G63A 5K3DA 1WPGA 3P5BA 4MV3A 1TUIA 1O08A 1C3OA 3JAKA 5G0VA 1G8JA 4Z4CA 3EEQA 2X2PA 4E7PA 3B51X 2WQ6A 3V9AA 4MP8A 1RLIA 1XJ0A 1OFUA 4Q24A 2V03A 3I3SR 4OJKA 2XYHA 4X3CA 3SQLA 3ETLA 1Z7YA 1UFOA 2FN8A 3Q8WA 1Y1KE 3V1MA 5F51A 2CDAA 1IM8A 1ORVA 2GLTA 2I33A 2MR5A 3PXEA 4OH1A 2QLFA 1H2XA 2UYHA 1H2EA 1K5DA 1RPJA 1ORRA 4PZEA 2C5EA 2GN1A 1HK7A 1MV8A 2Q3LA 4RKYA 3WTBA 4EFKA 1K7CA 1W4ZA 2ZIZA 4P0QB 3BERA 2YJTD 3KWJA 4D0GA 1LW6E 4DJTA 3H1FA 1AB6A 1JMVA 4NULA 3WGLA 1DKOA 4C6TB 4WBSA 3IKTA 3K9LA 1WX1A 2IBMA 3PZRA 4DDWA 3M8KA 4QDJA 2VJBA 3PRHA 3UB3A 3IFSA 4PBTA 4LFAB 1BDMA 4O4JF 1IB6A 3ZVKA 3FGZA 4GOXA 3WP0A 4A0FA 5B6IA 3QMVA 4OJQA 3AY6A 5DYWA 4EI7A 5IJZA 1AG9A 5JXIA 3HJBA 1TCVA 3WSVA 1U8CB 1UMBB 4C0JA 3CYFA 3WV4A 1CQIB 1FBTA 1U6JA 4LZZA 3WL6A 3IP3A 4Y18A 1L5VA 3C48A 4XLZA 2MINA 5J2UA 4S1NA 3MEQA 3QY9A 5HCNA 4AC9A 3CCBA 4EHJA 2ATIA 4IHQA 2QN3A 1AD2A 4QPPA 3G9UA 6PFKA 2RJ3A 4MUYA 1CF9A 3EZFA 3LKVA 3H2JA 5DTRA 1MIOA 2E4WA 4GZ5A 1F4PA 3OLQA 4HNRA 4ZQEA 1PEYA 4XA8A 4DSZA 4KDEA 3U17A 3WGOA 5ABPA 1ZVQA 5DN6D 1MBZA 4PRKA 4I4CA 3SZMA 1PGJA 3SX4A 1FYXA 2OCGA 1F8GA 3AKYA 4JFAA 4ZCLA 5LP6B 1JLRA 3K9BA 2ZE6A 4RVCA 3TQSA 3OPQA 4DA4A 1VOTA 2QG4A 1O5TA 2GCNA 2NSLA 2PGJA 2Q6KA 1GYQA 3OCCA 5ADUS 2HK9A 1FNSA 3OM1A 4Z0PA 2MSWA 3AGPA 3KJGA 1K7FB 4LK2A 1DO8A 2AJLI 2VHJA 4D8WA 1N36B 2QRUA 4OJTA 1QOPB 4RJJA 3LHFA 3EDYA 3ZD6A 2E2WA 2O8CA 1KOGA 2R47A 4N6OA 1TM7E 1JHRA 1AIPA 3COVA 4CG0A 4KHPB 4LGYA 2W6QA 4AJHA 4ZTZB 3A27A 2ZBVA 1JSLA 2VCYA 4DCUA 1GGJA 2VAPA 3KDSE 3LPLA 4YP9A 4PO3X 1T3LA 4NQRA 4MCAA 4XGNA 4EJ6A 4DDKA 3CBGA 4I46A 1JNYA 2TMYA 4UNPA 1AV7A 1YVUA 2ZYSA 3UWKA 5C7YA 4WK0B 1TGVA 3OIGA 3HNOA 3PQFA 2GWRA 4YI3A 4ENWA 5E38A 4F4IA 3H0CA 4F0JA 2ZTMA 4ZOLA 1B8UA 2A86A 1TL7C 2CC2A 2VNKA 3KUXA 4CLRB 4DUZB 1PT9A 4XFDA 1SUFA 2C3MA 3VR5H 2P2ZA 3CO5A 3MD0A 3M9WA 3SZ3A 3AESA 4KQEA 3FNEA 1PJZA 3W4JA 1CF4A 3QLJA 4U0JA 3JX9A 2WZDA 2CY0A 2PLRA 3SKYA 4YCSA 3AXSA 3VVLA 2JH9A 3NANA 5FBZA 5FPHA 3KQLA 1B6TA 1RSZA 4R1UA 3MELA 3CVVA 1TUEA 3E8SA 1SC1A 4P31A 2F3PA 3CRNA 4H08A 2IS2A 1AS2A 1YU6A 1NT2A 1Y4ZA 4QJIA 4PSKA 1Z62A 1BROA 5EERA 1YI1A 1LPAB 3FOZA 1W87A 4MCIA 4AKHA 3DOIA 2GO1A 5DYYA 1NVUQ 1M2HA 1H8EA 2XMZA 1MVNA 2A0WA 3OU2A 4JDUA 3RRMA 4KJZA 1KWKA 1RXVA 3IIMA 3ENZA 2NV0A 4K3VA 2ZUSA 4MJXA 4V3BA 1O94D 4L4SA 2ZGVA 1NU6A 3EH1A 3B7PA 3THWB 2EIXA 2C9CA 1WJGA 3MHTA 4IUCS 2QE7A 3KR0A 3QG1A 1NUSA 1J8VA 5IM5A 2FQ1A 1ZD8A 4D6YA 2EHJA 3AVYA 2C3PA 2ISQA 2MTBA 3H4VA 3E9RA 4O3MA 2XMDA 2ZJ0A 3FG9A 3ITEA 4JQYA 1KAQA 1TYDE 3O73A 4IY1A 4FI3F 5EQTA 5IMBA 4WECA 1WD7A 2OM6A 3INYA 4OMUA 2ODTX 3T5BA 3QVLA 3G49A 1U1DA 2QRGA 4S1PA 1JP7A 4JI1B 4B7AA 5CHYA 3F3SA 4NOLA 2WHPB 5D1HA 4G67A 3RC9A 5JADA 1CUUA 1VKNA 1X74A 3LT1A 4MS3B 3ZI0A 1DAHA 1D6SA 1GZVA 3VI4B 2ZSEA 3T61A 2ZCJA 4DTCA 1YTUA 1O2DA 1PG0A 2X13A 4ESHA 1AE1A 1BYUA 4F1WA 2ZUTA 3U48A 4KO8A 3REOA 2Q7DA 4Q4AB 2LRHA 3DPSA 3HV2A 3DDNA 2F55A 1TUGA 2C1ZA 2QZPA 1X80A 2Q2QA 2VDRB 2WJHA 3IKMB 3KLOA 3QVUA 2QBYB 1IXYA 3I34X 5EE9A 4E51A 5JH7F 4LOAA 1A96A 2Z9DA 4E3WA 2G28A 1BXRA 1QE0A 2EWMA 3WNDA 4L08A 2H17A 4L28A 5GM1A 4IJVA 2G9ZA 3ZE7A 4YRSA 1ZONA 2GKGA 3GIDA 3R4CA 2X0KA 4IGEA 4M36A 4UNSA 4UAJA 2YASA 2C7OA 2WZBA 2X4LA 3TPCA 3O3CA 2OHHA 1X7WB 5K4GA 1W94A 3B1WA 1IZ8A 1MJNA 3ETNA 1KDZA 1KVSA 2A5DA 1XAJA 3RU2A 3TSCA 1YIDA 2FETA 4CMEA 2QHXA 2Y2UA 2KBFA 1GTVA 4MJLA 4XWGA 5I48A 2V7GA 5A2GA 1W35A 3ER9A 2OHXA 3EC2A 2R62A 1MAHA 3KQQA 3X1JA 1K9VF 3HKCA 3LL4A 3TI7A 4E07A 2HWYA 2ZVJA 4JB3A 5K8CA 4V0MA 3WRXC 3A0UA 4QBGB 2Q3JA 3DFZA 3Q3IA 1X1EA 4RHXA 1DAKA 1ZVMA 3KKQA 4B2IA 1F14A 1LV8A 1YJAA 4MZXA 3IX7A 1OSNA 2GETA 5J1SB 1KK3A 3SIXA 3I12A 3CS3A 4PWZA 2C2MA 3DCJA 1EJBA 7REQB 8GPBA 1LK5A 3T38A 1TQ8A 2HK6A 5F7OA 2BHSA 2G08A 2HU7A 4LSZA 4NDZA 3TRIA 4BIMA 1NMEA 5A2QA 1YI0A 2VH5R 4LYYA 5KREA 4Y1RA 3VKFA 1VHDA 2AMJA 1QVRA 4GAEA 3NC0C 1TAUA 1MU0A 1II0A 3NT4A 1WSBA 2I8LA 2X2OA 1MT3A 4TZ6A 2EWVA 4X60A 4WPGA 3U80A 2IZOA 2WJAA 3P2OA 4P33A 1YQUA 2I03A 3D31A 4AMYA 5KWIA 4TWIA 1XVUA 3IQIX 1E79D 1M2OA 1YGPA 3TE7A 3P9RA 4LF6B 4X71A 4FHDA 5FYDA 3WK5A 1Y5NA 2Z3VA 3LCVB 4GYKA 2DQKA 2G09A 4TKUB 4A0RA 1RC8A 1LSJA 1OFTA 3A32A 3JVEA 2XVMA 2I3GA 3OEHD 4EZBA 1AX9A 1GJRA 1HYEA 3KB8A 1F48A 2IYWA 1TQ4A 2QRMA 3O90A 1LSOA 3Q15C 1F2TA 2IE0A 1OMOA 4XB6B 1U02A 3KXDA 4GIBA 2HTEA 2VWGA 5HNKA 2C4WA 2GF2A 1O9GA 2J30A 1MIHA 3W5UA 2Q4TA 4K87A 3OAAA 1WEHA 1E1NA 2VUUA 2IV7A 2OFOA 2UDPA 1X94A 3DPUA 3WWYA 5HOEA 2W6OA 4NJMA 3U61B 4TT3D 4ZC8A 3ZDEA 3PA8A 2WJZB 4KR0A 4P9NA 2YR0A 4U63A 4WQMA 3V8PA 5LSAA 3HCNA 3TLXA 4ROTA 1EUQA 3CPSA 5HCUA 2GA8A 4NK5A 4YDQA 3ZE1B 2F1JA 3V7NA 3FKSA 4OFXA 2RH9B 5KMGB 2QI9C 4Q3EA 1AN9A 1TXGA 3JQ7B 1W5EA 3DWFA 5GONB 1FTGA 2ZB3A 3W6PA 2JGLA 5AVRA 4U2BA 4XYMA 1ECJA 2D7DA 4YJ2F 2PBFA 4AMBA 4MULA 4UM9B 3FMGA 5AVVA 3ZLJA 3IDFA 1QF7A 2UUPA 2W2LD 3LZCA 3N8DA 2DTDA 5TMDA 3SR0A 1C7FA 2Q2WA 1QP8A 3FD8A 1QZ3A 4XB1A 1BX3A 5DM1A 3WYDA 1PQ4A 2A9QA 2O52A 2OC9A 2RONA 1Q11A 3CRZA 4UHCA 4AU1A 2IZ6A 2PXCA 2WWXA 3GBVA 5JHHB 1OT3A 1ESNA 3AXTA 3BXGA 1Z2AA 2IUEA 1YQDA 1VZ3A 3B5IA 3GN2A 5J5VA 2XD9A 3WQSB 4AJIA 4I66A 2PTHA 2M6LA 4Z4QA 3JVUA 3DZIA 4UXJA 4ABYA 1UDRA 4Q1CA 5JFOA 3GAZA 1XD9A 1XZNA 4G8CA 3RTDA 3G8CA 4L9SA 5TS3A 1RKUA 4Y0NA 1O96B 4TKLA 1MB2A 3WK8A 3OEED 1IUNA 4CRWB 3F8SA 3M2TA 3NKLA 1VG8A 1E1KA 3A4YA 3LSYA 4PY2A 3ZWAA 2FN7A 2OEPA 2UZ0A 3AJ9A 4RCYA 3KTAB 1GA6A 1NVBA 4QWMA 4CEIA 4FFRA 1HMPA 3GPLA 1G5IA 2XV1A 3PVCA 2PHZA 4KP7A 3T3DA 2DFNA 2V74B 4NBVA 5LDHA 1DT5A 3HEAA 3OX1A 1VLMA 5CGQB 1H2YA 4ECEA 4R83A 5IK2D 1A2QA 3CWQA 2GNAA 3WB2A 1IDN1 2ZXEA 4PZUA 1JQLB 3EUAA 1SU7A 1XTTA 3FYUB 1HA3A 2AYXA 3FOCA 5AMXA 5KWEA 4B3SB 3EOZA 3D8UA 4EW3A 4MH0R 1LC3A 2P6PA 3EPRA 1Z8HA 1JJVA 1DQNA 1GFZA 1ZU4A 3GJ4A 1TFRA 4HXEB 4P38A 3VPCA 3HBLA 3AUFA 4E2FA 4ZK6A 3PFFA 1BWPA 4NPCA 3DO5A 3DTVA 5CW2A 4EYGA 3N28A 1HLDA 3OMWA 3GI1A 4P7GA 3DQPA 3IBFA 2ID9A 3BPSA 3F6RA 2IS4A 2OAGA 2WU1A 4M86A 3UIEA 2CUKA 2P79A 1WAMA 1LI5A 5CU7A 1IQ0A 5HFAA 1LS1A 1THTA 1XC7A 5FOVA 4PICA 1ZBQA 1LZLA 3B5JA 3QU5A 2LP4Y 2WU8A 4H2DA 3S5UA 1JPUA 2FFHA 3NS7A 4IIGA 4JC8A 3TD2A 3OQ1A 1ZM9A 5ICGA 1B4DA 3GLRA 1V8PA 2X0FA 1CDDA 1SKYE 3B9PA 3B8HA 1X0VA 1YT5A 2AN1A 3OIDA 3RKRA 4I2VA 2Q2NA 4PO8A 4O2LA 4ACBA 4GKJB 1M75A 2GB4A 3ITDA 4QDTA 2CFOA 5IARA 1ISGA 2JCSA 2YVKA 3SFVA 1E9FA 2Q1WA 4MQBA 1O6ZA 4A0HA 2ZSBA 4ZAYA 3DO8A 5DWQA 1X1CA 1JFVA 3K1TA 3VAAA 2X7XA 3TIGA 4I1SA 4E11A 1P44A 3G7NA 1MAAA 3QUTA 2QV0A 5EVCA 3RAPR 2G4CA 3ILXA 3JQAB 4DJJA 2BIFA 3ZGLA 4ZI3A 1UQUA 4N5DA 4DWOA 3C1UA 2QRVB 4W5TA 3HDHA 3VNVA 3KKMA 1KI1A 2X0IA 5BWCA 4XFKA 4CLXA 1M54A 3A9VA 3RIXA 2I8AA 4KHZA 3ZE9A 1DHTA 3AERA 3L1UA 2XTZA 1PZHA 3QFFA 5FNZA 1U0GA 1W2HA 1T15A 4ZAFA 1T2FA 2QRZA 3KK0A 2DECA 4PHTA 1G5PA 3EXIA 4OHPA 2WM3A 3WKAA 2GFIA 4M9QA 1U7PA 1NI5A 3IVRA 4YRMA 3K5PA 4N5LA 3OWOA 3B2EA 3EQ9A 4MV9A 1G6HA 1JLKA 4RLQA 3ZGNA 5FFMA 1WB4A 5T4BA 2KHZA 4Q7MB 4U7DA 3GR6A 4RZXA 5L95A 3VUEA 1HXHA 4QYIB 1QWOA 3BB1A 1XDGA 1Z17A 4HDRA 4A2CA 4LXHA 3BE6A 2XUIA 3TOXA 1CUZA 1DAEA 4C78A 3IMGA 4GMGA 3JARA 4FM9A 4OX9B 4QGAA 1NOJA 2Q2OA 2V7UA 1BCSA 1N6PA 2VYQA 2FOLA 3LXMA 4FDLA 2HMAA 4KAFA 4KQ1A 4MKGA 3FCCA 4ZT3A 4FHZA 4DXDA 5EJ6A 1W7AA 2IWHA 3TR0A 6ADHA 1I2ZA 2IU6A 4R7ZA 4FD2A 3SQXA 2NP6A 2OECA 2B4KA 1NC3A 4DQLA 4F5EA 1TCBA 3D6TB 5BQFA 3S1AA 2HA4A 2R5NA 4PNPA 4F86A 1ZCJA 1RWVA 4OYHA 1VB5A 1VPDA 1E9AA 3ANLA 4MV5A 4Q16A 3DE1X 5FOSA 5U4QA 4B44A 5JC8A 1KAHA 1SO8A 3KSUA 5DM4A 4MS4B 4EHFA 5BR4A 3Q7SA 3I42A 2N75A 5IVPA 1WVGA 1HURA 1P1JA 3Q6NA 1XFAA 2XUJA 3KSAC 3PU6A 1NXSA 2L17A 2IF2A 3RANA 2I54A 3WK7A 2JEZA 1LS6A 2UUOA 3E03A 1QRSA 1Z8DA 3IH5A 3HKBB 3N0WA 1NULA 5KQLA 4Z0TA 2FB9A 1IZ7A 1VMEA 2EEPA 2FZEA 1B41A 3OE7D 3ICPA 3PGMA 2OORA 1ZHHA 1U0EA 3BRWA 4FLEA 3U1VA 1UT5A 2YFHA 2OAEA 3KQVA 3IQHX 3UMFA 1NLYA 4FGWA 4F3TA 3RVOA 2XNSA 4F8EA 3SZGA 3GA0A 5AOVA 3OLVA 1UFVA 1SD5A 3P4YA 4E13A 5JQGF 5CX4A 4JI7B 1RJGA 2R00A 4B80A 3EWAA 821PA 2VT7A 2X0DA 3ZYZA 4X9XA 2YMPA 1W44A 2O0JA 2R6DA 3IVCA 1FDVA 4JUAA 3T4PA 3KKEA 2XUPA 1Q1BA 1G20B 2GLUA 3COPA 2JFZA 2NVOA 5DEIA 2IU3A 3JQAD 3KYBA 4NC9A 4TQ9A 1IXRC 3PFWO 4FB4A 3QKSA 2GS9A 4TXLA 1LTQA 4ZT5A 3GGSA 3RGGA 1WMSA 2CXUA 1KY4A 2A9JA 1H1TA 3C6XA 3ID6C 4OKIA 1QFJA 5H02A 3TFQA 3TXAA 1DEHA 2OZLA 4DS3A 5L51A 1JH9A 2J4CA 2ZEJA 2P0AA 2DM6A 1BU5A 3OZ7A 5F2EA 1X7YA 2R6CA 4OUKX 3LJKA 3HVUA 1IEXA 4O2RA 1NLFA 4LQLA 4M7RA 3U7IA 4DL9A 3SXPA 5BPFA 5HKAA 3UXEA 5L4NA 2B0CA 3IQZA 1DWPA 2VSOA 5H5JA 4CL3A 1Z25A 5I7UA 1OFIA 4RDHA 3FN4A 4HTAA 3W5CA 1QNFA 2X2EA 1CUCA 4PFSA 4D3FA 4DTIA 4D9NA 2I6SA 4JY7A 1RJEA 2H06A 1XDSA 2H5EA 3KUDA 3PWKA 5F76A 2UUBB 4RKRA 4R2WA 3ADOA 5I01A 2DY0A 2XMSA 5FI1B 4WEOA 2P5YA 4L7VA 4C0LA 5BV0A 2CXQA 3JQRA 4GKBA 4JGBA 1PJ2A 3LW8A 1VE5A 3ILVA 2P91A 2XVZA 3OT1A 1YVDA 3GOQA 2XE8A 4K0RA 4M21A 4O4HA 3SYNA 4BB5A 4LAFA 4UUBA 3KL2A 2R87A 2FPPA 3BHJA 4JLPA 2FUG6 5HF8A 3RHZA 1C9JA 2E0IA 3C1OA 3Q3HA 1VL5A 1NI4B 3T7RA 2C78A 2WT8A 3GJXC 3QJ5A 4DCOA 2PX8A 3VR5A 2GBIA 4H7FA 4DWJA 3M4ZA 1AKMA 3B3JA 1A2KC 3NDIA 3OIVA 3CGWA 4FKZA 1HDYA 5E8RA 3PX7A 4N9WA 4HAVA 1C0EA 4IP0A 1H4SA 1LI4A 2VJLA 1P7PA 2HHAA 3DZDA 3PFBA 1XXHA 3P9SA 3W1VA 4L8YA 1NTOA 1O95A 3W8NA 4MVJA 4Q3LA 1JIIA 1N2ZA 1S2DA 3WHPA 1EE2A 1FNBA 3KQWA 3GRFA 4B75A 4U2DA 1ADFA 3GL9A 1JDBB 1NUAA 1VB3A 2CXHA 3ZHZA 2BR4A 4F4JA 4LXQA 4H7DA 1Z13A 4NNJA 4R6WA 4QOHA 4RV9A 1KJJA 1L5GB 1YJBA 1ARZA 3KJIA 1ODLA 3SJCA 4CF5A 5L40A 3BSFA 2O7QA 4B6PA 5H0IA 3OUZA 1ILEA 1RJ9B 2XEDA 5KX5B 3FX2A 1Z2CA 4WNIA 2QJTA 1M6NA 3ICWA 5IBPA 2GBLA 3DNMA 2YN4A 2WABA 1KMCA 3ZDXB 4Z3KA 1SRRA 2KYRA 2WYIA 1KI4A 1F2DA 2P1RA 4YP5A 4E5VA 5COQA 5CB4B 1JBEA 3ZVLA 5JAQA 3D5EA 3E5MA 3CKYA 2XKBA 3DE2X 3PD0A 3M5CA 4FQ7A 6Q21A 2I6QA 5ESWA 2Q8PA 4ZHSA 3L04A 2FPWA 2A84A 3FZNA 4RUKA 4MUMA 3VC7A 2XCTB 2FEKA 4MRPA 4OHMA 1Y7HA 3PL1A 2RHGB 2PL1A 1PJQA 2M6SA 2X0NA 3HJTA 2OWEA 1J0AA 4ILEA 4J90A 4UATA 2RB5A 4IX9A 2GWHA 4L75A 5AXCA 2B78A 2RAVA 3FNFA 3IP6A 4KOAA 2JJ2A 4IDDA 5T6MA 4ZTUB 5A9TA 1RIIA 1TE2A 1FSPA 1MDBA 3MJVA 4W9NA 4JC0A 5HF6A 2WBLC 10MHA 3AUTA 4K40A 3SKXA 3TOVA 5CVEA 3GLFB 1KI7A 4D99A 2PH3A 3C87A 5U1PA 4B8YA 3T1TA 4V0SA 3CLUC 2W6ID 1G16A 3B6MA 4YV0A 2MSKA 1NAHA 2CLOB 2ZWPA 4N8DA 1J8YF 4XVUA 3ECCA 2IKSA 3T7CA 2BF7A 4EA7A 2OZKA 3LFTA 3BULA 4MW7A 3EIUA 4NQZA 1Y3FE 1OXVA 2G7ZA 3LYHA 3OT4A 3UYLA 3ZCRA 2BBWA 2ZWMA 3Q5GA 1SXGA 4AX8A 4CU5A 5DB4A 3EF0A 2QLBA 3RS0A 2H51A 1ZK2A 4P3NA 3KSRA 3K35A 2O3TA 1N2EA 1U9JA 3D7LA 3H8WA 1I5OA 4HL6A 3QVJA 4PSAA 1GZDA 2AKAB 2X19A 2PUFA 4NE9A 1KZGB 2OV6A 1EG2A 4BMYA 2G9UA 2YYAA 4RZQA 2GM4A 1PJTA 3LP6A 3L4SO 3ONVA 2A6PA 1JWBB 1NSYA 4WGFA 5EZYB 3OLCX 3R3WA 4Y30A 4IILA 3TMKA 4MW1A 1M33A 5B7GA 1OLXA 3DO6A 1W2WB 4QOIA 2PS9A 4E1BA 1O87A 2QTZA 3GXBA 3IAUA 1Z4JA 2J7KA 2CJPA 4F4HA 2BUBA 4F92B 2BP7A 5JMTA 1GA4A 1OTHA 2DG2A 1EP2B 4EABA 3OY7A 5F98A 2I62A 3RT9A 3LPAA 1XEXB 2BWJA 2NZYA 2VJQA 2ZG6A 3JRWA 3P0RA 3UO8B 5COBA 2O5CA 1E1RD 2EW8A 3K15A 3P94A 5FHRA 3TUIC 3PICA 3A25A 3F5QA 4BBJA 3HYRA 1EG7A 1Q1GA 4KQGA 1TKCA 2AXEA 2CNKA 5EWJB 1NC1A 5ITWA 2W0SA 2QVLA 3K4PA 4XPZA 3OMXA 3SJUA 3I6BA 5KOIA 1KQ3A 3DMFA 2AOVA 2JLAA 1AO0A 1GGFA 2BBSA 4OPMA 4PQGA 3T7JA 4FFNA 3AGQA 1W0KD 2V7QA 3O82A 4JU9A 4LY0A 5L6MB 5GJCA 2H65A 3HKDA 2BFEA 1BHQ1 1L1QA 3DVSX 3PT9A 1Z6QA 3D6MA 1VPLA 1AKRA 4X1IA 1G7SA 2VDPB 5L3ZA 2GRUA 3BJRA 1J99A 1XZFA 1JEDA 1TK3A 2ZB2A 2I6FA 4YJHB 4JI0B 1Q57A 1RHUA 3PDIB 3BUSA 1EGMB 1TQHA 1XF1A 1K6XA 4ZD6A 4E12A 1IMOA 4KLRA 4Q3KA 1V7PC 2H52A 2Z6AA 1ZD5A 3TF5A 3FTEA 2FQQA 3EXFA 3LXRA 1EX1A 1G4UR 3DE0X 4S35A 5D3QA 3T7AA 1PN3A 1ST3A 3QWHA 4OYLA 4BL5A 4YUYA 3WYFA 2YNMD 2AFHE 4KQJA 5H3CA 3BJZA 1CVLA 2RC5A 1EKXA 1Z4KA 4M9CA 2IPXA 4YI5A 3VH4A 1X7ZA 4P7KA 3QLUC 1J6UA 4REQA 2H92A 1K08A 2K6GA 2XJ4A 2HCJB 3R5KA 4D6PA 4XKJA 3SF8A 3B9BA 1NSFA 3OCUA 3RC7A 2PUAA 1DNPA 1EK2A 5K8IA 3NXSA 1CY6A 1QQBA 1YZFA 4KMOA 3F1LA 5IAKA 4EJFA 2WTEA 5FI3A 3WHKA 4KITB 3HJNA 2O3UA 1P1BA 2C4TA 5JRJA 2UUAB 1NVEA 4WBNF 4CM4A 5ILOA 3AF6A 1M5RA 4FEYA 4QQ8A 5KTYA 3WQBA 1JQJC 1U0TA 3JD3A 3DC7A 3QUAA 3JQEA 1Y7IA 4M3NA 4DLZA 3KKPA 1ZO8A 3D1VA 5IM4A 5JXJA 4IG4A 2H2AA 2WAXA 3GCXA 5KQSA 4FYJA 4BP3A 2I6TA 4II7A 3M33A 4WLVA 2PJRA 1ZZGA 1TTPB 3QVGB 4QRIA 3IUSA 2EF1A 4EVIA 2Q28A 3COZA 4RSMA 1TD9A 1NOIA 1IBLB 3NUGA 1KEEA 1Y63A 3G5UA 1CUSA 4LJAA 1WMAA 4NPAA 3UY4A 5I7FA 3QV1A 5LDDC 4RBNA 2NTYC 3NBQA 4L22A 4PLCA 1QCZA 3VPXA 3U3KA 2RBEA 4JQOA 5J63A 4I7EA 4B3MB 1KDTA 1PQPA 2EFGA 4NYIR 3ZNQA 5AW4A 1M34A 1MPXA 1P2BA 3CJTA 3UJCA 2HWWA 4P83A 5EHNA 8AT1A 4DDHA 3J81k 2NUPA 2DP4E 2QGZA 4Y2QA 4XSHA 3TJZA 3H97A 3V7UA 3AM4A 5IVIA 3WHLA 4ZQHA 5LXTA 3JQDA 3PTZA 1XTUA 4NMXB 1MFPA 2W2KA 3JD1A 2CJFA 2EJTA 2G4VA 2WSMA 3I5AA 3RS2A 2W6JD 3QLVA 4XFJA 2QJOA 1SFRA 3VZDA 3ZDFA 1VRWA 1OH8A 4LXYA 4KIWA 1RDFA 3G3EA 4GMHA 2F6RA 3GWZA 4A5SA 3PRKE 3O2JA 1LPMA 3E7XA 1GUDA 1XVLA 2JARA 2PXXA 2A5LA 4HZIA 4X7BA 1X1QA 4XI9A 1K66A 4LQCA 4O4LF 5IAJA 3SE0A 2C99A 4QXAA 1SOMA 5HIJA 3VUFA 4BN0A 3Q8MA 2VG8A 2FXIA 3ACBA 2Y1WA 3E18A 4E94A 1UDXA 1RYFA 4BFYA 2O0HA 1JA0A 2PQ6A 4M83A 4AL4A 1DRWA 4XIFA 5LQAA 4EL0A 1RVDA 2O07A 3FYDA 2ZYRA 3PVZA 4YV1A 3C6BA 1Y5RA 1UH5A 1XD8A 3FDZA 3DWEX 4PLFA 1FDRA 1MOZA 4H6PA 1LDEA 3NO4A 5CLQA 4C7BA 1ENPA 2VRCA 1J4AA 4MIOA 2PUCA 3M5WA 1I6KA 1Q83A 3P9QA 4FQ8A 1IPFA 2AOXA 3AKDA 3RFVA 4A8JA 2ONJA 2Z5LA 4G81A 2O8BB 5TEWA 4BV2A 4K2AA 5FWXB 3IVMA 1X1AA 4PM4A 4UOQA 1AQIA 4Z9BA 5AVZA 2HI0A 5MFZA 1E6KA 4JT4A 1ZUD1 4UMVA 2JAWA 4COKA 4R5MA 3JQFC 3A4VA 1FTNA 1TO2E 1XRRA 3EXEA 4QJ4A 5AJXA 1QGUB 5ALSA 3I09A 9LDBA 5C8ZA 4YR9A 1UK8A 2NADA 4KC0A 4YCLA 4F4UA 3UJBA 2RHTA 2XNHA 3PR2B 4KXXA 4RKWA 4AG6A 1LQTA 3H2BA 2PR2A 2WKRA 3AOGA 2HXYA 4RH3A 4Z0HO 3SSAA 2C4NA 4I2NA 3CLTD 5CLLA 4WL0A 1KYXA 3FSGD 1WY5A 2XGMA 4HYEA 2NTVA 3NHUA 3UT5B 5LU9A 4Q3NA 1RE0A 2IYNA 5IJWA 2VAXA 1D5CA 3Q85A 2J6IA 2Z4SA 2BFBB 2BUCA 2BJHA 2VDOB 1VJTA 1YU9A 4M89A 3OPMA 2NZXA 1XWIA 1XRMA 3LQYA 3DVAA 1ELOA 1NKVA 2ONCA 1QV6A 3EQ2A 4I9UA 1RAAA 4HXYA 4US1R 5D01A 3WGJA 2XECA 3WZ2A 5KYXB 3GLIE 2YOGA 2OHFA 4ZZ0A 3G5LA 4JCCA 4WMLA 4Y2YA 5BQ5A 4DR6B 1GTRA 1AHPA 5AJYA 5LUBA 4AZVA 3AB8A 2YV4A 2ZUEA 2BEWB 4F38A 1BH6A 4QPJC 1DJQA 5BN5A 1R0RE