2FG5A

Crystal structure of human rab31 in complex with a gtp analogue
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
165
structure length
165
Chain Sequence
b'IRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-31
publication title Crystal structure of human RAB31 in complex with a GTP analogue
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 54
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fg5A00
1F3OA 1ZUIA 4P32A 2VSOA 1GTVA 2O0HA 2FFQA 3B7GA 1ELOA 1HUQA 2GCPA 3EG5A 2YZ2A 3FKSA 1FNNA 3SHFA 1E94E 2VBCA 1N6KA 3ND9A 4WVFA 5EE9A 3FFBA 5KNBA 1J70A 1G3UA 3QXSA 4LRWA 1E1RA 5ANRB 1ZM3A 4RD2A 1I4TD 4Q9IA 421PA 5E7JA 4B33A 2ZJBA 4DC9A 1DAIA 4A36A 1OXXK 1F2UA 1MO3A 3I72A 4KO8A 4C0AC 2QORA 1Z83A 4EPWA 3U6BA 4QM7A 2R62A 1AKYA 5CDFA 3RNLA 5DNYB 3DMDA 1OYYA 3OZXA 4JZKA 2JJ8A 5TVKA 1XD8A 1TX4B 2VSFA 3F3YA 1JQJC 1DPFA 1RYFA 1XEXB 1SVSA 2VP4A 2Z5FA 3TJZA 4JMPA 2PMKA 1IHUA 3I8SA 3EZ7A 4GZLA 4ESVA 1CIPA 1XFAA 2WOJA 4LY6A 3UPUA 2QT0A 3TBKA 4UNSA 5DI9A 4OI1A 2ODNA 2FSIA 1E2HA 3L0SA 4D25A 4YONB 4CEIB 1T6NA 3GFOA 5FOWA 3RDPA 4C0SA 2ZE8A 3LLMA 1E2FA 3QE0A 4L15A 3SQXA 4TN1A 2CNWD 5LD2B 1N6PA 2GVZC 2JATA 3V9PA 1E1QD 3TR0A 1X8LA 3TRFA 2ZRMA 1H8EA 4MUBA 3RSOA 1KMHB 2Q9BA 5FBQB 4DUGA 2WKPA 2FGKA 1W0KD 2UVQA 2RCNA 2QMOA 2ASEA 1XD9A 2V9PA 3LBIA 1Z2CA 1GNRA 3B85A 3GJ4A 4DLYA 1PV4A 3EZ2A 4K8OA 3SS8A 2PEZA 3L8ZA 1DAGA 1XRJA 2C5LA 4LJYA 3S1AB 4AG6A 4MRVA 1VYTA 4LBZA 5KOYA 1N0UA 3IBYA 3GD7A 2G77B 3QEOA 1MABB 3BC1A 3DZ8A 4QKQA 4OJQA 2QAGB 2ZUBA 4PC3A 3SC3A 4O0MA 1G8FA 4PAMA 1M7GA 4LC0A 3I73A 2ONJA 5KPDA 3OFND 3QVUA 5CJPA 3CWQA 4JLVA 1KI2A 2GKSA 2XOKD 4N0DA 3IILA 4XD7D 2WJHA 4M4SA 2P0EA 3K9NA 4DT1A 2OILA 2DR3A 4Z8XA 1NSFA 1U8AA 1X3SA 2K5UA 3UG7A 1E9CA 1P4SA 5CK4A 5FOUA 5FTMA 2NO1A 4TYQA 2A7QA 4YMUA 2PL3A 2PLFA 2IWHA 3BGWA 4D4JA 4DLZA 4URWR 2CNWA 4F4IA 2J0QA 3FDIA 2BEKA 2AD1A 3O47A 1I2MA 2FFBA 1E1QA 2CL0X 2ORIA 1JJ7A 2IWRA 1GL6A 4X8MA 4EIWA 4NCIA 4P3YA 1VG8A 1W0KA 3EWAA 2OBMA 4FMCB 4MA4A 4M9ZA 5FBLB 4E5UA 1P3JA 1T4GA 3CBQA 3CRW1 4DIDA 5FPKA 1JQLB 3SR0A 4EPRA 2EYUA 1RPZA 4UNQA 3B9PA 1SXJB 1VTKA 2IYYA 3H4MA 4TLCA 5A0FA 4Q4HA 1OXSC 3RSLA 4JLOA 3TSWA 2ZI4A 2EFCB 5IK2D 3SJCA 2BEJA 2C9CA 3GQBA 2X19A 3U44A 4A4DA 4Q9HA 1R5BA 4IXNA 2F3RA 5H70A 1ZBDA 4PSAA 2WMNB 3SE0A 3MMPA 3TSZA 3REGA 4ARZB 1NF3A 4WOPA 1GUAA 4DHEA 1CBUA 2IA5A 5GVRA 1IN4A 3V4RA 3FVQA 2CCJA 3KB1A 1G6OA 2LKCA 3A4MA 1G5TA 2IYUA 3M1IA 4IOKA 4RY2A 2R44A 3R7WA 3OFNA 3EZFA 1P7CA 3GJ0A 3BBPA 4NBSA 2XOKA 2LWIA 4E09A 2W58A 1LF0A 2MSCB 4RFSA 4XIGS 1XTJA 3PR1A 3LVRE 1V43A 3SYNA 2ORWA 2VRWA 3H2YA 2PT7A 3HWSA 4MH0R 1DS6A 5KTYA 4BUJA 1GM5A 2QUZA 2IF2A 2N42A 2VYFA 3F5FA 2H92A 2ZRFA 5G3YA 3X1WA 1YR9A 2QENA 1I4LD 4Q7MB 3UANA 4MYCA 3B9QA 4E07A 2REOA 1P2TA 4IKEA 1VCOA 1DAEA 4XH9B 3VR6A 1NIPA 1DG3A 1W36C 1Z0DA 5AWFC 4V0ME 5FR2A 4A82A 4RCZA 3GLIB 3LBHA 3KJHA 4JVLA 4B3XA 1N5IA 2ZI9A 3CWZA 5DISB 3LQQA 3K0FB 2AK2A 4QBFA 4US2R 1ZU4A 621PA 1JXMA 1JJVA 1US8A 1U81A 4GI7A 2V55B 5KDDA 2OT3B 1DG1G 4LV8B 2WIBA 4NYJR 5IK2A 3TQFA 4URYR 5AJYA 4OHZA 4TSFD 4GDFA 1TEVA 4QHYA 1E32A 5B57C 4LJAA 1G16A 2OBNA 2X1VA 4HLUC 2QQEA 5CYOA 1HQYE 5GVSA 3AGQA 5GJCA 3K8YA 3QQ5A 5JCZA 3EWSA 1S96A 4HAVA 5JFGA 3U6KA 3KQNA 2XEXA 2W2TA 4C2TA 2GCNA 3EC2A 4EJSB 4YQFA 5J47A 1Z6GA 1N2CE 4AY2A 3WYFA 4HAZA 3PEYA 1GDDA 2CJWA 3N2IA 4NYMQ 3AF3A 3ZZUA 1IY2A 2PX0A 3B60A 2HF9A 2JAQA 4NHOA 4HUQB 3C5CA 1G7TA 1C9KA 2C9OA 1MH1A 3GEEA 1PUIA 4JVSB 1KI4A 3T5GA 4ACBA 3A1TA 5BN3A 1RW4A 1KI8A 2RHDA 2XITA 2IS6A 2ZRCA 3ASZA 4N1AA 2KBFA 4Q7JB 5IRCD 1CJTC 2W83A 1XP8A 2QP9X 3EZ9A 4LYFA 1KSFX 2ZS8A 3QF4A 3CIOA 2IW3A 3A4LA 3NC1C 4Z51A 2WWYA 2CHGA 3I1FA 1YU9A 5LD2C 1Z63A 3NBZC 1W47A 3AUXA 1W5TA 4IDHA 3B1YA 5EE1A 2GHIA 4YDSA 4KITB 4XWOA 1R10A 3MJRA 3QENA 3IUYA 1P73A 3H1TA 4JSTA 2OEPA 3L43A 2O8CA 2IUTA 2YHSA 2NO0A 4F4CA 2XZLA 1T5IA 2JJ1D 1U94A 2RH5A 4TSFA 3TAUA 1NG9A 1Q0UA 1XEFA 3SJAA 4BASA 4LBVA 1QF9A 4JBWA 2DB3A 4A8JA 5CLQA 1G291 2J0SA 3NBFA 5GJBA 2B8WA 5F9HA 3W6PA 4B71A 1RRFA 1DE0A 4B44A 1FPMA 3GJ3A 2RB4A 4NCJA 1R0YA 2HYIC 5L3SA 1F5NA 4GP6A 2W0MA 1UKYA 3KL4A 4JVMA 2VPPA 2Q3HA 3EXAA 1XTSA 5FOVA 2QAGC 2X2FA 4LUCA 4TMTA 2EU8A 3VNVA 3CLVA 3CF6R 1E2QA 4EPXA 4DCTA 1F2UB 5GJWC 3RS4A 2FE4A 3BH7A 2C78A 3U7EB 1S1MA 5FFMA 4MYUA 4BFUA 1YZTA 4TQ9A 5EP3A 4FMDB 2PT5A 1ESMA 1KI6B 3MD0A 1OXVA 1VCNA 1WQ1R 1AA9A 1Q1QA 5KSPA 4Q03A 1N0WA 5J4VA 1M34E 4Q7KA 2IYSA 4F93B 4DLTA 4AYWA 1SQ5A 1S3GA 1AS2A 2WIAA 4C30A 1KHTA 4LHZA 4Y0VA 1AN0A 3QPVA 1KK2A 1Z06A 3K9HA 2JLWA 2MMCA 2F1JA 2OFOA 1M2OB 5FBWB 2QG6A 2WAYA 4PO8A 4R7ZA 2JLVA 1Q20A 3GJ5A 5HE9A 3EPLA 4P4TA 3KQHA 2JJ1A 3QXXA 4GMDA 1E98A 3CZQA 2A3RA 4JLNA 5FOXA 1XPRA 2VP2A 2WBLC 5DYGA 4CT4B 2QGZA 3K0CC 4E03A 1SXJC 3CB4A 3WMFA 1GZSA 1NVUQ 3P1JA 1GNQA 3K09C 3NHBA 4KXFB 5F3WB 3LXXA 2A5DA 4GL2A 4X8OA 1X6VA 2Q0HA 3NEYA 4HATA 3QKRA 2OCPA 1L8QA 1IONA 1OIWA 3U3JA 3BJIC 2ZQ5A 2ZRIA 1KSJA 3EIHA 2B6HA 1Y3AA 1TF7A 2XZPA 4KBFA 3CRMA 5EZ5A 3AF4A 1II0A 4TL6A 4ASUD 5JJLA 3A6PC 3A8TA 2GCOA 5EE3A 3THYA 1J90A 4I4LA 4A0RA 1F2TB 2HEIA 2ZRNA 1Z47A 2PZEA 2ZE5A 3RABA 2YOGA 1M8PA 4DT1B 2ZANA 1ZW6A 4RD1A 2Q9CA 4A2QA 2W0SA 2J45A 2IXFA 3V00A 1JR6A 2RGGA 3ZH9B 2VA8A 2E1RA 1P9WA 5HZKA 1TU3A 4TLDA 1OJLA 3VHLB 3T1VA 3AVUA 3KB2A 1T0HB 4TZ6A 1CR0A 4JLPA 1W1WA 3TW8B 3CNNA 1DO2A 4GRAA 1G19A 1CKEA 3W90A 3K70B 5JJKA 1QHNA 3K9GA 2D2EA 2JGNA 4ACAA 3FGNA 1SVKA 1II8A 2ZRKA 4KYUA 4PZYA 1XPOA 2AXPA 3GLGE 4CEHB 4QG7A 1G4UR 3ASYA 1ZD1A 4CRWB 1SKYE 1F6BA 4A0GA 4HLQB 4Y0AA 4BLTA 5DI3B 4PXAA 3TGPA 3WY9A 1HV8A 2BCJQ 3FWYA 1SHZA 5JRJA 4D0NA 4Q4HB 5TY0A 2IBMA 3LW7A 1UBCA 4XJXA 1XCMA 4TLEA 2O0JA 5FTJA 2NPIA 1Z28A 3MFYA 2ZVQX 4H1VA 3ZS8A 3U44B 4IVQA 5BW8A 3FOZA 1OV4A 1W44A 1T9HA 3PG5A 3HDTA 4EJSC 3UG6A 1UDWA 1DARA 2EW1A 5FPSA 4BECA 4C9BA 2GJ8A 4DDUA 4ASUA 3RWOA 2AR7A 3C14C 3PEUA 3WYAA 1E2JA 3X1YA 1CJVC 3QKUA 2DY1A 3IEUA 1CR1A 1R0XA 3FHOA 3LAWA 4IHQA 3R7WB 2ODWA 2P3SA 1ZUNB 4M2LA 3EIQA 4MGIR 4TTQA 1DELA 1TUIA 3PFIA 2ZRDA 1L7VC 1JB1A 2J1LA 2DFTA 1HT1E 2A5JA 2PLRA 3AKEA 3NC0C 4IOJA 3U3OA 1GG2A 4D26A 1U99A 1FMLA 2J41A 4BFYA 4KVAA 1IJEA 1HA3A 4PC7A 4M1YA 2P6RA 5FBRB 2RGNC 1KKLA 3AM1A 3CO5A 2P6NA 3WBJA 1Q1EA 3J81k 1DAKA 5BXQC 1E2GA 1U8YA 4FMBB 4NU0A 4W5JA 2J0UB 4OYHA 3RRMA 3RVBA 4M53A 4URVR 1NIJA 3SBDA 5IF9A 1K5DA 4NZYA 1XCGB 2ZXUA 3VHXA 3SU8A 5TMPA 3VR4A 4NTZA 5AJVB 3O8BA 3VU9B 1RJ9A 2CMKA 2VLIA 4GNKA 1US8B 1ONBA 2D7DA 4C4PA 3WP1B 3LY5A 5DGXA 4LJ5A 2P5SA 4JLMA 1GSIA 3E70C 2XXAB 3UWOA 4JYCA 3RS2A 4WZ6A 2LKDA 2XGJA 3AVXA 2KWIA 2AHOA 2ZSEA 1FUUA 3RAPR 1QHHA 2N1BA 3DOEA 2JLUA 3CRVA 2DBYA 5DE3A 4Q1BA 4W7SA 5AJXA 1UEIA 4LJ4A 1FW6A 5IDVA 4PR0A 4B48A 2G83A 3OHMA 4DLWA 1EG7A 4BRWA 2CXXA 5FOSA 4G3XA 2CJWB 2Z4RA 2AN9A 2BWJA 1XWIA 3WHKA 1GIAA 4D4LA 1VG9B 4WAUA 2JLYA 3LRPA 2RGXA 1NVVR 1W4CA 3E1SA 3ICQB 4M1OA 1XMVA 1S4QA 2GXAA 2NMVA 2IYWA 1ZD8A 2QPOA 5D3MA 3I61A 3U4QB 1W5SA 5AUQA 3EIEA 2IS2A 1TADA 4WIAA 4QBGB 4Q02A 2OE2A 3QKSB 3K0EA 4M22A 3LWNA 1GVNB 2OM2A 1F60A 4BZXA 4DLUA 4LOAA 3I3SR 2FFHA 2BCGY 1J7KA 5K8LA 4AURA 3IO5A 4BLRA 1G5PA 2WMOB 3NBXX 4X8HA 3ZYCA 3ADKA 1BKDR 3C41J 4JSYA 4TWZA 4YC7A 1G9XA 3RS0A 5CLLA 1P2SA 1UADA 1SGWA 4GOKA 4HYYA 4TQUS 1AQUA 3I5XA 2XJ9A 2YWFA 3LVQE 3P4XA 2IS4A 2ZJ8A 4Q5IA 1D9ZA 3X1DA 3LA6A 1UPTA 2C99A 2O8CB 1IN5A 3VKWA 2XTZA 2R9VA 4PPQA 1U9IA 4AD8A 6Q21A 4HB3A 1Q3HA 3UKDA 2HV8A 2Z83A 2F1RA 1E0JA 5KYKA 4UXHA 3KXKA 1O3YA 4MGKR 4DLRA 2P67A 2BBTA 2JLXA 2MMGA 4NYIR 4JBXA 5BN5A 3QNUA 1U90A 5BN4A 5BYJA 4MRNA 4BEJA 4V0MA 2R2AA 3V4FA 4CIDA 5A5GA 1Q1BA 3CRQA 2AKAB 4BQSA 4KV9A 4QGHA 4KBGA 5CIQA 4G0NA 2AWNA 3KXLA 3MWJA 4II7A 2FPMA 4JT2A 1XMSA 5JSZB 3M6AA 4HAWA 4LHXA 2OUKA 4R9UC 3QXCA 4OK5A 3REFA 3WP0A 4RZ2A 5B58C 1OT3A 3C5HA 1U2RA 3IIKA 3BFKA 2H17A 4IDNA 2BJVA 3CF2A 3VKGA 3SQWA 4EFNA 4G1UC 1KAOA 2B21A 2ATXA 2OG2A 5L3RA 3MGCA 3T35A 1I4DD 2GA8A 3GFTA 4G5QA 4RKEA 5SZJA 1SVOA 4BZPA 3K70C 4Q21A 4PQRA 1E0AA 5L8VA 2C9YA 1RRPA 4D4KA 4ITRC 1ETUA 2YV5A 4G5GA 1IM2A 2F9MA 2QROA 2VP9A 4DSUA 1N5LA 1IN6A 1FX0A 2ZRBA 4L8GA 4OHWA 4ILEA 4A15A 4O3MA 3EA0A 1S1CA 3LQRA 3MLEA 1E2PA 3HU1A 1OLOA 3IPXA 4LJ7A 3A58B 2O8DA 1ZM9A 2O8FA 4POAA 1G18A 1PZNA 1N6RA 3BWDD 1KAGA 4BLOA 2G3YA 3L0PA 3P20A 5K8TA 5LPNA 4YXWD 1KKMA 3DVLA 3ND8A 1W4BA 2FNAA 2ZREA 1KJZA 2IXGA 2SHKA 3CX7A 4U5XA 2C98A 3L2OB 1EGAA 4EQ6A 1RC8A 2E87A 1HE1C 2P65A 3Q85A 4NPHA 2XNSA 2D2FA 3VFDA 3U7HB 5KO2A 3G0HA 2ZUDA 2I3BA 2BKUA 4BLPA 4OQNA 1FQJA 3FPAA 2RKOA 3N2EA 2GCOB 4DDVA 4DRZA 3CH4B 1LB1B 1P9NA 3D8BA 3IHWA 3PUWA 3ZIAD 4BRUA 4PQFA 4I81A 2RHMA 1GL7A 4B3FX 1Z6XA 1DADA 1R5OA 2YC4C 5FUVA 1BMFD 3QKTA 3U3RA 5C4MA 5CB6A 4RZXA 4PO1A 3A1WA 3TIFA 1JR3E 4AK9A 2NO9A 1P72A 4JLKA 4UXJA 1FP7A 3R9IA 4D0GA 1R0ZA 2ZJAA 4OJKA 4F91B 1S3SA 5JS8A 4LHYA 4MDFA 5C1BA 4DXAA 3SNHA 3AF0A 1FZQA 4N0EA 2WAXA 2VO1A 2QNRA 1UM8A 5BQ5A 4DSNA 4HLCA 4MDEA 1LNZA 3RLFA 1SXJE 3Q5EA 1KDOA 2H1LA 1B23P 1ZUHA 1JI0A 2V6IA 1II8B 4IEIA 3A36A 3GPLA 4KVGA 4X8LA 3GJ6A 1XB2A 4YXWA 1GP2A 2IT1A 1KSHA 1VIAA 4Z1MD 5FTKA 4QGGA 3AKDA 3IIJA 2EWWA 4FMCF 4LI0A 4M1MA 4LJ6A 1QHGA 1ANKA 1CJUC 4YMTA 4C0JA 3QJYA 4ZCLA 1COWD 2BIFA 1XXHE 2GZAA 3O8DA 4AKEA 2WSSD 2REBA 3BIFA 1PLKA 3GJ7A 5K8IA 5JCPA 1XNJA 1G5RA 1D8TA 2ZRGA 3ZIAA 4U00A 3TVTA 1ZNYA 4GT1A 1IOZA 2PCJA 3MWYW 5C4GB 1UKVY 3THWA 5CM8B 4LDJA 1SVWA 2R6AA 2CLSA 1BMFA 4TYPA 4HZUA 1N6HA 3CX8A 2XB4A 3B78A 2GESA 3R20A 4IFBA 4JL8A 5E4FA 5JZVA 1NY6A 1GRQA 3FHTA 1A5TA 4TT3D 3WMEA 4MKIA 4FI3C 3SJBA 4DCUA 1OH6A 3T5DA 1KO5A 3EPKA 1QVAA 3GEIA 1XZPA 4PHHA 3GLIE 1VG1A 3HR8A 4O25A 5D3QA 3JZMA 5HTKA 3VQTA 1KJWA 4CDGA 1X8KA 5CYPA 1CTQA 3ZQ6A 1PLJA 4WA7A 5JWRA 2KI5A 1D2EA 1JBKA 2AFHE 1HURA 4M0LA 5DSZA 2WVJA 2ZI5A 2ZRHA 4TTRA 4NONA 4Z54A 3B8HA 2F1HA 4IDOA 3IHLA 1KO1A 3U7GA 1RFLA 4A92A 1KI9A 1X86B 3HU2A 2OESA 2V7QD 4Z1MA 3LD9A 4HAUA 3CR8A 1PLLA 4GP7A 4GZMA 5SZKB 2H5EA 1IN8A 4US1R 2QMHA 3TW4A 5C18A 4YLGA 4OQLA 1COWA 4A6PA 1ZD9A 2HYDA 4KLNA 1Q3TA 1XD2A 2WSSA 3QG1A 4LYAA 3BFXA 3AKCA 1H65A 3KTAA 5TB5A 3NXSA 1XPUA 1EX6A 1QHHB 2AK3A 4C3ZA 5EXXA 1XJQA 4HAXA 1LVGA 3EPJA 2PZFA 2HDNB 4KFSA 2C77A 2JLSA 3LDAA 5J4LA 1VG0B 4QBIA 1L2TA 5JI3E 3GLGA 4Q9JA 3UIEA 1WB9A 4NYJQ 4A2WA 2OV2A 3U5ZB 1Z6TA 2FSGA 1A2KC 3PEVA 4XWAA 3BK7A 4JKIA 3TUJC 5C46F 1HH4A 1MT0A 2GBLC 4KI0A 1EFCA 3LFUA 2J0VA 2G0NA 2WWIA 4I99A 3EX7C 4IOLA 3PVSA 3OAAD 4CEJB 4Q1EA 4KFRA 1E69A 4TT3A 2ANCA 2Q6TA 1S8FA 2RGEA 4D81A 3JVVA 2H18A 3LW8A 1Z6YA 4H9GA 2BMEA 3ZD6A 3PIRA 1KOFA 1KO4A 2DWQA 3RANA 2ZSFA 3DL0A 1BYIA 5GADl 2ZTSA 3B2EA 3KKMA 3KUCA 5KSYA 4MKGA 2FEOA 1W7AA 3NKVA 2FMXA 2FPLA 4U02A 2QBYA 3B1VA 1T3LA 2J3EA 1G3RA 4TQAA 5EXTA 1KGDA 3AP1A 2GNOA 1Z3IX 2IUUA 1CRQA 4AG5A 1OH5A 4IRUB 1XDBA 3GJXC 4Q19A 4BFXA 3GEHA 1G1MA 1AKEA 1RRGA 2BMJA 3B1XA 4ON9A 2XAUA 3O8RA 4P33A 2HCJB 1GFIA 2OXRA 2V7QA 1A1VA 4FIDA 3MUFA 4ERNA 5LBIA 1P62B 1BS1A 1FMJA 2VF7A 3T1OA 1T91A 1Z5ZA 1GL9B 1OW3B 4GMXA 4PAOA 2O0KA 1HEIA 1Q57A 2J87A 1AK2A 4LWZA 1QRAA 4I1OA 4L4UA 4YMVA 4EPTA 1NLYA 3BB4A 3DEFA 4ABYA 4BLSA 2C96A 2C8VA 4YMWA 4HI0E 5AR1A 2D06A 1N3BA 5KHOC 1EK0A 1M6NA 2V4ZA 2VHJA 1HE8B 3THXB 4P4UA 3UATA 1DAHA 4DZZA 2QY9A 3BH6A 3AGPA 4Q4AB 4PQYA 2CEAA 3MWKA 3FMPB 3K0AA 4NKRA 4TMVA 1YZGA 4OHYA 1MOZA 2Z6VA 3OAAA 1Z0IA 3OESA 4ZI2A 2JLQA 4PPNA 1R5NA 1UDXA 2D62A 1G7SA 3GLHE 3QXHA 5JRZA 2GZDA 5EXSA 4BFSA 3LBNA 3RC8A 3U2QA 4HB2A 5F9FA 2RGCA 4DDTA 3IQXA 1MRNA 1MKYA 3BH0A 3IGFA 2FH5B 4KYIB 4RD3A 1P9RA 3DM9B 5EP2A 1NN1A 1E0KA 5KSOA 2JEOA 2QI9C 3MJHA 3DOFA 2NZ8A 1VHTA 2C95A 2ZJYA 4FMDF 3QY0A 1QHIA 4AI6A 4JLJA 2GEDA 3X2SA 3DDCA 4HLDA 1KY3A 4OL0A 4ZV4A 1CP2A 1E2NA 3F0TA 1PVOA 3NG1A 3A37A 1KDRA 4B3BA 2JDID 1VDZA 3ETLA 3F8TA 3W6NA 5EE0A 1QHSA 1ZCAA 2CHQA 2OFXA 1DAFA 4LJ9A 3BD9A 3TQCA 2FSHA 1T3HA 5TXGA 4BZQA 3UMSA 2R8RA 2GDJA 2AWOA 4M9QA 5F98A 1XMIA 2VP0A 4RKFA 4C0KA 2ZIAA 2VHUA 3QPWA 2WKQA 3C16C 4QC2A 4B3GA 3BS4A 4LJ8A 4W9MC 4O2RA 2I4IA 4IVPA 4JIMA 4AIIA 4PX9A 5UKDA 5JI2E 2WSMA 2P2LA 2UKDA 1ZJ6A 2OLKA 4M9SA 2FEMA 3AVWA 3KDSE 1QG2A 1EFRD 2ZU6A 4MGZR 5EUQB 1FUKA 1G7CA 4IEEA 5F2EA 1XF9A 4HDOB 5JLJA 1DVRA 3IO3A 1YKSA 1JECA 4ZCMA 5KUTA 1ZP6A 3ZS9A 3WYGA 2OSBA 3Q3JB 1NN5A 3W3AA 1LFDB 4DEXA 4HLUA 4Q1DA 2B7CA 4OI2A 5FPHA 4Q18A 4R98A 3WRYC 2HCBA 2G0TA 3CRRA 5J4KA 2F9LA 4O2LA 5BYKA 3QOFA 4I1VA 3U3KA 1E2DA 4Q1CA 3Q7QA 4DJTA 4RVCA 3PITA 2VHQA 1DBSA 4OHVA 3SZRA 2ZI6A 2VF8A 3P4YA 4WXPA 2XSZD 4URUR 2QPAA 4LPSA 1L4UA 4FW9A 1K8RA 3KKOA 4DLXA 5EXPA 1GWNA 2QZ4A 2OBLA 3KFVA 2PZGA 3NHAA 2IYTA 1IBRA 3AV0B 3GLFE 1VMAA 4FCTA 1RVDA 4C0QC 3QI2A 1WF3A 4QBHA 5EP4A 4PPFA 1XEXA 1YE8A 3ONWA 4B73A 1JEEA 2JDIA 2W6ID 4WXRA 3NWJA 1J99A 3VKHA 5H8WA 4NCKA 3RS7A 2I1QA 2FDCA 1EWRA 3TK1A 2ZRLA 2YWGA 5E3HA 2H16A 1OFIA 1NLFA 3BFVA 2QM8A 3EA5A 2GF9A 2GJAA 3KJEA 1UFQA 3KX2A 2F7SA 4B32A 2A5YB 2DFLA 1JR3D 2I1VB 4OQFA 3NVAA 2FJUA 1NJFA 2WICA 2EYQA 4BEBA 5B2ZA 4L5BA 4NCNA 3IIMA 3HU3A 1CULC 2VP5A 2IHYA 3AKYA 3NDPA 5ELXA 2C03A 1EFRA 5FR1A 1GNPA 4AKIA 3NEJA 4B35A 1R4AA 3VX4A 1NBME 5A4JA 1RIFA 4ZDIA 1SXJD 2H7VA 2QGNA 3D6TB 1IQPA 3EARA 1JAHA 1E79D 2CK3D 4KSCA 3THWB 2KSQA 1NMZA 3S1AA 1QZXA 1XJ0A 1T8UA 2AL7A 2ORVA 4Q4JA 3WNCA 1J8YF 4BGDA 4TZ0A 3UMFA 1FFHA 3MCAA 3QBTA 4CF7A 2YKGA 2FPKA 4M9XA 2OLJA 2XSZA 5G41A 2ZJOA 2V1UA 1IXZA 2ZYVX 3KKPA 4Q9LA 4QGAA 1G3IA 1NVXQ 1NRJB 2DFKB 2OFWA 4AWXA 3DO6A 2FX3A 1TTTA 2VL7A 1NKSA 2NGRA 4FINA 3A1UA 1BYUA 2W6IA 4NE2A 3TH5A 3AF2A 1AJEA 2PCLA 2GVDC 1GILA 2XX3A 4Q9KA 1D9XA 4YDHB 2JLZA 2H8KA 1WBDA 3UMRA 4QM6A 1YZNA 2ANBA 4OK6A 2WKRA 4A2PA 4M1KA 3VAAA 4GPTA 4EPYA 4RFSB 1BOFA 3M0EA 1KJYA 4PFSA 4R2HA 1RE0A 1JR3A 2OCAA 1YRAA 3KQUA 1E2KA 3NBYC 1RKBA 4C0HA 3G5UA 2YVUA 1PUJA 1IJFA 2ZYTX 3FMFA 3N5CA 3CPJB 4BFWA 3CKLA 2J9RA 2BMFA 2P5TB 2A78A 3AF1A 1FNMA 2QRNA 1TQ6A 3PCRB 2ZSAA 1OB5A 4QL3A 2CBZA 4IOMA 1I2DA 2QAJA 2FV8A 1C1YA 1G3QA 2BM0A 3K0CA 1Z2AA 1OYWA 1E9EA 1SXJA 3BOSA 3L0IB 2X8AA 3K09A 5J40A 3IBGA 1VCIA 4CZ2A 4JYBA 1E79A 2CK3A 4QGFA 5FPTA 3EASA 3QVVA 1XJCA 3U61B 2G88A 4RFVA 2GZHA 3OEHD 2PJZA 2FG5A 4J0QA 1A7JA 1EFTA 1E9RA 3QIAA 3KZ1E 1KZ7B 1LS6A 3EZ6A 4FD2A 1ZMXA 4K81B 1ZIPA 3FHCB 4B3CA 2BHRA 1CJKC 4BPBA 1XXHA 2NO7A 5KDOA 4BLQA 3CPEA 5CM9C 2Q3FA 3OE7D 2BKEA 5CK5A 1JAIA 3E2IA 3Q72A 4R71A 4U7DA 3QEJA 4UKDA 5KPJA 1E9FA 1NVVQ 3K53A 3EC1A 1R7RA 1G20E 1GITA 4XWKA 2V8OA 4TL8A 1AGRA 2Q3MA 4A9AA 1D2NA 3U3MA 1D2MA 1AQYA 5HE8A 2XJ4A 5HZHA 2YWHA 3BERA 4G5SA 3QUSA 3SYLA 2FA9A 2QMUA 2RGDA 3AP3A 1GKIA 1X8JA 2YJTD 2RGBA 3ZQJA 4UJ5A 3P27A 2VEDA 3C15C 3GLIA 3AVVA 4LGMA 3B6EA 2FGJA 2QMEA 5FPYA 5SZHB 3K0FA 4FN5A 2ZR7A 3QF4B 2KBEA 5DIFA 2JCSA 3C8UA 1Z07A 1G7RA 2ZE7A 5E95A 4LYHA 1P6XA 1JEDA 2Y8EA 1ZAKA 1LW7A 3Q8XB 3VR3A 1E9AA 5B30A 3W6OA 4G5OA 2HJGA 1XTQA 2A5GA 3K0AB 3OEHA 2BJWA 3VR1A 1NI3A 1FQKA 4KJZA 2GXUA 4M21A 4XSGA 5AUPB 1MO6A 1B0UA 1TU4A 4DCNA 5DLQC 4NYIQ 4QXAA 2GXQA 4PANA 4B2PA 2IXEA 4EJSA 4B47A 4LSGA 2ZR0A 4A8JB 1YR7A 2ECKA 3HYTA 3OE7A 4ZIRA 1K6MA 3IPYA 4TLBA 2IYXA 2YC2C 1H8HD 2XNDD 5FUXA 4ZDWA 4B74A 3TMKA 3E5HA 4S2EA 1OFHA 5CJ2A 3ZJYA 5DHAA 5L3SB 3R8CA 1ZRHA 1U0HC 4DBLC 5E7MA 5JWOA 2VQSA 4ESHA 1QHYA 1AIPA 3BB3A 5JEEA 3GP8A 4DCVA 2EFHB 4RD4A 2BBSA 1KYIA 3T15A 1TEXA 2RGNA 2Z43A 4WW0A 1NY5A 4I1UA 1HYQA 1E2LA 3PV0A 3Q7PA 1TAGA 5J4HA 2FOLA 1N0VC 2OAQ1 1KTVA 3CPHA 4KU4A 2ZR9A 2QN6A 2PX3A 1J8MF 5CITA 1P75A 1E2IA 2D3WA 4ZKEA 2BC9A 3B5JA 2OHFA 1UBEA 2NQ2C 1KNXA 2EWVA 2CE7A 2HLDD 3T12A 2IYLD 3RRNA 3SI7A 1UKZA 2NTYC 3U7FB 5SZIA 5AJWA 4BFZA 2BMDA 3H84A 2GEVA 2IEZA 1AZTA 1WRBA 2HXYA 3VR2A 4LHVA 2A9KA 2NO6A 3LX5A 4Q47A 3RYTC 3HYRA 1WE2A 4XTRA 1CR2A 1O87A 4TYNA 2IC5A 2ERYA 2V6JA 2ZRJA 4GFDA 1NP6A 1W2HA 1G64A 1WA5A 4YMSA 4D2IA 2WJYA 2J59A 4N3NA 2ZVPX 3I4LA 4DVGA 1S2MA 3WNDA 2QSZA 3DMNA 1YVDA 1CXZA 4DSOA 1GOTA 2BM1A 1VECA 3Q9LA 5FTNA 3FFAA 1UF9A 1KI1A 2WZQA 4LX0A 2IL1A 4QFMA 5JMTA 1U0JA 1VYVA 1W4RA 4UXIA 1TQ4A 2ZRPA 3QKRB 1R0WA 1H8HA 2XNDA 5KU1A 4URZR 3SBEA 2R6DA 3ZGXA 1K5GA 4MYHA 4GSYA 5FOTA 3VR5A 3OF5A 4QHSA 4OI4A 2QTHA 5FUWA 3I5YA 1MO5A 3I8XA 1IY1A 1KI6A 2ATVA 4LYJA 1P5ZB 3A1VA 3PUXA 3HJNA 3BXZA 5K8UA 2FSFA 2IYQA 3GLHA 4JLAA 5IT5A 1V5WA 2JJ2D 3THYB 3PJRA 4G01B 4F92B 2WWFA 2QT1A 3I92A 5JS7A 2QU8A 3KJGA 3TAHA 2BOVA 1R6BX 3QXJA 4C0LA 1NKTA 3P26A 2ZE6A 2F6RA 2ZAOA 2XTMA 4UJ3A 2HLDA 2ZI3A 4RZ3A 4F4JA 1VHLA 3BORA 3A1SA 2GWHA 3TUIC 3AVTA 4QOSA 3P32A 2QRZA 3WXMA 3K70D 2CHVA 2GAOA 1KI3A 3D3QA 1NN3A 2IUSA 3FE2A 2BDTA 3OIWA 5DO9A 3LXRA 4PPGA 2P6UA 5HCIA 3G82C 2WTUA 1OH8A 2O8EA 3CNOA 2VSXA 2CLCX 5KNDA 4JKYA 1XEWX 1SZPA 4JT4A 2J5XA 1WCV1 5FBVB 1IY0A 1DO0A 2EFEB 2PH1A 1T8TA 2ZS9A 4V0OA 1DAMA 4OQXA 4DB2A 2WWXA 1L4YA 4CYMA 2WWWA 1OSNA 4Q1FA 4Q4JB 4UQOA 5LB4A 2AKYA 5KSZA 2IEYA 3OEED 2ZSDA 2FZ4A 2FZLA 3FB4A 4QRHA 4I1SA 5FL7D 4BFTA 3TR5A 4ZI3A 3L8YA 4HEJA 5CIWA 5JWHA 1A82A 1Z6AA 4IVRA 3DPUA 1F2TA 2W2VA 5BWMA 5JJIA 1CRPA 4V0NA 3UXMA 1ZVQA 1NBMD 1OE0A 1VPLA 4FWIB 1Z0FA 4MKFA 3BB1A 2JJ2A 2VP6A 5AJZA 1JNYA 2IF0A 1UAAA 2Q9AA 1Z0AA 4OK3A 3DKPA 4Z8YA 2QA5A 3SDZA 4TYWA 2RMKA 5AK0A 4E22A 1YR8A 1YQTA 3M4YA 3TSOA 2GILA 2HXSA 2O8BA 4NP6A 4PO9A 1ZC4A 4LCBA 3RRYA 1TF2A 2G1KA 3T61A 5FI0B 3OIYA 2GJKA 1QVRA 4JL6A 2GRJA 2V3CC 4CEHA 2C2HA 3GLFA 2RGAA 3CONA 1D6JA 2ODBA 5DI3A 4MRSA 2JLRA 5CB8A 4P0TA 4P31A 5LB2A 4TMWA 4IDPA 3MSXA 4WBSA 1IXSB 221PA 1GKYA 3IDQA 4QJ4A 3ZZTA 3KXIA 1CLUA 3CNLA 5G3ZA 3AVOA 1RJ9B 3CUEF 3Q5DA 2AFIE 4DDWA 1XX6A 1ZCBA 3AVQA 3OEEA 1CEEA 1Z0JA 5FL7A 2XZOA 1HT2E 4A8JC 1E9DA 5GJVC 1E2EA 4RCYA 3KFXA 2FWRA 1FL9A 1QBKC 4EAQA 5AUNB 1ZC3A 2RAPA 3L0OA 4JVNA 5EQTA 1YRBA 4D0LB 1XTRA 1KO8A 1XXHB 1NBMA 4XD7A 2PBRA 1N5KA 1OPXA 4M1SA 2EFDB 3JVUA 4M1TA 3IEVA 3KKQA 2NG1A 2B7BA 1KMQA 4NH0A 2OZEA 2DWPA 1NMXA 4HSEA 4EFMA 2YWEA 1RRCA 4PSVA 2A2ZA 4EUNA 1X1SA 5FTLA 2ODEA 2ZU0C 1R2QA 1N6NA 2B8TA 2FU5C 1UKEA 1XU4A 2J7PD 1T0JB 4S35A 3QSYA 1NG1A 2CE2X 2GJ9A 3U60B 1VKJA 1C4OA 1Z8FA 2O52A 1FTNA 3FMIA 3CZPA 5D3MB 2R65A 2J0UA 4MYTA 2PMDA 1XEWY 3K0SA 1BH2A 2CCGA 1MRSA 2IX3A 3KQLA 2WV9A 4ZCIA 4PAQA 2QTVB 4URXR 1G21E 1YZKA 4CW7A 2WWHA 1Z22A 3VU9A 2R6FA 3D31A 3X1XA 5DH9A 1DOAA 1OXUA 4D4MA 1ZNXA 2G1JA 2PJRA 1LTQA 2J7KA 3B1WA 3BAFA 3FTQA 2ZJZA 2GK7A 2MSEB 2YOHA 2XXAA 1W4AA 4HUTA 2IYRA 3SFVA 4IXMA 3GCGA 2DPXA 3IKJA 1ZINA 1G17A 1CS4C 4KCGA 3N70A 4LK2A 2ZS7A 1NJGA 4DKXA 1ZU5A 4DSTA 2EFGA 4DLVA 1YZUA 2VH5R 2QL6A 1AS0A 1R8QA 4US0R 4EDHA 1W36D 3ECCA 1UJ2A 1JALA 4DIEA 4ZIRB 3LLUA 2WM9B 3ZVMA 1R8SA 2UZ3A 3SN6A 5TARA 3ZVNA 1QHXA 5JBQA 2ZPTX 5CDFE 3L82B 4XTCS 1KDTA 4KFUA 2WJVA 4JLBA 1GRNA 2F43A 4NYMR 2X77A 4IJMA 2FFAA 3U4QA 4WZBE 3UK6A 1Q44A 1ZIOA 2ZAMA 3W8RA 2J7PA 3LX8A 1KK3A 2JIZD 3HR7A 4HB0A 5L3QA 1UBFA 3QKSA 4Q7LA 4OKSA 5JEDA 4KSBA 2O5VA 1J2JA 3H0KA 3NH6A 4JBYA 5DHFA 3K9LA 3T1TA 2GF0A 3PUYA 4PC6A 1EX7A 4F7WA 3AB3A 121PA 5DN6D 1BO6A 4D6PA 4QNMA 1OKKD 1LV7A 5EZ6B 4B43A 1KY2A 2YOFA 3BE4A 1VIYA 2V1XA 4WZAE 4F38A 8OHMA 2NIPA 5H1YA 1T5LA 1P60A 4KLZA 2MSDB 5HCNA 1NN0A 3OIVA 1XCPA 2QQ0A 3IQWA 2WJGA 2GTPA 4XVRA 4ZPXA 4MKHA 1WMSA 2ZJ2A 4ZKDA 1MO4A 2WWGA 3RC3A 1CR4A 2IYVA 4KHZA 3ICEA 4LPKA 1TF5A 5EUMA 3R9WA 1FX0B 2L0XA 2OCYC 3WBKA 4V0LA 4PHFA 2DYKA 2REXB 2C04A 3KUDA 1SKQA 4V03A 2O8DB 4G5RA 2O8FB 4A0FA 1HY3A 4TMXA 1W46A 2AX4A 2CLDX 4XVUA 4TL7A 3CF0A 5FH9A 3WMGA 5IHPA 2IK8A 2ONKA 3CX6A 4B34A 3HPRA 3AVPA 5JSZA 3ZLJA 4EQ6B 4P4SA 4FWTA 1FOEB 1U98A 2QEQA 2GBLA 1KO7A 3T06B 2QP4A 5P21A 2N46A 1LY1A 1OIVA 3RHFA 3DZDA 4DEYA 4FXPA 2H57A 2IS1A 2G9NA 2FN4A 2JIZA 1D5CA 1TUEA 4NDZA 1KSGA 2NZJA 2J46A 2BVNA 3GLHB 4B2IA 1IAQA 1MR3F 2D7CA 3NTUA 5TV2A 1P61B 4RJLA 1A4RA 3DKVA 5DN6A 3GFPA 1OKKA 3LO5A 3AP2A 2W6JD 4RSGA 3CR7A 5C2JB 1NL3A 4NMMA 4TMZA 1NNEA 1VYUA 3TVDA 1WDTA 1YZLA 1OB2A 1TL7C 4QHTA 2EVWX 3LV8A 2QTFA 2F55A 3KKNA 4JL5A 4ZDJA 2BBWA 1SULA 3PEWA 2ZI7A 3SOPA 2IHBA 1E3MA 3B1ZA 3W5IA 2VHCA 2QM7A 1LF5A 4OBEA 1HQCA 1N6IA 3ADBA 3LH5A 3MG9A 3DHWC 2O8EB 1YR6A 2ZYWX 3RRZA 2ZRAA 5FUYA 821PA 4TMKA 3SYKA 1TPZA 1YZQA 1OXTA 3EPHA 4R2IA 1M7BA 2ZYUX 3EW9A 2WPDD 4CEIA 4HAYA 3W5JA 1Z08A 2F3TA 2EQBA 3TKLA 1SVMA 4W5WA 4IFEA 5FL3A 721PA 3FYHA 4JS0A 3KQKA 4FCWA 3SJZA 2JA1A 1X1RA 3EAQA 1OH7A 3ADDA 3O8CA 1M74A 1PJRA 4B6EA 3SHWA 4ZDKA 1KMHA 4AKHA 4JLDA 5KDLA 2DWOA 4K46A 2AXNA 3AH8A 4PHGA 1ZM4A 4DCSA 2CDNA 1M1YE 4XVQA 1G8GA 2HF8A 521PA 1S9HA 2DHRA 3LNCA 4UNRA 3T34A 4Q4LA 2Q21A 2A5FA 3C4JA 3ZZ0A 2OO7A 2OXCA 4CVNA 3NDBB 1LS1A 4Q01A 1SHKA 1U0LA 4HZUB 1AZSC 2W6JA 2KB0A 1P2UA 3UWKA 3R8FA 2O8BB 1E96A 4EPVA 1W49A 4QNRA 4AYXA 1MABA 3PENA 1W2GA 4PTLA 4V0KA 3I62A 2KE5A 4RZUA 2QAGA 4A0HA 2GXSA 2F1IA 1Z0KA 5G53C 1G4AE 2HJVA 1KNQA 2XTNA 2ZJ5A 3FKQA 3PUZA 5M04A 3GLFB 1RYHA 3MAAC 5TDHA 1ZM7A 1A2BA 5AUOB 4MGYR 2VHTA 2DFNA 5KNCA 3KJIA 3NH9A 4Q48A 3TE6A 1KK1A 2WOOA 3RWMB 3CW2A 1E4YA 4MQBA 1EFHA 1E0SA 3VNUA 4L9WA 1N6LA 3W34A 1AS3A 3W3ZB 5B64A 2WPDA 4MRRA 1YHNA 2GJSA 1QG4A 1U9IC 2GK6A 2WJIA 1GAJA 1N5JA 3TNFA 1W48A 3PUVA 5DYIA 1Q1ZA 2CL7X 3K1JA 1WBBA 3VX3A 1E9BA 1OHHD 4RD6A 4C7OB 1OIXA 1YJ5A 1XTIA 3W8NA 1G41A 1ZM2A 1HTWA 2OCBA 1XD2B 1KZGB 2ZROA 5LDDC 5E7IA 1SVIA 3KTAB 2GETA 5HPYB 2NPFA 3H86A 2CVFA 1QDEA 4HB4A 2QP3A 4A6XA 3AQ4A 2ZETA 4XOIA 1G8YA 4LBYA 3NIBA 1U8ZA 1G8HA 2BBOA 3GLGB 1W0JD 1IXRC 4C0BA 3PQCA 3AEZA 1SKYB 4W5HA 3C7KA 4AC9A 4B3DA 3HP1A 1E2MA 2VTKA 2IYZA 5FI1B 4ARZA 5J5CA 3QBVA 3TUZC 1E99A 4TTPA 2R6GA 4OQMA 4UNPA 1JPNA 1AM4D 2QSYA 4PZLA 3GMTA 5HKKD 3AVYA 5JECA 1P2VA 1EESA 2OAP1 3D7MA 1KDPA 2ERXA 3ADCA 1T3SA 4AYTA 5HR5A 4DLSA 4OHXA 1NMYA 4GOJA 2QBYB 3R9XA 4AKGA 3WHLA 2ZITA 2KJQA 4H1UA 3RS3A 2Z0MA 1M7HA 3WRXC 2W2XA 2JASA 3CH5A 3SFZA 4C2UA 1IN7A 4TLAA 4V02A 4TL9A 2V54A 3SEAA 2HUPA 3MWLA 4B6FA 4NCHA 1OFUX 1KI7A 1KK0A 1MV5A 4HDQB 5EJEA 1E9SA 1FTSA 4M8NE 5J4YA 4LHWA 1AGPA 4CGZA 1KIMA 3A4NA 3ZVRA 3GJ8A 3B82A 1UBGA 2WJJA 4JJZA 3AUYA 1OHHA 4IW3B 1Q12A 4IDQA 1TNDA 2QE7D 4M1WA 1XZQA 2Z4SA 3ZVLA 5L3VA 1G8PA 3I32A 1TMKA 3QPUA 4LV5B 1JPJA 2D74A 1N25A 1ESNA 2GAAA 2BV3A 2YYZA 4UNNA 5JHGB 1DEKA 4Q1AA 4MITA 5G40A 1TQDA 4PC1A 4QJ5A 3T1QA 2HT1A 3VMFA 4PHTA 1CF4A 4JJKA 4ZO4A 2YINC 1W0JA 4CEJA 4GOXA 2F43B 1XBTA 2B92A 4NL4H 3ZD7A 3CM0A 1G3MA 1G6HA 3OIUA 3MRSA 4MRPA 4KAXA 1XMJA 5EE5B 3FMOB 1ODFA 4B76A 4EKDA 4PSKA 5L3QB 4HDCA 2ZM5A 3FKSD 4LBWA 3BRWD 4DB4A 2CVHA 5HKKA 4LC1A 1GRRA 4LV6A 4GBMA 4PZZA 1WXQA 4Q00A 4D82A 4KODA 2FF7A 1ZNWA 4L16A 1Q22A 2HT6A 4D80A 1E1RD 3B13B 1E4VA 2VIIA 4QJ3A 4HUQA 4EFLA 1ZYUA 2NOAA 1WP9A 3VTKA 2ZUCA 4XSHA 4OI0A 1S0UA 3QF7A 1DTSA 1EFUA 4DWJA 1CJMA 3RS5A 4A1FA 1VCMA 2GEUA 1NSTA 4HZIA 1F48A 1N6OA 3WNBA 1CU1A 2A30A 3QG5A 1Q21A 5JHHB 1NVWQ 5H68A 1RZ3A 2QPTA 2D4HA 4L9SA 4PC2A 3ZDQA 3HPQA 4B75A 2UZIR 2ZEJA 3TLXA 4B2LA 2AD5A 4TYYA 1GKUB 3PXGA 4BFVA 1EXMA 3W9YA 2PEYA 1XTKA 1S9DA 2G6BA 2QE7A 2CCKA 2DCUA 2ZSBA 3THXA 1FP6A 1NLZA 2X2EA 1UEJA 4BWYA 1TQ2A 2W00A 4KFTA 1W36B 2CL6X 4Q4AA 5EP1A 2XB2A 4Q66C 4LZZA 4MUAA 4CT5A 2TMKA 1EWQA 1OFTA 4BE7B 1Y63A 3JZAA 3DM5A 4C7OA 2LCFA 4FCVA 1JXOA 1SVLA 4P4SB 4RD0A 1ZNZA 1BIFA 1E6CA 1II9A 1H8ED 2R6CA 2YNMA 1OF1A 1Z29A 2E9SA 4DUGD 3THOA 3X1ZA 2WHXA
chains in the Genus database with same CATH superfamily
1N7JA 1GGNA 1IPEA 4H6VA 2VSOA 4MV4A 2H0AA 2F4VB 1Y9EA 1NYTA 1LLUA 3E2PA 5LWQA 5FAXA 3DLTA 2VBCA 3DBHA 4J7XA 3RSQA 1IWBB 1VIVA 4MNTA 3M4ZA 4E3ZA 1CIVA 1WPRA 3ND9A 4GMHA 4XYMA 5FLKA 1G3UA 4GLLA 5A3VA 1J07A 3OO0A 1T5TA 3ZQKA 4AULA 2P90A 4FYVA 1X1EA 2GM4A 3ND6A 3AL0C 2HDWA 4K9SA 4RD2A 2QX7A 421PA 3SVTA 5IS2A 3OCWA 2W90A 3WA6A 1I4WA 3DLIA 1U04A 4A36A 2AXQA 2JZNA 1P5HA 5GGYA 1X9GA 2VUIB 2C84A 3R77A 4KO8A 2E6UX 2UZ0A 4L9AA 1ISMA 4ZRMA 4BNNA 1QB8A 3RNLA 4KWHA 4L8WB 1BA3A 4NCXA 1KARA 3DMDA 4BATA 1PJTA 3OZXA 5JI3E 4JZKA 2JJ8A 2XCUA 3Q41A 4WZBA 4LI3X 1BU8A 1OY1A 1Z0SA 1DPFA 3HACA 2VP4A 2W22A 2VQFB 3TJZA 4JMPA 3UV3A 2X9GA 3ZQUA 1IHUA 4AJLA 2HJ9A 3C1UA 4GNRA 3RM3A 4C2AA 1CIPA 1PJBA 5ALEA 4UNSA 4OI1A 3FPHA 2PSHA 1Z12A 4BNZA 4CM8B 3KQPA 4YONB 3H9EO 1VE3A 3G1WA 2PWAA 4YMHA 2QRVB 4MW5A 2O7QA 3RDPA 3QE0A 4PGFA 1FP2A 3SQXA 2IYPA 1A8SA 5LD2B 4PYRA 1PHRA 1VE1A 2G9RA 4O4LA 5DK6A 1V4VA 1SKUA 3V7YA 3P2OA 4WKCA 2QZPA 1FB5A 3V9PA 3TR0A 4ZALA 1BXKA 4BEVA 3Q3HA 1R4MB 4DMKA 3IUNA 1T8RA 1KMHB 1MH9A 1U2ZA 5FBQB 3RS9A 3TLEA 1PN3A 4DV3B 3LUFA 3NASA 4Q9NA 1OAOC 2UVQA 1U2DA 2RCNA 3GEPA 3IQEA 1QUFA 1V8ZA 4Q3BA 1E3JA 1CF2O 2IPLA 3H16A 3KYDB 3PNOA 3WL8A 1PS9A 7YASA 3B85A 3C3DA 3IP8A 1PV4A 1YB1A 2ZT5A 3EZ2A 4K8OA 3ZK9A 5BN1A 3S6JA 3L8ZA 2RBEA 2GBIA 4KREA 3ZDAA 2UZ1B 5EHZA 3O0DA 4LJYA 5DBHX 4DE5A 5HF6A 4MRVA 1VYTA 3AI1A 3FYUC 4JJAA 5KOYA 1W9MA 3H5WA 3DE6X 2HMVA 1CEYA 1U2SA 3ANLA 4U39A 2FF5A 3JD2A 2Q4TA 1S89A 2HBZA 3E03A 1QWOA 4PC3A 5A9TA 5HP4A 4A23A 2P9EA 3TPCA 1IL0A 3IERA 4O0MA 1G8FA 2V0GA 3M5PA 5U4QA 2AZTA 4N7MA 5SYAA 4J8PA 3A7EA 4UATA 3RBVA 4DFDA 2OR3A 2WD7A 1KI2A 2GKSA 2D0PB 4N0DA 2WJPA 4N40A 4XD7D 3OZAA 2GEBA 3TF5A 1U7XA 1XK7A 4CUKA 3OQIA 1M6YA 1PIWA 4GX1A 1YH3A 1CQZA 1EUQA 2C2OA 3IAXA 1MA0A 2J6IA 2WFZA 3N75A 4KXUA 3TDKA 5B1HA 4LQ4A 3VTZA 2H08A 1QLHA 2WE7A 4G24A 4WRRA 2B8NA 2PX5A 4XSVA 2C9ZA 2CNWA 4MMYB 5B7QA 3E8XA 3QHQA 1NZJA 2RE8A 1Z62A 1I2MA 1ZCZA 1RWQA 1GSAA 1UK9A 2EFYA 3F6CA 3JPYA 4OUKX 2AE1A 1KYVA 1ZVVA 2D0IA 1ZHHA 4WLVA 4MW4A 2IWRA 4PU0A 1INLA 4EIWA 1EK2A 4P3YA 4CCSA 4CG1A 1JEYB 1VG8A 3EWAA 1OBVA 1T2DA 2ZBQA 3N8GA 3SXUB 4EAAA 3CRW1 3CBQA 4Z3OA 2VT2A 4HNAB 3SR0A 3TQRA 1DWUA 2R751 3KKZA 1GAWA 5E38A 4Z0HO 3R4VA 5D87A 4TRJA 1Z17A 1SXJB 1VTKA 2IYYA 3ISJA 4RVDA 4Q4HA 1P0FA 4FR0A 3PD1A 5IG2A 1IXYA 3RSLA 4DMMA 3DE4X 1I7DA 2ZI4A 3TLAA 2EFCB 2O7NA 5JSHA 1LCIA 2FDXA 4KRFA 4FSHA 3ZJVA 3CZCA 2AN4A 2FSPA 2GLXA 2C0CA 1KEEB 2HRRA 1FDVA 3C5EA 2LPMA 1KVSA 4CKWA 1HFWA 2HU8A 3MMPA 3QUBA 3REGA 3TSZA 4WOPA 2CKMA 3AJAA 4O4HF 1JG2A 3F3KA 3PNVA 3RJ5A 4DHEA 2IA5A 1YS2X 4E1AA 5GVRA 1IN4A 4HDMA 4JB3A 4U2CA 2CCJA 2XCOA 4BLVA 1N9KA 1G6OA 2JI8A 3C3KA 3KDPA 2IYUA 3F8SA 1ZVJA 2R44A 3R7WA 3ETJA 3TQTA 2VG8A 2LIVA 3GHYA 3AG5A 4S1VA 1ZUNA 4M36A 3RODA 2Q5QA 4K9NA 4IKPA 4E09A 1WKBA 2BKVA 2MSCB 2SICE 4GXQA 4FD3A 4RFSA 1K0UA 4XIGS 1R3UA 1GT6A 5ELMA 3ROXA 1XTJA 1Y42X 1YS4A 3PR1A 4IGFA 3CW8X 3GCXA 1JEAA 3HVJA 3LVRE 2WIKA 1MT3A 2VRWA 3H2YA 2PT7A 4C29A 1V1RA 2YH2A 5KTYA 4H16A 2BTQB 4UEKA 2NNLD 1KJQA 3GO4A 5BSMA 4JI8B 2J3IA 1B1AA 2EW2A 4Y9UA 1HDYA 2HCFA 4JUFA 4LK3A 2X0NA 2ZRFA 4RAOA 5G3YA 1S7CA 2PGJA 2QENA 3RVNA 2QNIA 3X1WA 5CXUA 1F17A 3UANA 2OFPA 2QLTA 4MYCA 2ZYIA 1RQLA 4LTDA 1P2TA 2HGZA 1VCOA 1VP3A 2R25B 4K86A 3WZ2A 3VR6A 1C1XB 1PBNA 1H69A 1J0EA 4AICA 4CMGA 2DSTA 2B82A 2FSVC 4YRDA 3ZV5A 4CLRB 2QGFA 3H1GA 3NONA 3PDWA 5DSTA 2IU4A 3M3HA 3NHPA 4YP5A 3GLIB 3HTXA 3OJWA 3ZJUA 3KJHA 4UPDA 5EEGA 1KE2A 4E7PA 1H4SA 5K0LA 2QD3A 1HWYA 2W6PA 1T36A 4WA8A 2AK2A 3IP1A 3ZV4A 2IZOA 1WCYA 1J1UA 621PA 1JXMA 1SVUA 1JJVA 1TECE 3HADA 1PS8A 4GI7A 2DJ5A 4E2XA 2AFHB 5B7GA 5BUZA 1YA8A 2JS7A 2SKCA 4DMHA 4RK1A 1UT6A 2H4FA 3T3OA 1QE3A 1C9YA 2XDQB 5IDYA 2QUBA 5IK2A 4OHZA 3TQFA 5CFMA 5CEFA 1CHDA 2CXPA 4PGMA 1MN6A 1G16A 1TD1A 2JVKA 3W78A 1Y5LA 4EO4A 2EBUA 4QUAA 1JHOA 2X1VA 4AJPA 4AM8A 1FVFA 1HQYE 4Z9FA 1ZS9A 4NMHA 1ZSYA 3AGQA 2VQDA 5J2UA 2RG1A 2W6ZA 2BRUC 3OZ7A 3KJQA 3EWSA 3JZFA 4HAVA 2XWJI 5JCZA 5C1DA 4C2TA 1PFYA 4UASA 2GCNA 4EJSB 3OQVA 1P0PA 4B3TB 1EHCA 1TXGA 3U56A 3WRVA 2XF8A 5BNIA 1K75A 2PWBA 3WYFA 4X41A 1OCEA 2QNBA 1JHMA 1GDDA 1YZYA 1HBJA 3N2IA 2POCA 4RF5A 2OZLB 2Q1SA 2X2PA 1SPBS 3B60A 1LSJA 2JAQA 4X3OA 1ESDA 4NHOA 1H2BA 3O4GA 1G7TA 2VDWA 5E1OA 1C9KA 1SUBA 3P5SA 1KZYC 4R9VA 4FLEA 4M38A 1VE9A 5I8WA 1KI4A 1MEOA 3T5GA 1NOKA 3GZTB 3A1TA 4QFBA 5AVTA 1RW4A 1KI8A 4OQYA 2B94A 4NJMA 3T7SA 1TMOA 4FTWA 2ZJ0A 2Y1KA 2KBFA 4Q7JB 5M7EA 5IRCD 4Z53A 4OQEA 3DUFB 2PS9A 4NHEA 4A26A 4D96A 1F38A 2DUNA 4C4XA 2X5OA 3E3AA 1IYZA 1KSFX 1K6EA 4WKOA 3ZCTA 1EBBA 3PCTA 5AIAA 4DLPA 3MINB 2BFMA 2GHTA 3NC1C 3CEAA 4NRDA 4EVIA 2CHGA 2QPLA 5EMJA 3BAZA 5LD2C 5MFZA 1YF3A 5B3AA 1RYNA 1T26A 1T2NA 3ZH2A 1G63A 1XOIA 4N3AA 3C6MA 4XWOA 1QRDA 3QENA 4O33A 4FOPA 5CMLA 1WETA 3W8DA 1ZGCA 2XPCA 1P1HA 4RNDB 2YHSA 4KOAA 4ZT2A 3WGYA 5BOSB 5GGXA 4N0QA 4DV4B 3INGA 4MRAA 4WEOA 1V37A 4GX2A 2QG9A 1QCZA 2O9JA 3BREA 2DH6A 3STHA 4W1PA 1KQOA 1V11B 2AXEA 5CLQA 4YCAA 3QPDA 2LGJA 3U16A 3JSAA 4LRSB 2MSNA 2FJPA 2B8WA 4RVUA 4TRNA 2QRLA 1FPMA 4EGFA 4EGCB 3AIOA 1R0YA 1R88A 5DNEA 1L7QA 2P69A 2H85A 4GP6A 3ZZ1A 2HYIC 2W0MA 1A5BB 4JVMA 2Y0DA 1ODJA 2VPPA 1IK4A 1DB3A 1XTSA 5FOVA 1C0KA 3BULA 4WCVA 1ISJA 3PRYA 3E4CA 3ST7A 3CF6R 4DCTA 5GJWC 3VOBA 3U7EB 5B2EA 5JANA 1ZSVA 4Z6KA 4I5IA 4EG1A 3KQYA 5HBGA 4TQ9A 3MPOA 4WZBB 4FMDB 1PHPA 2PT5A 1GQSA 3BSYA 4D97A 2J5QA 1GADO 3SIWA 4N8SA 3RHTA 4RELA 4XM2A 2JFGA 4DREA 2VRCD 4CR6A 4XJSA 1RXUA 5CIYA 1SURA 1SC4A 4TWBA 4WWHA 1NMSA 2A1UA 1HF3A 2H7XA 4DLTA 4E3WA 3PUIA 5K4HA 1KHTA 1SMKA 3C3XA 4ID9A 1D3AA 1ENOA 1YCHA 2VJCA 3WG9A 1XDZA 2F1JA 1EE2A 2OGSA 2C42A 1B14A 2VJMA 2Q4OA 3QTBA 4GSKA 2IOHA 5FPQA 2O1XA 1BAPA 1Q6ZA 4PO8A 4R7ZA 5HDBB 5ITVA 3UAYA 3IB6A 2GPWA 1NJ8A 1Z4PX 3WK4A 5EERA 3L1KA 4RJTA 2G80A 3KQHA 1UZUA 3QXXA 3FBTA 1IMOA 1HSOA 1KIFA 1VIMA 5BPFA 3VISA 3SC2A 4C7JA 3TX6A 3H9GA 1WZNA 1SXJC 5H82A 1HE5A 3ECSA 4LE2A 5I9LA 1U2TA 4KXFB 3G6WA 3KDAA 4PW0A 3T0IA 1J0DA 1YTLA 2GN0A 2A5DA 2J6BA 2M6LA 4B81A 4X7BA 3SX2A 3V8MA 3O95A 1X6VA 1T8PA 4X0EA 3RSSA 3TZCA 4AO7A 1ECFA 2Q28A 2RH9B 5I5GA 2CLFB 1L8QA 2F00A 3GL9A 4PZCA 4PYIA 5JJBA 3PHLA 4IIDA 1KSJA 2VBFA 3OPXA 4HX5A 1Z4KA 4DIBA 1Y3AA 2V96A 1E1YA 2FMFA 2Y1LA 2I3GA 2OMEA 3CRMA 3PGJA 3ZKWA 1P2FA 1BC5A 4RZIA 3VPCA 1UQUA 1QRUA 4D9NA 1JLHA 2GCOA 1U0GA 2Y4NA 3HKCA 3M7IA 3PTLA 1GCAA 1H2AS 1YRLA 2CVZA 4I4LA 1LBHA 4BY9E 1F2TB 5GV8A 2IQ5A 4XGNA 1ODLA 2V5UA 1Z47A 2WD7B 2Y77A 3KALA 2AA3A 4XUCA 3A4VA 1BX1A 5M2QA 3OLZA 2YOGA 3EUWA 3ZOZA 5F3DA 2E37A 2ZANA 3D5QA 1V2HE 4I55A 4ND4A 3UWDA 2GO1A 1VJTA 1KYZA 1PDOA 2W0SA 2J45A 2O2SA 3V00A 1QP4A 3IV7A 4QO7A 4FDVA 4IP0A 1TCUA 2JFBA 2RGGA 1WB5A 2DFVA 3BJMA 2VA8A 1W88A 2NVUB 4JJEA 1P9WA 5EIEA 5KKNB 4HSGA 5ISMA 3I6IA 3VHLB 2HA6A 3AVUA 3W2EA 2IEGA 1SHUX 2GDZA 3H1EA 4BC0A 1U3DA 3LECA 3DOJA 4FKZA 4OXXA 2L2QA 3K70B 5AW7A 3BMCA 2I62A 4B8YA 2SECE 2H1FA 1AZLA 2PH7A 3QMPA 1SVKA 3V2IA 3ZHCA 5B37A 3FG9A 1WXWA 1WY7A 3RYIA 3TXXA 2G7MC 7REQB 1H3EA 2OK7A 9MHTA 4G26A 3V8QA 4DSAA 3N2KB 1Y5NA 4HLQB 4Y0AA 2G8LA 2WM3A 4YJDA 4ZK6A 4PXAA 3V80A 2QOEA 1E89A 5AHXA 3WY9A 2BCJQ 5AJHA 5JBNA 3CNBA 4DQKA 1AQJA 3AZOA 4FILA 1SHZA 2IIBA 2A5LA 3I2GA 4NI5A 4Q4HB 1NZDA 1W93A 1Z7WA 2IYAA 2IBMA 3I2FA 3N39C 4XJXA 1HFKA 2GT1A 4TLEA 3R5TA 5L6MB 1HRDA 1Z28A 1Q17A 2PE5A 2ZVQX 1ULZA 1YZHA 5EHXA 1Y5IA 2GLTA 4IVQA 5CT9A 4B80A 4KV7A 4B6GA 3OWOA 5AM3A 3DDZX 4CKWB 3HDTA 2QKYA 3ZZMA 1JPUA 1QYCA 2EW1A 3IS3A 5FWXA 4BECA 2GJ8A 4C7XA 3C7AA 3PQ2A 4ASUA 4Z4FA 3C14C 2FN7A 2ENWA 3TTSA 1E2JA 3UK7A 1W5BA 2DPMA 4G07A 5ERXA 2Y76A 3LAWA 5HHTA 2ODPA 1HOTA 3R7WB 1TOAA 3LDFA 1SG6A 3OPMA 1ZUNB 1U2QA 2AF4C 4Z4EA 4M2LA 1L4LA 4GM1A 1DELA 1TUIA 4YACA 3NHYA 3ELUA 4HC4A 4II3A 3ODPA 3QLVC 2J1LA 2A5JA 3IJRA 1Q74A 3K2EA 3WRYA 2PLRA 3NC0C 1AUVA 1KAQA 2EW8A 1T25A 3GOHA 3KQMA 3C3WA 1IZ0A 1HNNA 1LQ2A 4O3FA 1FMLA 1SEPA 4J07A 2NVOA 4DIKA 2OY0A 4D26A 4XDHA 2OOKA 3DAFA 1S2DA 4OAPA 4RJIA 3O9VA 3CO5A 2P6NA 4U7JA 3W5CA 2FFJA 1XAIA 3MWDA 2R86A 1DAKA 4NAUA 5AXDA 4LWPA 4F60A 1UUFA 2X7JA 3HJTA 4IICA 4QLBA 2HHLA 4FWBA 4XARA 4D4IA 4OYHA 3LZCA 3GLRA 3MT9A 4IQ4A 4M53A 3RVBA 4URVR 5IF9A 1KEKA 2AJBA 5EKUA 2IZ1A 4YJ3B 4OIMA 1H2RS 1JE1A 1JKFA 4C6RA 2BFDB 1XHEA 1XZBA 3MLAA 5CDUA 1M10A 1U7OA 4JNCA 4P84A 5DVZA 3RTEA 3ZGYA 1FYFA 1D5WA 1OQAA 5E1MA 1RJ9A 2G36A 1QQ7A 5PNTA 5FDFA 3PNKA 3AY3A 1ONBA 2RG7A 3ABSB 4IHAA 5K7SA 5LYJB 2D7DA 4XFJA 2VTEA 3T95A 3WP1B 5DGXA 3CB2A 3O84A 5B3LA 1NNI1 1UBTS 5DTIA 1YTUA 2XKAA 4JEMA 4GMKA 2FW6A 4MJLA 3D3WB 3N07A 4JYCA 4LOHA 4YEDA 3TRKA 1OX6A 3UWOA 3DF9A 4FMPA 2ZP1A 3IL2A 3NVMB 4IIYA 2WT9A 2LKDA 3CX3A 4WQMA 3RS2A 5ALRA 3B2NA 4Z4CA 2AHOA 3RAPR 4RUKA 2CWWA 4KE6A 1QHHA 4EGAA 3DOEA 1KQFA 2DBYA 5JUWA 2WV7A 4CV3A 3PHCA 1XWFA 5AJXA 1YZFA 1I5OA 1UEIA 4LJ4A 2Q45A 4MWGA 1FW6A 1GPDG 3CLKA 4PR0A 1WDWB 2VN8A 4CL2A 9GPBA 1EFAA 4DLWA 1WIWA 3EZYA 4HNQA 2XT6A 2CKDA 1PX2A 1XWIA 3UAGA 4WAUA 1W4CA 2ATCA 2C3YA 4KPUB 2VDWB 3CZRA 1ESZA 4W5TA 1H9BA 1XMVA 4ZMSA 5IM4A 5JNRA 2GXAA 3K5IA 4ISBA 5KYGA 5D3MA 3QFTA 2IVFA 5AKXA 1AMNA 3EBPA 1RBZA 4NJMB 3Q5GA 1BX0A 4QBGB 1V4BA 4GZ3A 4TS1A 3FOCA 5JYBA 4Q02A 5IVHA 4QYXA 5MDHA 1BWSA 4GKBA 1HMYA 4MEBA 3ZUPA 4LOAA 4P81A 5KTKA 4RLQA 1JN0A 1RRVA 2BCGY 2FFHA 2VLBA 5AKZA 1FE8A 1Z4NA 2VT6A 4MVCA 3GRPA 3ZYCA 4IYRA 3GW8A 4JSYA 3M6IA 3VPDA 5EIXA 4NICA 1K7YA 3RS0A 1PK7A 3BXHA 1TK2A 3I5XA 1YB5A 2YWFA 1Z8HA 2JZCA 3AF5A 3F71A 3I1IA 2EGGA 4L51A 4Q5IA 3X1DA 2L17A 2YMQA 3LA6A 4CFZA 4E2FA 1XGKA 1HFJA 3FNGA 3FW1A 2HMAA 1Z5OA 5AOCA 5IBRA 4KYTA 3SQOA 3V55A 4AD8A 2BKAA 4YREA 4BKRA 2Q5LA 4C3OB 2HV8A 2Z83A 3FZQA 3R9KA 2YS6A 1BCRA 1PJQA 2W8BA 4I4NA 4IV5A 5KYKA 4FE7A 5DULA 1C7EA 4L5JA 5E9AA 4TLMB 4PLGA 5LBUA 4HRYA 2Z04A 2VUHB 4WK4B 1SHJA 1OASA 3QTTA 1Z4OA 2XCIA 4JBXA 3G2HA 4YJ2F 3VYWA 4N76A 4Y2RA 5BN4A 3P8ZA 3ISTA 1UWVA 1MX3A 2HW8A 2WNHA 1KZHA 1IM5A 1Z2OX 2VF2A 4MVWA 1C7QA 4V0MA 4YO7A 1Q0SA 2M32A 3V4FA 5EKXA 5A5GA 3BTOA 1ML4A 5EEHA 5C51B 3E5MA 4OO3A 4UW9A 3RJTA 4GU5A 5KTPA 1BXZA 4R40A 1XI2A 1Z7BA 2EQ5A 1JQBA 3NWBA 4J91A 1XMSA 4UARA 5AJUA 4LSZA 3ROZA 4LHXA 2OUKA 1LWNA 4R9UC 5TPZA 3ZBPA 4BMVA 2C8LA 1THGA 2DTXA 4C5BA 3OU2A 4K6HA 3C5HA 4W5OA 2A4MA 2Q41A 3GFBA 4YRKA 5G4KB 3BFKA 4UHDA 4NENA 3ELDA 4H17A 1R6UA 4RABA 4KWEA 3KYCA 2NNWB 3FPGA 1FYDA 3ZWNA 4X1OA 1UWLA 4ESOA 1ECJA 2Z57A 4JVOA 3VR0A 4YMGA 2WIGA 2ATXA 1MAVA 1N2OA 4NOLA 3SICE 3NUZA 5JASA 1I13A 1JUDA 4E4TA 1H6DA 1N2CA 3K70C 2RH8A 3GAZA 4PQRA 2I76A 2P4QA 3AWDA 2BGLA 2PVPA 3GIWA 3RI3A 3O4RA 1EUYA 4CI0B 1J33A 2WU3A 1QBGA 2WYWA 4OM7A 3UNXA 3G2KA 3VSEA 4MLZA 4CQNA 4WGGA 1IM2A 2F9MA 2QROA 2ZRBA 2HREA 1NOIA 1QGDA 3CLTC 4KO2S 3U19A 3MEQA 4FW8A 3D3EA 3EXHA 3RFUA 2C58A 4ZT7A 3WLOA 3LQRA 1GLVA 1FYXA 1E2PA 3OBIA 4E46A 4LJ7A 1A2OA 2NU6B 2AB0A 3TECE 3OCVA 1F9EA 1DC8A 2EV9A 2G3YA 3ANTA 4ADSG 2C2WA 3NT4A 5K8TA 5LPNA 1M2FA 1YBAA 4X85A 5LQCA 5EJMA 3JQFC 1UMBB 2IXGA 3AHFA 1NYQA 1CRZA 2QTLA 3VOAA 2Q5JA 1VL0A 2C98A 3C3YA 1EGAA 4U5XA 3A1EA 4DMCA 1MAWA 1EP9A 4RMNA 2P65A 3Q85A 5EQFA 5G0TA 5JCJD 2UYGA 1GZUA 5IASA 4QU8A 3VFDA 3EY4A 3QHAA 4ZT4A 1JYSA 1PVVA 1W2WB 4P3NA 5LP6B 4HNGA 3O8QB 1XZLA 3HWX1 3IE1A 2GCOB 3BE5A 3HKCB 1VXOA 3HA2A 3LXMA 1P9NA 3P9SA 4DRZA 4B4DA 3D8BA 2VC2B 4BRUA 1SQ0A 1SAYA 1YMVA 1V8OA 3EGDA 3L0YA 4I81A 3ZWOA 4BYGA 3TLKA 1VKOA 1TM3E 2AVNA 1SJ9A 1V7QA 2O0LA 2RHMA 3B1KA 3L4BA 1DADA 4YRTA 3P0IA 4CE6A 1BMFD 3E7WA 1A8IA 2ZLBA 5CB6A 3M4XA 4PAWA 4PO1A 2XUZA 2NX2A 4EECA 4JHLA 2CGEA 5ALPA 2WDZA 1KS9A 5JH7A 2H51A 3CBGA 4B4KA 1C3OA 1R0ZA 1M2NA 3F67A 3FCOA 1NDUA 2OCDA 5DHPA 4FB4A 5CFPA 5D6NA 4M87A 1Z5WA 3V8RA 1FC0A 3IOMA 4F91B 3WWDA 1S7GA 3AERA 4ZAFA 3SNHA 1VM6A 3D2AA 2I7VA 1E0DA 5IJ0A 5H16A 2GHQA 1UFOA 2WAXA 4ICIA 1WCIB 4EABA 1DNPA 3EVZA 3OQ1A 2HJRA 4DSNA 3BMCB 1LNZA 1B23P 1SXJE 1PL0A 1L5HA 1JI0A 1A8PA 2QXYA 2V6IA 2RHLA 4IEIA 4WI1A 1JT2A 4JJ7A 4LVNA 1B6RA 1UBHS 2OENG 4WNYA 3I5UA 5HBRA 3GJ6A 3A11A 4RANA 3N8HA 4ILKA 1PUXA 2XNKA 4W9NA 2WNSA 1NKVA 1U0EA 4YVFA 4XI9A 3Q87B 1M34A 2EX4A 3UC5A 1QUEA 4OLBA 1RC0A 5FTKA 1N78A 5A4AA 4QGGA 4DPKA 4LI0A 4EYQA 4AZ0A 4EM6A 2ZB7A 2XBUA 4KGDA 4F71A 4JJ8A 1T3ZA 1ANKA 3MJDA 1GNVA 4O02B 1CJUC 2AOTA 3OSUA 4MP8A 2EF1A 1JB9A 4WFIA 4YMTA 3F2IA 2C59A 1VIDA 5E2IA 1XXHE 3O8DA 4YBRA 3AFGA 4P5EA 1A95A 5E4JA 3GJ7A 4NXMB 1PLKA 4N9WA 2HQBA 2Z5VA 4S1WA 5JCPA 4JITA 3ZE9A 3IIIA 1DRVA 1LBSA 2J4CA 2YZMA 1AKWA 4FGWA 5CXSA 3TVTA 2J07A 3PHHA 3QTLA 4NFYA 3MWYW 4ZU1X 4LTNA 5HFJA 1WMEA 5ICEA 4W5RA 3HCNA 1YCFA 4LDJA 3ZE2B 1J06A 1EUDB 1SA0A 2DUWA 3IAS6 4TYPA 4RKQA 1O4VA 1N6HA 3VDRA 4NVRA 5CHYA 4BMZA 1JU3A 3NAGA 5DXAA 3DDUA 5EXEA 2GESA 5BSHA 1C4WA 2HJSA 3ABRB 4FZVA 3H1BA 1QH8A 4JL8A 3STWA 5JZVA 2PAAA 2PUEA 1NY6A 1GRQA 1IWOA 4IIBA 4MVJF 3FAKA 4QFDA 2VYND 4WNIA 4FFDA 1Q50A 4JX9A 1A5TA 1EGMB 3WMEA 1P31A 3SJBA 4DCUA 3D9QX 3MCZA 1NWHA 4O8CA 5ALWA 1ZW1A 2JGEA 4HEA1 3GVCA 2D59A 4JR0A 3GLIE 3EPKA 1VG1A 1F3LA 3MWDB 4QUIA 5B5SA 1ITZA 5ADVA 4LF9B 3KT3A 4LY9A 1YDHA 3JZMA 4JEIA 5D3QA 4UE3S 1MB3A 4U9HS 4FYJA 3RKRA 3ZQ6A 2Q1YA 2R7MA 3O2SB 5KTTA 3ACBA 1CNMA 2KW5A 4I9GA 1I3MA 1XELA 1D2EA 2AFHE 4C4AA 4TPKA 5JWRA 2DXIA 1IMJA 4LJSA 4E31A 2YICA 3L6EA 4Z9XA 3B8HA 3CLRD 2F1HA 2HXGA 3IV9A 4EGJA 3IHLA 3I12A 1RFLA 4A92A 1XRQA 1DWOA 1X86B 1YHYA 2J4DA 1W19A 2OESA 5K3SA 3JQ6A 5L45A 3R9XB 5HCUA 1T4BA 2ZAIA 3LD9A 4GZMA 5JU6A 1RM0A 2H5EA 4G8JA 2DKOA 4MR9A 4RETA 3QPCA 4QX6A 5F7ZA 1NVMB 5C18A 3NAMA 4OQLA 1Z25A 3RQSA 2DLNA 2ZK7A 5IVIA 2F64A 2X40A 4OTZA 5AVKA 1M8KA 4C1NA 3G9ZA 1EINA 1K4MA 3JWGA 3ZWAA 3KTAA 3OLCX 5TB5A 3WL5A 1QHHB 1U8FO 4K6GA 4GHWA 3DP9A 3LUJA 3THRA 3EPJA 1YDGA 3UW1A 2PZFA 2HDNB 2IKSA 3AFHA 3D4PA 3KLNA 4KFSA 3VO1A 4QBIA 3GLGA 4Q9JA 2QS9A 2F3SA 5J3JA 3ZLTA 1EM8A 5EMHA 2KM1A 1AE1A 1E7SA 4HAOA 4YAWA 4ARIA 3TUJC 1Q0RA 3QNWA 5DYWA 2F17A 2HO5A 2QRGA 1NV8A 4L73A 4QXPA 2E18A 2JFUA 1GTL1 2FDRA 2J0VA 2G0NA 1I0ZA 4I99A 2RHGB 3W5DA 2JFYA 3OAAD 1UC8A 3OCUA 5H81A 4C20A 1NM5A 4CEJB 4TT3A 4ZCSA 4RPCA 4ZP1A 1HC7A 3JVVA 1YDEA 5DHQA 3LW8A 4R69A 5C0OE 4D9MA 4WY8A 1CJCA 3A3YA 4HUJA 3PT9A 2VPYA 2B7LA 3L7LA 1JLRA 3QVGB 4PLVA 2IOQA 5A3JA 2ZSFA 1BYIA 1ZHFA 2ZTSA 5ENZA 5JZ9A 4GM0A 5B12A 5KSYA 1VFPA 3LI2A 2FMXA 2VHEA 3EY9A 4Y2YA 1JILA 3O74A 3SPXA 4ZN6A 3B1VA 4TQAA 1KGDA 2JHGA 1H2XA 1Z3IX 2IUUA 3W9BA 1CRQA 3O1LA 3AETA 3WWPA 2QRPA 3JYHA 3GEHA 4NESA 4BFXA 1G1MA 1RRGA 2VJDA 3EISA 3HKBB 2XAUA 4FR2A 4ON9A 4P33A 4PM4A 2FLVA 5TQ2B 1PO7A 2IPAB 5FWYA 2OXRA 3GDFA 1ZX1A 2IHKA 4ZCQA 5IANA 1NT2A 1ZD3A 3T9BA 4ZC1A 2UZ4A 5E1BA 4ERNA 4MUIA 3H9UA 5BR4A 3ZE7A 5IJWA 5EPUA 2I2BA 4AN4A 3F5DA 4BB9A 1J20A 1GL9B 1OW3B 4GMXA 1VZ3A 1HEIA 1Q57A 4LWZA 5ERGB 1BCRB 2NXJA 4V0SA 4F0JA 1QRAA 1CDEA 3MIIA 3J7AC 3LMKA 3OTIA 4YMVA 3PC6A 5A05A 3RF7A 2CMHA 1XMPA 3IDSA 3AIIA 4YMWA 4HI0E 5J5VA 4YP0A 5I48A 5KHOC 3GDHA 1IY8A 3L79A 1X1CA 1EK0A 3OLWA 2XA2A 4YJKA 5AOVA 1RTTA 2VDPB 3NALA 1DKLA 3NETA 5LP6C 1SU6A 2GPAA 3BH6A 3AGPA 2NZXA 1HDGO 3IKTA 3AR3A 4Q4AB 2I6FA 3JYPA 1VMEA 3MWKA 5BW6B 1LDYA 3MIZA 4BVKA 3K1AA 4BXOA 4NKRA 4UUQA 4D92A 2FR8A 2VKQA 4HY3A 5FB3A 3R5XA 1R6AA 5B3KA 4MQ4A 1MOZA 4OHYA 1Z0IA 2C5GA 4FFSA 4C7OB 2D62A 1G7SA 4KN5A 4N39A 4I6EA 3RAFC 1SBYA 4HB2A 4UMEA 2FWMX 1SD5A 5BUCA 1MKYA 4C7KA 3AZPA 4KYIB 3FF1A 1TM5E 3NTRA 4R1TA 5DLYA 4IIXA 3MJEA 1U0RA 2ON6A 4R3WA 2CFOA 3H2KA 2QTCA 3KYCB 3CFYA 3MJHA 2G67A 3DOFA 4HHEA 1SRQA 1XDSA 4PG7A 2NAPA 3R3SA 2Z30A 1THTA 2LW7A 1JKXA 1TAHA 4FMDF 1EWTA 3QY0A 4J29A 3W79A 3ZBUA 1C9DB 5KVQA 4S1NA 2JGJA 5EZSA 4AI6A 2GEDA 1WSAA 4QU9A 1QPBA 3KELA 3DDCA 1B74A 1KY3A 3Q7TA 4F6LA 1S2NA 2Q5HA 2YCBA 3OO1A 1MP0A 5G0VA 4CN9A 1Y6FA 1GTRA 3E9QA 3IT3A 1KDRA 5F77A 1BHSA 4EI7A 3NI2A 1RQ7A 4BO3A 3ETLA 2IZ6A 4IQFA 1ZCAA 4BO8A 4ETMA 2CHQA 2OFXA 1JFRA 4ZOBA 1DAFA 4CKYA 4UBIA 1YB4A 1U5CA 3C43A 3GGSA 2A35A 2FSHA 5CNKA 1X1DA 3UMSA 2R8RA 3LX4A 2JFNA 2XVMA 3FDXA 4TXHA 3GH1A 4JROA 2VP0A 4A27A 5KVVA 4C0KA 1GLGA 4NU6A 4PX2A 4C14A 2VHUA 1WEHA 2M6RA 3NOOA 3KJFA 1BWRA 4FYXA 4IH9A 1QDUA 1YR1A 2OWEA 3BS4A 5E4YA 5FJIA 4PE5B 2VUTA 3PFBA 3VGPA 2Y2VA 2FWJA 4IVPA 4W9MC 2BSXA 4MPPA 4UBMA 4PX9A 4AIIA 4EX7A 5BNTA 2P1RA 1KQ3A 2P2LA 4ETWA 5IXSA 1J39A 5EJIA 2DLCX 5EQJB 1QG2A 4JX8A 5EUQB 3WGMA 3WLFA 2XWQA 1P29A 4MLDA 4U0JA 5F2EA 3V1MA 1XF9A 4HFJA 4CMAA 5IULC 3G02A 1TLFA 3IO3A 1YKSA 1JECA 1VJ0A 1Y8QB 4L07A 4WY2A 4N03A 1C7IA 1QGAA 2OSBA 1VBMA 1Y6JA 2AMYA 1JIIA 1LFDB 3GPBA 4HLUA 2XMQA 2B7CA 3LT5A 4YAKA 4ZVQA 4O1HA 3L6UA 4CM9D 2VXBA 3WRYC 2HCBA 2G0TA 5DU2A 5IBPA 4O2LA 2VJBA 1XN4A 2IIVA 3CXUA 5EJGA 2P3LA 1E3IA 3RAGA 3SC6A 2CV2A 3IIEA 3SZRA 5COQA 4ZJUA 1BXRA 2VF8A 3P4YA 4PAGA 4IZIA 1H2EA 5JNLA 2GA9A 3BBLA 4P34A 2O1SA 2XSZD 4URUR 5FNVA 5NULA 2AI3A 1UFKA 4M7OA 5JS1A 3P2JA 3OQBA 2QZ4A 1F2DA 3HDQA 5B7NA 1GQQA 1IBRA 1NXXA 2JGDB 1RZUA 3AV0B 2X4LA 3LRTA 3QI2A 5IJ0B 1F1JA 1IN1A 2C2MA 1PEKE 3BTUA 1YE8A 5CLHA 4B73A 4Z1OA 2G9ZA 3N6XA 3QMWA 4OP2A 4BNHA 4QO8A 4EPWA 3NHWA 4RMJA 1ATIA 3QH4A 4J03A 4B17A 5TMEA 3NHZA 4NCKA 2LRHA 2Y1XA 3C45A 4K6CA 5FQNA 2WSBA 3UENA 3VC3A 2H1OA 2I1QA 2WUVA 2XGGA 4YDQA 5KJ6A 2FDCA 5D51S 1EWRA 2DPYA 4IJKA 4U9UA 2R11A 2ZRLA 5DW0A 4J2HA 3LG2A 5DMHA 1PQ4A 1W5FA 1OLSA 5HVNA 1WZCA 3LKDA 4R0VA 3S8YA 2WA1A 4I5GA 1YQGA 4B32A 2AC4A 1FDIA 1M34B 1JR3D 2I1VB 1WVGA 3A3NA 3Q4GA 1ADCA 4AZ0B 4ZAWA 4D0NA 3QPAA 4EUEA 3UCXA 4DJJA 2C0QA 3PE3A 2AN1A 4L5BA 3HU3A 2PZKA 2VP5A 2IHYA 3AKYA 3B9RA 3G59A 4RK5A 1EFRA 5TGZA 4NJEB 3AVWA 3WHPA 3H3JA 1BS9A 1UMKA 8LDHA 1CETA 1KFCB 2A57A 3V5NA 1U7HA 5KU7A 3NAZA 5AVJA 5A4JA 1RIFA 3DULA 1XYYA 2GAFA 1WPXA 2GN1A 4JUIA 2H7VA 4JGIA 1NXVA 3KSRA 1QIHA 4D5GA 4ERXA 4R1SA 3EARA 4Y0NA 5BORA 1PFQA 3KQTA 1NMZA 3S1AA 1SA0B 4C30A 1QH1A 1XJ0A 2AL7A 4JWTA 4N6OA 4HWOA 4F8YA 4KOEC 3G0GA 1C30A 3TSYA 1R18A 2DT5A 2X6RA 1FFHA 4R3NA 3W0LB 1O6CA 4BTEA 3GFVA 2FY8A 3FWPA 1DEHA 4FXOA 4DVJA 1WSDA 3KSDO 1AB6A 4BBAA 1KFJB 2P6MA 3Q7RA 4HDRA 4QGAA 1NDQA 3GQBB 3L7YA 3PPVA 3USES 1EXDA 2XR1A 3AWIA 2B4YA 3GXBA 3JATA 3C1OA 4FQ7A 1CY6A 4E11A 1TTTA 1L1QA 1PP4A 2UU9B 1O8BA 2VL7A 1NKSA 2MYUA 5K4AA 4I2VA 3IRUA <