2Z5FA

Human sulfotransferase sult1b1 in complex with pap
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
b'PKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKRKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfotransferase family cytosolic 1B member 1
publication title Crystal structures of human sulfotransferases SULT1B1 and SULT1C1 complexed with the cofactor product adenosine-3'-5'-diphosphate (PAP)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.8.2.-:
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2z5fA00
2XZOA 3GFPA 4UQOA 3QF4A 1EFRA 3GLFA 2WAYA 5FOVA 5AUOB 2HT1A 1PUIA 3ZLJA 4I81A 3MGCA 4TL8A 2OXRA 3KB1A 4IEIA 4ZV4A 3BH7A 3ZDQA 4JLBA 1S2MA 1BYIA 2CLSA 5JI3E 1ZCBA 4P32A 4DIEA 3F0TA 3Q8XB 1SHZA 3EWAA 5JZVA 5KDDA 2JATA 1VECA 2AFIE 1L2TA 1AKEA 4UNSA 2RB4A 3BH6A 2O5VA 2J0VA 3GLFE 3AVUA 4OHZA 5A0FA 4LBWA 5DYIA 2F1JA 3QPWA 1F60A 1S96A 4EJSB 1WQ1R 2YWFA 5GJBA 1Z0FA 4IDOA 3TK1A 1RRFA 4LY6A 3KKNA 2IYSA 3KFVA 1II8A 1KI3A 1DARA 1RRGA 3LAWA 1TQDA 2ZRNA 1OKKA 721PA 3CRVA 3PUZA 1ZM2A 4IKEA 5GJVC 2HLDA 2IYQA 4RFVA 3EC2A 4MKHA 3WP1B 4DDVA 3WXMA 1B23P 1II9A 2ZR7A 5FTJA 2DB3A 1J70A 2OLJA 2Z0MA 1Z28A 1Z0IA 1MKYA 1IXZA 2IEYA 2UKDA 1UDXA 2P5SA 4DDTA 1T9HA 3L43A 4W5HA 3NHBA 2XTMA 4MGIR 3NEYA 1IN8A 1CR4A 2J3EA 5D3MA 1UEJA 4TQ9A 4WZAE 2C03A 5TY0A 4KITB 4TYYA 3OIUA 2IYLD 1KY3A 2GZDA 4L9SA 4Q9LA 1II0A 1ZNWA 2ZJ5A 4WBSA 2HJGA 1J7KA 1OFUX 1UDWA 2LKDA 2CHQA 1E2IA 1OV4A 3FE2A 4DKXA 4N3NA 2NTYC 1V5WA 4KI0A 2NO1A 1UPTA 4B2LA 4C0AC 1OH8A 3B60A 5SZIA 1Z0KA 4DLSA 1VTKA 4DJTA 1KI4A 1QDEA 5FBQB 4ESHA 3M1IA 1P75A 1Z6XA 3OFNA 2ZS7A 4H1UA 1OIXA 4NYMR 1W4RA 2CJWB 1Z8FA 2BV3A 3H0KA 3GPLA 2BMJA 2ZE6A 5EP4A 2QTVB 2HCBA 3EZ6A 1Q1ZA 1OYWA 4W5JA 4B3DA 3DOEA 1R7RA 1N6NA 2QP9X 3RSLA 4BFYA 5AJYA 3LH5A 1W49A 4M1TA 3K0FB 4F38A 1IY2A 1XEXA 1AS0A 3JZAA 5A5GA 4B71A 3OAAA 4B76A 3B1YA 3T1QA 2H18A 2ZETA 2QE7A 5JHGB 4Z1MA 2ZU6A 3FHCB 4KLNA 4AYWA 4C7OB 3FHTA 2JLYA 3ZS9A 2GXAA 3A37A 1KJYA 2RH5A 4MITA 1KMHB 2ATXA 1SVKA 2H16A 2F43B 4DSOA 3ZIAA 1Z22A 3MD0A 2IF0A 4NCNA 2H92A 2YYZA 2I4IA 5LBIA 5EE0A 1PUJA 4GMXA 2ZI9A 4JMPA 4BZPA 1X3SA 3PXGA 2ZANA 5H8WA 2I3BA 2GEDA 1DAFA 2GETA 3GJXC 1K5GA 3NBYC 3OEHA 4QHSA 4M0LA 2G77B 2IXFA 4II7A 3OIVA 2MSDB 3TR5A 3KDSE 4BFWA 2J87A 5FI0B 2BEJA 3CWZA 3D7MA 4R2HA 4X8LA 1FUUA 4JVNA 3AVYA 1KO7A 2GDJA 4U02A 1P62B 1Q20A 2A30A 4QGFA 1CU1A 4ZDJA 2D3WA 2X8AA 4GZLA 1Z6YA 4L15A 1WBBA 1KSFX 2IXGA 3BBPA 1F48A 4MKGA 4TQAA 4DBLC 4W9MC 3U7HB 4DC9A 5G53C 1NLFA 2E87A 1A5TA 2R6GA 4QXAA 1T0HB 5HZKA 5JSZB 1XXHB 1HT2E 4QGAA 5CM8B 3LV8A 3O8CA 3QBVA 1BH2A 1YRBA 3SI7A 2XTZA 1NJGA 4YMTA 4NCKA 1NI3A 1FNMA 1VIAA 3SJCA 4YLGA 4KVGA 1U99A 3GEHA 2JJ8A 3WRXC 1VG8A 2FSHA 4LJ8A 4DLZA 4OQLA 4Q1FA 4TMWA 5C1BA 4MYTA 4UJ5A 4AIIA 1Q3HA 2ZRJA 3DDCA 2IYRA 4MUBA 1TX4B 1N2CE 2VP5A 2D74A 3IIKA 2BMFA 1KDRA 2NOAA 4JLKA 1H8HD 3IBYA 4A8JC 1TQ4A 1XD8A 4MRNA 3TGPA 1VYVA 2G6BA 2JLVA 1W4BA 5CK5A 1GM5A 3L8ZA 4K46A 3LQQA 3VKHA 3H86A 1KI8A 4AYTA 5EE9A 4DLWA 4ASUD 2IYUA 2W6IA 3SYKA 4BFVA 5BN3A 3EPHA 1E3MA 2W6JA 4RD6A 3HP1A 4FINA 2GVZC 5EP2A 4URVR 4HUTA 1C9KA 2B92A 1M8PA 2IS2A 3FKQA 4Q4LA 4A0FA 1KSHA 4BLTA 2PZGA 3ND9A 4F4JA 5KO2A 1E1RA 2OXCA 2IA5A 3WMEA 2Q9BA 3ASYA 1K5DA 1NMZA 1DAKA 1SXJB 2OHFA 1E9FA 4KFUA 1IXRC 4EFNA 4TT3A 1L4UA 1G3IA 4GT1A 3TSZA 3MWLA 1R5NA 4Q9JA 3QKTA 2XB2A 1FX0A 2ZRBA 4Q9KA 2RGDA 3AV0B 4PHGA 5KSPA 4EPTA 3N70A 4HZUB 1M74A 4G5SA 1G5TA 3TMKA 2P6RA 4US2R 2CCKA 1X1RA 3VFDA 1EFUA 4FWTA 1WBDA 1NJFA 5AJZA 5KHOC 4GFDA 3LVQE 1TQ2A 4RD1A 4ZDIA 2PBRA 2WSSD 1UM8A 3MLEA 1TTTA 1COWA 2YWHA 1H8ED 5BN5A 1P6XA 5EXTA 4E09A 4PTLA 4F4CA 5J40A 2BM1A 2YKGA 4C2TA 1YQTA 5EZ5A 1M34E 1WRBA 3PFIA 2OFOA 2FPMA 4DEYA 1GKIA 2O52A 5UKDA 3VX3A 4BFXA 3B1WA 3A1UA 2P0EA 3P26A 4O3MA 1N0WA 1OXVA 4EUNA 2QPAA 2V8OA 5AJVB 1VKJA 1X8KA 1MO6A 5CK4A 1BMFD 1DBSA 3X1ZA 1L4YA 5HKKA 1Z2AA 5C2JB 3EAQA 2TMKA 5DLQC 4Z8XA 5KNDA 2CK3D 1FQJA 4RSGA 1U98A 4ZDKA 4IOKA 4WA7A 4DWJA 2V1UA 1E6CA 1Z47A 1MABB 4B2PA 3AVXA 2NG1A 4IXNA 2VP6A 3CIOA 1R5BA 1QHHB 2R6DA 1E1QA 3VHXA 4GL2A 5B57C 1SZPA 4URUR 1E2DA 1UJ2A 4S2EA 4AD8A 1IN6A 3CZQA 4JLMA 1Q0UA 4QC2A 2ERYA 2FWRA 1CRQA 1R0WA 3CRRA 3PG5A 2XXAA 4GI7A 4BLRA 4ZCMA 2CBZA 2GWHA 5CDFA 3J81k 1DG3A 4PQRA 5AJWA 2ODWA 2F7SA 4XOIA 1G3RA 2WPDA 3D8BA 5B2ZA 4OHXA 1KHTA 1XF9A 1ZD8A 4CVNA 5J47A 4RD2A 1N0VC 2AX4A 2GBLC 2IYTA 2XZPA 1LF5A 3E1SA 3QKRA 3T5GA 1NG9A 2ODEA 3DL0A 4G0NA 4TMKA 1SULA 2AKYA 2QENA 2D62A 3VR3A 4JBWA 4U5XA 3IDQA 5EE1A 3GMTA 2OLKA 1KZGB 2DWPA 1KK0A 3DHWC 5CDFE 4BEBA 5B58C 1GFIA 2GHIA 3R8FA 2EWWA 4Q01A 2ZPTX 1NP6A 4BZXA 3Q7PA 2ZE5A 5K8UA 3X1YA 4JLDA 4GP7A 1RJ9B 2Z6VA 2R65A 2O8BB 1DEKA 2HCJB 2A5YB 4HDOB 3A4MA 4PFSA 4MKIA 2X2EA 4B3BA 3TAHA 1XTJA 2ZRKA 2Q0HA 3BORA 1HQYE 4HLDA 1VHTA 3AVQA 2FGJA 2OAQ1 3ZH9B 2PJZA 4Q48A 4TYQA 4XSHA 1OFIA 1VCNA 1E9EA 2Y8EA 4G3XA 2NZ8A 2R9VA 2ZAMA 1GNPA 1NIPA 3V4FA 1XWIA 3QSYA 3SHFA 2QBYA 1XB2A 2VA8A 2VL7A 1CJUC 2XNDA 2FNAA 4KU4A 3ZZTA 5DI9A 3UPUA 2CHGA 3EW9A 4U7DA 4B74A 1E96A 2OCBA 1ZCAA 3NG1A 2ZEJA 4A0RA 4LV8B 1G8YA 4KXFB 2QSYA 1W36C 1GSIA 4E5UA 4CEIB 3SHWA 2ZJ8A 2OG2A 2QMUA 3K53A 3K0AB 1S8FA 1YZLA 1GUAA 2VRWA 3SQXA 1CJKC 1G3MA 3TW4A 2ERXA 1DAIA 4FXPA 2JASA 4OI2A 2V7QD 4AI6A 1NMXA 1HYQA 4FCTA 4B3FX 5CJ2A 4B75A 1G1MA 3K9LA 1NSFA 2VO1A 2ZI7A 1FW6A 4A2PA 1M1YE 4QRHA 2O0KA 2ZVPX 3K1JA 5JBQA 4EJSA 4R71A 5FOWA 1NMYA 1W0JD 5L3QB 4ITRC 4G5GA 4P4UA 1AKYA 2YOFA 3ZQ6A 1SVMA 1MOZA 3BE4A 421PA 2OO7A 2H7VA 2CCGA 3RRMA 4TLEA 3PITA 4CW7A 2ZJAA 2WSMA 2VP0A 4CGZA 1C4OA 2BMDA 4LHXA 5EE3A 4WXPA 3A1TA 4EAQA 4JLVA 2V4ZA 3RS5A 2ZJOA 1AJEA 1E32A 3CR7A 3L82B 1DO2A 2C9OA 4OQMA 1ZBDA 2FZ4A 2X1VA 1R6BX 1VMAA 2X2FA 5EP1A 1JNYA 1SQ5A 1YZKA 1N5JA 1WMSA 2EW1A 4PPQA 2RHDA 4GOJA 3WHKA 2LKCA 3WNDA 3IPXA 5DYGA 4EPRA 5LB2A 3FFBA 5LD2B 1KMQA 3A1WA 3CF0A 5SZKB 4TN1A 1E2FA 1JQJC 1FX0B 1DPFA 1RIFA 3A4NA 4LBZA 4C0QC 3I32A 3RAPR 1N5KA 2PLRA 2H17A 3EXAA 3IGFA 4Q9HA 2J7PD 3AVPA 2RAPA 2WJYA 3JVVA 3Q3JB 4NCHA 4DUGA 2W00A 3KL4A 2O8FB 2XSZA 4Z51A 4LZZA 3DVLA 3EX7C 4WXRA 2NO0A 4MRSA 1AQYA 5F2EA 3X1XA 4AWXA 2CJWA 2IUTA 4OQNA 5E3HA 1P60A 3TNFA 1CJMA 1R0ZA 4BLSA 3LDAA 2BIFA 2QORA 1IOZA 3Q72A 4I4LA 4AKGA 2NIPA 4Q1AA 2F1HA 2PZEA 4XD7A 1Q22A 4R2IA 2WKPA 2QEQA 2ZRMA 2GK7A 3U7FB 3R20A 1IQPA 3PUYA 5SZJA 1ZW6A 1G7CA 3FKSA 1OKKD 3ZS8A 1G3QA 4A8JA 2GILA 1UF9A 3FTQA 3KJGA 2J7KA 4HDQB 4PZYA 1XRJA 4BFUA 5BXQC 4PPFA 4D25A 1YR6A 1E94E 3SJBA 2V54A 2ZJZA 3I1FA 3TSOA 4EPXA 4MUAA 1TUIA 5E7IA 4PZZA 4Q4HB 4DLTA 4C7OA 2N1BA 1Q3TA 2JEOA 2CNWA 3SC3A 2IBMA 4DCUA 3VNUA 1KMHA 4HAZA 2PJRA 1EXMA 1W36D 2R6CA 4G5QA 1JBKA 2CHVA 2XEXA 2ZRLA 2PLFA 3FMPB 1N5LA 1BKDR 4IEEA 3REFA 3V9PA 1CEEA 1KGDA 1KDOA 1ETUA 3Q5EA 4NP6A 3GJ6A 1N5IA 5EJEA 2PH1A 3SOPA 5KPDA 4NPHA 5GJCA 1W1WA 2FEOA 4PSVA 3GLGB 2V55B 2ZJYA 4JVSB 2XOKA 1VDZA 4Q7LA 3U4QB 2FX3A 3IKJA 1YR9A 4JT2A 4BFTA 3P20A 3UIEA 2DCUA 3OFND 1P5ZB 5BYKA 3I3SR 1CLUA 2ZXUA 1GZSA 1G8HA 1HY3A 1D8TA 4D4KA 3ONWA 2UZIR 1QHNA 2JLSA 3PUXA 4A2QA 2VEDA 4QM7A 1LS6A 5LD2C 1XP8A 3EARA 2FF7A 5JSZA 2YC2C 1G5RA 2A5DA 1NVWQ 2G3YA 4BWYA 5KDLA 4QL3A 1OF1A 2C9YA 4MGKR 2ZI6A 2A5GA 4JBYA 5IF9A 1N6HA 3OAAD 5GVSA 1DAGA 4OK3A 4EQ6B 5JS8A 2QE7D 4Z1MD 2QRNA 1EX7A 3NBZC 1OFHA 5BWMA 2VF8A 4QBFA 1X1SA 4Q7JB 3TR0A 4BLQA 5B64A 4LRWA 2VHJA 3HYRA 5FOXA 1GL9B 4PPGA 2I1VB 1RW4A 2GAAA 4D0GA 4V0LA 3JVUA 3VKGA 1XXHE 5EE5B 2EQBA 4K81B 3AF4A 4KV9A 3BH0A 4UJ3A 4TZ6A 1U90A 5BN4A 1Z29A 2BKEA 3SFVA 3O47A 1N3BA 1U0LA 3LXRA 3VX4A 2JDIA 1E4VA 2GCPA 1ODFA 4OKSA 1QHGA 3RHFA 4A2WA 3CPJB 4LJ9A 1CTQA 1BS1A 2WWFA 2CVFA 3AF3A 4Y0AA 4YMUA 4M9SA 2AD5A 3LLUA 3T15A 2ZRIA 1U8ZA 1XMSA 3TE6A 3OHMA 4GBMA 1XMJA 3HU1A 3UWKA 2WZQA 1HTWA 2QMEA 3GJ5A 3LW8A 4C0SA 1XD2A 2AK3A 5DH9A 4Q21A 4R98A 3AVTA 1JEDA 1KKLA 3DO6A 3THWB 5GVRA 4FMCB 2Q3FA 5JJIA 3QENA 4Q1EA 1G8PA 1NL3A 2L0XA 4D4JA 1T5LA 2VH5R 4GDFA 2ZI3A 3B9PA 3QVUA 3QXSA 1XPOA 5FPSA 3EA5A 2GBLA 4Q02A 2JAQA 5CLLA 2J1LA 3SBEA 3U3RA 5G41A 1SXJA 1TUEA 2XJ4A 4HB3A 3TKLA 2WICA 4DEXA 1N25A 2N46A 2KWIA 2BDTA 3AM1A 2P6UA 3FOZA 1VCOA 1E9BA 4TSFA 4HZUA 4HAWA 1LTQA 3R8CA 1RC8A 1W0KA 1R8QA 2IX3A 5KUTA 1NKTA 2OT3B 2ASEA 2P2LA 4F93B 4IJMA 3PUVA 1DTSA 1SHKA 2V1XA 1SXJE 1OHHA 2VP9A 3FMIA 3QQ5A 3TVTA 2W58A 4BLPA 1NLYA 3VMFA 3W5IA 3DOFA 1G4AE 2ZVQX 3QXXA 4RD3A 2FN4A 4NE2A 2QGZA 1XCGB 1KKMA 1YZUA 5E7MA 3TH5A 1KZ7B 3BIFA 1WP9A 2GCNA 3AB3A 3L0SA 2YWGA 2BBSA 2WVJA 5FL3A 3VR1A 2NMVA 2IF2A 2QAGC 3CX7A 2C95A 2W6JD 2WJIA 3LY5A 3LO5A 2JJ1A 2CL7X 2VP2A 1FTSA 4FCWA 4PPNA 5DO9A 2VQSA 2BVNA 5EXPA 1Z06A 2YWEA 3SQWA 4W5WA 3S1AB 3U3KA 2IYVA 2PEYA 2N42A 1W5SA 2ZJ2A 3DM9B 5KPJA 3ZVMA 3WP0A 2WM9B 4TL6A 4XTCS 4EPYA 3CONA 4Q5IA 1MABA 3X2SA 2MSEB 1F2TB 2FPKA 4QBGB 3QG5A 4QJ4A 1E2MA 1XDBA 2RGNC 2HT6A 4TMTA 3I62A 2C9CA 1QHHA 1S1MA 5F98A 2EU8A 3K0CA 3RRNA 2WMNB 1WE2A 3IBGA 4KSBA 4TMZA 3WY9A 2HF9A 2QG6A 2HXYA 3QKUA 1E2JA 2ODNA 2WWHA 4V0MA 1DAEA 4URZR 3R9WA 4PSKA 2F1IA 1CULC 2J41A 3ZZUA 2GEVA 5KTYA 2HF8A 1GIAA 1M7GA 4A8JB 1NG1A 4UKDA 3RS2A 2WWYA 1GWNA 3BS4A 5HCIA 1LS1A 3EZ7A 3B1VA 1ONBA 3BB1A 3KXLA 5FBLB 4KHZA 4N1AA 5L3RA 3PJRA 4I1UA 3QUSA 1CIPA 1J8YF 5G3YA 3QVVA 5JS7A 2QSZA 1R10A 3LNCA 4DRZA 1LY1A 1OW3B 4LC0A 4JVLA 4HZIA 3ADKA 3VTKA 3ZGXA 4LK2A 1Q57A 4NDZA 2JIZD 3TRFA 2GKSA 1Z83A 1G21E 1RYFA 3DKPA 1U94A 3AKCA 1KYIA 4DSNA 1ZM9A 5FBRB 2YZ2A 4MKFA 3B7GA 4UXHA 5EQTA 2C99A 4HSEA 4PO1A 4TQUS 1RJ9A 4QGHA 4O0MA 3EIHA 2O8BA 3ZJYA 4JKIA 2AWOA 2NPIA 3CX6A 2ZU0C 3DKVA 1TADA 2X19A 2WOOA 2HDNB 2HYIC 3E70C 4IFBA 3LVRE 4B35A 4URXR 5HTKA 4CEJB 1NBMD 3AF1A 4YXWA 1GP2A 2Z83A 4A1FA 1N6PA 3SR0A 2KE5A 2QP4A 3IHLA 4WZ6A 4B33A 5AR1A 3K70D 1GNRA 3UWOA 4OI1A 4KYIB 1ESMA 1S9DA 2QI9C 5JJKA 3W90A 3V00A 1W46A 2EFCB 2FJUA 5KSYA 1A1VA 2DY1A 2JJ2D 2WPDD 1ZNYA 4PQYA 1KOFA 1U9IC 3R7WB 2KI5A 1MV5A 3IQWA 4Q00A 3ZVNA 3CWQA 3NIBA 3ADCA 3THOA 1KO8A 1US8B 3LX5A 5TXGA 1Q12A 2ZQ5A 1DADA 3PCRB 4P4SB 3W6PA 5AUPB 3OZXA 4NKRA 2CLDX 1OH7A 4NYJQ 1EX6A 3WMFA 4CEIA 3KQUA 5FPTA 3FGNA 2BWJA 3AKDA 1QBKC 3K0AA 4I1OA 1KNXA 2FGKA 4C0KA 2R6FA 2WJGA 4GP6A 2A5JA 5JHHB 1JEEA 2ZRHA 4GPTA 1XTIA 2GJ8A 4DXAA 1E2LA 1JJ7A 4CF7A 4M22A 3K09A 1QHYA 2ZROA 2ZUCA 2F55A 4DT1B 4UXIA 4CIDA 1T4GA 3MWKA 2QT0A 3VR2A 4DSTA 2D7CA 2D2FA 2QMHA 3QBTA 1FP6A 4ON9A 2GK6A 2GJKA 5M04A 2CE2X 1PLLA 3KXIA 3U7EB 5L3QA 4GMDA 3O8DA 4MGZR 1EESA 2QN6A 1YZTA 3MJHA 1Z0AA 3BFVA 1Y63A 4PR0A 1E9RA 4LDJA 2KSQA 4DDUA 4E03A 1SVWA 1KK2A 2Z43A 1UEIA 3QY0A 1MO3A 4FD2A 1PLJA 1XD2B 4GOXA 3AEZA 4NU0A 1E2PA 1G17A 1JPJA 2WV9A 4CRWB 4IRUB 4DLVA 3B5JA 4D4MA 4M9XA 3CNNA 4B3GA 1KO1A 1CR1A 2IUSA 2WWGA 1QG2A 4JSTA 1W47A 1VCMA 3B8HA 3NBFA 4RCZA 1OT3A 2DR3A 1ANKA 1G64A 1KI2A 1QVRA 5CITA 1GTVA 1ZUHA 1M2OB 5IK2D 3BB4A 3T12A 1CJVC 3NWJA 4IVPA 3P1JA 3AKEA 3CH4B 3MMPA 4HAXA 3HWSA 4RZXA 1CS4C 1GAJA 4UNQA 4US1R 1OLOA 2AKAB 1H65A 4Q9IA 4D4LA 1OIWA 4ZCIA 5E95A 2O8FA 3OE7D 2GESA 3AUXA 2H5EA 4B34A 3T35A 3E2IA 2C8VA 4FCVA 4AG6A 1W4CA 4G5OA 5J5CA 3BK7A 4M9ZA 2AD1A 3DEFA 1G41A 4LGMA 1HT1E 4M1OA 1UKVY 4BRWA 4TYNA 4KAXA 3EASA 4F92B 2DFLA 2DWOA 1CXZA 1LNZA 2I1QA 3TVDA 2A7QA 2VSOA 2OESA 1OIVA 1CR0A 4LSGA 1Z3IX 1JQLB 1M7BA 2AXPA 2XJ9A 3FHOA 4Z8YA 2QA5A 1T8UA 2NO7A 1Q21A 2WOJA 4Q4HA 2P65A 2ZRAA 3B78A 5CIWA 2GF0A 5K8TA 2O8CB 5DGXA 4FMDF 3SU8A 4ARZB 4IDQA 2BMEA 3U7GA 3AGQA 1HA3A 2RGEA 5FH9A 1ZD9A 2BHRA 2Q3MA 3LXXA 1W36B 1HE8B 2WIAA 1DVRA 3KQNA 2PMDA 1Z6AA 4LYJA 1NN3A 2B21A 2QGNA 2ZRFA 2FZLA 2BOVA 1IAQA 1FFHA 3B85A 2OFXA 4MRVA 3UG7A 2Q3HA 4BPBA 4MA4A 2D7DA 2Q6TA 2H8KA 2OEPA 4FMBB 1BYUA 1F2UB 4LBVA 2A2ZA 3GLGA 1O3YA 4M4SA 2HEIA 2YVUA 3B13B 2PX0A 4DUGD 1HURA 3U4QA 4AURA 4FIDA 5F9HA 2GA8A 2V6IA 1J8MF 3R9XA 2ZRPA 2ZRGA 4O2RA 5CYPA 5HZHA 1A2KC 3TQCA 2RGAA 4HAUA 1XX6A 1AS2A 1SVSA 4B3CA 4BUJA 1SVIA 3BAFA 4KODA 1WB9A 4BFSA 1OXUA 4LJ4A 2BBWA 2A78A 3GP8A 2BBOA 4V03A 3KQLA 4IVQA 1MT0A 4QHYA 4LJAA 3NC0C 5L3SB 2VHTA 1ZNZA 1KSJA 2ANCA 2XTNA 3PENA 1QZXA 3SS8A 3GLGE 4A36A 1L8QA 5KU1A 1X86B 1XCMA 4HUQB 2NO6A 4IOJA 4EFMA 3GJ3A 4QFMA 1VCIA 2B8WA 4N0DA 2A3RA 4O25A 2CEAA 2B7CA 2ECKA 3FMFA 4BFZA 1QVAA 2OFWA 2XX3A 3CLVA 1FMLA 3T1TA 4EQ6A 4M1YA 1IN7A 4IOMA 1G20E 1IXSB 1XPRA 3UATA 1E0AA 3VR5A 2RHMA 3FMOB 3WRYC 2CNWD 1U0HC 3G82C 4DIDA 2J45A 2RGXA 2PT7A 2WKQA 3C5CA 4C2UA 1UADA 2IHBA 2FG5A 1F3OA 4PXAA 4DLYA 3I8XA 2IXEA 1E98A 2R8RA 4URWR 3Q5DA 4KCGA 2OILA 4CDGA 5J4KA 2G1JA 4P3YA 5FTLA 2FFAA 3CPEA 2AHOA 3IIMA 5FTKA 4EIWA 5C46F 3UKDA 2ZJBA 4LPKA 4DB4A 4C30A 1GOTA 1D9XA 2H1LA 4JSYA 4LUCA 1U2RA 4X8HA 1E2NA 2QZ4A 2ZSEA 4MRRA 4DCTA 3N2EA 4KBGA 2IEZA 4HB2A 2E1RA 4ASUA 2WHXA 4ACBA 3THWA 1KY2A 4M1WA 3CH5A 3HU3A 3H2YA 4AKHA 1ZUIA 3WBKA 1OXSC 2KB0A 2IK8A 2VTKA 1XJCA 3HPQA 4BEJA 1OSNA 1DAMA 5GADl 1ZM7A 4B73A 2F9LA 4YDHB 3KFXA 5EP3A 1E9AA 3GEEA 4EDHA 2J0UB 1Z08A 2QM7A 4JLPA 4MDEA 5JLJA 1YR7A 3A58B 2A5FA 2J0SA 1KAOA 3TAUA 3CF2A 1CJTC 1EG7A 4HATA 3RABA 3LLMA 2QQEA 2EFGA 3DMDA 2JLRA 3NXSA 2ZYWX 4OBEA 4NONA 1E9SA 1ZU4A 3C14C 4OHVA 4PO8A 4ZPXA 2KBFA 4OYHA 3P32A 4A0GA 5AJXA 3B6EA 3SZRA 4JLOA 1XU4A 2JCSA 1UBFA 3SFZA 3VR6A 3FVQA 1SKYB 2YC4C 4TWZA 3TUJC 5JWOA 1P2VA 3CNLA 3OEED 2DFNA 3AP3A 2JDID 1CKEA 1KK3A 1VYTA 2BC9A 3B9QA 5FUYA 4NYIR 1LB1B 4CT5A 1H8EA 3Q85A 4TYPA 5E7JA 3QEJA 4K8OA 5IRCD 3I61A 4BLOA 4B43A 2QNRA 1NN5A 1D2EA 1GKYA 1ZVQA 4G1UC 3AVVA 4Q03A 5IDVA 2Z4SA 1JR3A 1QHIA 3SBDA 1EFRD 2FSFA 1E2GA 3CPHA 1TF5A 2FFBA 1G5PA 1KTVA 4Q7KA 3DPUA 1BMFA 4Y0VA 3S1AA 3H84A 5FI1B 2YJTD 2CK3A 1IY0A 4DVGA 4C9BA 3PEUA 4YONB 3VQTA 3ADDA 1J2JA 2BJVA 1XTSA 2IYXA 3P4YA 3AVWA 2OCYC 1MO4A 1KAGA 1F2TA 2ONJA 3ZZ0A 2QP3A 1HQCA 2V9PA 3AP1A 1A7JA 3DZDA 1JR3E 3QEOA 3U6KA 1GRNA 3CM0A 4F7WA 1QF9A 2W83A 4IFEA 3IHWA 2RKOA 4CT4B 1R5OA 4EPWA 1M7HA 2D4HA 3U5ZB 1KI7A 1XJQA 1G6HA 4G5RA 4M1MA 3ETLA 1G6OA 1Z2CA 4RD4A 5HR5A 1Q1EA 5FPHA 4PO9A 4TMXA 4OHYA 2WBLC 2RGGA 1NRJB 3WHLA 2CL6X 5SZHB 5FPKA 2VHQA 5KDOA 1E2HA 1RZ3A 2JLZA 4OJQA 4RFSB 2E9SA 2FV8A 4DSUA 2HLDD 1B0UA 1YJ5A 3IO5A 3KKOA 3RC3A 3RC8A 1PJRA 2WWIA 2C5LA 4LBYA 1CBUA 3A36A 3FYHA 3G5UA 1JALA 2ORIA 4TLAA 4DLXA 1I4LD 1KI6B 2AWNA 3IILA 2FPLA 2QT1A 4GRAA 1TQ6A 4LJ7A 4NYIQ 4PAQA 3RS7A 3CRQA 4OK6A 2GJ9A 1P2SA 3PV0A 3U60B 2ZREA 4M1KA 4PSAA 4NHOA 2ORVA 4IDHA 1WCV1 2G1KA 5L8VA 3W8RA 1XEFA 4V0OA 3VHLB 1BOFA 821PA 6Q21A 4U00A 4RCYA 4F4IA 4QNRA 2JJ1D 1XTQA 1VIYA 4KVAA 4V0KA 1XBTA 3U3OA 1VYUA 1Z6TA 2G0TA 3KKMA 2Q9AA 3RNLA 1CP2A 1RFLA 1FQKA 2Z5FA 4Q4AB 1LF0A 3RS0A 1GILA 5FTNA 2WTUA 1E2KA 1GL7A 2CE7A 3HJNA 4LPSA 4CEJA 4X8MA 3TSWA 2QL6A 2YNMA 3ZD7A 3BD9A 4NCIA 4M53A 4BECA 4JLJA 5JEEA 5FOTA 4L4UA 1N0UA 1GITA 4P4TA 3K9GA 2R62A 4PZLA 4ZI2A 3I5XA 4D6PA 2SHKA 3QXJA 4Q4JB 1XZPA 3K70B 4XJXA 2OAP1 2WWXA 3ZVLA 2IYWA 1LV7A 3O8BA 2CMKA 3R7WA 3UK6A 3W8NA 5KYKA 3RDPA 2BCJQ 3T5DA 4E22A 4M2LA 2BBTA 5KOYA 2VYFA 1US8A 4CYMA 1C1YA 4P4SA 3MUFA 4WAUA 1T6NA 1TU4A 1VG0B 4H1VA 4KJZA 2P5TB 3EWSA 2QAGB 1GRRA 4JVMA 1NN0A 3I92A 3ZIAD 4H9GA 4PQFA 3T06B 4NL4H 4ESVA 1E2QA 1P9NA 3VU9B 1BO6A 5A4JA 3THYB 1G4UR 3KKQA 5HCNA 4DT1A 2V7QA 2O8DB 4HLCA 1FPMA 2VP4A 4QOSA 1HUQA 3OEHD 3ND8A 3L0PA 2RCNA 4NMMA 2C78A 3U6BA 3KB2A 5FOSA 4P31A 5LB4A 4Q47A 3CO5A 5CIQA 2IT1A 2CCJA 3RVBA 5P21A 1VG1A 4DCSA 1W0JA 4OHWA 2A9KA 3BGWA 1KDPA 3CBQA 2J5XA 4V0NA 2IW3A 2VF7A 4PC1A 2F3RA 4GZMA 3REGA 1E79A 2CVHA 2CL0X 3CF6R 3M4YA 1Z5ZA 2EVWX 1SVLA 1R8SA 3FPAA 1E0JA 4OL0A 4PHHA 4POAA 5K8IA 2ZI5A 4NBSA 2NQ2C 2XNSA 2ZE7A 3D6TB 3AUYA 2FFHA 4PHTA 1L7VC 3MWYW 2G0NA 1N6OA 2B6HA 2WJHA 4F91B 3A1VA 4D81A 1G9XA 1ZC4A 1DAHA 3A8TA 1ZUNB 4BE7B 4TMVA 4A82A 2LWIA 3PR1A 1X8LA 2NO9A 4YMWA 5IT5A 3KQHA 2GCOB 4HLUC 2R44A 1N6RA 1ZIOA 3K9NA 4IDPA 1AA9A 2QTFA 5C18A 2XAUA 2RGCA 3GJ4A 1R4AA 4Q1DA 3IUYA 2PZFA 1EFHA 5JWRA 1NY5A 2IC5A 2QUZA 3EZFA 3SDZA 1UKEA 2LCFA 1NVVR 1FTNA 1XCPA 2J7PA 2QY9A 3K70C 3V4RA 3TUIC 4G01B 4R9UC 5LDDC 4OK5A 1P4SA 4LV5B 2MSCB 1LW7A 3I4LA 4KO8A 5L3VA 4B3XA 1T0JB 3CKLA 3QE0A 1NVUQ 1E69A 5EUMA 5CB8A 3GD7A 2GXQA 3MCAA 1TF2A 1VHLA 1TEVA 2ZE8A 4IOLA 4KFSA 1QRAA 4DDWA 221PA 4E07A 1N6KA 2FEMA 3NHAA 1U8YA 4PC6A 2GF9A 4BRUA 2W6ID 4YMSA 4QJ3A 1HV8A 1Q1BA 3RWOA 3ZVRA 4A92A 4WIAA 3QG1A 5FOUA 3BFKA 4XIGS 1GVNB 1KO4A 2G83A 3ICEA 1SVOA 5FTMA 1ZRHA 3BERA 4R7ZA 1R0XA 4Q18A 4QBHA 1P2UA 4MYHA 5JI2E 1G18A 1E4YA 2VSXA 4TL9A 1I2DA 1OE0A 2ORWA 2O8CA 1E1RD 3I72A 3WBJA 3U3JA 4ARZA 4NZYA 5JMTA 1ZINA 3CR8A 1AIPA 1E2EA 4LYFA 4B47A 2HXSA 4D0LB 2GZHA 4TT3D 2GAOA 1S4QA 5D3QA 4W7SA 1T5IA 1QHSA 2XITA 3GLHB 5KSZA 1XTKA 3THXB 5EZ6B 4NH0A 1ZYUA 4YQFA 3NC1C 1F2UA 3T61A 1ZC3A 2PCLA 521PA 2QPOA 1KSGA 2WMOB 3LW7A 1NVVQ 2FE4A 4LHYA 4YC7A 3QPVA 2VIIA 2HUPA 3GEIA 4NCJA 3ICQB 2O8EB 3NH6A 2IL1A 5KNCA 4AKIA 2GRJA 3IEVA 4C0BA 1JAIA 1P9RA 4N0EA 1HH4A 3KJEA 1COWD 2DYKA 3FB4A 3W5JA 4XVUA 3DZ8A 1AK2A 1GDDA 5JWHA 2PCJA 4M9QA 4OI0A 4D0NA 5L3SA 4V0ME 4NYJR 1Q1QA 1XTRA 4IVRA 4HEJA 5BQ5A 1IN5A 5ANRB 2WKRA 4HUQA 2ZUBA 4QKQA 3W9YA 4ZI3A 5F9FA 4UNPA 3LFUA 2NPFA 2QQ0A 3MWJA 1Q44A 1GL6A 4AC9A 5F3WB 3KUDA 1ZNXA 1EGAA 4WVFA 5HKKD 1TEXA 3X1DA 5J4VA 1J99A 2CXXA 3QF7A 4AK9A 4CZ2A 4JYCA 2VLIA 3AP2A 5HE9A 2ODBA 1W5TA 2W2VA 1ZAKA 3I8SA 4EKDA 4MH0R 4US0R 1UKYA 1IONA 2GVDC 1TMKA 1I2MA 2R2AA 2VBCA 1TF7A 4HYYA 3T1VA 2D2EA 3VKWA 4B6FA 4EJSC 3GLIB 1ZD1A 4JBXA 3W6NA 1BIFA 1E1QD 3CZPA 1P72A 1AZSC 1XNJA 3KJIA 1A4RA 2DWQA 1DE0A 1UBCA 4RKEA 3U3MA 1ZP6A 5IHPA 1KIMA 1WF3A 1VG9B 1S3SA 2ZRCA 4HAVA 2GNOA 4I99A 5DN6A 5BW8A 2IS4A 1AQUA 1I4TD 2ZM5A 5FL7A 4YMVA 1P2TA 3E5HA 2EFEB 3GJ0A 3KZ1E 5DHFA 3MFYA 4KFRA 3U44B 2B8TA 2EFHB 4C4PA 2AXNA 2G88A 3HPRA 3B2EA 3WMGA 1CRPA 4IW3B 621PA 3PEYA 4BZQA 2GTPA 4NYMQ 1NLZA 1X6VA 3KJHA 3OIYA 1RPZA 3RWMB 4TLDA 1TAGA 5C4MA 1G7RA 1OFTA 3LRPA 1UBGA 2J0UA 2JLQA 2J9RA 4ZIRB 4L8GA 5G40A 3KTAA 3CRW1 2JGNA 2ZSDA 2AFHE 4PAOA 1Z07A 4V02A 5LPNA 1IJEA 3CNOA 4L9WA 2C98A 4JJZA 2O0JA 4TTPA 8OHMA 1FMJA 2Q21A 4GSYA 4TLBA 3GQBA 3P27A 1V43A 4JZKA 2PX3A 1D9ZA 2O0HA 5JFGA 3PEWA 2VPPA 1NIJA 5K8LA 1XEWY 5EXSA 1DELA 2IS1A 2REBA 3N5CA 4B6EA 4CEHB 1ZU5A 5FBVB 3L8YA 4JT4A 1U81A 2CLCX 1WA5A 4ERNA 4MDFA 2P67A 1P9WA 4HLQB 5DHAA 3LBIA 1J90A 4TTRA 1IJFA 4RVCA 3GFTA 3C5HA 2AR7A 5FUXA 3FDIA 3CX8A 4YDSA 2XNDD 3PEVA 1JJVA 4DLUA 2GEUA 2BKUA 3W6OA 5G3ZA 1SKYE 3C7KA 2OCAA 2REXB 2IHYA 1M6NA 1S3GA 1SGWA 5FPYA 1RRPA 2GJAA 3AGPA 1G8FA 3FFAA 3A4LA 1NY6A 1W7AA 1XFAA 2K5UA 3QF4B 3GLFB 3RANA 1IHUA 2VHCA 3NKVA 3TW8B 2WJJA 3MAAC 4DCNA 1AS3A 1ZM3A 2BJWA 4LCBA 2V6JA 1MO5A 4PAMA 3C41J 5J4HA 1JB1A 1PLKA 2BM0A 4URYR 3A1SA 2RMKA 1D2MA 3OIWA 3HU2A 1KO5A 2ANBA 3QNUA 1YZNA 2F6RA 4IXMA 4QGGA 3TBKA 5JCZA 2NZJA 4ZKDA 2ZYTX 1W48A 1G7TA 3NBXX 4TL7A 1W4AA 4HB4A 3B1XA 5TARA 3RS3A 2B7BA 4ZCLA 1TU3A 1NN1A 3AF2A 4LHZA 4KFTA 3G0HA 3VNVA 3AQ4A 4A6XA 1E9DA 4Q7MB 4WZBE 1A2BA 3D3QA 3WYAA 5FUWA 3EZ2A 1E0SA 1II8B 3DM5A 4RFSA 4PC2A 4P33A 1NF3A 3OF5A 2X77A 5CLQA 3MG9A 3EC1A 3PVSA 4J0QA 4MRPA 5C4GB 3AKYA 2C2HA 3K0EA 4IHQA 1OB2A 2WJVA 2FMXA 2UVQA 1KI6A 1G8GA 1AGRA 5DISB 3IQXA 5AUQA 3Q9LA 4LYHA 2ONKA 2HJVA 1E0KA 4JL5A 1D6JA 1KNQA 4JL6A 2FSGA 1YR8A 4KYUA 2QU8A 2JIZA 1JR3D 4ZDWA 1DOAA 2ZR0A 4PC7A 1EWRA 2ZYUX 4Q1BA 2XB4A 5D3MB 4OJKA 4EPVA 1EWQA 3WYFA 1G19A 4KBFA 4LC1A 1RKBA 2MMGA 4XSGA 5FUVA 2W2TA 4Q4AA 3QXHA 3WNCA 3MJRA 2IWRA 1X8JA 5FR1A 5JECA 1IM2A 4D26A 1XJ0A 2AN9A 5AWFC 2DFTA 1NVXQ 2JA1A 3BXZA 4HLUA 4JL8A 1NNEA 3LA6A 3M0EA 3QKSA 2XSZD 4FW9A 4B48A 3TUZC 1T3HA 5CM9C 1NBMA 1XPUA 3OESA 3QXCA 1AN0A 1K8RA 2W2XA 3QOFA 1ZJ6A 1MR3F 3UANA 1KI9A 1PVOA 5ELXA 4Q4JA 1FUKA 2QPTA 1Z0DA 3K8YA 4XD7D 4C0LA 2OCPA 4L16A 4M21A 1TNDA 1W44A 4UXJA 2OBLA 3FKSD 1IY1A 1MRNA 2VSFA 5TVKA 1UAAA 2JJ2A 1HEIA 3BWDD 4AKEA 4QM6A 1XEXB 1CF4A 1NBME 3H1TA 2V3CC 3C16C 3LQRA 3LWNA 5J4YA 2FH5B 1YHNA 4MQBA 4C0JA 3RLFA 1SXJC 1OPXA 1RVDA 3F8TA 2QAGA 3L0IB 3MSXA 2KJQA 4RY2A 3T34A 1QG4A 4XVRA 3GJ8A 3C15C 4QHTA 5EXXA 2YOGA 4DLRA 1XMIA 2JLWA 2REOA 4M8NE 2HYDA 4LJYA 2DPXA 1DG1G 4MYCA 2ZI4A 3BRWD 3VU9A 3THYA 1FOEB 4XH9B 1EK0A 4RD0A 2O8DA 1XD9A 2FA9A 3SJAA 1P61B 2AK2A 4PX9A 4JYBA 1H8HA 1YZGA 2XZLA 1E9CA 2DFKB 3QPUA 5GJWC 2ZUDA 2RGNA 2XGJA 3PUWA 5DI3A 2XOKD 4Z54A 5KNBA 1AZTA 1ZIPA 2P3SA 3AVOA 1FNNA 1XEWX 3H4MA 4DCVA 3RRYA 1YKSA 1YE8A 2FDCA 3A6PC 2IYZA 3FWYA 4MYUA 5AUNB 2RGBA 1O87A 1JR6A 1D2NA 3LBNA 4A6PA 2HV8A 2G9NA 4LHVA 3HYTA 4LOAA 4GOKA 3I5YA 3QI2A 3TIFA 3ZYCA 4AY2A 1P7CA 5CB6A 1DO0A 1IBRA 1YZQA 5FR2A 3L0OA 3NVAA 3KXKA 3LX8A 1JXMA 4BGDA 3RS4A 3CB4A 3KTAB 2EYUA 2GCOA 1W2GA 3SNHA 4AG5A 5IK2A 4RKFA 2IWHA 2GZAA 4RZ3A 3C4JA 3MRSA 4B44A 4BASA 3K0CC 1KK1A 2QROA 2KBEA 2QMOA 4A9AA 1T91A 2WWWA 2JLXA 2YHSA 1KDTA 3IIJA 3QIAA 4FMDB 2OBMA 4PHFA 4A4DA 5CJPA 2ATVA 1S0UA 4QBIA 3U61B 3UG6A 1LFDB 3Q7QA 5JCPA 3OE7A 5BYJA 3NTUA 4QNMA 4JKYA 4A15A 2AL7A 2QM8A 4FI3C 2EYQA 2WSSA 4HDCA 3QJYA 5FFMA 4HI0E 3BFXA 3VAAA 1YRAA 2ZRDA 1Z6GA 1A82A 1CR2A 5KSOA 1UBEA 3BC1A 2EFDB 1OXXK 4M1SA 1UFQA 4Q1CA 1OXTA 2ZAOA 2ZITA 5E4FA 2OM2A 1OJLA 3K9HA 4DHEA 1E79D 1R0YA 2CDNA 4TZ0A 1KJZA 5TB5A 1JXOA 5EUQB 1AGPA 2ZSBA 1NKSA 1TPZA 4RZUA 3TQFA 4QJ5A 2QTHA 3PQCA 1R2QA 2GXUA 2VHUA 1FZQA 2W0MA 3KUCA 5TMPA 2FFQA 1U9IA 3GCGA 2GXSA 4EFLA 2J59A 3P4XA 1SXJD 1NSTA 3EIQA 121PA 4LWZA 3IO3A 3RYTC 1GRQA 4C0HA 3D31A 3SJZA 4D2IA 1T8TA 3U2QA 3N2IA 2ZS9A 4C3ZA 2BEKA 3F5FA 3GLHA 4S35A 3EPJA 2ZSFA 4LI0A 3M6AA 4TSFD 2OBNA 3THXA 3T1OA 2OZEA 1W0KD 4JLAA 2FSIA 5HPYB 4RJLA 4HB0A 4A0HA 1U0JA 2BCGY 4LX0A 4O2LA 1GNQA 4D80A 5H1YA 3TLXA 4ILEA 2O8EA 3CRMA 1OHHD 3SEAA 1XMVA 2F9MA 4TYWA 1D5CA 2J0QA 4TLCA 3GLHE 2H57A 3F3YA 1S9HA 3CUEF 3HR8A 1RRCA 4RZ2A 2FU5C 4FMCF 3R9IA 1P73A 3SYNA 4FN5A 3NDBB 4KLZA 1DS6A 3EA0A 4QG7A 4DZZA 5DNYB 5HE8A 2D06A 2P6NA 1AM4D 2OE2A 2ZSAA 2R6AA 1ZMXA 2Z4RA 3ECCA 3ZD6A 2WIBA 3K0FA 1MH1A 1U8AA 4XWOA 3KQKA 1TL7C 1K6MA 3ADBA 4IDNA 2EWVA 3IEUA 3K0SA 1OH5A 4JS0A 4LV6A 5B30A 2DHRA 4I1SA 3WYGA 1JI0A 4L5BA 3TJZA 3K09C 3NDPA 2YINC 3GFOA 2Q9CA 4TTQA 1T3LA 3HDTA 4XWAA 1OH6A 3SN6A 2ZS8A 4B32A 4OI4A 3GLIA 3EZ9A 2F43A 4OQFA 3QKSB 4NTZA 5H70A 4D82A 4Q66C 3BB3A 1WXQA 2FOLA 3AH8A 4UNNA 1Y3AA 2C04A 3UMRA 3KX2A 2YOHA 5JEDA 1ELOA 1W2HA 2ZIAA 4KSCA 2XXAB 2QAJA 3WNBA 3DMNA 4DB2A 1LVGA 1YU9A 2OUKA 2GJSA 3RRZA 3GLIE 1Z0JA 3EG5A 3GJ7A 4ZKEA 4PC3A 3I73A 4JJKA 3HR7A 3U44A 5JJLA 3B1ZA 3SYLA 2F3TA 4I1VA 3UXMA 1EFCA 2DBYA 2UZ3A 2PL3A 1JECA 4ABYA 3ASZA 1ESNA 3QKRB 1UKZA 3L2OB 2PMKA 3W34A 2W0SA 1I4DD 4AYXA 5DIFA 2C77A 3UMSA 1KJWA 1RYHA 1N6IA 4ZO4A 1Z63A 2QRZA 1PZNA 3BJIC 1EFTA 1FP7A 2IYYA 4MGYR 5FBWB 5H68A 1XZQA 3SE0A 5JRZA 1XXHA 1GKUB 2F1RA 2OV2A 1IN4A 4ZIRA 1MRSA 1WDTA 1YVDA 1F5NA 4XTRA 3EPLA 1G291 3NEJA 1G16A 2PEZA 1F6BA 5CYOA 3W3ZB 2J46A 4JIMA 2IS6A 3ZQJA 1VPLA 3EIEA 3CW2A 2WAXA 4P0TA 4UNRA 1G7SA 1FL9A 1ZM4A 4GNKA 4LJ5A 4LYAA 1G3UA 3JZMA 4XVQA 1SKQA 2C96A 5DI3B 1T3SA 2ZTSA 3NH9A 5J4LA 1JAHA 3B82A 5TV2A 1P3JA 4JLNA 4FWIB 2IUUA 2OSBA 4WOPA 4YXWD 1E99A 3EPKA 2MMCA 4CEHA 2ZYVX 1HE1C 5DSZA 1N6LA 3O8RA 4B2IA 4Q19A 5JRJA 3AF0A 3BOSA 4LJ6A 3OEEA 3VR4A 2YV5A 1JPNA 3LBHA 5DE3A 2JLUA 3IPYA 3PIRA 1RE0A 3UMFA 3C8UA 4XWKA 4LHWA 5DN6D 1QHXA 1KI1A 5TDHA 2ZR9A 4ACAA 4PANA 3X1WA 2QBYB 3W3AA 5FL7D 1OB5A 2PT5A 1GG2A 4OQXA 3RSOA 4HAYA 2NGRA 3LD9A 5AK0A 4BQSA 1OYYA 3KKPA 1S1CA 4WW0A 4X8OA 1PV4A
chains in the Genus database with same CATH superfamily
4PIVA 4JUFA 1IK4A 3GFPA 4UQOA 5CG2A 2XZOA 1O1YA 3DFFA 3BK1A 1BJRE 2IQ5A 4LRYA 3D7KA 3EQ2A 3O3MB 4QJBA 5C9ZA 2CVZA 3H5VA 3R3SA 3BILA 2UVPA 3TW8A 2HFKA 3PP8A 4WCVA 1QSGA 3V5NA 3FFWA 2OXRA 5ITSA 2AJCA 3DB1A 1KERA 3ZDQA 4YAIA 5ARBA 1JHUA 1DKLA 2Y9MB 3F0TA 1IJKA 1WDLA 1RAEA 2XLBA 1JPVA 1CVIA 2V7UA 1L2TA 1HFWA 2I65A 1RKQA 3ET4A 3L7MA 1GAQA 4FK8A 4IYRA 4CIAA 4DWWA 5KNCH 3L8CA 3GLFE 1U2SA 4UM9B 5A0FA 1WM1A 4L1KA 1EB9A 2BAGA 1TVCA 4PCUA 1Y9DA 3KB6A 1RYZA 4RLHA 1S96A 3QZUA 1WQ1R 4FPXA 4ARCA 3OOWA 3CLTC 2FPWA 4OL9A 4OIFA 3QVJA 2R68A 2CXTA 3TK1A 1GUFA 4LY6A 2PR7A 3KFVA 3RJMA 1GQRA 4YRAA 2FJPA 3D4OA 2ZRNA 3TXYA 3PE6A 3LTEA 1OKKA 721PA 4QUKA 3PUZA 1ZM2A 2Y1XA 3P71T 4R8VA 1POWA 1SC3A 4P58A 2HLDA 1FIUA 1U8UA 1YL6A 7MDHA 1WPXA 5FLEX 3EC2A 5DBGA 1PR6A 5M34A 3WLKX 3EXFA 2VHXA 4DDVA 2O05A 3AEKB 2ZR7A 4AN1A 1DWQA 5FTJA 1P1BA 3ZZNA 3K5HA 3LX6A 1Z28A 1YCDA 1VRCA 4KAFA 3V4VB 3BXXA 3HXQA 4JC8A 1IXZA 4U0KA 1PTKA 5J2TA 2P5SA 3G89A 4BQNA 2VAMA 1H1DA 3DCNA 4C4XA 2W98A 1T4BA 2XTMA 3NEYA 1CR4A 1OWMA 4F4FA 2G08A 5D3MA 5B3JC 2DBQA 3N53A 4IHJB 2B30A 4TQ9A 5CNKA 3WLNA 1ISGA 1LI5A 1TKCA 4LZAA 4KITB 3EULA 4TYYA 3HQ4O 2IYLD 1DC8A 1BFDA 3OZAA 3N0TA 4L9SA 1J49A 1SIBE 3ROQA 1TVKA 4J2OA 4QPCA 3GYBA 1Y8RB 5B1DA 4WBSA 3HEMA 1J7KA 1UOEA 5E1OA 3UJDA 1E60A 3LZDA 3W5AA 1YAHA 2Y1EA 2ZT5A 3IUQA 3RWBA 3L1HA 4KI0A 4LVCA 4QYIA 4S0ZA 2NO1A 4B83A 3IP6A 5D6OA 4OGWA 3QVMA 5ALVA 3B60A 5T7BA 2H9YA 1Z0KA 1VTKA 2OD7A 4HH4A 1UJMA 1YA8A 4BATA 4OGLA 4G8CA 3OFNA 3L9XA 1GUYA 1VYHA 1OIXA 4H1UA 4DBVO 1SIUA 2CJWB 1Z8FA 5FO1A 4M76B 1L5MA 3H0KA 2BMJA 2XA1A 1G60A 2QTVB 3B36A 3FCXA 4EFKA 1RFGE 2YRWA 1ADBA 1P1RA 4F6LA 2BI4A 2JH9A 1OY1A 2JIOA 1Q1ZA 2BR3A 2SCUB 4KWHA 4W5JA 3DOEA 3U3XA 1N6NA 1SZDA 4ZXFA 3K0FB 3KO8A 4IIHA 4WVLA 5AW5A 1A72A 1AS0A 1QX4A 3E8SA 3GJSA 1B8PA 1E1CB 2YH2A 3OAAA 4F1JA 3B1YA 3KVVA 3T1QA 1GTRA 2H18A 3T7DA 3IV7A 3QLUC 4U6SA 3S81A 3FHCB 3ZNOA 4AYWA 5DN9A 3G9UA 1XDDA 2C3UA 4MROA 5L7WA 3FHTA 2E4WA 4C4OA 1XTZA 1UWVA 2AA3A 3Q7SA 1KFEB 2EDCA 3A37A 2QRPA 2RH5A 2ZYAA 4NATA 4LTDA 4ZRMA 4F12A 4KTVE 5K0FA 4DSOA 4KV7A 1TJ3A 1FSSA 2X8JB 4MJXA 3TPCA 4BB5A 4E7OA 3EK2A 1GGVA 2ECQA 1NVTA 4RK5A 3GNQA 2JVIA 2EKPA 2HPHA 1IG0A 4BZPA 4U7TB 4GPZA 3PXGA 2ZANA 10MHA 2J6BA 1BXGB 5BWLA 2ALJA 2GS9A 1K5GA 4M8LA 4QHSA 1F51E 3DR3A 3AG5A 2MSDB 3TR5A 3KDSE 3DFUA 3LT5A 4U7PB 3RARA 3DZGA 5FI0B 4IGEA 2XD9A 1WTAA 2QVGA 1FUUA 2OCKA 4JVNA 1EUQA 1KO7A 4PG5A 2MCFA 4E46A 2WVGA 5TT1A 1TJPB 1G8AA 2I4RA 1C1XB 4JFRA 1D6SA 1Q20A 4QT4A 4QGFA 1PJ3A 3E2MA 5IN4A 1PT9A 4F4DA 3LQFA 1QCYA 3JQPA 1SCUA 2JLCA 1HG1A 2WILA 2FZGA 1WBBA 1O0CA 4UCQA 1R6DA 2GHTA 4UTZA 1QYRA 1F48A 1NFRA 2QNIA 2O7QA 3LBAA 3BDIA 4DBLC 4W9MC 1FP4A 1YK0A 3VRHA 1ZN8A 1A5TA 4N4AA 5JUWA 4DMRA 4AQYB 2R4QA 5JSZB 4WV3A 2A0FA 5HDQA 2ZWAA 3TD2A 3LV8A 3L4KA 1N2CA 4JD5A 3JD3A 1A5AB 2W2LD 5ERYA 1KOJA 1PQYA 1N75A 1VLHA 3DFIA 3SJCA 2PTGA 4AL4A 1ABBA 2YL2A 4MVJA 2JJ8A 3EEYA 4BCBA 5KWJA 4FFBA 1GZ7A 2PBZA 3U1VA 3WRXC 4RF4A 3E84A 2QRGA 2FSVA 1K7SN 2RHRA 4TMWA 2O7VA 1CNMA 3C7DB 2D5AA 3DE5X 1DC5A 1W5FA 2YV2A 3PYXA 1Q2UA 3Q15C 3UN1A 4RXTA 4L4YA 2M6SA 2Z5GA 2W43A 2MHCA 1I1QB 1AOXA 1Z4JA 2VP5A 3IIKA 5KYWB 2XWJI 3DCYA 5CFMA 1XALA 4E5MA 3MUNA 2PX2A 5CT4A 5CPFA 1SG9A 2P3OA 3NOXA 4B09A 2N0SA 5E9QA 2PMEA 4N6OA 2AHRA 3MWDA 3SBOA 1F8FA 2QZJA 2FFRA 3M82A 2DQ4A 1JQKA 1U9YA 2B20A 2YVQA 3OI7A 2G25A 1DIAA 4FE7A 1V8FA 3EHEA 4TM7A 2V03A 3JYPA 5CK5A 4F3CA 1I1NA 1GM5A 1KR5A 4I1IA 4P7BA 3BFPA 3IT0A 3B6KA 4ZZ2A 3JD4A 1XF1A 1Z7BA 2Q0QA 2CMDA 2MU1A 4CKWB 1KEUA 2W6IA 4CMEC 1QF7A 3VVCA 4EB8A 5BN3A 3EPHA 1RMYA 4ALKA 2VTBB 3K1TA 3MBKA 3I04A 1LPAB 3PXEA 3PL5A 4Z4GA 4KQIA 3BHMA 2FAXA 1GY8A 2P91A 4FBGA 4Y2PA 1QRTA 2C7GA 4QOIA 3W2TA 4WESB 3WKAA 1AGYA 3WOHA 4CL0A 1QYWA 4A0FA 1DQPA 1PZMA 4B6GA 1YHYA 3N8DA 4BXOA 5F33A 1E1RA 3NJRA 2OXCA 3ZGZA 2CKDA 3KOXA 2O20A 3ASYA 4G2NA 3B8EA 2OHFA 3S1SA 2X5JO 1E9FA 4KFUA 2BKAA 4MQ4A 5T57A 2FSPA 1EK2A 4J43A 3IAHA 4EFNA 2G4CA 5A7FA 3UBMA 4QLBA 3QKTA 4MYSA 1FX0A 4P1ZA 3IUJA 4PHGA 4Q7QA 2NU9A 5K2OA 3F46A 4N3AA 1M34A 3A70A 3BA1A 3PC3A 3T7SA 3VR6D 4EO9A 1UXOA 1IH8A 2OMKA 1EFUA 1MFPA 1WBDA 4C3OB 5SYAA 1SWWA 3QEMA 5AJZA 3HKCB 3PJEA 4HGPA 4KXYA 4Q24A 5H4GA 3INYA 2ZYRA 2WSSD 1ISRA 3W6ZA 2Z2YA 3TZHA 2JH8A 4R05A 2YASA 4PR3A 3EHDA 1P6XA 1Z74A 1ZH4A 4E09A 2HBQA 3CE6A 1LDBA 4PTLA 1SKBA 1X7YA 2RE8A 3GA0A 3PF9A 4C2TA 4CFSA 2V65A 3P0JA 1WRBA 4QGSA 3FRIA 2FPMA 4FYMA 2XGOA 4H7FA 1GKIA 2E4AA 2XXJA 4IKPA 5AM4A 3VX3A 2E4YA 4LKOA 3A1UA 3P26A 4QAQA 1C7RA 4D42A 2V8OA 7REQB 4XYGA 5CK4A 1LRLA 4D56A 3WL7A 1WUKS 1AN9A 4TZKA 2O19A 2KM1A 5DLQC 4MV6A 3CURA 3UGJA 3O1HB 3IB6A 1I3NA 1GPMA 1U98A 2V1UA 2C8LA 2R6R1 1T36B 1MABB 4JYZA 3AERB 5C3UA 5EZSA 2Q8NA 3CFYA 4FB5A 5BORA 5KWVA 3U40A 2C94A 4BZZA 2R6DA 3OZEA 1DU4A 1ZCFA 4ZJZA 2YV1A 5B7QA 2Q8PA 5JYDA 1P4JA 4PS0A 1GPJA 3OJ0A 3RKUA 5D86A 4URUR 2ID4A 2VC2B 4H15A 1W5BA 2ERYA 3CRRA 4GBED 4HDRA 5CVJA 3ZIUA 4L6CA 4UC0A 4BB6A 4GI7A 4F84A 1PWHA 3JVDA 1ZQ1A 4FNOA 1B8VA 3VYUB 1O95A 1UIMA 2ODWA 3ED1A 5AJWA 1Q0SA 1KJIA 2F7SA 4XOIA 4BLTA 3H5TA 5ELMA 4CVNA 1VJTA 1E3WB 4OHXA 5BNZA 1HT3A 1RRKA 2G5TA 3O8LA 4RD2A 2ACVA 4DOMA 3M3DA 2WZCA 3GVPA 2XZPA 1LF5A 3B2QA 4Y1RA 5CBKA 1UBOS 2YTZA 3IUMA 3KLMX 3QYAA 4MVXA 2ODEA 3DL0A 4OUDB 3RSGA 4TMKA 1SULA 3BMOA 2QENA 4EW1A 3EMBA 1V8ZA 2ZW9A 4GVLA 3T38A 1QRRA 3K31A 3OHPA 4A0GA 3GMTA 3RFXA 2J9XB 2IH2A 2DWPA 2E4ZA 4ZK2A 5CDFE 1P19A 1M1UA 5B58C 3HWRA 3K8QA 4AECA 2GHIA 3VR6H 5BMOA 2X8LA 1NP7A 1IOVA 5CRIA 5D3ZA 1CWUA 4NV0A 2BUBA 4AVYA 4M55A 4YAEA 4GYKA 4HXGA 4RPCA 2R65A 1SB8A 4XAQA 2A5YB 4MKIA 1LBQA 4XQEA 2BEVB 3U26A 1V41E 1Z7EA 3T9AA 1C4XA 3BORA 1NA5A 3AEUB 2RBGA 4K1LA 4COOA 3T1YB 5JSKA 2ZSHA 2RHGB 1NBHA 2HWKA 3AVQA 3E8MA 5EMKA 4NC9A 2HRQA 4ZFNA 1DKUA 3TLGB 3LUJA 1VCNA 3GGSA 2QTRA 2R8PA 4BBPA 1PR1A 2BH2A 2NZ8A 2WG0A 1U1FA 2ZAMA 4DTCA 2D5CA 1NF9A 1ZESA 4HTAA 4I4TB 3P52A 4JEHA 4DBZA 1IWPB 2WT4A 1C7FA 3DFKA 3C3YA 4LOIA 2E2WA 2QBYA 1JDNA 1ORRA 1XB2A 3IRVA 5HWSA 3DBVO 5JJBA 3UXYA 2YFYA 1J1UA 3BYZA 3H8VA 3OM1A 5B12A 3HMKA 3HXOA 2OGZA 2CMGA 1NWHA 3BTSA 5DOVA 4DRXB 3TJRA 4X84A 1M10A 3EW9A 5BSHA 1L6IA 1SUAA 2GBCA 3HCBA 1ZCAA 2XUJA 2Y1GA 2PZMA 2Y99A 4A16A 2YJ5A 1X1CA 3DXYA 5DSTA 1PUXA 4A0RA 2JB9A 3N7AA 3ROEA 1RXIA 3ZK7A 2WLSA 4Z7OB 1CDZA 2GPBA 2QSYA 3LPNA 2WWTA 4MWTA 3R5KA 1ONOA 4CEIB 2J9ZB 2XB9A 3D54D 3MEQA 3D3EA 5D7BA 2FN9A 1GUAA 3FPSA 3TRDA 1Z15A 2UXCB 2XDQA 1G3MA 3AV3A 3VJMA 3BZWA 2AEJA 1E5VA 1XK7A 4FZJA 5CXUA 4ARIA 4FQ5A 4CKYA 3BGSA 3WFIA 3ZX5A 1A8UA 4JOSA 2X15A 1K92A 5CJ2A 3AR8A 1NSFA 3LVFO 2VRCA 5AI6A 3BE6A 4MA5A 2O0KA 5G1PA 3G1WA 3O2SB 1V96A 1CZKA 1A4IA 1NXPA 3CTPA 1NMYA 2D0PB 3T8YA 4IZHA 2BY4A 5C1OA 1W0JD 2Q5CA 4CFZA 4ZVLA 4ITRC 5L3QB 4EHKA 4WJLA 3TG2A 1AKYA 4IVNA 4EKNB 4Z0PA 4PRZA 3V8VA 4DVJA 1GEEA 3JQ7B 3OU2A 3VPFA 421PA 1JG6A 2JH3A 2CCGA 2XW6A 3ITNA 4J0CA 1EZ4A 3RRMA 3ZE2B 4CW7A 3DTNA 1PGOA 2VP0A 4YRTA 2YVAA 1C4OA 4X44A 3TLYA 2W42A 2BMDA 3AEKA 5EE3A 4WXPA 1XAJA 2VP3A 4GOOD 4JLVA 1NBAA 4BIIA 2V7VA 2ZSKA 3IP7A 1IVNA 3V9AA 1ZBDA 2Q1TA 4B80A 2FZ4A 1V3UA 1UK6A 3KE8A 4LVOA 4RTSA 5K0GA 2ZTUA 5LA6F 1M9NA 3UMVA 4BC0A 4L51A 1AKTA 3DE7X 2ORED 4H35A 1CCWA 4PLCA 1WNTA 4CF4A 2YJNA 4ND5A 3U0VA 2FOIA 2ZBGA 1CYDA 3WNDA 2FKAA 3M2PA 4IHJA 1Z38A 1TT7A 4J29A 5LB2A 1DQNA 3ZKWA 1KMQA 2GN0A 3ZUPA 1U0OC 1LUAA 3Q3CA 1JQJC 1WWKA 2RI0A 4JITA 5ALQA 3GZTB 4AX8A 4X1IB 4JLUA 4LBZA 1C0LA 2IZ0A 3DYBA 5EJGA 4ZAXA 4ZVSA 3RAPR 3UMMA 2H17A 5LQDA 4ZVVA 1TO6A 2Q2VA 3SSOA 3AVPA 2B2CA 1F5SA 1LLCA 3FPGA 4YAWA 4RA6B 1J0BA 5K6RA 2O8FB 1OAKA 3KLNA 4C89A 4ZTZB 1ZH2A 4NBTA 4L6IA 2PV7A 2CW5A 3AEQB 1QMGA 3RSFA 3T9FA 2WHEA 1GCUA 2QYHA 3OTQA 4P5EA 2NLOA 3VC7A 1AQYA 2H7YA 4RK1A 3TIXB 3X1XA 4AWXA 1W85B 2CJWA 2FVXA 3IPRA 5CB0A 1EQAA 5CDUA 1P60A 4MDYA 4MUYA 1CJMA 1O9GA 3TNDA 2BKLA 1OXMA 2QTVA 2QORA 1IOZA 1CJCA 2JAWA 3BN3A 3G7NA 4L4ZA 3ZBQA 4EGAA 1VKOA 1GVHA 5LFAA 2E49A 4AKGA 2SCUA 5IKXA 4CLEA 2QEQA 2GK7A 2XQVA 3PUKA 3UFXB 5DWVA 3K0KA 5CD9A 5HILA 1ZW6A 2BJHA 4RJKA 5AJUA 3TZEA 1OKKD 2NZWA 3FTQA 3DXXA 5JMPA 4JFAA 1E1CA 3CUTA 3MCZA 1UXKA 4HDQB 1PN3A 1T5BA 2CWWA 2RONA 4PPFA 5LBUA 1AZWA 3R76A 3UXEA 4BFUA 1PKXA 4C06A 1N77A 3DHEA 4KR2A 3KR0A 1VB3A 2V54A 3KQSA 1NASA 2RGWA 1TUIA 4MUAA 4Q4HB 3SP1A 3G8CA 3GHYA 4QOHA 1JDSA 3CPSA 5J58A 4TS1A 2N1BA 1Q3TA 2JEOA 4MQ6A 2UXBB 1GHTA 2CNWA 2H2HA 5JZSA 4DCUA 3VNUA 3SC2B 1YUBA 2A88A 2RI1A 3ESAA 3H4IA 1Q17A 2X8JA 1W36D 1YQ9A 4Q34A 3TZBA 2CMHA 1L7EA 3JAMA 3PWKA 3U9TA 4EABA 2ZB2A 1DQSA 1TECE 4RJTA 2CT8A 1IM5A 4W7IA 5DM2A 2QN7A 5L6LB 3WIVA 3GCDA 1JJBA 3F2IA 1CUZA 4B1FA 3MWEB 2JCVA 3SEFA 2VNHA 3RODA 1XMQB 1L1RA 4DJDC 1HMPA 4RZHA 5CP8A 5T8KA 3SOPA 1Y8QB 4ZOBA 4LMAA 4R1PA 3PVZA 4AU1A 4C20A 4JVSB 4S05A 4LRUA 3U4QB 1MJHA 3HRKA 3L5KA 5TT0A 3CCBA 4X65B 1ZIYA 3PUHA 5AP9A 1C1XA 5HQTA 4QPNA 2M1XA 1HL7A 3VM6A 1CS0B 1AB5A 3P20A 3UIEA 2RKBA 3GLVA 3NRBA 3OFND 1B6GA 2AJDA 3LF2A 4R3UC 1XRLA 4W6ZA 4MWSA 1T10A 6ADHA 5A4IS 2UZIR 1KIFA 3OLWA 1JFTA 1FDTA 1CY1A 3N2GB 4A2QA 3ZW8A 3M8KA 5LD2C 1XP8A 2JFFA 5AOBA 4ZZ0A 3BIWA 5JO9A 3N86A 5JSZA 1NVWQ 2NVUB 2G3YA 2HC9A 3R7NA 1YJBA 2GD2A 1BRTA 1OF1A 2C9YA 1A0OA 3DBLB 4RGBA 4AO6A 2A5GA 5IF9A 5GVSA 3OAAD 2AOTB 4GGOA 1U02A 4IDGA 3NDJA 2IY8A 4JJEA 4R31A 3GAFA 4U9UA 4EQ6B 3DCIA 3RVJA 5HZGA 1W6RA 3SXPA 2QRNA 1EX7A 1WEHA 1C81A 2CBXA 2MSNA 3D7SA 4QDUA 1T25A 2YBDA 2W4MA 3L8GA 3NHJA 2WFLB 5DK4A 3U7QB 5ITWA 3BIXA 3EXHB 2H59A 4LSZA 3CNQS 1NVEA 3IUNA 4A5OA 1RW4A 1Z18A 2GAAA 2V4UA 4D0GA 2E4VA 4EATA 1XXHE 1VE5A 4DMHA 4Q3NA 3RUPA 1RWXA 4K81B 1I3LA 1G42A 3OA2A 4KV9A 4D3ZA 4EMUA 4M8SA 5CNJA 5G2OA 2CF5A 4DR2B 4IMIB 3GP5A 3H6KA 3HP7A 1U90A 3IAAA 5KYWA 3F9CA 4UBNA 1CUSA 2GAFA 2XUFA 4WLUA 1U0LA 3SR3A 4OQZA 1E4VA 4A2WA 2PV0A 3ZOZA 3CPJB 1CTQA 4FHFA 3STVA 3FZNA 3DJYA 4IWXA 4M9SA 1OILA 1J97A 3SMQA 3PL1A 2XV1A 1E5DA 1RJWA 3GEDA 3R0JA 16PKA 3GN1A 3B3GA 5KAMA 1XMSA 3UWKA 2ZJ7A 2A9FA 1Y4DE 3MTQA 3O75A 4ZALA 3CW9A 5DHQA 5FUBA 4L8WB 5C52B 2X8WA 4G41A 4KMRA 2PL9A 4HPWA 1F4LA 1XD2A 2JIDA 4CM9A 2QY6A 3AVTA 5U9CA 4KRFA 2XYRA 1XC7A 3N28A 1PYGA 2A58A 4JCCA 5JJIA 1NC1A 4GDFA 2WTEA 1T5LA 3HB4X 4CI0B 2CLLB 1EWKA 2ZI3A 3WNQA 1H5QA 1WVGA 3UAZA 1BWQA 2R2GA 4YJ2B 5FPSA 3HHPA 3T9EA 4KVFA 3UCFA 2JAQA 1M6EX 4OJNA 4WQMA 2OHJA 2BGKA 3AEYA 4WFIA 5C8YB 1BKSB 4DV7B 1UOOA 4LOKA 1LI7A 4O2BF 5SICE 1TUEA 1JGTA 2XJ4A 4KTTE 4F06A 3HVIA 1BVHA 4EG3A 1P1HA 1QCDA 3HBAA 4MVJD 1UK8A 2SICE 1B8OA 1E9BA 4Q05A 3CYFA 2GSWA 3R8CA 1M2VB 2Q5OA 3IVAA 4C6TB 4F96A 3TIGA 1GCGA 4YAKA 2C00A 1NKTA 1WXEA 4DT1A 3FPKA 3NETA 2IXAA 3OMLA 3PQ8A 1HDEA 4IJMA 1ZGCA 2MJLA 1T5TA 1RI3A 3HKCA 4B46A 1VJRA 3NX4A 2V1XA 4BMYA 1OHHA 3INNA 1QU3A 1NYTA 2ST1A 3CC8A 3F5MA 3JWPA 2QZ9A 4N5NA 4BLPA 2X6TA 4JP3A 1GG8A 2QX7A 2AC4A 3CN9A 3DOFA 4FFNA 1G4AE 1LFAA 3WWCA 4TVOA 2JNWA 3VR0A 2I03A 4E4RA 1UPXA 1YE3A 2YXLA 2DPYA 1POXA 1IZZA 1SY7A 2VZ0A 4FYJA 4TUYB 3OZIA 2Q62A 4DJEC 1U3UA 4YACA 5E7MA 3GYGA 1CW2B 3GEGA 5DCUA 3DZIA 2C2WA 3L0SA 5CEJA 4V1CB 1UZAA 1BX0A 4GLFA 2XAAA 2WC1A 4JJAA 2IF2A 2QAGC 3CX7A 2N75A 2C95A 5E1BA 3PLAE 3SM3A 5I4CA 3LO5A 3HA2A 3TGLA 2OP1A 1I7PA 5DO9A 3OSZA 4ZC1A 2BVNA 3RM3A 2YWEA 3ZGVA 5KYTA 4W5WA 1RQNA 3S1AB 5IKOA 3SQWA 5CB4F 1K08A 2E37A 3BM5A 4DLNA 2J85A 2N42A 1ULTA 2ZJ2A 3DM9B 4KQJA 3TSYA 5KPJA 2F2TA 3A6LA 1T36A 3VOTA 1A27A 1TJ5A 1MABA 1XWFA 2PFKA 4AJIA 4KIWA 4MVJG 3AERA 2IHKA 2FPKA 1IUNA 1QX3A 2LZ0A 1SFRA 1PTJA 3DMTC 4QJ4A 2O2ZA 1ZLXA 3VSEA 4BFCA 2O54A 1K88A 1VL6A 1GTMA 13PKA 1WE2A 3C1UA 3KZXA 4QPZA 2Y77A 2DG2A 2EHJA 4ZVRA 1E2JA 5JSYA 3SLKA 1EGQA 2EL7A 4JGGA 4URZR 4EUEA 4MIOA 3IE2A 2JHCA 2R6ZA 2J41A 3QX3A 3KOMA 5ILGA 1FSGA 4V0SA 1T5OA 4DIUA 3B12A 5LQUA 1LX7A 4NVRA 3G9XA 1E3WA 1NG1A 4R9NA 1GWNA 1O6BA 2B61A 4R8MA 5JAHA 5HCIA 2I3AA 2B0CA 1ONBA 2X1HA 4HGZA 1TM7E 3VYVA 1CUYA 3JD0A 1MAUA 3SF8A 2JGFA 4I1UA 1J8YF 1KYXA 3EAGA 1X9HA 1X39A 1R10A 4FKMA 1AG9A 4DRZA 1LY1A 1EA7A 3M1YA 2O2DA 1UM9B 3L40A 1QK5A 3NALA 1CERA 3QVKA 4PWYA 4HZIA 3ADKA 3VYWA 1U0NA 3X0DA 2XQIA 1KAHA 2BEWB 1O9BA 2JC3A 3S28A 2GKSA 4XI9A 1VGQA 1Z83A 3NT4A 4DSNA 2HDWA 3IERA 1Z6PA 4HYEA 1ZM9A 3BXHA 3A3NA 4F3NA 3B7GA 2D1FA 2PKQO 3V8QA 1JJIA 2HZ7A 3NBAA 4E2YA 4BO6A 5HJ2A 2VLBA 4TQGA 4W9NA 4IGFA 1WMBA 1O5IA 4OKIA 3PJDA 4G8BA 4JKIA 3DL2A 3S55A 3MT0A 4OA5A 1HORA 2BEVA 2ZU0C 3DKVA 2O4UX 5EPOA 3U3DA 2X19A 4F5ZA 1WETA 2CBGA 2WOOA 4CV3A 3AEUA 1P8JA 3DLIA 2W2QA 4B35A 5IMBA 2ZJ4A 1NBMD 1AV6A 2AJ8A 3TLGA 1P8AA 5HHTA 4P3KA 4R8SA 2QP4A 3PLRA 4BO8A 1ZEJA 4DNXA 3K2BA 3OJCA 5A06A 3IHLA 3AF6A 2OHIA 5C35A 2RHHA 4I4TA 4B33A 1GNRA 1FLVA 3N39C 5TJ9A 2XKBA 2GPWA 1VJ1A 1DL5A 3HY6A 4IJQA 3S40A 1KOGA 1VFNA 3FBGA 4UCWA 5JJKA 3R3YA 4FFPA 4IBOA 3NUZA 5EEHA 1W46A 1X74A 3MTBA 1GAXA 4LXUA 4J0GA 4DRXA 4HVTA 1PFYA 5KSYA 3I2JA 4MULA 4CMJA 1H4QA 3KD2A 2TRSB 1KOFA 1DIGA 2HWYA 4I9FA 3R7WB 2YDYA 2BFAA 3NAMA 3VSBA 3K30A 3QVOA 4CM3A 3CWQA 4D74A 5FOQA 3THOA 3AOGA 1G9SA 1KO8A 1N7HA 4WJKB 5TXGA 3O4RA 4OFBA 1WCWA 4CIYA 1Q12A 3PCRB 3W6PA 2D6FA 2VAPA 3OZXA 4NKRA 4E21A 4EVIA 5A5EA 3N87A 1OH7A 4CEIA 2POCA 2BWJA 2LR0A 3DE1X 3G9TA 2I7VA 2PRJA 1SCKA 4PIMA 2WJGA 4DM7A 1YC5A 2CMFA 2AUMA 4ZREA 1GZ5A 2ZRHA 4Y8VA 5KJFA 4ZOAA 3U4GA 1XTIA 1NTRA 4M22A 2ZUCA 1T4GA 3MWKA 2QT0A 4ND7A 1JIIA 2D2FA 1VRVA 4EI7A 1T5HX 3RUEA 2JI8A 5IULC 5U4XA 3BSFA 2GK6A 3LA8A 3PNMA 4HF7A 3AY0A 4WX2B 3ZY3A 1RYMA 4Z7JA 3I4FA 3FCSB 2HO5A 4KYVA 3FPCA 3FGOA 5L3QA 4MGZR 1EESA 1WOYA 2QN6A 1YZTA 3NHRA 4JT9A 3TTYA 4K9QA 3RREA 4CLHA 5BXYA 3BFVA 2HIHA 1E9RA 2PU7A 3DHNA 3IEPA 2GN9A 3V2IA 4L8YA 2QIOA 1KK2A 5H4HA 1SBIA 1MO3A 1PLJA 1ZUD1 1SZJG 4ZA2A 3EUFA 2PWYA 4DJAA 3P5BA 4NU0A 5E2IA 3VSAA 4X62B 1JPJA 2XT6A 4P7JA 3LZ6A 4OSEA 4C43A 3TLBA 5LP6C 5JNVA 3LQ2A 4WXEA 1M6VB 1UK7A 1VDMA 3UHAA 3KHUA 3D43A 4FDUA 1EM6A 2JCYA 3KAPA 3KOWA 5IANA 1RHKA 3H1PA 4TWJA 1YB1A 1IM8A 1OT3A 2KX7A 4JQSA 3WK9A 1TJ4A 3WKDA 4H77A 4X95A 1G64A 1QVRA 3EUAA 1CD5A 4KXLA 5HS6A 3QVXA 3IELA 5LU9A 3O4VA 1SUDA 2PX4A 2Y68A 3D2AA 3BCHA 4EG5A 3AKEA 2LUOA 2C31A 3MMPA 4X6LA 4X1IA 5ALUA 5A5VA 4HAXA 4HX5A 4RZXA 1N8KA 4Y1EA 1SOWA 5JT1A 1WZUA 2AKAB 4AY5A 2YJGA 4D4LA 3L07A 1X7HA 1Z7YA 2MYNA 2C3OA 1CQIA 5E95A 5BSMA 2O8FA 1QAQA 3J81A 1NV9A 3AEQA 4BJHB 3T35A 1XVTA 4P53A 3KLOA 4UM9D 3EFBA 4DQLA 2PS3A 2WG2A 1W85A 4DV4B 4TVBA 4ZQBA 4TMFA 3ZDZB 1MJGA 3COSA 2JGJA 3BK7A 1VKHA 2PX6A 3AFMA 3GUYA 3EDYA 4UM7A 1G41A 1HT1E 5L7YA 3O1JC 3GFGA 3WIBA 5BRJA 2QTMA 2XGSA 4TYNA 4CF5A 4F92B 2NO4A 2PHZA 1QYCA 3UFXA 3UAVA 2FEXA 2YWCA 4FGUA 3G3EA 3FF4A 2LDXA 3I9KA 4HNSA 2C1XA 3TVDA 5A5FA 3AYZB 4BBAA 4CDMA 3D8TA 1HETA 5HUHA 5KSWB 2ECFA 3RQIA 3TQOA 4Q37A 4DWOA 2OESA 1CR0A 2JGLA 4HWRA 3ID6C 1JQLB 1UBUS 4LSGA 4EA6A 1G2PA 2PZBA 1XVVA 1KYZA 1J24A 1X0XA 3E23A 2WG1A 2XJ9A 1QO9A 3OVMA 4Z8YA 2R47A 1T8UA 2NO7A 4Q4HA 3H1FA 1J33A 2ZRAA 3QYPA 5K8TA 4O33A 4YAJA 3SC2A 3L4BC 2O8CB 1OZAA 4FMDF 3A1NA 1NULA 2WKWA 1AUOA 1JR2A 1GU7A 1QYDA 2BMEA 3CEAA 2RGEA 3BJZA 3E2PA 2Q3MA 4OATA 3U7GA 5HGJA 1Y5NA 1PNVA 5DMHA 3ZE1B 3ZDRA 5LYJF 2BFEB 2ESRA 4D3DA 3WAKA 5E3JA 1TD9A 5C1IA 4ALLA 1BFKA 2ZIGA 1SUBA 2B3DA 4JX9A 1L8LA 4U7GA 1FFHA 3B85A 2I8CA 2RCYA 1CRZA 2Q3HA 3JR7A 3MWEA 1LGYA 4MA4A 3T3DA 3DAOA 1AU9A 2IU3A 2Q6TA 3UB2A 2DF8A 1NAIA 2AQKA 3E4DA 4RMHA 3HY4A 2VYNA 1F2UB 1EDOA 1TTQB 1Y8QA 1RWKA 3ANLA 4RVGA 1JG1A 3PX7A 4LBVA 2A2ZA 1O3YA 1DP4A 3K1YA 5B3AA 2PX0A 2PBLA 3GARA 3U4QA 1WDKA 2O8NA 1U3VA 4JWTA 2OTCA 4FIDA 4ZGWA 5BOSB 1BRMA 3DOHA 1J8MF 4DXHA 1IBMB 2ZRGA 1ZHHA 1CS0A 3IPAA 3OURA 5CYPA 2DSNA 2HSGA 2RGAA 3JSAA 1QZTA 1AS2A 1SVSA 4B3CA 3BAFA 3DA8A 1IQ0A 3A28A 1OXUA 4LJ4A 3PTAA 2LGJA 2C4KA 2BBOA 4V03A 3R3HA 4PRLA 4KO4S 3N2GA 3HGMA 2BFOA 3ZXXA 4AUKA 1U4SA 1BX3A 2ANCA 1QZXA 3GLGE 4A36A 2NVUA 1QVVA 3PHLA 3DBLA 4QFMA 3WIOA 2WYVA 3O4HA 5K4GA 2A3RA 1SQSA 3FMFA 1PFVA 2AOTA 2OFWA 3QMVA 2Q0XA 4EQ6A 3PDUA 1O03A 3D8RA 3IOYA 1OXBB 4QLAA 1PJSA 1ZD5A 2AOUA 4ZU6X 1KOLA 1FP2A 3VNQA 2WFLA 4C7KA 1S5PA 1CJBA 1XZDA 1QQ5A 3EXHA 3FMOB 2UZAA 2H29A 4UM5A 2CNWD 1U0HC 4DIDA 5B3JA 5CXSA 3DD5A 1JG2A 4NX2A 1LD3A 3ZDYB 2YFHA 3TLCA 5DYNA 2XNCA 2HF2A 4JGIA 4ZOLB 1BROA 4PXAA 1OLXB 3B52X 4DLYA 2L82A 4OM7A 4HMOA 2GNPA 3EZYA 2OILA 5A3QA 5J4KA 3HH8A 2WAMA 4AZSA 3DVAB 1JYSA 4W5OA 4P3YA 4S1NA 4BO1A 1P17A 4KGXA 1B3BA 4KRYA 4QTTB 4EUFA 1JX6A 4H4DA 4GLBA 5C46F 3UKDA 4OQEA 1JHPA 1Y3HA 3RS9A 4G85A 2ZJBA 4DB4A 4XCQA 4PX2A 4BO2A 1GOTA 2AR9A 2GCEA 3MTIA 1KIAA 2CDAA 2DPGA 1R0CA 1IRIA 4PGMA 3C8ZA 3SF0A 2BHTA 3EY9A 2QZ4A 4MRRA 1FW6A 2VFAA 4IJVA 2IEZA 3LC7O 5BW6B 3D1JA 4MLDA 2WDPA 4DGSA 1KY2A 1ZZEA 3HU3A 1CEQA 1ORDA 3H2YA 1YACA 1ZUIA 3L7JA 4XR9A 5EIFA 1OXSC 2JAXA 3WBKA 2A9QA 1XJCA 3EQ6A 2Q7OE 4UHEA 3ZJ5A 3AUAA 3VXKA 3WNVA 4YJ2A 4YJFB 1DAMA 3WKCA 7YASA 5B53A 4YDHB 3EQZA 3KFXA 2FRVA 1E9AA 2A0KA 1TO1E 3DGFC 3QLUA 3PI6A 4Y6OA 5C8YA 4YVFA 3ZR4B 4JI7B 1YR7A 3BTOA 2PWPA 2YXNA 1D6NA 3SKVA 2KLHA 3TCXB 4ER0A 4HADA 4W82A 2P9FA 3MJSA 4G6ZA 3WSVA 2G1PA 1MMFB 4JI2B 3IMEA 4F3YA 3ZJVA 3NXSA 1EB8A 4OBEA 1BC5A 1ZU4A 4C6TA 3CLUC 4XGKA 4OHVA 2R96A 3KSMA 3GQBB 1NMQA 4OYHA 1M2VA 2J32A 1FVHA 5BNFA 1QRDA 1YQXA 2A9VA 2W6ZA 2Y0BA 1VJGA 4AZWA 4UFPA 1F12A 5JAOA 2BTEA 2RIPA 2JCSA 5F5XA 4PYQA 5FLKA 4YT2A 4ABTA 3KC2A 1XL0A 2YC4C 3DC2A 2ZSUA 1Y33E 3KPUA 4TWZA 4UUNA 4Y9DA 3RW9A 4FHDA 5AQ1A 5JZMA 1KAMA 3BXPA 2YZ7A 3CINA 3DR5A 3AP3A 1LNSA 1NR5A 3LYLA 2XUIA 3JXEA 1VYTA 2QJTA 4S1OA 1C9MA 5HIJA 2H2GA 3WK8A 4NYIR 4DV5B 1FDWA 1BU5A 2BFFA 2H4HA 2P1ZA 3V1NA 4TUYA 3DE0X 3H04A 4U8GA 4K8OA 1Y8ZA 1SEVA 1WCIB 4N76A 5JRDS 4QXQA 3IC5A 4B43A 3EEOA 1MIHA 1WUIS 2GB4A 2Q3LA 3MTGA 4N18A 4V1CA 1ZVQA 1TCBA 3AVVA 1G5IA 4Q03A 1Y6GA 4LOLA 4CM9D 3AYXB 1IPEA 1FLAA 5ICMA 3SM9A 1E2GA 4RDIA 1LSUA 1Z33A 4NS1A 1YZYA 4W8OA 1WB5A 2NTEA 1KTVA 4MUEA 3UK1A 3G8BA 4H1HA 4IG4A 1RI5A 5CU7A 3AUFA 1USIA 3S1AA 4RTNA 5FI1B 3IYLW 3GLQA 4X24A 2ZJ3A 4GH5A 2CK3A 4C9BA 4YONB 4ML3A 2VWGA 2II6A 1KAQA 4NDNE 1W93A 1R6VA 1MU0A 1MO4A 1KAGA 3LGXA 2GFHA 3GY0A 4GZ6A 3NFRA 3NI2A 2SKDA 4BKQA 3TR6A 1A7JA 9ATCA 1JR3E 3WRXA