2Z5FA

Human sulfotransferase sult1b1 in complex with pap
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
PKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKRKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sulfotransferase family cytosolic 1B member 1
publication title Crystal structures of human sulfotransferases SULT1B1 and SULT1C1 complexed with the cofactor product adenosine-3'-5'-diphosphate (PAP)
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.8.2.-:
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2z5fA00
5B2ZA 5ELXA 3BB3A 2V7QD 5HR5A 4LV5B 1CJTC 4M2LA 3KQHA 1GNRA 4IOKA 4MKIA 5JSZA 3ZZUA 2P0EA 3FGNA 2PT7A 1PLKA 3RLFA 2REXB 2RGAA 2VSOA 5DH9A 4EUNA 4RY2A 3PEWA 3N70A 4DLRA 2ZRNA 1E2GA 4MKFA 3PG5A 3WMFA 1U0HC 4URZR 3CONA 4PAMA 2FJUA 1E6CA 3RRZA 4AKGA 1IY1A 4HDOB 2QSZA 4Q47A 5CK4A 2J7KA 4EPWA 1CJMA 1JBKA 2QTHA 2W58A 3SC3A 1KKLA 3WRYC 3P26A 3VR6A 1EFCA 4JYCA 3DM9B 1M2OB 4OQFA 3CRRA 5HE8A 2DFTA 5C18A 1W0KA 2VPPA 3EPLA 3VKGA 1W7AA 1FMLA 4JVMA 2PT5A 4NPHA 5ANRB 3U5ZB 3QKUA 3THWB 1G7TA 1Z0FA 3T1OA 3ADCA 1AM4D 1ZINA 4RD2A 2MSDB 3ZVLA 2A5GA 4JLOA 4NONA 4W9MC 4DC9A 3DMDA 1PLJA 3P1JA 4AYXA 4M0LA 3CBQA 2ZUCA 4I1UA 1OIVA 4DIEA 2NO1A 4XVUA 1TUIA 1YJ5A 1Z07A 3O47A 4Y0AA 2ZI4A 5J4LA 1SXJE 5BN5A 4GP7A 4POAA 4B74A 2ZE6A 5JRZA 1ZAKA 4B47A 4EFNA 3FMPB 1G41A 5AJWA 3FKSD 3I61A 1QHHA 5A5GA 1YU9A 5G53C 4DB4A 3K9LA 3HR8A 2OZEA 5CLQA 1EFRD 1ZC3A 3SJBA 3Q7PA 4UJ5A 1FFHA 1N2CE 2IYZA 2OT3B 1J70A 1XMJA 2F1RA 1TF7A 4ZI2A 3IO3A 1DVRA 2ZIAA 3VFDA 1ZM9A 2FGKA 4FMCF 2D62A 2JLSA 4IVRA 5DI3A 4G0NA 3THXB 4JL6A 2D3WA 1RJ9A 2VL7A 1T91A 3DHWC 521PA 2ZJAA 4MQBA 3C41J 3R20A 4H9GA 1IY0A 4PC2A 1ZVQA 5EUMA 1M34E 4AURA 1JALA 4KVGA 1UKVY 3LY5A 5DYGA 3VQTA 4OHXA 1P75A 1KZ7B 1XX6A 4JYBA 2PX0A 1E0AA 2AFHE 1J99A 2J5XA 5DISB 4XSGA 3GJ5A 4BFVA 3D7MA 2WMOB 3AM1A 1XPUA 4ON9A 4CYMA 4QGGA 3ZH9B 3CX6A 3SU8A 2ZYTX 3SYNA 4AG5A 1NLYA 2FOLA 1D9ZA 1JQLB 3EA5A 5EE0A 2FSHA 5FPTA 5LB2A 3TSWA 1WB9A 3MRSA 2BBOA 4URUR 3JVUA 4A0FA 3GLHB 1TEVA 3AV0B 1Z0AA 4B3XA 2OE2A 2V9PA 4DLYA 3V4RA 1OIXA 2F43B 2ZRIA 2RHDA 4RZ2A 5EXXA 4RCYA 1SVKA 2QMUA 5FI0B 5FBQB 4KITB 2IWHA 5FL7A 4BGDA 5JHHB 1N6LA 4CEJA 2GJ9A 1JAIA 1XCPA 3GLGB 3MSXA 1GAJA 1OB5A 2NO7A 3NC1C 4WXRA 4ZDJA 3F3YA 5EXTA 2O8EA 2KWIA 2WWGA 1GM5A 1W36C 2VLIA 5FTNA 2QU8A 3VMFA 3RRNA 3RVBA 2ZR0A 2JLVA 5FR1A 2HLDA 3EX7C 1XZQA 2ZI5A 3PITA 2ORVA 2JDIA 4Q9LA 1M74A 1KSJA 1OHHD 3GEHA 1TAGA 4MRRA 4U5XA 2CCKA 2WWWA 4HLUC 1NKTA 2YINC 1Z8FA 4LI0A 4LJ6A 3ZZTA 4WA7A 5FTMA 1VHLA 4DT1B 5JECA 1QHYA 4URWR 5FI1B 2B7BA 5M04A 1LS6A 1DAHA 2GZAA 4Z8YA 3TAHA 2WKPA 1AS0A 1P72A 2IA5A 1G8HA 1NN1A 2GRJA 3B13B 4MGYR 4WIAA 3IILA 1OXUA 4A1FA 1COWA 1UBCA 5J4KA 3OIWA 1OIWA 4UXIA 4MITA 1UEIA 2B92A 4JVNA 1AIPA 4ZCLA 3W34A 3P4XA 2JLXA 3KTAB 2BWJA 3PR1A 3CR8A 3LAWA 1KDPA 5GVSA 2XXAA 1SXJD 4E03A 3N2IA 1HT2E 2J1LA 3LVQE 2OUKA 3NG1A 3CNLA 3QF4A 4B2LA 1R0XA 1W5TA 4XWOA 4MRPA 4OI1A 4ZIRB 4BQSA 4WW0A 2GK7A 3KJGA 2GAOA 4TZ0A 1AGRA 2FU5C 4M21A 1G3QA 3MUFA 3CRVA 4RFSB 1QG4A 4V0OA 2XITA 4LRWA 3ASZA 2ZS7A 2NO6A 1EK0A 3AKCA 2OESA 3TR5A 2WIAA 1FZQA 2RKOA 3L8YA 3SR0A 4TSFD 1RRFA 3CRMA 1OLOA 1AKEA 1XTJA 3EZ6A 1JPJA 3L0PA 1UBGA 4LJ8A 4JT4A 3EWSA 2PJZA 4CGZA 5FOTA 4ESHA 4Q21A 1TQ4A 1NJGA 2ZROA 3REFA 2QPAA 2YVUA 1ZC4A 4C0HA 2ATVA 4U7DA 3IEVA 1AQYA 2I1VB 4G3XA 1W4RA 1AN0A 4MRVA 1KI1A 2NGRA 2JATA 4AKEA 3I3SR 2ZANA 2KI5A 5A4JA 4H1UA 4D0GA 1U81A 1OYWA 3FMOB 5HTKA 2JLWA 5JWRA 1ANKA 3ETLA 1TQ6A 2C9YA 4RD3A 4AYTA 3LLUA 5EXPA 3U3OA 2BIFA 5EZ6B 2WWFA 1C1YA 1NN0A 1N0UA 3U4QA 4JT2A 5EJEA 2HCBA 4B48A 2V6JA 3ICEA 3BORA 4LOAA 3DEFA 4KVAA 4V03A 4V02A 4KJZA 5J4VA 4QGAA 3B7GA 1KK0A 8OHMA 2O8FB 3WMEA 2FZLA 4TMTA 1U99A 1IHUA 5HE9A 2JA1A 4V0MA 4ZKDA 1KO7A 5TARA 4A82A 4UNPA 2EFEB 3OAAD 3DZ8A 2VP6A 1XXHA 2PLRA 3DOEA 1JPNA 3TIFA 2XB2A 5L8VA 4JLBA 4TYNA 4QBIA 1RRCA 4JSYA 1XEFA 2AL7A 5KPJA 5A0FA 4D82A 1II8A 2IXEA 1CJVC 2R62A 3TVTA 3M6AA 4OJKA 3OE7D 2GAAA 1AGPA 3LRPA 4LSGA 4HLDA 4C0JA 4TL6A 4DDUA 2GCNA 2FSIA 3K8YA 2ZSFA 2EFDB 3CPHA 4Q66C 1XTRA 4E5UA 3QEOA 1DAMA 4D4LA 3U61B 1R8SA 4C2UA 3CM0A 1VG8A 4TT3D 4ZV4A 2BMJA 3EARA 5FPSA 3EW9A 1H65A 4Q19A 4XSHA 1GKUB 1MR3F 1DADA 3PUZA 5DN6A 2FSFA 1LFDB 4DLWA 2Q0HA 1GL6A 3I8SA 3NXSA 4ZCMA 2IK8A 2FPLA 1FNNA 2CLDX 2ZJ5A 3W5JA 3AB3A 3W6PA 4BUJA 3U7GA 3ADDA 3CZQA 4XIGS 3WBKA 3ND9A 1OW3B 2RH5A 1E1RA 3K53A 2WSMA 4DRZA 4LBWA 3FVQA 4C0KA 4DLVA 1CP2A 3NWJA 1IN7A 2YC2C 2QENA 4A2WA 1G8YA 2JAQA 2A78A 2QE7A 3WP0A 3FE2A 4LYJA 4QGHA 4MA4A 2VHUA 3KX2A 5JCPA 3UWOA 2O8CA 1X8KA 1AZTA 2QAGB 2OILA 4URXR 4KFRA 5GADl 2YOHA 2HF8A 2ZRKA 2QQ0A 4F38A 4GOXA 4OL0A 3IBYA 3NDPA 4PHGA 1O87A 1KO5A 2XOKA 1FP6A 2A30A 2XEXA 5HKKD 2P5SA 2PBRA 4PX9A 4ABYA 5FBWB 3G5UA 2BMEA 1TTTA 2FE4A 4IEEA 4JBYA 2BKEA 4GBMA 1E69A 4IXNA 2IT1A 1P4SA 2AXPA 1HY3A 1VDZA 3BC1A 3KB1A 4Q5IA 1GWNA 2JIZD 4F4JA 5C46F 4MKHA 4AWXA 2BOVA 2J0VA 1Z2CA 4MDEA 1LVGA 3QY0A 4ITRC 1DAFA 1AZSC 2Q9AA 5DHAA 5G40A 4LX0A 5DI3B 2MSEB 1P73A 1W44A 1A4RA 2ZJBA 4LJ5A 3QI2A 4OKSA 4TMXA 4WBSA 5D3MA 4PPFA 1OFTA 1D8TA 1H8HA 3KKPA 3THOA 2IXFA 3F0TA 5JJKA 2R44A 4R71A 1DG1G 2ZTSA 2W6JD 4OK5A 3RHFA 2NZJA 3CR7A 3BE4A 4PQFA 1XTSA 1N0WA 1E9CA 1SVMA 3KQUA 4DCUA 5JRJA 4LJ4A 4DVGA 2MSCB 3LX5A 1WCV1 5G3ZA 4DCSA 5K8TA 1JQJC 2ODNA 1S9HA 2F7SA 4M1OA 3LW7A 2I4IA 1NL3A 4Q9KA 3GEEA 3Q5DA 1MABA 2HXSA 4ZCIA 2D2EA 5LB4A 4BFZA 4MGZR 5TMPA 3NHBA 2N46A 3IO5A 4B3GA 4PO1A 1ZD8A 3VR5A 4TMZA 3ONWA 4M9XA 3KQNA 2QPTA 4F4IA 5FBVB 2XZLA 1W46A 2BV3A 5JEEA 2O8BB 1CULC 3DPUA 1OH8A 2QSYA 3CF0A 3KDSE 3QBVA 5F9HA 4W5WA 1IJFA 2H17A 2H7VA 4RKEA 4A36A 3WMGA 1A2KC 2ECKA 1OXTA 3MGCA 3GLFA 1W47A 4A2QA 3NH9A 1N5JA 3AVXA 4Z1MD 4TQ9A 3BH6A 2WJGA 4LYHA 1DPFA 2P2LA 4KXFB 3TW8B 4P33A 1E96A 3HU1A 4HATA 1K5GA 1OKKD 1YR7A 2QM7A 1KDRA 1BKDR 2BVNA 2ZSBA 4LJ7A 4Q4HB 4TQAA 4WZBE 1KMHA 1N6IA 4NYJR 4Q4JB 3WP1B 2J9RA 2IYRA 421PA 1J7KA 4TWZA 3SQWA 2VEDA 1JJVA 2OO7A 3LQRA 3MCAA 4B35A 1W0JA 2O8DA 2Q3MA 3FKQA 1G1MA 3S1AA 4MDFA 3GFTA 4HYYA 2WKQA 4JLVA 1TX4B 1KO8A 1OFHA 1UKEA 3LNCA 1CIPA 4DIDA 3H2YA 2X77A 5KOYA 3NKVA 1OB2A 2DFNA 2EW1A 1CR4A 4Q01A 1P9NA 1TL7C 2WJYA 4OQLA 2NO9A 3SHFA 4JS0A 2G1JA 4C9BA 4CF7A 3EAQA 4TQUS 1T9HA 4HSEA 1E1QD 1FX0A 5E7IA 3IIMA 2J0QA 4MYCA 2V4ZA 4P4SB 5KYKA 4B71A 5FL3A 1KMQA 1DARA 2IS6A 2CE2X 2WSSD 2OAQ1 5E4FA 1ZYUA 3B1YA 2WIBA 3QF4B 3WBJA 3HP1A 4S35A 5HPYB 1MV5A 2C04A 5JI2E 4A15A 4Q18A 4HZUB 4PPGA 3WNCA 3GEIA 4NZYA 1WE2A 5DIFA 1EESA 2H92A 3RC3A 4BLOA 1GSIA 1E0JA 4CEHB 4XTCS 1VG9B 5DHFA 3IQXA 5EQTA 3R7WB 3K0AB 1QHXA 2VRWA 2IBMA 2F9MA 3Q5EA 2GK6A 3AVOA 4GZMA 4AKHA 1E0KA 1VMAA 3SNHA 2ZUBA 2A5YB 1R7RA 2AKYA 4M22A 2Q9BA 5L3SB 2CL7X 1N6PA 4BZPA 3GLHE 2WJHA 4M1WA 1FNMA 3A4NA 4IHQA 3FYHA 3WHKA 3FKSA 3A4MA 1KZGB 4IXMA 2IUSA 3T1VA 3D31A 1SVSA 1T3SA 4QJ5A 3UXMA 1FW6A 4H1VA 4L8GA 3H86A 1MO5A 1YVDA 4UXJA 2V55B 4DKXA 3GLGE 5CDFA 3BFKA 2QI9C 2JLUA 3OEED 1EX6A 5J4HA 1M6NA 4YXWD 1Q0UA 3IHWA 4GFDA 2GBLA 2QMHA 3A1SA 4LBVA 4OYHA 3U44A 1PVOA 3MJRA 2CK3D 3EPHA 1XJ0A 4DSTA 4D0NA 1PV4A 1KIMA 4LBZA 2W6ID 1LNZA 2J41A 4PR0A 4RJLA 1LF5A 1ZCAA 1E4YA 5FTLA 1G18A 3RWMB 3SJCA 1JEDA 1R5NA 4HI0E 3GLIA 2G83A 1WMSA 1KI6A 4IDQA 3T15A 4FN5A 3DMNA 1XXHB 3RS5A 2PLFA 5FTJA 121PA 1F2UB 3AGQA 2A7QA 4JSTA 3IIKA 3U60B 2DCUA 4KSCA 1S9DA 5H70A 2WPDD 2IF0A 5F3WB 2E1RA 1NI3A 3HPQA 2DWOA 1F60A 3B2EA 1T5LA 1DEKA 4IOMA 1T8TA 3IGFA 3MFYA 4MKGA 2QBYB 1LY1A 2AX4A 3GMTA 1R10A 3SBDA 2ZSEA 5AUPB 2OEPA 4JVLA 1SQ5A 3OEHA 4Q4AA 3X1DA 4AY2A 3WHLA 2W2VA 3D8BA 3PCRB 4FMBB 4BZXA 4R2IA 2DHRA 3SYLA 3LBHA 3T06B 1HA3A 3O8RA 1DE0A 4LC0A 4V0KA 1IN5A 5K8UA 3RS2A 1OHHA 1OFUX 2GEVA 4IKEA 4UNSA 4FMDF 1Z29A 3ASYA 1YR9A 2BC9A 1KYIA 3GJ0A 3DKVA 1A1VA 1KGDA 1QVAA 4L9WA 4K46A 1Z0JA 1YRAA 3RS7A 2J0UA 5SZIA 3GCGA 4RZUA 1ETUA 4E09A 4R9UC 4BLPA 4ZDKA 4US0R 1E0SA 3Q7QA 1L2TA 2QMEA 4YDHB 2RHMA 4DLSA 5D3QA 2GZDA 3VHLB 4OQMA 1G21E 1NN5A 4JJKA 4MYTA 1W4CA 4N0DA 1W49A 4HUQB 1ZUHA 2O8CB 3H4MA 2IUUA 3BFXA 4MYHA 3BB1A 1PLLA 2IYQA 3C15C 1XD9A 5SZHB 3SDZA 3ICQB 1US8A 2CEAA 3LXXA 1W36B 4Q4LA 3K9NA 2RGGA 2ZJOA 3LW8A 4GMDA 2LKCA 2G0TA 1GZSA 3QG1A 4LK2A 1E32A 1KSHA 3V00A 4DCTA 4GOJA 1G5TA 1TQDA 1XJQA 2XZOA 2WJJA 1XTIA 4M1YA 2F3TA 4GL2A 3ZVNA 4A0GA 5TB5A 3TH5A 1ZNXA 2BDTA 3WNDA 3MD0A 2BEJA 4DDVA 721PA 3KFVA 4D81A 2ZI3A 1KY2A 2B6HA 4OHVA 3A36A 2LWIA 1E99A 1NIJA 3M4YA 3L0IB 3F8TA 4OQNA 4EAQA 1EFUA 4X8HA 1RC8A 1UKYA 3ZGXA 4DUGA 1HH4A 1IOZA 1M7GA 2ZI6A 5K8IA 4NYJQ 3TE6A 2ZRPA 1P2VA 2QRNA 2QM8A 3KB2A 4ZKEA 1GG2A 4FCVA 2WWYA 3AQ4A 2WAYA 1ZIPA 5FBRB 4L16A 4MYUA 5JMTA 2K5UA 2GETA 1YR6A 1M1YE 5JJLA 1GKIA 5AJVB 2EFGA 3QPVA 2FN4A 4B33A 2Q3FA 4BFUA 2C95A 3OFNA 4WOPA 3R9IA 1SVOA 2VHTA 5FOXA 4AD8A 2IYWA 5EP3A 3CNNA 2HT1A 4DB2A 1C4OA 1QZXA 2Z43A 1Q20A 1WP9A 2FFHA 3QKSB 1ZJ6A 2EFHB 4TLDA 1GL9B 5KDDA 1E3MA 1AJEA 4CT5A 2BMDA 1ZM2A 2ODWA 3LVRE 3QIAA 4D80A 2QL6A 1P62B 3NTUA 1B23P 4PTLA 1IQPA 4LYAA 4OHZA 1Z22A 3U7HB 4A0HA 5DNYB 1KK2A 2YOFA 4N1AA 3E2IA 3QUSA 1IONA 1EFHA 3QVUA 3L82B 5EP1A 1FTNA 1E2FA 2XTMA 3I5XA 2YKGA 4QM6A 1T0HB 3OE7A 1VIYA 2NG1A 4OHWA 1CJUC 4ZDWA 4PHHA 3RWOA 3L0OA 3X1YA 1V43A 2ANCA 1Z83A 1XD2B 2VA8A 2ZJ8A 3EG5A 2WOOA 5AUNB 4ERNA 3QOFA 2OBMA 1PUJA 3K0FA 2CL6X 2QP9X 3M1IA 1WF3A 2REBA 4EQ6A 5DGXA 3U2QA 2NMVA 2XSZA 3RSOA 2I1QA 2YNMA 2FDCA 4B73A 2YHSA 3EIQA 1X3SA 4HZIA 3UMSA 1CXZA 1Z6TA 5HZKA 1GRQA 1S4QA 2O8DB 1T3HA 1NMYA 2QORA 4DEYA 4HDQB 1QHGA 4KCGA 3TUIC 3VKWA 4BRWA 1FPMA 2ZVQX 4TLBA 4LZZA 2GEUA 2RB4A 3EPJA 1OF1A 1XP8A 1AK2A 4W5HA 2YZ2A 3A1VA 1F5NA 3FHCB 3ND8A 1E2LA 3E70C 2QG6A 4ILEA 2ZYVX 4YMTA 1MO3A 3F5FA 1CR0A 2Z83A 3SYKA 4ARZA 4YQFA 1NLFA 2F1JA 3A1TA 5KUTA 1YZNA 1LTQA 1VYVA 4J0QA 2FWRA 2VH5R 1JEEA 4M1MA 4UNQA 4RD0A 5H1YA 2G9NA 1S3GA 1F48A 2QPOA 1DBSA 3TKLA 1I4DD 1VECA 4HB3A 4JJZA 3NH6A 1KI8A 5IK2D 3OIVA 3FWYA 3UANA 1E79D 3EIHA 5C1BA 1KO1A 2RGDA 3RANA 3AF3A 4TMWA 1L7VC 1Y63A 2A9KA 2KSQA 4IDNA 2IWRA 3FTQA 2WBLC 4B3BA 4TYQA 2CJWB 2GJ8A 2Q9CA 2UKDA 1TEXA 3TR0A 3VU9A 4QJ3A 2C9CA 4M9ZA 5HKKA 2BCGY 2WMNB 3X2SA 4Z51A 4GI7A 4L5BA 1XCMA 1HURA 2R6DA 4BWYA 2P6RA 3ZS8A 3ZIAA 1NRJB 4CEIB 4O2RA 2J46A 4G5OA 4LHWA 1KI4A 1IBRA 4AI6A 1JR3D 2DWPA 3NBFA 4K81B 3U6BA 1GRRA 1ONBA 2W0MA 4ASUD 4DWJA 5KHOC 3PXGA 2XNDA 2R9VA 1P2UA 1OXSC 3UG6A 3AVUA 2GCOA 2RCNA 2FF7A 1LB1B 1M8PA 2ZYUX 3SI7A 3PVSA 4R2HA 3CRQA 2OCAA 3U44B 4NYIR 2JLQA 1N6NA 1P5ZB 2XX3A 3HYTA 1E9BA 2PZEA 2OXRA 1OYYA 3D6TB 3LFUA 1UDXA 3K70C 1XD8A 4BECA 3CH4B 4JLJA 1W2GA 4O2LA 4HAWA 4AYWA 1R4AA 1S0UA 4EJSA 3VTKA 1XB2A 1KI6B 1GRNA 2ORWA 3EA0A 5JI3E 3QE0A 1HQYE 4N3NA 2GNOA 4RD1A 4F92B 4EFMA 2QRZA 4US2R 3JZAA 1U8ZA 2ERYA 1G3RA 2WM9B 3AP2A 3W6NA 3Q8XB 1W0KD 3FHOA 6Q21A 2G1KA 2ANBA 2C9OA 2UZ3A 2JGNA 5JBQA 1ZNZA 2QT1A 3TAUA 1F2TA 4PC6A 2H18A 1DELA 1U9IA 5CIWA 1N6KA 1RIFA 1AQUA 4OI2A 1FUUA 4Q7KA 4TTRA 4U02A 5L3QB 1GOTA 4Q9IA 4LCBA 1XEXA 2D74A 4PO9A 1XF9A 3I8XA 4FXPA 1S96A 2WVJA 1D2MA 4MH0R 2WICA 1QHSA 2JCSA 2RMKA 1BYIA 4PO8A 3W8RA 3CB4A 2HYDA 4A8JA 1E9EA 3QVVA 5BQ5A 3NBZC 4PAQA 4PC7A 3A58B 2C2HA 3KL4A 4BLSA 1UAAA 3TUZC 1L4UA 3AVPA 2XGJA 3QKRA 5B57C 3SN6A 1JXOA 4BRUA 1MT0A 4GZLA 5C4GB 2ZSDA 4EPXA 3OESA 3W9YA 3AVTA 1NP6A 1NSFA 3TUJC 2EYUA 1ZMXA 2YWFA 4HLCA 3UKDA 1E2NA 4D2IA 2PX3A 1G291 3CUEF 4TL8A 3EC1A 2VSXA 3QKTA 2EWWA 4GNKA 4BZQA 4A6PA 3SS8A 1OH7A 5FUYA 1I2DA 4I99A 1CTQA 1GVNB 1ZP6A 4EKDA 3BB4A 4PZZA 2YYZA 2WAXA 4Q9HA 4V0NA 3UWKA 5GJWC 3ADKA 2ZM5A 1ZM3A 4NCKA 5FH9A 3PJRA 3U3RA 1E1QA 1NSTA 2N1BA 3LXRA 2FA9A 4X8LA 5CLLA 3X1XA 2G6BA 3UMRA 2HV8A 3CO5A 2J7PA 3VX3A 5JSZB 2ERXA 5LD2C 4RD6A 5BN4A 3HWSA 4PZLA 2F9LA 1S2MA 4PHFA 1N5KA 1E2DA 2BMFA 4BEBA 5JWHA 1IY2A 4G5RA 3GQBA 3B60A 1JI0A 2G3YA 4P0TA 3QXHA 1J90A 1OH6A 2YWHA 3KUDA 5B64A 3BERA 3QSYA 5FFMA 4KLNA 4V0ME 2WKRA 5IT5A 1NF3A 5J40A 2V3CC 2QAJA 1E2EA 1XPOA 1XXHE 4OK3A 3RS3A 4LPSA 1DAGA 4PPQA 2IYLD 3GFOA 4TYWA 3U3KA 1WQ1R 2GBLC 3KUCA 5JFGA 2OCYC 2KJQA 5EE5B 2O0JA 3T5DA 4Z8XA 3IDQA 3VR1A 1XMSA 2Z4RA 4G5GA 1YZKA 2GEDA 4Q03A 4BE7B 4LWZA 2WV9A 3RC8A 1P60A 4AKIA 1KDTA 2RGXA 4KODA 4C7OA 2YV5A 2P6NA 2UVQA 3DVLA 3E1SA 4KU4A 2CCGA 4FINA 1KI2A 3WNBA 3THYA 1FQJA 2JDID 4L4UA 4UKDA 2BM0A 4CRWB 2ZRDA 5KDLA 4WXPA 4Q1BA 5EP4A 5DYIA 3SBEA 2ZYWX 1GTVA 1CEEA 3HR7A 3OEEA 4QRHA 1HE8B 2XB4A 1AKYA 4TTPA 1GKYA 2WZQA 2LKDA 2CK3A 4P4TA 3V9PA 2GF9A 1QHHB 4QBHA 1RYHA 1COWD 4FWTA 1KK1A 2H8KA 3BD9A 5E95A 1NY6A 4EPTA 3IHLA 3FDIA 1CR1A 2XTZA 2F1IA 1BMFA 5FUVA 3UIEA 2OCPA 4DSOA 4HUTA 1BS1A 3VNVA 3CPEA 4Q1DA 1UBEA 3IQWA 1UEJA 1R0YA 1RJ9B 2V6IA 4KYUA 3BRWD 1G6HA 3IPXA 3EZ9A 4Q1FA 4M9SA 2H16A 5BW8A 4TYYA 2WJIA 3KFXA 4NYMR 1GNQA 2R6CA 4OI4A 3THWA 3CF2A 4QHSA 1FUKA 2GA8A 2CE7A 4O25A 3CH5A 2VP4A 5TXGA 2ODEA 1W5SA 4RZ3A 2PCJA 4LJYA 3R9XA 3BH7A 4RFVA 3T1QA 3C8UA 3O8CA 1ESNA 3AH8A 3BXZA 1ESMA 3DZDA 4URYR 2ZQ5A 2MMGA 4CZ2A 2GXSA 5JEDA 4NP6A 1TNDA 4XVQA 5AJYA 1GNPA 2AD1A 3BFVA 2OBLA 2EVWX 1DO0A 4KV9A 1HEIA 4MGIR 1ODFA 2AD5A 4JKYA 4UXHA 2ZRAA 2WOJA 1VHTA 1T0JB 2IW3A 3W6OA 3CZPA 4GPTA 2VP9A 3AF1A 4YMVA 3A4LA 2W2TA 2YOGA 1Z06A 4CEJB 1UF9A 5CK5A 3AP3A 1DTSA 2IYTA 5JLJA 2IUTA 4GDFA 5G41A 3LLMA 3I5YA 1SXJC 2O52A 4TMVA 2PL3A 2H5EA 4GOKA 5SZKB 2O8EB 3HU2A 1O3YA 4D4MA 3EXAA 4KFTA 4NYIQ 4JBWA 2GXAA 3BH0A 4G01B 4JKIA 3FB4A 4NBSA 5TDHA 1WBBA 1UADA 1VG0B 1W48A 5IHPA 3LX8A 1T3LA 1A5TA 3KXLA 3SJAA 4NCIA 3ZJYA 3C14C 4W7SA 1II9A 1G8FA 2HCJB 1YZUA 1E9DA 1XNJA 3QBTA 4JLDA 5GVRA 1GFIA 3TRFA 2OFOA 5JWOA 2JJ1A 2H1LA 1G8GA 4I1VA 2VBCA 2JASA 1GDDA 3FMFA 4K8OA 5BXQC 2V7QA 4OK6A 2ZU0C 3CLVA 1K6MA 4P4UA 1ELOA 1VCIA 4LHYA 4RD4A 2P67A 3RYTC 3WYGA 2FH5B 1CR2A 3VAAA 5KNDA 1XCGB 2BJWA 3L0SA 3WYAA 4JLKA 3GLHA 3TVDA 2QGZA 3PEUA 5EE3A 2QEQA 1U98A 3Q3JB 2F43A 4FMCB 3B8HA 3OF5A 3AGPA 3QJYA 1OPXA 1E9AA 2VSFA 821PA 3I92A 4IDOA 5JCZA 4JMPA 1N6RA 1BO6A 4BLTA 2D06A 2G88A 2XXAB 1W4BA 3BOSA 2GWHA 4GT1A 4X8OA 2FFQA 1HUQA 2ZEJA 4PSAA 2ZAMA 2QY9A 2R65A 2BKUA 1R5OA 2ONJA 3EIEA 2YJTD 3L8ZA 4DSNA 4UQOA 4IW3B 1CU1A 1G7SA 1DS6A 2RGNA 3HYRA 2RAPA 4X8MA 4NCHA 1OXVA 2RGEA 4XOIA 3W5IA 1Z0KA 2VO1A 1XDBA 4ZI3A 1G20E 1Q57A 1YRBA 2NPIA 1Z28A 1U94A 5JHGB 4UJ3A 1G5RA 4DT1A 2V1XA 2VP2A 2CNWD 2X2FA 5KNCA 1R5BA 1WBDA 2ZITA 1QHNA 2IC5A 1E1RD 4WVFA 4PC3A 2L0XA 3KKMA 2ATXA 4JLAA 4BFXA 4M9QA 1EFRA 4GMXA 2QE7D 1Z0IA 2BCJQ 2CVHA 2F6RA 4HB2A 3KTAA 2X2EA 1SZPA 4XWAA 4MRNA 2PCLA 2JJ8A 1W1WA 3AVVA 2IYVA 2OHFA 3I73A 4BEJA 3I62A 4Y0VA 1GUAA 1XEWX 3U4QB 3ADBA 4DHEA 1W36D 4ZIRA 4DLUA 2WWHA 1KKMA 1X8JA 4JVSB 3LWNA 4DSUA 1XPRA 2XTNA 1NBME 2XOKD 4RFSA 4BFWA 4PPNA 4TL9A 4JIMA 3FFAA 4PQRA 3QNUA 3KQLA 2ZRMA 1G9XA 4Q9JA 2IEYA 3QXCA 3TK1A 4XTRA 3HDTA 4PSVA 2ZI7A 5DI9A 1P2SA 1U8AA 3SJZA 1Q3HA 4EFLA 4NE2A 1LW7A 1JJ7A 3AF4A 1XU4A 1I4LD 3B1ZA 3BWDD 1SULA 1U0JA 1II8B 1E2IA 2O0KA 3EASA 3KJHA 4KFSA 2N42A 5CIQA 2NO0A 4EPVA 1XZPA 1G4UR 4I1OA 1S3SA 3TSZA 2PH1A 2AFIE 4B75A 5E3HA 2RGBA 1S1CA 2BJVA 3PENA 4IVQA 4AIIA 1RPZA 2KBFA 2A5FA 5GJCA 4IDPA 2QUZA 1Z2AA 1XTKA 4Q1EA 3LV8A 4EPYA 1H8HD 1Q12A 3P32A 1Z3IX 4CW7A 1TPZA 1LF0A 2CCJA 4LC1A 4P32A 5SZJA 1TQ2A 2KE5A 2DPXA 1R6BX 3GP8A 3CWQA 2R8RA 4PAOA 1H8ED 1SVWA 5DSZA 5B30A 2OSBA 3ZDQA 1P7CA 1MKYA 1N6OA 2PEZA 2O8FA 1ZM7A 3C16C 3K09A 4DLXA 4C0LA 3L43A 3WYFA 1TU3A 2FGJA 3A8TA 2DFLA 2QP4A 1II0A 2QT0A 4FCTA 1FQKA 3KZ1E 4D26A 3NIBA 1NY5A 5KPDA 3NHAA 4NYMQ 3O8BA 4F91B 4MGKR 1ZNYA 5P21A 1E2JA 4DLTA 3K70D 4Q1CA 1NIPA 1ZU4A 2JJ2D 3IPYA 3AF2A 1R0WA 1Z6AA 4JZKA 2W0SA 3K9HA 2AR7A 2HJVA 3ZYCA 1A7JA 1CBUA 3MAAC 4QJ4A 4OBEA 1SXJA 1Z6GA 3J81k 3DO6A 3DKPA 2GVZC 3T61A 2IEZA 3NDBB 1RZ3A 4NMMA 4IOLA 1X8LA 4D25A 3ZQJA 2FFBA 4I4LA 1CS4C 2J3EA 4EJSC 2JLYA 1VIAA 3FFBA 5EE1A 2IL1A 3ZQ6A 4DDWA 4AG6A 2ODBA 2ZUDA 3BBPA 4ASUA 2P65A 3WY9A 4XWKA 1W0JD 3O8DA 2RGCA 3VNUA 2J45A 4IOJA 5F2EA 1G3UA 1BOFA 3VR2A 2R6AA 1I4TD 1ZD9A 4TSFA 3X1WA 2PMDA 4YMWA 1MOZA 3OHMA 1U9IC 2R2AA 2VHCA 1SKQA 1ZCBA 3Q9LA 3D3QA 4GRAA 2D2FA 3RRMA 3NBXX 1KAGA 5KSOA 4KI0A 3GJ8A 2DR3A 2IYSA 4WAUA 5EE9A 5J47A 1NBMD 3IKJA 1RYFA 4PANA 4G1UC 2R6GA 4I1SA 1NJFA 4WZ6A 2V8OA 4O3MA 1TMKA 1E2HA 2AWNA 3LBNA 1DAEA 4A8JC 2ZRHA 3SOPA 1KK3A 2O5VA 3TJZA 1Z08A 4M8NE 5D3MB 1T6NA 4YDSA 1AS3A 1SHKA 4Q02A 2QAGA 2ASEA 4LGMA 1IN8A 1YZGA 2CLCX 1JR3E 2CVFA 1E9SA 1OH5A 3R9WA 2OXCA 4L9SA 1S1MA 1SGWA 3C4JA 3P20A 4OJQA 1F6BA 1HT1E 4KBFA 2AK2A 4HAUA 2F55A 2IXGA 3ZD7A 2ZSAA 1E98A 1FL9A 1NVVR 3KJEA 2D7CA 3UATA 4DEXA 4DCNA 3T1TA 1KJYA 3OAAA 3PFIA 5HCIA 1MABB 3W90A 1G4AE 1Y3AA 3TSOA 5KU1A 1N6HA 3SHWA 1B0UA 3IBGA 1ZUNB 3RS0A 3LO5A 4OI0A 3U7FB 3SQXA 1SHZA 2ZJZA 1NVXQ 3MWJA 1YE8A 4LHVA 4RSGA 3K70B 1EXMA 4M1TA 4L15A 3DL0A 5DO9A 2DBYA 4HLQB 5CJPA 1U8YA 4G5QA 3RSLA 4C4PA 3AEZA 4MUAA 4QHYA 4A4DA 3GLFB 4OHYA 1XTQA 4YMSA 3B1VA 3PEVA 1G19A 2NZ8A 4KAXA 4D0LB 1R2QA 5FUXA 5G3YA 2ZS8A 4TT3A 2B8WA 1KNXA 1MRNA 1P6XA 4IRUB 5AJZA 3SE0A 2PZGA 2C03A 3M0EA 4B43A 1KMHB 4JBXA 2AXNA 2ZRBA 4XD7D 5EZ5A 2QMOA 3I32A 1E9FA 1ZRHA 1VTKA 4R98A 3S1AB 2C99A 3DDCA 2OCBA 3UMFA 2ZRJA 4ESVA 1IAQA 4YONB 3W3ZB 2GJAA 2WWIA 4F4CA 1KTVA 4LV6A 1HE1C 4ACBA 2ZE7A 1V5WA 3AVQA 2CDNA 2QROA 2J0SA 3KQKA 1CF4A 5AWFC 3U6KA 1M7BA 3CX7A 3FOZA 1NKSA 3DOFA 1CKEA 1FX0B 4V0LA 1UFQA 1Q22A 4E22A 1D2NA 2O8BA 4OQXA 1GITA 4WZAE 5E7JA 2V1UA 2IF2A 1UJ2A 1EGAA 4HAYA 2VHQA 5FPKA 3K9GA 3QF7A 3OEHD 3RDPA 1RW4A 1EX7A 3N5CA 4Q48A 2GJKA 4QBGB 3TW4A 1WRBA 4PFSA 4NU0A 4Q4HA 3BIFA 3MJHA 5FOWA 1NNEA 2EWVA 2IX3A 1BIFA 1VCMA 1X6VA 4Q4JA 2C8VA 4GP6A 3V4FA 2VF7A 2OLKA 4TTQA 4IFBA 4HAZA 1DOAA 3OZXA 4ACAA 4BASA 1W4AA 2Z0MA 1DAIA 5LD2B 3K1JA 1YZQA 1N3BA 1QDEA 2OFXA 1N25A 3B85A 3QG5A 4GSYA 4C0QC 1IXSB 5C2JB 3QXJA 3TBKA 3H1TA 2YWEA 1XMIA 2E9SA 2GILA 3AUYA 3NEJA 4LY6A 5F98A 2DB3A 1ZUIA 2AK3A 2JIZA 2ZETA 3KXKA 3K0EA 4KFUA 5TV2A 3GPLA 1VYUA 3HJNA 4FW9A 3I4LA 4P4SA 5BYJA 2CHQA 2IS1A 1EWQA 3CF6R 5AR1A 2NOAA 4HB0A 1D6JA 1LS1A 1EWRA 2QQEA 3R8CA 1J8YF 2W6JA 1OT3A 2CMKA 2TMKA 4HZUA 1QVRA 5H68A 2Q6TA 1FP7A 2J87A 4A9AA 2Y8EA 3LDAA 3GLIB 2IYUA 2WHXA 4CEHA 2FFAA 2GKSA 4NTZA 4QKQA 2IYXA 3R7WA 1UPTA 3K0AA 3EZ7A 3KXIA 3GJ7A 4TMKA 2ZE8A 2ZVPX 3K0CA 1NVUQ 4DCVA 4LBYA 4UNNA 4B3DA 5L3SA 5FOVA 2B7CA 5DLQC 4TYPA 2VP5A 2X19A 3UG7A 4AK9A 2IS2A 4BFSA 3IIJA 1E2PA 4DUGD 2ORIA 1SKYB 5FPYA 2OM2A 1KAOA 1D5CA 3GJ3A 1G6OA 3A37A 3CWZA 1L8QA 1OJLA 4LJAA 3QEJA 4QNMA 4JLPA 1FMJA 1T8UA 4IFEA 2NPFA 4CDGA 1E9RA 1F3OA 4DDTA 3VKHA 5FTKA 3T5GA 4Z1MA 4Q4AB 3ZLJA 3PV0A 2JEOA 1N0VC 5UKDA 2BBTA 2VP0A 3CRW1 3G0HA 1VYTA 1OKKA 2ZS9A 1NVWQ 3C5HA 3B1XA 3OFND 3PUXA 5IRCD 2Z4SA 5LBIA 5HCNA 4B6EA 4F7WA 1G17A 1KO4A 2CL0X 2WJVA 5KTYA 2AN9A 2FMXA 1NG1A 5BWMA 4LJ9A 2Z6VA 4NCNA 1D9XA 1SVLA 3RAPR 3ZVMA 1W2HA 2BHRA 1YZTA 3VR3A 4M53A 2ZAOA 5EXSA 5LPNA 1F2UA 1E2KA 2J0UB 1NG9A 3QENA 3EWAA 1Q21A 5CITA 5L3RA 3TNFA 2G77B 4RCZA 4A0RA 2RGNC 2DYKA 4KO8A 2ZRLA 2AHOA 1CRPA 1R8QA 4IJMA 4FWIB 1RVDA 4Q7MB 2QA5A 5E7MA 4Q7LA 2QBYA 1NVVQ 5FBLB 3U7EB 5L3VA 1SXJB 2WSSA 1XRJA 2GJSA 4URVR 4C0AC 1G3MA 4KLZA 2HXYA 2GESA 1KJZA 2A3RA 1US8B 3MG9A 3PUYA 4QXAA 2G0NA 4N0EA 3AVYA 1BH2A 4ZO4A 5CYOA 3B78A 2XSZD 3T12A 1AS2A 4CIDA 2HYIC 1DO2A 5FR2A 3ZZ0A 1M7HA 2C96A 4W5JA 2C78A 5JS8A 1RFLA 5AJXA 4M1SA 4BLRA 5FL7D 4A2PA 1EFTA 4PSKA 4B3FX 2JLRA 5B58C 4LV8B 2QTFA 4B76A 4PQYA 5F9FA 4FCWA 3A6PC 2XZPA 5CB6A 1JECA 2HEIA 1ZBDA 1PZNA 1X86B 2D4HA 3MLEA 5IDVA 4RVCA 2ZJ2A 2FEOA 2AWOA 2BM1A 3P4YA 2FEMA 2CNWA 3X1ZA 2VHJA 5DE3A 3ZD6A 5TVKA 2XJ4A 2W00A 2WTUA 3LH5A 3ZS9A 2HLDD 5HZHA 3PUVA 3GJXC 5AK0A 3UK6A 1Q1ZA 4KHZA 2V54A 5FPHA 4DLZA 1XMVA 1QHIA 4KBGA 1LV7A 1NMXA 4KSBA 5KNBA 4ZDIA 4FD2A 3AKYA 1NN3A 4M4SA 4TLEA 1KSGA 1FTSA 3PUWA 1KSFX 4C3ZA 3EC2A 4CT4B 2PJRA 3AKDA 3WXMA 4HUQA 2X1VA 3CW2A 3W3AA 4IVPA 4M1KA 4YXWA 1P9RA 1I2MA 4LDJA 4R7ZA 2ZR7A 4TLCA 1WXQA 4BLQA 1XEWY 1K5DA 1XWIA 2O0HA 5H8WA 3TLXA 2W6IA 4FMDB 1P2TA 621PA 5GJBA 2P5TB 2CLSA 1Q3TA 3SFVA 2A5DA 2DFKB 5EP2A 4IEIA 2GXQA 2ZPTX 2XNSA 4D4KA 1P61B 4FIDA 2P6UA 2CXXA 1JAHA 2VIIA 2HUPA 3I72A 2BBSA 3GJ4A 3SZRA 4JLMA 1RRGA 1Q1EA 3CX8A 3C5CA 1MRSA 4DZZA 3Q72A 4HLUA 3JVVA 3TMKA 4P3YA 3AF0A 4EDHA 3KKNA 3ZIAD 2R6FA 2XAUA 5IF9A 3MWYW 3CKLA 3KKOA 3EZ2A 2QGNA 3GD7A 4BFYA 4LHXA 3NBYC 2WPDA 5KSZA 1L4YA 1YR8A 2FG5A 2XNDD 4Z54A 3VHXA 3K09C 3RS4A 1NLZA 5EUQB 4HB4A 2NTYC 2CHGA 2EYQA 1MH1A 2KB0A 1IXRC 2UZIR 2D7DA 3LD9A 1Q44A 1HTWA 3LQQA 1Z47A 1Z63A 3U3JA 1X1RA 1UKZA 3K0FB 4YMUA 4DBLC 4EQ6B 1YZLA 5KO2A 3QXSA 1OSNA 4B34A 1IN6A 3QPWA 4Q7JB 3K0SA 1GIAA 4NL4H 1G5PA 5JZVA 4BPBA 1H8EA 4HAXA 2E87A 2GHIA 1BYUA 3B6EA 4G5SA 5GJVC 1E94E 5CB8A 5CM8B 3QKSA 3QPUA 5JS7A 2A2ZA 3A1WA 3IEUA 3THXA 1ZIOA 5CM9C 3PEYA 3KKQA 2X8AA 4RZXA 3JZMA 3R8FA 1KY3A 3LBIA 4LYFA 1CLUA 2LCFA 4ARZB 1JR6A 4MUBA 1UBFA 1IM2A 1HV8A 4D6PA 4C2TA 2HT6A 3RABA 2JJ2A 3SEAA 4C30A 3RNLA 4B3CA 2IHYA 3KJIA 3EPKA 1UM8A 2VTKA 4QNRA 3ZVRA 1EG7A 4QFMA 2ZREA 1X1SA 3C7KA 2PZFA 2BEKA 1XD2A 1CRQA 2QTVB 4QGFA 5AUQA 1ZM4A 2FPKA 1T5IA 3NEYA 4QG7A 4JLNA 4C0BA 3UPUA 4A92A 2GCPA 1T4GA 3B1WA 1FOEB 4D4JA 4O0MA 1VKJA 1PUIA 2NIPA 2GZHA 4II7A 1GILA 3BJIC 3VU9B 1KJWA 1KOFA 1PJRA 2ONKA 2REOA 3FPAA 2B8TA 3BAFA 1XFAA 1MO4A 1QF9A 1N5LA 2FX3A 2P3SA 3REGA 3GLGA 4UNRA 2QAGC 3N2EA 3TQCA 2MMCA 5JJIA 1TUEA 4B6FA 3MWKA 1J2JA 4PHTA 5LDDC 3VR4A 2ZR9A 3GJ6A 4QOSA 4E07A 2QZ4A 5C4MA 1G7RA 4TN1A 1OV4A 2HJGA 5DN6D 4NCJA 1U2RA 1NBMA 1XJCA 1Z6XA 4B44A 2ZRCA 2VQSA 4QM7A 3GLFE 2GCOB 2I3BA 4AC9A 1U90A 1RE0A 4RKFA 2W83A 1VG1A 2VYFA 3H0KA 2J7PD 1YHNA 3MMPA 1ZW6A 2PMKA 2ZE5A 4MRSA 3CNOA 4HAVA 4F93B 3DM5A 2YWGA 2KBEA 221PA 1U0LA 1MO6A 4XJXA 4NDZA 2VF8A 5AUOB 1OFIA 1QBKC 5J5CA 2NQ2C 3CPJB 2OFWA 2C77A 2AKAB 4HDCA 3I1FA 2CJWA 4EJSB 1G7CA 2ZRFA 3TQFA 4CVNA 4LUCA 5BN3A 5CYPA 2DY1A 4LHZA 1JNYA 4PZYA 4B32A 4TLAA 1KI7A 1E2MA 1GL7A 1Z6YA 3T35A 5KDOA 1UDWA 2FPMA 2GDJA 1DG3A 3BS4A 1F2TB 2F1HA 3HU3A 2JLZA 2QN6A 3GFPA 1G8PA 5FOUA 4P31A 3IUYA 4CEIA 1OXXK 5FUWA 4C0SA 4FI3C 1HQCA 2A5JA 1Q1BA 1XEXB 1E4VA 1TF5A 2XJ9A 2H57A 2BBWA 3OIYA 1IXZA 1Q1QA 2FZ4A 4NKRA 4TL7A 2W2XA 4YLGA 3E5HA 3FMIA 1NMZA 1XBTA 3OIUA 1KDOA 4NH0A 1VCNA 4A8JB 1G64A 2ZU6A 5J4YA 4BFTA 2SHKA 4XH9B 2ZXUA 4Q1AA 4Q00A 2HDNB 1ZNWA 4ZPXA 5KSYA 4EIWA 1YKSA 2GXUA 1K8RA 2Z5FA 3B9QA 4JL8A 3FHTA 1TU4A 3QKRB 5BYKA 2QNRA 2FSGA 3B82A 1S8FA 3LA6A 4S2EA 2CHVA 2B21A 4XD7A 1BMFD 4TZ6A 3QXXA 1OE0A 4A6XA 3W8NA 1AA9A 1TF2A 2IYYA 3AVWA 4NHOA 3CIOA 1YQTA 3VX4A 4B2PA 2EFCB 4LPKA 1DAKA 1WDTA 3EZFA 5FOSA 4HEJA 4IDHA 3AP1A 5TY0A 1KI9A 1QRAA 3BGWA 3U3MA 2FV8A 4XVRA 1C9KA 1VCOA 2QP3A 3ECCA 3B9PA 1KNQA 5L3QA 1RKBA 4KYIB 1IN4A 4QC2A 3L2OB 3NC0C 2ZI9A 3B5JA 2IS4A 2GTPA 1G3IA 2J59A 1D2EA 3WRXC 5CDFE 1JB1A 2FNAA 4YC7A 1SVIA 4DXAA 2IHBA 5CJ2A 4B2IA 1G16A 2EQBA 2HF9A 2OBNA 1QG2A 2PEYA 1J8MF 2C98A 2Q3HA 1N5IA 2YC4C 5IK2A 1JXMA 1E79A 2CBZA 4EPRA 1IJEA 1KHTA 2Q21A 1R0ZA 2ZJYA 3RRYA 1GP2A 3NVAA 3MWLA 1ZU5A 2ZRGA 1E2QA 3A1UA 3GLIE 4QBFA 4US1R 1ZD1A 2OG2A 1TADA 4PC1A 3T34A 1Z0DA 2OLJA 1KI3A 2GF0A 3G82C 2C5LA 2F3RA 2OV2A 2WWXA 1HYQA 4DJTA 1CJKC 1Z5ZA 3BK7A 5KSPA 2DWQA 5K8LA 3AUXA 4U00A 4JL5A 3AKEA 1P9WA 3QQ5A 4C7OB 3H84A 1SKYE 3PIRA 3HPRA 2OAP1 4PXAA 3P27A 1JR3A 4I81A 1A2BA 3PQCA 4QL3A 3THYB 1VPLA 2EU8A 2GVDC 3Q85A 1P3JA 1RRPA 1WA5A 4QHTA 2JJ1D 3TGPA 3SFZA 1A82A 3K0CC
chains in the Genus database with same CATH superfamily
3BB3A 1IIBA 5CVDA 3LXMA 1IEWA 3BJRA 3UEOA 4EI7A 5HP4A 5JAUA 5HGJA 2P0EA 2X7JA 2SCUA 5IS2A 1C0LA 2REXB 4FOPA 4MUNA 5DH9A 3C2QA 3QYFA 2JHFA 1P0PA 2YY7A 3WMFA 2W6ZA 3HXOA 5K9ZA 1I3CA 4CMEA 4OLBA 2FJUA 2JFBA 2DUJA 4IHJB 1X80A 4DMFA 2IIQA 1Y4ZA 4Q47A 1CW2B 5CK4A 3LQFA 4PXYA 4BMSA 2QDXA 3DW3X 3P26A 3VR6A 5L51A 1DJLA 3OOYA 3I52A 1O6FA 5HE8A 5LMUB 1W0KA 2F67A 1QORA 3EUFA 3RVRA 4BJHB 3KPYA 3QKUA 1D0IA 2QJRA 4ND4A 5KWVA 4AJ9A 5H4HA 1Y82A 2RC6A 3ADCA 1ZINA 4RD2A 3ZVLA 2MSDB 4K6OA 4C7BA 2CMDA 5EMHA 1PLJA 1QGAA 4IUBS 4AYXA 1FSSA 2VK1A 1Y6QA 2A1TS 3RUDA 3UYKA 4BMYA 3G9QA 3N8NA 4QQNA 1Z07A 2Y1LA 3EISA 2J4DA 3MLBA 5C81A 3DL2A 1PTJC 4N7BA 2IPNA 3QA9A 2Y1FA 4U2KA 5FA5A 1GCUA 5A5EA 1FK8A 1UXHA 1A97A 3RYCA 1AV7A 1IEVA 5D7NA 4EFNA 3H1FA 1HLPA 1H2BA 2JG3A 3G68A 1C3JA 1XO1A 5T5QA 5F73A 1AMOA 1QHHA 2IVFA 2IPOA 2C4KA 3DDWA 1YU9A 4BZZA 1QCCA 1GEGA 4D99A 5A5GA 4DB4A 4G0WA 3R0VA 4M0KA 5BSHA 1JDZA 3E7WA 4Y6OA 1BC5A 2ADOA 3BMQB 3MOSA 4ZYZA 5C1OA 5HQ3B 3ELDA 4UJ5A 2W6MA 2WYVA 4W8HA 4PLHA 3VSBA 5E6RA 2ZIXB 1UQTA 3AUFA 4KPGA 4A6DA 5CT4A 4D9MA 3EVTA 3ST7A 1DIAA 3FWPA 1ZHOA 3HJFA 4WZAA 1ZM9A 1H5NA 1YZ3A 2YQ5A 4FMCF 1VC2A 4G0NA 4JL6A 3THXB 3DHWC 4L28A 1J0XO 1GR1A 2ZJAA 4MQBA 2WYWA 3C41J 5JANA 1JMKC 1M73E 1P7VA 5DTJA 1M34E 2OHIA 1JALA 4R2LA 5DJ5A 1KMCA 1N4AA 2IV7A 3HS3A 5DYGA 4QGSA 1SN7A 5C80A 3AFOA 1CQJA 2DG2A 4LQDA 4MX8A 1V5IA 4YRMA 3OJLA 1KZ7B 3PNVA 4B17A 1E0AA 2PX0A 3CE6A 1TOAA 2FJPA 3GJ5A 4XSGA 4D8UA 2QL7A 1XPUA 4RLHA 1MDBA 2VNAA 4XFJA 4HDMB 2HIHA 3SU8A 3CYFA 1QP8A 1U5CA 2J31A 3R5XA 4I46A 3SYNA 4OUDB 4JC0A 1ZQ1A 4E30A 3P7MA 1ISHA 2P9EA 3DYVA 5FPTA 3REQB 1IXKA 1U1CA 2BBOA 3ZGNA 3LM8A 3P97A 4BOYA 1D0SA 3ESYA 2BMAA 3ZE2B 3AV0B 4GDMA 1JEQB 5JSKA 1NXPA 5KQLA 3AQIA 2BFAA 3BHIA 2V9PA 3EEQA 3IP1A 4I8XA 4PAWA 4WXHA 4DLYA 3V4RA 5EXXA 4BMCA 1N2IA 2WJZB 2MINA 4MWDA 5A6SA 5KJCA 2EP7A 2NAPA 1MB0A 2IWHA 5FL7A 2HHHB 4CEJA 2WSYB 1B3BA 4UUPA 1GAJA 2PTHA 3BXEA 3LOUA 2F8SA 2GPNA 2JF0A 2C3UA 3RQIA 1BFKA 3IA7A 1H0RA 5HKLA 3S7ZA 4OP1A 4OMUA 3F3YA 3ZWMA 5EXTA 3D8HA 4EY5A 2KWIA 3BL8A 3LKZA 5B53A 1N36B 4B6OA 4MARA 2VLIA 5FTNA 5B6IA 3HCPA 1XQXA 3L8FA 1TRKA 3RADC 2ZR0A 3I0NA 3UUEA 4DE5A 1CDOA 1JZQA 2WTBA 4BCCA 3W5AA 3SSOA 1OD6A 3WL3A 1QO0A 3L01A 1UJ5A 3OZFA 3STTA 2XRZA 2DU8A 4E6EA 2JA2A 1W5BA 2ORVA 2JDIA 4Q9LA 3PPWA 5BR4A 1OHHD 4FBGA 5EHGA 5LXTA 2CCKA 4OGKA 4ETIA 1DMRA 1V4VA 4HFMA 4DQ0A 4BB5A 2AG1A 4YAFA 3RVKA 3ZZTA 2B20A 2PG3A 4FNAA 1IPHA 1VHLA 4U7TB 2F64A 3H7IA 4ES6A 5FI1B 3UY4A 1LS6A 1EVKA 3DMTC 2GZAA 3HY3A 5JXHA 3JYLA 1AS0A 2IA5A 3ETHA 3HC7A 4HK4A 1ZW1A 1KR2A 3B13B 4ZD6A 3PX3A 1OXUA 5IUJC 1RAAA 2WUVA 4XQ0A 3I1IA 5J4KA 2I4RA 1MHPA 5KJFA 3O21A 5B1YA 3H05A 4PCUA 1XRNA 5MF6A 1OASA 1AIPA 2CDAA 2OBFA 3IUEA 4HRAA 3PHGA 5JASA 4F86A 3P4XA 3UJ8A 1ACMA 3KTAB 5KREA 1N3YA 2AYZA 2BWJA 4KQWA 3PR1A 5GVSA 1KDPA 1YQDA 5JY6A 4ICIA 4YO8A 2FVYA 2XHEA 4BC0A 4ZU6X 3BREA 1N9GB 3N2IA 4E03A 1HT2E 2AOTB 2J1LA 3FCXA 3LVQE 3O4JA 5SY6A 4EL5A 2OUKA 2PVPA 3D6JA 2P9TA 3CNLA 2WP8J 3QF4A 1ABBA 1R0XA 3AHEA 5AVSA 3PEEA 3WLKX 4EHBA 3RFVA 2VTBA 4EEXA 4PTZA 2DTXA 1R3UA 4TZ0A 4M21A 4JP1A 2PNFA 5DMHA 3CRVA 3BN3A 2OO5C 2XITA 2PKEA 1ZUWA 3UUGA 4P8RA 2PKXA 3TYXA 1T13A 2NO6A 4K03A 5T8KA 3TXYA 4EL0A 3AKCA 3NHSA 4UU7A 1L4BA 3V7YA 4RQTA 4AXBA 3L8YA 5BRAA 1GZDA 1RRFA 4YH1A 3CRMA 5DX1A 2OP0A 4CG3A 1I3KA 2XUOA 4YJDA 4BJ5A 5CFNA 4JT4A 3EWSA 4MV7A 4CGZA 1A9ZA 3JQGA 4ESHA 1MQSA 4U6SA 3VNBA 5DEIA 3VU3A 1PEDA 2EJVA 2ZROA 1X7GA 1I7QB 2YVUA 3H83A 4ZEMA 3PPXA 2ATVA 3BD7A 3RSGA 2I1VB 5AW9A 4YUYA 3KR2A 1AN0A 4HNAA 4WLUA 5BVHA 2NGRA 1Z39A 5ALDA 3I3SR 1OA0A 2W6PA 2KI5A 5A4JA 5LZ7A 4XPIB 3DNFA 4D6XA 2F4VB 1ODKA 2PFGA 2JLWA 2Q2WA 5JWRA 3Q8WA 2QZPA 1X0VA 1PNTA 1BS9A 2QL5A 5G0UA 1TQ6A 1SB8A 2C9YA 3AY0A 3LLUA 5KAPA 4IP0A 5EXPA 1W30A 1ZN2A 5EZ6B 3GN1A 5ALLA 4HAIA 1NN0A 2XT6A 1N0UA 3TQTA 4JT2A 2BAGA 2HCBA 4WN9B 5KYYB 2FW1A 2VZ8A 4D3ZA 4WLFA 4ZO8A 3KSAC 4LOAA 4GEGA 1CFZA 4KVAA 2GTIA 2IPAB 1OYOA 4V03A 4ND2A 1PZHA 3FDJA 1A8IA 1L7OA 1U63A 1HLFA 3L84A 1BAPA 4AKSA 3QBJA 1ADYA 2IEGA 3WMEA 2FZLA 4J1TC 5HE9A 3MF4A 1ISSA 2B4TO 3D8TA 2W8BA 4ZKDA 1KO7A 3DMYA 5TARA 4EMBA 1PWHA 4UNPA 2HLHA 2HMVA 1J42A 4N6GA 4FKBA 4OP3A 2PQ2A 1CQIB 2D5AA 4JLBA 2WQ6A 1MAVA 5AI0A 1D6NA 2I3AA 4JSYA 2QD3A 2ZJ1A 4PN7A 2PWZA 4S05A 3C45A 4MJ7A 1N77A 1Z4NA 3GVHA 2V7XA 4K6CA 2C5BA 4BC1A 4N3AA 1RM4A 4RSMA 2C29D 1II8A 1I10A 4C3VA 4WUTA 1EEHA 1CJVC 3IKMB 1UC5B 1E7SA 4XX0B 1DL5A 3LRPA 4ZU1X 2Q45A 2I29A 3T5CA 4C0JA 3PNQA 1ODIA 2D13A 4DDUA 5AHOA 5EC8A 2MYUA 5I9SA 1A27A 2ZSFA 3LF2A 1VLQA 4L5AA 4QWWA 1JVNA 1BMTA 1DU4A 3IUMA 1YQEA 5T4FA 1R8SA 4Z4EA 2XOEA 2GF2A 4BE4A 3DMRA 5KKCA 5KOHA 5EAIA 2JGAA 3ZGVA 1H65A 4BX3A 3UH1A 2I4TA 1D6MA 1MR3F 3M6UA 4FFBB 4W7IA 5BT9A 3RYFB 4DLAA 4EKYA 4Q4DA 5DN6A 4BNXA 2BEUB 3FSEA 4FOTA 5F7OA 3SDSA 4U2CA 1H2YA 3HVKA 2CZQA 5JC8A 4P38A 5I5EA 2VCHA 2IK8A 3ESBA 3QFSA 5GY7A 4EGSA 1O7JA 1W88B 1W1IA 3CFYA 1XALA 4TXHA 4B3RB 2YN2A 1R18A 1NNSA 3KO8A 2BHNA 1M2KA 3JWPA 3HXQA 4JOBA 2IBSA 2O2GA 4RWZA 4KWIA 4EF4A 5JG7A 1Z2PX 3WMRA 2G5GX 2L69A 3KELA 2Q7OE 3R3VA 4M1ZA 2BM8A 2WSMA 4WOKA 2NZVG 3R5HA 3FVQA 1K9VF 4PW0A 4BVLA 2P7HA 4RPGA 4JI5B 4BEWA 1GPAA 3DXYA 1IN7A 3ZDFA 1ID8A 1LBQA 2A78A 3OM9A 2R751 4LMBA 3KOOA 3HBFA 2H31A 2RGYA 3FE2A 3LY9A 4CE6A 1BE1A 2AYXA 5AVOA 4YQEA 1D4AA 1OC4A 1W29A 2O2IA 3UWOA 4ZGGA 2OBBA 1QWOA 2ZKLA 2A88A 2CC2A 4P83A 2H7XA 2OILA 3O8LA 5LDGA 4BV3A 3WQBA 3GUVA 4YHBA 2ZIGA 2PS1A 2RG7A 2ZRKA 4F38A 4RZHA 2WKWA 2HXGA 1O87A 2XOKA 4WESA 1DIGA 2Z95A 3EGVA 4GSKA 4EM6A 3KHTA 1PFQA 2DECA 3DBOB 4FR5A 4ZT7A 3ZXUB 2K87A 1KXZA 3FJ1A 4B4DA 2A84A 2I4MA 5IM5A 3ZHSA 5C8YB 1YBAA 3LU1A 5AW2A 5CXQA 4OSOA 4IEEA 4JBYA 4WOBA 4CWAA 2XCRB 2CLEB 4RGYA 4EF5A 4PYRA 3UCFA 3HWWA 2NNWB 2Q29A 1HY3A 1VDZA 3LG2A 5DTMA 1M5RA 3ETJA 2JIZD 4C89A 1QB8A 5C46F 3W8EA 4AWXA 2PXHA 2YFYA 1B2RA 3QY0A 3O8OA 4HX9A 1ZEMA 1GCOA 3RU7A 3G5TA 2Q9AA 3IP6A 4BXOB 1XCOA 1RLTA 2IP1A 3N9IA 5D6NA 3HYCA 3V97A 1P73A 1T6ZA 1MFPA 2ZJBA 3FPEA 1PAUA 4GVPA 4ENSA 1P77A 3TD9A 4PPFA 3L7AA 4V2UA 3NV7A 2EKQA 1D8TA 1H8HA 2FAXA 3KKPA 4KRYA 4RS3A 2IXFA 3ELBA 2KS6A 4CM4A 3HB7A 1GAXA 3AFNA 1WW8A 1ADFA 3VR5H 3RFTA 5JMWA 3KHKA 1SU4A 3BE4A 1AUXA 4BWFB 1UDAA 1XTSA 1NI4A 3KQUA 1I30A 1FRQA 2OCIA 2QUKA 3VSCA 1A71A 1JTVA 1KAQA 3LX5A 1WCV1 3CLKA 3LE8A 4DCSA 3HK2A 1JQJC 4MRAA 1W8IA 3I58A 4QNNA 4D46A 2LW7A 2O1SA 3CPSA 5JAHA 2R6HA 4ND5A 4GX2A 2LP4Y 2OAEA 1RADA 1JIUA 3FWNA 4QFCA 5K3OA 3RHSA 2P1RA 1P5RA 3NHJA 1SIWA 2IH5A 3BCRA 1H66A 2PZ8A 2JGDA 3ONWA 1ZL0A 3LT4A 2Q4EA 4M9UA 1N5OX 1DTWB 4FK8A 2HKIA 5BV7A 5AW5A 4F4IA 2MINB 4IICA 5A6SB 1W46A 3QX7A 4OMCA 3W8FA 4CM8B 3VDRA 5JEEA 1CULC 1XN1A 3DPUA 4Y1EA 3IEXA 1WOYA 4IXDA 1SPXA 3NM4A 2HI0A 1IJFA 2WYUA 2H7VA 5I51A 4A36A 3HA7A 3WMGA 1A2KC 3KU1A 4XQGA 4QQKA 1FDIA 2B30A 2ZSHA 1F4LA 2FQ1A 3NH9A 1AF7A 3ABZA 3HNOA 4XKJA 4FTWA 1Q92A 4LYHA 1Y5NA 4YAUA 1LDMA 2DTEA 2OCLA 3TW8B 4EUEA 4HATA 2Q1SA 1V41E 4FNOA 1H2EA 1YR7A 2RG1A 3EXHB 4XFDA 3FLMA 2FPWA 3VYRB 4TXLA 3VR4H 5G0TA 4YRAA 1GHTA 4MCIA 4TQAA 4B5KA 2O3QA 3MC1A 1UK8A 4U7GA 4WZBE 5JYCA 2G17A 3E8SA 3VZRA 1B74A 2J9RA 2IYRA 5C1IA 3SQWA 4TOIA 5LXTB 3IVAA 3PYXA 4B35A 2OO7A 1N7GA 1L4EA 2Q3MA 1Z82A 3O4HA 2WUWE 2OZLA 4MLDA 1KA9H 3THSA 4JLVA 1TX4B 2B4RO 4WA8A 1GQSA 4LFAB 5CYFA 1JWLA 1OFHA 1UKEA 1H2FA 3INGA 3EULA 3AR3A 3LNCA 2FUKA 3ANXA 3OOSA 4LMAA 3S1LA 4Z49A 3EQZA 3IFSA 4EGAA 3RU2A 4D74A 3OWOA 2OMKA 2QY6A 1CR4A 3H5LA 1N1DA 4HDNA 1P9NA 1TL7C 4OQLA 2GQ0A 4JS0A 4CQMD 2ZZMA 4H0NA 1JQBA 4TQUS 3AXSA 1DQZA 5I4CA 1SQ6A 4MS3B 2J0QA 5ITWA 4P4SB 5KYKA 3QUAA 4COOA 2JLCA 1KMQA 4K1LA 5FL3A 3WLTA 5LQDA 5IANA 4K3UA 3ERCA 1JQAA 1PNRA 2WFLB 3NOXA 4R0NA 3TIXB 3WLHA 5E1BA 1DBVO 3QF4B 3ODPA 4EYSA 1AXGA 1Y1LA 1Z4MA 5HPYB 5AQEA 2F8LA 4HZUB 4PPYA 1KYZA 4D98A 2JIDA 2VJOA 1WE2A 1NDHA 2ETVA 2P2CA 1GSIA 5FV7A 6ABPA 3H5VA 3QGMA 4XTCS 3NXKA 1YS9A 4B7ZA 4CKBA 4DC0A 4EGFA 3EOZA 4BMOB 5EYPA 2IBMA 1PV1A 2YXEA 1CDEA 4RANA 2GK6A 3A6GA 4AKHA 2CVQA 3TB4A 1JR4A 1O9GA 4GS5A 3GQVA 3SNHA 5M2QA 2QVLA 3TLGA 4M22A 4LF8B 4Z1MA 3KUKA 2LDXA 1HGXA 1EVEA 1N6PA 1XK6A 3INNA 3GLHE 2WJHA 3I01A 1KPIA 2QK4A 3OPYA 3N2KB 4KUEA 3W5VA 4ZYLA 4DTIA 3UJDA 2B94A 2ZB2A 4RLSA 1QG0A 1DRWA 4BO3A 4EB3A 3FBWA 1T3SA 2RK3A 1RDFA 3K4HA 3P71T 4H1VA 5EWMB 1AQJA 3H86A 1FQWA 1MO5A 1ZNQO 2V55B 4BNIA 3PGMA 3CLUC 1LBTA 3G7NA 1QTRA 2AXQA 5DNDA 1A7UA 3M1AA 5LOVF 3UH0A 3B52X 3FI9A 4JN6B 1EHYA 2NU8A 3W3AD 5FO0A 1NE2A 3VVBA 4GFDA 3U7QA 1MCZA 3A1SA 4D3FA 1NOJA 3V7WA 2FP4A 3EPHA 2ZWVA 4Q3AA 4UZSA 4DM7A 4EJMA 1QQ5A 1O94D 3AHIA 3MZ0A 4GE3A 1LNZA 2JBWA 4WK2B 4YRGA 1FXSA 1ONNA 1ZCAA 2CJPA 2X9VA 5ALJA 1UMCA 1NV8A 1G18A 3O26A 1E3SA 2NUTA 3RWMB 1R5NA 4HI0E 4F3RA 5LBUA 4MS4A 4QSHA 2QXUA 3GLIA 4DAEA 1WMSA 4MSUA 3VUEA 2WTEA 5DHRA 4TWAA 5ITZA 1XHFA 3RS5A 4OXYA 2PLFA 3S5JA 1XYVA 4KYVA 3IAFA 3L4EA 3V4VB 1F2UB 3M49A 4AJKA 3LNTA 2UUAB 2K2QB 3D0OA 4HS4A 1POWA 2LRHA 2YS6A 4XYGA 3VYTB 5JSUA 3NHWA 1SBIA 4ZZ1A 4GLJA 1ULAA 3FDZA 3G8YA 1NI3A 2DWOA 5FV4A 2HNKA 3B2EA 2VUHB 2HCTA 2AG0A 1DEKA 3KPVA 2PXAA 1LWNA 4DIOA 3UNXA 2A9FA 4MIKA 1RWVA 1EK6A 1FXWF 3GMTA 4L7VA 2I3DA 4IS2A 4JYMA 3SBDA 5CFOA 2JZCA 1AB5A 2ZSEA 3GVPA 1JR2A 4MWZA 2OEPA 4OU5A 3RTCA 4U9IS 5IEJA 2ON6A 3OWXA 5DYYA 5FORA 5T6BA 3M2TA 3TJMA 5FUQA 3WHLA 1KP9A 1Z18A 4YCMA 4IIJA 4IY1A 2R48A 2BGGA 2O3TA 5F76A 3K6SB 3CNHA 4FMBB 4BZXA 4P81A 3N0WA 3VOBA 1XDSA 1E18A 1HA3A 1WSBA 4JBGA 1DZ3A 5K8UA 3U16A 3Q1KA 2OXEA 4P7BA 3MCWA 4KNWA 1E0DA 3FTFA 2XUIA 1OHHA 2H63A 3OQJA 1EA7A 1WX1A 2GEVA 4MLPA 4UNSA 5D8DA 2EDCA 1XJ5A 2W2NA 1DJMA 4K6MA 2BEVA 1UM9B 2CLIB 2MR5A 3WWYA 4JBIA 4TS1A 4OLFA 4KPYA 1NBEA 3DOCA 4K46A 2VJLA 1Z0JA 2P90A 3RS7A 2SECE 5SZIA 3GCGA 4LMPA 4E09A 3DLTA 3PGJA 1N8SA 3CN9A 3HUTA 4QU8A 4RBNA 7YASA 5JD6A 4ZDKA 3PSAA 3OJXA 1RXUA 4D1YA 5D1HA 4YUVA 1N8KA 1U2ZA 3KEMA 5LOVA 3DTNA 2W2LA 5D3QA 3ZIDA 3R77A 4BNWA 1L4HA 2Q4RA 3OICA 1NN5A 4JJKA 4BP9A 2GNPA 4WEQA 3F7MA 2GEFA 3VR6H 3AR9A 4H1WA 4CI0B 4S12A 4UDYX 3H4MA 3JWHA 1Y9ZA 3BFXA 4KBYA 3C15C 2M32A 3SDZA 2W48A 3QSGA 6CHYA 5LL6P 1YRLA 3QVTA 2R1TA 1IK4A 3T7RA 3WIDA 3ES9A 2FDRA 3LW8A 3SLRA 2RIPA 1R16A 1QYDA 1HPLA 3M34A 2F00A 2G0TA 1Z2NX 2R84A 2O0LA 3QG1A 3QOYA 5FADA 3U1TA 1E32A 3V00A 2O2DA 2N3ZA 2WIDA 3DHNA 2FY8A 3TRKA 1BEZA 3TCXB 1G5TA 1TQDA 1EJ0A 2XYQA 1HI9A 4Y7DA 4HRXA 4PYNA 3I64A 3RO7A 4C29A 4A0GA 3ZVNA 3HB5X 2BDTA 3A2LA 4GXTA 1KY4A 1LK0A 2CNOA 5CTAA 4CMGA 721PA 1GQFA 2B6HA 4NZPA 4OD0A 4NG5A 3M4YA 3L0IB 3DWEX 4OQNA 2PGNA 3WFJA 4X8HA 1U3GA 4DBLE 1RC8A 1NA5A 5EZYB 2OCKA 1J5EB 4DUGA 1HH4A 1CX9B 1LLQA 1M1NB 3QTLA 3K3PA 1FXWA 2ZI6A 2XAAA 3DHYA 3OSUA 3N1UA 2BLNA 4LDQA 3ESQA 4QUBA 5JARA 2EKBA 2Y1CA 3WSVA 2BUBA 2WT8A 2QM8A 1EZ4A 5DTEA 4ZKEA 2CUKA 1O6GA 2JD1A 2WWYA 3AQ4A 3BEDA 3HI4A 3KJQA 1S4MA 3VNRA 4UAGA 1ZIPA 3LSYA 3ORRA 3KQMA 1H9AA 5KNCD 1VLLA 1WBJB 5FBRB 3RVLA 4P3XA 5TVGA 3BGOS 1MTZA 2EARA 4KZKA 1M1YE 2WTXA 3PUIA 4RIEA 4UZEA 1UCFA 5AJVB 1MAUA 3MT8A 2FN4A 4B33A 2XODA 4BWGA 4MP8A 3R9IA 4AD8A 5ED0A 5FOXA 1R8YA 2I2CA 2VXCA 4AJLA 2IRWA 1XZHA 3AZPA 1P7YA 3CNNA 4BGVA 4RTRA 4DB2A 1G8MA 1C4OA 2BT4A 3R3UA 4QU9A 4AWBA 3ROMA 1Q20A 3WLAA 1PBTA 1ZJ6A 1RXCA 1E1CB 3K32A 5A71A 3AO0B 1K63A 1YR2A 3O90A 3U4AA 2Q27A 1ILEA 1KFEB 3ENZA 1U3CA 4R41A 4HAOA 4DVJA 1IQPA 1F4VA 3IQGX 4TRNA 1VLZA 5J2TF 2VDJA 4R9SA 4DRXA 2X5OA 4YAWA 3KD2A 3PDWA 5IVPA 3N0VA 4IQ8A 1IONA 1EFHA 1Y4UA 4O4JF 2BTEA 1JA0A 1FTNA 2XTMA 3ID6C 4B7UA 2P6MA 4EG3A 4ER7A 4FQ7A 1I6LA 1PKEA 1B8VA 4YGXB 1CJUC 2D2XA 2VSNA 5LP1A 4RUKA 5ECYA 1QZUA 2PO5A 1EUQA 2I6UA 2XNKA 1XD2B 2ZJ8A 2WOOA 1WVMA 5AUNB 1Z5GA 4QZVA 4NCAA 3A9SA 2OBMA 2V0CA 3M1IA 1JIKA 1AH2A 1PSWA 1IATA 4A3SA 3FYCA 5DGXA 5EGNA 2NMVA 4F84A 3B9RA 1TZKA 2QMYA 2YHSA 4ZC1A 1SFRA 2PLWA 1X3SA 2C3YA 5KB3A 3G02A 2XDAA 1S4QA 2Z5GA 3U3DA 1NMYA 1G5HA 1SUWA 1LVUA 1WDMA 2PKYX 2VZLA 3G2LA 3JQAB 3O9MA 2JFWA 3EVEA 4HDQB 4KCGA 5CJJA 5D01A 3SBXA 3NBKA 2HIMA 4XGQA 5C8XA 3EFEA 4TLBA 2YICA 2JAHA 3NAZA 5REQB 4M8LA 1OF1A 1XP8A 5ELMA 4CL0A 2YZ2A 1QSGA 4QQRA 1MD9A 2REQA 4EYEA 4PBTA 4JI8B 1QIIA 1JQ3A 4LVCA 4YMTA 1XA0A 3GYBA 1VPVA 3SYKA 3O38A 4YQFA 2QJFA 4TZKA 5EHIA 2D2VA 1U5BA 3DMGA 1MB2A 4WHMA 1HT3A 4AJHA 3SSNA 3FYTA 1J2EA 4UNQA 1A77A 2HGZA 2WAAA 3R3XA 3O91A 4JELA 4ZVQA 4RD0A 3GJSA 2G9NA 1F48A 2OD9A 4PLPA 3KEOA 4B7XA 4Y9SA 3KZCA 5E2BA 3NH6A 3TKAA 1BHO1 2GAJA 3U3ZA 5LKRA 3V2UA 3OU2A 1USWA 1KO1A 1UDCA 2H1HA 3DPIA 3N6RA 4Y1FA 3UT5A 2RGDA 4J3NA 1KAEA 3AF3A 3QU9A 4TMWA 3RANA 5K01A 1WU8A 1YJCA 1IG0A 1RWPA 2A9KA 3Q10A 5JPIA 5TQ2B 1POXA 4ARAA 2C94A 3T7KA 2XMSA 4ISCA 1DP4A 4YRKA 4V3CA 1CIJA 1XNGA 1Y48E 5ALYA 4BQEA 2Q1WA 1Y9AA 3VU9A 4E7PA 1SCKA 3EVZA 2C9CA 4QDTA 4GO1A 1XLWA 3VPBA 3N6XA 4HKTA 4Z51A 2Y0DA 3X2SA 2Z3VA 5J2TA 5A9TA 1YQWA 3QV2A 1EM6A 1OAKA 4L0QA 1ZK0A 4RXMA 1C8VB 1Z2DA 4E1AA 4O4JA 2P6RA 3NW9A 3ZS8A 3OPYB 4YT5A 1DWQA 4RTOA 2D1SA 3Q3HA 1GU0A 1OU0A 1ENPA 5C37A 3J7AC 3GAAA 3GARA 2K7ZA 2W0MA 1Q0LA 1CUDA 1VSTA 2O23A 4BVHA 5A4FS 1SQSA 4YCAA 2YTZA 4TVOA 2BLLA 1XZIA 1U9CA 3KXPA 3AVUA 2IOFK 5JR3A 1LB1B 3DDNA 2I2DA 1GRVA 1M33A 4ANFA 3L18A 2QTMA 3CVXA 2FZ5A 3I23A 3UQZA 1WCIB 2ZVJA 4X1YA 1K06A 1Z25A 1TJ3A 2XX3A 3VI3B 1P4GA 3ACDA 2AMFA 5JBIA 2RHJA 4CLDA 2QRGA 3K70C 1D09A 3LFUA 3UW3A 1EUCB 2J8ZA 1UMCB 1W2GA 2X1HA 5IWCA 2QLLA 1R4AA 1GZ4A 4BVJA 4DMHA 4O1MA 3FOEC 1XB2A 1OXBB 2ORWA 5ERGB 3QE0A 1Z4JA 1R0CA 4RD1A 4RDCA 5AOCA 3H8VA 3SGLA 5CUQA 1V8ZA 2QRZA 3N76A 1H6DA 1DKPA 3JZAA 4AJPA 2ERYA 1GUBA 5TMDA 6Q21A 3TO5A 5IABA 2JGNA 1ZNZA 1YI1A 4LHSA 5IHXA 1DELA 1BX0A 1YTUA 3IXMA 1AQUA 1HNNA 2AZMA 4H7IA 2J3JA 4OI2A 3SQNA 5LUAA 1GOTA 1R4ZA 2QLBA 4LCBA 4OKIA 2D74A 1RIIA 3C70A 3RH0A 3I8XA 5FPPA 1XC7A 4FEYA 5CA0F 3OCJA 3UHOA 4L1KA 3AJDA 3BK2A 5D2CA 4V39A 3EZGA 1QHSA 2AN1A 1A1SA 1PJ8A 3CB4A 3CH6A 3F4KA 3K9BA 4OXIA 1UBLS 1NF9A 2R8PA 3WQQA 3W9UA 1OBCA 4PAQA 2G08A 5AKYA 2M2IA 4UQPA 1X13A 1OZFA 1BWQA 1EP1B 2GT1A 5AVWA 3IUJA 3BMOA 4P3PA 3TUZC 2GKGA 3NRCA 4F72A 2YFHA 4QRDA 3HLTA 1LSJA 4MYRA 1GUDA 4HDSA 4JXZA 1Q1NA 4QECA 4EPXA 3VYVA 2O2CA 3OESA 1RD4A 2P8SA 1VZ3A 2VPYA 1ISRA 4HYEA 4O2BF 5ALNA 3L1UA 4PZUA 2ZT5A 2FSUA 4F5DA 3UKDA 3Q3CA 4HNTA 3CUEF 4QDOA 1MJNA 4X9XA 2VA9A 3PNSA 5DT2A 1JV2B 5GONA 2V4UA 3NOQA 5FUYA 1I2DA 4I99A 3ROEA 1JFLA 5DGDA 3BB4A 4PZZA 2WAXA 4V0NA 4ROSA 4L5YA 3UWKA 1WETA 2VG8A 3DEAA 5ALEA 3ADKA 4H0CA 1ZM3A 4M9RA 2RFLA 4KGVA 4EW1A 2JFYA 1N8TA 5I7WA 3W5BA 2XE6A 2VAXA 4FYYA 1VDMA 3BQ9A 1ECPA 4A8TA 2FA9A 3KG2A 2FFJA 1JP7A 4Q24A 4QYXA 2H3HA 4XAQA 1RS0A 1T0UA 2HV8A 2J7PA 3CY6A 4HH1A 2CXOA 2OGUA 1G2IA 3TQQA 5LMCA 2ERXA 3CF4G 4H6XA 5LD2C 1QK3A 1CUIA 1AURA 2P7IA 5BN4A 3HWSA 3O3NB 4PHFA 1E2DA 2BMFA 4AG5A 4BEBA 5JWHA 1IY2A 5J9FA 5ADHA 3GRZA 3GQBA 3JQ8A 2G3YA 4P0TA 4MGHA 3QXHA 3FZNA 4BFCA 2JRCA 2OL4A 4DA0A 3MWEA 1M76A 4YVFA 4ZO7A 1HYGA 4FHGA 4E3ZA 1YK0A 4S3MA 3V6MA 3ORFA 3H6HA 3A9TA 1R4NB 3MIIA 5A3QA 1P0IA 4J0HA 3OH8A 1JIJA 2Q1UA 2QAJA 3JVIA 4RK0A 4AUMA 1G59A 3GAFA 1CETA 4ZVPA 4D0RA 2W98A 4YJGB 4CV3A 1D2GA 5JFGA 1GNSA 2OCYC 5EE5B 3T5DA 4MK4A 4Z8XA 2HNAA 2HU2A 4KE7A 4ID9A 4R2WA 3N8GA 4UZFA 1XMSA 2Z4RA 3IV6A 1YZKA 4G5GA 5CLHA 5KNLA 5BP7A 2WV9A 2V03A 2X4GA 1REQB 2EZ8A 2Q6OA 4OB7A 4AN0A 3SOZA 3H2GA 3COZA 3JR7A 4S1WA 3E1SA 4D9BA 4KU4A 3KK0A 5IF3A 3WNBA 1J0EA 2A9RA 3BK1A 1ZCFA 3R6WA 5KDLA 5KI6A 3R4VA 5U1PA 2ZUVA 4Q1BA 1KEUA 2PYDA 3UQYS 4DJFC 3QZUA 2VRBA 1CEEA 4X94A 1HE8B 3HN6A 1N2OA 1F38A 5LYYA 3LDGA 4PS1A 4OHMA 4HRVA 1QC5A 1FFYA 3L92A 1RYHA 2ZWMA 2GR9A 1IHDA 3FZGA 1J2RA 1KK1A 4AW9A 1LLUA 1IB0A 1WZ2A 1NY6A 2OXIA 4IZHA 1QGUA 3CISA 4MHTA 3GH3A 4YAIA 3RK1A 2COEA 3ZX5A 2Q49A 1RYEA 2D7JA 2F1IA 3AB7A 3AL3A 2A0YA 2OCPA 4RLQA 1U0BB 1BS1A 3CPEA 4Q1DA 3I05A 3IQWA 5DF1A 1UEJA 3F6BX 1R0YA 2F90A 2V6IA 4FLMA 4BZWA 3I6QA 4RF5A 4Q1FA 5BOVA 1THTA 3LBAA 3ZCRA 4B87A 4NQRA 3ABQB 1JQDA 2B2NA 1GNQA 1ZLYA 3EDYA 4KQMA 5ALIA 1UKBA 1PS0A 1W34A 2E4UA 2RJ3A 4FNGA 4JJ6A 4O25A 5CCDA 5TXGA 4F71A 5IT9A 3SS9X 1Z4IA 3OT4A 3CZ5A 2IKQA 1NT4A 1Y4AE 3A9RA 3PPIA 4G4SO 5AKXA 3T3GA 5AIBA 2FUNB 2ZDGA 4RFVA 4C22A 5JU6A 3O3OB 2H0AA 3AH8A 3BXZA 2BI8A 2UXCB 1HNZB 2GXSA 2JHPA 1K66A 4NP6A 1P1FA 1GNPA 1TMYA 3BFVA 4FMPA 3S27A 2C7BA 1DO0A 4EKGA 2P4UA 1DTEA 4FJ2A 3HLKA 5KVAA 4R9RA 4L3VA 1KEEA 1QTQA 3BF7A 4JKYA 4UXHA 2WOJA 1H94A 2HO4A 1W2WB 1NW7A 5A9SB 5EKXA 4P3NA 3KBBA 2YASA 3W6OA 2WNIA 3CZPA 4GPTA 5EPUA 3TRJA 3PD1A 5K0EA 1Z06A 4U4AA 2I6TA 4R1UA 4MPTA 3RGGA 4RVHA 3AP3A 1DTSA 2CLOB 1Q91A 1QX3A 1RKVA 2GRUA 2IYTA 1XPJA 3KOUA 1WY7A 5DNWA 3SLGA 2WNHA 3I5AA 9ATCA 4IDGA 2O52A 1DKUA 1Y7HA 4AAYA 4YV1A 1USIA 4GOKA 3T4PA 4JAVC 3UGKA 4R7TA 3R41A 4D4MA 2AC2A 2QRVB 4EA9A 2C82A 5ERXA 4PNZA 4REOA 3SHTA 4EJSB 4FB5A 3BH0A 3OHSX 4JP8A 1UIRA 4I5DA 1ATZA 1QLWA 4JKIA 4LXIA 4M86A 4NBSA 4XASA 5CNMA 5TDHA 1Y7PA 1H4VB 5FKJA 1U3DA 2VDWA 4UBKA 3BHMA 3HNPA 1A5TA 3CGWA 3IIEA 1UBTS 3SJAA 4MPPA 5EJ5A 2DLCX 5ENZA 3C14C 3ZV5A 1II9A 3LDFA 1L7QA 4DVGA 2HMUA 4EA8A 1DLIA 5EHZA 3TCNA 2W2QA 4QOEA 4TTJA 5JSQA 1Z38A 1VJ1A 2H1LA 3EGXA 3BWCA 1LWOA 4I1VA 3TTUA 3V8BA 5HDBB 1GDDA 4K8OA 4LVUA 3NYIA 3AHGA 4U7JA 1Y8AA 4EEKA 1PYDA 3CLVA 1ELOA 4RD4A 4PLYA 1K8ZB 1YMUA 3JQEA 3I9LA 4FBMA 5A1JA 1CR2A 5HS4A 2Z6UA 3DBLB 1DCTA 4K9LA 3TXAA 5KNDA 1VPWA 2BJWA 3P8ZA 4LGVA 3WYAA 3UFXB 3H2ZA 4JI1B 4B3JA 2QEQA 1OXMA 5MFZA 3Q3JB 3ZCXA 3OF5A 3U1BA 1TAQA 4KQJA 1V16A 3UMJA 3V1NA 2Z04A 1JG4A 1MG5A 1R8JA 2P9GA 2YIJA 1J1IA 3I92A 3ZCQA 3ABOB 2GM5A 3GN2A 4NATA 4BLTA 3TFOA 1ZH0A 1W4BA 2B98A 3BOSA 1NQOA 1GG5A 2GWHA 4GT1A 2FFQA 2VJYA 1HUQA 3PFNA 3TSCA 2ZEJA 4NPAA 4PSAA 3QRWA 1T2FA 2DHEA 2ZAMA 3BGDA 2R65A 3IVCA 5T4EA 2BI7A 5HQJA 2BKUA 1R5OA 4TUYF 4PZ0A 2HD4A 2IY7A 3FH0A 2AQKA 1AK9A 4ND7A 4C6RA 1UUFA 4DSNA 2C1XA 4IW3B 3V9AA 1CU1A 2C4TA 1DS6A 2RGNA 3L4SO 4Y2TA 2GFIA 2CXTA 2RAPA 3D7RA 4X8MA 2DX7A 4R8SA 1QCYA 4YRFA 2KHZA 2H7CA 2A6PA 1GRCA 3D8SA 1KGSA 1ITZA 4ZV9A 1OFGA 2NPIA 3RAJA 4YCNA 2GARA 4CMIB 5A0VA 4UJ3A 1G5RA 5AK5A 2V1XA 3AR4A 4IGIA 2GK4A 1U6IA 2W6QA 3P0JA 5F33A 1VBFA 5KNCA 1E7WA