2Z5FA

Human sulfotransferase sult1b1 in complex with pap
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
PKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKRKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human sulfotransferases SULT1B1 and SULT1C1 complexed with the cofactor product adenosine-3'-5'-diphosphate (PAP)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Sulfotransferase family cytosolic 1B member 1
total genus 99
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.8.2.-:
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2z5fA00
2ORIA 2XOKD 3OESA 4OQMA 2HLDA 1YVDA 2DFTA 5DYIA 4C2UA 3BGWA 5CK5A 1ZC4A 221PA 4JZKA 4UNQA 1UEJA 3MWYW 5DIFA 1EFRD 3GJ8A 5GVRA 2D7DA 1CBUA 1SHKA 2FEOA 1II8A 4XTRA 1G7TA 5CDFA 3RC8A 5FH9A 1JNYA 3IBGA 3QKRB 4ON9A 4E22A 2HLDD 1TF7A 1GL7A 2AFHE 5HPYB 4KVAA 2PX3A 3V00A 3LW8A 4FCWA 3AKYA 3LA6A 3M1IA 1G41A 2AKYA 4FMCF 4P4SB 4AWXA 1NG9A 3NEYA 2IXFA 3K70B 3I8XA 3I8SA 1BOFA 2EWVA 2Z5FA 2P3SA 2XJ9A 1Z07A 1E94E 4Q1BA 1R0ZA 4FXPA 2IYUA 2O8BA 4GDFA 2VPPA 3BRWD 2DWPA 2WWIA 4MRVA 3CB4A 5CLQA 1Z06A 2E1RA 2ZYWX 3RLFA 3N70A 1VTKA 4DCVA 1I2MA 2W00A 2ZSEA 2CCKA 1SXJD 4NL4H 3C41J 1KDRA 5EP2A 1YRBA 5IT5A 4MDFA 3HJNA 3GJ7A 1CJVC 1H8HA 2FOLA 2IYZA 2QMUA 2J46A 3LNCA 3LRPA 2BMEA 2J7PD 4DSNA 4M1OA 2YWFA 4B73A 2FSIA 3R7WB 2RHMA 1TAGA 3TAUA 4DBLC 4L9WA 4XWKA 3TLXA 5CJ2A 3QJYA 1YZQA 2OAQ1 3K9GA 2NMVA 2GEDA 1T3LA 2FA9A 1TQ2A 4OQXA 4BFUA 4Q1EA 2JJ2A 3KB2A 4WVFA 1FTNA 3CPEA 1YE8A 1OHHA 2B8TA 2D4HA 4F4CA 4NH0A 2BEJA 1E2DA 1QG2A 4QBFA 3FPAA 3K70C 3U2QA 2Z43A 4MRNA 2UZ3A 3VNUA 3WNDA 4LOAA 4EKDA 4EPVA 2VP6A 1KMHA 1UADA 2CJWA 5TVKA 2QRZA 4IJMA 3QF4A 3VR3A 3UMSA 3WBJA 2GILA 2GTPA 1DO2A 4V0KA 3GEEA 3THOA 1W2HA 2OBNA 3BB4A 5GJVC 5E7MA 1M7HA 1ZAKA 2B6HA 2JDIA 3WXMA 1XF9A 4OK6A 2JLUA 4PQRA 2OUKA 4EPYA 1TTTA 4XD7D 2C77A 2LCFA 3AF1A 1ZM2A 5CYOA 3W5JA 3S1AA 1FFHA 4G1UC 5AUQA 1MT0A 1XJCA 4IVRA 1Z47A 4KFSA 2WKRA 4PZLA 3X1WA 5F9HA 1ZNXA 5GADl 5DO9A 1LTQA 1EX7A 2GK7A 3EIEA 2VYFA 1S9DA 3G5UA 4HUTA 2AHOA 2XXAB 2F3TA 2QQEA 1HEIA 3QG5A 1ZJ6A 1WBDA 4OJKA 5BXQC 1Q12A 2UKDA 2FG5A 5B30A 1DG3A 1E0KA 2JEOA 2PMDA 4TQ9A 2GA8A 2ZUDA 1U0JA 3REGA 3VHLB 4TL9A 1HT2E 1R6BX 1Q1ZA 2CL0X 5E7JA 2ZE5A 3DVLA 2MSEB 1HYQA 2ZSAA 1AS2A 4QGGA 4CZ2A 1T3HA 1VG0B 1ZD1A 2OO7A 2QTFA 2J1LA 2X77A 4G5GA 4CEJA 2GDJA 4A4DA 1CTQA 3B13B 1N6IA 4NMMA 2BOVA 4EJSB 3RDPA 1BYIA 4C0HA 2GCOB 2AR7A 4MGKR 2IF0A 5AJXA 5LBIA 4B48A 3THXB 2JIZA 3RWOA 3WMFA 1P3JA 1U99A 1GL6A 2JA1A 1N3BA 4A8JB 1E1RA 2A9KA 2QGNA 1XD9A 5UKDA 5EP1A 4MITA 3QOFA 3EPJA 1FQJA 2KJQA 2H16A 1Q1EA 3OHMA 4EFMA 3U3RA 3M6AA 1XZQA 1Q0UA 2ZI7A 1KI2A 3B85A 3GD7A 1W49A 1JPNA 4GOJA 3RC3A 3DZDA 1E2NA 2JGNA 4P33A 5A0FA 5FTLA 2YWEA 1N5KA 1G16A 1XXHA 4Y0VA 3U60B 2YKGA 4PR0A 5C4GB 2NPFA 5HKKA 2WOOA 1N0VC 3F3YA 2AWNA 2GXUA 3JZAA 1TQDA 3BWDD 3NBYC 3K0CA 3SS8A 3PUWA 3OZXA 5AJYA 1KI7A 3U4QB 1WXQA 1IY0A 5EZ6B 3KUCA 4NPHA 1WB9A 4ZDJA 4RD6A 2FPMA 1Z6GA 3AUXA 4L8GA 4GI7A 2OV2A 5HKKD 2P6RA 4OHYA 3FDIA 2XTZA 3TSOA 4QHSA 1N6RA 3BOSA 5DHAA 2BC9A 2ZIAA 2IWRA 4PTLA 3SZRA 3WNBA 4EIWA 721PA 2QP3A 5KTYA 5L3QB 2HCBA 4F7WA 2DY1A 4JLKA 4B3CA 4PPFA 3GLFB 4DLZA 1OIXA 3IDQA 4B2LA 3W8RA 4JKYA 4NYMQ 2IEYA 3CX7A 2BCJQ 3NXSA 1BMFD 4IOLA 2JIZD 3NIBA 3OE7A 4XVUA 5LPNA 4EFNA 3NVAA 1AK2A 3RRMA 2X8AA 4IDPA 2RAPA 3U3KA 3CLVA 2DFKB 2ZUCA 4IW3B 2IL1A 4QNMA 3L2OB 4KYIB 3A6PC 3RRNA 2VLIA 2C96A 3EG5A 4XJXA 2F55A 2E87A 1EXMA 1VG8A 3IO5A 1YR7A 2XB4A 3GLGA 1XTSA 4B75A 2ZS7A 3LAWA 1B23P 1IOZA 2QMEA 3FGNA 2C9YA 1SKYB 3SYKA 1HA3A 3GLIA 2HF8A 2WJVA 3DL0A 5CB8A 2FDCA 1KIMA 1M6NA 5A4JA 2RMKA 4MGYR 1LVGA 3Q3JB 4D2IA 3OIWA 3QBTA 1P61B 5JWHA 2ZREA 4KU4A 2ZRDA 4C0QC 1XMVA 5CITA 3AF2A 4CIDA 1NI3A 1J2JA 1MOZA 3V4FA 1T5LA 4MGZR 1G4UR 2ZE8A 4DDTA 1E99A 4XD7A 3DMDA 1JAIA 4NONA 1Z8FA 3P1JA 2O8FA 1GWNA 4TQUS 2ODNA 3SC3A 4B6FA 1R10A 1G64A 2D06A 3CF2A 5JWOA 2WKPA 3EZFA 1YU9A 4D4LA 1OF1A 2VHTA 5JEDA 4D25A 1KOFA 1SVKA 1Q3HA 4GBMA 2QG6A 4IFEA 4LY6A 4NCJA 4TSFA 4AKHA 1G7RA 2ZRMA 4PZYA 5C18A 3A4LA 4B3BA 1AQYA 1TL7C 1VG9B 2NO1A 3ZVMA 2ZM5A 1T5IA 5IF9A 2QROA 2V9PA 3OF5A 1FNMA 3NBFA 3QSYA 4J0QA 1E6CA 2OM2A 1Z08A 3P4XA 3PUZA 2ONKA 2QT0A 3CW2A 3LH5A 2OAP1 4IRUB 3U3MA 1GOTA 5FFMA 2PT5A 3KKQA 4CRWB 1GNRA 2P5TB 4PQFA 3A8TA 3GLHE 2KBEA 3K0FB 4Y0AA 1HE8B 4A2WA 2O8CA 1NKTA 3ZD6A 4AYWA 4Q9HA 4DUGD 2XXAA 4Q00A 1CF4A 3SJCA 4TL8A 4BLSA 1KY3A 1H8EA 2CEAA 2F43A 1K8RA 1KJYA 1JQLB 1ZM7A 1E2MA 2WAXA 3QUSA 5L3SA 3WHKA 2G77B 3U7GA 5JHGB 2QP9X 3F0TA 1AZTA 4CT4B 1W0KA 3C8UA 4TSFD 3EZ7A 3TQCA 3AUYA 1UBGA 1RIFA 1OJLA 2GCNA 4N3NA 1KK1A 4DIDA 1NNEA 1BKDR 3D31A 4UXJA 1OSNA 1YHNA 2V7QD 2YC2C 3EASA 4WZ6A 5G3YA 5DNYB 3AVVA 1QZXA 1NLFA 2DBYA 2A5FA 4Q1DA 2FSHA 3I5YA 1RPZA 2NTYC 4B3FX 4ZCLA 3TIFA 4L15A 3EC2A 1Q1BA 4O2RA 4URVR 3QNUA 1X6VA 3BH6A 2J5XA 1GUAA 5M04A 3Q85A 3F5FA 3BBPA 1FX0A 2ERXA 4LYFA 3VR2A 5EE0A 4DLTA 4BUJA 1CR0A 4GZMA 2HF9A 1W1WA 4C30A 3SNHA 2OLJA 3IQWA 4HEJA 3W90A 1AGRA 3TW8B 4KVGA 3ICQB 4RKEA 1KSHA 4AIIA 1A1VA 2HJGA 2P67A 5ANRB 4QRHA 5L3RA 3KJIA 2HYIC 3VTKA 5EE5B 2K5UA 4BEBA 2EFCB 1GILA 4F93B 5JRJA 5B58C 2J0UB 2KSQA 4A15A 4DSOA 4FMCB 2D7CA 3EWAA 3SFZA 3REFA 1AKYA 1M2OB 4CEIB 3TAHA 3T1OA 3U7FB 5IHPA 2W2XA 2VF8A 1P60A 1VCNA 4A0GA 1SVLA 4D82A 3EC1A 3MD0A 4F4IA 5KHOC 3U4QA 1SXJC 4RFSB 1M7GA 2JAQA 3A1VA 2IYSA 4NYIR 1E9FA 2IS1A 5FPKA 2GXAA 3T5DA 2FSGA 2RGNC 3ZS8A 3PQCA 2GWHA 2SHKA 4OI0A 3EXAA 2NZJA 4HAVA 3VFDA 1VECA 5JLJA 4B76A 1XTQA 4K8OA 4PAQA 1XMIA 1NJGA 5GVSA 1OT3A 4U5XA 1Z0KA 5CM9C 2P2LA 4GFDA 5F9FA 2REBA 1G3IA 2VSXA 3CF6R 3VU9A 3B1XA 4LPSA 4A92A 2PEYA 2VF7A 4LWZA 1HURA 1FP7A 2NG1A 1RKBA 2P6NA 3AH8A 4M1SA 2EFEB 4A82A 4WA7A 1UBEA 3K9NA 2PL3A 2NGRA 4BEJA 5E3HA 1XU4A 2REOA 2WKQA 3LO5A 3K09C 4QM7A 1A7JA 4ILEA 1G5RA 1G8YA 4B32A 2MMGA 1X1SA 1T0HB 2F1RA 3CRVA 4PHTA 5ELXA 1F2UA 2F1JA 4QJ4A 4BQSA 1BH2A 2PBRA 5JMTA 2NO9A 4MDEA 2V4ZA 4B3XA 1E1QD 3KXKA 2C2HA 1XPOA 2XTNA 2Z6VA 4TTQA 4MUBA 2WWXA 4TMVA 2OZEA 1ZCAA 2GZAA 2XB2A 3KL4A 2PCJA 2RGXA 2O0KA 4R2IA 2WIAA 4HZUB 1QHSA 3A1UA 3LX5A 4JVNA 1FMJA 3MG9A 5JJLA 4DT1A 5TARA 4M53A 4DLUA 3C5HA 4TWZA 3TJZA 1ZYUA 4OHVA 4RCZA 1Z0IA 3CF0A 2YZ2A 5JJKA 2CL6X 2QBYA 2QPTA 2ZRBA 2BMJA 2PH1A 4OHWA 5F2EA 2LKCA 1D8TA 1Z6AA 3PEUA 1MKYA 1AN0A 4GT1A 4PO8A 3L0SA 2O8FB 3W5IA 3X1DA 4Q9JA 1VIAA 2WJIA 3IHLA 3ADBA 4D81A 1E79D 2VSOA 1QHHB 2VHJA 4HB0A 3KJHA 1U94A 4B43A 3CRQA 1US8B 3K1JA 1W48A 3QENA 4LHXA 3CX8A 3PJRA 1C4OA 1MABB 2QEQA 3QE0A 4HLDA 1X3SA 1G21E 4TMTA 2J0VA 1DG1G 2GXSA 5P21A 2QZ4A 2RGAA 1YZGA 3OAAD 3KQUA 3KZ1E 5TMPA 1A82A 3PR1A 2Q0HA 1DTSA 1ANKA 1I4TD 1ZP6A 5AJZA 121PA 2GCOA 2MSCB 4JLJA 2FEMA 2ECKA 4P31A 1AJEA 3THXA 3LVRE 3QXJA 4TLCA 5G41A 3AV0B 3RHFA 1G8FA 5FOUA 4DJTA 4M9ZA 3K0FA 1JR6A 3NBXX 3LLMA 3AP2A 4DEYA 5C46F 3B2EA 3TGPA 2JLSA 4LX0A 4U02A 4YC7A 4LJ7A 4B74A 4D80A 3B1ZA 1NVVQ 2ZRJA 2VTKA 3E5HA 3LXRA 1JJVA 1HQYE 4OKSA 2R65A 4EPRA 1II8B 2AKAB 1EFHA 4Q9LA 5KSYA 2W0SA 4TYQA 1UDXA 2XJ4A 3IO3A 1KDOA 1DAIA 3DDCA 3NHAA 1IN4A 3C15C 2ATXA 2QNRA 1MO4A 4LZZA 1XEXB 1TU4A 4M1TA 1Q21A 2ZRKA 3E1SA 5J4VA 4JL8A 4JSTA 3OEHA 2WWGA 4WW0A 4DCSA 2ZRNA 3RS2A 3RNLA 2PLFA 2IYRA 1C1YA 4PSAA 3GFOA 1W36D 1Z0JA 5EXSA 3SYLA 1GKYA 3Q7QA 2QP4A 1CXZA 2V6IA 2X19A 1JAHA 5D3QA 2FX3A 4ZI2A 2ZE6A 4Q01A 2J7PA 4Q7LA 1XPUA 1G8PA 1NRJB 2ZSDA 1U81A 3QKSB 4JL5A 4NCKA 1CKEA 4JLBA 821PA 3QXXA 2FU5C 1F60A 3TVTA 1L2TA 2DR3A 4W9MC 3A1WA 2FE4A 1ZBDA 5FBWB 1W44A 5HCIA 4JBXA 2VH5R 4DCTA 3T34A 2ODEA 3EA0A 4RZ2A 1GRRA 3FMIA 3I1FA 3K8YA 3O8RA 1KKLA 4ZKDA 5KNDA 2J0QA 4F92B 4JSYA 1ZUNB 3B6EA 4RD4A 1TU3A 2QGZA 4TLEA 1QVAA 4HB4A 4D4MA 2J9RA 1E9AA 4QBIA 4BFXA 1RRFA 4N1AA 2RCNA 2G0TA 2DCUA 3IIKA 3RS4A 3UMFA 4EPXA 1NF3A 4QJ3A 2Z0MA 1YZTA 1N5IA 4MGIR 2MMCA 2BDTA 4TYPA 2QE7D 1JI0A 4OHZA 5CDFE 1OLOA 1ZVQA 1CR4A 4DLVA 2QAJA 1JXMA 2WM9B 2QTVB 3HU1A 1D2EA 3U7EB 3T1TA 4PHFA 4TN1A 4F38A 3SEAA 2GEUA 2H7VA 4C0KA 1SVIA 4LBYA 3RS7A 4EDHA 1MV5A 4URYR 2BWJA 4O2LA 2O5VA 3T12A 2KB0A 4C0SA 1T3SA 5JSZA 2JLZA 1OIVA 3MWKA 1DAGA 1OKKA 2FWRA 1R0YA 3NH9A 2H18A 1HQCA 4LBVA 1FL9A 5FR1A 3K0SA 3KUDA 2CNWD 3JVUA 3OEED 3W6NA 5EE1A 1AS3A 2ODBA 4IXNA 4V0LA 2YOGA 5CIWA 3O47A 2ZRAA 1ZD9A 1HY3A 4W5JA 4XIGS 1XP8A 2YINC 2WAYA 2CDNA 1XD2B 3CH5A 1FTSA 2BHRA 1W47A 2WWYA 1M34E 1X8LA 2QAGA 4QJ5A 4TZ0A 2AXPA 2G88A 3U3JA 1D9ZA 4PHHA 3PEYA 1EESA 4Q02A 3CO5A 1L4UA 2Y8EA 3UIEA 2QY9A 4NYJR 4A0HA 1UF9A 2VEDA 1R2QA 3FMFA 4X8LA 3QPVA 3AQ4A 5HTKA 3BIFA 5B57C 1GVNB 1G3MA 1MO5A 2WIBA 4PPQA 4KJZA 3RANA 1XTRA 1ODFA 1VCOA 3K53A 3BAFA 2BBWA 2XNSA 1ZINA 4DDVA 4ESVA 1OH6A 4M9SA 1RFLA 4RSGA 1UDWA 3W3ZB 4BFYA 2XNDA 3MMPA 4URZR 1IXSB 2XSZA 4BLQA 4BE7B 4DUGA 1D9XA 1E96A 3BC1A 1YQTA 2FNAA 2Q6TA 5FPYA 2PMKA 4DT1B 4MKFA 1P2SA 5TDHA 4LYJA 1TPZA 3HP1A 1TUEA 3ND9A 1NBMD 2GESA 4HLQB 4A8JA 2F1IA 3K0AA 4HUQB 2CLCX 3LBNA 5AWFC 1KK2A 4A1FA 4HAWA 2PJZA 4S35A 1A2KC 3EW9A 1D2MA 2FSFA 1P6XA 2J0SA 3ND8A 4Q7KA 5BN4A 3NWJA 3RWMB 4XSGA 2ZUBA 1ESNA 4BFZA 4ZI3A 1FQKA 4G0NA 1OXUA 4Q4AA 3GLFE 3FWYA 1KNXA 4XWAA 1SXJE 3ZIAA 1DO0A 2HXSA 1IONA 4MYCA 4FMDF 1K5GA 1NJFA 1FX0B 1T8TA 2HYDA 4OQNA 3V4RA 2ZI5A 1QG4A 4PC7A 5KUTA 2V1XA 3BORA 4KBGA 2A5DA 2Q3MA 1VCMA 3QKUA 1OW3B 2FJUA 4AY2A 3WY9A 3IEUA 5EUQB 1UKZA 1FNNA 3K0CC 2XGJA 3LX8A 2ZJ8A 3ZGXA 2J0UA 3B1VA 2WMOB 3RRYA 4BASA 2WOJA 4S2EA 4A0FA 3MWJA 5KSZA 5IDVA 2AXNA 4E07A 1VKJA 4MA4A 4WOPA 1E79A 2NO6A 2IYWA 1NN0A 3WRYC 4D4JA 4A8JC 1HT1E 3BE4A 1AS0A 4QBGB 4B6EA 1SULA 1N5LA 2LKDA 3VX3A 3SBEA 3K9LA 1CP2A 1VYTA 4A36A 3ADCA 2GEVA 5TB5A 3KDSE 1L7VC 2GVDC 3HU3A 3QPWA 1R8SA 1P73A 2OHFA 4HDCA 1GRNA 2BJVA 1P5ZB 1BMFA 1UKVY 2IXEA 3N2EA 2BKEA 3X2SA 4EQ6B 3KXLA 2QSYA 3WNCA 3H86A 1XXHE 2G83A 4ZO4A 1H65A 1XX6A 2OFWA 1Z2AA 4MRPA 3GLIB 1XMJA 2IHYA 3FTQA 5CB6A 5F98A 1KDTA 3CRMA 1P9NA 2R2AA 2ZRFA 1DADA 2G1JA 2RGBA 2WICA 2ZVQX 3T1QA 2ASEA 1AQUA 2FPLA 2ZR9A 3CM0A 4UNRA 1IN6A 1S8FA 4G5QA 3EIQA 3GFTA 4C7OA 1II0A 3H2YA 4FN5A 3IUYA 4NBSA 1CJKC 1IQPA 2DFNA 2QN6A 4PXAA 5JWRA 3UWOA 3SOPA 2VP2A 2PX0A 3D3QA 4DB4A 1QHXA 3TUZC 4TMZA 3SJZA 3FB4A 3TR5A 4KV9A 3RABA 4TT3D 4ASUD 4C0LA 1XEFA 2W6ID 2ZTSA 4QFMA 4TYNA 5HR5A 1HH4A 2R6AA 2IWHA 4HI0E 4LYHA 4ABYA 4HLUC 5BYKA 1Z29A 2F9MA 4ACBA 3QXCA 1KMQA 1G3RA 3A1TA 4M1YA 1SHZA 4NCNA 1CULC 3VNVA 5FUYA 1JEDA 2TMKA 4BPBA 1G5TA 4GP6A 1XPRA 4XOIA 2C9OA 2KE5A 3BFKA 4NHOA 5SZHB 2BKUA 1KHTA 2Q9AA 2VHCA 3NDBB 1EFTA 2WPDA 1N0UA 2D3WA 4WBSA 2IYXA 5JECA 1F2TB 1GFIA 4GP7A 3AVTA 4BLRA 1E2HA 3MCAA 5JHHB 3VR6A 3U44A 4MKGA 5FOWA 1XCPA 2WJJA 1KI1A 2G0NA 2OESA 3C4JA 3GLGE 1Z0DA 3GPLA 4L4UA 1DE0A 4U7DA 2W2TA 1QHHA 5FUVA 1XBTA 3DPUA 1WRBA 2GZDA 3CNOA 2FGKA 2ZRPA 5L3SB 4DIEA 3GLIE 5EP3A 2WWWA 2REXB 2R62A 3A1SA 5J4HA 2IXGA 5CLLA 1M1YE 1BS1A 1KO5A 1W5TA 5DISB 2RH5A 1IHUA 1AZSC 3SQWA 1CRQA 2R6DA 5GJBA 3MRSA 1YR8A 2G9NA 5IRCD 2R6CA 5FR2A 2J87A 3EWSA 5E7IA 4H9GA 3QVVA 4BRUA 1ELOA 3AP3A 3BD9A 3Q9LA 1TX4B 4FCVA 4G3XA 2ZETA 1GP2A 1Z6YA 1Z6TA 4LC1A 4TMWA 3SI7A 1Q3TA 3QY0A 4Q9IA 2JATA 2GF9A 4UNPA 4EPWA 3ASZA 2OT3B 1IY1A 1T4GA 2ZS8A 1XNJA 2FFQA 4NP6A 2Z4SA 1M7BA 5FUWA 4US1R 4D0LB 3C5CA 4NKRA 3RS0A 1KO4A 2ZITA 4XH9B 1CU1A 2IUUA 3WYGA 1KSGA 2GF0A 2E9SA 1E69A 3AGPA 4AG5A 1CRPA 4B2IA 2O8DB 4A0RA 3LY5A 2F7SA 1GL9B 4TLBA 3BFXA 2GBLC 4CEIA 2YOHA 1XWIA 1OHHD 3EAQA 3W6OA 3UKDA 1LS1A 5G53C 2V6JA 5HE9A 2JLXA 4RD3A 4KFTA 1JR3E 3B78A 3LV8A 4IOJA 4IDNA 3EARA 2AX4A 2VP0A 1ZM4A 2VQSA 2XSZD 4C0AC 3LDAA 1O3YA 3VMFA 4AK9A 1P2UA 5GJCA 3ZDQA 3K09A 4MKIA 1G3QA 5LD2C 5TXGA 2QPOA 2ZE7A 4IFBA 5JJIA 4Z54A 4ZCIA 1KJZA 2ZJAA 3DEFA 3SBDA 5JCZA 1E0JA 5HZKA 1KMHB 2LWIA 2CJWB 2PZEA 2OFOA 1DOAA 2ZU6A 3LQRA 4QGHA 4X8HA 2ANCA 4PO1A 4TTPA 2GRJA 1DAKA 2GJSA 3QPUA 3M4YA 2XAUA 4I1UA 3SHFA 2W6JD 4QG7A 5KSOA 5AUOB 1FUKA 5E4FA 1YZNA 2YNMA 4QGFA 1XCGB 4LSGA 1RYHA 1KI9A 4XVQA 1RW4A 1Z63A 4E09A 1F2UB 3ICEA 1CR2A 4MYHA 2BM1A 1CS4C 2O8EA 2OFXA 3VHXA 1U8AA 2AL7A 5AJVB 1Z2CA 1FUUA 4N0DA 1LW7A 4YMUA 1FZQA 3TNFA 3AEZA 3AVOA 2GJ8A 4EQ6A 1NVWQ 1MRSA 2G3YA 4HAYA 3KQKA 4JLNA 3KFVA 3P32A 4AKEA 4BLTA 5BWMA 1WBBA 1U0HC 4PZZA 1T9HA 4DB2A 2QPAA 3PUXA 3LD9A 4Z8XA 2HV8A 2YHSA 4ZV4A 2JLWA 1WA5A 1Z3IX 2I4IA 5KU1A 1KKMA 4DXAA 4M1WA 1XEWY 2IC5A 3THYA 4IOMA 4URUR 1UPTA 3QI2A 3B9PA 1DVRA 2PCLA 4LBZA 1WF3A 3ZYCA 4LHWA 2BVNA 2A5JA 2OBMA 3ZLJA 4TL7A 4RZ3A 5KO2A 3KQNA 5EE9A 2C95A 3R8CA 4LHZA 3I62A 2WWFA 4JS0A 3B9QA 4CDGA 1IXRC 4UXHA 5K8TA 5KNBA 1FMLA 2HXYA 2V54A 2GNOA 2CVHA 4KFUA 5EXXA 2HDNB 1RJ9B 1MABA 3OFNA 1ZUIA 1R5NA 1YR6A 5HZHA 1EWRA 1L4YA 1KSJA 1ZIOA 2IF2A 2CBZA 2W2VA 1KNQA 1ZIPA 2RGNA 1GNPA 1ZNZA 3PENA 4IDQA 3B7GA 4YXWA 1S96A 2BBSA 4R98A 2Q21A 4ERNA 4JL6A 2DFLA 4D0GA 1U8YA 3PUYA 5CIQA 2I1VB 3BFVA 2I3BA 1R5BA 1EGAA 4PAOA 4ZPXA 4HUQA 4TMXA 2QM8A 1E2EA 4HDOB 4KYUA 3AVPA 2ZRIA 5DH9A 1IM2A 3NH6A 4YMWA 3DZ8A 4OK5A 4TLDA 1E2LA 3U7HB 1F6BA 3IPXA 1GNQA 2O0HA 1TEXA 2CLSA 4BWYA 2H92A 3P26A 4L5BA 4ZIRB 2ZAMA 4CF7A 1OXXK 2ZI3A 3B8HA 1JB1A 4Q47A 4LJYA 4LJ4A 3SR0A 3QF7A 1EFUA 2ZANA 3NTUA 4Q4AB 4RZUA 4DC9A 1W5SA 1ZUHA 5KSPA 4R71A 1JPJA 4AKGA 3PG5A 2Q3FA 2V8OA 4RKFA 3ZQ6A 3EZ6A 2AK2A 2EFHB 2KBFA 2X2EA 1G19A 1VDZA 1C9KA 4YDSA 2B7CA 4Q1CA 2ZRCA 4M1KA 3KFXA 1GDDA 1UAAA 4TZ6A 3RYTC 1II9A 1N0WA 2J41A 3LFUA 3NBZC 3MGCA 1ZNYA 4MYUA 4CEHB 4RFVA 1XTIA 1Z0FA 4M0LA 1TNDA 3Q5DA 2EQBA 3X1YA 2ZAOA 3PIRA 2OE2A 1ZD8A 3NHBA 1KY2A 4YQFA 3N5CA 4U00A 4RD1A 3FMOB 1NG1A 1OYWA 2NIPA 1G8HA 1TUIA 5FTJA 4IKEA 1NVXQ 1RRPA 3QKSA 1CIPA 1XFAA 2FFAA 5JI2E 4DVGA 1TMKA 1G291 1GM5A 3T1VA 3T5GA 3QKRA 3AKEA 3MLEA 2P6UA 2KI5A 1AKEA 4GSYA 3AVXA 3KXIA 1SVMA 1E2FA 4I4LA 2WTUA 4B44A 1S2MA 4ARZB 3ADDA 3NG1A 1R4AA 3X1XA 2IS2A 1YZLA 4P4SA 5TV2A 3PV0A 1PUJA 4RCYA 4ZKEA 3FE2A 3IKJA 1WCV1 2A7QA 1S3SA 4TTRA 3A58B 4C0BA 1YJ5A 2VRWA 5FPTA 4CW7A 5DGXA 5CM8B 4Q7JB 2VBCA 3U61B 1WDTA 4YMSA 4IDHA 1E2JA 1VHTA 2JDID 3GJ3A 3PCRB 4KLNA 2NO0A 1QHGA 1EK0A 4LK2A 4V03A 2OILA 4QHTA 2H57A 3SDZA 4A2PA 4KI0A 4F4JA 3ZVNA 1E32A 4UJ3A 4R2HA 2G6BA 5FL7D 4KAXA 3THWA 1VG1A 4Q4HB 3IEVA 5K8LA 1T8UA 1RRCA 3AVWA 2NZ8A 4IEIA 3KQHA 4AI6A 1G6OA 2ZROA 5DSZA 4LCBA 4M9XA 1BO6A 2ORWA 5JSZB 2B7BA 3PITA 4DDWA 4UXIA 4M1MA 2QI9C 3W34A 4DEXA 2B92A 3Q8XB 4URWR 4O0MA 1OIWA 2A5GA 2W6IA 4DLYA 2EYUA 3TKLA 1OB5A 2QL6A 5JZVA 2QMOA 3AM1A 1SVOA 4BZPA 1AIPA 2JJ2D 2PZFA 1U8ZA 3FYHA 4JJKA 2B21A 2FZLA 3KQLA 2YJTD 1ZW6A 2CCGA 3AKCA 3AVQA 3SE0A 2BV3A 4V0ME 3UXMA 2F3RA 3LBHA 4G5OA 5HCNA 1E9EA 1QHYA 2A30A 3CONA 1T0JB 4HLCA 5FUXA 2JLVA 1A4RA 2OG2A 4LV6A 1EX6A 2NQ2C 1E9DA 2F43B 3UMRA 2OBLA 1G7SA 2ZJ2A 4WXRA 5EQTA 1KI6A 1G8GA 1JXOA 3LW7A 4P0TA 3ZVLA 4KITB 4RD2A 4YMTA 1W4BA 1G7CA 4PC1A 1E1RD 1TQ4A 5EE3A 2R8RA 1W46A 2J7KA 3B5JA 1E4VA 3QG1A 1NVVR 1XTKA 3CNLA 2ZI9A 4II7A 3KKNA 4V0OA 4Z1MA 4MQBA 3AVYA 1KAOA 3FKSD 4BFTA 2ZSBA 1MR3F 5EXTA 2XEXA 4FI3C 2EFDB 3NC1C 3PEWA 3CNNA 4GRAA 1G4AE 2RHDA 3PUVA 3K0AB 4M21A 4LRWA 1ONBA 1RC8A 4GL2A 1N6NA 4FW9A 3FVQA 4AYXA 1TF2A 2ZJZA 1DAHA 1J8YF 3CUEF 4TQAA 3GEHA 3AP1A 1ZU5A 5KDDA 2VHUA 2ZR7A 4I99A 3NEJA 3KKMA 1EFRA 3A4MA 3I73A 4D26A 2IK8A 5L8VA 4UNNA 2YOFA 4Q4JB 3SQXA 2UZIR 5CYPA 3BERA 3GCGA 1EFCA 3K9HA 2DWQA 1S3GA 4I1OA 3Q72A 2OCPA 2W83A 3T35A 1NN1A 4JBWA 3GP8A 4A2QA 4PQYA 4HAUA 1ZCBA 2A5YB 3P4YA 3QVUA 1ZNWA 1Z22A 3RRZA 3RS5A 3GJXC 1E2QA 2QENA 4GMDA 3SJAA 3ZJYA 4PAMA 4JLAA 1MO6A 4FCTA 5B2ZA 1IJEA 3ZIAD 4CGZA 2V7QA 4YLGA 2C98A 2BCGY 2F9LA 4NYJQ 3WP1B 3M0EA 4WXPA 2VO1A 1YKSA 1Q57A 4A6XA 1ZRHA 2O8DA 1W0KD 3ZZTA 4JLPA 1XXHB 1TF5A 1YZUA 2ZYTX 2IW3A 2VA8A 3E70C 3EZ2A 2VHQA 4E03A 4JVLA 4PO9A 2RGDA 2CK3D 1H8ED 4LV8B 2YWGA 4MRRA 1WMSA 1G20E 4B47A 1E2GA 4LJ8A 3UPUA 3I4LA 2VP4A 2GK6A 3QBVA 5H68A 8OHMA 2C9CA 1ZM3A 3P27A 4AURA 5AR1A 421PA 1IN7A 4HB3A 4Q9KA 5AJWA 4PSKA 3C7KA 1W0JA 1OH8A 4KXFB 1NBME 2Z4RA 5DHFA 1UM8A 1G6HA 3W3AA 5J47A 4AKIA 1P2VA 4OI1A 1UFQA 4QC2A 3T06B 3GLFA 3T15A 1J8MF 5H70A 2CCJA 3TVDA 1SXJA 2ZSFA 3GLHB 1V43A 3BB3A 3C16C 2XTMA 4JYCA 5FL3A 4CVNA 1GRQA 3FFBA 1IN5A 2V1UA 3PXGA 3EZ9A 1U0LA 2RGGA 4ARZA 5K8IA 2GKSA 1U90A 4LUCA 4BLOA 3E2IA 1OFIA 1G17A 5FTKA 2MSDB 3R9IA 4NZYA 2JLQA 3NC0C 3Q7PA 4PANA 5AUPB 4HZUA 1KTVA 2VSFA 4PC3A 2O8EB 1WP9A 4JIMA 3H4MA 3HPRA 3BXZA 1FPMA 3QEOA 3KB1A 1OYYA 2QT1A 5JS8A 3DOFA 5AK0A 4D0NA 2CNWA 1KYIA 2HUPA 1P2TA 3OEEA 3RAPR 4DWJA 4EPTA 3H0KA 5LB2A 2QAGC 1U9IC 1MH1A 2W0MA 1DAFA 4X8MA 1OFTA 2QBYB 4QM6A 5FPSA 3I61A 4Q19A 5KPDA 1IY2A 1K5DA 2QTHA 4C4PA 3DHWC 3CR7A 1P62B 1IJFA 1X1RA 4E5UA 3TSWA 4O25A 5JFGA 5FBQB 2ZVPX 4RVCA 1P75A 1QHIA 4POAA 4DSTA 1E2IA 4IOKA 3V9PA 4DHEA 3THYB 5D3MB 5C2JB 1US8A 5J5CA 1S4QA 2CL7X 2IA5A 1E0SA 2NO7A 2QE7A 3O8CA 2XOKA 2JLYA 3SU8A 3CIOA 1OFUX 4HSEA 1E0AA 4Q03A 3TR0A 4B2PA 4F91B 1N5JA 5FTNA 3J81k 2CHVA 2O0JA 3FKQA 3ZZUA 4DLXA 521PA 1W2GA 2FPKA 5A5GA 1R0WA 4ITRC 5G40A 2NOAA 3SFVA 3TMKA 3BK7A 3DM9B 4Z1MD 1SKYE 1T91A 2AWOA 1W4CA 1XCMA 2F6RA 4C3ZA 2C99A 2P0EA 4GOKA 4BECA 1GKIA 1Z83A 1NVUQ 2BMDA 2DYKA 1UEIA 4IVQA 1V5WA 4AG6A 2Z83A 3RSOA 1Y63A 4ZCMA 2VP5A 2O52A 2FFHA 3GMTA 3A4NA 2NPIA 2R6FA 3BB1A 5JI3E 1ETUA 2BBTA 3UATA 3EPKA 1TADA 5KPJA 1LNZA 2EU8A 5EZ5A 2PZGA 4M22A 1XZPA 1XEXA 1VYVA 3OEHD 1NLYA 1UBFA 4TLAA 3R20A 3KKPA 4PPNA 4M4SA 3SHWA 3R7WA 3UWKA 1QRAA 4WZBE 2QORA 4W5WA 2FZ4A 2HT1A 3A36A 3O8BA 1GTVA 4R9UC 1JR3D 4KSCA 4EJSC 3BH0A 3SYNA 2ZJOA 3MJRA 2PEZA 2HEIA 3D8BA 1XD8A 4A6PA 1ZMXA 3RVBA 3CR8A 4URXR 1VMAA 5FL7A 4B3GA 2C5LA 1E9SA 2AD5A 3LVQE 1EWQA 3KX2A 4CT5A 1T6NA 4MKHA 3IPYA 4JKIA 2CXXA 2JJ1D 3MUFA 3MWLA 4HLUA 3SN6A 4OJQA 3HR7A 1M74A 3UG7A 1I2DA 3L82B 2EVWX 3G82C 2FGJA 2RKOA 4DLSA 3DO6A 2ZXUA 3CPJB 1CLUA 3TUJC 3WMEA 1P9RA 3OIYA 2FN4A 4TYWA 3L0IB 1JQJC 3L43A 4LJ5A 2IUSA 4BZQA 4M2LA 4W7SA 5SZIA 3C14C 5FBLB 1S0UA 4DCNA 2DPXA 3H84A 2JASA 4LHYA 1OH5A 2KWIA 3R8FA 3VR1A 4LJ6A 4BRWA 3L8ZA 621PA 1KZ7B 2CE2X 1G5PA 1AA9A 4FMDB 3UK6A 2IEZA 2ODWA 3AVUA 1YR9A 4FWTA 3QQ5A 1S1MA 4KCGA 1SGWA 2BBOA 3WP0A 2XX3A 3ZH9B 2IYQA 1RZ3A 2J45A 2YWHA 1Z0AA 4WIAA 1KJWA 4RFSA 1R7RA 1W36C 3PEVA 3IQXA 2CLDX 2WSMA 4Q7MB 1COWD 1VHLA 1KGDA 1Q22A 4QHYA 1UKYA 4D6PA 4TYYA 1E3MA 2H1LA 3VKHA 4P4TA 3A37A 2IYYA 3O8DA 2HJVA 4Q48A 1N6PA 4NTZA 1G9XA 3KJEA 3CWZA 1U2RA 1LF5A 5DI9A 4ACAA 3THWB 3ECCA 4Q4HA 3IILA 4PSVA 5DLQC 2YVUA 1PZNA 3TRFA 1KI3A 3VAAA 4B33A 1NMYA 1VIYA 2QRNA 5L3VA 1KI4A 1X86B 1NP6A 1CJMA 1GITA 2QAGB 1JECA 4BFWA 3IBYA 4OHXA 3UANA 1NMZA 2EW1A 1R5OA 2EFGA 1W4AA 1NMXA 3FHTA 3TUIC 4JLMA 1E1QA 1JR3A 4OQLA 3HDTA 3LWNA 3B1YA 4ASUA 4WZAE 1Y3AA 1J70A 4P4UA 4JLOA 2IS4A 5BYJA 1BIFA 1K6MA 2ORVA 3I92A 4GZLA 4B35A 4B34A 1I4LD 3AF3A 4KSBA 4DRZA 3HWSA 3S1AB 1OXSC 4M9QA 3RSLA 4WAUA 5KOYA 3D6TB 3U6BA 2R9VA 2ZPTX 3TQFA 1XRJA 4XWOA 5DI3B 1GAJA 1N2CE 3TSZA 3JZMA 2GXQA 2XNDD 3EX7C 1P9WA 3BJIC 4YXWD 1G1MA 4JLDA 3PVSA 3W8NA 4CYMA 4IEEA 2GJKA 3AKDA 3HYRA 1G18A 4Z51A 4QOSA 1IN8A 3JVVA 4Q4LA 3D7MA 1I4DD 1NLZA 3IGFA 1PLLA 2C03A 2ZRHA 2GZHA 1R0XA 5B64A 1FP6A 4KODA 2VIIA 1Z28A 2WVJA 1OPXA 5D3MA 5J4KA 2OCBA 4H1UA 2C78A 3IIMA 4TL6A 1DS6A 4PC6A 1AM4D 3ZQJA 4DZZA 4FD2A 4G01B 2CMKA 1SVSA 3ZVRA 2ZYVX 3NKVA 2L0XA 5JBQA 3W9YA 5FI1B 4PFSA 5JS7A 1E9CA 2IS6A 1NN5A 1VYUA 2WSSA 2ZS9A 3VX4A 3U6KA 1OKKD 5F3WB 4L9SA 4ZIRA 3L0OA 4V02A 1L8QA 2Q9CA 3CPHA 3R9WA 2EYQA 2P5SA 1E4YA 4IVPA 1D5CA 1ZU4A 2OCYC 4Q4JA 2H8KA 1DEKA 4G5RA 2PLRA 2DB3A 2IUTA 2GJAA 2OXRA 3MJHA 3KTAA 4OK3A 1S1CA 1W4RA 2Q3HA 1IAQA 4PX9A 2HCJB 3EPLA 2CHGA 4LJ9A 1GIAA 4FWIB 4ZDKA 2ZYUX 1CJTC 4IDOA 3SJBA 1TQ6A 2AD1A 2R44A 2WWHA 3B60A 2D2EA 1XJQA 3TH5A 2WBLC 4RJLA 2J3EA 4Q21A 5EXPA 5DN6D 1OE0A 3BS4A 4LBWA 2ATVA 1N25A 2ZI6A 1KZGB 4W5HA 2V55B 3QKTA 2H5EA 1P72A 2WJYA 2W6JA 4Q5IA 5FTMA 1PV4A 2QU8A 4YONB 3CRW1 4GMXA 4FIDA 2PT7A 2WZQA 1SZPA 2ZEJA 3EPHA 3U5ZB 1JALA 1QBKC 2N1BA 5FBRB 1OB2A 1NIJA 4BFVA 4DLWA 3DKPA 2ZQ5A 1JBKA 1VPLA 4PHGA 2FF7A 2O8BB 3L8YA 5J4LA 2Q9BA 1J90A 1OFHA 3ADKA 4TMKA 1FW6A 1ZM9A 1KO7A 3TE6A 4C0JA 2QM7A 1W0JD 3FMPB 4PC2A 1U9IA 4KO8A 1OXVA 4JT4A 5H8WA 2J59A 2XZOA 4M8NE 3P20A 1KDPA 1W36B 2R6GA 4B71A 5KNCA 1QVRA 4C9BA 4DKXA 2JCSA 4GNKA 1GG2A 3X1ZA 3QIAA 4DLRA 1XMSA 1SXJB 3GLHA 4JBYA 3GFPA 5CJPA 4LPKA 4LJAA 1XEWX 2WV9A 4PPGA 3WRXC 2QQ0A 4AYTA 2BMFA 3ETLA 2GAOA 1XB2A 3DM5A 3GJ4A 3DOEA 3OIUA 2GBLA 5SZKB 4Z8YA 2IYTA 4LYAA 1EG7A 5G3ZA 3QF4B 4JLVA 2IX3A 4QL3A 4EUNA 2GJ9A 4I81A 1LF0A 3F8TA 4H1VA 4JMPA 2C8VA 2BJWA 2IT1A 2GHIA 4C2TA 3CZPA 5SZJA 1UJ2A 5JRZA 1S9HA 2OXCA 2BIFA 2RB4A 1HV8A 1SVWA 1U98A 4GPTA 3ZZ0A 1DELA 1JJ7A 4D4KA 2XITA 3TK1A 3ZD7A 1QDEA 1F2TA 2QMHA 2ANBA 1RVDA 4XSHA 4UQOA 5BN3A 1X8JA 2ZI4A 3U44B 5FOVA 2WJHA 1DARA 3I5XA 4KBFA 1YZKA 5BQ5A 1OH7A 1DPFA 1Q44A 2D62A 4NE2A 1JEEA 1TEVA 3GJ6A 4LGMA 3OAAA 1KK0A 4HB2A 1Z5ZA 1VCIA 1RRGA 1Q20A 3IHWA 3CWQA 1CJUC 4MRSA 2OCAA 3AF0A 1KI6B 4IHQA 4NCHA 2DHRA 2ZRLA 5KDLA 1SKQA 1J99A 1ZC3A 4R7ZA 5J4YA 2BM0A 5KDOA 2W58A 3ASYA 1D2NA 2WSSD 3T61A 4FINA 4QNRA 1XD2A 1BYUA 2CE7A 3HPQA 3MFYA 1F5NA 2F1HA 4BGDA 3AGQA 2FV8A 3GJ0A 3KKOA 5FI0B 3TBKA 3VR4A 3FKSA 3B1WA 5DE3A 1WQ1R 4EAQA 4ZDWA 1PJRA 1GSIA 1M8PA 1DBSA 2ZU0C 3OE7D 2FFBA 5DI3A 2A2ZA 6Q21A 3LQQA 4EJSA 1QHNA 4DCUA 2WPDD 3ONWA 2BEKA 1O87A 2YC4C 3KJGA 2VP9A 1OXTA 2G1KA 2PJRA 1X8KA 4Q1AA 3ZS9A 4OQFA 4K46A 2N42A 1MRNA 4X8OA 2GETA 2OEPA 3I3SR 4NU0A 4UNSA 1D6JA 4Q66C 3FHCB 2ZJ5A 4TT3A 2ZJYA 4B3DA 5IK2A 2JLRA 4V0MA 2FH5B 2B8WA 4NYIQ 3K70D 5JCPA 4HAZA 2JJ8A 2YYZA 2D2FA 4KLZA 1CEEA 1KSFX 2FMXA 4OI4A 5FOXA 5IK2D 2QUZA 4KFRA 5EJEA 3B82A 4JJZA 3LLUA 4I1VA 1GZSA 4RY2A 2RGCA 1ESMA 1Z6XA 4G5SA 4LDJA 4JVSB 2ONJA 3HR8A 4XVRA 4K81B 4MH0R 1XDBA 2CVFA 2IHBA 4NDZA 3CRRA 3RS3A 3U3OA 3WYFA 3OIVA 3UG6A 1IXZA 4MUAA 3KTAB 1E9RA 2C04A 2CHQA 4UKDA 2YV5A 4DDUA 5L3QA 2QA5A 3VQTA 4ESHA 3MAAC 4GOXA 4KHZA 2GVZC 2WJGA 1KO8A 3I72A 5J40A 4YMVA 3HYTA 3NDPA 1FOEB 1COWA 1HTWA 4V0NA 2XZPA 4P3YA 1N6LA 3WHLA 1A5TA 1RYFA 3GQBA 2HT6A 1NIPA 5FOSA 2EWWA 2A78A 4FMBB 4LHVA 4QGAA 3N2IA 3QXSA 4XTCS 1DAEA 4BFSA 1HE1C 2XZLA 3DKVA 5FOTA 5C4MA 1AGPA 3W6PA 1LV7A 2VL7A 4O3MA 4OYHA 5KYKA 4YDHB 3VR5A 1PUIA 3LBIA 4NYMR 3GLGB 2V3CC 3FFAA 4BLPA 4JT2A 3QXHA 1QF9A 5GJWC 3VU9B 4LI0A 5C1BA 4NCIA 3R9XA 2WMNB 2OLKA 1NSFA 4I1SA 4JYBA 5AUNB 1UKEA 5CK4A 4ZDIA 2DWOA 1PVOA 1P4SA 3MSXA 3EIHA 2OSBA 1N6KA 4HAXA 1LS6A 3CZQA 4OBEA 2A3RA 2JJ1A 3EA5A 1SQ5A 1LY1A 1F3OA 3WMGA 4BZXA 2IYLD 4US2R 1WE2A 3PFIA 2AN9A 4HZIA 4US0R 2H17A 5TY0A 4P32A 1XJ0A 3VKWA 3Q5EA 4MYTA 1MO3A 2GAAA 4LV5B 4C7OB 1KK3A 3GEIA 3AB3A 2RGEA 1OV4A 2ZRGA 1RJ9A 4HYYA 2X2FA 3K0EA 1GKUB 2UVQA 1A2BA 1E98A 3CH4B 3G0HA 4EFLA 2X1VA 4CEJB 5DYGA 5HE8A 1KAGA 3BH7A 3HU2A 1NBMA 4QXAA 1N6HA 1NL3A 2P65A 3FHOA 4RD0A 2ZR0A 5EUMA 3H1TA 1XTJA 2AK3A 5FBVB 2AFIE 4OI2A 1J7KA 1KI8A 4RZXA 5BW8A 4QKQA 1Q1QA 4HATA 2D74A 4JVMA 5FPHA 1E2PA 5LD2B 4UJ5A 1E9BA 2IYVA 2I1QA 3WBKA 2O8CB 5EP4A 5H1YA 3LXXA 2WHXA 1H8HD 1RE0A 2CK3A 1W7AA 4AD8A 2ERYA 5LDDC 1N6OA 1LFDB 1IBRA 4OL0A 1PLKA 1LB1B 3OFND 2QSZA 4LC0A 1NN3A 3DMNA 3GJ5A 5BN5A 3CBQA 4N0EA 1YRAA 1NKSA 4Q18A 1G3UA 3QEJA 4A9AA 3I32A 1PLJA 3AF4A 3L0PA 3TW4A 1KO1A 1F48A 5LB4A 2ZJBA 4HDQB 4QBHA 4Q1FA 1NY5A 1UBCA 5K8UA 1B0UA 1P7CA 3CKLA 1E2KA 4AC9A 5JEEA 4L16A 1NSTA 3WYAA 1CR1A 1R8QA 3IIJA 5DN6A 1HUQA 1DAMA 4IXMA 3VKGA 4CEHA 5E95A 2GCPA 3CX6A 2N46A 3FOZA 2IBMA 1NY6A 4DSUA
chains in the Genus database with same CATH superfamily
4IXDA 3W04A 1AK1A 2X4IA 3B6JA 3EOBI 4C2UA 4DY6A 1KDZA 5BYBA 4UNQA 4JC8A 1SBZA 3DNPA 1UEJA 5E2AA 3WLRA 5DIFA 3FF1A 5B1HA 2G72A 3GJ8A 3GLTA 1J07A 1KJ9A 4AUKA 4MW0A 3EVDA 5PGMA 1II8A 1G7TA 4PHCA 3DT9A 3O8LA 4JITA 3SHVA 2ZZMA 3KR0A 1WZCA 3JQ9C 3P2EA 4NBUA 3IAM6 3NJ4A 4WQMA 4IGKA 4KXNA 5JVDB 4E22A 1MMFB 3R5XA 4IV5A 4L95C 1GL7A 2AFHE 2A59A 1MG0A 2AT1A 1MJGA 4N0QA 1E66A 2PX3A 1Q7CA 3V00A 3LW8A 4FCWA 5AKYA 3AI2A 3W7VA 3AKYA 4QUEA 1KYYA 1S4MA 1P9OA 4RY8A 3FLMA 4H7EA 3LP6A 4JUCA 1M8KA 3G17A 3I8SA 5D3KA 3JCZA 2WJZB 3O4JA 3H8SA 3QELB 4PLVA 3MAGA 4JQYA 4MUIA 3Q8WA 2VC2B 3CF4A 4GDFA 2B9VA 2DWPA 3IPCA 1F8UA 1NWHA 3CB4A 3S0JA 1SN7A 1OZFA 1VTKA 2EX1A 4DCVA 2LBPA 2R5WA 2W00A 5JR3A 2ZSEA 4A3SA 1Y1SA 4A26A 1SXJD 2X40A 1ODCA 3VAZA 1KDRA 3LVFO 1OD6A 4AJPA 5LP6B 1QOZA 4MDFA 2AE2A 3DCIA 1YRQA 2FOLA 3NAGA 1REQA 1WY7A 1L4KA 2OOKA 3MWEA 1BMDA 2JANA 2OGUA 1Y89A 3ZE2B 4JUAA 2YWFA 2NNLD 2FSIA 2RHMA 1GLGA 1TVEA 3NEAA 2WSLA 1LI5A 4U4AA 4UREA 1QYVA 2WMYA 1SCJA 5JANA 1DP4A 1RBYA 2GEDA 2SNIE 2X5KO 2BEUB 2FA9A 2XIQA 5H83A 3SP1A 4Q1EA 2GLTA 3WDLA 1JJBA 4BFUA 4F2WA 4RAQA 2H1OA 4MS3B 5CU7A 4KHPB 2NTEA 5LP1A 4MHOA 4ZANA 1NURA 1IPFA 2ZIGA 3JTMA 3L7MA 2PKQP 3PWKA 4UCWA 3MCZA 3ZNPA 1MDBA 4KXXA 4E6EA 4EY3A 2B8TA 3O91A 4F4CA 3REOA 3WWCA 1U5CA 1DDGA 2ZBDA 1T43A 1VSUA 4KTVE 1BD3A 4B83A 3K5PA 1Q5PA 4EF5A 2UZ3A 3RYHA 4EPVA 1K7YA 4LOAA 1L7EA 5I8ZA 2PUTA 1UADA 4OH7A 1WV1A 2CXSA 3KE8A 5C8YA 1X42A 3VR3A 4E08A 4PX5A 1NXTA 3WBJA 3ZTTA 5LWHA 2GILA 5AHOA 3N7UA 4V0KA 2OBNA 3BB4A 4B31A 3ESRA 1ZDMA 2YQ4A 3FRHA 2VNKA 1DFGA 2D0OB 3FUWA 4LS3A 1XXLA 3RAGA 3O0DA 4BMYA 2RFLA 2B6HA 3B3FA 3LUCA 1ORVA 3CEHA 2OK8A 4QTXA 3HJBA 1P0PA 3PXEA 1TTTA 2QJWA 3BILA 4G1CA 5CYOA 3W5JA 2JK1A 3QVXA 1QQBA 5AUQA 1XJCA 4IVRA 1R74A 1Z47A 2WKRA 4KFSA 3JY6A 5AM4A 5TGZA 5B6PA 5F9HA 2V7EA 4LF8B 1E64A 2LVBA 4FMPA 4JLSA 2VYFA 2HQRA 4HUTA 4DUPA 4OHBA 4TKMA 3BJRA 2QIPA 3H2GA 1WB6A 4WFQA 3SGLA 4OJKA 3C1OA 4EJ0A 4YY3B 1QNLA 5J1SB 4QVIA 1RLUA 2FG5A 1YMQA 1DG3A 3ZBTA 3F9RA 4BNHA 2Q1UA 1N4DA 1ULTA 2X76A 3LT4A 3TW0A 4JK3A 2B37A 4LE0A 5DPMA 1EU1A 3RIXA 3SZGA 1GZ3A 3K4HA 1Y5RA 2Y1LA 3VHLB 1RYDA 3LYUA 4YJKA 4C4XA 1Q1ZA 2CL0X 5LQRA 3AY7A 3HS3A 1IU9A 2IYNA 2LDBA 4BMXA 3N28A 4IHJB 4QGGA 5DDIP 5CA1B 4CZ2A 2UXBB 1T3HA 1XNHA 3JQ9A 4GMGA 2OO7A 2QTFA 1H05A 3QU4A 4KQ2A 4X60A 3FFWA 2J1LA 2X77A 5DMHA 3D3WB 4AY5A 1P3Y1 4GI3A 3AZOA 1PDWA 3OU2A 2GDJA 2YMQA 3BHJA 4A4DA 4OHUA 4U7JA 3TJRA 1V1RB 1N6IA 3OTIA 4NMMA 4EJSB 1NHGA 1GRVA 1UOEA 1ECGA 2J9GA 3PD1A 4FZRA 3QVOA 8AT1A 2DPLA 2GCOB 1IH8A 1JL3A 5AOCA 5LBIA 2EOAA 1AHIA 1RXSA 1UBKS 2ASVA 2JIZA 2Q4TA 3FNIA 5ALJA 2X1HA 5AKGA 5LM3A 1U99A 1N3BA 2JA1A 5HJ2A 3TIVA 5F5NA 2VDWA 3CVUA 3O9VA 4S1TA 2FN7A 1L9KA 5EP1A 4NEGA 4G8BA 2AYZA 2HO4A 4KQ9A 3QOFA 3VPXA 3EPJA 2KJQA 2AOUA 5H3LA 1RT9A 4B9EA 3OHMA 4AN4A 2PUCA 1NUAA 4BO2A 1FA9A 1XZQA 1Q0UA 4OMFG 3GPCA 4GOJA 4CIAA 1QRTA 2E89A 2VT7A 3DZDA 4P5PA 4NJMB 2X0JA 2YWEA 3C3KA 5FTLA 2YKGA 3U60B 2V5UA 2D4AA 3S7ZA 2IDMA 4XQGA 3TEJA 1JHAA 4U7HA 1TQDA 1VL8A 4KK4A 2ZIEA 2D1YA 3ESBA 5DYYA 2D6FA 3A26A 3NHPA 5A6SA 4O33A 1B74A 1L3IA 1WXQA 2DHEA 1ABBA 1BWQA 4MPTA 1Y3FE 3R3XA 4XIIA 3ZU4A 2E82A 2JHCA 4PF1A 1U9JA 5A7FA 3VISA 1WB9A 1KH2A 1KMIY 3BDAA 4L8GA 4GI7A 2B82A 4ND7A 1W88B 3MRXA 4MW9A 3C5EA 2P6RA 4OY3A 3FDIA 4CQMD 4W6QA 1Y82A 3TSOA 2FPIB 2GEJA 3H1GA 2PY6A 3ESZA 2PQ6A 3F5SA 5DHAA 5BVGB 2BC9A 2D59A 4EECA 4QEKA 1KMCA 3SZRA 3WNBA 721PA 5L3QB 2RE8A 1ZWKA 1A50B 4G0MA 1S5PA 4F7WA 2DY1A 3C70A 1C7QA 3P9PA 4IQ8A 1OIXA 4KQCA 5K6TA 3G1TA 4IMIB 1JILA 4DQLA 1W581 2ZWAA 3TOXA 1VKHA 3UMGA 1KRXA 3UQZA 4AROA 3U39A 3O21A 2UUBB 1JTVA 1QIHA 3AQIA 2XTAA 3QEMA 3O4HA 3GQBB 5AKIA 5IMSA 1Y6FA 3ZUPA 2Q6IA 2R4QA 3R41A 3CLVA 3IUNA 5EMJA 4IW3B 5CR9A 4LY3A 2CB0A 4EMTA 2IL1A 4QNMA 2DUNA 1G21B 2B4RO 1F8GA 2P8JA 1XLVA 1X7YA 2PBFA 3DGFC 4KYIB 3BWYA 1K8YB 2C96A 2VLIA 1DSSG 2BDEA 2Z3VA 2F55A 3QJGA 3IO5A 2QZZA 1YR7A 3SFTA 2YXDA 1XTSA 4JXKA 4AMZA 4UD6A 4AU1A 1CIVA 4ZVSA 1E7WA 2EZ4A 4YLEA 5FCDA 5TPZA 3QWAA 1TKAA 4YRPA 1T6BY 4QODA 1U7WA 3NBQA 5FIUA 1W5AA 2HXGA 3CW9A 3L8MA 3DHNA 1ZS9A 3IDFA 4IZIA 5CB8A 4ND3A 1KIMA 1M6NA 3FBGA 5A4JA 3Q3JB 4JFRA 3R3YA 5LIPA 1YBHA 2QHXA 4PV7A 4DC0A 4KU4A 3ZD9A 4EL5A 3NWEA 1NSYA 1DRJA 4YMHA 3MRVA 1XMVA 2HF2A 2BGLA 3K6KA 4PBSA 1VJ1A 1MX9A 3D6MA 4F6CA 2VOJA 3V4FA 4RIGA 5AW1A 1QVWA 1ZI6A 2ZB3A 4IH4A 3SR4A 2QAIA 3CJRA 5TPWA 1E99A 3WK7A 1HDOA 1X7DA 3BWMA 1JAIA 3DMDA 4HX5A 4NONA 1Z8FA 4QUIA 1WOMA 3EXHC 1EDDA 2WEKA 3GWZA 1BFKA 3O1JC 3T5BA 9ATCA 1G64A 1U0NA 2QYSA 3AEKA 3CF2A 2WKPA 5B3LA 4MUKA 2IH2A 2UZ1B 3JQ7B 3TVYA 4GS5A 1J97A 3V3TA 1T15A 5HMMA 4WZBB 2GX6A 3EZGA 1U5AA 4L5AA 5HM6A 4DW8A 3HB0A 2ZRMA 1U7TA 3OWOA 4PZYA 2GDZA 3RYCA 3WYCA 3MINB 3A4LA 4D8WA 5EIXA 3ROQA 4K0KB 5DNUA 1BVHA 1XZ8A 5CGQB 4J76A 3PPXA 4Z4HA 3OF5A 2V9PA 3LCRA 2BZGA 1E5VA 3CLUC 4BQRA 3EPRA 3QSYA 1P4JA 2DR2A 1ISPA 1E6CA 3CVWA 3Q8KA 1Z08A 3P4XA 3T7TA 4IRUB 2OAP1 3DEYX 2PT5A 1PGNA 3KKQA 4CRWB 1GNRA 1MB4A 2DPGA 2HDOA 3U3XA 4BP9A 2BF7A 4C14A 3I5AA 1T1GA 4R7GA 3CW8X 3E7FA 1HE8B 1QGED 2AEMA 3NWPA 4ZAVA 4XEHA 1NKTA 3AUFA 4Q3LA 1C7IA 5FF9A 4OEHA 3RKUA 4ALNA 2XXAA 1CF4A 4Q00A 2ACWA 3SJCA 2I3ZA 4BLSA 1TA0A 1Y1LA 1R4MB 1H8EA 2F43A 2R25B 1K8RA 1W30A 1XDGA 1J2RA 3I09A 2WAXA 3O3OB 5FLKA 5BN5B 4BMNA 3T3NA 3LQFA 2ZTMA 4X54A 2IKQA 5F7JA 1QZTA 1W0KA 1ILEA 3TQCA 3CYFA 4F6RA 1R9GA 1NI4B 1ZMOA 1D0SA 1KK1A 3D31A 4NFYA 1O8BA 5KQRA 4PLWA 2YC2C 1G2IA 1JQAA 3Q2IA 1P3DA 2DBYA 2A5FA 2PBLA 2FSHA 2AJDA 2NTYC 4FCCA 2AQ8A 4PTZA 1L7PA 2E1PA 3JD3A 4C5CA 4MV0A 2G9VA 1H6DA 2XUIA 1DC4A 3QVTA 4O2RA 4B0OA 1OLUA 2VYCA 2WK1A 5CG2A 3BH6A 3HNRA 3LUKA 4JNKA 1JSRA 2PO7A 3Q85A 1E7YA 2DHCA 2E3JA 5B37A 3SIRA 2GNPA 1W9HA 4AM8A 3H4IA 1CD5A 1N8SA 3W5BA 3IEKA 1YCHA 2J08A 3VO8A 3SNHA 2Z6UA 1D0VA 2RH8A 3TW8B 2YV4A 4RKEA 4AIIA 1P1CA 2P67A 4WEOA 4B6GA 4F9GA 5A5EA 5CEEA 4RZSA 4UMFA 4N03A 3IAS6 3EF1A 2B9EA 1M83A 2COUA 2IVZA 3SK0A 3VKUA 2OCIA 4DNFA 3C24A 5EE5B 4BTEA 2EFCB 3A6LA 4G1FA 4O29A 1ULSA 1YFJA 2KSQA 1OBFO 4A15A 4CDNA 4DSOA 1E5XA 2JJMA 1H5QA 5K3EA 4K9DA 1BAPA 4C3OB 1KKUA 2HCTA 4DV3B 1JMKC 1N5DA 4FFDA 1X2EA 2WYHA 4M7OA 1GEGA 5DM70 1HL7A 4CEIB 4EGQA 2I2DA 3M3DA 3TAHA 1CJCA 1U0GA 1SEPA 3U7FB 2BFMA 4A0GA 2I65A 4D82A 2B1JA 5BSKA 2D0PB 2P2ZA 1CUUA 4RFSB 4GQIA 3SM3A 4TTJA 5K0EA 5LUAA 2JAQA 5KJFA 2EAUA 1ZKDA 1U2SA 3PQ6A 5G1OA 2RONA 1XTVA 1KRWA 3BWBA 4UEOA 1MEEA 2FSGA 3ZS8A 4RMNA 5JATA 1Q74A 1XKXA 3ABZA 2BFBB 1RQPA 5CUQA 2VTVA 3DF9A 1YB4A 1XMIA 2R1ZA 1NJGA 2X22A 1OT3A 1T25A 3K2EA 4GH5A 1Z0KA 2Y6VA 3C48A 4GMFA 5F9FA 1IVNA 1A5AB 2REBA 3LKDA 1AXGA 1G3IA 2YBEA 4O59O 3HCOA 2VF7A 5HIKA 3PX7A 1DAPA 4E2XA 5DOVA 2J4FA 1IM5A 3DV9A 3UHFA 3RHZA 5D01A 3GARA 3SJUA 1L4FA 4Z99A 3BTOA 1PIWA 4FFMA 4A2CA 3LO5A 4FQ8A 4KGVA 2A14A 4DLBA 5FWYA 1N8TA 1A7JA 2VDNB 3EXEB 3H6KA 3OIGA 1G1AA 3M49A 4P80A 3CRVA 4G9GA 3EISA 4QJ4A 5FJJA 5HBGA 4LMAA 4RXMA 5AW7A 5HIAA 1VSBA 2P4HX 5F78A 2OZKA 2NO9A 1YA6A 4B3XA 4IIUA 1VP3A 2OD9A 1EUQA 3M6XA 2IV2X 3H0EA 4FYJA 5ECGC 3WLQA 2QLMA 1N0HA 1DHTA 1TMYA 3LFTA 1NPDA 1QWSA 1YR1A 1N0IA 3EEFA 4OG2A 1T4BA 2VNHA 1ZK1A 1JQBA 2GO1A 5FB3A 4F3CA 4BYMA 2X0FA 1RXCA 1ZICA 3OU6A 3E05A 4OTZA 3LX5A 4EZIA 5LDGA 4TWJA 1P29A 3UFXA 1MC8A 3GBSA 3FPKA 3QX8A 3TJMA 3MG9A 4CI9A 5JJLA 1YUMA 2CF6A 4LRTB 1GKLA 4TWZA 1LBTA 1B2RA 1YXMA 3TJZA 1H66A 1MC1A 1CY7A 1GGHA 1ESEA 3MQ2A 5L53A 2ACKA 5JJKA 1ISIA 1RAHA 1OLXB 3RTGA 3ZQKA 3C87A 3PDIB 2PH1A 4XWGA 1FPQA 5F2EA 1BXRA 1ZCFA 3K05A 4PO8A 1AN0A 4MR9B 2Q8QA 1UPFA 2XE7A 2B1QA 1BJKA 3KBBA 3L0SA 1T1EA 3S28A 1EFVB 3STYA 3W5IA 2O8FB 3PUIA 3KS9A 5IC6A 2ADFA 3L7BA 5BN4B 1AV7A 3PHIA 2FEXA 3HMKA 4J1NA 4U6SA 2ECFA 3IEMA 2F3QA 1QJ4A 2CLKB 4FKZA 2Q5CA 4ARBA 2I8AA 1Z5VA 3CX8A 4KQJA 4BVGA 4I9HA 4ZRNA 4GYYA 4TMTA 4CV0A 3HACA 2OHGA 2B4KA 2J0VA 5KAMA 2GXSA 3PDJA 5P21A 3OAAD 5DGHA 1YZGA 2GUGA 5K05A 3VNRA 3OLVA 1DKQA 1A82A 4I3GA 2ACVA 2PQ0A 3HCFA 4U0JA 5ULLA 3S55A 2E48A 2F3UA 3AUUA 4HDRB 3WL6A 1ZP6A 1Z2EA 1EUCB 1DOZA 3ET4A 3AEYA 5JCOC 4CGYA 2R2GA 5TT0A 4I6JA 2JGMA 2NU8A 4JY7A 3HSYA 1S2LA 3AV0B 4HQ0A 1G8FA 5I7SA 1HFEL 2VPIA 4DJTA 1JR6A 2Z58A 2HJ9A 2YVLA 4DNPA 4DG5A 1GQ2A 4MR8A 4UHEA 1ZK0A 2CLLB 4GEKA 2JLSA 2AZMA 3O03A 4PQGA 4LJ7A 3BD6A 4B74A 3LC2O 3NHRA 3ORFA 4RA6A 4K87A 3JARA 1SOVA 2CD9A 1EJ2A 3UB2A 1KH3A 3BE5A 1WNFA 1HQYE 5AI0A 4EB6B 2VJMA 4CLDA 3HBJA 4EPRA 1KYXA 4ZA2A 2VDOB 3H5NA 2DULA 2OV6A 2Y27A 2JBWA 3ILYA 5IZ4A 3QTLA 4PZAA 4U1RA 4TYQA 5EXEA 8ADHA 3IO3A 1N77A 4UDXX 2ZBFA 5FV4A 3NOVA 5AJUA 1Y3CE 3V1YA 1A7KA 1IN4A 3FUCA 3C15C 2ATXA 2Y68A 4FOOA 5B1DA 1MO4A 1OV6A 5J2TB 2AFIA 3A6GA 3U81A 5K3OA 2YJNA 2C2KA 1GJRA 3IEIA 3TRHA 1SBNE 4RDIA 4M1TA 2ZRKA 4E31A 4F5YA 4UTOA 2ZTLA 1DO8A 3NEPX 1AZWA 4JSTA 5B6IA 2WWGA 3JS5A 2RHBA 2YUTA 4K9NA 4MNTA 4P7JA 2O3SA 7REQB 5K45A 4F2HA 2ZJ0A 1C1YA 5LA6A 1W36D 3RASA 3GRUA 4L85A 2QR3A 2QD3A 2V9CA 2WYOA 3HDYA 5EXSA 4FB5A 2C8JA 5K6AA 2W8BB 2WHYA 1JAHA 4OQ4A 2FX3A 3I6MA 4TRJA 5D3QA 5K4AA 2X0DA 4ZI2A 2ZE6A 4Q01A 4U9UA 5D00A 2I1LA 3DBLB 5DIZA 2WF8A 5THXA 5D85A 1CYEA 1DRKA 1WMAA 3WZMA 4MWTA 2WM8A 3G8BA 6AT1A 2RGWA 3QXXA 2E5LB 3AESA 4C5BA 1VJRA 2FU5C 1W59A 3MMNA 2FPPB 3TVTA 3DXYA 3RJTA 4BV8A 1L2TA 4HRXA 5AVZA 2HA3A 1TLTA 2PS0A 4W9MC 3A1WA 3NT2A 2VJAA 1ZBDA 5HCIA 1W44A 4DCTA 7AT1A 1N2EA 3U1VA 3OUUA 4DDMA 1HDCA 3EA0A 1XL0A 3JPYA 4RZ2A 5DM2A 1SUPA 4ALIA 1KAEA 5KNDA 1SXPA 1SOUA 4F92B 3PYMA 1JDUA 1TB4A 3K6RA 4L7QA 3ORSA 4RD4A 3ZHBA 5IJ9A 2UYHA 1QVAA 4NRDA 1BROA 3UJDA 3KHKA 1XE3A 1E9AA 4HAIA 5DBIA 4EHJA 4N1AA 4PG5A 1V5EA 2RCNA 3IIKA 3HEBA 4ZC8A 3RS4A 3N3AC 4ZVLA 3UMFA 3QE9Y 3FPGA 5ED4A 1I9GA 3FDZB 4EZBA 5DTEA 3WZ2A 1DJPA 2WINI 1YZTA 3ZWXA 4NJOA 4MGIR 4Q3AA 5BMOA 2BDTA 3W5VA 5JCXA 3A70A 3IA7A 5CDFE 1QKKA 1ZVQA 4I1PA 2YZGA 4LYYA 4YT2A 3LPDA 4BNDB 3T9BA 3AUJB 3GVCA 1SB8A 3HU1A 4M54A 1QIMA 2PD4A 3HBMA 2PFKA 5HA5A 3UUWA 3T1TA 2GEUA 2H7VA 4P35A 4MUMA 5C8VA 1PNVA 3EXG2 4CMEC 3AMVA 2UAGA 1NHWA 3MGKA 4WCFA 2XKAA 2XGMA 3HBLA 2O5VA 3CLSC 1QH1A 2FPXA 3NALA 4EW1A 1C7ZA 1T3SA 2ID7A 1Y5LA 1G0OA 2Y0BA 4IUCS 4ZZ2A 1OKKA 3BXEA 4C76A 1NX9A 4LBVA 2GRAA 1FL9A 4Z6KA 3DE5X 3LK6A 2CNWD 3A6DA 3RUEA 1VHJA 3A9CA 4WY2A 3OICA 5K1ZA 5K8JB 4N76A 4IXNA 4E5PA 1DDOA 2YOGA 3FR8A 2J3QA 3OHSX 1QDLB 2M6RA 2BP7A 2ZRAA 3TZLA 1DBRA 1K66A 1T4DA 1GV0A 1HY3A 4XIGS 2YINC 3KOMA 7MDHA 1WXIA 3ONNA 3VO1A 1MFPA 3OX3A 2QAGA 3JWEA 2PKCA 2CUNA 2G88A 3EVCA 1HT3A 2LIVA 1EESA 3R9KA 1CE8A 4Q02A 3ZV4A 5BSMA 4REQB 5EHGA 2VAPA 1G4HA 2ZJ1A 3HE3A 1V8BA 3MUEA 1R37A 2FP4A 2PR7A 3BUSA 4IHKA 5AK6A 3WV5A 1SHTX 3PKJA 4RWEA 4AJ1A 4F5DA 3AQ4A 5AD1A 1GVNB 1MO5A 4BNNA 2WIBA 3JAWB 3ESYA 4G0ZA 1UUFA 2IBTA 2PXCA 4NE7A 1EHCA 2V7WA 1XTRA 4EARA 2PFSA 3VPHA 1KAMA 1IBKB 1OYOA 2BBWA 1ZINA 2H3EA 4H6WA 5B58T 1F2VA 3ILSA 4M9SA 5ALYA 3WQRA 1TRKA 4BFYA 3MMPA 4HNGA 3GCXA 4BE7B 2DBZA 3QTBA 4AZVA 1X7WA 1DXHA 1OASA 4OP3A 2Q6TA 1QO0D 2PUVA 2ALJA 4MKFA 2VXBA 1OY1A 1P2SA 4WDQA 5TDHA 1PJ8A 1ZL2A 5JMPA 4FWBA 2C7OA 1NBMD 3P9XA 1G20A 1QTNA 2C2MA 2JKVA 4ECAA 2GESA 2CLEB 4M0MA 4O4LB 3UT5A 4HLQB 1GTG1 1H2ZA 2AF4C 2I67A 2ZSJA 3JR3A 3K0AA 3NP7A 4BOYA 2CLCX 4QDOA 1JDZA 1KK2A 2VAWA 3HV0A 1DKNA 1MDFA 3ZLUA 1KP2A 3P0HA 3NOOA 3MT9A 3O6VA 9LDBA 2SICE 1NOIA 1UZUA 1QLHA 2EEZA 2FZCA 1TTHA 2Z9CA 4ZOCA 2EP7A 1XZDA 1NNI1 4WZAB 2HIMA 4QUKA 4UDNA 5FV7A 1NJ5A 1P5JA 2PMEA 4AZ0B 4BFZA 1R4NB 4GR5A 4G0NA 4MW2A 1SQSA 3QLJA 2AW5A 4KSYA 2ZP1A 5T4EA 1Q7RA 2V65A 4XB6B 1KNXA 1LZKA 3DXZA 1SXJE 4KE7A 5BR8B 3ZIAA 4EYEA 2PWZA 5DRTA 3G2HA 3GR6A 1W4ZA 4ID9A 3R4CA 4EL0A 2HYDA 2I7CA 2FPGB 3ZX4A 1CEYA 1C0EA 2F8MA 2WABA 3RHSA 4NPCA 1XRNA 2IV7A 4KBGA 4I8IA 3T0FA 1OW3B 1Z33A 2FKNA 3N1UA 4AY2A 4E15A 3WY9A 2B94A 3ZNNA 5DYNA 1YASA 3IT3A 5EUQB 4J1TA 1O0BA 4HN9A 1CUFA 1GNSA 4GHWA 4WUVA 3PHHA 3ZWAA 3ZDAA 3EXHB 3DHEA 4XPIB 2IDZA 3A3KA 1J33A 1FFEA 2J0UA 3B1VA 3FGOA 1BHJA 2GUWA 1G5FA 2ZB4A 1SU6A 3ANNA 3O1IC 4J0KA 4K86A 3MF4A 1P45A 2WOJA 3LSTA 4XYEA 3DZHA 4ZXFA 4RH1A 2B78A 1N3LA 1ZOSA 5KSZA 2HCFA 4E07A 1RJDA 2QW8A 5BWOA 1ISRA 2IQIA 2NO6A 4KNYA 2VDQB 3WRYC 1K8QA 3K2BA 4A8JC 4CDMA 2XUZA 2HN9A 4AJJA 5HGJA 1Z4KA 3N8GA 4B6EA 1XNGA 3EVAA 4KMOA 2LKDA 2J8ZA 3KELA 1GNLA 3OBBA 1J8QA 5BPHA 5ERYA 4ZCRA 1UXKA 3CCCA 4BNTA 3TF5A 2C2OA 4A36A 2GEVA 1VRVA 2GVDC 2XT0A 3HU3A 3IPLA 5KYXA 2WZDA 1VM6A 2BEWA 3PGLA 1UKVY 4B3JA 2VS1A 3X2SA 1HZJA 2IITA 2CF5A 4OU4A 3FZGA 3FGPA 3G2PA 1PNOA 2LTAA 1TPYA 1UKCA 4TKVB 3WNCA 1AGXA 4GKBA 2VHEA 4ZO4A 5JCJA 3OUZA 3CCFA 4ZTUB 2ID8A 4MRPA 3GLIB 1Q16A 1XMJA 2I4LA 4FFBB 4JQOA 4CMGA 5CB6A 1LLDA 5HDBB 1JEYA 1TYEB 1JSXA 2Y9PB 4JBHA 1RD4A 1ZNQO 1UJBA 3GN1A 3QWIA 4UW9A 5CURA 2ASEA 2ZR9A 4H15A 3X0DA 4EFKA 1S8FA 2X42A 3MCUA 2R86A 2ZYRA 1C9MA 2J6BA 4GAEA 1Z17A 2I76A 3T7CA 1GYQA 1ZUNA 3TNDA 3TOCA 3IUYA 4B48A 1CJKC 2DFNA 2P4UA 1KYQA 4EW2A 4ZYXA 4ND6A 1JHDA 4KQMA 3RFXA 2VP2A 4DB4A 3W3AH 4TMZA 3IT2A 3GVXA 3SJZA 3TR5A 2WC1A 3DDOA 4R9VA 3T5TA 1TUBB 2W6ID 3T3DA 4TYNA 2VDJA 2CYBA 3EULA 5I9BA 3A2MA 1EB8A 1N5MA 1O94D 4CM4A 4LYHA 3D0OA 4ABYA 4PCVA 3MK31 1C3VA 3P0FA 1Z29A 4NK4A 1G3RA 2C4WA 2PZJA 3PEFA 1YCFA 5FUYA 4OYRA 1XDDA 1PZFA 5GGYA 3II6X 1G5TA 4GP6A 2Q07A 2C9OA 2I9PA 1IG0A 4XUDA 1E1LA 3EMKA 4S12A 1GN8A 1E7RA 2WPDA 1NW6A 1N0UA 4WBSA 3AG6A 1FJHA 3O92A 1XZMA 4K6GA 3MGAA 1ODSA 1M6VA 2C2XA 2P77A 3OE1A 3BMQA 1IG3A 5HZGA 5EPUA 1S7GA 5JARA 1GAEO 3VR6A 3PNQA 1Y1QA 2HMTA 4MKGA 4X7BA 3U44A 1RXVA 3FYSA 2NVWA 2OESA 3A14A 1FDOA 3PE3A 4IWNA 1KPIA 3W8DA 1YOVA 4PGHA 4Z4GA 3ACCA 4U7DA 4P0QB 4FN4A 4CR8A 4AF7A 4J90A 1TO6A 3LIIA 2N75A 2QOEA 1CS0A 2FGKA 2O8VA 4LCJA 1V11B 1L7RA 5KHAA 3P9SA 3VRHA 3EWIA 4XLLA 3ZJUA 4FZ5A 3NMUF 1I01A 1ACMA 1ZSVA 3GEGA 4C7VA 3D7NA 5TQVA 5J4HA 2RK6A 1AN9A 1HEUA 4QWWA 1BS1A 3AI7A 2QYHA 3DWFA 3Q11A 1X1AA 3KU1A 2H0RA 4ZTBA 4BVHA 2HWWA 3CU5A 1YR8A 1B1AA 5IRCD 3EWSA 4WK4B 3VZPA 1K9SA 4WLEA 3FN4A 1YBAA 1I4WA 4FD3A 4HNAA 4O2AA 4WA8A 4WY8A 4BRUA 1ELOA 3Q9LA 1K08A 1R4ZA 1RM0A 1TX4B 5AK3A 3OQOA 3G2NA 2ZETA 4TMWA 3SI7A 1Q3TA 3A7DA 4OBWA 2JATA 4DA0A 1LD3A 1AB6A 4HFNA 1H6CA 5BMVA 2GF9A 1W25A 3ASZA 5AW5A 3JSXA 4XCVA 3S29A 1SUIA 1AMOA 1CZOA 1PR4A 5TIIA 3MTDA 1KFJB 3OU7A 4DQ0A 2XCUA 1ZWLA 5I4CA 4ER3A 3R0IA 1KHHA 2YZ7A 2FFQA 3SVZA 1WPGA 4XWWA 2BEVA 5FUWA 4US1R 5CT6A 1I7LA 1QIGA 1EG2A 1KO4A 5TR9A 3ZNQA 4RS4A 5F3RA 3N05A 3JALA 5EKSA 1U3UA 5K3FB 3MJCA 4X0EA 1J42A 1E69A 5DV9A 4KYVA 2O8DB 2P9YA 4A0RA 1RI5A 3LY5A 4KQHA 2XDQB 3T9CA 1C2TA 4OAQA 1V48A 1GL9B 4LFAB 4D3YA 4TLBA 3V8QA 3JQFC 3SM9A 3H2ZA 1FJXA 2YOHA 1XWIA 3M3PA 1KBZA 3KV3O 1P5HA 1RM3A 4HRAA 2YV3A 2B61A 4XSVA 1SG0A 2PM8A 1F51E 1ZZGA 1OOEA 3HZHA 3NRJA 4GC5A 4B6QA 4KFTA 1IMJA 3LV8A 3B78A 2EQAA 3G02A 4IDNA 2C4NA 5HS4A 4YDRA 4BNIA 3BDVA 3AZPA 1P1RA 2X9QA 2PUWA 2VQSA 3H97A 5I7AA 4C0AC 4C7JA 1R9NA 3VMFA 4ZEXA 3DXXA 4DTIA 3CEPB 3K09A 4EGSA 5A7GA 1G3QA 1HYGA 2V0CA 3NIWA 4INJA 2XA1A 4UQPA 3NS7A 3PYLA 4Q3NA 1J0CA 4JJFA 4M87A 5TXGA 4DUZB 3PCTA 4BQEA 1FNDA 3FPCA 2OB2A 5A5FA 4CMHA 3FCYA 2IHJA 3DT6A 3SBDA 5JCZA 1Z2PX 1N9GA 3T4PA 3KOUA 5HZKA 1Q6ZA 2PZEA 5H5JA 5KNBD 1B73A 1Y6JA 1NUTA 1YS7A 5IXSA 4UFNA 2FI1A 3D4LA 2GJSA 3QPUA 4JH0A 1J5PA 1MA3A 2J9ZB 2CXOA 5I51A 4CG0A 1PD0A 4LF9B 1FTGA 1Z26A 3OZ7A 5LDHA 1Y9EA 3COYA 2O3UA 4W5QA 1Y6GA 4LFBB 4EJ6A 5E4FA 4AMYA 2WKSA 1LK5A 1R8JA 2YNMA 3CB2A 2W4QA 7ADHA 3B6IA 1KI9A 3TSCA 1O96A 3I05A 1F2UB 3KR9A 4E09A 2H2HA 1CR2A 4E4YA 3RUDA 3VH4A 1CS4C 4ZAGA 1ZHHA 2OFXA 2BMVA 1YJXA 3JD2A 1U8AA 4PYRA 5IH3A 4YJ3A 3W9BA 2F8TA 1N1MA 1Z2CA 4M38A 1LW7A 4N0DA 2JI8A 4ZEWA 2FUG1 1A9ZA 3WFIA 2ZT6A 1EB9A 2CUZA 2G25A 3LE8A 3H9CA 1MRSA 3P9IA 3PGXA 4OXRA 4UDYX 1A98A 5KAPA 4CMIB 4R0MA 3GUCA 4BLTA 1UDAA 3C3CA 4LDRA 4M0CA 3NHMA 2QPAA 3LD9A 4Z8XA 4UASA 4RMIA 2HV8A 4RSRA 4ZV4A 3ED1A 1LBQA 1VJTA 3G68A 3KUXA 2JLWA 1WA5A 3FY4A 5CH3A 4C1BA 1KKMA 1QGUA 3THYA 4URUR 3ZCSA 2SKEA 3ZHZA 2GBIA 1FP1D 3T95A 4IHJA 4GM4A 2HSZA 4RKWA 3FDXA 4LBZA 2PZKA 4BS9A 3SPXA 4HXYA 3LC1O 4GUDA 5IKOA 4C7MA 4ZOEA 4UBJA 3TE7A 3P7MA 1B8PA 3ZLJA 4TL7A 2IZ7A 5KO2A 1EFDN 3ELBA 1E4EA 3AFIA 2EIHA 3LUJA 5DEIA 2Q3BA 3B9QA 2HTEA 1RM4A 3DV0B 1UP7A 3ZHOA 4GPZA 4UXHA 2RI0A 3ITEA 2V54A 4V3CA 5DGTA 1HKUA 2FFJA 1O5OA 2YN4A 3NWBA 3IJPA 4RESA 3QLUC 3PBKA 4ZMBA 4NENA 1ZUIA 4PGGA 1COZA 5HZHA 2ZJ4A 1L4YA 1KSJA 2XWSA 1MGOA 4BO7A 4WOJA 2WG1A 3ISTA 2VXCA 3RU7A 1S96A 2OOSA 2P41A 1OI3A 4ERNA 1WLYA 3AXTA 1APBA 4UEKA 1U8YA 3IHKA 3IR5A 3IQEA 4FR2A 2I1VB 1SOWA 4H1TA 4NJMA 1YU6A 4MGHA 3RTAA 4AECA 3RU2A 5JUWA 1D1TA 4PAOA 1B93A 4FNMA 4TMXA 4AP5A 1E2EA 5FORA 3VI3B 3NR2A 4NX2A 5FA6A 3PNLA 3DZ8A 1GA6A 3U40A 5B4TA 2CXNA 4QQKA 4WV3A 1TEXA 5JAZA 1LBEA 3A05A 2NV0A 3MNFA 4J94A 5TMDA 3KXDA 5C5CA 2H92A 4L5BA 1ECBA 2ZAMA 1JB1A 4LJ4A 3W2IA 3QF7A 2W48A 4HQNA 1EFUA 2ZANA 4IS2A 1CQJB 3NTUA 1NDUA 1D7OA 2BYTA 3CEJA 5CYGA 1WV0A 5AM3A 3PGA1 5KSPA 4R71A 4QFCA 4FOPA 4RKFA 4MQFB 2AK2A 2ZBEA 1HNZB 2KBFA 3WSWA 1U0TA 4MJXA 5FBHA 4S0ZA 3NTXA 2B7CA 5E2IA 2I2WA 4WRRA 5A4AA 1NP7A 1ULZA 4MLCA 4EAQA 1VPWA 5AM1A 1UAAA 1N0WA 4EHBA 3LFUA 4MYUA 3HM2A 1XTIA 1Z0FA 3Q4GA 1TNDA 3PT5A 3JASA 2P7HA 2PLNA 4N0PA 3HGMA 5FP0A 2WTBA 3X1YA 3RFTA 4B4KA 4S24A 1I33A 4WESA 2OE2A 4B6PA 1ZD8A 4YQFA 3D4OA 3KSMA 3MPUA 3N5CA 3ZE1B 4LMBA 5FTJA 3GOHA 3QKSA 1I5EA 4KR0A 4W4TA 1L7XA 3GRRA 1G21A 4MB6A 4EEZA 1T2CA 4QOJA 4C6TB 6ABPA 1TM2A 1MX5A 4DVGA 4H16A 3MJEA 3C4QA 1ZSYA 1QFMA 2JBAA 1M1YB 3QKRA 3AKEA 1YC5A 4EX6A 2B4TO 2D5IA 4GSYA 3KSUA 4TKZA 4D9BA 1E2FA 3DBRA 1PQPA 4RC9A 4ROTA 5M3BA 4NBWA 2WTUA 3BGSA 4ARZB 1TTPB 4MIKA 4R1NA 3H11B 1UFVA 1IUPA 4CLHA 5TV2A 3U31A 3VJLA 3WL5A 4RCYA 2I3DA 3DAGA 1JDSA 2FJPA 4V3BA 1JQKA 2HNAA 1CDZA 2PSFA 4WECA 5HIJA 4BVLA 3WICA 4L57A 1IPEA 2VF4X 2J9YB 5DGXA 1RZVA 4IILA 5CM8B 5C8YF 3OEWA 1UAYA 2H7CA 4KRGA 1WDTA 3V2GA 3QU5A 2NO5A 3W77A 4TUYB 2JH9A 5GADl 1E2JA 1VHTA 4LK2A 4V03A 3PCRB 2WY2D 2NO0A 1A04A 1EK0A 1T0UA 5ITSA 2OILA 5K8CA 4IXWA 4KI0A 1E32A 2DJIA 4UJ3A 5BUQA 1YDGA 4KAXA 4JI2B 3NBAA 3PJEA 2P2CA 4Y2VA 2O50A 1NQXA 1T5HX 3DUFA 4UHFA 3ZWNA 3D7RA 4M0EA 3C7DB 3AVWA 3KQHA