2QUKA

Crystal structures of human tryptophanyl-trna synthetase in complex with atp(putative)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
374
structure length
374
Chain Sequence
KGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophanyl-tRNA synthetase
publication title Catalytic mechanism of the tryptophan activation reaction revealed by crystal structures of human tryptophanyl-tRNA synthetase in different enzymatic states
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 125
structure length 374
sequence length 374
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2007-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2qukA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2qukA01
1PG2A 4OUDB 1T9GS 4UZEA 4MW2A 2V0GA 4ZT6A 3SDBA 1M83A 4MVYA 4CDNA 4KR7A 4DNXA 1NUQA 1TYAE 1R6TA 1A8HA 4JFAA 1KP3A 4J75A 2JA2A 2WQ7A 4MW5A 3RBAA 3AG5A 1KH1A 5HUJA 4MW1A 3PRHA 2D54A 1LI5A 3ND5A 4YP5A 3IUEA 2CV1A 4DJAA 3P52A 1JEDA 2PG3A 3CVVA 1O0CA 2J4DA 3A04A 3QTTA 1J21A 1U0BB 1OWNA 3NBAA 3SZGA 3ILVA 1B6TA 1CT9A 4HPWA 1N75A 4ZT2A 3D6VA 2GOYA 4WSOA 4OUDA 2PZBA 4PY2A 3P0JA 3TQOA 3M5WA 1NURA 4NAHA 1IRXA 3CLTC 2CV2A 3UOWA 3ZJUA 2BYTA 1QRTA 1JIKA 1F4LA 3FG9A 1QNFA 3X1JA 4MW7A 2ZUFA 4ND7A 1IVSA 3C8ZA 4EG3A 1N77A 5H7XA 4NDAA 1Q15A 2GKSA 1KQNA 3FIUA 1S4MA 4KPUB 2E18A 5EKDA 4CT0A 5LLTA 3ELBA 3K32A 4G5FA 3IH5A 1Q77A 3HL4A 2RE8A 1KH3A 2CSXA 2Z08A 3ZGZA 3COYA 1QU3A 4MUEA 1JGTA 1WKBA 1G8GA 2B7LA 4G5YA 3AFHA 2Z09A 2H2AA 1G8FA 1KAQA 2DPLA 4CDMA 1KH2A 4XSVA 1RQGA 2X0KA 4MQ6A 3N2YA 1FYDA 1FFYA 1O97C 5TS2A 1EE1A 1XNGA 1K92A 3KT3A 1G59A 3RK0A 4MW6A 4KPUA 4MUKA 4PBRA 3CLTD 1X6VA 1XNJA 1KQPA 2QUKA 4K03A 1EUQA 3P0HA 2X3FA 1Q19A 3N05A 1P7PA 4QREA 3A05A 3TQIA 4HK4A 1GLNA 4TS1A 2DETA 4A91A 4KR6A 4MUIA 1U3CA 3COZA 2D5BA 4MLPA 2CFOA 3H99A 5TEWA 1LI7A 1ZUNA 4S1OA 2AKEA 3CR8A 1SURA 4WNYA 5DK4A 1MRZA 4U8HA 3MUEA 1IQRA 3PXUA 2G36A 1LW7A 1PFUA 3CLRC 4ZT5A 1J1UA 2DERA 2TS1A 2A4MA 1NYLA 1EFPB 1U3DA 4I6GA 2PZ8A 2VTBB 5IJXA 1N78A 1GPMA 3DO8A 2QJFA 4MVWA 3AKZA 3GUZA 2OV4A 2WQ6A 2E21A 2ZP1A 3DPIA 4ZCSA 1NUSA 3CVXA 1O97D 4K0RA 4ZCTA 1M8FA 3LOQA 3G5AA 2DEUA 2QJTA 5HG0A 2CYBA 3CVWA 2AZXA 2O8VA 4CQNA 2HGZA 2C5SA 4XFDA 5KCMA 2QUIA 1GAXA 1WQ3A 1JILA 3ND6A 4EG4A 4R2MA 4QBTA 1H3FA 1EFPA 3CVYA 2VTBA 1T9GR 3CLSC 3MLBA 4G6ZA 2AG6A 1GZUA 1T6XA 1T6ZA 1WY5A 3HMQA 1K97A 4U63A 3ZJTA 1N1DA 1MB2A 2HZ7A 3IOCA 1K4KA 1Q11A 2O5RA 3ZXSA 1KAMA 1ZJWA 3Q10A 3TS1A 1MOPA 1Y42X 4KKVA 1GTSA 1YUMA 5IHXA 1M8JA 4ZT4A 4ND6A 1V8FA 4R0NA 2EL7A 4MW9A 2QTRA 4EGAA 1JHDA 2DLCX 1O95C 3FOCA 1JIJA 1EUYA 1H3NA 2J5BA 3L92A 1ZH0A 2PXHA 5DB4A 4NZPA 3H05A 1BS2A 2D13A 3CLUC 3DLAA 3KT8A 4ZCPA 1ZH6A 1OWOA 3NBKA 5J5AA 4BWVA 1EXDA 1QJCA 1O0BA 1N2IA 1PFYA 4ZCQA 4QRDA 3U1VA 4X0EA 4AQ7A 1J09A 1R6UA 5DEOA 3SP1A 1YIAA 4MWCA 3VRHA 1R6XA 5KHAA 2Z3VA 1MAUA 3RFFA 1JZSA 3HZRA 1QRSA 4ZT7A 1X8XA 1KKUA 3CLSD 5J58A 3H9CA 1JIIA 3GMIA 1I6LA 3PNVA 3OTWA 4DLPA 1M8PA 1J20A 4PBTA 3BL5A 3AIIA 1T6YA 3MLAA 3IOBA 1OBHA 2A88A 2YY5A 2A1TS 4DDKA 2QTMA 3X1MA 2A84A 3TNJA 5HUHA 1N2JA 4JYZA 4JXZA 1MJHA 1QU2A 5FO0A 1TYCA 1H3EA 1MC1A 3CLUD 1ULHA 1IH8A 1KORA 1TYBE 3SZ3A 3ZXIA 2JAXA 5FNZA 1IHOA 3MXTA 3CA8A 5LFAA 5J59A 4YP6A 3FWKA 1VL2A 3DV2A 1H1TA 1M8KA 4GU5A 4RUKA 2I1LA 3ND7A 3IVGA 1EFVB 4J76A 1V47A 3KT6A 3FY4A 3UC5A 2XRZA 3SEQA 4ARCA 4F4HA 3A4IA 1JECA 2J09A 4HJXA 1I6MA 3HGMA 2DUMA 5DASA 3MMXA 5LM3A 3N9IA 1TYDE 4YP7A 2GM3A 1NUTA 4E1AA 4F3RA 1NUPA 4MUHA 3UK2A 1EJ2A 3LCJA 3AL0C 1OWMA 1J70A 1F7VA 1MBZA 3TZEA 1I2DA 4DDHA 1GTRA 3NV7A 5KWVA 3ZIUA 1WXGA 2A86A 5H16A 4OJMX 5BNZA 1EFVA 1KR2A 1QTQA 2CYAA 4Q93A 4NAUA 3K9WA 1VBNA 1NUUA 5TGTA 4ZCRA 1QRUA 4MWDA 4JZYA 1NI5A 1TEZA 2NSYA 2DXIA 2A1UB 3CLRD 3FHJA 2X1MA 1WXHA 1MB9A 4HJRA 3KT0A 1K4MA 1IQUA 2X1LA 1ILEA 1YIDA 2JANA 2J07A 1O96B 3ZJVA 4MAFA 4MVCA 4U7JA 3IMCA 4EFKA 4I6EA 2EJCA 3QE4A 2E0IA 2V0CA 3VGJA 3H9BA 1XNHA 2HMAA 3IMEA 2IJGX 4EG7A 3JXEA 3PNBA 1VBMA 1M1ZA 2YXNA 4AS1A 3PNYA 3UMVA 2CT8A 1JMVA 2NZ2A 1I6KA 1OWPA 3COWA 4MUJA 3G59A 2QTNA 4MW4A 2PIDA 1HYBA 1N3LA 4RPIA 1XJQA 3Q4GA 3N8HA 2CUZA 2ZUEA 1OD6A 2A1UA 2QUJA 4MUNA 2PFSA 2E89A 2RD2A 3A2KA 3KFLA 1IQ0A 1O96A 4KR9A 4I6JA 1J1ZA 1YUNA 4DE5A 3FI0A 1WXIA 1WQ4A 3RJZA 4NX2A 2J08A 2R5WA 4MVXA 1N2EA 1WXEA 1M8GA 5AHWA 1VBKA 2CYCA 1F9AA 1KP2A 1N2GA 1OWLA 2A7XA 2IELA 3FNRA 4XFJA 2QUHA 5K0TA 4DDMA 1NZJA 3SEZA 1COZA 3AG6A 3Q12A 4GRIA 1DNPA 3SYTA 4L2IB 1O94C 4EG8A 5JBNA 3GLVA 1PFVA 3VU8A 1O95D 1TQ8A 4EG1A 3HFJA 3IVXA 1TFUA 1VLHA 3CVUA 1WZ2A 3X1KA 4EF6A 1JZQA 4ARIA 3ZUGA 2H29A 1U7XA 4MWEA 3S3TA 4Q16A 1UFVA 1IFXA 4P2BA 4EG5A 4EG6A 3D6UA 1YI8A 3ISJA 1YULA 2A1TR 3IMGA 1MAWA 1WOYA 1KQOA 1N2BA 3E27A 3L93A 3RK1A 2DR2A 2VXOA 4H3SA 3COVA 3IUBA 1D2RA 4FZJA 2WB2A 4L2IA 3FH0A 4R2LA 5K0SA 2YWCA 3RHSA 5TEVA 1N2HA 2CV0A 4UZFA 3I05A 3FETA 3F3MA 1GN8A 1JEEA 3HV0A 1O6BA 3LE8A 1QQTA 4MWBA 1WJGA 3IDFA 3H97A 1WXFA 4YBRA 4ZT3A 3IOEA 4MULA 4MW0A 1G8HA 1NP7A 1O5TA 4JXXA 1NSYA 2OQ2A 1O94D 1PFWA 3QTBA 1OBCA 4PBSA 3OP1A 4MUFA 3IVCA 3UY4A 1F7UA 1U7DA 2WSIA 5F23A 3G6KA 3TZLA 5FO1A 2QJOA 2IP1A 1PG0A 2BTEA 4YMIA 2PZAA 4NATA 1N2OA 3INNA 2XRYA 3FDXA 3IODA 4MUGA 3P0IA 2YWBA
chains in the Genus database with same CATH superfamily
1FTNA 5G1PA 3W7AA 5DP1A 2RGXA 1V16B 4MVJG 2V7VA 1T5IA 1BGVA 4FLEA 1CY4A 2XB6A 3I2FA 1LNSA 2CF6A 4M53A 4MR8B 4DDTA 3L4JA 3ZDAA 4TPKA 2P2YA 2WT8A 4D0LB 5FUXA 3I9V6 6ADHA 1FK8A 3UKOA 5LYJF 4HQOA 4BVJA 2ZBVA 2QZPA 1KERA 1D2EA 5FTMA 3WG9A 3Q8WA 1YL5A 2P4HX 2RGAA 3HCDA 2PQ6A 3PRHA 5CLGA 3TQRA 1ATIA 4L78A 5ALVA 5JXWA 3QFTA 3EPPA 3Q3JB 2VPPA 3QQPA 4MEJA 4DJAA 5KTPA 4GMKA 2HPAA 4YFYA 5HKLA 3GMDA 3KS9A 1SD5A 1XP8A 5KI6A 4AI6A 2YUTA 3ZHTA 3K92A 4Y2HA 1L9KA 3NBAA 4MR7B 3TD6A 5FXMA 1YZTA 2ANBA 5IZCA 3BWEA 2EX4A 4XVQA 2IRWA 3WS7A 1X19A 3LQ2A 5HS6A 3OZAA 4BO9A 4OUDA 2PSSA 2YW9A 1HORA 1FQKA 4EYOA 2AJLI 4AROA 2OV8A 1YS6A 4IGAA 2D5CA 4OXNA 1CF4A 1NXQA 4YXWA 3EQ8A 1NURA 4ZARA 2V0NA 1AUPA 8ADHA 5IKXA 3AHHA 2R86A 3CWQA 3MJCA 3NTLA 3T5GA 3HDJA 4RXUA 2FG6C 3GN1A 1W6UA 2H06A 1CF2O 3ES9A 4EYSA 5SZJA 4C3VA 3AETB 1UC5B 4MKZA 1KDTA 5A5FA 3I72A 4F5EA 4XIIA 3SJBA 3LX8A 2WHPB 4FNMA 5E1DA 5FBHA 2C88A 2AFIB 3IL2A 1IVSA 2V3VA 4N4AA 5DHPA 1PSZA 1EDEA 2JCGA 1PWZA 3L40A 5F64A 4B5KA 1VJ0A 2RJNA 3FYDA 1GPAA 1GRVA 4M9ZA 2C97A 3EOAI 1OIXA 2O2JA 4HTAA 3UG6A 4BO1A 1TM4E 3BXZA 1REQB 4D0RA 3EZGA 4L85A 1NNSA 1KH3A 5KZMB 3V1YA 2J5XA 5KUTA 5DU2A 2CSXA 1C1YA 1NYRA 2PS0A 5D6NA 5CJ2A 3EUWA 2R1VA 2X8JA 1JQJC 1RRGA 3DL0A 1ORWA 1IAQA 2VZEA 4LNHA 5KQLA 1M2WA 1YKGA 1CY7A 1DRVA 2YN0A 5FEMA 5LOVA 1IWOA 4AO8A 3C24A 1RBQA 1S8OA 3FYHA 2Z09A 4OMUA 2WV9A 4B3RB 3AUKA 1T5BA 4Y67A 4YGYA 1XB2A 3UBMA 1WZIA 1NT4A 1U3FA 3K9HA 3QF7A 3W2GA 3U6BA 1RYDA 1BD3A 5BV7A 2Z1DA 3B7WA 1HYGA 2CFCA 1NQOA 3S4YA 3HM9A 1XNGA 2Y2UA 5HJ7A 1KSHA 2YOHA 3FKQA 4HSGA 2I2BA 3G9QA 1ISFA 3H1TA 5TF4A 4EJ6A 3QTLA 4NJEA 3ILXA 5CIWA 3H84A 3L82B 2JAUA 4I1IA 1JXAA 2X5KO 2AT1A 2EFCB 2AFHA 2QLLA 5E7JA 4MRAA 3SFVA 2ECOA 1Q19A 1EZZA 4BMDA 4GOND 1U63A 5EEHA 3QU7A 1G6HA 3INYA 3BZUA 4KR6A 1AO3A 4OBBA 1QMGA 4HR7A 1TQ4A 2D5BA 1OXVA 1IPFA 1UMDB 4MIYA 1M6YA 4UAGA 3TLCA 4WBNF 1YZFA 4GYYA 1MDBA 4AY6A 2PLFA 1S2OA 1ZVQA 3KZMA 4LG1A 5EP4A 1SKMA 1ZQ9A 2JEYA 4CR8A 5LA6A 5HTOA 3WLAA 2YIDA 2E37A 4KRYA 4JQYA 5BWLA 5C5EA 5DK4A 1PZMA 1XTIA 1CV2A 1W9HA 4U7TB 4XPIA 4FYJA 2G5PA 3PNOA 4OSOA 4O1HA 1FBTA 1PFUA 5JQGA 2RAFA 5B5SA 3HXMA 2FLWA 1K0FA 2J6CA 2QQ0A 1YRLA 3CXUA 2Z58A 2OUKA 3IPRA 5A4KA 3CX3A 1EXNA 1K68A 1VE3A 2WILA 3LL4A 2NLOA 3LVQE 1WQ1R 2J0QA 5BP7A 4LDPA 1Q3HA 2JFYA 4JQSA 3C5VA 3DAOA 1MEJA 1Z6PA 3R6WA 3S2EA 3ZN2A 3GZJA 3ZXYA 2XMRA 4MV5A 3FOBA 3U1TA 1IN5A 4GPIB 3JTEA 2H4XA 4J0DA 3ZD7A 2B82A 2LCFA 2VJLA 3N87A 2Z6AA 3W8FA 4OGGA 2LWIA 2MSWA 2W2NA 3KJZA 2X0DA 3EXEA 3HXLA 4KH0A 4PG8A 2IPNA 2FH5B 2XYQA 1ZK2A 2NM0A 4DMRA 5DPMA 4A0QA 4HDAA 1XVAA 3NHAA 3P71T 3WYDA 3RHZA 3KC2A 4G2TA 3KTAA 4QDTA 4BWFB 3G9ZA 3RVKA 5HZHA 2PT6A 2QTLA 2P9TA 4OB6A 1HFKA 3ZYCA 3NTXA 4O29A 3RR2A 4BN4A 4WESA 3ITDA 1X1BA 3PJEA 1U8TA 3EWNA 1KI6A 2HCBA 2TMGA 4KRXA 4EW2A 5JBQA 2WEKA 1M0EA 1T24A 3FNGA 4CFSA 1Q12A 1T6XA 1NC1A 1TO2E 1WCYA 2G40A 3MRXA 2JDID 2XNDA 4OX9Y 2VJMA 5LYYA 4ZVMA 4AMGA 4TQGA 3NS7A 5IJ9B 2O5RA 1U31A 4L8YA 3ZXSA 5T3YA 1NQAO 3HO8A 2IW1A 2X0RA 2WMYA 3ME5A 4NIMA 3GLIE 1UEJA 3GJ6A 4W8OA 4B71A 4UQLA 1NVWQ 2B99A 4Q4JB 3WGGA 2LGJA 1J06A 1V5WA 3A1CA 1G0OA 2NYVA 4DOMA 2WIJA 5ITWA 2PJUA 2ZGVA 1NHGA 1Y7LA 2O2EA 4E14A 5JYBA 3GDOA 2D2VA 5DHTA 4UHBA 4XTCS 1JQLB 2NO4A 1AQYA 1KC1A 2LVBA 3JQGB 3NTVA 1ML4A 1G6OA 4BX8A 1P18A 1IM5A 5I9LA 1G21E 4LVNA 3F5DA 4HNAA 2BI7A 2DFKB 4NZPA 4QXAA 2FWAA 2LXNA 2QG6A 3L6EA 1NBEA 1QGZA 2HPVA 5IYZB 1M67A 2GZDA 4MPTA 4MQEB 2PN1A 2Q7OE 5D86A 4LF8B 1X7WB 3DB2A 2C83A 4PLPA 1AHPA 4P7GA 4YY3B 3JW8A 3BZBA 3RUFA 4FDMA 4N54A 3VRHA 1J8DA 4ZFNA 2JGJA 2FX2A 4JQCA 3P4YA 3RFFA 3WWEA 2GN6A 1FFAA 1W73A 4CM3A 5B6JA 5EHGA 1DAEA 3LYAA 1DG1G 4WA7A 3HM2A 5ADHA 3CLSD 1ACLA 1M1XB 2CVPA 3ZDYB 4DMUB 3NBFA 1P1HA 4ZODA 4PIMA 2DWOA 2J4CA 1C1DA 5LD2C 1SVNA 1I6LA 2CLCX 2NTYC 2OFXA 4L3WA 4EMSA 1RPZA 3WXBA 1XHFA 3BS4A 1JQ3A 3E81A 3IQZA 2QYHA 4H35A 4KI7A 4CTKA 1H1LB 1M6HA 3PV0A 3O8CA 1QX4A 3QEKA 4RPLA 5IVPA 3IUQA 5JPCA 1GPH1 1M1UA 3BD6A 2B1JA 3TEJA 1I36A 2O2XA 1NI4B 1FU4A 1PR5A 1QH9A 3AIIA 1CETA 2FUG1 3DT9A 1PN3A 4FZVA 3UWSA 1EUZA 2XB8A 2H5LA 2WD7A 2ZAMA 2FGJA 1LS1A 4JSTA 5BSUA 1LSJA 4DLZA 5C1DA 1A77A 3U9TA 2OLEA 1VYVA 3Q0EA 4GS5A 4A5OA 2H00A 2WVGA 3T99A 2VAXA 3TNJA 3WZ2A 4B3IA 1R4MA 1L5YA 3VMFA 3G82C 4M9RA 1KPGA 2OVFA 2P9CA 3MF4A 3NHZA 4UKDA 5I45A 1SXQA 1MDFA 4LY3A 4MVJM 3DC2A 1E4OA 4AUNA 5CURA 4TUYB 2AMJA 2JAXA 2OAEA 3K0AB 4X1KA 1GR1A 3TJZA 4HH3C 3VDQA 2QMQA 5GOZA 4WY2A 4GL2A 1ONSA 1PDVA 3DOHA 1QLWA 2A0KA 3VZQA 4IIFA 1P2FA 4OL0A 4NCIA 5AOAA 5CT5A 3ZS9A 1QG2A 2IK8A 2WKRA 5JLAA 3TX6A 1YBFA 3CVOA 1UFQA 4HC4A 4I99A 4ZU6X 3NT2A 1IEXA 1QAQA 2C3PA 4BGEA 2FWIA 2C7GA 1WU8A 3L6OO 4RU1A 3MCTA 4A2CA 4BRUA 4Z6KA 3L0IB 1DBIA 1U8YA 5CHEA 3AUTA 4BFSA 2H4YA 4ZMRA 4GD3Q 4F4FA 1T5DX 3L41A 4QSMA 4NE7A 3LTNC 4LZNA 3ETLA 3ESDA 5B2EA 5BYJA 2VPIA 2DUMA 3BXGA 4WZAB 1TMYA 2JIBA 1FRNA 3IQDB 3WLQA 4D99A 3D5TA 4MAAA 3AL3A 3BCRA 1X94A 3E4CA 5B4UA 3PFFA 3HJAA 2HJHA 2WYOA 5LM3A 5DMHA 1LV7A 4JLNA 1X0VA 4F4CA 2QRUA 4E1AA 1PNRA 6REQA 1EFLA 1G4UR 3Q6MA 4RA9B 4NSNA 1KP9A 2Y71A 1N4DA 4UU1A 1RZUA 5EMJA 1PQPA 4X1IB 4EA9A 3L1KA 3H6HA 3DLBA 1DX9A 1FDVA 1LK0A 2DYKA 3F9CA 2BEVA 3OD1A 1QP8A 2QM0A 4O2AA 5DVZA 4AJHA 5LMUB 2XF8A 4RESA 1GO2A 3M4ZA 4XIFA 1OH6A 4PAOA 3RU3A 2PU5A 1JYEA 3SF8B 2WFZA 2NT3A 1CR0A 1E7WA 3UK1A 1NRWA 1TCCA 1U5CA 1NBHA 2P2CA 3AF5A 4GT1A 1DBRA 2I4NA 3AVQA 3PSHA 4CGYA 1VE6A 4CMCA 3KJIA 4OMFG 2C2WA 2EFYA 3ROZA 4K9PA 1RQNA 1OB2A 4PTLA 4DSUA 1E1NA 1VRWA 2OV3A 3NV9A 3RYTC 2XTJA 2W6ID 1DAPA 3FHJA 3DOIA 4D74A 4JJ7A 3UV3A 5TXGA 4YRMA 2HA4A 4UQPA 3U3ZA 2FSIA 2QN6A 3OEHD 3I0NA 1I3NA 2FPWA 2GCNA 3JWPA 4HNHA 4PV7A 5IH7A 3PRKE 4EGQA 3QEJA 5AOVA 3WIEA 3BOSA 4OJQA 3U13A 5GVSA 1KGSA 3A3OA 3Q15C 1GL7A 1SR8A 3BPSA 3VR5H 2Z8ZA 2M6SA 4RMHA 4DN6A 1N0HA 2FPIA 3TAUA 4RTKA 1KOJA 2VPZA 4ZV7A 4WXPA 1CNMA 4GPD1 1PCXA 2IYZA 1TJPB 3JRNA 3TQQA 3W5UA 1C81A 4CV2A 4PQEA 4RJTA 4X3PA 4P08A 2JJ2D 4F06A 3R3JA 2NZ2A 2WOOA 3M6IA 3WSVA 5CX1B 3A3KA 1X1SA 1BA2A 3O4IA 2Q3HA 2V1XA 3K94A 3LW7A 2QTNA 4UMFA 1TJNA 4YJKA 3TB6A 2PAAA 1L9XA 4S2EA 3MS7A 4D3ZA 5FOQA 2JLZA 3DL7A 1XJQA 2CBXA 3PGLA 3QKWA 4IZOA 4OXKA 5BNTA 1VSVA 3RUIA 2LIVA 4MSUA 4GC9A 1K8XB 1OAOC 1CE8A 4UU0A 2QPLA 2GYWA 4DDWA 1S0UA 2WKWA 4NYJR 1ADBA 1QJ4A 1ZLYA 3DUWA 3F4LA 4YAEA 3SZUA 1GPYA 2HHAA 2PMDA 3E9EA 1G5QA 4KE8A 4L5YA 4QOIA 5KJCA 2D2IA 4GZLA 3WISA 2DWPA 2XNSA 4TMZA 3PWTA 3TRHA 3A4NA 1YZUA 1AE1A 1XELA 2APJA 4JBHA 2ZVJA 1NE7A 2KI5A 4LHXA 1GKLA 2DKOA 2PH5A 2X6QA 1T9AA 2ZAYA 2ZIAA 5AHWA 5I7EA 5KYKA 1B16A 1OWLA 1V4VA 4G0XA 2J3IA 4G9EA 4KRGA 4BFCA 4AUKA 4QWMA 1RJ9A 2P8JA 5TMEA 4V1CB 4B8ZA 2PX0A 2QJWA 5EJEA 4X9XA 2P35A 5EE9A 4H7HA 1TZJA 4KMMA 4ZAFA 5JE8A 2P2GA 1FQOA 4J9UE 4NV0A 3WB9A 3BWMA 4TKVB 1K1EA 4D8XA 5JROA 3THRA 2BDTA 3DWEX 4RD4A 5BVHB 4ZTUB 4UEOA 1G8MA 3OCUA 5FPHA 3TAXA 2GVNA 3TOCA 2P9JA 1OGJA 2I8AA 4OLBA 1XJWA 1BVYF 2BSXA 1DEHA 2NXNA 4I9HA 2ZB4A 4HX5A 5E0OA 5HS4A 3M34A 2YN2A 1XF9A 4XRRA 5CXQA 4K6KA 2J3JA 3ASVA 4LE0A 1KAEA 4ARIA 2QRGA 2G0NA 3R6LA 3OQIB 3AWIA 4KK3A 1WVIA 3BMCB 1ORHA 2AYYA 2EHJA 3FNHA 2GPWA 4GRDA 4JA0A 1MQ8B 4M0DA 4LZPA 4QASA 4WT7A 3RARA 5CG2A 4EG5A 1Q1QA 5DNCA 3GQBB 1Y1KE 2XHZA 5D1HA 3PE3A 5MHTA 2YNMC 3VHRA 3RAFC 4YROA 3THXB 3RUEA 5KQMA 3QV2A 1C3OA 5JYCA 2DT8A 1K7XB 3HVKA 3ORYA 2ZAGA 3EXIB 4NQZA 2QMZA 3CB2A 4RMJA 1NM5C 5FTNA 5C5DA 4OX9B 1J49A 3GFVA 1SY7A 1U28C 2EKBA 2ZRBA 4KSBA 3RHSA 3V7NA 4DNFA 2XUKA 2B20A 2IYUA 3IIIA 3PPWA 4AUEA 2GAJA 3IUSA 1U8FO 1QQTA 1ID8A 1UXJA 2YJZA 3EJ6A 1BDBA 1WJGA 4BNNA 4RADA 4ZT3A 2Z56A 3UAVA 3LKDA 4ZA2A 4X24A 2QLNA 1XL1A 4BMNA 3OFJA 3TRKA 4KQ2A 2AMYA 3G5LA 2BONA 1JFFA 1LPMA 1LD3A 1QDLB 1YCGA 1OBCA 4JOBA 4PRYA 1CBUA 4LKOA 4IQ0A 4U2EA 1F48A 3ENWA 1VYHA 1KO7A 3L43A 1R5JA 2D2FA 3ET4A 3AW8A 1SKBA 1C3XA 2G09A 4KHZA 3PLAE 3B9QA 3FLEA 3I04M 3S8MA 7ADHA 3B3FA 5AVOA 2XVYA 3DLCA 2Q1SA 3DMPA 3W8EA 2AMVA 1PTJA 1USGA 3IKTA 1QK3A 1L5HA 3M5PA 3WMGA 4ZICA 2O07A 1JEYB 2ZS8A 1A9QA 3TIVA 1XV5A 2WNIA 4RY8A 5JIBA 1HT0A 1SB9A 1KFJB 1XQWA 4D9JA 2IA5A 5B53A 4KR7A 2COEA 3K6KA 5JG7A 1J97A 3D6JA 1TYAE 2IGBA 4K87A 4R1PA 1WMFA 2MU1A 3EVZA 3EIUA 2CLSA 4IDFA 2CXRA 4XWWA 2C4UA 4KO4S 4D6PA 3OJLA 3WBBA 2AN3A 5H02A 8OHMA 4U6SA 3GOQA 4B2IA 1KBZA 4Y18A 4W1SA 4EVQA 2HLHA 3TE6A 1V7ZA 3DMDA 1R15A 2GFIA 3W90A 3T34A 1CU1A 2ZE6A 3E2MA 5KAPA 3V1NA 5BSGA 621PA 1O0CA 4CF4A 5JVDA 5A3VA 2IU0A 3G8BA 3A7EA 1AKUA 3NCTA 1S2LA 4R9VA 5HMLA 3UK6A 2I6QA 3O1HB 2OHOA 3OMLA 4CMJA 4KJXA 3W6PA 2FUKA 5FR2A 4BZPA 4I9NA 3C3EA 3TPFA 3EAGA 3OLCX 2PZBA 1P2TA 3L4BA 1IQPA 4P3KA 3KTDA 5DGIA 4UJ3A 2YHAA 3KZ1E 3RC8A 4PSAA 3FGOA 4R84A 2R96A 3QUBA 3KUKA 4PFJA 1OYVA 4NYIR 4EUEA 1K3FA 1Z7WA 3STXA 4Y6GB 2ZSUA 1QNFA 2H9YA 2WFLA 3S2YA 3CG4A 4R7ZA 1XRQA 2I80A 1TD9A 1WXQA 3RT1A 4ERXA 4BQFA 3N3BC 5KTOA 4MYSA 2IP4A 3PRYA 1MGOA 3CKYA 5AK6A 3VC2A 1C9DB 3QBVA 4MDFA 1K5PA 1QV7A 2I1QA 4B4UA 4C3ZA 1T2NA 2G04A 2J9FA 1RS0A 1ICEA 3JQ8B 3K9BA 3D0RA 1UJ4A 2R8RA 1ADJA 2ZJ1A 4N9WA 4ID3A 1PRYA 4EEZA 5K8TA 2LKCA 4KXUA 4QNMA 4TVBA 1XK6A 1XCMA 2X2FA 4HQFA 4G36A 4BBPA 1S89A 1DTEA 2Q1WA 4JP1A 4LX0A 3OMWA 2B7LA 2C5LA 5FI3A 5JD5A 1FIUA 4G5YA 5J4KA 3M6FA 5KU1A 1J5PA 3NBQA 3HJUA 4B9EA 2Y9MB 1U0JA 1LJLA 5HZKA 1G8FA 1KH2A 1J7KA 4H3KB 5F73A 2QSJA 2D1SA 3P7MA 1NF3A 3VMMA 1JKFA 2OXFA 4IXTA 3T5PA 1X1QA 4NBSA 5JJLA 3W04A 1QG6A 4BN5A 1PEDA 1WLSA 2RHOA 4KXXA 4KPUA 2QYTA 1HF3A 1U0GA 4BVLA 4NAVA 3UXYA 3N2KA 4GR9A 4JS0A 1HT3A 4OHXA 3MT8A 1XRSB 5FHRA 5BN1A 1EKXA 4H0FA 1KQ3A 3AVOA 5DX0A 2Q6KA 1XDSA 1O03A 3A05A 1FNDA 3RDPA 4CUZA 4D4GA 2DETA 1BVHA 3MD9A 1WB5A 1I2ZA 3HA5A 1GG5A 3MWKA 1OB5A 4O3MA 3TQFA 1K3TA 2BMEA 2PMEA 5HJ2A 3RAGA 3DEIA 5CX4A 1TLTA 3ENQA 2Y1EA 3OETA 1KI3A 1TCBA 3ZEIA 4AYWA 1LI7A 4FE4A 1MENA 3ZLJA 4DLLA 1G5RA 4WN9A 1U2ZA 1SXJE 4S1OA 4DSZA 3A1WA 4J2OA 3OEED 1V11A 1JR6A 2VPYA 3QRWA 5HF6A 4WNYA 1R0KA 4U8HA 1B41A 2OHHA 3EVNA 1RRVA 3MUEA 1NVMB 3EC2A 3TW8A 1JVNA 2DERA 4NF2A 4WEQA 5JSKA 2IYAA 4Z0HO 4ZZIA 4UDOA 5J2TA 2A4MA 2WYVA 2PGOA 3DV0B 3DXZA 4KMOA 1PJBA 1EVZA 2A0UA 2P9QA 4EVRA 1J0EA 1GPMA 1CVIA 1FMTA 4GI3A 1FW6A 3LGXA 2ORIA 4BNWA 1PT5A 5LQNA 5IU6A 4Q1FA 1T4CB 4OP2A 1E8DA 2JC3A 4WBXC 2QLBA 5FX2A 1QPZA 1J2RA 2BRUC 5C35A 1H0HA 4PYMA 3CRZA 4IUDS 1O8BA 4J1TC 3AFGA 2W6QA 1DV2A 2VP0A 4JMPA 1NR5A 3UGJA 2C2BA 3AOGA 4WOBA 2OMKA 4H7IA 1ABBA 3W8NA 3P2JA 4RCZA 4JXJA 4HADA 2AZ4A 3OY2A 1NIJA 2FX5A 4RK1A 3EVCA 4Z9FA 2CNDA 3U3KA 3NGXA 2EQ5A 2I8CA 4F11A 3BC1A 4QUIA 2B36A 2W0MA 4W9NA 3S2IA 1AQUA 2O8DA 1O6GA 2C7RA 4U2GA 3THWA 3ICPA 3AVXA 3AR8A 5KYYB 1H3FA 1EFPA 1UDCA 3QHQA 3UCFA 1RPTA 3R0ZA 4B1FA 1ZUD1 2GH1A 4FU0A 2RMKA 4Y2XA 2FN4A 1J2YA 1WSBA 4J1SA 4L0DA 3ESZA 5BMVA 1UDXA 1T6ZA 3HWRA 2B6HA 2YHIB 3LQRA 1NBMD 1XTTA 1DFIA 3P9QA 2Y4OA 2B1QA 3GI1A 4FPXA 4EUSA 3E15A 3HNOA 3KAKA 1G38A 4WOKA 2FPXA 1BJTA 1IZ7A 2YMPA 4KKVA 4QUBA 3IS3A 2BV3A 5H1YA 4KITB 3KZVA 3C1UA 1YR2A 2AKAB 4MUBA 4FHDA 1JFSA 1DPGA 4IO0A 3UHFA 5AI6A 3VPFA 4CVNA 2ZCVA 1PYDA 3IR6A 3FOCA 4MI1A 3ZDCA 4GH5A 2PMCA 2BFAA 1XLVA 1EM8B 1O3YA 2J5BA 1GRRA 2PRYA 4WLUA 1JV2B 1ZJJA 1Z4LA 5DB4A 1S9HA 4F72A 2V7PA 4EX6A 5DK6A 1O57A 1IEVA 2NO9A 1IZ9A 1DAHA 1PJCA 1MUUA 1OWOA 3IV9A 3W1WA 4C0KA 1UPTA 2DQYA 4LWOA 4FI3F 2YHUA 3HYSA 3ACDA 1FSSA 1NDQA 1TA0A 4AMBA 3RJTA 1CJKC 2P0EA 3G8YA 1GILA 3ESCA 2A5GA 1VZ3A 3U4QA 3F2VA 4X0EA 4XQEA 1EESA 5IJ0A 1RM5A 4UEKA 3RGGA 5MN5A 2QLJA 2GRUA 3NBUA 2O0KA 3WSWA 2XDYA 3PC6A 2Z3VA 3QELB 4I0WB 4RK0A 1HH4A 2VDNB 3AIKA 2HMSA 1CDOA 3GRCA 4QYIB 1OX4B 3C85A 1YHYA 3H9CA 4DQKA 5JSZB 2XE4A 1NVVR 2QRQA 3BERA 3DAGA 5CTJA 1OYWA 1DKRA 1V26A 1W1WA 3QMMA 4JCCA 3TQTA 5FKJA 1BG6A 1SCJA 4D3YA 3KFVA 2OXTA 3G2PA 4H60A 3QBTA 2QN8A 4NZOA 3SBEA 4UM9B 2BGRA 1Z0IA 2W2MA 5T7BA 1M0WA 1JXMA 4REQB 4KWHA 3LXRA 3OH8A 4AZWA 3U4IA 1EUCA 1KGDA 1HK7A 4CMGA 4KN8A 4QUHA 1Z0AA 2AJCA 4FJ2A 3TLYA 4DSOA 1P3JA 3FAZA 1R0WA 3DZCA 1NX6A 3L7CA 1Z06A 4DBLC 5DMXA 2DFLA 2Y6UA 4H0NA 4CIAA 3OHMA 1NRXA 1XCOA 1NWHA 3M3PA 1FFHA 2G08A 4R2IA 4RA6B 1P9WA 4BX2A 5JJ5A 2A84A 3F7MA 5JC8A 2RK3A 2P5TB 3L01A 4JD5A 4W5RA 4Q4AB 3JPWA 1GSHA 3P9PA 3CC8A 2J30A 1X92A 1IZZA 4GPBA 1H2RS 4HYTA 1JJVA 3BBPA 1QH1B 4L4YA 3M89A 4R05A 2HOQA 2R79A 4CV1A 2WI8A 3DEFA 4KYVA 4BJHB 5JECA 4RS4A 4CDRA 1A1VA 2QAGA 2V8OA 4CL2A 5SY9A 4PCUA 1PGNA 2GO7A 1ADFA 4MQBA 2CLEB 1KEKA 1CRLA 2QRMA 4YP6A 3FWKA 1T3TA 3DV2A 3VR0A 2D1FA 3G68A 4LHEA 5LOVF 4CKBB 4F04A 3IVGA 4IIUA 4LYYA 1AZLA 3QVGA 3I83A 4J76A 2PGDA 4EA6A 1QORA 1NW5A 4RFVA 3L18A 4D3DA 3ZLUA 2ZT7A 2A78A 2NQ8A 1B93A 2F7SA 3RTGA 4I4LA 5IEJA 2OLKA 3EGDB 3R3WA 4LXHA 1T3HA 4NC9A 5CA0B 3FWYA 5E2AA 2R97A 4AWXA 3VO2A 4N18A 1F0YA 4KQ6A 3V6MA 3LV8A 4YMGA 4I9GA 4M0LA 1R8JA 3ADCA 4OV6B 1FTYA 3CHYA 1Y9DA 2FKNA 1ZUWA 5EJ6A 4NI5A 3INGA 1MOQA 5C53B 1BMTA 1YBAA 3D6HA 3Q3CA 4KODA 4CKWB 4NE9A 1GZ4A 3AEYA 1BN6A 4YCMA 4K88A 4CM4A 3OLQA 4RH3A 4DJ5X 4JX9A 4ZAXA 4LE2A 1GTRA 2J46A 1E9RA 1T0HB 3ZIUA 1TZKA 2PWZA 4J91A 5EMLA 5BXYA 5H16A 3Q1LA 4WCFA 3C3DA 3WLOA 1QTQA 1D4OA 5HRAA 4D42A 8GPBA 3NHJA 5LA6F 3OUTA 1ULAA 3VR6D 4AN1A 1OVMA 5EVCA 5AW0A 4IILA 3U4GA 3OX1A 2AJBA 4EQZA 2O0MA 2PU7A 4GSLA 2NSYA 2NIPA 2P65A 3EIEA 4RO0A 5JQGF 3CLRD 5M29A 4EJSA 2PXAA 4HUQA 1XZJA 2Z4SA 4G41A 4KACA 3I64A 2R7NA 3HA3A 3JRXA 2UZ0A 4OK3A 4AMYA 2PO5A 3HU5A 3O74A 3ROGA 4B7XA 1Y9EA 5ARDA 3U17A 4MVCA 3OTIA 3GJZA 3NKVA 2CDCA 4AB1A 1S2GA 5AW8A 1LBEA 5REQA 1G6KA 2HTEA 5KS2A 1N9GB 2W48A 4RQBA 4JITA 2WFMA 3EF1A 3JQQA 3NNDA 5BWNA 2CLOB 3I9KA 4H3VA 1F0PA 3WLNA 3ERCA 2IXEA 3GO4A 2J6HA 3SGLA 1M1ZA 2F2TA 2ROQA 4RMIA 4L4UA 2HF2A 3D3NA 3LQKA 3ILSA 3Q88A 3N0RA 5I8WA 2Q1TA 1OA1A 2JGRA 1PTKA 1W8IA 1XRRA 1E2MA 2FV8A 2Q6OA 1C9NA 4EY6A 2B7BA 3MILA 3OM8A 4MB2A 1L7PA 1OZGA 1TUBA 2BFBB 1NVEA 3BE5A 4NCXA 4PRKA 1BWSA 3A1VA 4R68A 4U6NA 2AR0A 3DBRB 3FJ1A 3WO0A 3DNFA 5CW1A 3IHTA 2QRKA 3K9CA 2ZIZA 4QVKA 2CVOA 3KOWA 4R1QA 3OEYA 4X8MA 1XDDA 3UHJA 1KIFA 3R40A 3ROEA 5AUNB 4KGXA 1XD9A 2ODNA 1G5IA 2X4IA 2ZTHA 2OO5C 2XSZA 1Z9BA 3FIJA 3OPQA 3PQ7A 4FYPA 4K3UA 3ZGLA 1Y8QA 5EJ8A 2BKVA 1SCUB 3AXTA 4QHTA 4UCXA 2HADA 1H2ZA 1LNZA 5AW5A 3FVQA 3DYIA 1T0UA 1E1RD 1RHQA 3H87A 1N2GA 2X41A 4FFRA 3V7FA 4BLQA 3L6DA 4KQWA 2DGDA 3WZMA 5JS7A 2A59A 2BCEA 2FEPA 1JDNA 2GZHA 4TRRA 5DSZA 1AT1A 4F2PA 1J99A 3ECSA 2ZM5A 3OC0A 1R66A 3M5CA 4GP6A 4HXFB 2XE8A 5IJAA 1GNVA 1PJ8A 4GRIA 4UOEA 1C9YA 3FHCB 3ML1A 2QX4A 1JLMA 2R65A 4MV0A 2PMFA 4DJJA 4EGFA 4HVCA 2ZRQA 3KFXA 3LT0A 1PQUA 3PJRA 1X0XA 4ZJPA 1Y8AA 3HFJA 3EXHB 3NC0C 3KXLA 4N39A 2XXBA 5AHRA 2C8JA 4CTMA 3KQOA 3C70A 3UAZA 2G5GX 2HMTA 3OZEA 4GWKA 4HDMA 3REOA 3ROQA 4A0HA 1Z5WA 3ZDDA 3N2GB 3ND8A 4RDXA 5G2OA 4WOCA 5BUZA 3UMJA 1W5TA 4M0EA 2C3OA 4Q16A 4JI1B 1XNQB 1LRJA 4HWPA 5FTKA 3THYB 1IE3A 4JP3A 1R0ZA 3KQYA 4B46A 2WP8J 4Q3NA 2VWQA 3VX4A 1CERA 4KIUA 3N6VA 4QHSA 1N5RA 2Y6VA 4I1UA 3ETGA 3AHCA 2WTXA 2DR2A 5I3ZA 2AGVA 1U2EA 3COVA 3DV9A 3EDQA 3FMIA 5C4GB 5HVNA 1PZFA 4LRQA 2FSUA 4XM2A 2IPXA 3BRQA 1XROA 3PXBA 4NMWA 4U39A 4YDQA 3ICVA 1UPUA 2QLFA 5J4VA 3KZCA 4QTXA 1BVUA 2ZZMA 1ZNYA 4NOMA 5MF6A 5B2ZA 1AKNA 1UIMA 3S1LA 4NABA 5B6PA 5MFZA 3RG2A 2ZRIA 2GZRA 3M6AA 4PLYA 3PIIA 5LP6A 2REOA 1KJYA 2NG1A 3HU3A 4LHZA 5LZ8A 3O83A 1AD2A 4WADA 3K2EA 4K9KA 1A50B 3EGXB 2ZJ8A 4B4VA 3L7AA 4DCPA 1RCUA 1C30B 5IEBA 3RS4A 2RARA 2GFHA 3BK1A 4C06A 3EMDA 3RVMA 4OI4A 3TDKA 3OX3A 3I5XA 3VUEA 1DHTA 2CJXA 4YH1A 2BTEA 5ALOA 2P0YA 3JAWB 4DMMA 1P5RA 4JNCA 1JKXA 1JQKA 2DSNA 3FDXA 3IODA 3IP1A 3SZRA 2OD7A 1RRKA 3T9AA 2Y0BA 1LNQA 4PYIA 3JYNA 4UJ5A 2QMUA 4KOEC 1GT6A 2EFJA 2FAXA 4ZYXA 2IYYA 3K0HA 4HLUC 4DV0B 2V0GA 1N6KA 2IZ7A 1I7SB 4RVSA 2DJIA 1M83A 2YW2A 3ABIA 4G56A 3DKVA 1RI5A 1GQYA 1VPLA 2J5KA 2JIMA 1V8DA 3WK4A 4BHTA 4PGGA 3D2CA 1A8HA 2BJWA 1AZTA 4TLLB 2DBQA 3T9FA 5AHXA 2YVKA 2CDRA 5GVRA 4OCZA 2PT5A 3CFYA 4FT4A 5BSWA 4YV7A 1U81A 2GPNA 1L5ZA 2YVLA 2R60A 1JNXX 2BBTA 3EQ7A 3O2SB 2JI9A 3OKFA 5ES4B 3A6PC 4CHGA 1E3QA 4RWEA 3H16A 3DF9A 3UJAA 1U4NA 3KBOA 1QF7A 4NE2A 3V4PB 4KBGA 4FNOA 4I66A 4X65B 3H75A 5A4AA 5LU9A 3CVVA 4YR7A 1SIUA 3SKYA 3LKBA 3G1UA 4QOFA 2JZCA 4FFBB 1M7HA 4C2UA 3C5CA 4NYJQ 3HBAA 1K2VN 1W5FA 1WSDA 2GOYA 2GSDA 2ZUWA 4BFXA 3NYWA 5IVDA 1EQAA 1OBVA 1XGKA 3OPYI 1DC7A 1UH5A 2XAUA 4O2AF 4TZ0A 3E58A 1K7CA 2XXAB 1YZ3A 4YREA 1VIVA 1LA2A 2QT0A 3CLTC 1ZNWA 3DO5A 3QU2A 1IULA 1EA5A 2BF7A 1F4LA 1JN0A 4OQMA 4ZGWA 4AYTA 5PNTA 1WW3A 3LUJA 2JD2A 3FOAA 4H1TA 4LXYA 1T3GA 1ZD9A 4QIHA 2ZYSA 4P7JA 2SCUB 3WP1B 3K9QO 4NMMA 1AGYA 1QFSA 2HCTA 1TZCA 4CCYB 2RGYA 3H8VA 1OH8A 1FTWA 2WABA 2K7FA 1RMQA 3QEBZ 5AK0A 4DCNA 1Y3HA 3GFFA 2WD9A 1H8HD 5EIXA 1EHYA 3WAJA 4FOPA 1X7YB 3PNLA 3ZGZA 1HC7A 5EWJA 1CY0A 2OZVA 2OL4A 2XYRA 3V7UA 4C87A 1YKSA 3T5CA 3WRYA 1VOTA 1K08A 3GRKA 1OFUX 3BH0A 1E77A 1XU9A 4Y7DA 1G8GA 1CY8A 2RHBA 2ZVQX 4L7QA 3RVLA 4OY3A 4M0CA 5CHYA 4MRVA 3OU7A 3GLUA 5EZYA 2VP3A 2YWHA 5F98A 2X1HA 1C41A 4PANA 4EGCB 3LNCA 2EGUA 4YRNA 5EHXA 4MQ6A 1CUUA 1F2TB 2B9EA 3LCVB 3LZCA 5EYPB 1FFYA 1HDCA 1RFLA 4IS2A 2ZJ4A 3HU2A 4TLMB 2IITA 2UZ1B 2IC5A 2HMUA 5BSRA 5CCEA 4LYDA 4MKGA 2Z5FA 3OZRA 1UZMA 4YGXB 1ZRNA 5BSEA 2EQBA 2FMUA 3SNKA 2VK2A 3U40A 1FYXA 4OK5A 1PF7E 1P62B 2VS1A 2XRFA 4D9HA 3ENVA 4W5TA 3WHKA 4UFPA 3DZIA 1AUVA 1KQPA 2Q3LA 4MMZB 1P45A 4EW6A 3PXEA 3J7AC 2GK4A 1UM9A 1X9GA 3A6DA 2VN8A 3LSYA 1K5GA 3E3OA 4EFNA 2LV8A 3D81A 3GDWA 5EIHA 3ZWPA 4B79A 2ZRNA 4P38A 5LIPA 1HSZA 4MLPA 4R69A 1JDSA 2W70A 1RYZA 1Z39A 3GN2A 4BE7B 4LJLA 4F85A 4EOGA 4YQEA 1U9IC 2BTOA 1SRQA 2R47A 1QE5A 1PJTA 3MRSA 3KR1A 3CX4A 2O6HA 4GL4A 1MRZA 1QHXA 1SUWA 4KO2S 5BQ5A 2QD4A 3L4KA 3TPCA 5EHQA 2POCA 4PHGA 3LGAA 3DFUA 4WFQA 1YMUA 1OROA 1A9PA 1OUMA 2IODA 4E07A 4C4SA 2XZLA 3C7KA 4OUKX 2A9FA 1WNFA 1MABB 3BTVA 1MOSA 3A4VA 3N59A 1XJCA 4FXOA 2YWRA 4GMFA 5HA5A 3UJ6A 4P98A 5A5GA 1LKZA 3E5MA 4OHFA 2QDXA 1NUSA 3CZ4A 1TTTA 3DBHA 3SZLA 1DFHA 1G20E 3R7DA 1AS3A 3QXHA 5E2IA 1SUSA 1LK7A 4G23A 1TNDA 3WWYA 3NUQA 4N48A 1RWBA 1VPEA 2WR8A 4E32A 3KSAC 3UKDA 2C2XA 4IVNA 2IOFA 4IMIB 4CLRB 3AHDA 5IDYA 3WBJA 4WDRA 2I78A 1F3OA 1JU9A 3IUPA 3G8AA 1LLUA 1RLJA 3N5CA 3I45A 3LUDA 1FDOA 4QXMA 4HGZA 3LBYA 4PLWA 1SPBS 2QLMA 4DLRA 2VDWB 4E0BA 2RKOA 5GJWC 1JR2A 3I1IA 4OO3A 3SU8A 1D6SA 2QU7A 1USKA 3ZIAA 1XG5A 3OQ1A 3WA6A 3BWYA 3I1JA 2CD9A 3KKPA 1P5JA 3AKDA 1DARA 4BNGA 2VTBA 1BXGA 1USIA 2PVPA 3WWDA 3GU3A 2ZK7A 3H9JA 4J0JA 1Z36A 5G0UA 4YRPA 3I62A 3RIYA 1EAMA 4KAFA 1O87A 4L0MA 5ARBA 5HP4A 4J1QA 3T5MA 2AR9A 2QW1A 2PZFA 4B35A 4DFDA 5DXJA 3KBBA 3GH1A 4KL8S 2D3WA 3UOAB 1QZUA 2V59A 4C0JA 2ERYA 3Q10A 4G0ZA 3E0QA 1DDGA 2B8WA 1MOPA 4WZBA 5CEFA 5F1PA 3FNEA 3HO1A 2WF5A 3JD0A 2Q5JA 4W7HA 4YECA 3TWOA 3ADBA 2CCKA 2DRIA 3A06A 1RTKA 2I3GA 3EJWA 3DC7A 2R6GA 4PLZA 4PYKA 2VAMA 4ZVSA 4EGAA 1GA1A 3SXUA 4R1LA 2WKSA 3C16C 1SAYA 2FUCA 3DGFC 1UBJS 2F4NA 2Y3IA 5CK4A 3F49S 2OGTA 1P5HA 2OHXA 2PTHA 3V7YA 5CLJA 2Y0CA 1VSQA 1SM4A 5F5NA 4CTOA 4FC6A 3EYAA 1P2GA 1OLUB 5H70A 3NC1C 3RBVA 3H1BA 5B4VA 4FYHA 1W2GA 1AQNA 2PBFA 3SQDA 2PWBA 5J5AA 1NFRA 4FDTA 4LVOA 3RRYA 1QJCA 3GGPA 3PQFA 4URUR 2JI4A 3ESQA 4ZCQA 1QHFA 3ESAA 1QC5B 5J4LA 2A5FA 3H11A 3VNVA 4Q3AA 1R6UA 4G9BA 3N0VA 2AZTA 2ZITA 1YIAA 3IPLA 1MX3A 2GILA 2LPMA 4GI1A 3B5IA 2ZZKA 4YONB 2CHFA 2WIFA 3MRVA 2IYXA 5KHAA 3IQIX 3GLHA 5EJ2A 1AN0A 4G63A 2RDMA 1NYTA 4I50A 3WLMA 5JVDF 5IVHA 1GL9B 5ALTA 1VG8A 2GBGA 2HB6A 4NULA 4DGQA 3RYHB 2W93A 5HKOA 1ESDA 3UUFA 1HDOA 5D7NA 3PNVA 4ZYUA 2YZMA 3OTWA 1GDTA 4KFRA 3HCAA 3B51X 4PZLA 4DLAA 4JL5A 4HZUB 1VKZA 3KTFA 2OTCA 3KQSA 1QRRA 1SU8A 3AQIA 3LY8A 5H9VA 1ML3A 3AU8A 2DHRA 1ZU5A 3DE5X 4RW0A 5KQPA 3GRPA 3IOBA 4AZ0A 5EJ9A 5IS2A 2C20A 3MK31 4IOLA 1WHTA 1I14A 4UMEA 4C5BA 3O8OB 3OPYA 1XK7A 4OAPA 3X1MA 4Z3KA 3LHKA 2P5UA 5A6SA 5JH7A 1EFDN 1CPYA 2ZAIA 1QX3A 5EWMB 3HLYA 1ANKA 3OJXA 1Z82A 5E1OA 1Z4NA 4N65A 3UJHA 3UUEA 4DCGA 3DQPA 3FUVA 1ZSVA 4PWZA 5LDGA 3TZQA 4F56A 1JT2A 1M1NB 1A4XA 3ACCA 3HP1A 1IRIA 1T9ZA 2OECA 3PUXA 4EKDA 4TTPA 2C3YA 3B1XA 1MFZA 4NZYA 3RREA 2X2PA 2IW3A 5F5XA 1Y81A 4RPHA 4RLSA 1TOAA 2IYQA 3CA8A 4MA0A 1JDPA 4YMSA 4RKFA 4P32A 1ST3A 3AR4A 3TLMA 4JC0A 5IJZA 4DR3B 4UM9D 1CYEA 4JT8A 1FP4B 3TTYA 3PGKA 1I4WA 4ED9A 4EHAA 3EXFA 2DECA 2NTNA 5NULA 4ARCA 2G3YA 2ATVA 1V6SA 1T8SA 4KLRA 2O8EB 3RAJA 1QRAA 1E5VA 1R10A 1XU4A 1N92A 2FSHA 5DGDA 3A6FA 2AOTB 1HTTA 3VHLB 3BWCA 3LVBA 3Q3IA 2I8LA 3MTIA 5AW3A 4KXVA 3GD7A 2PSEA 4NJOA 1W25A 3DSRA 4FR0A 3NIGB 3JQ7B 3PZRA 1Y6FA 3P8ZA 1Y9AA 3ETEA 1O6FA 2XUZA 3UT5A 3T5TA 1AGXA 1F14A 1DDOA 3AEQA 1ZIDA 3SQNA 1MHTA 2FRVA 3R3XA 5GP1A 1AKMA 2HRQA 2PS9A 2HUNA 3C14C 2C1XA 5JZ9A 4WTOA 1VCOA 2H2GA 1PVVA 3P2YA 3DYVA 3IFSA 2QZ4A 4TYWA 1WXDA 4QZVA 3ZR4B 5DM60 1QGYA 1RVDA 1GTL1 1HFEL 2EQAA 2N3ZA 3MXOA 4U5QA 4Y0AA 1L5NA 5A3SA 3GLGE 3M6LA 1MO4A 1SH7A 3CTMA 5I5GA 4MKRA 3R5HA 5JPIA 2I2DA 2JDIA 1IJFA 3WOVA 2B8JA 3BH6A 4OJYA 3PDIA 3E3AA 3E61A 4IHJB 1W0CA 1E3TA 5FFNA 1RYEA 3QBDA 5FR1A 5IMSA 3S28A 2ATXA 4W5WA 1BHQ1 2CXHA 1L6RA 5AYVA 4HAYA 5J2TF 4E46A 4GKJB 4V0OA 1T8UA 4O08A 1E79A 1G21B 1D8TA 1MN6A 5IH3A 4MNTA 4CEJA 4CMEA 1YIDA 1Z5OA 1RXVA 1JEQA 1O96B 1VMIA 1RLIA 2DJ5A 3UZUA 1XTVA 1E9CA 1II9A 1Z07A 1ZH4A 4JLOA 1A5TA 4KOAA 4TKUA 5IM4A 3PX7A 3WYFA 2C84A 1ITZA 3VYVA 4BKQA 3KO8A 1RCTE 3KQQA 4KYUA 2IOYA 2VA9A 1N25A 3EQZA 2BFDB 3E05A 1BXRB 2H7YA 2R6FA 3SHOA 1OTHA 5ENVA 2I4OA 2F17A 3AHFA 5FPYA 3ELUA 3QBJA 3RYCB 5AXAA 1XRMA 3TL2A 4ALJA 2A0YA 4HEA1 6CHYA 4FNAA 5FWXB 3UTDA 1OD6A 3E9NA 3KKMA 4S2UA 4D02A 1KZ4A 1N2ZA 4L9SA 3U5ZB 1DU4A 3LECA 2R6HA 3VOTA 3N7UA 2V7TA 2VBIA 1WB9A 3LWDA 3N2IA 5HZMA 1YQGA 5KWSA 1M2VB 4QVIA 1IJBA 3INTA 5A3RA 3JQ9A 2W6ZA 3KVNA 2P69A 1GGJA 1YUNA 2RKBA 4XXHA 4CI9A 5BMVF 3TSOA 2DQZA 4YRJA 1YFKA 3GF4A 3HWX1 3T3DA 1F9AA 2F8SA 2PRZA 2IELA 1EJBA 2OE2A 4E5MA 2CLKB 2Z8YA 4ZGBA 4ER0A 1INLA 3WGQA 3WYCA 4UCWA 3Q72A 3O94A 4J1NA 3AG6A 3C39A 3WV5A 5JCJD 4Q34A 2YIVX 2G72A 2YRWA 3UV7A 3LJKA 3E1KA 1H22A 3C0KA 5DOZA 4BKMA 3TFOA 1M2OA 5C1IA 4QPJC 2ONKA 5KYNA 3Q0TA 1DC6A 3VVBA 1L5MA 2QNBA 1E3IA 2GLTA 4RELA 2JPDA 2PSFA 4LYAA 5DYYA 1TFUA 5JEDA 4PS1A 3GL9A 1OHHD 1PD1A 3PF9A 1TVCA 4GF5A 4HQNA 2VTEA 5JZMA 1KDOA 4ZOLB 4M21A 4EMTA 5BSHA 5K0FA 2ZUVA 4UUQA 2WWVD 2HIGA 3PIDA 1JLHA 4XX1A 4G8BA 3ER6A 5KO2A 2Y68A 1EXVA 5L6MB 1NW7A 4FGKA 4L6AA 1CB7A 4AF6A 5KBYA 5CDYA 2ZRFA 1W35A 4RHCA 2WT4A 3K16A 4Y2SA 1HFJA 1VL6A 1YI8A 1QQ7A 2P1ZA 4X66B 3GT3A 1RBMA 3PC4A 3GFOA 5CGQB 1W1UA 1PV4A 4UTXA 5TJ9A 1F1BA 1Q3KA 3VU9A 4AJJA 4TS3A 2VXOA 2NQTA 3UAOA 3A9VA 4M46A 5E6SB 4QU0A 2GK3A 4A9AA 5JPDA 1QO7A 5L7TA 3BFXA 1V5EA 1Z33A 3DL4A 3K1AB 3O26A 1IOZA 1JR4A 2AG8A 2AMFA 2JFVA 3GPBA 2Y93A 3IAS1 4JELA 1IG0A 4XUEA 4LQDA 2P3QA 4NS1A 5ALKA 2B34A 2NVBA 3ADDA 2RKWA 1CS4C 4Q9LA 5D3MB 3WO1A 4HN9A 2VHWA 1Y5NA 1Y5RA 4MS4A 1KU0A 3IDFA 3KE8A 1KMNA 4URYR 3PT5A 5DM1A 4JOCA 1O5TA 3D1JA 3RBZA 3GV0A 1WCIA 4KUEA 3PT9A 4R54A 1YR3A 5DH9A 3QTBA 4I5GA 2ZBEA 5TGZA 4P8RA 4PSKA 4B75A 1X8LA 1TIBA 1E9EA 3A6GA 3EB9A 3UWMA 2ZRGA 3FCUB 3H17A 3FKSD 3GYBA 3PD0A 2ZIXB 1E6KA 3I3SR 3BF7A 2ZXUA 3WJAA 1IK4A 2JI8A 1PHPA 2QN2A 3AV0B 3GELA 3KPYA 3WB0A 1K7EB 2NYUA 3N75A 3FROA 3PDCA 3MMNA 4OHRA 4XB1A 3ZKWA 5KHOC 4MDEA 1B6SA 2I62A 2B2XA 1U7UA 1KFKB 2I6TA 1L7QA 4Q5IA 4TTJA 1JDZA 1QDEA 1D5CA 2HJRA 1G3UA 3I4LA 3OLXA 2W6IA 2G82A 2VZ0A 2UUPA 5AQEA 3FOZA 3AU9A 4XE5A 2BDUA 3FCEA 2ZJZA 3IHKA 4R0MA 4M87A 3IT1A 1FXWA 5EIEA 2L42A 3QXSA 3E1GA 1KP3A 1GUAA 3N53A 4FIDA 2QN9A 3LF2A 5JU6A 1J2JA 3A1NA 3K1TA 1LI5A 1E2FA 3ETDA 3BFKA 3O8LA 4RFSA 2GESA 3GRZA 2HW8A 4J16C 3VU0A 3ZHOA 4FCTA 1Y6GA 1L5SA 4MQ4A 4ZXFA 3A04A 2B21A 4H7PA 4RHYA 1VMDA 3ILVA 3O75A 3P0RA 4LMBA 3KQUA 1XDBA 2WJ3A 2GPTA 4GMXA 4YRSA 5HSGA 3QVTA 4HPJB 4G8DA 3ZJ4A 5MFPA 1RYMA 3I9JA 1U3GA 1NVGA 2WF9A 1BMFD 1QM5A 1VPTA 1ZGAA 1OJLA 3FHTA 3TNFA 3EIWA 5ALRA 3LVRE 1NP6A 1SXIA 1AKTA 2FA9A 2Q2NA 2R44A 2ODPA 1PR6A 1UC8A 1YQTA 3HP7A 3IP5A 3IVAA 3QA9A 1FF9A 2HEGA 3MOGA 3I9LA 3OSUA 4MRRA 4RE5A 1LSOA 4GRAA 2F1HA 4Y0VA 4YJHB 5TMDA 2BYTA 2PMKA 3ZJUA 2VF8A 3W3AD 2YWJA 2JLUA 5L4NA 4ZAYA 1CS0B 2JGMA 2NU9A 5K3FA 4MW7A 4RK4A 2ODAA 4QT4A 1JEAA 1U6KA 2OQIA 2XVAA 3AI1A 3KLPX 4R8LA 1YU9A 1ONBA 4C4RA 4C22A 1KY4A 3QSYA 5FL7A 1SXPA 1FS6A 1FSGA 4AYXA 4KIJA 2H5IA 3ELWA 2XOXA 1YZLA 1TLLA 4KXNA 1KQNA 4DB4A 5ENZA 2O8CB 2PV0A 3H65A 5GJCA 3AR6A 4UHEA 4X7RA 3FSJX 4ZO7A 3ZBQA 4ZRNA 2YFKA 3GARA 1UAYA 1H6DA 1NN3A 1AK2A 1U0OC 4JEUA 4LOLA 4TXMA 2YHBA 2Q4RA 1GA4A 3OICA 2RGNC 4OFWA 2XRZA 3KEOA 1QFMA 3UJPA 4N47A 2VQFB 1OILA 2WVJA 4FKZA 3D5QA 4M83A 4Y2GA 4E3WA 1Y34E 2JI6A 1CUDA 4HNTA 2YJ3A 1H2AS 2UXCB 1LU9A 1J56A 5IPFA 5H9WA 2H2AA 2DPLA 3GX1A 3HNRA 3OT4A 3M9XA 1AC5A 4EAAA 1EFHA 3JAKB 4FSHA 1TKBA 4EUNA 1LB1B 2ADFA 2I7XA 3URMA 4BVEA 2GASA 4C05A 2HQ1A 3A70A 1SC4A 1Q0PA 2AUMA 1G5FA 5TS2A 5KX5A 2W4MA 1HT1E 1SUEA 1TAUA 4PAGA 1CQWA 4BNJA 1Z2DA 3JTMA 1QMPA 5CA1B 3PP8A 4S0ZA 4ALNA 2J3MA 5IC4A 5CCDA 1AKYA 2CVHA 4BASA 2ZBGA 1CEYA 3IUNA 4WBSA 3RAEC 1MIOB 4MPRA 1R9JA 5DJ5A 1R5BA 4HDKA 4DV7B 5DO9A 3R7AA 2B8TA 4F2WA 4A2PA 2GUGA 2IF0A 3IRUA 1M5TA 4EX7A 5B6IA 5PGMA 1PE0A 2J9RA 3LQ4A 3H1GA 2FN8A 5DLPA 1RXIA 1GARA 2VJAA 2P2LA 3H5AA 1NHWA 1XA3A 1PJLA 1UF9A 2P1RA 2Q0HA 4DADA 1RLUA 3DMNA 3GW8A 3HDHA 3MFQA 3BGDA 2P6UA 2JJ1A 4RSGA 4KE9A 3HB0A 2JEOA 4C7BA 1KBOA 3CLRC 4KN5A 3K15A 1W4RA 2JGKA 1JXOA 5CLQA 2UU9B 3UK7A 1RJFA 3ZWAA 1RI2A 2TS1A 4EB6A 4J0EA 4OI0A 1WMSA 3L8HA 4DBLE 4Y2PA 2NUBA 3B89A 3FA2A 4DBVO 1FRZA 1ZESA 3GRVA 3PFIA 1VYUA 1CUJA 2AG0A 3F7NA 2I3BA 1V39A 1DS6A 1MAAA 3KAPA 2PFGA 1OLXB 1LC3A 3IQWA 4L5BA 4LYHA 3X1WA 5KHLB 3GP5A 2AZDA 3SVZA 1F6WA 3UG7A 2XGOA 1EG2A 1QV9A 2QTVA 3E70C 2IHKA 3K1YA 2HCRA 2KLHA 1W5BA 1MVNA 5ALNA 3AXSA 2FQWA 4DMFA 2ZDGA 4D6XA 1GJRA 4B74A 1GL6A 4XH9B 1Y98A 4BFLA 3QX9A 3I39X 2EOAA 1GYRA 1JBKA 3PU6A 2QZZA 1DWUA 2XCTB 1U9ZA 5SYAA 1BA3A 2GM9A 1T15A 1QZXA 2FR8A 3PFNA 4FYMA 4QBKA 4C3OB 5CB0A 3K96A 2F8TA 1I9CA 1JSXA 4Q3OA 2ODQA 2ZSIA 5C8XA 5HE8A 4XEHA 2W6CX 2XW6A 4E5DA 4LSWA 1TAGA 2QU8A 4WOJA 5ALEA 1VLMA 4JN6B 1KO5A 3LX4A 2QTCA 2F3PA 2OORA 1IEWA 2QZJA 2EWWA 3I34X 3I9OA 3EIOA 4N0PA 3DGEC 4TMYA 5G02A 5LP6F 1N1DA 3ZJTA 1WZNA 1K4KA 2O20A 2HHCA 4NEQA 1P5ZB 2IWHA 9ABPA 3LYUA 1I5OA 2O2GA 1G7RA 4BNYA 1W36B 3CG0A 3KSUA 3P27A 1FJXA 3HDGA 2WJAA 1PYOA 3CNLA 4KIFA 1U65A 5FLEX 4CRWB 2I66A 2OSVA 4NNJA 4RJLA 2FVXA 2PX5A 3AJEA 4O4JA 1JMYA 4QXRA 4POAA 3F6EX 2IEIA 4YNBA 2B4QA 1IEQA 2IH4A 4Z1MD 3WGYA 3AZOA 2WZBA 1KETA 1P2SA 4H77A 4IJKA 4RX1A 3AHGA 4ZVKA 2ZJ2A 4NFYA 1BCRB 5HKKD 5ICGA 2YV4A 3LO5A 2XUFA 4ETNA 4K28A 1BN7A 1H2YA 2PKRA 1IM8A 3B2EA 4MGHA 5DYNA 4D2IA 2QYSA 1B15A 3Q8MA 3PQ8A 1PBNA 2ZBFA 4YHHB 3NANA 3D6NB 1TMKA 2XF2A 4IRXA 2ESRA 3TGPA 1XU7A 5AICA 1BD4A 3R0JA 4II3A 1PFYA 3E53A 1KAOA 1E2KA 1LJUA 4AQ7A 3U7GA 1DQRA 2E9SA 2I71A 4FWBA 3G7NA 3Q7QA 4QRIA 5BUCA 5E9WA 2CC2A 3U3MA 4K0KB 2Z4RA 3IAUA 4GYWA 5IDQA 1K6IA 3USZA 1AHHA 3EEYA 3F6SA 2NZUG 3KYDB 1I30A 2B4AA 1VCHA 4KAJA 3W5JA 4B09A 4BLUA 4C6TB 1QP7A 3TMYA 5UKDA 1RHRA 2H4FA 4WACA 4YTEA 2WSMA 3A1TA 4LJAA 1WRBA 1S3SA 2FSSA 5CDFA 3JZAA 1H4QA 3LQFA 2AI2A 1UJNA 2YN4A 1CUHA 2EP5A 1C3VA 4GM0A 5CA0A 3AFMA 4MS3B 2Q2QA 4AK9A 5KYXB 4UVEA 3K71B 4R1TA 3BB1A 3O82A 4BJ1A 2AOUB 2XX3A 2C7PA 5DHQA 4IJ6A 3RIXA 2DF8A 2IYNA 2XITA 5FFFA 2LTAA 3EXG2 3W5SA 3OZDA 1U11A 3RS7A 3ISTA 5JMPA 3CPHA 2V6IA 3PQEA 2O2SA 2WAOA 4JB8A 3VNRA 5HXAA 1P72A 5ADWA 1L3BA 2G9UA 3AOEC 2C57A 1JLKA 3TCKA 4YWHA 5L53A 4BV3A 1U0SY 4C43A 1OTYA 3OEEA 4XDGA 1S4QA 4RD1A 4M7WA 4WNIA 1YZGA 3LKZA 1V4BA 2AZMA 4JL6A 3UFXB 5DKFA 4B0OA 3LUBA 1LBSA 1Y7PA 3AVWA 4Q7EA 3NYRA 4XCXA 4XYMA 3X1ZA 2I6XA 3I8OA 2DVMA 4MDYA 4RYDA 4UATA 3T0IA 1II0A 4AJIA 1H1TA 5CFMA 5FJIA 4R3UC 3AP2A 1PJSA 2Q5LA 4ZCIA 5E7MA 2BF4A 1P6UA 1XN4A 1W1IA 3PPYA 2BCJQ 1EFVB 2G1AA 2HK8A 2A94A 2N75A 4FFSA 3WKAA 1QHHA 4QOSA 5CVVA 5DXFA 5EZYF 3WGOA 3ZH9B 5TLSA 3HKBA 1GOTA 1JHXA 3UPDA 5EIAA 3X43A 3OQOA 4Z7OB 5F78A 4TTIA 3MJEA 5DASA 4EHHA 4IXDA 2F3SA 2YXLA 3AYZB 4LN1A 2GPAA 2XJ4A 4PHTA 1Z8DA 1D6NA 2GM3A 4DNPA 1BMQA 3DE1X 3U37A 1J33A 2JS7A 1KKMA 5CVDA 2QE7A 1XZGA 3A4MA 1GZ6A 2J6BA 5IUNC 4Q18A 4KNVA 4BRZA 5B58C 5C7IO 4AUMA 3ZI0A 3R3VA 4FSXA 4Q7LA 4U0JA 1VC2A 4Y1GA 2DWUA 3NWEA 4POOA 5ANRB 1CR2A 2BHSA 5WRFA 4YRKA 5AESA 2XZTA 2QORA 3I01M 4BEVA 4G01B 1JNYA 3U3JA 5KTRA 1FMFA 1D2GA 1EVJA 5CXSA 5HMMA 5L3RA 4BGIA 2H1WA 3RU9A 4Q93A 6AT1A 2OGZA 4E5YA 1NBMA 3DHYA 3MTEA 4FK8A 3ZJ5A 4AJPA 4RD6A 1AOXA 2QSZA 3IP3A 4WKNA 2JFUA 4IDAA 3IP9A 2X1MA 3O3CA 1WXHA 2EJVA 2X9QA 3TZ6A 2J4FA 1A5AB 1X70A 4S1PA 3QJ5A 3RTCA 2WTNA 1UXHA 5HFJA 2BHLA 2JFOA 4BBZA 1QBKC 1W2WB 4R6XA 1U2RA 5EZQA 4FX5A 5ESRA 3ZCUA 5KKCA 1SBQA 3GFTA 2PX3A 4DNQA 4ID9A 4GWGA 4Z1OA 3PNQA 2DFDA 1DC5A 1VHTA 1N6HA 2EP8A 1V7PC 3HMKA 4FYXA 4Y6PA 1QIEA 3OQHA 2FKAA 5A9RA 2PRJA 4XVHA 4WJKB 3D54D 3V6LA 1B4DA 3DONA 1NJ5A 4HI0E 3K5IA 1C9JA 3U3XA 1X1CA 3PVZA 4V1CI 2MWMA 2IOFK 3HYRA 2HPHA 4Y2UA 5KVAA 1B8UA 1C80A 1M2KA 1ULTA 2GN9A 2QRJA 1XN1A 2O7NA 3F67A 4Q01A 3B1YA 5AKIA 4CMKA 4D9KA 1OFUA 5P21A 1QV6A 4MCAA 5BSMA 1N34B 3UGKA 1Y8RA 1NN5A 4M7PA 1GDHA 2XWBF 1MMFB 3OO1A 4GGPA 3A2KA 2JGDB 3SYLA 1EINA 2HWUA 2AC7A 3MN1A 4LWQA 1SQGA 2HSEA 1R0XA 1V1JA 2L17A 3PGXA 5K51A 2OMEA 4RTRA 2IS4A 5F2NA 1X80A 1QHYA 3NUGA 1T1JA 4KG7A 3ZY3A 1OQAA 2BTQB 2XLBA 3NPMA 1CQIA 4XW2A 3WKDA 3EWSA 3WLIA 3KUUA 2BN4A 4W9RA 3T35A 5KPDA 5A62A 1S2IA 1MZVA 5ENDA 5FBLB 1RC1A 4HH1A 1D2MA 1NV9A 5A05A 3ZX5A 4BLTA 2OUIA 2HHJA 4AO7A 4IHQA 1SC3A 1AKRA 4EENA 4AKIA 2JIQA 3IPCA 3UCEA 2BGLA 3GUUA 1EUDA 3KEMA 3QKSA 2PE5A 2HO5A 5M7EA 3HJHA 2HH9A 4P4NA 1BEZA 2VWHA 4NBNA 3X3HA 4EG1A 2WC1A 4L8GA 5KYUB 2Q3CA 1E64A 4X8HA 4BQPA 7MHTA 4NQRA 3JSAA 5LXTA 2HWYA 5AJTA 1VHWA 1I13A 1NG1A 2IZ6A 2NZVG 2A5DA 1PQWA 2ZULA 4OEHA 5SYMA 3BK7A 3CY6A 2J7PD 3MQFA 4A6DA 2QG4A 3NHLA 2FVYA 1IFXA 3KLBA 2XQGA 2VT2A 3N8GA 4D4JA 5JATA 5EP1A 3CS3A 2WJHA 3B20A 3IAM6 3PPXA 1YTLA 4A4DA 2WJJA 4E5UA 2CFRA 1TZ2A 2CEKA 4RF3A 2FWRA 3UUWA 4EPVA 2CE7A 2FPMA 4I50F 4IKPA 4LMRA 1OZHA 7REQA 4L2IA 4O4LB 4F3CA 2FXIA 1U0NA 4JC4A 2PT7A 1JKJB 3T3GA 5K0SA 3RT9A 1NVUQ 2Y92A 3TZKA 3T4PA 4V39A 1ILWA 1KJ8A 4K46A 1I4EB 3S99A 3P19A 3LE8A 4BLSA 2PY6A 1KC3A 1VMAA 1KL7A 2GEFA 4H7DA 4A8JB 3GJTA 2JK0A 2ZYRA 1V96A 1XZNA 2FWNA 4IIJB 4Q4LA 1VLJA 5CYPA 1HYEA 3WB2A 1G8SA 1JG3A 4KGDA 4PNHA 3T1QA 1P29A 3UJ9A 4P6VF 2IHNA 3KPJA 1I5EA 3SPXA 5BWBA 2PIAA 2IF2A 4BRSA 2M32A 3C5WP 5COQA 3GGDA 2GCPA 2EG5A 3FMFA 4TRJA 3GG2A 4IV5A 1JQDA 1D4AA 4RSMA 4FB5A 1RDFA 1VECA 2QD5A 1ECJA 2EGGA 2Z9BA 3PQ2A 3BWDD 4HAIA 4X97A 2EFDB 3UWDA 4CLEA 1NKVA 4B8YA 1WBBA 3ITNA 1U8XX 4PSDA 3VR6A 4YDHB 3K9NA 5EPUA 3P0IA 1EIWA 1U2DC 1EP9A 4DQDA 3H1FA 4JP8A 4YLGA 5I9BA 4NXMB 5DYGA 1PL6A 5I3CA 2ZPUA 4D9BA 1FBNA 2HRBA 2XOKD 2A5YB 3U3OA 2PDAA 4CMHA 1AXGA 1RWOA 1Z6YA 1Y33E 1L4LA 4D6YA 1JX6A 3CJTA 1M76A 3BMQA 2WQ7A 3C3JA 1GVHA 1RPAA 3CR7A 3EEFA 4MV1A 2FU5C 3O4FA 1E60A 4H3HB 5KTTA 3MD0A 4EKYA 3AB3A 5HUJA 4FHEA 2B0CA 3K05A 3PHJA 3D6MA 1UANA 2ZIVB 3OTQA 2PWYA 2XCIA 2EYQA 3JRWA 3WRYC 4UD6A 4FFNA 4JUDX 4A8HA 1T35A 2EKDA 4BLOA 3T41A 1U0BB 2Z1MA 3PG5A 2IL1A 4X8LA 2YS7A 2ORVA 1IN8A 1MHPA 3IQXA 4Q9IA 3GJYA 1O6CA 3RBXA 4AJOA 4BQOA 9LDTA 2GQ0A 2Y67A 3CO0S 4WSOA 4AJLA 1C7ZA 4DZRA 5D5HA 2O4CA 4FMCB 4A10A 3GGJA 1P9LA 5BORA 3PGJA 1D8AA 1QKKA 4M1OA 1U3TA 1P1FA 4PC2A 5FI1B 3TE7A 4ZPXA 2GRJA 1W4AA 4WVFA 3EK2A 3DLIA 1IRXA 3ITKA 4JBIA 4HB4A 3HWSA 2JLAA 3WWZA 1LK5A 2C9CA 3ET5A 5F77A 1NMZA 2Q4TA 2ZWAA 4AICA 1TYZA 1UQTA 5K0ZA 4Q9NA 3G1WA 3FPSA 3UEOA 3X1JA 1A88A 1I33A 1Z0KA 1S3IA 2VCYA 1T5LA 1CQJA 3VNAA 3T7CA 4WJZA 3C8ZA 1M34B 2O8NA 1U0HC 3LMKA 4LVUA 5EJ7A 1E1RA 2XOEA 3PLNA 1NVAA 2XB4A 4GYJA 3C4QA 1JB1A 4UXIA 1L5QA 5LZ5A 4YPVA 4K1LA 4F92B 1P3Y1 2WUWE 5AJXA 1DP4A 1UMKA 4GX5A 2ZB3A 4HATA 3F9RA 3II6X 3EOZA 5AKEA 1OXBB 4MKXA 2Z2ZA 3OAAD 4Z2YA 1F5SA 5IX8A 2RK6A 2YDYA 4WK0B 3CTPA 4TYQA 4TXLA 5IM4F 3KYCA 4GG1A 4M7RA 3EG9B 4XGRA 1Q3TA 4UAJA 3VI3B 1C3JA 2VLBA 4D9EA 1NXWA 3PCTA 1KAQA 4KWIA 4TL6A 4ZP1A 1QFYA 3DHNA 3INRA 2OESA 3D2BA 1V8ZA 4UD2A 4QA9A 1HDEA 2O4UX 4N5MA 4NBKA 4YAUA 2O8BA 3N2YA 2GWRA 3EUAA 4IRMA 4TSRA 2F1JA 2GGSA 4OBWA 3TSCA 4ER6A 5BO5A 2DFVA 3R8FA 1P80A 2AOWA 4W5HA 2A9KA 1Z35A 3RK0A 3MRTA 3ROFA 3OCWA 2NVUA 4MUKA 2IS6A 1RWMA 3UMSA 2E4XA 3Q9SA 4K8OA 1I7DA 4BU1A 3IQHX 4LWZA 1UIRA 1AN9A 3W9YA 2VRWA 4FCWA 3SQOA 1YQQA 3KWLA 3QQ5A 3PC3A 4V1CA 3E22A 4P5EA 4BU0A 4I36A 1P7PA 1AKEA 3ZGNA 4URVR 5LJIA 2O6LA 1FFWA 3NTQA 3BWBA 2BR3A 4J0HA 1PK7A 5TMPA 2PCJA 2RSLA 1BOFA 4NV3A 2W42A 3JATA 1GPWB 2G70A 4G1VA 4CLOB 1JWBB 2V6FA 1TK2A 3FB4A 4QUKA 3RE1A 1Y4UA 3NU1A 5K45A 2HBQA 3EC7A 1YNSA 4KGVA 4BMSA 2JIOA 3VA7A 4OMCA 1P2DA 1SURA 2VHJA 4CF7A 3KR9A 5AH0A 5JSYA 1R88A 4M6WB 4AC9A 4QQNA 2PKCA 2C42A 4OLFA 2X4LA 3L8ZA 3OQIA 1TYEB 3PX3A 2XGJA 3K31A 2BM0A 4QXOA 2HT6A 3OLVA 4Y6LA 4AF7A 4OFZA 2X5JO 3QE3A 4YXFA 4BVAA 3UWOA 1IL0A 6PFKA 3NASA 5JXJA 2H59A 3DE7X 3P2IA 2PO7A 3K0FB 3S2UA 1PR0A 5TT1A 1PJAA 1WZUA 1A97A 4DCTA 2WQ6A 4G0VA 2PNJA 3OX2A 3DPIA 2QR2A 3EXIA 3MGAA 2PNFA 2A33A 3CVXA 2FW9A 4LFBB 3EGEA 2GPYA 2IEGA 1WEKA 3QK7A 4KC0A 3EGCA 4I1YA 4HTFB 3WYGA 3R7WB 4CQLA 2GZ3A 1BE6A 4H4CA 4EFMA 2AR7A 4I1OA 1YZKA 3PQ6A 3PGVA 4FHGA 3HFSA 1ENOA 4AG5A 1F8FA 1MOZA 1DO2A 3AK4A 3V9PA 1CZOA 2WJPA 3AIMA 3KJQA 3IAAA 1RE1A 3GWZA 4IDHA 2H85A 4G89A 1TPZA 3SJ7A 3BXPA 1FFEA 3NVKI 1SZJG 3E7WA 1EDBA 3GJ8A 1OXKB 3AUJB 1AMOA 4NK4A 2VKTA 3GRRA 3V1MA 1DFGA 3AM1A 3RV4A 4J7AA 4DVGA 1YB5A 2R84A 3UF0A 3HUDA 5EXDA 5ALSA 3DCNA 4JU8A 5KJ1A 3Q7RA 3N7AA 2AG6A 2I7TA 3IQEA 2F59A 4L0CA 4BFYA 3PEWA 4NZ9A 2HZ7A 3QYFA 3MNFA 3G8CA 5AT1A 3DAYA 2A5JA 1AKVA 1HT2E 2BFNA 4KR2A 3VHXB 4YRIA 3R9XB 3F6YA 4LC9A 2QPAA 2ZVDA 1E7QA 2QI9C 5C8DA 2JFBA 1T0BA 5FB3A 2J67A 1ZCBA 5L51A 5IZ4A 1RAGA 3FSGA 2NU8B 3SQXA 2UVPA 3FRIA 3IXLA 1V8FA 4PYQA 1GRQA 1WDMA 2B4TO 2OQVA 1QGUA 4JAVC 1U0TA 3DE0X 3GBPA 4DMGA 3T38A 4TMFA 1ULZA 2DLCX 1ZH8A 4FW9A 5AP9A 2R8PA 4L9AA 1VI6A 4N5NA 5EE5B 1JPNA 2PLWA 1JA0A 2D1QA 5T8KA 4EQ6A 4YRRA 1WDWB 1CLEA 1JA1A 4ZCPA 5CFZA 1F2UB 1FXWF 3O0TA 3N5KA 3WYNA 1VBFA 2RB5A 3M9LA 3OM1A 4BCDA 2QXUA 3R3YA 1L5LA 4KJZA 1CDDA 3FTCA 1MW9X 3SICE 3U1VA 1UJMA 3B53X 3LHDA 3SMQA 1YQUA 3U26A 3EC1A 3UJ8A 2PKQP 3TYXA 3WQHA 1OF1A 2C8KA 3RFVA 2ZIWB 2QX8A 2IXGA 4QAJA 4ZKEA 1TTPB 1FQJA 1JHOA 1YE5A 1W36D 1OIVA 1VLLA 1LLCA 4V0KA 1KKUA 1NR7A 2NTEA 5J58A 1MVLA 3L0CA 1JWLA 1PHRA 4RJKA 4BTVA 4ANFA 4CKCA 4ESOA 2MSDB 3MWDA 3T0FA 5CIQA 1IB6A 1DIBA 1ZNZA 3KZKA 4F4IA 3E23A 3QLUC 1M2GA 1KS2A 3TCNA 1D7OA 1KSGA 1ZAKA 3EXHC 4QGGA 1D09A 2NYRA 4YRAA 3LX6A 5LYJB 4BVFA 2XBLA 1BS1A 4PPGA 2F90A 2EZ8A 1MP0A 3CKKA 5F9MA 4O4HA 3SX2A 2AFIE 3EGWA 4HQKA 5TRTA 2YY5A 4MGIR 1CUFA 3ZWKA 3JQ8A 2X4DA 4BX9A 1PGQA 1SIWA 4EKNB 3K4PA 5HIMA 1CR1A 3VR2D 2W00A 2IUYA 4OQDA 4PFSA 1DBQA 4YIKA 1FZTA 2A9RA 5A4JA 1R74A 2ZR0A 2AIRA 3PTZA 1MJHA 4YJ3A 1GAWA 3H2BA 3VFDA 4JVNA 1H3EA 1V5FA 2WJWA 4OKIA 3OBBA 2JLSA 4GLBA 4JU9A 3FDZA 1XMJA 5GGXA 3TLGB 3WNZA 4RD0A 1ZG3A 1CUBA 2BHRA 2QLTA 3LRTA 4JC8A 3WIVA 1L7XA 2Q99A 1O1YA 2NN3C 2ZWPA 3IYLW 5G53C 1OXMA 4BV8A 4KWTA 4PW0A 4E5VA 4XWOA 5A1JA 1G20B 4UZSA 5J59A 3VPAA 1T2FA 2XKJE 1DQPA 1GG2A 2VJBA 3NUZA 4UNIA 1YZHA 4RM3A 3V8QA 2FE1A 3AHIA 5HF9A 3AMVA 5D6OA 5K0GA 5LBUA 1K6MA 3LM8A 1T4BA 2GCGA 2JJMA 3GAAA 3L7YA 3MBIA 1ESCA 3M1AA 4RKEA 3AX6A 3VI4B 5IK2D 2FN3A 1N5MA 1A7JA 2UAGA 4ZYWA 2NZ8A 4C7KA 4Z51A 1UK6A 1Z0SA 3C4JA 2CLMB 4IIGA 3IB6A 2YQ5A 3NHMA 5KX5F 2G17A 1PWYE 1RZRD 2IEDA 3IDSA 4XEUA 2Z2KA 3MERA 1EDOA 4Z3OA 1YVPA 3MMXA 2POQX 5EMMA 2CUTA 2EERA 3DR3A 5C7LO 3LHIA 3QVKA 3M8KA 3ZDZB 2CLDX 3M7IA 3HLKA 5I9IA 1EJ2A 3EFOB 2VHQA 3PB3A 4ZOCA 3W4IA 3H3FA 3L04A 4XQ0A 3RUAA 5HE9A 1K8ZB 4NZZA 4A6EA 5L7WA 4W6QA 4IFIA 1LWOA 4YT8A 2H0RA 3R7LA 1J0AA 2WZDA 1GU0A 2GNPA 5I7SA 2NU7B 1IBSA 2VTVA 4TMWA 4YCSA 2JG3A 4FFLA 3LDAA 2ECFA 2CJWA 4HYQA 4KNYA 4TLDA 4YUYA 4O2RA 3HBMA 4U8GA 4UDXX 3K9WA 5JLJA 3BJZA 4MIEA 4URFA 1NUUA 2CL5A 4N7RA 4RABA 1LH0A 1O9GA 5LBTA 4CWAA 3LGSA 1AQIA 3HADA 3RUCA 4GZ6A 1QRUA 1DGQA 4PZCA 1LUAA 2J6IA 3DKIA 2BHTA 1G42A 1IDN1 3LIPA 3WRXA 3GVIA 2X13A 4QJIA 4UEWA 4OHOA 1ZFNA 2ZS9A 4C4OA 5FLKA 1LPOA 1QK4A 2HJ9A 4WASA 3ABSB 4H16A 1USWA 5ELXA 1Q22A 4BX3A 2Y77A 2EFEB 2Q0XA 1F4PA 4L8WB 5G4KA 4D9IA 4CDGA 2G07A 3EW9A 3HY4A 4K5QA 3SS9X