2QUKA

Crystal structures of human tryptophanyl-trna synthetase in complex with atp(putative)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
374
structure length
374
Chain Sequence
KGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophanyl-tRNA synthetase
publication title Catalytic mechanism of the tryptophan activation reaction revealed by crystal structures of human tryptophanyl-tRNA synthetase in different enzymatic states
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 125
structure length 374
sequence length 374
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2007-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2qukA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2qukA01
3INNA 1XNGA 1JEDA 4CDNA 3SYTA 4G5FA 1H1TA 3P0HA 4ND7A 5TEVA 1QRUA 3CVYA 1LI7A 5FO0A 1IQRA 1JIKA 1EFVA 3LOQA 2H2AA 4GU5A 5K0TA 2J5BA 1JMVA 1JZSA 3ND6A 3ZJUA 3DPIA 2A88A 4MWDA 1LW7A 3C8ZA 4KPUA 1NSYA 1PFYA 1PFUA 1OD6A 3K32A 1IQUA 1GN8A 3OTWA 1XNJA 4HPWA 2RD2A 4JYZA 3PNBA 3U1VA 2QJOA 1B6TA 1N2GA 1KAQA 3CVUA 4ZCPA 5LM3A 1WXHA 2QJTA 3GMIA 3UMVA 1O95C 4MUGA 2TS1A 1MC1A 1IHOA 5DB4A 4CDMA 1OBHA 2DR2A 3CLUC 3HZRA 1G8HA 1OWMA 3TQIA 1TQ8A 2XRYA 1JEEA 3DV2A 3UC5A 2C5SA 4H3SA 4MW0A 1N2BA 1PG2A 1LI5A 1PFVA 1VL2A 1O0BA 1IQ0A 1R6XA 2I1LA 1WQ4A 4EG4A 4RUKA 3ISJA 3BL5A 3ZUGA 4U63A 3IOBA 4MWEA 1OWPA 3D6UA 4MQ6A 3TZLA 1WXFA 2A1UB 1O96B 2NZ2A 1MJHA 4MAFA 3ZXSA 5HUHA 4L2IA 3AFHA 3FG9A 4YP6A 3CA8A 4YP7A 3LCJA 4EG7A 1WY5A 1NUPA 4QBTA 4I6EA 3RK0A 4MULA 3FNRA 3TNJA 1JIIA 4AS1A 2PZ8A 1V47A 5KCMA 3RHSA 1TYAE 3CVWA 2IELA 1OWOA 4ZT5A 1BS2A 3AG5A 1Q19A 4EFKA 3ILVA 4MVYA 1WJGA 4KR7A 1X6VA 2GOYA 1O0CA 1G8GA 3CLSC 1QNFA 4DE5A 3HMQA 3ND7A 2X1LA 2EJCA 1KP3A 4R2MA 4AQ7A 2YXNA 1H3FA 3VU8A 2X0KA 3PRHA 1R6UA 1P7PA 1N2IA 5KWVA 1QRSA 1YI8A 5LLTA 1MRZA 4MW7A 3JXEA 2DLCX 2CYAA 1MAUA 3ZJTA 4QRDA 3VRHA 2EL7A 1J1UA 4OUDA 2A1TS 2PG3A 3P52A 4ZCQA 1JIJA 1MB2A 3L92A 4MUHA 1TEZA 2DPLA 1KP2A 3MLAA 2OQ2A 4MW9A 1I6KA 4OJMX 4EF6A 2DXIA 1I2DA 1SURA 3S3TA 2OV4A 2J4DA 4YP5A 3QTBA 4J76A 4A91A 4ARIA 3COYA 1T9GR 2A4MA 1Q77A 1U3CA 2PFSA 1O5TA 2X1MA 3KFLA 2ZUEA 3P0IA 2QUHA 3SP1A 1R6TA 2DEUA 3IODA 4NDAA 4ZCRA 4I6GA 1O97C 2A84A 1M8GA 4DDKA 4FZJA 1QRTA 3MLBA 4DLPA 4EG3A 1N1DA 4JXXA 3CLTC 3QTTA 3A4IA 3FH0A 4MWCA 4MW4A 2QUJA 1XJQA 1A8HA 5IJXA 3X1JA 1MAWA 5HUJA 1N2HA 3RK1A 4ZT7A 1N2JA 2JAXA 2IJGX 1EE1A 1M83A 1NUUA 3TQOA 4KR9A 4MWBA 3ND5A 1ZH0A 2A86A 1IH8A 3IVCA 3IDFA 2H29A 4CT0A 1JECA 1QTQA 1K4MA 1I6MA 3FY4A 1EUQA 4R0NA 1K97A 1YUMA 1N77A 4MUIA 5DASA 1O6BA 4WNYA 2XRZA 1O94C 2R5WA 3CLRD 1U3DA 1N2EA 3SEZA 1TYCA 1J21A 1U7DA 4PBSA 1NYLA 1GTRA 4PY2A 1GPMA 1FFYA 4MW5A 1EFPB 2O5RA 1KH3A 4JFAA 4G6ZA 1ZJWA 1GAXA 3D6VA 1GTSA 4G5YA 5LFAA 4MW6A 1CT9A 1IVSA 2CSXA 1WZ2A 4PBTA 1KH2A 3ELBA 3N05A 3RJZA 3UK2A 1GLNA 1KH1A 1M8KA 1J09A 3FI0A 3G59A 1TYBE 3K9WA 1WXGA 3LE8A 4HK4A 1MOPA 2NSYA 1TYDE 1X8XA 2HZ7A 3ZXIA 2QJFA 1NI5A 1COZA 1KQNA 2BTEA 3MUEA 1F4LA 2QTNA 2YY5A 2DERA 3A2KA 1NZJA 4QREA 1EFVB 1T6XA 1NUSA 3IUBA 1I6LA 4KPUB 2CFOA 4MLPA 3PNVA 1O95D 4MVWA 3H9BA 4KKVA 4K03A 3G6KA 4MUFA 1N78A 4ZT4A 2CUZA 1J70A 4MVCA 2HMAA 3CLUD 2CV1A 4HJXA 4P2BA 2WQ6A 3COWA 3NV7A 2YWBA 4DJAA 1NUTA 4MUNA 1N2OA 1KQPA 1G8FA 1KQOA 5DK4A 4HJRA 3FHJA 3CVVA 1PG0A 4Q16A 2D13A 1N3LA 3HFJA 1VLHA 3P0JA 1MBZA 3NBKA 1OWNA 3DLAA 3AKZA 3I05A 3M5WA 4JZYA 5H7XA 4MVXA 3HL4A 1WKBA 3RFFA 1JGTA 4I6JA 4ARCA 3IUEA 1H3EA 5HG0A 1WQ3A 3SZGA 4K0RA 2Z09A 3IMEA 1UFVA 4DDHA 4F4HA 5BNZA 1KORA 2A1TR 3OP1A 1QU3A 3QE4A 4PBRA 1RQGA 3Q4GA 2BYTA 1V8FA 3COVA 1J1ZA 1ILEA 2A1UA 4ND6A 3TZEA 5EKDA 3N9IA 4L2IB 1NURA 2GM3A 1N75A 2J07A 3A04A 2WQ7A 2PIDA 2CYBA 5TEWA 3KT8A 3FETA 3CVXA 1OWLA 3HGMA 1JZQA 3KT0A 4MUJA 3CLSD 1M8FA 3E27A 3PNYA 3FDXA 3FWKA 1G59A 1T6ZA 2CV2A 4MUEA 2JA2A 4ZCTA 1YUNA 2QUIA 1WXIA 1F7UA 3F3MA 1GZUA 3UY4A 1QU2A 4JXZA 2D54A 2AZXA 5F23A 1XNHA 3ZJVA 2J08A 5H16A 1K92A 1H3NA 2ZP1A 2AG6A 2VTBA 3X1MA 2QTRA 1WOYA 3PXUA 2E21A 2X3FA 3IOEA 4DNXA 3ZGZA 4XFJA 4U7JA 1TFUA 4MUKA 4MW2A 3FOCA 3X1KA 4CQNA 1ZUNA 4ZT6A 5KHAA 3VGJA 1VBMA 4ZCSA 2V0CA 3N2YA 3GUZA 4XFDA 1QQTA 3L93A 2CYCA 4NAUA 2O8VA 4OUDB 1YIDA 2WSIA 3NBAA 3SZ3A 3UOWA 5J5AA 4R2LA 1NUQA 2DUMA 4EG6A 1K4KA 4EG5A 3IVXA 5AHWA 4X0EA 1U7XA 1OBCA 2E0IA 5K0SA 1S4MA 3MXTA 1M1ZA 5TGTA 1ULHA 3CR8A 1FYDA 1O97D 3AIIA 1YIAA 1EXDA 2RE8A 1EUYA 1EJ2A 4J75A 3N8HA 2A7XA 4S1OA 2PZBA 3CLTD 2E18A 3KT6A 4Q93A 4NX2A 3ZIUA 1PFWA 1IRXA 4ZT3A 4KR6A 4GRIA 2G36A 4YMIA 4EG8A 1T6YA 2QTMA 2HGZA 1JHDA 2GKSA 4YBRA 2PZAA 2PXHA 3H05A 2Z3VA 2V0GA 3H97A 3Q12A 2DETA 1M8JA 3G5AA 1IFXA 4U8HA 3SEQA 3A05A 4UZEA 3MMXA 1QJCA 4EGAA 1DNPA 1M8PA 2E89A 5TS2A 4EG1A 4F3RA 1O94D 3IOCA 2JANA 5DEOA 2WB2A 4NATA 2IP1A 2VTBB 1YULA 4DDMA 3RBAA 3SDBA 1Q11A 1VBNA 3COZA 1MB9A 4TS1A 4NZPA 5FNZA 3H99A 4BWVA 1JILA 1Q15A 4MW1A 2QUKA 3KT3A 4UZFA 3AG6A 2ZUFA 3IMCA 3HV0A 1EFPA 4XSVA 2B7LA 3GLVA 1Y42X 4ZT2A 3H9CA 1T9GS 2Z08A 4WSOA 1F9AA 1WXEA 3Q10A 5J58A 4RPIA 3FIUA 3CLRC 1ZH6A 1VBKA 1HYBA 2VXOA 1KKUA 2J09A 5FO1A 5JBNA 2CT8A 1F7VA 1O96A 5J59A 2CV0A 3TS1A 3AL0C 1D2RA 1U0BB 5IHXA 3IMGA 1J20A 1KR2A 3IH5A 3IVGA 4NAHA 4E1AA 1KAMA 2AKEA 2YWCA 3DO8A 1NP7A 2D5BA
chains in the Genus database with same CATH superfamily
4NBLA 3ZGNA 2C88A 1VGVA 3U3RA 1XZGA 5K0FA 1H1TA 3P0HA 1T9BA 2P5SA 2WKWA 3AHHA 4KQFA 4M88A 4EVQA 1QRUA 1KJZA 3VR5A 3T1YB 1AQUA 1UBMS 1EVJA 3HDYA 2IYSA 1KI2A 2YY6A 1EJBA 2Y1KA 4UCQA 1G16A 1PR3A 1GZ3A 2J5BA 2NVUA 1QO0A 3ICWA 3U44B 3BWVA 2CUNA 2GF0A 4NULA 5BW4A 2WT9A 4L7VA 1NSYA 1N0IA 2FN8A 1K75A 3AVWA 2GBCA 2TMYA 4QRHA 3IBTA 5CVJA 4U2FA 3V97A 4C6RA 2M6LA 4ZI7A 2EFCB 1CEXA 4QVIA 1Z18A 2OBNA 3RTCA 4JYZA 2DBVO 2B7BA 2G83A 3VPBA 4P0QB 3FA2A 4YV1A 2BBSA 1X7YA 3GMIA 2C5HA 3R5TA 3GW8A 2EL9A 2P6OA 4U2CA 3KZNA 4ENVA 5AVJA 3DOCA 1TZBA 1B74A 5JFTA 1JALA 4A2CA 1ZRMA 2RJNA 3GJTA 3NEPX 2UZ4A 1EX7A 1U8UA 3OWOA 1KI3A 3Q6MA 3TLGA 3IOYA 1EDZA 5FWDA 1A4IA 3BSYA 3G68A 3WI7A 5GINE 4DV1B 1EGVB 3U60B 3TTWA 5LMUB 4DBZA 4LF7B 1OXVA 2DMRA 4GMGA 2V7GA 4A16A 2H16A 3OZWA 2ONJA 3HJRA 4K6FA 2C1EA 4IJWA 1HDYA 1ZDMA 5IUNC 3L05A 1KZ4A 4BNDB 4PX9A 4BN5A 3F5SA 1KSFX 1S3GA 4HFRA 4JVSB 4MI9A 3IOBA 5CB0A 1DUVG 1XYVA 4IFTA 1YCHA 3GB9A 2QTAA 2V9PA 2O3JA 4C21A 1C30A 2WHXA 3WDMA 3PFNA 3CJTA 3JU3A 3QHQA 1NMXA 4U00A 3ZXSA 4DSUA 5D3ZA 5CFZA 4MP8A 4MX8A 3K71B 4IFIA 4L2IA 4YI5A 4F8JA 4TWBA 1DQSA 3B9RA 4Q15A 3T5PA 1OKKA 3BFXA 3RRJA 2Q9UA 2A78A 4PZZA 3WLAA 1F6WA 2OBXA 3ETCA 3DOEA 1XVIA 5DH9A 2JG3A 1JMKC 3DAYA 2GJ9A 1UC5B 4K2AA 3H8SA 5PGMA 1A72A 1A1SA 1UBSB 1ZVKA 3DE5X 2OYCA 4D3SA 4N76A 1GT91 3MS7A 3RSSA 3EIOA 4DNQA 2Z9BA 5B3LA 4ETWA 4I50A 1OWOA 1NPYA 2Z2IA 5CVUA 4CQMD 2QYHA 3I4FA 4MVJH 2R2AA 3AG5A 4TKZA 5EHGA 1NT4A 2YJ6A 3HWRA 1L7MA 3HVRA 5KSZA 1TUIA 5C8DA 4Y0NA 5JWHA 5MF6A 5FNVB 4P5PA 4WFQA 2BEJA 1O0CA 3FZQA 4JI1B 2BHNA 1XEAA 2PUBA 1G2QA 2RFLA 5DXJA 5C4IA 1N8KA 3DB2A 2EF0A 2KQUA 3CRQA 4RQUA 1IM5A 2YXNA 3PUHA 3UMCA 5JCPA 3C48A 2NO1A 1W19A 4C3VA 5DF1A 5JNLA 1YJCA 3VR5D 4CM8A 4C6HA 2NTYC 2B99A 1E20A 3BHJA 3D3KA 4KH0A 4WX2B 3PLRA 4NONA 4I0WB 4YCDA 5LLTA 3ER8A 4N5DA 3Q9UA 2QLJA 1NVMB 1QO0D 5I7VA 2HJGA 3IGFA 3RJMA 4WKBA 4PQGA 2ZYUX 3VRHA 2GPTA 3C1OA 3C1UA 1ICIA 3DBRB 4UTPA 3WLQA 5HZMA 2AEEA 1DKRA 4Q4HB 3SGLA 3WRWA 3UFXB 4JGIA 4X1IA 3OIUA 1TEZA 1KMNA 2B8JA 4ZXFA 3BTVA 2OQ2A 1TVCA 2HPAA 4H59A 2I4IA 4C7XA 1HL7A 1LUAA 1X0VA 3ZD9A 4XIFA 5BW5A 4YRRA 1Y6JA 1ZJWA 2BD0A 1CUCA 3OIVA 1I2DA 2IE0A 3G1UA 4IMPA 1WCV1 2Q45A 4YP5A 5D1HA 2PFKA 2XECA 3SYRA 1P0FA 3KZOA 5GZ6A 5BQFA 1KS9A 3GFRA 5FWYB 3LWDA 2WD9A 3EUEA 4RSMA 4KW7A 2O4UX 1PTKA 1EP2B 1T1RA 2VVTA 2PFSA 2ZSKA 3UV7A 3DBHA 4QU0A 5DHTA 1Z2EA 2OCIA 4LF6B 3B60A 1HEUA 1BAPA 2PUHA 4OXIA 4Q9KA 4ZHQA 4UUAA 3QKSA 3CWZA 2IZ0A 2A92A 3DXFA 4KZKA 5ICFA 5BR4A 3A1WA 3JASA 3MLEA 3DDZX 4QXOA 1XTRA 1UWVA 3ZWCA 1RRGA 3QX8A 2B4QA 1W46A 4GR9A 2PKXA 3P5BA 2BCGY 4RXUA 3RTDA 3T4EA 2WWYA 5EMHA 1FNCA 4XDHA 2WHYA 5KYKA 2CLDX 1SG6A 3RVLA 5BSVA 4DR2B 2YXDA 4UARA 3EXIB 4MW4A 3RU9A 5KCZA 4PG4A 5J1SB 4B6GA 3QJYA 5DMHA 4UW9A 3H2GA 4QTUB 1NT2A 2IZZA 3FVVA 4C0QC 2FRXA 3H2HA 1N2JA 4WY2A 3QI2A 3PPIA 5CAEB 1OKKD 4EAAA 4Z4FA 5BWLA 1YMVA 2RBGA 2ZJZA 1WHTB 4H3VA 3DR3A 1YZNA 1C0KA 2PGDA 3EOZA 4CF7A 1JR6A 1CYDA 1U2GA 1I6MA 1W8IA 1WVIA 1E1CA 1XCJA 4Q24A 4NOJA 1BWSA 1YUMA 4JR2A 5DBEX 1PDOA 4JJZA 1UPFA 3ZLBA 4CV3A 4M0FA 1U31A 4D8VA 1QQ6A 4ZKEA 1CVLA 4H31A 4MLCA 1YKGA 1AGRA 5TPWB 3SFZA 5KYNA 2F17A 1N2EA 1CD5A 5K0CA 1AHHA 3BXZA 4N4AA 2EQAA 2PPLA 1E6MA 3AHJA 4PX5A 4D80A 8LDHA 1P5JA 3L0YA 1TOAA 2HHAA 3KWMA 2O5RA 2Y67A 4BMXA 1ZU5A 1BEEA 2YICA 3IIMA 1J6UA 3EXHC 3QKRA 3BE4A 1K66A 1YAHA 3VZDA 5BSWA 3L7DA 3RASA 4MW6A 5C8YA 4LZLA 1NLFA 5DM70 1NNUA 1WZ2A 5D85A 5CM2Z 3MJSA 4XYEA 1WCYA 4OPMA 3E6AA 2G88A 3ETGA 1PX0A 3RJZA 3HUFA 4BAGA 3X1XA 2F9MA 2QN3A 1YQQA 3JAMA 1YQXA 4NBNA 2JBAB 2G5CA 4Q3NA 4BOYA 1CF4A 4DSAA 3PI7A 1LH0A 4DQKA 1NQOA 1DE0A 1P4HA 5FR2A 1U8XX 5BN4B 2Q50A 2PZFA 5JAQA 2CHEA 3M5DA 4FOLA 4HL6A 1EDEA 1I24A 2E6UX 2NV0A 1E1KA 1W0JA 1W76A 2OT3B 4R4JA 4ARSA 2OBFA 4BO9A 4ZALA 4UEJA 3L46A 2CW5A 2QP4A 2X4LA 3C8MA 3P4YA 4KFTA 3M3DA 1EUDB 4B43A 5JO0A 4N7RA 2ARKA 1W1WA 2A9PA 4WOKA 2UVPA 3RUHA 3WRYC 1KO8A 1CHDA 2XJ4A 3E8SA 2P79A 1D5WA 3F7NA 2B9EA 2LDXA 2K4MA 3V42A 5BOSB 2ZIEA 3IUBA 4OMCA 5DNVA 1BU8A 4JYPA 1XFDA 4PXSA 1XHFA 4K6GA 4U5QA 3EIEA 3WLOA 2O5CA 1T6NA 3W9YA 4Q9LA 4K03A 1PV4A 2NP6A 3E5NA 5IJ0B 4F60A 4V38A 4GG1A 1DADA 4N3BA 1AJEA 4MTLA 1ULAA 3CLUD 3EFHA 3FW1A 3HNPA 3A6JA 3R41A 4Q1CA 2F1KA 4US1R 4Y8VA 3VZCA 2H4YA 5JSFA 2JLWA 1ODIA 3NV7A 1ZO8A 2L17A 4BNUA 2GK7A 3W8EA 3RU3A 1GV0A 1M67A 3TEJA 1FVXA 1K6XA 1V43A 2IT1A 4UM8B 4W1QA 4Z9AA 2EFYA 2A5YB 3I5AA 1I4OA 2II6A 4QU5A 3VKUA 1O6CA 3BBPA 4DV3B 3GLHB 2IY7A 3UIEA 3OC0A 3DF9A 4IQ0A 2CL0X 5A2GA 1YBMA 3R7BA 3LUBA 4TTIA 1AX9A 1RXSA 4OGKA 4EPWA 3H04A 1OBFO 3HL4A 1YZKA 2AMYA 4UAJA 4IV0A 4GR4A 1Q0UA 1DKQA 2LD4A 1AO0A 4I8IA 3F1KA 5E2AA 3OF2A 1TUGA 3QW4B 4W6ZA 1ST2A 3AESB 5EXXA 4F3NA 1ULUA 3ZLJA 3K9FC 2Z09A 4TM8A 3VISA 1MZVA 3V4ZA 1GV1A 1GTMA 2R62A 3GO4A 3H4TA 3JQAB 1Q0PA 4J1TA 1LPNA 5IEBA 2QMQA 3ST7A 4LI0A 4CKWB 4DANA 2RGRA 2D59A 4CTOA 4N8DA 2GD0A 4BC0A 2OV8A 4K9DA 3NWPA 4LA4A 1SWWA 3P2YA 4YV7A 4OXNA 1LLFA 4RWZA 1E2HA 2I71A 5TT1A 2R68A 5HM6A 3HCNA 5JZSA 3IV9A 4N5MA 2OV3A 1W4RA 2BR5A 3FN4A 3PHCA 5BSTA 1XKLA 3I34X 3O0TA 1D04A 2GPSA 4X61A 4H27A 3RIYA 3WL7A 5DNDA 3S81A 1S8OA 2IU3A 2XNJA 3PSHA 4KWTA 1N1EA 1XUOA 3MRXA 2VI5A 3HGQA 4FLFA 3H18A 4WLUA 3KT8A 2IDKA 3ANXA 5GM1A 1P2GA 4X97A 3FHLA 2LXNA 2OC4A 1KFKB 2IHYA 3HGMA 2RHDA 3E27A 1NONA 2C9DA 1Y5RA 4LISA 3ZJYA 1S2NA 4HDRA 4OX9Y 1OE0A 1WMSA 1WXIA 4LGCA 2AKAB 3WGVA 1VMEA 4MS4A 3GARA 4AWAA 4ECEA 1KZ9A 1XZPA 4JGBA 3JALB 1FFBA 2TMDA 2F3QA 3TX2A 5BSRA 5JMWA 1FJXA 5SV2A 2JGNA 4QNMA 3HMKA 4Q1AA 5CH3A 5FNVA 2ZWAA 1SCQA 1TNDA 1EAMA 2CC2A 4Y2TA 1GFZA 5P8WA 3IP3A 1EEXB 4RJJA 1R0RE 2KB0A 1W0JD 2W71A 3IOEA 4Y2YA 3K8QA 2HJRA 1MDFA 2BMEA 1NHGA 1G18A 2MSKA 4GQBA 3OT4A 3PJFA 4ZT6A 3VPDA 1LTHR 3H86A 1VPDA 1N5KA 3HCOA 3K0EA 4CQJA 3GLGA 3NT4A 4GOLD 1GLVA 3S5UA 1GQQA 2BMWA 2PH5A 1XN4A 1JQBA 2XNHA 3Q88A 4KGZA 1TRKA 2HL6A 1LPBB 4B5KA 1R50A 3DBRA 2J3JA 1E2JA 2ZE8A 2FWMX 1U65A 2WSIA 3NEYA 1DJOA 3UAZA 1L4LA 3UFXA 4Z86A 4BTLA 1N5DA 4U2DA 1LVUA 4RSHA 2DQSA 1G3RA 3P20A 4O6VA 1M2WA 4UDXX 1OBCA 3SZRA 1VSVA 2PHZA 1UOPA 4DSZA 1GRCA 1CZUA 4MUAA 4Q34A 1O58A 3MGCA 4XJXA 4MJXA 1VKZA 3KXLA 1XK6A 2X1VA 3UXEA 4YRSA 4YT2A 1RWVA 4H1VA 4HOYA 4F4JA 3AF2A 3VR0A 2FZWA 5FWYA 4UHDA 3HI6A 2G9VA 1I3CA 2GEJA 2IYRA 2PZBA 4XPIA 5TF4A 4EEKA 4QDJA 4LTMA 3KUKA 4NX2A 2I4TA 1N92A 1YT5A 3DP7A 5J63A 1SKMA 1SM4A 4Q9AA 1EG2A 4XGKA 3F90A 5DM4A 3S8MA 4FSXA 2EZTA 4NFSA 4NHOA 2P4EA 2OCAA 1Y6GA 2HGZA 4RVNA 3SDSA 1OI7A 3PUWA 2XF2A 1BWRA 3NT2A 1RQNA 5SZIA 1JKFA 3X1DA 2OC9A 5EC8A 3RKSA 1ZAKA 2I6UA 3DCNA 1Q7CA 2EV9A 3EXIA 4KN5A 1OFTA 2E85A 4DJDC 3J7AC 4M83A 1JPVA 1Z74A 2I4OA 4LOIA 2Y0EA 5AIBA 3O91A 2YJ4A 3U26A 1M1YE 4LXGA 3M2PA 1AXGA 4PHGA 1DQNA 3TR6A 5LXTB 4RD4A 2WTBA 3SBEA 4BFVA 2BM1A 2X3UA 4WY8A 3JWJA 4L95C 1WHTA 4TMXA 1PT9A 4KPFC 3KR1A 3LQRA 3K0FA 2IP1A 2XGJA 2MU1A 3UPDA 2WF6A 3OTHA 3AGPA 4W99A 5AXBA 4DRYA 1FQWA 1XBTA 3DS8A 1PJLA 4LYHA 1AK1A 3NHRA 3PICA 2X8AA 3QLEA 1SAYA 4ALLA 4RQAA 4KO8A 5BT9A 1BHQ1 2I5PO 3P9YA 3W5AA 5AVTA 2I6QA 3ND9A 4MR7A 3LYAA 1XTPA 2A9KA 2QKYA 4O63O 1U9IC 4QXMA 3CN9A 5LZ2A 4NXMB 2WB4A 4RTJA 1JI3A 4E5UA 5JRZA 1JG3A 3QOXA 4JLAA 4BZZA 2Z9CA 3F96A 4XUCA 4K8OA 5HM8A 2YJ5A 3C3DA 4UE3S 4O25A 2OFWA 3GJ5A 2QPAA 1QFSA 4LX8A 5E95A 1T13A 2IFTA 2AG1A 3MS2A 1G64A 1TO6A 3QUCA 1WMDA 2L82A 4BFYA 3BF8A 1RJEA 1NPTO 4X00A 5FUVA 1GD1O 4A0QA 3BOSA 4JLOA 4EW1A 3P2OA 2JBAA 1U0OC 1J2EA 3OZFA 1NW7A 4O8ZA 1NJ2A 3O4IA 3FIJA 3ODGA 2Q6TA 2JFHA 4S2UA 2HA4A 2JFUA 2LVBA 1AGXA 5AWFC 1PR6A 4HEQA 4KAAA 1K8QA 3QWAA 3OLXA 4H0FA 2WYHA 4NAHA 1OH5A 2YWCA 3DO8A 1ESDA 1NRIA 3KDAA 3N8GA 4RYDA 5IUKC 4YR7A 1Z6PA 5LQKA 3O90A 3GCXA 3RYTC 1JJFA 3MAAC 3QUBA 1C0EA 4NFYA 2XWBF 3CVYA 1KZHA 6ADHA 3OOEA 2H85A 1X7DA 4GGMX 1ISMA 1YVDA 3T0GA 5ITSA 4HPXB 5TPZA 2PT9A 1SO8A 4C7KA 2LCQA 4XGNA 2HF7A 4Y7DA 2GT1A 3PQEA 2JFWA 2QNRA 3KWLA 2H7VA 5EI5A 3RS7A 1VHDA 1XF9A 5LOVF 2KWIA 3GVCA 1R0XA 4NZNA 1XCLA 2G1KA 1CJBA 2A9VA 4MEAA 3JTMA 4YR9A 3MOIA 4DIFA 5IJ0A 5IWCA 2B8EA 1IN1A 1KO5A 3UK1A 4YRTA 1QAMA 4RIFA 1T0JB 1JNXX 3CNQS 4AL4A 2V55B 2EEPA 1E9BA 1KC1A 2BW0A 4UPVA 3ZCQA 4FT4A 5BR1A 1GTJ1 5F3DA 3KYJB 3R4VA 4HBZA 3PGXA 2VUUA 5F1OA 3UMVA 2IYFA 4FX5A 3JAKB 4FHFA 1IM8A 2AXEA 1U0GA 2OUKA 4DDWA 2XOKA 4X3PA 3GRAA 1T1JA 3EZYA 5F33A 3TD9A 2IHBA 3GLHA 3NBYC 4CF4A 4P3KA 1O3YA 3O21A 5COQA 3GEPA 4CEIB 3WXMA 3KQNA 4KFRA 4DQUA 2VH5R 5ITZB 1XVAA 2WHEA 1O8BA 3AESA 5EZYF 5DFAA 4HC4A 2W6JA 1BEZA 2VZ8A 4Z4EA 3JQAA 3OUZA 4RUKA 4RF4A 1REQB 4HLNA 3L43A 1Q7GA 1Z6XA 1FP1D 3LS2A 4IRUB 4AZSA 4QPCA 1H1DA 3NHAA 4KDCA 4HWGA 4ZFNA 5KSPA 3V4RA 1KEEA 1EFDN 5CFPA 4WADA 3RWOA 4AJIA 3KZXA 1MJHA 4KQWA 4U2BA 3ZOKA 1J22A 1OLOA 2DFPA 1A69A 1EFCA 1JJVA 1JXOA 5MFPA 3TTTA 1PQWA 1F38A 4QASA 1ACMA 3B3FA 1JKJB 2GN4A 4O4LB 4F5ZA 3WNBA 4AVYA 1D6MA 1K7XB 5EIAA 1NI4B 2V65A 4NAVA 1BJKA 1J97A 2ZAIA 4IUYA 3GRZA 5BNIA 2C7GA 2K2WA 3BB4A 2AJCA 1Q2UA 4FLEA 1FJ2A 1U2PA 5TGZA 2JLRA 3MVEA 4J0DA 5EUBA 4ZVKA 1RVDA 1KYZA 7AT1A 2C7OA 3L8ZA 1LRLA 3JALA 1W34A 4IWYA 3RPEA 2WZQA 3CLSC 2WU3A 1Z2PX 4B3TB 3C16C 1XZAA 2P9QA 2TSYB 5DRYA 1KP3A 1L4EA 3PUYA 1YR6A 1H2EA 3VU8A 1YZHA 4FNGA 1M5TA 2P2NA 2ZVQX 4Q1BA 2MINA 2EWWA 4J3NA 3EDQA 3KG2A 5FUWA 4FEGA 1FF9A 1R0ZA 1ZSNA 2QRVA 5TPZD 2QW1A 1XLTC 3PR3A 3RVPA 5BV7A 4IQFA 2B83A 4U7HA 1Z12A 1ESZA 1Q14A 1B76A 3JRWA 2P68A 1IULA 5GMOA 4F3TA 1KVQA 2Q2OA 3L8GA 1XF1A 1DMSA 2P1RA 4HN4B 4PPNA 1P3JA 4MUHA 4N7MA 5KNBH 3VNRA 3NPAA 1LK7A 5K6RA 4GBED 4CJXA 1Z4MA 1QYDA 1IN8A 1E8NA 1XYYA 1RDFA 2D74A 5CNIA 5SYAA 1RYEA 3K8ZA 1N7HA 4X24A 4OJMX 1Q95A 1XPJA 2QT9A 5FAKA 2B78A 1WSAA 1FFXB 2DXIA 2JHFA 1BMFA 5AKXA 1SURA 1MGOA 1ZD5A 4MKZA 1Z4OA 1UAYA 1OU4A 1C3OB 1GJRA 2JAHA 2PYDA 3CZRA 2W6QA 4IHAA 4EO4A 3A1CA 5BSEA 3FRJA 1GPDG 2XOKD 5G3YA 1MVLA 1T9GR 2CWWA 1Q77A 2VDPB 4LSWA 2ZYAA 4LY0A 5FCDA 2HEGA 1U7ZA 1U5BB 2Y0PA 2OGSA 1ZD3A 4ZJYA 3ZHOA 5KAPA 1OTYA 3M1AA 3AR7A 2O0KA 1N0UA 4R16A 1KO1A 1UBKS 1MN6A 3CX6A 1NRXA 1CRLA 4GSKA 3CNNA 1IXYA 3CYFA 2EWVA 2P35A 2EZ8A 2WTEA 1VXRA 3JVVA 5IYZF 1V8DA 3TKYA 2EZ9A 2HCFA 2W6JD 4OQ4A 5U1PA 5LUBA 1SBHA 3JQAD 4M98A 1E9FA 1L5OA 4MV8A 1RM4A 1JXAA 1CR1A 3FH0A 1TJNA 1SHKA 1N34B 4ND5A 3ZD8A 1NJ5A 2EBHX 3ZCXA 3ZHTA 2ZDHA 3EVZA 1KR5A 4PIVA 3W2GA 1P1JA 4FIZA 2P6RA 1KOGA 4QRIA 4M0LA 2KBEA 4XVQA 1VG1A 4DKJA 3RVMA 1NWCA 3RF7A 5LXTA 1XPUA 9LDTA 2QP3A 4WFIA 3FVTA 2OHXA 1OHHA 5K0GA 3IEUA 3PGVA 2V9CA 2JASA 1ZH0A 4MWBA 5FRDA 1DOAA 3IVCA 4BHTA 1LBEA 1SIBE 5AVRA 5DYYA 4G09A 2H29A 3NDPA 4PTZA 5DTEA 1XRSB 4GO1A 3H42B 3N7TA 3TTXA 3E2IA 5JS6A 4PICA 2WABA 2VFAA 3JWEA 1LBTA 3L6BA 1XZMA 4MUIA 3FRHA 5H82A 3SSAA 3UXYA 1M0SA 2CVZA 4MZXA 4O4JA 5B7NA 4G0XA 4CM9A 3LTEA 3SVZA 3CLRD 3NETA 4D02A 2GF2A 2ZZNA 3JYQA 2C2GA 1ACLA 3BC1A 2BE9A 2WYIA 2XCOA 3CO0S 1UXIA 3HUDA 4LVOA 5EHZA 4KAFA 4BGDA 3NBMA 1UFOA 4WK0B 1SKUA 2PKCA 3EVTA 5AM1A 3R09A 4AMBA 2I8LA 1O6ZA 4IKEA 5AVVA 4JI0B 3UVEA 3FYDA 3E81A 1CT9A 1ENOA 2RIRA 4L73A 4LDNA 3T9EA 4B3JA 3A1FA 2CJXA 2BR4A 3SBXA 4J0IA 2ZRJA 4JP3A 4GZ5A 1UBJS 2NT4A 2FDRA 1JAIA 3GFVA 3GT0A 4CLXA 1CZOA 4MHSA 5CJ2A 4D42A 1HNXB 4ONEA 1J09A 4H6WA 3H7IA 2H00A 3O2JA 3KQHA 2BDUA 3NH6A 3WGUA 3ONEA 1OC4A 1BNCA 1UQTA 2FQXA 2ZBPA 4BJ1A 1EFHA 1PR2A 4C4XA 1RT9A 4ZU3A 2AI3A 3AVQA 2O48X 1K6MA 3P9PA 5J2TF 7ABPA 3HXQA 4KO3S 5HGXA 1MNQA 4P86A 5C31A 3W04A 1BO6A 3ILXA 5CVDA 1BMFD 5CURA 1GQOA 3JQ7B 4ACBA 2C20A 4PLWA 1U7PA 1XMXA 4CCAA 3FAKA 3GFSA 5BVGB 2NT3A 1ZIDA 5IX8A 3CFYA 5G41A 3AUKA 2AT1A 3AVPA 5CU7A 1ZXXA 3R7DA 2AFIE 2DR3A 4W5WA 5HE9A 1X74A 2WBLC 3D1LA 1M2OB 4NQRA 2AR9A 1VTKA 4QXQA 2P8SA 2NXEA 3QVSA 3BGWA 3PRYA 2R25B 4L9WA 1GZ5A 3CUSA 4B81A 4K0KB 4DZZA 5I8PA 1BE1A 3R3XA 4G3XA 2IBSA 2VUIB 3IDZA 1QO9A 4C5BA 1JBQA 3WGOA 5JHHB 1LD3A 2FUEA 1ZNQO 2HWUA 1SXJE 4J3FA 1J0EA 4QPNA 1IY8A 1PWHA 2DLDA 3FJ1A 1ZOOA 1AY0A 5E7QA 3T1HB 3A1TA 1WMFA 4DKXA 1AUVA 1U1CA 3FDJA 3HEAA 4RMIA 4BVJA 3P27A 4ZRDA 1JS1X 1SKQA 4IJVA 4JEUA 2DFTA 4WJLA 4UHJA 5ALOA 4CR6A 5LWQA 1T2UA 1J8FA 1A9ZA 5ALUA 4ZA2A 3DMTA 2ZYTX 2M6KA 4ZYVA 2FZ5A 1OHHD 1W29A 3WAKA 1GG2A 3VYWA 2C07A 3UCXA 4EUEA 1H3EA 5ITZA 2QVGA 4HH0A 3CIOA 2PX4A 5DGHA 5LU9A 1QR2A 2INGX 2R7KA 3G2OA 1CR6A 3F49S 5H02A 4QO8A 5H3LA 4L5AA 1E2EA 1M6EX 4ZOAA 4ALNA 1Z6AA 2UYGA 2WFLA 2Y77A 5EWJB 3QF4A 3T9BA 1VG8A 2O0MA 4TTSA 5KIAA 3VHLB 1IN5A 2NQ2C 1H2WA 1I7PA 1ZKDA 2QXUA 1HYQA 2DLNA 2R7MA 1DVRA 2Z30A 4ZAWA 3RLIA 3UAVA 3VI4B 4FFLA 2VWGA 4F84A 2V7VA 5IDVA 1M2GA 1KSGA 2PX8A 3G5MA 1G8YA 1FXWF 3MHPA 2J07A 4RJKA 3GAFA 2FYTA 4KQMA 1V4NA 4RENA 2BEUA 1KY3A 1OJ7A 2QPLA 1Z6QA 5TEWA 2J32A 2F59A 1ZOSA 5ALGA 3TZKA 1JPUA 3CLHA 4A8PA 5CCBA 3BB1A 3LDHA 3C3XA 5KTNA 1NI4A 5K5EA 3K16A 4QJ5A 2VP3A 3YASA 3N6VA 4ER5A 2ZYHA 1I10A 1G21B 4IMIB 3AI2A 2C2BA 4ZCTA 2V6FA 4J0KA 2YMLA 5HMMA 4N18A 3W1WA 1KFEB 4ESHA 3O3NB 4BE4A 4ND1A 2OTCA 2IXAA 4F71A 1P18A 1UOQA 2J48A 3R7AA 2HSJA 3A4YA 2NTJA 3MCTA 2PAAA 3CONA 3QH4A 4FOPA 3QVJA 4RH0A 4XEHA 1YBHA 3JQGB 4F11A 4D8WA 5K8IA 4DR5B 1ZXBA 1Z4KA 2QMYA 3FWPA 4RJTA 4LVCA 3QEOA 3LCUA 1D0VA 2PWBA 2GFIA 3NOXA 4P4SB 3AEUB 4ZCSA 4DHEA 5GQSA 3E7FA 5JMPA 4H1TA 2IGBA 1PAUA 1JFFB 1K89A 2LKCA 5E8JA 3RFVA 4CMIA 4DUPA 1HFWA 1QQTA 1XU4A 3QVUA 1NVWQ 4QOHA 2IY8A 2PXCA 2EXXA 5DBOA 4UTNA 3R23A 1OT3A 3UW1A 4XM1A 4Q19A 4OXYA 4NOMA 4HWOA 2PBRA 1THZA 4R31A 3I45A 4EVRA 1T9AA 4EG5A 4Q05A 2MR5A 1P74A 1T5HX 2QWXA 2XVMA 2R48A 4RKEA 2I7CA 1IUNA 2CL5A 1Y5IA 2OQIA 4IDGA 5EINA 2FQ1A 1T1IA 2DECA 3LBNA 1FFXA 3CTMA 2QN8A 2PD4A 2PVPA 3DFIA 2VSXA 2H63A 3DE1X 3VMMA 2JGFA 3WL3A 1G6HA 1NXQA 1C3OA 2O3UA 2SNIE 4IIXA 2Q21A 4J75A 4KQKA 2ECOA 4KSYA 2ZRFA 4M21A 3WWCA 4EW6A 1YH3A 1DAPA 4S1OA 2GHIA 2QQ0A 3ZDBA 4O3FA 3LOUA 1UPBA 2W6NA 3ZX4A 3ZDDA 1E5DA 2FETA 2AFHB 4UAVA 2QR2A 3L0ZA 3CISA 1DRKA 4E0BA 1OZ0A 3H0CA 2FZCA 2KLBA 3OLCX 3KVRA 4L7QA 4LHVA 3UZUA 1JEQB 1AQJA 3HB4X 3D5TA 1G2OA 4MA5A 2PXHA 2CJWB 3EXAA 3I39X 3DUWA 3C6MA 4K3VA 4P1ZA 4TX1A 5KKAA 1F48A 3L8YA 1GYRA 3VPCA 1TEHA 1STOA 3HKEB 1S01A 1Z35A 1QV6A 1P9LA 1W5TA 2ZWVA 1IEWA 1A9OA 3CNBA 3KVOA 4LOHA 4EPXA 5JZMA 3EXHB 3K8YA 4CN8A 4EGAA 4LXYA 5JNUA 3A6HA 1T43A 5JNWA 1TEXA 3EK2A 5D5QA 1SHTX 4F3RA 4GX1A 4BCBA 3DZDA 2C3UA 4U0KA 1L2TA 3VTZA 4JVLA 3G17A 2B1QA 3KUUA 1GUAA 3MA0A 4B74A 4HAVA 2I33A 3IJ5A 4AY3A 3K5HA 3OCCA 1T5DX 3W9UA 3BIOA 3TPZA 3VDNB 1TLLA 4PXAA 4PYNA 3SDBA 1T0UA 3AUFA 3TE6A 3ZDYB 4X5OA 2NZUG 3VU9B 4YGXB 2A35A 5I7UA 4PGHA 5CLLA 2D5LA 5K9ZA 3KQSA 2HI0A 4C89A 4MV9A 5EESA 5AKZA 5CFQA 1NVGA 4MPPA 2HMTA 3OPVA 1ZJ6A 2GQ0A 4LHWA 4C22A 1XWFA 4LY6A 5T3UA 2RDMA 1WOMA 1MRNA 2O2GA 4Y2PA 4B8ZA 3K6SB 1PZFA 3OUUA 1VRWA 3TOSA 1IZ9A 1HYGA 2CT8A 1RYHA 2ISQA 3OECA 4MDYA 3U49A 4CDGA 2OOSA 3BH6A 4BKOA 4U02A 1JW9B 2YZ2A 2BZGA 5ERXA 1Z4JA 1JEAA 3VAYA 3FAZA 4GM4A 1CY7A 1U1GA 2PX6A 3I5MA 4JC0A 4D9EA 1TVKB 3B6IA 4IDFA 1TT7A 3K70D 1E60A 3MRSA 3U4QB 3B6JA 3EDMA 5PNTA 3UF0A 4WCVA 2EKZA 3HXLA 1YTUA 3LRPA 3E1KA 3PFGA 3GDHA 4ZVOA 5TSDA 1QGZA 1UMBB 3DTVA 3ZY5A 1DKMA 2R96A 3VNVA 4Q3EA 1ZH4A 4C4RA 1IQRA 4MIKA 2DUJA 3JQ7A 4TVOA 4XR4A 3RR2A 1JHQA 5CYGA 4FE4A 5BVGA 4UMEA 4N0MA 2W98A 1C50A 4HS9A 2OCLA 5CLGA 2W7TA 3F8SA 3ZGXA 3QKUA 4HZUB 4OK5A 1G20A 5KOJA 1AN0A 1LWOA 2IE8A 3EAGA 1CJCA 4Z9YA 3WK8A 5F9FA 1OXUA 1W5AA 4R9NA 1BU5A 4OIMA 4AN1A 4BB5A 2V5UA 4XQ0A 4ABTA 1HLDA 5ICMA 3F73A 3U1VA 2C1XA 1SBZA 1SUFA 2I65A 2W48A 2VK4A 4S1PA 3SEFA 2FF5A 2F9LA 1SXHA 2C8JA 1EQUA 2QN7A 2Z2KA 3FZEA 4QPJC 3CB4A 4MV0A 3WNQA 3QBTA 4LK2A 3F74A 3RSLA 5KC8A 1IM2A 4A1FA 1I3KA 3SIRA 1P80A 1OBVA 4H15A 3PZBA 1HT3A 4AS3A 3M7IA 3DTNA 1PSWA 3EF1A 5AUQA 5A5DA 1OBHA 1G7TA 4OP2A 1QDLB 4RLSA 4O33A 2IP4A 1QE3A 5ALRA 1OWMA 1CK4A 4QBFA 3NZEA 4KLRA 2MYUA 2ZIAA 4KL8S 1HE2A 5JNTA 4F96A 5JNRA 1E4EA 2O59A 4ZQIA 1GQYA 4M36A 1LI5A 1PFVA 4CNQA 3TFOA 4NBKA 4C4PA 1WEHA 1E4VA 3TNYA 3B5JA 3JVDA 1N8TA 1Z13A 3PQCA 5AJHA 2AG0A 3N2GB 3SJCA 1AS2A 3KBOA 3INRA 5EWJA 3IFSA 2EYUA 1RLMA 4HGPA 1JYSA 4G67A 5M2QA 2X4GA 2YASA 3LA6A 4G0UA 2MOKA 1GZDA 1THTA 2BHTA 3HCDA 1F20A 3O8RA 3ZCVA 4DC1A 3G82C 2QGNA 2V7UA 1YRWA 2YC2C 3ACBA 4ZODA 5JLAA 3X1WA 4BNVA 2QZ4A 2YIDA 1X8JA 3BCRA 3CA8A 4TKVB 5AW8A 3ETHA 2XOEA 4OHMA 3RAPR 1MD9A 1NUPA 4UJ5A 5DNUA 4XWWA 3DXXA 3KJNA 5DTIA 3TQHA 4NKRA 4PLYA 1DOHA 5JPCA 4WE3A 1K0UA 1U8CB 1G21A 2R6GA 4HV4A 6YASA 4EB3A 4B3BA 4ZT5A 1PW5A 2Q2QA 4DGQA 5LJLA 1BS2A 3L7NA 3NIGB 2UUAB 1OA0A 1OR8A 4P2GA 5T4FA 4IIHA 2HNAA 1V25A 2OBYA 5A04A 1EE2A 3FPFA 4MGKR 4KR7A 1C2YA 5HFAA 4NE7A 1DC5A 1C81A 4C0WA 4J16C 4DMMA 1TJPB 5JNVA 1XTZA 1JQDA 3I2IA 1S2LA 4ED9A 3LCCA 5BORA 5F9MA 1OV4A 2EQ5A 4LYAA 4CUZA 4P93A 5LN1A 1H0SA 2PNFA 3N8IA 3WV4A 3MTGA 4D3FA 3FUVA 3DTVD 1QZ3A 1JPNA 5B3JC 1HSZA 1C1HA 4PCLA 2QORA 2R65A 3KIPA 3QRWA 5JW6A 1V5FA 3ICEA 4P4SA 3LXXA 1MLDA 5J9FA 2Q4DA 4IDEA 3RV4A 3GJ4A 4CL8A 2P9EA 1XRLA 1JFFA 1L5YA 1YMUA 3BD8A 2W22A 5AKLA 4C0KA 5A02A 1QJ4A 3CR7A 3L8FA 4YJKA 4MYDA 1ZCJA 1V35A 1A8QA 1GYPA 1XXHE 1Y4ZA 5JSQA 1SA0B 4JNCA 4HG2A 1WBBA 4M8NE 1E1YA 3UUGA 4LNUB 3RS3A 4JS0A 3TBKA 4ARZB 4A36A 5AH0A 4DJFC 4MW9A 2AS0A 4MV3A 3VMFA 2CF5A 2I99A 3QLUC 4EHBA 3O2QB 1RZUA 3H1AA 1MAHA 1GL9B 3MGBA 4Y18A 2J4DA 2VUTA 3I6YA 2Y1EA 4GF5A 1DRWA 4QQFA 2NU8A 1KRXA 2Q2VA 3MERA 1UPTA 4X54A 3A06A 4YBZA 3PHBE 5D3MB 4W9RA 3K4PA 3C7CB 4A82A 3KFLA 1NDHA 2ILTA 4KP7A 4RSRA 3FOFC 3AVTA 1T1SA 2A4KA 1DAEA 3BXOA 3WLRA 2J45A 3FNQA 3IODA 4URUR 2AFHA 1S7GA 2ZWPA 2FFBA 3ZY3A 3JZIA 4FKBA 3EWSA 4GDFA 5CT5A 1U4OA 1HFEL 5L4LA 5LQCA 2F7SA 2CNWA 4J1NA 4NRDA 1IBMB 4EGCB 3IELA 1W4ZA 3CZPA 1EK1A 5FFFA 1KJ8A 2C57A 4EG3A 2JCXA 1UT6A 2CJWA 2M1XA 3A4IA 3CLTC 5A9SA 3KZKA 4QIHA 4TXMA 3PNSA 3AKDA 3WK5A 4II2A 2UYHA 3D6FA 2W6ZA 2XCRB 4AKIA 2EW2A 2HJWA 4AMYA 2OL4A 1EMDA 1NF3A 1L5MA 5FLXA 3FCEA 3BULA 4N6OA 5AW6A 4A92A 5HUJA 2FNAA 1MHPA 1Y4AE 3KXPA 4ZT7A 1IDOA 3QVXA 1EFTA 1VJGA 1PYOA 3NQ41 2CB0A 1JFRA 4OJNA 4KR9A 2HR1A 3RI3A 4YMSA 3VTFA 3NVKI 1NQAO 3LU1A 2IXGA 2C9CA 4HDCA 1TD9A 5LQSA 2BKLA 3SIPA 2E1PA 1F14A 2GPNA 2QLFA 4ZQHA 1Y8CA 3ZIAA 3REQB 4JWKA 5TQ2A 1QHIA 2CLMB 4AY5A 3TVYA 5FI1B 3IEPA 2I2AA 5GONF 1VFPA 4M89A 3ASZA 3MTDA 2GSWA 3QFHA 3PTLA 2RGEA 1CJKC 3AU8A 2IHNA 2PRJA 2Q5QA 5A3JA 2CCKA 3FHTA 3WGTA 1ZJJA 2NU7B 1GAXA 4DWOA 2P4UA 1NVBA 3C3CA 1RJGA 2IEBA 3A10A 3NV9A 4RFSA 4KQ2A 5I9LA 5KDDA 2NX2A 3AEYA 3OIGA 2W11A 3DZIA 4LXHA 5ALKA 4M8SA 2OQVA 2G5GX 3A4VA 2LTAA 5HIIA 4BEWA 1ZVQA 3O4HA 4CMKA 5JZVA 2ZSFA 2HXGA 1OCEA 5F3RA 4DRZA 5CYPA 2J3HA 3WQRA 5JS8A 5IC5A 4WA7A 1TM3E 3C3KA 3ONDA 3CUWA 1Z15A 1JFLA 4Z3KA 2QAGB 1LPMA 1WXGA 3NTRA 4EPRA 2AN9A 2NSYA 1TVKA 4EKGA 1XD9A 1QGYA 1YQWA 4KKVA 2EGUA 1NFQA 2AUNA 3WY9A 4FTWA 2VK8A 3D3QA 3OQ1A 1XDBA 3KLNA 4NYIQ 2RKBA 3HKCB 5B4VA 8ATCA 2G82A 3H3JA 1JFTA 2I80A 1SKBA 3NAMA 2ZOSA 2IZ6A 4ZVPA 1GUBA 5IW8A 2Q2NA 2Q4OA 1X15A 2GWRA 4CIVA 4D9FA 4KOAA 1CE8A 4FT2A 3CZ4A 3BIXA 2HRZA 2PLFA 1R0YA 3GVPA 4B7AA 1Z8NA 2GCOB 2NYUA 3MT9A 1P77A 1P2FA 2CEKA 3DLHA 2ZI9A 4OHUA 1U2EA 4LJ8A 5JRDS 3K0CA 4R1OA 2JRCA 2XUQA 5DJ5A 3DMDA 1T5LA 5D2CA 1ND5A 2GM5A 1TZCA 3E22B 1IY0A 2CUZA 1Y7TA 3HFRA 3AUAA 4AX4A 5A2QA 2CNWD 2ZUWA 4J29A 4IVQA 4XVCA 1BQEA 1AA6A 1PX2A 3MCUA 4QUJA 2VCYA 5ECGC 3D3JA 3LO5A 2WQ6A 3AY3A 1E64A 2VP2A 4R2JA 1NUTA 1RM5A 5AQEA 3UT5B 2NUAB 3ZZUA 1NV9A 4C4ZA 1KEKA 4Q6WA 3FHJA 2ZB8A 4JUDX 2ZYIA 4KYVA 4QL3A 3EZ2A 1Y89A 3DE4X 3Q87B 2XXJA 2GN9A 4LS3A 1YR3A 4WVFA 4TYQA 5B57C 3X44A 1DO0A 1AZTA 1F4PA 1W75A 2BFCB 3DQZA 1VCMA 5BV8A 4YRZA 3CCFA 1H05A 1WF6A 3CLKA 2XSZD 4ARUA 3Q3VA 1ILWA 1FEZA 3NTVA 3TUIC 3JQDA 2ZSUA 1ISFA 1U9JA 3JVEA 3U7JA 4QFMA 5F78A 4U7WA 1XTIA 1AUXA 2VTKA 2V3WA 5K3BA 2FRVA 2WT4A 2ZT5A 3SHVA 4X7PA 1RPTA 1PR4A 1HQDA 4IHJF 1EHIA 4TYPA 2NXJA 3ZVRA 4LPKA 4CIYA 1GVHA 4XCXA 1QYWA 2SBTA 1XI2A 4D6YA 5BPHA 2W00A 3SPXA 1JEYB 4LRWA 2Z4RA 1RTKA 5CFOA 4I3GA 1GCGA 4G81A 3N86A 1N75A 1PU2A 1R4NA 2PYZA 2WFMA 4QBHA 1TTQB 4ZU1X 2W37A 5IU6A 4IRMA 3QU4A 4RA6A 5C1PA 2QR3A 4C7JA 4YHHB 2SKEA 1M8FA 1QXSA 4G5OA 4MGZR 4RVGA 1X1EA 2XYHA 1JG4A 3FDXA 1QYVA 1U3VA 5AW7A 1Q22A 1Z56C 4MUEA 3TYXA 4R05A 3KEQA 1J9EA 2QG4A 4IILA 4DLLA 1XMOB 2VQDA 3GEMA 2HC9A 2ZJ6A 3IPAA 3U81A 1J42A 1ATZA 2XD4A 3ORYA 4AIIA 4FKMA 4G01B 3SM3A 4P08A 2QROA 3REOA 3CG0A 2NSJA 2VBIA 1FZQA 1E0KA 1JJ7A 2VOEA 3JD0A 4TLAA 1DIBA 1LU9A 1SBNE 1VOTA 1IY2A 3TB6A 3RBXA 4B79A 4IH9A 1EDDA 1SC4A 3D6HA 4U6QA 3DAGA 4AT1A 1XEWY 4S24A 4XFJA 1T29A 3PFHA 4KDRA 2GUWA 3ONNA 3OU7A 4F1KA 3PQ5A 3L6UA 4NMXB 3V1TC 1RJFA 2YHBA 3FBGA 4C30A 1VBMA 1HMYA 2FEXA 3K72B 2ZU0C 3KHSA 1Z0JA 4YS6A 3KWFA 4CM9D 1U1FA 4FMCF 2A5LA 4GNRA 1GNLA 1RHRA 2RKWA 3GZTB 3ISTA 2OECA 2P65A 1FLNA 3BWXA 4MHTA 2W2NA 1YIDA 4EGJA 3GH1A 1R8JA 3I2YX 3IP6A 4MITA 4C4SA 4R2LA 1SA0A 3G9UA 2ZT7A 2JDIA 3QQ5A 2LE0A 4KB5A 3R3YA 1EWTA 2B92A 1PUIA 2Y68A 2ZROA 1T2FA 2JLUA 3RADC 1T25A 1FSSA 5K0SA 4DV6B 1CZLA 1V3VA 4KAXA 4DCPA 4HNVA 1NYTA 3G88A 5TGTA 2XNSA 4CVNA 1ZSYA 1FYDA 5CCXA 1B1CA 1WXWA 2XGMA 4I99A 4DA6A 4XD7A 2H0QA 3FUWA 3JAWB 5LBTA 1C9KA 1JT2A 5IAGA 4LG1A 3HO6A 3R76A 4Q48A 3ZLVA 4QECA 5D3MA 2OCBA 3AK4A 2QL7A 4PLZA 1L5ZA 3AXSA 1W0KA 1JQLB 4NENB 3PIRA 4RD0A 3CR3C 4BATA 3M6MD 5DZSA 4OXKA 3RG2A 5EYPB 1DXOA 1X1RA 2NSHA 3A4LA 4QDZA 1FP2A 2SICE 3RCBA 3RUEA 3W1EA 4RNCA 4CF6A 2NO4A 3K6KA 2UVQA 4GM1A 3EW9A 4DBVO 2O57A 4BQRA 5I4CA 4LJYA 4B32A 5GPBA 5DGDA 3ZDCA 4LSMA 4ZAZA 5B58T 2G4VA 4PZ0A 4N5LA 1K3TA 1F1BA 1LDGA 4OQLA 1M2VA 2IEDA 4H7DA 3L4KA 1CZHA 3EVAA 3PJRA 3G9TA 2XUAA 4JSYA 3U9TA 2VJMA 4YRFA 3WA6A 5AJUA 3AFGA 3CIFA 3F9CA 4YECA 1XRMA 2RK4A 4EHKA 4OK3A 3CF4G 4KODA 3A05A 3EVBA 4RH3A 4YRAA 2CFRA 2J87A 2ONZA 4FFRA 4B44A 1YVPA 3QPAA 4XUGB 5TMBA 5TS2A 2CFCA 3G8CA 2BIFA 1GTZA 2ATEA 3NVDA 3PDCA 4L0QA 2RGNA 1YL6A 3UMRA 4HTFB 3FCCA 4PW0A 3R3HA 2OORA 1CYEA 2QM8A 2J3QA 5DHFA 3SJZA 1F8XA 2IPAB 4TLEA 1NW9B 1KEUA 3HU2A 4CQLB 5H1YA 4B17A 4B3XA 1RLJA 1X77A 4V3CA 1FTWA 5C18A 1TPZA 2LR0A 3DZGA 4DC0A 1OV6A 2Z6QA 5TARA 3TTUA 4IEEA 5FNZA 4N47A 3IA2A 4Z99A 3OO1A 1P6UA 3X2EA 3PE3A 3MFQA 3G2NA 1E2KA 4TLMB 3HKBB 5IP5A 4EOGA 5ABPA 4AF6A 3R6TA 3EEYA 4R2IA 3URMA 4EYEA 3C3PA 1QF6A 1F0PA 2Z08A 4OHPA 1PFKA 4OHYA 1G4HA 4F3CA 7MDHA 1R9NA 2VXOA 3C24A 3O31A 4HDSB 1L7NA 2BH2A 2YYYA 2IRWA 3VHQA 4NZYA 3OPYB 2CV0A 4G4SO 2JZNA 1IU9A 3TXYA 3ULKA 3UJHA 3OVMA 2H5JA 4R2XA 5G1PA 1GSIA 2QAGA 3OM9A 3QUAA 4DN6A 1TIBA 1QVRA 4X45A 2X0JA 5C8VA 1B26A 1P31A 2HQ1A 3L4BC 1ZD1A 4HLUA 5KVQA 3T8YA 4ER7A 4MS1B 3SQMA 1E94E 1PDVA 2DF8A 1M2NA 2Z8YM 2X9VA 4NTZA 1A7AA 4WKPA 2IS6A 1WD5A 3TK1A 1A9XB 3CT6A 4LKOA 3DOHA 1OC2A 3HKCA 3INNA 1XD8A 3FFXA 4RMHA 3KV3O 4U39A 1N6PA 1H65A 1ZCBA 4FNAA 4HH4A 5JE8A 5HIAA 3K5IA 3G5TA 2GYUA 4GMHA 1EVKA 2FZLA 2GK6A 2UZ0A 4ON9A 2OXRA 4K9QA 2M98A 2YWEA 3N75A 4J49A 3D4IA 4XD7D 2O14A 5ILGA 3JQFA 4JJ8A 4YNBA 1L5FA 3LO8A 1JZSA 1W5EA 2EBFX 3A3KA 1BRTA 2X0FA 3UMJA 2Q41A 1P2UA 1FMCA 2OLKA 1HPLA 4IKOA 4M8KA 4JHXA 2AMFA 1PFUA 4DT1B 5KJFA 1OD6A 1GXSB 1ZM3A 1B6GA 1GCIA 4M8IA 3RSFA 3NC4A 2J3IA 3ZW8A 2W42A 1QZTA 3RRXA 1LSJA 3IPCA 1Y5LA 4WUTA 4G5GA 2ZITA 3GGOA 1UMCB 4S0XA 2J5XA 3IV7A 5I7EA 1H6CA 1ACJA 1S4QA 3E22A 1GAQA 3FWZA 4RHXA 3T95A 4AXBA 2HMYB 5IKOA 4MVJA 2QVLA 1B6TA 2G3YA 3FCUB 3ZWQA 1P3DA 4ZCPA 4IF4A 5FEUA 3UT5A 1C9DB 2GZ3A 3PFKA 2NUAA 1Z0IA 3GX1A 4QLAA 5FTMA 3KQPA 1O95C 4NICA 5K3OA 2VHUA 1PUXA 2YW2A 1BHO1 4FX2A 4X1KB 1FQJA 3B82A 2QVYX 4C5AA 3F4KA 3LYUA 1QV7A 4JKYA 3EF3A 3CRMA 2YW9A 5J2TB 1HLGA 4BRSA 5JUWA 1EWQA 3DMNA 2C5SA 2ISSD 1Z2NX 5T6MA 3L18A 2G07A 2WI8A 3TH5A 1HE8B 1P0MA 3PUKA 5BO5A 1R6XA 2JKZA 5ILOA 3I04A 1ESNA 2PJUA 2ZW9A 2JKVA 2HY7A 1E9SA 3O8OB 1ONBA 1P44A 1RACA 3N7AA 4GZ3A 1XQYA 4J0QA 4UXHA 5JQGB 4G0VA 3OE1A 3D6UA 3D1VA 4YUZA 5AVYA 4EGSA 1PUJA 1N5RA 1QG4A 2JFXA 2G08A 1G17A 4XLZA 3OURA 3TX6A 5IKMA 4XWYA 4EGQA 1U90A 5HYVA 5HCNA 1E63A 1RFGE 5FLYA 1A2OA 1RP1A 1WMAA 4JL6A 2R6ZA 5D1NA 1YVUA 4I6EA 4HNGA 3QU5A 2EX4A 2RGCA 3OY2A 4BBPA 1FTGA 2GEVA 2RH4A 5HRAA 4CMEC 3IUSA 4D8TA 2X2EA 3P2EA 1V9SA 5KCMA 2CMKA 4IJ6A 3WWYA 5KEIA 4F5WA 4CU2A 2CNKA 1TA9A 5EJ9A 2X4DA 4Z3OA 2ZTHA 1IEQA 1ZY2A 2R6FA 4MO2A 3WGHA 1G3QA 5B2ZA 4MSUA 4B5LA 2FSHA 4IKPA 3UGJA 1US8A 1XQ6A 4LEIA 1G8AA 3QX3A 4KWEA 2VYNA 2AJBA 1WPXA 2P0EA 4QE3A 1M6WA 1YQGA 4CCSA 4DIMA 1OIWA 1B8VA 1QGUB 2EJCA 2G1UA 1C0LA 1VYHA 4JJEA 5AKHA 1JDNA 2AA3A 2QN2A 4BEBA 3IQEA 4GKAA 1KHTA 5ECWA 1PKXA 1VL5A 1R64A 1XTVA 4OI2A 4OMUA 3TQSA 1VA5A 3R6WA 4AZ3B 5AM2A 2H2HA 4EUFA 3Q0TA 4RK0A 2CYAA 1XQWA 4GBMA 2BCJQ 5FPHA 2X15A 2YIMA 3JYOA 3P26A 4INAA 2A9RA 3U4CA 5I5EA 1KDTA 4G1EB 4ZCQA 1UZUA 3L92A 3JWGA 3BUSA 4OYRA 1X3LA 4PAWA 4YRMA 1PRYA 1FS5A 4QHYA 4OJTA 4W4TA 1ARZA 3G2JA 4B6EA 3UMYA 2EW1A 2ZRMA 3OHSX 1TB4A 1QC5B 3AJ9A 1UMDB 5KO2A 4MVJD 1JZTA 5E7IA 1GY8A 5ENVA 2QVBA 1V45E 3FTQA 3NKVA 2AYZA 3WQQA 2D7CA 4Q1EA 1RC0A 5AO9A 3F7OA 5EJFA 3R7FA 2UDPA 1Y6FA 3M1LA 3TR5A 2I34A 3ROGA 2NPFA 5HOEA 4O59O 3RS4A 2OYSA 1VIAA 2QUHA 4NENA 3L7CA 2C9OA 3D7SA 3ECSA 3LY9A 4JQSA 1HO3A 3STXA 2EZUA 2AOTA 2FUNB 4S1TA 5JD3A 4DA0A 5EYPA 4F04A 3H4VA 1EGHA 2G77B 3P2KA 4Z4IA 1T8UA 2ZZMA 3GJ6A 1WHSB 3CUUA 3MG9A 4ZVRA 2X9GA 2VDUE 3PE4A 2VSYA 1M72A 4II7A 2H4JA 5EPEA 3ZWPA 5EJAA 5A9RA 3ZVNA 4ZO4A 1ZH8A 1L4KA 4MWCA 1FTSA 2IH2A 3F5MA 4IICA 3OZVA 4MYRA 1FTNA 2ECKA 2FG6C 5IWAB 3VKHA 3DJYA 4UJ3A 5DCWA 5CT9A 1GUYA 5HF6A 2GZMA 2ZK7A 3VZQA 1FYEA 3HYRA 4JHLA 1UAAA 1KMMA 2AC7A 1XC7A 3K09C 1CY0A 3OEHD 4I9GA 3LH5A 1UT8A 3KOWA 4TTRA 4RQTA 2NIPA 1J7JA 3KKEA 1CCWA 4OBEA 1VLLA 4WBNA 2HRDA 1LW6E 1RABA 3ZHCA 2C29D 3EW7A 1JECA 5H9VA 3NPMA 4JCOA 3S2UA 4YMTA 2VP4A 1K97A 3UGTA 5K99A 1DAIA 5FPKA 1S0UA 1VE6A 4BY9E 5AK5A 3QE9Y 1Q3TA 3GJ7A 3LUAA 5CDHA 3Q40A 3B2QA 2KHZA 4PRKA 1O4VA 3PT5A 3KJIA 3KVYA 3UB2A 3UBMA 5AVSA 1FW6A 5BMOA 1E7RA 3OFNA 3SEZA 4DB4A 2BMFA 5AHRA 2CWDA 3NVAA 1GTRA 1U7DA 2OZKA 1ITZA 1L1RA 3H4MA 4WOCA 3HKBA 3CCBA 4FFBB 2VYND 4MPTA 1G5RA 2JCSA 5FA6A 2WYOA 4RKWA 3SM9A 3FUXA 1LPOA 5FUBA 4Y2VA 3AVXA 3R7WB 3HVIA 4LQCA 1EFAA 1MABB 2Y2UA 2ZTLA 2PLWA 3MWJA 1HDEA 2C2XA 3T5AA 3CZAA 1NBME 3NHUA 3E1GA 1RIFA 2CE2X 5K3DA 5ALZA 2QM7A 1XEFA 3IPXA 5DOZA 5IN5A 3WQSB 4BWGA 4D56A 4D9MA 1H2XA 2AQKA 3OPYA 3TW6A 4TQUS 4CV0A 2O8DB 2Q6KA 4MWSA 2DHQA 3QUQA 4JA2A 4I8XA 5CTJA 1EH5A 5TC4A 3SFVA 5AIAA 1SZCA 4YT8A 3LE8A 1ZD4A 3IUYA 3I23A 3R8XA 2AK2A 1PLJA 4X44A 3VU1A 1I32A 4TM7A 1ZM2A 1L9XA 3WGLA 4CU5A 1A2KC 4MS1A 4GSYA 4CG3A 5ALYA 2QJFA 3IIKA 1UKAA 2NUPA 5BQ3A 5HVNA 4CM1A 3C6QA 2C8VA 1YBVA 4LC0A 1A9XA 3EIHA 4D3ZA 5IZCA 2GAOA 3FTNA 1ZXLA 2BTEA 1M3SA 2FZKA 2NO7A 5H80A 3WZMA 5B4TA 4OM7A 4K9MA 1CEEA 4NLLA 4DARA 2PXXA 2WKRA 2FTKE 4NBTA 3N8DA 2PH1A 2R8PA 1G3MA 2ZSIA 3SIWA 2XKKA 2QXYA 3EUFA 1BXRB 3K1ZA 1GILA 1X80B 1Z5NA 4OXQA 1VIMA 2EP7A 3DMYA 1L1FA 2J0UB 1PNQA 1E2FA 1KO7A 1KK3A 3D8RA 1GXSA 4MVWA 4BQNA 3H9BA 4DXDA 4XJVA 3QVLA 4B6FA 4BVBA 2HU5A 4Y9DA 2BSXA 1X7HA 3U4HA 4QAJA 1UMCA 3ZYZA 2HQBA 4CFSA 3L7JA 4HH1A 3QKIA 3TO5A 1XAIA 3DDOA 1SD5A 5LMCA 1ECPA 1IG0A 4Y9TA 2G5TA 3AFOA 1P1RA 5E8RA 3UCFA 2OCPA 5FBVB 2YWBA 4FZVA 2FMTA 2WR8A 4N54A 1T4CB 4RGYA 3DBOB 3T7SA 1D1TA 3EDYA 4D9HA 1A9QA 1R5NA 1V0JA 2IXFA 5CIYA 4P35A 2WMNB 3F6YA 2VT3A 4X1KA 4OREX 2FN9A 2R7LA 3ZNOA 1PK7A 1LDYA 3E84A 3H9UA 4QBIA 1MBZA 3OOYA 3NBKA 3CW8X 4UDOA 4LYJA 1RQLA 1RKUA 2B21A 2ERXA 3L01A 4KZPA 5FUYA 2ZB4A 4D99A 2HLNA 4KQCA 4NZMA 1PFGA 3D3EA 3TSCA 3K6RA 4HNTA 4I6JA 3PIIA 3SX2A 3MTJA 3TLBA 3C3AA 1WY7A 2OBLA 4NYIR 1XZ8A 3C2QA 3AP2A 4FJ1A 3WRXA 2BLLA 2QZZA 2A1TR 3CMCO 1EWKA 3FKSA 3UAGA 2WVGA 3O8OA 3EY4A 4N12A 3P0FA 5EUQB 5EMLA 4RX1A 4IXNA 3V7UA 3V8BA 2LPMA 2OCXA 2XUHA 5JQGA 3SXJA 4X90A 3SYKA 3OFND 1J1ZA 1DWUA 3CSDA 1NATA 3FVQA 5FORA 4ESVA 4TL6A 5HS6A 1LY1A 3UQYS 4HYYA 1Q0LA 2OGTA 3KHTA 2O9JA 3NB0A 4G1MB 1WW3A 4CT4B 5M5BA 1VE3A 1M7BA 4NPCA 3WLPA 3WGIA 4B7ZA 4RM3A 2G63A 3D7LA 1P0QA 2Z4TA 4JBHA 1TYEB 4B3DA 2ZVJA 2BI4A 1SC9A 4DUYB 2VHWA 2OKGA 3GJ3A 1G2PA 3O4FA 3GK3A 1KFCB 2A8YA 3BSWA 3L84A 4IGEA 1T6ZA 3SJAA 2Z04A 3RD5A 3QU7A 1HR0B 4MQLA 1NJFA 1T8WA 1YNOA 5AUOB 2AZXA 5INTA 4DUZB 3C8UA 4X62B 3MT0A 3L40A 2HQSA 1NKTA 3JW8A 1L1QA 1Q74A 1SVNA 3BXFA 2Q5LA 3TAHA 3TQFA 3WGZA 3U4AA 4EPTA 4MP6A 3WLFA 1U28A 2J9FA 3DKRA 3AL2A 1N8SA 1HE3A 2DUNA 1QFZA 1XDGA 1ZN9A 3W3AH 4JC5A 4JKOA 3K8OE 1LS6A 5BP7A 4B2YA 3R75A 1TFUA 2A7QA 1HFKA 2PSDA 3OFJA 4MUKA 1FNSA 1UZAA 2BBOA 2JEZA 1Q0RA 4YAEA 5L3RA 3W78A 4S1NA 3ZBPA 4KTTE 5KHAA 1FYXA 1VLMA 4KE6A 3WB2A 3FMIA 1J8YF 1L9KA 3JQBC 4AO7A 2ZJOA 4AZ3A 5J4VA 1PZMA 5HZGA 1MQSA 3GGCA 3ZW9A 4ISCA 4RTQA 3DVRX 4V24A 1EFLA 1XZLA 3P1JA 1E96A 1PI3A 4UU8A 2O1XA 4RZ2A 1Z22A 4MKHA 3Q8KA 4KGXA 4PZUA 3DFZA 2IHUA 1PS0A 1N6HA 2PS3A 2BEKA 2XHZA 3BL8A 3VPSA 1H1LB 4JQYA 4F7DA 1NXOA 5ALTA 1N1MA 1DGQA 1O6FA 1F2DA 1NF8A 1U7XA 2LRHA 2P5TB 2ZDGA 4TVKA 3NBXX 1KP9A 4PN3A 3U6BA 3H16A 1QC5A 4NEGA 1UMDA 3S7ZA 5IT4A 1FPQA 1X1DA 2RCNA 5K20A 1M1ZA 4WXHA 5EIFA 3AETA 4GEGA 1OA1A 5KINB 5CYFA 2AJLI 2HSGA 2H18A 3PNLA 4TROA 4DUGA 3AVYA 1ZI8A 3CJRA 1RHMA 3CCCA 3UTCA 3KSBC 1OXTA 5H81A 4BX9A 4ZZ3A 4N7JA 2BT4A 4G5RA 4QFCA 1XD2B 3Q5EA 2O1EA 4KQXA 1SVMA 2NPIA 4E11A 3O4GA 5IJZA 1IVNA 1Q1QA 2XUDA 2G36A 1AKMA 1K27A 1MAAA 3DVAB 3IHWA 3BWCA 3M89A 4TZTA 4EGFA 2BCEA 1B8UA 2QTMA 3A9VA 3LT4A 2ZUBA 2D0DA 3R3VA 4L6CA 1MW8X 1M9NA 4BV2A 5K2MA 4NNOA 3LC1O 3S4YA 3VKVA 3FKSD 4QNNA 3BWDD 5ALSA 1PV2A 3D7NA 1TIKA 4CCWA 2FMIA 3RVQA 3THRA 3FYUB 1LV8A 1Z28A 1TU0A 2EAUA 5L7TA 1N5OX 1IBCA 4KYUA 1YV9A 1MG0A 5HXAA 2AN4A 1RXVA 3G0GA 4BMPB 4JD5A 3AWIA 3H1PA 5IMBA 4DLVA 3BMQA 3PPXA 1QJCA 2J5KA 2ZBFA 2P9TA 2VDJA 3K53A 2XVAA 4UU7A 4ACAA 3HVUA 3MAGA 4IM7A 5DEOA 2QZJA 3EH1A 1ZESA 3GN1A 4JJ4A 3FSGA 3LC7O 4M1WA 3WBBA 4L0MA 3B89A 3TIVA 1YQUA 1OXXK 1U2TA 3DHEA 5HBGA 1HI9A 3AHFA 5K6AA 1TW3A 4R1LA 4ZJZA 2C99A 2WJPA 1CF9A 2BEWB 3KYBA 3TEMA 3WNCA 4CIAA 4RIIA 2W2LA 4W6QA 3VOBA 4C3UA 3I2GA 3ANMA 4TKLA 3WBKA 3AIOA 1TK2A 3JATB 3U7QB 1VRCA 4YT4A 3DW3X 2KMLA 4BPRA 4R9RA 4OJKA 2R85A 1JILA 2RJ3A 1L5KA 1E0SA 2YNMA 2QVZX 3P9SA 1Q7RA 2C58A 4FFBA 4EDHA 1L7PA 3BK2A 4P7BA 3L77A 4EVIA 3ZCRA 2O0HA 2DVMA 5F98A 5BY2A 4WZAB 2QTGA 4PIPA 3MD0A 3R7WA 1J4AA 3IUMA 2ISCA 2YBEA 3CF6R 1PR9A 3IBGA 1TO2E 3KR0A 4OF4A 2LZ0A 2WWIA 2CXPA 4HAIA 3MOSA 4ZDJA 2ONKA 3GEEA 1GRQA 4LCJA 4OHFA 3FOWA 1ZOIA 3A6EA 3FYTA 3K0AA 4HAXA 4UXJA 2O8DA 2ZETA 2PH3A 5IVDA 3OA2A 2C2OA 4AYWA 1EX9A 4XXHA 1ODCA 2OBBA 4JWTA 3BIWA 5FP0A 5G0SA 5HBRA 3EG5A 3KX2A 4ZGBA 3IH5A 1NMEA 2JFNA 1X7ZB 4OQFA 1SBIA 3UXMA 4J2HA 4P34A 4KC0A 5L8VA 2ZM5A 4WXPA 1FDWA 4ZQEA 1PTJA 3WJ2A 3GFOA 4PGAA 2ODNA 2FV8A 3P32A 3CINA 5K0NA 4ND7A 2HK8A 1QKIA 3ABSB 2ATIA 4X7BA 3ANYB 5GONB 5TVGA 3PKIA 2PU5A 3P9NA 3TMAA 1BE0A 1M75A 2FPWA 3L5OA 1V96A 4MV7A 4AURA 4M0PA 4DUGD 4LYFA 1OX5A 2I62A 1BXRA 1NKVA 1FMFA 1X80A 1IIRA 2REOA 5ADHA 1VJDA 4Z4QA 2VQ6A 3OF5A 4YUVA 3UTDA 4HWKA 2HBZA 3RUIA 4LI3X 5ER9A 3DEFA 4KV7A 4UNPA 3VV2A 2JGKA 4TTTS 3T52A 3FM9A 4H7EA 3J81A 4MGIR 2RD2A 3ZK8A 3SC4A 1D6JA 4DABA 3UWSA 4ADSG 3RFTA 4BVAA 1MX5A 3IMFA 1RC1A 3A4MA 1TZKA 1MFPA 2C5BA 3DPSA 3PQ8A 5LM3A 2AR0A 1V2GA 4NMWA 1T4CA 4E2XA 2VHZA 4QTYA 5ES4B 3NTOA 4DPMA 1I5RA 1TUBB 3WYNA 4GGPA 4HF7A 4JLVA 4M2LA 2Q1TA 1LK5A 1Y5NA 3A6FA 3WV5A 2WU8A 4YJGB 2GWHA 1PBTA 2Q6IA 3D8BA 2XRYA 2WNIA 4XUEA 3WJ7A 4ZD6A 1L5HA 3F47A 3D8SA 3BJZA 2ZULA 5DCUA 1SUDA 2Z8XA 4KBGA 4OAOA 3VC7A 5A6VA 1P8AA 3C0KA 4K87A 1C4XA 3EQ7A 1QHHB 4LMRA 1LBIA 1PHPA 1J33A 4MVJP 1QVWA 5E9QA 5F76A 1RPAA 1Y7LA 4TWZA 2P9BA 1U2DC 1YC5A 4RF3A 5LYJA 5L3SB 3S68A 2W2LD 2FUG6 1ADCA 3UPTA 1T36B 5KNBA 4RBNA 3OCWA 4JJ7A 3BH0A 3HJBA 5AJYA 4XQCA 2ZUVA 2YNMD 1YRHA 5TX7A 4HGOA 2OILA 3IXMA 3SQOA 1M10A 8GPBA 2Q0XA 3BJIC 1XIVA 5DX0A 1WB4A 3K1JA 2BDTA 4PANA 4MRAA 3SR3A 1FU7A 1WY5A 4QBTA 1XWIA 4PYKA 1RKQA 5EFOA 4MULA 1ZK3A 2IYNA 3TNJA 2IQIA 3QEMB 2XZTA 5H8WA 1P7ZA 2RARA 4KUHA 4NCNA 3HCBA 4HP8A 3JWIA 3X1YA 5F2NA 1PDWA 2PX2A 2XYVA 1TYAE 1Z3CA 3A27A 1YOVA 3CPHA 3SOPA 4Y6SA 2M6RA 5KNDA 1E2LA 5T57A 4PNHA 121PA 4N3CA 1F5SA 2YXLA 3WYAA 4M76B 1I4TD 2PR7A 2AD1A 4DVGA 4RE5A 4YUWA 1NW6A 4Q12A 2CF6A 4R6WA 2PBFA 3WX0A 1JEYA 1WSDA 3K9HA 2GBLC 4OK6A 1NASA 2QD5A 2HHHB 1JJIA 2X1LA 4R3WA 3JZAA 3OQ6A 4CTKA 3EXG2 1C9YA 2JFVA 1JLSA 3SX4A 3VPXA 5D7NA 3EGCA 3LCMA 2CLEB 4JYAB 1ZUNB 5AXAA 3O1JC 4OSOA 4QOSA 1KMCA 3TW8B 3AKYA 4B3MB 2R87A 4P3NA 4A2WA 2OM2A 3D8NA 3W8DA 4RMJA 4B75A 4IIJB 4EMUA 1Y1PA 3ZVMA 2CLHB 1MAUA 1JRLA 2GA8A 1TX4B 2GXUA 4WH0A 4WHMA 5ALQA 1MJGM 3NUZA 2D2FA 3AFMA 2Q1UA 2ZR7A 4P32A 3VO1A 4W63A 3AV3A 2WNHA 3UC9A 3I0ZA 1KP2A 2V6MA 1E5LA 1YB6A 3I37X 1KKMA 2C2WA 2ZJ5A 3W4KA 1QMGA 4XJSA 2R1UA 1N1GA 1YZGA 1FK8A 3RKRA 1L5RA 5JJBA 3R5JA 3CPEA 1WSWA 1NTOA 4ZQCB 4L6IA 2PT7A 2L0XA 1MCZA 1W7AA 4URVR 3HCCA 5DSXA 1C1XA 3BEDA 4W5RA 3E9NA 4GBGA 4GVLA 3V00A 3MTEA 2VYFA 4GZ6A 1OW3B 3TRFA 5AW4A 1PL8A 2X1MA 3DBLB 1XD2A 4K86A 5IVIA 5ELLA 1SVUA 1GNSA 2P9HA 1IWPB 3ADBA 1EXMA 2RB4A 1KZ1A 3DVAA 4FDLA 4TV8F 2NXWA 3AM4A 3TNFA 4DDKA 1P2DA 2ZJYA 3I3SR 3FOZA 4DLPA 3DBIA 4FMCB 3WBJA 2FSPA 1D4OA 2ZJ8A 3S2EA 4RVFA 3LIPA 4LJ4A 4UOQA 1ZS9A 2HT1A 3VSBA 2QRMA 3Q7RA 2PZMA 3EHEA 1EIWA 2I78A 1VYUA 2WIFA 3FYUA 3LVQE 4LCEA 5KNBD 5IJXA 4RF5A 5LZ4A 1QLWA 3RROA 2X6RA 1R6VA 4DRXA 1MAWA 2BFBB 2JJQA 5HKOA 1ODTC 4DILA 1NXVA 3O8QA 2GZAA 5DOVA 5BPFA 4FCWA 1UEXC 1K2WA 2PH7A 1NUUA 2F3SA 2VWPA 3DB1A 4GPBA 2Z2YA 1YCGA 1IG3A 1T8TA 4R41A 3K1TA 2SKDA 4YJ2A 1QNLA 3EA5A 3WDLA 4WA8A 2WJ4A 1I1NA 2YZMA 2WP0A 2F1IA 2ZWMA 3B48A 1OH8A 1P5HA 3ZHZA 5BMVB 2ZBUA 3I9V6 1QDUA 3T1OA 4NZOA 2BEWA 1R1DA 1XZCA 2BVNA 3V5NA 1CEYA 2HD4A 3TE7A 4JJAA 3PHJA 3V1LA 1NSFA 3JATA 3IR5A 1T4GA 2GLUA 4PNPA 1KTIA 1RI3A 3TKAA 1RMYA 1DIHA 1RYYA 1U0NA 4Q7LA 4BLVA 1OAOC 2NO5A 1HE4A 1CUGA 1MW9X 1ZKMA 3EZXA 1KH3A 1VJCA 2WIJA 4HDQB 4NV0A 1GG9A 4XCVA 1L4UA 4NH4A 4EA6A 3OTQA 4WZAA 2CSUA 2C03A 2M9MA 3OJLA 1W1UA 3D6VA 3BMOB 3CW9A 4G5YA 4GWKA 4JJ6A 5CX4A 2I2CA 1V7QA 1YDMA 1GN9A 2YFKA 4DFDA 1IUPA 1NC1A 4IVNA 2CSXA 1GVNB 1R66A 1GLGA 4UBMA 5K8LA 5KWJA 5LZ9A 1H85A 1KKLA 1PZEA 2H51A 3Q2OA 2GM4A 2O6HA 3QIAA 3EQZA 1POXA 3LQQA 4EQZA 4E13A 4FMDF 4GRAA 1RWWA 4MJLA 2AR7A 3R9XA 4W7SA 4QOGA 1EA7A 2ID4A 3P0RA 1X8XA 3EWAA 5HWSA 1SPXA 5K3CA 2WZDA 2QMEA 3QVOA 4WXEA 1QBKC 4BJ5A 2RI1A 1NM5A 2AI1A 2QMHA 2Q28A 3UYLA 1K6JA 3CH5A 3MYRA 4WXMA 4D4JA 5FWXB 1G4UR 2AJTA 1NJSA 1O5OA 5KX5F 3KZVA 2DE0X 4OBXA 3HWWA 3UWDA 4YDHB 4QT4A 2PTHA 5C4MA 2AW3A 1OOEA 2FSVC 3OZXA 4S1VA 3UXHA 4MYCA 3S8EA 1ECLA 1X3SA 2NW6A 3OX2A 2QN6A 1U1DA 2ZRBA 4L4XA 5EVCA 1P4RA 4W5TA 4TKMA 4KPUB 3ZV4A 4P4UA 3N0TA 5EKUA 3QTLA 2GBPA 2WMYA 4JLUA 2DHEA 2NSLA 3GWGA 3QM1A 4HGQA 5EIBD 3WGJA 4ZZ1A 1OX6A 2EGGA 1Z45A 2DUUA 2XMGA 4Z7NB 2BGUA 3IA7A 2PWAA 5CA0F 1OYWA 5I7SA 4CTJA 2UAGA 3MB5A 3C97A 2G25A 3W8NA 1ZUHA 2GVDC 4JCCA 2GZDA 4MUNA 4NBWA 4GMDA 4MH0R 3MQ2A 2JGDA 4I4NA 3A3PA 3FYSA 5CMLA 4OGWA 3AY0A 3GROA 4GDMA 3VPGA 4D9BA 1PG0A 1TUBA 1RCFA 1WG8A 1Z25A 3E7WA 4ITUA 4Q16A 4HQLA 2A0UA 2BR3A 4LUCA 4V0SA 4H7KA 2V7BA 3QOYA 3UJ3X 3LI2A 3ZGYA 5KTYA 3X0DA 1U6JA 2D5IA 1PQUA 2WWTA 5D00A 4YJGA 1Q20A 1RHQA 1QWSA 5CPFA 3E9DA 5HE8A 1ELOA 1WKBA 3V8NA 4XASA 1QOQB 3E3MA 1PE0A 2M2IA 1GFWA 2IYPA 2FSSA 2VDMB 1G0OA 3SZGA 1QHHA 4E70A 5C5CA 4G4JA 1JV2B 2C2KA 4L1KA 4PO9A 4NNPA 2XA1A 3OP1A 5T6BA 2YN2A 1RSZA 1FDVA 2JHAA 3DEKA 1S3SA 3EMKA 3QE4A 3PVZA 3O47A 1Z5UA 2REQB 4QT0A 4YWHA 1P75A 3NS7A 3PQDA 3NXSA 4C01A 1V8FA 4ZI7F 5AHKA 1T36A 1BQ3A 4Z7OB 2ERYA 2JH3A 3T5DA 4BKQA 3IRUA 4ND6A 1OIVA 3I3OA 3NMUF 2GBGA 3ESCA 1NWHA 4BBJA 3F5DA 2P75A 4ROTA 1E61A 3VNQA 3AUXA 3GFBA 2XEDA 3HB1A 3WO1A 2GX6A 3L7OA 1L4NA 1YR1A 2RCYA 3I8XA 1LCIA 3BDAA 2E48A 2FPGA 3HJUA 4WLFA 4BNNA 2OO5A 1R6AA 3PNYA 1OAAA 2IY9A 4Z0NA 4WV3A 5FJJA 2J9ZB 1P0IA 1A88A 1RXCA 2JA2A 1CDOA 4HD8A 3BKXA 4Q9DA 2R6DA 3H8WA 1T3ZA 2OK7A 2X5OA 2XR1A 1L4BA 5KKCA 2H0AA 2WIGA 2WJWA 3HJTA 2D5CA 1OI3A 4XX1A 4RIEA 3TJRA 5C3UA 3I53A 4IJ5A 2JLVA 1K92A 1H3NA 1TM4E 2P77A 3P2JA 4GI1A 3BFJA 3QSGA 4J94A 3A58B 3SF0A 1DTSA 2QTRA 4ZV9A 2ZRHA 4LYYA 2YHSA 4FKZA 3HVHA 3PNMA 4DNXA 2ZIUB 1WCIA 3HO1A 5B7PA 1NR5A 2WWFA 4ENRA 5L40A 1F1JA 1ZUNA 2LGJA 3KE9A 3VGJA 1K68A 1VCIA 3PE6A 4V0LA 2EKDA 2CXXA 3RTAA 3TW8A 4INOA 3MFYA 3GDGA 1KERA 4R71A 5I4BA 1ZVMA 3GUZA 4FMBB 2QTVA 3GJ0A 4IIJA 4XLLA 2PNJA 3VSAA 3HG7A 4FYMA 4KX3A 2PQMA 4FB5A 4OUDB 2HGSA 2OHFA 4KPYA 3Q7IA 4BX8A 3THWA 1KGDA 1YL5A