2QUKA

Crystal structures of human tryptophanyl-trna synthetase in complex with atp(putative)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
374
structure length
374
Chain Sequence
b'KGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophanyl-tRNA synthetase
molecule tags Ligase
source organism Homo sapiens
publication title Catalytic mechanism of the tryptophan activation reaction revealed by crystal structures of human tryptophanyl-tRNA synthetase in different enzymatic states
pubmed doi rcsb
total genus 125
structure length 374
sequence length 374
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2007-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2qukA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2qukA01
1OD6A 1KAQA 2DXIA 4PBSA 2TS1A 3K32A 1O95C 4MVYA 3CA8A 4CDMA 1TEZA 3CLSC 3COYA 1N2BA 3ZJVA 1EXDA 1XNGA 1QJCA 3IMGA 2A1UA 5DASA 1KQOA 1B6TA 1EUYA 3H9CA 4QRDA 1GN8A 3ZJUA 1KP3A 1OBHA 3IVCA 4JXZA 4Q16A 1M8GA 1S4MA 4WNYA 4DDHA 4ARCA 3FETA 1O0BA 1GTSA 3TQOA 2DR2A 2QUIA 3MUEA 3CLTD 2CYBA 1U0BB 1H1TA 4EFKA 5DB4A 2IELA 5TS2A 4RUKA 4NAHA 4DNXA 4HPWA 1GLNA 2PZ8A 2NSYA 3LE8A 3RJZA 4KR6A 3M5WA 5HUHA 2E0IA 4MW7A 2PXHA 1EFPA 1VBNA 1O97C 4DJAA 2J5BA 1T9GS 4R2LA 1PFUA 1J09A 1U3CA 3G5AA 4NAUA 1O6BA 2YWBA 3FWKA 4KPUA 4KR9A 4FZJA 3SDBA 4EF6A 3LOQA 2WSIA 2A1TS 3DV2A 1M8JA 3IMCA 2GKSA 4OUDB 2V0CA 2CSXA 1MC1A 1WOYA 1YIAA 1JZQA 1OWLA 2CV2A 1FFYA 1H3NA 2CYCA 3RFFA 1KH3A 3AG6A 3FOCA 1EUQA 1P7PA 1LI7A 2AG6A 4HJXA 3QE4A 1JMVA 4RPIA 3PRHA 1XJQA 2J09A 1Y42X 2DUMA 2Z09A 3VGJA 3P0IA 1M8FA 5FO1A 3G6KA 4K0RA 1GAXA 2V0GA 1D2RA 1GZUA 3L93A 5TGTA 5IHXA 3QTTA 1G8FA 3FY4A 4J76A 1KR2A 1IFXA 3HL4A 2J07A 3AIIA 3IH5A 1M83A 3NBAA 1O94D 3TZEA 1YULA 4L2IB 5FNZA 4MW4A 1N1DA 4CDNA 1N77A 3H9BA 4CQNA 1A8HA 5J59A 1M1ZA 3CLUD 2CUZA 5LM3A 2CT8A 2VTBA 1PG2A 3DO8A 1KQPA 1YIDA 3A2KA 2RD2A 1IH8A 4PY2A 3CVUA 2CFOA 4EG5A 2EJCA 2OV4A 2G36A 1MBZA 2BTEA 3KT0A 5J5AA 1OWPA 1WQ4A 3NBKA 4MW5A 3RHSA 4BWVA 4NZPA 4UZEA 2PFSA 4MUEA 1G8GA 2X0KA 3GLVA 1KORA 1BS2A 1V47A 1PFVA 3P0JA 3CLRC 1TFUA 3U1VA 2CV0A 2Z08A 1VBMA 4GRIA 1EFVB 1WKBA 3ND6A 1YI8A 3HGMA 1KKUA 3KFLA 2YXNA 4ARIA 1YUNA 1NUPA 3FG9A 3Q4GA 1WXFA 2PZBA 4MLPA 2PZAA 3Q10A 3HZRA 2E18A 1O97D 3ZGZA 1MAWA 4YP7A 4AQ7A 4UZFA 5TEVA 1KH1A 1MJHA 3RK1A 3N8HA 1TYAE 4EG8A 3HV0A 4MUFA 2A88A 4MWCA 4NDAA 1F9AA 3P0HA 1LI5A 4G6ZA 1I6MA 3OP1A 4ZT4A 1QTQA 1OWOA 1OBCA 1JEEA 2AKEA 2QJOA 2X3FA 4G5FA 1H3EA 3N2YA 2JAXA 1PG0A 2A4MA 4ND6A 2R5WA 3K9WA 4MW2A 1K4KA 5JBNA 4ZCPA 3TS1A 2VTBB 4ZCSA 1NZJA 4OUDA 4MULA 1N2GA 2XRZA 4WSOA 5KCMA 1F7VA 3TQIA 1QU3A 2AZXA 3UMVA 3H97A 4DLPA 4KPUB 5EKDA 4L2IA 4EGAA 4JYZA 1MB2A 1EFVA 3KT3A 1OWMA 2J08A 3X1JA 2WQ6A 4CT0A 1T9GR 1HYBA 3BL5A 1IHOA 3VU8A 1JHDA 1XNHA 4K03A 4I6EA 1WXIA 1N2JA 1Q19A 1TYBE 1NUUA 4MW6A 1TYDE 4P2BA 1GTRA 5H7XA 1WJGA 4NX2A 4NATA 4QBTA 4PBTA 4XFJA 3IODA 3IMEA 1K4MA 4MW0A 3F3MA 1JIJA 4MUIA 3FI0A 2CV1A 2B7LA 3CLRD 1KP2A 2IJGX 1N2EA 5FO0A 3CLSD 3KT6A 1ZJWA 1WQ3A 4ZCTA 4ZCQA 4F3RA 1ZH0A 2X1MA 1OWNA 2ZUEA 1YUMA 4EG3A 1LW7A 4MUKA 1J1UA 4EG4A 2HMAA 1WXEA 2E89A 3GMIA 3HMQA 1Q77A 3CR8A 4F4HA 3ZJTA 3X1KA 4PBRA 3SEQA 3CVVA 1RQGA 4MUHA 4J75A 2DPLA 3ZUGA 1MAUA 4ZT5A 3ZXSA 3A04A 3UK2A 3FDXA 3FIUA 4U7JA 1ILEA 4S1OA 1J1ZA 4YP5A 3SZGA 3N9IA 5LFAA 3JXEA 3MMXA 2RE8A 1NP7A 2QUHA 3Q12A 3TNJA 2D5BA 1QRTA 3H05A 3CLTC 2YWCA 5DK4A 3RK0A 1UFVA 3PNVA 3UC5A 1WY5A 3H99A 4JZYA 1IQ0A 1O0CA 3ELBA 1QRUA 1R6XA 5HG0A 1JILA 2DLCX 2XRYA 4DDMA 4EG1A 4ZCRA 1X8XA 1CT9A 4E1AA 4X0EA 3COWA 3SYTA 2E21A 5K0SA 1XNJA 3FNRA 3ZIUA 1NUQA 3QTBA 4A91A 1F4LA 2GM3A 5F23A 1Q11A 3A05A 4YMIA 5HUJA 2A1TR 2QJFA 1JIIA 1X6VA 4DDKA 1JIKA 4GU5A 1U7XA 2GOYA 4HK4A 2QUKA 3IDFA 3SEZA 3CLUC 2A1UB 3PNYA 1DNPA 4OJMX 1JGTA 1PFWA 4MWDA 3IUEA 5AHWA 4ND7A 1V8FA 4MW9A 4JFAA 1EFPB 1MRZA 3A4IA 1K97A 1K92A 3AG5A 1N75A 3MLAA 2YY5A 2Z3VA 1MOPA 1NSYA 1O95D 3VRHA 1J70A 1PFYA 4ZT3A 2DETA 1WZ2A 1NI5A 1T6YA 1G8HA 3X1MA 4MUGA 1VBKA 3IOCA 3ND5A 4DE5A 1J21A 2C5SA 3FH0A 2JA2A 1N78A 1I2DA 3E27A 5LLTA 4YBRA 5KWVA 2ZUFA 1IQUA 2A84A 1KH2A 3IVXA 2H2AA 3IUBA 1O96B 1N3LA 2QTRA 3COZA 1QU2A 1QRSA 1ZH6A 4MVCA 4TS1A 3N05A 3SZ3A 2IP1A 2X1LA 3CVWA 4EG7A 1NUTA 5DEOA 1ZUNA 1EJ2A 4MW1A 2A86A 4MAFA 1QQTA 5K0TA 3DPIA 1IQRA 2DEUA 3D6VA 3IOBA 1M8KA 1TYCA 4KR7A 1R6TA 4MUJA 4ZT7A 3C8ZA 1I6LA 4MVXA 5J58A 1J20A 1WXHA 2BYTA 2QTNA 2DERA 1NURA 4EG6A 2WQ7A 2D13A 4YP6A 2PG3A 1NYLA 1COZA 3NV7A 1GPMA 1ULHA 1VL2A 3HFJA 4JXXA 3LCJA 3MXTA 1FYDA 4H3SA 4MVWA 1MB9A 1U7DA 4AS1A 2O5RA 3L92A 1G59A 1JECA 2WB2A 4HJRA 1I6KA 4I6GA 1R6UA 1KQNA 4I6JA 4R0NA 1F7UA 3INNA 3DLAA 2JANA 3KT8A 1TQ8A 3MLBA 1M8PA 3ILVA 3GUZA 4XSVA 2HGZA 1VLHA 4U63A 3I05A 1JZSA 1SURA 3ZXIA 1T6ZA 3CVYA 4Q93A 2I1LA 1WXGA 4MWBA 2CYAA 2O8VA 1QNFA 1EE1A 3P52A 2D54A 5IJXA 3UY4A 4ZT2A 1IRXA 3IVGA 1JEDA 2QUJA 4ZT6A 1O94C 3FHJA 2J4DA 1KAMA 2H29A 2OQ2A 1NUSA 2ZP1A 3OTWA 3S3TA 3ISJA 4R2MA 2NZ2A 1H3FA 3AFHA 3G59A 2A7XA 3CVXA 3TZLA 1O96A 1N2OA 5BNZA 1N2HA 4G5YA 1T6XA 4KKVA 2HZ7A 2QJTA 4MWEA 5KHAA 2QTMA 4MQ6A 3SP1A 2VXOA 4MUNA 3PXUA 3D6UA 3COVA 5H16A 1Q15A 3AKZA 4QREA 1N2IA 1IVSA 4U8HA 2EL7A 4XFDA 3RBAA 1U3DA 3ND7A 3AL0C 3PNBA 5TEWA 1O5TA 3UOWA 2PIDA 3IOEA
chains in the Genus database with same CATH superfamily
5H8WA 1YDFA 1N33B 5G3ZA 2XUDA 2C98A 4QPDA 2WEKA 3ZDYB 4FYMA 4C21A 4C4XA 2HH9A 1W0KD 3L0IB 4M86A 2GDJA 4KXUA 4OLFA 1FJGB 4PNPA 2H4JA 3BHNA 4L6AA 4PC1A 5F12A 3RAEC 3FPEA 4US2R 4HB4A 3WBKA 1DX9A 3K73O 4KR0A 4JX9A 1UOPA 4Q3CA 5F5LA 3HPRA 5BOVA 4YXWD 4Q4DA 1T2CA 5K0FA 4L72A 1MV5A 2P6OA 1Z83A 1NW7A 2HDWA 3WNDA 3FDIA 5F51A 1RRCA 3VMMA 1VE1A 2IYZA 2JFQA 3ZK8A 4EPTA 2AFIB 4L3OA 3FPHA 5LOVA 3WJ7A 1HDZA 1ATIA 1NVXQ 3N5CA 3JQ7B 1O0BA 1TQ4A 3MGBA 1JEAA 3Q8WA 3P2KA 4P3YA 3WIOA 4KREA 1FFSA 2E4YA 4EELA 1R9MA 1E2GA 2QJWA 3D3KA 2YOFA 5GZ1A 5HK8A 1DIOB 1N9ZA 5FLKA 3TE7A 4BGEA 1LDNA 4BQPA 3AB8A 4DB4A 2VSQA 1C14A 3QYJA 4MRMA 1JVNA 3W5CA 1GCOA 2AQ8A 2C4HA 1U3UA 1WO8A 1QCYA 2XMSA 3WRWA 1RZUA 1ADFA 1YI1A 3ETEA 4C7BA 3VC2A 5ALZA 1KO7A 1HEUA 4QRIA 2E0IA 1HFJA 4J0KA 3GLFA 4X00A 5EA2A 3OZIA 4R2LA 4D9IA 1NHWA 4KFTA 3UXHA 3WWYA 4ZDWA 5GJWC 4D9NA 2X0IA 3LT1A 2A1TS 3DV2A 4J3JA 1F06A 3W1EA 4AECA 1Y37A 2WUWE 3ZD8A 3I5YA 3GBVA 1DLIA 3ZNOA 3PC7A 3RG8A 1N6IA 3BZWA 1BH6A 3ENQA 1U28C 2BFDA 4PQGA 4UU8A 3D7MA 1OWLA 2PX8A 3G2NA 2AEJA 4KV9A 4QBHA 1CY1A 2VAWA 4A5SA 4EG0A 5LZ4A 4HJXA 2J7PA 2JKVA 4N7MA 4EHDA 4UOQA 3NALA 1E6KA 1IZ9A 2W9XA 3NNDA 5K0JA 2EJUA 1IZ0A 3ROTA 4DS3A 4XUGB 1JBKA 1FMCA 5D3ZA 3H19A 3E8MA 2HK6A 4PYIA 4O2BB 5J2TF 3W3AD 5A1TA 2OD2A 4M0CA 1HT3A 3KQUA 2JDID 5CBKA 1MJFA 2XB6A 1ADYA 3R3VA 2VWQA 1Q0LA 3I9FA 3IHWA 2EW2A 1VJTA 3AJ8A 1E3WB 3QMWA 4HQ6A 4QOGA 4R1QA 3V2UA 3K9LA 3WLEA 4KN5A 3HXOA 4KH1A 3OPVA 2I91A 2C59A 3OQ6A 3NONA 5B30A 1YRQA 3TZEA 1L8LA 2OXFA 4W82A 4L4ZA 4QUGA 1GG5A 1O0SA 1M0WA 2GPNA 1XZAA 3G3EA 4R9NA 5C1BA 3L6CA 4GYJA 3HSKA 4M89A 5KWIA 2WIGA 5EQDA 1HNWB 2JGMA 4OP1A 1AGRA 2VBFA 3U0VA 5IFKA 2PFGA 3R74A 3WP0A 3LBAA 3FWHA 3NHRA 2YBDA 1XL1A 4ID3A 3KJQA 2BSQA 1CQWA 3ADPA 2BMJA 3D0KA 4XGRA 1XA4A 3O47A 3TQSA 2P41A 4U4AA 2GCOA 5FAKA 2P3OA 1RAAA 3C3BA 1E20A 2I6SA 4DGQA 2X9GA 2GAAA 2CFRA 3KYDB 3TF5A 4YBZA 3TWOA 5ENDA 3RWBA 5AWFC 3NBKA 2Z2YA 1PJSA 4GPBA 2LWIA 2CNNA 4FDVA 1I5EA 4Y2JA 3TSWA 4LRSB 4NBKA 3VH2A 3UV6A 1H2HA 1RFLA 2GK7A 3L0DA 4IDPA 2C99A 4DEYA 1XCMA 1T9DA 1V47A 1W2GA 4LPKA 1ITZA 1HEYA 2WJPA 5A1JA 1H1LA 2J0EA 3CT6A 2IIPA 4RDHA 5DP2A 3HL0A 3FTPA 2A0UA 3I2IA 4ZVTA 1UXHA 3H13A 2Y99A 3ND9A 3VTAA 4IKOA 4O59O 3L0BA 1U04A 3BAZA 1Z6ZA 2GJ9A 2IOHA 3I1JA 4FCVA 4RMIA 3SZMA 4YJ2A 5EHIA 4UM9B 4EHFA 5FV7A 3DCYA 1GITA 2B83A 4BVEA 2RHTA 4JT8A 4X8OA 1KSJA 1V8OA 1O5OA 2YIMA 3MHTA 3FG9A 3G6WA 1MB3A 5GZ6A 2WJ6A 5E6RA 5G53C 1K2VN 3MIZA 4C6TB 5C8DA 3TUZC 3NDBB 4Q39A 2FUG1 3Q10A 1QAMA 4RLQA 1RM0A 5AM5A 3ROZA 1DINA 3UW1A 1TCAA 3EQZA 5FOXA 1TO1E 2W11A 4LKOA 4QYWA 1W5AA 4KU4A 3BYZA 1T3TA 4PFJA 1R5OA 3PD1A 4NHEA 3X2EA 2PD4A 2LXNA 4DBLE 1OFVA 5DU2A 2JJ2D 5AJXA 3M5DA 2I8AA 3CKYA 1F60A 1WVMA 5G41A 1YDHA 4DRZA 1PUJA 3AVUA 3R6LA 4G3XA 4BIIA 5TV2A 1QTQA 3FD8A 4CBVA 1VYTA 2GRJA 1HFKA 1VCHA 2I2CA 2OZKA 3IYLW 4GLBA 4RCZA 2I33A 3I2FA 1NLUA 1KTVA 3DH0A 1BOOA 2GNOA 1L1FA 1A9QA 4X44A 2GN8A 2JEOA 4QGBA 1JIXA 1IU9A 1GQOA 4TTTS 2VDPB 2I0FA 2ZE8A 3KPYA 4I50F 1FU4A 1XR3A 3RSQA 5JBNA 5CGQB 2VTBB 1RYDA 2IU3A 1V2GA 2LZ0A 2XOKA 4KQEA 3CW8X 1PJ2A 2HI0A 5DCYA 1I2CA 4IRXA 4WZBB 2APJA 1W9HA 1JQAA 4G1FA 5CU7A 4QO8A 4WOPA 3SAJA 2QL9A 3TQIA 4F12A 3TEJA 5ALYA 2WM9B 2C7PA 2Q1UA 3G9QA 4KR3A 1KEZA 3G5LA 2IQ5A 2PUTA 2XR1A 3PQ5A 3R24A 5TGZA 3V1YA 1MB2A 2CD7A 3NHAA 1OHHD 1X14A 2R7MA 4N3CA 4WK4B 3I01M 2P9TA 1ISPA 3QUCA 1GPYA 2ZT6A 3KEQA 1HYBA 5HCUA 3UWMA 5BRNA 1DQPA 1VI2A 3EZLA 3FCSB 3GJTA 2NVOA 4JBNA 5A6SA 3OPYA 1BXRA 5JSZA 1B8NA 4D99A 5BNFA 3VH3A 1E2KA 4L08A 3WGQA 2VDUE 4C87A 4MW6A 1FVXA 1PNTA 2AW3A 2VUUA 2F3QA 4PAQA 4UQPA 5JH7F 3QE9Y 2OAQ1 2PA0A 3FZYA 4W9NA 4MROA 1KI7A 2FW0A 2D0DA 4E7PA 1WJGA 2AVNA 2IGBA 1C1YA 2HF2A 4LY9A 4RK6A 1M1XB 1VQ1A 4BPRA 1PX0A 3ANSA 4KSYA 1J8DA 5AK6A 4LQ4A 1NM5A 1LDBA 2OQVA 1XMVA 1KOLA 3R7AA 4B4KA 2ZBGA 4EJFA 1JIJA 1UWCA 2JFNA 2WD7B 4R54A 3DGEC 2XGGA 2FZ5A 4G9EA 3EXHB 2B7LA 3CLRD 4KCGA 2DFVA 1QYWA 1MO4A 5EE3A 2BGWA 3PGMA 2H1HA 1JLLA 5EJ2A 1T2FA 1Z2DA 2GCGA 2IFTA 1WQ3A 3PXEA 4NJMB 3G2KA 3RG2A 3DBRA 3IULA 4MV0A 4WADA 1SWVA 5ICGA 3U4IA 4G1CA 1TF5A 4HGOA 1DEAA 4EW2A 3RS0A 2GVZC 2EWMA 3BD8A 3NC0C 5ULLA 1T5IA 1VB5A 2ICAA 4L3WA 3VSDA 2FE1A 1Z82A 4OQQA 2WC1A 1FLAA 1A9SA 1R18A 3SEQA 2JLQA 4G1VA 1QGED 4TMKA 4J0IA 3ZLBA 2ATEA 4XASA 2H1LA 1NJ5A 4DABA 5BPFA 1NN5A 2OBMA 4GP6A 1YCGA 2R6FA 3AUAA 3HWSA 2XEXA 3KNZA 4U5QA 3U4AA 3V8MA 3CW9A 5CB0A 1P2TA 1T8SA 2FHPA 2RAPA 3FIUA 3P4UA 4CCWA 4ALJA 4S1TA 1D1TA 3EUEA 3L8HA 3WNBA 3F8WA 3FYUC 4UBIA 4UOZA 5L4LA 4AYTA 1OXSC 4BRZA 3WDLA 4ARZB 4MGKR 4D5GA 4Q7KA 2HCBA 4EHIA 1T5BA 2QUHA 3Q12A 2AFHE 2CXTA 2E48A 4DMMA 2JKYA 2VATA 1OH7A 4HNHA 3VOBA 3CZQA 4E13A 2LIPA 2ZYSA 4FWBA 2BEUA 2ZYVX 1LK0A 2P9EA 2FV8A 1ODTC 1UCFA 1UFVA 1A5ZA 2VNIA 3JQFA 3JYOA 4WE3A 3K6SB 1HGXA 4NE2A 4NU0A 3TVYA 1I9GA 2OBBA 3E35A 3ELBA 3MZ0A 2UYCA 1XZPA 1ZW1A 5JH7A 1Q0PA 4AF7A 2B1GA 1EB8A 4INJA 2O57A 1U0GA 3VR3A 1Y80A 3OP4A 4NYIQ 4DDMA 3K1JA 6GPBA 2IEYA 1EFAA 1ZS9A 2ZI9A 4ZQFA 4FHCA 2PXCA 3ZQJA 4HRXA 4CCSA 1H2EA 5BSVA 5CAEA 1EXWA 1VKZA 3RASA 4B5LA 2BFMA 2Y2UA 3L07A 3NH9A 3T5PA 3BQMB 3KLBA 2F4NA 1LWNA 3ZIUA 3EIWA 3ZXUB 4U7WA 3DLHA 1VPWA 1SCAA 4B1FA 1EVKA 1Z28A 1IZ8A 1A8IA 4LC0A 3DBOB 1L4GA 1PNRA 2QLJA 4LJSA 4ZJPA 2NAFA 3AJRA 2Q9AA 1T8WA 4MPRA 2IHBA 1L7QA 1QIMA 1O8CA 2GOYA 3Q9LA 2K5UA 2AX3A 1MOQA 1KTIA 3FF4A 3L7LA 3H5OA 2IYRA 2UVDA 2INGX 2VK1A 4GVXA 4MWDA 3LFHA 5J1TB 4E30A 1JHOA 3B38A 3OZAA 3N6RA 5B2ZA 4B2IA 3ZBPA 1HQCA 4FOLA 1E1QD 1FLVA 5F5NA 1AF4A 1MRZA 1FEZA 3IILA 4TS3A 5CB4A 1WUJS 2W6JD 2VL7A 2RIRA 3LP8A 1L4BA 4QTTB 5J40A 1ZAYA 3OG9A 3RYCA 4BO6A 4FS3A 4L4XA 1RQPA 2HFKA 4IXDA 2A0XA 4KQIA 3UCEA 4MQ5A 1SVMA 4CGZA 2MYNA 1GGKA 2WMYA 3KDSE 4WKNA 3EF3A 3OSUA 2ORWA 1SU7A 1OXMA 2NV6A 4HF7A 5K99A 1CRZA 4XWYA 3L1KA 1KR5A 4DLLA 1CJTC 2D2XA 1NYTA 1VBKA 2BGJA 2Y76A 3BQ9A 2FG5A 4L6CA 2WFLB 1QDEA 5AW1A 3FFBA 1AQIA 2CL6X 1UH5A 4YUXA 4PYOA 2HK9A 2ADFA 3HCDA 4QDZA 4XR4A 3NVKI 1PEDA 1GDTA 1UK8A 1U0OC 1UEXC 3C3YA 2AE2A 4OJNA 4R81A 3AR5A 5EQTA 3IE1A 3LBFA 1SUPA 3QU7A 4F3CA 5J2UF 2ZULA 2NVUA 1QU2A 1MDBA 3FJYA 2JVIA 2G9ZA 2C5HA 2WP0A 3N05A 2IP1A 2VWPA 1XHLA 4H16A 3VR6D 5AR1A 3QKUA 2CXUA 1BMFD 4XA8A 1Q57A 4BFYA 4HUQB 1DADA 1W0CA 3OLWA 3Q7QA 3ZVKA 1IQRA 4W5OA 2GPBA 3D6VA 2ZUTA 1FXWF 3PYMA 2BELA 2ZJ5A 4P38A 3WNZA 2OBFA 3AIMA 4GOND 3OQOA 3QKRA 1KI6B 4NFSA 5TR9A 1LQ2A 3FZGA 4H17A 4JL8A 4E21A 4LXTA 5JG7A 3RVQA 3S5UA 1VJ1A 2QTNA 2C2OA 2Q2VA 1H66A 1C1DB 1Y6RA 3IEVA 1OT5A 2AA3A 3F6CA 4GDFA 2VHUA 2J9ZB 4LHVA 1CY6A 2XZPA 3MB5A 5EJ7A 4HYTA 2QTGA 4FJ0A 1H2WA 2OLJA 5JC8A 5KNCH 1L5VA 4MGEA 1IJFA 4F56A 1YJBA 4HNTA 3V4RA 3EVNA 1Q1AA 5DM60 1ECLA 2PUWA 5H70A 3KAKA 2PT9A 3OM9A 4O29A 1SXJB 3QOFA 1KQNA 2M2IA 2Q4DA 2JLUA 2GEKA 1TZCA 3U19A 4QDUA 1R5BA 1ECBA 5AXCA 1NVTA 3ILVA 4G85A 2CLCX 1SCKA 1UR5A 3TLMA 1YFLA 1S3GA 2AFRA 1E2QA 3UANA 1ZGGA 2F8SA 1VPTA 5HJ5A 4DEXA 1DC6A 1XXHA 2ZU0C 2ZVDA 3GW8A 1XN4A 4N8SA 4BZWA 5A3JA 5CCXA 3FBGA 3UY4A 4ZT2A 2V6FA 1BHQ1 4XM2A 4AF8A 2FAXA 2QVGA 3LIPA 4EYEA 1CP2A 1C50A 1FUYB 1OH5A 3GQVA 2QPLA 1FQJA 1VIAA 2GF0A 3H04A 1B1AA 2X5XA 1I30A 5ESXA 5SY6A 3EFBA 1QYIA 3EY4A 2HLDD 1Y9AA 3PEFA 1VE9A 4LYJA 2EIHA 4DMGA 3A7EA 1GZ6A 1IG3A 2X1VA 2ZS9A 4N9QA 4NZ9A 4ZV9A 4BRWA 3U9TA 4ZRMA 1AG9A 3R8CA 1V37A 3RLFA 4KXNA 2K2QB 3NETA 5EIBC 4D3DA 1KEPA 1LC0A 1TMKA 4MUNA 1E58A 4RVUA 4ZOLA 4NOMA 5KNDH 1Q12A 1U0HC 1Q15A 2LGJA 4HVAA 5DFAA 2KWIA 5IBRA 1IVSA 3QIAA 3S2IA 4M60A 5H5JA 5KO2A 1GTJ1 3KZOA 3GN1A 1PR9A 5EJEA 1GEGA 4HSEA 4PRLA 3HRHA 2L2QA 1CDZA 1OT3A 3AUUA 5TEWA 2D3WA 1J99A 2I7VA 5DISB 3ZV4A 4E88A 2NGRA 4F60A 1T15A 1ZR2A 1RXWA 1V1RA 3KDPA 5EWLB 5AM3A 1ZL0A 4MJLA 5CDGA 4P83A 1P9RA 3JZMA 1N6NA 3AUFA 1UMCA 4MMXB 4MVYA 4JLNA 1ISHA 2XODA 2ZI7A 5GY7A 1F6BA 3TZHA 4DJJA 3B7GA 3C6YA 5CDYA 5JMOA 3KQNA 4AICA 5A0FA 2H1IA 2WAAA 3MJ4A 3Q5GA 1KQOA 3C7KA 4HX5A 5CXSA 1MX3A 3Q6NA 3T1NA 3TAUA 5H9WA 2HAEA 3R9KA 2WU4A 4KXVA 4WY5A 5AHOA 5JIBA 2WTMA 3UWPA 1MGPA 2I6XA 4NMWA 8MHTA 1EGQA 3K4PA 3QBDA 4Q16A 3T7EA 3BDVA 3JWPA 4IG4A 1UAAA 3L3BA 4IZOA 1IEQA 2DJ5A 4GPIB 2GZDA 4IM7A 3UB2A 2GZ1A 1Z6GA 4N6GA 2C83A 4E5VA 1JQBA 1TB4A 3A1VA 3F74A 5A5VA 1KNQA 2TMKA 2Q3BA 4FFPA 3O1JC 1T8PA 3U3MA 1RRVA 1EP1B 1RCUA 2BTQB 4A10A 1XEWX 4COKA 7GPBA 3IXLA 4O33A 2NYRA 1IXSB 3X44A 1QONA 1RXUA 4PYRA 2LCFA 2H7CA 3HRIA 1TVMA 3U48A 1DKRA 2I80A 1EFPA 1C9MA 1U2GA 1T9GS 4IYJA 1ZU5A 1PFUA 1F2UB 1NMQA 2P9CA 2VCYA 3A3KA 3AESA 3G2HA 3O1IC 3OC0A 3RUEA 4EGQA 1USVA 3D8SA 3LOQA 5KX5F 4PCAA 2A92A 2G0AA 4J7AA 3ZWYA 2QRNA 3NHJA 4XTRA 1N0VC 4X8LA 5KWSA 1PZNA 3WQQA 2V0CA 1QVRA 4GXQA 3RABA 3KQLA 3EG9B 3NFRA 4MKHA 4S2EA 2CV2A 4ZCMA 3LKZA 2Q5CA 4X1OA 1A9ZA 3ZEIA 1GKLA 2ID7A 4PAGA 1W8DA 2EQ5A 2JATA 5FBQB 3TLYA 5C53B 1KDPA 3KCQA 4PQFA 4ZQGA 5EKTA 5LL6P 2QAGA 3RM3A 1EX6A 1X74A 2NO6A 3E82A 1PGPA 2BEWB 1GAWA 3SSOA 4I8DA 4H35A 1U0RA 1ONNA 2FJPA 1XMIA 2NTEA 4G1MB 2ZK7A 4NDNE 2Q9BA 2B5VA 3CHYA 1X7YB 3CSDA 5B4UA 5G0TA 3LX5A 3A1CA 3R3ZA 1WDMA 4F8JA 1GAXA 1RAIA 2OB2A 4BWGA 2JGJA 1Z38A 5G4KA 2H1FA 3UVEA 1K6MA 4ZRDA 5KTOA 4TQ9A 4OQYA 2PS9A 2Q3HA 3PUWA 4F1WA 2J0VA 3FWNA 1DARA 4BKMA 4CQLB 2QMHA 2H52A 3NYQA 4CCAA 1BE1A 3TRKA 2CMGA 4PIVA 1PLKA 4JIGA 4KQ9A 5BN3B 3SF8A 2Q27A 3MS2A 4FGUA 1MJ5A 3MRSA 4AL4A 1VIVA 5KWEA 4G5QA 1NT4A 1SN7A 1WXDA 2CGEA 4JMLA 1JG7A 3ZY4A 2DH6A 3F1LA 3COJA 2AT1A 3OEED 3VR6A 1I9CA 2RDMA 4FLEA 4CEIB 4PLPA 1S4QA 1KGSA 4NZYA 4ZI7B 4DR6B 2NTJA 1H2AS 2J48A 2C29D 4YDQA 2O20A 1KI1A 4L1KA 1G6KA 4DV2B 4HDRA 2OYCA 4A8TA 4NU8X 2H8KA 4XDGA 3NV9A 3ONDA 1WBBA 3H2HA 4P84A 3QE2A 3R2JA 4K1XA 3OURA 1O4VA 4CTNA 2EATA 2GEBA 2NU6B 3ZUPA 2R0QC 1AHNA 2XNKA 4CODB 3CFYA 2B9EA 1NE2A 2PFKA 4MTCA 2IP2A 4NI5A 1Q7EA 5BXQC 2JJQA 4AKGA 4WTOA 4H08A 3HJHA 1ZLYA 2BZ0A 2OO5C 4NENA 4E3ZA 1G41A 3RVKA 1W36C 3ZCQA 2VP5A 5C1OA 3BXHA 4D4KA 1G19A 2WHEA 1ES9A 1PT8A 3H8SA 5LBIA 1W48A 2ZXEA 3ZCVA 1Y1KE 3NBYC 4G41A 3RYFB 3WB2A 4XX1A 4ZOBA 4D7AA 5FI0B 2H3EA 3FR8A 3NCTA 4ZVKA 4P93A 2NSHA 1S2DA 4HDMB 1DAFA 3RYHB 1HOXA 1KU0A 3ELWA 1T8TA 3MTGA 5HIJA 1KWKA 4PV7A 2O1EA 1JJFA 1YE3A 4F3NA 2GXUA 3QVJA 3GGDA 1HQKA 3RJMA 5IKMA 3R4VA 1P6QA 1HM5A 5J4YA 1XD2A 4O5OA 4PLWA 4CDGA 4BYMA 4YV7A 2IHVA 4EL0A 2XSZD 3K70B 3REFA 2W6OA 2PKRA 3AP2A 3HZOA 4QUBA 4R7TA 3K5WA 2FA9A 4K9DA 3H5WA 3QU4A 3GCXA 3ZS9A 1AA9A 1OWOA 1P3Y1 1LRJA 1OBCA 4HNVA 5IZ4A 4V0OA 4MHOA 4XWGA 3SKXA 4G5FA 3GZ4A 3MTAA 3HN7A 4TWRA 4XVCA 4BP3A 3VVCA 5CDSA 2WLSA 4I19A 2Y92A 4YCDA 5BYAA 1JHPA 2DTEA 2I6TA 5H4GA 4HWRA 2BMAA 3QA3E 1AT1A 1W5TA 2HKIA 1P6XA 4OP2A 4JKOA 1S3SA 4LBZA 5AO9A 4ZCSA 3RQIA 4IX1A 2XWSA 3OU6A 5KSWB 3MERA 1IZYA 4BMPB 1LTKA 3I09A 10MHA 1EVLA 3SYMA 2AZXA 3EXFB 4H4CA 5BQFA 5MHTA 1MO6A 2ZCJA 3ESCA 1QGOA 3RUDA 5HKAA 3QYFA 2WQ6A 1JBEA 1SC1A 4JEMA 4E3WA 1G20B 4ARBA 1DTSA 3DG9A 2G63A 3E70C 4QGFA 2HDNB 4Q05A 2XUIA 3A3OA 5ALNA 5IMSA 3QYAA 2H5EA 3LCVB 3T34A 5B1SA 1UP6A 1REQA 1AB6A 1OPRA 4D5EA 3Q3EA 1OZGA 1WA5A 1ZIXA 2IL1A 3PX2A 3TZBA 5CD1A 5CUQA 3QPVA 5MGNA 3P9XA 4DC1A 3AX6A 2X14A 3L0OA 1BQ3A 3MCUA 4J1SA 2HT6A 4DHWA 3C41J 3EDCA 1E2IA 4KE7A 4CM3A 4P7BA 3A14A 1S2GA 1ADGA 4P9NA 1NVGA 2Q0HA 4KQHA 4R40A 5D7BA 2B78A 1O1YA 5ECDA 4Q4CA 3GROA 5T67A 3CCBA 4GVPA 4IWYA 4ERXA 1SHLA 4Q7QA 3F7NA 1XROA 3HACA 4YJFB 3SXUA 1NQXA 3BZUA 1XRLA 3D54D 4R84A 4YDRA 1LJUA 4Q7EA 3UQZA 4XE5A 3IP6A 3OTIA 3ZV6A 1QO7A 3D64A 1NN1A 1V71A 1TUBA 3U1BA 4N0DA 4BV9A 2YNMD 3BH6A 1VJGA 5DWQA 3TZ6A 3FCXA 2RJ3A 3ZI7A 4DADA 4O3FA 3B5JA 1YOBA 2O5VA 5B64A 2O23A 1CJKC 2Q99A 4IP0A 2QD4A 3CSSA 3V97A 5A9SB 3D1JA 1Q77A 4R51A 1OZFA 4Q1VA 4B83A 5LIPA 2VP3A 1GARA 4F4HA 4J0EA 5CVCA 3VC7A 1K68A 2MSKA 1V4BA 2Z5VA 1MJGA 1SBYA 3Q3CA 4J0DA 4Z54A 4O2BA 4ACAA 2ID4A 5TQJA 4UXHA 3VNBA 5JOQA 3A27A 3DAOA 2PYIA 3K30A 2O1XA 4J75A 2OC9A 1DL5A 5FTMA 4GX2A 4DSUA 3PXCX 2LKDA 4J6FA 1PWHA 2G5TA 3IDQA 3T38A 4M22A 2QD5A 5LYJB 3D6FA 4FS8A 2BFOA 1E1YA 4D44A 4GXNA 4LW8A 4PPQA 4K8OA 5HIAA 1QFXA 2P7IA 3LX6A 3KZMA 4M8IA 5L9AA 4MZXA 2QYSA 2B6HA 5AVKA 3M3DA 1QZXA 2W2VA 5DWDA 1V11B 1YL6A 4NU5A 3L7BA 5LDGA 3FTFA 4U6QA 4A1FA 2XI4A 3CEMA 4HDSB 1DX6A 3LLUA 4KDRA 4ESEA 4DDVA 3OTOB 2AFHB 4B3HA 1RWBA 2H06A 1TEHA 1X8KA 4UZSA 1FP1D 3L41A 3AGQA 3PUZA 4JZYA 2O54A 4MLDA 2A5LA 4ICIA 2DG2A 3GWGA 3D5QA 3Q3HA 1KY5A 2QL6A 2YHUA 4O4IA 1VRCA 4ZEXA 5EVCA 4KXLA 3EFHA 3H8WA 3EDYA 3ZDDA 1N3BA 2RGNA 4IUBS 1W4BA 3QELB 4NOJA 3R44A 3A1NA 3WOVA 2IYSA 3ZU2A 5HYVA 4F45A 4CLRA 4OY3A 4YAKA 1WX1A 1Z2OX 2C0CA 2YFHA 3BBLA 4OI4A 1NXXA 1KI4A 1SVOA 1J2UA 1C4XA 2E21A 1P2GA 1Q3HA 2MJLA 4I4TB 4NEGA 5FUWA 4AO8A 1V16A 4TT8A 2NT4A 5ALUA 3O8RA 1AF7A 5DLQC 1G2QA 3DCIA 3OT1B 3D6HA 5TS3A 3V1KA 3KQQA 5D51S 4D6XA 2V7EA 2AYZA 3ILSA 2JFHA 3FPBA 1GRVA 1T3HA 2QRHA 3Q98A 1Z37A 1Q3KA 2J7KA 3WC4A 1FFXB 1B8UA 1BVYF 4DDKA 1UMDA 3UAWA 1TIPA 2OMKA 2SHKA 3DEJA 3O3NB 1Q14A 3RIMA 3UM9A 4TYYA 1JIUA 4CIVA 4C0AC 3GNSA 3D6NB 1AS2A 5UKDA 2C7BA 3IQZA 2IYEA 1I0IA 1WCIB 3MSCA 2WJYA 4AUKA 3FYTA 4XDYA 2UUPA 3WQRA 1KDYA 4RAOA 1UBSB 5IK2A 4OYHA 3ITKA 3OU2A 2PR2A 1V7QA 4B6OA 1EFPB 4PLHA 3K0BA 5H3LA 3F0TA 5JD3A 1JG1A 4JROA 4BFSA 1QIGA 3T5DA 4MP3A 4JNKA 4W1PA 1U7HA 3ZCRA 4O4LB 2HJ9A 4X91A 3VTFA 3W3AA 1VLQA 2QR2A 2XXBA 1A96A 1RI4A 4O4JF 4X54A 2YY7A 4OSEA 5CVVA 1H0HA 3LBNA 1IZZA 2NUTB 2QAGC 5E38A 5EKXA 1NI5A 5HFJA 1L5GB 5DGHA 1EFRA 2YH2A 2ECKA 5FUVA 4W5TA 4KAFA 2ZANA 4R2KA 1U9JA 1C0EA 1U9CA 1QE5A 3ND5A 3UH0A 4DG8A 4U7DA 5EUMA 2JFUA 5DM1A 1KBQA 2JC3A 4Z99A 2O8DA 4YBRA 2ZRDA 3S2GA 3K20A 4RZIA 5KC8A 2HQBA 2IYLD 1RQRA 3B85A 3I64A 2Z6VA 4CIBA 2A0WA 1Z0IA 1AS3A 1PAUA 1S2LA 3LPDA 4M7PA 2CLEB 2FN8A 2CEKA 4MCAA 1ZSNA 4Y1FA 1FJ2A 1UOEA 1EJ2A 4MW1A 1W19A 3HKCA 1F0NA 4LQDA 3HFRA 5AK0A 2YTZA 1RI3A 4CLOB 5K3SA 4M49A 4YRLA 4YT8A 3KU4A 3OBBA 2BY4A 2FWBA 1DIHA 2A0YA 2EHJA 4JP2A 4I2NA 2TMGA 2IIVA 3ORYA 3O8OA 4PS0A 4PONA 4B6GA 4D92A 2ENUA 1WXHA 1FRFS 3JQ8B 3NDPA 5IKEA 4LOKA 2O0KA 2WWHA 3E03A 3UKDA 3R9XB 3HZHA 3E9RA 2LCQA 3QX3A 3FUWA 2IBTA 2QAJA 1XP8A 2WQ7A 4RHYA 1ZISA 2IYWA 2F9LA 4WN9B 5JAIA 2QNRA 2Y1EA 3EFOB 1I4EB 1ZICA 1GUAA 3HMKA 1KZ6A 4BJ5A 3PRYA 4OM7A 4J1TA 5I01A 4ZOAA 2YIVX 5EI5A 3SF0A 5M34A 1DKNA 2VDJA 2GA8A 2V97A 1UMBA 1TVKA 2VPPA 3GEDA 3IP1A 3QF4B 4IDEA 3OEYA 5DNEA 3VU3A 2WB2A 1G59A 1T13A 1R6UA 1D04A 4I6JA 4MVJM 2QTZA 2XVMA 4UM9D 5CK4A 2QLLA 3N8GA 5DHFA 3T99A 1O6ZA 4EJSC 4IDDA 3ROEA 3PI7A 4YAWA 3D4NA 1TAHA 1SBZA 2AJBA 1GZHB 1M8PA 1NMXA 1UZAA 2MSWA 5INTA 3JS5A 5LP6A 3LW8A 3UT5B 4B9AA 4TXLA 1G60A 2FWNA 2GI4A 4IIDA 2B8EA 4HNAB 1VFPA 4MS4A 3KZCA 4XUEA 4F3YA 4DIEA 2QVCA 1Z39A 4NBWA 3FXAA 3MGGA 3AZPA 4Q9DA 3ZCTA 4FUQA 3EGDB 4AZWA 3THWB 4B0PA 2XZLA 5DLYA 1E9SA 1TPYA 2BISA 4MTLA 5IASA 3QHPA 2JLVA 2X13A 1DC4A 5KHLB 2GSDA 3ENWA 4UUQA 1XRRA 1MG5A 5SY4A 1E1MA 1BS9A 3PBKA 1HLFA 2ESRA 2YKGA 1QRDA 2FSUA 2CLFB 2RGUA 1KAGA 2NZ8A 3LCCA 3L4BA 5AM1A 1PWYE 4CLOA 6LDHA 3DB2A 1K9VF 1TAGA 1T4CA 1YHNA 3M82A 1NGSA 1HT1E 3JRWA 3O26A 3OTWA 1U2TA 3QBTA 1W96A 1NVFA 1PWZA 4NL4H 4R8RA 4YA6A 1AGYA 3VKUA 5BSEA 4B4WA 3EAFA 2W42A 1CR2A 1YB1A 4FZRA 4RJJA 2YYYA 5FTWA 1U8XX 1Z33A 3PPXA 4HQ0A 1E32A 3LK7A 3GI1A 4QD3A 3TFWA 4GI1A 2J5KA 3W04A 1UKZA 3OJ0A 4HRAA 3UOAB 1ODKA 1WVGA 1XEWY 3LC1O 4MYDA 4B4DA 3SM3A 3JVVA 4X60A 3QG5A 1FPQA 3NFYA 3I9JA 3HNRA 3KL2A 1AH2A 2R65A 1X94A 4BAUA 5K6RA 1B14A 1KKMA 1TUIA 4IQ8A 4K6MA 4V2IA 3DMGA 1H65A 5TPZD 4JP5A 4EW1A 2JFYA 4KQCA 4TTVA 5SYAA 1XD8A 2F64A 3P2OA 5T3YA 4DQKA 2ZJ1A 3PNBA 3WO0A 3H9GA 1OLXA 3I6MA 1ZW6A 3WG9A 5IRCD 3QOYA 1R6DA 1J97A 3OHPA 3M33A 3C8UA 2XD9A 1TVCA 1HH4A 2OCIA 4G65A 1CUJA 1MB0A 3QTLA 4MDFA 1D7OA 2GRUA 3PL1A 4JP1A 4QC2A 2PTHA 4Y18A 3TOZA 3OM8A 5I7SA 5IFLA 2HR1A 3PT5A 3W9YA 1SQ5A 3IUNA 3HDYA 2CC2A 2JK0A 4RSMA 4AJOA 2X7XA 3M4JA 3PHHA 4QICA 3HG7A 1P80A 3KOMA 3FTDA 1IOLA 3TLBA 4AKIA 1V26A 3A25A 4JBLA 5CVDA 1PLJA 2J45A 4Q01A 3AILA 4BNYA 1G55A 1QH0A 2M6SA 3BFXA 3G2OA 1OH8A 2G77B 3PB3A 5ITSA 1K3TA 3I6BA 1ZN9A 4ENQA 5EP3A 3DGFC 1C2YA 1QYDA 2OTCA 3KTAB 3MD0A 1JBQA 4RJLA 5DB4A 1AUXA 4NMHA 4PU0A 3CYFA 2PVPA 2ZTMA 5LB2A 2HA4A 3VI3B 2O7QA 1WB9A 1C3OB 2Q2WA 3D3WB 1GLNA 2VH1A 3DZHA 2DPGA 3IMKA 4MZDA 4F6LA 1G1MA 1RNLA 1PLLA 2QYOA 3JD1A 3RI3A 3RIHA 1YS2X 1FDRA 3OICA 1X7WB 3HRKA 4YDSA 3R6WA 4PZUA 4DCGA 4WUTA 1QG4A 3FZEA 3L18A 4ALIA 1G38A 2UUAB 2O06A 2WJ4A 1BWPA 4PRZA 2N75A 3OLZA 4L27A 3LRPA 3ZG6A 3KETA 3K09C 3S1LA 3AKYA 2R97A 1JHQA 1AO3A 2ZRLA 3TW8A 5FPKA 3UT0A 3SGLA 3QVGA 1XA0A 4M6WA 2P27A 4XM0A 5GMOA 5JNUA 1EWVA 3GRFA 4ESVA 2AQKA 1PQUA 2GKSA 4OUDB 1SZJG 3TLCA 2VTDA 1MC1A 1T2EA 2E5FA 3ZHOA 4MLZA 5ARCA 2ZSHA 1T1RA 5IAGA 1DEHA 2W8BB 1JA0A 2CLKB 1CJMA 3A6ZA 4CKBA 2Z8XA 1IHDA 4TTRA 4E12A 1ZVVA 1EVYA 1IB6A 4B4VA 2O3SA 4AZ0B 3X1DA 2GX6A 4NYJR 1JDBB 4XX0A 5JCXA 2DU8A 1M8FA 4EY3A 4DPMA 4UBKA 3B1WA 1MVLA 4J0HA 4JCOA 3U2QA 1O5IA 5B3KA 1GTMA 1MUUA 3VA7A 1GZUA 4NY1A 2QVZX 3NIBA 1EUZA 1Z9BA 2PWAA 3LY8A 1L7BA 1ZM7A 3IFSA 3R7WA 1DO8A 1FBTA 1OX4B 1Q7CA 3GUYA 3HV2A 4O4JB 4R9RA 4IOJA 2A9RA 1MC5A 1FB5A 1PR6A 3V4ZA 2FEXA 1UAGA 1FP4B 5BR8B 1YL5A 2Q0XA 4TVKA 2VC2B 1VLZA 3S5JA 5JQWA 1WF3A 2RGNC 1M1ZA 2HHJA 4KK4A 4M83A 3TIGA 4EZBA 5TMPA 2UUOA 2PS3A 2P1RA 1W47A 3ANMA 2X7JA 1G0OA 2QEQA 3KWJA 3A6KA 4HGZA 4OA5A 3MBIA 3O95A 3F8SA 3RHSA 2OP0A 1P18A 2X5NA 5JMWA 3ELYA 1Z0DA 4EG5A 1B0UA 2QRJA 4NPCA 4JNCA 2QP4A 4RH1A 3WHKA 1NXQA 3HXTA 1JR3D 1HY3A 2OZPA 1YZYA 3PEEA 4TXHA 1HUQA 3ENNA 1MXHA 3VZQA 4UD2A 4B9EA 4M55A 4Y6OA 1RWVA 3L9XA 4PTYA 4MVJE 3R8FA 1R12A 3EZGA 5K3CA 2C7VA 1OFIA 4GQIA 4R8LA 3NJ4A 2G5PA 3GLVA 4G86A 2QRKA 5DHUA 1LUAA 1TD9A 1RHUA 2ZUVA 3AO0B 2JBAB 4TYMA 5IPFA 5TX7A 1KDZA 2H51A 4IYRA 4B6FA 1J07A 2JZNA 5M5BA 3V46A 3ICQB 1KYYA 2A14A 3PE4A 4P5PA 1E0JA 4I50A 4ZAFA 4OB7A 1G5TA 4CFZA 1NF9A 1G7RA 2CHQA 4IICA 2PJUA 5IWAB 5FOTA 4DKJA 3I92A 2WU3A 3NBXX 5H9VA 4JOQA 2BGRA 2YJGA 4PCVA 4C20A 1KZ4A 1ZCAA 2HMWA 4Z1OA 2Y1DA 4HI0E 3DHVA 1EJ6A 4IGEA 4MKRA 4LRYA 4AJ4A 4C4AA 3AR6A 3E3OA 1UPCA 4RKQA 3BTSA 1U99A 2A6PA 4GM4A 4IIJA 4NCKA 4O4JA 4TZTA 2B9VA 1QO9A 4P08A 2YHAA 3DEIA 1TECE 1FX1A 1XRPA 1GQ2A 4RZ3A 3V48A 2BGIA 2R9VA 1C9KA 2AUMA 3X0DA 4TKVA 5C46F 4Y98A 4YB8A 2VHCA 3KKOA 1TQ2A 3FBWA 2BLNA 2QPTA 5T4HA 2AKEA 2VZ0A 2R48A 3ETJA 3ES9A 2NAPA 4TOIA 2AN5A 5F73A 2ZREA 3GRKA 1L7AA 4KWHA 4N47A 4RXUA 4UNNA 1XD2B 2O1WA 1Y8CA 5ER6A 3ZZUA 2IY7A 1XT6A 2R5WA 1QQ5A 3E4CA 2OORA 3GMDA 4MW2A 4YJ2F 4EUEA 4FDUA 3DE5X 4GX0A 4MCHA 4Q3AA 1CRWG 1A9XB 1P2DA 2PUHA 3DMFA 1H9AA 4X20B 1NZJA 5FIUA 3KVNA 1Y4ZA 3LECA 3P4XA 1N2GA 5K8JB 3MJDA 3L8GA 1NASA 1OBVA 2IYAA 3PDCA 4HLUC 4EF5A 1PW5A 4DLPA 3W6ZA 3HYCA 2Z3ZA 5K8CA 1NQTA 5EKDA 1OC4A 1EVIA 2PSDA 2XEDA 5KNCA 5LQMA 3H2JA 5LA6F 3F9CA 2WJHA 4B8WA 3CBQA 4QJIA 4DR4B 5TPZA 1CQPA 3KT3A 1M2FA 1CUYA 1OWMA 1P39A 2F1KA 3HHEA 3BL5A 1EXVA 1IHOA 1QHEA 2ZIVB 4H0FA 1XNHA 3T1YB 1LPBB 2WYHA 1YS7A 1Y6JA 3ETNA 4K81B 3V6LA 5FRDA 3EULA 1A8QA 1RRGA 3Q8LA 5DT9A 4BX8A 4Y1EA 3YASA 3NT5A 1F0PA 3QKIA 3GT0A 5FPYA 4C4ZA 4YIHA 3KTAA 2BFNA 1GTRA 1F8FA 3OF2A 4JGBA 2OL4A 1HPLA 4J0JA 1R50A 2WABA 2QZSA 4MV5A 1THMA 4RLHA 1N5DA 3NR2A 3IODA 3KDAA 8ADHA 4TTSA 4LHZA 1GPAA 2DHQA 2HSWA 3IVRA 1Y1TA 4LSGA 1RMTA 3UNXA 2CJFA 4DLYA 5I7AA 2HW8A 3W77A 3H7AA 3JVUA 5BSMA 4K26A 4YAJA 1JB9A 5KQLA 2C2GA 4WI1A 4DCPA 2K2WA 4RY9A 5D84A 1IUPA 1P1RA 5I4CA 2YYSA 1TADA 1PZEA 1SUBA 4RY2A 5BN3A 4B81A 7YASA 2AMVA 4GHWA 4LXUA 4LCEA 3UUEA 3ZWAA 4CQMA 1NW5A 1OWNA 5EJFA 5LOVF 1DMSA 3FAKA 5L3ZA 1B7GO 4CMEA 3S40A 1DPFA 2IXEA 3Q41A 3W2FA 1WHSA 1A4IA 4UVEA 1BX1A 1T25A 5K2OA 3EIOA 1OXXK 3CR8A 1RAHA 1T6BY 3OCCA 4RHUA 4LDZA 3JSAA 4FE3A 1VJRA 2AOTB 2FFRA 4M7RA 2W6ZA 3PHBE 3UKJA 1YK1A 4JLWA 4NNPA 5HIKA 2A9KA 3ASUA 1A7JA 4G0XA 4CM4B 2OV1A 2DPLA 3B9PA 3O9ZA 1G8KA 3GF4A 1MAUA 3NLLA 3RSLA 1JEJA 2R2AA 3UK2A 2O0HA 4N9WA 1WSDA 2XIQA 4URUR 4RHEA 5CVJA 4DLUA 4BKUA 3SZGA 2QG4A 3FLMA 2RG1A 2GCOB 3R7LA 3LBIA 2J6IA 5KTNA 4LJAA 2VDWA 4OBBA 4LDAA 4TM7A 3I04M 4YRRA 3HCFA 5IAJA 1Y7PA 5B4TA 2ZIXA 2JAUA 4BMVA 4PTLA 4RA6B 1NP7A 4L73A 4LC1A 5FBWB 2DFNA 3X1YA 2PSEA 4FZ3A 2PS0A 4CKWB 1FIUA 1M3SA 2YWCA 2B34A 3GLKA 1ZAKA 1SY7A 4E11A 1VHQA 4P31A 1Z2PX 2W6IA 1WY5A 2EJWA 4F2GA 2CLOB 3SBOA 3AJEA 5CDUA 5CW1A 2FWAA 1NNEA 3OQBA 4Q1AA 1R6XA 4FOOA 3VX3A 1C80A 2P91A 2R6DA 3W4JA 4YHHB 1S8FA 1JILA 1U3GA 1Y7TA 2AC2A 1GUYA 3D6MA 3FYSA 5AK5A 3EZ6A 3PPYA 2YVLA 2F48A 4PWYA 1G16A 3TLZA 3RJ5A 1ECCA 1EE2A 1MO2A 2PNFA 3R3JA 5IHPA 4D26A 3DE1X 3SYTA 2VA9A 3WHIA 4Q9KA 1W35A 1V3TA 2BKEA 3EDMA 4BQFA 3EAQA 1DOZA 3FNRA 1A2BA 4XOIA 3K9HA 4N18A 3GEPA 5FWDA 4D57A 3QKWA 2VYVD 3C39A 4IL5A 4RABA 3ZLVA 2D1RA 3LF2A 1OIWA 3AMVA 3KLMX 3SSNA 3TRDA 1A71A 4V03A 4WOCA 5A5EA 1S1CA 1HWYA 1T0UA 4YMIA 2A1TR 1Z63A 2IUSA 1N92A 2YFQA 3T5GA 4OQDA 1FPMA 3D1VA 1TCUA 4RS4A 5LQNA 1MOSA 3AYXB 2OCAA 3HWRA 3LVFO 4QOSA 1RAGA 2X19A 5IT4A 1AQLA 2GFIA 1CULC 2SKEA 4GLOA 3TNFA 3USCS 4YYZA 3A06A 1U7PA 1R8YA 2KBEA 3SEZA 3C5EA 1TFRA 5CDFA 1ESEA 1SCBA 2W2LD 2NZVG 4WN9A 5CT6A 5CD9A 4ASUD 4BBAA 1J2RA 2XCOA 4M9XA 4OFWA 3A26A 1HSZA 3GLFB 3I6ZA 1E5DA 1H42A 1WU7A 3D4PA 1AU9A 4UMDA 4F0JA 1QS0B 1LK7A 2BEKA 4JC4A 4BVKA 4MR8A 2PUEA 3MLAA 1VECA 1NATA 3MELA 5HTOA 1RYFA 2Z3VA 2GILA 3FCEA 1TTQB 4B45A 1OUMA 3F9IA 4PYLA 5HMLA 4OQLA 4EQ6A 4OJTA 1O95D 4KVZA 3R40A 4PG7A 1J9GA 3VRHA 1QGYA 5BRAA 3AF6A 2Q6IA 3UMBA 3KB1A 4OQFA 1NJ2A 5JR3A 3QX9A 2PVCA 3IT0A 2FPSA 2VJDA 4FYWA 1E59A 2PZGA 5DCLA 4B7CA 1U1FA 4DE5A 5EIOA 1X9HA 3NYIA 3PQFA 3PGXA 4ML3A 1N78A 2PAFA 4COOA 1N0UA 1VMDA 3LC0A 4HAOA 2RH9B 3DFZA 3EYAA 2R85A 3ER6A 4FFBB 3COZA 4KJZA 2VBCA 1MO3A 3OH8A 3Q7SA 1RM3A 3PKJA 2CXQA 3O31A 5FT9A 4FEEA 5ALDA 3DBLB 4LF7B 1ULZA 3H5LA 2YV5A 3C7CB 1RXVA 3O2JA 3PR3A 4LK3A 2NZWA 1ZUWA 3NIGB 1L8XA 4EMTA 4U8GA 5HF6A 2WBLC 1MHPA 1HOTA 3A4YA 4Y1RA 5KOIA 2E4WA 1S2NA 2QN8A 3LY7A 2ZZKA 4GO1A 3ITEA 3CZ9A 3E2PA 1WTAA 2DERA 2H1WA 2BOVA 4BCBA 1PJRA 3I2GA 4IDOA 1EUDB 1Y7HA 3OOWA 4DQVA 2NG1A 4FU0A 1K88A 1RZRA 2XMBA 3VPHA 3BX1A 3OFKA 3RAGA 1NVUQ 3V00A 2YWRA 2P11A 3RUAA 3TYXA 1TJPB 2ES4A 2HRQA 3LPLA 3QFRA 1N4AA 1U98A 5FUYA 1Z6YA 4UASA 4ZAZA 1Z8NA 2G5GX 2OUKA 3MAGA 1P4RA 3QQ5A 4KE6A 4BS9A 4CN8A 3OWXA 3FKJA 1TA0A 1FNBA 3HI4A 1H5QA 4JUFA 1NNLA 3AY6A 4OGKA 3HLYA 4R0NA 2IZ6A 3DAYA 1Z8HA 2Y9MB 5KJEA 5C1DA 4LA4A 4P53A 3W6UA 4UM5A 3PNKA 1Y3FE 1N2CA 1X7XA 3FMIA 1T34A 5IAAA 1YJQA 5LQJA 4M0FA 5H81A 3PR1A 4U7GA 2F4VB 1PJZA 1VMIA 221PA 4U00A 5KDOA 1Z5GA 1NBMD 3QKTA 1AK9A 1OH6A 3F5SA 3QELA 3IHLA 3QKSB 4L9AA 1NF2A 4WESB 3K2BA 1YZQA 2C92A 3NBQA 3UQYS 3BGSA 4QXAA 3FCUB 2B94A 4QATA 4W5WA 4NRDA 5HIIA 1TPZA 2P1ZA 5HOQA 3O4JA 4F2DA 1CJBA 1DDIA 2ZJ4A 4B3SB 3F2IA 2PGIA 4BXOB 3U1TA 2FR8A 1D9XA 2ZJBA 2HWUA 1N6HA 2W5UA 4C6SA 4JUDX 4R9UC 4X8HA 1K7YA 4YJHB 3PDIB 4NCXA 4Z8YA 5K6AA 1G7CA 4PFSA 5T57A 5KDDA 2PBRA 3AF4A 2O8CA 1OVMA 4KI0A 4W8GA 1ESMA 2Y0CA 1X80A 3I37X 1SUDA 1ZP6A 2ERXA 1POXA 4WHMA 1Y5LA 1JEYB 5FFMA 1U6KA 2PKXA 1UZMA 2BHRA 1LSUA 3U44B 4FB5A 1M2HA 2GS9A 5DWVA 4Q3KA 1XZMA 4FI3F 4CEHA 3R7DA 1OXUA 3KVVA 3W3ZB 1NW8A 4O1IA 2WDPA 3E48A 2RI6A 1EVEA 4BDTA 1U11A 4G84A 3JD3A 4RPLA 5ISMA 4R83A 4N54A 4BMZA 3WFZA 2R6AA 1TU4A 2HHCA 4JP3A 4QG3A 3AL0C 3I8SA 2BJWA 2FPUA 1JI0A 1KAQA 4PBSA 4N5IX 3H83A 4TTPA 4WLFA 1B1CA 3VKWA 4K6KA 3W5DA 3OSZA 5K6TA 2FF5A 4JAVC 4JJGA 4Y0NA 2WV7A 3V9AA 4D0GA 5JXHA 5LZ2A 2DCMA 4Y6GB 4Q7JB 2A1UA 4F1JA 5IDWA 4RWEA 5JDCC 1T9HA 2F55A 1VP9A 5JD4A 4R2IA 2J9FA 2VHTA 2WYWA 3HFGA 3VUEA 1VCNA 1OI4A 2Q4RA 4YGXB 5EE5B 2CDBA 3OD5A 4J03A 4M1MA 2HFJA 1DKQA 2CLHB 4TMXA 2V7GA 2EGGA 1CY7A 1Q91A 2M6LA 4A27A 2D1FA 3A58B 4LDPA 4M1TA 4EDHA 1W36D 3LFUA 1NWHA 4QPJC 5ICCA 1EQAA 4DRXB 4AKTA 1W87A 2SNIE 3SEFA 4ARSA 2ACVA 2X2PA 4H18A 1E6LA 3CV3A 2ZWVA 2O3JA 2OZLA 1KJWA 2YV3A 3RVPA 4OO3A 2PZ8A 4U9IS 1B26A 2HV8A 4FFSA 4PLGA 4Z9BA 4EHJA 4H7DA 1D1SA 2JD2A 1E6EA 4BUCA 1EG2A 1JHRA 1NI4A 1W44A 4BNJA 1HYHA 1HNZB 1BVHA 2XNDD 2XHZA 3Q5EA 1VBNA 5JMTA 2YHIB 4BMXA 1KMNA 4TKLA 3ZI0A 1O6BA 5LU9A 1SBQA 3QMVA 2IY8A 1EGHA 4BMOB 1X70A 3UT6A 5LBTA 2RFLA 3S2YA 1UPBA 2LR0A 4OL9A 5CT4A 5FOWA 3A2LA 3ZY6A 1QX3A 1YIAA 3M1LA 3MWEA 4ARZA 1H3NA 2BGUA 1XK6A 1C5KA 4QPCA 3ZGOA 1A76A 2EERA 3K0CC 1JLSA 1W6RA 5GWXA 2EJBA 4YY3B 2HHAA 2J09A 1ZITA 1JAYA 1CR0A 4JT2A 4TT3A 4Y3UA 4C0HA 4DMFA 3HDVA 3AVVA 3H2YA 2NTVA 4XXHA 2EIXA 2KI5A 1DAIA 1DRVA 2II6A 3CB2A 3G6KA 1T9AA 4QJ3A 4EUHA 1B15A 3LRXA 4OYLA 1QMGA 3GBPA 3U3DA 3LIIA 1O95A 3EQ2A 3LXMA 4PLTA 3G8BA 3TRJA 4Y2YA 4BQIA 4HVLA 1LBIA 3A1SA 1R0CA 2NU7A 3RQSA 4ITRC 1BYIA 3EPLA 2Z1DA 2Z83A 4JI2B 1UDXA 3A9WA 1X39A 1DKPA 2R8EA 1RVV1 1A2KC 3HL4A 1M83A 2FK7A 2B5OA 2V7BA 2V96A 2HJGA 1YONA 1N1DA 3EVBA 1IOWA 1K9SA 4ZTBA 1MCZA 3A9UA 4BX3A 1OCEA 1FDIA 1J24A 1T4DA 1IVNA 2JAPA 1XZHA 3TKLA 4CUJA 4YQFA 4EJ2A 4CKWA 1E92A 5ES4B 3SQWA 5D5QA 3VKHA 4JR1A 2XXJA 3IUQA 3K9GA 2IHYA 1GLGA 3RYFA 2HWWA 3OMLA 2R11A 4FYJA 3SD7A 5A3SA 3WIEA 2CT8A 3V34A 1NNSA 1CDOA 1KK0A 3VPXA 1XYYA 4KH0A 5BV8A 5K45A 4K9MA 1U02A 1MBZA 2W2LA 3ZWOA 2IDKA 2VJMB 5HM8A 4KITB 5KS2A 1IG0A 4HH3C 3BF7A 5THXA 3T9BA 2B4TO 4ZV7A 3EW7A 3NRCA 1BS2A 2BF4A 4BLPA 3L8YA 2E2WA 1C1XB 3OQHA 2C7RA 2CV0A 2V7VA 1SUFA 2RC5A 2VXCA 3N7AA 3PQDA 5E8JA 4OLAA 3ZQUA 2C77A 3LG2A 1WHTA 4XD2A 4GI2A 3MWLA 3CGWA 3F3YA 4LBYA 2F1OA 2I9PA 4GRIA 4JQCA 4KVGA 4ZAXA 1Q2XA 4EF4A 1O9HA 5DNCA 1DQRA 1F48A 4MGZR 3BILA 5ENZA 3SU8A 3CUWA 2WOJA 2XH8A 1FSPA 3G0BA 1IY0A 1DAMA 1Z8FA 4RADA 2ZBUA 4PYKA 1YUNA 2XQIA 1GFSA 1LRKA 1NUPA 5E9AA 4PVDA 1WMAA 3BWXA 4O1MA 3W6PA 4RTJA 1K2WA 2NZXA 4UXIA 1CWUA 1YBMA 5I5GA 3S68A 1PK7A 1T3ZA 3LA8A 1IUNA 1N8TA 3DOUA 2PEZA 3RBZA 4UZFA 4YQZA 4B31A 4BP1A 3UA3A 4FD3A 1P19A 3KR0A 4OQPA 4QDOA 5HF9A 2I65A 2BHTA 3LCMA 3RK1A 3MBKA 3TINA 5FDFA 1X87A 3RW9A 5A03A 4IDCA 1WMSA 4EB8A 3SQDA 1DC5A 5KCZA 3K2IA 3LYHA 1VJ0A 2ZI4A 1AKVA 2IS4A 5DBIA 3S29A 5KUTA 1NXVA 4UNSA 1UPFA 2IDJA 3A31A 3DA8A 3GJQA 3DXYA 1T4BA 4LX8A 4WXRA 4DQUA 1E96A 1U65A 1GADO 1R6BX 2AXEA 1BKSB 2WV9A 3A6EA 3KVYA 2ZLBA 4FGJA 4N82A 2HMVA 5HW0A 2DTXA 3O5AA 4JBYA 4BB5A 2FOXA 1MX5A 2HLDA 3K9WA 2IUYA 3A9TA 3HKDA 3A6FA 2C9ZA 2W71A 3E5RA 1E5QA 1AGXA 3IAM1 1WLSA 1YQGA 3DOJA 3KXDA 5EZYF 1A2OA 4YONB 1K27A 3DL2A 2R6ZA 3LLVA 3CKKA 2JLBA 3TX2A 2FN7A 4HDMA 4WSOA 1DTWB 3WV4A 2G4VA 3QQPA 3SHWA 4GPEA 1FSSA 5GJVC 1FZQA 4H4DA 3PV0A 4QJ4A 4YUAA 1FP4A 4GM0A 4C4PA 3JZAA 1A9TA 1KMMA 3K4QA 4JYZA 3ZBTA 3UGJA 5AW4A 2VHJA 2C04A 3NOXA 4Q9HA 1A4RA 1YR7A 3MQ2A 2C78A 1QFYA 1AX9A 3IIIA 5C35A 2C9BA 3II6X 1K6IA 2DWOA 1GTG1 1XG5A 1MAAA 1R0XA 3ZHTA 3KYIB 3KQKA 3DZKA 1EK5A 4TYPA 1M1NA 4ND2A 2EJVA 4HLQB 3RS2A 1S9DA 2XPCA 2NU6A 2QUAA 4HBGA 4UATA 1DJMA 5EPUA 2MTBA 3BRWD 1MT3A 1ML4A 1NJ1A 4TKVB 9LDTA 3W5UA 1RLOA 1PWEA 4IBOA 2R4QA 4C07A 5HZKA 1PSWA 2W6NA 4URHA 4UTPA 2JEYA 2KBFA 1LLUA 2HK7A 2VJCA 3IESA 4XYMA 5BSRA 1KDTA 1PP4A 2FZKA 1Q0TA 4MUIA 3AIKA 2EFEB 1A7AA 2WUVA 2G4CA 4Q9AA 4A92A 3WMWA 2RHJA 2E85A 4BQOA 5CB6A 2FFAA 4W1SA 3VO8A 1W4CA 5KYKA 4FEAA 3P32A 4LYGA 4DYHA 4IUDS 1BFDA 1FUIA 3DYBA 3R5SA 3T06B 1E69A 1ESDA 4WBNF 4A1OA 3P9YA 4WX2B 5HZMA 1PGOA 4EAQA 3WOHA 1YZFA 1IN1A 3V80A 3KYCB 5IKXA 1E4EA 1FVFA 2Y4OA 3HCRA 2DWCA 4G5RA 4GZ3A 4LXQA 4L3VA 4TLBA 2WWYA 2JGDB 4LZOA 4M7WA 3DL0A 1M0SA 2MSLA 3VX4A 2WA1A 2AOUB 3G8YA 3GMIA 4GQAA 3WTBA 2OM2A 3G68A 3ERCA 3R5TA 2VJKA 4DCNA 4RZQA 2JFPA 1HKHA 2D4HA 2HN9A 3C2QA 4Y67A 3BXOA 1SCJA 3VYUB 5KX5A 2O48X 3CR3C 4I9FA 3B13B 3WJAA 1M6WA 2H59A 2WJJA 3NHMA 3P9ZA 1YCDA 1U1CA 4UE6A 4ZT5A 3Q9SA 4EKYA 3L1UA 4OIMA 4BECA 1J1ZA 5HQ3B 1OXTA 4LSWA 1IYZA 2QT9A 1GPLA 4OHOA 5B4VA 5IZCC 5LFAA 1E9VA 4GX5A 4X45A 1RWNA 1ZVQA 3PDWA 4KGXA 3TTYA 3ZE8A 5BN4A 5JHHB 3MWEB 4EHNA 1QF6A 5DNUA 3UAOA 2GRAA 3HUUA 2YWFA 2CJWA 2FSSA 4RZSA 5E4TA 3TNJA 1U3TA 3QXCA 5AIBA 2BMVA 1QGUB 5BQPA 3BS4A 4BB6A 1YBVA 1WP4A 4CUKA 4D9BA 2NU8B 1OAKA 5LQRA 1WUYA 2V6IA 1W1IA 4KACA 5DYNA 1FQWA 4RY0A 4TM8A 4ALKA 4AJ1A 1NJFA 2IE8A 3AV3A 2WR8A 3ZDFA 1I1HA 2ZSJA 4AKEA 1DIBA 4LYDA 4ZCRA 5JAMA 3T7TA 1ODLA 3DP7A 1J8MF 4RVDA 5ARBA 1MVOA 1WDWB 3W5SA 2V8BA 1HMPA 2FETA 2J5QA 4IJ6A 2UVPA 3JX9A 4X0EA 5FUQA 3ORHA 3ETGA 4PE5B 4CL8A 5K0SA 1ILWA 2Z30A 3JASB 1QP4A 4LJ7A 4HGPA 1AN0A 2OPHA 3QTBA 1JWBB 2I3ZA 2RH8A 1Z68A 1TRKA 1J5EB 3LUBA 3OUUA 4P0TA 2FEOA 4GBJA 3VVBA 5F23A 2NTYC 2G67A 2I1VB 2VTEA 2PUAA 1DGQA 4EKIA 3D7KA 1QIFA 1FUUA 3CX8A 3WQBA 4GWGA 3ZDZB 1DUIA 3F5FA 5CXXA 3ZX4A 2Y77A 3LXUX 5CIWA 1VL5A 1Y6GA 2QDXA 3BQNB 5IG2A 2JLXA 2CJPA 3DZIA 4NOLA 1PFWA 2VSFA 4LDNA 2KMLA 3ZWCA 2BBTA 5DHTA 3MJCA 2OP1A 1JQJC 2Z98A 3KKPA 3OZ7A 4HWSA 3VPDA 3OBIA 5GVSA 2WHPA 3I04A 3NOOA 1VM6A 3HBNA 3HB9A 4KFUA 1I32A 3KXKA 4Y9DA 1CE8A 4RF5A 2WW8A 1T0HB 1XMPA 3C3AA 3HUDA 3PZBA 4OU4A 5AKZA 1NHGA 1BXZA 4ZI2A 3IKMB 2YXBA 3PEVA 4MS3A 3ROKA 1C9YA 1HT0A 1JSLA 4C2TA 1FA9A 4X1KA 1DKUA 1KO5A 1TM7E 3OE1A 4EY4A 2ZXUA 4BJ3A 1WZ2A 4I8IA 4CEHB 1ZUNB 3A9SA 1XJ0A 4C78A 1FLNA 2IOQA 1DDGA 3GLHB 2AW5A 4IHJA 3TG2A 1FW6A 2B36A 2QENA 1IWBB 1K5PA 1IN6A 4YI5A 4OI1A 2ZJOA 1SD5A 4OATA 3E27A 1SG6A 1FNDA 3H2BA 2BRUC 4HDAA 4E2XA 1PR5A 4I4NA 4J8PA 3AB7A 3VV2A 1Q95A 2H0QA 2QUZA 1NW3A 3O8NA 1M7BA 2GD1O 1QG0A 4MVCA 3DOFA 1S02A 3GLHA 5LC1A 2VNSA 2O07A 1QQTA 2YVKA 4NMXB 5GOTA 4YQEA 1Z25A 3I2JA 4KWTA 5EIFA 2CJYA 5HKKD 1GGEA 3WFIA 4A6XA 2H1CA 1PGJA 3DONA 4PZPA 1WAMA 1D4FA 2QLFA 1JHXA 1HK7A 3GJXC 4U0JA 2MU1A 5LXTB 3RYCB 1FNMA 2ZPAA 2ZRHA 5A02A 1TKAA 1OLUA 5BYKA 3H9UA 1CE8B 1IDN1 2Y0EA 5IAEA 4Z3DA 1NVVR 5JNRA 5K0ZA 5SZKB 3UTDA 2ZDHA 3GJ3A 3HBAA 1VHJA 2O19A 4R1TA 4M9SA 2NU9B 1R4NB 3RRYA 5BT8A 3LQ1A 1S5PA 1ZGCA 3UCFA 2PRSA 3DL4A 3U37A 1XAHA 2C9CA 5FORA 3I9NA 2BGMA 2DWQA 3GFGA 1GRCA 4ZZ0A 1SVUA 1T91A 2YV1A 4IO1A 4RTLA 4OSPA 4QSMA 4DWJA 2C2XA 3AUSA 4YRBA 5L95A 3DDWA 1FDSA 5GP1A 4QBKA 3CF2A 3W78A 2R8PA 4XSHA 5ALMA 3M0EA 4ZU6X 3G0HA 1B8OA 1X1TA 3H42B 1SIUA 1P45A 2NU9A 3KKQA 4JUBA 3BIFA 3K6RA 1UAYA 3KVOA 1E1QA 2F3UA 1SCIA 3M1YA 2ZITA 1GAEO 4ARUA 3OX2A 4BHTA 4WEQA 2X22A 4MWBA 2RK3A 4FDTA 5J2TA 1JDJA 2OZEA 5BSKA 4UEOA 3TTUA 3IBTA 1JHAA 1LH0A 1PV4A 5HGXA 3RVNA 4E2WA 5IJXA 3RAJA 2G72A 3CNEA 2MR5A 4LC9A 4OXXA 1IDOA 1CNEA 3LF1A 4WESA 1QORA 2ADOA 2Y4NA 3HR8A 4R0VA 1L4KA 4ZT6A 2BVNA 3M34A 2BP7A 4BO2A 1RYBA 4J0CA 1NUSA 3HKEA 4P54A 1F2VA 3HN6A 2IE0A 2YOGA 4X3PA 3SXPA 3UT5A 5A4KA 1E61A 4CM9D 4FVTA 4HLDA 3S99A 4DGSA 2FSIA 1CR4A 3FGOA 2IUUA 3TCXB 1S2MA 2PQMA 2WMNB 5SZJA 3W8EA 1JG4A 2HPAA 1X7ZB 4NV0A 5BN4B 2IRWA 2CHGA 5L4SA 3DVLA 1VGRA 1BN7A 1U5CA 2QX4A 3DBHA 4HWGA 4DA4A 3GDOA 1A7KA 2DF8A 2W6ID 3PXUA 4QU0A 3VR0A 4E94A 3PZRA 1UPTA 1L7NA 2FW1A 2QY9A 4QREA 1I1NA 4J94A 1UC8A 2VNHA 2WICA 3FDJA 2GWHA 2H17A 3L8ZA 4CLRB 4LOHA 2CUKA 3PL5A 3A6HA 2I4TA 3ABIA 1VYVA 4P82A 2W48A 2I87A 4UKDA 3AM4A 4P98A 5DI9A 4BNMA 3IOEA 3PHLA 1UXKA 3FMFA 3MQ4A 2BF7A 5TT0A 5L45A 3P5BA 2OV6A 3EDRA 5KYWB 5E9JA 2RGDA 2H54A 2LW7A 3WGMA 3P26A 1B0ZA 2I67A 3CZPA 5EHXA 2ZM6B 4MB2A 1MENA 5KOHB 3K5HA 3BWCA 3G0CA 2XJ4A 2ZI6A 3UBMA 3UK6A 2QRQA 2C9MA 4TSRA 2OD9A 1KDVA 1K0FA 3R9IA 2UXCB 2ZUUA 4AJLA 3E1KA 2AI2A 2LE0A 1M8GA 2WD7A 3QHQA 2FQYA 3QNUA 4PLCA 3TDNA 1Z6AA 5K4GA 3NP7A 2AQIA 1YQWA 5BVGB 4O3MA 2PO7A 3DULA 4Q19A 4WLUA 2NXWA 2WTEA 2AX4A 1V1MB 4KQMA 2GAFA 4RPGA 5AJUA 5IK2D 5IM4A 3EYWA 5ESRA 5IARA 3ZE6A 4GSLA 4INZA 4JB0A 5CX1B 4HXFB 5A3QA 3I72A 3D02A 2C94A 4HPWA 2ERCA 3N07A 1TIBA 4LISA 4WIAA 1R4AA 1I7PA 3AUTA 4E0BA 2O05A 5A9SA 2GK6A 4JJ4A 3U3RA 3L0YA 2DOKA 1U0JA 2ZSIA 3VNRA 4D1YA 4CV1A 5JASA 4G37A 4YRTA 3BXFA 1UOQA 4I8XA 4N0EA 1SGWA 3TDKA 1N9GB 5IULC 5DIFA 4EF6A 2KLHA 5LQCA 5HQTA 3R77A 1ORWA 3QBEA 3WGZA 1VG0B 2E55A 2Z2JA 2HXYA 2OFFA 1ZG3A 3SX0A 4C3VA 1JDUA 5CPFA 1LRLA 2WFMA 5KTTA 5C3UA 2CSXA 3C3XA 3ODPA 2C8JA 4EGSA 4BEJA 4NJOA 1RCTE 1CSEE 1WR8A 4W99A 3GLGE 2NW6A 4N5NA 1JFRA 3WADA 1ZOLA 1DAPA 1RQ7A 1N1EA 1WL8A 3OT1A 4C4SA 3QI7A 2VG8A 3OE5A 1D2HA 1QB7A 2J67A 2XIJA 3JTEA 1XZEA 5ALSA 2I3AA 3SZRA 1P1BA 3C1AA 3UV7A 2DWUA 3QU2A 4A9AA 4TS9A 2XE8A 2Q6KA 3E53A 3RGWS 1M6VA 3QTTA 3C4JA 2J3KA 2WHXA 1BJRE 2BFEA 2ZQ5A 1L7OA 3CUVA 3FY4A 3MPUA 2D8MA 3HGQA 4G01B 4PQRA 1W29A 4LKRA 4M38A 2XNCA 4Y0VA 4DA8A 3WGTA 5H3CA 4KQXA 4GRAA 4ARVA 4BN4A 4KXFB 3R9WA 3S2UA 4KIUA 1J8VA 3WGKA 2VHQA 3FHCB 1FFDA 1HE8B 2O2YA 4BRUA 1Y0BA 3S3TA 1O8BA 4EY5A 5ALRA 2PGAA 4M2LA 1GA6A 2BMFA 4QOHA 5EZ6B 3RF6A 3HCOA 3LK6A 2XMGA 5LYJF 4YPOA 4AI6A 2UAGA 4OP3A 1LNZA 3JD4A 2QE7A 4MB0A 4I36A 3IBSA 1XEXB 2Y1WA 1TD1A 3FYCA 1Z4LA 3I45A 3I5MA 4U3JA 1UKAA 1KSGA 4EEZA 1ZNXA 1YIDA 1E18A 2AF4C 3A2KA 4HGNA 4TN1A 3U4QA 2GEJA 3S8MA 4YVFA 3TGWA 5I48A 3TGLA 2MSCB 3AHDA 4Y7DA 1ORDA 1PDOA 2QWXA 5B7NA 1CS0B 3F4LA 3KRTA 5JISA 2XVZA 5U1PA 1ONPA 2ZWMA 3C8DA 2JVJA 1V8PA 4GMFA 2HBRA 4U2CA 4E5UA 4XCQA 3OPXA 4YAFA 3ZZMA 3C5CA 4RL6A 2X0KA 1NUAA 2IEAA 4NDZA 2CHFA 1IBSA 3P0JA 1UANA 1TFUA 2HWYA 3QUQA 4FFWA 1E6MA 2BHSA 5H59A 3SOZA 4DY6A 1E7RA 1YASA 4AY6A 1LPNA 4I1RA 4QOEA 1CY0A 2AL7A 4I9HA 4QXQA 1E2UA 5LDHA 3LUFA 2OFOA 1SXJC 2Q62A 3ACBA 1O7JA 4QARA 5IYZA 2BGGA 1SVKA 2OHXA 3QPUA 2QDKA 2ZYGA 2F6RA 4PVCA 4YMTA 4KDCA 2PSFA 1ZUD1 3WRXC 3OHMA 4C5CA 3B1VA 1SZCA 3N0XA 1E1CA 2YXNA 3V1MA 4M1ZA 1P0QA 3Q4GA 2H0RA 3QPCA 4BC0A 2XUZA 3EDOA 1XP5A 3P9KA 5JCJA 2FMKA 1J4AA 4J1NA 3T12A 3TRIA 1T6NA 4MHTA 1IXKA 1PVOA 1GD1O 4OL0A 3CONA 1DV2A 1KSHA 1ICIA 2VF2A 4Q4AB 3C7AA 3EWIA 3OEWA 1ZK3A 4MYTA 5EZQA 4LEIA 5IM5A 2Z56A 3T9AA 3TNDA 1RZVA 2PE5A 1N2CE 1PR4A 5I9MA 4UHBA 1PL6A 1KGDA 4HXEB 1F9AA 1Q0SA 3C6BA 1XMSA 1N6LA 2QIPA 2FMTA 3GPLA 1RE1A 3OAAD 3LD9A 5CLLA 2KYRA 5IJ9A 1E6UA 2M1ZA 1JEEA 2I62A 2WSSD 2IKSA 3AR9A 3ICVA 4S0ZA 2PKQP 3JQPA 2YJ3A 3ID6C 1JAZA 3SSMA 3N2YA 1FYWA 2AKAB 1JH9A 1JYSA 4EFDA 3KHUA 1GRQA 4OHXA 5EEHA 4MP6A 4PXSA 3V4OA 2F3TA 5JPCA 1QVWA 4QAJA 1KY4A 3AY3A 1F6WA 4YFYA 4KFRA 4UTOA 4YWHA 4KYUA 1AQUA 2WNHA 2H16A 1FYVA 2I3BA 2FJ0A 3T35A 2A1IA 2JJ1D 2Z2KA 3U3ZA 5KYTA 1VPLA 4DUPA 1E7YA 3PXDA 3FGPA 2R1VB 5C37A 4IZ6A 5HZHA 1YD7A 3OPQA 3VR5A 1E1RD 4FSXA 2WTUA 4MVJA 3O90A 1WF6A 4F97A 2XMCA 2PWBA 1RHKA 2AC4A 3PPIA 4F4JA 3VZRA 2ZR7A 3EZFA 8LDHA 1I2BA 3J81A 3V4LA 4DV7B 1WULS 1XQ1A 1E4OA 4K03A 1ZGAA 4MPPA 2C5GA 4C88A 1RCFA 3MF4A 5G1PA 3TN7A 5LJIA 3SQLA 2G8NA 3QITA 5JU6A 4HEA6 4JODA 3KQHA 3KPUA 2JLAA 4JELA 3MFYA 2W93A 3RIYA 3KC2A 2BUAA 1L5HA 4U39A 5AJYA 4E31A 4PBTA 1RZ3A 2CEAA 4PLZA 4TV9A 4A2WA 2O5CA 3W05A 1K4MA 2JS7A 1Z36A 3SHOA 1D4OA 3U49A 1E2LA 3ZZTA 3GZNA 5FWXA 5A4MS 5LOVB 3TLKA 1Q7GA 4FHFA 4K86A 4AUNA 4HLCA 1XLUA 5CM2Z 3PWSA 4ZPJA 3H16A 4HFJA 1Y3IA 1Z2NX 5BSWA 4DIBA 4BC1A 1DBRA 1B42A 4LY3A 1GSOA 4HLUA 3VH4A 4A8HA 4M8LA 3LMKA 1F17A 3E0QA 5JO9A 2ZAGA 3V32A 2C20A 4QZVA 2HX1A 3ODGA 1TTTA 1XWIA 5AM0A 1C0LA 1OI7A 2AMJA 2LPMA 5GGXA 5JADA 2XMRA 1UIMA 2YNMA 3PFBA 3OJXA 2FWMX 3F6SA 5KI6A 2J5RA 1ZHOA 4P81A 1G98A 2R6GA 3T54A 3EC7A 4O08A 2PVSA 2V7WA 4K5QA 3LDAA 2YW2A 3SZOA 2GESA 1YZKA 3CF4A 3D3QA 5CA1A 4FM9A 2GCNA 5AYVA 4C05A 4P7FA 1T5DX 5LU8A 4G07A 2KSQA 4QWWA 5FHQA 1YQXA 3PR2B 1JTVA 3E9YA 2VKQA 1OF1A 1MH9A 2FRDA 1YOVA 2BCEA 4DZTA 1PDVA 2YICA 2A5FA 4BN0A 1NDHA 1YZNA 1YA4A 3QXXA 4G1UC 4FNOA 3THXB 1RC8A 4BZPA 1JEYA 1XTKA 2BR5A 2Y05A 3QUTA 4XQEA 4YROA 1N5IA 1XRQA 5IVIA 2P68A 3ZWQA 1VDZA 3BWEA 4G36A 4MV4A 2VRBA 2FI1A 4LJ5A 1T5SA 3B1JA 3TSYA 1I5RA 4LHSA 2P9HA 5F9FA 1NQAO 3H05A 1ZK1A 4ZJZA 2J6BA 4ODIA 4EK9A 2QRLA 3I39X 3PNVA 3LUHA 3TIIA 4ZAVA 3BXZA 1BCRB 1GHTA 3OT5A 3EUWA 2YMMA 3QWHA 1IQ0A 3WKAA 1O0CA 2N42A 4PYMA 4EL5A 1ZQ9A 4AP9A 1NI4B 4Z4EA 4O2AB 4AJ9A 3JPYA 4EKDA 2DLCX 1P2VA 4MUMA 4QO7A 5DX0A 4DLSA 2RC6A 3LQFA 2FQWA 3M7IA 1EPUA 4QM7A 5ITWA 4QWMA 2XCLA 4DIUA 1ODCA 2PD3A 3ZNQA 1W36B 2ORVA 4R8KA 3T0FA 1KF0A 2ZIUB 4DQDA 3WGIA 4C3UA 1EK1A 4JLUA 2F1IA 4X90A 3TM4A 5JRDS 3FCOA 4M8KA 5DNYB 2W2QA 2I4RA 2DTDA 3DMHA 3BIOA 2QNIA 1RTKA 1RKUA 1FW8A 1WOMA 3RRMA 1Q11A 3IAM6 3IKTA 1TK2A 1LPSA 2VQFB 2J9GA 1SPXA 4EKNB 3FDZB 3L6UA 3WL5A 2BCGY 3MK31 4K9RA 4RV4A 5JV5A 1X6VA 3R41A 5KQPA 2UXBB 1EB9A 3AHHA 4NJEB 2B7CA 2VH2A 1UMKA 1XV5A 2IC5A 1NM5C 2O4UX 3KKKA 3C6QA 2CLDX 2EEPA 4FYIA 2Q45A 3ORRA 4HYYA 3ZWDA 2RONA 3EZ9A 3DEKA 3GMSA 3OIGA 4EYGA 2LKCA 1Y8RB 3UMCA 3S8YA 1ZBQA 2ZCUA 4YMLA 1XTUA 3BIJA 5B1IA 2D1QA 1A0OA 5A2GA 1DIAA 2PLFA 4CV2A 3URMA 3DDUA 3QFHA 5CVUA 1CHDA 2GO7A 2RH5A 2YC2C 2IYPA 4TLAA 3AZQA 4MR7A 1QHIA 3RTGA 2Q28A 3PJDA 1LJ8A 2CNWD 3H65A 3WDMA 4E1BA 4LJRA 1T10A 3V8QA 4CFSA