3D02A

Crystal structure of periplasmic sugar-binding protein (yp_001338366.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.30 a resolution
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
300
structure length
300
Chain Sequence
b'EKTVVNISKVDGMPWFNRMGEGVVQAGKEFNLNASQVGPSSTDAPQQVKIIEDLIARKVDAITIVPNDANVLEPVFKKARDAGIVVLTNESPGQPSANWDVEIIDNEKFAAEYVEHMAKRMGGKGGYVIYVGSLTVPQHNLWADLLVKYQKEHYPDMHEVTRRMPVAESVDDSRRTTLDLMKTYPDLKAVVSFGSNGPIGAGRAVKEKRAKNKVAVYGMMIPSQAASLIKSGDITEGITYDPATAGYALAAVASTLLNGKTIEPGFELKELGKAEVDSDKHIIRFHKVLLVNKDNIDSLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative LACI-type transcriptional regulator
publication title Crystal structure of periplasmic sugar-binding protein (YP_001338366.1) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 1.30 A resolution
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Sugar binding protein
total genus 106
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d02A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d02A01
3L6UA 3N0XA 1Z2EA 2MYUA 4G0QA 4B09A 3HUTA 4KQCA 5TQJA 3H5OA 1D1QA 3MQ4A 5IUNC 3O74A 2AYXA 3QX9A 2P9HA 5KC9A 3KHTA 4UHKA 5IC5A 4F12A 4YWHA 1KRWA 2ID9A 1QQBA 2E4YA 4PEVA 3O1JC 1NXTA 3UUGA 4RZSA 4MR8A 5B3JA 1D2AA 5BRJA 2PLNA 3DZDA 5TQ2A 3MMNA 4XAQA 1Z13A 4Z4CA 1LJLA 1P6QA 1PEYA 4XLTA 4ZMRA 2IPNA 4YLEA 1Z18A 2PJUA 4DN6A 1MVOA 3QEMB 4PYRA 4NCBA 2IPAB 2JVKA 4ZJPA 1CYEA 3BBLA 2VUIB 5JNVA 5KC8A 1LJUA 2QV0A 3IPAA 1ZITA 4L85A 5EWJB 3VNAA 4WXMA 3QELA 1FFSA 3G85A 2GKGA 2Q5CA 4DADA 3KS9A 1Z26A 3MYYA 3OMWA 4MS3A 4EUKA 1MAVA 4Z9AA 5HKOA 2X7XA 1E2BA 5HM6A 1KRXA 2QR3A 2VK2A 2FMFA 4OBBA 3IP5A 1BA2A 4N41A 2OQRA 3GT7A 4JASB 4MR9A 4YV7A 1YIOA 4Z4EA 1XWWA 2XDYA 3GA5A 4KK4A 4RXMA 1OXBB 1PNRA 4IILA 3SG0A 1CHNA 3OLYA 3SNKA 5I4CA 2E4UA 5IEJA 1BAPA 1DBWA 4HNRA 4TLLB 1F51E 4GNRA 1YMUA 1CEYA 4EY3A 4KQ9A 2GI4A 3LUKA 3H75A 4QYWA 5IEBA 2HPHA 3T95A 4EYOA 1FFGA 1Z15A 3G1WA 1AB6A 1JWLA 4RY0A 3HDGA 4QPJC 3ROFA 4LRQA 3E61A 4W5OA 1IIBA 3HZHA 1GCGA 3TB6A 4Z9BA 1ZN2A 1HEYA 4MR7A 4WXEA 2PE5A 1M5UA 1YK1A 1DZ3A 2JK1A 1USIA 5GOTA 3RVJA 4F3TA 4O5AA 4EGSA 1JF8A 3S99A 4MR8B 4WZZA 3CKMA 1E6LA 1ZDMA 1EAYA 5C5CA 4RXUA 3HS3A 2YHAA 1U8TA 1L5YA 2A9OA 2VYCA 3D8UA 3KYJB 3D02A 4ETMA 4G86A 2IOYA 3TMYA 1FSPA 5EWLB 1W9HA 2FMKA 2LPMA 3QEMA 2F8SA 3QLUA 4Z4HA 3KYIB 3FMVA 1Z2DA 3QELB 4JB0A 2FQYA 4D74A 1ISSA 5EWJA 3HCWA 4MS3B 3RH0A 4E7PA 1DCMA 1QKKA 1ZHHA 2L19A 4Q7EA 3CZCA 2WMYA 3H5VA 3T6KA 2FTKE 3KKEA 1TM2A 4RWEA 3OLWA 2FN9A 1EHCA 2V0NA 1QQAA 4Y9TA 4YGXB 1JFSA 4LE1A 1DC8A 2HQRA 3EQ2A 4NV3A 4D6YA 1P8AA 1SD5A 4EVSA 3DGEC 3RVLA 1P2FA 1QO0D 1T34A 4H3KB 1RZRD 1DCFA 3RVPA 4KRFA 4FE4A 3B2NA 5CNJA 1GCAA 2RGYA 3N8IA 2NT4A 3GBVA 4HNQA 1YS7A 3RQIA 1JYEA 1USGA 4MRMB 4MR7B 2PMCA 4LE2A 1JDPA 4YP9A 1MB0A 3EAFA 3QLVC 3HXMA 5CNMA 4RK7A 2FMIA 1APBA 1DC7A 3IPCA 2L17A 4N76A 3CU5A 3GRCA 3P9YA 3QEKA 3DLHA 5TPWB 3OMXA 1EWTA 4EVQA 2B4AA 1PNTA 3N0RA 1UDRA 3OLZA 1QMPA 2LIVA 4YS6A 4RK4A 4MQEA 4KFCA 3RVKA 1NXPA 2GX6A 2PUCA 1ZGZA 2E4ZA 3BREA 1DG9A 3KTOA 3OLXA 3QX8A 2WWVD 2E4WA 1KMIY 4NICA 5EWMA 1PUXA 1C0EA 3BRSA 2FQWA 5EWLA 4ZYLA 3O2QB 2PUEA 3KJXA 2MSWA 2QU7A 1QO0A 2E4VA 8ABPA 1VPWA 1VRVA 2KYRA 4KMRA 2ZWMA 2A9QA 1BVHA 4IF4A 3URMA 3IDOA 3N53A 3BRQA 3LUCA 4F11A 5KQGA 2QZJA 3OM1A 3Q15C 4LX8A 2IPLA 3LUJA 4YRZA 3ILHA 4KVFA 3H1FA 5BQ3A 3C3MA 2CD7A 5TQ0B 4RY8A 4OLAA 1TMYA 2RJOA 1L5ZA 1TLFA 3R0JA 3N75A 3I45A 1ZGGA 4Z4FA 1ZAYA 1TJYA 2J48A 1SRRA 2R47A 2HSGA 1NXXA 2N9UA 3JPYA 2PL1A 3RVOA 5BR1A 3F73A 3EDCA 1QP7A 3CG0A 2RDMA 4LZLA 5FBKA 2TMYA 5F64A 3FFXA 1E6KA 1GUDA 2A9RA 1NTRA 6ABPA 2JCGA 4YCSA 3OQNA 4MRMA 2PUBA 2H0AA 2JB9A 1E6MA 3KG2A 4JA2A 4MS1B 2HQOA 3E3MA 3JTEA 2RJNA 1LBHA 4MLDA 4FB4A 3HM9A 4MS4A 3HV2A 4PZ0A 4RDCA 4RY9A 2FMHA 4MPTA 1AB5A 4G0PA 4N0PA 2R48A 4MQEB 5JNRA 1JH9A 2FKAA 5TPWA 2FEKA 3HUUA 4G97A 3H5WA 5FBHA 5TE9A 2PUDA 3L49A 3F6CA 3QLVA 1J56A 1Z12A 5EWMB 5CNIA 2AYZA 2FW0A 5DGCA 5DKFA 5KQPA 2F8TA 4Z0NA 3GWGA 3CNBA 4PE5B 5B3JC 3FFWA 3NBMA 5TPZD 2MYTA 1NY5A 4RK0A 5E3JA 5C5EA 3A0UA 2WY2D 4Z4IA 3H5IA 4TMYA 4MQFA 5JNSA 3CS3A 3OO0A 4EYGA 2PKXA 4FE7A 4IGAA 4IRXA 1ZVVA 3O21A 2LBPA 4G0ZA 1A04A 4LDAA 2GBPA 4S05A 5DLEA 3HDVA 3ROTA 3GBPA 2R4QA 1PEAA 3A0RB 4EYQA 3Q9SA 2PAFA 4O1HA 1QP4A 1B00A 3OO1A 3EODA 3H1EA 4XFKA 5GQSA 4H60A 4IMIB 1RPJA 3H5TA 4HNSA 5TQ0A 1DJMA 4UHJA 3M6MD 3M9XA 2JBAA 3JPWA 2FXIA 1ZESA 3W9SA 4RK5A 2QVCA 3N0WA 4XASA 2M1ZA 4N0QA 2FLWA 3MM4A 1RNLA 1U04A 2MYPA 3EULA 4RXTA 1M5TA 1MIHA 1U0SY 4GPAA 4RK1A 1YK0A 3I09A 3O1HB 4KV7A 3UK0A 3KCNA 3LKBA 3A10A 1KGSA 4JOQA 1MB3A 2MYNA 3I42A 1H9CA 3OM0A 1SXIA 4KNYA 1NXWA 3DBIA 3SM9A 1EWKA 2NT3A 4JP1A 3TX6A 2IYNA 1ABEA 1NATA 1TVMA 1I3CA 2MSKA 3MF4A 4MS4B 4O1IA 5DCLA 4NCAA 1YTUA 2ID7A 4MS1A 5IUJC 1D1PA 5ABPA 1FQWA 1F4VA 9ABPA 3Q7RA 4OG2A 3DLBA 2FN8A 1DCKA 2LUOA 2A9PA 3LOPA 3Q41A 2HQBA 3NHMA 4JAVC 5KQMA 4W5RA 2JRLA 5FWXA 3LKVA 2QVGA 1K66A 4OTZA 4RU1A 2QXYA 1NXOA 1FFWA 3GYBA 1Z25A 3EGCA 3RVNA 2YHBA 3FDFA 7ABPA 2WJWA 3JVIA 3CHYA 2NZVG 4MAAA 1DRJA 1LBIA 4MQFB 1URPA 3ILYA 1XHEA 1DRKA 1JBEA 1M2FA 1Y1LA 3NHZA 4JB2A 1RZRA 4MYRA 5T3YA 1JYFA 3RVMA 3UKJA 4LE0A 1QP0A 4ETIA 4YR7A 1A2OA 4WWHA 2JVJA 4RS3A 5PNTA 2WJAA 3QLUC 3VNBA 1DP4A 1USKA 4G0YA 3JY6A 4KK3A 1ISRA 3QLTA 3A3KA 4M88A 2CWDA 5KI6A 3C97A 1JDNA 1VLZA 1JL3A 2FLKA 3BILA 1P6UA 1U2PA 1LK0A 3JS5A 4N47A 3HSYA 1YMVA 2PUGA 4W5NA 5IBQA 3TO5A 4RV5A 2JBAB 2M98A 4Q6WA 4RK6A 3LMKA 3NNNA 2HJ9A 3HJFA 4ETNA 3K9CA 1QPZA 3C3KA 5KWSA 5DTEA 3CFYA 1YS6A 4Z99A 1RXEA 5IUKC 2IDMA 1Z17A 4IMJB 2PL9A 1DBQA 3EJWA 4NQRA 2CHFA 2H3HA 4P1ZA 3O1IC 3LUAA 1PHRA 4E7OA 4WT7A 3Q7SA 3KSMA 4S04A 3HEBA 4D6XA 3CLKA 2FVYA 5FWYB 4QYMA 2I6FA 2JVIA 3LUFA 3LUGA 2LP4Y 4Z4GA 3TD9A 2VUHB 3KLOA 2WRZA 3MIZA 3FGZA 4TLMB 4XXHA 5CNKA 3SAJA 5T7BA 3HO1A 4F06A 4KREA 3GV0A 3OQMA 3FFTA 5JNTA 3CTPA 1NXSA 2QSJA 1VKRA 2L2QA 4G0MA 4YO7A 5FWXB 1U2QA 3HVRA 4MLCA 1OXKB 5CHYA 3K4HA 4P98A 1NXVA 1R8JA 4RSMA 1C4WA 2QW1A 3EQZA 3SY8A 3T8YA 1YVUA 3LUHA 4HYEA 3RVQA 5JNUA 2NZUG 3C3WA 1JX6A 1EFAA 3LFTA 3I5AA 5KQLA 2E4XA 4ZMSA 1EWVA 2IKSA 3O75A 3C6QA 1XHFA 4Q6BA 3RVRA 3H1GA 4W5QA 4KZKA 3H6GA 4EVRA 3T38A 3NNSA 5TQ2B 4WUTA 4TN5A 1QNLA 3IP7A 4DQDA 5ED4A 1M2EA 1A0OA 1Z16A 2B1JA 5JNWA 1BDIA 3O2SB 2ZAYA 4F8JA 4RKRA 3DGFC 1D5WA 4G0XA 6CHYA 2GWRA 3RVSA 2NUBA 3KLNA 3CZ5A 3F7NA 2MSLA 1SXHA 4G0OA 4EYKA 4H3HB 2IPMA 3H6HA 2PUAA 2CHEA 2O20A 1ZH4A 4KPYA 4PICA 2FQXA 3OLVA 2FEWB 3H5LA 3M9WA 3SQNA 3N6VA 2FEPA 3O2JA 1S8NA 4W5TA 2L18A 2R25B 4MR9B 4RKQA 5IX8A 4LDZA 1JHZA 1JFVA 3LUDA 4L4UA 4OLBA 3GL9A 4N03A 5TPZA 2PUFA 3F6PA 3Q7TA 2W42A 1ZH2A 3CRNA 3NNDA 3QK7A 4QICA 1JLKA 3JVDA 1ZY2A 2P4UA 5FWYA 2BGGA 4CBVA 5D2CA 1K68A 1W25A 1RXIA 3LTEA 5JS1A 4OATA 3OQOA 3IP9A 1D4ZA 1SXGA 5HQJA 3CG4A 2OENG 1BDJA 1WETA 1DBPA 5HSGA 4MGEA 3HK2A 4ML3A 1JFTA 4ZPJA 1GUBA 5IULC 1ABFA 3MA0A 3IP6A 5BRAA 1GLGA 2WB4A 2FSPA 2DRIA 4XARA 1BDHA 5JS2A
chains in the Genus database with same CATH superfamily
3SBEA 3WAGA 3NH6A 1Z2EA 1WHTB 4EMTA 2IQIA 4L95C 5IM5A 1U9CA 3LP8A 3QA9A 3QU9A 2J6HA 3PVCA 3I1IA 3JQBA 4HEQA 5GP1A 4M9RA 3GAZA 3O74A 5COBA 5EP3A 1FS4A 3T1OA 5IC5A 3WWOA 4YWHA 5EJ6A 1D1SA 1ZGJA 2XUQA 3D0RA 1RRVA 3LBNA 5ERXA 1WVIA 3IX7A 4K1LA 2ZJ4A 4MR8A 4P35A 1D2AA 3K0KA 3LQFA 4CIAA 4JBWA 3T3NA 3KKQA 3MMNA 1JQBA 3NWPA 5BN1A 1ZR4A 2CVQA 4W5HA 3TEFA 1QVRA 5IT4A 2YFQA 3BSFA 5IKMA 1TUIA 3GRKA 2YWDA 5JPDA 3UXMA 3BIXA 5A2GA 2W6PA 3ZHTA 4P54A 1O97D 4NOJA 4NCBA 1YRBA 3HYSA 4XYMA 3VSEA 3Q8LA 1XQXA 2W0MA 1JVNA 4ITRC 1RZUA 4RHEA 4UREA 5F78A 4E5SA 1S7GA 1LJUA 3RPEA 1G66A 2X1MA 4RYLA 4K6MA 2FPIB 3UK1A 4P2BA 3V7WA 1JLLA 3UC9A 3X0DA 2X2PA 1T8SA 2GKGA 3EYWA 3ZV6A 4ZN6A 1Z26A 3OSUA 3UHJA 1I1QB 3EDYA 4EUKA 3DKIA 5HKOA 3S40A 2G17A 2QR3A 3EG9A 3PXBA 2HWKA 1BA2A 2JKVA 4KGXA 1TD1A 5FOUA 4FHZA 2H63A 3DO8A 3FDXA 4JJ4A 2BJVA 3TEJA 5KOJB 2P6PA 3A70A 5AM5A 4PINA 3EN0A 3U37A 4DPMA 1XRPA 4LJ5A 5CHEA 4LOHA 3DMFA 3E0QA 3BWVA 1DG1G 2C07A 3FPSA 3M5WA 1G5QA 3DL0A 3P8ZA 1F2VA 1O4VA 2JGNA 2A5DA 4HQ6A 3KUCA 1CZLA 2JGJA 3VX3A 5B6PA 4Z51A 2P6OA 3UOWA 2H4WA 1IPFA 2AXNA 4FEGA 4B9AA 3R3ZA 1DXQA 2ORIA 1L5WA 4GMGA 4P80A 1R4MA 3B1FA 5A4IS 3PUVA 4Q93A 4LRQA 4W5OA 3V33A 1IIBA 3GHYA 3EXFA 1L7BA 2WKPA 1L4GA 1Q0LA 1R6BX 3M6IA 4AJIA 8ATCA 2Y6UA 3BBPA 3UXYA 1JG6A 1E99A 1U8UA 1VOTA 2ZB4A 1L7OA 4LPKA 4JN6B 2GNPA 4F3TA 1SOWA 1N8SA 3PQFA 3DZHA 3JXEA 4UASA 3MTQA 2OAQ1 1QQ6A 3B5JA 4QE3A 4BTLA 1Y6RA 2HD4A 2V98A 2CLFB 3LZ6A 1UFVA 4CUJA 1L5YA 3FJ1A 1JZSA 3FWPA 3HCNA 3OD1A 1C1DB 1XWFA 3G8BA 2C1EA 1QP8A 2G6BA 1GZ4A 4ILKA 4PG8A 3A6ZA 4DT1B 4Z53A 3ZIAA 3OIWA 1DKNA 1LBTA 2WHPA 3BD9A 3FNEA 4YV2A 4BNJA 4A16A 1T1RA 2O3SA 4H7KA 1UPCA 3DG9A 4OJKA 5K0FA 3DHYA 1QG0A 2BYTA 5K3EA 5BWLA 5ALOA 3DCJA 5AJXA 2OHOA 4J7XA 4U3JA 3WLJA 1U5BB 3NASA 2NUAB 5G40A 2O5EA 5D85A 1II0A 1GNLA 3HBJA 4HH4A 1U2RA 5EWJA 5FTJA 3RODA 5ILQA 2I9KA 1WL8A 1X1RA 3L7DA 2AVNA 3EXHA 5FI0B 5C5IA 3KKEA 5EEHA 1C9DB 5G0TA 2IS4A 4OUKX 3PCXA 2A9KA 4OJQA 2O2GA 1A8HA 4TMKA 4F86A 4ENWA 2AX4A 3VPDA 4ZGBA 1S2DA 2PH5A 2QUHA 1QK4A 1RHKA 2HSDA 1OASA 3ZXSA 1V45E 1U8ZA 2WINI 1AMOA 3EAQA 1V96A 3MS2A 1GG2A 3GZTB 1MX1A 1SD5A 1F8YA 3WS7A 5KTNA 2PJZA 2VHJA 3BMQA 2J85A 1PDWA 3CEMA 4BVKA 2VP6A 4MGIR 4F9TA 3VOSA 1GYQA 2ADOA 1E3JA 3ZK8A 4R8VA 3OQPA 4F6RA 3ML1A 3JATB 2YOGA 5LOVF 3IS3A 4OI0A 1G4HA 1J2JA 2EKLA 3OY7A 4Z1MD 1U6KA 2VA9A 4OHUA 1IEQA 2X76A 4LBZA 2PFGA 3ONNA 2VJYA 3W2HA 4EFLA 5CEFA 5D51S 4BL5A 1ISGA 5F51A 2BF7A 4NPCA 3DLAA 1XZPA 3GI1A 4K6HA 5E9AA 4AC9A 4EHKA 3DLHA 2FOIA 1GRCA 2Q2QA 2R6ZA 5D1NA 1IHOA 1RQXA 2VT2A 2EIHA 2ERXA 2OV8A 2WSMA 1EDBA 2P1ZA 3I6QA 3LF1A 1UWVA 2GERA 4JI3B 4ZCTA 3LGXA 3WGJA 2C9DA 2GX6A 4DWOA 2V7QA 3I0ZA 5FFNA 4F6LA 821PA 3JD4A 4L6IA 1ID1A 1XN4A 3L07A 4KBGA 4JUBA 2OKCA 2QA5A 2R1TA 3I6ZA 3IIIA 4TXMA 2IYOA 5DSTA 3MJ4A 3H2GA 3WB0A 1B15A 3K1AA 4OH7A 5ANRB 1KS2A 5U1PA 1QR6A 3GFTA 1GGFA 2YS7A 2XYHA 3L06A 5EHGA 1HNXB 5E9QA 3RTEA 2W70A 2YASA 1M2GA 2AE1A 1JDVA 1FW8A 3DV0B 4QFMA 2QRKA 4RW0A 1YR9A 2UYQA 1DXYA 2P3OA 3CF6R 1F0YA 4JC5A 2IHTA 5FO0A 4AL4A 3OCCA 4D3YA 2B99A 2WMNB 4Q4AB 4IDEA 4B5LA 1KOGA 1H0RA 1E4EA 3H2HA 5BO5A 3BH0A 5CFQA 3RSGA 2R7KA 3DOUA 2QT0A 4LW8A 1R4NA 1JG4A 2XD9A 4JNKA 3ESAA 3ICEA 1QONA 4HQ0A 2HWYA 4Q1EA 1S02A 3Q85A 4PLVA 5JHHB 3P1JA 1Y80A 3CVVA 5AM3A 1NURA 3JQGB 4IIGA 1ZVJA 4MW7A 4AK9A 3KALA 2Q5QA 3WGQA 2J48A 5G41A 2R11A 1JR3E 4WXRA 1YA4A 2Y05A 3WAKA 2ZTUA 2BMVA 2VK8A 1OROA 2A3NA 2O0LA 3H4TA 4GHWA 3GOQA 1T9AA 1ZI9A 1FMFA 3DZ8A 4ZALA 1GZ3A 3FPJA 4J1QA 3IRUA 4PZUA 4JA2A 4B43A 5K0JA 5JCJD 2AD5A 4UAUA 3NHRA 3M70A 5ED0A 5CVUA 2OXTA 1FFAA 1TW2A 2J5XA 3B6IA 1CRZA 3HV2A 2K5UA 4YUYA 2WTMA 3E9RA 2ZSJA 3H7AA 3QKTA 3R76A 3CJRA 5GJWC 2VKQA 4F7DA 3L01A 1E1YA 1YJXA 4UNSA 4OBXA 3C7KA 3LD9A 5A1TA 5BR4A 2VQDA 1NBMA 1NQOA 3DUFB 3Q7QA 4FFPA 3A28A 3PNBA 3I2GA 1ZK0A 4A8TA 4WFIA 2DPMA 3DCNA 5B3JC 4KRXA 3PA6A 2C5SA 3BHJA 1YS2X 2FE4A 3A0UA 1LI4A 2GZAA 3HMQA 3GFBA 2WY2D 5IAKA 3VHLB 4V1CA 4ID9A 1TC1A 5A62A 3PENA 4MK4A 5CCXA 2YWEA 3OO0A 4YP7A 3RE1A 4KO3S 2VJAA 2HT6A 2WHXA 3TBKA 4DUGA 2I7DA 1ZQ9A 3VDXA 5I5EA 4LZZA 1FLNA 4Q9HA 1E7WA 2NSLA 2CDCA 1V25A 1Q20A 3A6LA 1J24A 1UZAA 1VL0A 1HOXA 1O54A 5DX8A 2R3SA 3SSMA 5KX5B 3RYFA 3W3AA 1B6GA 4TWIA 2FRDC 4JU9A 4AUEA 1MUUA 5JI3E 1IZ7A 2V3VA 3DOIA 5HIAA 1PUIA 1VSUA 2O8CA 2DPXA 1XRSB 3GDFA 5FPSA 8GPBA 5JADA 1C8BA 2FX3A 2R6CA 4HL6A 1FQJA 5AVOA 3NAMA 3W9SA 1QFXA 2OAP1 1B4DA 2B6NA 5CA1B 2SCUB 1S01A 1UJMA 3WOVA 4RXTA 2XMCA 5C52B 1DJNA 4GPAA 5HQTA 1AQYA 3FSEA 1YK0A 2ZB3A 3I09A 1SCDA 1VTKA 4Q3OA 2XNDA 4YASA 3RNLA 1XR3A 5FA6A 1BXRA 2ZRLA 4L7VA 3KCNA 2WUVA 4G5HA 2F64A 3PHLA 1TU3A 2N46A 2QN8A 2Z04A 1F1JA 4QUBA 3SM9A 1P1HA 1N5KA 3ZHYA 4DOMA 3PJRA 4UQPA 4XB6B 5HUJA 4O1IA 3EUAA 2R0QC 2HTFA 2P62A 3RGGA 2FSGA 1PV4A 2VJBA 2ZCVA 3CX4A 1F4VA 1TZMA 2GZ1A 3QSGA 1CUDA 1SPBS 2ON6A 3TR5A 4UBOA 4DLLA 2CFIA 1ZH0A 1QVWA 2P2SA 3TRFA 3T4XA 1DO8A 1TGYA 2QMOA 1BKSB 1L6RA 4JAVC 4B2YA 3WHKA 1FUKA 5AJZA 3DKVA 3I53A 4D96A 1PJRA 5EE3A 1EX1A 3SYLA 2FSUA 3C16C 3NHJA 5LD2C 4MRNA 2BTOA 1FFWA 2RMKA 4L9AA 2XE8A 5HIIA 3QXCA 1PDVA 1TJ4A 2WBLC 2WA2A 5CDFA 4MAAA 4C4YA 4ZCSA 3SQOA 1A2BA 2XY4A 1TF7A 1XELA 5AVUA 3PEWA 2RHBA 1L4UA 1URPA 3ILYA 2WTUA 1RP1A 5CCBA 3SN6A 1LNQA 1HDEA 3AIKA 3EMVA 3E2PA 3NDJA 4FQ8A 1E8NA 3SR3A 3WKCA 4BEWA 5IRCD 1RZRA 4JQCA 5TMDA 4MGKR 1XRNA 1JYFA 5FNVB 4EGFA 4ETIA 4RPIA 4BO8A 2CNWA 4EHDA 4YP6A 4R4JA 1JEYA 4YTEA 1NIJA 4R0VA 4YMSA 3IIEA 1KI8A 2OAGA 3PQDA 3E84A 3F6EX 4CM9A 4CM4B 3CCFA 3BGOS 1R0WA 3JR7A 4ZI7F 1EP1B 4JLMA 5LLTA 1E89A 5IZCA 2M98A 2VUSA 3I1FA 1JKJA 2Q8QA 1YBHA 5HGXA 4ALJA 3KDAA 3PFHA 1N3BA 5CTJA 4BTVA 4B6RA 1JEJA 4KYIB 3BK7A 4M22A 1B0AA 4YIKA 3ZVRA 2D3WA 4CL8A 5KNBH 2GCPA 3AI1A 4QVIA 3A2NA 4B82A 3RSZA 3EPLA 2HYIC 1QF7A 3FHCB 2FUG1 2VAVA 3OD5A 4MB0A 5FDFA 2YUIA 4F3NA 4ZI7A 4HDKB 5F4ZA 3UMMA 3E9QA 5AK0A 3INNA 3IHKA 1KE2A 4GNKA 1CERA 2PKEA 1M0TA 3KJGA 4NYMR 5IJ0A 3LUFA 3SS7X 3ZR4B 4J43A 2CNDA 4KDEA 3RRFA 4ANFA 4YRMA 1DAMA 3L7IA 3DAYA 4YCLA 3IAS6 4MRSA 4DIEA 4B6OA 2UYCA 3BB3A 4K81B 4M7OA 5JNTA 3FCOA 3NYIA 9ATCA 1IEXA 3LIPA 3HJHA 5C8DA 5JQGB 1WKBA 2PLAA 3SMVA 1P4GA 1W2GA 4QOIA 2G9ZA 2Z95A 2FPGA 3ETEA 1W59A 1XNHA 3K4HA 4HVAA 2IELA 3RHFA 1P8JA 4MWEA 5JS7A 2CLEB 2OCGA 4L9SA 1T8PA 5G0WA 1A3CA 1LCIA 1YVUA 1WXIA 3T9BA 1PLJA 3G49A 3HYLA 4YMLA 4BJHB 1DUSA 2R2GA 5EIOA 5IBRA 2ODBA 1NNI1 3GFGA 1FP7A 2B8TA 3AO0B 3MT7A 4O2AB 4WBXC 4XWTA 4EGQA 1WMEA 5DTRA 4BE4A 4DWVA 2XNHA 1T5DX 2GXQA 3KD2A 2IYFA 4EEZA 2AKYA 4HVTA 1N3YA 2IU3A 1TJ5A 2NU7B 3FYUA 1CY2A 2ZYHA 3S55A 3HXOA 4MHTA 1E1QA 3BWEA 1BOOA 3TJMA 4AKGA 5FBRB 1F9EA 1GGKA 3WYCA 4CMKA 1M34A 1E9RA 4AY6A 2BEUA 3KOUA 4GMKA 1U7XA 3AR5A 3ZQUA 4HLUC 2BELA 2J87A 4L3OA 1N6PA 4N3AA 3VBEA 1NWHA 1YHZA 1E64A 3W8EA 3O2SB 3RF6A 2ZAYA 4J49A 4JH0A 3JWJA 4GGMX 1Y34E 4QEDA 5IVPA 4N7BA 4C03A 3TLJA 3ZN2A 5JPCA 2VRCD 1V6CA 2HBZA 4J91A 2XQJA 2W22A 4IQ0A 5LA6F 4O4IB 3QP9A 4K9KA 4AZTA 4BO0A 3R4CA 5BQOA 1SXJA 2HMAA 2K4MA 1NIPA 1U31A 1UC8A 4QU9A 4LNUB 6PFKA 1T5IA 3KD3A 5AKHA 2NM0A 1T1JA 1UZLA 4WGGA 4WJKB 3SQNA 1JWBB 3FZEA 5ALIA 2O7VA 2FB9A 3KZOA 2Z4RA 1M1NA 3OPVA 1YIDA 2BHRA 2JRCA 3PQ2A 2WU4A 1VJ0A 4IZIA 2V74B 1IUOA 1Z0FA 3N74A 3R3JA 4M8KA 2P1DA 4X7BA 3UMRA 4AB1A 5BV7A 1SQ5A 3P96A 5IN4A 4A1FA 2YCLA 3SLRA 5C8YB 2VNHA 1W25A 2PZMA 3KCQA 4MQ4A 2PRYA 3BN3A 4ZRNA 4A6XA 4OATA 3ZD7A 1P7VA 2W0SA 4N0MA 2HNAA 4BQQA 4OBWA 4MJ7A 1TYCA 4YPOA 3OZVA 1KO4A 4HNHA 4MX8A 4A8JB 1YDHA 1JG1A 3VR4H 5DYYA 4AJOA 3JQ9A 2O2SA 4ZPJA 5KDLA 5HIMA 1SVLA 2Q7OE 1JIQA 3H4VA 3T1NA 3MA0A 2B8JA 1SVKA 2Z09A 5H0IA 5SZJA 5IULC 3LP5A 3LYLA 4OMDA 4F4JA 4R54A 4EA6A 2DLNA 1F5SA 5FTMA 7REQB 1IWPB 1OZGA 2HWXA 2C3OA 3LWDA 4KIJA 4YP0A 3I6MA 1AUVA 3VDMA 3WYBA 2PIAA 1ZJWA 1KVRA 1PIWA 1Y1PA 2X77A 3OAAD 1E1RD 3N59A 4GPZA 3TKYA 2RH5A 3T5BA 1NG1A 3PSHA 4JLAA 1HPLA 1M2WA 1C0PA 2W48A 4RS4A 5DN6D 2FOLA 1KXJA 4P34A 5L7WA 3LC0A 4UM8B 2Y1LA 5EA2A 3MUOA 3MJDA 4FFWA 4W1RA 4BLTA 3P71T 4AKIA 2YR0A 2Q0XA 3GLFE 4CNBA 4LHWA 5EMKA 1NUTA 3G9QA 1J99A 5KSYA 3F9CA 1NUAA 5CFNA 1Z0KA 1YOBA 3E0XA 4GP7A 4RTQA 1MRNA 2GO7A 3ASZA 2AC2A 2IFTA 2M6SA 2V7VA 5LDDC 3EYAA 2XLBA 4LNAA 4O8ZA 1GTG1 3E03A 2ZLBA 3AEKA 4AY5A 1E5TA 4TMFA 4MUGA 5TDHA 4JQZA 3V1YA 4DRYA 4K7JA 1L8XA 3GIDA 5KEIA 3KQUA 4DADA 1AC5A 2LGJA 3KQOA 3AHEA 3AJ9A 1ZVQA 3DT9A 4YEDA 2CZGA 3HXPA 2Q3MA 1T0PA 1AA6A 1ZUNA 3WLNA 3KETA 2ZJ0A 1I01A 3U44A 3W4KA 4CV0A 3Q3JB 1GNVA 1ZUD1 2ZE8A 1CY6A 1KJYA 3UCXA 1MO6A 3ZIAD 4AYWA 3G2QA 2LDBA 2QZPA 1C2TA 1R8XA 1RT9A 3SE0A 3MOIA 1XZ8A 3GEIA 4BOYA 2YVQA 2LZ0A 2O2IA 3K1ZA 3WDSA 3L43A 4BZXA 1K86A 4FW8A 2QRVA 3DEFA 3OSZA 2J6BA 3H75A 2DQ4A 3NFYA 2IITA 1YNOA 4ZAYA 1XBTA 1EXWA 2JARA 1T0JB 2GMWA 4JQOA 1J06A 4CWAA 1FJXA 2H57A 2BR3A 4ZDIA 3WGGA 1G5IA 3PD7A 3IUSA 2RHMA 1GZUA 4P93A 4IH1A 2W2MA 4P36A 1ZJ6A 1BGXT 4NH0A 2HV8A 3AHCA 4FEAA 3NT2A 5EJ5A 4GE0A 1EPUA 2VS1A 1Z08A 1YHYA 3WMRA 5L95A 5E7QA 1IBKB 1WHTA 4GECA 4P33A 1G291 3OJFA 1EBUA 2GK3A 4UUAA 1L2TA 3AGQA 4YJHB 1JF8A 1J2EA 1JPNA 2HHCA 5E4YA 5AD1A 2BDEA 3R9XA 1VQ1A 2VDNB 1JT2A 1UK8A 4L8VA 4RGQA 2O50A 4A36A 5HHTA 2VPQA 4JYPA 4OQPA 5EXTA 3SQXA 2O5CA 1RRFA 1MG0A 1X19A 1XEXA 4PHHA 5IT5A 3JZMA 1IUNA 3HB4X 1S2MA 5GVSA 1XP8A 4BN4A 2FMKA 3IMGA 4HB4A 3WNBA 3CLSD 1U7WA 2QVBA 4QPDA 3UJ8A 4ZDKA 5HJ5A 2DLCX 3PHCA 1EVEA 4PZAA 2ZXEA 4BWYA 3MWGA 4LV6A 2GZ3A 3ACBA 1WZEA 3MD9A 4RJ2A 4Y3UA 3TLCA 4BRUA 1NR7A 4D74A 4F0JA 4X84A 4PV7A 4S1WA 4MS3B 5EJ2A 2YIMA 1YXMA 3VYWA 2PZBA 2BUAA 2NSDA 2GYUA 3NWEA 4ILEA 2VDVE 4ZANA 2OSVA 5JO0A 4RENA 4E51A 4PYJA 1JNXX 3SDZA 1OZ0A 2VHVA 1BQ3A 3LDHA 1L7VC 3KOOA 2XLCA 1EK1A 5AHRA 4MEBA 3HUFA 4CU5A 1TUGA 5G3ZA 1W4RA 3FBWA 2CYBA 4QXOA 5H3LA 9MHTA 4CDRA 3D6HA 1Y82A 1B7GO 1P8AA 1UDXA 3ER6A 1T0BA 4E14A 4HTFA 1R0YA 4RF4A 1VL5A 2YNMA 4I1VA 4FGSA 5AHKA 4DANA 4EWLA 1Y8RB 3HCOA 1FZTA 3HRKA 1YOVB 4FE4A 2XDAA 4W8GA 1EZZA 2QRHA 1TT5B 4DMGA 1V35A 4WQMA 2REOA 2G9RA 5LQCA 3CTMA 2WDPA 3FWYA 3G3EA 3VR5H 1Z56C 3U4IA 3R1IA 3QPVA 2ZBEA 4MRMB 4NEHB 1PKXA 2QMYA 4HFNA 4ZVTA 3TLGA 3P0JA 2QLLA 3GROA 4HBGA 5CNMA 3VTAA 3BB1A 4A9AA 2WF9A 4M0PA 4DCCA 5AVSA 3WSWA 4J0JA 4KN5A 1BYIA 3MERA 4R0NA 2WMOB 4TSFD 1ES9A 4ZT6A 2O07A 1JA1A 3OH8A 4JMLA 5AHXA 4K0KB 1V3UA 2I2AA 4BB6A 5CEJA 3PX3A 1NXPA 2LRHA 1T4CA 2Q2VA 3M6WA 4OQNA 5THQA 1RQRA 5FV7A 2DECA 1GTZA 5EY5B 1CG6A 3KO8A 1ISJA 3AESA 4JT4A 1J2TA 2OCPA 8LDHA 1E9FA 1GTL1 3C6XA 1NFQA 5KNDH 3C6MA 5L40A 3UAWA 4FOLA 4U39A 1SEVA 3ULKA 4BMPB 1PFUA 3IDOA 2UVPB 3RS3A 5K0GA 1CZHA 3RANA 3AVUA 1XZFA 1GRNA 1A95A 1H69A 3MRTA 4FGWA 1SFRA 2B4TO 2RKBA 2WIKA 4G01B 5C7OO 1L5QA 2QW0X 1L3CA 1R37A 4HFRA 2QJRA 4TWRA 2AC7A 4KVFA 4J07A 3GEGA 2AUNA 1H2BA 1NBMD 1HTTA 1YQEA 3GCXA 1UIMA 1U28C 1Z35A 2X0KA 1PGNA 2C2MA 3MNFA 4QXMA 4RZ2A 3RFFA 1I5RA 1ZKDA 4ZI5A 1JB1A 2PYDA 1WUJS 3LWNA 1E2HA 3N75A 4HDAA 4ZCIA 1BHSA 2ZTLA 5ECDA 5AUOB 2IYLD 3KXDA 4BKRA 2EW2A 3SBOA 2AXQA 1Q44A 4D5GA 4K8OA 3ZWBA 1BN7A 1HQKA 3D4PA 1QTRA 2WG1A 2DE0X 1T8YA 3F73A 1XCBA 3T5CA 5ADVA 1R66A 5FT9A 5J9FA 4UM9D 4I50A 1QZ3A 1SBTA 2VQ6A 3JATA 3IAXA 1OIWA 4O4LB 3T12A 2E87A 3ZQJA 1XMQB 2XB6A 2Y93A 1CWUA 4MAFA 2NZXA 5A9RA 4P7FA 2J3EA 2DTEA 4WCFA 2EDAA 1WO8A 3F3KA 3A3OA 4QPCA 1LBHA 4LHXA 3L46A 3UZUA 2QTVA 3ZU2A 4ZYYA 1CDEA 3I9KA 1ECLA 5CVEA 4N8EA 3PKIA 2QUBA 3W79A 4E4TA 3NTVA 3MBOA 3QVLA 4H4CA 5AICA 1Y3AA 5D3ZA 3KIPA 5TE9A 1POWA 4MUHA 4RAOA 1J8FA 1LY1A 1SUWA 1FXWF 2J9XB 2OPBA 3M1LA 3RIXA 3D6AA 1KY4A 1F12A 4RHYA 3GG2A 3AM4A 4PE5B 3W1WA 4AIIA 1J5PA 1L8AA 1NQTA 5LWHA 5LVAA 5BQPA 5DM60 3CLHA 4BVLA 1NMZA 5BMVB 1Z4KA 1W581 1G0OA 4RMNA 3EF1A 1ZCAA 1LH0A 2Q9BA 2R85A 3ZDYB 5BWMA 1WA5A 2WWYA 1B43A 1Z8NA 1HYEA 2RAUA 3I76A 3AR8A 3KK0A 2QN7A 2PCLA 1A69A 2IX9A 1QFYA 4Y2UA 2JFZA 4ALLA 4J29A 4X54A 2R1ZA 1FXWA 4Q4AA 4M0FA 2ZUBA 3H1EA 3INGA 1Z3CA 3NEPX 5IVDA 2XWJI 3KV3O 1EK5A 2NXNA 3IEUA 4JQYA 5CXSA 2B92A 4HNSA 5E1MA 5GV8A 4P0TA 3I30X 4U0JA 5IDXA 3M9XA 3PA8A 2A59A 4DFDA 1TXGA 3PNOA 1DIGA 4RTNA 2HDWA 1ACMA 2VHWA 1OZHA 3S6JA 3JQGA 2C5LA 1ZM7A 4GQIA 3T0IA 1YB7A 1U04A 3UXEA 4QM6A 3UW3A 1XVUA 4PHGA 4HN9A 2CXXA 2VG8A 4OBEA 5LNK1 5IAOA 2D7DA 1VPVA 2P90A 2BAGA 1A88A 1OBFO 1OWMA 3WMFA 2R8ZA 5DBFA 2AFHB 1SCIA 2QT9A 5GAJA 4ESEA 1ZOSA 3CYFA 3VNSA 5JLJA 1EQUA 4J3FA 2HCRA 3O90A 2ETXA 4DE5A 1TAGA 1Y89A 1Z07A 1EE1A 1V39A 2HCBA 1HFEL 3CKKA 4IFIA 4B6EA 1NVTA 2IUFA 4RH3A 4CLHA 5IUJC 3LQYA 5J59A 1Z22A 3FNHA 2XZTA 3F90A 3G79A 1Y7PA 4A0QA 2ZRKA 5TS3A 1ONBA 4PX5A 5DN9A 4CUKA 2W6JA 1R27A 2LUOA 2YN4A 2WWFA 2WHYA 3E9ZA 1LQ2A 3PQ8A 4NU8X 3R74A 3H83A 5FWXA 4O29A 1JILA 4XD2A 1XL0A 1QYVA 2XITA 2ZOSA 5LCXA 3DBLB 3M2TA 3DSRA 4BLSA 1U98A 2GN9A 4CMEC 2PLRA 1GL9B 1XZAA 1T9CA 1JHXA 2V4MA 4AO7A 3DUFA 4N5DA 2PT7A 4FHDA 5ALZA 3FHOA 3WC4A 1RRPA 3OKAA 5KX5F 3RWMB 3FYHA 2X5JO 3OOHA 4HJRA 3UENA 3H2BA 4NJEB 2AFVA 3NANA 4G1BA 3ZBUA 4RNDB 5DIFA 3UOGA 2N0SA 2IXFA 1C7RA 1CETA 1COZA 2O4CA 3U62A 3ZY6A 1T5HX 5BSVA 5AWFC 4QTXA 1WSDA 1JG7A 1Z82A 3GZNB 5CW1A 3V8BA 5CA1F 4RA9A 4Y2YA 3UUWA 3AH8A 3FCAA 1VLZA 2H4JA 2JJ1D 3FHLA 3AW8A 5BSEA 4Q3EA 5TMPA 4IM7A 5TGDA 4DWJA 5KX5A 3PNKA 4DVGA 2JBAB 3BIOA 3GG9A 3K8ZA 3IV7A 5JMTA 4F38A 3QU4A 5FTLA 1J5EB 1I2BA 2AHRA 3NNNA 1RVV1 4UBLA 2G1UA 2BHTA 3UYKA 3LGAA 1YIAA 3ELDA 4ETNA 2Y66A 3AVWA 4DDMA 4GRAA 4OI4A 1CUWA 5AXDA 3H3JA 521PA 4Z99A 1FP1D 3FH0A 3VV2A 3W5JA 4DEVA 2PMEA 4WJZA 3EIXA 1DDIA 2GM4A 3F3SA 1G98A 3FG9A 5K8CA 3ECAA 3TFWA 3ZKAA 2FW9A 4M1OA 4L74A 1PHRA 4E7OA 1T5SA 5K6TA 4GKKB 3GGPA 1H8HD 1E0DA 3E53A 1XC7A 2BI4A 2JIQA 2PKQP 3EQ9A 4KWCA 4ZREA 1KQOA 1RI4A 4PYQA 3G2PA 4RJJA 5F3RA 3GMIA 3I8XA 1GG5A 1CSEE 2X5KO 4E3WA 2ZR7A 4WBSA 5DIZA 3AVVA 1WZNA 1AF7A 1N5RA 3N2KA 5I7VA 4RTMA 1DUVG 3TOCA 3MWDB 4MWDA 2PSJA 5KKCA 3CH4B 3ICWA 2BBWA 1G8GA 1QCYA 3OIGA 1BE8A 1Y7HA 4G0MA 4HV4A 3RHZA 2WIJA 5DTJA 4XWWA 2ZJ2A 3I5MA 1VZ2A 1MB4A 1J2RA 2CEAA 3FTPA 1FVFA 1V8FA 3DR5A 3VUFA 4MA0A 5FNVF 1C4WA 2GVZC 3EQZA 3TDMA 3FMIA 4C2UA 1R4ZA 1NUHA 1XWIA 4EUHA 4RDXA 1A9RA 4RTRA 3ESZA 1KFKB 2POCA 3OP4A 4ZMSA 4Q16A 3LDAA 3U60B 1ZU4A 3H2SA 3C6BA 3K6SB 2BFCA 3EHDA 4ETWA 5DB4A 2FEMA 3EEYA 4PIVA 1XXHB 2FVXA 4ZWNA 4F84A 3DTTA 1ZSNA 3I9V6 1Y0BA 3MAGA 3RS4A 3WJ2A 3KPUA 1J33A 1QQ5A 3P9IA 4AN1A 3U40A 5FNVA 1N9KA 2A3RA 4V38A 4ASUA 2W6NA 4BJ3A 4BO9A 1R64A 1QNLA 2PZJA 1PWZA 2CLDX 2JLRA 4G1UC 3AOEC 2I2BA 1IVNA 3NOVA 4OIMA 1NI5A 3EGVA 3RASA 4BUCA 5H1YA 2CV2A 2XTJA 3BZUA 3ZCRA 1H5QA 3G88A 3QF4B 1JFLA 4AUMA 5EIWA 2X13A 2L82A 3TVTA 4EW2A 3JVVA 2CN1A 3V80A 1SXHA 3BFJA 1E9VA 7GPBA 2F55A 3H6HA 3G2JA 3O3CA 3LH5A 4R2KA 3WLFA 3A6GA 5HKKA 5A3QA 5GY7A 1KU0A 2PCJA 1A9PA 1CRQA 2GT1A 3ICCA 3E3OA 1XZEA 1UK6A 2PGDA 1S8NA 1XKXA 3O2JA 4OHPA 1HXHA 5AKIA 3HRHA 3TM4A 4B3TB 4E3ZA 2O7NA 3MBIA 1YACA 4TGLA 4YRRA 4HDKA 3VSCA 3ONEA 4KGVA 1NBOA 1XTPA 2WWIA 4GQBA 4Z9YA 3FVTA 3L0PA 2BGGA 3WLAA 4OB8A 3GGDA 4AJ4A 4C78A 4DA7A 1BS1A 4QFCA 4O2AF 2Q4OA 1UMKA 3CT6A 2CXTA 1E3TA 2H5IA 3P4XA 5ECGC 3B1YA 1WXQA 3GDOA 2ADFA 3F2VA 1LPPA 4QRDA 4RCZA 3VPBA 1WETA 4KFRA 2GHQA 4WZAA 2DBYA 1DIRA 2BEKA 3GRPA 3WICA 4DCPA 4JI2B 3TLYA 4UM5A 1IJBA 1LFAA 2XUPA 2H1OA 2GAAA 4HDRA 1FNNA 4HAOA 3E9DA 1BDHA 4WN9A 1BX1A 5BWBA 5HM8A 1FS6A 3KEGA 3NDPA 3PC2A 5E8JA 1ZYUA 3VGJA 4F9GA 3U48A 3CIOA 3THXB 3WNCA 1VPDA 3RSSA 4O2AA 1TEXA 2YFHA 1C2YA 2ZJ7A 4UMDA 1L4NA 4CEHA 5GIOE 3QX9A 2P9HA 2GJ4A 2JFUA 4LOKA 2DU8A 1QVAA 3AXSA 3ZWVA 3DFFA 2NU7A 3LO8A 4IUYA 3AU8A 3L1VA 4OLJA 4O4IF 4JLDA 4QD3A 5AYVA 4ZEWA 4EGCB 4UM9B 1P2TA 1S3IA 2ZDQA 4JL5A 2FH5B 4MDEA 1QYWA 3WYEA 2PY6A 2WZCA 3NJ4A 4DDUA 3FAZA 5CJJA 1Z4QA 1KVQA 4E46A 2FN3A 2IPNA 1LNZA 2KW5A 1Z18A 4BNNA 4I1YA 1V47A 2ZBQA 3O8DA 1QX4A 4KSBA 4IIYA 2J3LA 4Y7DA 2JVKA 3RU9A 1UOEA 3E9MA 2C4NA 1RQNA 5SY9A 2PQ6A 2VJMB 1CRWG 3EDRA 3GELA 2HBRA 2PWAA 3STYA 3PI7A 5IABA 3TM5A 3VNAA 4O4IA 1HT1E 2BFAA 3X44A 5C8YF 1W5AA 3C7DB 2O1SA 3EXG1 4K0RA 1DDGA 2LCIA 4OK3A 2QXUA 3MUFA 1XMJA 1UDWA 4GAEA 1ZICA 1XSEA 2QZ9A 3F5FA 4XDHA 3ADOA 3T41A 4DSOA 4DDTA 5DNYB 4YV7A 4FR0A 4URHA 5IF9A 2J4CA 4HGQA 3WZMA 3NHUA 5IP5A 2ZZNA 5I4CA 3SNKA 1P29A 1ATZA 4DLKA 2FZGA 2VYQA 1U9YA 1BAPA 3NGXA 5JAPA 1U2GC 1XK6A 3MFQA 5C8YA 3TAXA 4FCWA 2C9YA 3QUQA 2PUTA 3H8SA 4KQ9A 5DISB 3DQZA 4YAKA 3K2IA 3CZAA 3MJHA 5JQWA 2X9NA 3AR3A 5BQ5A 1Z6ZA 2G70A 4ZOCA 1K06A 2EF1A 5IEBA 2C4HA 3O83A 4A8JA 4ZEMA 1KI6B 1LFDB 1TQ6A 4Z9FA 3CR7A 4PCLA 4D3SA 3HGTA 4NCXA 3TTSA 4Y6OA 1MHTA 1PGPA 5TXGA 1RI3A 2ZBGA 2VWPA 2GD2A 6ADHA 4X91A 3PXGA 1B1AA 3ZDAA 1YUNA 1R6TA 2BI8A 3D5EA 3L8ZA 4RBNA 4UU0A 2JLYA 4TMZA 2VVTA 4CKCB 1I3KA 2DULA 3AC0A 3PNMA 2XR1A 2F9FA 5ER6A 2JCXA 3U4MA 1P9WA 1M54A 2ZT8A 4BB5A 3DVLA 4CQJA 1KI7A 2QTHA 4B79A 1CLEA 2F1KA 3U9SA 4FFRA 4XUCA 4U0KA 2G1KA 2J09A 1XQ9A 1RAFA 5A5DA 2NPIA 1KDVA 3ZJTA 1WMAA 2NO0A 3LJKA 2EBHX 4YCDA 4EOGA 4YX9A 2PT9A 3BMCA 3E05A 1OLXB 2O2ZA 1ZOIA 1XTTA 1K5HA 4L5JA 1QIMA 5G0VA 3FRHA 1N25A 2YWBA 4JB0A 4QUEA 1MVNA 1H4QA 3JQPA 1UIRA 2HMSA 3BF7A 1OZAA 2QN2A 1QBGA 1SURA 3DC7A 3IUEA 3OKFA 4OYLA 3TR0A 3QOFA 4AYTA 5HTOA 4QLAA 4KPYA 4AVYA 5JJLA 4DQKA 2JI9A 2FTKE 5IT9A 4OB7A 3ZH2A 4JJ6A 4CV1A 5EPOA 3K92A 2DFVA 4KVAA 5AKYA 4YGXB 3TOSA 3BDIA 5CG2A 4GUDA 4L7QA 1E3WA 4OB6A 5EHNA 4BNIA 2Q0SA 1TO1E 1G2IA 1YC2A 2AJLI 3OOWA 1YCFA 1XLWA 4ZZIA 2OCKA 1UMDA 3ZE2B 4CG1A 4DLZA 5DNUA 2PS1A 2G1PA 3PQ4A 4XI9A 4NBTA 4MJXA 1IUPA 3HM9A 3ZVNA 4KRFA 2ZRNA 3E48A 2ZS7A 4LZPA 3NW9A 2D6FA 5B1DA 3KZ1E 1KC1A 1SUPA 1WD5A 1WX1A 3A58B 3DLPX 1ILWA 1AHNA 1N3LA 3R7SA 4R40A 2WIGA 5JS8A 3NGLA 1W36D 4EO4A 3N0TA 3NIBA 5F33A 4HF7A 1I33A 2ZANA 3KKKA 1JDPA 4XDYA 4ZDWA 3ZUGA 2E89A 2ALJA 4LXIA 3IULA 1AO0A 2PH3A 4XPIB 3VNQA 4C0XA 3LY7A 3TTTA 2BM1A 3QEKA 5DYNA 3H87A 1V37A 3K0EA 3OMXA 3W9YA 4F60A 2B4AA 3E5HA 4J7CA 4Q7QA 3N0RA 3ORHA 1DJPA 2GJKA 4YS6A 5AW1A 2A5FA 2BJWA 2VTKA 3BUSA 5ALTA 5ALDA 2LR0A 1RWPA 3WB2A 1NSTA 2ANBA 2BGMA 1RAEA 1E59A 2I62A 3K30A 4OYHA 4QASA 2BR4A 5ALFA 4EB3A 4C0HA 5EWMA 1VBMA 5AJHA 5B1HA 2R4UA 3FB4A 3WTBA 3T34A 4C20A 9LDBA 4KL8S 4BHTA 1I0ZA 4G8DA 1I7LA 4ZCLA 1FJGB 1K63A 1LJ8A 4ZQBA 3RWOA 5C18A 5KU7A 1VPWA 2XXJA 5ALNA 3EIFA 3PL5A 4OIFA 2XMQA 2HMYB 2HBYA 5A9TA 1H05A 3R20A 4K9RA 2XB8A 2IXDA 4FVTA 3QBEA 2CDAA 1TVKB 1HORA 3OU2A 1Q22A 1PE0A 2WSSA 4G5GA 4HEHA 2XB9A 4U7TB 2YHIB 3FPBA 4RY8A 3OE5A 5AKEA 4FR2A 5J2TB 2EP8A 1GGHA 1VG1A 3A4IA 2UUOA 4OL0A 3ZHRA 2C61A 2P67A 2W6OA 3QVGA 2Y3IA 2X7JA 3G2LA 3UGQA 2X2OA 3L18A 3VKFA 2J31A 2ZW9A 2D4HA 2XRYA 3I5UA 4B80A 2X3UA 2D1FA 2W2VA 2WFMA 1NOKA 1IY9A 2ZAIA 4OCZA 3HHPA 5IVKA 1EBBA 1NVVQ 4AX4A 3EFOB 1BRTA 2ZJAA 1PJTA 3N2ZB 4RV4A 1Z7YA 2VDWB 4U8GA 4LF7B 2C78A 1H3NA 2RDMA 3A1VA 4KU4A 3VH3A 3ZX4A 3ZCTA 1Y8RA 3L40A 3OTWA 5LP6B 1H2FA 1YOVA 5IM4A 4QDKA 4I5EA 4RABA 3ROKA 4KN8A 5K1ZA 1CZUA 1ECCA 1HLFA 1ODKA 1K3UB 4FGLA 4LYGA 2A9RA 2WSYB 5F1KA 3VAZA 4DCOA 4HK4A 4D9GA 4GEGA 4MRMA 4NOLA 4PYKA 5IKPA 3R8XA 1YI0A 3L7YA 4ZTBA 2J30A 5KDOA 2PUBA 3JTEA 1K7YA 1PJ8A 2M9MA 2P75A 4BUJA 1TM3E 3KZXA 3OE7D 2DHEA 3LBYA 4ZV4A 2JBHA 3BZWA 2DQYA 2WAAA 5J2UB 5BWNA 3EGXB 1IZZA 4N0PA 2JANA 2QQFA 5JNRA 1JA0A 3AUFA 3PUKA 1KZ7B 3HEMA 1TMGE 4ZT3A 3R0ZA 1I13A 3EZ6A 1KF0A 1T2AA 2RBKA 4I3HA 1UBFA 4WOCA 1E1MA 1J56A 1OU4A 3J81A 4FFNA 4NCJA 2DCMA 5AW3A 1W85B 2IWRA 2A5YB 2HHJA 3WGTA 3SD7A 4WBNB 1MO5A 2GJSA 1SK8A 2IP1A 2J6CA 2P2CA 3ZDEA 1LRJA 4BNGA 1PQWA 4DRXB 4XWKA 3NALA 2AI2A 4UW9A 2WEKA 2C42A 2VF2A 2RI1A 4OMCA 3Q1KA 4HEA1 1UAYA 4FGJA 4NI5A 1GPBA 1L7QA 4LDAA 3GVCA 4ARIA 3KQKA 3V6MA 3WI7A 2QBYB 3H9QA 1PEAA 2UVPA 3ASYA 2J33A 2W2OA 1OFUX 4ALIA 3BOSA 3QHAA 4R1LA 4BZZA 1ODSA 3RT9A 1H2HA 3EODA 4NS4A 3KM0A 2B35A 2EW8A 2HY7A 4XFKA 4BFXA 3UPUA 4OXQA 3DNMA 1EWYA 3VPGA 4D41A 4J9UE 4P58A 4HAWA 1GQ2A 2IT1A 4PC7A 4YJ3A 1Z0AA 1XXLA 3PFIA 4O4LF 3N0WA 4X1KB 3ZJUA 1W93A 2JFHA 3N70A 4TVBA 3RD5A 4AKTA 5MF6A 3DFZA 3OEWA 4OVKA 3IAM6 5E3IA 1CJCA 2QM3A 3I37X 4KDFA 4KV7A 2X9GA 4Y9SA 5IH3A 2PD6A 3E7FA 4KQ2A 4EG5A 4S35A 1U8FO 2BCGY 1RPZA 1YE8A 2P6NA 3AEYA 2PN1A 2RCYA 2O8BB 2R6FA 1K8RA 2WJ4A 4FKMA 4I3GA 4HH1A 4X6XA 4BASA 4BB0A 4R7GA 4N0DA 1HDYA 4O4LA 3UAOA 4R1TA 3C7CB 1J8VA 3AP3A 4H4EA 1XLTA 1FFCA 1Z6TA 3FCCA 2ID7A 1LPSA 3CZRA 2GN8A 3K53A 1TM7E 4H3SA 4X1YB 5AJYA 4CMGA 5JXGA 3PNPA 9GPBA 3PPWA 1PSWA 5BMVF 4F2GA 2P9ZA 4LJSA 1QIIA 2C3UA 1DO0A 3LOPA 3L0ZA 1P1RA 1YTLA 2HQBA 3PQ7A 4WXHA 5JC1A 5REQB 3U2QA 1XCLA 1Y5IA 2VAXA 1THZA 2P7IA 2FR1A 3PEVA 1MAUA 3NOOA 1HNNA 2EGGA 5KTMA 1TYDE 1MKYA 1GPAA 2PV7A 2L0XA 2ZAMA 3H2YA 1AS0A 1WDWB 3JWPA 1VE7A 2YQZA 3P0EA 2WJVA 4NU0A 2J3HA 1EIZA 1LBIA 3WJAA 1PRYA 2FSIA 1XHEA 3FKQA 1DKMA 3SJAA 1Y1LA 3KUKA 1BCRB 3VAAA 1ENYA 1XA4A 3K4PA 4OMUA 3B1XA 3RYHA 3UAGA 1TNDA 4BIMA 1T5OA 4MUJA 1RJWA 1HT2E 3FZYA 5K3FA 1EM6A 2DPGA 3IMKA 4G0YA 1FUUA 4KIGA 1ULZA 1OR8A 5D8DA 2GUGA 3BXOA 2C4TA 5EZQA 2DXIA 4RH1A 1N2CB 5K3DA 1NJ6A 4GVXA 4N47A 5D6OA 1HLDA 4W5NA 2B2XA 2RSLA 1YMVA 2YDXA 4GDFA 1QDLB 4Q12A 4YCAA 3U7RA 1Q7CA 3RUHA 1YV9A 4OGGA 4TS3A 4N3CA 2Q5JA 2IF0A 4ZAZA 5K09A 2A58A 1A5SB 2WJYA 1XCJA 3PXAA 1JFRA 2GEVA 3JX9A 5DWVA 2EF0A 5FL7D 4F91B 4RM2A 3HA5A 3TGWA 4GL4A 5J5AA 3EVCA 5HQ3B 3RS2A 4GPEA 1F6DA 3VNRA 5HCNA 2HSZA 1TM4E 1R6AA 3AV3A 4G8CA 5JBNA 4X8HA 3C2QA 4EUFA 3ZOKA 3A1TA 4ALNA 4TWAA 3U3DA 2LVBA 3TQTA 1OREA 3T5PA 4FBGA 4CFSA 1IJFA 2AFHA 4Q19A 1GFSA 3TZBA 3LCMA 2DR3A 1OILA 5JHGB 2V8OA 5KNCH 4CT5A 4KITB 1Q0RA 4M86A 3G23A 3L7CA 3KTAA 4TLMB 4DSNA 1FXSA 5LBTA 1QIHA 5HF9A 5F2NA 1XZMA 1WV1A 1VKRA 4COKA 2HRDA 1XALA 1G19A 3HVRA 2ID8A 5JT1A 3DE0X 1OXKB 2G67A 1UEXC 1WHSB 2WWRA 3T8YA 4IS2A 3ZY5A 3N8HA 3HR8A 3T06B 5DGDA 3GDGA 4RTLA 1H8EA 3TSAA 1KEUA 3DBLA 2FWJA 4FS8A 2E2WA 4K9OA 4NXMB 1UBHS 4J2OA 2P6UA 3BCHA 4RZHA 2P35A 4BQPA 3CWCA 3ET5A 3K9LA 2I8CA 2QAGB 2Z8ZA 4JJ7A 3HDTA 1CDDA 3HCDA 2DHDA 4Q6BA 4IIJB 1SD1A 4JBHA 5HS6A 4DQ0A 1Z4NA 1M2HA 4JEUA 2JLSA 3FPCA 4R1MA 2XCUA 3NTQA 4X85A 1RXWA 3Q1LA 2OFPA 1SCJA 3DW3X 4DR2B 1UBEA 1A4UA 4AS2A 4X65B 2FW6A 1N78A 1XDSA 5AW2A 2WF8A 3GZNA 1CEEA 3ZWKA 1O77A 1PYGA 1PR9A 2IYRA 3QW4B 2QTTA 3TNYA 2EX0A 2UYOA 4DR5B 2BDUA 4LX0A 1BDBA 1E4YA 4V1CI 1NYQA 1P31A 4MUEA 1KMQA 3JQ6A 3KZCA 3HCRA 2C2KA 3FUXA 3B3FA 2KE5A 1NDQA 2A4MA 4EYKA 2HJVA 5KOHB 2OP0A 4FMPA 2FZKA 1ENZA 4MI6A 3MWEB 1PTKA 1V2GA 2VOJA 1IWBB 2XNSA 3ES9A 3LLCA 3LU1A 2V5UA 2WD7B 4R6XA 4CCYB 4U02A 4BQEA 1LLFA 3CRRA 2FZVA 4YXWD 5KHLB 4TSKA 2OB1A 3RV4A 3DR3A 1XAHA 4W5TA 4MR9B 3I4LA 3BGVA 4N8SA 4RKQA 5FOXA 1A1VA 2HDHA 1RAAA 2O1WA 3GL9A 3RSQA 3S2SA 5IDQA 3K31A 3O84A 1ESNA 1XTSA 4OPMA 1UP6A 1KAEA 1A4XA 3DMYA 1ZY2A 2CDNA 4HAIA 1RI2A 2FSSA 1BGVA 1KQNA 4DCMA 4EJFA 1Z6AA 4M9QA 1KI1A 1IXYA 1N92A 1FNDA 3UAYA 3LM8A 3AB7A 1BU5A 5DHFA 2P9QA 1LWNA 3CEPB 3OZGA 1DLIA 4KPEC 1WCIB 2Z4SA 2H51A 4AXXA 2C7PA 3HK2A 1JFTA 3S1AB 4TL8A 2QMQA 1HKUA 4Q21A 4X3OA 1J0EA 4PAGA 1WZIA 4LDQA 3VU0A 3NUGA 3IBCA 1GUFA 4OAPA 4IQGA 1CJKC 4N12A 4LF8B 721PA 4YR9A 3PFBA 3IIKA 1FTWA 5JDIA 2RGBA 2MYUA 1NVDA 2JGKA 3AHDA 1OCEA 2Q3JA 2WABA 1D1QA 3EXIB 3R0IA 4MIOA 5BR7A 4C7OB 4UHKA 4BLOA 4F12A 3UTCA 3O82A 1PAUA 1NLZA 1EHYA 3VBCA 4P32A 1B23P 1ML3A 3PQEA 1IVYA 1WLSA 3HYTA 4XLLA 5FP0A 4LBWA 2CWWA 1KPGA 2QZZA 2IYWA 4N3BA 4IKOA 3UGTA 1C4XA 2IHBA 4WZBA 2XRMA 3OFSA 4CF7A 1PJQA 2PD4A 3B70A 2GCOB 4PYRA 3SOZA 3EE6A 3EFEA 3V8QA 4A2QA 1DKPA 3UOAB 1GT91 1SUEA 2ORVA 5JNVA 3NR2A 1KNXA 3D6JA 1Z7GA 4UARA 2JCVA 4U2CA 3SFVA 3ANSA 3G85A 1HZZC 1UPFA 3DVRX 2HNBA 3I8SA 1I3NA 3N58A 2IUUA 1L8LA 4IGIA 2AOVA 2HX1A 2VPTA 4MVJD 1PR3A 2TRSB 3RC8A 3VZRA 4F3YA 4B3MB 3IUNA 2R79A 2ZUCA 1MF7A 2GEJA 4TRJA 5HM6A 2CNKA 1P4HA 2ZBVA 4YB8A 1GFZA 1UBJS 2XWPA 3VNVA 4EHAA 5EC8A 5BSGA 2WU0A 4N54A 3TB4A 1OXBB 3LLVA 1R6VA 3BMOA 4X45A 5KYUB 4ZYVA 3SSNA 2ZRGA 4PNEA 2C88A 3V8MA 4IHJA 2OMKA 1U3FA 4LIPD 4C76A 3SZMA 4CTOA 5L45A 2ODWA 3F46A 2Q0QA 3ITEA 4R98A 1QOZA 4CI0B 5KS2A 4MDHA 1P4JA 2XCOA 5MGNA 4HP8A 2J0UB 4KXFB 4D2IA 2W00A 4LSGA 5EUMA 1FFGA 4JEIA 2C7RA 5IKXA 2Z2KA 1SA0A 2GYVA 3L1HA 4MKGA 4K9NA 3GT3A 3H19A 4E15A 4EATA 5ADWA 1IJKA 1RKQA 3BZBA 2NZYA 5J47A 4HDSA 4IV8A 2FZCA 2RHRA 1ZMOA 4RVNA 1B6TA 4X90A 3QFRA 4R6WA 3NT4A 4KV9A 4UUPA 5KWIA 3THXA 1X80A 2XIJA 2QQ0A 4B8YA 1JJIA 1O94A 4YJGB 2AXPA 2XA1A 2JKYA 2ZDHA 1LU9A 3BRWD 3DA8A 4I55A 4LUCA 1RS0A 4ZVNA 4YDHB 1YU9A 1I2CA 3AIIA 5AMXA 2P27A 1LVUA 5K2OA 1T36B 4B45A 2GFQA 3SXUB 3QKSA 5FI3A 1MOSA 1SVUA 3OWXA 2P40A 2CFTA 1CIVA 1W47A 2X8JB 1GPUA 1FNSA 2FWIA 3TFOA 1BS9A 1IY0A 2GEKA 2WM2A 3MTJA 4TYPA 5EWLB 4DZZA 1X6VA 3BL5A 3C3XA 3H5NA 4TL6A 4D25A 1P5HA 1NMYA 2WG2A 1BXKA 3QELB 3HBAA 1CKEA 1YNSA 1XQ1A 3JAWA 3KB2A 4B3XA 5ICGA 2H1VA 1TDJA 4FM9A 1ISIA 3T1HB 2EFDB 1OPXA 1AQJA 2Q3LA 1QBKC 3W2IA 4MOWA 1IN6A 1ZD3A 1GSIA 5IC4A 2V3CC 1AUXA 5E2BA 3T6KA 5ELMA 1MAAA 3OLWA 5AM0A 3ZU6A 1GN9A 1RVDA 2V0NA 1OA1A 4ZJUA 3B1WA 3DUWA 1S3FA 3UV6A 1JFSA 1BD3A 2G0NA 1HTWA 2QI9C 4DCVA 3FOWA 4BBPA 2J59A 3P2KA 4JI4B 4LWZA 1AV6A 2YV4A 1ZJJA 5C7LO 1SHUX 4LCJA 3T1VA 4YYZA 5JZOA 3TCKA 1IHYA 3LY8A 3DE3X 3Q12A 1YTUA 2GBGA 1JFFA 2P3QA 3FOBA 4JB3A 2LCQA 3BA6A 1GDDA 3NHKA 4MV5A 3ADPA 4P53A 4HNQA 1OMOA 4CKWB 1OWPA 3GRFA 3LRTA 3L0IB 2O6HA 1QFJA 1UBSB 5B7QA 5EYPB 1J25A 1DQYA 2KMLA 3T7DA 3HFJA 1FJ2A 4TXNA 2FW1A 3U7EB 4PLCA 3FXAA 4U7DA 4WLFA 1U0TA 2B34A 2L17A 2Q27A 2RGNC 1TIBA 2XVYA 1X1CA 2LCFA 3DMGA 3LHIA 3WBBA 2QRQA 4BEVA 1D7AA 4CKCA 2R7NA 1QLWA 5DGXA 5A4FS 3O4VA 2CLSA 2YZNA 5JYBA 1UDRA 3EVAA 1QMPA 4FEEA 5EIAA 1G2PA 2C2OA 4MJLA 3ZYCA 1Q6YA 4E2FA 1V5GA 5CGZA 3WA6A 5KNBA 4DNFA 4FD2A 1JPVA 3WLTA 5AW6A 3THSA 5F2KA 1I3OA 3JQ8B 2HF8A 4K40A 1KJIA 1M2VA 1Y9AA 2JFGA 2NAFA 5HF8A 2EWMA 3FPKA 2GF9A 2O23A 4LRXA 1P44A 1Q3TA 2H5LA 3G9UA 4WH0A 3AEQB 3JQDA 3NKLA 1IWOA 4KQKA 4JLOA 2E4VA 3VMFA 4IXMA 3FPLA 1FQOA 4Z4QA 3VDNB 2A9QA 5AQEA 2GTIA 4I5DA 3URMA 1CS0B 3E9CA 1WV0A 2QUKA 3N07A 1ZL0A 3AZPA 1IK6A 1KP3A 1LDYA 2WVAA 2YV1A 4KN9S 5E9WA 4B6PA 2Z57A 3QU7A 3I3SR 4TL9A 5A5VA 5INTA 4DV7B 2OCYC 5FULA 4ZOQI 1XROA 2QUJA 1I3MA 3H1FA 1J0BA 5BQ3A 2W6QA 4JR2A 4IJ6A 1VSQA 2RJOA 1TLFA 1U0RA 3ENWA 5FUXA 2XUHA 3N2GA 4JYZA 1DC6A 4ZIRA 3KQYA 3NT5A 2O06A 3F98A 2YKGA 3VSDA 3IESA 2HSGA 3JYNA 4LRTB 3ROEA 2CJXA 3UN1A 4D9CA 5BVHB 5CXQA 5BR1A 3GJ8A 1G41A 3EDCA 5M29A 5K4AA 1O4WA 3P27A 5DMXA 4X94A 1STOA 3TRDA 3MJTA 1D04A 1CJBA 4L4XA 4LZLA 4EI9A 2ZWAA 4LHSA 2TMKA 2FAXA 1YL5A 1VHWA 4C06A 1G8JA 4OP1A 1U7HA 2GEUA 3LWZA 5FPPA 3CX8A 2OQ2A 1N36B 1AHIA 3QPDA 5A9SA 1R74A 4IO1A 2PK3A 3EEQA 2ISQA 1SQ6A 3JV7A 4GFDA 1E2QA 4B46A 4MPTA 3VC1A 4D4MA 1Q91A 3K70C 4MQEB 5EQDA 5FF9A 2FEKA 1UZNA 1V26A 2QLBA 3OM9A 2HK8A 2B20A 1LLUA 4I99A 3JQBC 3K16A 4RVUA 1YFJA 1IVSA 1DSSG 1CR0A 4W6ZA 1SN7A 3R6WA 4H1HA 2IL1A 1JKXA 2IV7A 4IOMA 5FJJA 2FW0A 4DNPA 4N65A 1QH1A 1SM4A 3CUWA 5EN4A 3A9TA 4N3GA 3NBMA 3VJMA 1VYHA 1PFQA 4O6VA 3I92A 4ECAA 4D81A 4EGAA 2XAAA 3PQ6A 4MQFA 3Q72A 5J2TF 1QGDA 5TT1A 4RA6B 3L77A 4CR6A 2IW3A 2ZULA 3GBPA 4RQBA 5E2IA 2ESRA 5HZGA 3C3CA 2VSNA 1K89A 4OHWA 4ENTA 1C7FA 4FZVA 4Q47A 1XF9A 1CUYA 2XWBF 3VR4A 3W8RA 4F2WA 1KQGA 3BK1A 5F3WB 1E9EA 2QYHA 1QDEA 4Y6PA 2VYVA 5LP6F 3GH1A 4BYGA 1DXOA 2YHIA 1WEKA 2DFTA 2PPLA 1REQA 5ENZA 4JUFA 1NBME 5H70A 1QKJA 3JYOA 5KAMA 4RMIA 4ZT7A 4C4AA 2QVCA 1XD2B 4HB0A 2WAOA 2ZT7A 1UC4B 5DT2A 3P9SA 1YL6A 2ZIAA 3EULA 5AXCA 1GEEA 1W5FA 4KWHA 1SC9A 4K1XA 1TI7A 5J2UF 2R751 1YFLA 4U8HA 1A50B 5H68A 3EFOA 4NBVA 3VDQA 5K7SA 1LDBA 5E6UB 3TRIA 3CVXA 3ZCQA 4D9EA 2C29D 3H2IA 3MWFA 4QBKA 6YASA 1CNEA 1DFGA 2G9VA 2WE7A 1US8A 2ZUVA 2RGUA 3DBIA 3G59A 3PDJA 1NYLA 3SSAA 1TMOA 2ZETA 4BO2A 1T9DA 3MF4A 1FC0A 1Q1NA 4MS4B 1CYDA 1PFWA 1T24A 2ZI4A 5BOSA 4FLMA 4WBNF 4POOA 1Z28A 3GZ4A 4CDGA 4ZZ0A 3AU9A 4MPPA 1SXQA 5KNCD 4D0NA 2J6IA 1C0LA 3MJRA 4JVNA 4K9PA 1U1CA 5ES4B 2QVGA 2ZSDA 1XZCA 1UJCA 2QXYA 3DKKA 3C4VA 4TMTA 4EPWA 5BN3A 1B2RA 4KLRA 7ABPA 4CM1A 4R9NA 3JVIA 1JDBB 1NNLA 1GPNA 1W85A 3OJWA 1SCAA 1YUBA 3DTVD 2VL7A 1VIAA 1BFKA 1RCUA 4KQJA 4KIUA 2VQFB 1TE2A 1R9JA 2QRJA 1P0PA 2CFCA 2UAGA 4KVZA 3CA8A 4DRXA 3NOXA 1N4AA 1M2FA 3RW9A 3T3DA 3WLPA 4Q5IA 5I8WA 4MYRA 3AR7A 1NI3A 4LE0A 1RHJA 1SOVA 1FL9A 2QLJA 2Z2XA 3AUAA 3ILXA 5PNTA 1AKEA 1DP4A 3W34A 4UCWA 5TT0A 3MC1A 2QBYA 3GD7A 3RSLA 1OW3B 3OX3A 1E2UA 3ZVMA 1S4MA 3U19A 1R0LA 3B36A 4JYMA 4RYDA 4BJ1A 1MDFA 1JIIA 2GPSA 1X7ZB 2YVLA 3P4UA 2YWJA 2G9UA 4NBSA 5LZ5A 1YMQA 3THWB 3TO5A 4AJLA 1LQUA 3LTNC 3EXHC 1NU6A 2WFLA 3MVEA 4HYYA 3MINB 2FSFA 2NO5A 3GLUA 1NJ5A 3LPLA 3A4LA 1DOHA 5KWSA 4P22A 1F2UA 1N0VC 1YS6A 5DV9A 5AW8A 4IJMA 1G42A 5CDFE 5M2QA 2RB4A 3NB0A 1RYBA 4X1KA 2WHRA 3D6TB 4DQUA 4QBIA 4YAWA 4JC4A 4A0SA 4CGZA 3E9NA 2I2WA 4IGKA 4ZAGA 5JXWA 1Q6ZA 4R9RA 4NRDA 4DLRA 5FPQA 4IWYA 2OBFA 2PM8A 4DHWA 5BWOA 1C81A 1RJFA 2NZWA 3AKZA 2I6FA 2D7JA 3PXDA 3WGHA 4TV8A 4B6FA 1ZONA 2DC1A 2RIRA 5EQFA 2ZYSA 2VUHB 3CUTA 3NJRA 2C4UA 1DQNA 3FGZA 3SAJA 4B7UA 5IS2A 3KKMA 3I6YA 1W35A 3CSDA 2WM8A 2VPXA 2P9YA 4X1YA 5ARCA 2UZ4A 4C2TA 3HKDB 4MV6A 2AG5A 5BQFA 2HEIA 1PD0A 2OBMA 1QHGA 3GUUA 2P9CA 4MLCA 1PVVA 1PSDA 2F3PA 2ZI9A 5LQAA 1OJ7A 1NXVA 3IEVA 2JLZA 4EO7A 5H9WA 1MD9A 1XK7A 3NWJA 5CMLA 3UFXA 4B3IA 1SHZA 1P39A 3KR0A 1DQSA 1VA5A 3DHVA 3B52X 4TROA 3O8RA 5EVCA 4M1ZA 4AROA 4DA0A 2D5LA 2IKSA 4FILA 1NQAO 2NAPA 5CH8A 1U4SA 4D8XA 3JW8A 4I2NA 2Q1WA 3OVMA 4CR7A 2JAOA 3GLSA 3H6GA 2BSXA 5FB3A 3WGUA 5IXSA 4G5SA 1DVRA 2P2GA 2XKBA 3MTIA 4LYJA 3CUYA 2XMSA 3GLHA 3VR6D 2C8VA 4LN1A 1E2GA 3D3WB 3JARA 4NSNA 5JNWA 3SKVA 5KQSA 1FW6A 3GUCA 3GFOA 1N2CA 2MU1A 4G0XA 3AVPA 1PW5A 4NFHA 6CHYA 4LF4B 4NENB 4UPVA 1RBZA 1MH1A 3VR5A 3LPNA 4MYCA 3I9NA 1KFEB 3TLKA 3QNWA 4AM8A 4GOJA 5FKJA 1E8DA 5E2AA 5M3BA 4M8NE 1E1LA 5CVVA 3N1UA 3ZXXA 1SQ0A 2YZMA 1ZA2A 4NKRA 5K8TA 2ZIZA 3K1JA 3QJGA 2F43B 1NHWA 4DG5A 2FEWB 3KDSE 2O8CB 1EP9A 5HQ3A 3TXXA 1JALA 2PX5A 5HOQA 3VKGA 4TKZA 4ZEOA 1W19A 4ZVVA 1YRYE 1W0JA 3L0SA 4X61A 4P9NA 5B1IA 4B3DA 4GRDA 1WQ3A 2HMUA 5BYAA 5TPZA 1TGVA 3GCWA 3AJRA 4FGKA 1IM8A 1DTWB 1M34E 3DOFA 3GMDA 4XVRA 3NNDA 5E7MA 1X7XB 2QX6A 1ECBA 3CKLA 4YAOA 1H6DA 3O03A 1ZPDA 5D2CA 1DS6A 3EZNA 2NYAA 5JD6A 1R8SA 4X6YA 3UUFA 2G5CA 5KDDA 1U4OA 4XPZA 4GEKA 5KNDA 3EVFA 4IVPA 3UMBA 2C3MA 2ZXFA 1U90A 4IIJF 2P9BA 3FPGA 2WWWA 1M1YB 3G0IA 1XEWX 1O08A 2BEWB 4MGEA 4O4HA 5K8LA 2QN1A 2IU0A 3QITA 3QVSA 3FGNA 3RVDA 3UCEA 4V0LA 1TTPB 1Y4SA 3ST7A 1DJLA 3BD8A 2BFWA 2IZ6A 1VGQA 1EDZA 3LDUA 3RUEA 2XHEA 1Z5PA 1SG9A 4JK3A 1FIUA 5FFFA 1F38A 4NFSA 3VHXA 2QEQA 2V0GA 2ZYTX 1SVIA 3H5OA 4PF1A 1EXMA 2QAGA 2AEFA 5IUNC 5LDHA 1RQPA 2Q0HA 2DQKA 2FF7A 2WPDD 2OVBA 4IFBA 1F2DA 4WOJA 1YZ3A 4EKDA 1U1EA 4K3UA 5KTOA 3P45A 3H7IA 1XLUA 5DHRA 3AJDA 5KAPA 2YRXA 4LWPA 4UCFA 3KOMA 1H9AA 4XAQA 3I2JA 4MB6A 1Z13A 5IK2A 4BFVA 1ZH6A 4GLBA 4CI9A 1SQGA 3NO4A 2OQIA 3TLAA 1PDOA 3GLIA 4URVR 3ORQA 3VM6A 3EWSA 1I0LA 1KZ9A 3E5NA 4DN6A 3EDOA 4V39A 3ROXA 5BWCA 3Q3EA 2ZE5A 2OE2A 1F4LA 3G7NA 3BHIA 5JR3A 4HLUA 2CL7X 4R8KA 4FNOA 1PZHA 3ENVA 4PG7A 2OO3A 2QN3A 5F9HA 2RGEA 3HU5A 4YACA 5AK4A 5KOHA 3AWDA 4B31A 1EJ0A 2VCEA 1H6CA 3Q9NA 3BHMA 3HP7A 2DZDA 4JUDX 1LW7A 4KXNA 5KSOA 4EQ6B 4Q7JB 1FUEA 1S1CA 4G63A 2FHPA 3TRKA 5C8VA 4UATA 1V11A 1ORHA 1UM9B 2OQRA 3GU3A 4HZUB 1JHUA 1XJCA 4I8IA 4MR9A 2CUNA 4WFQA 3ZZ1A 4E4YA 3BIJA 3DQQA 1V8PA 2VZ9A 4X8OA 1VBKA 3HP1A 1MNQA 1EUDB 4HXFB 4DMCA 4MVCA 5JMWA 1DOAA 3HB9A 5DM70 1ZBQA 5JD4A 1Q1ZA 1F51E 1X0VA 4TLLB 4QDXA 4IRUB 2MR6A 3H65A 2CVZA 4EY3A 1Y1SA 2VP5A 5CVTA 4WXYB 4P3NA 1AKVA 4NHEA 2XVZA 4XFJA 4LJLA 1I6MA 3IRVA 3OZIA 4K9MA 2V7XA 3TG2A 2OHFA 3L9XA 1ODTC 1Z34A 3PFKA 4ITUA 4NE2A 4EKNB 1AM4D 4I5FA 3S8MA 4AZ0A 2AS0A 2VPZA 1JKIA 1JQ3A 2JLQA 4L08A 3CPSA 5AH0A 4H3VA 1S1MA 2IYAA 3SC3A 3VVLA 5CDUA 2Y1DA 2KWIA 1NBIA 3FNIA 1K5PA 1NWCA 2J0EA 1E1KA 2J7KA 3SHOA 3Q6NA 4AKEA 3DBOB 1VJCA 2C3YA 1K7XB 3EZYA 2W37A 5G0SA 1GPYA 2GOYA 3GCDA 3OE4A 2FDCA 1K1EA 5DI3B 2QVLA 3GJYA 4F4UA 1KIFA 1SUFA 3OOSA 4L15A 4X66B 1DKUA 3SLGA 4Q00A 1F1BA 1OKKD 1YB2A 1TFRA 4RXUA 2NZJA 5GOZA 3AWIA 2PRZA 2YHAA 5JMOA 5DYTA 1WB5A 1WSWA 3HUEA 4LHVA 4J76A 4A2WA 1W44A 3QVMA 1W6RA 1ZVMA 4OFZA 4D9JA 1F8UA 2ABWA 3RROA 4E0BA 1KS9A 2PQMA 4XIIA 3I1YA 5F9FA 3NS7A 1Q0UA 1ELOA 4M0LA 4ZVMA 1HE2A 1KJZA 3R77A 4Z4HA 5JJKA 4Z3KA 2PFKA 1RM4A 4QO8A 1KAGA 3TVDA 2FN7A 3KBOA 4INOA 4OQEA 4UTXA 1FLDA 4RGBA 3RFVA 1BE0A 1EJ6A 4I7EA 3QKRB 3B48A 3GLGB 2R2AA 4B4VA 3K2BA 1X7YB 1LPAB 2ONYA 2Z08A 2QRLA 3KWLA 2G09A 3SLKA 1GNPA 2OOSA 1XMPA 2YV2A 4P4SB 1LSSA 4DM4A 4O2BB 1NFRA 3H13A 3A3NA 1MPXA 2JAPA 4RMJA 4EUNA 3B5IA 5HBRA 1AO3A 4BGVA 5LYJB 3KYCB 3NHAA 5EE9A 1T35A 3HJBA 2PBRA 1E6CA 4JEHA 4C3OB 4FUQA 5HMMA 5KYUA 5AM2A 2QAJA 2XVXA 3FPAA 2JIMA 1SD2A 5CEEA 2BD0A 3UW1A 2GK7A 1TO6A 3WMXA 3P52A 4OHCA 3M4YA 5CPFA 2ZJ6A 1S2OA 3I61A 3RIHA 3BPSA 4EGJA 2V7WA 3O8NA 4PSKA 2YZ2A 1D03A 4Y2JA 3K71B 2J0UA 2PHZA 3GBVA 3MPOA 4R8SA 2I7XA 3M2PA 1HEUA 2BE7A 3LA6A 3T7EA 4MW9A 4L0DA 1CY1A 2CNNA 2PBLA 3MB5A 5LJLA 3NG1A 1YA6A 2JA2A 4MR7B 4Q1BA 1FTSA 2PMCA 3AX6A 3ZV4A 3WL8A 5HE9A 3OCYA 4GLLA 4YP9A 4BO7A 1RTKA 3QLVC 2Y71A 3HVIA 2UZ1B 3ZJVA 2PLWA 4R2HA 4PNHA 1GAQA 1YKGA 4CFYA 5IXJA 1Q2XA 2LV8A 1SUSA 4CPDA 4NK4A 1KK2A 5H3HA 4Z1OA 3G0BA 4YJGA 1TUBA 1VG8A 4LV5B 3CXRA 4R1SA 1QO9A 4DV4B 4DLBA 1BVUA 3FYUC 1T36A 1ZW6A 3O8LA 4BZWA 3Q3VA 3QX8A 2AN5A 4GM1A 4MWZA 1WQ1R 3A32A 4XGIA 5JEEA 2G40A 3KUUA 5JI2E 2XGOA 2V4ZA 5E6SA 2IIQA 3PFNA 5DOZA 2AN9A 5ALVA 4MUXA 4E11A 1RC1A 5EWLA 3QHQA 1I3LA 3ZBPA 2X14A 5LDGA 4X93A 1UWCA 4GQAA 2C7BA 1NN5A 4ALKA 3UYLA 4LZNA 1RU3A 4ZV7A 1K4YA 3EQ8A 3IURA 4IF4A 4A26A 1K4MA 3A9RA 2QVZX 4IDDA 3CRQA 3IHTA 2DR0A 4A5SA 4AZ3B 4F11A 2XA2A 3IAEA 3OM1A 4IHQA 1K98A 1M8JA 4IJKA 1I4LD 5L3QA 1T5LA 1FRVA 2HA6A 1SXJC 4Y2RA 1C14A 3AF2A 2IY9A 1V8OA 1GLVA 2PRJA 2ZYUX 1XVAA 1TM1E 4TWJA 2FFJA 5CB6A 3HTXA 3K15A 1YCGA 2VIIA 4IOKA 2PGAA 1E66A 4OI2A 4MLZA 3SF0A 1V7QA 1IOWA 2R6JA 3CUKA 2WZBA 2XEXA 4N7RA 4S3MA 2DJIA 2PL3A 3O9VA 2OVFA 3R9WA 1LSUA 4K9LA 4XTRA 1ZWLA 1T8UA 3ZDQA 1SOAA 4PPYA 1W29A 3EJ6A 5CR9A 1WXFA 1EG2A 2AEJA 1RSZA 2Q1SA 4XLZA 1CDOA 5BR8B 4QU5A 2DOKA 1SCNE 3B82A 1ZC3A 2W2XA 4RSRA 3RUIA 1DX9A 1EH5A 2QTGA 1MAHA 1VYTA 4MTLA 4M9SA 3E35A 5F2EA 1Z4MA 3ESYA 3UT5B 1HNWB 3JQ9C 4IVRA 1THMA 5K0SA 3WIDA 4LQLA 4FONA 2IZ1A 2WE8A 2WIAA 3JTMA 3KG2A 4H35A 1H2EA 1LRKA 1ESMA 1KQPA 1OI4A 3EIQA 3GVXA 4NFYA 4Q7MB 5JXIA 1JLRA 1QHSA 1CHDA 2I1VB 4GS5A 4HWPA 1QUEA 2XHZA 4CLDA 1AB5A 2C83A 3QPBA 1DFHA 2Z9DA 4P7KA 4Q3AA 5CA0B 1XF1A 2GN2A 5HZMA 4N6NA 5ESWA 3Q0IA 2PUDA 1E5QA 2IEIA 3F6CA 1T10A 3Q6IA 5AESA 1OLUB 2VXYA 2VLBA 5CAEB 4C0BA 2IXTA 5CNIA 1C7ZA 5KQPA 2HA5A 3H9JA 3GRAA 3PUIA 5DWDA 4EHHA 3MJSA 3QY0A 4UNQA 3ZH9B 3D2CA 2JGEA 2R86A 1RKUA 2Y4NA 3GEPA 4QGBA 5A71A 4EHFA 621PA 5JSFA 4UTPA 1U1IA 1K6IA 1A4IA 3AEQA 2DBVO 2Z3ZA 1V8BA 3SC2B 3X2FA 3ZK7A 2JLVA 3O21A 1HOTA 1ZGHA 2LBPA 2ZT6A 2NVUB 3AZQA 2G71A 2JIZA 2RGGA 1ODFA 1VXOA 1CQJB 4O8CA 1T8WA 4JT9A 4WK2B 4X97A 4JVSB 3WGKA 3LECA 1CS0A 4E5KA 5J43A 3NM5A 3D6FA 3P97A 3HDHA 3QVJA 3U39A 5FUYA 1QP4