3D02A

Crystal structure of periplasmic sugar-binding protein (yp_001338366.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.30 a resolution
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
300
structure length
300
Chain Sequence
EKTVVNISKVDGMPWFNRMGEGVVQAGKEFNLNASQVGPSSTDAPQQVKIIEDLIARKVDAITIVPNDANVLEPVFKKARDAGIVVLTNESPGQPSANWDVEIIDNEKFAAEYVEHMAKRMGGKGGYVIYVGSLTVPQHNLWADLLVKYQKEHYPDMHEVTRRMPVAESVDDSRRTTLDLMKTYPDLKAVVSFGSNGPIGAGRAVKEKRAKNKVAVYGMMIPSQAASLIKSGDITEGITYDPATAGYALAAVASTLLNGKTIEPGFELKELGKAEVDSDKHIIRFHKVLLVNKDNIDSLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Putative LACI-type transcriptional regulator
publication title Crystal structure of periplasmic sugar-binding protein (YP_001338366.1) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 1.30 A resolution
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
total genus 106
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d02A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d02A01
2FXIA 2RJOA 5TPWA 2E4WA 5E3JA 4LDZA 1KGSA 3H6HA 3T8YA 3SAJA 1USIA 4KPYA 3Q41A 2VUIB 3L49A 5DKFA 2E4UA 3HXMA 3KKEA 1BDIA 1C0EA 1DC8A 2FKAA 2PUAA 3HZHA 5BR1A 1W25A 4O1HA 1GCAA 4PEVA 1QP7A 1YK1A 2E4YA 3DZDA 3CU5A 4G0OA 2PUCA 1PUXA 5TPWB 1A2OA 2NUBA 3DBIA 3O2QB 4G86A 4PYRA 1EAYA 1W9HA 1NXPA 3KYJB 4JP1A 4MS4A 3FFXA 2ID9A 4PE5B 1M5TA 2JRLA 3GA5A 4N47A 4F11A 2R25B 2WMYA 1JLKA 2WRZA 3RQIA 3UKJA 3I5AA 5TPZA 1U2PA 2IOYA 3O74A 1JFTA 1ZGZA 2FMHA 4N03A 3M9XA 4KV7A 5JNVA 4W5OA 2VUHB 1D5WA 2IPAB 3LUDA 3OM1A 3T38A 4MS4B 4F8JA 2PKXA 1SXGA 3KYIB 4QYMA 1MB3A 3CZCA 3NBMA 3VNBA 4UHJA 3DLBA 2JBAA 1XHEA 1YVUA 4IMJB 4XFKA 1TLFA 1MB0A 5I4CA 4Z0NA 5TQ0A 5KQLA 3Q7RA 1U04A 1RPJA 4Z4HA 4KMRA 1ZN2A 2R4QA 4W5NA 5T3YA 1D1PA 1E6LA 4XASA 4RY0A 1AB5A 5GOTA 3VNAA 1FSPA 1ZVVA 1USKA 1TJYA 2OENG 1A0OA 3N0RA 3RH0A 1FFWA 2FLWA 2WJWA 3JS5A 1L5ZA 2B1JA 2JBAB 4YLEA 4YR7A 3F73A 3MM4A 2L19A 4RK0A 4KVFA 5TQ0B 4MLDA 4F06A 3A3KA 3EDCA 1JYFA 1KRXA 2PUEA 1ZHHA 2LP4Y 3H6GA 2FN8A 3RVRA 4OBBA 3OLVA 1NXOA 3OO0A 2CHEA 4F3TA 1D2AA 3LUAA 2R48A 4MYRA 4ZPJA 3OLXA 2GWRA 3QEMB 2MSLA 4QPJC 4OTZA 1FQWA 3H5IA 4ZMRA 1AB6A 5TE9A 3JPWA 5HM6A 3I45A 2FQWA 1RNLA 1T34A 4KQ9A 3F6CA 4G0ZA 4ETNA 4O1IA 2FVYA 3C3WA 5TQJA 2PL9A 3TMYA 4S04A 3EULA 1JFSA 4RV5A 4RY9A 1NXSA 5CHYA 1FFSA 2TMYA 3SG0A 5IUNC 3OMXA 4E7OA 3IDOA 4G0MA 1DCFA 3N0WA 5B3JA 4JAVC 5B3JC 1NXXA 5FBHA 3QEKA 2RJNA 4L85A 3MMNA 1BA2A 5C5EA 1U8TA 2FSPA 4EVRA 1QP0A 4RXMA 3EAFA 4D74A 1M2FA 1DP4A 2HJ9A 3O1IC 4NCBA 4RXUA 2IPNA 3FMVA 5JNSA 5GQSA 1P6UA 3IP7A 4Y9TA 2NZVG 1P8AA 1APBA 3NNDA 1ABEA 4QYWA 2IYNA 5IUKC 4EYKA 1LBIA 1ZITA 2WB4A 2FW0A 4ETIA 6CHYA 2GX6A 3E3MA 4KK3A 1ZGGA 3GWGA 3JY6A 4HNSA 4JASB 4EYOA 5EWMA 3CG0A 2E4VA 3JPYA 1WETA 3N0XA 3H1EA 1VKRA 2IPLA 2MYUA 3BREA 3FDFA 1RXIA 3F6PA 3R0JA 4ZMSA 5ED4A 3HJFA 4RK4A 3HK2A 3LKBA 4MR8B 2V0NA 4YS6A 2W42A 4D6XA 1E2BA 4D6YA 5IEBA 2Q5CA 2YHAA 1YMVA 1R8JA 3C97A 3K4HA 4WUTA 4Q7EA 1IIBA 2VK2A 5EWMB 3O1HB 1DC7A 3KLOA 3HEBA 1TMYA 3EJWA 1GUBA 1LJUA 3H75A 3LUGA 1DRJA 1JBEA 1YS6A 2XDYA 1NATA 4MQEB 4RK1A 1NXVA 3D02A 1H9CA 1JDNA 3GBVA 3CRNA 2JCGA 4NQRA 5KC9A 5KWSA 4G0PA 4YV7A 2A9QA 1JL3A 1DRKA 3RVMA 1ZH4A 2LIVA 1RZRA 2HQRA 3EODA 1OXKB 3O75A 2HQOA 1QO0A 1L5YA 3Q9SA 3EGCA 3JVDA 1ZDMA 5IC5A 2QVGA 4QICA 5JNRA 3NHZA 1Z26A 1CEYA 1YS7A 2DRIA 4NICA 1F4VA 1NY5A 3D8UA 3QX8A 5KQGA 1MVOA 3HM9A 1C4WA 4LDAA 4OLAA 4RS3A 3KJXA 4WXEA 4RK6A 1NXTA 4Q6WA 3HDGA 3BRQA 1JDPA 3KHTA 3ROTA 1Z18A 1XWWA 1NXWA 3QX9A 3F7NA 4TLLB 3ILHA 1EWVA 4Q6BA 4MLCA 3NNNA 1Z2EA 1Z15A 4EYQA 1DBQA 1K68A 4XARA 3TX6A 5IX8A 4H3KB 2QV0A 2NZUG 3RVQA 4RSMA 5KC8A 2FEWB 3FFWA 3N75A 3MYYA 4XLTA 5FBKA 3QELA 1EFAA 1SXIA 3JTEA 2I6FA 1JX6A 4FB4A 3NHMA 5HSGA 3A0UA 4H3HB 3HUTA 4FE7A 5DLEA 2JK1A 2HSGA 2FN9A 1URPA 3QLUC 3QLUA 3E61A 4MAAA 1Z25A 5EWLA 4M88A 5CNMA 4EYGA 3QELB 3FGZA 2QSJA 3M6MD 2JVJA 5PNTA 4GPAA 2PUFA 4Z4IA 1VLZA 1FFGA 1HEYA 4RK5A 4XXHA 1MAVA 2F8TA 3O2JA 2MYNA 4HYEA 3QK7A 2KYRA 1JF8A 5IUJC 4DN6A 1QKKA 2BGGA 3IPCA 3KLNA 1ZAYA 5EWLB 2P9HA 5KQMA 3OO1A 3HV2A 1P2FA 3SM9A 1U0SY 3Q15C 4ML3A 2HPHA 3OLZA 2RDMA 4Z99A 4YO7A 1YK0A 1SXHA 1U2QA 2AYZA 3M9WA 1SRRA 3O21A 4RXTA 5D2CA 3LUJA 3LMKA 3GRCA 2A9PA 2PUDA 1DCMA 3QLVA 4YCSA 4KFCA 4RK7A 3H1GA 3H5LA 2NT4A 4N0QA 2PAFA 4KK4A 1DG9A 3LTEA 4UHKA 4WWHA 2R47A 3N53A 4WXMA 2PLNA 3CLKA 3GV0A 3SNKA 3H1FA 3BBLA 4G0XA 2FQXA 3GL9A 3Q7TA 3NNSA 1M5UA 2YHBA 4IILA 1PNRA 4MGEA 2IDMA 3KS9A 5HQJA 4IGAA 2PE5A 1QQAA 2F8SA 2RGYA 3LKVA 5JNUA 3HDVA 4Z4EA 1UDRA 2FQYA 3CHYA 2FMIA 2N9UA 1KRWA 3IPAA 3RVLA 3O2SB 4HNQA 3ROFA 5CNKA 4F12A 5IEJA 3FFTA 3MA0A 3LUHA 1ZH2A 1DBPA 4LZLA 3P9YA 2MYTA 5C5CA 1VPWA 2A9OA 3A10A 2VYCA 2FTKE 3C3MA 5F64A 3CKMA 1LBHA 1P6QA 4P98A 4JOQA 3ILYA 4WT7A 3C3KA 4RKQA 3RVJA 2M98A 2E4XA 5TQ2A 4L4UA 1LK0A 1B00A 1QPZA 3UUGA 1D1QA 2QZJA 3I09A 1E6MA 2WY2D 4W5QA 3SY8A 3KCNA 1JFVA 2PL1A 4MQFA 3H5TA 4LE1A 1QNLA 1DZ3A 1OXBB 1RXEA 4OATA 3OMWA 1BDHA 4OG2A 5BRJA 5DGCA 2OQRA 1J56A 2QXYA 3N8IA 4TN5A 3GYBA 2ZWMA 1LJLA 3HSYA 4NV3A 3I42A 3LUFA 3OQOA 2GKGA 1S8NA 1TVMA 2WWVD 4G0YA 1BAPA 3EQ2A 2J48A 4MQFB 1JWLA 4MPTA 1USGA 4KRFA 1BVHA 2QU7A 4N0PA 4KZKA 4N41A 4E7PA 3N6VA 3KG2A 3OQMA 3TD9A 4G0QA 4O5AA 4N76A 2O20A 4YGXB 3RVPA 3RVNA 3H5VA 3OLWA 5KI6A 8ABPA 4RZSA 4RKRA 4OLBA 4LE2A 3UK0A 2E4ZA 1ISSA 2AYXA 1CHNA 3DGFC 5JNTA 3OM0A 4Z9AA 2MSKA 3EQZA 3LOPA 1YTUA 4WZZA 4Z4GA 5FWXA 1Z13A 3OQNA 3QLTA 4EVSA 2IKSA 4XAQA 3W9SA 4ZJPA 3IP5A 3T6KA 1CYEA 4LX8A 4Z4FA 5CNIA 2PJUA 2WJAA 4MRMA 4JA2A 3BRSA 2H0AA 4IF4A 4PICA 3DLHA 4MS3A 3S99A 2GBPA 2HQBA 2L18A 5FWXB 3K9CA 1Z12A 1DBWA 1NTRA 2CD7A 1TM2A 4G97A 1JYEA 4MS1A 3KSMA 1PEYA 2LBPA 1YMUA 3JVIA 1GUDA 4YRZA 1ZESA 4FE4A 4MRMB 1YIOA 3HS3A 2M1ZA 5JS2A 4CBVA 3OLYA 2PUGA 3MIZA 4MS3B 3TB6A 5BRAA 1EWKA 2CHFA 2PUBA 3QEMA 4YWHA 3IP6A 4NCAA 3IP9A 2ZAYA 4H60A 4DADA 3A0RB 1EHCA 4MS1B 2JVIA 3H5WA 3LUKA 2JB9A 1Y1LA 1JH9A 2MSWA 4B09A 1JHZA 1SD5A 3HO1A 3CG4A 4P1ZA 2NT3A 1VRVA 2H3HA 3MQ4A 4IMIB 3HUUA 2FEPA 4S05A 3LUCA 3T95A 5IULC 2FLKA 3QLVC 4EGSA 3DGEC 5CNJA 6ABPA 5JNWA 1GCGA 1E6KA 5T7BA 4KNYA 5BQ3A 4DQDA 5FWYA 4JB0A 3G1WA 3H5OA 3HVRA 2FMKA 1D4ZA 2QW1A 1F51E 3MF4A 2MYPA 4RDCA 4ZYLA 1QP4A 5JS1A 4RY8A 9ABPA 3Q7SA 3CTPA 4EVQA 1Z2DA 2LUOA 1MIHA 4GNRA 5ABPA 2QR3A 5FWYB 1PHRA 4KQCA 5KQPA 4W5RA 1EWTA 2QVCA 3SQNA 3O1JC 3LFTA 2A9RA 4PZ0A 1DJMA 2B4AA 2ID7A 3CZ5A 1A04A 4ETMA 4EUKA 3G85A 7ABPA 1XHFA 3BILA 3TO5A 4RWEA 1GLGA 5HKOA 3URMA 1I3CA 4IRXA 1ABFA 2CWDA 4MR9A 3CFYA 5DTEA 1QQBA 5IBQA 1PNTA 1QMPA 1RZRD 1K66A 1M2EA 2L17A 1BDJA 4MR8A 3KTOA 3GBPA 4Z9BA 2P4UA 5EWJA 4Z4CA 1QO0D 2IPMA 4LE0A 2GI4A 4MR7A 2X7XA 4JB2A 3CS3A 4TMYA 5DCLA 3L6UA 3B2NA 3RVSA 1Z17A 3CNBA 2FMFA 2PMCA 2LPMA 4LRQA 1ISRA 4MR9B 4TLMB 5TPZD 4RU1A 4YP9A 1Z16A 1DCKA 3GT7A 5EWJB 1ZY2A 4MQEA 4HNRA 3RVKA 2JVKA 4W5TA 5TQ2B 2L2QA 1KMIY 3C6QA 3HCWA 4MR7B 1PEAA 2FEKA 3RVOA 4EY3A 4KREA
chains in the Genus database with same CATH superfamily
3V1KA 3AI3A 4LYFA 3MMZA 2GPNA 1UBEA 3PGXA 3RS5A 3HCDA 2YZGA 3WBBA 5CG2A 2A59A 5CDUA 3I61A 1CJKC 4MMXB 3GVCA 5EJ2A 3QJGA 3T8YA 2Q0HA 3HXMA 4H16A 2LCQA 1KIAA 1T24A 1XGKA 3MPOA 1VRCA 1J8YF 1SVOA 5A5FA 1W25A 4GYYA 4RTJA 3E9QA 1P1FA 2AOWA 1E4EA 4FDTA 4W4TA 4BYGA 1GITA 2DQZA 2WSBA 3AH8A 4Q3DA 1L8QA 4UXJA 5G1OA 5KKAA 5TPWB 2BIFA 5KHLB 3GLIE 2O8DA 4R3WA 3E18A 2OOKA 2EKDA 1NXPA 3GLUA 3ZHTA 2UKDA 3FHJA 4M9SA 4FT4A 2E82A 5FHQA 4P4SB 4A0QA 3DQQA 2CFRA 2PVSA 2RGNA 2ZRPA 3BEOA 3ORQA 4YMIA 3QUAA 1ZJZA 4UNIA 2FX2A 1JT2A 2DTEA 2V8BA 3VBEA 3VU1A 5KYTA 3R9XA 1AV7A 2BMJA 1UDWA 5JHHB 3OZCA 2QZZA 4Q9NA 4ZVPA 1UBRS 3IHWA 5I4KA 2C82A 1O2DA 3TFQA 4F8JA 5JZMA 4UHDA 2CT8A 1SXGA 1IG3A 3KPWA 5SY4A 5KOJA 2ZRCA 3ZGYA 4JUCA 4IS2A 4XFKA 2HMAA 2O54A 3CB2A 2MSCB 3RF7A 4UTVA 1I1NA 2R4QA 1VLJA 1E6LA 1II0A 2UZ4A 3GMSA 3LCJA 2FMTA 1C0KA 1PRYA 2Q46A 3FNIA 4QPCA 3KUKA 5FR2A 1CE8A 4L0CA 8LDHA 1UZMA 5DVZA 1NBEA 4GSYA 4LRSB 2EBHX 1JV2B 3BWEA 2CJYA 2PMWB 1VKJA 1NVKA 2FXVA 1FUEA 3REFA 5E4TA 1ZI9A 4PC2A 5ALZA 2RGUA 3AR4A 4BFUA 4KO4S 4L5AA 4P58A 3PUIA 2HK6A 4OAOA 3GFFA 4PYKA 1TC1A 2V7EA 1OZFA 1M1YE 1T8RA 2IHZA 2JJQA 3ZE9A 5GONF 4C6TB 2AFVA 4RHFA 4CLHA 1OH8A 1UZLA 4HOYA 4DJAA 4OP2A 1L5MA 3TPCA 1KFCB 2DWCA 4AMYA 5B1EA 3SYRA 1GFWA 3SBOA 4D41A 2C7PA 2JI4A 1U63A 1D03A 3DV2A 4HB4A 3KL2A 3RABA 3RG8A 3T3IA 3WHLA 4D4MA 1IQUA 2AI1A 3JQ7B 3WKBA 5I9IA 4AZ0A 1YB4A 3CE9A 4PPGA 5EXTA 3CGWA 2YVUA 1AKQA 4KO8A 4F2HA 7ADHA 4ISCA 2QJRA 2JIPA 3SYLA 4G5QA 2O6HA 3AJDA 2HYIC 4Z8XA 3PHGA 1NN0A 2UDPA 3DOJA 1FFSA 4V0OA 2TMYA 4G07A 3E2PA 1B43A 2C58A 2E9SA 3GGDA 3IVXA 3L0PA 4L6CA 4G0MA 4FNMA 4E3WA 1A5ZA 5B3JA 4ROTA 3EMKA 1W96A 4NTZA 1R8QA 4D9EA 3HDQA 2QZPA 4TLDA 4LY3A 3R8XA 1MABB 3CZPA 4O2AF 4ZT5A 5BOSB 4YJ3B 5EOVA 2E21A 1JAZA 3T1QA 1RZUA 3F6SA 1Q0SA 2PLRA 5TGTA 3R3JA 2IIBA 3IQXA 3EK2A 4YTEA 5ALXA 3HCEA 1V9LA 1SUEA 4PHCA 1R10A 3IEVA 1G60A 4RCZA 1AUVA 5CM8B 5GQSA 3IDQA 3NIDB 4A10A 4B3IA 2I4NA 3ZX5A 1P8AA 3HY3A 4ZQHA 1G2PA 4UFPA 1EFDN 3PFHA 4PFKA 3VMMA 2AXPA 2IUYA 3F3YA 2WZCA 2QE7A 1L5OA 1JEQB 4I4IA 3PXEA 3NC1C 5J58A 5AK0A 3BH0A 5IXJA 2OYRA 4TKVA 5FJIA 4RVNA 4ZQFA 3H8SA 3PR1A 2J3EA 2YTZA 1YS1X 4GDMA 5IAGA 2HXSA 3BH6A 5FTWA 3EIXA 4YUWA 1QRDA 2GEFA 3D9QX 3C41J 1WHSA 5IEBA 5K9ZA 4C43A 1UMDA 2CW5A 2A1UA 2WIBA 3CUUA 1SOMA 1YMVA 1QG4A 2DY1A 4KAFA 1QYDA 1T0UA 2FOLA 4K46A 4X1YA 5FTKA 3DTVA 5EWMB 1M2VA 5LUBA 3R7WA 3LPLA 3M83A 3VUEA 1L4BA 3B9BA 1Z0ZA 1XQXA 1N25A 4O2LA 5KKCA 3EPKA 1IRXA 3ZV6A 4S0XA 1K8XB 3ZUPA 1NNEA 4U63A 1U5AA 4LHSA 4WXHA 3ZQ4A 4X0EA 4HX2A 4O2AA 1JLHA 1LQ2A 2X6QA 4LZPA 1TCVA 4N8SA 3THOA 4DA7A 1RP7A 3IQDB 2A8YA 3WGYA 2A9QA 4NU5A 1KIMA 5EFZA 3L4KA 2C2GA 3QVLA 5AFSA 2FZGA 1RE0A 4P35A 2R60A 5BT9A 1E0JA 3T0FA 3UWKA 5L4LA 2G0NA 1HRKA 2P9QA 2KX7A 2B34A 1WV0A 5G0VA 3MN1A 3JVDA 2Y1FA 2QZ9A 3DNMA 1ZRMA 5IC5A 1WOYA 1P0IA 5F1KA 1DAEA 1V8FA 1PAUA 2DFVA 2DRIA 2FPSA 2HBYA 3GZTB 3TGLA 2YJGA 2A0WA 2R86A 3GRRA 5LD2C 2ZZMA 5B12A 1NKVA 3DZ8A 1UPXA 1XF1A 3BMNB 2A88A 1GL6A 4G5HA 5DDIP 3TQSA 3RD5A 2EFCB 2VJDA 2WIDA 1ZNZA 1OSNA 1Y81A 4B6JA 4RF5A 2X8LA 1SA0B 3O8BA 2GM5A 5KX5F 1MLDA 4HADA 3ZHOA 1VHQA 1R5OA 3WDKA 3NIGB 4NAHA 2P5TB 2RHGB 4AKHA 3PL1A 1K68A 4XARA 4DWOA 1V8OA 4IX9A 1E7MA 4QXQA 3AUAA 1BHJA 5AP9A 1IXYA 4KR6A 1YL7A 2QTTA 1X1EA 3KQSA 2RK6A 3RTAA 3D2AA 4F38A 1Y5MA 4X84A 2J3HA 1G8MA 4OU5A 5IPFA 4PSVA 2BBTA 1UWVA 1X1TA 3KZ1E 5I9NA 3IVAA 3ZQJA 3MWKA 2WU0A 1QLJA 2WV7A 4FS8A 1FJ2A 1OZAA 3UBTA 2ZUBA 3DBOB 2PZMA 3PC4A 3E61A 1R4AA 2P1RA 5EWLA 5C8ZA 1XZIA 2OXFA 1M3SA 4M89A 4UBMA 2OKCA 4ENQA 3QE4A 2VRBA 3MUFA 3JQAB 3MTDA 2GARA 3ZHUA 4DMCA 3IERA 4HAXA 2J31A 4BLRA 3H4IA 2F8TA 4Q1VA 2Q2QA 3HY4A 4EFDA 2ZJ6A 2KYRA 3H1TA 1ZM4A 4DN6A 3A6HA 2YN4A 4PNHA 3CVJA 1TFUA 4TRJA 4RYDA 3OO1A 1LKZA 3EEFA 2AX3A 5KX5A 4OGGA 3WSWA 3BWMA 3GVPA 1PZEA 4GX1A 4LY6A 1J4AA 1J70A 1PFGA 4WXPA 2UUAB 4Q4JB 1SQSA 3I2FA 4K86A 1I5EA 1U11A 3OE7A 2ZBGA 4WECA 2LGJA 2OV3A 3FPCA 3RLIA 2VK8A 2I66A 3WGHA 1GGVA 1SHJA 2XQGA 2QLNA 4PLHA 4D80A 5IASA 3K2IA 2HF8A 1I51A 3FRHA 2ATXA 2RIRA 9GPBA 3RJTA 2V5VA 3AI1A 5ULLA 2NUTB 3IEIA 4KIJA 2NT4A 3AY0A 1OI4A 4Z5XA 4Y1FA 1CZHA 4L6AA 4WWHA 2R47A 5EZSA 2IYTA 3SOPA 5K45A 4G0XA 4RSGA 1LFAA 4Z3OA 3UPDA 1UPTA 2AN9A 1W6UA 1G5IA 4I1PA 1UBOS 2R5FA 2XCLA 2YYSA 3IJ5A 4DCGA 1FY2A 1O5OA 5I7AA 4F9GA 1EK5A 5CH8A 3PEEA 3SSAA 1NRJB 1Z4NA 2CXUA 1BOFA 3CT4A 4OK3A 5ETJA 2I4LA 3RRFA 3ZHZA 2C61A 3M4ZA 3N7TA 3RVLA 2JJ2D 4MZDA 3I9JA 5T57A 2AEMA 3DEIA 3FFTA 4LS3A 4DT1A 3MA0A 1KA9H 3C45A 2AEEA 3SFVA 1BE0A 4ZYYA 5FPPA 4RLFA 2IYYA 2ZYVX 3PDIA 1ZH2A 1B1CA 1EHYA 5C5CA 1PV2A 4GVXA 1YZNA 3FUXA 5LQSA 3CLUD 3C6MA 1W19A 4YYEA 5J2TB 2Q3FA 1J9ZA 2ZPTX 3G2QA 2E6UX 2CL6X 3QXHA 1J2EA 3E53A 3Q12A 3HXPA 4K6GA 3RUDA 4ZEWA 2HRCA 5CW1A 1AMUA 3GXBA 3EOAI 1V1MA 1JXMA 4JJKA 4V2IA 5F77A 4AZ3A 1GXSA 1W2HA 2EJBA 1EWYA 1VSTA 2HCTA 3DYVA 4OQMA 4C5CA 4QVIA 4NMXB 1E6MA 3PQCA 3EIEA 2H4YA 4GWGA 3UXEA 1VHWA 2Z6UA 3HP7A 2NNWB 2Q9BA 3UC9A 7REQA 4LXGA 1ZCJA 1XA4A 3F0TA 5KYXA 4HLDA 2WABA 2DYKA 2BKUA 2NSLA 2QXYA 1RJ9A 1U7WA 2ZM6B 2V7QA 3G13A 2ZUVA 3FNBA 4NDAA 4ND8B 2HPVA 1DOAA 2BM8A 5DXAA 4PZDA 2D7JA 3HA5A 4OM8A 5AVUA 2NZ2A 1VSQA 2CK3A 3JD0A 1MQ9A 1N5OX 2G7MC 2OBXA 3DMNA 3H2HA 5FORA 4KZKA 2QUJA 2ADFA 2IXBA 2J3LA 4B0OA 1CNFA 1V41E 5T8KC 5I8WA 2DX7A 1YGYA 2CWWA 4E2YA 3W1WA 3B1VA 4FDMA 1CUJA 2ILTA 2SCUB 2BMFA 3C70A 3LS2A 3R4CA 4KN8A 1CKEA 1I7LA 1E7WA 4YJ2B 3VV2A 3EQ9A 2HO4A 1UDBA 2NPFA 3RYHA 3TZQA 3ZYCA 3GFVA 3GR6A 3H5VA 4U6QA 4Y3UA 3WVNA 5BV8A 1WMBA 1BWQA 4QJ3A 1W36C 3CVXA 2KE5A 1I9GA 1ZW1A 4ILKA 3UTCA 3LTNC 1IHPA 1YTUA 4JITA 3LUPA 4WZZA 2UVPB 1W34A 3EVFA 2N1BA 3KC2A 4OYRA 5NLLA 3SR3A 3KQWA 4DWJA 4YXWD 3T6KA 2VHZA 5EQTA 3RSHA 1PLLA 4MINA 1DWOA 3OPVA 1JJBA 2YZ7A 2XW6A 1IK6A 4PAQA 3ROZA 1BN7A 1SJ9A 1P5FA 5A4JA 1FMLA 1RHJA 2ECKA 2PFSA 4YY3B 5ISMA 3NV7A 3ETHA 1I3NA 2RD2A 4M36A 1E5XA 3IMEA 3LZ6A 3DMRA 5GZ1A 4GOOD 3PCTA 1RKXA 1XQVA 3F5QA 1ZKDA 2QX9A 1QKIA 2HLHA 3M89A 4G01B 4M9XA 3E9YA 4ON9A 1BD4A 2HWWA 1CUXA 1TM2A 3T3MB 3R0ZA 4DNQA 2XHZA 2ZSDA 4PLZA 5E9QA 4DDMA 3JVIA 2CE7A 1Z6GA 2BHSA 1PT8A 5IFKA 2UYCA 1Q7GA 3HS3A 1T1RA 5IWAB 1D4AA 3BJRA 3WK9A 2FWIA 3LVFO 4FN5A 4Q12A 5EJMA 1M67A 4Z7JA 4YBRA 7YASA 3NUGA 3LBIA 3OT1B 4UUNA 1VPLA 3P0EA 4U9IS 4NCAA 2CZCA 1UDXA 3IGFA 3HGMA 3P5BA 2DWQA 2WFMA 2FP3A 4MWEA 1JIIA 2PUTA 4MPJA 4IY1A 4RQUA 2GPWA 1Q2XA 1H8ED 3EZLA 1OWOA 3LYUA 2G1JA 4LTDA 4RWZA 2RARA 4N3GA 1AGNA 3RRNA 3QJYA 4J0QA 3KBOA 3MTGA 4YMUA 2O2DA 4L5BA 2R00A 2NP6A 4K3UA 2JLZA 1IDOA 3ZG6A 4AJ2A 1V0JA 10MHA 3M4YA 3RRMA 3LT4A 3MMPA 5MN4A 2CDCA 4OQFA 3GA7A 3CLTC 4KNYA 3DM9B 4L7QA 4MYCA 4BZQA 4MA0A 3X2EA 2PEZA 2QB5A 3A7EA 4M0CA 4BASA 5BWOA 5CEJA 5CEFA 3T54A 9MHTA 3LUBA 3OH8A 3UG6A 4FJ0A 1I7PA 4R2LA 4HNTA 3OEYA 5IC4A 5JS1A 1Z0AA 1ADYA 4NPCA 2J9GA 1OE0A 4FGZA 5G4LA 1HZJA 3U9LA 1IY0A 2D4AA 3L05A 4GNRA 1O4WA 3DCNA 2GD0A 4CHTA 5HZMA 5I5EA 3KIPA 4NBWA 2BH2A 2YJZA 1SBHA 1N8TA 5I7EA 3KQLA 3LFTA 4K0KB 4E2ZA 1P9OA 1NUAA 3LU1A 1RI2A 3O4RA 1OKKA 2W0SA 1KOLA 2G08A 2ODNA 3ZV3A 2YASA 3DBRA 3W7VA 2IIQA 3INYA 3OY7A 4KQ6A 4YQEA 4ONEA 1Q7EA 1ODSA 3EGVA 2WQ7A 3TE7A 2YINC 1IOVA 4GE3A 4MWTA 5EWJA 3S7TA 4Z4CA 5KSOA 1HR0B 1B6TA 1VL0A 2HR1A 2WK1A 4FFRA 1QHEA 5KNDD 3RSSA 3O8QA 4JI7B 1Z7GA 3PNMA 5HQ3B 2Y0EA 1KAOA 2X2PA 2BF7A 4LXTA 1E3WB 3CNBA 2O19A 1LS1A 2ZB4A 3B3GA 3E9RA 2G6TA 5EXSA 1RE1A 1U0LA 3A04A 2XXAB 2Q45A 3LW7A 5KPDA 3V48A 5C0OE 4R1QA 4U2DA 3F78A 4M2LA 3LBFA 4OYLA 3AYZB 3F8WA 2J41A 2PLWA 3UXYA 3GLHA 2WKRA 4A6PA 2ZJFA 1YRWA 1JHAA 2X22A 3R3XA 3GLKA 3O94A 4C03A 3ST7A 1DHRA 3V8RA 1M1NA 3EFBA 5COBA 3EC1A 3E7DA 1U8CB 2XUZA 4N3AA 1NBMD 3AZOA 2D0OB 4Q1EA 4LC1A 4COOA 4WLUA 1JGTA 2ZYGA 4WLFA 2V65A 2YYYA 5K6AC 5ADVA 3ZQ6A 5IKMA 2L69A 4JUAA 2EFGA 2PGAA 2GASA 3I9V6 1ESNA 4E07A 3K0AA 2Y0DA 2YS7A 4Q1BA 1HLFA 3STXA 3FRJA 4WVFA 4X8HA 3CVWA 1C4XA 1JHYA 2FR8C 1Q92A 4HB2A 1A1VA 2QX4A 3BWDD 4MUXA 4JWKA 3VR6D 1FFYA 1OASA 3IXMA 3LA6A 2P3LA 3JATB 5LB2A 4NVRA 1KPIA 3EW9A 2OB2A 3ANMA 4RHCA 2VRCD 2X86A 1RU3A 2GR9A 3AHHA 3IPXA 3JALA 4MV9A 5LA6F 3SI7A 3G0HA 3SLGA 3F1KA 3WAKA 2ODAA 4WCFB 3WKEA 2CY0A 5E7JA 3QHAA 4J9VA 4F04A 3ZWYA 2W2MA 2G70A 4IRMA 3KYBA 2XGJA 4W5OA 1VCNA 2MMGA 4UTZA 5EEGA 1ECCA 5T4FA 2JAOA 1Y7HA 3Q7IA 4G85A 1UK6A 1Z0JA 3KYIB 3TJMA 3KJZA 2JBAA 4M60A 2BGKA 4QYIB 1KKMA 2QN3A 4YV2A 3CKYA 1Q0HA 2ONKA 5JCJD 1NHWA 3KETA 1U04A 1JEYB 2ZR9A 3QI7A 3KVVA 3M1LA 2I34A 4G24A 2ZLBA 2EARA 3E5RA 3ILXA 4LW8A 4PZLA 5K5EA 2PIAA 2J6IA 3AHJA 2NXEA 2BMEA 1CR4A 2AFHE 2QL5A 3DKIA 3ENZA 3MNFA 4P2BA 4E5VA 5JBQA 5SICE 2D7CA 4YCBA 4AYWA 2DPMA 2GVNA 3OG9A 4Q18A 5BWBA 4QATA 2UUCB 1QB8A 1M8GA 5IJ0A 1PNQA 1ZIDA 4BS9A 3UMMA 3WK7A 3LOQA 4FD3A 4UCWA 4XX1A 1AXEA 3M5DA 1QCYA 1LDBA 3MWDA 4EMUA 1CRWG 1JECA 3VU0A 4F06A 1MO5A 3D7MA 3IV7A 2VL7A 2XE6A 2OLKA 3NEPX 1L5GB 5HW0A 2HLNA 4G4GA 4NY1A 5FPTA 3WLRA 4UFOA 1NXOA 4LGYA 1OYWA 4EDHA 4YIHA 2ZWPA 4QXPA 2YJTD 1B23P 3U44A 2KPOA 2NGRA 3KD2A 1BDBA 5LA6A 4ZCRA 5JCOC 1JDBC 1OWPA 5CFOA 3SEZA 1WSWA 4D43A 3AFNA 2ZTLA 2CFCA 2GZRA 4QGBA 3AW8A 5DTMA 5CLJA 5DTJA 2ZAOA 4EELA 1IHUA 1RIFA 1E1QD 4ESOA 4QEDA 2IQIA 3GG9A 4V03A 5SZHB 1QYCA 4DNPA 2TMKA 5CT5A 2O7RA 1V7QA 5LYJB 4LJ8A 2WNSA 4QELA 4EL5A 2GILA 3FLEA 4DR1B 1EUZA 3BG5A 2AVNA 3A8TA 4JAVC 4BUCA 3EEBA 5D84A 2VP3A 4PSAA 2JI7A 2RJNA 3SPXA 1UXJA 4B6EA 4M0DA 2UZ0A 4DY6A 4ZYTA 1DVRA 2H9IA 2Z04A 1L4KA 3MMNA 3E1GA 3RF6A 1U7ZA 2CLSA 1O94D 2YWBA 2EAUA 3NHKA 2OGTA 3ZKWA 3TOCA 1VE7A 3N2YA 4N3BA 2JS7A 4C7OA 1O03A 1M6VB 4LI0A 4LDRA 3GDGA 3OIFA 4RXUA 2EQAA 3Q88A 4PGMA 2O8CB 1PV4A 1ORVA 3V1TC 121PA 1U3GA 4U7GA 2R65A 4OHZA 3HJUA 1TVKB 3K92A 3IUPA 4MV4A 3EQ7A 3WLQA 3C1UA 1ABEA 3U1TA 2BFBB 3Q7PA 2WB4A 4LRUA 4M1OA 3F3KA 1NOIA 3IMGA 4CTKA 3BT7A 4TV8F 2CLOB 1AY0A 1CEEA 1UL1X 3KZMA 3TVTA 5DI9A 4EQZA 2ORVA 2EWMA 4IFEA 2ILVA 2VWPA 3K3PA 4NFHA 4OP1A 1IONA 1EK6A 1T2UA 3B7WA 3ENKA 3AIIA 3A37A 1AOXA 3KJHA 5KYWB 2HW8A 1J0XO 1ZG3A 4ZT4A 3WYFA 3UJNA 1VCMA 2GCGA 5CT9A 3PHLA 1XKTA 4AECA 2Z2ZA 3WBFA 2HH9A 2O57A 3ZV7A 2QRHA 4R2XA 3INGA 1G20E 1E7SA 2IYFA 2QD4A 1SWVA 3BWCA 4B48A 4PX5A 1DRJA 1JBEA 4C0HA 3R3SA 1Z4LA 2XBLA 4X00A 3ANXA 2JBWA 3IDAA 5ER9A 1QS0B 1EUCA 4ZALA 3VKFA 5DSTA 3ZVKA 8OHMA 3PTAA 5K0EA 3Q8MA 1CQWA 3RVMA 5LXTB 1ESZA 4N01A 3OTGA 1PYOA 3K2BA 3S40A 2AZDA 3GROA 2XBMA 2ALJA 4PPQA 4KQIA 3TMAA 3LSTA 2QI9C 3SYTA 3CW8X 4ARAA 5HTOA 3TSCA 2YDYA 5IDQA 5DTQA 5J9FA 4LXIA 3T1HB 1G3RA 1ANKA 2WYUA 3BD9A 2PZKA 4TV8A 2PMEA 4NK4A 5BMVB 1NY5A 4D26A 2FJ0A 2OK8A 2QSUA 4B87A 4MUBA 4BTEA 3AF1A 5KYUA 1V4BA 1MJGA 1U1IA 1I3KA 2JGRA 1FBNA 3FAZA 4FKZA 4MWCA 5E9JA 1UXKA 4BPRA 2OD9A 2QW0X 4N7JA 1I4DD 3HJCA 4LSGA 4UEKA 1G17A 3FYCA 2O06A 3MT8A 2QPLA 4GE0A 1H1DA 2PCLA 3GF4A 1OH6A 3L7KA 1EI9A 3EXHA 4R2MA 5CB6A 3U16A 1CF4A 3QYPA 2N3ZA 4W82A 1OJ7A 2AMFA 1XVAA 4RH0A 1KSHA 2WPDA 3I9V1 1IPFA 2C2HA 3LPCA 2B9VA 3ODPA 2FSGA 2FQQA 3M2TA 3D4BA 2Y99A 4RMIA 5ARDA 2H5IA 2QUBA 2OV6A 1CDEA 2P7IA 1BCRB 1YDFA 3BXEA 5LKRA 4P5EA 2CVQA 2ZJ1A 3FFWA 4AF7A 3DLCA 4J3FA 4DDTA 2Z2XA 3IR6A 4NQZA 1UAAA 5FL7D 3ISTA 3NHMA 4LC9A 5NULA 3FOWA 1WD5A 3FPLA 1QKJA 3DR5A 1KVRA 1JSCA 4PC6A 5I3CA 2C7BA 3OE1A 3FJOA 1GTZA 4XGNA 2C00A 5AW9A 1Y5NA 1BGXT 3SJCA 3BCHA 4S1OA 1Z25A 4M88A 1L4GA 1ZNYA 5CNMA 5AHKA 3FGZA 5DNEA 3WWDA 1JDVA 5FEMA 1TM3E 1NULA 3W7BA 3L6DA 1VLZA 3GFSA 3L7YA 4JVSB 3BVPA 2FPWA 3ESAA 4RTPA 5T3UA 4B81A 3AL0C 3PZRA 3UG7A 4XYMA 1FYDA 3SIXA 2AN1A 3M33A 1HK7A 3ZE0B 1HV8A 1MORA 2BCJQ 3ZGLA 5K3OA 1JFRA 1LQUA 4JN6B 2C03A 1YO6A 3SQWA 1QU2A 2LVBA 1HXHA 3EJ6A 4Z9YA 4BN5A 1W4ZA 1NQXA 5TVKA 3PE4A 4DCTA 3Q15C 4EL0A 5B7QA 3MUOA 4N65A 1GZDA 1JHDA 4BVAA 2O8BB 1IN4A 3M9WA 4EHFA 3O21A 4FFLA 2I2FA 1GPJA 2O6LA 3QI2A 1U0OC 5D2CA 5CFRA 1OAKA 4EHBA 4ZVLA 1O95A 3NHWA 3EY9A 3OA2A 5LQUA 2O8FB 3UMJA 3TSYA 1AGYA 1QGAA 4IEFB 5FBLB 3KE8A 5M04A 3CNHA 5AW2A 4EATA 2GM9A 4IXDA 7GPBA 2ZTVA 3QX3A 2ZIWB 3G8YA 4QJBA 5TEWA 3V4SA 1TEHA 3ON5A 3VC1A 3ND6A 4CF4A 2HMUA 5JY6A 1VJCA 3IE0A 4S0ZA 4BB5A 3PDUA 3GEDA 1A8UA 2O9JA 4IOKA 3K5HA 3WJ2A 4G0VA 2UZAA 4E03A 1BRTA 3H11A 2VJYA 1T1JA 3QPWA 4J0CA 3UWOA 1VB5A 2IHYA 2IVFA 3RJ9A 1JA9A 4DMUB 2PE5A 4H15A 1CJUC 3T0GA 2YVLA 2W48A 3B1FA 3G0DA 5LP6B 4QUHA 3PDHA 4KVZA 4PFJA 5HDQA 3GOQA 1Q7BA 1R5NA 1SHTX 2BTQB 3EYWA 4W7HA 4G0WA 1HMPA 2JZNA 1JDZA 1H1LB 1Q20A 2LV8A 3RC7A 3E48A 3C4JA 2ECPA 3HB9A 4M54A 3VOAA 1VG8A 1SZDA 4ZVKA 1DBPA 5EPOA 2FG7C 5JXHA 4EG4A 2VNKA 1DKUA 3ER9A 1KARA 4P3PA 2FPGA 1EUDA 4DIFA 4AJPA 1GTL1 2POQX 1N6NA 3U4HA 3SE0A 2V0GA 5EG5A 5K0NA 2O05A 2CYAA 3L8YA 1PR9A 1O5IA 2IEZA 5IYZF 1VIYA 4LJLA 5AKLA 1IEVA 2XUJA 5JAOA 5I9SA 1KKLA 4YQYA 3RUIA 4P0PB 2WHYA 1NLFA 3SY8A 1VHDA 2IX3A 1XRPA 3JASB 2C7VA 4PZCA 4PSUA 1ZNXA 3WO0A 1GSHA 3IUYA 3IA2A 5JRDS 2EBUA 5K7SA 3JSXA 4OB7A 2BP7A 3COPA 5JH7F 4I4TB 1NAIA 2HL6A 4GZ5A 2EJTA 4FZJA 1FQJA 5AOAA 4HT3B 2WEKA 1OFIA 1NPTO 2Z1DA 3L7DA 3LHIA 3C5WP 3EZ9A 2YNMD 3N2LA 5C5DA 3DC2A 4REQB 1J6UA 2FOXA 5ICSA 4KKXB 1RM0A 2WT9A 4K9LA 4MA4A 1ZUIA 5ALTA 2VBCA 3K9GA 2AHRA 1P75A 4I1OA 3JRXA 1RWXA 3FGNA 1D09A 1JJVA 2O48X 2QP9X 3A2NA 4KNWA 1E2LA 2GJSA 3VHLB 2C8JA 4OP3A 4QHTA 2ODTX 1VYVA 2NU7B 1R88A 3KG2A 4FGWA 3MTBA 5TR9A 4DB4A 4WXRA 2QZ4A 3R6DA 4PRKA 2ZUSA 1CP3A 2I4IA 3EF1A 1C9EA 2B4QA 4JOBA 1T91A 3DB2A 4N0EA 4PG8A 1TGVA 1GA4A 4LCEA 5IVDA 3QFTA 4FFSA 3UK0A 5AVVA 2VUSA 4FYYA 5DHFA 2AOUA 4R1OA 4XJTA 5IYZA 5E3HA 2FW1A 2X2EA 3VX4A 1YZQA 3R5TA 4CQMB 3C3PA 2H48A 2V98A 4RD4A 3FTEA 3IP5A 4FFDA 4LFAB 3HB7A 5IJ9B 3PA6A 3NAQA 4DA9A 1AKEA 4TRRA 1CB7A 3DE7X 5JH7A 1ZQ9A 3JZAA 2RGXA 1D0SA 4J7CA 2IDJA 1RLIA 3TUIC 4MPRA 2JATA 4F96A 4FR2A 3L1IA 4OCZA 2FSVC 2PYDA 4AJEA 4P4UA 4Q7MB 4TTJA 2X23A 2WD7A 1Z7EA 5JARA 1NNSA 5FOUA 1SKAA 3BA1A 1I0IA 4M9QA 4CF3A 2VNIA 2WA1A 5BSEA 1B8UA 1KI6A 1M2OB 1X6VA 1M6YA 5ALOA 1FSZA 3N74A 3I53A 3PPWA 4XKJA 5F9MA 3ZNPA 1VL8A 1HQYE 2BFMA 3CF0A 3PGMA 2DLNA 4GG1A 4EA6A 4L3OA 2J8ZA 5DLDA 5AXBA 3SC4A 1I24A 4ZA2A 1EWKA 1GPWB 1RPTA 3QVMA 4FCVA 4YUZA 3QEMA 4AZSA 3FIJA 3ICOA 2CLHB 2E0IA 4G89A 4QO8A 1SPBS 3TIIA 3GJRA 1O5TA 2REOA 4JZYA 4D82A 5BV7A 5J43A 4AKIA 4H4EA 2C3OA 2QLBA 1WLSA 4L4XA 3L46A 3SXJA 2J5XA 4X60A 2OGSA 4KQ1A 3NHJA 1AO3A 3HL4A 3HN6A 4ZARA 4N5MA 1KE2A 3VR2D 1TECE 2CVOA 2AN5A 2BEJA 2FEPA 5C32A 4CMIA 2B3TA 3L82B 5IULC 3ELUA 5IDXA 4A6DA 4XM2A 3ED1A 1AUXA 5FQNA 5A4KA 2H1FA 4NYIR 5DXFA 4QAJA 4QFDA 4BQFA 2Q5OA 3CN9A 4AJJA 2AHOA 1U2RA 5LLTA 4I1SA 4QSMA 4MYDA 2L82A 3ZDAA 4GH5A 1C2YA 1L7NA 4AG5A 3PXDA 1KJQA 4BFXA 2CDNA 3NWBA 5DIFA 2P9GA 4JUBA 2Y1WA 1QFXA 2P5YA 1EXMA 2ZCUA 1KJYA 2I99A 5BXYA 2JIZD 3MTEA 1KAQA 1PJTA 1ZCFA 1GTJ1 1JN0A 4O3FA 1RYHA 2XUOA 4CIDA 1HNXB 1R4NB 1MIHA 3ABOB 1KZ4A 3CF4G 4P5DA 3W5BA 3GGOA 3TRHA 2IH4A 2BJHA 1VMAA 3HSKA 1IY9A 2QVCA 1U2DA 2PTGA 2YYAA 4CKEA 2DXIA 3NDIA 4QDTA 3QMPA 1SXJB 1TJNA 2Y9MB 1HBJA 2R6ZA 4U2FA 3TUZC 1XZEA 3URMA 1YRBA 1W0CA 2VCHA 3AIMA 1G6KA 2YC2C 2ETVA 3GQBA 4TS1A 1J20A 3BCRA 3RYFB 1RYZA 2ZS8A 2WM2A 1KDPA 1PNTA 1QH0A 4GZ6A 2IOHA 4B71A 2YWCA 4KQKA 4ES6A 3RC9A 1YVDA 1E59A 3BS4A 3JWIA 1NOKA 2G72A 2LZ0A 1U8AA 3HVKA 2QJTA 4CMEC 1PZFA 3CS3A 3FUVA 3CPSA 5K3BA 1QO9A 2P2DA 3HNRA 3A1SA 3RCBA 3RVSA 5IZCA 1Z17A 3KWMA 3B60A 2FMFA 4RPJA 4XVCA 1NL3A 2I6TA 2AMVA 4ZKEA 1QC5B 4WBNB 4NXNB 1MRSA 1OD6A 3NUZA 4FFMA 1SUBA 2R66A 3MFYA 1FZTA 3QF7A 3EGDA 4JP8A 4M9ZA 5TQ2B 5EN4A 1JZTA 1RD4A 3VR6H 4BMSA 5AKGA 5CYOA 3PRKE 1V45E 4DXHA 1QLWA 2D5IA 3TLMA 3AY6A 4K7JA 1ODLA 3CSSA 2P6PA 4OSEA 4LDZA 3SAJA 3FKSA 3KOOA 5FCDA 5JSYA 4L2IB 3HYSA 4Q34A 1W5AA 3B85A 1EH5A 5BR1A 1Y1SA 1QP7A 3CT6A 2JAPA 2E4YA 2M6RA 3KPJA 3TW4A 1YA8A 2PUCA 2PX8A 1IHYA 2ZATA 3DP9A 2AC4A 5CH3A 1H3FA 2QY9A 3O2QB 4WLVA 1R0SA 4ALKA 4E5SA 5DBHX 3KYJB 5DJ5A 1YKFA 1VI5A 2OFXA 3K32A 3CSDA 5EHGA 5GZ6A 2M1XA 3ZHQA 5JXIA 3ESBA 2DULA 1YCHA 1XLTC 3H7IA 4H7DA 5L4NA 3SHWA 2ZUUA 3SJAA 1L7RA 2OC9A 3QXCA 4INZA 2XQJA 3VHQA 2I3BA 5L8VA 3AUXA 3G23A 4HEA6 4JIMA 4KN5A 4B9EA 1S2GA 1JR6A 4YMVA 2LRHA 2HCFA 1B6RA 3JSAA 4TKUA 5F7ZA 5BR7A 1G8KA 4DC1A 1SZCA 1NP7A 1OLOA 3K1ZA 1CUYA 3G2LA 4RM2A 2CKMA 1LBQA 2HA4A 1IM8A 1PJ2A 1QONA 3K2EA 1TFRA 4GZ3A 1ZINA 3C98A 4L9AA 1CJTC 3UKOA 4Z4HA 3G9ZA 4DJ5X 5HMLA 4JK3A 1XU7A 1K7XB 3GNSA 2EW2A 3IDSA 4RY0A 1AHHA 3LO5A 1USKA 2JH8A 3V1LA 4ED9A 2AUNA 4PYJA 3LCVB 3NWJA 4G5SA 3OOSA 3LC2O 2R1VA 3NIBA 1FW8A 4I55F 3I76A 1YKSA 1YFJA 1ELOA 2VTBB 1C3JA 3AK4A 5JWHA 3CX6A 4YIKA 3THWA 4Q9IA 4YQZA 3FZYA 1TYCA 3R7BA 1KYZA 4D3XA 2DR3A 3K1YA 4I08A 2X3FA 4ZU3A 4DZRA 4ZVRA 2VPZA 3Q1KA 1T3ZA 2R00C 4KVGA 4UARA 4HAZA 1Z6QA 4JDUA 821PA 5JAUA 2CUKA 3D1JA 4JI0B 3U3JA 5F3RA 3KB8A 3ONWA 1SQ0A 3WLOA 3I37X 4C5AA 4W8HA 4F5DA 5HM6A 2YN2A 3KXKA 4JLUA 4G67A 1T34A 2JLCA 1CDZA 1ZSYA 1I3OA 3AEKA 1RMYA 2PL9A 4PLGA 1LBTA 3EULA 2HNAA 1JFSA 1E3IA 2ZT8A 3SZRA 1QTQA 3UGKA 2J3KA 3QUTA 4W5JA 3NDPA 2GESA 3U31A 2V1UA 3OFVA 4RGBA 1Z6PA 4GC9A 5AM0A 5JMOA 5FDFA 3K0CC 3Q8WA 3W3AA 2Z3VA 4H0NA 4UOQA 3UAYA 1U81A 3X43A 3PPVA 4A82A 2CUTA 4MRNA 3S0JA 1OBCA 3BMXA 3F90A 4CU2A 3SZGA 4PO1A 4MB0A 3IIMA 1HLDA 1R8SA 4PCAA 2XNHA 4P8RA 3PXGA 4BVBA 3BB3A 1WP9A 2CF5A 1N3LA 2WYOA 4I6EA 4Q15A 1I2CA 3OM9A 1WEKA 1YJ8A 1DCTA 2E4AA 3P9SA 3ZD7A 1D6NA 1UXHA 2F43A 3IVRA 1M2NA 1SO8A 3CPEA 4LHWA 1QLHA 2Q5JA 4RKWA 3ABSB 1Z7BA 3C7KA 2MR6A 4QVGA 5DSXA 1V8PA 1XRSB 2NZVG 3TRFA 3T1VA 6LDHA 2X0RA 2F3RA 4WDRA 2EYUA 2VOJA 3LQ4A 2IPXA 1E89A 4HWGA 5LZ7A 5IJZA 3GWGA 2ZBUA 3LPNA 1G1AA 3WMWA 4DIMA 1E2KA 1TIKA 4B6RA 3EXFB 3FCXA 3DEKA 3PUVA 3TW8A 4WOKA 3HJFA 2GFQA 1QR6A 1EE9A 1DARA 2O4CA 2FR0A 4OA8A 4CEIA 1XQ6A 4JELA 5EJ7A 4X8MA 3GELA 4YDRA 1CD5A 4QEZA 1F4PA 5J5AA 2BUBA 1E9CA 1GZUA 2BSAA 2PUJA 5DP2A 2JGDA 2P0AA 2BGMA 1G3IA 4IDPA 3CBGA 2VHQA 4M98A 4GXQA 1P17A 5L53A 3SR0A 2GCPA 4CKWA 4HK4A 3GLIA 1C80A 4KR7A 1JDNA 3OAAA 5EGNA 4B3BA 3RIMA 4C78A 5KWSA 3RIYA 4V3CA 4YX9A 2VI5A 4W1QA 2BKEA 2R7MA 5FTJA 2PZEA 4R69A 2BJWA 5GGXA 1PTKA 2EZ4A 2GZMA 4KUHA 4F93B 4G36A 4HWTA 3MS7A 2X8BA 4PO8A 1IQ0A 2QTRA 3RYTC 3S44A 3TSZA 4EPVA 4UJ3A 2JGLA 1I7SB 3GLGE 4DBLC 1P62B 5K8TA 1BE6A 1T29A 1TCUA 3HDYA 3S2YA 1QF7A 4LQ4A 4X90A 5EESA 1AZWA 2FZ5A 4ZZ1A 4IFBA 2W71A 2ZYUX 5L51A 4BQNA 1W1UA 4G5GA 3W9UA 5HBGA 4RK6A 5EJ5A 1E1YA 1ND5A 2B5WA 1T2CA 1ZGBA 4NECA 3FCOA 1NXWA 3EWIA 3VAYA 4TYYA 1KQNA 4GYJA 4NBTA 3WNQA 2C29D 3GLQA 1YOVB 4AD8A 3Q0TA 1JDSA 1XCGB 2AXEA 3FR8A 3IEXA 3NNNA 1C9DB 4K88A 4O02B 3H9CA 1J5PA 4EYQA 2HHHB 1DBQA 3NH6A 1PDWA 2ZYDA 1R4ZA 3FA2A 2XD4A 4JLVA 4R1TA 3HFJA 3EIHA 3D7KA 3TPZA 1K92A 1MKYA 1M1YA 4XLTA 4ZVUA 1KK3A 3RYCB 1OFVA 5AM1A 5JZVA 3WJ1A 1ZMOA 4Q4HA 2V7UA 2FK8A 3PLNA 5COQA 2XZDA 4HUJA 4L3VA 1W36B 1VPDA 3EMDA 1C1HA 1SULA 3O38A 4L76A 3KKQA 4NPHA 3ZGOA 4UVGA 4YAEA 2AWNA 4U2CA 1OXSC 4ZJUA 4AU1A 2IE8A 3PVCA 4YRLA 1O08A 3QLUA 2FSSA 3MG9A 2D6FA 3ZWCA 3ZD8A 1FFXB 1ESCA 4KRGA 3WB1A 1PDOA 5FOWA 4EITA 2OP1A 1MG5A 3QMVA 2XQVA 4XVUA 1QFYA 1BU5A 1G8FA 1TM1E 4UVDA 1PG2A 3DOFA 4YRCA 1H6AA 3L79A 5CDFE 3BGOS 2BDUA 3FVTA 2GD6A 5DYTA 1D4FA 2GFIA 2QVXX 2CVFA 3EUAA 1CUIA 3ZCVA 1QGZA 4AVYA 1GYQA 1O6CA 4YROA 1ZI8A 4FDVA 3CW2A 3L6RA 1A8IA 1JAIA 5JMPA 3SZUA 5AKJA 2CLIB 4HFNA 1FTWA 4ZCLA 1J7JA 1U9ZA 3HV2A 1SCIA 2RBKA 3V7WA 1U0SY 3MJEA 5I45A 4M0UA 3RAJA 1JB1A 4Z99A 5DLQC 2VEOA 4GBGA 1VG0B 1XPJA 4LOAA 4OOFA 3LHKA 5FKJA 3LUJA 2ZBEA 1UJ2A 1UBUS 1KMNA 2FR1A 1A71A 3N8DA 3P0RA 4K9PA 4BTLA 4EYEA 1JQEA 1PTJC 1OGIA 4B79A 2VHUA 1DAMA 4P86A 2PGDA 4MEAA 2QPAA 1VG1A 5KTMA 2X4LA 5JJBA 3CCCA 4J0EA 3VHXA 1MXFA 1DG9A 3DKRA 3BM5A 3BMQA 3KHUA 2BR5A 3NOQA 3O4JA 5F7JA 5LZ5A 3ZU2A 1X38A 3EVAA 2W70A 4IQ4A 4IDHA 2WFAA 1E64A 1R6XA 2HHCA 4MGKR 2TS1A 4NATA 3NNSA 3B1KA 3B9RA 3UC5A 3K96A 1Y89A 1G8AA 2D3WA 4G1BA 4MK4A 4B3DA 1NMSA 3TD2A 1WXFA 5FTLA 3S4YA 1S8OA 3Q6NA 3UWDA 3T12A 5FUBA 3SMVA 1KRWA 1VPTA 2I4TA 2ZI7A 4IVNA 1F1BA 2PRYA 3ROFA 1NKTA 5CB0A 1MVNA 1HM5A 2PX2A 3DPSA 3K9BA 1UZUA 4LZWA 2Y05A 1I32A 2AI2A 4I5IA 4AI6A 4OQPA 2VDUE 3MB5A 4LRWA 3AI7A 3ZCRA 4D4IA 2K4MA 4D46A 3MLBA 1WXGA 2DUWA 4CKBA 3NM6B 2ZITA 3RUCA 3LH5A 2QN8A 3NAMA 2RAFA 4PS0A 4XQCA 3RVJA 5KSWB 5FUXA 3UFXA 2QBYB 2Y1LA 2BGRA 2X5OA 1CXZA 3QSYA 2KLBA 4N6NA 3VC7A 1VQ1A 1KU0A 1GA1A 1ZUHA 2IV2X 5KB3A 3HYTA 4D3FA 3IAEA 1P7CA 3N86A 3WL7A 2O14A 5FYDA 2GUWA 5DISB 1P4AA 2PGIA 2CFOA 1QRRA 2G0TA 4HY3A 3UZUA 4BFTA 1QFZA 1PEKE 4BO3A 4E1AA 2JKYA 3QYFA 4IW3B 3K30A 4G8JA 2X76A 2YJ4A 1T6XA 2R7LA 2GHIA 2BAGA 5JQGA 2ISCA 5FHRA 4F45A 1J00A 3GJ7A 2J48A 4X5OA 4RFSB 1TM5E 1GNSA 1DIAA 1V16A 2BCGY 2GCIA 1VKHA 2RGCA 3A36A 4IMPA 4XX0B 4C0BA 2I0FA 3VZRA 4L5YA 2FDCA 5FA8A 2V7WA 3TL3A 2FHPA 4IHAA 4BMOB 4E7PA 3R6WA 1MC8A 1E4VA 3CXUA 1Z88A 4EG6A 1ONSA 1JR3D 4G0QA 1IEWA 1VSUA 1ZBDA 4O5AA 4DPLA 5JMTA 1AKVA 2O20A 1U3VA 3LXXA 5EEHA 5KO2A 3MERA 2X19A 3WYEA 2PHZA 5K2MA 5KTKA 5BUQA 3RU9A 2ZT5A 4CLRB 3OM8A 3U9TA 1HUQA 1Z5UA 4E5MA 3G9XA 1EQAA 4F1KA 4WBXC 4XPZA 1X13A 3T7RA 1JIUA 2JHPA 3U80A 4EVSA 2NPOA 2R7NA 5JJ5A 2I91A 2X0EA 5KYYB 3CISA 4CR8A 1U7UA 3AUFA 3EC7A 3RBZA 4R1PA 2AJDA 3WYAA 3PT9A 5K1ZA 2P75A 2GAFA 2XDQB 3L18A 5MGNA 1OYOA 4IAOA 4WKPA 5F1OA 3WK5A 4C01A 1WKCA 4F4CA 2E18A 4AAYA 2GBIA 4MVCA 3RFFA 3VNRA 4C89A 2FFHA 4REOA 4CKCB 5JDCA 3VVMA 1IEQA 2YIMA 3G8AA 3OP4A 5ALDA 1BW9B 3QMMA 3LWNA 1O6BA 1Y7LA 2CYCA 5K0BA 1ISPA 3DA8A 1QP8A 5CAEB 5CD9A 5EJ6A 4L75A 4X6UA 1I4OA 4HDQB 4KGVA 5AQ1A 2GAAA 5ITSA 2FPMA 1L7XA 1N2CE 1Z4IA 3W2TA 2P6OA 4OJQA 4NBNA 1A98A 4NBUA 1E9RA 2BFNA 4C88A 4BFLA 5BQXA 1E9BA 4NS4A 1EHCA 3PG5A 4BGEA 1GRRA 2FA9A 3X1KA 1SCKA 1XTVA 2JB9A 2HLDD 2V3VA 4BVLA 2R1ZA 4ZHQA 1JH9A 2YOHA 5FR1A 1ZK1A 2UYGA 3CGGA 5B3AA 3CJQA 3VR0A 1X70A 1KAHA 3DD5A 2H3HA 4JJGA 5JAIA 2XT6A 5DGIA 4KJZA 2DLDA 5EP2A 1HE2A 4LF5B 3QPCA 1Z34A 2CDBA 5TXGA 4GBMA 1XTKA 4ZEOA 1ZM7A 3QTLA 4OGKA 2FRDA 4TVBA 4DA0A 4H3VA 3DW1X 5AVWA 1Y8QB 3K9FC 3EH1A 3G1WA 1YDGA 1XVIA 3R3VA 1IBCA 3AZQA 3QWFA 3AXTA 3CINA 4URXR 2XX3A 1FLVA 2WW8A 2WM8A 4BEVA 5IDYA 2G6BA 2XVZA 3REQA 5E0OA 5TLSA 4E15A 1JSZA 3DPUA 5EP3A 4M6WB 4R8VA 4RNCA 2BR4A 5EE3A 4JJZA 3NHUA 1Z2DA 3MWJA 4HRVA 4PXYA 3B3QA 4UMFA 4ARBA 4CMJA 1XRQA 5DWVA 2IELA 3AINA 4PN7A 1EFLA 3EW7A 2A1TS 2QP4A 3S29A 3WHKA 3KU4A 3DNFA 3HJNA 4GMXA 4MUFA 2XYVA 3BFPA 5HGJA 5U1PA 4L8VA 4XB2A 2OCIA 4OMDA 5D86A 4EKIA 4OSOA 3AG6A 1MQ8B 1RMQA 1FYXA 1YQDA 1TK9A 2OZLA 3H84A 3O4FA 4GICA 2R1TB 3REOA 4MW6A 1MJ5A 3HMKA 1IQRA 1ULBA 2H11A 3LDGA 2FRVA 2FPLA 4XRRA 3CFYA 5GV7A 3TW6A 5B53A 3HYCA 3VPAA 1QQBA 3H2ZA 5IAOA 1K66A 4Y6GB 1RKVA 2JAUA 4EENA 3JARB 3UMSA 3KP1A 1TT5A 3A27A 4BNDB 1M6NA 3OKCA 2XCTB 5B7PA 5J1TB 3T3PB 1JQLB 1HT3A 1DIBA 2YYZA 3GG2A 1ABBA 4AZWA 3OQ1A 5JYCA 3NGLA 1I3MA 4E14A 3HN2A 5EKXA 2E3JA 4DLPA 3FSGD 2Q29A 3O8OA 4JXXA 3WK8A 2QJFA 4NONA 1Y1RA 2IYZA 4RW0A 4QKQA 3MS2A 1E6CA 1N9GA 3MT0A 4BVEA 4RHUA 3EBLA 1SEVA 4L4SA 4EFLA 4LPKA 3RTCA 4CM4B 2GA8A 4QQFA 1FP6A 1ILWA 2IP1A 2Y1XA 1ECJA 3LFUA 4OFBA 4CCYB 1YE5A 4JHXA 1PFKA 4IIFA 5BW4A 1UM9B 5BSUA 4ZI5A 4DIDA 2HM7A 5FL3A 3B36A 2JJ2A 4QGFA 5WRFA 3U81A 3WLKX 3U26A 2Z6VA 2W2XA 1U6IA 2E4UA 2HZBA 4GMKA 4E22A 3JQBC 4FPXA 3PITA 4IG4A 1QZTA 3HZHA 2CJFA 2WBLC 1HOXA 1EFVB 3HMQA 1G42A 3D7SA 1DG3A 1GNQA 3CU5A 1SD2A 4NKRA 2HT1A 1FIUA 1PUXA 4W8GA 1GG5A 2R5WA 3EZ7A 3TJZA 1EGAA 1I2BA 1RS0A 2G1KA 1Y4SA 3DBIA 3EGEA 4MI1A 4U1RA 5DX8A 1Q22A 1SN7A 4UM9D 4QU0A 5LQAA 1EJ0A 4JP1A 3DMPA 1KTVA 2B36A 1W49A 3U56A 5DF1A 4BO9A 1SMKA 2J32A 5LUAA 1CS0A 2QYTA 4F11A 4EJSC 3D6FA 2XUIA 2X0JA 5MN6A 3G5LA 1N6KA 3IEPA 3EMBA 1H6CA 2Q27A 4Y2TA 3FGOA 1SUIA 2FMHA 2AYYA 2O8DB 1PGJA 1P4GA 1UOOA 2HDNB 2J3DA 2RGDA 4B7UA 4H18A 2WSLA 3U40A 1AQYA 1C1DB 4HRXA 1DX4A 1PG5A 1W73A 2H63A 2PSHA 2R84A 3A6EA 5DB4A 3ZK9A 3FTQA 1F60A 4CI9A 5JEDA 2FZEA 2V58A 4RACA 5L3ZA 3GRUA 3LQKA 1TLFA 3B1ZA 1HDRA 4UM5A 1FTNA 3H13A 3BK1A 1NR7A 2OXTA 2I9PA 3JAKA 1Q0PA 3PHIA 4FFPA 3R9XB 4RF2A 1JALA 3NWPA 4HZIA 4OL9A 4DKXA 2I6SA 2CEKA 1E2MA 1M83A 1ONNA 1A0OA 1H93A 3AQIA 2DPXA 3U3OA 5KOJB 4OMUA 3LIPA 1L5ZA 1PI3A 1Y6ZA 2GCOB 1NMXA 1NLZA 2JRCA 2OCPA 2R6R1 4GVPA 4YCMA 3ND7A 5JUWA 4HUQA 4DBZA 5HNKA 4P82A 2FVXA 1E7RA 3KB1A 3L7NA 1W44A 2OM2A 1NYLA 1TD9A 2B9EA 2BUCA 1Q7RA 1DT5A 3ACCA 3N2KA 4FGKA 2QMUA 3OLVA 1AKMA 5CFLA 1EFCA 2GDZA 3AHCA 3O8CA 4KZPA 4MYRA 4W7IA 4QPJC 3Q72A 4LYJA 2FE1A 2I7VA 2ZSFA 3PLAE 2EX4A 3LF2A 1XUOA 2PR7A 3I45A 3QE0A 3B5JA 3TL6A 2HCBA 3DCYA 3OUZA 1ZHOA 3OZSA 4O4LF 4WASA 5DX0A 3TCKA 3RAFC 1RLTA 2WDPA 2QW8A 4DQVA 2HMVA 2WHPA 2MSDB 3CNOA 3KKZA 1DKNA 4XEHA 5TS3A 1IK4A 1OTYA 3ND5A 1ZM2A 4RY9A 4QULA 4UU1A 5AH0A 4YPVA 2J9XB 1T9HA 5IXSA 3J81A 3WYBA 1QDUA 2XCSB 1Q0LA 1TQ8A 1ZJ4A 2FEAA 2HRBA 2X1VA 1E32A 3INNA 4ZU6X 3BGIA 1GFZA 4KYTA 1K27A 1JNYA 4G37A 1SURA 1V96A 1II9A 4BEBA 5AW4A 1E2FA 1I7NA 1R2QA 3N0TA 3U3DA 4BVHA 5AVZA 3OTHA 3HLYA 3EAFA 4LRYA 2G40A 3W6ZA 4WW0A 2NZ8A 3LX4A 1SD1A 3IRVA 4FXOA 4OEHA 4A8HA 1JH8A 2GVZC 3O1IC 1U8EA 3VR5D 4NCBA 3GCGA 3DL0A 3HNOA 5HGXA 1H8EA 1RQLA 4N6GA 5IM4F 1QIJA 1VFNA 4IDQA 1Q12A 2ONJA 2XY4A 3E3LA 3O83A 2I7TA 2A5LA 3PUXA 4HXEB 4DA6A 5IUKC 4BNXA 4FHZA 2GX6A 3P2KA 5FWDA 1WCYA 4JASB 3I4LA 4PBSA 4RQBA 1SXJE 4MJ7A 1DAHA 2FJUA 3S1AA 5IZCC 5LDDC 1IVNA 1W47A 1VKRA 2IPLA 3A4VA 1JIXA 5LBUA 2DWOA 4O4LA 4DREA 2PY6A 2OKGA 2P7HA 1FLNA 1TIBA 3I12A 8ATCA 1DTWA 3K9QO 2HRDA 2ATVA 3L07A 4NCKA 5LQCA 5CBPA 4D45A 4TMZA 1KEZA 4YS6A 2X5JO 1O3YA 2GXSA 3QU5A 3HY6A 3NBQA 5AR1A 2ONCA 1BWSA 4PIMA 5HUJA 1JI3A 4MUIA 4OLHA 2H1WA 4XQGA 5CFZA 1LX7A 4JR2A 2ORIA 1RC1A 1TMYA 4G4JA 4TKVB 4PRYA 4R2JA 3VO9A 1N2GA 3R3WA 2PL3A 2AMJA 4CTMA 5TARA 4MQEB 1H9CA 3L1JA 4YBZA 4B3CA 2P0EA 1GZHB 1UMDB 1LPPA 3ASUA 2Q3DA 3FFBA 4G0PA 4HDAA 2FUG6 4X1YB 1RYMA 5FV7A 3ICPA 4B3MB 1M2VB 4LV5B 3OWOA 2AJBA 1ZUNB 4BMPB 4JBWA 4EBBA 3TN7A 5C9ZA 1NIPA 1OXKB 1QV6A 2GS9A 3AOEA 3F7MA 2CNWD 4ND2A 1S7CA 3RHZA 5KNDA 3UANA 4BUJA 1OZHA 3NHZA 1AX9A 2IIVA 1EDEA 2HJRA 4RM3A 5ER6A 1JG7A 2FG5A 3HM9A 3KVRA 2DM6A 2WIJA 1TJ4A 3KXIA 4HX5A 2IZ1A 3EDYA 2FGKA 3SC2A 1ZS9A 4WXEA 1HDYA 1QZUA 3IE1A 1GRQA 2HU7A 3UOAB 4BIMA 1YUNA 5EZYF 1T9CA 1ODKA 5K0CA 4H1VA 2UYYA 4AXXA 3AGPA 4E6EA 2F59A 2QF7A 3QX9A 1PUIA 1EVLA 1QR2A 3ZJ4A 1PGNA 2CSXA 3D7RA 1YFKA 4CMBA 3TQQA 3FYUA 1Z15A 2ZQYA 3LLUA 1HEUA 2HRQA 2WKSA 3M4NA 4MQLA 4QREA 5AO9A 5H59A 3TX6A 2W6MA 5EUCA 5KNBA 5KC8A 2E55A 5JE8A 2ZVPX 4CCAA 2WJ3A 2DG2A 4FR5A 2YDXA 4AO6A 3N75A 2P9TA 5MDHA 1JX6A 1GA6A 3P4UA 3T7AA 5AKXA 3DT9A 3W2GA 4CDNA 4EPTA 5AKKA 1VBKA 2C04A 2FYTA 3OQJA 4ZQGA 2ZYSA 5DZSA 3KPYA 3ISVA 3PGA1 3LQFA 4F1WA 4LFBB 5C31A 2NU8B 1UBMS 1URPA 5AJUA 3BE4A 1SGWA 2QSZA 2DECA 1UFQA 2CYBA 3LF1A 2X58A 3NTVA 3QNWA 5E7QA 4BE4A 3WMFA 2BDTA 2Q8NA 4DUPA 2OPBA 2R7KA 1GP2A 3M4XA 4RH3A 3FKQA 1RWKA 2VRCA 1T36B 1ZYUA 4XM0A 4N7MA 2HA5A 3TIFA 2QRZA 1T6ZA 2BFFB 5D1NA 4AS1A 3CMMA 3R0IA 1ECPA 1UBFA 4PS1A 2VKTA 4Q3AA 4Z86A 3ZZNA 2P65A 5EZYA 1QKKA 2JIQA 4R5HA 1BMDA 1JJAA 3VR4D 2YOFA 5EWLB 1WW8A 1VJ5A 2FPOA 1SC3A 3SZOA 2HRZA 3EY4A 5AXAA 2P9EA 3GB9A 5BUZA 2JGAA 4C0QC 1DIRA 4ENRA 1BH6A 3K0KA 5JCJA 2WHQA 5BR8B 2COKA 4RXTA 1QZ3A 4G5RA 2REQA 4MRRA 1CIPA 5AJWA 4X64B 4NENA 4UBNA 5FLXA 1ZIPA 3EXG1 4K8OA 1YZHA 3RAGA 4GLOA 3ZWDA 3ITNA 3LPDA 4CR6A 1KRHA 5E2IA 3X0DA 3DV0A 5KX5B 3JAWB 3L6CA 4BLUA 2FFBA 721PA 2VPYA 1DQSA 1PX2A 5FEUA 3AV0B 2CLFB 4N0QA 2ATCA 2R1UA 4ZEMA 1F7VA 3K5WA 3DAPA 2RHLA 1E7QA 3N53A 3OJOA 4LIPD 1NY6A 1IHDA 1RQPA 4PINA 3RK0A 5BO5A 4H0CA 4MTLA 4E2XA 2GPYA 2GT1A 1DFGA 4B34A 3PEUA 3QGMA 1EGHA 2P62A 1UFOA 2I4OA 1N7JA 1CEQA 2Y1GA 1SR8A 3KR0A 4MOWA 2PBFA 4MRVA 4PRZA 4DANA 4DQXA 3PFBA 4X97A 5K0GA 4LGMA 2WYVA 1QK4A 3IPAA 4MVJD 4WZ6A 3DLAA 5IC6A 1HLGA 3RT9A 4BO2A 3GY0A 1AZTA 1MPXA 5CNKA 3TLBA 3U0BA 4B5KA 2ZM5A 3WLFA 1G20A 4ESEA 1ZH6A 2XNJA 3UUFA 2J09A 1E1QA 2YCBA 5FIUA 2W2KA 3VU3A 1P2VA 2I33A 4WE3A 2UXBB 4NCHA 3TMKA 3UK7A 2ACWA 4HH1A 4Y98A 2N46A 4E08A 1KZYC 1U5BA 3KAKA 4FFOA 4OHUA 1UC4B 3SE7A 5JZOA 3QE2A 1K6EA 4PWZA 2HA0A 1ISHA 5TY0A 1QPBA 1DAFA 1H2RS 1I5OA 3F97A 3GJ3A 2FFAA 4DLRA 1YA4A 1DFIA 3VNUA 2UZ3A 5AM3A 4PVCA 4DT1B 4YRIA 1GPLA 1QH1A 4Z8YA 2F3PA 1DRVA 2BOVA 2GEDA 4MV8A 1O94A 2FB9A 2FLVA 3PDIB 4IGIA 4R81A 4LMRA 3VC2A 2B82A 3CEAA 3WIDA 4A0SA 4W5QA 1U0JA 1NT2A 3I04M 3VSAA 4CNBA 2N0SA 3E1SA 4R8KA 4MKHA 2OQIA 4BGDA 1L6IA 3CIOA 1X1QA 2Q6KA 2PS9A 2YXPX 3L5OA 2V55B 4S1TA 2F55A 1SCJA 1KSGA 4NV0A 4OG2A 5I8ZA 5DGCA 2OECA 5K3EA 1NBAA 1UINA 5EE1A 4DRXA 3SX0A 1VHTA 4KAAA 4M83A 4AZ3B 2AC2A 2AZXA 3NP7A 1EXDA 2FGJA 3I3OA 4P7FA 4QJ5A 3W3ZB 1ACJA 2A9JA 3PEYA 1S8NA 3OECA 4MVJG 3QEOA 4JLBA 1KY5A 1US8A 1P1JA 3E7WA 7REQB 1TUIA 4L8GA 1G9SA 4PZPA 3CLVA 3UW3A 1PZGA 1Z5ZA 3V4FA 5L7WA 3INRA 1X9GA 3C43A 5KYXB 4BU1A 3KWJA 4PQEA 4ZOCA 5JISA 1XCLA 1M5RA 1GLVA 1SK9A 5CFQA 1Z29A 2EKLA 1BYIA 3GPBA 4DPMA 2W7TA 5M29A 4MVJE 2GBLC 3FNGA 3QFCA 3U4QA 5KYNA 3KWLA 1UOEA 4OQQA 1E3QA 4F7WA 4B45A 1XT6A 4Q3LA 1GM5A 3CUYA 3N7AA 2R96A 2XGGA 4OLBA 4LE2A 2E4ZA 5ENDA 3K6JA 3AWIA 4NE2A 3PC3A 4Q4DA 4XIIA 2HKIA 2I1QA 1OLXB 3G2IA 4Z9AA 1FU4A 2A0KA 3EQZA 5C18A 5HM8A 1N92A 5FWXA 2CB0A 5MGBA 2J9ZB 2JGKA 4GKKB 3DJFA 1QHHA 4G1CA 3OT4A 2UXCB 2GKOA 3KLMX 1MNAA 5JD5A 2O7VA 3K73O 1YBAA 4HRYA 4TTQA 2DQSA 4LX8A 3PT5A 1O96A 3RYHB 1GV0A 2C54A 4MRMA 2WIGA 5IP5A 4ZI7B 3GCDA 3DE6X 1LDGA 3I0NA 4DLWA 3PIRA 5KJFA 1FF9A 2L18A 3OESA 1W1WA 5M2QA 4HAVA 2D0DA 1L5FA 3BERA 2I65A 1S8AA 2WM3A 4UNPA 1KFJB 3T9CA 1WAMA 1UEJA 1T0BA 1A1SA 3A1CA 2CXPA 4X3CA 2X5XA 1XZMA 1MIOA 5FPKA 1QGED 2Y3IA 3LRXA 1RTKA 4IRUB 4N9QA 1I6MA 3NXKA 4YWHA 2ACEA 2O50A 3IP9A 3PIIA 4PZZA 1ZONA 4K6OA 1QHSA 3JQ7A 3W5DA 1A7JA 3GNTA 2WVHA 3JQDA 5CYGA 3B7PA 3CRMA 2W6JD 3MD9A 4A4DA 2PS3A 1UMKA 2WT8A 2JD2A 2VA8A 5HRCA 3LY9A 2ZXUA 2XMZA 4BU0A 2RAUA 2O1EA 4MTCA 2Z9CA 2QNIA 4P81A 4DMMA 2NLOA 1EVKA 4OHVA 5JSUA 3ZJUA 4ZZ2A 2AOVA 4RZIA 1CZNA 1DDOA 4L78A 3T95A 2H7CA 5FL7A 5H70A 4EGSA 1ULTA 3DGEC 5CNJA 2D8MA 1Z06A 5JNWA 5CVDA 1V37A 3HCAA 4OIMA 4A8JC 5DM60 4TMKA 4X92A 4DIKA 4ZYUA 1Q0QA 4MXDA 3BGSA 2XWQA 5TF0A 2WWHA 3JWPA 3Q11A 4DQ0A 1D9ZA 3L4SO 3T15A 2ASVA 3HVRA 2XNKA 4AY4A 4UTNA 9LDTA 4KODA 4POAA 4LF9B 2BKAA 3JZDA 2CVZA 2ERYA 3F1LA 5I8PA 2IYUA 3MF4A 2EJVA 4RD2A 5IBPA 2B0CA 2ZJAA 4J2OA 3SGLA 5LDHA 1Z6XA 3OIDA 3TI9A 1ZUWA 9ABPA 1DX9A 4K9OA 1RXYA 2QLLA 4UBJA 4BIIA 2PWBA 3DWGA 5JD3A 4ATNA 3UPTA 1A5BB 2PR2A 2ZBPA 5BSWA 3WDLA 3RFCA 2HNBA 5AD1A 2VHWA 2C2KA 4FZVA 3ZBUA 4OY3A 1JEQA 1EJ6A 4NJMA 1AKUA 5A4MS 2VT6A 5JBIA 5TDHA 2Z9BA 4EY5A 3QVJA 4DTCA 3WLLA 13PKA 3ITDA 1PHPA 1B74A 2P2YA 3QV2A 3ZDCA 2JCBA 3EXAA 2P4UA 5ARCA 4EPRA 1Q3HA 1O9GA 3WL4A 1XWIA 2P4EA 2HIMA 2XDAA 3ETDA 4P4GA 1X1BA 3PFGA 4ID3A 4YMSA 3IP3A 1CIJA 4KQFA 3NTLA 1FFBA 5DCLA 3ZU4A 4UZFA 1YHZA 3B2NA 1MW8X 1SQ5A 2FI1A 3GU3A 1P8JA 5LJIA 4G8BA 5KTRA 1KVSA 3D5TA 5FWAA 1Q1NA 1GRVA 5M3BA 1RQXA 1J5XA 2ODEA 1N2BA 3L8FA 2JGMA 3AYXB 5EWJB 4LDPA 1K97A 2I1WA 3EF3A 2PV0A 3I6MA 4LYHA 4QFCA 5KUTA 1A2KC 1XRJA 4JYBA 3H97A 4YHHB 1S1MA 1F3LA 3O8QB 2AW5A 3O3MB 1KL7A 4URFA 3TVYA 4C2UA 2ACKA 3C7TA 3S2EA 2FWNA 1Q83A 4CEHA 3EGIA 3PFIA 4PHHA 3QPUA 1IL0A 4DCSA 2FP4A 2PX0A 2ZAIA 1TT7A 1H2ZA 5U9CA 5JFTA 1AGXA 2FKAA 2XTZA 4GECA 1GGKA 2ZIEA 4A6XA 2AW3A 3DFIA 1SHLA 1HOTA 2J4CA 4ALNA 3U1BA 4C4TA 3GLHB 3X1MA 2O0LA 3HVIA 4CLOB 2GPBA 4JFAA 3FKJA 3WIUA 4LZNA 5ELMA 1CBUA 1GG9A 3N8GA 2SICE 4DR7B 1M1NB 4QVKA 5DE3A 3KUDA 1NZDA 2OHVA 4TSFD 3SS7X 1VHLA 3IC5A 1NSYA 4JT4A 2M9MA 2ONYA 3IQIX 3O8DA 4TQAA 3LD9A 3NZEA 4QX6A 4MUEA 5JS6A 1PE0A 1ODIA 1Y48E 2EIHA 3FDZA 1K06A 1RLUA 1GARA 3ISJA 4U3JA 3K0AB 2I03A 1ZK4A 2VSFA 5CB4F 1R6DA 2IQ5A 3HN7A 1DWPA 2P90A 3S68A 4CIWA 5ITZA 1WPGA 1XCJA 1NI3A 2VJOA 2W8ZA 1P5RA 1JKJA 3DMTA 4FX5A 2YNMA 1O77A 2JI9A 1TW2A 5JDCC 4BNYA 5BW5A 5JO0A 2ZCJA 3JALB 1DWQA 3MHPA 1U2GA 1FS5A 3TTXA 5LLDA 2W98A 4D0NA 4W5NA 1UBGA 1O54A 3D64A 3ITEA 4FB5A 1HLPA 1BOOA 1CG6A 1Z6ZA 4FZ3A 2FSIA 2R751 4PSKA 4Y1GA 3ZQUA 4UMDA 3I0ZA 1XZPA 2ZDQA 3DDNA 3EZXA 2PGOA 4OHCA 4NG4A 4UNNA 1YQXA 5DM4A 3SEAA 3L8CA 1RIIA 2UU9B 1H66A 3Q3VA 1OWLA 2JBAB 1XD8A 3IQZA 3N7UA 2FQ1A 3MM4A 4PLFA 4XDZA 1YMQA 4QXRA 4EEKA 1D0IA 1KSJA 2H1HA 3KLBA 5DHPA 1YRAA 3CN7A 2DBVO 4JBIA 1ZEMA 1S3IA 3RVRA 4WZAE 1RWOA 3OCZA 3ONDA 4LXUA 5DN9A 4LF8B 1ZW6A 3CNEA 1AF7A 1PJBA 3NQ41 3T0IA 2BKXA 1F0KA 1GAEO 2A3NA 4HTAA 4ZVOA 2WF8A 1X8LA 1W5FA 2B21A 2E5FA 2H1RA 4I3GA 4RGQA 1TM7E 3WQHA 4KGDA 2BT4A 1VJDA 4P84A 3N28A 1SHKA 2AIRA 2BW0A 3BZWA 3IVGA 5CB4A 1EA5A 1E9SA 5SY9A 2IKQA 4N82A 1IWPB 1B0PA 2V6JA 1TO2E 3VA7A 1XP5A 3ZVRA 3ELBA 2CXSA 3FCEA 4XJVA 1N6IA 1KI2A 3CF6R 3EZYA 5HCIA 3PHHA 3U44B 4WNYA 3ROPA 1A95A 1P73A 3IAHA 3GT4A 3ZYZA 2ZRKA 3S6JA 1JQ5A 1U1CA 2C07A 4G4SO 3WQSB 2WFLA 2ZAGA 3N0WA 3N2NA 1L1QA 3FUWA 3UMRA 5KPJA 4YMWA 3CF4A 3E3NA 2FZVA 1NX6A 3HM2A 4QOHA 1ZD5A 1XYGA 4WZBE 1IZZA 3AILA 4Y1EA 3W04A 2C8LA 2WD8A 3D6MA 3DCIA 3E8MA 1X42A 2G06A 4QNMA 2RFLA 1JS1X 3I01A 4ASUA 4EFKA 2IRWA 1V8ZA 4EB8A 1EB9A 1S8FA 2H1SA 4P92A 3RQSA 5EJEA 5F73A 4U7FA 5PGMA 1E9AA 2IPNA 4JBYA 1E3TA 5A03A 4DCPA 4CN8A 4O4HF 4JBXA 3I2IA 3OLCX 3GA0A 4G25A 3VR2A 4EKYA 5IF3A 2P0YA 3DKVA 2V5UA 3EFOA 2FW0A 3L7MA 3P96A 4IFTA 4ETIA 2HIAA 4PLWA 4LYEA 3ZKWB 1B6GA 1RM3A 2PTHA 3VDQA 3ZHSA 1LDYA 2NO4A 4EKNB 4C7OB 1OA1A 1LK5A 3O0DA 1ULSA 2MYUA 3R0JA 3L06A 4U2KA 4NNPA 3WDMA 4BNMA 4A6EA 4LBWA 4IJKA 4X20B 3ZLVA 3UMYA 3HYLA 1XTJA 1HQCA 2GTHA 3ASYA 2V0NA 1H9AA 4XPIA 4B2LA 5B64A 1THZA 2W42A 1E2BA 2YWFA 2OHXA 4JYMA 5CT4A 1FUIA 5L3QB 1XVUA 4U8HA 1WEHA 2JIZA 5CJJA 3TI7A 3WXMA 3PTZA 3COZA 4GX2A 4QFMA 3B1WA 1SVLA 1XJ5A 3EJWA 1E94E 3H75A 4DC9A 2I4RA 4G1MB 1OX6A 1XX6A 4I3FA 4XWGA 5IHPA 3DDUA 2NM0A 4DV6B 2JLVA 3N59A 4IVRA 4L8YA 3GBVA 4IDNA 3UUEA 4IH9A 4QHYA 5B36A 3MJTA 3Q4GA 4Z0TA 1AKTA 5IM5A 4F6RA 3HSSA 1ZOIA 1ZH4A 1JTVA 3LO8A 3LA8A 3CJRA 4K3VA 4B3HA 3T3DA 2IYSA 4O4HA 1JXQA 2QQ5A 5CTAA 3Q3CA 3IKTA 3K0HA 1RFLA 2RG7A 3QPVA 5AJXA 1W35A 4BQEA 4BKRA 1IQPA 1F6BA 1U28C 2J9YB 2NO6A 2F6RA 3KB2A 2D06A 1CEYA 1F4VA 2VZEA 5BW6B 2UVDA 3QX8A 3SQDA 4F84A 9ATCA 4YRJA 1ADJA 3L8MA 5EIOA 1IAQA 3IRUA 2RBEA 2PU7A 5DIZA 3TK1A 5SV2A 1IE3A 5ALWA 3RU3A 1OI7A 1DU4A 1JXOA 1Q1QA 4LJ5A 3K8YA 2VYND 1JKFA 4LI3X 3T7IA 2AA3A 4TV8B 2X9LA 4TLLB 2ZJBA 2WU8A 2FN7A 2RHJA 5D00A 1CRQA 1SVSA 1WTAA 1TQ6A 1XDSA 1EYZA 3T52A 1R3UA 3AF5A 5H9WA 4JJFA 4MH0R 1XEWY 4O3MA 1Z8FA 3R5SA 1UKYA 1P7ZA 4HN9A 2JFNA 3VXKA 5A4IS 4KDEA 5HFNA 1LRKA 3MRTA 1EFAA 3AUYA 4HG2A 4OHRA 4PCUA 4JVMA 3EXHB 1LRLA 3FPGA 3HUTA 4P36A 4HDRB 3UVEA 4WJLA 1JB9A 2HSGA 3AUKA 4QQ8A 4PC1A 2YY7A 1ZK3A 2JC3A 3PZBA 4NZYA 1GQFA 2OUKA 3KAQA 2HJVA 1M6HA 3V55A 3P2EA 3VDMA 3VH2A 4TTPA 1SCQA 3BFVA 4EYGA 5AI5A 2V03A 1L8OA 2BN4A 5I5GA 2KW5A 4O2BA 2HZ7A 4HO1X 1DBIA 3ZW9A 1C7QA 1W5EA 1KOJA 3ZIUA 1L7PA 1LPBB 2FUCA 3MK31 4NZ9A 4UE6A 5K8UA 3DVQX 4UVIA 3RODA 2PXCA 1NN1A 3H2JA 2YWRA 2CVHA 2QYSA 4LJSA 4B47A 1V1RA 5B6IA 2F48A 2VXBA 3DSRA 2YQZA 4UUQA 1EAMA 5C1OA 1RJFA 1XOIA 2DQKA 2XQFA 4M7OA 2V6MA 5EZ5A 5BSTA 3WS7A 2I55A 1