5JPCA

Joint x-ray/neutron structure of mtan complex with formycin a
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
229
structure length
229
Chain Sequence
QKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neutron structures of the Helicobacter pylori 5'-methylthioadenosine nucleosidase highlight proton sharing and protonation states.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
molecule keywords Aminodeoxyfutalosine nucleosidase
total genus 79
structure length 229
sequence length 229
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jpcA00
1TGYA 1K27A 1A9PA 1PWYE 1I80A 4F2WA 5IFKA 4NY1A 2HN9A 4DARA 3IOMA 1V41E 3C74A 1Z5NA 1Y6QA 3BJEA 4QEZA 3FAZA 4YMLA 5ETJA 4OGLA 1Y6RA 1TGVA 1U1CA 4ECEA 3UT6A 1Z5PA 1PR4A 1V2HE 2RJ3A 5EUBA 3OPVA 3F8WA 4MCHA 4JWTA 4TTAA 2QPLA 1T8RA 3DDOA 2A0WA 1PR2A 3OZDA 1K3FA 5F76A 1G2OA 1RXSA 3NBQA 1U1EA 1SJ9A 2A0XA 5F7ZA 2XRFA 1RXYA 1RR6A 3E0QA 4F2PA 3BL6A 2QTGA 4L5AA 3OZEA 4WKPA 1OU4A 4EB8A 1VHWA 1YR3A 2OC4A 3EUFA 4NSNA 3UAZA 2BSXA 4G41A 3FUCA 3P0EA 2A8YA 2OECA 4PR3A 4LZWA 3INYA 4TXMA 4BN0A 4P54A 1ZL2A 1OTYA 4YJKA 1B8OA 1VMKA 1OUMA 1QE5A 5B7QA 5B7GA 4GMHA 3OZBA 4H1TA 1YRYE 4R2XA 4TXJA 3D1VA 4TYMA 1PK7A 4G89A 3MMSA 3P0FA 1ODIA 2Q7OE 2QTTA 3OF3A 4GLFA 3KU4A 1YQQA 1N3IA 2QSUA 3TL6A 4JP5A 1TD1A 4TXNA 4DA8A 3OCCA 1Z35A 1JDUA 1Y1QA 1Z39A 4X24A 3MB8A 3OOEA 1A9TA 4TS3A 1Y1SA 1Q1GA 1SD2A 3UAVA 1PR1A 1OTXA 1PR0A 4RJ2A 4L5YA 5F77A 5F7OA 3E9RA 1M73E 1JE1A 4TS9A 3UAXA 4F1WA 4BMZA 4QASA 5JPCA 1ODLA 3PNSA 1JDVA 1JDTA 4GLJA 4QFBA 3QPBA 4OJTA 4L0MA 5EFOA 4BMYA 2HRDA 4R31A 1C3XA 1A9SA 3K8OE 2H8GA 4IP0A 4M1EA 4LNHA 1T8YA 4QARA 4OEHA 2ISCA 3UAWA 3OOHA 4D8YA 3FNQA 3K8QA 2A0YA 3FOWA 1A9RA 4EARA 1VFNA 5IU6A 3NM4A 5CXSA 4D9HA 1CB0A 1PBNA 3IEXA 5F7XA 1A9QA 1JDZA 4KN5A 3PHCA 4R2WA 1NC3A 4QATA 1RSZA 4L6IA 3DF9A 4DABA 1JP7A 2I4TA 4E1VA 4TTIA 3ENZA 2OC9A 3KVVA 1NW4A 1NC1A 4DA0A 4M7WA 5F7JA 3KVYA 1PK9A 1VHJA 4LNAA 4MARA 1OV6A 1TCUA 5B7NA 3DPSA 1V4NA 1PR6A 3ONVA 3PNPA 4WKOA 1Z37A 3LBAA 1CG6A 4LDNA 1RCTE 3EEIA 3OZCA 2IQ5A 4QAQA 1V45E 3O6VA 4DA6A 1SQ6A 3E9ZA 2B94A 4DA7A 5KB3A 4GKAA 5CYGA 1T8WA 1PR5A 3T94A 3ODGA 4L5CA 2PGAA 2AC7A 3KUKA 4F3CA 1Z34A 1K9SA 5I3CA 4M3NA 2AI2A 1A69A 2QDKA 3KVRA 1Z5OA 3SCZA 1FXUA 4OGKA 4DAOA 5B7PA 3NM5A 1B8NA 2HWUA 4D8XA 1A9OA 1SD1A 1LV8A 1ULAA 4D8VA 1YBFA 2AI3A 4WKBA 4OY3A 4FFSA 5EPUA 3LGSA 1JPVA 4BMXA 1YQUA 1ECPA 1U1FA 1RFGE 5CCEA 1ULBA 4DAEA 4PNPA 4G8JA 1LVUA 5CCDA 3BGSA 1Y1TA 1JDSA 3DP9A 4OF4A 3UAYA 4K6OA 3PHBE 4TTJA 1Z38A 2P4SA 5F78A 3LA8A 5F73A 4TXHA 1PF7E 4U2KA 5C80A 1RT9A 3KHSA 3NM6B 2ON6A 5CYFA 3O4VA 1PKEA 4JOSA 3DJFA 1T8SA 1RXCA 1RXUA 4MCIA 4WKNA 5DK6A 1Y1RA 4YO8A 4D98A 1Z33A 1ZOSA 1PW7A 1OVGA 5CXQA 1U1GA 4F3KA 2AI1A 4DANA 1XE3A 3EUEA 5FAKA 1JYSA 4NS1A 4TXLA 1Z36A 1RYZA 3GB9A 2I8AA 1U1DA 3FB1A 4LKRA 1V48A 1WTAA 5K1ZA 1TCVA 4UC0A 1JE0A 3BSFA 3GGSA 1T0UA 1LX7A 4I2VA 3U40A 1ODKA 3EMVA 4WKCA 1ODJA 1V3QE 3FWPA 4YNBA 2HSWA 2GUWA 2OXFA
chains in the Genus database with same CATH superfamily
1AIPA 4NHOA 3U56A 1FFCA 1Z0DA 2YJ3A 3D0OA 4KWTA 3TQHA 3QLVA 3L6OO 4JELA 4AS3A 3A4TA 5KZMB 2PQ0A 1HDRA 3REFA 2Q6VA 3AY0A 1AMUA 3O7WA 1TAUA 4G5OA 2HGSA 4HB0A 4OHZA 3IOMA 8OHMA 2B5VA 2NVBA 1V3UA 3N7TA 2AEMA 2OCDA 4FYYA 5FI3A 4DIMA 3PL5A 2OCBA 4G0QA 4HQNA 2A5JA 3UWDA 1ZM2A 1E3JA 1EGAA 2EKBA 1RHJA 2VHVA 2ZTUA 4J1SA 4G0WA 2C83A 4JUIA 3O38A 1DRKA 3B7PA 1C1DA 1RHMA 1Y6RA 3LBHA 3HVKA 3RW9A 5J43A 4D25A 1JIQA 1JNYA 1YSCA 4HUTA 1OVMA 2BELA 1GTL1 2ISSD 3GUUA 4U63A 2DE0X 4XUEA 1QH1A 4HB4A 4CIXA 1WY5A 1XZKA 2QU8A 5A5VA 5CGQB 3RAJA 3OIUA 4U39A 4KIJA 1F9EA 2Z4RA 4UVEA 2AE1A 2QT1A 3HNRA 3W7VA 2HR1A 5EJ4A 3AF1A 2VT7A 4QYXA 5LFAA 4BB5A 1WMEA 1OFTA 1NF2A 1N0UA 1OXTA 1U65A 1X6VA 3NIBA 3RTCA 2X7XA 1K6MA 4ZCMA 4KR7A 2HJWA 5CFLA 1TAHA 2UZ3A 3K9NA 3DW1X 3MLEA 3N0RA 1GXSA 2ENUA 4B7UA 1H5QA 4LOLA 4URWR 2LNDA 3OZDA 1TL7C 3D7KA 1VGVA 4FE3A 4NZNA 4C20A 2KYRA 2PE5A 1CY4A 1GAXA 4XGRA 4F6RB 4IOJA 3D43A 2D8MA 4E5MA 4BRSA 1JKIA 1QRDA 1X7ZA 1RXSA 4GQIA 1W0JD 2YYYA 1J20A 4G36A 3NBQA 1A2QA 1GKKA 2GHTA 5BNTA 1M6YA 1NM5A 4MYUA 2YWJA 1FFGA 2VK4A 4TZ0A 3KJIA 4EITA 2IF2A 2WF6A 1K5HA 3OC0A 3VUEA 1QQAA 2JLAA 3E0QA 2X0JA 1CJBA 4OFWA 3EG9A 4B48A 1X8JA 1TCBA 2WYOA 2IHNA 3K8ZA 3HBNA 4DRXB 1ST2A 2FQXA 2VZLA 2RI6A 5LQKA 1LFAA 1T2UA 2LIVA 2Y71A 1M9NA 3PEYA 4XWOA 4CV0A 3HYRA 1X1AA 2WFLB 3AERB 4QVGA 2XNCA 2IHKA 3DEIA 4EGFA 3EAGA 5DGXA 1MIOB 1R0KA 3GEHA 2QTLA 4WOKA 3EXEB 2Y0PA 4J9UE 4QGBA 3DD5A 3FWHA 2RSLA 2EEPA 2QOEA 3AR6A 3QFCA 1GEEA 4KXLA 1N5JA 4B7XA 4B3TB 3H05A 3K4PA 2YS6A 1ZQ9A 3INYA 4BN0A 4H7KA 2F3PA 4KZPA 4CL3A 3K92A 1KY3A 3V7FA 4EGSA 5K0GA 1KO7A 4YJKA 2EARA 1DAKA 1GUDA 3I9LA 3LDFA 3QMVA 1V39A 3KYIB 1YR2A 4KAJA 3I9V1 1C2YA 1RCFA 3TJZA 5FBKA 4US2R 4MR7B 4GP9A 4DRYA 3FDFA 5CDYA 2FEPA 1TQ2A 2P5YA 1ZJ4A 1PR3A 4GVPA 1E3SA 1Z6PA 4LX0A 4Z3KA 2F3UA 2BI8A 2VTDA 1KMHA 1ZD9A 2D2FA 1WBBA 1IZ0A 5FWDA 3WNZA 4ZCQA 1KZ4A 3JSAA 3BIWA 3G0OA 1WKCA 1R50A 3ESRA 3IIIA 5ED0A 3TBFA 2AG1A 4PO9A 2JIMA 2OP0A 1RHQA 5D87A 3V1TC 2O8FA 2ZAOA 3CXUA 4HZUA 4MULA 5CJPA 3C8HA 5JJKA 1KSJA 1JIJA 4WDQA 2HU5A 1GT91 1O77A 1MMFB 2W6JA 3SR0A 1PZNA 4IGFA 3RVOA 4P2GA 4S3MA 3OQPA 2AJDA 3D3NA 3N2NA 3CE9A 3K1JA 4NHEA 1JA1A 2V4UA 4Q4HB 2G06A 3UT5A 4BV2A 4CG1A 5BUCA 4WT7A 2HHJA 2AZDA 3HJAA 3CUSA 1GPMA 2E6KA 2B8EA 3LYUA 1I7PA 5CAEB 4WXRA 1TKRA 5DXJA 4TXNA 4DA8A 4EY7A 1I3LA 5LVAA 3WJ1A 3HK2A 4IBOA 4L85A 1N57A 1RYMA 2C58A 4BNJA 1ZHFA 3VTKA 4D0SA 1NVWQ 3VHLB 1SVLA 3SYNA 4B6EA 3U0BA 2HA7A 4IX9A 1F2TA 1M1YA 1AS2A 1SXGA 4Q9NA 1JT9A 1Z47A 3ZQJA 4IUYA 4QREA 1JVSA 1JAIA 2R7NA 3AR3A 3OLXA 1ISIA 1E6MA 5ERYA 3VSBA 3K6SA 1EX9A 4J8PA 1U5BA 3CEJA 4M1QA 1BO6A 4W9NA 2Q3MA 3KSMA 3L02A 1KZ9A 2JAUA 3RUFA 1GQQA 2JA2A 2XMPA 3L1JA 3UAVA 2IY9A 4BAZA 4DWOA 1VSUA 2WVJA 2XVYA 3TZCA 3T5DA 5JLJA 2Q2WA 3IPLA 4PAOA 3LFTA 2ZRAA 3M0EA 4JI3B 3T41A 2VF5X 2VRCD 1VE5A 3BQ9A 4JT9A 1GVNB 4FJ2A 4R0NA 1OWNA 2GNOA 1YACA 3BG5A 1KYVA 2CLKB 1XR3A 2IYVA 2DX7A 5IMSA 3N87A 2D4HA 1J0EA 2ZJFA 3GEGA 2YDYA 3PNQA 1L5HA 1CU1A 3UK2A 1L5RA 5BQ3A 3LM8A 1TZBA 1JDTA 3MELA 4FMDF 1XBTA 5BVGB 1P1FA 1IAVA 2UXDB 3E8MA 2FF7A 4LVNA 5JH7B 1UINA 4LV8B 4O4HA 4MTLA 2HZ7A 3NKVA 2NO7A 1QUFA 2BCEA 2VJMA 5IH7A 5H8WA 4GYJA 3LRXA 4L8YA 4QJ3A 1A71A 1C8VB 1R64A 5DYYA 5EXSA 4BMNA 3DW3X 4RIHA 4WN9A 3QNMA 1IBSA 2VVTA 4RXMA 1XPOA 3V46A 3HWX1 3UJBA 4R0MA 3I6MA 5KVQA 4UDYX 2W4MA 2P5TB 2GZMA 3MCAA 2PKEA 2B9VA 3EC2A 4HVTA 4EM6A 1QO0D 2XE7A 2VQFB 4MVJD 4Q7KA 1LK7A 3IQZA 3G8AA 3E6AA 1QFJA 2CGEA 2Q5JA 2Q1SA 4HAIA 3U3XA 4DE5A 1GV1A 3AL3A 2JB9A 3CZQA 4DLAA 1HNWB 2XQFA 4RABA 2N42A 4Q4JA 1GOTA 3HH8A 4CM1A 4YRNA 1TJ3A 4K3UA 2FEXA 4KFTA 5D3QA 5EKTA 3WWPA 2PAAA 2DRIA 5AWFC 1VBFA 4BX0A 2ZR9A 6REQA 1N6OA 2JFBA 2XKJE 3TECE 3DZ8A 2OYCA 4Q21A 1GLNA 5J40A 2HMVA 1SOVA 2ZIXA 3B1KA 5A2GA 2QU7A 3LMKA 4DZRA 2G88A 5AK6A 4FS3A 2VT6A 1ZXXA 5BYKA 1SKYE 2QAGC 3JAWA 4TLCA 4IFBA 4ZQFA 4YRDA 1T26A 4Y9UA 3I76A 3BQNB 3QLEA 1ZOLA 1WB5A 3NM4A 1SUBA 2CL6X 4Q3DA 3JYPA 4FOPA 1VKRA 4I1VA 4LDZA 5CMLA 5ESRA 4DOMA 4PG7A 2I71A 1JSXA 2C5GA 1QOPB 4YRFA 5A6VA 3TCKA 5JZOA 2X8AA 1NC3A 1BMFD 3H5TA 4Y7DA 1T8PA 4RV9A 4RCVA 4UQLA 3QU5A 1C2TA 2VAPA 3A6LA 3DXYA 3GD7A 4ROSA 2VHZA 4U5XA 1KYQA 2DPLA 3GIDA 3AM5A 2QZSA 3RBZA 5KYUB 4C5BA 2Z58A 2CMDA 3PQCA 4GR5A 3CZPA 3IEPA 1ZN8A 3ETEA 2I54A 1QH8A 1YASA 4AJ9A 4IRUB 3I64A 3ERCA 5KS2A 3WLRA 3EWSA 1Y8AA 2F1JA 4INJA 4QNRA 2OYRA 1CLUA 4KBFA 3DL4A 4I6JA 1TYCA 5DK4A 5ALKA 2KQUA 1AKNA 2NSJA 4GVXA 2H54A 4G24A 1NJSA 3EUWA 4HFNA 4Y6PA 2JCSA 3L0CA 3QKRB 5BSUA 4NR0A 2O57A 1K5GA 2P3QA 1R9GA 3DFZA 1QBKC 4P7GA 2B78A 4ZRMA 2Q5EA 1VBMA 1XD9A 1V8DA 2ZSIA 1CG6A 2QQEA 3P4UA 1N2OA 2IY8A 3BMCB 3A11A 4QYSA 3E81A 2AQIA 2X8JA 3IMCA 3AQIA 3ON5A 1E2EA 4MPJA 4X1KB 5J2TF 3WIDA 1VMAA 1WP9A 3TD9A 3G8BA 1Y80A 3ETJA 3OE1A 4EB0A 2YQ5A 1C3VA 3HGQA 4GSKA 4CM9A 3ZBQA 4FFLA 3PC8A 2O2IA 2PJUA 1RADA 3H1EA 4FLFA 4PZPA 4PXAA 5F3WB 1E63A 1JRLA 3IDOA 5JSZB 4N54A 4NECA 1WZIA 3DVRX 4KH0A 1HT3A 2ZI3A 5GM1A 4NEQA 4YFYA 3SI7A 2PMDA 2I6UA 1P3JA 3IV7A 1N9ZA 5IM4F 1H42A 3FCOA 1CLEA 4RZIA 3GNQA 2JD1A 4N7RA 2HEGA 4JYPA 5I45A 1ONSA 2XQIA 2Y4OA 5A5EA 1PD1A 3LK7A 5I3CA 1XVTA 1T6ZA 4ARUA 1RZUA 2GLTA 1T34A 1QRSA 3BTSA 2AMYA 2CNLA 4ZDIA 1SELA 4CF3A 1OAAA 4PLZA 3X2FA 1FTYA 1E94E 1PJBA 1W75A 3TTYA 1ZDMA 3V32A 1XF9A 1YC2A 3AF2A 4L4XA 1BGVA 1JFVA 1ZUHA 4WK6A 5A4IS 1RAHA 3WGYA 1NNUA 2YVUA 3VPAA 4PGHA 3V7WA 4EUKA 2DTXA 4L22A 4N39A 1YBFA 3OY2A 4Q9KA 3RK1A 3RUAA 2FR0A 3KALA 1AD2A 3EAQA 4JDUA 4UMDA 3I9V6 4K5QA 4OAPA 3FLAA 3VH2A 4RTKA 3I4LA 1QGUB 1Z2OX 3P0RA 4KWHA 3BCRA 5AYVA 1WTCA 2LKDA 3ABRB 5CLHA 2QK4A 2M6KA 2QTNA 3NWBA 4ZT5A 3KXKA 2WKQA 1E1DA 3LHKA 3OD5A 2IWRA 4BFCA 2ZUFA 4G8JA 1M1NA 4JNKA 1ZH2A 4GZ6A 2O8EB 2OT3B 1Z0JA 4KSCA 1EUDA 4KIFA 4O5OA 4Q82A 2PRYA 5FLXA 4A27A 1HI9A 3LP6A 2Z5FA 3IOEA 4JLBA 1MABA 2ODEA 1JXAA 2MR6A 2JIDA 3MXOA 4AZ0B 4OXXA 5GGYA 4EY3A 4GWGA 4F46A 1DCKA 3KXDA 5KTPA 1FMFA 1PZHA 2UZ1A 1OLSB 4B17A 5JY1A 4S04A 3I1FA 2HA2A 2Q4EA 2O8CA 3LZDA 1E3DA 2DH5A 2XA2A 2FN4A 2C57A 2O7RA 4O8ZA 1ENPA 4EFKA 3WAJA 1LSJA 5F78A 2Y2UA 3NH6A 4IJQA 3ZHRA 3ELBA 4MV4A 3WG9A 4UDOA 1VPTA 3STYA 2ZRJA 3RUDA 2QRMA 3F4KA 4AX8A 1DRUA 1L1QA 4WMLA 2D13A 3ZXIA 1KVRA 3TNDA 4O59O 5CYFA 1IEXA 1G1MA 3IP5A 4ZVSA 4B80A 4DV6B 3Q8KA 3NX4A 4AWXA 5HIAA 1FBNA 1TD9A 4OREX 4UNNA 4CQNA 3G9TA 2RK3A 1UP4A 4AF7A 4IIJB 2Q7DA 3E2IA 1T8SA 2DBZA 3E22B 1KMMA 1BXRA 1RJWA 1RXCA 2CLMB 1ZP6A 3OCYA 4NU6A 4R98A 3CU5A 4UEKA 4WFQA 3T06B 1P1HA 5AW7A 4GE0A 4U8GA 2PWZA 4P08A 5AVYA 3CZ9A 1LLQA 2YIVX 4ND6A 4Q1DA 5DCUA 4IZHA 3E4CA 2FUKA 3V34A 1Z5GA 4YR9A 2PYDA 1OZ0A 3EYAA 5I9BA 5ALHA 3AV0B 1MB9A 4M1YA 1WMAA 3W06A 5TPWA 1T4BA 1F5NA 1E32A 1V96A 2Y8EA 1BE8A 4HVLA 4F1KA 3QE3A 1BN6A 1CT9A 5L4LA 2FP4A 3FHOA 4JP3A 4LGMA 5BOSB 5F3DA 5JMPA 5ULLA 3DWGA 5EIHA 2F3SA 2ZCVA 1Y5LA 3AR8A 1JYSA 2SHKA 3KIPA 5AXCA 4DLSA 4MV8A 4U7DA 2ZWOA 1QQBA 1HEYA 3S2YA 3TVYA 2Q3BA 3M6UA 5BVHB 1M6HA 5COQA 3TLCA 2ZDQA 1XTZA 3PR3A 4R2JA 4C30A 1DADA 3ZDFA 4CMJA 1K8YB 3RK0A 5ITVA 4KRYA 4GRIA 3TRJA 2GESA 2YKGA 4FQ7A 4OHXA 4UZEA 1WCXA 1SUFA 5DLPA 3TX2A 5IAJA 5LZ7A 4H15A 2EZ9A 2HMUA 3DZIA 3GRCA 5TNXA 2JK1A 4IY1A 4RYLA 1XROA 2W37A 4DRZA 1ABBA 4EHBA 1B43A 3OTQA 3UMBA 5FBVB 5L3QA 3QMPA 1I5OA 4A8JB 3M1IA 1NJ1A 1NBHA 1T0UA 2OTCA 3EIFA 4N49A 3B3JA 1JEOA 5K7SA 3U40A 2XGJA 4XRGA 2DSTA 4DV1B 3PFIA 1BFDA 2A7QA 3KTFA 1WKVA 3I1IA 5HFNA 5BNWA 4ARZB 2DVMA 4BYMA 2I2XB 2R66A 4KO3S 3T1TA 1YAJA 4BN5A 3BORA 3NUGA 2I34A 1YDMA 4WY8A 4PO8A 3VGPA 2C97A 2CB9A 3OOSA 3W0LB 4EHLA 1P7PA 4Q00A 1VL5A 4Q47A 4UU8A 2BL4A 5HF8A 3HXOA 1SCAA 2I2FA 2VP3A 3V1UA 4P34A 3T7DA 2I9KA 3DB2A 2GZAA 5IEJA 3RBVA 2ZANA 4FDVA 3NPAA 4EJ0A 3AETA 1N2ZA 1E59A 2CL0X 2DEUA 1P2FA 4LGVA 2R62A 1E2HA 2B36A 2XNDA 1JQJC 1MVNA 1RDFA 4KDFA 1IY0A 2QTZA 3GRZA 4P6VF 1Q1QA 5FOXA 5IBPA 2GBCA 2OCIA 2GVDC 3EDRA 4PBRA 4QDJA 4YJGA 5AW1A 1YRHA 2CW5A 4K8RB 1CF4A 1QORA 1BCSB 4QYIB 2GNPA 4ZC8A 1L4UA 4JLOA 3JQ8A 1MCZA 2BISA 3WL5A 3R4VA 5FR2A 3HZOA 3UYLA 2PIDA 1VIDA 1TGVA 5JD4A 5MFZA 1ISMA 4GBED 2QPTA 3SMVA 2KBEA 3PL1A 5IT9A 2FSGA 3H9BA 5EHQA 2ORVA 3BVPA 3ZW8A 3D8HA 3BWVA 5AESA 5AK3A 4JCCA 1GRRA 3UJNA 3RTAA 3ZI4A 1D6NA 3SBOA 1VB3A 4V24A 3REQB 4OSOA 4TTAA 4BNTA 3IMKA 3U3JA 1XZIA 2HA3A 1BCRA 2PM8A 2EJWA 4CF5A 4Y1RB 1NVUQ 1HOXA 5M34A 1UDXA 1CETA 2AX3A 3FB4A 4WXMA 1RLOA 3QUSA 1T2EA 5DU2A 4E5YA 3CRRA 3FCAA 5DN9A 4RD4A 3T9FA 5BN3B 2DQZA 4OHFA 2F90A 3A2MA 3DFIA 3UWOA 2IDMA 2GYVA 3QKIA 2YCLA 1G20B 4M83A 1YRWA 2QTCA 4EA9A 3P52A 3FYUA 4J16C 5KQRA 1ICEA 2H18A 3H4TA 4TKLA 3LLCA 5LOVF 3RG2A 1C9NA 3UQYS 2PY6A 4BKQA 5B12A 3K2BA 1AHHA 3QPUA 1KDYA 4S1WA 3R3JA 4B6JA 1JT2A 1UODA 4Z4EA 4MUYA 4PYIA 2M6LA 2F1IA 1GV0A 3U4QB 1SJ9A 5JJBA 2HC9A 1SIWA 2JLSA 2F4NA 2APJA 2QE7D 3ZKWB 3MRXA 4EECA 1KBQA 2XRFA 4IF6A 2C77A 4JJFA 4JJ6A 4Z7QB 3TGPA 1YS4A 1P3Y1 1KORA 2UU9B 4R1NA 1EM8B 4MYCA 2Z1DA 4ZQIA 3UJ7A 1QIHA 3CB4A 3FOAA 3GJQA 2JHFA 2I66A 5JLAA 5JVDB 5TQJA 4ZAVA 3UYKA 4PIPA 3WGTA 1U7WA 4JZYA 4G5YA 4YRTA 3AONB 5I4CA 4DKJA 3VNUA 3LU1A 5CT9A 4ESEA 1U0OC 3MTDA 2FMFA 2YHSA 4F56A 2PUVA 1UZMA 2ERCA 2X0NA 3LVBA 4OQEA 2YXBA 1Z6GA 4H6VA 1QFMA 3QFSA 4H3VA 5DASA 1DIOB 1T3GA 3CCCA 3H2KA 4JVLA 3ZHXA 2GCGA 1RWPA 3LUHA 5JE8A 2HCJB 2PG3A 4BNUA 4EAAA 1NKSA 2I2CA 2W0SA 2OECA 4RAOA 4BFLA 4DNPA 2HK7A 1IPHA 2XZLA 1N33B 4BGUA 4MAAA 1JI0A 3I53A 3ILYA 3C6XA 1E3TA 1XWIA 2G9QA 3R3ZA 5JARA 1CVLA 4KPUB 3DVAB 2D1YA 4JR1A 1C41A 1SEVA 2HBQA 2VCYA 3I58A 1AUVA 2VDPB 4UZSA 4HUJA 4CM3A 3DMDA 3DWIA 3AVPA 3ZCTA 1L9KA 3DEKA 1OSNA 4FYKA 4UCXA 1Q95A 2CNKA 5LU9A 1U0GA 4GPD1 1GAJA 4LZPA 1X1SA 4DMMA 1IBLB 2A7XA 1L8OA 3PBKA 2J0QA 4Y8VA 3ZIAA 1ZGGA 3P45A 1KYIA 5FL7D 3ZDXB 2KPOA 3R5TA 3BHNA 1IY1A 4C01A 2OVFA 3ZY5A 3EEBA 4EKYA 1G0OA 2PSFA 2O0LA 4LW8A 4DBZA 3LNTA 4D9MA 5JJIA 4GKJB 1QGDA 2QXTA 1UC4B 4XSHA 1KTVA 1GQYA 3OM1A 3KPWA 5KSYA 5KHOC 2BF7A 2VJBA 1K68A 1T13A 3DL7A 1C7FA 1VG9B 3AG6A 3A0UA 1Z45A 1UPUA 4X41A 4BB6A 2P0EA 1IBKB 3EEFA 2W6JD 2J3MA 4Q9HA 1I36A 3SNHA 3THWB 3ZN2A 1UJBA 4JLKA 5INTA 2C5BA 3M9XA 5HG0A 1N4AA 3ASUA 2ZXEA 4QJ5A 3UGJA 2VSOA 1KDTA 1QIIA 5CT6A 1N5OX 1H0SA 3P97A 3TR6A 2FPXA 4FMCF 4DXHA 3R8FA 1D5WA 1MQSA 1D8TA 1GJRA 3EIXA 2XSZA 1F3LA 4WNYA 4YXFA 4S12A 1DJOA 4F6RA 4LZOA 1PEAA 3TK1A 3VA7A 4UMVA 4BLOA 3V8PA 5B55A 5CVUA 3CFYA 2ZDGA 1UPXA 3FFAA 4W5QA 1WSBA 1ZM3A 1HE8B 3B1ZA 4RLHA 3TNYA 4E32A 1Z26A 1IBCA 1Q1GA 1RHRA 2D59A 4RSMA 5EN4A 5JCPA 5JNSA 1DT5A 2WY2D 1U8EA 3BMQB 3GRAA 3JVUA 3VO2A 5D00A 3TBKA 3PENA 4NZMA 3EDCA 2C9BA 2EJBA 3HV0A 5FV4A 3DAFA 3OJOA 4HO1X 4LVOA 1IHOA 4KQFA 1R8XA 3O03A 4F1WA 1ZRMA 3Q9NA 4TMXA 2AHRA 121PA 1ND5A 1Z4LA 4CG0A 3CG4A 5L9AA 2X1MA 1UK6A 1VE1A 2ZIAA 2AGVA 1PT8A 2CFCA 2WFLA 1EWKA 5E8JA 4J2HA 3X44A 1WB6A 3DE3X 1KO4A 4OG2A 3INGA 2P77A 2PPVA 3VJRA 1DC4A 3EXEA 4YT8A 3ABZA 2ZRGA 4BO7A 3MTEA 3ZW9A 4AM8A 4BMYA 1Q0TA 1H4QA 2X9GA 1I6WA 3Q7TA 4REQB 3OX2A 1U5CA 3AUJB 2HQ1A 2ZAMA 5K03A 3IP8A 4RJTA 2JGLA 1TPYA 4ZDWA 1C30B 2XWPA 3ILHA 4C7OB 1KI2A 4YQFA 3JQAD 5CNKA 4RPIA 4H7DA 2B83A 1B0UA 3OFND 2C2GA 2C5HA 1T9DA 3P19A 5ICEA 1FTSA 4BLUA 1NDQA 2FEMA 2AXPA 1WMSA 4DNOA 2G5CA 4XCQA 2GAFA 2GQ0A 4OHCA 2RHBA 3AUFA 1XFAA 4GEKA 3TKLA 3L43A 3P2OA 2VBCA 3DE0X 4ISBA 3D6FA 5LYJF 1NNEA 2NZ8A 2Z56A 3I52A 3KZXA 1S2IA 4JFRA 3LT4A 1SXIA 4YRKA 4DDKA 3KETA 2Z8YM 4O2LA 2R6HA 4IDBA 4C0KA 1D2AA 4C4XA 3E9DA 3INTA 2FGJA 2FG7C 3W05A 4LOHA 2FMKA 1ZMRA 4YECA 5KU1A 1NT4A 1NVMB 3GCXA 1NZJA 5JNRA 3THYB 3FNQA 3WLNA 2VDUE 1SHLA 5IDXA 3A25A 4YTEA 3SQWA 4EVQA 3HBAA 1DG9A 4ZFNA 2JJMA 1IATA 1SPBS 3MAGA 2BZGA 1R0ZA 2QLMA 3FWZA 2QJRA 3TTWA 4EARA 3DMYA 2L69A 4KSBA 5JTTA 2IH2A 3WZMA 4BBZA 2B6NA 1PGNA 2V6IA 2V7TA 1CB0A 5LP6B 4YP0A 4ZHSA 2AX4A 1H85A 4KN5A 1R27A 2ACWA 1GCOA 3IUYA 1ZUNA 4KE6A 4PW0A 4LJ5A 1CEEA 3OIGA 5LL6P 2ST1A 2Z95A 1Q2UA 2NN3C 3HUDA 2ZJ2A 5AXAA 1ZD5A 1I4OA 4LDPA 1RSZA 3CNOA 4EG0A 4DS3A 3P2MA 4OHWA 4JJKA 1GA1A 1FTGA 2A67A 3KB2A 4FHFA 2BE7A 1BMDA 2VYQA 2ZPTX 3VR1A 4PYJA 5CH3A 1VLQA 5ALLA 3RIYA 1CUAA 4TKUB 1IVYA 1W88B 4J43A 3SIXA 5FHQA 2P9BA 4PV7A 3SKYA 1FVOA 3SS9X 3VYTB 2FWRA 1B4DA 1E3WA 1CVIA 3OFVA 3W6PA 5F12A 3GV0A 1QZTA 3M6XA 5K0SA 1N3BA 1AHPA 2HPAA 2N0SA 3BE6A 4RVGA 4QUHA 4IH4A 4WGGA 5BPFA 1GAWA 3F3SA 3SEFA 1SUEA 3PD0A 4FDAA 5ES3A 4E1BA 5T5QA 2WG1A 3QELA 2CUTA 1FDOA 1TVCA 3GEEA 1N2GA 1XVLA 1P39A 2QUZA 3FVWA 1AXEA 1DEOA 3F6YA 3KR9A 4O4LF 4YJHA 5CG2A 2GXQA 4DV7B 1DC3A 4OHUA 1SCNE 3EY9A 1GR1A 2MINB 5HKOA 2KX7A 1WCV1 4Q24A 2QAJA 4D5EA 3WE7A 5TQ0A 3LBAA 3ZLVA 1RCTE 2PQ2A 3MINA 1SUDA 2IQ5A 4UE3S 2Y0BA 2ZE6A 2PUTA 1W47A 2QZJA 2WLSA 1X1EA 4FZRA 4N0MA 4Z3OA 5CA1F 2VJMB 1DX6A 3TUIC 1DQZA 1QVRA 2CNDA 1CRPA 4PTYA 1Q20A 5AT1A 3RSQA 2YUIA 2HJ9A 1F0KA 1PG2A 5UKDA 5JAIA 3JRWA 2QT0A 1Y8ZA 2L2QA 2FSHA 1CZOA 3B1FA 2EX1A 3F3KA 4HGRA 1EB9A 2RC5A 2HAEA 1WJGA 2MU1A 1MORA 1QIKA 2IZZA 1HL7A 1Y6GA 2F9FA 1DT3A 1GGHA 4FOLA 2FH5B 3AQ4A 2GXAA 3KVRA 3BMNA 3M6VA 3PC4A 1R0RE 4H16A 2ZI9A 3NGXA 4M8LA 3B53X 4N6OA 4UU0A 3UK1A 3GJ4A 3BD8A 4P93A 4IICA 4GLLA 3RPEA 1WD7A 1ODFA 5JXGA 4M53A 3KOWA 4MYDA 4P3OA 3RCBA 3D2BA 4EHAA 3TAXA 4CMIA 2PK3A 4G5QA 5FA5A 4BWGA 3MWDB 2PHZA 1IBRA 4UHDA 1TLLA 5DW0A 5EGSA 1YCGA 4HNRA 2W2XA 2BM1A 2X23A 3CX6A 4RKFA 1HH4A 3DMPA 1QB8A 5LP6F 4RHTA 3V2IA 3GFVA 2QKYA 2JFWA 1JIXA 2IHYA 3C3PA 1V25A 4OYLA 1SB8A 1DZIA 3U4MA 4K7JA 5KNCA 3G0DA 2G9RA 4W4TA 1IN5A 1FFSA 4RADA 3PPIA 2E5FA 4RCZA 1H2XA 5IWCA 2IS2A 1FRZA 1PFQA 2JIQA 2BRUC 3E5HA 3I42A 1MV5A 1CJKC 5ILQA 3VZCA 3WI7A 4GS5A 1OF1A 4CI9A 2Q21A 3H86A 4ID9A 1JWAB 2HCFA 4FYIA 3AFNA 4E2XA 4M6WB 4Y2PA 1TCCA 4ND7A 3ZCVA 5AVZA 1EE9A 3FWYA 1YH3A 4LY6A 4MVXA 3FH0A 2I3AA 3KSZO 3AF0A 2TYSB 3TRDA 4URVR 2X77A 3NUZA 1V8BA 3KLPX 1CY7A 1WOYA 3DOCA 1SOMA 3I8OA 1COWA 1C3JA 3A9VA 1PNRA 2DR2A 4JLSA 4FK8A 2VPXA 4TT3A 4WADA 2EF1A 4AJEA 4TTJA 2O23A 2R1ZA 3NTQA 4P7FA 4QYMA 3SEZA 1VKHA 4UBLA 2A59A 1J00A 3A9SA 3O4GA 3RTEA 1HLGA 3QKRA 3OLYA 2B9EA 4R69A 1OAOA 2GEUA 3IBCA 3NXKA 3NHAA 1DKPA 1ESZA 2E4YA 4IJ6A 3SZ3A 3QNUA 3NHWA 3PICA 1WPXA 4MQBA 1Z3CA 4HYEA 4I8IA 1H2YA 2YY6A 4YK7A 5FUMA 2EBUA 4BU0A 2H1RA 3AJ9A 3CH7A 4BKMA 4CDRA 4O33A 1T5IA 4JOCA 1B1AA 1M67A 1PKEA 4EY5A 2ZITA 4DV5B 2VZ0A 5E6SB 1B76A 3MWFA 1DKNA 4E2ZA 4Q9JA 2UUAB 3AHJA 4MCIA 1UPBA 1ZKDA 5A9TA 2AN1A 1D04A 4WA8A 3WDLA 5FO1A 1E3IA 2C82A 3KFLA 5IF3A 3U7GA 1RPTA 4O4IF 5H82A 2Q7XA 3BILA 3ZE6A 1NXOA 1SBTA 3EA5A 1OBFO 4HNQA 4D9IA 4EW6A 1LZLA 2YJ4A 1E2DA 3OQMA 4CLOB 4O2AF 2C03A 4Y67A 2QW0X 3COZA 2EFJA 4X5OA 4B4OA 3NIGB 1UBSB 1L5VA 3LC2O 4ES6A 3LS2A 1I2ZA 5CUQA 4KDEA 3M49A 5G0VA 4R1UA 2ONCA 2YWGA 3BOSA 3NETA 4RA6B 4F38A 2QD2A 3N0TA 1FUKA 2WK1A 4FFBB 4WLNA 2XNKA 4QE3A 3OCZA 2G1AA 2Z09A 3GB9A 3E3MA 1JKFA 3G0GA 5AKYA 5EKXA 3VC1A 1CEQA 3HR8A 2RH4A 4EYOA 2F3RA 2Q1UA 3L7CA 3TVDA 1KP2A 1GUFA 3H1AA 1B8VA 1EVEA 2R84A 2R5NA 4IDPA 1E9AA 1IONA 2VHUA 3R3XA 3RBXA 3ICEA 2HIGA 4MPPA 5CX4A 5FWAA 5A4KA 2C96A 3G5TA 3CJQA 4TZKA 3WLKX 1W34A 2P9FA 4BTEA 1G18A 5BV2P 4Q4DA 3I09A 2Q9BA 2ZRBA 2ATXA 4RFVA 2QSZA 4BV8A 3K9FC 4JEHA 3TLJA 2RGBA 3NORA 3OFJA 4ZTUB 3W5AA 1ZJ5A 1QGUA 3EVCA 2YYAA 3SM9A 5JR3A 5K05A 3MJDA 4UE6A 3MGGA 1X1BA 4JU8A 1ZITA 3HB0A 3O8LA 1KFCB 4V0NA 5G3ZA 5CTAA 2R1UA 1UBLS 2VL7A 3NFRA 4U6NA 2EBWA 5DBOA 3QY0A 1DJLA 5REQA 1PG5A 2FFAA 3GK3A 3LL4A 3TUJC 4F2DA 1VI2A 3ABSB 1W1UA 4B87A 3UOGA 2JFVA 1R12A 1ZVQA 3A4VA 1RIFA 4PYQA 1TGYA 5ADWA 1PI3A 3PWTA 4ENTA 1XSEA 5CDHA 2HEIA 4FUQA 4U8HA 3ZR4B 4F2WA 2VAVA 2FX3A 4BEWA 1E1CB 1UFVA 2NQTA 1B8UA 1XALA 1FVHA 1V41E 2G04A 1HURA 4A5OA 1TRKA 3JPWA 5K6AA 2X58A 4B43A 2Q5LA 2GARA 1B3RA 2BEUB 3LSYA 4XRRA 4YCNA 1J9EA 5CITA 1QPZA 1S4QA 4C4TA 1BHJA 4LC9A 1Z16A 2J5KA 2L18A 5ICGA 3GJTA 1JMYA 3DO8A 2J09A 2D5LA 3VGJA 3Q6IA 4YRPA 3TDKA 2OO3A 1RP1A 3CZCA 2XCUA 3DLAA 4X90A 5J5AA 1QK3A 1OW3B 3GW8A 1QO9A 1YBVA 2PSEA 2PDAA 1PR4A 5AHOA 5M5BA 2CXSA 3U4CA 3GGOA 2N46A 1JGTA 4AIRA 4F1JA 1Z0ZA 1Y4AE 2J3QA 5FFMA 3DJYA 1RI1A 1TLTA 3WDSA 3LRPA 2G7ZA 4EFLA 2WP0A 3JAKB 1NY6A 3U3KA 3K0CA 2UZ0A 3IEMA 4A0HA 2O2CA 3COYA 1W0CA 1PVVA 4PPFA 2GK7A 1E9SA 4UU1A 1FDSA 1JLSA 5T4HA 3COSA 2XCTB 1QHNA 3O75A 2D8AA 4OO3A 4C4RA 1JHAA 1W2HA 4YJ3B 5JZ9A 1ZD3A 2C98A 1QDUA 1VLHA 3M70A 1C5KA 1GUBA 1AKVA 6YASA 4KQJA 4CNQA 1WQ1R 5CCXA 3QKWA 2YHIB 1NN0A 3ZJUA 1NI5A 4DIOA 4KN8A 3K09A 3KHTA 4DR3B 3A1WA 1QC5B 1Y7IA 2AE2A 3L93A 5KWVA 2QN9A 4G9EA 4JU9A 4XM0A 4KAAA 4YQEA 5K8UA 4RZ2A 4A2WA 2BGWA 1KA9H 2G28A 2Z3WA 3VNRA 10MHA 1FNDA 2OV6A 1TO2E 3RT1A 4MO2A 1OFGA 4NYJR 2Z2YA 4DSUA 4BNNA 3Q8WA 4I36A 3TQOA 3TZBA 1YR3A 2VHYA 5AVSA 3NT5A 1RLJA 1NOJA 4G0NA 2IODA 2BKLA 2BFOA 3KUUA 1CF2O 2JH9A 3WKEA 3THWA 1KR5A 1OBHA 2XD9A 3N6RA 3PHIA 3ROTA 1I6MA 1KMQA 2GCOA 4MS4A 4P4UA 5IJ9B 2J8ZA 2VEDA 2QIPA 1EWTA 3CTMA 4M8KA 3AR5A 1W35A 4TMYA 3PGJA 4J90A 5B2FA 2IU4A 2CFIA 3GXBA 2I03A 3A6EA 4HDQB 4LWOA 1PZXA 3LCMA 4E46A 1H4SA 3WGOA 1QRUA 2E1PA 2VHWA 4IQFA 8ADHA 3B6KA 5HIIA 2P0AA 4UAJA 3B12A 1N7GA 4ZHQB 2BBOA 2HK9A 3A1TA 3ZZTA 3Q2KA 1OH8A 5E0KB 4MQFB 1FZTA 1SXJD 2A5GA 1D0VA 2AXQA 2AN5A 3HJCA 1DCTA 4C6TB 1AQLA 1O94C 2E21A 3L8FA 1VMKA 4UTZA 3IT3A 5JCOA 2X42A 4M9CA 1SR8A 4U9UA 5DNWA 5JD3A 2NPFA 4TUYB 3W8DA 4KXYA 4AJKA 4QU5A 4DW8A 5IULC 3C3DA 1GZVA 4WNCA 1TF5A 4DIUA 4RBNA 5EQDA 1M2VB 3A26A 3VTAA 4E5SA 2EDCA 1ZG3A 4X8HA 3AETB 2W2VA 3UV6A 3OECA 4KLNA 1WKBA 5ALMA 3DGEC 4P4TA 1PNQA 3WLQA 1EM6A 2PMEA 3YASA 1U7TA 4JDPA 4C1BA 3ZIDA 2CVQA 2OBMA 4ZK6A 3F73A 4DR7B 1Y8RB 3IVAA 3L18A 4IXMA 5IRCD 4RDXA 4W5NA 3IVRA 3PE4A 2Z9CA 1RS0A 3DL0A 5K8IA 4TXJA 3NR2A 2ZK7A 3O8NA 1M1UA 3GH3A 4CR7A 1U8UA 4BNYA 4BOYA 5C37A 3C15C 2O4UX 2ANBA 2Q5QA 3P0FA 2AZMA 1FDIA 1HTBA 1W5BA 2X76A 3BE8A 4X1IB 1MR3F 2AJCA 1NN3A 3E53A 5G41A 1X9GA 2Q7OE 4NPAA 3RVPA 4EQZA 2AR7A 5DIFA 2W42A 4Y2VA 4PIVA 3AHHA 3KAQA 3D6UA 4K03A 1JAXA 1KY5A 1Y3FE 1ZIYA 4Y2JA 1DQRA 1MC1A 1RWVA 3G2KA 3R6DA 4GBMA 4HFRA 4QDUA 2Q6LA 1FCJA 4M9RA 3M6FA 2IHZA 3Q85A 3UMGA 4HGYA 3K0KA 2XDYA 4M87A 4W5TA 3AUYA 4GKKB 4GUAA 1RU3A 3FVTA 3OLCX 1ECGA 1PNTA 3DB1A 4R2MA 1TX4B 5BNFA 4DG9A 1P1IA 1K6JA 1NFQA 5C8ZA 3AH8A 4NOLA 4U02A 3O8RA 3EH2A 3DR5A 1O96B 3U4AA 5IVPA 4G81A 3C6ZA 4CF7A 2V7EA 4L7QA 1XELA 5LB4A 2XUJA 2WT9A 3O91A 1H2AS 4WY2A 1PT7A 4OAQA 3AK4A 2NPOA 1Q17A 2QRVB 1ONNA 1T2CA 1QIFA 3TCXB 4EGCB 4NYMQ 3W9BA 3Q3EA 3G2OA 3ZKWA 3E0XA 4LZZA 5F77A 2O20A 2AK2A 1VHLA 4I4NA 1XNHA 1EINA 1EK1A 1O9GA 1L5FA 5JS2A 1PWEA 1UXJA 2O7VA 3A1VA 4RVNA 5ILGA 4EOGA 5JV5A 4HS4A 1TJ4A 1XRNA 3MXTA 1RRVA 4L3OA 4BC1A 1AV7A 2FSUA 3N39C 3BMXA 3CN9A 5T8KC 3M6WA 5HZGA 1V47A 4OGFA 5D84A 4FB4A 1M2HA 2GTHA 3C3MA 1MRSA 3KU1A 5EPOA 5LZ4A 1XXHB 3K0BA 3V80A 3VR6H 1HE5A 3EW9A 3GHHA 3IBTA 4IIBA 4P3KA 2O52A 2W43A 3GLKA 1CQIB 1CZNA 1Y7LA 2WFMA 3CF4A 2ZSEA 4R31A 3L5OA 4JI2B 4CM7A 1SC4A 3CH5A 1UAGA 3WYGA 3QPVA 3UT0A 4GM4A 4NDZA 1TUBA 2OO5A 5TC4A 4JLJA 2JAXA 3NV7A 1H1TA 3OJXA 1XZJA 3D8TA 2C8LA 3NIFB 5CW1A 3VMMA 1XKXA 3GXOA 1RZ3A 2XCOA 1NRWA 2NNLD 2OFOA 3G2HA 4TVBA 2H3HA 4I1UA 2DJ5A 1U2GA 3H5IA 4DUYB 1WEKA 4KX3A 4OVKA 1KAQA 4A6DA 1KFBB 1LLDA 4YDRA 3G8CA 1DV2A 2GD2A 2IHUA 1OILA 3QVSA 3UMFA 5CA0A 1WF6A 1IPEA 4KXQA 4UVGA 1R6DA 5DM2A 4EZEA 1AQIA 1M0TA 3BJIC 5JFTA 1K4KA 2EYUA 2O1WA 4FJ0A 2P6NA 4PSCA 4X00A 1UQUA 1ESEA 1EP3B 4V02A 4EK9A 2QAIA 2GM5A 2NV2B 4PPYA 1GLGA 4V0SA 2Y05A 1KEVA 2P2DA 2PMWB 2YHUA 4ZOLB 5LKAA 1IXYA 3TL3A 5AI0A 3SWWA 5I4BA 3NJRA 4PS0A 4CFYA 4XYLA 4YRJA 1IPFA 2ZT7A 1V5WA 2H7VA 2OCLA 1T6XA 2RI1A 1FFEA 4MQ5A 1ENZA 4EJ6A 1BS1A 3BRSA 3F46A 4XDGA 4MOWA 3T0IA 4LNUA 1NIPA 1NJ2A 3FCYA 4NJEB 4D9HA 3VTZA 3IP7A 5FTWA 4FBGA 1IL0A 2HK6A 1Q91A 2XGSA 3B9QA 3P20A 4L4YA 3ZD9A 2A86A 3F98A 4BO0A 4DMCA 4EDFA 4NP6A 1P77A 2WHEA 3PNKA 1WZ2A 3NDBB 3HUEA 4YMWA 1IY9A 4JBYA 1X3LA 2C54A 4DABA 1DQYA 1KFJB 4QBFA 2VBFA 4M38A 4PRYA 5IKPA 2GN4A 3NHBA 5I7VA 1UMDA 2ZJ7A 3HWWA 4LBYA 1I5EA 2P1ZA 2VNAA 1IULA 4HGQA 3W5DA 2RGEA 4PSDA 4D9BA 3U7FB 3MMXA 3HU2A 1U9CA 2I4LA 2ZG6A 3BGWA 4V0LA 2ZB7A 3T99A 1L6RA 4X63A 4OQQA 2C2WA 3D64A 2QG6A 3R9IA 4EY4A 3C8DA 3TNJA 2OB1A 4AF8A 4AJPA 1VSQA 1OD6A 5GM2A 3KBOA 4L51A 1Z12A 5EXDA 5IVIA 3SX2A 2P1DA 4CCSA 2W11A 1HEUA 2PFSA 5DW3A 5EJIA 1YBHA 2GJKA 3IMFA 1CJUC 5FL7A 4BVEA 4N41A 3PNPA 4KO2S 4ZV4A 1OXXK 2FA9A 3DE7X 1H1DA 2NUAB 1VRCA 2BGJA 3OZCA 4YJFA 2QTMA 1CIVA 4GZ3A 1VJ1A 4HWPA 4MV5A 4NL4H 2VZ9A 4PCLA 5CVCA 4Z6KA 4AK9A 4HDMA 3T4PA 3D2CA 1GQ2A 1GD1O 1YR6A 1U04A 3EIHA 5DNUA 3GDHA 2HDNB 3D5QA 1K9VF 2DSNA 2GPJA 5AP9A 3S2ZA 4DA7A 3DFKA 2IE8A 3I2KA 3N0WA 3SU8A 3UUFA 1TC2A 2LPMA 3OPYA 1UZUA 1ITZA 4JJ8A 3CS3A 2D2VA 3NHFA 1FMCA 3QXXA 5B37A 4KQHA 1JVBA 2G83A 9ABPA 5EOVA 4W9MC 2IBSA 1C30A 2C4NA 5IM4A 4C7OA 2ENWA 1EVZA 3AFIA 3KEMA 5IBCA 1Y4DE 2AC7A 3OOYA 4F06A 1ADYA 4J0QA 2O6LA 3DEAA 4URFA 1KJNA 5BR7A 4OOEA 2VP6A 3M5CA 4M3NA 4ALIA 5IJ0A 2GWRA 5EZYA 4HT3B 1A5TA 2VKTA 1K2VN 4OAOA 4MMXB 5AI6A 2YFKA 4QUBA 2XHEA 5KYYB 3ZD6A 5F98A 4EL0A 4YCAA 4HMQA 3PR1A 4Z2YA 5CA1B 3QUBA 4ZVQA 3QI7A 1UWKA 3HYCA 1W5TA 2B3TA 3PSHA 4HQRA 5CVVA 1XRPA 5J2TB 3ADBA 2XMSA 4JKIA 2I6QA 1OZGA 2EKDA 4RDHA 1ZSNA 2HWUA 3NWJA 2EW2A 4R9UC 3VPSA 1TTTA 3HM2A 4J07A 4DV3B 5DCWA 2WU4A 3JQGB 2WAAA 3AU9A 1T2NA 2IGTA 3ETLA 3NYWA 1CUGA 1O97C 1YV9A 4MUMA 3WTBA 1WW3A 3DUFB 4P81A 3IT2A 2RHMA 4NCKA 2AI3A 4PHFA 3PKZA 4IOKA 4BEBA 4OY3A 4R8MA 4XVRA 2OG1A 1H1LA 3G0HA 4GRDA 1UPCA 3OQVA 1JPVA 4BMXA 1HKUA 2P68A 3O90A 5IJWA 3PCXA 1Z0UA 1E3EA 2H00A 2VTEA 1X7YA 4PNPA 2C20A 2CXNA 4JQZA 5P21A 1PVOA 5CCDA 3OMXA 4CKBB 1KSHA 4RMNA 3DMNA 1CJVC 3I9JA 1Z83A 3HYLA 5ERXA 3ZHSA 2P6UA 5AJTA 5ERGB 3TM5A 5FYQA 3BFXA 3WWDA 1E3WB 1IEWA 3PJGA 2NP7A 2GZ2A 2AXEA 3ACDA 2BMWA 3TE7A 4ZYWA 3C3BA 3L0SA 4ZCSA 4OFBA 2QBYA 1RTKA 3V1MA 4ARSA 1PO7A 2I99A 3I01M 2C3MA 1QTRA 1T6NA 2O8BB 1XU7A 1I6KA 1JU4A 1BG6A 4NENB 1FC0A 1DWPA 1EG7A 2IHTA 2PSJA 3AOEC 4G86A 1EDZA 2FEAA 4QJIA 3VXKA 1FP4A 1S3IA 2UVQA 3DH0A 3E7FA 4B8YA 4U2KA 1KIAA 1M5UA 1NF9A 2DKOA 1G42A 3CUVA 4MKRA 4KQCA 3RI3A 4KN9S 2MSLA 3EGDB 3SLGA 3VYRB 2QMEA 2WVAA 4DY6A 4YP7A 4KQ6A 1Z2CA 3U1TA 1Z2EA 1QIJA 2BUBA 5T4EA 4BNDA 3VSEA 5U9CA 5CGZA 4RIGA 1FNBA 3L7DA 4BDTA 1H22A 2ZBQA 2Y1GA 1EFRD 2PUJA 5M04A 1RC8A 4EW2A 2XB4A 2WJPA 5EE0A 3FPAA 2HA6A 4ZU3A 1O95C 4JX8A 2HM7A 3U09A 1YQDA 4Y9SA 4EKNB 1QJ4A 2H65A 1NW5A 1XAGA 4BUCA 2JGFA 4IOMA 1UOPA 1X80B 5ICSA 4OPMA 2D1TA 3TJRA 5DRTA 3P8ZA 3C70A 3V1LA 2LR0A 2ROQA 1GPAA 1PWHA 1U1GA 1ZHHA 3FNRA 5EXTA 1E61A 5JY6A 5E1OA 3AEKB 1E66A 3OO1A 4IIVA 4MYSA 3OTIA 4R3WA 5AM5A 3UV7A 1KDRA 1A4RA 1IWOA 4UDXX 2Q3JA 2Z30A 5GONA 3RU2A 2F8MA 1IQRA 4YUZA 3E03A 2QVXX 2OKGA 4KQXA 4ZC1A 3DEJA 1ULSA 3SXUA 4BBPA 3BWBA 4OHBA 1GPNA 4CMIB 3U5ZB 3QEMB 4FMBB 3RSOA 3KVNA 2VP2A 1V48A 2X0EA 2J3IA 1GTZA 2Q9CA 2X5XA 2ZIEA 2QRUA 3PFBA 2Q0QA 4QPPA 3TMKA 3CZRA 3QA3E 4C88A 1OY1A 4PY2A 5HJ5A 3I0MA 2FKAA 3NBYC 3O8QA 5ELXA 4BQPA 2X2OA 1CUJA 1GAQA 1SUCA 2ZUBA 5CIQA 2ID4A 2ZTMA 3L6EA 4LHZA 1DKLA 2C88A 4HPWA 4QFDA 4YPOA 3OZSA 2EIHA 4XSGA 1VCMA 1IEQA 3NYQA 2WD7B 2IYWA 3ZWWA 1P81A 2IEZA 3UK6A 2CLSA 1UKEA 4TWAA 1TJ5A 3G79A 1V3QE 1ZM9A 3PC3A 5CVEA 2BSQA 2FDCA 2C29D 4R9RA 1WR8A 5E6UA 4KLRA 5HZMA 1M8PA 1HA3A 4Q9DA 5D1HA 5HUHA 1JR6A 1WZEA 1Q57A 1WOMA 4DUZB 2FAXA 3X1MA 1ZOOA 1R7RA 1OXBB 1OWOA 3BFJA 1KOLA 4C06A 4C2AA 4DCUA 5JYDA 4RNCA 2DTDA 2XXJA 3HLYA 2CE2X 4NY1A 1IB0A 4DARA 1PN3A 1UDAA 4V0KA 4ZAGA 1YJBA 3TLGB 1TXGA 1Q74A 3C74A 3KFVA 1V1RA 1Y6QA 3WRYC 2YYSA 4B3MB 4MQ4A 1X9IA 3FAZA 4TTQA 3ZXXA 4YMLA 1DBVO 2AOUB 4O4JA 5AOAA 4KXNA 5FD8A 1H2RS 3OZ7A 3QU7A 1HM5A 4TMZA 1XB2A 1F4VA 1DMSA 3EMKA 3ZGXA 3LLUA 4TV8F 3W77A 5KOHB 3OCXA 3MJCA 3RC1A 1QUEA 1XLTA 3QG5A 4CUZA 1E99A 5ALNA 3EIWA 3R7AA 3HZHA 2IYXA 5K4AA 1RI4A 4LQCA 4G1BA 2RHJA 3L84A 2L42A 3ME5A 4IFEA 5DF1A 5E6SA 3WGGA 4GWKA 1X7XB 2J41A 3H11A 2G0AA 3MB5A 4ZZ1A 3EUAA 2IOFA 1GFIA 2QJWA 1LNZA 4FMCB 3THXA 5BUQA 5A04A 2JKVA 3TRIA 4O63O 5DDIP 2CVHA 5B30A 2BHNA 5A71A 2BAGA 3NVAA 1W48A 3C3CA 4JNCA 4DZZA 1F8UA 4GZ5A 3H0CA 2ODAA 5EQFA 1SQGA 3DDOA 4YRZA 1DRJA 2ZUEA 1KRXA 3IQIX 2H4ZA 4EJSC 1IZ8A 2WYIA 4ER6A 4WBNB 1HTTA 2JH3A 1SY7A 4R84A 1PTJA 2W6OA 3QEJA 3STWA 4C2TA 4OIMA 3EGXB 1ECBA 4HMPA 1KETA 3U13A 4DPMA 4D9KA 5EWJB 1IOWA 3WYAA 1R1DA 1M0EA 2VHEA 1I9GA 1VG0B 1MEOA 1GRCA 1WZCA 1BKSB 2ZSUA 4ZQHA 4BNLA 4L0DA 1N0IA 1WQ3A 5KCZA 2IXEA 2GPTA 3HB1A 2WSBA 3SXPA 2IZ5A 1PGPA 3ZGOA 1MAVA 2O2SA 1OYWA 1C4WA 2HQOA 4QOIA 3TIGA 3CMCO 3FX2A 4R41A 3RYFA 5CJ2A 3BL6A 4IJKA 4KO4S 3VBEA 3LP8A 2AFVA 4HP8A 2FTKE 3DAYA 5TF0A 4GW3A 2WHXA 4N3GA 4B7ZA 1V9LA 1XMPA 2VDVE 4LXTA 1DIRA 2I2BA 4LOKA 1U8XX 3QXSA 1K7EB 2R4UA 3D7NA 4HDRA 4HRXA 1VBKA 5G1NA 3N59A 3DDZX 1DTWA 2Q41A 3QWIA 4N3BA 1H8EA 4M37A 4RH0A 4RSGA 3RSCA 3PQDA 3UJ8A 4RVSA 4I1PA 4HH3C 4DM3A 5IFLA 3HACA 1FA9A 3G9XA 4H3SA 1XAJA 4H6XA 4E13A 2A8YA 3CX3A 2GEJA 2BRUA 3AW9A 1E18A 5I01A 3JRXA 3U19A 1M75A 2Z2JA 1Y3AA 1BE0A 2IV2X 1SBIA 1W4LA 4JD5A 1NP7A 4I9GA 3DTVD 4G0XA 4GZMA 1QYXA 3CB2A 5L7YA 2WZCA 3E2PA 3CJRA 3DLPX 3IAHA 1PS0A 3NHZA 4JUDX 4TL6A 1NAHA 1VSBA 3QVUA 4C4YA 1OUMA 1DELA 4U0JA 1Y5MA 3CN7A 3CEPB 4DCVA 1AE1A 1L7EA 2V0CA 2CBXA 3DUWA 3LXRA 4ESHA 2OK7A 5L4SA 4QM6A 3N2LA 2PR7A 2ZJAA 1DRVA 2HZBA 3M5PA 4HDNB 4QBKA 4BECA 3PDCA 4BKRA 1ID1A 1M2FA 2JHGA 1GUZA 4PC1A 1J09A 5E4FA 1FSPA 4PCVA 4CM4B 2EZ8A 4ZXFA 2X5NA 5B1SA 4UKDA 1H2WA 1ZX1A 5A4FS 4QQFA 1XA4A 3VKHA 4B5KA 2PTHA 3FXAA 1CUYA 1RE1A 4Q66C 5FWXA 3WIUA 421PA 3OPXA 1NURA 3NH9A 2FWPA 3D7SA 2II6A 1RQLA 4KG7A 4I6EA 3EFHA 3SZOA 3T7SA 3GLFE 1C7IA 2H6EA 1SCBA 1HX7A 3SSNA 3EVEA 3L7MA 2IZ7A 3OPNA 3JD3A 1CUBA 1K06A 4P5EA 3K0AA 2BD0A 4K0KB 1TJYA 3HDGA 3U7EB 3VVLA 1K86A 3DZBA 3WRXA 2REOA 4I5IA 4JUFA 4X1YB 1ABEA 4JGBA 1W76A 2VLBA 2FZ4A 1SKMA 4WJKB 3SQXA 2FVYA 1X0VA 5TQ2A 3G2PA 4Z0TA 2J6IA 4AJ4A 2O3UA 4OMCA 4DSAA 3BGDA 2A6PA 4PQFA 1Z35A 4FSXA 2NSLA 3ZPXA 4IR7A 3NT2A 2A9FA 4JLUA 4X3OA 3RRBA 4J0HA 5L6LB 2YN4A 2WQ6A 3ZE9A 3PNMA 2DLNA 4MV3A 2DR0A 3ED5A 1Y1QA 2WKPA 4E7OA 5CDFE 1UF9A 1UH5A 1KVQA 4U7JA 3WKCA 4D6YA 4LJYA 4RD6A 3P7MA 4TX1A 1EDBA 2RARA 3Q9SA 4B6RA 5ECWA 5JASA 1VTKA 1B3BA 2BZ1A 2YXLA 4OP1A 2R7MA 1TZ2A 1JQAA 1E79D 4MGKR 1Z6AA 4TS1A 5F7OA 1X7WA 2FWIA 1SRRA 2X14A 2QQ0A 5ALIA 2WU1A 1N2CA 1HRKA 3T5GA 4ZMRA 1AUOA 2Z2KA 4ZQBA 5CB4A 4M60A 1GGNA 2QAGA 2XYQA 3D0KA 1V6AA 1T0HB 4L8FA 3CNBA 2P9TA 3QHPA 4A0FA 3I28A 5HTOA 3SZMA 4FKZA 4IJ5A 4B34A 4MINA 2BBTA 1R4AA 5FBQB 4IWXA 2UVDA 3I05A 3NNNA 4CPDA 4EEKA 3GPLA 3QWHA 1BU8A 1ZD2P 2KLBA 3MWKA 2Z6VA 4TKVB 4PZEA 3WISA 3AHIA 4CHGA 4CCAA 1TFUA 1QR2A 4D8WA 4KRFA 2EJUA 1MJFA 1EHIA 4HQ6A 4OM8A 5K3FB 2G71A 3W6UA 4TVSA 5JWOA 1C3XA 1XUOA 1DWOA 2OHFA 1AKWA 1A76A 4X6UA 5AMXA 1W0JA 5FEMA 4E5PA 4MW9A 5HKKA 4LYHA 1M6NA 2DHDA 2H8GA 3B7WA 1P5ZB 1YJQA 2RKBA 3L4JA 5F1PA 1NIJA 1NQWA 1TZMA 1Z0AA 1EUQA 3QE0A 3NUQA 1LXCA 2OBXA 1DAEA 4ZO9A 3WK8A 2W2PA 2I76A 2YX1A 4ZOAA 4JBHA 4GIBA 1N5RA 1R6VA 1JAYA 2EGUA 3B70A 3UCXA 2NADA 1RC0A 1F14A 4M0KA 3VI4B 1JEQA 4G01B 3RHSA 4OBEA 4A23A 1VLVA 4RXTA 4NG5A 4TM7A 4AG6A 2JLUA 2FF5A 1SVOA 4OQZA 1DS6A 4UNPA 2B8NA 4LF7B 3IX7A 3UKJA 1XTQA 4AROA 4W5WA 3SBDA 4ZD6A 3PQ4A 1VCNA 3L9WA 1JALA 2ICAA 3CSUA 4F7DA 2VDOB 2XAUA 1C7RA 4UNRA 1NXSA 4OGGA 4XWAA 1Q7EA 1QGAA 4ZVUA 5JAHA 2QTFA 3UTCA 1P17A 2RGRA 4PZDA 3DXZA 5HQ3A 2Y77A 4IVPA 3N7UA 5FNVF 3ZEAA 2QMHA 1L7MA 4J7CA 5F7XA 1J90A 3TPCA 1PTJC 1INLA 1JKMA 5HIKA 2PN1A 3PHCA 1DU4A 2WMYA 2ZJ5A 3OZRA 2QL5A 3IAUA 3N2KA 3C1OA 4JH0A 4DREA 1AS0A 1C14A 2EZ4A 2FI1A 4JR2A 1GTVA 1P61B 2XDQB 3DBOB 4FC7A 2C5EA 4L0QA 3BZUA 5ANRB 2Q5FA 3DF9A 4GFDA 4B76A 1JP7A 1XO1A 2YUTA 1Y81A 2FFQA 1ZBDA 2C92A 4JGIA 1R5NA 1C3OB 1N1DA 1MH9A 1W1WA 3IS3A 3MRSA 5DGHA 2XYRA 2JFGA 3I1YA 4DLVA 4YIHA 2ZYRA 4IV5A 4DTIA 4B3IA 5A9SB 2G63A 4DA0A 4GP7A 5F7JA 3RODA 3F8TA 2PMCA 1FRVA 1VI6A 2JFZA 1VHJA 4LNAA 5EHIA 3OX1A 3SIWA 4Z49A 4IDQA 1J0CA 3SIPA 4QGAA 4WLFA 2NU7B 1WA5A 3O1JC 5BV1A 1YK0A 2X6RA 2WVGA 2G9UA 1FBTA 3ONVA 1PD0A 3ZHCA 1B0AA 1DP4A 1APBA 2ZP1A 1USVA 1WB9A 2VI5A 2NSYA 3FYCA 3GCDA 3LQ4A 3OOJA 3KJHA 3C7KA 4AN1A 3LNCA 1UBFA 4R3NA 1ECCA 3ZU3A 2EFDB 3H6GA 5AW3A 1K3UB 2ZT5A 5JAUA 4QDXA 4DA6A 4YX9A 2J85A 2Q3DA 2QXUA 1Z2DA 1U4SA 2BGNA 3TVTA 5AW5A 3KYJB 5DYGA 4A6XA 4YMUA 2AF4C 3KSAC 2G80A 1FLVA 3R7NA 1R18A 3HCWA 4GI2A 4GWLA 1U3CA 3WR5A 4YAUA 3GZNB 2PZFA 3AJDA 4PAMA 4G0VA 1LTKA 2E48A 3G1TA 4S2EA 3DHEA 1MTOA 3E1SA 3U3RA 3F97A 3KB1A 3AWDA 3UMYA 2GK3A 3RIEA 3DSRA 3G8DA 4CTJA 3OZVA 3QSGA 5EESA 3FRJA 5BWCA 4E21A 4J6EA 4OB7A 1P0QA 1T2DA 2X3YA 3DCJA 4Q02A 4A7PA 1UBGA 3TF5A 5KPJA 2O5CA 3AIKA 1H9AA 1K9SA 1E8MA 4NE2A 2XITA 1UANA 4NRDA 4QUEA 4MVJM 3KZOA 1E64A 1WWKA 4Q5IA 4V0ME 2I3DA 4NU0A 4PBTA 3B5EA 2FK8A 3CPEA 5FPHA 4C0XA 2QN6A 4CKWA 3EXFB 3WNDA 5AVRA 2EOAA 3OZTA 4FZ3A 3MLBA 3UXHA 4DAOA 5C2JB 1VLLA 1P45A 3UWSA 2H4YA 1O58A 3AERA 2QSYA 2Q8NA 3UWKA 1LLFA 1WUTA 5LJLA 1JQEA 5FBHA 4GOXA 2H7CA 1AK9A 4U5QA 4D8XA 1M8FA 3Q1KA 3HKBA 3KJEA 4BLQA 4D3XA 2GSDA 4CKCB 3WOHA 2FHPA 1NXXA 5EWLA 1EXMA 2GEFA 2Y9PB 3LY9A 3KP1A 1EVLA 2X5OA 3PX2A 3ROKA 3NC1C 4D8VA 2JCYA 1R00A 2ILVA 5EXXA 1T2FA 4DLBA 1MU0A 4A26A 3NPMA 1LWNA 3HDYA 1XQ9A 1RWOA 1SGWA 4QAJA 2V65A 2O50A 2WTXA 3DDWA 3W1WA 1U1FA 3IP6A 1RFGE 1UKAA 3OWHA 2X9LA 1XLWA 4URHA 1T5TA 3VR5A 1I4TD 2Z3ZA 2G3YA 3GLVA 3WYBA 2CKMA 4GXRA 4OF4A 4QHYA 1B93A 3T4XA 1TMYA 3JWGA 4HEJA 1GR0A 4JBIA 4BO2A 1WD5A 2GD6A 4I50B 3SR3A 2MYNA 5HUQA 2OPHA 3K6RA 1CR2A 4M1WA 3Q7PA 4ZPXA 4YV1A 5H16A 2C2HA 2GO7A 4P5DA 3W5BA 2WB2A 4A0GA 2WQ7A 1Y6ZA 2O8NA 3O5AA 4RMJA 5C5EA 5EJAA 3C4QA 3TZQA 3VZRA 2PT9A 2R4QA 2PX2A 1UJ4A 2O3JA 5IUJC 4JYMA 4XB1A 5AI5A 3AHFA 4XX0A 4JODA 4HUQB 4MRMB 3U48A 4EA7A 1D1TA 4MDYA 1IOLA 1U28C 1WHSB 3GDOA 4G65A 4FEYA 4JOSA 3S27A 3TW8A 3K16A 3VZSA 5BN4A 4ZICA 3R9XA 1OT5A 2PS1A 1IXKA 2O2ZA 4K05A 2IV7A 1M2OB 4HV4A 4YREA 3JQFA 4U2DA 1HE4A 2C8JA 1KZYC 2ZYDA 4XTRA 1J42A 1UMCA 1YR9A 2MT9A 2O05A 4N8EA 4DIKA 1Y33E 2QD3A 4OQXA 4RZUA 4L6AA 3I0ZA 3FOFC 1ZN7A 4OQFA 1V7CA 1FX0B 1CRZA 3DVLA 4UM9B 4OMDA 1J8YF 3LECA 1TIKA 4FHEA 4HJXA 4MZDA 1CY6A 1EBBA 3AUXA 3C5CA 2X1VA 1R8SA 1ZJWA 3KHKA 4MVWA 4AWBA 1N1GA 3IHWA 4H08A 4NBLA 4ODIA 5DOVA 3R6GA 3VC3A 1JVNA 3II6X 1Y4ZA 4FW8A 4MR8A 4Q37A 3ZGNA 4BIIA 4CW7A 3A9CA 4JLMA 4EYQA 1O5OA 2BEVB 4UEWA 5LQMA 1J2EA 4ED9A 3BJRA 1TQDA 1PJTA 2W6IA 3ESXA 3MN1A 2KW5A 2HRRA 5CK4A 5CFOA 4ENPA 2NTYC 1Z36A 4F9GA 4PHCA 1N2IA 3FMVA 1YUNA 2PUWA 2J3DA 1XN4A 2B5WA 4II7A 2FZ5A 2IYTA 3W5IA 3K70C 2QMYA 2WJAA 4BE4A 3OCVA 3A9RA 4LJ4A 4XCXA 4F4JA 2XTMA 2MDTA 4RK0A 3WL6A 4EFDA 4MITA 1HE1C 1QV6A 1VBNA 1X8LA 5H02A 1QTNA 4HG2A 3SHOA 4BV3A 4EATA 1GZUA 2FXVA 3FBTA 3G2NA 3FKQA 4I4LA 3GGSA 4JLWA 4EI7A 5DSTA 3P0JA 1GEGA 4BQRA 1A7AA 2EQAA 1DPGA 2NXWA 4I2VA 4GC5A 3A6KA 1KAMA 4ENQA 3MM4A 1G3MA 5AKEA 2EVWX 4ARCA 3LE8A 4ZVPA 2ZJ0A 1ZJYA 2UZ4A 3O21A 1SUIA 2PVPA 1NMXA 4Y6OA 5A3JA 3CNLA 5LA6B 4CKBA 3O83A 3O82A 1U31A 2AD5A 1BVRA 1LDNA 4OHKA 4N7BA 3K0HA 1SHKA 1U2PA 3HJUA 4GLOA 1DSSG 1WO8A 1X92A 1E5XA 3NO4A 4C76A 1G8PA 4J4BA 2IUTA 4KYTA 1MGOA 1UBMS 4EELA 1SHZA 3AW8A 3NBAA 1U2DA 2QX8A 4RHEA 3ECSA 2EAUA 4RC9A 1B1CA 3JAWB 4G5SA 4B46A 3PNLA 1BZYA 1B2LA 4G9BA 5KVCA 2XECA 4GVLA 1E2KA 4BVLA 2ONKA 3CF0A 3IPCA 4XX1A 1MNAA 1N7HA 1Q0PA 2B8JA 3AFHA 4UUNA 3WWEA 2J4DA 3U1BA 4D2IA 3BX1A 1NKVA 4NH0A 5EP4A 5GQSA 2F8TA 2FQQA 2I22A 3MD9A 3C1UA 3Q7RA 2PT5A 1C1HA 3HYNA 4MW4A 1V95A 1NUPA 2I3BA 2YYZA 3QK7A 5CT5A 2VPQA 2DY0A 3VZDA 3BERA 2CDRA 1FUEA 4PLTA 5JBQA 3N70A 5BWBA 1KFEB 1OT3A 3WTCA 5KYKA 3PQ7A 5BQFA 1DKRA 1KMIY 3WRVA 1J97A 2IK8A 3PP8A 3VR2A 4KR2A 3WBJA 2R1VB 5GZ1A 2YXEA 4RFSA 3HN2A 1YHZA 2Y0CA 3NTRA 4Z4CA 4PQGA 4LY0A 4JWKA 1DNPA 3HCPA 1ZU5A 3PEVA 1GO2A 1T4MA 2VNJA 4ZT6A 1E7QA 4DLPA 2D1SA 1KI4A 4GR4A 3V97A 3KAKA 3QIVA 2G9ZA 1ZAYA 1M34E 4NZ9A 4NU5A 2ZRIA 4GMGA 1XRRA 3UUEA 4QXAA 5D3ZA 5C4MA 1AQJA 2BR3A 3BXXA 1QE3A 1NBME 1VDMA 2FMXA 2CMHA 2XWSA 3O9ZA 4BRUA 1ZRHA 5ECGC 5C81A 3SYRA 5F5NA 5K0TA 3E9YA 1JB9A 4W6ZA 2RJNA 1QYWA 2XMQA 1MOPA 3CLKA 1NVXQ 3Q8XB 1RR6A 3HY6A 1J56A 4GX2A 4ZEOA 2EEZA 4B0PA 4EF4A 1UZNA 3C6MA 1OZHA 3CC8A 3CZAA 4D9JA 1TM5E 1KQ3A 1PW5A 3GCZA 1XQ1A 3D6HA 4GNRA 3AVQA 3HBJA 2ATEA 2XAAA 4D1YA 3EA0A 3F8SA 5BW5A 2ZRFA 4ZO8A 2O2XA 3PXAA 4P82A 3WK7A 4DDUA 4LG1A 2ZBRA 2BSXA 4NE7A 4BLSA 1CQPA 4G41A 4LC0A 3NT4A 4AP5A 5A6SB 3RVDA 4F9FA 4CIAA 4H17A 4UNIA 1U3DA 3K2EA 3EQ2A 1NBIA 1XZGA 4K6FA 3WRWA 3FETA 3QU9A 4Q1BA 1FJ2A 3KRTA 4PZUA 1NX9A 4BYGA 3HTXA 4DR4B 2IU6A 1NA5A 4PONA 1N92A 2CSUA 4L73A 2QN7A 4QVKA 2C2KA 5U4QA 4YT2A 5D2CA 5DNYB 2K2WA 3U9SA 5AQ1A 1WDTA 1YFLA 1C8BA 3LSTA 4DWWA 3BPSA 4J9VA 3HJGA 1WW8A 1XVUA 4HQKA 4Q48A 1U9YA 3N58A 4ZQGA 5YASA 1PHPA 2R5WA 5EQTA 4CL8A 3K9CA 5K01A 3A3NA 4BO9A 1EFTA 1GYRA 2CVFA 3LFUA 4GMHA 3FYTA 4JC8A 4XOIA 5AW8A 1Z63A 4CKEB 3I5MA 1E1LA 5ALWA 1YRYE 4J94A 2Y4NA 2W6ID 4U2CA 1NU8A 3V4PB 1AV6A 1U8YA 1PLKA 2GPSA 3VTFA 1CUFA 3FY4A 3N8NA 1P1JA 3JQ7B 4RVUA 5KTTA 3QRWA 4Q19A 2PUDA 4GH5A 3FE2A 3PDHA 1RM5A 4WOCA 5AJXA 5LNK6 5COBA 4W8HA 3DBLA 4JB3A 1RRFA 3ZTYA 3L6UA 2C4HA 3GFPA 2ARKA 3ONWA 4LHXA 3CA8A 5T8KA 2DY1A 3VU9A 1X7XA 1RYFA 3H11B 3KM0A 3WV4A 4KRXA 4OJMX 4A03A 1GDDA 4INZA 1GPJA 3KUXA 4OQMA 3F1LA 4OQ4A 2WI8A 1FZQA 1AKRA 1R5BA 1EUZA 1RPJA 3LY7A 3PXGA 3OX4A 3VX3A 3ZWPA 4B84A 3EHEA 2F3QA 2Q3EA 2H1HA 2WIJA 3WSWA 4DLNA 4NLLA 5K6RA 2XA9A 1VPEA 4CMHA 5IABA 1Z0FA 3DTNA 3L7JA 2QNIA 4DLWA 5CM8B 4WBNA 3EZ7A 2O8CB 1SQSA 1OIWA 2P8JA 4I14A 4WJZA 4WV3A 4XPIA 4LF5B 1ZMOA 3OJEA 2WOJA 1H8HA 2IYYA 2JJ2D 3HDHA 2WRZA 5BR4A 2POQX 1OU0A 3MTBA 4TRRA 5C9ZA 3ZZNA 1UDWA 4MICA 3EFOA 2YRXA 2XIJA 3NBZC 2WWRA 2NUTB 4MXDA 2A1TR 3VNQA 3P9NA 1ZO8A 4KK3A 3RYFB 5KOIA 3RUPA 3SMQA 5AK0A 2YJGA 4D9EA 3CRZA 3COJA 3UHOA 1ZI9A 1L8QA 2GAAA 3NOXA 3PHGA 4GI1A 2AL7A 3KDAA 2F8SA 2FQYA 1N3YA 2I6GA 4S1TA 5MHTA 1U02A 1Q3TA 2ORYA 2ZW9A 4Q7JB 3DO6A 2A5DA 3AGPA 1H2HA 3ZJYA 3DAOA 3USZA 2WM8A 4CE6A 3IAM6 1NQXA 4C0WA 4QZVA 3R5JA 5H3CA 1QO0A 2O1XA 1L7PA 4AKHA 2WU0A 2YNMA 4RMGA 3H13A 3KOOA 5DN6A 1WIWA 1BQ4A 4L4RA 4A2CA 5DM70 4E5UA 4PTZA 5LSAA 1P5RA 1EZ1A 4COKA 1PL8A 2B98A 1QHYA 4DC0A 5JNTA 4PX5A 2IELA 1PQPA 5HDQA 1R16A 1JDBC 2XI4A 1HYBA 1ZISA 2FP4B 2GXUA 3ETDA 3HP7A 1IFXA 2OCPA 3L2OB 1LDBA 5A4JA 1LV7A 2A1IA 4DA4A 2C7PA 2AMFA 5JG7A 4F92B 1XRSB 2WYUA 3CRVA 1PFYA 1DMRA 2K7ZA 2ZVDA 4UU7A 5BVHA 3DNMA 2REXB 4HLCA 1K98A 4A8JC 1WV0A 1TYZA 4IUBS 4QARA 1TFRA 3M6MD 4XASA 4MJ3A 4P32A 3HA2A 1JWBB 3EVTA 3KBBA 2ETVA 3R41A 3RWMB 1GNPA 2ZYIA 4JUCA 5KX5B 3TOVA 5D51S 3UEOA 4B9AA 1ZS9A 4BKOA 4ZVKA 1I7NA 4BP1A 3MCVA 3V8EA 3WK4A 5I8WA 1UJ6A 5L3QB 3QGMA 4TROA 5C1PA 2QUJA 3P0HA 5CYOA 3NATA 1WU7A 3R0QA 3TL2A 1CY0A 2JI4A 3LCJA 5IAGA 3WGZA 3AXTA 1BWQA 4WTOA 4CMBA 1YL5A 1PTKA 3SF8A 1G8FA 4PG4A 3FOWA 4WCFB 1S6YA 2IS1A 3PC8C 5B6JA 4G5RA 1JNXX 3B3AA 3OPYI 4BLTA 1R3DA 1IZZA 4CEHB 1CWUA 4PYRA 4HWSA 4JQYA 4A15A 1DKMA 2XYVA 3RO7A 2CV0A 4NTZA 4DUPA 2Z6UA 2BFFA 1F8GA 1PBNA 3DMHA 3F90A 2BM0A 2EGGA 3QOYA 2Y1FA 2A9JA 4NU8X 2CJPA 5DTJA 5FFFA 3RFFA 5I4IA 2C2OA 3AU8A 1W2GA 3S1LA 5LQCA 4DLLA 1IBMB 4D3FA 1GFWA 4A1FA 5LD2C 3ISVA 3FMIA 4Q7MB 2OXEA 4JI8B 2IV3A 4I46A 4YIKA 3ZV6A 3ZCPA 4P1ZA 3HA3A 1XT6A 2H1CA 2R87A 1ZK4A 4QHSA 1VJ5A 1TF7A 1C1XB 5AM4A 1DJQA 4GNKA 3BFPA 2OAGA 3FAKA 4MLCA 1WEHA 3EVNA 4KR6A 1D4OA 4NJMB 5EGNA 4X60A 1LPMA 1X74A 2FEOA 3FR8A 3ONNA 5HXAA 1VPVA 4LJ9A 3PPXA 4P4SA 2PZ8A 3QOFA 1GZ6A 3ZHYA 3FDIA 1KQPA 1H69A 1PUJA 2RG1A 4DQ0A 3PPWA 2CLEB 4ECAA 3Q8MA 3MOSA 5I9NA 3BMOA 4D9CA 5FNZA 2G0NA 2GEVA 2IUEA 1YOBA 2XVXA 4IXTA 4BFUA 4D4IA 1QOQB 5FTJA 4ZVNA 1JH9A 4D5GA 4ALJA 1U0SY 4RUKA 2Z1NA 3FROA 2ZAYA 2OPBA 5K8TA 4UD6A 3K9LA 5KYXB 4DMUB 3PPYA 3REQA 4CIYA 3Q9LA 2J9FA 5KOJB 4LEIA 3IUMA 1FY2A 4EMUA 3PYMA 1MZVA 1NXQA 3CGWA 1CQWA 2CHUA 4PLGA 4S0ZA 3Q3VA 2HNBA 4JEIA 3DM5A 4CG3A 2C95A 3QLVC 4EPWA 2Q9AA 1HNXB 5L53A 2B94A 3ELYA 3H4VA 4E4YA 1GZ3A 5KEIA 3O8CA 4XH9B 1EQ2A 3FYUB 5KIAA 3ABIA 3T94A 5ALXA 5JAZA 1J1IA 1R2QA 2AHOA 4DA9A 5DXAA 1UK9A 1VG1A 1E7YA 1KDZA 4ENRA 1VC2A 1C7ZA 1VJCA 1W2WB 4RHUA 1YVRA 3PGMA 2O5VA 5IH3A 3GCWA 5DYNA 1ZMXA 3D3WB 3WP1B 5AIBA 5GIPE 5E2BA 2JFUA 3C14C 4IS3A 1MXFA 1VYHA 2HDHA 3GPIA 4FE7A 4ME6A 5EAIA 3UCEA 5F3RA 1FSGA 1EM8A 4XGKA 1T3LA 3AIIA 2B1JA 1YTLA 3GY0A 1SOUA 4RH3A 4B74A 4EPVA 1QP4A 3NBFA 4N3AA 2OB2A 3VPCA 4YRBA 1RYBA 2CXHA 1NYTA 3GLSA 1BOFA 3KPJA 3OQJA 2BV3A 3RT7A 2FZGA 4LX8A 3ZXYA 2FWAA 2TRSB 4V1CB 5ALVA 2DT5A 3SE7A 5LOVA 5GY7A 3BT7A 4ZWNA 3RAFC 3OU7A 2V0GA 1ZJJA 1J9GA 4UEJA 3IEVA 4ZAYA 5IPFA 3NCTA 3CQ9A 4Q15A 1B6GA 1DPFA 1CYDA 1FVXA 4OU4A 1LVHA 2AOWA 2P9QA 3HC7A 4MV7A 2VF2A 1ZR4A 3RV4A 1A9OA 3CUWA 1JHXA 4OH7A 5A06A 2GLXA 5HF5A 1Z62A 3UPTA 1BDJA 5B36A 2ZE5A 3I39X 2PL5A 3REGA 1CFZA 1Y7HA 3AIMA 1VYUA 4M86A 5KI6A 3ZKAA 5HKKD 5LM3A 1MQ8B 4FU0A 1PNVA 3FHLA 1D2CA 2ZRNA 2XEDA 5TVGA 4Z4QA 1UAAA 1EE2A 5CCEA 2VQSA 1N5KA 3G6KA 4ZODA 4C03A 2PUFA 1BXZA 1NYRA 3EVFA 4L8GA 4DLTA 4PHTA 2P4UA 1FYFA 2WAMA 2H8KA 4JJAA 4MUEA 5E9WA 3KWLA 1PLJA 2I6XA 3TD6A 2PKWA 4B32A 4GOJA 4GE3A 4MWCA 3VC7A 2E2WA 1DAFA 1R9NA 2ZU0C 4MHSA 3IR5A 3C4JA 3P9YA 4NAVA 3EPRA 4E94A 1N5IA 1KI6A 4G4JA 5GPBA 3VU1A 5A0FA 3DPIA 1BNCA 2FV8A 4YMIA 4E5DA 5A9SA 3GZ4A 1DBWA 1ZONA 2Q49A 4XAQA 5TY0A 3R9KA 5I47A 1I6LA 5JNUA 3A36A 1KSGA 2BH2A 3LDGA 1E8NA 5HF6A 4DMFA 1QANA 4YHBA 1NV9A 4H0CA 2EX4A 1L5YA 4FLEA 4K26A 4O2AB 2J46A 3LDHA 4RXUA 4YGXB 4EGQA 3H2ZA 2VUSA 5LLTA 3B89A 4B2LA 4KUEA 3N28A 2G08A 4JJGA 2ADFA 1T5BA 3KCNA 3OESA 4C0LA 3FHTA 1PSDA 1OHHD 1DL5A 2IE0A 2C31A 2R00A 5ESDA 4AS2A 4LFBB 3RS2A 3IXMA 3N8KA 1EWYA 1RXWA 4MCAA 721PA 5GVSA 1D8AA 3PUJA 3THOA 2W93A 2IKSA 3MA0A 2Y92A 5GWXA 3VV3A 5ALDA 3JU3A 2HADA 3BA6A 3IJPA 4QDTA 3I2FA 3GUZA 4FD3A 1RAIA 4G85A 1KR2A 5SYNA 1Y1RA 4NEHB 4IG4A 4BJ6A 5EEHA 1S2OA 3ENNA 1N34B 1VGRA 4ZEVA 3L7AA 3UHJA 4BDSA 2WB4A 2PWYA 2WWIA 2IXAA 3Q7IA 3MJTA 3MTAA 2NU9B 3TE6A 1PK8A 3CKMA 1J7JA 4YXWD 3ZS8A 4ZEMA 2EKZA 1NY5A 3CLTD 1M2KA 1WBJB 3K35A 1M8KA 1ZQ1A 3PZRA 2OEPA 2P4EA 4M9XA 1EA7A 5DM1A 1I7DA 1UFQA 2PBRA 2NQ2C 4AZ3A 3EUEA 4I1IA 3JVVA 2YR0A 1ONOA 1HC7A 2NM0A 3IO5A 3LIPA 3HWRA 2A9PA 1FNNA 1SCIA 2HHAA 4MI3A 3AGQA 3SJ7A 2X41A 3RAPR 4CKWB 1V71A 1ZK2A 3CCFA 2H9IA 3G7NA 5E6RA 4J7AA 3F6SA 3UPDA 3V7YA 1K7CA 5JC8A 1VG8A 3OZIA 2M1XA 4ND1A 3GRPA 3ZHQA 2PX4A 5H5JA 1YZNA 2WE8A 1Z8DA 4F4IA 5ALRA 2RGUA 1K89A 5F2OA 2ESRA 3TI7A 3RV3A 2ABWA 4JT2A 4CKCA 3Q12A 3X1DA 3VAYA 2OAEA 2G1PA 3BSFA 4KQEA 3FA2A 2V0NA 4RIFA 3AB8A 2R44A 3EPPA 5CVDA