5JPCA

Joint x-ray/neutron structure of mtan complex with formycin a
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
229
structure length
229
Chain Sequence
b'QKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminodeoxyfutalosine nucleosidase
publication title Neutron structures of the Helicobacter pylori 5'-methylthioadenosine nucleosidase highlight proton sharing and protonation states.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
total genus 79
structure length 229
sequence length 229
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jpcA00
3LGSA 1A9TA 2HSWA 5JPCA 1U1EA 4M1EA 4QARA 3SCZA 1PWYE 1NW4A 4MCHA 5K1ZA 5F7JA 1ODLA 1VMKA 4TXHA 5EPUA 5I3CA 4BMZA 1Z5NA 4LKRA 4X24A 1PKEA 1ODKA 1Q1GA 1ZOSA 4GLJA 1Y1SA 1A9PA 4WKOA 1N3IA 1V4NA 1I80A 3BSFA 4LNAA 3ONVA 1XE3A 4LZWA 2A8YA 2AI3A 1A69A 1OTYA 4G8JA 2AI1A 2I4TA 1RXYA 4JWTA 1PK7A 1Z39A 4D8YA 1Z5OA 1T8SA 3PHCA 3EUFA 2OECA 4QEZA 3O6VA 4WKNA 1LX7A 2QDKA 1JE0A 3ENZA 3OCCA 5B7GA 1ZL2A 1OU4A 1G2OA 4L5AA 1OV6A 4TXMA 2P4SA 4DANA 5EUBA 1C3XA 5C80A 3DDOA 4F3KA 4PNPA 3K8QA 1VHJA 1Z37A 3KVYA 1PR0A 1U1GA 2OXFA 1RCTE 4JP5A 3FAZA 2HN9A 4M7WA 5F78A 1B8OA 1JDSA 1SJ9A 3FOWA 3FB1A 3FWPA 4YO8A 1JPVA 2IQ5A 4D9HA 4TS9A 3KU4A 3BGSA 4F3CA 4L0MA 5F7OA 1JYSA 4R31A 1ODIA 3OZEA 2OC9A 3OZCA 2B94A 1CG6A 1U1DA 4F2WA 1Y1TA 1YRYE 3NM4A 1Y1RA 2RJ3A 1NC1A 3PNSA 1YBFA 4GKAA 1Z38A 2XRFA 1SD2A 4K6OA 1T0UA 5CCEA 4D8VA 4QASA 4TS3A 4EB8A 3T94A 3C74A 1PF7E 4UC0A 3EUEA 1Z33A 3LA8A 1K27A 5F77A 1T8YA 1OTXA 4I2VA 4F2PA 4WKBA 4JOSA 1ECPA 3UAVA 1Z5PA 4DA6A 4BMXA 4IP0A 3ODGA 1SD1A 2H8GA 1JDTA 1TCUA 1V2HE 3BJEA 3IEXA 4D8XA 2QTGA 5CCDA 5EFOA 4OF4A 4L5CA 1VHWA 2AI2A 4BMYA 1V41E 4QATA 4RJ2A 1QE5A 3NBQA 1CB0A 5B7QA 3D1VA 1RT9A 1SQ6A 5CYFA 4BN0A 3INYA 1JDZA 4GMHA 3UAZA 4OEHA 3UT6A 3BL6A 1V3QE 2PGAA 1K3FA 4TXLA 2GUWA 2I8AA 4ECEA 3DF9A 1Y6RA 4DABA 5FAKA 3PNPA 1PR2A 1T8WA 4OGKA 1RXUA 3TL6A 1YQUA 3OF3A 4DA8A 4TTJA 2BSXA 1OUMA 1PR1A 3F8WA 1U1FA 1A9QA 1RYZA 1TCVA 1JP7A 1JDUA 4FFSA 3E9ZA 4NY1A 1A9SA 4OY3A 1OVGA 3DP9A 3DJFA 5B7PA 5CXQA 1Z36A 2QTTA 3MMSA 5DK6A 4KN5A 1A9OA 4QAQA 3P0FA 1PR4A 3O4VA 4YNBA 4TTAA 3PHBE 3IOMA 3EEIA 3OZDA 3UAWA 3E9RA 1Y6QA 3FNQA 4GLFA 4YMLA 3KUKA 4H1TA 4R2WA 3KVRA 3UAYA 3K8OE 3MB8A 1RR6A 1LV8A 1V45E 3KHSA 2A0YA 3UAXA 4DAOA 1TGVA 4TTIA 1TGYA 1B8NA 1ODJA 1ULAA 4TXJA 4NS1A 1NC3A 1JDVA 3NM6B 2QSUA 1K9SA 1YQQA 2HWUA 1M73E 5IU6A 1Z35A 5F73A 4E1VA 1PBNA 2HRDA 4WKCA 1T8RA 2QPLA 4OGLA 5KB3A 4YJKA 1JE1A 2A0WA 3U40A 3KVVA 4U2KA 3LBAA 5CXSA 1RXCA 4DARA 5F76A 4DAEA 1U1CA 4OJTA 4D98A 3GGSA 4NSNA 1PK9A 4F1WA 4TXNA 3QPBA 1RXSA 1A9RA 1YR3A 4R2XA 1RSZA 2ON6A 1LVUA 3OOHA 2A0XA 3P0EA 3DPSA 4WKPA 5F7ZA 4QFBA 5B7NA 4MCIA 2ISCA 4DA0A 4LDNA 1RFGE 1FXUA 5CYGA 3EMVA 3NM5A 4G89A 1V48A 4MARA 1Z34A 1PR6A 1PR5A 4L5YA 1PW7A 4TYMA 3GB9A 1TD1A 2OC4A 5F7XA 3OOEA 1Y1QA 4P54A 3OPVA 4PR3A 4LNHA 2AC7A 5ETJA 1ULBA 4DA7A 3FUCA 3OZBA 3E0QA 1WTAA 4L6IA 1VFNA 4M3NA 4G41A 4EARA 2Q7OE 5IFKA
chains in the Genus database with same CATH superfamily
1FXSA 1FX0B 1A9TA 2J09A 2IOHA 1P2VA 3LGSA 3N76A 3QWBA 1QP7A 1EK1A 4AMUA 4HDSB 2BDEA 4YPOA 3GFGA 4ENWA 2PUTA 2FR1A 3Q9LA 4MKFA 1SXJD 2C9OA 4MAMA 4QBGB 4ZZIA 1O89A 1Z2OX 2PZMA 1ZSVA 1JILA 2HIGA 2P77A 4LIPD 5I3CA 5KCZA 1F4LA 1LPBB 2VK4A 3LPLA 3Q6MA 3TFWA 4D96A 1ORDA 1QNLA 2WFLB 3WL3A 3RK4A 3PDUA 2VN8A 2E85A 3A1VA 3FPHA 1E5VA 1QORA 1GT6A 3ZV4A 4OJNA 3RREA 5GZ1A 3C6BA 1BSVA 4C2TA 4ARZA 2Q6OA 4NZYA 2Q2WA 2WUDA 2Q8PA 2X22A 1P1JA 2YXEA 1D1QA 2WB4A 2HZ7A 3IDAA 4EB0A 2WF8A 2B37A 5EAIA 1T1EA 1BDJA 1G4HA 2B30A 1PJ8A 3AOGA 3NAMA 4IFEA 4IDOA 3ONVA 5L6LB 3FTEA 3LHFA 5CIWA 2VC2B 3NVMB 4U9IS 1TUBB 2ZBQA 4D6YA 4N9QA 3OEEA 1I2AA 3RAPR 4D3FA 3DNFA 2YXBA 4QDUA 1A2QA 1YVEI 3HCBA 1V8OA 3M3HA 4XSVA 3RSSA 3C3YA 1FW8A 3LUDA 5K8CA 1U7UA 4M46A 4CQMB 1OXKB 1G5IA 2CLFB 4ITRC 1JA9A 2Y3IA 2VAPA 4II2A 4PPGA 4ZD6A 1PTJC 1X7ZA 5LPNA 1CF4A 1ZIXA 4TVBA 5HUHA 2JLZA 1KKLA 5C5CA 3VNUA 3IAFA 5EJFA 2ZCUA 3JVIA 3GLSA 3JARA 4J16A 4WZAA 3RU9A 1LJLA 4PO1A 1TIPA 4JFAA 4DYDA 5LMNB 1FS6A 1E63A 1RM3A 5BSWA 3VKUA 2OB1A 3O4IA 3AWDA 3SX4A 3LH5A 2YHIA 2NVOA 4KSCA 4WKNA 2C54A 1FLDA 1COWD 1EGQA 1HK7A 2XUZA 3SG0A 4NAVA 2WWYA 1U8CB 2PUWA 5T4HA 1TOAA 3ZV6A 2JFPA 1MC5A 3MJFA 2A9JA 1O96B 4ZODA 5B1SA 2WQ6A 4F4HA 4UATA 5HKKD 3FX2A 4R81A 3GDFA 3SZGA 4RW0A 3S1AB 5LQRA 3UXYA 3TM4A 2GEBA 2MTBA 4L7VA 5JD4A 4TYYA 3DW1X 3OE5A 3L3BA 3PBKA 2O8DA 3ROMA 1ID1A 2WM9B 2N1BA 5K8UA 5ITVA 3AC0A 1KDRA 1T9CA 5BWCA 1IXYA 4JA0A 1KC3A 1P8JA 3RBXA 3OURA 1XK7A 1RCTE 1U2DA 2DYKA 3PTLA 2VYVA 5LUBA 3SQLA 4JLWA 1K63A 3C98A 3OBIA 3OIDA 3O8OB 1ZN8A 3DUWA 1XIVA 5LLSA 3VDNB 1YO6A 3IMKA 3AILA 2BONA 2O1SA 3GDGA 1H2AS 2EATA 1EE9A 2X4DA 3FPLA 4YRMA 2YWDA 3OQPA 2I33A 3EW9A 3FLAA 2LZ0A 1JHDA 3L1KA 1FBNA 2KLBA 3VZRA 1T0JB 3H5TA 4A8TA 4DLTA 2IH2A 1CIVA 4H7PA 4DB2A 3HU3A 4MH0R 3O8CA 1F2VA 1EP9A 1SC6A 1ZD2P 4KDEA 3L46A 1VIYA 4MHSA 4XEUA 3EE6A 5ALTA 2VXYA 3VZBA 2O2IA 1OV4A 1PGQA 1UM8A 4UBIA 2JZNA 2BRUC 5B3JA 4N5NA 2VLIA 2VKTA 5I01A 4YRAA 4D57A 1QVVA 2ZYUX 1H93A 3PUJA 1WVGA 2FR8A 4HUJA 3ZGXA 3KEQA 4I6GA 4IRMA 4AURA 3JQ9A 4RQUA 3G82C 5LMCA 4EZIA 5AKXA 4OI1A 3JPWA 4B4KA 4OBWA 4LGCA 2O50A 4JI6B 1OH6A 1M10A 3ILVA 1DNPA 2HJWA 4C0XA 3ABQB 4PO8A 2DP4E 3TNLA 3P9PA 1GCIA 3AI2A 3A6ZA 5BUQA 3NU1A 2PD4A 2DHQA 4GXQA 1SVSA 4CQLB 5AW4A 1YS2X 1KORA 3JY6A 1U9YA 2B3DA 3FCXA 4P7FA 3ZKWB 4B85A 1P9NA 1SM4A 1FNDA 1KI4A 2B82A 4K6HA 5IVDA 2Z2YA 4YI3A 2RBEA 4WESA 3H4TA 3QKIA 3MELA 4X44A 1IB6A 3BJMA 4DPKA 2VZEA 2XRFA 1OH8A 3HDGA 2VJAA 4HDKA 3NKFA 2CFCA 1M7BA 1BQ4A 2Z8XA 2OD9A 2DE0X 2W22A 1O6CA 3I5UA 4A27A 1J8YF 2XOXA 3CZQA 2SKCA 3DKPA 1U7XA 4HDCA 2FSIA 1TU4A 3GMIA 4XDHA 1IPHA 2E6UX 4DPMA 4PZPA 4XCVA 4UC0A 4Z1MD 4MWGA 1IWPB 1SKYB 5HIMA 1OHHD 4ZQGA 1TM2A 4QYWA 3E9NA 1C80A 2WSMA 4J7CA 4IDAA 2H17A 4N5DA 4QDTA 2C5HA 1OBOA 4OLAA 1NG1A 3O1JC 3WLIA 3KYCB 4BZQA 1ZK2A 1P3JA 5D84A 1IONA 3KZKA 4RAQA 1WQ4A 4U2GA 2ODAA 3T7DA 1VI6A 2Q6LA 1H9BA 1XMVA 4LDJA 4CMJA 2GAOA 1ZNZA 4Q01A 5KOJB 1U0TA 1XLTC 2D1QA 3IP7A 1C0IA 3ROGA 2O3UA 3M70A 4IDHA 4R9SA 4BJ1A 5HIKA 5KCMA 2QZJA 4XUGB 3W5SA 1L7EA 4URUR 1S2DA 3B9RA 3N59A 2BOVA 3LFHA 4JR1A 5CMLA 5C1IA 2ECOA 4K87A 3DEKA 4ZDWA 3O3OB 3RRMA 1ZONA 9MHTA 1OXUA 1GLVA 4O5AA 3UBTA 4LMAA 3EZ6A 3WNCA 3KTOA 2ZYVX 2C9BA 2FWJA 1D6NA 2IIQA 4ZVUA 3RIHA 1ZXBA 1E2NA 4M83A 3MILA 5DGCA 3O0DA 3UK0A 4GFDA 1YR2A 5B6JA 2IS4A 4BUJA 4ME6A 4EHIA 5ICSA 1BXGB 4HC4A 1A88A 4EQ6A 1NVUQ 4RTMA 1T1GA 1LPAB 2EX4A 1L7AA 4FJ2A 4MPTA 3LAWA 5SZIA 4X20B 3V34A 3D6FA 4J8PA 3VO8A 3OCXA 3MJDA 2AOUB 4LSGA 1GTG1 3AR2A 1F6DA 3D1VA 3PJRA 4DMCA 5DNEA 1L4LA 2JJ1A 4G24A 1K6MA 3KWFA 2C9DA 1BH6A 1U7OA 2P1DA 3HVKA 4UZSA 5G0VA 3ZN2A 4ZIRA 3HYCA 3MJEA 3PB3A 1Y89A 5BN4A 5L3RA 3WL4A 3GROA 4R7GA 5HQ3A 3RTGA 4YAEA 6ADHA 3FFTA 2POCA 1CUZA 1O94C 2GZAA 3GIDA 4IRUB 3STWA 3N3AC 1UMCB 4MUYA 3TECE 1L5HB 4KN8A 4TMYA 4Y6GB 1E61A 1CR4A 1QH8B 2CLKB 3RUEA 1IQ0A 3QI7A 1FYXA 1CT9A 3IV7A 1J1ZA 1JFLA 2RGNC 4PEVA 4RIGA 3K9GA 3JAWB 5CTAA 5K8IA 1Z9BA 4CMIA 2IK8A 2O57A 4KH0A 4URZR 3DF9A 4IJVA 4XGNA 4R1PA 2JI4A 3WNVA 4DJJA 4IYRA 4YFVA 3VOBA 4F56A 5LD2B 1PYDA 3KKQA 4P80A 3IQEA 1GZ3A 1MO6A 1MHTA 1XZFA 5AM5A 2GPBA 3AR4A 4R69A 2AOTA 1KBQA 4OAPA 3MWEA 1EJBA 1HNNA 3TLZA 3WQRA 3ZV5A 1NFFA 5HZKA 4LHYA 1A9QA 1OD6A 2RGXA 2PZEA 3C7KA 1PQUA 3PXAA 2X58A 4P4UA 4R8KA 4B87A 4DR2B 1JP7A 1XLVA 4GXRA 2WWGA 1WW2A 4CKWA 4XX0A 4LQ4A 3WGYA 5JS6A 3LHSA 4NPAA 5PGMA 3HB4X 3WMXA 4E6PA 1GCUA 4RANA 3BFPA 4IHJA 2XNDD 1TVMA 3B6IA 4IHQA 2IYAA 4Y1RA 5FUXA 3TQTA 3UKDA 1W73A 3W1VA 2IITA 5ALPA 2CDAA 2V96A 3BORA 2O8CB 3OTOB 3DKVA 4EG5A 3NH9A 2YX1A 5KNBD 4ND8B 1EIZA 1VA5A 1WXHA 3R3YA 4IVPA 1R16A 3WO0A 2QTTA 1GVHA 1T2AA 4N8EA 3TLKA 4X6XA 2ZS7A 3ZE6A 1DKQA 4FNGA 1E59A 2DPMA 4HXGA 1QZZA 4IXNA 4NG5A 5CNJA 4BPBA 4EVQA 4S04A 3BMQB 3AV3A 4KE8A 4KODA 4HDMB 2J8ZA 2DQYA 1MB2A 3H2HA 2JJMA 4RLQA 1AS2A 2H4WA 3BB4A 5D2CA 4C4TA 5I9SA 3B6JA 4O29A 4J7AA 3HN7A 5CGZA 1CY8A 2W6ZA 3OA0A 4C4YA 4IINA 1SH7A 2XXBA 2REQB 1Y42X 5DZSA 3DLPX 4MV8A 3T9BA 3HXQA 3M6LA 2V3WA 4O02B 5EWLB 2UZ4A 1Z4LA 1KDOA 2XE4A 2PVSA 1DEHA 1EDZA 3KLMX 4KOAA 4N0QA 4R2WA 3O75A 4RZQA 2DC1A 1C7FA 5GQSA 1Y7IA 2ZRPA 4KK4A 3OP4A 4MIYA 3F98A 5TPWA 1KJYA 3OU6A 3LT5A 2FUG1 2PNJA 3DLCA 4YDSA 5A4FS 2IVZA 3VU0A 1FS4A 5JAQA 2CNDA 2ZWIA 1U6KA 1OFGA 2R1ZA 2G0AA 3MQFA 5IC5A 5M34A 1EXMA 3MJSA 1YJCA 2EOAA 3ZJVA 5ALVA 2EZUA 5IKEA 2O9JA 2YASA 4X91A 5BN5B 4FR2A 2IX9A 3F3YA 2GX6A 4TTIA 1E9SA 1TCBA 4YACA 1UCFA 5HE8A 3TRDA 1AKNA 1JJBA 1N0HA 1G21A 2YIDA 2ZB2A 5EEHA 2HV9A 3LC0A 5EJ7A 3K5PA 4NCHA 4I81A 5ALKA 1V11B 1RKVA 1U3FA 1W0JD 2CDRA 2C8LA 2BN4A 3MINA 3MBOA 1WCIB 2H7VA 4BB6A 3LY5A 3RRJA 4JEIA 4OXYA 2AXEA 1XQYA 3UB2A 1WDTA 3OP1A 3RRBA 5EIOA 2KSQA 1XGKA 5GGXA 2JHCA 1JMVA 3K70C 3KM0A 1L7PA 5FORA 1LTQA 3A0RB 4M76B 4R05A 1M8GA 4TM8A 4X3OA 5EG5A 2OAGA 2Q5FA 2QXTA 3SBOA 5AJTA 5IHXA 3ZS9A 4ARCA 2QM8A 3ANSA 4NHEA 1AT1A 2G04A 2XGOA 3RIMA 3SJ7A 2C8VA 2CNBA 2G06A 3EGXA 2VCEA 4M22A 1R5JA 3ZR4B 3GI1A 3EXAA 1MXFA 5AHWA 5KOHB 2J48A 3N8IA 3NIWA 4EL5A 1IVSA 2VPIA 3KB6A 3U7QB 5IVHA 3MHPA 3WTCA 2W58A 4YJKA 1RJGA 2F3RA 3TL3A 5IK2A 4I2NA 3CNNA 1JMKC 4KLRA 4OSPA 2A86A 2OB2A 2WVHA 1W1IA 4GU5A 4PFQA 4TS4A 1QLJA 1XYVA 1QWOA 1L5WA 3KJZA 4FDMA 5ALSA 5E8JA 5C31A 5FFFA 3FRIA 4KZKA 3RTBA 4G8BA 5ITSA 1BCSB 1T6NA 2GK6A 4BP8A 4D81A 3JD4A 3OTIA 2F00A 4IMPA 4ZDIA 2N0SA 4JKIA 2H2AA 2YWEA 3GFPA 2XEDA 1E5DA 1PJ4A 4KSYA 2ZBGA 3IALA 5EMLA 5BWLA 1LZKA 2F9LA 3R5HA 3ETCA 1P60A 1P4RA 1RYEA 1MC8A 2OORA 4E21A 3IE2A 1A8IA 3T5AA 2KLHA 3OAAA 2Q2VA 1X19A 5B4VA 2PZGA 3E1SA 3PDIB 1YB4A 3EA4A 4UE6A 2ZCJA 4JVOA 1NFQA 3SS7X 3WP0A 5FPYA 4JXZA 3INTA 3I5YA 4AX8A 4PVDA 2RHMA 3C8DA 1QNFA 2AUNA 3FWZA 1YGPA 1KE1A 4U6SA 1RSZA 2IE0A 3TO5A 4EUFA 3AUUA 5JCOC 1CULC 2ZDHA 1URPA 3BRWD 5HHTA 2WKWA 2GCPA 3BL5A 4TTRA 3MBKA 4UUPA 5FI3A 1T5SA 4UAGA 6REQB 2GYVA 3W8EA 1OY1A 4PLWA 4H3VA 4MCIA 3TSYA 4A2QA 1KNQA 4ZJZA 3K71B 1PEAA 3QLVC 1L4FA 2UXCB 1QANA 4CG3A 1R0YA 1AB6A 1MR3F 2ZT6A 3ZDQA 1FFXA 4R2LA 3HVHA 1ONOA 1NUUA 2H9YA 2EVWX 2JI8A 4F1JA 3AK4A 4LYEA 4BVLA 5EERA 5BXYA 1E7MA 1SUPA 3N9IA 1JFSA 1CYEA 4BAUA 4RETA 5KYKA 2DBVO 3PT9A 3HVRA 3GFSA 1LW6E 1VE6A 2C3OA 2IKSA 2KB0A 2QRHA 4JP2A 3HGMA 5A3VA 3RC7A 4OA8A 2C58A 2QLLA 3RK0A 1QK3A 2W98A 2ZTVA 3F1KA 3PZBA 4W7IA 1M54A 2I6FA 3JPYA 4HMQA 5JYEA 4QUGA 4RTJA 4QBHA 4PZCA 4ZT2A 1QZTA 3D6HA 4FHDA 1CCWA 4J1QA 5AWFC 3S70A 4Y67A 5AFSA 4CM7A 1SGWA 4HGPA 1NXQA 1M1NB 1O94D 4OXXA 3EZ9A 4MDHA 1B0ZA 1FC0A 3TW8A 3DZKA 5A3SA 3ZEIA 3PR3A 5DN9A 3W06A 2NVBA 2GCOB 1XMQB 3QUAA 1E2KA 2QHXA 3FUCA 3NOXA 1XJ0A 4RD1A 2Z30A 3RFFA 1GCGA 1Z88A 4OFXA 4UOQA 3I6YA 2GXQA 5GOZA 1UADA 5IC6A 4RD0A 2VUTA 3CR7A 1OAOA 4B40A 1A9YA 4BFLA 1OC2A 5A7HA 1K9VF 3V3KA 2E2WA 4XOIA 2RAUA 5LJLA 1RPTA 4IZ6A 2VS1A 1R6VA 5JRDS 2PS3A 2R5NA 4PZYA 2Q46A 5JPCA 1X7WA 2JAHA 2AG8A 1VRVA 4NK5A 3OWXA 4IEFB 5JANA 4NR0A 3A04A 2OAEA 1OGIA 3GLUA 5LQMA 3GFFA 2IXEA 3TRIA 3HNOA 3KZMA 2FETA 2X9LA 5BT9A 1N92A 1GV1A 2CXTA 3DKIA 1C8BA 1F0YA 3CLVA 4QNRA 4DLZA 1EPUA 2G8LA 4U7FA 4INAA 2NYUA 3EW7A 4JT4A 2YVKA 4JT8A 4OJYA 5EIFA 4CFYA 4TKMA 2NU9A 4Y2JA 3S4YA 5CT8A 4QU0A 2IDMA 2V7WA 2XTAA 2MU1A 3NDIA 2IV7A 4EA7A 1AQLA 4LCEA 5CVJA 1FDIA 3DWIA 1PL0A 3IJRA 1PKEA 4E07A 1GAJA 1OLSB 3AONB 4KE7A 3GL9A 5H5JA 3RKUA 1JECA 1QC5A 1TA4A 2QD1A 1VTKA 3QUTA 4KQFA 2PWZA 3CLRC 1EZ4A 1UMDA 2H2GA 3CLUD 3H86A 4R68A 1RYBA 5C1PA 3I0NA 4GPAA 4PHFA 2GILA 2HD4A 3H11A 2QZPA 2JARA 3HEMA 3NWJA 5THXA 4BMPB 1ISIA 2Q3EA 1Z18A 2CZCA 2Z3WA 3MA0A 4G1UC 4J03A 4X6UA 1GPMA 1QJ4A 2XMDA 3D7MA 4LV5B 2QNIA 1GG2A 1SCQA 1VZ3A 4W8HA 2XLCA 5ARBA 4LTNA 5A3JA 3O8BA 4AQYB 1PL8A 3V4VB 1WKBA 3LUAA 2QT0A 1HDXA 3PR2B 4E33A 1KI8A 1VE9A 3ZD8A 2XADA 3EZXA 3IAXA 2RIPA 1XMOB 4IJUA 1OASA 5GM1A 5HM8A 3QY0A 3ACBA 1ODFA 3HJNA 4BFVA 4ZAWA 1Z8DA 2WWTA 2IF0A 5EKXA 2DWQA 3T0IA 1SBTA 2C4TA 4QYMA 1JLHA 1E1LA 2G6TA 3WKAA 3G49A 2JCYA 4MPPA 5TF4A 5G41A 1PT5A 1VJGA 4RFSB 4CM9D 4IGEA 4MA0A 1BGWA 1F48A 1DBPA 2HBZA 3RIXA 1HLFA 4QVIA 2JS7A 4I1UA 1EFLA 4GI2A 3RBVA 3PD0A 5H4GA 1HRDA 4JSTA 1T3GA 2E37A 1T9BA 3CZRA 1R2QA 3HC7A 5HUQA 4JIGA 5JEEA 4BNJA 3ZLTA 2IGTA 4NV1A 2NN3C 2QR2A 4KXNA 5E1BA 4P84A 4C87A 5J2UB 2D54A 4GE3A 4NG4A 4BMDA 2RK4A 4JJ7A 4L3WA 3N28A 3RTCA 3MTQA 4C2BA 4WFIA 5L95A 1PR0A 4GQIA 4Q21A 5BVGB 3P32A 3NHLA 3D6MA 1EDBA 1J9ZA 1RADA 4NZMA 2LDBA 3F4KA 3QNMA 2BP7A 4HQRA 5JSZA 3KKLA 2Q9CA 1O1YA 1RMYA 3C4QA 1PNQA 4FYMA 3N2EA 1CUBA 2ZSFA 2XBMA 1JH9A 4ZT7A 5HR5A 4QJ4A 1C30B 2RGBA 1PRYA 4M37A 2C94A 4PC6A 5B3LA 2HHCA 2C7PA 3H1TA 1VHLA 4ZAYA 2X9VA 2YCLA 2V7EA 3ENKA 5THKA 4EPWA 3KJHA 1G55A 3OZWA 1YZNA 2GTPA 5KSOA 4C6RA 2QYHA 2JBWA 3NBZC 4E70A 4Z4QA 4UZEA 2JIZD 5CU7A 4ZU3A 3LXRA 2VQFB 2D7DA 1CEQA 5B1YA 4FN5A 4JLVA 2Q6IA 5K4GA 3RU7A 3F8SA 5F1KA 4TS9A 4HL6A 1SHUX 4K9QA 5HOQA 1BE8A 1QV6A 1MG0A 5JBNA 3O90A 1VGVA 1KTIA 4C4SA 1H42A 1FP2A 3IP1A 1JYSA 2JEZA 3K4QA 1UL1X 5CURA 4KMOA 2H1VA 4DQ0A 3ZV3A 4EFMA 3ZJ5A 1QYRA 3CO0S 3HY6A 5TT1A 2BEUA 4XW2A 3DE4X 5DVZA 3ROKA 4A4DA 4NYIQ 1FDSA 2AE2A 1YBAA 3P20A 5TT0A 3NM4A 4X5OA 2FPRA 3ZDCA 1NR5A 3SC2A 3EIQA 1CUIA 5B57C 1GQSA 2ZAIA 4OK3A 1USKA 2FK8A 2YVAA 4MV3A 2EGHA 1FJHA 4MKRA 3EVAA 4O4LB 3PPYA 1F38A 1T8UA 1H8HA 1J07A 1TLTA 4ND5A 5KHAA 2W2PA 3OBBA 2WZBA 1ZMTA 2YIMA 4MOWA 3DVAB 2A4MA 1A1SA 3CWQA 3ONWA 3QE2A 1Z38A 4FNOA 1RHKA 2PUJA 4G2NA 4HPXB 2GO7A 4NWIA 5DLEA 2H51A 1HLPA 3D7RA 5D3QA 3ADCA 1NR1A 4RABA 1MO4A 2XGSA 2C9YA 3H2YA 3TDKA 4AZ3B 5CXUA 3HO1A 3CB2A 1D8TA 3D1JA 3IQZA 3L8DA 3VR6D 1AMOA 3FF4A 4LSZA 4PZAA 3R3UA 3OPYA 1X1DA 3PUZA 5DBOA 5B30A 1XNHA 2YXNA 4PPNA 1JI3A 1GQ2A 3R3ZA 4CR7A 1Z0ZA 1DPFA 2GARA 2PYZA 2OHVA 2ETXA 4BNWA 4CW7A 4P7JA 1AXGA 10MHA 5DX0A 2GOYA 5HOEA 3CVYA 3TZHA 3OLWA 4CMAA 4UW9A 3U1BA 3M33A 4Y30A 1XU9A 5GOTA 1NQOA 2CLHB 5JEDA 1EHYA 2PT5A 3II6X 1WLYA 3KR0A 2BI7A 2V9ZA 1TMGE 4OBEA 4WBNB 3D9QX 1PG2A 1XF1A 2HLDA 5L51A 4N5IX 3GEMA 4UHJA 3ASZA 1HOTA 2GT1A 2ZQZA 3HKDA 4IP0A 4PYKA 4UEKA 5DW3A 2B1QA 1G66A 4NBNA 2VBCA 3PNKA 2ZRLA 4P4SA 2ZE6A 1R6TA 1MO5A 2GZ2A 2OD2A 2OO5C 2PXCA 3EVTA 1QU2A 3GEPA 4ONEA 4ZARA 4PN7A 3CVUA 1E9VA 4W5NA 2QJOA 3BKXA 4E03A 4YCCA 3RVBA 5TXGA 4WBXC 2E18A 4HQLA 1V6SA 1N8SA 5CEFA 3TSCA 3MT0A 3VA7A 3GVXA 5LA6F 3DBLA 1W6UA 3URMA 1TU0A 4BKQA 5JPIA 1NOJA 4EDFA 3ELBA 3WG9A 4B2IA 3SOZA 4ENQA 2CCGA 5J2TA 3F3KA 3DDHA 3EGWA 4YP0A 1B6GA 3PP8A 3FMIA 5ED0A 2IWRA 3REOA 4JC0A 3UHFA 4DQVA 5CFRA 4OI4A 2C2BA 3DYBA 2NZVG 1SURA 4V3BA 2P75A 3EMKA 3DEFA 3KXPA 1QWSA 5DP2A 3CLSD 4MPRA 4B7CA 1E5TA 4YS6A 2JNWA 3DXFA 4W1SA 3KEGA 3NHAA 5ARCA 3GLVA 5C3MA 3JYPA 5H81A 2WWHA 4BN0A 5AUPB 2Y1KA 4X7PA 1QCDA 3ZKWA 2BSQA 3VYTB 1ZXLA 3UMYA 2O2SA 3V8RA 5CLLA 4IIBA 2J3HA 1P1HA 3BF7A 4J9UE 1EI9A 3A3KA 5T67A 4E5PA 5I4BA 1SNYA 1KK2A 3A25A 3EYAA 3UV3A 5CW2A 3OZXA 5EL0A 1YFJA 1DEKA 4HVTA 1NX9A 1ZH2A 3X2EA 1JA0A 1FJGB 2ES4A 4TXLA 4DV4B 5FPQA 4L22A 2ZS8A 4FZRA 5DI3A 4JBYA 3VR6H 3H65A 4X1IA 4WNAB 4LE1A 4PYRA 2I8AA 4W5QA 1GZ6A 5AM1A 4EDHA 4CKCB 4DABA 4HRXA 4NCIA 2HUPA 4KDCA 4HZGA 3USZA 2G72A 3UXHA 2DT8A 1H85A 4LV8B 4C7JA 5LP6F 3L0SA 4A0QA 4QTZA 2Q5QA 4US2R 1KJZA 4I99A 4WACA 3UWOA 4IEEA 2JW5A 2FEXA 5DIFA 4DXHA 1EXVA 2CUNA 3GT7A 4HTFA 4YLGA 1Z0KA 4GOND 2I4MA 2O20A 2UYQA 4QECA 2UZ1B 5DMXA 3N0TA 5JSUA 2Q5EA 3T3MB 2HTEA 1TCVA 2XODA 3DB2A 4KO3S 3SR4A 1A82A 2C2XA 3LF2A 3WJ1A 1DKNA 2J07A 1QH0A 2BM0A 5HE9A 1P33A 3AG6A 4JV5B 1FX1A 4RVCA 4EYEA 2CCKA 1V26A 4JHLA 4EB6B 2VWPA 2P35A 4YPFA 3FKQA 1YZFA 2C57A 3F9CA 2VDPB 2VQDA 2OSVA 3UWMA 2G7ZA 3TSWA 1KQOA 3BTUA 2JI7A 3WK9A 2ZTHA 3NRCA 4F92B 2X0RA 4XJSA 1P80A 3KEFA 4UEOA 3R6WA 1HLDA 3V7FA 2J7PD 2F8LA 1NBIA 5JJKA 1G6Q1 2BGRA 2Q9BA 4V1CA 2XUOA 1P2UA 4WLOA 2QKYA 4IM7A 5JZSA 3K0FA 1MT0A 2QVCA 1XEXA 4FYYA 1ECBA 5LB2A 1PWEA 1OAKA 3RANA 1G16A 1GYRA 1PFWA 2OCBA 1ONPA 2VNHA 4HP8A 4LNUB 2IXAA 1KDZA 5K6RA 4TWJA 4NYIR 3G0CA 8LDHA 1M34E 3L4JA 4W99A 1L7QA 1MAVA 3EZNA 5JFGA 2PN1A 2VJNA 1QFSA 5BRJA 3D2AA 1N77A 2B3TA 1ENPA 4JUBA 2J32A 1UXJA 3ZWYA 1Y8RA 1MZVA 4YAIA 1S2LA 3E27A 5AVRA 1GZ7A 2F2TA 4XLZA 1QF9A 1RZUA 4HFJA 1RFLA 3B3QA 3TQRA 2XCOA 1F3OA 2OV6A 1DC6A 2YN0A 3C5EA 4X61A 2JATA 1BMDA 3OM0A 2IV2X 4ZGWA 3TN7A 1M0EA 2COEA 1WVIA 4JITA 1CW2B 2G1UA 1YVDA 3THRA 2W7TA 5CVEA 2XE8A 5KKCA 1O3YA 4O4IB 2KS6A 4NJEA 1RBZA 1GPUA 4FZ3A 2W2LD 4GR4A 1EFPB 3ZK9A 1XTIA 1UKYA 4X00A 4XIJA 3DXZA 4A0GA 4OUDA 3DC2A 3KKEA 3H1EA 4ZMBA 1N2GA 4OAQA 2XUIA 3U2QA 2QRNA 3I9V1 1J49A 4NBRA 1DEOA 4J1NA 3V48A 1NIPA 1SUIA 3UUWA 1VKHA 3PPXA 3PI6A 3ZIAA 1U3GA 5AM0A 1VCHA 4HDOB 2X2PA 3OY7A 1GKYA 4DJTA 2AXPA 3ZGNA 1X1RA 3QVKA 1V9SA 1CQWA 3AB8A 4RVSA 1C0LA 3L8YA 4TTQA 3RC2A 1C2YA 3NOQA 1Z35A 1CQJB 1J8DA 1ABEA 1W0KD 2LCIA 1CUYA 2B6NA 2WAXA 2E7ZA 3PRJA 4D6XA 1DC4A 1OT5A 3LKVA 5FOSA 3MJHA 3MPOA 1TB4A 4MW4A 1NXSA 2YNMC 3PWKA 1KQ3A 1Q0RA 1BQ3A 5FQOA 2V4MA 1Q1EA 2B34A 4MRMA 5AOAA 3S5UA 3LVBA 4F7WA 3L6UA 4ETNA 4AI6A 2QP3A 1J8QA 2BHLA 2ZJ7A 4TV8A 1N9GB 3PCRB 3WADA 4LXTA 4YN3A 4DCCA 3OPYI 2FFHA 1AUQA 3HDVA 3IJPA 5IT4A 3V8EA 4QG3A 5F52A 4YRPA 4HAIA 5HMMA 4K6MA 5JC1A 1K1EA 5C8XA 1XDWA 4R54A 4RJJA 2RBGA 4ERXA 1OA0A 1OOEA 1ZN7A 5FWAA 3HBAA 4MW9A 2ODPA 4F5DA 3JAKB 1JAHA 3A06A 3I01M 1LS6A 1LI7A 5F76A 3VZDA 3CRVA 3CINA 1NVXQ 3KTAB 1U5BB 3DPUA 1XZDA 1Y7TA 2YBEA 2FCAA 5L4LA 3KV3O 3GGSA 1Y9JA 4IY1A 4TXNA 5EJ2A 3JQ8A 2JLYA 1JF8A 2CFIA 3EG9A 3K2BA 1ZVMA 1ESNA 1JG4A 1U2SA 1YR3A 1T5HX 4UHBA 4YY3B 2OGTA 3V4ZA 3WMEA 2QU8A 3R9WA 2BBOA 1LSUA 2C5SA 3M5CA 4TLMB 3SFTA 4HRAA 4YRGA 4M53A 1KERA 1S8NA 1XHFA 3DVRX 3RAEC 3LUFA 2CT8A 2J3KA 4CYMA 1R64A 3IP5A 3FB4A 4IQ0A 7GPBA 4JI5B 1MQAA 2EZTA 2KX7A 5H70A 1ORTA 3HJCA 1GNLA 3TX6A 3DOCA 3VJMA 3G2HA 5BP7A 4G63A 4JVNA 2Q1YA 1ZICA 2XD4A 3EVEA 4FKBA 1NUPA 4TWIA 2AKEA 1ESMA 4FE3A 4DJEC 5CFPA 4YJ3B 1RFGE 1QHSA 3W5HA 4X7BA 3ISJA 3AV0B 4U8HA 2HYDA 3L05A 3OY2A 5E0KB 4G5HA 3EXHA 3R7FA 2P8SA 1BNCA 1BX1A 3LZDA 4DZRA 2EDAA 1P7PA 3QBJA 4U2DA 2V0NA 1CVLA 2VTDA 3IB6A 4NENB 1F1JA 1WO8A 3DO6A 1GHTA 2C99A 3FKSA 3ABSB 5J5CA 4ZK2A 4MS3A 3VPCA 1PJRA 3PS9A 3TRJA 2ECKA 5HCUA 3SYMA 2MMGA 4UM9D 4U9HS 2R7KA 3KL4A 4JGBA 4WFKA 5BV7A 2J3QA 5J4HA 2D1SA 3MTJA 4YDHB 3E9DA 2GA9A 3OQHA 1SCBA 1U0OC 4KIJA 5AHRA 4EK9A 2ZVPX 4LYFA 4XGKA 1WXFA 3PEUA 5DP1A 4CM4A 4V0SA 5MDHA 5MFPA 5K03A 1VIVA 5JQGB 3TGLA 3W0LB 1YK1A 4DFDA 4BECA 2R25B 1WQ3A 2WKRA 4QTXA 7YASA 4N6OA 3U0BA 3MGAA 4UQOA 2PTHA 3U7IA 1WL8A 1P6QA 1LDEA 2O2DA 3RVNA 2NYRA 3CLKA 4CPDA 3W7BA 5ANRB 3K5IA 1R4MB 4RKRA 2BFCB 3V00A 4G67A 4M3NA 4RTPA 1J5EB 1KZGB 1RAEA 3MIIA 1JH8A 1IK6A 3AJDA 2W37A 1MOSA 1KI1A 3CUVA 4B3FX 4TWAA 2OZLB 4CNBA 2V97A 2WSIA 2QM7A 3BRCA 3W4IA 4QYIB 1XEAA 4H7IA 4O2BF 4DMGA 5DM60 3QE9Y 2V9PA 4GVPA 3FR8A 1NW4A 5CW1A 3LPAA 2R6AA 2BL4A 3KE8A 2RH8A 4JT9A 1ODLA 1VMKA 4KU4A 5E3HA 4IGIA 4DDVA 2I78A 3G5AA 3NGLA 3ZBPA 3B70A 4ZCPA 2DWOA 2VXBA 1OMOA 3CVJA 3LLVA 2BUCA 3UFXB 3CF6R 3DCJA 3JASB 2OCKA 4N3NA 2W42A 1TJ5A 4Z0PA 4DSUA 4ZHQA 1K92A 3OG9A 3LYHA 4U02A 1WVMA 3GOQA 4Z3OA 2GSDA 3B1XA 5TS3A 1J4AA 4MYTA 2P2LA 4KGDA 5K6AC 5KTRA 5G4KA 3B1JA 3D5EA 4C88A 1N3IA 4KXQA 4MQFA 2D2VA 4ZQIA 3VYSB 4V1CI 4EY6A 3QVLA 1AJEA 2J6CA 5H83A 1P5ZB 1AE1A 3WLFA 5BR8B 3I30X 1T13A 2DBRA 2FH5B 4P35A 2ZSUA 1KK0A 4E22A 4B2PA 3BOSA 4R41A 1IAQA 4DIMA 1ULUA 1KTVA 4YIKA 5JYBA 4XX1A 1RI2A 1U8TA 2GVNA 3TD6A 3V8PA 4E08A 2HBRA 5FBHA 4KBFA 3VC3A 4WOBA 4AWXA 1PW5A 4AWBA 5KYNA 3AY0A 2WP0A 5FBRB 2FZCA 3QFRA 1GUBA 1OFUX 3BXHA 3KHTA 4CV2A 1F7VA 1E77A 5D5HA 1Z5OA 1V5WA 5J5VA 3DKKA 1Q0ZA 4D42A 2HU5A 1Y8QB 1RXIA 3RYFB 4D5EA 1C41A 1YJQA 2FSFA 4M0MA 5E6RB 2H1SA 2PQ6A 4I4CA 5AUNB 1N1MA 4RS4A 1CUAA 1F2UB 1Z28A 1NM5A 2H08A 2IZOA 2QVLA 3QXGA 5UKDA 5CJPA 3PX2A 4KAAA 5KC9A 1PWHA 1RE1A 1E60A 2QX4A 4NMMA 5E2IA 3LOPA 4CRWB 5B7GA 2BIFA 4P53A 1JQ5A 1E5LA 2XGJA 4MUHA 3L6EA 3KSAC 3KPYA 1LBTA 2D74A 3STXA 1FTNA 4MUFA 3SVLA 4GNKA 2C9ZA 3HPRA 5KQLA 4CCYA 1BWQA 2RHJA 3I92A 4FI3C 1UKZA 2WJHA 4GXNA 4I1RA 4HEA1 5DBIA 1NQWA 2WU4A 2AL7A 1ZUIA 1LK7A 2A94A 3CURA 3JQBC 4TPKA 3I8XA 4OHVA 2K7FA 3PWTA 3B2QA 2H0QA 1U1GA 3MGKA 3MMXA 3NHMA 4LUCA 4ID3A 4YDRA 5FNVA 1PD1A 2H85A 4X3PA 4D3YA 2R1VA 1CZHA 1EFDN 1X1CA 4RIIA 5ELLA 4B31A 2NZWA 2PSDA 2KBEA 3GPCA 2QW0X 3CF0A 4MV7A 3WYBA 3ZW7A 3ZCTA 1G38A 5KMGB 1D2HA 1YDEA 2QSYA 2Z5FA 1Q1ZA 3FR7A 3I4CA 2VSYA 1QPGA 3H3JA 4QRDA 3PNMA 1P2GA 4PG8A 3EXIB 4G0XA 2WAYA 1LFAA 1PV1A 1O4WA 1XQWA 3OFSA 3C4VA 3PWZA 3EEQA 4HH1A 4HNGA 4P81A 4L73A 1PJQA 1M0SA 3RVPA 4HG2A 5M04A 1JEAA 4AN1A 3JQAA 3VR5A 3ZYCA 3GRYA 3N8KA 3GD5A 1NN0A 1YRHA 3FYHA 3BGSA 1CQXA 2N3ZA 3FDZB 3OIUA 4ZYTA 2KM1A 3ENVA 1EZ1A 3IPCA 1Z0IA 5K8VA 4PAGA 3VR3D 3SR3A 1QHIA 2NU8A 4DOMA 4NCKA 2G71A 4RVHA 3WLMA 4UCXA 3L7DA 2PCLA 5LXTA 3OIWA 3IUNA 3CWZA 3MYRA 3AYZB 2VHCA 4ZEVA 4MVJE 3B78A 4POOA 1SQSA 4R51A 3UEOA 1MBZA 2WJYA 2R79A 1Z0JA 1K75A 3GFVA 3IIKA 4J7UA 4F6RB 1RM0A 5CX1B 5IXSA 3UMFA 4B17A 2BFDA 4BTLA 2H1OA 1LXCA 2RKWA 1PVOA 4UKDA 5WRFA 3LLSA 2ZUTA 4QJBA 2H0AA 4RVFA 3QWFA 2IY8A 5CAEA 3CEJA 1OWPA 1RAAA 3BGIA 3GT4A 1WPRA 3RYIA 3GBPA 1JPJA 3O95A 3QI2A 4WH0A 3T7TA 4EHKA 3FUVA 2YHUA 1N75A 4ZI7B 1C29B 1VPVA 4Z4CA 3FTPA 5REQB 1ENZA 1ZK4A 2C20A 4Z4HA 3DE7X 4YO7A 3SEZA 4ZVQA 5KDOA 4BTVA 5KI6A 4XM0A 1FMFA 1Z4JA 1SUBA 2OV3A 2XNCA 3ORHA 4ISCA 2FZWA 3ORSA 1D7OA 1LBQA 2QGNA 3EVBA 3GGDA 3OKPA 3Q4GA 4LYAA 1OLUB 4TS3A 5DN6A 4EW6A 4N5MA 2GAFA 7ABPA 3WICA 5HZGA 2YJGA 1KK3A 5BMOA 5EFZA 4XD7A 2XCLA 3DMTC 3OUUA 4BZZA 2RGCA 2J9ZB 1QJCA 3DV2A 3IUSA 1I8TA 2F3QA 3GPLA 2IC5A 3SF0A 1NW8A 3DWFA 1Z4QA 1P1CA 3IBGA 1CVIA 1RZVA 3VR4D 2NT4A 2GEKA 2MT9A 4BB0A 2ZI7A 1AQIA 4IGFA 2WA1A 2P41A 1RTTA 1NYTA 1V2GA 3ZY5A 4FBMA 4LJSA 1Q1NA 2Q62A 1EP3B 2IEBA 4CM3A 2OBLA 3OZRA 4WKBA 4ZU1X 5TLSA 3R6LA 4EG3A 3DQPA 3I83A 3P5BA 5KYWA 4HWGA 5JZVA 2PVPA 4FU0A 3UMBA 1B73A 1VSVA 2QVYX 3BD7A 3MWYW 3P9KA 4OKNA 4DA6A 1NG9A 3T1VA 2B35A 4JEHA 1ZS9A 3JATB 4EJ0A 2PYIA 3ODGA 4MVJG 1JDTA 1V5EA 4MWTA 4C0BA 5IDWA 5CD1A 3X1JA 4B82A 2EW1A 1E2UA 1CJVC 1VCOA 4DC1A 4DMMA 4DR7B 3R9XB 3OQ6A 2YWJA 4LOJA 5DHAA 3IUYA 2FK7A 1VKOA 3QKTA 5GZ6A 4PLTA 1L8QA 4MQ6A 4QNNA 1DFIA 3B9BA 3IESA 4MVWA 3RU2A 1E3SA 3Q8LA 2IUUA 2Z2JA 3BH7A 3KXLA 2GRJA 1JKFA 2ZR8A 4RJ2A 5D51S 5H68A 3WL5A 1QGDA 2XB9A 3NBQA 4X3CA 3F6YA 4EY3A 2I8CA 1JJ7A 4QGGA 3WNBA 1E3DA 1E0KA 2VL7A 4HAVA 4A8HA 1J7JA 1YR9A 4YV1A 1MN6A 1QXSA 3ZJYA 4ZP1A 1JEYA 1FFCA 1GAQA 3KB8A 3HV0A 5D3KA 1GPDG 1M34A 5NLLA 5DT9A 2DKOA 3EOBI 4R40A 3I6QA 4RELA 3A3PA 3STUA 4DIFA 3C85A 1NUAA 1PJSA 2GCGA 2W6MA 2YCBA 2ZAOA 4J0KA 1YU9A 3WAGA 4O3MA 2B92A 3BIFA 1SAYA 4PYLA 4WCFC 4NL4H 1XXHB 4IWNA 1EVIA 1PDOA 5BNTA 4B5LA 4WLEA 4RY8A 5JSQA 3DONA 4FMPA 4GEKA 4Y0VA 2C98A 2H3HA 1S02A 4MR9B 2BGKA 1TK3A 2F1RA 5K0TA 2XEXA 5IT5A 3P9IA 4GBMA 1TQDA 2P6MA 4MQEA 5T3YA 5LWQA 4JP8A 1R5NA 1SMKA 4XXHA 3BSWA 4IO1A 4NBUA 2BV3A 3RS0A 2B4AA 4JP1A 5C5DA 2Z95A 1QIIA 2RI1A 3OHSX 1QYWA 4YYZA 1KARA 2GJSA 1H6BA 1WR8A 3RWBA 1UJBA 3D6UA 1KSGA 5FNZA 4DIUA 3VR4H 4RKEA 3TTTA 3VKVA 3RS7A 1UC4B 3FFWA 5BOSA 4EHFA 4GRDA 5DRTA 3S28A 2WYWA 3FPFA 3AIKA 3IDQA 3K72B 5EY5B 2V98A 5IYZF 4CGYA 4COOA 4KXVA 5F9FA 2WIGA 3TBHA 2WT8A 4PBRA 4F4UA 4MDFA 3GGCA 4QLOA 3VNQA 2ZI4A 4RF4A 3ZIUA 5IHPA 1KEKA 4O59O 2BFAA 3AJ8A 4XVQA 1CLUA 3WLQA 1XD8A 1CX9B 4FFSA 3IUBA 1W5TA 4PGFA 2E4AA 1KETA 4JNCA 5EP2A 4M1OA 4FOLA 1Z5WA 3ESQA 1WP4A 4TMFA 1QGYA 4PAMA 4KN6A 5A62A 3SDZA 1WE2A 4N03A 1IXKA 1U2DC 1Y3IA 3FZEA 3F1LA 3G23A 5IBRA 1T6YA 5T5QA 4BQPA 4QOHA 4DCSA 4PG4A 2PWBA 4AJHA 4KKXB 4L16A 1HG1A 1XQVA 5AXAA 5IW8A 4C7MA 1Z73A 2ILVA 5T6MA 5EJ5A 1R6BX 1OH7A 3LL4A 4QRHA 1D8AA 4RACA 2QE7D 5CD9A 4QEDA 5LB4A 3M82A 2ZJ2A 3VV3A 4BFSA 4CDGA 3R0ZA 5JHGB 1IXRC 1F8XA 2QMQA 1RBMA 3CONA 3O4VA 1Z3IX 1H23A 4G0MA 4YNBA 4BLRA 2O7NA 4JYMA 5COQA 5COBA 1BOFA 1JDPA 1K8RA 3HCCA 3G6KA 4V24A 1VJRA 1UPXA 1BHO1 3IVMA 3BDVA 1C9JA 3VOTA 4KLNA 2ZRGA 5EA2A 2XOKD 1PN3A 1HDIA 4CUZA 3I5AA 4QXRA 3DDCA 3GYGA 2GTHA 2VF7A 2B98A 4K8OA 1AZTA 2F8MA 2QRPA 4RJIA 5ALJA 5DXAA 2W2NA 3ZDRA 3LT0A 3ZI0A 3H75A 4UBOA 2QJFA 2ATEA 2RMKA 3QY9A 3LG2A 4L4UA 4Q7JB 2FP4A 3F2VA 3ORRA 4ND3A 2H5LA 4H3SA 4HQOA 2X8JB 4IDDA 2Y2VA 1J00A 3WYDA 4JBXA 3ZXSA 3E23A 2G5GX 5LBTA 3VUEA 4E31A 1N6LA 1QMGA 1PUJA 4IH4A 4FEAA 3W5DA 3MD0A 2AZDA 3OQVA 1ZMOA 1TCCA 3I1IA 2UUPA 1JJFA 2D2IA 2NXNA 2V9CA 4V39A 3N2KB 5AKIA 1B00A 2P9ZA 1PFUA 2HL6A 2WAAA 4XKJA 5FTKA 1QCZA 3A9CA 3H5VA 2CHEA 2QUBA 4HWRA 2QSUA 2XRMA 2YV1A 1KRHA 1U7HA 2X1VA 1P75A 1JR3E 4RLSA 5I4CA 2Z5GA 3JARB 2JHGA 1KAMA 3U1TA 3NTUA 3RARA 4PIPA 3SI7A 2EU8A 2WU0A 4HGNA 4LOHA 4Y18A 1IM5A 2R3SA 1WZUA 4RE5A 4B3GA 2VTVA 2DPGA 3EC7A 5BUZA 1QX3A 3FGNA 4Y9SA 1T8RA 4M9UA 1EIWA 4N48A 3EF0A 3GVCA 2HYIC 4YRSA 5LQCA 2OCGA 4N3BA 1TVKB 3CZAA 4OYHA 4MROA 1SA0A 2ZQYA 4RF3A 5I45A 4NMXB 4ZOQI 1O58A 4O4JA 2WYOA 2XVAA 4EHAA 1WWKA 1BA2A 3K0EA 4LVCA 4LF6B 4ZFNA 3K53A 4B32A 3UOWA 3EHEA 3G0IA 1YTLA 2ZSJA 4ZJYA 5IBQA 5JXGA 1FFSA 1EA7A 3LPMA 1V95A 3DF7A 4E13A 3CV3A 1JEJA 1MABB 1ORIA 4WFJA 2ZWMA 1USIA 4EMBA 1YNSA 2VSFA 3G9XA 2QRVB 5KDLA 3SQMA 1ZRHA 4FDAA 5M29A 5KYGA 1C0PA 2CW5A 5BVHA 4A91A 4I4TB 2EW8A 3CZPA 2XF2A 4LFAB 2BYTA 1ZOPA 4D98A 2H1CA 1HQYE 1SWWA 4B34A 1XZEA 2FN8A 1GXSA 1ZUD1 3E7PA 4QUBA 1FRQA 1V8PA 2P4UA 4DBZA 3U5ZB 4Z7JA 3RSFA 3NH6A 2BHNA 1PE0A 4RQTA 3OT1A 3TR6A 1XDBA 2XE6A 4UMEA 4LHVA 1D9ZA 1P6XA 4GPEA 4P6VF 4HB4A 1XTKA 1FBTA 2FZGA 2NXCA 1B7GO 4W5JA 3DEIA 3Q41A 1QZ3A 4AJ9A 2M2IA 4QBTA 4RHXA 3T1OA 4GGPA 5B1HA 1E7WA 3VPSA 3MOGA 5CCBA 3E9YA 1RACA 5E9AA 3A6HA 2IPLA 4Z9YA 4DC0A 1PLJA 4LDNA 4MRNA 3RSZA 5I9TA 2DH6A 4KBYA 3T9FA 3ZWDA 3KK0A 4OG2A 3QEOA 4M1ZA 1AX9A 1SWVA 1Z0SA 2G1JA 4DM4A 4AJ4A 4ON9A 2WTUA 4JYAB 2B8NA 1SK8A 5DCYA 3VKGA 3AFIA 4Y2SA 1HA3A 2J5XA 3PUYA 3M4JA 2AWOA 1AU9A 2O0JA 2F4NA 3A4YA 3NFRA 4I1VA 5DCWA 3TRHA 4Q4AA 2R8XA 4DCNA 3EZ7A 3GNLA 2RHHA 3IXMA 4C0QC 2VH2A 3VV2A 3KQTA 3KOWA 5CLJA 1TKBA 2H4FA 1SHLA 2J08A 1RM4A 3KJNA 1KU6A 3DFZA 2ZUBA 3FCEA 1DVRA 3AW9A 5FBZA 4WESB 2ATCA 3EGIA 2A1IA 4E3ZA 5AQ1A 2VAMA 2OV2A 3RVKA 2BF7A 3ZNQA 3AM4A 3CTPA 3EVCA 1UFQA 2FSUA 3M6IA 3IUQA 1O6BA 5EWMA 1KJWA 4KJZA 2AD5A 3V9PA 4E4TA 2ACWA 3OEED 3ZE8A 3PL5A 3Q0IA 2GR9A 1R50A 1TYZA 1YBHA 3N2GA 4XQGA 5AOVA 5B6PA 5K2OA 4OYLA 5JADA 1NUQA 2B8TA 2J7KA 3DE1X 3H5WA 1T1RA 1ULSA 1N1DA 3I1YA 3IMFA 4M9SA 4MLCA 3WVNA 4AQDA 1T9ZA 4L0DA 2PKQO 1PJZA 2V1UA 5B58C 4L8YA 2B4QA 2EKQA 2FMFA 4LRTB 1LJUA 4ZRDA 5DHTA 1A5TA 2EP8A 2YQ5A 5BSEA 5FV4A 3L5KA 1YE8A 3MCTA 3FCSB 4KGXA 4RFLA 1XZQA 4RGVA 2Q5JA 2PUGA 4KL8S 3RHTA 1WEHA 3U19A 4EATA 1XUOA 2AZXA 1N2OA 2QGFA 3RSOA 4OHWA 1G59A 4XASA 3IEIA 5ULLA 2G08A 4MHOA 5KU1A 1JHVA 1I0LA 5GONB 3U4CA 5LQAA 3SM3A 4URYR 2EBWA 1W88B 3NHFA 1PFGA 3MJCA 4FUQA 4AFNA 1LDGA 3CVVA 1Y3CE 3DZFA 1GITA 1U2RA 3G2PA 4CN9A 2JAOA 5JU6A 2ZYWX 3IVRA 1ZCFA 1HTBA 1RMTA 3PDJA 3DBRA 3GH3A 1GN9A 4X9XA 1B23P 1UEXC 4N7RA 4RH0A 3P2YA 1A2OA 2I22A 6PFKA 1H4VB 2QR3A 3HN6A 1GZVA 1O57A 3ADKA 1JAXA 2P2DA 2ZE5A 3FNFA 3D7KA 3Q7QA 3QOYA 4PIMA 4UHEA 1Z47A 4OHUA 5FPTA 1L4MA 2MMCA 4HFMA 1C4KA 4ACAA 2WMDA 3OTGA 5DHPA 1GCAA 1GSOA 2ZK7A 3H2GA 4PX5A 4F85A 1UIMA 1UMBA 4UCFA 4KQMA 1KY2A 4ZI3A 1LA2A 4TLAA 1V3UA 4MVJA 1JR6A 2Y1DA 3MAAC 5FR2A 4EW2A 4AG3A 3I6BA 1VLQA 2I4OA 4YCDA 4MS1A 3DV0B 4ZIRB 2ZBVA 4UU0A 4C78A 1R4NA 2I0FA 3CJRA 4Q4HA 3WLJA 1HI9A 2XYPA 3BK7A 4BJHB 1IVNA 5LN1A 5JIBA 3U6BA 3HYSA 5F5LA 3WX0A 1GTJ1 3KQSA 3OESA 5AH0A 4JKOA 4Q19A 1AS3A 3WWPA 1SVOA 4M8NE 3IA7A 2J5QA 5I3ZA 3DLHA 1SKQA 5M2QA 4JJKA 4O6VA 4CLHA 2GF9A 3FMVA 1DC3A 1ZMBA 3DPIA 1KMQA 3MRSA 1CD5A 4QBIA 4R3WA 1L5NA 1FMTA 1GTRA 2BR5A 1ISHA 1VP9A 3GCZA 4PAQA 3RS5A 3AEZA 1FMJA 3M6WA 1QRSA 1FPQA 1NATA 3JTEA 2IZZA 3V9AA 4GUAA 4YUXA 3PC8C 2WJZB 3SZUA 5ALWA 2WWRA 2FDCA 2OCYC 4N41A 1VB3A 1X3LA 4DANA 2EFDB 1F06A 1XN4A 2AOTB 2C7OA 4CIBA 1X7GA 2BEJA 1LPMA 2W2MA 1VXOA 3Q6NA 4IIJF 4P34A 4RSHA 4WQMA 3VI4B 3Q98A 4B9AA 1CVRA 1TTQB 3CQ9A 1PAUA 3REGA 4X8HA 2W8ZA 1QHNA 4XGIA 4WXPA 1Q2UA 2JLVA 3HRKA 3OFKA 1JIKA 4Z4IA 1GNTA 1S01A 4IHJB 4XYEA 1DSSG 2Q3CA 2L0XA 5DHFA 4Y1RB 1VJCA 4J91A 4AECA 4C2UA 2Z6VA 3ZWOA 1EFCA 1Y8AA 3VH3A 2FZ5A 2QTVA 3LP6A 4DE5A 4QOEA 5I9IA 4OMDA 3QSYA 2WFMA 3GH1A 3B85A 3ZPXA 2BCGY 4RTQA 2NU6A 4KX5A 2IDJA 2NV0A 2VG8A 1JFRA 1IQPA 3MTIA 1NJ6A 5CPBA 1CJKC 5ENDA 4D3DA 5EJEA 4K5QA 2GERA 2VSQA 1GTZA 1KNXA 3FFBA 2XWBF 1PNRA 1F7UA 5CB4A 2OT3B 2RG1A 3NJ8A 3C3AA 1I13A 3HB5X 3O4HA 2DUWA 4DDUA 2O2XA 2QPOA 2BH2A 1BVYF 4JJ8A 1KKMA 3D4PA 3OOWA 1YQ9A 2CUKA 1J5PA 1UPBA 3OZEA 13PKA 2PKYX 4WNYA 4WZBA 5KWVA 4HSGA 5ESRA 4KRFA 4K1LA 4NZ9A 1KFKB 1Y1TA 5CT6A 5KJ6A 5A05A 3TD9A 5EUQB 4YRBA 3ENNA 2ADFA 3ZNPA 4DKJA 5LMZA 3FA2A 1V1MA 5IM4F 1QPZA 2QBYA 4BO1A 4OI0A 2G5TA 4O1IA 3ROXA 1FNCA 1Z75A 2PX8A 2HU7A 2WABA 1IBKB 1CUVA 4XRRA 3KG2A 2MR5A 4MXDA 2Q4OA 2V54A 1JLSA 1G8JA 5ALXA 3OQJA 3W8RA 4F5YA 2ZZMA 1TEZA 3MGGA 1KR5A 3DDUA 1XZCA 1GPAA 1UFKA 1IY8A 2HX1A 5L3SB 2RE8A 1DV2A 3CUWA 4FC6A 4A8JA 1SHKA 2UZIR 1O95A 1UUFA 2H1FA 2IUSA 4KWEA 4XIFA 2QI9C 4BOYA 1UJ2A 3B1KA 1XZBA 3QSGA 5DBFA 2P9CA 1Z15A 3NHWA 3TXAA 5KNDH 1Q0PA 2Q3LA 2YOGA 2C00A 2JFUA 4UM8B 2H2DA 4YAWA 4F04A 2JJ1D 1IFXA 3H9EO 3R6TA 3F46A 2PMKA 2P3LA 3DL0A 4ENTA 2JAWA 5ER9A 3E8SA 4IIUA 4NE7A 5EKUA 4WLNA 3BMNA 4DMUB 4J4BA 3LT4A 5LZ9A 4KR0A 2A59A 3LA8A 5HFAA 4QXOA 2FZVA 3I76A 4S2EA 1V8ZA 2GFQA 3WQSB 4CF4A 4EPTA 1K4MA 4BKOA 2FFRA 6LDHA 5EIXA 1UT8A 5BRNA 1QONA 4L0QA 5SYMA 1K7CA 5C7LO 5CVTA 3TMYA 4OB6A 5ADVA 3HS3A 4PRLA 1NJ5A 2Y6VA 1UXIA 1KFJB 1A3CA 4CEJA 1GAWA 3I9MA 3AY7A 1XLWA 1UXHA 3GEEA 3JVEA 4GC9A 3P2JA 4DUYB 2AN3A 1OAOC 3LQQA 3UG7A 3DE0X 4PNZA 1GEEA 5FFNA 2PQ2A 3IL2A 3WFJA 3LWNA 4AM8A 1QQ5A 2VRCD 4ZN6A 4RQBA 4A0RA 2VDWA 3HR4A 4W1QA 1E1QD 4BJ5A 3IVCA 4JNKA 1NQAO 3O93A 2O7RA 4GI3A 5FLEX 5CCDA 1XTZA 3P9SA 3T06B 1NU6A 2NXWA 4DSZA 1VLZA 2OKGA 2WIBA 1SUCA 4ZEWA 3UO8B 3NAGA 4K9RA 1MDFA 1FVHA 1J56A 2IIBA 2JFGA 3L7LA 1C3EA 5HF5A 5KQPA 2XR1A 3EXEA 4NLLA 4A6XA 5CDYA 5L6MB 1XJWA 2HQRA 2ISQA 1MU0A 2OHOA 4BKPA 5I8WA 1BRTA 3Q72A 1N2CA 2EF1A 1CJTC 2FA9A 2V1XA 3BMCA 5JAHA 3SYLA 1Y4DE 4I1YA 4MUBA 4FLMA 1WLSA 3CPHA 1TI7A 3AY3A 3CW2A 1XO1A 4V02A 5IZ4A 4LXIA 5ITZB 4RMHA 1XAIA 3NO4A 4LVUA 1CRWG 3HZHA 3L7MA 2HO5A 4HD8A 4M0DA 4MV4A 4BLQA 4IS3A 2A5YB 5DNYB 1X8JA 2VJMB 3I9FA 1S96A 1I3MA 1ODSA 2FOXA 5DULA 2IOFK 2VATA 2HDNB 4D92A 1N2BA 4EEKA 4CMEC 1ACLA 2FAXA 3U7RA 3C6MA 4OXKA 2BFWA 1G8GA 3U7FB 4ESEA 3G7UA 1FU4A 1DX9A 1RRPA 1EGVB 2E3JA 4R4JA 5ALLA 3RBZA 3WLHA 1W4RA 1T15A 5JCZA 5A71A 2GUWA 1VZ2A 3REQA 2K87A 3G0BA 1WBBA 3JZAA 1M0WA 3EA5A 3TIIA 2FMTA 4F5ZA 1EFVA 3FBGA 3E03A 3EOAI 3ZDEA 4B74A 2GZMA 3KQLA 1M6WA 2FZ4A 3ITKA 4EECA 5BYBA 4PS0A 4W1PA 3FBTA 5JSHA 4LYGA 1ES9A 2FVYA 3A28A 2NPIA 2ROQA 5DYTA 3G1TA 5EE9A 1P5JA 1U28C 3KUDA 3OF3A 4PC7A 4ZXPA 1EVLA 5K0JA 1U9IC 4P83A 1OUMA 3GXBA 1CDOA 3TR5A 3C3MA 1JG2A 2HA5A 3JWEA 2ZJOA 6CHYA 1B0PA 2BFFB 1ADCA 1DIBA 5E0OA 3ETEA 2W70A 1G20E 1P0IA 1A7UA 2B7LA 2O2CA 2XXAB 4D6PA 4UREA 4TMTA 4CM1A 1MV5A 1SCNE 4AZVA 4YX9A 1VYVA 3E9ZA 4LC0A 4OYRA 1MRNA 5FLKA 4E15A 2WTXA 3OLVA 4K88A 3LHIA 3GLIA 5A1TA 2R8PA 4Y2XA 4CEIB 4HN9A 1PGJA 4MRPA 3SD7A 1YF3A 2EG9A 5EZ5A 3U62A 4BNDA 3TW8B 4UTRA 1VSTA 3RRXA 2X13A 3WGNA 5IJ9B 4BQOA 2QSJA 2JFWA 2XB4A 5JG7A 4EKGA 2PIDA 5DSXA 1T2UA 3O7MA 1ZLYA 4TRMA 5DFAA 2YYYA 1SC3A 3NETA 3BFJA 3QKUA 4M0CA 4CCAA 3KOOA 2X42A 2HMYB 2IOQA 4IPTA 1I7QB 2C04A 2O19A 1GILA 1M6YA 1X7WB 5LQSA 1N5DA 3I8SA 2XCQA 3BJIC 4KPUB 2DHRA 3LE8A 3T9AA 1J8VA 2NZ8A 5FRDA 2BCEA 1IXSB 1DOHA 3M8KA 4E5DA 2PUAA 3S0JA 1ECGA 2PR2A 4JQSA 3EC1A 3DUFB 3EOZA 3GUHA 3H04A 1EWTA 4LWPA 3GPBA 2JHFA 5KTOA 1BDMA 1KVQA 3X2SA 1LBIA 5BNFA 1NVVQ 2NU9B 2XVXA 3KLNA 2MSEB 3WE7A 3LUJA 4ABTA 2OVFA 5IK2D 1RU3A 5KUTA 2P91A 3SIWA 3UAYA 2YS7A 1X92A 1AY0A 1BEUB 2JRLA 3DLTA 3FJYA 3R09A 4XH9B 4LZZA 2XWJI 4RA6A 1QC5B 4L4ZA 4WJLA 5I9BA 4LHXA 2WD9A 1VBMA 1E6CA 4ESOA 2MYNA 2NMVA 3BAZA 1A8HA 4OQLA 2A58A 1U63A 1G8MA 1JEOA 3AIIA 2OXIA 3EB9A 3ZE2B 3T7KA 1VFPA 3WSVA 3C1OA 1PX2A 4QVKA 5FO1A 2FJUA 2FN4A 4NESA 5KSWB 3F96A 3IEUA 3PNVA 3OAAD 4MMZB 3KZCA 3MWDA 3OM9A 3HN2A 4TXJA 1RE0A 2R4TA 2CVFA 2H1LA 3VU1A 3ZZMA 2BBSA 4HWPA 4Q1VA 2FU5C 3WXMA 3BCUA 4TRNA 2BZ0A 4YMSA 3DMPA 1RRMA 5EHGA 3BHIA 3TOCA 2H4ZA 4GOLD 2O14A 2X14A 3F67A 3SIPA 3A6KA 1Z12A 2I5PO 4J0HA 3MBIA 3NHJA 1N4DA 5A3RA 3SX2A 3SLKA 2O1WA 4O08A 5LBUA 5AMXA 3CRRA 5TRTA 1JNXX 3FPSA 4QD3A 1EUCA 1NULA 2RSLA 4H4EA 3C41J 4XQ9A 1W93A 2D5BA 2VYNA 4MINA 4Q47A 3A10A 4PTZA 5IANA 4BMOB 4CBVA 2Y8EA 1C3JA 5EP1A 4F9FA 1U4NA 2ACVA 2GH1A 2CDCA 2PBFA 3GN1A 4TLDA 2HFJA 1T1SA 2PRJA 3HBFA 3ZYZA 4QKQA 2EL9A 1AMUA 1SELA 4W5HA 5KYVA 1ODCA 4EY8A 3A26A 3G2OA 1N2SA 4Q1AA 3LCVB 4I5FA 3X3HA 2PX6A 3OQOA 2P62A 3E3MA 1VRCA 2V7TA 2R1TB 3CR8A 4PYIA 1IM2A 2FLKA 4JQCA 4I5DA 5H9VA 5JE8A 3WHLA 4YUAA 4Y2YA 1TYBE 2GF0A 4RTRA 3LOQA 3ND7A 2HIAA 4QYSA 1X2EA 3S2SA 4S0XA 5FR1A 1QTNA 4R3NA 2JFBA 4KFSA 3G8DA 4CM8A 4DAEA 4MR7A 4J0GA 3HJTA 2VQ3A 1SXJA 3K09C 1JQ3A 4TKLA 2J9XB 3FOCA 4P4GA 3IQDB 4RV9A 3HZZA 1FW6A 1Y9DA 2YYZA 3L1VA 1OYYA 1RXSA 1PNTA 2W6QA 4NC9A 4OOEA 3W5BA 1O2DA 2IEYA 5EP3A 5B53A 4LWQA 5B3KA 3D0RA 3VNSA 2C5AA 1N6PA 1B2RA 1HYEA 3HYLA 2XVYA 3AVPA 4JU9A 3OOHA 1FVFA 2P4QA 2WNHA 3P0EA 1XNGA 3DPSA 3GNSA 4RXUA 4UULA 5TNXA 3VRHA 3BE6A 4RSRA 1FU8A 1LI5A 1CZUA 3I2KA 3U37A 1YA4A 3EEYA 4Z9FA 4L1KA 1BJRE 4Y2TA 4YRIA 5KVSA 2FEAA 2RAFA 3Q3CA 4PGMA 5BNIA 2CBZA 3RSCA 5C37A 3ETHA 1EFTA 4AMVA 2XQVA 4TVOA 1DBSA 3IIEA 4KQKA 4Q3BA 4AKGA 3GLTA 3KLOA 4KR6A 2I65A 4JIMA 1APBA 4BDSA 4JXJA 4X84A 1JTVA 4WOCA 1E9DA 1K7FB 1Y3AA 2G4LA 4PCLA 3P0JA 5T3UA 2OA0A 3VOSA 4YJHA 3LNTA 4XTCS 4C6SA 1KEPA 1JBQA 3AVYA 4C4XA 5BN3B 5HX7A 4J49A 3UH0A 4DXAA 2E55A 3K3PA 5F7XA 2NVWA 5EKSA 1L6IA 3U80A 4KSBA 5C8YA 1M1ZA 5CT4A 2H1RA 2VDOB 3NOOA 1CS0B 1IYZA 5E9JA 5TQ2A 2AC7A 3V46A 4BV2A 1GJRA 2IS6A 2UVPA 3WMRA 3NTQA 3P9ZA 1LKZA 4H1WA 1ZJZA 1YZGA 4HB3A 5HK9A 2JCGA 3BEOA 4O2AA 2DHEA 2G9RA 3VPDA 1A77A 4MR8A 4FGLA 4TYWA 2AQHA 3OPYB 5C7IO 5AW6A 4Y1FA 1MX9A 4EKYA 2DERA 3DD5A 1NW7A 1MHPA 1MVNA 2P5TB 2ZJAA 1YCFA 1PZNA 3QENA 1BMTA 5DWVA 1GNSA 3A9WA 1R9MA 3N6VA 2XNJA 1WEKA 2C95A 5A1JA 1LBSA 5AJWA 5FTMA 1JA1A 5LNK1 1ESCA 2HK8A 5F2EA 1LLUA 1S2MA 2A1UB 4LI0A 1U1EA 3THYB 3RABA 1T2EA 4JVMA 2ZUUA 1E2PA 5E7IA 2Z08A 3B8HA 4BRZA 4CLOB 5C8VA 1XTBA 1KU0A 5JASA 1S4MA 4NMWA 1HDOA 4B6PA 3CIFA 3SVZA 3AXSA 3N70A 3QLUA 1X1TA 4AD8A 1DJPA 1ZIYA 1DBIA 5EPUA 3DFFA 5IF9A 2NNWB 4P4SB 1K86A 5A5DA 1G6OA 3BDAA 4J6EA 4A9AA 3NEPX 5ED4A 3EQ6A 5EKTA 1SBYA 2WD7B 1XD9A 4LX8A 2HDOA 1ATIA 2JLAA 2VUUA 4PLFA 3ZWPA 1KEVA 2JLWA 3HCRA 1JIUA 5JDIA 1LS1A 4FS8A 1LTHR 3CVWA 5KYXB 3V4OA 3ZDAA 2DM6A 4AG5A 4UAVA 2J3IA 1XTPA 1Y1SA 1QHYA 1QZXA 3BZUA 3OEWA 3OU7A 2I1LA 2NTJA 4DRYA 1XB2A 5CA1A 3NTVA 2VP5A 2VP4A 2A30A 4B7AA 4BATA 1XE3A 4LZWA 1OH5A 4LSMA 4RO0A 2P2GA 2D59A 2IEDA 2QRJA 4XM2A 3HMQA 2UZ3A 5IM4A 3ND6A 1JTEA 2HPHA 4BKUA 4LRSB 1NDHA 3K0HA 1C7ZA 4Y2QA 2VT3A 2R00A 4FD2A 5IN4A 3GG9A 1NJ1A 4X90A 4DLNA 5JY1A 5EXTA 1WXQA 4DR5B 2X8AA 1HE5A 3CNHA 4MQ4A 4Q3AA 3WIUA 1RWQA 2OYSA 3ABIA 4CL2A 1F2DA 3JZMA 2YMPA 3AVUA 3ELDA 3OIVA 1VMAA 3HU5A 4ENUA 5LKAA 1KS2A 1R5OA 2IYLD 3PQDA 4JBWA 1RAFA 3SYTA 3VISA 3TG8A 1EDDA 3BICA 3JYQA 5DI3B 5FLYA 1P4JA 2UVDA 3KPWA 3RQSA 4X1IB 3WGLA 3HTXA 2WZCA 2V6JA 5B37A 4I46A 2WF6A 3I72A 2DJ5A 4PHHA 4PLGA 3RT9A 3IGFA 5FEUA 2YW2A 4I8XA 3L0IB 4L27A 2DRIA 1HEYA 1K8ZB 1CETA 3A9UA 1NRXA 3M5WA 3OFJA 1QV9A 1IH8A 4H16A 4FIZA 5FH9A 4HWSA 4EF6A 5K3AA 5FBQB 3TLXA 1C3XA 1PFQA 4XJVA 5DI9A 5GM2A 1ISMA 1VL6A 3GZNB 3OZTA 1H8HD 3C16C 3G89A 2P0EA 2DULA 3DHNA 4YCMA 3R8CA 1M3SA 2I6GA 3RU3A 3LPDA 3GLGE 3EQ9A 3EWNA 3VAAA 4IQ4A 1OLXA 3WNZA 5JLJA 1HNWB 4P82A 3ZY2A 2YMQA 1PQYA 2B25A 4C3UA 1IEVA 4QGSA 6GPBA 4OXQA 4TTTS 5A6SB 3BE5A 5KX5F 3D3WA 3ON5A 1BMFA 1VCMA 3IOEA 3NIDB 3MTBA 3GLFA 1YL5A 3DD1A 1M2FA 2H3EA 2X0IA 4P7KA 2QLBA 2Z2XA 4FCTA 1M2NA 1VC2A 5I5EA 5BSMA 3L6OO 3R7LA 2IJGX 4IH1A 1Y34E 5IABA 1US8A 1CE8B 3GEGA 2CSXA 4LBWA 3N0RA 1XEXB 3R3JA 4J94A 1BS9A 1D2EA 2CD7A 2Z6QA 3KR1A 4TZ6A 1YDGA 5KSYA 3NC4A 1IN8A 3V7UA 3D4BA 4M6WB 4FQ5A 2I03A 3B3AA 2O6LA 2Q2OA 3VTZA 3OZUA 1GZUA 4BYGA 3G8AA 3KLBA 2HLDD 2NTYC 1BHQ1 1SHTX 1TTPB 2A0KA 2H2IA 1NNLA 1PKXA 4KMRA 5HSGA 3SHQA 2XA9A 3BEDA 5DPMA 4PLZA 3SNKA 2YRWA 3PE6A 2PSEA 5JO9A 2HWKA 1ZLXA 1E3EA 3IIMA 1YZKA 2VZ8A 1VCNA 3ZXUB 1XTTA 3HKCA 1Y1RA 4EMSA 4DY6A 1WS6A 3QELB 3T3EA 3LWBA 1ZOOA 3UAGA 4ERNA 3TX2A 3H0EA 5HS4A 3UYLA 4DUGA 3TLCA 1GU7A 4RF5A 3BCSA 2BR3A 1SOAA 5BR1A 5FI1B 1GRCA 1F4PA 2J67A 1VHTA 5E1OA 3V8MA 4N01A 5JT1A 1SQ5A 2RGEA 1YCGA 1ZHOA 1I2CA 1R1DA 4Y9DA 5JDCC 4EB8A 4NYMQ 4DCPA 5AM2A 4OUDB 4CDMA 4OM7A 5EE0A 5EJ8A 4MB6A 5KYYB 3LX4A 3RQIA 1YKGA 3K94A 4UXHA 3ZD9A 2QTHA 2PKEA 1JSLA 4LQCA 3GK3A 3PA6A 1P5HA 1L4UA 1U2GC 3OIGA 3UV7A 3U7HB 1T5OA 2JAQA 1JEDA 4DNFA 5B1DA 4X1YA 3KJXA 4EO4A 4PANA 3NNNA 3AEKA 1CIJA 3JQFC 2IOFA 3DFMA 5H9WA 3QXSA 1DTWB 1PTJA 2YV3A 3CNBA 3IELA 1H6DA 3T1QA 3DE2X 3WRVA 3V3TA 1EU1A 2VWGA 3M1YA 2P2NA 1CUSA 1MEOA 1HYHA 1UH5A 3N39C 2Q5IA 2I2CA 4EI7A 3R4VA 5KYUB 1P1KA 2D5IA 5ICEA 3EY9A 5HFJA 5AI6A 4ZAXA 4AROA 5DNWA 1ZGCA 4JDPA 5EGSA 3AFOA 1U02A 2Z1DA 1Z7GA 2ZRCA 3LQ1A 4Y9RA 2JG3A 3WOHA 1NAIA 2OLKA 1KH3A 2BBWA 3BJRA 5L4SA 3HXTA 4I5EA 4L5CA 2NSYA 3S2UA 3IE1A 1VM6A 2JLRA 1SFRA 1G8AA 1LLFA 3UHAA 3WK6A 4P3XA 1KWGA 3AHFA 4H7JA 3E3NA 5GJWC 1HRKA 2FNAA 4UHHA 2E5LB 1QE5A 3KR9A 1AIPA 4I8DA 3MSXA 4HZUA 4XJXA 2PX4A 5EHNA 4CGZA 3W2TA 2JFYA 5FJJA 1H5NA 3TSAA 5KBYA 1E79A 2WJGA 2DSTA 2VHTA 1A2KC 1SK9A 4PFJA 1A5ZA 1L5QA 4IOJA 4B3CA 2FOIA 5JFOA 5K8JB 3I37X 1F51E 2O3QA 3M49A 4L0CA 4YEDA 2GSWA 3VMFA 2RHTA 3R9KA 2XUAA 5CYFA 4J0JA 1YV9A 3L0CA 3UKOA 1SCUB 3RIGA 2BTEA 2Q6TA 1M67A 1WF3A 4H2DA 4XIYA 1CJBA 4CCSA 4FILA 3CUYA 5E9WA 3C3XA 2KJQA 1G0OA 2R85A 3D2LA 5K4AA 3UT6A 4AJ1A 2CWWA 3WMGA 3PKJA 4X7RA 1AO3A 1WMEA 4KX3A 4UVIA 4G07A 3J80A 3P2EA 2A4KA 3IBSA 4ZCSA 4RK4A 3GNTA 3IVAA 4OGFA 1IBLB 2C5GA 5HFNA 3D4OA 1PL6A 3N6RA 4B6SA 3JWJA 1H2XA 4EAAA 2BRUA 2VXCA 4D3ZA 2ETVA 4BVJA 1P44A 1KEEA 3U3MA 2A7QA 1LPNA 3EXHB 1TRKA 4MYDA 1V37A 3PNPA 2AK2A 1PR2A 5TGTA 2ZJZA 4OGKA 3F0TA 5AVWA 1VLHA 3TBFA 2HH9A 2EG5A 1LD3A 2AS0A 2V7GA 2VWHA 3FMOB 4ZVRA 4RGBA 3GX1A 3G0OA 4QUIA 3Q0EA 4OREX 1E7RA 2IIPA 4HGZA 2H06A 3OHMA 4S24A 2XAUA 3H17A 4MVCA 4DV0B 3OQIA 1DFHA 1WHSA 5SYAA 1C2TA 4NVRA 4P86A 2J46A 3DULA 3W2IA 4BNGA 1OT3A 2X40A 1KAHA 2JLCA 3I58A 3WYAA 1SZJG 3EXFB 2AFHB 3SHWA 2FXVA 1R6DA 3ET5A 3HA2A 1XAHA 4DCGA 7ADHA 4BVFA 1E7YA 2ZSIA 4JT2A 3CYFA 3KL2A 2O7SA 1JV2B 4RIHA 3ZIAD 2ZANA 4WNIA 4QM7A 5DK6A 3ICWA 3ZHXA 3WOVA 5A04A 1BKSB 1T8TA 3EODA 4IEIA 3TTSA 2J45A 1QE3A 4GX0A 2HW8A 2B69A 3ZOZA 4F7DA 5FBKA 1D7AA 1T2CA 1JHZA 1XD2B 4DLBA 3P4XA 3JQGA 3FTNA 4GDMA 2NO7A 1PR4A 4HX2A 1XZGA 2VSOA 2P67A 4IFIA 2J0QA 4FFBA 3B3JA 3RUDA 2CCJA 2FUG6 1M83A 2PUVA 1EGMB 4EKNB 3WWZA 1QIKA 4NZZA 3JVVA 1UODA 1JJIA 2JK0A 4D4MA 5EWJB 1U3VA 1R8JA 1K3UB 4HFNA 1RYNA 5LC1A 2FUEA 1XLTA 1KPHA 3K6RA 2QVXX 2JJ2A 5DMHA 3OMLA 1Q7BA 4ITUA 4XGQA 3USCS 2GGSA 3U4MA 1YSCA 4QUAA 1U7ZA 3C7DB 3N8GA 4ETMA 1Q3HA 1IU9A 3WLOA 3L7CA 1I1NA 5FWYA 1ZJWA 2COKA 3Q11A 1C14A 2FEKA 2XTZA 4NYMR 5IKXA 1PJ3A 1K4YA 5EHIA 1KVUA 5AO9A 5GVRA 4CLDA 3MUNA 5AKEA 1AV6A 1M5TA 4WUTA 3E22A 5EXSA 1PEDA 4IG4A 2KYRA 2FCRA 1AGRA 3PQFA 2PBRA 4BFTA 5BSKA 3NALA 1FP4B 1TF5A 3LNCA 2XQGA 3O38A 2J4DA 4IYJA 2GF2A 2GPNA 3VU9B 3E35A 4GI1A 4WMLA 3B9PA 4G5YA 4MV6A 1V16A 3WTBA 4QPCA 4RWEA 3JAMA 3QTLA 1OZFA 4ER3A 2HWUA 2PO7A 2F3TA 3GZTB 4WGFA 4H15A 3GRUA 1F8GA 1DQYA 1P9LA 2HC9A 2MOKA 3OZAA 4RA9B 1UZLA 4LYDA 5E4YA 1L1RA 2AKYA 1GEGA 3FCAA 1AQ6A 2AX4A 4RD2A 4D4GA 2O5VA 5IXYA 1EVZA 1O94A 5BPHA 3P7MA 4M4SA 1GPH1 1LY1A 2ZS9A 5JOQA 1GDDA 3P4UA 3ADPA 2G67A 4G0PA 4LRWA 4Q9JA 4EGFA 3ME5A 4N7BA 4HRVA 2RGNA 4R3UC 3CG4A 1XL1A 4RTOA 1MXHA 4AZSA 3EIFA 4CCYB 4P0TA 5H82A 1XWFA 3FKSD 3OUTA 1UBLS 4CUJA 2VDJA 2JLBA 1F3LA 4QREA 3I1JA 4Q15A 2OAP1 2Q3JA 1B8PA 4IFBA 1C7JA 1U0FA 2VHVA 3DGFC 3FSJX 5CXSA 1P2BA 3SZ3A 4EEXA 1FNMA 1G19A 1Z7EA 2RGYA 5K05A 1Z6QA 2EIHA 4ND4A 1P7WA 3W78A 3T8YA 2RBKA 5KVVA 4PSAA 3W2FA 2J33A 2Q1SA 1KQPA 1V5IA 4U7HA 4IICA 5G1NA 4HS9A 5ALNA 1FUEA 1Y9ZA 1VHQA 3UWDA 3R7WB 3PFGA 1EFAA 3CVOA 4L28A 2HU2A 3D6JA 3G79A 3Q8WA 8ABPA 2H5EA 2XJ9A 5C51B 1NDUA 4RHYA 5IMBA 1QHGA 4JLOA 1J21A 2Q0QA 2X6QA 3GJQA 3LCJA 3NCHA 1PT6A 4FHZA 3JQAB 5LA6B 4URXR 3D4LA 5E3IA 1AHHA 2Q9AA 2COUA 3T3DA 4LYHA 1XU4A 3OKFA 4DR3B 2EGUA 4Y6SA 5CX4A 1NJFA 3F7OA 3HP1A 2ZRJA 2C8JA 4FCVA 5L7WA 2J0EA 3RT7A 1NLYA 1BN6A 4LHZA 1N5IA 1V3VA 3PUXA 5DYYA 2A35A 1CR2A 5BSUA 2OPHA 3VHXA 4XPIB 3F73A 4LEIA 4E4RA 3UWKA 2BGWA 3B82A 4RH3A 1V4BA 1ND6A 3N2YA 2ORVA 3EMVA 2OFFA 2GKSA 3WYGA 4DLRA 4ENRA 1PZHA 1ZNXA 4IV8A 2M6KA 4N49A 4BMSA 1YASA 1F8UA 2BFDB 2JCVA 3L0DA 3BZBA 4MYUA 3AERA 4GMGA 5K2MA 4D0GA 1NP7A 2ECPA 2J59A 2PNFA 5CAEB 4M9ZA 3ZUGA 1U9JA 4D2IA 3I5MA 3ESAA 4KIGA 1NL3A 4PSVA 5BORA 3I61A 4TYMA 1JFFA 1TD1A 4LMBA 1GL3A 2GM4A 4FIDA 1FTYA 3PIIA 2R86A 5ALIA 1Y1QA 4DLXA 2JVJA 3O8LA 2YY5A 3UMMA 3F6PA 2Q5HA 2VQEB 2K5UA 2XDAA 2VF8A 2BDUA 3JQ6A 2GBCA 3R5XA 3KVNA 1C8KA 3E7XA 3AVXA 3Q10A 3AFGA 3AUTA 3K9LA 4RVGA 3L40A 3OPMA 4AN0A 1FCJA 3NEAA 4L4YA 1MJFA 4YLEA 3L4KA 3G1WA 1UAGA 3OC6A 2PH3A 3BFVA 4Y1GA 2Q2NA 3KHKA 3OZBA 4U2EA 3RSQA 2ZUCA 1VPLA 2P1RA 3K0AB 3N2ZB 1QOPB 1E98A 4C21A 2YQZA 2CE2X 1JSCA 2WSYB 3Q7IA 1HFKA 1YR1A 1XJQA