5JPCA

Joint x-ray/neutron structure of mtan complex with formycin a
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
229
structure length
229
Chain Sequence
QKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Aminodeoxyfutalosine nucleosidase
publication title Neutron structures of the Helicobacter pylori 5'-methylthioadenosine nucleosidase highlight proton sharing and protonation states.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 79
structure length 229
sequence length 229
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jpcA00
1Z35A 4L5YA 1PR2A 2QPLA 1YR3A 4MARA 2B94A 3FOWA 3UAVA 5K1ZA 1JPVA 4H1TA 2QDKA 3KUKA 2RJ3A 1CB0A 4PNPA 1K9SA 5EPUA 5F73A 3SCZA 3FUCA 1VMKA 4LZWA 4GLFA 2HWUA 1U1EA 1PR6A 5B7GA 1SD2A 4DARA 3GGSA 3O4VA 2H8GA 1OU4A 4DAOA 2Q7OE 5CXQA 4DAEA 4R31A 3FB1A 5JPCA 5F7JA 4F2WA 2QSUA 2OC9A 3C74A 1LX7A 2HRDA 4D98A 1RR6A 3KU4A 1OVGA 3UAWA 4M1EA 4TTJA 3BJEA 3E9ZA 4DA8A 1U1CA 5CCDA 1ODKA 1A9QA 4YJKA 3O6VA 1A69A 2OC4A 1PWYE 1B8NA 3ONVA 1T8SA 4D8VA 1ODLA 1PR5A 3OZDA 4DABA 4LNAA 1Y6QA 2I8AA 4IP0A 1RYZA 2I4TA 1VFNA 3NM5A 2AI2A 1YQUA 4BN0A 4F3CA 2A8YA 1A9RA 4TXJA 1RCTE 3EUEA 4L5AA 3UT6A 1JDUA 3MB8A 3PNPA 4YNBA 1Z39A 5B7NA 4TTIA 5F7OA 4OJTA 3UAXA 1PR4A 4L5CA 3FAZA 3KVRA 3LA8A 3TL6A 1PKEA 3IOMA 4MCHA 3BL6A 1U1FA 1SD1A 3LBAA 4X24A 1ODIA 3D1VA 1RXYA 2A0WA 4JOSA 4GMHA 4U2KA 1Y1SA 5F78A 2HN9A 1JDVA 5F77A 4WKPA 4YO8A 3EEIA 4OF4A 3DPSA 1Q1GA 4LKRA 4TYMA 5EUBA 1Z34A 1VHWA 1Y1TA 3OCCA 4F2PA 1OTXA 3DDOA 4GLJA 3UAZA 3KHSA 4G89A 4UC0A 1TCVA 1Z36A 1PBNA 3BGSA 3DF9A 4BMXA 1ZOSA 4D9HA 2ISCA 1I80A 4TXNA 4L6IA 4JP5A 4JWTA 3EUFA 4I2VA 4OGKA 1PK7A 1A9PA 4ECEA 1T0UA 3ODGA 1RSZA 4LDNA 1QE5A 1TCUA 1RFGE 1PR1A 1Z5OA 4WKNA 4E1VA 4NS1A 1V45E 3QPBA 3UAYA 4WKBA 1TGVA 4QFBA 5B7PA 3PHCA 3NM6B 2GUWA 1OV6A 1YBFA 4EB8A 3PNSA 4RJ2A 1T8YA 1WTAA 1A9TA 4D8YA 3OZEA 4OGLA 1G2OA 1OUMA 2P4SA 5IFKA 3OOHA 4PR3A 4QEZA 4NSNA 3OPVA 1V48A 1RXUA 3K8QA 4D8XA 3F8WA 4P54A 4DA0A 1RXCA 3NBQA 5DK6A 4OEHA 1CG6A 2IQ5A 2BSXA 4F3KA 1Z5PA 1C3XA 5F76A 1YRYE 3LGSA 4DA7A 1NC3A 1K3FA 2AI3A 1JDTA 1M73E 1FXUA 4TXMA 1ULBA 1Z37A 1JE1A 3E9RA 1K27A 1ULAA 3KVVA 4QASA 3FNQA 3U40A 1LVUA 2XRFA 4FFSA 4TS9A 5CYGA 3BSFA 4BMZA 3PHBE 1T8RA 3OZBA 1B8OA 4TXHA 2QTTA 1Z33A 4M3NA 4GKAA 2A0XA 4BMYA 1V2HE 1Y1QA 5CYFA 1ECPA 1SJ9A 1YQQA 5I3CA 3DJFA 3T94A 4G41A 1RXSA 1V41E 3MMSA 4G8JA 1JYSA 1PF7E 4OY3A 4R2WA 1RT9A 5C80A 4TS3A 4K6OA 1JDZA 1OTYA 1NC1A 1A9SA 1N3IA 1T8WA 5IU6A 4WKCA 1ZL2A 1V3QE 1PK9A 2HSWA 2AI1A 4F1WA 3NM4A 3K8OE 1SQ6A 3ENZA 3OZCA 5KB3A 1Z5NA 1LV8A 2A0YA 2PGAA 1A9OA 3IEXA 3KVYA 2ON6A 3EMVA 3OOEA 4TXLA 3P0FA 4NY1A 4KN5A 4TTAA 1TD1A 1NW4A 4QARA 3OF3A 4YMLA 1U1DA 1PW7A 5FAKA 4QATA 4EARA 3FWPA 2QTGA 1XE3A 1JE0A 5CCEA 3P0EA 3E0QA 5F7ZA 1Z38A 5B7QA 1ODJA 1Y1RA 3GB9A 3DP9A 1V4NA 4DA6A 1JDSA 1PR0A 2OECA 5F7XA 4M7WA 1VHJA 2AC7A 4MCIA 4QAQA 5ETJA 4R2XA 1JP7A 1Y6RA 4WKOA 4L0MA 2OXFA 5EFOA 5CXSA 4LNHA 3INYA 4DANA 1TGYA 1U1GA
chains in the Genus database with same CATH superfamily
4YMWA 1AQYA 3N2GB 4WOPA 3FTFA 5BNWA 1G5FA 1UPTA 3CUYA 2QQEA 3FNIA 1QIGA 3PBKA 4TLBA 1GTG1 1M5TA 2R96A 3AM3A 4AJLA 1JEAA 1R0CA 4YFVA 4KHZA 4ND2A 1P33A 2K6GA 1G9SA 2ALJA 3HKCB 2E48A 2J3LA 5DYTA 1C30A 2NT4A 2JIMA 4UUMA 1EH5A 2O54A 1AHPA 1GUAA 1HE8B 1BDIA 1U6KA 1J9ZA 5AW5A 1F7UA 2QTVB 1Y63A 3R41A 4ZJYA 1FRZA 1IHUA 1NVXQ 2H1FA 2F8TA 2ODAA 3UFBA 5F5NA 1GCIA 1YKSA 1G8GA 2V4MA 2XHZA 3RVQA 3VC7A 3ZIDA 4D9EA 5ICMA 2XGGA 3DL2A 3EDQA 1UWVA 2HPHA 1DQSA 3KWMA 1M1ZA 1NMEA 4UFNA 1XT6A 1DIRA 3FNGA 3DZCA 5FT9A 5B7GA 4PFKA 3C8ZA 3SYKA 2WKQA 3R6GA 4Z0TA 4EB6B 1A72A 3N6RA 2H8GA 3WJAA 4RHTA 4Q47A 1KAMA 1Q7TA 4H7KA 4N7JA 5JBQA 2GK3A 3GVCA 3V00A 1ZKDA 3FHLA 1ZGJA 3WB0A 1O9GA 2VDMB 4IDEA 3TW8B 1XQVA 1Z0FA 5F7JA 3X44A 2VNAA 3DEAA 1X1CA 4LOAA 4K26A 1PR9A 2W98A 2XQVA 4PLCA 3ZVLA 3WAGA 1R0RE 4R3WA 1M1YB 4O4IF 1V95A 5LUBA 2Z1DA 3PZRA 4TRRA 4YP9A 1M10A 1JTFA 4K8OA 1T10A 5CT9A 4KUGA 2ZRMA 2I4MA 3TQQA 4CN9A 2BLNA 3EFOB 3W8EA 5FYDA 3S28A 5KS2A 2R4QA 4U3JA 3JQFA 3QVWA 3E70C 3GWZA 5DI9A 1ZS9A 1TEZA 4G4SO 2OG1A 1KVSA 2OGZA 3DS8A 3KV3O 1ODKA 4WPGA 1LZKA 2BKXA 3E22B 4RJLA 4V0LA 2MCFA 2O1XA 2PAAA 3IMKA 4N8EA 3JR3A 5T4BA 2WK1A 3TI7A 3ZJUA 4IQ8A 4L4RA 3ZHCA 2BUCA 4FZJA 2P5SA 2Q6OA 2XNJA 4HNHA 2IS2A 1GN9A 1MB2A 1YDFA 3JATA 4UTZA 1W4RA 2FJ0A 1CZHA 4I4IA 2WWHA 3K0BA 3FYTA 1QHFA 4A0RA 4YR7A 1C1DB 3QPAA 5GONB 1FXSA 2H1VA 3QBEA 4JEHA 3JYHA 4JUCA 5DBGA 3PVZA 1GHTA 1D2CA 1ODLA 5ERXA 1XG5A 3U3OA 1OZAA 5JFTA 2B5WA 2C4MA 3OBIA 1FTGA 1Z73A 5EE9A 1ZH8A 1VFNA 1DKNA 2AI2A 1E1RA 2VHJA 3QEJA 1H1DA 4PQRA 3I01A 4HSGA 4X6YA 4ZV7A 4G0UA 2IHNA 2ZBPA 4S2EA 3K9CA 2QVCA 3ON5A 3EUEA 1ESDA 4GVLA 1ZG3A 2I2BA 3T5CA 1RRFA 4U7DA 1HDZA 1QPZA 4EVRA 1I9CA 3HVHA 2JARA 1Q7RA 2ZIVB 1IAVA 4I81A 3F7NA 2WQ6A 1EJ0A 3HU1A 3SFVA 2G1JA 4B31A 4EUFA 4TTIA 3EY9A 2HHLA 1JIJA 2W37A 3OJFA 4ISBA 4MKXA 1AK1A 4U7GA 1J2TA 2X0NA 3F97A 1FLNA 4DR6B 1SVSA 1LJUA 2QQ5A 4EJSC 2QTHA 1T5TA 4Q9DA 5BN5A 2C1XA 4O2BA 3T4EA 1TZKA 2QG6A 3O1JC 3TX2A 3HPQA 4DMUB 1FXWF 2AOUB 2X23A 1IOVA 2PD4A 1JXQA 1PGPA 4S1WA 5JW6A 3H1BA 3TR5A 5ADHA 3VYSB 3AERA 4KLNA 3KJIA 2O3RA 1YHZA 1QGUB 2HHAA 4PSAA 4Y18A 2K5UA 4JDUA 2GPBA 1A8IA 5CVTA 3OM9A 5KX5B 3RJ9A 5CB0A 2AMLA 1XMOB 5C7IO 3RCBA 1U7WA 3DR5A 1IZ7A 2ODQA 3BA1A 3B1XA 3L7OA 1X0VA 2O2EA 4Z1MA 4E1BA 2Q3MA 3K3PA 3DPSA 3FUVA 3OM1A 4IIHA 4MW0A 4QYXA 5FLEX 1V96A 2FGJA 1HTWA 3LX4A 4A6EA 4AW9A 2LIPA 3D4IA 1R6AA 1A2OA 4GOXA 4HQFA 4LJ4A 2ZLBA 1F9EA 3HADA 1ZXLA 5G0WA 2ZAOA 3GX1A 2FUEA 2CWWA 3A05A 2GDZA 2QIPA 4IOLA 1Z0SA 2FPSA 4P4GA 5A3VA 4EUKA 2DLCX 4IXTA 2NTVA 4X94A 3TQOA 1E7MA 4DNQA 3OZFA 4YLGA 1BS2A 1X0XA 1U9IA 1XKXA 4I8XA 4RNCA 4WOBA 1DJNA 4N4AA 2ZTMA 2JCSA 4MCJA 3GN2A 3BMQB 3KDSE 2DFNA 3WQBA 1BEZA 3VDNB 1Y1LA 4I1YA 2AUTA 4X54A 2AG1A 5M29A 4LF9B 4LVOA 4ZHSA 1MC1A 5IJ9B 5I3ZA 1AB6A 5J4VA 3N8GA 4B8ZA 5LWQA 3C6MA 3SQDA 3A6DA 4TYYA 2C2BA 2FN7A 4QBFA 1X7ZA 1KP2A 3RAGA 1MQ8B 4FEAA 1HDEA 4TTVA 3TZHA 1TAQA 3RVNA 4KACA 4DSTA 1TTQB 5CLJA 4GW3A 4I8IA 1V47A 3DFKA 2CC2A 1ZD3A 3HU3A 5A05A 3U7EB 4YAIA 4CKCB 1NA5A 3ODGA 3NS7A 4ARBA 1VSBA 3QEAZ 2X41A 5HNKA 2H4WA 5B3AA 3TSYA 3L4EA 3FWKA 2Q9UA 4NEHB 5DT2A 5FA8A 1Y4SA 1ZM3A 2FOIA 4E09A 4H7HA 1HWYA 7ADHA 1Q95A 2EDCA 1M34B 3EF3A 3MC1A 2QYOA 2CUTA 4KN9S 4YUXA 4FXOA 4Y1GA 1PO7A 4MR8B 1ZNQO 5BWCA 4IQGA 4EAAA 6Q21A 5LMUB 4Q1VA 4N0QA 2QYTA 1PNOA 2LRHA 4XARA 5EKDA 4CGZA 3LUAA 5EZQA 3K2QA 1KBZA 1TVEA 3NBYC 5IS2A 4BC0A 3KUXA 3R44A 4B3BA 2R11A 3DLAA 2QMQA 2GUWA 3DE2X 3U4HA 3PE3A 1Y3FE 3WL8A 4MPJA 2VUHB 3AF0A 4AX4A 2HHJA 3GU3A 3CV3A 4E5KA 4E94A 4ND7A 1S8NA 4J76A 4Y0NA 1UK7A 1NX6A 4EY4A 3PNKA 3LX6A 5K8TA 4DLZA 4MWGA 3IDQA 1GKUB 1MRSA 4M53A 4NOLA 1DO2A 3GN1A 2WM2A 4UEWA 3HJUA 3G0HA 4BEWA 1L5MA 2QLNA 3JVIA 3Q7QA 4M83A 4Y0VA 1AU9A 2V6IA 1ZGAA 2C8LA 3A0RB 3IEKA 4PCUA 1XCBA 2PUWA 1AK2A 1IVNA 3Q7IA 3OPQA 3TLGB 4HTAA 1Z28A 4EHFA 5HZKA 1KAGA 3DE6X 5EIOA 2GZHA 3DMTA 4TMKA 1F7VA 2BM0A 5DM4A 1Z4NA 2KBEA 4QT0A 1VL8A 1A7KA 4WFIA 3ZOZA 2V9ZA 2ZBQA 4IIVA 3QMMA 4EPTA 1E7SA 1I6MA 1L5GB 3ND6A 3MGGA 2HL6A 4EJFA 5KQLA 5LBTA 1L5SA 3SWWA 4IHQA 4QPCA 1Y9ZA 2VDRB 1GPMA 1Y6ZA 3EA4A 3KC2A 4MVJE 3SE0A 4DGQA 2GZAA 1DAGA 4ZDWA 3GBSA 3HCPA 4YMGA 4WV3A 1RXCA 3H11A 4X1YB 3E9MA 4HXYA 4LI3X 2Q4TA 4BEJA 1VG1A 4FNAA 4GVPA 1JA9A 2HMVA 4NBTA 1NTRA 2HMAA 4JYPA 1O95D 4CM3A 3WLJA 1G98A 2Z0MA 4N47A 4RFSB 1PGOA 3HQ4O 4YPVA 4DBZA 4MHTA 2XAAA 1N33B 5BMVF 5EYPB 3LSYA 4DQXA 4LZZA 3JQRA 1QPBA 4URFA 3VR2A 4PRYA 1NDUA 1NE7A 2ODEA 1Q44A 4UTNA 1DGQA 4Y1FA 1JKXA 1Q3HA 2WEKA 4KYIB 3T6KA 2XB2A 1X8JA 5JMOA 5FR1A 1ULBA 4ARIA 4YAJA 3ZC3A 4CL8A 2DUJA 1RHUA 3KT0A 4OQFA 1QVWA 2C5EA 2JFPA 2RIPA 3RVLA 1NX9A 1QRRA 1NHWA 4QUJA 4OHRA 4BRWA 5KNCA 1J0AA 4EK9A 5JCJA 4JI0B 4J2HA 1Y98A 2GDJA 2RGGA 5AO9A 1EA5A 2PGNA 3L0ZA 2JGMA 2ZVPX 3H6KA 5TQVA 4C3OB 3FPGA 4ZYZA 1JFLA 3CNBA 4CMCA 1XMPA 4H18A 4BGUA 4HOYA 3MCTA 4JFAA 8ABPA 4KZKA 1VPWA 4F2GA 2P3OA 2HK7A 1MVLA 4Y1EA 2C77A 3ENNA 1K06A 3D43A 1AUQA 2J6BA 3ORQA 2ZUSA 3U9SA 4ZWNA 4M0MA 4KUEA 3U3MA 1OWMA 4YHHB 1B8OA 1WW8A 1W4AA 3I34X 2YXBA 5ENVA 1GZ3A 1JG3A 1KPGA 3QNUA 1BMFA 1VXRA 2ZXEA 3OSZA 2JFUA 2R1ZA 4OBXA 5SZKB 3RF7A 2GHTA 1PT8A 1YUBA 3RSFA 3TQRA 2PPVA 3TOXA 1V8BA 2PUTA 5EQDA 1ECPA 3VMMA 3NYIA 2BYTA 4REQB 2GOYA 4S1PA 2R87A 4B6EA 5WRFA 5BQ5A 2JEOA 2WSLA 5EJ9A 1B76A 4Z4GA 3FWHA 4LXYA 5ISMA 2I9KA 3V34A 1M5UA 3CWQA 4XWWA 3PWKA 1VBFA 3NTOA 4HWTA 4JB2A 2QTZA 5AMXA 4A6PA 1JG2A 5ERGB 4YALA 3PEYA 1NP6A 3OLYA 5AKIA 3TN7A 1WV0A 2OA0A 1QHNA 2PAFA 4KE6A 2W0SA 4FEGA 4HDCA 4GC5A 2WJJA 1ECBA 3T15A 3LYUA 2R7NA 1TFRA 1JHRA 2VP6A 2WVHA 2Y67A 2BWJA 4EKIA 2BFFA 4IY1A 1OREA 3FSJX 1P0CA 1CK4A 2JJ8A 3DBRA 1VE9A 1EFDN 2I55A 3EAQA 3P9ZA 3QOYA 1K6MA 2QR5A 1QFSA 3BRQA 3ETDA 1G17A 2Z58A 3E35A 4MZDA 1BGWA 1HYEA 1H23A 1X3SA 2ZIEA 3AF3A 4BN5A 4WEQA 1V3QE 1E3JA 1VGQA 3G02A 3NBFA 2TMDA 5EJ5A 1I3NA 1H9AA 3HVJA 2GPJA 3K70D 4EFDA 1BRMA 5CT5A 2WJAA 3EIOA 1XDBA 2VCEA 2DFDA 3GD7A 4GOLD 4IHAA 1CUCA 4YI3A 5HOQA 2NO6A 3WL7A 4I6GA 3LVQE 2IOFK 1JMVA 1C8VB 2F48A 3VO8A 1E8MA 1XQ9A 3FPKA 5EEHA 3OOEA 3U4CA 1TKCA 2M32A 3LQQA 4PYKA 3VR3A 2YDXA 2YNMD 2QP3A 4RTNA 5BUCA 1UBKS 2YY6A 3E4CA 5K3DA 3TOCA 4CV1A 4F12A 4ODIA 4M1ZA 4UQOA 5D84A 2GCIA 4OHKA 2I3AA 4X7PA 3KOXA 2QKYA 4EABA 1G3RA 4R0VA 2P4UA 4ZZ1A 2QN3A 3GDOA 3QFCA 2YYAA 5LR6A 2HUNA 4IXMA 1JALA 5E7JA 1MD9A 2V65A 1Y5IA 2L82A 3GMDA 1U28C 5LQUA 3LQYA 4CG2A 3GPIA 4CKWA 1FQOA 2AIRA 1NP7A 2W6OA 5GONF 5KCZA 2P9FA 4ZEMA 3M1AA 1XE3A 2AN5A 3RG2A 1UKZA 5TMDA 5CLHA 3U49A 3IVAA 4K3VA 1WU8A 4LCJA 2CEAA 2OZLA 4PYOA 3DTYA 3C7TA 4UM5A 2HCTA 2ZFUA 2FXIA 3EDCA 3STWA 4EI2A 3CEMA 1TT5A 5H5JA 5L53A 5JCOA 4U39A 4DR7B 1II8A 1NXVA 4FCCA 4TT8A 3TJZA 5IYZF 4BE9A 3AOEC 3U4AA 2GN1A 3DTVB 3QIAA 4ND8B 4GEGA 1GPLA 2AKYA 2QX9A 3MRXA 4JXJA 1J9GA 4V0QA 3ZDQA 3BMCB 2EXXA 1ZYUA 4U2EA 3VBEA 4LHXA 3MCVA 2AC7A 4PBTA 4FKBA 1UJBA 1CJTC 2C2XA 4BO1A 3T5PA 3DKIA 3MWLA 2C7GA 2YY5A 3KPJA 3OZWA 4ATNA 5JCXA 3EBPA 3ISVA 4FWBA 4N03A 5CCXA 4EPYA 3ZGXA 3C5WP 3IAAA 1EWQA 3RT1A 5BSUA 4NJEB 2ZGVA 5AVYA 3M9WA 4I2NA 1C3VA 2RGDA 2F55A 3N5CA 3SJCA 4LVCA 3ZLVA 2BLLA 5GADl 1KXJA 2PZAA 5BRNA 1E2GA 3EXHA 1N6LA 4NV1A 4BO0A 3RUIA 1EP1B 4QXMA 3GXBA 4I1IA 1L3CA 4BWYA 4AZ3A 1EFPB 5A1TA 1TK3A 3QPVA 1DQYA 3I45A 1ZU4A 1SU8A 1UF9A 3RYCA 3F3SA 2GLTA 2IPMA 5GQSA 5KX5F 1UUFA 1GPDG 1LNSA 2DWOA 1JZTA 4M89A 1KK2A 4A7PA 2CVPA 3FVQA 4OXRA 4AD8A 5HIKA 1Y89A 1HYGA 2DAPA 2CXXA 1Z68A 3CCCA 1DBRA 2BFAA 4WNCA 2IYVA 3U60B 1QZUA 5BVGA 1Z9BA 3VM6A 5IMSA 2ID4A 4JC5A 5BT8A 1UP4A 1CXZA 3RVPA 1SOWA 5BO5A 1U9YA 2W6CX 1IUPA 1UPFA 1XU4A 2GN9A 2QZ4A 5EN4A 4CKEB 2LD4A 3LDFA 3ACCA 1H3NA 1ISHA 1ZD4A 2R5NA 4TWZA 1MJHA 1V8OA 3CVJA 5FPHA 2BJWA 3E1GA 2O8FA 4CM4B 4GH5A 2B9EA 2EP7A 4PLVA 1TJNA 2J30A 1YJAA 2R1VB 1MA3A 2VF7A 3QF4B 2IU3A 3HJTA 4IIFA 4WZBE 5BSMA 4B0PA 1KI2A 4TL9A 1P2TA 2CZGA 4HDQB 3K6KA 2OVFA 3BA6A 4DARA 1AH2A 4MPDA 4ARSA 1XD2A 1OU4A 1G3UA 1EDEA 4ZJUA 4C7MA 2BDUA 1E6EA 3A6JA 2NXCA 2XA1A 4QQKA 3ZWQA 4AKSA 1BFKA 3QVSA 3B12A 3TTXA 5LWHA 1E1CB 4A6DA 2XZDA 4WLOA 4IZIA 2HB6A 4ZGBA 4F2WA 3AVYA 2QSUA 2PA0A 1QS0B 3C74A 1VJGA 4R01A 3B5IA 3TJMA 3HZZA 4B7AA 3I04A 2ZPTX 3DV9A 3ZV6A 4TLLB 2B98A 4H77A 3K4PA 4GFDA 1J5EB 4QJIA 3GHYA 1AN9A 5JEDA 4DLBA 3GUHA 2XNDD 3C39A 2CHUA 3OQ6A 1ZGBA 2VXCA 1YR9A 2YICA 3IIJA 3MT9A 4UUBA 2CVZA 1A9XB 4MW9A 1JWLA 2GBLC 3CFYA 4DA8A 1IIRA 1U2ZA 3LM8A 1C0IA 5ARDA 1XELA 4CTOA 4QG7A 4IXNA 1XA4A 1RIIA 3EHDA 1T0HB 1RRPA 4TKVA 4M0DA 3G9TA 3HMQA 3PNLA 4XVHA 2WU3A 2V1XA 1QYDA 5EMJA 3LQKA 3IGFA 2FCRA 2FLWA 5MGNA 2FMKA 1R50A 3E8SA 3T0IA 3BPSA 3U7RA 5TT0A 2IWHA 4P7GA 3EAFA 4XLZA 3UN1A 4NBUA 5FV7A 4LDAA 1OWPA 3K9QO 2MR5A 1IB0A 1T8SA 1J1IA 1N1MA 2CLDX 4RVDA 1UANA 2HSEA 5T4HA 3LLCA 1E4YA 1ZNWA 3FYUB 3V1UA 4D9NA 1E2HA 3MIZA 1OGIA 3L82B 1RAHA 3KM0A 5BQFA 1N2CA 3FLBA 3K6RA 1AX9A 4OHWA 3RM3A 1KZ6A 4EHAA 1EK6A 3B82A 5JJCA 3PC8A 4P4NA 2GBGA 4DYHA 3NOQA 4FSHA 3TRKA 2B8JA 2W6JD 2Q0HA 5E7MA 2C9BA 1I36A 3CNQS 4DBLE 1WD5A 1NASA 4IWNA 3HBAA 4OXNA 3EVAA 3S6JA 3OTWA 1CYDA 2QTRA 2F67A 3FTCA 1GNPA 2H6EA 2OQIA 3MJDA 3WGVA 3GUVA 3DHNA 4MYTA 1UBFA 4D41A 3NV9A 5CX1B 1MNAA 2IZZA 2OD7A 1UBJS 1NMYA 2ZBEA 3SY8A 1ZM2A 3HBNA 3BWYA 3BF7A 4U9IS 2EERA 3P2KA 5CM8B 2I7XA 4FFNA 1IPHA 4FEYA 1GGKA 1HZZC 1N0WA 2V6FA 5JLJA 5DN6A 1W85A 2JA2A 1DJOA 2B0CA 2GNAA 4GNKA 5E9AA 4XVUA 1MNQA 3ID6C 4DQKA 3ECCA 1D7OA 3LBAA 1HYHA 1M54A 3TQSA 1Z2OX 1KYZA 2H18A 2WWXA 2ZB2A 5JRJA 5DM1A 3VRHA 3PR3A 5HIJA 4L08A 3AEUA 2JLRA 3IPAA 4M55A 2QT1A 1D4ZA 1SHKA 2EX0A 2WM3A 2XOKD 2HXYA 3VZQA 2IELA 2TSYB 3IB6A 5AXCA 4KXUA 2HN9A 2JZOA 1ZOPA 1AS2A 3I2FA 1LS6A 4Y2UA 3ZHQA 4UM7A 2JJMA 3SP1A 4CG3A 4HB4A 2RI6A 4EYSA 1JQBA 1TVKB 1EP2B 3C3DA 5K0NA 4HHEA 5T4EA 1TA0A 3LSTA 2AN3A 2AR0A 1XCPA 4D8UA 4ZCMA 1K8XB 5DCUA 2C00A 2O19A 3IAXA 4IYJA 4KAFA 2O4CA 5CB6A 1K7FB 2ZYAA 1JLSA 2VSQA 2GD2A 4TKZA 2YL2A 3PDUA 5THKA 3ECSA 4WXHA 1OXSC 2Y71A 3O4RA 4JXXA 1JKFA 2WHYA 3GBPA 3L1IA 4RO0A 4D3SA 1GTMA 5BPHA 4U4AA 1VL0A 2E6UX 2JIBA 2PT6A 3KHSA 4XWGA 4AKIA 1QTNA 4UE2A 1BTOA 4EYKA 1ZN8A 2H5LA 4MIOA 4QLBA 1UBSB 1YKFA 1O9BA 3U2QA 4EJ0A 4TTPA 2WNSA 3F9CA 4IMIB 4HFJA 3WHKA 3TLMA 1L8OA 2EFJA 1WHTA 2ENUA 2MMCA 1Z6YA 4D9HA 1UMDA 1I80A 2AFHB 3EG9A 3FUUA 4IDNA 1O77A 3AR9A 4KQ6A 4PQYA 2QI9F 3MA0A 4NZZA 1ECJA 4KREA 2YVAA 3TTSA 1VBKA 1XXHB 2YIMA 3A06A 2BEVA 2R00C 4MKHA 5LQSA 3JQGA 1Y4ZA 3WIBA 3I39X 5IPFA 4HX2A 1Q1ZA 4UD6A 3KT8A 5FFFA 5KWSA 4X44A 1W1WA 4WDQA 1BNCA 2AKAB 2RGNA 3C14C 2C97A 4LY9A 4ECEA 4C7XA 3WLHA 4BX9A 3QVJA 4LCEA 2MHCA 4DGSA 4Q7QA 4R98A 5AJWA 2VPZA 2Q2VA 1GGEA 2Z2JA 1U0EA 3DJYA 4X6LA 1L5QA 3OFNA 2OP1A 3BMOA 1NYLA 5J5AA 3RSHA 1MJNA 4DSAA 5JS6A 1K1EA 1RQ2A 3ZCRA 1ZITA 4M4SA 1NOIA 2PMWB 4O2BF 1ZCAA 2IYWA 1C29B 5BQOA 5FOTA 5F98A 3OG9A 1IN1A 1V45E 3LGXA 1EFUA 4QQ8A 1WX1A 4K03A 3FKQA 3OFSA 4LECA 1EX9A 4XEHA 3TZKA 3OURA 5DPMA 3L9XA 3PFIA 2C9MA 1RJEA 5JATA 5EI5A 3ER6A 2DR2A 4YX9A 4R1NA 4WA7A 2YJGA 4ZOAA 3ABIA 4PAMA 1ZONA 4MS3A 1MMFB 4KIUA 3EVTA 1QNLA 5I8PA 2G09A 4FYMA 2FRXA 3PXAA 4JV5B 3IVRA 4DV1B 1XQWA 1IEXA 3CT4A 4CUJA 2CJPA 4HS9A 1GARA 5REQB 3WGYA 4QVGA 1LS1A 5FUXA 4S0ZA 5HM8A 1UC5B 1GDHA 4W5JA 4WDRA 4OHFA 3UW3A 4A6XA 5HUHA 3I30X 3AR2A 1YK0A 3EDYA 4QREA 3DAGA 2BEWA 4JI6B 2PIAA 1OUMA 2BKLA 4UJ5A 4V02A 5ES3A 5H83A 4C0KA 1BXGB 4CM9A 3L92A 2OUIA 2YYYA 4CKZA 2DXIA 2UVQA 3QUBA 1EQUA 1V4BA 1FC0A 5F35A 3IL2A 1Y3HA 1Q6ZA 3C5VA 2HGSA 4ZYXA 1BHSA 3BH7A 2C7OA 4BV3A 4ZK2A 2OWDA 3Q9UA 3MS7A 2BCGY 1VYVA 1YNSA 1YR6A 1E3SA 3QWAA 3MT7A 1FFHA 3B1YA 3CJTA 1Y7IA 3NVKI 2VSXA 3I9MA 4IMJB 3IFSA 3PFKA 3MCUA 2EW2A 3G9ZA 4UKDA 3TSCA 2QLJA 2QP9X 3WYBA 4AJ2A 5I5EA 3CX7A 3TLYA 5KTNA 2AEEA 1AUPA 1Z6XA 4WLFA 3TRDA 2P68A 2OQRA 1P2SA 1SUWA 2VLIA 3AR3A 3EEYA 3GJXC 2BGNA 4P54A 1ZMXA 2KB0A 2RKWA 1P62B 1JDPA 1QGDA 3EGXA 5E6SA 5T3UA 1OAOA 3A58B 2ZXUA 5F1PA 1CE8B 1LCIA 3SBXA 5K3EA 5CHYA 1APBA 1I5EA 4HAOA 1CIVA 1P6XA 4X5OA 4LEIA 5FBKA 4OSOA 1BGXT 3DA8A 2OILA 3K96A 4LJKA 4OLJA 3ZHSA 5AJUA 1DZ3A 2WUGA 1UKBA 4HDAA 3SBDA 1O94A 4HB3A 5KC9A 2G8NA 2FPWA 3G0BA 1U8FO 5A6SB 4C4SA 1EPUA 1BCSA 1ONBA 4EPXA 4FDMA 1GG2A 1QGED 3BTUA 1OOEA 2HA5A 2A33A 4EGAA 5HRUA 2D5BA 2FSSA 3DTTA 4O2AA 4CQJA 3K7EA 1XTRA 4FU0A 3V4ZA 1ML3A 2QV7A 4JB0A 4G0WA 1M1YE 4V3BA 4H4EA 1BX0A 1KZGB 2HI0A 3WKCA 2FQQA 5BYBA 4YUWA 3IAM1 1K63A 3T06B 4G0QA 3GWGA 1WXHA 2VRNA 2XYHA 4PSDA 2R5WA 1E5XA 1UT8A 4WZAA 3RKSA 1RPZA 3OPYB 2VLBA 2XCUA 1TQHA 3EZYA 4UFOA 2WFZA 1US8B 3AP2A 1NFFA 4E5MA 2V7VA 4IBOA 3N0WA 5L7YA 1C1YA 4M2LA 3DDWA 1I3LA 4PQFA 5LJLA 4UDOA 3PHLA 1S3GA 1WHSB 1DEKA 4O1IA 2V7UA 1NG1A 4LMPA 2EBFX 3OLZA 3IQWA 3T7DA 1MR3F 3TLXA 1HFEL 1QH1A 3BM5A 2Z3WA 3HYCA 4TXHA 3VH1A 4TMZA 1JECA 1IEQA 2VT6A 4IDFA 1Z33A 2C9OA 4MI6A 3UOAB 3UWDA 5G0TA 1XAHA 3U6BA 1AJEA 4NICA 5TARA 1Y5RA 1QIKA 4XFKA 1M2OA 2Q07A 3O8LA 1ZNYA 1DIGA 4H7EA 2V5VA 3L84A 1K5HA 2O7RA 1AKYA 4G01B 4ZXFA 1XZBA 2CW5A 5LLDA 4FFPA 3U5TA 1EUZA 3EQZA 1DX4A 1N92A 1RRGA 3NBKA 4G1MB 4NU8X 4QOJA 3IBCA 1MKYA 1Q6YA 2Z57A 2VIIA 5EPOA 4KN6A 3TUIC 1WUHS 2G7MC 5DWVA 5HPYB 2SCUA 3OBBA 2WI8A 3G2NA 3V4OA 2GLUA 4FMPA 2HZ7A 4YUYA 5J2UB 1E2NA 1ZNXA 3EH1A 3GH1A 5A7GA 4YRGA 2EKQA 3EOAI 5TMBA 2V7TA 3QEMA 5EAIA 3VNVA 1C3OA 3RTCA 2X9NA 1SHTX 1QB8A 4UCXA 4ZJPA 4UVEA 3ZXXA 3RU7A 4JI8B 2WHPB 1U3VA 2II6A 1NC1A 2PGJA 3FAKA 4KPEC 2AMFA 1W47A 5SYNA 2QN8A 1I4EB 1ZRNA 1UMCB 5LQCA 4PAWA 1WSBA 5K0ZA 1E5LA 2XUQA 2GPTA 2IVZA 4ERNA 2ZI6A 5IK2D 2B8NA 2R8ZA 3O5AA 5CNJA 2PUBA 4FMDB 2VKTA 1FBNA 1P8AA 5CFQA 3F67A 4GM0A 3T8YA 1SUEA 4GX0A 2X0EA 2YMMA 3PCTA 1E0DA 2DUMA 3TTTA 5AVWA 3G8YA 2QD2A 2PBLA 2VVTA 4CIVA 2LCFA 1LF5A 4LGMA 3FMGA 4P4SA 4XXHA 3TSAA 5AVRA 3KVYA 2LTAA 4HDMB 4RPGA 1W59A 3LA6A 3OJ0A 1WM1A 2QSYA 4Y6SA 4HRYA 5IAEA 4D46A 3SBEA 5A4KA 1K92A 1JSRA 4F21A 1TJ5A 2ZWAA 4RQBA 2D1RA 5HE9A 3GAZA 3U3KA 4DRZA 4A0SA 4FYHA 1E6MA 2J5KA 3ZOKA 4B3IA 5CTJA 2UZIR 3E81A 3PVCA 1KP9A 3WV4A 4D43A 1C9MA 1BE8A 3P9KA 1PFUA 5KJ1A 2OSBA 3PXUA 3K0FA 2WSBA 1U4NA 3GRKA 1UCFA 1Z62A 2YV5A 1NBEA 1YE5A 4YAKA 2CLIB 2JCXA 1I0ZA 5A62A 5FAKA 1DBIA 1JSCA 4JJEA 4QX6A 3SIPA 2FXVA 1F12A 4DM7A 3AVXA 4IV8A 4KXYA 1IBCA 4K6KA 1W9MA 1ZCFA 3EXAA 1CIPA 4FXPA 3NHRA 2YIDA 2HW8A 1PT7A 3OP1A 1J9EA 5IAKA 2XZTA 1JE0A 1RLMA 1YCDA 3CUEF 4FOPA 2MU1A 4G81A 4PQEA 3SLGA 4F4UA 2WD7B 1AIPA 5ILGA 5KYYB 4JJFA 1D0VA 5GVSA 2DKNA 1EUCA 2Q1XA 1HT2E 2DSNA 2YY7A 3A1CA 1VKZA 3CZAA 4M36A 2P5UA 1AF4A 3P2OA 4MUNA 4W7HA 4KFRA 5K0JA 2DY1A 1WDLA 1Y1RA 3LVFO 3L7YA 5BORA 1UP7A 2FZ4A 4KE8A 5ELXA 4CL3A 4DMCA 4RW0A 3EYAA 2XH8A 1LPMA 2YWXA 4EX6A 4RKRA 4CU5A 4FDTA 3HCOA 1T5BA 1H1TA 3FOEC 4G5FA 4GZLA 4DJAA 3LPDA 1V7ZA 1QYRA 1Q12A 3AY3A 1IOLA 4JEIA 5H80A 2WE8A 4N3CA 1XN4A 3ESYA 3A4TA 3X3HA 5ITZB 2ZRAA 3OI7A 1OLUA 3IE0A 4FDUA 2IFTA 2BPOA 3GLGA 2X2OA 3M6MD 4D0SA 5A3JA 3V6MA 2X22A 1U81A 3T5BA 2JGKA 4IVQA 1T9ZA 3A3OA 3C4QA 5FD8A 4JHLA 1RP7A 1KYQA 2XUAA 3ZBQA 4B44A 4KSBA 1EWTA 1YK1A 3RRZA 3H5LA 1M34E 3K0AB 1YZYA 3IR5A 4ZVOA 3ZJ5A 3SIWA 4EY6A 3U44A 3FHCB 2DHDA 2D7DA 4KPUA 3KJZA 2GX6A 4XPIA 1Y0BA 5IDVA 4NV3A 1M5RA 4WXEA 6CHYA 2KSQA 3FPJA 4LSZA 3AVQA 4GX1A 4BUJA 5FTMA 4BLPA 1FFCA 4U2FA 1DLJA 1MV8A 5COQA 4HLCA 4D56A 4EH1A 3DXFA 2JFXA 4FX5A 5DHRA 4X91A 3O8DA 3TVTA 2NO0A 1IQRA 2XT6A 3TIGA 4AZWA 2HPVA 2XKJE 4QDJA 4RZXA 4FR5A 1E59A 1JR2A 1HV8A 1R3DA 4J1SA 3M6FA 5HE8A 3CVWA 4HS4A 1NN1A 2EKPA 2VNJA 4BX0A 1P80A 2CLOB 3M3HA 2Z43A 4CQLB 4GGMX 3WXMA 5AUPB 4DLKA 1E6LA 1KZHA 4Y1RA 3PDHA 3VNBA 3I4CA 5CVUA 1Z5VA 1IHPA 3AO0B 4CKYA 1CHDA 2IZ1A 3AH8A 2CCJA 1HE4A 4N54A 4FB5A 1B3RA 1K9SA 2I7DA 4FFMA 4JBWA 4RWEA 1R9MA 1A3CA 4G5SA 3SCZA 2ZJBA 3AESA 1G5IA 2AEJA 3IV9A 1JFVA 3PKJA 5ALYA 1N36B 1OLXA 3N7UA 1Z4IA 4BJ5A 4C7VA 3U09A 3QUQA 3TZQA 4J6EA 4RLQA 1MC5A 4WFJA 5AJHA 3ITDA 3EG5A 3PC7A 3D3WB 4CTNA 2PN1A 4I9FA 4LOIA 5FUBA 1Z6GA 2C8KA 4U1RA 1SA0A 5CDUA 4KXLA 3GCDA 3VHXA 2XCRB 4Y6QA 2NU7B 3R74A 3L4BC 3LY9A 3OLWA 1KI4A 2GXAA 3AHFA 1V7QA 3LPMA 3NEYA 3PUVA 4PGHA 3VPGA 3N2IA 3TZLA 1PLLA 4RZSA 1VZ3A 3CZCA 1L4EA 2NU8B 1UEJA 2AWOA 3DW3X 1K0UA 2O2ZA 3CLTD 3ZTYA 1DIOB 4J1QA 1ZK0A 4CV3A 5D00A 3WGQA 1XRPA 3KU4A 3G1WA 2G17A 1OVGA 1CV2A 1NN3A 1OIXA 4TLMB 3NC0C 4B40A 4HF7A 1TPYA 3IKMB 1E79D 5F51A 1KEKA 1AHIA 1W5BA 4K87A 3RRJA 4KX3A 3RV3A 3SNHA 1PHRA 2DLNA 3GFQA 2P7HA 4YIKA 4AI6A 1TXGA 1I3CA 1U1CA 1JJBA 821PA 2A35A 2Z8ZA 3EXFB 4HDSB 4YP5A 5EY5B 3AV3A 3EWNA 3EEQA 1SBIA 2JIDA 2BGRA 4BYGA 3CRNA 1N4AA 2P6PA 1KOFA 1PTKA 4W1RA 2I7TA 5KTKA 3WJ7A 1K8QA 4B73A 2O7NA 2OZPA 3BK7A 3QM1A 5G1PA 1T6XA 5BR4A 4PZPA 4QFCA 4XSVA 3DGFC 3VZBA 2F62A 3DTNA 3ICEA 1PWYE 2O0HA 1V0JA 5FH9A 1JHDA 2VA9A 4AUNA 5K4HA 4PXAA 4BXOB 2BELA 3BTSA 4WUTA 2PVCA 3C43A 2DHEA 2ZOSA 1IMJA 2NU9B 1NXSA 3JWIA 1X9HA 3NM5A 4CQNA 1KVTA 1UBUS 4G6ZA 4LA4A 4BN0A 5A7FA 2MT9A 3UHJA 4BP1A 5KSOA 3QP9A 2W70A 4K5QA 2OHVA 3UBTA 4U7HA 1FFGA 3AJEA 3QU9A 4G9EA 4U02A 4ZCTA 3G2KA 2EP5A 1OA0A 5HQ3B 5A5FA 3OCWA 2Q2QA 3SF0A 2GARA 5FIUA 2PLFA 2Q1SA 3NUGA 3AI3A 2PFGA 3LRPA 2QZPA 1E94E 1KAQA 4H3KB 4MVJD 4D82A 1NW6A 1SCUB 1RWNA 2TMGA 3QBVA 3EIFA 4OH1A 4PZUA 3DBHB 2R4UA 2ZYWX 5IC6A 3UAXA 2CBZA 1ZD1A 2PLRA 3NBAA 1C8BA 5HRAA 1JQ5A 1E5QA 4JL6A 1CUEA 4MVJH 5KAPA 2Z2KA 1LQ2A 3VV3A 4AG3A 3PWZA 4OHYA 2ADOA 4R3UC 3CWCA 1LRLA 4PYQA 4H7PA 1OYYA 3BL6A 2ZU6A 3CVYA 3B78A 3RAPR 3WLKX 1SBTA 2RHWA 4BNZA 1ORWA 2OHOA 1ZVKA 3JX9A 4OQXA 4WWHA 4B8YA 3H0CA 1SOVA 3CPSA 4B3XA 2IUTA 3WB2A 1D04A 2WSYB 2GAFA 3LX5A 4KQ9A 1LLCA 3ZTTA 2OL4A 2JHAA 2OZEA 4MW5A 1I0IA 3EZFA 3F5SA 4BVBA 2Q3EA 2B4AA 2VJKA 4EGFA 1WMSA 2RONA 1QC5B 2CDAA 4JITA 5TV2A 5KSWB 3AFNA 3AK4A 4TRJA 3P2YA 3SYMA 1USVA 6NULA 2E82A 1B6TA 2JJ1A 1HLPA 1V39A 1YZHA 2YXPX 3MJFA 4WFKA 1SQ0A 2JIPA 4JXZA 3RYHA 4QGBA 2VOEA 3HCCA 1P5RA 3GA7A 1KIMA 1YRHA 2QD3A 4PYNA 3OC6A 5EVCA 2FDCA 4UEQA 1QG0A 1WQ1R 1P1BA 1SBZA 1IHXA 2YUTA 5IAOA 1EDZA 1F8YA 3E9QA 1ECLA 4MA0A 4QT4A 3T9FA 1S9HA 3JQFC 2HT6A 4C05A 3GJ8A 4KITB 2VNSA 3TWOA 5K8JB 3W5DA 1OTXA 4YP1A 2ECOA 3GRUA 4HX9A 3T5GA 3IERA 1UFKA 4JI5B 1HOTA 3SE7A 4NENA 1YQEA 4RE5A 3T9EA 1QP4A 4MIEA 1ZXXA 3C41J 4PSCA 4ZD6A 5FJJA 4M8IA 2YS7A 2BKAA 5KNDD 3WNVA 3CBQA 1R1DA 1Z82A 2XX3A 4AJ9A 1JEJA 1KZ1A 1PBNA 3BGSA 1YBHA 3DO5A 3RHTA 3ZHBA 2UU9B 1ITZA 2AXPA 2ROQA 4QU9A 3OIGA 1Z75A 3MMXA 4FZVA 5KNDH 3L6CA 5JJLA 2GN0A 1RXVA 4QHTA 3WMWA 5JVDA 4A2PA 1UDWA 1T9KA 1RTKA 1SURA 5CU7A 1ADYA 1WXWA 5BV0A 4IFTA 4B4DA 4MWBA 4Z6KA 2XVAA 4JWTA 4ALJA 4LMAA 2RGXA 4WOKA 2IPNA 5PNTA 1POWA 1K6EA 1ZUWA 3H1TA 2IP1A 3WLEA 3TI9A 2CLCX 5GJCA 1HF3A 5IVPA 1MN6A 3QFHA 4LDNA 1PD1A 5C1IA 1F2TA 3AIIA 5C8YF 1G6HA 4A0QA 1C5KA 4RY0A 3QSGA 3B3JA 1HETA 1QE5A 3MJCA 1XPRA 1OFUA 1Z6ZA 3UBMA 2NO1A 4ETMA 1ZDMA 3W5VA 3M7IA 1X7YA 4Q4CA 5I7HA 2XXBA 3QPBA 4BMPB 2YJTD 1H1LB 3K8ZA 3KHTA 3SGLA 1S7GA 2QD1A 3EQ6A 2ICAA 3Q9NA 2G9QA 2IY8A 5CA1A 1AK9A 1P4GA 4L6AA 1GDDA 2GNOA 3IYLW 4W5QA 4AZ0B 2NYVA 1A8QA 1Z7BA 2FX2A 2BDEA 3GC6A 4CFYA 1U3GA 5LZ2A 1R18A 4IHJF 1EUDA 3B53X 4Q02A 3FPAA 1KSJA 4FMDF 3BSYA 1T4MA 3FPSA 1MEJA 1QWSA 1ZHFA 2ODTX 3E9EA 3OOWA 4R6XA 5UKDA 3H5VA 2OBLA 1E4VA 2WIJA 3AV0B 4PXYA 4DDMA 2XYPA 2ISQA 2E4UA 2FTKE 5EZ6B 3JZFA 4TRNA 1YVPA 1L6RA 4GXNA 5JWRA 3R3YA 2PCLA 4TS4A 1UBLS 5KQMA 3MQ2A 2NUBA 3LC0A 3CLVA 4QD3A 2AFIB 3LV8A 1BW9A 3BS4A 3OEED 5CM9C 2NX2A 4ALLA 2G63A 2WWIA 2QPAA 1ZNZA 5IJXA 4TSFD 2XT0A 3MUEA 4QA9A 1PJRA 2V0GA 3I1IA 3TLEA 2QF7A 3N2NA 1GPJA 4KWHA 2ZT6A 2NPOA 1S1CA 4L76A 3RUPA 1FL9A 2ZYVX 3NGLA 4QEZA 4G23A 3RIYA 1EESA 3H3JA 2XECA 2QVBA 4RK7A 1E9SA 4FHDA 5GJWC 5BOVA 2F6RA 2VPPA 1WNTA 3K8QA 5DMHA 2IHKA 4DXAA 1U9IC 1V11B 4MB6A 2R7AA 4BVJA 2PS9A 2F1RA 2OHXA 2DERA 4AMYA 3NBQA 3P5BA 5DN9A 2L2QA 1GU0A 5IZCA 3J81A 1YACA 1DKMA 1O4WA 2H2IA 3DPIA 3REFA 3P1JA 3EZ6A 3AKYA 1CDEA 3RS0A 1P2VA 3NBMA 3U9LA 1RABA 3AUAA 2NUTB 2QSJA 1QHSA 1FDUA 2W93A 5EMKA 1WSAA 2F9MA 2ZRJA 4GICA 4IDGA 3DWEX 1DMSA 3THWB 1NJ8A 4Y6PA 4ZZ3A 5DM60 2A5YB 2BHRA 2X8JA 4Z4HA 3B1KA 4NXMB 2P69A 5KVSA 1LTQA 1ZOOA 1MO3A 5F2EA 1ZHHA 4MS4B 2ATVA 4X64B 3IB3A 1T8TA 2Y3IA 2IWRA 9LDBA 4PTZA 1EGQA 2PZFA 3EIQA 2XNKA 1HL7A 1NR5A 1JPUA 2C5HA 1WPQA 4H6WA 3V97A 3VTZA 2ZZMA 4OHCA 3DC2A 1GL9B 3E27A 3TRFA 3NG1A 4PX2A 4B2IA 1O03A 1ENPA 4K2AA 1FK8A 1KEVA 3DB2A 1ZJWA 5B6IA 4FFSA 1PJ8A 1OBOA 3ZE0B 3E84A 5D5HA 2IUSA 1XL0A 2XRYA 3OKFA 3QYPA 5G3ZA 1SXJA 3UB4A 1KMNA 3W6NA 3FH0A 3WL6A 1KMCA 3LHIA 2PZJA 4QYMA 1F2UB 4D5EA 4M9RA 2J87A 4TWBA 1QPGA 4AX8A 5FUQA 4JGGA 4WY8A 3QK7A 4ZVTA 2OWEA 5DLQC 5ALPA 1GCOA 5L6MB 2A0XA 2OHHA 3EGCA 1XTTA 1EEHA 1U7OA 1U2GA 3F74A 3DLPX 3PHIA 4IUCS 3TKYA 1K3TA 3I62A 3URKA 1LF0A 3GGGA 3MMNA 3ZHTA 3K6SB 3FOZA 1H9CA 2C2KA 4RVUA 3V32A 2BUAA 3NTRA 3F5MA 3GZTB 4DUGA 2CSUA 4D3ZA 4DV7B 1LK5A 3BD8A 1YZQA 5C46F 2DPHA 1JKIA 3DMTC 3AY6A 1O54A 2HBYA 3ZE7A 3UVEA 3CNNA 1GTL1 1T3GA 3ADDA 1I4OA 3W2FA 4C6TB 1F8XA 1XDGA 1NG9A 2FQ1A 1XRJA 2ZR9A 4JMPA 4HZIA 4DJFC 4EB3A 4YVFA 1M67A 2BFCB 5A06A 3F73A 3ZI0A 5LJIA 1VP9A 4RCZA 1JDZA 1CUVA 3H9CA 4PLWA 1V1MB 3VR4D 2HBZA 1U0SY 4HUQA 4LF7B 2ZIXA 1A9SA 3FNEA 4UTOA 1A71A 4EEKA 1O1YA 2ADFA 1UPCA 4QZVA 3MTGA 4ARZA 3ZK9A 3MWDB 3LCVB 3O3OB 3B9PA 4FYXA 3TQHA 4MA5A 3WRVA 1UP6A 3MWEA 5IU6A 3VR4H 3IQZA 1U3DA 4F0JA 1F14A 4BQEA 2HK6A 4F93B 2XLBA 3MINA 3WDSA 3ESQA 4IVNA 4WK4B 3OX4A 4ID9A 4IJ5A 2YFYA 1W4BA 4QPNA 4GXQA 5JSKA 2D13A 2VTBA 2J45A 3CR8A 2AYZA 4G5GA 1QYVA 4F4JA 2HA6A 2IPAB 3M34A 3HWRA 4XGRA 4ZVPA 1RCFA 2VZLA 3GFOA 1Q20A 3LBNA 2J3EA 2OUKA 4E5VA 4QGAA 3KXLA 1EU1A 3ANYB 5DE3A 3U0BA 4NZOA 5HR5A 4DV0B 1AY0A 4XM1A 4F8EA 3UXMA 4N7BA 1QU3A 4INZA 3KZXA 2GFIA 4EUHA 4DCCA 2PRSA 3M4ZA 2FMHA 2G07A 3W9UA 8LDHA 4EI9A 2WF8A 3WO0A 1EB8A 3LUHA 4BLWA 1Z3CA 2CZCA 1EX6A 4OB7A 1RQXA 5TX7A 4NKRA 1FRFS 3EC2A 4TKMA 4AROA 2P2YA 4RV9A 5JXGA 2NACA 3Q2IA 1X94A 5DYYA 1NQTA 1FDOA 5LYJB 1HRKA 3LQ4A 1DQNA 3BFKA 5T64A 4E1AA 2JLXA 2COKA 2WLTA 2XOXA 4BB0A 4MIKA 2NUAA 5AK6A 3R5HA 3ZGVA 1G0OA 3G3EA 5L3SB 4KXVA 4J0JA 4P31A 3U61B 2R86A 1EVKA 3B6IA 2AD5A 4HD8A 4KSYA 4ZQIA 1OBVA 1XTZA 2BMDA 1E1DA 4MUAA 5F21A 3MVEA 3ZXYA 1N57A 3GUCA 5ILQA 2OGTA 2AFHE 2BF4A 2X7JA 3D7LA 4KBFA 5HM6A 5KU7A 1MJGA 1U3CA 3EOZA 3NANA 5JWOA 1HNNA 1XXHE 3BTOA 3IRVA 3WA6A 4YROA 4DA6A 3DV0A 2AJDA 1QKJA 4OBEA 4KDRA 5IVHA 3RI3A 4YRZA 3HCDA 2ZUBA 4LYYA 1KI7A 4M7WA 4XGKA 1PAUA 2GQ0A 3OZVA 1EVIA 5IC4A 3TIIA 3HJNA 5FPQA 1AS0A 3HFSA 4YBRA 3P52A 4KHPB 2RCNA 4RKEA 4A1OA 4L0MA 4CXMA 3O31A 3KLNA 4QU5A 2RBGA 2Y0CA 4MYHA 4WL0A 2QGFA 1VYTA 4EMTA 3PLAE 1HSOA 3DUFA 2GN4A 3OO1A 4L16A 3PFFA 3NIGB 3P9SA 5ICGA 3BE6A 1X1AA 1WF6A 4GI5A 3EQ2A 1KKLA 2G9NA 3EQ9A 2WV7A 5TLSA 4K9KA 5I8ZA 3S2EA 3C45A 3OZTA 3EGVA 1C1XA 3L3BA 2XUFA 4E5SA 5TQ2A 1UQTA 2NTNA 4JJKA 4EYGA 1CJBA 3A6LA 3E3OA 3CMMA 1WMAA 4BTEA 2P6OA 5H3HA 5TPZD 4A23A 1D6MA 1FDTA 3O8NA 2WJVA 4OQZA 2DGDA 1J2RA 1EFLA 2MDTA 4YMUA 4RKYA 5KNBD 1NMXA 2VHZA 4ZHQF 1NQOA 1RWVA 3NRBA 1JPVA 2P6MA 3TDMA 4LJYA 4R81A 3VU8A 1CY2A 2WFLA 5KNBH 2HADA 2KYRA 5DM70 2PL1A 5CDFE 1CB7A 1T13A 2JH9A 3OM0A 2C99A 4BQQA 1U8UA 3TTUA 2SHKA 1WMBA 1WSWA 2ZE5A 1JNYA 1Q0LA 4CMAA 1NXWA 4XVRA 4L5JA 3TRJA 3NEPX 3R7BA 3SLKA 4BWVA 3Q7TA 4A8JB 4DRXA 4Z7NB 2ZETA 1N9GA 1YA4A 4WHMA 1QIMA 1JDJA 3U37A 2EFDB 4EPRA 5L4SA 3ZW7A 4I1PA 3ESCA 3Q7PA 1ZCBA 1IRXA 1XI2A 2I7VA 5BW8A 4DIOA 1FDIA 4JAVC 3LP6A 4DAOA 1QRSA 4J6FA 3E18A 1CFJA 3NAGA 1D4FA 5ESWA 5CXQA 2K7FA 4G5YA 2RFLA 1AQLA 1XMXA 2LCIA 1SGWA 3O83A 1HFJA 1UR5A 1P5HA 5JPCA 5H81A 3AFHA 2ZRBA 4NBLA 2NO5A 5AJXA 1OX4A 4KQIA 3GFPA 4GYWA 4LGVA 3AJRA 3HLYA 4W63A 1LX7A 4AJJA 5JCOC 1FY2A 2O2YA 3OY2A 5L3QA 4DV4B 1OFHA 4HVLA 2I2FA 4RIFA 3OHPA 3TOZA 4Z9BA 1QORA 3HA7A 1RRCA 4C0XA 5DI3B 1KJQA 3OLCX 3LUBA 3UUWA 4UU0A 4R5HA 1NWHA 1UZNA 1WMFA 5KSZA 1Z2NX 1AKQA 1D0IA 1E1YA 2FFHA 2WC1A 4U63A 2NTYC 1H05A 2NMVA 1SKYB 3O21A 3STYA 3BXFA 3BIJA 3C6ZA 4B32A 1I2MA 1KKUA 1MEOA 1XMQB 4E7OA 3T3OA 2GF9A 2O3TA 2R44A 4HBGA 4IJWA 4AWAA 1XAJA 1OJLA 4HNRA 1MRNA 4A0GA 5GZ1A 3M6AA 1S9DA 4O4JF 2BR4A 3HY3A 3GLRA 5H59A 1GZ4A 2BY4A 5AXDA 4PICA 4ZIRA 1QRAA 4IUDS 3E2MA 4E5YA 3UJHA 5GM1A 3I6ZA 4RL4A 1N6PA 3RRFA 1YMQA 3TTWA 5KQRA 3T5MA 2WHRA 5JNSA 1WU7A 1ZZEA 3HSYA 4UW9A 4RTQA 5BSWA 1W5FA 3E7PA 3EXHC 4HXFB 1R4MA 2PVSA 2P2SA 3G85A 5GV8A 4JGIA 4TLEA 1ISGA 1QH0A 3NYQA 1UQRA 1TEHA 1YZTA 3QHQA 2D4AA 2P9TA 4WESB 1Q1EA 3AINA 2Q2OA 2BZGA 2WHQA 2XUZA 4FYJA 4EW3A 4IP0A 4C3ZA 3QZUA 1BA3A 2XGSA 5KINB 2AOVA 4X1IA 2QPTA 1KAEA 1RCTE 2BTQB 1LGYA 1Z06A 2VPYA 3JQ9A 4EY5A 3F3YA 5FLKA 2DPXA 2H4FA 4FGWA 4ZAVA 4K9OA 2GM9A 5C7YA 4QDZA 1QV6A 1HFWA 5H82A 3O1LA 4AF8A 2W6NA 3UEOA 1M33A 1J5XA 3BEOA 4HYQA 4LY0A 1IY0A 3VJMA 4DNOA 2Y93A 1R6BX 1T9GR 4ILEA 4MW6A 2GB4A 4OJTA 4E15A 4JI7B 3VI4B 3R7DA 3D3JA 2H0AA 3D8BA 4OHVA 5FNVA 2ZUFA 3LA8A 3O1HB 4MPRA 3FY4A 1QR2A 2Q6VA 4MCHA 1P9LA 1X80A 2GCEA 1MVNA 1D0SA 1EM8B 3D1VA 3TSWA 2J6CA 2A9RA 3K20A 3PNVA 3RWOA 4I3HA 3SR4A 4ZO8A 4UARA 1U02A 3TSZA 1QRTA 2OO5A 2LDXA 5BV8A 5F78A 4U8GA 3GLUA 3F47A 4N3GA 4N0MA 4XVCA 1DWPA 3MJHA 1WXQA 5FTKA 3WB9A 1W2HA 3OT4A 2FH5B 2QT0A 2WJZB 4RH1A 4B6JA 4BU0A 3KXDA 4YPOA 2YTZA 1G6Q1 4LQLA 4OF4A 2VTVA 3L7JA 3O47A 1KJNA 1ZC4A 3NU1A 4FC6A 2JRLA 2VYVD 4XUDA 5ALGA 3WGHA 1JFFA 1M8KA 4S04A 4I55A 5DKFA 2ZYGA 3RIEA 3UJ7A 4UE3S 4AXBA 3R1IA 4NJOA 4R9SA 1VHWA 1NVGA 1SVWA 1NSYA 2B1RA 2EGGA 4D0NA 3DDOA 1P0QA 3RGGA 4CG0A 2YN2A 3L6EA 5KYKA 2HMWA 2ZS7A 4C0QC 2ZBUA 1CS0A 4L0DA 5FWDA 3C3MA 1E6CA 4RTPA 1TEVA 1H2ZA 2WG0A 3GPDG 3ZDAA 1XAIA 1AXRA 2FEPA 2H17A 4QBIA 3T3NA 3H42B 3RVMA 1JU3A 4IUYA 4RJIA 2FPIA 1I2DA 3R3VA 1F2VA 2GAAA 3WYGA 1KO4A 1O97D 2N0SA 3GQBA 4YAEA 1LBIA 3K30A 2E5FA 1GTJ1 1QDEA 3V1YA 5B30A 5B6JA 5K6RA 5IM5A 1N5IA 4HLQB 3C3WA 1H42A 1A98A 4LJ9A 3E58A 1QDLB 1XCLA 2QMEA 3U17A 4PO9A 5I9MA 4UVDA 3DR3A 1RQNA 2HRBA 3KSDO 4B7UA 4S0XA 5C51B 2QJRA 5T67A 1OASA 2FETA 4ZDJA 3PC8C 5LDDC 2G5GX 5IULC 5DCYA 2C5SA 2QGZA 1H2BA 1GPKA 4FWTA 4GRIA 4POOA 3SN6A 2H16A 3EIUA 3KKKA 4DNXA 5KWIA 3GLFB 1ZP6A 3EGDA 2JJQA 2O9JA 5F2OA 5G0UA 4RTRA 1I2BA 1GTZA 1NKSA 4LV8B 3REQB 2VQEB 421PA 1OROA 3JQ8A 1XVLA 3RKUA 4AY5A 4NYJR 3HJGA 4JBYA 3W04A 2EEZA 1H4VB 1OYWA 1PG5A 4HDNA 4HNUA 1ORDA 3UAYA 5EE0A 2Q2NA 3TLCA 5JNUA 5I7FA 2OD9A 1L5FA 3KQOA 4PC6A 1KNXA 3CF6R 4QAJA 4QTYA 3UJNA 3NOVA 1RQGA 1RRVA 1E99A 5EHZA 1NGSA 2IRWA 2XYGA 3GVIA 2QUAA 3AZPA 3RTDA 3WGUA 4DLPA 4EO7A 2FZKA 1FDWA 2ECPA 4B74A 4K6MA 2J7PD 4EY7A 2HSZA 3OESA 3MQ4A 2VDPB 2WJ3A 3KEGA 4OQNA 1YFJA 2VPQA 4NEGA 3DT9A 2AYXA 4EW6A 4HAVA 3L40A 2Z6VA 4P53A 2BONA 1RI1A 2RHHA 1OD6A 1SRRA 4H17A 1V25A 5DYIA 2B36A 2IITA 4OGLA 4ZALA 3GFTA 3FWZA 3HZHA 4WADA 1RAAA 1OZFA 2I6XA 3KAPA 3ZEAA 2ZYTX 4C6RA 4M1SA 2R48A 4X95A 3QFTA 4BGDA 5FBRB 1DIBA 1K0FA 2FEWB 3TGPA 3PEEA 1UMBB 1YZVA 2WSSA 3SICE 3RIXA 3L8CA 5C4IA 2TMYA 4FT4A 2Z2IA 1M2KA 1NPYA 3EFHA 3EQ7A 2C42A 3LPNA 2C4VA 4EDHA 4Z9XA 4AKEA 1V48A 5MF6A 4LJAA 1F0NA 1GRRA 4X7MA 2GEBA 2W0MA 2XEDA 3EXIB 4QUGA 1KE1A 5LYJF 4CMHA 1NOKA 5DLDA 3ILSA 1OF1A 3KJGA 4GI3A 4PZAA 5IKOA 3EMDA 5FTJA 2C4HA 2D62A 3H1EA 4HLUA 4WJLA 1EJ2A 2W6ID 4ICIA 2X2PA 3P27A 4H7JA 4JR1A 4JYBA 2ZI3A 3SU8A 2GKOA 4LGYA 2A5GA 3A1VA 5AESA 3IUJA 1XALA 1O95A 1C2TA 2C95A 2L42A 2RD2A 3ZE8A 3OU6A 1TM3E 2O3UA 2VQ6A 5G4KA 3UWMA 4XQEA 1F20A 1MZVA 1HBJA 3HDVA 3N87A 3PUIA 5ER9A 1E61A 1QG4A 2PZBA 3B6MA 3DOFA 1ZK1A 3G0GA 3UMGA 3TPCA 3UTDA 4M7OA 2IEIA 5CLFA 2FWMX 1NC3A 1QE3A 3HZRA 3ZCVA 3THSA 4DFDA 4U2GA 1JMYA 1V6SA 2B1IA 2RGNC 3FMOB 3OPMA 4JJ8A 4IF6A 4NQRA 4PBRA 5ECGC 2IS6A 3INTA 1PX2A 4YO7A 2AC2A 3QKSA 4B6RA 4GI1A 5E8JA 1H22A 3W8NA 3GFFA 5A4IS 4JLAA 1AD2A 2NXWA 5TGTA 2CF5A 3AEQA 5LZ9A 1B1CA 3RVOA 2ZYRA 1M2WA 3A14A 4BEBA 2CV2A 4CF6A 5EE1A 3B6EA 2VFAA 4OKSA 1N9KA 4OHMA 2G0AA 4WMLA 2IV3A 4WINA 3U40A 5TEWA 3RRMA 1F8UA 1UXHA 5ITVA 5JSHA 1Z7WA 5CYGA 2BT4A 4AY3A 3TCKA 3JYPA 4Q9KA 3VPHA 3HV0A 1Z0IA 2C4WA 1BMTA 1YI1A 2GWHA 4I4LA 2C9ZA 2PV0A 2RK3A 3OZBA 3EVNA 4N65A 5CK5A 5I4BA 2OBNA 3IV7A 5DTRA 4KQGA 4U9HS 1HLDA 4TV8B 1KRHA 1M0SA 6ADHA 2V58A 1R5NA 2JJ2D 3KDAA 4GKAA 3UG6A 4OAPA 4R83A 3BB3A 1RQPA 3R40A 4GDMA 4TOIA 1QK3A 3RC2A 4JLPA 3AIOA 1JIUA 2PIDA 3FFXA 1I6KA 1SJ9A 2CXNA 4NBVA 2AJBA 1P81A 1W94A 5HDQA 5I3CA 1RZRD 2ECQA 2Z98A 1KQPA 2HWWA 3DJFA 1PYOA 1DC7A 3NHKA 1V41E 4O4HB 4D4JA 5E1OA 2AX3A 2CD7A 4KXXA 5BYJA 2R3SA 1FIUA 3MB5A 2Y4NA 2M98A 4ZARA 5I48A 1YJ5A 4HG2A 1WDKA 4OY3A 4RGQA 4CLOB 4YGYA 4H3HB 1M6NA 2B3TA 2YZNA 4LC0A 3RF6A 5J4HA 2F00A 4P81A 3B7PA 4BMSA 3EXG2 4EZIA 2X0FA 4N7MA 4ARVA 2QENA 4G4IA 1GRNA 1SU4A 1NOJA 4OX9Y 2VHWA 4M8KA 1T5HX 1TF5A 3ZZ1A 1TZCA 5GV7A 3PA6A 4JYAB 4ABTA 2PX4A 2Q41A 5CBPB 3DHYA 4HL6A 1DJPA 1E62A 4MA4A 2BI4A 4O4LA 5KVAA 5IHXA 1OAOC 4KYUA 3A1SA 3U16A 1T9CA 3DW1X 4J7XA 3RHZA 1E9CA 1E3LA 2XA2A 3ZQJA 2PT7A 2HY7A 5KOHB 3CG0A 4E12A 1E8NA 2O7VA 3K8OE 1UT5A 2DQSA 1U3FA 1XTQA 3DQZA 1PFYA 1W8DA 1FF9A 2XDQB 1LDNA 2Q5FA 2YRXA 3ENZA 1KC3A 1AC5A 3HC7A 3OZCA 4Z9AA 1O94C 2V7QD 5KB3A 3FDIA 2G0NA 3QW2A 1DTWB 2VJYA 3A6GA 1BGVA 4ILKA 4LDPA 4S24A 2O20A 3CRQA 3MXOA 3VVMA 1NL3A 2YJ5A 3EMVA 3GJ4A 1G4AE 3GI1A 4U2CA 1W5SA 1T6NA 2WWVD 2YNMA 4DR1B 1REQA 1VLJA 1ZH4A 2OEPA 2R8OA 3U7GA 2ZBVA 3M70A 1QAOA 2O1EA 2VWQA 2ZULA 3BIXA 3GMTA 4PG5A 1DAHA 3L93A 4AQDA 2ZDGA 4GOMD 1HE1C 3LK6A 1WUJS 4WI1A 1RYBA 1QX3A 4I6EA 4DQDA 1ESZA 4M7RA 4PIMA 4F84A 1PW7A 2GEVA 3N7TA 3R9XB 3FDFA 1AV6A 1U4OA 1M2EA 2XODA 2H7CA 4ZQBA 1W0KD 2YH2A 3MBOA 3HO6A 4MP6A 3SPXA 3SSNA 1AQIA 4TWAA 1JYEA 4YAFA 1GQYA 4GYYA 3UKJA 1GGNA 1Y8CA 2QXUA 2YVUA 5JTUA 1YA6A 1B8VA 4TQUS 3RTAA 3A6FA 4TZ0A 4PFJA 2WJGA 4KFCA 2B2NA 3EPKA 3OF2A 1SK9A 4JOQA 1SXQA 3DKPA 4KFTA 3H8VA 1NZJA 1WL8A 1Y8AA 2B5VA 2PL9A 3DBRB 4NJMA 4EFKA 5AIBA 3TB6A 4KR7A 3KZVA 1M2VB 1XL1A 3DULA 3A26A 3BFJA 4E3ZA 1GGHA 4CIAA 4FYVA 5JYCA 1IY8A 4PZDA 4B2YA 1V4VA 4X1KB 4RM3A 1Y4DE 2V98A 2C88A 3GLIB 1WMEA 3GRZA 4RY8A 1M3SA 1FFXA 4N0DA 4YLYA 4ZCSA 3EPRA 2PMBA 4ZGWA 1WS6A 5ERYA 4QOSA 1UOEA 2CGEA 4P5DA 3KYIB 4D26A 4TUYB 1DWUA 2FZEA 5IJWA 1KTVA 4CQMB 4KIGA 4TVKA 2H1IA 2A78A 3ANXA 2Z6QA 2FEAA 1MX5A 1XEWX 4ZOLB 1YXMA 2A5LA 3QQ5A 3TH5A 4B83A 5FO0A 1P1CA 1EKXA 2FG5A 3M89A 2OXFA 3DH0A 1DMRA 1JXMA 1HYQA 2FX3A 2Y27A 3ZKWB 2R85A 5DGDA 2JBWA 1IBSA 3W2TA 2RH9B 4LRUA 3UOGA 3U4QA 3KYBA 4HAUA 1M7BA 3L4JA 3F1LA 1K88A 3M2PA 5DBHX 4H6XA 4CKWB 1ENYA 2AQ8A 2VNHA 4JJZA 5KYVA 1CWUA 2PRIA 4NTZA 2ZRNA 2X13A 3DZKA 4MDYA 4OYYA 4BO8A 1S02A 5BV7A 3NTUA 3KFVA 4DXDA 2RG1A 2XCIA 2ZI7A 3PQDA 1ECFA 1JPJA 4URHA 4TTTS 4QKQA 5JECA 5KJCA 2E5WA 1QP0A 4EWLA 3KQYA 2O2HA 4YT4A 3LUCA 1GNQA 1C4KA 3UAVA 3FOBA 4BHTA 5TQ0B 3JYNA 5JALA 4GD3Q 3KEFA 2NQ8A 4PW0A 1ZRHA 4WN3A 2AFIE 3FI9A 3R5SA 4F7DA 3Q11A 3GO4A 4GQIA 4MUKA 3R09A 1G41A 1O9HA 3DVRX 3KVOA 2AHRA 1JJIA 1H94A 1O96A 3O9VA 4J9VA 1SHZA 2NP7A 3CURA 4L78A 3A4NA 4DMMA 3G88A 1N3LA 2W6ZA 1I7LA 1YUMA 3B1JA 3TLAA 1DEAA 4CHTA 4YGXB 2Q5CA 2H3HA 3NNSA 5E0OA 4BZZA 1CZOA 4QHSA 5KC8A 1A9YA 2AW3A 2HQSA 1ICIA 2QU8A 3HRKA 4I9NA 1W46A 3D02A 1XKLA 5KYXB 4DHWA 1KAHA 1OC4A 4YRBA 4D6YA 3ZLTA 5BWNA 4G24A 2QQGA 5LM3A 3V80A 1NVDA 5M34A 4OD0A 1JAXA 4M1YA 3OA2A 4RXTA 4UEKA 1A4XA 1HUQA 3T1NA 4OI0A 2X7XA 3EAGA 3FB1A 1GADO 3QLJA 3OLXA 5LDHA 4ID3A 1HDGO 2QUHA 1WXGA 3BSWA 1NVKA 2FQXA 3C1TA 4L8VA 3JAKA 1GKYA 3T7RA 1ONPA 3IELA 4CCSA 4NHEA 4IG9A 3DTVD 3IMGA 4FGUA 2ZRFA 4KU4A 3AVWA 4NPAA 4OAOA 5AP9A 4BQOA 4GPEA 2WZBA 4HQLA 1A04A 2EX1A 2XNDA 5JWHA 3NH6A 2YZKA 3U7QB 5DF1A 3UUGA 1XEFA 3GPLA 1SOAA 4L15A 4ZRMA 5ECWA 1JU4A 4R1UA 2RAUA 3CTPA 2WT4A 1JBQA 3EHEA 1C14A 4BN4A 2ZEJA 4YAWA 3U3DA 3F4LA 1GNSA 2GEDA 5EHXA 3WV5A 3OCYA 3OE7D 3M1LA 2IP2A 1B15A 3KXKA 2F3UA 1TLLA 1OLSA 2CNDA 2Z2YA 3NPAA 5KHLB 1WZEA 4NX2A 2VA8A 2IYOA 4Y2RA 1E92A 5ECYA 3GVHA 4HFNA 2O8FB 5COBA 3KQKA 4E21A 2H31A 3OPYI 4XCQA 4MGZR 1C8LA 2A1UB 2WD9A 3SR0A 2LNDA 2Q5LA 1HKHA 2DR0A 2P3SA 3T52A 1TRKA 5ICCA 1XD2B 4KH0A 4MLPA 4KBYA 1XVTA 4YJFA 1CNEA 1XK7A 1UH5A 3HPRA 1L5HB 3H9UA 3PRKE 4ZT7A 2B9VA 1Z0ZA 1GPUA 4RM2A 4P4TA 2JANA 3IHTA 5MGBA 2J67A 4YWJA 2W6JA 1TCBA 4NARA 2AR7A 1E1MA 2X5NA 2P41A 3KTOA 3LK7A 1EHIA 4TXJA 1CEQA 1TYAE 3WC4A 2QRLA 4NLLA 5EPEA 4MWOA 2FMXA 1Z8DA 3AHIA 1ZKMA 4UXHA 4EA7A 3G8BA 2PL3A 3DDSA 4IEIA 4Z3DA 2FP3A 2CY0A 3E61A 4YJ2A 2XUGA 3RTGA 3NBZC 3RUDA 4B43A 2LVBA 2ZWMA 3I6IA 4N12A 5KKAA 3S8MA 3B7GA 3H19A 3G7SA 3IILA 1CVLA 4HX5A 1CUAA 1KYTA 2PWZA 2QZ9A 3KVRA 2P5YA 1ZRMA 2R6FA 4W82A 2AZMA 1RS0A 3SHTA 4KRYA 1R9JA 4E2XA 1GYRA 6REQA 3BC1A 4Z99A 1IK6A 1MO5A 2QNIA 1NV9A 4H9GA 5CVCA 5E95A 2DPGA 3O8QA 3QQPA 4LNUA 4Q19A 1GTVA 3BWDD 4ZPXA 4CL2A 3CRW1 2XOKA 4DMLA 5I9IA 3H1GA 1IM8A 3VPFA 4C2TA 2JLVA 1I5RA 3CUWA 4U2KA 1NNUA 4MQUA 5DO9A 2BFNA 4AK9A 1SZJG 2EFCB 4PC3A 5E6UA 2C0QA 1U2DA 3JVUA 1FP2A 2WIFA 3I32A 1QIJA 3NVMB 4YBZA 3PL1A 3FR7A 2P4QA 1TF2A 4XRGA 5F5LA 1RWBA 3LFTA 1QTQA 3G17A 1XN1A 4PC2A 4KEAA 1R10A 2FW1A 4HMOA 5ILOA 4GR4A 4L57A 1V1JA 1EE9A 3AJAA 3NJRA 2ZBDA 5SZJA 5KHOC 5FDFA 2Z2ZA 3G0CA 3GT0A 3LE8A 2ZRCA 3OQHA 3NBXX 3RLIA 5I4IA 3HA5A 2O8DA 3FMVA 3L1HA 2QVGA 5DXJA 1JA1A 3R7FA 2F4NA 2YV1A 1K8YB 5HGJA 4F2PA 5H02A 4N9WA 3T7SA 1MPTA 4RK0A 4I5GA 4BKQA 1TYDE 1XRMA 4DQVA 2OV2A 1Z2EA 2GYYA 3D54D 3D6NB 1JH8A 2CXOA 3I5AA 5IDWA 4TYNA 4H31A 3AU8A 3V4VB 3EW9A 1BWPA 1JA0A 3K2BA 4HYEA 4M54A 4TWRA 4UC0A 4N01A 5DJ5A 3ETCA 3NHLA 1WBDA 4C5BA 1MU0A 4YCCA 1JT9A 1M8JA 1EHYA 4D99A 3EEFA 1BVHA 1BE6A 5CIWA 2BGMA 2YV4A 4MH0R 2VWPA 5I6DA 1I6WA 3IKTA 3V4RA 1IJFA 2V4ZA 4P7KA 1W85B 2BHNA 2RHBA 4QLAA 5LP1A 1CR6A 4TV8F 4WXPA 4X0EA 1W29A 3H2BA 3LY5A 4IGEA 4L8LA 1MQAA 4NVRA 3ZGLA 2JFVA 4OSEA 1P7PA 4LRXA 3V7FA 4X3CA 3FZYA 3L43A 2WYVA 4GUDA 4EF5A 2W4MA 1CU1A 3WWDA 3E48A 4WH0A 2HJVA 1LJLA 2WOOA 2BEUA 4O4HF 4OXQA 3N0TA 2ODBA 1KIFA 2QN6A 1R8SA 2NIPA 2ETVA 1N8TA 3B1ZA 3H83A 1TCUA 5L7WA 4AM8A 1RFGE 3MOSA 5IG2A 4Y2QA 5D5QA 5BN3A 3SVLA 4C0WA 4CEHB 3GOHA 1U2PA 2ZJYA 4J43A 1NJSA 4HO1X 3SEAA 3FMPB 3PEFA 2HLPA 1A5SB 2VT3A 1CC1S 1G4UR 3R7SA 5DWDA 3WNBA 2V5UA 3ZV3A 4G0PA 4GSKA 3U5ZB 4B4UA 3MTQA 2ZWVA 1AN0A 3MFQA 3O94A 2F3RA 4A2CA 3VPSA 4ES6A 3PF8A 3LWZA 1SVIA 2G0TA 4BMVA 1OV6A 1LVHA 3QE2A 1PZEA 1LWOA 4ER7A 3ELUA 3H6GA 3F6EX 3I8OA 4GWGA 4BVLA 3T1VA 5DHSA 3D4OA 4DNFA 2W8ZA 1W96A 4IIGA 1BHJA 4Y9RA 4WERA 5D6OA 2M6KA 4GXRA 2Q7DA 1P0PA 3AZQA 4BTVA 5CA0A 1ONNA 1X7XA 2HMTA 2H2AA 3VYVA 5SY9A 5IF3A 1YOVA 3OZEA 4RTOA 4J75A 1C7QA 2BEVB 3C24A 4LPSA 3TNYA 1JQJC 5AVVA 1V6CA 4JA2A 5JAHA 2PX0A 3PCXA 2JLYA 4JB8A 4CMIA 2WJPA 2VJPA 2R9VA 2FSGA 4KR6A 1WY5A 4F72A 1TIBA 1MX9A 3QLTA 3ANTA 2X9QA 4C4AA 2XNHA 2PFSA 2DPYA 1LDYA 1HGXA 2EJVA 4D7AA 2UYGA 4HPWA 3L05A 5HW0A 2VXBA 2PE5A 1W52X 1FS4A 4JR2A 5CFRA 4O29A 3CXUA 5IT0A 3KZOA 4JQCA 2ZUEA 3TVDA 3H84A 4C0SA 5KI6A 5ITSA 2QR3A 2Y66A 3FNRA 2XTAA 2ZITA 1R8YA 2XXAA 1P7YA 2YIJA 4UCWA 4DT1A 1V7CA 3GGCA 2MINA 1LI4A 3F71A 5J1TB 1MFPA 7REQB 2X1HA 3EVEA 1U3WA 1SUDA 3PWTA 4BAZA 1WULS 5B1SA 1W30A 3SQOA 2MWMA 4BY9E 2JFFA 3KEOA 3VZCA 3ZCQA 5JY1A 2Q3HA 3EUAA 2XCQA 1ISPA 3FUWA 4ZC8A 3X2SA 1I5OA 4RQAA 3C8UA 1U9ZA 3EXEB 1ACJA 3D0KA 1NMSA 5LD2B 3OJCA 1T29A 4CCYB 1NI4A 4PV7A 1SFRA 1XTPA 1FFWA 4HWSA 5JHGB 2EV9A 5JDIA 3RJMA 1CS4C 1FTSA 4M1TA 4TUYF 1O5TA 4F3RA 1CIJA 1GO2A 1HDRA 5EZYB 3HCWA 4QOEA 9MHTA 3WHPA 1CW2B 1RI3A 1FRNA 1YH3A 2G5TA 3M0EA 2CVOA 2RMKA 4IZOA 3DBIA 4ZXPA 2PO7A 4UREA 2DYKA 2CNBA 2K2WA 3OZ7A 3NEJA 4PS1A 3O7WA 4G85A 5JCZA 2W6MA 2QMZA 2DWQA 4YRCA 3ZD8A 3F5DA 3L7KA 2CKDA 1SKYE 4UUOA 3N58A 2BTOA 3DMFA 3RSLA 5EWJA 4ER6A 5IVKA 3LT2A 4OUDA 3FD8A 4QUKA 1UBEA 4PG7A 3ZE1B 1T91A 2EDAA 1I2CA 1P7VA 2FUCA 2NVWA 2Q21A 5I7SA 3AVVA 1F38A 1I7NA 3L7DA 3CSSA 4LV5B 2HJGA 1Z17A 2Q4RA 4BMZA 1LDBA 3E5MA 3ZG6A 1VYUA 3KKPA 4JJGA 4B3HA 4J4HA 2IIQA 4R7ZA 3JXEA 4K6FA 1KFKB 1NTOA 3OT1A 2EG5A 3A10A 4QDOA 5F12A 5C0OE 3R3SA 1LLFA 5J40A 4AB1A 3MAJA 3QFFA 5JJKA 5KSYA 3VNRA 4Q03A 3O2NA 4J0CA 4DTIA 5K45A 3SZLA 4B5KA 1HQCA 3MSXA 3FUTA 5KJFA 3FZNA 1NJ6A 4A8HA 1PV4A 4KC0A 2WY2D 2CT8A 3JD0A 3C2QA 3M49A 4RK5A 1XZIA 1YZGA 4F11A 1NE2A 2DHRA 3NW9A 3KKZA 4B6SA 1BCSB 4V0ME 4CMGA 4YK7A 3AHHA 2AV6A 3D81A 2MMGA 3LKVA 4PRZA 4QGGA 3UMCA 3WYDA 3ZN2A 1THTA 4A91A 4Q6BA 4K05A 2EBWA 4ZK6A 5FWYA 2FSIA 1A7AA 3NDPA 5AM4A 3WMFA 1IAQA 2QOEA 1GPBA 2ERXA 2W2LD 5FA5A 3BGOS 3SJUA 4DVJA 3IBYA 1H2FA 3AF2A 1MUUA 4LXIA 4BFXA 3NMUF 4PLHA 4MR9A 4AWBA 5H9WA 3KG2A 4X8LA 1N3IA 4DLUA 4M9CA 5DX8A 1DQZA 1K6JA 4HI0E 4NYIQ 3Q4GA 4Z86A 3VFDA 4B48A 3KZ1E 3GVXA 4WVLA 5IK2A 2X4DA 5IZCC 2CJWB 1EWRA 2WU1A 2Z8YA 4AXXA 4BBJA 4WASA 4CV0A 1ZINA 3GUZA 1V1RA 4BRUA 3QUSA 1P1JA 4ZYLA 1PS0A 2HSWA 4A2QA 3ER9A 3A9WA 3QPCA 3ROGA 1QH1B 5DB4A 1R64A 5F2NA 2Y0PA 4HRXA 2PTGA 3K0CA 1LV8A 1SXHA 2A0YA 2PGAA 2QW1A 3IEXA 4B9EA 4YV2A 1IM5A 2Q3FA 1IM2A 2GAOA 5I9NA 4YCMA 2EGHA 1PEKE 5DULA 1VG0B 5DIZA 2IODA 3ZCTA 4NY1A 2IDMA 3CNHA 4Z7QB 2X0JA 4ENSA 1KERA 2MSEB 1L5YA 3AQIA 2CYAA 2VO1A 4GOND 4M60A 4PTLA 4ZO6A 1Q14A 4G0NA 4FI3C 4QARA 3WMEA 4U5XA 1Z18A 2QL7A 4DS3A 2ZP1A 1E2KA 1O87A 3U1VA 1C4WA 2IDZA 4G1UC 4AP6A 1C9NA 4YMLA 1JAHA 1LI5A 2WTAA 2GK7A 3UO8B 3VU9A 1KS9A 1EZ1A 2OZVA 3COPA 3N8IA 2JVJA 5IBRA 2EC5A 2ZIFA 4LTDA 4BNHA 2NO7A 4HNSA 1L0BA 3O26A 1Z4PX 4DC9A 1SXJC 1AQJA 1BN7A 1MDFA 2J7KA 3UMMA 3FZQA 4H0CA 1H6BA 4YH1A 4YXWD 1J8DA 4YRIA 1AQUA 1ZHOA 2WPNA 3JQCA 2P78A 2BFEA 4YJDA 4YJGA 1NFRA 3L49A 3S0JA 1GXSA 2YN0A 2G1PA 4BVGA 1SR8A 5JVDB 1ZR2A 1W36C 3H1FA 3TUJC 3NWPA 4MO9A 1U2GC 4ONEA 1GPH1 4LY6A 3L6DA 2ZYHA 4PG8A 5H4GA 1YONA 4JZKA 4NNOA 2UAGA 2GZ1A 1IXSB 1S2MA 1T5IA 1J0CA 2YZMA 1N6IA 3O74A 4I5IA 5BNIA 4RA6B 2IU0A 1H3FA 2BHTA 3AF1A 4ANFA 5K0CA 2N9UA 2R65A 2WABA 4TTSA 3ZI4A 3GLFE 1C9KA 2C5AA 2WKRA 4NMHA 1H0HA 3PWSA 4MUYA 3DUWA 3NQ41 2IHUA 5KZMB 5HZGA 2F7SA 3L46A 1VGRA 1NDHA 3NORA 4P22A 4AFNA 2I1VB 1U7HA 3UA3A 2NWQA 4ASUD 1OT3A 4L9WA 1MG5A 2NVUB 3IAS6 2YHBA 3IALA 3INYA 3HUFA 1GRVA 4TSKA 4YV7A 1DHTA 1JLHA 1KR2A 4DANA 4BLTA 4E4YA 1T3SA 2ZVDA 3NWJA 5G4LA 1UBTS 4ND6A 3R9WA 1YB2A 1R0LA 4H1WA 1RM5A 4MUJA 1ZBDA 2GASA 2P40A 4L5YA 2D4HA 4RD3A 1P5ZB 2NU6A 2ILVA 2OQ2A 4M1MA 2O7SA 4UM8B 2J5QA 1A2KC 4BP9A 4F91B 4BLOA 4W6ZA 4BLSA 5K8UA 8ATCA 3A25A 4KXNA 4EHLA 3PLRA 4LZOA 2RJOA 1GOTA 1BRTA 3DFFA 3FVVA 3UZUA 1I2AA 1FMFA 1R6UA 1CQWA 4MR7A 3LC7O 4JC8A 3TR0A 3X1YA 7MDHA 2FWBA 3ONFA 5SZHB 1ENOA 1H0KA 4GEKA 3QXCA 1RLIA 1WVMA 3KUKA 2RJ3A 5CT4A 1OILA 3ONNA 5FFMA 4RAQA 3ZX5A 3SXPA 3ZV4A 3FUCA 2GETA 1T6ZA 4MIYA 1JR3E 1K66A 1KETA 1VMKA 3GUYA 4KPGA 4OP2A 2REQA 4NATA 4OHZA 3RHSA 1QFJA 3FCY<