2ATXA

Crystal structure of the tc10 gppnhp complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
186
structure length
186
Chain Sequence
SMAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords small GTP binding protein TC10
total genus 50
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2005-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2atxA00
1II8A 1AQUA 2GBLC 1ZYUA 1KDPA 4IDPA 3AB3A 3GLHE 2VHUA 4I1OA 5FOXA 2HLDD 5GADl 1KO1A 1ZUNB 4DDTA 2GETA 3Q8XB 2R6DA 4CRWB 4DLSA 2X77A 4UNRA 1YZUA 2Z0MA 2C2HA 2I4IA 2ZI5A 3ICQB 2BHRA 4DSOA 5JHHB 4EJSA 4EPXA 4KJZA 4C30A 1VHTA 1UBCA 1QHXA 4M1KA 3QXCA 3R7WA 4DXAA 3EA0A 3QJYA 1OW3B 3OE7A 1A2BA 4QHTA 5E3HA 2VP6A 4KFUA 3RRZA 2VQSA 1OFUX 1BO6A 4AI6A 2GEVA 1NLZA 1P5ZB 3ADKA 4NCKA 5GJWC 4D2IA 2IYUA 4MKHA 5IK2A 1UKVY 4B2PA 4B6EA 3U5ZB 2P6NA 5LB2A 1Q1ZA 4HAWA 1E69A 3PEYA 1W7AA 4HAZA 4YQFA 1AS0A 5DI3B 2C77A 1WMSA 2OXCA 3G82C 3GJ0A 4I1UA 1ESMA 4IDOA 2WKQA 3MAAC 1LF5A 4BEJA 1BMFD 5JEEA 4MKIA 4AKIA 3UG7A 1ZVQA 4B73A 4U00A 3CO5A 4R9UC 3BE4A 1F48A 3LAWA 2GZAA 3KXIA 3RRMA 1UKEA 1D9ZA 2ZI4A 4BZPA 1UEJA 2GBLA 1WRBA 4NBSA 1CJUC 3A37A 3AGQA 3MWJA 4OHXA 2ZRNA 3K1JA 2XZLA 4LWZA 4MA4A 5DHAA 3PEVA 5K8LA 3FDIA 2ERYA 2IWRA 1AJEA 3NC1C 3AVUA 3GLGE 2AK3A 3DEFA 3W5IA 1IAQA 1ZUIA 3THWB 3IEVA 1ZM9A 5JSZB 2JJ8A 3CF6R 5EXTA 1ZNYA 2FFAA 2QRZA 3TR5A 4Q21A 2RHDA 1OH6A 2I1QA 4LBVA 3SBDA 4CVNA 2XOKA 4TYPA 3GJXC 1TU3A 4RKFA 3BAFA 4DIEA 5IF9A 3QENA 3WNBA 2R6FA 2V7QA 2VHQA 3KL4A 1UJ2A 2F1IA 2PMDA 4WAUA 2GILA 3OESA 4B35A 1KHTA 1A82A 4RKEA 5EP3A 1P9RA 5EE9A 4ARZB 4OQLA 4MGZR 3V9PA 2KE5A 4I99A 3CPHA 1AKEA 2ZE7A 3LW7A 3IIKA 1XTJA 3U3JA 4YDSA 3UWOA 1SXJC 4HZUB 5IDVA 4AKGA 5KO2A 1T8UA 1PLJA 4NYIQ 2BCGY 1ZRHA 4YMSA 5EXPA 4BECA 2REBA 5JCPA 4PPQA 1R0YA 3C8UA 3EARA 4MRVA 4M9XA 1KI2A 5LD2B 2AD5A 2QP9X 1KAOA 5KNDA 2JASA 2DPXA 1AGPA 3JZMA 4F38A 4E03A 2WSMA 2ZRKA 2R6GA 2XTMA 4GMXA 3PEUA 4OI0A 1P2SA 2ZSBA 2GCOA 2QBYB 2FPLA 3K0FB 1OB5A 4M1TA 1UADA 3SHWA 1ZP6A 4EPRA 2A9KA 5FBVB 1GG2A 4LJ8A 2G83A 3I32A 5AJWA 3X1XA 2JAQA 1GRRA 2FSGA 2G6BA 3EXAA 2ZVQX 1P61B 4F4IA 2J0VA 2GZHA 5BW8A 1Q0UA 2ZR0A 4LPSA 3TNFA 2WSSD 3AP2A 1W49A 1FQKA 3EZ6A 4TMKA 4HB4A 4DCVA 2JEOA 2XSZA 2NPIA 4TLAA 1W0KD 4QC2A 2QE7D 2JIZA 4Q03A 1NJGA 4C9BA 3AKCA 3B82A 2V6JA 1BS1A 4PPFA 3QKTA 1OFIA 4FN5A 1KK1A 1W4RA 2QMEA 3VHLB 4BFXA 3CR8A 2ZJZA 1YJ5A 2J0QA 4A0HA 3FMFA 1JEDA 4Q02A 5FFMA 2WOJA 1IY0A 2IF0A 1XEWX 5EP4A 1KI4A 2CXXA 3GLGA 1BH2A 3LLMA 4EQ6B 4IVPA 5CJPA 2NGRA 1U98A 4JSTA 3S1AA 2BBOA 3MD0A 3T15A 3WRYC 4LJ4A 1FL9A 4WBSA 3ZZ0A 5EQTA 3I8SA 1R6BX 1VG0B 1E9FA 3CRVA 4JVSB 2FFHA 3RSOA 3Q3JB 4Z8XA 2JLUA 5KUTA 5EE0A 5JLJA 4JLAA 2WKRA 2QT0A 4BFTA 3IKJA 3B1XA 2CCJA 3H2YA 1TEXA 3LXXA 1EFCA 3U7FB 2H92A 1YHNA 3B85A 1Z83A 4ESVA 4IKEA 1CKEA 3KFVA 1E2EA 4JVLA 2J9RA 4HLDA 1XMSA 2BBTA 3V00A 4PPGA 2IS2A 1KDTA 2CHQA 1P6XA 4BPBA 3NDPA 4PZLA 4DBLC 3TAHA 3Q72A 2DR3A 5K8TA 2GVZC 3W5JA 2NO9A 1NLYA 2FGJA 1AK2A 1TQ2A 2VHJA 4B3DA 2GXSA 1RIFA 3GFTA 3VAAA 2ZIAA 4ZV4A 3KUCA 3RHFA 3TQFA 1VG8A 3QKSA 4GPTA 4AYTA 2ZJ2A 1SQ5A 4N1AA 4ZCMA 1G8GA 2HCBA 1YVDA 4CT5A 3DZDA 2O0JA 3X2SA 4KBGA 4U7DA 2XB2A 1W2HA 1OIVA 2QMUA 1E0SA 3QPUA 2ONJA 4NCHA 4IEEA 4RY2A 4QGAA 1UEIA 2H16A 2YKGA 2CBZA 4YONB 1E9AA 2V4ZA 5E4FA 3LBHA 3BFXA 3OEED 4Z51A 2WM9B 4LI0A 4YXWA 1JQJC 4DVGA 3KKPA 1T3SA 4KFSA 2CDNA 4NTZA 4PC7A 2QTHA 1LV7A 1ESNA 2ZI9A 1WA5A 2O0HA 1RRPA 3AEZA 2GJSA 1U99A 4JBYA 2JLVA 4LHYA 1J8YF 3KTAA 2QGNA 5BN5A 3RS4A 4YMVA 4TL6A 2B8WA 1SGWA 3CH4B 4TWZA 4NMMA 2A5DA 3OEHD 5J47A 5DHFA 1XTIA 3RS0A 2RGEA 2C99A 1T5LA 3F0TA 2FU5C 2ZVPX 4N0DA 3W9YA 4GDFA 3L0SA 5AK0A 3PIRA 1AKYA 1EK0A 1HQCA 4DT1A 4HDQB 2HF9A 5B58C 2A5YB 5CYOA 2XZOA 3ND9A 1O3YA 1XTSA 2VHCA 4A9AA 1GAJA 2H8KA 3I73A 2YC2C 4PZZA 3KQUA 3U3OA 2GWHA 3SJBA 4D81A 3UG6A 4DIDA 3GLHB 2RHMA 3K53A 1RFLA 1KIMA 4A0FA 2KI5A 3QVUA 4O0MA 3EZ2A 3R8FA 4UNPA 1YQTA 2V9PA 5IHPA 3DHWC 4G0NA 5H1YA 4DLVA 3A1UA 3NH9A 3C4JA 4YMUA 2VHTA 3W6NA 1DBSA 5IK2D 1EWRA 4JT2A 4QHYA 1LNZA 1S4QA 2F43B 2OT3B 1KI6A 1UKZA 3QQ5A 5AWFC 3GEEA 2J0UB 1HTWA 4XJXA 3TVTA 4EQ6A 5IT5A 2V1UA 4MUAA 3OFNA 4P4UA 1GNRA 1E2KA 3K0CA 3THXB 4JBWA 3ZVLA 4NE2A 1Z6YA 5DYIA 4MYUA 1JAHA 4S2EA 2ZREA 3OEEA 4BLTA 5EXXA 1DG3A 1BMFA 2ZQ5A 3QIAA 4B2IA 4DWJA 1M8PA 1OHHA 2HCJB 2FPMA 4GFDA 3NEYA 5B2ZA 5DSZA 3TW4A 1KO4A 1GRNA 2W2TA 1R0XA 1G4UR 4QL3A 3ADBA 1MKYA 2AKYA 4Z8YA 4NCIA 2ZR9A 2ZANA 1W1WA 2ZJBA 4W5JA 4MH0R 5DO9A 1ETUA 1LW7A 3NHBA 2W6JA 1S0UA 2NQ2C 2FA9A 3C5CA 1G5RA 4A8JA 3TLXA 5JCZA 4BWYA 1NMYA 4B44A 721PA 2OXRA 1MRNA 2Z83A 3GLIB 2W0MA 1G9XA 1YR8A 1NBME 2X2EA 3IPXA 5DIFA 5FR2A 5JSZA 3DM5A 4OHZA 1GSIA 4BFZA 3FHOA 2AFHE 3NXSA 2HDNB 4P31A 4TQUS 2IUSA 421PA 1W36D 1EGAA 5KDDA 2QQ0A 3PITA 2D2FA 3AKEA 3TVDA 3LRPA 2GDJA 3EZ7A 3CPJB 4WZBE 5FPHA 4B3GA 2PCJA 4TL7A 2ECKA 4TSFD 4RZ3A 2VP4A 2VP0A 2WV9A 4G1UC 4QM6A 2CL7X 4MDEA 1P9WA 2CMKA 3Q7PA 3OIYA 4UNQA 1XB2A 1NVUQ 4BGDA 3TRFA 2L0XA 1R7RA 4DLXA 3EIEA 3GLIE 1T6NA 1KKMA 1ZW6A 2ZYUX 3AF1A 3IBYA 1CJVC 4B33A 4TTQA 4JLVA 4BEBA 5J4KA 2VRWA 1W36C 2AWOA 5DLQC 2GAAA 2AR7A 2VF8A 4URUR 2RGAA 2R8RA 2V55B 5C18A 1G3MA 1ODFA 4A8JB 5JWRA 4D6PA 1CIPA 1OXTA 2IX3A 1P7CA 1FTSA 3NIBA 3T1QA 3MCAA 2VP9A 1NBMD 3C15C 4OJKA 2GXAA 1G19A 2JLRA 2QROA 3CNNA 4M1SA 4JJKA 3T06B 1S1CA 1VG9B 3AF3A 5FOVA 4ZI3A 4DB4A 3PVSA 5CIWA 4F7WA 1GDDA 4C2TA 4RZ2A 3RWOA 1R10A 3KQKA 3OZXA 1GP2A 3LBNA 4ZDJA 3R8CA 5HKKA 1E2PA 5FI0B 2VLIA 1QHHB 1IN8A 4LK2A 1C9KA 5C4MA 3TGPA 3BBPA 3B1VA 4A8JC 3U7HB 2OCBA 5FR1A 5M04A 4Q1AA 1JNYA 4OQXA 5FPTA 1G8YA 2DFLA 2ZRFA 1QHGA 1XP8A 3MJRA 4F91B 3BS4A 4CEJB 1E2FA 1Z5ZA 2FJUA 1SVIA 1UFQA 2ZS9A 3DZ8A 4KSBA 3SN6A 2ZAOA 3SOPA 3CX6A 4EKDA 4TTPA 4XWOA 4DLZA 2X8AA 2J41A 4HUQB 4RSGA 2QE7A 1SVSA 1NP6A 3N2EA 3BWDD 3WHLA 2ZU0C 4V0ME 4JLJA 1QG2A 2F3TA 1CRQA 2Q9BA 4C0KA 1FX0B 5BWMA 1Z0IA 1UM8A 5D3MA 1IONA 1J70A 4B43A 1E9EA 4E09A 1AZSC 4IVQA 4OQNA 3N70A 1LFDB 4P0TA 4DLTA 3R9XA 1E4YA 2QA5A 3WBKA 2RGGA 1T8TA 3AP3A 3AVOA 3L8ZA 4CZ2A 621PA 1QVRA 3H4MA 3K9LA 2REOA 3CZQA 1KO8A 2ZXUA 2PEZA 2QORA 1J2JA 1AS2A 2HXYA 3LX8A 2F55A 2J0SA 1L2TA 3FPAA 2XXAA 1KO7A 1S2MA 3K09C 2NO0A 5KSZA 5KHOC 1PLKA 2O8CB 3D8BA 1NIJA 4PC3A 3QKSB 2IYQA 3QSYA 1SHZA 2H18A 4KO8A 1G16A 1OYYA 4Q7KA 2CHGA 5HE9A 3IQWA 2GCNA 3HYTA 1KI8A 1DAMA 1G6OA 1MR3F 2HJVA 2MMCA 3LV8A 5BYKA 4MRSA 2ZU6A 4OJQA 2X19A 3B1WA 3KTAB 5HE8A 3FKSA 3HU2A 5FBWB 4KODA 2J46A 2WVJA 2P0EA 2ZRJA 4JZKA 5FUWA 2BDTA 3CRRA 4MGKR 4MQBA 1XJCA 2OLJA 4LV6A 5B30A 1CR2A 2IS4A 4NYJR 1NG9A 1X1SA 3R9IA 3IDQA 4JS0A 4HSEA 1QVAA 1XTQA 3VTKA 1ZD1A 2J7PA 1ZC3A 3EC1A 4PC2A 2HYIC 4POAA 3UPUA 1NN3A 3P26A 1N6RA 2H57A 2XXAB 4BLQA 2VIIA 5JRJA 2H1LA 2XJ4A 1P72A 2ODNA 4G5QA 1YR9A 4HLUC 3T1VA 3VFDA 4Z1MA 1G8HA 3SYKA 3U6BA 5KDOA 4RFSA 1AS3A 1DOAA 1JR3E 3HR8A 4BASA 1XXHB 2ATXA 3IO3A 2QNRA 3VKGA 1EFRD 2FFQA 2ORVA 2FMXA 4HZUA 3SS8A 4RFVA 1DVRA 2Q3FA 1KZGB 4B3FX 1KAGA 2CJWB 5JJIA 4DSUA 2VH5R 2CNWD 1YKSA 1NNEA 2CVHA 4FWIB 4M2LA 3NG1A 3FMIA 1VYVA 2ZRLA 4LHWA 4C2UA 1IJEA 1CR4A 3CPEA 3R9WA 3SYNA 4OK6A 1XMVA 3LO5A 4X8OA 4J0QA 1DE0A 2C04A 3OEHA 2OSBA 4Q1DA 2W00A 5CLQA 3KKQA 1XPOA 1TNDA 4IOKA 5SZHB 4ARZA 1ANKA 1XD2A 3PENA 2QM7A 1JEEA 1I4TD 1UBFA 3AKYA 4MDFA 4L5BA 2PT7A 4CEIB 1DAHA 4FIDA 2DWPA 4LOAA 3KDSE 3SR0A 4DT1B 2WJGA 3PQCA 1N6NA 1E2NA 3MUFA 2IA5A 3DOFA 3PCRB 3ZVRA 4ZI2A 2YWGA 4BFWA 5KNCA 1WCV1 2ZTSA 3LVQE 4D4JA 1XPUA 1JAIA 2QQEA 3BORA 3SQWA 2DCUA 1WB9A 2OZEA 3A1WA 1D9XA 2Q0HA 1E2IA 1P2TA 3OIVA 2OILA 4PSVA 2ZUDA 3I5XA 3CF2A 3E1SA 1GFIA 4LHZA 3TQCA 1QHSA 4URWR 2QMOA 2WWHA 4HB2A 1XPRA 4HYYA 4MRPA 1ZM3A 2EQBA 1CR0A 2RGDA 4LYHA 4MRRA 4QOSA 2WJVA 5AUNB 4A6PA 4B3BA 2Q3MA 1WP9A 3QF4A 1XNJA 1N0WA 3PUXA 1Y63A 3GPLA 1ONBA 4LSGA 2BEKA 1N3BA 1PJRA 3QXJA 2BMEA 1WE2A 1OIWA 1OHHD 2DFNA 2E87A 4M9QA 1OSNA 4NL4H 1CULC 521PA 4BUJA 5A4JA 2PH1A 1Q1EA 3ZLJA 4TYNA 3WYAA 3O47A 1RJ9A 3UWKA 3TAUA 1C4OA 3C5HA 3HR7A 2IUTA 4YLGA 2XZPA 4L16A 3K8YA 4RJLA 4A0GA 1SXJE 3QXXA 2P3SA 1G41A 3K0CC 5C2JB 4UJ5A 2ZRCA 3ADCA 3Q9LA 4CGZA 1Z0FA 3FYHA 3VHXA 1GZSA 5JI2E 1M1YE 2W6JD 1Q22A 5LBIA 4C7OA 4IOLA 3WBJA 4WW0A 1KNQA 1W0KA 3D6TB 1DARA 4JL6A 1RPZA 1TU4A 1XMIA 4P4TA 4DLUA 2WAXA 2OFXA 3HYRA 5TVKA 2QM8A 4K8OA 1T3HA 1RYHA 4RD2A 3WRXC 2BMDA 2XNDA 2AXPA 1RVDA 4X8LA 1Z07A 1DG1G 2FWRA 2NTYC 1KI6B 2F43A 1CR1A 1YR6A 1OXVA 3OE7D 4IVRA 1N6KA 1WXQA 1RZ3A 1M74A 4TMVA 3FMPB 4FWTA 2GHIA 2O8FB 2GZDA 3CWQA 4KBFA 3KJHA 3JVUA 1I2MA 5L8VA 1XD8A 1DAKA 4D82A 1LS6A 1E6CA 3B9QA 2EWWA 1G4AE 1U9IA 4LV5B 4HI0E 4XWAA 5P21A 3W8RA 1KMHB 2O8EA 1W48A 1O87A 3GD7A 2ODWA 2ERXA 2J59A 3CR7A 4TTRA 3OFND 3EPHA 3MFYA 1N5JA 3AH8A 1A5TA 5HTKA 3RABA 1OE0A 4PO1A 3BRWD 4OQMA 4QGFA 1VCNA 1H8HA 3VKWA 2JJ2A 3CRQA 4QBHA 2WWFA 1OYWA 2J87A 4B75A 3NBZC 1ZNWA 1D2NA 1PUIA 2CVFA 4LPKA 1S8FA 2OE2A 4PHHA 3IILA 4D4KA 1E1RD 4JVMA 5AJXA 4W5HA 1U94A 4XTCS 4DUGD 3CF0A 4JLBA 1Z06A 3VR3A 2OCYC 2QI9C 3SDZA 2IF2A 4L15A 5CK5A 2BV3A 1KYIA 4PHFA 5CYPA 5K8UA 1W2GA 2O8FA 4GOJA 3ICEA 4E07A 4PR0A 1EWQA 4URVR 1N5LA 1W4AA 1G21E 3Q85A 1A2KC 4Q1CA 4YDHB 3LY5A 3VNVA 4M1YA 2ZUCA 4I4LA 2VP2A 3I72A 4FMDF 4Q7MB 2CE2X 1AN0A 5KOYA 4OK3A 3VR6A 4DSNA 4AG6A 3ZYCA 1GKYA 1RRFA 1ZU5A 3RYTC 1MO6A 2FX3A 3BFVA 1G291 1KSJA 4QBIA 2JA1A 3P1JA 4TLCA 1GL9B 1US8A 1JR3D 3HP1A 5CJ2A 3NH6A 1NVVQ 4OQFA 1FX0A 2C5LA 5FL7D 4ASUA 4DDWA 3ZZTA 1CJKC 4QG7A 2CLCX 1OKKD 4B3CA 1D2MA 1OJLA 2REXB 1TAGA 2CCGA 3FB4A 2OUKA 3I92A 4JL8A 3VR2A 2AD1A 1YE8A 2XGJA 4UXIA 3QBVA 1RKBA 1ZM7A 2C98A 4LC0A 4Q1BA 1TQDA 2AHOA 3DVLA 4Q48A 5KDLA 4V0OA 4U5XA 1P62B 2UZ3A 1OPXA 3PR1A 4OYHA 1XX6A 1OLOA 2QAJA 1P9NA 2CEAA 1F5NA 1KK0A 5EZ5A 4GNKA 2FSFA 1UDXA 1MABA 1BIFA 2RKOA 2ZE5A 2A5GA 1UAAA 3CKLA 1E1RA 1OIXA 1G5TA 3IQXA 1F6BA 4PC1A 1PZNA 5B57C 2QP3A 1NN1A 1HT2E 1SXJA 2IEYA 3U44B 2Q21A 3U4QB 2J5XA 4HATA 3EW9A 3GJ5A 1S96A 2O8BA 2GRJA 2ANCA 3QG5A 2YYZA 3BB3A 2DB3A 3B7GA 4URZR 1IY1A 5KU1A 1JJVA 1JXOA 3R20A 4OKSA 4QNRA 5L3QA 2EWVA 2XNSA 3MMPA 1Z6XA 2GK7A 2B6HA 4US1R 1JECA 1EX6A 2EFDB 4O2RA 3ZIAA 1H8ED 1N6IA 1SHKA 4PPNA 1P4SA 2OO7A 4ZDIA 3MJHA 2GJAA 3GJ6A 3NTUA 2PZGA 1TUIA 4TMWA 1WDTA 3KXLA 2E9SA 2GVDC 2H5EA 3WHKA 4BRWA 5CB6A 1XTRA 4B76A 3FGNA 4O25A 4EUNA 1Z0AA 4Q1FA 5CM9C 4AURA 2EFGA 1JBKA 2G0TA 2MSDB 3A8TA 2ZEJA 1W5TA 1GKIA 4EPVA 1UF9A 3MLEA 1E98A 4JT4A 2P67A 2YJTD 2ZJ8A 4KYUA 3K70D 4N0EA 2B7CA 1TF7A 2GJKA 4IEIA 1YR7A 2QAGA 1VKJA 4BFSA 2CL6X 2F6RA 2ZAMA 4NDZA 4M53A 1DS6A 4PANA 4R2HA 3HU1A 3U2QA 4IDHA 2Q6TA 2WMNB 4CF7A 3IGFA 3OAAA 1LVGA 4LY6A 4XVQA 2FEOA 1MT0A 2GA8A 5BQ5A 5BXQC 3EPKA 4NZYA 2AL7A 3IHWA 4LJ7A 3BH7A 3TBKA 1NRJB 4GI7A 1R0ZA 2CL0X 3L2OB 3AF4A 5EP2A 4Z54A 3C7KA 3M4YA 2V54A 1CS4C 4I1VA 4A15A 1E9CA 2WKPA 2P5SA 4LCBA 4HAXA 1YZQA 1OH8A 4AK9A 4BLSA 3DL0A 1GNQA 4AYWA 1P2VA 2FG5A 4QXAA 4B71A 2QT1A 2ZRIA 4DCTA 4AKHA 1JALA 5DH9A 4N3NA 1I2DA 4D0GA 1Z2AA 4KVGA 4QJ4A 3G5UA 2P6UA 2QEQA 4M22A 2WAYA 2Z6VA 2DFTA 3TUJC 2JLWA 2FZ4A 1ZM2A 2ZRGA 4PX9A 3PJRA 1G3IA 1N6OA 2V6IA 2VYFA 1AGRA 5SZIA 4G5GA 1W4BA 2PEYA 5CITA 1SVLA 1TMKA 4QKQA 2Q9CA 1XCGB 2XEXA 2OCPA 4XOIA 2OHFA 3BB1A 1F2UA 1VIAA 4P4SB 3ADDA 2J0UA 3FTQA 4MITA 5HKKD 1G6HA 1E2MA 3B5JA 2Z43A 4KU4A 5CB8A 5C46F 2BEJA 2BKEA 4NU0A 3U61B 1OH5A 1OFTA 4PO8A 3FVQA 3PXGA 1E79D 821PA 1IQPA 1ZC4A 1ZIPA 1HUQA 1U90A 5AJYA 2FDCA 4PAQA 3X1WA 2UKDA 2JDID 5L3VA 3REGA 4OI2A 1F2TB 2FSHA 4L8GA 3E70C 5L3SA 5F3WB 4CEIA 2ZS8A 1K5GA 4PZYA 1Z63A 1KY3A 1EX7A 4XWKA 2IW3A 2QPTA 2QTVB 3MSXA 2ATVA 4KXFB 3LBIA 1Z28A 4XD7D 1XD9A 2WOOA 4M8NE 2ODEA 2V7QD 4IFEA 3C41J 1SKYE 2VA8A 4OBEA 3VX4A 3MWYW 2X2FA 3L43A 2G3YA 4LJYA 1X8LA 3L8YA 4DCNA 2RGNC 2R6AA 4BZXA 3KQLA 2MMGA 3NDBB 5J4LA 2EYQA 3U3KA 4I81A 1KKLA 1R5OA 3L82B 1JI0A 1QHIA 4WOPA 4IDQA 4Q1EA 5FPKA 2JCSA 1D5CA 4A4DA 2FOLA 1X6VA 3A1SA 3M1IA 2NOAA 1GM5A 3A6PC 3BXZA 5HCIA 1JXMA 3R7WB 3CWZA 4FW9A 4EPTA 2QAGB 1CU1A 2WICA 3KB1A 3NC0C 2H7VA 1LS1A 1LY1A 4HLCA 3SI7A 4LJ9A 4KFTA 1OT3A 5A0FA 1FMJA 1NN0A 1US8B 4B48A 5JEDA 4FXPA 1VHLA 3BK7A 3QKRA 1OH7A 1XJQA 4B47A 2Z5FA 5LDDC 4JMPA 2EW1A 4AY2A 4ZIRA 3NEJA 5E7IA 4XSHA 2WWWA 2C78A 1KNXA 2WZQA 4B6FA 1WBBA 2H17A 1G8PA 4HDCA 2JJ1D 4RZXA 3UMFA 4DUGA 5J40A 1YU9A 3I3SR 1Z0DA 4US2R 1W46A 4MRNA 3SC3A 2OBMA 1T0JB 4FCWA 5BN3A 4F93B 4LV8B 4CEHA 3ETLA 4BRUA 1TX4B 2IK8A 1MO5A 1SKYB 5G3YA 4H1UA 2C9OA 2ZRDA 5SZKB 5KSPA 5F9FA 3GEHA 4Z1MD 1UKYA 2RGNA 2Y8EA 2ZYWX 4LJ5A 3RC3A 2IUUA 4D80A 2OFOA 2QPAA 4ACBA 4DRZA 1R5BA 5CLLA 3GQBA 1G8FA 1LTQA 4Q66C 3SYLA 4AC9A 1TEVA 4ZKDA 2UVQA 3TUIC 4IJMA 4D4MA 4C0HA 3P4XA 3HDTA 1E2LA 2A5JA 4NYMQ 5FH9A 3GLGB 1TADA 4FI3C 4KAXA 4RD3A 1IHUA 1NJFA 3EIHA 1NN5A 5DE3A 3LFUA 3GP8A 2OBLA 3A36A 1HY3A 2PZFA 5GJBA 1VCOA 2A3RA 2ZETA 1QDEA 2ZITA 4KITB 3THWA 1DADA 5GJVC 4DCUA 1D2EA 2CK3A 2ZJAA 4TZ0A 4WXRA 5L3RA 3BJIC 4P3YA 1H8HD 2ODBA 5BYJA 1KOFA 2HEIA 2WPDA 2D7DA 3CH5A 1VPLA 1E3MA 4NPHA 2WIAA 2CCKA 2QSZA 2QN6A 2TMKA 3CZPA 3CIOA 4R2IA 4LBZA 1MV5A 2B8TA 3I62A 3H0KA 4DZZA 2Q9AA 4B32A 5FOWA 5AJVB 1Y3AA 3U4QA 2ZSFA 3QPVA 1FZQA 4Q18A 1TQ4A 1Z29A 2PBRA 3PV0A 3A4NA 1IN4A 2ZS7A 3MRSA 1B23P 3ZH9B 4P32A 4Q9JA 1IXZA 2IYWA 4IOMA 2YOHA 1ZU4A 4Q00A 2RAPA 3VNUA 4MYCA 3WP0A 4DDUA 2GK6A 2WWXA 2G1KA 2GCOB 2IXEA 2QBYA 4DKXA 2V3CC 1P75A 3CRW1 1XTKA 2WHXA 2YWEA 2D62A 2G0NA 1EFHA 4LDJA 1PLLA 2XTNA 1ZJ6A 3EZFA 4OHWA 2ZYTX 4QHSA 3RRNA 4GL2A 4ZCIA 4V02A 3AVTA 1QHHA 5LPNA 1X8KA 3QBTA 1FP6A 1Q57A 1OXSC 2JATA 4H9GA 2GJ9A 1HURA 1SVWA 2OAQ1 2OEPA 1TL7C 4HB3A 2OLKA 1AQYA 4LC1A 2YV5A 3K0FA 4V0MA 5J5CA 5A5GA 4JSYA 5JFGA 4YC7A 3IHLA 1FQJA 4CIDA 3K9HA 4Q9KA 2YVUA 3KKNA 2QTFA 1TUEA 3T35A 1Z0KA 3RC8A 3K0AB 3T12A 5EUQB 2IYSA 4PHGA 1P2UA 1KSFX 3WY9A 2NZ8A 1E0KA 2D06A 4JL5A 1OFHA 2R65A 3BIFA 1IXRC 5JMTA 3REFA 1L7VC 5TARA 5AR1A 1TTTA 1VCMA 3TE6A 3AVQA 3G0HA 1DAIA 2BJWA 2FSIA 4JKYA 1IN7A 4W5WA 3D7MA 1W36B 2C9CA 1KSGA 4D26A 4A6XA 2QGZA 2B21A 2OFWA 2GESA 1NMZA 1T3LA 5EXSA 1YZTA 3RS7A 3W90A 4C0LA 4GOKA 5JS8A 3K09A 1A4RA 2W0SA 5FUYA 3VR4A 3PUZA 4G01B 2ZYVX 3TSOA 5G41A 3I1FA 1XEFA 5DI9A 3CNLA 2QENA 3GJ7A 3FFAA 3RANA 3DMDA 3VKHA 2N42A 1U0LA 2BKUA 5FBQB 3ZIAD 4DEXA 1H8EA 1F3OA 1R0WA 4EDHA 2GTPA 2J45A 2QRNA 4QJ3A 2NZJA 1BYIA 2JGNA 3JZAA 2BCJQ 5HZKA 2C95A 3J81k 3BFKA 4R98A 3DKPA 4KVAA 1N6LA 1G7TA 4F4JA 1RW4A 1BOFA 2VBCA 4IHQA 5LB4A 1J99A 2GF0A 3IO5A 1W0JA 5FTMA 3KQHA 4NH0A 4LJ6A 3CLVA 3K9GA 2K5UA 4NP6A 1G17A 4LZZA 2CLDX 3EAQA 2YOFA 3U3RA 5JECA 4EJSC 4P33A 5UKDA 1EFRA 1E32A 1NG1A 1E1QA 1P60A 4XH9B 5HCNA 1UPTA 3PUVA 1ZINA 4URYR 3I61A 1GVNB 2EU8A 1NLFA 3FWYA 3EC2A 1G18A 5DI3A 5G40A 1L4YA 2F9LA 4QFMA 1KO5A 4CW7A 4RZUA 1XDBA 1U8AA 1CF4A 2PZEA 4NCJA 4HLUA 4RVCA 1KGDA 3LWNA 3V4FA 2ZM5A 4EFLA 1XCMA 2IYXA 4C0QC 3TKLA 1EFUA 2YC4C 4M1OA 3K70C 2N1BA 1RJ9B 3DMNA 4II7A 1HT1E 5TMPA 1RRCA 2VSXA 4H1VA 4C0SA 4HUQA 2F7SA 2ZI3A 2ZRPA 4TL8A 2FZLA 4DLYA 2YZ2A 1Q20A 4Q9HA 4RD6A 4GSYA 2IYZA 2KBFA 3KJIA 3B60A 1DEKA 2XAUA 1KZ7B 2DHRA 3SFZA 1OF1A 4XIGS 1E2DA 2VEDA 3GJ3A 4UQOA 4QBGB 1SVMA 5KSOA 3AVVA 1EXMA 1CEEA 1JQLB 3B9PA 5AUOB 1HYQA 2IL1A 3D31A 3ZD6A 2ZPTX 3A58B 4KYIB 2W6IA 5J4YA 1IOZA 4ZIRB 1I4LD 2EYUA 1KK2A 2ZJOA 3B13B 4UNNA 3GMTA 4B2LA 2WSSA 2WWGA 1MABB 3W3AA 4PXAA 1ZAKA 3RVBA 4ILEA 3U60B 2HV8A 3CRMA 3E5HA 1QRAA 1OXUA 2O8CA 2ZE8A 4CT4B 1LF0A 1ZUHA 1GWNA 1G5PA 3IPYA 1E9BA 2ZROA 1U8YA 4F4CA 1U0HC 3T34A 2G9NA 1XWIA 2MSCB 3ZD7A 4IXNA 4KLZA 2F9MA 3SJZA 5J4VA 4PHTA 3A4LA 2R62A 3QY0A 4WXPA 1CJMA 4TLBA 3F8TA 8OHMA 3PUWA 1SXJD 2IBMA 4GP6A 1QG4A 2OBNA 3OIUA 3QE0A 3ZJYA 5L3QB 4HLQB 3Q5EA 5GVRA 3B1ZA 4JJZA 3GLFB 1ZNZA 3SU8A 1GNPA 3AM1A 2HT1A 5E7JA 1N25A 1E2QA 2WJYA 2NO6A 3TMKA 3THOA 2ZI7A 2O5VA 3H84A 5JJKA 5ANRB 1HE1C 3IUYA 4RCZA 1SKQA 3SZRA 2ZRBA 1Q1QA 1V5WA 4C0BA 1VDZA 4RD0A 1II9A 3VMFA 3BERA 4Q4LA 1Q3HA 1HE8B 2XOKD 1VCIA 3RNLA 4NYMR 4BLOA 1XEXA 4XTRA 3DDCA 2BJVA 1X8JA 3FHTA 3N2IA 3KXKA 1GITA 2C03A 1XZPA 2EFCB 2HXSA 2ZI6A 4A36A 4M21A 3SJCA 1AA9A 1R5NA 4OHVA 5EP1A 5BN4A 5TV2A 1S3GA 4TT3A 2ZRMA 4JLNA 1Q12A 4XSGA 1WF3A 2B92A 3WP1B 1TF5A 1SXJB 3L0OA 3U44A 3RS5A 1E2JA 1M7GA 5KPDA 2BC9A 4MYHA 5D3QA 5GVSA 4O2LA 1NKSA 3K9NA 2OV2A 3BD9A 4AD8A 1E0AA 1NKTA 3LA6A 3GLFA 3A4MA 4Q4AB 3B6EA 2AN9A 2D3WA 1NY5A 1NBMA 3EWSA 2GNOA 4FCVA 4HB0A 2XTZA 3TSWA 5KNBA 2IYRA 4TN1A 3W6PA 1G7SA 2NG1A 5E7MA 2O8DB 2XB4A 4UJ3A 3KQNA 1AM4D 2DFKB 2WWYA 1JPNA 2ZSDA 3MWKA 2JLZA 1NVWQ 4KI0A 3SEAA 121PA 1XEXB 3LQRA 4YMTA 4OI4A 4YXWD 3WMFA 2OESA 3C16C 4D4LA 4KLNA 2HYDA 3S1AB 2ASEA 2GJ8A 1NSTA 4BZQA 4NHOA 2NMVA 3FHCB 1K8RA 1ZD9A 2P5TB 4GZLA 5F2EA 1QZXA 1U9IC 2R44A 1N6PA 3LD9A 4ACAA 2AWNA 2XJ9A 3OIWA 4PQFA 4B74A 5L3SB 1EG7A 3DOEA 4C3ZA 5G3ZA 3QEOA 3VQTA 5JWHA 1NIPA 1NSFA 3VU9B 4Q47A 3THYA 2Q3HA 3GFPA 3KFXA 3T5DA 2AFIE 1R8QA 4MGIR 4TYQA 3L0PA 4U02A 5EUMA 3SE0A 2RGCA 4ESHA 2BOVA 2XSZD 2KBEA 1U8ZA 5FOTA 2QZ4A 3TH5A 3P20A 4JBXA 5JI3E 1QF9A 1MO4A 3DKVA 3EZ9A 3LW8A 2DWOA 4LGMA 4A2QA 5DN6D 1F2UB 4P4SA 3KX2A 1DO0A 2KSQA 4GZMA 2QL6A 4Q4HB 3UKDA 1NL3A 3EG5A 4US0R 3U7GA 4LHXA 1AIPA 2J1LA 2EFHB 1Q44A 3AUYA 5CM8B 4CDGA 4TLDA 4NYIR 2BIFA 2IT1A 1Z22A 4MKFA 5C1BA 1SULA 4A1FA 2LCFA 3LVRE 3QF7A 1JR3A 1R8SA 3QOFA 4ZO4A 5CK4A 5FL3A 2OAP1 3B78A 1V43A 5CDFE 4OHYA 1ZCBA 5EE1A 1M34E 3AF2A 4M4SA 1JR6A 2W2VA 1N0UA 2BVNA 1IJFA 3QKUA 3WNDA 5H68A 2CLSA 1XBTA 3FE2A 2G77B 5CIQA 1E96A 1AZTA 1RE0A 2FE4A 3QVVA 3MWLA 5FTKA 3TSZA 2AXNA 1XFAA 4TL9A 3ASZA 4XD7A 4GBMA 1SZPA 2I1VB 3Q5DA 1TF2A 1U2RA 3DPUA 1S3SA 2CK3D 2GCPA 4Q19A 5LD2C 2D74A 4A82A 2LKCA 2YWFA 5FTJA 1Z08A 2ANBA 4C0JA 1TPZA 1E99A 2IWHA 2IEZA 1NVVR 1I4DD 1XMJA 2P2LA 1T0HB 3RSLA 3T5GA 3ZS8A 4K46A 2IYTA 3KKOA 2HUPA 3ND8A 2R6CA 1HEIA 4MUBA 3U6KA 3SHFA 3GLIA 4NYJQ 1Z6TA 4X8HA 1FNNA 3L0IB 1RRGA 1N6HA 2J7PD 3HWSA 3AKDA 2WWIA 2HLDA 3QUSA 1KTVA 1NVXQ 3BOSA 1E2GA 2VL7A 3TR0A 2LWIA 3HPQA 1C1YA 5JWOA 3WMGA 2DY1A 1IM2A 2GF9A 3C14C 1IXSB 3EA5A 1KMHA 2O8EB 1B0UA 4V0KA 4HEJA 2XITA 4Q4AA 2QG6A 4MKGA 4CYMA 2A78A 4PTLA 1CXZA 4QRHA 4OL0A 1N5IA 2F1JA 5FUXA 1T5IA 2BWJA 4QGGA 4EJSB 5ELXA 4Q5IA 2JLSA 2QUZA 4LBYA 4TMZA 5FTLA 4LHVA 1R2QA 1YZNA 1W4CA 4PSAA 3O8RA 4TSFA 1QHYA 2IXGA 2BBWA 4MGYR 2O8BB 5FPSA 4HAYA 4FMBB 2MSEB 3QI2A 3GFOA 3P32A 3QEJA 1RC8A 4AIIA 1X1RA 5JJLA 4AG5A 3KZ1E 1M7BA 4KV9A 4L9SA 4C0AC 2VSOA 3SFVA 4GMDA 3AUXA 4DEYA 3NWJA 3KJGA 3I4LA 3WMEA 2OG2A 2YINC 1XXHA 3DM9B 3LDAA 2IHYA 3OF5A 1L4UA 2IC5A 2WMOB 3B2EA 2XNDD 3NVAA 1FNMA 4EFMA 2NO1A 2ORIA 2QAGC 2QSYA 1OV4A 3UIEA 1CP2A 2NIPA 2ZSEA 3I5YA 4FMDB 6Q21A 2FFBA 5FI1B 5CDFA 3KB2A 2NPFA 3FKSD 4AWXA 1MO3A 3IIJA 2QPOA 3LX5A 4DLRA 2PX3A 4Q7LA 3B8HA 3T1TA 4NONA 2GXUA 4TMTA 1OB2A 1KDOA 4LX0A 2F3RA 4ERNA 4DDVA 1ZMXA 1FUKA 3UANA 1Z0JA 2Z4SA 1S9DA 3EIQA 3TJZA 1XD2B 4ZDWA 3ONWA 3UXMA 2Z4RA 4PAMA 2IS6A 2PX0A 4GRAA 3GEIA 1SVOA 1VECA 4UNSA 3ZQ6A 2BBSA 2ZJYA 2RGBA 2A5FA 1XEWY 1HH4A 2PT5A 1NI3A 3A1TA 1U0JA 3CB4A 3V4RA 3F3YA 3GLHA 4I1SA 1G64A 4M1WA 4UKDA 2W83A 4A92A 3BC1A 2ZE6A 2CHVA 4JLDA 4GP7A 3K0AA 3U3MA 5JBQA 3OAAD 1Z6GA 1Q1BA 2CNWA 4G5SA 1KI1A 1T91A 2GKSA 1WQ1R 3E2IA 4ITRC 4IFBA 4Y0VA 2JLXA 2IS1A 2BMJA 3EWAA 1MOZA 4A0RA 5TB5A 1KK3A 4Y0AA 5KYKA 1F60A 3X1DA 1U81A 1QBKC 3W8NA 4DSTA 4RD4A 3O8CA 5TXGA 1JJ7A 3HU3A 4C4PA 1LB1B 3BH0A 3VR5A 1S1MA 5EZ6B 1Z3IX 3TUZC 2ONKA 3WXMA 2V8OA 2XX3A 4LBWA 1YZLA 2RMKA 3SJAA 1KY2A 5DGXA 3QPWA 3GCGA 3GLFE 1N0VC 2KWIA 3ZVMA 3DO6A 4CEHB 5FL7A 4UXJA 3PEWA 2KB0A 4M1MA 1KJYA 4TT3D 4URXR 2R2AA 2PMKA 3SBEA 1GUAA 1HQYE 3ZQJA 1E94E 2G88A 1XCPA 2C9YA 3D3QA 3KUDA 4IOJA 5JS7A 4TZ6A 4TYWA 4HDOB 4R7ZA 2PCLA 5AUQA 3U7EB 3ZS9A 3CM0A 3W34A 3ZZUA 3KKMA 5JZVA 3I8XA 2RH5A 4LYAA 3GJ4A 2RGXA 1DAEA 4DLWA 4DB2A 5KPJA 5B64A 4G5OA 1COWA 4BFVA 1ELOA 1UBGA 4C7OB 1FOEB 5FOSA 3EPJA 1HV8A 4G3XA 3PFIA 4KCGA 1TQ6A 1JPJA 3AF0A 1A1VA 3N5CA 1VYTA 2W2XA 3CX8A 4WA7A 1RYFA 2QY9A 2PJRA 3NBXX 2BM0A 3VX3A 4LYFA 2FGKA 3FOZA 3UK6A 2X1VA 1CTQA 2D7CA 4M9SA 4X8MA 4ZDKA 1E4VA 2C96A 2A2ZA 4QBFA 5KSYA 2A7QA 2OM2A 2VPPA 2VO1A 4KSCA 3F5FA 2O0KA 3AQ4A 2JJ1A 4JLMA 1E9SA 3ECCA 1W44A 1II0A 4A2WA 1DAGA 4JLPA 5H8WA 2VSFA 1N5KA 1NF3A 3CBQA 2FV8A 5K8IA 1FPMA 1YZGA 5FBRB 1G1MA 1Z47A 2R9VA 1D6JA 3A1VA 2BMFA 2JLYA 2F1RA 5G53C 2YNMA 4L4UA 2UZIR 5AJZA 4XVRA 3AVPA 3EASA 5SZJA 2FEMA 1D8TA 3Q7QA 1G20E 2WIBA 4IRUB 2A30A 4ASUD 1EESA 3M0EA 4EIWA 1DPFA 1OXXK 1Q21A 3W6OA 4NKRA 1WBDA 2QP4A 3LLUA 2WJIA 4OK5A 2AKAB 5HZHA 5H70A 4PSKA 1M6NA 5F9HA 2J7KA 3KJEA 2ZJ5A 1VTKA 2WBLC 1IN6A 3P27A 2DYKA 3QG1A 2WTUA 3MGCA 1QHNA 4CEJA 4V0NA 1Q3TA 3FKQA 1P3JA 3PUYA 3QXHA 4TQ9A 4AYXA 5E95A 3CW2A 4RFSB 1XRJA 4JLOA 3AVWA 1KJWA 3ZVNA 2BM1A 2O52A 4G5RA 4JYBA 3T61A 3GJ8A 5EE5B 4A2PA 2JJ2D 1IN5A 4FD2A 1EFTA 1XU4A 1CJTC 1CRPA 1W47A 2CJWA 4IW3B 4TMXA 3WYFA 4D25A 3B1YA 1KSHA 1CLUA 1UBEA 1XF9A 4EPWA 4KFRA 4DJTA 4ZKEA 1E2HA 2VF7A 2W6ID 2HF8A 3O8BA 1FP7A 1KI9A 1Z8FA 1ZCAA 3ASYA 2IYVA 2WJJA 5EJEA 4IXMA 3T1OA 4ZCLA 1FMLA 3FFBA 2IHBA 1FTNA 3TW8B 4BFYA 2JIZD 4TLEA 1A7JA 3CONA 4BQSA 1BKDR 3CNOA 3K0EA 4D0LB 1FW6A 4O3MA 4JYCA 5F98A 2QMHA 4WVFA 1ZM4A 1T9HA 3X1ZA 5DISB 5J4HA 2WJHA 3NHAA 3W3ZB 1KI3A 1YRBA 2FPKA 4DC9A 4HUTA 3UATA 3QKRB 1XXHE 1X86B 3NBFA 1N2CE 2G1JA 1NMXA 1K6MA 4W7SA 2B7BA 4V03A 2CE7A 2RB4A 4TQAA 1KJZA 3TIFA 3H1TA 2P6RA 2ORWA 1GL7A 3QNUA 4OI1A 1CBUA 1KI7A 1JB1A 1KMQA 221PA 4B3XA 1MH1A 1OKKA 2AK2A 2NO7A 3OHMA 5EE3A 2ZRHA 1DO2A 4KHZA 4LYJA 2FN4A 3CX7A 4WIAA 5FUVA 5C4GB 2J3EA 1NY6A 3AVXA 1YZKA 3RAPR 1M2OB 1BYUA 3AGPA 4JKIA 4Q01A 1K5DA 4EAQA 2OCAA 2V1XA 2EVWX 3QF4B 3CUEF 4Q9LA 4PC6A 5HR5A 3M6AA 4RCYA 3EPLA 1R4AA 2YHSA 3LH5A 5TDHA 1G7CA 3RDPA 1PUJA 1Z6AA 4FMCF 1E9RA 2IXFA 1GKUB 2GAOA 3VR1A 1GOTA 2PLRA 4ZPXA 2HJGA 2IYLD 5TY0A 1P73A 2ZR7A 4EFNA 3VU9A 3TK1A 3THYB 1FUUA 1GILA 4HAUA 5FTNA 1YRAA 4LJAA 4BLRA 3QXSA 4E22A 5DNYB 4YMWA 1G3QA 2I3BA 4FCTA 4WZAE 4M0LA 1DTSA 1GRQA 2ZUBA 5D3MB 1T4GA 4E5UA 1DAFA 2DWQA 2IYYA 3AVYA 4F92B 2PJZA 4MYTA 3BGWA 4BLPA 1G3RA 5GJCA 3SQXA 3AP1A 5JHGB 2PL3A 2N46A 2P65A 3X1YA 3RLFA 2YOGA 4Q7JB 3EX7C 1Z2CA 3ZGXA 4JIMA 4PO9A 2ZSAA 3ZDQA 2FNAA 4DHEA 4ABYA 4S35A 3WYGA 1UDWA 1IBRA 3IEUA 3BH6A 4K81B 3PG5A 3NBYC 1ZD8A 3RRYA 3P4YA 2PLFA 4ON9A 3HPRA 2QU8A 3WNCA 5FBLB 3IBGA 1E79A 1ZNXA 2LKDA 1XZQA 4PAOA 4PFSA 5DYGA 2JDIA 4WZ6A 4W9MC 1E1QD 5FOUA 4IDNA 3IIMA 4BE7B 4PQYA 2SHKA 4EPYA 1H65A 4AKEA 2D4HA 3K0SA 3FMOB 4LUCA 4D0NA 1G3UA 3RWMB 1M7HA 4L9WA 3LNCA 1GIAA 5DN6A 4FMCB 2O8DA 1ZIOA 1IY2A 2DBYA 4R71A 2YWHA 3SNHA 3UMSA 1SVKA 2VTKA 3UMRA 4Q4JA 1S9HA 1PV4A 4PQRA 5KTYA 1II8B 4BFUA 4Q9IA 1DELA 1VYUA 1L8QA 1G7RA 4HZIA 2GXQA 2VP5A 4GT1A 1KDRA 3BB4A 1PVOA 3LQQA 2D2EA 4RD1A 2AX4A 2FF7A 3K70B 4JVNA 4QNMA 4LRWA 3MG9A 3NKVA 4UXHA 2E1RA 2ZRAA 4GOXA 4JLKA 2W58A 3LXRA 3O8DA 3RS3A 2F1HA 1GTVA 3AV0B 4B34A 4HAVA 1VMAA 1ZBDA 1X3SA 2HT6A 2EFEB 4QGHA 1E0JA 2GEUA 4DCSA 1VIYA 3JVVA 1F2TA 1HA3A 2KJQA 4M9ZA 1W5SA 1J90A 5HPYB 2JLQA 5IRCD 1XJ0A 2C8VA 2GEDA 1GL6A 1COWD 1FFHA 4Q4HA 3HJNA 1VG1A 2WPDD 5AUPB 5FPYA 1J8MF 1W0JD 4TYYA 4QJ5A 4Q4JB 3H86A 1MRSA 1E9DA 4NCNA 3THXA 2RCNA 3RS2A 4XVUA 5JRZA 1J7KA 4V0LA 2FH5B 4QM7A 4FINA
chains in the Genus database with same CATH superfamily
1II8A 3AC0A 4LJSA 2GBLC 3HP7A 3OLWA 2WYVA 4P54A 2C0CA 4YCLA 2IWHA 4I1OA 5FOXA 4DL9A 5GADl 5JUWA 1Q0LA 1HLFA 1KO1A 2ZYDA 1ZUNB 3DHEA 3HNRA 4P38A 1QJ4A 1KVTA 2AE2A 4WY5A 1GEEA 4CRWB 5HIKA 4YRIA 2D4AA 3D5TA 2Z0MA 2ZT5A 4MIYA 3I2JA 1Z37A 2IU0A 4I9FA 2BHRA 1BX1A 2IHJA 1CQIA 5IVPA 4C30A 1MTOA 1QGED 1V9SA 1VHTA 4JC4A 3TG8A 3RNOA 1P0FA 4M1KA 5CVUA 4EG3A 4DXAA 1U04A 3I39X 1A2BA 3JYQA 5KJFA 2JHGA 1RRMA 5EJ4A 5C37A 2VP6A 2O6LA 1BO6A 3KSAC 3QH4A 4AI6A 2GEVA 3PQ5A 4C5AA 3OQPA 3WLNA 3CISA 1QE5A 1U1CA 4NCKA 1LLFA 2NXCA 3FGPA 5GJWC 4EEXA 1VGQA 3AL0C 4MKHA 3H18A 5IK2A 4B2PA 2R66A 4B6EA 3U5ZB 3AONB 3UPTA 4HWGA 1S2DA 2PIDA 2JFOA 5D6OA 3RUDA 5CA1A 4CIAA 3K5HA 3OP4A 3O94A 3L7IA 3L1VA 5HG0A 2V65A 5HW0A 2CDAA 2OXCA 5CXXA 3GJ0A 3PE3A 4I1UA 4WA8A 1DKMA 2R84A 4IDOA 1YFZA 3C97A 1L8OA 3N6XA 3LUCA 4CKBA 1LF5A 3A4VA 5F64A 1KXJA 3DE2X 5E1MA 1BMFD 4DYVA 2QZJA 4MKIA 4ZU6X 5HBGA 1BMTA 1ZVQA 2KX7A 2Q50A 2R6JA 4Y6OA 4R9UC 3JWEA 2DP4E 2GZAA 1V7ZA 4J91A 1C3XA 1MQSA 3AHHA 4LMAA 3RRMA 1BX3A 4QD3A 1Q95A 1UKEA 2Y68A 1PZFA 3VNQA 3ZI0A 5GZ1A 4QPDA 4YCCA 1JLLA 2PD4A 9MHTA 1GLNA 1XLUA 5IBQA 4TS1A 3MWJA 3WWDA 5JR3A 4J4BA 4OHXA 4OBWA 2ZRNA 4XD2A 4LWZA 1SXHA 4MA4A 1CUSA 1OWPA 2P35A 3M3DA 5K8LA 2BFDB 3LZDA 3FDIA 2ERYA 3SSMA 3QLJA 5DRTA 3KNZA 4FNMA 2YJGA 4EKIA 4N6NA 3R41A 3MT9A 5ALUA 1UZNA 2WFLA 1LZKA 1J8QA 3NGLA 1CY1A 2IW1A 2QTRA 5EXTA 1QMPA 5TGZA 2QRZA 5EJ6A 1NKVA 2CL5A 3UHOA 5D84A 1T35A 4TT8A 3GLQA 4MVXA 5HDQA 4A5OA 1TU3A 2OTCA 4DIEA 1UK7A 3TLCA 4LGVA 1D4ZA 1HWYA 1XKLA 1YIOA 5GY7A 2ZYIA 4DEVA 3WNBA 2V7QA 1XTZA 3P71T 4IZIA 1PI3A 4JT9A 4BUCA 1UJ2A 1L4GA 3CXUA 2GILA 2AN5A 3AR6A 2AFIA 3OT1A 5HMLA 1I2AA 2JD2A 4U5QA 4WN3A 4RKEA 3O4JA 4C4ZA 2RFLA 4PYIA 1HRDA 1M76A 4ZEOA 4XVHA 4I99A 2QN3A 1Q16A 4XVCA 3PGXA 4M7RA 1PS9A 1ULBA 4JD5A 4W5QA 2NZYA 2ZE7A 2WF8A 4FFSA 4ENTA 5KMGB 5IDVA 5F78A 3DBHA 4CM3A 2G1AA 3PBKA 3MJSA 5IFKA 3Q10A 3HRIA 1LBIA 1UPFA 5EXPA 5JCPA 3NX4A 5INTA 1RWNA 4MPPA 3OZBA 4TSKA 3C8UA 2HU2A 1TLTA 1WW3A 3DF9A 3EARA 3JD3A 4MRVA 4R1LA 2YR0A 2AOUB 4FEEA 5BW6B 5KNDA 1QRRA 2CNDA 2IHKA 4F38A 1PGNA 1M9NA 4MV0A 3DL7A 1C9EA 2O19A 2AC7A 1M5RA 4BNMA 4RAQA 3I0ZA 2ERCA 4IDAA 2CVQA 5G1NA 2XMBA 3BHIA 3BYZA 3M4NA 2M2IA 3QTLA 4XX1A 2PRSA 4K3UA 4MEBA 5HJ7A 3ZJTA 1V11A 3AXTA 4JI4B 1IZ9A 4YN3A 2ZQZA 1OB5A 4WK0B 4X00A 3ZU5A 4M1TA 1UADA 1DSSG 1ZK0A 1EM8B 1F4LA 5GONA 4W5OA 2G4LA 4OP1A 5BWNA 1PT7A 2Q2OA 3GDFA 2G83A 2B5VA 2HA0A 4IHAA 4F5YA 2GM4A 2FSGA 2WU0A 5MHTA 2G70A 2ZVQX 2CMGA 1JSRA 1ODSA 4G5HA 1QIHA 2J0VA 2GZHA 2VBFA 3ZHOA 4EH1A 1W73A 2HREA 3W3AD 2FJ0A 2VK4A 2X9QA 5TQVA 2HRCA 1W49A 3EZ6A 4WECA 5TMBA 4NXMB 1YDHA 4I3FA 1GZ6A 1XRQA 4W8HA 3V4PB 4BVGA 4C07A 1DIAA 1VBFA 2JIZA 3ME5A 1TZBA 1IEQA 4IYRA 5FFNA 5L6MB 4Z53A 2E49A 1BS1A 1FXSA 1MTZA 1OFIA 2HA2A 3QKTA 4FN5A 1W4RA 3I5MA 2M1XA 2P7HA 4K5QA 2QY6A 2OD7A 1H4QA 1YJ5A 4A0HA 4CBVA 3IUEA 1BSVA 1I6MA 3OCXA 2WOJA 5T64A 1XEWX 2PV7A 3KJFA 4GOLD 2JBHA 2QD1A 2VQ3A 4KQ2A 4B3HA 1GGJA 3LLMA 4MLPA 4S1WA 1Z4QA 1JG6A 1I3OA 2NGRA 2AZDA 3PPXA 4FHZA 3S1AA 3MD0A 4LDRA 3VPCA 2O2SA 1JBQA 3JASA 1EM8A 1FL9A 1RCUA 3C1OA 2XUAA 3TTUA 1KYQA 2EL9A 4WBSA 1UWKA 4X71A 5TEWA 1B93A 1Q0RA 1PJ3A 3FW1A 3IUMA 4FBLA 1D6MA 4JB8A 5AI5A 5IC6A 4XJVA 2PG3A 2Z2KA 3RSOA 2ZUFA 1NXTA 2JB9A 4Z8XA 3T3DA 5B3LA 2BLNA 5DNCA 5KUTA 1QH1A 3ELDA 3KWMA 4UAUA 3AJAA 1XRPA 2WKRA 3OZ7A 1VLHA 2VS1A 4LX8A 3VU3A 2XIJA 3CGWA 4C6RA 3IKJA 1KQFA 3B1XA 2CCJA 2PR7A 1TEXA 3FNGA 3ND7A 4JUAA 1EJBA 3BMOB 3NRBA 1L5ZA 2YXEA 2I99A 4HFJA 1CZNA 4UULA 3WE7A 4LGYA 1E2EA 5C80A 2J9RA 1XMSA 1RXSA 3C8MA 2K6GA 3BCHA 1NTOA 2JI8A 2YNMD 4ISCA 2XUKA 3NB0A 2IS2A 5TC4A 1P3Y1 4DAEA 3ZEAA 1SCUB 4DCGA 2YMMA 3CT6A 2C5SA 3G2NA 1T4BA 2YV1A 2WYOA 1L0BA 3FBWA 3Q72A 4LW8A 3ZCSA 5K8TA 1LDNA 4XWYA 3PNLA 4FC6A 4WESB 1IUPA 3GFVA 3ASVA 3OOJA 2Q3BA 3T4UA 2XDAA 4U6QA 4B3TB 3RW9A 4B3DA 1RIFA 4DXDA 2P2ZA 1JYFA 1KAEA 2OZPA 3C6QA 2ZIAA 4IFIA 5EKUA 4ZV4A 5LQCA 1ZHOA 3TQFA 4GPTA 3HZZA 3QKSA 3UT5B 2FUNB 5I47A 2MWMA 2WHPB 4ZCMA 2FDRA 2HCBA 5BSKA 4TUYB 3W04A 1CY7A 3DZDA 3X2SA 4U7DA 3GG2A 3K2BA 5DULA 1G9SA 1W2HA 3GMSA 5CX1B 2QMUA 2XB2A 1E0SA 2C5AA 4NCHA 2EDAA 1JTEA 5BMOA 2DT8A 2QQ5A 2XWSA 4RY2A 4FYVA 4RADA 1T15A 2JKYA 2JIOA 4F4HA 3ZWNA 4YJ3F 1UBOS 5A7FA 4YLYA 2V4ZA 2YYYA 3ENNA 3LBHA 3O8QB 4MX8A 2FPOA 3ZNPA 4AXXA 3ANXA 2VH1A 4DAOA 4CJXA 4Z51A 1ONSA 3CUYA 4IZOA 4LI0A 4YXWA 1PYGA 5JC1A 1JQJC 2VYCA 1JVSA 1T3SA 2YWCA 2DU8A 2Q9UA 3KKPA 3DUFB 4NTZA 3R0ZA 4PC7A 2QTHA 1ESNA 5IKEA 1JVBA 3HUDA 6NULA 5HX7A 1RRPA 2O0HA 1VA5A 3FB1A 1TYDE 4G8BA 3TGLA 2HWXA 4Z2AA 4CM4B 5IZ4A 3QFRA 3KTAA 2QL9A 4G97A 2QGNA 3KU4A 2DULA 2XUQA 1XTVA 1EUZA 2D8AA 2QTNA 3MIZA 1TM1E 3DFZA 4G36A 3UENA 5J58A 2B8WA 2PS3A 3OQVA 3CH4B 2PO5A 4J94A 4R8MA 3FOCA 4TWZA 3TCNA 2YTZA 2A5DA 5EEHA 1F4VA 2YFQA 1VSUA 3D8SA 1AXEA 1LDBA 5DHFA 4GMGA 1VGVA 1XTIA 2RGEA 5D5HA 2RB5A 4UVEA 4QA9A 1KWGA 2FU5C 4OVKA 1F17A 5IARA 3WFZA 3ZU6A 3W9YA 1ENZA 2H4HA 2OZVA 2W2PA 3GUYA 2Y05A 5AK0A 3WKCA 5K3EA 5J2TA 4NOJA 1HQCA 2QRQA 2RK4A 2XXJA 1NV9A 2HF9A 5B58C 1LDYA 4WWHA 2C9ZA 1HFKA 3CLTD 3GYGA 3JPWA 3KOUA 1O3YA 1T5SA 1XTSA 2VHCA 1FFCA 2YZ7A 3D7SA 3INTA 3OFJA 3BL8A 3OQBA 4OJNA 5ARDA 4L5IA 3KQUA 2RK3A 3B6KA 3SJBA 5BR7A 1N7IA 2RHMA 5G02A 4DQUA 1RFLA 3HKCB 4JENA 5JXHA 4CQNA 4A0FA 1PSZA 2KI5A 3QVUA 4KQGA 1A95A 2OV1A 2QX6A 3AXSA 3HJTA 2PUHA 4N8DA 5TPZD 4ZEVA 3JAMA 3CUTA 1JXQA 4ZT2A 4D41A 3CB2A 4YMUA 3QHPA 3R4VA 3IVCA 2P1ZA 4HFNA 1ISMA 4TVSA 3VM6A 4JT2A 3JAKB 5IK2D 1JQAA 4H18A 3GEEA 4JT8A 4HS4A 3CV3A 4HWSA 4XJXA 4LTNA 3ILSA 4AJ9A 4QUIA 4C2BA 3EVFA 5IT5A 2VBGA 3JATB 4G5XA 4MUAA 4BNHA 5KTPA 2V1UA 1XDDA 4MVJM 4J3JA 5DBEX 1QE0A 4WACA 3G59A 5F1PA 4QDOA 4BVHA 1W5BA 4MYUA 5DYIA 1EZ1A 3F6YA 1DRVA 3COSA 5EXXA 3VZPA 4W5NA 1BMFA 3QIAA 1GAWA 4OB7A 3F6EX 4B2IA 4EB6A 1Z4NA 4JJ4A 1M8PA 2D0OB 4LF7B 2O59A 4GFDA 1V8BA 5EHQA 1H05A 1WD5A 1KO4A 2FSVA 3MD9A 5F1KA 1NUPA 3LP5A 4DMKA 2OA0A 4ADSG 1JEOA 1TIKA 1YRHA 5KX5A 5LZ2A 2NV0A 3EGOA 2Q4OA 3ZE1B 1MG5A 3ADBA 1OGYA 2WSLA 2ZANA 5IP5A 1W1WA 2ZJBA 1J8FA 3VC2A 4MH0R 4CUZA 1M72A 3FRJA 1LW7A 1PEDA 3T9DA 2GJ4A 5CNMA 1Z8DA 3WA6A 5M29A 2NO4A 1QU3A 3GFSA 2FA9A 3MRVA 3A3YA 3PCTA 3K8OE 1V4VA 1DBWA 1U7DA 2GN4A 3WAJA 5WRFA 2XMGA 4JP2A 1OFGA 2YIMA 3KEMA 4LDNA 2AMFA 4B44A 3BXGA 721PA 2OXRA 3GLIB 2GZSA 4RS3A 4F21A 3DEHA 2BI7A 5DIFA 2O07A 2WV7A 3VISA 4R1PA 3LUGA 2A9JA 2ADFA 4OHZA 3ZHZA 1A8PA 2W90A 3DQPA 4BFZA 3FHOA 1JU4A 3O82A 3CUKA 4WK6A 3W9BA 1IWBB 1EGAA 4F2PA 2MR5A 2GDJA 4ZVLA 4KMSA 4B3GA 1SM4A 4DFDA 1GUBA 4RNDB 2YXDA 2F8TA 2PCJA 1R6DA 4L95C 4TSFD 4RZ3A 5K03A 1QIDA 2F59A 4RXMA 4BGDA 3OIYA 3B3JA 1WMBA 1XB2A 3GLTA 3WYEA 4E5SA 9ATCA 1CCWA 3ICPA 3V1NA 3K71B 2J5QA 3AOEA 1KKMA 5IUKC 1IBMB 3ZLBA 2PGDA 1LPOA 4G5YA 4BEBA 1U9YA 3CU5A 4UU0A 4YRSA 2GD1O 2ZIXB 4XEHA 2V55B 2W6OA 2AG6A 1ODFA 1Y8QB 3ZJVA 4D6PA 1N77A 3WR5A 5BV1A 5FI3A 5KMGA 3NIBA 3LOUA 4OJKA 2O2DA 3CNNA 2B82A 3VZCA 1U4SA 3NW9A 3FCCA 3OUUA 5FOVA 1UOOA 2RHWA 5LBUA 1JTVA 3LI2A 3B9BA 1IU9A 1JIIA 3T7CA 3BTUA 3CWCA 1V5EA 4F7WA 3ZH2A 2C4VA 1RBYA 4NICA 1ADFA 2JHAA 3CLUC 4XWWA 2XQJA 1R10A 1K6EA 3RCBA 3KLBA 1GP2A 4HPWA 3N3BC 3R8CA 3DAOA 5AM3A 5HKKA 2CNKA 3HA5A 5AXBA 1QHHB 1IN8A 1C9KA 1MRZA 3E05A 2VHYA 2X8WA 5HQTA 1YBMA 3U7HB 5I7VA 2Z57A 5C0OE 4YUAA 5DN9A 2FN7A 1PGOA 5ECWA 1JNYA 1WXGA 2J3IA 3GPCA 1D2HA 3LCCA 2FN8A 1N9ZA 4Q3LA 4M7WA 4GOND 3E1GA 2AOXA 1XP8A 2CMHA 3NGMA 3M6XA 2JFWA 1QLWA 1P1JA 4JU8A 2ZB8A 3QKWA 3T7RA 4F91B 3T9AA 1Q7CA 1E2FA 1UFQA 2FMUA 3WLHA 2NP6A 4RORA 2Y66A 3CX6A 1DT5A 3IEKA 3UEOA 1NZFA 3AU8A 4MQ6A 4TXHA 2A4KA 2CV0A 1TT7A 3LP8A 1V2HE 3VU1A 3WK8A 3WHLA 3RC1A 3MYRA 3WI7A 1QG2A 2BRUA 1LBHA 1J39A 1UM8A 5K1ZA 3RFVA 1NATA 3F3MA 1FLAA 4P6VF 1OASA 1VJDA 3UJ8A 1C3VA 4D44A 4E0BA 5CA0B 4IVQA 4OQNA 4P0TA 4TX1A 1E1LA 3SOZA 3AU9A 4DLTA 4YMLA 3AP3A 2GN0A 2H85A 2REOA 1JJIA 1KO8A 4UVGA 3FBTA 3H9UA 2PEZA 1K98A 1G55A 4B4OA 1JAZA 4QECA 5JH7F 1E3JA 4N40A 1B16A 1ECLA 1SC1A 1QWSA 3FPAA 1IZ7A 1W6UA 3H1BA 3FSRA 1FFXA 1O54A 3VH1A 5KSZA 1R00A 2B1IA 5KHOC 1ESCA 5CAEB 3E8MA 4YMGA 2FWPA 4Q0MA 3N2LA 2W6QA 2CV1A 2FR8A 3O1IC 1N2JA 2FQYA 2OGTA 3REQB 1QRDA 3LA8A 2IOQA 2QUIA 2GCNA 1IOVA 4F4UA 1KI8A 3ABRB 3ZN2A 3QWAA 4AO8A 3CCBA 2V7XA 1QIFA 1RQPA 2OP1A 5G4KB 2HMWA 2O23A 4OJQA 2XBMA 5DV9A 2X19A 3B1WA 4KO2S 5HE8A 3FKSA 3HU2A 2XA9A 3F5SA 2HAEA 2WVJA 5I45A 4BO4A 1UXJA 3U1VA 1MENA 4EG7A 2BFMA 3GVPA 4BMYA 3EN0A 2D1TA 3HGMA 1XJCA 2B5OA 4MIEA 2WJZB 4LV6A 2B0CA 4X65B 1L3IA 2FSPA 4NYJR 1NG9A 4L5AA 3WAGA 4A7PA 4BC1A 4E2XA 3R9IA 1E7QA 4E11A 2LUOA 3UAGA 3FDZA 3CLRD 4QYXA 5I3CA 1CZLA 2YWXA 4KRGA 1SKBA 4KUGA 3I4CA 3UPUA 3PDHA 3WAKA 2XIQA 3K96A 4N5HX 1ODTC 1ZA2A 2CVPA 3FDXA 1P72A 2ODNA 3G2OA 1VE6A 4K2HA 3PNMA 3T9CA 4IDFA 1J2TA 1YASA 4LXGA 1A72A 3BCSA 4MVCA 5F73A 5J2UA 1W8DA 4RFSA 4V2IA 2YY7A 3IQIX 3GFRA 4GE3A 1VZ3A 2CB0A 3HR8A 5C31A 1XXHB 3FNQA 4KQCA 4CUKA 1N1MA 3DHNA 3DYIA 3N2KA 1VE7A 3UAWA 1EFRD 2RBGA 3CVUA 5EIAA 1QLHA 3GGOA 4H7IA 2YMQA 1DVRA 2C57A 5DYWA 3F67A 2FFRA 1PX2A 1PZHA 3VAZA 2CC2A 2VH5R 4J2OA 5TEVA 1RQXA 2J6IA 3UJNA 1PFVA 3O7WA 5FD8A 3S28A 5DBIA 2FX5A 1PO7A 2ZRLA 1IJEA 1A97A 2Y92A 1CR4A 2O7RA 3GNSA 1FXWA 2OHJA 5KJCA 2CGEA 1UOPA 4XEUA 2WIJA 2B0JA 2C04A 1N9KA 2FZWA 4Q1DA 2W00A 1K0UA 3UMVA 1T10A 3KKQA 1XPOA 4WESA 1Z8NA 2TSYB 3A0RB 4J16C 3CCFA 4LDPA 1UJCA 1RWVA 1QDLB 2JANA 2YWBA 3GAMA 5AOCA 3VYWA 2P9EA 3DF7A 4MINA 1DCFA 3QX8A 3A3PA 3UH0A 3EQ6A 1JEEA 4MVYA 1PFKA 1I4TD 2Q2NA 1SC9A 3AKYA 2PT7A 1DAHA 1AN9A 4FIDA 4LOAA 3KDSE 4UPVA 4ZCSA 3RQIA 4Y1GA 1N6NA 3L7YA 4BJ1A 2XUPA 1E4EA 1G21A 3ESRA 3L4SO 3L8CA 2HL6A 3P7MA 3ER8A 1NHGA 2ZTSA 3LVQE 3F5MA 2J8ZA 1JAIA 3N2GA 1BVYF 5HJEA 3SQWA 4CMKA 5C5DA 2DCUA 1VMIA 1WB9A 2OZEA 4ZZIA 2HI0A 2X1LA 4CM6A 5I01A 1QX4A 1XHEA 1P2TA 1QE3A 2OILA 3JWPA 1JIQA 1E5QA 1LTHR 4WFQA 1RI4A 4ZVOA 4R84A 2P9JA 3CF2A 2JJYA 4JHXA 4LHZA 3SK0A 4BP1A 2L69A 1B8VA 3LDUA 4X90A 3X0DA 4EK9A 3TNDA 1HBJA 2EQBA 3O6VA 4MRRA 5AUPB 2WJVA 4V38A 4X20B 4A6PA 4B3BA 3T4EA 4LS3A 5KAPA 2IEBA 3FIJA 1WP9A 3M3PA 2BEVA 3ITKA 4RY8A 5A05A 4L3OA 1FYDA 2NXEA 4RENA 1RABA 2HO4A 4YYZA 4KR3A 1RLMA 1W4ZA 1FDWA 1G60A 3IQGX 4QDKA 3NOOA 2BEKA 2VT6A 5FA8A 4LA4A 4IO0A 5ALQA 4N0PA 1T6XA 4FLMA 1HQKA 1GCOA 1UMDA 2ZTLA 3KLMX 3NAZA 3ZNQA 4K0RA 1Q1EA 3L7CA 4E7PA 2EJCA 2EWMA 3WDSA 3WYAA 2BKAA 4DN6A 3HKEA 1PJ8A 1M8JA 2E4AA 4YLGA 2IUTA 1JDPA 4UBJA 2C7BA 2AYXA 3C6BA 1ADYA 3WHPA 1D0SA 1VJ0A 4RA6B 1ES9A 1SXJE 1JHOA 5LZ5A 1G41A 2ROQA 3VJMA 4EAAA 1KS2A 1LLQA 3FYHA 2Z09A 3D3EA 4Q16A 2YXPX 1PEYA 2Y1WA 5LBIA 1G6KA 1DJMA 1U4NA 2D1YA 3WBJA 4WXYB 1W0KA 2BSAA 1M6VB 2GARA 2FZEA 3D6TB 3OBBA 3UHFA 3ZPXA 3FNIA 1BEUB 1TU4A 5DCLA 4AM8A 3EHEA 5IKPA 4OLBA 4G0VA 1T3HA 4F4DA 3QYPA 4GPAA 4KWEA 4H0NA 1GPWB 4NY1A 5IXYA 5HJ5A 1RVDA 4V1CB 4E70A 1QKJA 1KA9H 2WQ6A 2FWRA 3F5DA 4HYQA 1YR6A 5A5EA 2X13A 3EIUA 2QN9A 3M6FA 4IVRA 4MWCA 2B8JA 5DCWA 4BNLA 2ZSJA 1FYEA 4WK2B 1DAPA 1O6BA 1E6LA 2CFTA 3BTSA 4TMVA 4UU7A 3RHSA 1XRSB 2XNKA 3IAFA 4YR9A 4LXUA 3RTAA 4KBFA 1JEYB 3PFFA 3KJHA 3S2GA 5K0TA 2JVIA 1J06A 4QU9A 1LS6A 2C1EA 2OYSA 1FXWF 2QTVA 1PR6A 1E6CA 1TZKA 2P2GA 1U9IA 3B9QA 4L57A 1TM5E 4LV5B 5P21A 2J5KA 2EJUA 2IELA 3ONEA 2VTVA 4F04A 2E48A 5A0TA 2ODWA 1B43A 1QGUB 2J59A 2XDWA 3CR7A 5I9NA 2PM8A 2QUJA 3EPHA 4E46A 4PWYA 1H1DA 2VKQA 1O97D 5CXUA 1EUCB 1XLTC 4IQ0A 1MC1A 1CY8A 3VU0A 2DFDA 1SU8A 4C3UA 3QHAA 1VCNA 1DKNA 4M54A 5DTJA 3RVDA 3SSNA 4M55A 2J87A 1I10A 1KERA 1PUIA 1UBNA 2EX0A 4LPKA 2I4OA 2OE2A 1DLIA 3IILA 1ORWA 1SB8A 3S2ZA 1QZ3A 2CLLB 5AJXA 3UK0A 4RVOA 4W5HA 1JBEA 1OWMA 1V7PC 4B6SA 2X4GA 2HMVA 3QOYA 2FSSA 13PKA 3IVXA 3VR3A 3SDZA 3I2IA 1M54A 5CBPA 3F1KA 2UUOA 3QVTA 4QJBA 1KPIA 2MDTA 2UDPA 1NA5A 1THMA 2AJCA 2I6FA 2JI7A 2VA9A 4OYYA 3E3OA 4FGJA 3TQRA 3V4VB 2NU6A 4I4IA 3DOCA 1A04A 1CUUA 3E3AA 3FCUB 4URVR 5FI5A 3VPBA 5B2EA 1W4AA 3LPLA 4MWTA 4OA5A 1GA1A 3S0JA 3Q85A 1J6UA 3NTXA 1Y82A 2ZUCA 4NG4A 2FVYA 1TA4A 4QX6A 5LNK1 5ALKA 4Q7MB 9ABPA 2CE2X 2X5KO 1OREA 4KKXB 3WZ2A 1DC8A 1UJ5A 3ZYCA 4KN8A 5BY2A 3HCNA 1V25A 3DKIA 3EY9A 1RYBA 3HSKA 1BTOA 3QBEA 2GHRA 4KMMA 1YMVA 3RYTC 4AZTA 5LXTA 2FX3A 1KFCB 1SCJA 2WWVD 2BTQA 4J1QA 3K9QO 1USKA 5CEEA 1LBTA 4UOQA 5E1OA 4P86A 5GOTA 1GL9B 3L46A 4ZOLB 1CUDA 1QKKA 4LQLA 3GUUA 5F7ZA 5JASA 1SCQA 4B6OA 4GAEA 1N2BA 4ZVKA 5IBPA 3RSCA 3ZZTA 4COOA 4QG7A 4B3CA 1OKKD 3NWPA 4F3KA 3ITDA 3FLMA 4RK1A 2CLFB 2XGJA 3BMQB 4URFA 2JJQA 4RGYA 4GMKA 4UXIA 1RKBA 2AFRA 1CD5A 2JG3A 5EAIA 4QULA 3H05A 1TQDA 4Q1BA 3MTGA 3FSGA 5EA2A 5KDLA 3A3NA 3CEHA 1CS0A 1M2NA 4U5XA 4V0OA 3VTAA 4J0IA 4ENQA 2FWNA 4HHEA 1Y3BE 1C9JA 3GZNB 1XX6A 4TWRA 2F9FA 3OTIA 5JXWA 4QLBA 1DZ3A 2VJAA 3CZ5A 1KK0A 2FF5A 2FSFA 2QW0X 1MABA 4D9KA 4LCJA 2J9ZB 2O57A 2ZE5A 1ZH4A 1MIHA 2AW3A 1E61A 2Q99A 3K8QA 4OSPA 4QE3A 4EL0A 1PT8A 4GWKA 3OT1B 3CKLA 5DNVA 5EHNA 3ZNOA 5T3UA 2WEKA 1OIXA 1WXFA 3LUPA 1OQAA 1F6BA 5K0LA 5B57C 3ENKA 2QP3A 1Q7GA 1HT2E 1Z73A 2Q5IA 1UK9A 2RAVA 3ICOA 3U4QB 2J5XA 1IK4A 4GLFA 4MVJD 3G2PA 3VTZA 4BO2A 5CDUA 1YQGA 2C4MA 2GRJA 2X15A 4FZ5A 3QG5A 4K6CA 1OC4A 3G2LA 4UBLA 5F1YA 1HDIA 2YYZA 4ZD6A 1M8FA 1Q15A 2BSQA 2DB3A 1FRVA 5KU1A 3E2PA 3CBGA 1JJVA 4WNCA 1T1SA 3MAJA 1ECPA 1LI4A 3ZJ5A 5L3QA 2XNSA 4NE7A 5DM2A 4PYMA 2HKIA 3M33A 1Z6XA 3DOUA 4OIFA 5EWMB 4C21A 3ZIAA 1FNDA 1CQWA 5J5AA 3KZMA 2OO7A 1UMCA 1HLDA 5K01A 3COJA 3WLFA 2WVGA 4D9BA 3A2NA 1R4NA 1ZNQO 3A0UA 1WDTA 2IXAA 2E9SA 2GVDC 3KXLA 4AJ2A 4GYWA 4PYOA 1YCDA 1GFWA 1NLUA 2B83A 3V2IA 2DLDA 4AURA 5I7EA 1D07A 2I2XB 4TVOA 2ONZA 3V6LA 3KB8A 1OBVA 1ULAA 3ZXSA 3A8TA 3EQZA 4L9RA 4CKCA 3E15A 1K97A 4EPVA 2VG8A 5E7QA 4WPGA 5B7QA 1N5DA 5LQAA 2RARA 2ZB3A 1SC3A 1V8ZA 3H97A 1KEWA 3GCZA 1QOZA 4OIMA 4ZC8A 5IM4A 3USZA 4O4IF 4M53A 4Y9TA 3WZLA 2XMPA 1JDVA 3RR2A 2R8EA 5DK6A 4CF7A 2PUWA 1WV1A 3IC5A 3IGFA 4HH1A 3FCSB 2W48A 1I6WA 2PK3A 3VDQA 5CW2A 1QV9A 1GDTA 1MT0A 2A14A 3AY3A 3OIDA 4Q3DA 1NFQA 3SIWA 2AL7A 2WFLB 4FYPA 4FGLA 3J80A 4IDCA 4XYEA 4Q93A 1DBPA 2GSDA 3JD4A 3WGQA 5EP2A 1QFXA 3P9QA 2P27A 3C7KA 4B85A 2H07A 5JD3A 2FQXA 3PX7A 2OYCA 3M4YA 2V54A 1CS4C 3GYBA 3MCWA 4A15A 1E9CA 2WKPA 3RH0A 1CB7A 1H9CA 2P5SA 5JTUA 1JFRA 4HAXA 3BK1A 1CVIA 4FUTA 5IJWA 4WNIA 2G17A 1DCMA 2N0SA 4N3GA 3RKSA 4BLSA 1OI7A 1BA3A 1OH8A 4OXIA 1FVOA 2LPMA 1IB0A 4AYWA 5IYZA 2MR6A 5DGDA 3RVNA 3V7NA 3ILYA 1XYVA 1N2XA 2Y3IA 2BEUA 5JAPA 4PRKA 4P7KA 2X6QA 3MIIA 3DOOA 1QH9A 2G8NA 4YRNA 1GZ4A 2NVWA 4AKHA 2EDCA 1JALA 1J1UA 3OFVA 4N3NA 1C2YA 1JILA 5LUBA 4KVGA 2P6UA 2E55A 2YHUA 4N18A 4TROA 5K6AC 1FCJA 1MOQA 4G1EB 2NVBA 2VUSA 1FTQA 2XTAA 4UVHA 5HDBB 3V2GA 3IP9A 3WYCA 5FULA 1NUUA 2JLWA 4OYRA 5M3BA 3P9ZA 3SYTA 1G3IA 1N6OA 1IJBA 2DPHA 2G7ZA 2H5IA 3GEPA 3OE5A 1W4BA 1BD3A 1HDYA 2JGMA 3KAJA 4IGFA 1G8KA 1AOXA 1TMKA 2NZUG 4BN5A 2OCPA 3TLAA 3BB1A 5IT0A 2O9JA 3DSRA 5J23A 4QASA 1E2MA 3B5JA 3L4BC 2Q1TA 2Z43A 4I5EA 4KU4A 5CB8A 1RI3A 3NOXA 2XB6A 2ZT6A 4EVQA 3ZXXA 1A9RA 2H1IA 2VF4X 1AUPA 2P3LA 4XGQA 3PXGA 4BU0A 3HXQA 1SH7A 2B3TA 1Y34E 2NWQA 821PA 3DHYA 1HE2A 5KYUB 1Z16A 4ND8A 3D6JA 3NBKA 1SUIA 1KS9A 2EP8A 4R81A 5JZSA 2JDID 3OPVA 5TGTA 3REGA 2EC5A 5L3VA 4X1KA 5T57A 4L8GA 1A9YA 1QX3A 5L3SA 1JMVA 1OVGA 1RMTA 3I9V6 5DEIA 5ELLA 3WIVA 1K5GA 2Y71A 4YDQA 1KY3A 2X4IA 5JISA 3QGMA 2J9FA 4UBIA 1DNPA 5DOZA 4KUHA 1T8SA 2G1PA 3S55A 3DLAA 1I7QB 4HG2A 4WKGA 1GCGA 5KVAA 1TFUA 2WOOA 1TTHA 4M8NE 3LG2A 2V7QD 5IW8A 3QYAA 1ZGAA 4RVUA 2HMSA 3Q15C 2BUAA 3QFFA 3GW8A 5BUCA 3EE6A 4PEVA 4LJYA 5AKJA 3CO0S 1X8LA 2X7XA 3L8YA 4DCNA 4ZMRA 9LDTA 3T1NA 1JHQA 3CEPB 4HQOA 3H11B 2LBPA 1Q92A 3KP1A 3O4HA 4NS4A 1M6HA 2MMGA 3NDBB 1P1KA 3DW1X 2EYQA 4C4OA 3UPDA 4I81A 1HFWA 1KKLA 1X13A 5LOVA 2C58A 1JI0A 3JASB 5DRYA 2NLOA 3ACDA 4WOPA 4Q1EA 3PKZA 1FUEA 3CEMA 3C74A 3OU2A 2AR9A 4A4DA 1X6VA 5DHPA 4R0MA 1XU7A 3JCZA 4E5MA 1GM5A 4AAYA 4OBXA 1DKLA 1KKUA 4MARA 2WICA 3OZCA 1X7WB 2XE7A 4JFRA 2VT3A 3NC0C 2F67A 2M6LA 2A9OA 4A03A 4MUEA 1OT3A 5E6UA 1NW3A 1PK7A 2VJQA 1R9JA 1QGZA 4HEA1 1NN0A 2XOXA 1BWQA 2PDAA 4L8WB 4WZAA 1U3FA 4F6RB 1VHLA 1EUCA 2CLKB 1F8UA 3HACA 4DTCA 2IRWA 3HKCA 3EF3A 3AWDA 1UIMA 4UM5A 1AB5A 4NU6A 3YASA 4DUPA 1N5OX 4AY2A 3NEJA 5E7IA 4KR6A 2G36A 2NXWA 2R87A 1WBBA 1U1GA 1CZOA 1WEHA 4NJEB 1G8PA 4HDCA 3AR9A 3A1CA 4IIJF 5M34A 5J40A 3I3SR 4US2R 1CRZA 2XF8A 2AEFA 1T0JB 1B0PA 2F1OA 4V1CA 1GQSA 1K5PA 3TZBA 3HBJA 3M2TA 2IEGA 5JXJA 4BRUA 1H1LA 2D1QA 1SKYB 2V0NA 3QHQA 5JAZA 2LXNA 4DNPA 2CD9A 4J16A 5KQGA 1IFXA 4ALLA 5EERA 3N0TA 1ZFNA 1NNI1 2UZAA 3ZGZA 2IUFA 3LSTA 3I6MA 1EBBA 1CUCA 4LJ5A 2ZYWX 5DCUA 3RC3A 3CYFA 3F96A 4C2AA 7ABPA 4D80A 4CM5A 1K1EA 1MJGA 2OFOA 1ZOOA 4LYDA 4E13A 4ACBA 1BVHA 1TDJA 5BPFA 1I4WA 1KY4A 1QZTA 3VV2A 2QJRA 3ROQA 1G8FA 4Q66C 3SBXA 3SYLA 3VPDA 5ADHA 2VPQA 1TEVA 2UVQA 1L5HA 2FPPB 4HXGA 3RAGA 1R15A 4HGQA 4QATA 3I76A 4BCBA 4OH1A 3E7XA 1YC2A 3OZEA 1Z36A 1TYBE 2G5PA 1JN0A 1O6ZA 3HB4X 4F84A 4BJ5A 4G81A 3HDTA 1E2LA 2A5JA 4NYMQ 3OLCX 1DRJA 2ENUA 4EW6A 4Q7QA 4Z7JA 3W2FA 4FI3C 4XLTA 5T4EA 2QV7A 3ENQA 1J49A 1NU6A 3TCKA 3I83A 4JBHA 4N6GA 1XA4A 4R2JA 5E6SA 3STHA 3UAVA 1G5HA 4D56A 1NN5A 2D59A 2I3AA 2QTWB 1BS9A 2X42A 3P9PA 3M4XA 4KG7A 5K8CA 2Q2QA 5IBRA 2AYYA 4UTOA 2FJPA 4FKMA 3THWA 3X3HA 1D2EA 4MKRA 1KZ1A 1XZEA 2MHCA 3DWFA 1PK9A 4RA9A 3SHOA 3UFXB 1FZTA 1FP4A 3QWFA 5BYJA 3AR3A 2HEIA 2QW1A 2VQEB 4F2DA 4FQ8A 3CH5A 1VPLA 1PVDA 4YRMA 5JANA 5AVRA 1GPMA 2PWBA 4RC9A 3H6GA 7REQB 2P3OA 4ME6A 2QSZA 3ERCA 4GRDA 4F97A 4R2IA 5DEOA 1G59A 3JYHA 1J2RA 2ILTA 3E03A 2YQ5A 3I62A 1F12A 1RBZA 2AN3A 1ZD4A 4DZZA 1CQJA 2Q9AA 1Y3AA 2FPPA 4Z0HO 3U4QA 3QPVA 1FZQA 3HKBB 3OE1A 1F8YA 5I4BA 2PS9A 1XLWA 4DBVO 3Q8KA 3NHFA 1H4TA 3VJKA 4MGHA 5KYVA 5C7YA 5LU9A 2O0LA 4IOMA 1L5NA 2BTQB 3WG9A 4FS8A 4Q00A 2DUMA 2RAPA 3C3JA 3A2LA 3OZVA 1SRQA 2CZCA 1YRLA 1HDOA 3MS7A 2G1KA 2GCOB 2GCEA 3CN9A 4QAJA 4H31A 4MO2A 1E3QA 4WI1A 3WLEA 3ZWWA 3E22A 3WB1A 2Q6IA 2WHXA 1GHTA 3H8VA 1X39A 1JEAA 4QIHA 2A0YA 4OHWA 1ZJ6A 3UFXA 3ABIA 4AJKA 2ZYTX 3EGVA 3HGQA 4W4TA 1LI5A 1QHHA 4QFDA 4UU1A 3G9TA 3QI7A 1WQ4A 1N0IA 3OX1A 1WKBA 3JZFA 4Q4CA 3GN2A 3GNQA 2R7NA 1OGIA 2H5LA 5EIBD 2FET