2ATXA

Crystal structure of the tc10 gppnhp complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
186
structure length
186
Chain Sequence
SMAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords small GTP binding protein TC10
total genus 50
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2005-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2atxA00
3ZJYA 1G8PA 3T06B 4Q1CA 3C8UA 2HF8A 1KSJA 2B7CA 3KXLA 3QKTA 4OHYA 1R10A 3BWDD 4JVMA 4URVR 1XCGB 3PXGA 3DZDA 4MKFA 2XNDA 1Z0JA 4F92B 4QBHA 1T8UA 1RZ3A 4IEEA 4IXNA 2C96A 2D3WA 5B58C 4DB2A 2CCGA 4Q02A 1Q12A 2FDCA 2GETA 3PITA 3EWAA 1SKQA 2QM8A 5BQ5A 3CH5A 5JCPA 3SJAA 1TUEA 4MYUA 3D6TB 4KV9A 2F9MA 2Z83A 5EP1A 4D82A 2ZRCA 4Q9JA 2GA8A 1XD8A 3BE4A 1GFIA 3CPJB 2KBEA 3AKEA 1PLJA 3AF2A 4C0LA 3RHFA 2WSMA 1BOFA 3W6OA 2IK8A 2RGNA 2GCNA 5G53C 3WBKA 4RFSA 1UF9A 4TZ6A 2NO1A 3K53A 1ZBDA 2N46A 1FX0A 3B7GA 5CDFA 4Q7JB 2G1JA 1W36B 5KPDA 1AS2A 3U3KA 2OAQ1 1ZC4A 2VHCA 1DS6A 1FZQA 3WP0A 1ZC3A 3FDIA 4LYHA 2C98A 1FFHA 4B75A 4MRNA 4GNKA 1L7VC 3EA5A 4AYWA 4UNRA 4OI0A 4M1KA 2ZYTX 3NVAA 3DL0A 1R8QA 1AM4D 1W2GA 3TQFA 1NSFA 3Q8XB 1NVXQ 3U3RA 1WBDA 5JFGA 2J9RA 2WVJA 5L3SA 4CEJB 4L9SA 4C0KA 4PPNA 2QQ0A 1K5DA 4BLOA 1XRJA 4NCKA 4U02A 3DDCA 1G8GA 3G82C 2GK7A 2VP9A 1LY1A 3B1WA 1AS3A 1J2JA 3T1OA 1KKMA 3MAAC 1EFUA 3ZS9A 4LPSA 1QHHA 1R4AA 1S9DA 3GD7A 3NHAA 3EPHA 4RCZA 3DOFA 3QOFA 4LX0A 5EE1A 4AKEA 4BRUA 2R65A 3NBYC 5IT5A 2OE2A 1G64A 4YDSA 4Z8XA 1Q3HA 3I3SR 4BZPA 1RRCA 2PMKA 2G1KA 2QY9A 2JATA 1VIYA 2LKCA 2ZANA 3P4XA 1W36C 2BV3A 3VR2A 3I62A 3V4FA 1FTNA 1UADA 4DLYA 5IK2D 1FMJA 1Q22A 1W36D 1F48A 3U7HB 1XMSA 5L3QB 1KK1A 2A5JA 4KHZA 1U0LA 1D9XA 1N5LA 4JLOA 5FL7D 5JZVA 3KQUA 1E0SA 2GCPA 2PEZA 4A9AA 5JRZA 1TQ2A 4TL8A 4BZQA 3U4QB 3TAUA 4AYXA 4D0NA 3ETLA 5J47A 3R8CA 1OB2A 2OHFA 1NVUQ 2V6IA 1BH2A 2F6RA 1DO0A 2H16A 1Q0UA 1TX4B 1GAJA 1Q21A 4OHZA 1N0UA 3QKRA 2IYLD 3A8TA 3U6KA 2Q3MA 3CBQA 3MRSA 4LOAA 4GBMA 1JR3A 1G8HA 4PANA 2CNWA 4TL7A 1W46A 3LW7A 2FOLA 5FH9A 3LFUA 1G4UR 2ZAMA 3QI2A 3SJBA 3EC2A 1E79D 2H57A 2QM7A 2XOKA 5AWFC 2AFHE 1AS0A 3M0EA 3PVSA 3QXJA 4HI0E 1CRQA 1W0KD 4AKHA 2QMHA 1JB1A 3CM0A 4L16A 4OL0A 1F2TB 1T9HA 3SN6A 621PA 2C5LA 3BERA 3NC1C 1ANKA 1HV8A 3FWYA 1YR8A 3QNUA 5TXGA 2Q9BA 4B48A 4M1YA 5DNYB 3LDAA 1SHKA 4X8MA 1N5JA 2QRZA 4M1SA 1WA5A 1YZGA 2QAGB 821PA 4C0HA 1E2EA 2GILA 4DVGA 4WBSA 5SZKB 3K0CA 3GLFA 4DCTA 1EWRA 1N6LA 4TLBA 2O8DB 3AKYA 1G21E 3NH6A 1Z63A 3CRMA 2GKSA 1FUUA 3EC1A 3S1AA 3FHTA 3I73A 4Q48A 4BFWA 1Z0KA 1MO5A 4F38A 521PA 2WWWA 3CZPA 2QBYA 3QG1A 4HUTA 4PX9A 2W58A 4BRWA 2GZDA 3AV0B 5FUYA 4WZAE 3ZVNA 3TSOA 1FX0B 3D31A 2REOA 3E70C 5EXXA 3B82A 1NVVR 4MYHA 4OK3A 1NKSA 3I5YA 4TQ9A 2CEAA 1U0HC 3HPQA 3GQBA 3U44A 3CF6R 1NMXA 2BEKA 2REXB 1E2FA 4DIDA 2CNWD 1VKJA 2ZI3A 4IOMA 4Q03A 4D2IA 1OSNA 3GJ3A 3GLIE 2JGNA 3NBXX 3GLGB 3MLEA 3I72A 1M7GA 1E9FA 1BYIA 2OAP1 1G3MA 4HZUA 5TB5A 2A9KA 1OKKA 2FFAA 1KGDA 1XZQA 3SE0A 1E98A 3BB1A 3T34A 1OH7A 2B8WA 2JLXA 5UKDA 2NG1A 5DLQC 1E69A 4BE7B 2VRWA 1ZNXA 4DLSA 2WOJA 4JS0A 3R20A 2FSGA 2QRNA 5CYPA 3DMNA 3HU1A 4C9BA 4DDWA 2O0KA 4Q5IA 3RRYA 4D0LB 2GAOA 2C8VA 4LJ8A 1CRPA 5LD2C 4PXAA 3SQWA 3K70B 2OFXA 1TU3A 2CCKA 2N42A 1N3BA 4ZKDA 1OW3B 1E0KA 2BCGY 5CM9C 2OT3B 4WA7A 1LS6A 3K0EA 4A0HA 3W8RA 2GJSA 2BMEA 4ZDKA 2WWYA 3BH7A 5GJVC 1YZKA 2GK6A 2ZI7A 4DLTA 1M7BA 2OUKA 4URYR 1EFRA 5D3QA 1HQYE 5TMPA 5CK5A 4U5XA 3LX5A 1DBSA 4RJLA 1UAAA 1IN6A 5AJWA 3VNUA 1KDRA 1KK0A 3AVVA 2J0UB 5B64A 3MWJA 4KFRA 1N6HA 3CWZA 2RH5A 1OT3A 2O8CB 1QF9A 3CRW1 3U6BA 2JIZD 2ZSFA 3NXSA 1G3UA 3JZMA 2P5TB 2QPAA 5JECA 4MYTA 2F3RA 3ONWA 2ZREA 2BBOA 4M9XA 5IHPA 5IRCD 2QA5A 4ZIRB 3BJIC 1GNRA 1R2QA 1U90A 2ATVA 1CIPA 1JI0A 1TF7A 3GJ4A 1HT1E 5E7MA 3OEHD 1OKKD 4PSVA 2ZRPA 1JR6A 2IF2A 5TV2A 1S4QA 3R7WB 2C9CA 3QJYA 4Z1MA 1X1RA 1XJ0A 2MMCA 4LYJA 1E2NA 5AJYA 2UZ3A 2QAJA 5E95A 1BMFA 2AFIE 3TUIC 5KSOA 2W2TA 4IDHA 1T5LA 4O2RA 2AD1A 1R5BA 1VCOA 4O25A 2QSYA 4L8GA 5FTLA 2RGNC 1V43A 3ZVRA 3VR5A 1N6IA 2YV5A 2AHOA 1TEXA 2YC2C 1IAQA 1KNQA 4C3ZA 4E22A 5DI3A 4MGKR 4TL9A 5FOSA 1MT0A 3EASA 3Q7PA 1NL3A 1SVKA 3LQQA 3P1JA 5GADl 1RPZA 5KSZA 2PJRA 1VMAA 3QKRB 5KDOA 5C46F 3ASZA 1X86B 4H1VA 3A36A 1G6OA 3ND9A 1OYWA 5FTKA 5KYKA 3IUYA 5EXPA 3KFXA 2OCYC 4Q66C 4YQFA 2XAUA 3NHBA 1F2TA 3KQKA 3AP3A 1DAMA 2JLQA 5LPNA 1Z2AA 4BECA 3T1QA 5CITA 1P61B 2PX0A 2VL7A 1KI6B 1CF4A 1D6JA 1OHHD 4DCVA 5L3VA 4JT4A 4QM7A 5DE3A 4G5RA 3EPLA 2GCOA 3GMTA 1OXXK 2F1RA 5CLLA 1AIPA 3BXZA 2ODBA 2CCJA 1KI6A 3E5HA 4LJ6A 2Q0HA 4Q7KA 3T5DA 4HLQB 3WNDA 2XX3A 3NH9A 4ZV4A 4P0TA 4HB3A 4EIWA 2ZYVX 3FYHA 4G5OA 3KXIA 3FFAA 4HAYA 2P5SA 2NGRA 3G0HA 3WNBA 1G7CA 4BZXA 4PZZA 2PH1A 4V0LA 5B30A 1KJZA 5AJXA 2ZVPX 1CJVC 3HR7A 3PUXA 2YC4C 4YMTA 3ICQB 5D3MA 5BWMA 2ZSEA 3MCAA 2EFGA 3LNCA 3NWJA 1NLFA 3X1DA 5CJ2A 1XCPA 2WJJA 4BFYA 4U00A 3W90A 3THXA 4B3CA 5CIQA 3B78A 2EYQA 4NMMA 4KSCA 3D3QA 5JWRA 4KLNA 1S0UA 1YR9A 4PQRA 2ZR0A 4LBYA 4EFLA 3A1UA 4FINA 4JBYA 4D81A 2OCBA 3ZD6A 1E79A 2J1LA 1D8TA 1EK0A 1P2SA 3GJ0A 1DELA 1TUIA 4KVAA 1U8AA 2DB3A 1Z07A 4HATA 5DO9A 2BC9A 1YZLA 5IDVA 3CPHA 5FTMA 3C14C 4D6PA 2GJAA 4O2LA 4JJZA 4RFSB 1KO5A 5FUVA 1E99A 1NVWQ 3DHWC 3TSWA 5FBRB 1KI1A 2R62A 4M22A 3ZD7A 2ZU6A 1AK2A 1KKLA 2Z5FA 1OPXA 3GJ7A 3U2QA 2J87A 2H8KA 2QQEA 2YVUA 4HSEA 1ESMA 2FFBA 3DKVA 4JVSB 4MRVA 5A5GA 1SVWA 2NIPA 4TYYA 2IL1A 3SYKA 1G5PA 2A5FA 2J45A 3FPAA 4XVUA 5EE0A 5AJZA 3LO5A 1RC8A 4WOPA 4GPTA 2VF7A 3KUCA 1GNPA 1GG2A 4DEXA 1RYFA 2CK3A 1XMIA 2CHQA 5GVSA 1KSHA 2V4ZA 2AR7A 2JAQA 1ZJ6A 3KQNA 2D2EA 3QPUA 3SYLA 4DCUA 5JJKA 1KY2A 4M4SA 1FQJA 5SZIA 1RJ9A 5JS8A 3ZDQA 2P2LA 4P31A 2KI5A 3ZIAA 4EJSA 2WWGA 4QFMA 1EFHA 3TJZA 3IHWA 1BS1A 4IDOA 5JHHB 2MSEB 1J99A 4XWAA 3QXXA 4MH0R 3ZGXA 1SXJB 1FNMA 4DB4A 2WV9A 4WW0A 3U5ZB 5DN6A 2UVQA 1H65A 4BFXA 3TVTA 3TAHA 1T3HA 1SXJE 2P6NA 3Q3JB 3SHFA 5DHAA 4US0R 1W0JA 1OFHA 3RS3A 3TK1A 1K8RA 1VHTA 4YMVA 3AVXA 4QJ5A 2W2XA 3AQ4A 1G5RA 2A5YB 4QGGA 3W5JA 4A8JC 4NBSA 4TQAA 4RD4A 1KI2A 2WHXA 721PA 4P4UA 4URUR 2JLWA 1KMHA 3UANA 5AUOB 1KI4A 4M9SA 1G4AE 3GLFE 3SOPA 5DYGA 5L3SB 2ZJ2A 1SVOA 3IQXA 4ILEA 5TDHA 2QP4A 2FX3A 3GEIA 4G0NA 2NPIA 2EFDB 4XTRA 4B3BA 1YVDA 2O8BB 5LB2A 5KNDA 1G9XA 1ZM3A 3BIFA 1JQJC 5EE3A 1E9BA 4TN1A 4ZI2A 4Q9LA 2ECKA 2C04A 1P9WA 1ZD1A 1F5NA 4TL6A 3RNLA 2GCOB 1F6BA 4A2PA 2VHTA 3VHXA 2WPDD 4IXMA 3N70A 2BM1A 5CLQA 2ZRFA 4PC2A 4QKQA 4BGDA 1T91A 1IXRC 1E1QA 2FZ4A 4FMDF 5CJPA 4R9UC 4LSGA 4QBGB 5E7JA 4Q9IA 3PUZA 3H0KA 1CU1A 1E4YA 3IKJA 3TBKA 3AVWA 1TQDA 3WMGA 1D2NA 2B6HA 1Z8FA 4BUJA 4TYNA 1QBKC 3LY5A 4BFUA 3MMPA 3UPUA 3FMPB 5JHGB 4PPFA 1VCIA 1PUJA 4DSOA 4EQ6A 2ZSBA 2NOAA 1SKYE 3K8YA 4ZCIA 3CR8A 3N5CA 4POAA 3UK6A 3GLIB 3KXKA 2GRJA 4GRAA 3ZYCA 4TSFD 1OH8A 4B35A 3M6AA 5DI3B 3W3AA 4UNNA 2D7CA 2AWNA 3RDPA 2O8EA 1E1QD 1ZD9A 4DZZA 2VIIA 1OXTA 2FMXA 2ZI5A 4QGHA 4KO8A 1KHTA 1MV5A 2P65A 4TYWA 5HZHA 3X1XA 1H8HD 3DM9B 2ODNA 3VR1A 4OQMA 2O8DA 4B74A 4IOLA 4JYCA 2PZFA 2RGDA 3MG9A 6Q21A 1SQ5A 5KNCA 3KQHA 3KB1A 3SEAA 4JL6A 2EYUA 1KSFX 3LWNA 2PCLA 4KI0A 5G3ZA 4CIDA 5FPSA 3PQCA 3ZZTA 4AYTA 2GEVA 4C2UA 3TRFA 2FF7A 4A36A 4M1OA 3A6PC 2ZIAA 4QC2A 3K0AA 1US8A 3U3JA 2B92A 2CL7X 3V4RA 4CGZA 3LBIA 1GIAA 1JNYA 1NY6A 2HJGA 4DT1A 1G19A 1GITA 3D7MA 4JLBA 4DLRA 2HJVA 4GZLA 5F2EA 2P6UA 1NBME 1RYHA 1OFIA 1X3SA 4M1WA 2EW1A 4ZKEA 2EWVA 1MO3A 3M4YA 2BOVA 2JJ1D 4DKXA 1FQKA 2GZHA 4KODA 2ZROA 1XWIA 3SYNA 3P32A 2R2AA 1XEXA 2DCUA 2ERXA 1IN5A 4TTPA 2ZE6A 1IN7A 1OYYA 3B1XA 3T5GA 3BFXA 3BOSA 5HE9A 5FOTA 4PZYA 2Z0MA 5JJLA 4QHSA 1ZUIA 4RKFA 4PC7A 2J5XA 1NKTA 3P20A 1A1VA 2WAXA 5GVRA 4JKIA 2J0UA 5K8TA 4Q4HB 4FMBB 2IA5A 2FN4A 2ZE8A 5FBVB 3IO5A 2GF0A 4YONB 3VFDA 5C4MA 2ONKA 4Q1AA 1GRQA 5AUNB 5DGXA 4MYCA 2SHKA 1KO1A 4V0ME 4PAQA 3AGQA 3RANA 1XZPA 1GM5A 1G1MA 5FPKA 2ZJBA 1KAOA 2A7QA 2XSZD 4A0GA 4URZR 2KB0A 1E2DA 1HH4A 2TMKA 2VHUA 3LXXA 5EP3A 3QSYA 4M2LA 5K8UA 3CZQA 4KFSA 4WZBE 4S2EA 4NTZA 1MABB 5FOUA 3N2EA 3QKSA 1GNQA 1VG1A 3U7GA 3R7WA 1VG9B 1Z28A 2WWXA 4M9ZA 1G5TA 4NYIQ 4TMKA 4YMUA 3NEYA 2G6BA 3EPJA 4C4PA 4I4LA 5K8LA 1FTSA 1SXJD 3UATA 4Q1EA 2J46A 2QP3A 1IM2A 2WOOA 1E2KA 4DLUA 3NG1A 2EFCB 2EFHB 1NF3A 2IUTA 3MSXA 5FBWB 2QMOA 3RVBA 2OG2A 1ZUHA 1RIFA 4FWIB 5BYKA 1JEEA 1TF5A 1E2HA 4Q4LA 2G83A 2BMFA 2O8CA 3QENA 1QHYA 5H1YA 1I4TD 4Y0VA 1EXMA 4HLDA 1GOTA 2K5UA 4NHOA 2CHVA 1WB9A 3PEYA 1G8FA 2IUSA 2RGEA 2X2FA 1F2UA 3CB4A 1JR3D 1Z5ZA 2QENA 1PZNA 3P26A 3EIEA 3QY0A 3F8TA 5BN3A 2VSOA 4GZMA 5DI9A 1XPOA 3GCGA 2GTPA 1XTJA 3LX8A 2OSBA 2YINC 1ZD8A 3WYFA 3GJ8A 1DAFA 4OHVA 4N0DA 4DRZA 2BMDA 2IX3A 3H86A 4XIGS 4F4CA 4ACAA 4U7DA 1XEWX 3T35A 2V7QA 2OBLA 1GP2A 1II9A 3GLIA 2B21A 3KJIA 1ZYUA 4IDPA 4OKSA 5IK2A 1E9SA 3F0TA 4GMDA 4WAUA 1F3OA 1OV4A 4TSFA 2J7KA 1BMFD 1TL7C 4DLXA 4O0MA 1WMSA 1U0JA 3E1SA 3EZFA 3GLHB 4LJ5A 2H1LA 1YR6A 4OI2A 3B2EA 1NBMD 1SVSA 5SZHB 4D0GA 5KSYA 2DFKB 4ACBA 2W6JD 3M1IA 4L15A 1UJ2A 3EZ7A 5EXSA 4V02A 4R71A 3HYTA 3P27A 3PJRA 3A58B 3QF7A 2HXSA 2ZAOA 3RS2A 2QP9X 2OCAA 4TT3A 2D7DA 5J4HA 3CIOA 3QEJA 2MSCB 4HUQA 1LF0A 3UXMA 4WZ6A 1E2JA 2WWFA 2YOHA 3FFBA 2XXAB 2J0SA 4NYMR 2ZUBA 1PUIA 2P67A 4BEBA 2WM9B 2IHBA 2IYYA 2X77A 5JEDA 2OV2A 3HDTA 4NCIA 3VMFA 4FWTA 1YRAA 2DPXA 2W6JA 1E2LA 3KFVA 2HT6A 3A1TA 5J4YA 4IW3B 1CJKC 4QGFA 5FFMA 4M0LA 5E4FA 5LB4A 1UBEA 4JL5A 3RS0A 4QXAA 2I4IA 1S3SA 2WICA 1T0JB 4S35A 2E1RA 5EP4A 4ZCLA 3H2YA 4LRWA 1R5NA 2QE7D 1ZRHA 4JLVA 3K9LA 1NN5A 3THWA 4CDGA 1D9ZA 2Q3HA 4QL3A 1DG3A 2OEPA 4ITRC 4PHFA 4GT1A 4PQYA 4ASUD 1OH5A 3THWB 1XPUA 1ZM4A 4BLTA 2YHSA 2FEOA 5EZ6B 4KAXA 1E4VA 1DAGA 4KITB 1FUKA 2PBRA 4JBWA 2PJZA 4NE2A 3CH4B 4B3FX 3PIRA 3K1JA 2DY1A 2WWIA 3AP2A 3EIQA 2ZRAA 1TADA 1W0JD 4LDJA 1B0UA 1BO6A 1GRNA 1II8B 1R6BX 2JLUA 2DBYA 4TLDA 1IHUA 1YZTA 2DYKA 2A30A 4QOSA 3B6EA 1OIWA 4CEJA 2VSXA 1KZ7B 4IOJA 5CB6A 2OLKA 1T4GA 4RD2A 2WAYA 4BQSA 2XNDD 4Q9KA 4O3MA 2ZE5A 2V54A 2E9SA 5AJVB 1H8ED 1NP6A 5KOYA 1NN1A 3C16C 3HR8A 2NO0A 1IBRA 1VECA 2RB4A 1TU4A 3QUSA 1GILA 2D2FA 1YZNA 3UMRA 1II0A 1W5TA 3BFKA 3CLVA 3FTQA 3I4LA 3I8XA 4JLAA 1JQLB 5CB8A 5JS7A 4URXR 3RC8A 3THYB 2P3SA 4CVNA 2JA1A 3BK7A 3L0OA 3PFIA 1I2DA 2HLDD 1P9RA 2FPMA 4NL4H 2FSFA 2FWRA 3HJNA 3F3YA 2DWOA 2GWHA 3B9PA 4Q9HA 3TIFA 1EFTA 1E9DA 2R6AA 2FH5B 5EUQB 3W9YA 4C0AC 2JJ8A 2OILA 4LHZA 4E09A 1KMHB 1Q57A 2XB2A 4AG6A 5FTJA 1VTKA 2BEJA 1VYUA 3TSZA 2PT5A 4HZIA 3B1ZA 5GJBA 4JLKA 3WRYC 4FN5A 1WE2A 1N0WA 5TVKA 1K6MA 1CTQA 2KJQA 2VF8A 3RS4A 2GNOA 4BFTA 1GVNB 4GOXA 1M6NA 4HB0A 4OK5A 2J0QA 2G0TA 3PENA 1A7JA 3SFZA 4AG5A 4JLMA 2FFQA 3I92A 4ZCMA 3EW9A 3R9IA 3KX2A 3RAPR 4A8JA 4QG7A 1QHHB 1S3GA 3SU8A 2DFTA 1OXSC 3OESA 4IVRA 2G3YA 5FUXA 3P4YA 1XPRA 5FPHA 4KLZA 3A4MA 3WXMA 4P4SB 1S2MA 1JXOA 1TPZA 4MQBA 2EWWA 3KJGA 5LD2B 2A2ZA 2Q9AA 1TQ4A 3LLUA 1PLKA 2RGBA 1U98A 2GBLC 4M21A 4NU0A 2FPKA 2VP6A 1ZCBA 2WMOB 3QXSA 2IEYA 2CE7A 3CF0A 1AN0A 4P4SA 5SZJA 1ZCAA 2G9NA 3U60B 4LPKA 1N6KA 3OEEA 4ARZB 3L8ZA 3TVDA 4B76A 4DLWA 5AUPB 1KZGB 3FE2A 4PC3A 2BWJA 1CJMA 2V55B 2YWEA 3MWKA 4Z1MD 1H8EA 1DPFA 2FFHA 2WMNB 5GJWC 3LW8A 3A4LA 2ZUCA 2LCFA 3KZ1E 2B8TA 1E9CA 4EUNA 5J5CA 2JDIA 4I1UA 2J7PA 5J4KA 2QN6A 4Q01A 5HR5A 1LS1A 3W3ZB 4Q47A 4MKGA 3CX8A 4R7ZA 4DDTA 1Q3TA 4JYBA 4Q4JB 4KYUA 1ZM7A 2V8OA 3RC3A 1F2UB 1N2CE 1Z29A 4JMPA 2XZOA 3IIJA 1KJYA 4LC1A 4EDHA 1JECA 3EAQA 3C15C 4ZDJA 3RYTC 3A1SA 2ZPTX 2VP0A 4JSTA 1IJFA 1J8MF 3VTKA 1W4RA 2ZR7A 4EPVA 4TMVA 2WJGA 3PUVA 4ASUA 1E1RD 1AQYA 2GESA 1KSGA 4B34A 1E32A 2F1HA 2OFOA 1Z6GA 4R2HA 4PO1A 4W9MC 3L2OB 3OIYA 1W7AA 4HAVA 2ANCA 2QT1A 4KU4A 5L3RA 1YU9A 1ZNZA 1EWQA 3EWSA 4PTLA 1KK2A 4YDHB 4PHHA 4RZ3A 2RGCA 2VPPA 4OJKA 3GJ6A 2QORA 4LHXA 3RSLA 2W83A 2NO7A 2CLSA 2JJ2D 1J7KA 5C1BA 4C30A 4II7A 1OXVA 2NZJA 2BBWA 5A4JA 3DZ8A 4F4IA 2AKYA 4ZDIA 3X2SA 4P32A 4IEIA 2XTNA 1R0ZA 2QUZA 3IGFA 1R7RA 1DTSA 4P4TA 2FSIA 2N1BA 1T8TA 5HTKA 4AC9A 5BYJA 4YMSA 4D4KA 3CUEF 2Q3FA 3HU3A 2FGJA 5EP2A 3OIWA 4JLJA 4AKGA 4LZZA 4Q1DA 5J4VA 1KNXA 2R9VA 2P6RA 3I5XA 4BEJA 3QVVA 4OQLA 1I4DD 2QBYB 3B1YA 1EX7A 1Z6TA 4TLAA 3B13B 3B85A 3Q5DA 1KO7A 1G3QA 5EJEA 1M74A 4LJ7A 1XTKA 3VQTA 4LHYA 5B2ZA 5JI3E 5F3WB 2J41A 5KDDA 3VKHA 1NN0A 4Q4AA 4B2LA 1KK3A 4OHXA 5KSPA 3VX4A 1EGAA 2FG5A 3ASYA 4QNMA 2ODEA 4B47A 4P3YA 1TTTA 3KTAA 1E9EA 3Q9LA 3C41J 3W6NA 4TQUS 5DHFA 5JWOA 4B3GA 3ICEA 1PV4A 5DH9A 5DYIA 4L5BA 2F3TA 2VO1A 4N3NA 1YZUA 4XSGA 1FMLA 4K8OA 4G01B 2GDJA 3Q72A 1Z83A 1NG1A 3A37A 1SVMA 3T12A 4C2TA 2CDNA 2QG6A 3IDQA 3QPWA 3QKSB 3SFVA 3AVTA 3KDSE 1WCV1 4ZO4A 4IDQA 4OQXA 2ZRJA 1LTQA 4FMDB 1X8LA 1VCMA 1Z0DA 3LBNA 3AKDA 4F93B 2QGNA 3K70C 1JAIA 2ONJA 3O47A 1EX6A 4BLPA 3SI7A 1P3JA 1W48A 2A78A 3GLGA 5FPTA 3C4JA 5G40A 1A82A 4DJTA 1OB5A 5FTNA 5C4GB 1UBGA 5FOXA 3EX7C 5P21A 3X1WA 2XB4A 4R2IA 1CR4A 2JJ2A 1GKIA 2GXAA 2OO7A 3RRMA 1UKYA 2A5DA 2BKEA 4KCGA 1R0XA 1UEJA 4MUBA 1G6HA 2QT0A 3L0PA 3CWQA 4YC7A 4ZDWA 3IBGA 3OFNA 3ZLJA 5JSZA 1CEEA 1MO4A 3BRWD 4KVGA 1XEWY 2IXGA 4NONA 2OFWA 3LD9A 3NDPA 4TYQA 1U94A 4OHWA 2ZITA 1W4AA 1FL9A 3WMFA 3KJHA 4DWJA 5LBIA 1NJFA 1RRPA 3QEOA 1NRJB 2AXPA 3OE7D 5CYOA 3ZQJA 5HKKA 3RRNA 3W8NA 1HA3A 3ZZUA 2JLRA 4IDNA 4LGMA 2QPOA 2WIAA 2VHJA 3ADKA 3F5FA 2PMDA 4IVQA 4MKHA 3VX3A 2WJHA 1VCNA 3TGPA 4TMTA 4MUAA 4V0OA 1Z2CA 1U8YA 3IHLA 2WZQA 3C5HA 4Q4JA 4HDOB 1MKYA 2H17A 2CJWA 2HUPA 2KBFA 2R44A 2ZS7A 4RKEA 3CO5A 2ZU0C 1BIFA 3RSOA 3GLGE 4LK2A 1SZPA 2IHYA 3TW8B 4A6XA 4B2IA 2PEYA 2W00A 2W2VA 3IILA 4KJZA 1E1RA 1Z08A 2H18A 5JMTA 4XVQA 1GSIA 4NCJA 3BAFA 2CLDX 4Q00A 1S1MA 2FGKA 3WBJA 3K9NA 1P72A 3OEED 4IFEA 5C2JB 1XXHB 2F55A 3NKVA 3T1VA 4B6FA 4MKIA 2WSSA 1UDXA 5CDFE 3IEUA 1E2PA 1LW7A 2CLCX 2RAPA 3PCRB 1ETUA 3R9XA 1L8QA 1KI8A 4EFMA 4MDEA 5K8IA 5HZKA 2ZETA 4GMXA 1X6VA 4RZXA 4OI1A 2ZRHA 4PR0A 4PFSA 3WHKA 1DEKA 3CKLA 2ZQ5A 2JLZA 1S1CA 3K0FA 1P6XA 3GLFB 2QE7A 3WP1B 2CL6X 3QXCA 5C18A 2W0MA 4A92A 2WKQA 3QIAA 4X8OA 1P73A 1KAGA 2QMUA 3VU9A 2O52A 2WJYA 3EXAA 2WJVA 3LAWA 4XD7D 1IQPA 2V6JA 3T1TA 2G88A 2XGJA 1PVOA 1ZM2A 4AIIA 2HYIC 3KUDA 4MRRA 4RZ2A 3QKUA 5E7IA 2IWHA 2KE5A 1VIAA 2RHDA 2O8EB 1HUQA 2G0NA 1TMKA 3HP1A 3OIVA 1XTRA 3B5JA 1TAGA 1XTIA 5B57C 4JLPA 1M7HA 2ZRNA 3EARA 4NPHA 1YHNA 4AK9A 2FZLA 4PHTA 4QBIA 3GP8A 4TTRA 3PG5A 2ORWA 3CPEA 4K81B 4UXHA 4PC6A 2NO9A 4KBGA 1QZXA 4MGIR 3X1YA 1TEVA 1AA9A 3NBFA 1UKZA 3EZ6A 4JVNA 2C9OA 4LV6A 2IWRA 2NPFA 2XZPA 2ZS9A 2KSQA 5FR2A 1KY3A 3EZ2A 3TLXA 1C9KA 4DBLC 2YWFA 4V0KA 1RW4A 1N5KA 3K9HA 3Q5EA 5EXTA 2ANBA 1JPNA 3UMSA 1E94E 4Q19A 4OJQA 3RLFA 1MR3F 1HURA 1ZMXA 2IW3A 4LHWA 3OEHA 1DAEA 2PZEA 4LBVA 4CW7A 3V9PA 2FA9A 1L2TA 4J0QA 4EJSC 2IS4A 2ZJ8A 4HYYA 5D3MB 1OF1A 2BVNA 5KTYA 3UG7A 1Z6YA 1GUAA 1OIVA 3KJEA 4JKYA 4MITA 5HCNA 2GJ8A 4Q1BA 3LXRA 3O8RA 2AKAB 2PCJA 3HWSA 2BMJA 4I1OA 4C0QC 1EFCA 1N25A 2ZEJA 1ZVQA 4G5GA 5FI1B 3BFVA 1E2QA 2ASEA 4GOJA 4V03A 2HV8A 5CIWA 1XJCA 4A82A 2UZIR 1QHSA 5FOWA 2DFNA 3BGWA 3DVLA 4BASA 1NI3A 2HEIA 2X1VA 4A1FA 3VKWA 3CRQA 4GP7A 2KWIA 4DLVA 3NEJA 4AY2A 1KI9A 3AH8A 3FVQA 3JZAA 2QZ4A 1UKEA 1IONA 3NC0C 3Q85A 4BFSA 2PZGA 1UPTA 1P2UA 2HXYA 2ZS8A 3WYAA 1NG9A 2IC5A 3BS4A 1HE8B 4GL2A 1G7SA 1Q1EA 2RGGA 3U3OA 4JLNA 4M1TA 1T3LA 3CW2A 2JASA 4PHGA 1GDDA 2XZLA 4V0MA 2AX4A 2ZJOA 3H84A 1Q44A 4PQFA 3KB2A 1P62B 1DAIA 5KO2A 1J90A 2I1QA 3BH6A 1P2TA 4CT5A 1IJEA 1R8SA 4Z51A 3AGPA 2BBSA 4C0SA 2B7BA 1X1SA 1ZIOA 3AUYA 3G5UA 2RHMA 4XD7A 2FSHA 4LWZA 4H9GA 2NZ8A 1GKUB 2X2EA 2R6FA 2ZTSA 2WKPA 3N2IA 2IYRA 3QBVA 4HAWA 4JT2A 3AVPA 1NLZA 1E3MA 4EPWA 2C99A 1ZINA 3SJCA 3MJHA 3VR6A 1JALA 1HY3A 5FUWA 1M2OB 4A15A 4PC1A 1NY5A 3QF4B 1S8FA 4Q18A 1OFTA 4LJAA 2CL0X 2QROA 2XNSA 2E87A 5FL3A 3QQ5A 1CR1A 3SBEA 1TQ6A 3EIHA 3LBHA 2O0JA 1CR0A 1P7CA 4FCWA 4DC9A 2V3CC 1VDZA 2BJWA 2C2HA 2F1JA 1QG2A 2QSZA 4W7SA 4L4UA 1NBMA 5HCIA 4YMWA 4B6EA 1RE0A 2NQ2C 4HUQB 2NTYC 1U99A 2HCBA 4LJYA 2O8FB 1DOAA 1Z0AA 1N6RA 2WTUA 3K0FB 2VA8A 2GJKA 4RFVA 2OM2A 2I3BA 3R9WA 1PLLA 3AVOA 1OH6A 2ZI9A 4H1UA 1Y3AA 4A4DA 2CHGA 1EG7A 1CJUC 2XXAA 2W6ID 1HEIA 4OK6A 1E6CA 1E9RA 1Q1BA 5FR1A 1DAKA 2GJ9A 3RS5A 1C4OA 3L43A 4LV5B 2PL3A 3DEFA 4UXJA 4BFVA 4DDVA 4NYJQ 2D4HA 2WPDA 4ABYA 1XBTA 4ERNA 3OFND 4LBWA 1M8PA 1JEDA 2IYVA 3HPRA 1W1WA 3WHLA 2BDTA 2JLVA 2GEUA 2VP5A 2IYUA 5FL7A 3CNNA 2H5EA 3MUFA 4KSBA 4DSNA 3CNOA 4TMZA 3TUZC 1LF5A 4HLCA 1GL9B 2YYZA 2YWHA 3L0SA 1KJWA 3I8SA 1XTQA 2YOGA 1MRNA 1KIMA 1GKYA 2IS1A 2REBA 3K9GA 4TT3D 3KQLA 5EZ5A 4C7OB 1SULA 1W47A 3K09A 221PA 3ECCA 2BHRA 5F9FA 3K0AB 3BH0A 4RVCA 1P75A 4B3DA 2LKDA 2QEQA 1FOEB 4NCNA 3REGA 4W5WA 3NIBA 4M9QA 4XWKA 2R6DA 4ON9A 1A4RA 2XSZA 4HLUA 2JIZA 4IRUB 4NYIR 1HYQA 2WSSD 2FPLA 4UJ5A 5HE8A 3AB3A 1Y63A 2J7PD 2D74A 5AUQA 4A6PA 3MD0A 1GZSA 1ZP6A 2DFLA 1ONBA 5H68A 2OXCA 4HB4A 2ZRIA 1O87A 2G77B 2ZI4A 2VLIA 5HKKD 2CE2X 3AVYA 4HAUA 4BWYA 2WBLC 1Z47A 1T6NA 3AEZA 4RD0A 3KKMA 2ZUDA 5FOVA 2VBCA 3ND8A 1A5TA 3ZH9B 3ADCA 1E2IA 3AF4A 3AM1A 1AZSC 4ZIRA 4CEHB 2IYTA 1SVLA 1QDEA 5BW8A 4PAOA 2BKUA 2A5GA 3GFOA 4OQFA 1R5OA 4G1UC 3OIUA 3THYA 3EG5A 4XJXA 3U7EB 2MSDB 4GI7A 4N1AA 3AVUA 1DVRA 1Z6XA 2OZEA 2QTHA 3LRPA 1RRGA 4XTCS 4C0JA 3UKDA 3PEWA 4LV8B 1G20E 3MGCA 3ZVMA 2QAGC 2F1IA 2IYQA 4MDFA 1G16A 1G7RA 1KOFA 1AZTA 1E2GA 4FMCB 2RCNA 4NZYA 2GXUA 5TY0A 2V1UA 3UMFA 3ADBA 4UNPA 5JWHA 4TWZA 1I4LD 2EQBA 2J3EA 2IUUA 2OCPA 2ODWA 3AVQA 3FHCB 4XOIA 4DHEA 2WIBA 2AWOA 4F7WA 3UIEA 4URWR 1YZQA 4Q21A 1G17A 2RGAA 4G5QA 2JEOA 4DUGD 4EPXA 2F43B 4XH9B 4GDFA 5JI2E 5L3QA 4DCNA 2MMGA 4BLRA 1LVGA 1Q20A 2AK3A 3SZRA 4XVRA 1ODFA 2AL7A 3I32A 3BC1A 4XSHA 4W5HA 2FNAA 1SKYB 1ZAKA 3CR7A 4EKDA 3B8HA 5AK0A 5DISB 3LLMA 2OXRA 1NJGA 3GLHA 1CJTC 3CX6A 3H4MA 2RGXA 3AF1A 1X8JA 3B1VA 4G5SA 1MO6A 4HB2A 1EESA 4QHYA 5KHOC 5ELXA 2ZJYA 1W44A 2LWIA 3TR0A 4AD8A 5BXQC 4Z54A 1QVRA 1G291 3D8BA 1Z0IA 3QF4A 2X8AA 1KI3A 1FW6A 4ARZA 2FU5C 4LYFA 1X8KA 2DR3A 4BPBA 2JDID 4KYIB 4YLGA 1JAHA 1ZNYA 3NTUA 3SHWA 3E2IA 4Y0AA 4EFNA 4OBEA 4TLCA 1XD2A 1XEFA 1NMYA 2XITA 4D4MA 2BBTA 3X1ZA 1LV7A 2R6GA 2ZRDA 3GEHA 2O8FA 1XCMA 4FCVA 3W5IA 2D62A 2HDNB 4HAXA 1WQ1R 4RD6A 4DSUA 1VYTA 1J70A 4B71A 1AKEA 3QVUA 5EE9A 3UWKA 2VP2A 1TNDA 1QG4A 4GSYA 2C03A 1YRBA 2V7QD 4E07A 1IN4A 2ORVA 1KDPA 1WP9A 3FKSD 2W0SA 1QHNA 4JZKA 4MGZR 2CXXA 2PX3A 4B43A 4BLSA 1U9IA 2QL6A 4HDQB 1GTVA 3O8DA 3U4QA 4IFBA 4CRWB 4LJ4A 3ZQ6A 3IEVA 5G3YA 1E0AA 2C78A 4EAQA 1FP7A 1QHIA 1DE0A 1VHLA 2Y8EA 3TQCA 4UJ3A 2YOFA 5JCZA 4FD2A 4M1MA 1KTVA 3HYRA 3TNFA 2Q21A 1Z0FA 2EVWX 5H8WA 2QGZA 3DOEA 4M8NE 2X19A 1D2MA 3OZXA 4RSGA 5HPYB 4WXRA 1WXQA 3KKQA 3C5CA 1JXMA 4ZPXA 3DO6A 4GFDA 2GVDC 4JBXA 3OAAD 4CEHA 2Z6VA 3IPYA 1NIJA 1W4CA 2QTVB 2YJTD 2IF0A 1P5ZB 2JCSA 4FXPA 1IY2A 3I1FA 4RY2A 3QG5A 4Q1FA 1Q1ZA 2VH5R 2ZSDA 3L82B 3MWLA 1NLYA 1NMZA 4HZUB 3VU9B 5KNBA 1QRAA 1YQTA 3GJ5A 3ZZ0A 1OIXA 4TMXA 4JJKA 4D80A 1SGWA 4HAZA 4I1VA 2IT1A 3S1AB 2I1VB 2IBMA 1HQCA 4LCBA 3SBDA 3QPVA 3WNCA 3IO3A 1COWD 4IOKA 3RS7A 1CXZA 1F60A 4MGYR 1T0HB 3UG6A 4PPGA 4KFUA 2GHIA 1SXJC 2HLDA 1OJLA 2PLFA 2XJ9A 2ZRLA 3VHLB 1CBUA 1II8A 3QXHA 4D25A 1AQUA 1NN3A 1A2BA 4A2WA 1ZU4A 2A3RA 3EA0A 4QGAA 3MWYW 4XWOA 1W0KA 3NBZC 3OE7A 2PT7A 3A1WA 4NYJR 2CK3D 2EU8A 4F4JA 4K46A 3CF2A 4I81A 3GJXC 4DSTA 1AJEA 3LVQE 3CONA 4CEIB 4C0BA 1QHXA 1UEIA 2HF9A 4BLQA 4RZUA 3IIKA 2QU8A 3WMEA 3VAAA 3ZIAD 4BFZA 1U8ZA 3BORA 3U44B 2GVZC 2L0XA 4KFTA 4WVFA 2R6CA 3B9QA 1A2KC 1W49A 3AP1A 4TLEA 3ZS8A 3ZVLA 4CEIA 3NDBB 2WJIA 2AN9A 121PA 1DG1G 5FPYA 2P0EA 4JLDA 3WRXC 3TE6A 3AKCA 1S96A 4A8JB 2DWQA 1UM8A 3V00A 4FCTA 3RRZA 4EPRA 1XF9A 2GBLA 3TW4A 3MJRA 1AGPA 3FMIA 4QJ4A 1MH1A 5JBQA 2J0VA 4G3XA 1E96A 1ESNA 3KKPA 3CRVA 5M04A 1HTWA 2ZRMA 4TZ0A 1ZUNB 3T61A 1J8YF 4MA4A 1G8YA 3LH5A 3TR5A 3VKGA 4DDUA 1R0WA 3L8YA 3TUJC 4QM6A 2OBMA 2VSFA 3B60A 3FKSA 1IXZA 1ZNWA 2V1XA 3OHMA 4FIDA 1UKVY 1VG0B 1U9IC 4OI4A 1S9HA 4JL8A 5ANRB 2WKRA 4AI6A 2QMEA 4D4LA 4PAMA 2ZJ5A 5EE5B 2GAAA 4OQNA 2O5VA 2IYZA 4M53A 4FW9A 4N0EA 4RD1A 4F91B 5LDDC 2OBNA 5JJIA 4FMCF 2ZRKA 3PUYA 2DWPA 5J4LA 1RJ9B 2ZR9A 4B32A 1XP8A 3PV0A 2YWGA 1XMJA 4A2QA 2VEDA 1LNZA 1BKDR 1M1YE 4X8LA 3PEVA 4AKIA 2FE4A 1VPLA 1CR2A 3SC3A 2ZM5A 1KO8A 2GXQA 1TF2A 3TKLA 3CX7A 3SJZA 1G3IA 1E0JA 2XOKD 1R0YA 2ZRBA 1M34E 1XD2B 1Z3IX 4TTQA 5FBLB 3K0SA 1XNJA 2Q9CA 1ZIPA 3EPKA 2WWHA 1T3SA 4X8HA 1FNNA 2XTZA 3U3MA 4UNQA 5F9HA 1KDOA 3DM5A 1O3YA 5E3HA 5DIFA 2HT1A 1HE1C 1XXHA 3PEUA 1PJRA 3FB4A 4DLZA 4V0NA 1DADA 3KKNA 3TMKA 4US2R 1I2MA 1RFLA 2FV8A 2O0HA 3BB4A 4IVPA 4US1R 4KXFB 5KUTA 4FI3C 3GEEA 4EPYA 4B44A 1LFDB 4ESVA 1OLOA 3FHOA 3IPXA 3U61B 4HLUC 1RKBA 2CJWB 1YKSA 1N0VC 1OE0A 2ZYUX 3W6PA 1WRBA 4WXPA 2QNRA 3AUXA 1K5GA 4CZ2A 2ATXA 2IEZA 5BN4A 1KMQA 1XD9A 3K09C 5F98A 1SHZA 2IYXA 2FJUA 2VQSA 2XTMA 3Q7QA 1ELOA 1G41A 1E2MA 4B73A 4NCHA 4NYMQ 3C7KA 3J81k 1UDWA 1DARA 1ZU5A 4LY6A 3GPLA 1JJVA 1ZM9A 5AR1A 1BYUA 3FOZA 4JSYA 5EQTA 3QE0A 1U81A 3REFA 4PSAA 3I61A 1N5IA 2ORIA 4TYPA 1COWA 5A0FA 1G18A 2IS2A 5FBQB 3ADDA 1N6NA 5CK4A 1W5SA 3R8FA 5BN5A 4LHVA 1SVIA 2ZYWX 1IY0A 1RVDA 5FI0B 4UNSA 1AGRA 1GL6A 2OESA 3SNHA 4YXWD 2QI9C 3SQXA 3LVRE 3RABA 1CLUA 3KTAB 4I1SA 1G3RA 2AXNA 3KKOA 3LA6A 5DN6D 1XEXB 4EPTA 2BIFA 4CF7A 4W5JA 1T5IA 1JR3E 2IS6A 2C9YA 1P60A 1N6OA 3THXB 1WDTA 2Z4SA 4Q7LA 2XJ4A 4IHQA 1B23P 2CBZA 2IXFA 4QJ3A 1KYIA 4JVLA 4MRSA 5CM8B 1YJ5A 2VP4A 4D4JA 3L0IB 5DSZA 1KO4A 2IXEA 5J40A 1DO2A 1XJQA 2JLYA 3SDZA 2ZJAA 1Z06A 3GLHE 1IY1A 4TMWA 2Z43A 2ZVQX 1QVAA 2IYSA 2HYDA 3K70D 3DPUA 1N6PA 4R98A 2YKGA 4DXAA 4CT4B 3JVUA 4Z8YA 3THOA 1Z6AA 1CKEA 3FMFA 4DT1B 4ZI3A 2VTKA 4JIMA 4Q4HA 4QHTA 2GZAA 1SXJA 1MABA 2JLSA 2RKOA 4HDCA 1WF3A 3A1VA 3LQRA 2QTFA 2DHRA 1HT2E 3PUWA 4DEYA 4E03A 1V5WA 4P33A 2F43A 4LUCA 5EUMA 3WYGA 4DCSA 3RWMB 2D06A 4LBZA 2PLRA 4A0FA 4EJSB 2RMKA 4NKRA 4PSKA 3WY9A 4KBFA 1Q1QA 3VR4A 1G7TA 1P4SA 1C1YA 2Q6TA 1GWNA 3IQWA 2Z4RA 3K0CC 5IF9A 4UQOA 1NSTA 5G41A 3T15A 1FP6A 4NP6A 4RCYA 4CYMA 4ESHA 1RRFA 4QNRA 1MOZA 1W2HA 4GOKA 2IYWA 3W34A 1NVVQ 5TARA 4DIEA 1EFRD 5KDLA 2C77A 2GEDA 3BD9A 3CRRA 2VHQA 4LC0A 5JSZB 1MRSA 4PO8A 2BJVA 1YE8A 1D2EA 1UBFA 4WIAA 2R8RA 2EFEB 1WBBA 3EZ9A 1W4BA 3SS8A 421PA 2NMVA 1IOZA 3CNLA 4MRPA 1XMVA 3DMDA 3FGNA 3VNVA 2ZJZA 4B2PA 1NIPA 2F7SA 1XB2A 1DAHA 2YZ2A 3RWOA 3TH5A 1XX6A 1KI7A 1Z22A 1CS4C 1GRRA 3MFYA 1AKYA 2NO6A 1JBKA 2HCJB 3DKPA 1VG8A 3OF5A 1JJ7A 1OXUA 4DUGA 4NDZA 1D5CA 1UBCA 3JVVA 4LJ9A 2GF9A 4B33A 2BM0A 1QHGA 4LYAA 4IKEA 2H92A 2V9PA 3OAAA 2XEXA 3A4NA 1XU4A 3VR3A 1XDBA 3GFTA 2FEMA 2VYFA 3SR0A 3HU2A 4AURA 5JRJA 4UXIA 2ZXUA 2H7VA 3UWOA 1JPJA 1XTSA 2QAGA 2UKDA 4PO9A 3GFPA 4HEJA 1OHHA 3AF0A 1CP2A 1VYVA 2CVHA 2QPTA 4IJMA 5KPJA 1P9NA 1IN8A 2ZI6A 1CULC 1KDTA 3H1TA 3PR1A 2JJ1A 1YR7A 4A0RA 1IXSB 2W6IA 4RD3A 5L8VA 1XFAA 4D26A 1OFUX 1NNEA 1XXHE 3QBTA 2ZSAA 1H8HA 4PPQA 4QRHA 4UKDA 4GP6A 1L4YA 2YNMA 3O8CA 2O8BA 5GJCA 1P2VA 4C7OA 2AK2A 2GXSA 3FMOB 2ZE7A 3IIMA 3IBYA 3AF3A 4B3XA 2F9LA 4AWXA 4QBFA 2ERYA 1UFQA 4L9WA 4I99A 2CMKA 3KL4A 1FPMA 2BCJQ 4NH0A 2C95A 3BBPA 3O8BA 1L4UA 2CVFA 3BB3A 3FKQA 4E5UA 1US8B 4OYHA 4PZLA 1U2RA 4YXWA 3LV8A 4EQ6B 5JEEA 5H70A 1GL7A 4Q4AB 3U7FB 4LI0A 1E9AA 1LB1B 1ZW6A 2OLJA 2AD5A 5KU1A 4Q7MB 2J59A 2ZRGA 5JLJA 8OHMA
chains in the Genus database with same CATH superfamily
4G1FA 5ICCA 1Z2PX 1X1QA 3HU5A 4U7TB 4WJZA 5GGYA 1CWUA 1KSJA 5DRYA 1LJUA 2CFIA 2QRVA 3FTPA 3HP4A 3QKTA 2O2DA 5DYYA 4TTTS 4IZHA 2ZJ4A 2RGRA 3DZDA 2A58A 2OAGA 3S8YA 3H04A 2WZBA 1Z0JA 3H11B 2VS1A 3NTOA 3TTUA 5IH7A 2XT6A 4NEHB 1MVLA 5IBQA 4IEEA 1HOXA 1O94C 2C96A 3H5LA 3EFHA 2POQX 2D3WA 4DNPA 1E3QA 4OMCA 2ASVA 2WKWA 3NOXA 1UM9B 4Q02A 4P1ZA 4ZP1A 3DTNA 3TX6A 2GETA 3PITA 4B84A 3Q9SA 2PRYA 2O1XA 2VDPB 4HDRA 5BQ5A 2VXYA 2IVFA 3GEBA 1ZUWA 3PTLA 4YJFA 3SJAA 2ZTUA 4UBNA 3PHBE 4Y2UA 5HOEA 3DDUA 3LYUA 4KV9A 4YQZA 3GAMA 3S7ZA 5ER6A 1QOQB 5ENZA 3T41A 2AX3A 2YX1A 3BE4A 5TNXA 2CHFA 4DKJA 4JI1B 3HBAA 4R05A 4GPZA 3K2BA 1PLJA 1NLUA 5FO1A 5SYAA 4CFYA 4M7WA 4DMRA 5DKFA 1FFSA 1UXJA 2XDYA 2QL5A 4TWIA 3RHFA 4KE9A 3PI6A 2XMCA 1T4CB 4OMFG 3WBKA 1ZCJA 3FBGA 4MYDA 5CW2A 4KDFA 4INOA 1EDBA 2FMKA 2ZBDA 4ENWA 1FX0A 1PG2A 4NU8X 4S3MA 5DGTA 2G1JA 4UBLA 5KPDA 5KTOA 1AO0A 1KQOA 1ODJA 2VHCA 1DS6A 4BMPB 1DKMA 4ETNA 3RSGA 3FDIA 2BFFA 4LYHA 1U6IA 4B75A 2JFFA 4XX1A 2HF7A 1Y9ZA 4ZMBA 3RG8A 1NATA 1WEKA 4JJ7A 4QOFA 4DA9A 3WO1A 1XTVA 4IDAA 1DKPA 2HLNA 5U4XA 1A9SA 2WVJA 3DUFB 3ZE8A 4C0KA 1CUJA 3LT2A 5BSMA 4YREA 4E33A 5C7OO 4U02A 1QAQA 4G5HA 5TGZA 5F7OA 1XVUA 5F7JA 2OFFA 4KR7A 1T2VA 1J2JA 5D84A 1L4FA 3T5TA 1P29A 1V39A 4JAVC 2WG1A 5ALOA 3U1VA 5K0GA 4M36A 1YF3A 3DE1X 1R4AA 2JIQA 1RCFA 1PFYA 1X14A 2Z8YA 4ZVOA 3EPHA 3DOFA 4HQOA 4BRUA 2Q6VA 2R11A 4JDPA 1QR6A 3HFSA 1QRSA 1P8JA 1NQAO 3OA0A 4IUDS 4F8JA 2OE2A 1P1CA 3C1TA 2LR0A 4I1YA 3PP8A 5DWDA 3W78A 1X1BA 1XEAA 2G07A 4AXBA 5AW5A 4Y2TA 2R8EA 3OQHA 4BZPA 2VJPA 4PNEA 3M9XA 1VIYA 2Z5LA 3ONNA 2H9AA 3CNEA 3O9VA 3I62A 4N7MA 1C14A 2O3JA 2XUZA 4FC6A 3O1HB 1YJCA 3ASUA 5IK2D 1FMJA 2J32A 4TS9A 3EQ6A 4WJLA 4B82A 1W36D 3VZQA 3GEMA 1TJ4A 5L3QB 1KK1A 3M81A 3PNOA 4ZAGA 2A5JA 2QJWA 2VXCA 4KHZA 4XFJA 1D9XA 4DW8A 1B1CA 1CY6A 1N5LA 4JLOA 1E0SA 2GCPA 3BWXA 4IJUA 4PZUA 2PH7A 2NVWA 5HF6A 1O95A 3ETLA 4PLGA 2FX5A 3ZEIA 5J47A 2AT1A 3R8CA 2IRWA 2Z3VA 4KI7A 1XDDA 5DXFA 3WRVA 1OB2A 1V35A 2CJYA 2XD4A 2YY5A 4GE3A 1NVUQ 1GSOA 4I19A 1K1EA 5BWBA 1X7WA 2AOUA 1BH2A 3I3OA 3VU1A 1CS0A 1UINA 4WNCA 3QKIA 5C35A 1NE7A 4QUBA 1WNTA 1GAJA 1Q21A 3E1KA 2BR3A 3BA6A 1P7YA 2OD9A 2WB4A 2B99A 2OUIA 2D8AA 3A8TA 3BA1A 3CBQA 3DO8A 3GJZA 4UASA 4XARA 5ALSA 3WLKX 4DNXA 2CNWA 3LPAA 2PUJA 2CFCA 3LW7A 3RUCA 4BMXA 1N8KA 5TGDA 2NTJA 5KB3A 1ST2A 4XFKA 1E79D 1Y8QB 1ZN8A 2HWYA 2XYQA 3ADOA 3AR9A 2H57A 4L2IA 4YAUA 5I3ZA 4NESA 1M2WA 2GBGA 3EVBA 1G21A 3EOAI 5KJCA 2HSWA 2PLWA 2QMHA 3CM0A 3OTQA 1M1YB 3KBOA 4L16A 4KPFC 4PU0A 3SN6A 2BPOA 2WIGA 4JHLA 4W99A 2XWJI 3BERA 1HV8A 4GKAA 5D2CA 5EJ4A 2E5LB 3QNUA 1DDOA 4B48A 2V7WA 4A26A 1CDDA 5DNYB 3N2GB 3SM9A 4NI5A 1QIEA 2FZVA 3AOEC 3HDGA 4LIPD 4UW9A 2RDMA 4P3KA 2GK4A 4RVFA 1WA5A 4QPPA 2QAGB 4MP6A 4C0HA 2P2CA 3QNWA 3GVIA 3AW9A 3D6AA 3SXPA 3K0CA 4P80A 4QATA 4GBJA 3UN1A 3F7TA 1EWRA 1NV8A 1OZ0A 3MMNA 4ENUA 4WLFA 1JG7A 4ITUA 5U4QA 3QITA 2IW1A 4S24A 3FNGA 2BMAA 3NH6A 1Z63A 3S1AA 3FHTA 1WDKA 5F4BA 5TLSA 1WNFA 1N0HA 2YW2A 4I2VA 1WD7A 3D1JA 1J06A 4RZSA 5LZ5A 3RYFB 3FUCA 3PX3A 1JG6A 1L5WA 1GXSB 5DGCA 2CV1A 2FEAA 2ONZA 3G23A 4I50A 2FZGA 4DEVA 1OROA 3AV0B 1NNSA 2XECA 5CEJA 4BGIA 3TSOA 3FOEC 4RXUA 3D31A 3I1YA 1P9OA 2FUG1 3E70C 3ESDA 3GDFA 3VPGA 5EXXA 1BD4A 1NHGA 3L5KA 4MYHA 4PWYA 4OK3A 3WWZA 4EYSA 5DTEA 5BVGA 3GF4A 3Q3HA 3HPQA 3WL3A 5BNTA 4KQ1A 1NMXA 3DLBA 2WHPA 1EZZA 2REXB 1E2FA 3IEIA 3ABQB 2NXWA 2PL5A 2ZI3A 2X8BA 1R4MA 4Q03A 1AUPA 4D2IA 5C8YB 5BUQA 1OSNA 4Z4EA 4HQFA 4G4GA 4L4RA 4YRAA 3HXKA 3MLEA 5K6RA 3UPTA 4KIJA 5G0VA 3K0HA 4H15A 2HHAA 1FFEA 5B1SA 2JI8A 3P0FA 2OXEA 4M1ZA 3SDSA 3J80A 1EUYA 2FFAA 2W2PA 3PUIA 1R8YA 1PR5A 1W85B 2PSEA 1H2HA 3QVLA 4TLLB 1S3FA 3T34A 1GCGA 3V5NA 1R00A 3HN7A 2Z57A 1E69A 5C5DA 2Z08A 3O8QB 5JNRA 2WOJA 4GR9A 3AHCA 4JS0A 2JB9A 1UBTS 2Y1GA 1MTOA 1PJBA 3DMNA 1I32A 3JQAB 1JG3A 4KSYA 4QYWA 4EO9A 3IKMB 4LJ8A 4WRRA 3ZV5A 3JW8A 2Q0SA 5KZMB 2JD2A 3TZHA 3HDQA 1Y5IA 3OLYA 3QPCA 4E12A 1DB3A 3SQWA 4F96A 2Y1FA 2OFXA 4C06A 4EARA 3FY4A 5IT0A 3IB6A 3IAS1 3GZNA 3EXIB 2N42A 1OW3B 1E0KA 1YMQA 2R86A 4GM4A 3T54A 2YXEA 4WA7A 3K0EA 4A0HA 2GJSA 3ESBA 3JSXA 5JRDS 1IWBB 5IZCA 2ZI7A 1RZUA 3KWFA 3DCIA 1M7BA 2OUKA 4WI1A 1HNZB 1FQWA 2PRSA 5EI5A 5D3QA 3F6BX 3PD7A 2AJCA 4QQ8A 3INRA 3OQOA 5SY4A 3LX5A 1LWNA 2FPGB 4LF4B 1GZ3A 2C1EA 2IGBA 3FCSB 3KT0A 2P9EA 3AHHA 4HWTA 4IQ4A 1JEAA 4K7JA 5KVSA 1A88A 2NUTB 5D8DA 1KDRA 3GDWA 2J0UB 1CNFA 4ZTBA 5B64A 2DUWA 1S2LA 3OU7A 5AIBA 1ZJYA 3X2EA 4TGLA 2JIZD 1TXGA 4MLDA 3BREA 1ZONA 2X5KO 4MYTA 2COKA 4MV5A 3ONWA 3MERA 3PZRA 2ZREA 2I4OA 4Q4DA 5G4KA 2PT6A 4M9XA 1QVWA 1A9YA 1ZMRA 1GNRA 5TT1A 1U2EA 1R2QA 1L1FA 1ADJA 3P7MA 3HKEA 1Q6ZA 1JI0A 3PC6A 5E7MA 3ULKA 2VDOB 4YRNA 3RADC 2PUAA 4PSVA 5AXDA 1NULA 1I01A 4MVXA 2X0FA 4KQHA 3AU8A 4E5VA 1S4QA 4GR4A 4Q3EA 2F3PA 4MX8A 2GI4A 5HP4A 5H83A 5E95A 2AFIE 3AR4A 4JD5A 3TUIC 4E1VA 5KSOA 1I7QB 4MULA 1T5LA 1R5BA 3WRXA 1T2NA 4L8GA 4XGQA 1GAQA 2WF6A 2RGNC 4FC7A 3QSGA 5JIBA 2X2OA 2I99A 1Z7GA 1YHZA 3OLZA 1N7IA 4A5SA 5EJ5A 1XZIA 2YC2C 5DI3A 5AHOA 5INTA 3CCCA 2NUBA 1NL3A 3VBCA 5KDOA 2BEUA 3ASZA 2Z09A 2JGRA 3BSFA 3E7DA 3LXMA 4HO1X 3S2ZA 3ZW7A 1EFLA 3IHKA 1G6OA 2I6XA 3ND9A 1XL1A 3C0KA 1A5AB 5E2BA 1EG2A 2R96A 3I9LA 5KYKA 1NNI1 2ECFA 4LC9A 4D8WA 2O48X 2Z04A 5E8JA 2NSHA 3HL0A 2VCEA 4N0QA 4AY5A 4LNAA 1U28C 3W4IA 3ZE9A 2JLVA 2UVDA 2IHUA 4UDYX 1YS7A 1NJ2A 2VL7A 4BPRA 4EI2A 1VJ5A 3AWDA 3MB8A 3NDRA 4H1HA 4WY2A 1WAMA 3EH1A 5L3VA 1KJNA 4TKMA 1KOGA 1LSSA 4REMA 5JCOC 4QM7A 4G5RA 4B3JA 3G1TA 1OXXK 3DGEC 1EDOA 2Y1DA 1AIPA 2R1TB 2O8VA 4FX5A 5HK8A 4ALJA 2COUA 3H8VA 4RVSA 6ADHA 2NUAA 2F8MA 4MO9A 3AX6A 4D7AA 5I5GA 2XX3A 4OU5A 3G9QA 4M83A 1KDVA 4EP1A 2TECE 5KINB 2XUGA 4FUTA 3RYFA 4EIWA 3GCWA 2ZYVX 3TZQA 1K75A 5K0SA 5JADA 5JAUA 1CUFA 4C76A 3RQSA 4XQEA 5GV7A 2JFWA 2JK0A 2BFDA 2GERA 3BRQA 3ITKA 4G5OA 3ZR4B 3FFAA 2NV0A 4G97A 5KQGA 5AVKA 1POXA 1HE5A 2P5SA 1JFLA 3G0HA 1G7CA 4L6CA 4EYQA 1H9CA 4BQNA 1ZOPA 5I48A 5B30A 5I7HA 1KJZA 3S2IA 1YXMA 2YC4C 3A0UA 1QZTA 3KYJB 2XZTA 3ML1A 3DA8A 2P2GA 3MCAA 1VA4A 2BGRA 3RJMA 2P9QA 3DMTA 5CJ2A 3GFFA 3LUCA 1NXPA 4U00A 4ZYUA 3AERA 2EBFX 2QQ5A 3PFWO 3CN7A 4CKEB 1DFGA 4RH3A 4F3YA 3P9CA 3UAGA 2EYQA 1RCUA 3HDVA 4KSCA 4BJHB 3M4NA 1VFNA 4HVTA 3OQIA 5F77A 4A0QA 2FZWA 3U16A 3EUEA 4KLNA 5JS2A 3ITDA 1YR9A 2IDKA 1UJBA 5CFQA 4EFLA 2IIBA 4JBYA 4AQDA 2QXUA 5AKHA 1LZLA 2RONA 3F6YA 3AF6A 3ND6A 2D2XA 1D8TA 2J1LA 1QFXA 3N2ZB 1U8AA 2I80A 2W4IA 5KVVA 4N5LA 4Y18A 5BNZA 5KTSA 1G2QA 1X87A 3RTCA 2ZBVA 1LPBB 2A84A 3JALA 5CH5A 5JH7B 2GJAA 4O2LA 5EKXA 2SKEA 5ICSA 3VYUB 5I9NA 5EHQA 2CNLA 4TKUB 3MAJA 1E3WA 2VPIA 3LRXA 2OZLB 2FG7C 3DHWC 3TSWA 2QMQA 4BKPA 3RRJA 4F45A 4IM7A 3F49S 2ZU6A 1AK2A 3MINB 4FZ5A 2QD4A 4F4FA 4Z3OA 3VH4A 4HSEA 3WWYA 2PLAA 2WYHA 4B6JA 1ESMA 2OHIA 3KJQA 4MRVA 1BG6A 1SVWA 3F1KA 1E66A 4FYIA 4BQFA 2DEUA 1CG6A 1ZO8A 2PFKA 2J45A 2ZIXA 3TTYA 3MPOA 3RBAA 4HQKA 1WKVA 1DLJA 1FDIA 2GLXA 1HKHA 1QQ7A 2YV4A 4WOPA 1RC8A 1KP3A 3KUCA 3AW8A 1GNPA 2GPJA 3VYVA 1QRUA 2IV3A 5EHXA 1EUCA 1VMKA 4C3UA 3L1HA 5DEOA 1KSHA 1I7NA 2AR7A 4IZOA 5B1IA 2RD2A 3F74A 1MX9A 2OWDA 2M6LA 4QTXA 1MBZA 1LSOA 4XKJA 1KY2A 2HJRA 4H7JA 3P8ZA 3PJGA 5ALPA 1ACMA 4UOEA 1SWWA 2KI5A 3KE9A 3C6QA 4KLAA 2XB6A 3COPA 4PQGA 5M3BA 3RIGA 2WM8A 1V96A 1IDOA 1QJCA 2B4TO 4QFDA 3CUYA 1PRYA 3OX3A 3D4LA 3NATA 5E7QA 3REQA 4NECA 1NM5C 3RROA 4GI2A 1XAGA 2ZLBA 3ZGXA 4ATNA 3COJA 1R9MA 3DHYA 2O4UX 1E6KA 3MWDB 3U5ZB 2ATIA 1Y8RA 2JHAA 2UVQA 4N0PA 4OH7A 1NE2A 4BFXA 3VU0A 4R9SA 3O4FA 3PR3A 1TZMA 1QO0A 2P6NA 3G0GA 3QWIA 4J7UA 2N0SA 5BT9A 3G13A 3IR6A 3RS3A 1KH3A 1U5AA 3L8CA 1EUZA 2A5YB 3BXEA 1ZUNA 4J94A 2XGMA 4BV9A 2AOVA 2V3VA 3BF7A 5K0NA 4RD4A 3JPYA 1YBMA 4XJVA 4G0PA 1P1IA 5K1ZA 2HH9A 3ZWPA 2UZ4A 4OJNA 5FHRA 4ZTZB 3LYHA 1KI4A 4LE1A 1N9ZA 4L8YA 1SUFA 1I5RA 1A69A 5DYGA 1RPAA 2YW9A 3FHJA 4WCDA 4QYXA 4JEIA 4EJMA 5A3RA 2GD6A 1KH2A 1NW5A 3GEIA 2FLVA 1IFXA 1Q84A 2EDAA 1QC5A 2EFDB 3HO8A 4WN9A 4XTRA 3VRHA 4ONEA 3HJFA 4I9HA 3C2QA 3LIIA 1QPZA 4ZD6A 4CXMA 4NJOA 2IY7A 2NAPA 4YJ3A 3O90A 1D6NA 5J1SB 3U4MA 2X0KA 3KQQA 3RW9A 1FDWA 4CQJA 1U0NA 3CG0A 4CBVA 3ESAA 1WW8A 4JJ8A 4UHHA 2V3WA 4TL6A 1UUFA 3FA2A 1F6BA 1EVZA 4U6SA 3V7NA 5FAXA 1G8SA 1L4NA 1LFAA 2ZKLA 2BM1A 1STOA 1BMDA 2Y71A 3L7CA 1ZX1A 2ZRFA 1L3IA 5CLQA 4DJ5X 4IRMA 3OE1A 1T91A 1IXRC 3EN0A 3TRKA 3IL2A 1B1AA 1LRLA 1TT7A 5I7SA 4QBGB 3L4BA 4BRSA 4DR7B 1KYTA 5ICGA 3IKJA 3ABRB 1ADGA 2B6HA 3GQBB 3MMPA 5JHGB 4PPFA 4XLZA 3RV4A 3U39A 4EQ6A 1KZ6A 5IARA 3ZWXA 2Q3LA 2XUIA 3K8YA 4ZCIA 5IUJC 3OC6A 3N5CA 3LT5A 4HDMA 4XYMA 5CBPB 4WV3A 1WQ3A 4RJIA 3R5JA 5FV4A 2HK8A 1TE2A 2B0JA 1L7AA 3DTTA 3M6AA 1F1BA 4RK7A 5G1NA 2AWNA 4ARSA 2O8EA 4F3TA 1E1QD 1XMQB 3IFSA 4AMYA 3WR5A 3KEGA 1NP7A 1YRQA 4DZZA 4KPYA 4QPCA 4CMBA 2VIIA 5AKXA 3CN9A 4KO8A 5IJZA 3RE1A 3BK2A 2WYVA 3W9BA 5D3ZA 4CKEA 1I4EB 3OZIA 1SK9A 5CAEA 1Z33A 1PG5A 1WLSA 1WSDA 3EWIA 1OZFA 1K66A 3HL4A 3K4QA 4B87A 5A0TA 1FB5A 2OXTA 3KAKA 4B74A 3IKTA 1IAVA 4DRYA 4FB5A 4JYCA 2OAEA 3S99A 3FBTA 1A8IA 3EUWA 2PZFA 1TVMA 2XQGA 3KR1A 1TOAA 4CR6A 5KNCA 3KQHA 3KZKA 3ROGA 4EABA 1N8SA 3BXGA 3D3EA 3GT7A 2HJ9A 2NVOA 5SYNA 2PL1A 1R4MB 1KSFX 2Q29A 3K94A 2PCLA 1E64A 4KXQA 4BO2A 2AZ4A 7REQA 3PSAA 3PQCA 3S70A 1YQDA 2CXTA 4KMSA 4NABA 4QWMA 2I9PA 2VNIA 4J4BA 4X61A 2FF7A 4A36A 4M1OA 4MUFA 4QC2A 4NICA 1W59A 2UZ1B 3DPIA 4JA0A 3CZCA 3INYA 3UAVA 2BFNA 3HN2A 1U5BA 2V74B 3LBIA 3ZBTA 1Y8ZA 3FVTA 2W6QA 3OKPA 3QW4B 1B6SA 4JLBA 1P44A 4F12A 1WPQA 5BWNA 4ZV9A 1YGPA 2GDZA 1E1CA 4JYAB 5F2EA 5DM4A 4M89A 1RBYA 3V34A 4KQFA 2PR7A 1RYHA 5D1NA 4C7JA 2CZGA 4ZKEA 3IMGA 1MO3A 2XCTB 4HDNA 4QXQA 1ZIXA 1OA0A 3M4YA 5HKOA 1JW9B 5MGNA 3FGPA 4BQRA 3HC7A 2ZROA 3ISTA 4TRMA 3DL7A 3FLBA 1QLWA 3WYEA 1UDBA 4O33A 3SZMA 5AKLA 3E1GA 3L0ZA 3R3VA 4KQ9A 2ERXA 4DCCA 3C5EA 3EGWA 1I3MA 1W88B 1HL3A 3I2GA 4FDTA 3K3PA 3JAWB 2D6FA 3B1XA 3T5GA 5FJJA 2UUCB 4DOMA 2QN7A 1RWPA 1R37A 2EBWA 3I6MA 3FSGA 3A3OA 1A7AA 4LSWA 3IX7A 1GR0A 1RWWA 2VYQA 2YXBA 1RJDA 1PNOA 1BHSA 4CHTA 3P20A 1A1VA 5GVRA 4N7JA 2HRZA 2J0UA 2OXFA 4ND5A 4Q4HB 2MOKA 3ZHBA 3IALA 1W4ZA 3DHVA 4E2YA 5C53B 3PLAE 2IZ6A 3IO5A 3KPUA 3VFDA 3INTA 4Q1AA 3ZWNA 3MFQA 3S7TA 1NC3A 3TL6A 2SHKA 3E0QA 4FZJA 4V0ME 2G82A 3AEKB 4DQUA 5LP1A 3RANA 1XZPA 1GM5A 4D3XA 3BDAA 3VNSA 2HPHA 2ZJBA 2OD2A 4YACA 1KAOA 4A0GA 2F17A 3EAFA 3WE7A 4YI3A 1AN9A 3H9QA 1HH4A 4ZYZA 3H2BA 4FOLA 1F17A 4Z0HO 1ZQ9A 3DWIA 2VDWB 3CZQA 4BL5A 1C0LA 5A3QA 3FNHA 3HP7A 3ZJUA 4U7FA 2P5YA 3OJLA 5FOUA 1GNQA 1VG1A 1YQGA 3U7GA 4RAOA 1Z28A 3I2HA 2FJ0A 3NEYA 1XZJA 4AJIA 1CZRA 2G6BA 2MINB 3EPJA 1YC2A 2AOXA 4XXHA 3BRSA 3FVWA 4C4PA 3VPHA 2FXVA 1FTSA 1E7MA 1PS0A 1X38A 3EQ9A 4J0CA 4YVFA 4FYXA 1IM2A 2WOOA 1E2KA 4UTNA 1BDBA 4EHKA 1S02A 3OJ0A 1XU9A 4ZVLA 4F2PA 1NF3A 4RPIA 4WFKA 1OU4A 3R3YA 5DEIA 3MSXA 2NU9A 1CERA 1ZXLA 4AUMA 3KQYA 2QMOA 3W1VA 3RVBA 4OCZA 2B35A 5KWEA 4C07A 4YPFA 1Z5WA 5BYKA 1JEEA 3RVJA 3CB2A 1E2HA 4Q3CA 4Q4LA 2G83A 5A05A 1C9DB 3V55A 5ALEA 2AZDA 2PRKA 3C1OA 4RKQA 3ERCA 3HCFA 4DMMA 1JV2B 3A9UA 4MHSA 2CHVA 4E94A 2R6JA 2RGEA 4QREA 4DV7B 3HRIA 5EWMB 5KNCD 1Z5ZA 2Z4TA 3IQZA 1DG9A 1PZNA 3B6JA 5EMHA 3UV6A 3DCNA 2W8ZA 4GZMA 2YZKA 5L95A 3GCGA 3HUEA 4Q3DA 1XTJA 5HFJA 2RE8A 2NU8B 1VSVA 4YCNA 1PQ4A 1B7GO 4CMIA 1EJ6A 3BRCA 1ULAA 3EVFA 3K73O 5DF1A 3WYFA 3AL3A 3C8HA 4DRZA 5KYYB 4DR4B 4ACAA 1XEWX 3MK31 4F5DA 3RI3A 3A31A 5JXWA 2BGIA 1RWOA 4TXJA 2JRLA 2VDLB 4HQ0A 5JDCA 4RE5A 2N75A 2B21A 2JL1A 1ZYUA 2DLNA 3KJIA 1EH5A 3KT3A 3N2NA 1L7BA 4GMDA 4C03A 4IUBS 1SB8A 2HU7A 1QZUA 2JK1A 1H9AA 1L8XA 1SU8A 3LP6A 4JXXA 3GLHB 3VJRA 3F4BA 3HACA 3WIUA 1YR6A 3SFTA 1NBMD 3JYOA 3M49A 1VJ0A 4YJHB 1WZUA 4D0GA 4TV8B 2W6JD 4I9NA 2PS0A 3EBPA 4C2AA 4V02A 2ZWMA 1PVVA 4BVEA 4QYSA 3ED1A 3OE4A 3PJRA 2XKBA 3QF7A 1U3GA 2HXSA 2I4NA 2GSDA 2WTMA 2ZAOA 3PFBA 3RS2A 5JCJD 2D7DA 3AEQA 4TRJA 1ARZA 4QYIB 1IPEA 4DDKA 1LF0A 2AMYA 2F9FA 1HE2A 3FFWA 4WZ6A 2WP8J 1E2JA 2H5IA 3L8GA 4PTZA 1AF4A 2J0SA 2FP4A 4ZZ1A 3H11A 2XXAB 4F5ZA 2ZUBA 4BEBA 1XDSA 2EFYA 4FFBA 1O9HA 4I08A 4C6SA 2NAFA 1NQ5A 2OV8A 2X77A 5DHRA 2VYVD 4PBSA 1OI7A 3GRRA 2JD1A 1EXNA 3PPWA 1J0AA 3N0TA 3ZXSA 2I78A 2WQ6A 1C7ZA 3NCTA 4BBPA 2PANA 2WYUA 1RTKA 3OD1A 5J4YA 1KF0A 4IW3B 3OZGA 3M83A 4JL5A 4E31A 2AFIB 2I4IA 4QXAA 2WICA 1ZLXA 1Z25A 2QTRA 2GHTA 1Z5GA 4OG2A 1DBIA 1UAGA 2A0UA 1J8VA 3EZYA 2H1CA 2BRUC 2ZAIA 3O2NA 4S35A 3RVPA 6AT1A 1OBHA 2ECOA 3E0XA 3H2YA 3IXMA 4LRWA 4D99A 3CYFA 4EMTA 4JLVA 1AXRA 1GAWA 5HM6A 1I9CA 4CDGA 3JAMA 1FFBA 2Z58A 4FT4A 5DV9A 3BG5A 4EMUA 3ANTA 2FRVA 4RTPA 1I94B 3JWHA 1DG3A 2W2NA 4B45A 4PHFA 4BO0A 1OH5A 2QYHA 4BP3A 3D4BA 4WLOA 3FWNA 3PEEA 2L42A 4XEHA 2YHSA 4BLTA 2FEOA 4OYRA 1J8DA 1O96B 1P80A 4BO8A 4F6RA 4JNCA 1OLUA 3IMKA 1SJ9A 1WCYA 3PQDA 3WVNA 3LPNA 5IN4A 4CKXA 1HORA 1J4AA 4KQCA 1UKBA 5LL6P 2HW8A 2WWIA 4PG4A 5HKAA 4LDJA 1JBQA 3R40A 4TXMA 1NXWA 1SB9A 1GRNA 1MIOB 3L7DA 4L72A 5SYMA 2XCRB 1N9GB 2HZ7A 3RASA 2DYKA 1I3LA 1FVFA 3DOOA 1V3UA 3FVRA 3ZX4A 5C1PA 3PT9A 3U4GA 1TO6A 4ARBA 2VSXA 1KZ7B 5I7EA 3KSMA 4PLTA 3V4OA 2Y0CA 3CV3A 3NGLA 2WAYA 5EVJA 4J1SA 1UMDA 1MIOA 2NM0A 3QUBA 4HGQA 4DC1A 1NONA 3RIMA 1ORWA 4W4TA 2O5EA 3LSTA 1M2VB 2ZQYA 5LWHA 5AJVB 3CGWA 2ZIGA 1Y3IA 2Q2QA 4CIVA 2VHYA 4JB8A 5E1BA 5K0JA 3LL4A 1PR9A 4I6GA 5K9ZA 1M66A 4ZOLF 1BX0A 1JEYB 1C3VA 2D2FA 1H2FA 4Z5XA 3HNRA 3UMRA 1EWKA 1V8BA 1II0A 1EZ1A 1GPJA 3BFKA 3I4LA 3I8XA 1U2QA 4L8FA 1C7RA 1AB6A 1YS1X 5J9FA 5CB8A 4URXR 1P91A 2P3SA 1SCNE 3EFOB 3PFIA 1T1SA 2HLDD 4LDAA 1R4NB 1TECE 2FWRA 1FUIA 2ZT7A 4X45A 3F3YA 2CD7A 3NZEA 3EW7A 3B9PA 4R5MA 2PRZA 1E9DA 1D0IA 2H0AA 2PRIA 2Q46A 4G1CA 2JJ8A 3BCHA 2AJBA 3QUCA 4E09A 1KMHB 3KBBA 1N32B 2CDCA 2XR1A 3HCWA 1K3UB 2H9YA 4RF3A 5FTJA 1P2BA 4JWKA 1NA5A 3TSZA 1DI0A 1EUDA 3DW3X 3VC7A 1A9TA 3WRYC 4FN5A 4BAZA 4G8JA 3H97A 1K6MA 2WVGA 2ZJ3A 1UJMA 3I76A 3OZSA 3PDIB 4UHEA 3ZTYA 1I7DA 4ZJPA 1ZNQO 4HB0A 2J0QA 1QKIA 3FOBA 1QNFA 1BFUA 2AI3A 3V4LA 5EESA 4AG5A 1QP4A 2FFQA 1U3UA 3KZCA 4TKZA 4TOIA 2OKCA 3R9IA 2XWSA 4QG7A 4Y2HA 4A8JA 1AUQA 1S3GA 4MB0A 2DFTA 2XDQB 3GN1A 3RVSA 1OXSC 4A8JC 4AJ4A 1BXZA 5DXJA 2IHNA 3SJUA 1WB4A 4Z4FA 1VZ3A 1S89A 3DP9A 5FPHA 5ALDA 2FW9A 4RF4A 3RBVA 4YMLA 1B73A 1AT1A 3GJQA 3HR4A 3KJXA 4WUVA 2A2ZA 5G0UA 2HO4A 2H31A 1PLKA 1Z8NA 1U98A 2RCYA 3FWKA 3OBIA 1PQYA 4X6UA 4EGQA 4GHWA 2CE7A 2IEYA 4TKLA 3TEMA 5AK5A 4RIEA 2GOYA 2II6A 3V8PA 4D8YA 5E0KB 3AR8A 3BWBA 4LPKA 3LOUA 1N6KA 3OEEA 3PNMA 3R3JA 3TVDA 5DASA 2XF8A 3TWOA 3DMPA 4B76A 4HDMB 4OA8A 2XE4A 2V55B 4WNIA 1FDTA 2WMNB 5GJWC 3PJEA 3D7LA 3SX4A 3WK9A 4BMVA 3IHTA 1NUHA 4N5DA 3S81A 5JTUA 3UA4A 2H1VA 3KZ1E 3SM3A 1E9CA 3A2LA 1QO9A 3NVDA 4HGZA 3OM8A 4UCFA 3PGMA 4N54A 1E1MA 4Q4CA 4CIWA 1A2QA 2CUTA 4MKGA 4MVJF 4DXHA 3CX8A 4LTDA 1L7EA 1MU0A 1USIA 2N9UA 2WVHA 4JYBA 3MYYA 5IAEA 1EE1A 3KQWA 4CV0A 3NMUF 4FKZA 2QTAA 2CF6A 5ALGA 5A4IS 3A6DA 2Q8QA 1OBVA 2OHOA 1Z29A 4XYBA 4RENA 3AFMA 3QA9A 1VL6A 1YJBA 3UVEA 4EDHA 4E1AA 4UM9D 1KZYC 3C15C 5JD5A 1QGZA 3I23A 3RYTC 3ELBA 5T3UA 5EYPA 2ZPTX 1DU4A 4O08A 3EXG1 2F2TA 4LXIA 3EIXA 1BFKA 3ROZA 1SUIA 4PIVA 4WFJA 4AZ0B 2HIAA 2WJGA 3VZCA 2RAVA 3VDNB 2GESA 3I9FA 3U4HA 2VNHA 1Z6GA 4R2HA 4TS3A 4E5PA 3CQ9A 3T1TA 3LF2A 3OIYA 1W7AA 4DA4A 2WHYA 2C7VA 2QLFA 4WDQA 1DQRA 1DO8A 5L3RA 1YU9A 1O9GA 3EWSA 1WU8A 1JVNA 4N7RA 2HLPA 1IE3A 2OHGA 5CDGA 5I9LA 3DSRA 1RRMA 5ICMA 2VUHB 3T7AA 3D2AA 4LHXA 2W83A 1WTAA 5AFSA 5FLEX 5KNDD 2CLSA 1J7KA 1T9GS 1K08A 2VLBA 4II7A 3LCRA 1OXVA 5ES4B 1QH1B 2PZ8A 1AKMA 2AKYA 2DVMA 1M8JA 3NU1A 4J1QA 2IXDA 1ESCA 5JATA 1OWLA 2I6UA 3FRJA 4AS1A 4B3RB 1R0ZA 2QUZA 3AXTA 2RK3A 3QLEA 4MPRA 4Y6LA 1DTSA 3CVXA 1QU2A 3PQ7A 3E5RA 2N1BA 1YK1A 3PPVA 3EVZA 5K03A 3FOFC 5DDIP 4I55F 5BSUA 4X1KA 3NP9A 1R6TA 3R7AA 3ZLVA 4D4KA 4ZYXA 1U2SA 2Q3FA 3MMSA 3F96A 1SOVA 4GOLD 4N41A 2R9VA 2X9GA 4BEJA 2QBYB 5SICE 1U3DA 1V5EA 1JDVA 3B85A 3TQOA 2UUAB 3RUPA 2FN8A 4MVCA 4KQ6A 1M74A 2O2EA 4LHEA 2XQIA 1XTKA 3VQTA 1HYHA 4FFWA 4LHYA 2B6NA 1L7PA 5KDDA 2F64A 3INNA 4LCJA 2POCA 2FDRA 2QHXA 5B7NA 4I8IA 4B2LA 2G28A 2EG9A 1L7NA 4QNMA 4B47A 5KYXA 1P19A 1YA4A 1GPAA 3K2QA 2B9EA 3BCUA 5ALJA 1PGQA 4P22A 3W6NA 1N3LA 4D45A 5LQRA 3M3HA 3ICEA 1PV4A 1SBYA 5BYBA 1J9EA 2F3TA 4MVYA 4XSGA 5CXXA 4M60A 3S2GA 4H3VA 4K8OA 1F2VA 1TC2A 2HSDA 3IR7A 4DR3B 4C2TA 3O2JA 3OCJA 1C3XA 3B6ZA 1CFJA 2HWXA 3BTVA 1WCV1 4RV5A 1M5UA 4ZO4A 3PXEA 1RM0A 1LTQA 4BKRA 4R2XA 4W5OA 1E5VA 1P17A 1RLTA 1BCSA 1N2SA 1VCMA 2PSSA 3IP8A 1H2BA 3E8XA 3K70C 2MTBA 3ECAA 2ONJA 3MT8A 1H4TA 1WEHA 4KL8S 3HCCA 2A78A 5GINE 1RAGA 5JMPA 4EB6B 4L3WA 3I2IA 3MCVA 5FA5A 4ZI7A 3L1UA 3ZBQA 4DJTA 1OB5A 5FTNA 1RPJA 4QLBA 1UBGA 3ZHUA 2O19A 4IPTA 1NJ1A 2WD8A 1KVSA 4R2IA 2A8YA 4IV5A 1MGOA 2G4CA 3FIJA 5KOJB 1B8OA 1B2RA 1SC9A 2O23A 2GXAA 4GO1A 3PXDA 4X20A 2A5DA 4IIYA 3R74A 1C9YA 1WZCA 5EPUA 4K1LA 1G6HA 1XNHA 3CUWA 4YC7A 2SECE 3IAEA 4ES6A 1PR0A 4JJ6A 4PZEA 1MO4A 2X9NA 4WBNA 3E6AA 4KVGA 4MP3A 4L51A 4RVGA 4NONA 1RE1A 4MSUA 1CRWG 1Y3DE 3LD9A 3GH1A 4GC9A 1I0ZA 1MC4A 4U3JB 1P0QA 1AKTA 2OENG 3L7NA 3GRYA 3LKZA 2VZ8A 4MRMB 5LBIA 4U7GA 4DWJA 1NRJB 3OE7D 2G0AA 2Y1EA 4MUKA 3SIRA 3VI4B 4F6LA 5AH0A 2Q5HA 4IIJB 3ZQJA 1AGNA 1UQTA 3JYNA 5HKKA 3W8NA 5LQKA 3GNLA 1KEEB 1SBHA 4MNTA 1YH3A 2O8NA 2C58A 2P9HA 4PSUA 3CEJA 1Z0SA 2PMDA 1ID1A 3HCDA 3HLKA 5HEKA 5B37A 2WMDA 4D9HA 5IAOA 4PN7A 4V0OA 3OCYA 3IHLA 2WJZB 4NDAA 5LMUB 2AYZA 3IVMA 3UUFA 3ANSA 2H85A 4MI1A 5CG2A 1SC3A 2H17A 2WD7A 4WFQA 4BTVA 5ESRA 5CBPA 2RIPA 4RMHA 4F71A 1VJ1A 1WXWA 2JH9A 10MHA 2QLLA 3UF0A 3B3QA 2QTWB 4UMVA 3VI3B 2XW6A 4UE2A 5ALVA 3H83A 1MA3A 2W2VA 3GAFA 3W06A 4C4OA 3IIEA 3RYIB 3KU1A 1GSIA 5EJ9A 3OOWA 1YWGO 3R6GA 3BAFA 1OXBB 4BMYA 3GEPA 3TECE 3K9NA 3QX3A 1P72A 5DM1A 2ZBRA 2QVZX 3NKVA 3W2TA 3C5VA 2Z95A 4R0VA 4R7GA 1GV0A 2WSSA 1CQJA 2RAPA 4ZHQF 5KOHB 2R47A 5FUMA 4MPDA 4DM7A 3HCPA 1BHJA 3H3FA 1Y48E 2A88A 5BSWA 1AD2A 1X9GA 4OI1A 4RZXA 4AURA 4FQ5A 4L22A 3R7FA 3UXHA 1IM8A 1N57A 2GCGA 4QYIA 3AUFA 2I7DA 3DE6X 3RT9A 1BXRA 2WSBA 4IGFA 5AI9A 3AB8A 3QIAA 1KAGA 4YP5A 4MKZA 4ZCSA 2WJYA 2HDHA 4DY4A 1N2BA 3PHJA 4NCBA 1FP4A 1YBVA 2G88