2ATXA

Crystal structure of the tc10 gppnhp complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
186
structure length
186
Chain Sequence
SMAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords small GTP binding protein TC10
publication title An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2005-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2atxA00
1MO6A 1HA3A 4NYJQ 1S3SA 4LGMA 3MSXA 3RDPA 2C9CA 3FOZA 1ZNXA 2BMEA 2QN6A 2VF7A 2XX3A 3U4QB 4KVGA 2QP4A 1IY2A 2ZYVX 5J4HA 1TU3A 4IEIA 3V4RA 3MWKA 5H68A 3VHXA 1E9FA 3U4QA 1GRNA 4HSEA 3TH5A 4XOIA 4OQXA 3TVDA 5SZKB 2JJ8A 4LJAA 5TXGA 1NVVQ 1OSNA 3Q9LA 1MRSA 3I72A 2VRWA 2ZPTX 1NMZA 1OFIA 1N6HA 1Z0IA 2J46A 1KK2A 4QHTA 4D4JA 2OFXA 3CRMA 4R2HA 3BC1A 1G5RA 2QRNA 5FTLA 1IONA 5IK2D 1PVOA 4LHVA 3KXLA 3CKLA 4DLWA 3SR0A 2YVUA 3IILA 3QEOA 4WW0A 2W2XA 2PCJA 3IIMA 3ZDQA 1RYHA 1OJLA 2FFBA 3B60A 1OYWA 1U98A 3B1YA 4JVMA 3I8SA 421PA 4AYWA 2QRZA 1G64A 3ZZUA 2XJ4A 1DG1G 2QGZA 3BS4A 5DYIA 3U61B 2VO1A 1K6MA 3GD7A 2ZRKA 1MV5A 1E2FA 2VHJA 2PX0A 3MAAC 1HE8B 2PBRA 2H57A 3AGPA 3EZ7A 4A82A 1KNXA 1WA5A 3OIVA 1LS6A 1JQLB 1UDXA 2F6RA 2GXSA 2ECKA 2PLFA 2ZE5A 1T8UA 4UNSA 3MUFA 1NIPA 5DI3A 4BFTA 1U9IC 2PJZA 1TF2A 3ZS9A 4LC1A 1T5LA 4TSFA 4B3CA 1W4BA 2PLRA 1MT0A 4A36A 4HUTA 1E2JA 3FFBA 3K0SA 2O8CA 3IIJA 1F6BA 1R0YA 1Z0KA 4DCTA 1G4UR 1OFTA 5TDHA 1SKYE 1RRFA 4ESHA 5E7MA 1ZU5A 2ZUCA 1JJ7A 1M1YE 1RRPA 5B57C 4LX0A 5SZHB 4JT2A 1OT3A 3IEVA 1COWD 5CK5A 4LWZA 2Q9CA 3B9PA 2BVNA 4MYUA 3TK1A 4A8JB 2H92A 1Q20A 2WWWA 4D2IA 4M1TA 1EK0A 1E0AA 4M1MA 2RHMA 4Q1FA 4A0GA 5H1YA 4FWTA 2CHVA 4PPFA 5AJWA 4V0ME 4JBXA 4MRRA 3U7GA 2YINC 4YDHB 5JJLA 1EX6A 2EW1A 1D6JA 5JLJA 1BKDR 1IOZA 2PH1A 3TKLA 4DCNA 1Z0DA 1T0JB 1UKVY 4GBMA 5CYOA 2ZI3A 2ZRNA 1PJRA 3L0OA 4PO8A 2WSSA 1E0KA 4DZZA 2QPAA 1XPRA 1GL7A 2ODEA 1X8KA 3TBKA 3WMEA 3GEEA 1AS2A 4GOXA 1V5WA 4M4SA 4ZCIA 1QHSA 1WXQA 2A3RA 2XB4A 2DPXA 4FN5A 5J40A 2CMKA 1GILA 3RS7A 4BZXA 4QGAA 2IXGA 2ZJYA 3C7KA 1D2MA 2N46A 4O3MA 2HJVA 3PEYA 1E94E 2JCSA 1DAEA 3LH5A 4WZAE 4DWJA 4ERNA 1MO5A 4YXWD 3Q8XB 4Q03A 3U7FB 1IAQA 4KV9A 1AKYA 3BFXA 4RFVA 4EFNA 1CR0A 5G53C 2IEYA 1N0VC 1T3HA 2CE2X 2WBLC 4KLZA 1M8PA 1XDBA 5EUQB 3QXSA 2R6DA 1GRQA 5C46F 5ELXA 3A4LA 4AC9A 2GNOA 2B6HA 2GDJA 3PITA 2GXQA 5DGXA 4C7OB 4IRUB 3GMTA 3PEWA 4LJ7A 3Q7QA 4O2LA 4FMBB 4CYMA 3ZZTA 2J45A 3EWAA 3KXKA 3M0EA 5B64A 3THWA 1KOFA 5JSZB 4QGGA 5E4FA 4FIDA 5G40A 2WKPA 3WHKA 1DAKA 4DCVA 2FEOA 1WCV1 2Z4RA 5CLQA 1KMHB 2IYTA 2GCPA 3U2QA 5JSZA 4MDFA 1Q57A 4PC1A 4OJQA 1UEIA 3K09A 1H65A 1A4RA 3NWJA 3C16C 1KMHA 3VTKA 1JECA 4JJKA 4K81B 3TNFA 1HUQA 1XX6A 1KDTA 1ZD8A 3LVQE 2GVZC 4LV6A 2AN9A 3JVUA 3UXMA 4B3XA 4NDZA 2GBLA 4EDHA 4UNNA 1E3MA 5BN5A 4W5JA 4LYFA 2G3YA 1W5TA 3KL4A 3MGCA 4JLAA 4Q9HA 2ZJZA 3VFDA 4QXAA 1YZUA 1MO4A 3AUXA 5EE3A 2W6ID 1EFRD 1HY3A 1TPZA 1TX4B 4S2EA 3BRWD 1DBSA 1N0UA 1P9WA 2FNAA 1Q3HA 3E2IA 2W6JA 3I4LA 3QPWA 4TL6A 2QM7A 5EUMA 2HF8A 1TUEA 4ZDKA 3NKVA 1ESNA 3UWKA 2GK6A 3SDZA 4F4JA 2OEPA 1S96A 1BO6A 5CK4A 3FTQA 2WHXA 2FE4A 3R9XA 1UFQA 2YC2C 3VR5A 2JJ1A 2P3SA 1C1YA 1IN5A 1LB1B 4OQMA 3K70B 4DSTA 1L8QA 3TMKA 1ZM3A 1OLOA 4IDPA 4YONB 2ZRCA 3RRZA 5HZHA 3KJHA 3T1QA 5FPSA 2KJQA 1EWRA 3ZZ0A 5HKKD 1YVDA 2D06A 1G1MA 3UWOA 2H5EA 1P73A 2AK3A 3FDIA 4DCSA 4JT4A 2W83A 3LX8A 4DJTA 4NU0A 2DFTA 4KYUA 5DO9A 1W5SA 4EUNA 3AVTA 4KSCA 3CPJB 2ERXA 2WAXA 2AWOA 3QENA 1EFTA 3RS3A 1G41A 1OIXA 2O8FA 1G5TA 5HZKA 4GDFA 4E07A 1IN8A 1NP6A 4NYJR 1T8TA 1VHTA 3LFUA 5BN4A 2J0SA 1JBKA 4FMDB 3OFND 3B1ZA 1PZNA 1Z0JA 2GK7A 2QAJA 1DO0A 1F48A 3GEHA 1S3GA 4NCKA 2WV9A 3RWMB 1E4YA 2ODWA 1N5JA 2J0UB 3GFOA 1W47A 3P32A 4Q4AB 5JI3E 4LJ8A 4HDCA 4D6PA 3ONWA 3SBEA 4DUGD 2J0UA 4XH9B 4Q4AA 3TUJC 1KNQA 1OH7A 1Z08A 2CVFA 4A8JC 1NVVR 4B33A 2VEDA 3SYKA 3HP1A 4TWZA 3X1YA 721PA 1KI8A 2NGRA 3NTUA 1JB1A 3TAUA 4DBLC 5DISB 3GCGA 4D82A 1VYTA 2YKGA 2BMDA 2RGNC 4QFMA 2V6JA 1ZIOA 2A5JA 1GFIA 3QJYA 4Q7JB 3FGNA 1YR8A 4IDOA 1P2TA 1ZUIA 1JPJA 4MGYR 4PPNA 3GFPA 1RYFA 3BAFA 3KKMA 1XMIA 1KSFX 1CBUA 1XEXB 2D3WA 2GTPA 5D3MB 1IN4A 3W90A 2AXPA 3GJ0A 4LBVA 3RNLA 1XEXA 2AKYA 2ZR9A 2QTVB 5CDFA 5D3MA 4M1KA 1ZUNB 3K9HA 1JAHA 3CNNA 4GOKA 3VR6A 5JHHB 4B2LA 1T3SA 1YJ5A 5KSYA 1T0HB 4KLNA 3CF6R 1ZP6A 2AKAB 2IYZA 4JVLA 5LDDC 2QI9C 5K8UA 1E9EA 4DLUA 1E9RA 1FNNA 3UG6A 3PCRB 1MOZA 2EU8A 4EIWA 4TQAA 1XF9A 5E3HA 4JL8A 3FWYA 1AK2A 2V7QA 4BASA 2H18A 4AK9A 1OKKA 4TL7A 1EX7A 5B30A 2ONJA 2I3BA 4HATA 2J7KA 4GNKA 2BEJA 5TARA 4ACAA 1E2HA 2D74A 5EP2A 5EXSA 5C18A 2FWRA 1XNJA 4WIAA 2ZJBA 1Z2CA 2UKDA 5J4KA 1GNQA 1YR7A 4RD3A 2FH5B 3WY9A 4JLJA 1LF0A 4TLEA 3I73A 1CIPA 1H8HD 1NBME 4DRZA 2WJHA 4UQOA 1IY0A 1UM8A 3PUYA 2RMKA 3AM1A 3RS0A 2XSZD 1NRJB 3KZ1E 3BB1A 3O8BA 1RVDA 1YQTA 4ZCMA 1Z6XA 2E1RA 2VP6A 1VPLA 3AF3A 1RZ3A 3QI2A 1OPXA 1G19A 2GBLC 3LDAA 5CLLA 1XWIA 3REGA 3SU8A 1XEWX 1CJVC 2NIPA 2RAPA 1YR9A 1R10A 2O5VA 3OIUA 3KKPA 4OYHA 2C5LA 1DE0A 3AKYA 4URYR 3U5ZB 3DZ8A 3AVPA 1T91A 3T15A 1ODFA 1Q44A 2ORIA 3TAHA 5TMPA 1ZNZA 4CT4B 2ODBA 5HPYB 3ADCA 2ZVPX 4IFBA 1NKSA 2WIBA 2PT5A 2FMXA 2QENA 2HCBA 2IA5A 1GOTA 5HR5A 4KFUA 2DHRA 4NE2A 3S1AB 4DXAA 1QRAA 2Q21A 3GLIB 3QKRB 4WXRA 5DIFA 1BOFA 3QKUA 4US1R 5FI0B 3S1AA 3IO5A 1KZGB 1G8PA 1XXHE 1P9NA 1S8FA 2ZU0C 3GLIA 3QKRA 3K70C 4Y0VA 3CR7A 2ZETA 2AWNA 3HJNA 2GXAA 2D7DA 3OESA 2OAQ1 4M9QA 4MRSA 2EFEB 2L0XA 2W2VA 2WWIA 4ITRC 4A2QA 4BFWA 1OYYA 1VHLA 3MJRA 5J4YA 4MYHA 4QGFA 4H9GA 4TQUS 1Q22A 5FOTA 4B3GA 4LJYA 4HZUB 2ZS7A 2XEXA 4LY6A 1W2GA 3C5CA 1CR2A 5BYJA 1CJKC 2D2EA 4QL3A 4H1UA 3BJIC 2NQ2C 1X86B 5KYKA 3R8FA 1R5NA 3BB3A 5D3QA 1NSFA 2B21A 4IVRA 4C0HA 4D0NA 2CDNA 4U7DA 2CCGA 4FMCB 1VKJA 4ZI3A 4TT3D 121PA 3AKCA 2OBNA 5KUTA 1W49A 2KSQA 2QTHA 4M9XA 2FZLA 4QHSA 2JLRA 3CRVA 1XBTA 4JIMA 4FCVA 5BWMA 4AG5A 3KKNA 1N6KA 5CDFE 4A92A 4EPYA 1GL6A 2BHRA 2QTFA 2WWGA 2ZSEA 4POAA 4YQFA 1M7GA 1NN0A 1EGAA 3BFVA 3CH5A 1G16A 3EIQA 5KSZA 4OJKA 2QT1A 2NO0A 4LK2A 4LPSA 1CEEA 5JJKA 2ZI5A 1P4SA 1B0UA 2RB4A 1XD2B 3I32A 1Z29A 1JJVA 1ZM7A 5GADl 3EZ6A 4AKIA 3VKGA 4TZ6A 1W0KA 4V0NA 1IM2A 2V1XA 1A2BA 1XD2A 4NHOA 2QP3A 4PHHA 1KIMA 1Z22A 3CR8A 4PAOA 1ZCBA 1Z06A 1KI1A 5AJZA 1A2KC 4ZDJA 3TUZC 3GLHE 3EARA 5LD2C 2C04A 5FL7D 3CZQA 1OHHA 4G5SA 4CEIB 2H7VA 1LW7A 2ZUBA 2IYLD 3CRW1 3WP0A 1OH5A 3HU3A 2BBSA 1XJQA 3DDCA 1SXJB 2R6AA 4MA4A 4CEIA 3HU1A 1CKEA 4LC0A 1JAIA 2A5FA 2VBCA 1SXJA 1K5GA 4KBFA 4Q4LA 4RD1A 5GVRA 4AIIA 2KBFA 1IBRA 1E32A 1U99A 5FR1A 3WP1B 1X1RA 4GZMA 2GXUA 3IHWA 4O0MA 1US8A 4M9ZA 1JR3E 5CYPA 4IW3B 2ZITA 1KTVA 4P4SB 3EG5A 3EIEA 3GJ8A 4HDOB 1ZRHA 2B7CA 3RC8A 1SVKA 4P4SA 5FPYA 2WKRA 2FSGA 3KTAB 2K5UA 1QHIA 2X2EA 1Q3TA 5JCPA 2W2TA 4W5WA 4M9SA 5JMTA 3QXCA 2FZ4A 3KTAA 4QNRA 2C9YA 3MD0A 2XTNA 1MH1A 3OF5A 3BB4A 2AFHE 2JJ2D 5GVSA 5TV2A 2AL7A 3ZQ6A 4JSYA 5CB8A 1NVXQ 4LV5B 1FL9A 2RKOA 4B2PA 4BFZA 3GP8A 4Q9LA 1ZBDA 5AUOB 4Q4JA 1VMAA 4E03A 2A2ZA 2FSFA 4NMMA 1GTVA 2ZJ5A 2VYFA 1X8LA 1KO8A 1P2VA 4ESVA 1F2UA 4A1FA 1XEFA 1Z0FA 3SJZA 1XEWY 3AVWA 5FTJA 3MWJA 2W00A 1G7RA 2G1KA 2RGCA 1ZU4A 4GT1A 4S35A 2IUTA 2VHUA 2W0MA 1SHKA 3NIBA 4QG7A 5FR2A 4DC9A 2OBMA 3DO6A 1S9HA 521PA 1E69A 2FN4A 2VLIA 4OK6A 5FUWA 1T6NA 1RW4A 5DN6A 3ADKA 3X1WA 1XRJA 2X1VA 4B32A 1FMLA 3IPXA 2F55A 2OT3B 2DB3A 2IYQA 1TQDA 3JZAA 4UXIA 3L8ZA 4RCYA 4IVQA 1HTWA 4AY2A 3DOEA 5F9FA 3I61A 3FMIA 1GKUB 3DHWC 5JWRA 1CF4A 2PT7A 3IBYA 5FL7A 4PFSA 3SHWA 5TVKA 2N42A 4KYIB 1P2UA 4JSTA 4MGIR 1S0UA 1P9RA 2C95A 3BERA 3NC0C 4D25A 2V55B 4HB4A 3W6OA 4OI0A 3C8UA 3ZQJA 2YWGA 3ZD7A 4UXHA 3L0SA 1DADA 1N6LA 2J3EA 2XNDD 2GJ9A 4V03A 1XMJA 4MUBA 4RZ2A 2IYVA 1E9SA 4TQ9A 2Q3FA 4P33A 1IN7A 1NKTA 2P5SA 3M4YA 1ZNYA 3U3JA 4JL6A 4TL8A 4ZCLA 1U81A 4A0FA 4I81A 5TB5A 3NH6A 1NJGA 3VNUA 3QUSA 4EQ6B 1W36D 1XP8A 2D7CA 5J4VA 4LJ4A 4IHQA 2FGKA 2RH5A 1S4QA 2C96A 1LF5A 4B74A 1HEIA 5BN3A 2O0KA 2QZ4A 3AVQA 3K8YA 2G0TA 2WWFA 2GCOB 3HYTA 4F7WA 1HV8A 2ZRGA 1KY3A 1P3JA 2NO7A 1KK3A 2CLDX 2GCOA 2JDIA 2PX3A 4NPHA 4Q1BA 2G9NA 2CNWD 1G7CA 2ZI6A 3AVUA 2ORVA 1QHHA 4RY2A 1VCNA 1KKLA 1GRRA 3IHLA 2IL1A 2EFCB 4BRWA 4XD7A 2QNRA 1UEJA 1XCGB 2ZQ5A 4R2IA 5C4GB 2ZJ2A 3RRMA 1M7HA 4B35A 2QQ0A 4BQSA 3VMFA 3KQHA 4LYHA 1II8B 2GAAA 3EC1A 5FPTA 1VIAA 2ZRHA 2ZJ8A 2QPOA 1II8A 3CW2A 3AV0B 1RIFA 5KDOA 1E0JA 2OSBA 1AGPA 4IVPA 5CM8B 2EWWA 3HDTA 2QAGB 2F1RA 4YLGA 4PTLA 2VF8A 4P3YA 2XTZA 2QAGA 3QY0A 1YU9A 2RGAA 3Q5DA 2KI5A 3WYFA 4K8OA 1KK0A 1QHYA 2ZROA 4BLRA 1SXJC 1P72A 1IY1A 3THYA 1AZTA 1N5KA 2V1UA 2DBYA 2VIIA 2CCJA 4YMWA 3ZD6A 1PV4A 4AKHA 1RE0A 3CUEF 2FU5C 4NCNA 4EPXA 4YDSA 4TYNA 5DI3B 2HT1A 5FPKA 1JXOA 1SVSA 1L7VC 2QL6A 2AX4A 2DYKA 2ZRLA 1BMFD 4X8LA 5KO2A 1EG7A 1VG1A 3LD9A 4OI2A 5E95A 3HWSA 2GF0A 5HE8A 2FDCA 3NBXX 2J9RA 1W1WA 4RZ3A 1CLUA 2DFLA 4D4LA 4EAQA 3QNUA 1E2IA 2IYXA 2NG1A 3UATA 3KQKA 4KI0A 3SFVA 2XNDA 3LNCA 4AG6A 3SQXA 1QDEA 2O8CB 3NHBA 4B6FA 4TLBA 2OILA 4BECA 4AKEA 1IN6A 4XVUA 2QMOA 2ZRJA 3BORA 4L15A 2RGBA 5EE9A 4LDJA 2ZI7A 5KPDA 4HAYA 1OB5A 3N70A 4B48A 2BM0A 1TEXA 3P4XA 2ONKA 3FKSD 3ADBA 2R2AA 4PSKA 4BZPA 2JLVA 1E9DA 3K9NA 2FPMA 4G5QA 2NO1A 4Q00A 2VSOA 5KSOA 3AF2A 4NKRA 3Q72A 1NLYA 1E1RD 4UJ3A 1NVWQ 1R5OA 1KJYA 2OESA 5AJYA 3GJ4A 2QMUA 3A37A 3IO3A 2OHFA 1G3UA 1G8HA 3OAAD 4ON9A 3LX5A 1M74A 4OQNA 2JLXA 1UBGA 2WIAA 4PR0A 4B2IA 2VHTA 3B6EA 4A0RA 2QT0A 2EFGA 4BGDA 3W5IA 5JRJA 4OHYA 5F9HA 3UMSA 1AA9A 1RKBA 4Q66C 1QZXA 3L8YA 2JASA 3X1ZA 1WE2A 2IEZA 1SULA 1YZKA 2Z6VA 4B47A 4BFUA 1J7KA 5IT5A 3G5UA 5G41A 1GAJA 1OIVA 1QG2A 1FZQA 2FF7A 2HF9A 1XJ0A 3D7MA 1X6VA 3K53A 5IK2A 2D62A 1Y3AA 3F5FA 3U6KA 5DH9A 2NPIA 2OBLA 2YOGA 4DDUA 4NYMQ 3W8RA 3VR3A 1D9ZA 1H8ED 4UJ5A 3CX8A 2HLDD 3IBGA 1DEKA 4MQBA 3UIEA 5JS7A 2R6GA 5FOWA 4DIDA 4CEHB 3IQWA 2WVJA 4Q9IA 4LV8B 3PG5A 4CEHA 2FFHA 3NEJA 1HE1C 1LTQA 2OFOA 3THWB 2VHQA 1G8FA 1E2KA 4ZV4A 1WMSA 1YR6A 3R7WA 3I92A 3ZVNA 5JFGA 2H17A 1E9CA 4Z8XA 5FTMA 4Q48A 2WOOA 4TYPA 5AUNB 4V0LA 4PANA 5A4JA 3NH9A 8OHMA 2SHKA 2YWEA 4TMZA 4L4UA 1M7BA 1NL3A 2FSHA 1VIYA 4NYIQ 4DLXA 1X1SA 3A4NA 3QXHA 1N6RA 3QXJA 4RZXA 5JWOA 1R0WA 3CB4A 3EA0A 4I1UA 5JRZA 1BYUA 4EPVA 1OXVA 4BE7B 3A1TA 1ETUA 1COWA 2VL7A 4C2TA 1SVMA 2OE2A 4TLAA 4JKYA 5DLQC 1XD9A 3CF2A 4GI7A 1SGWA 4GFDA 2J41A 3OAAA 2F1HA 4Y0AA 3VR4A 1KO1A 4URVR 2MMCA 3BGWA 3IIKA 3KFXA 5F3WB 1GM5A 4OHVA 3UMRA 4NH0A 4E09A 4P31A 2BIFA 1MABB 4DLYA 1F3OA 1KJWA 1LVGA 1Q0UA 4P4UA 3B2EA 4DLZA 4X8OA 3ZIAD 3LQRA 2C8VA 1MABA 2WMOB 3P4YA 3BWDD 5DHAA 2B8WA 5UKDA 3A1UA 3B7GA 1CXZA 1HQCA 1GUAA 2O52A 2QGNA 3D6TB 4P4TA 4WBSA 2QP9X 1S2MA 3L82B 4YC7A 3W8NA 4D81A 3T61A 5L3SB 1L4YA 4Q21A 2YWHA 3L0PA 2PL3A 5L3SA 4L16A 3PXGA 2ZAOA 3WYGA 3UG7A 1U2RA 2HV8A 3KFVA 4YXWA 2DFKB 1Z28A 2Q6TA 1Z3IX 4O2RA 2OCAA 4TN1A 3TW8B 1XPOA 2RGGA 2V4ZA 4XVRA 2GJSA 2O8FB 2B92A 2WTUA 2UVQA 3VKHA 3SZRA 4C0KA 4BRUA 4N0EA 1XTRA 3ETLA 1HT2E 3FMFA 3TSZA 4Q19A 3THOA 2BMJA 1UADA 4NBSA 4PC7A 4LJ6A 2XOKD 5KNCA 2A5GA 2XGJA 1R0ZA 4QM6A 1U94A 1LV7A 3CRRA 2ZJOA 4LJ5A 3GJ7A 2IS1A 1U0HC 2ZS8A 2BWJA 2VQSA 4LSGA 2W58A 2ZSFA 2C9OA 1GKIA 2OXRA 3G0HA 4PSVA 2OM2A 1FMJA 4BFXA 3RABA 4QM7A 2G88A 3WMGA 1G6OA 1ZINA 4NL4H 4JLPA 2H8KA 2IF2A 1P2SA 4F91B 4KFRA 1NN1A 4AKGA 3ASYA 1Q1ZA 2CLSA 3KQLA 1XZPA 4MRPA 3P27A 1GWNA 5DNYB 1RJ9B 2I4IA 4R7ZA 4RFSA 3I5YA 2ZRBA 3SOPA 2ORWA 2OXCA 2VP5A 1TTTA 2R8RA 4I1VA 1RJ9A 3VX4A 2X77A 2CLCX 5DYGA 2P67A 1E2DA 1T5IA 1WRBA 4JVNA 1ZYUA 3BFKA 2FPKA 4G5RA 3T12A 2WICA 1O3YA 3ZVRA 2F3TA 2A5DA 3ZH9B 2W6IA 4OHXA 1EFRA 1GG2A 1YKSA 3NHAA 3C5HA 1AN0A 1DARA 4NCHA 3VR1A 4CVNA 2ZE8A 1DELA 3NDBB 4ZKDA 2OCBA 3ZIAA 1FP7A 1NF3A 3AP1A 4V02A 4UNQA 2WJVA 2WZQA 4ZO4A 4G3XA 4BFYA 4BZQA 4DVGA 1K8RA 1UBFA 2ZSAA 1VCIA 4G1UC 5LB2A 3PENA 3IPYA 2CHQA 5KTYA 2CL7X 4Q18A 3F8TA 1DOAA 1TAGA 4MUAA 4QBHA 4I1OA 1JXMA 5JI2E 2JGNA 1CJTC 1SZPA 4G5GA 4B76A 4C9BA 1I4TD 2F43A 5HKKA 3EZFA 1HQYE 3KXIA 2IYYA 1YZLA 1G7TA 1QVAA 3PUXA 1U90A 2BMFA 4PXAA 4WA7A 4I4LA 3EPJA 4GOJA 5FL3A 5L3RA 2OLJA 1UKEA 4JS0A 4MRNA 4Q9KA 4LI0A 4DSOA 1R4AA 4PC6A 3EPKA 2ZREA 3K09C 3NG1A 1OXSC 3DEFA 3KUDA 3IDQA 4IOKA 4LZZA 4E5UA 3L0IB 2BKEA 3TGPA 2QU8A 3OFNA 3QSYA 4MGZR 1FTSA 2XOKA 1IJFA 1N0WA 4W7SA 1QG4A 3TW4A 1W7AA 1Z83A 4X8HA 4NCJA 4R71A 2ZU6A 3NEYA 2IS4A 2J59A 3REFA 4DUGA 2FSIA 5EP3A 5FUVA 1UJ2A 4IOJA 3EC2A 1DAMA 5CJ2A 4Q1AA 1AJEA 1CP2A 3CONA 3AH8A 5P21A 4KFTA 5JZVA 2BM1A 1NG9A 2O8DB 2NZJA 2CVHA 2WOJA 4XJXA 1KY2A 3HR7A 1TQ2A 2QSZA 2O8DA 5TY0A 1ZM9A 3E70C 2IUSA 5FTKA 4QRHA 5EJEA 1VCMA 1W0JD 3M6AA 3QPVA 3EWSA 3IGFA 4DB4A 3T1VA 3MCAA 4NYMR 4FMDF 3NBYC 4HAWA 2NO6A 2PZGA 1BYIA 4JLNA 4TYYA 4WXPA 2ZR7A 2RGEA 3PIRA 4QBIA 3VQTA 1MRNA 1GIAA 4IEEA 1J90A 2FV8A 1FTNA 2O0HA 1O87A 5FBLB 2X2FA 4PHFA 4YMUA 3SI7A 4HAXA 2RGXA 1CS4C 1AGRA 2DFNA 2R44A 3PEVA 1E6CA 1JI0A 2WPDD 2GF9A 1KJZA 4HAZA 1VCOA 3HYRA 3QQ5A 1E2NA 4QBGB 1NN3A 4C3ZA 4FW9A 3QBTA 1RRCA 1F2TA 3RS4A 4KU4A 5EZ6B 4G0NA 5DE3A 4GSYA 1XJCA 4NYIR 4M0LA 3VU9B 4RD6A 2MSEB 1G8GA 2OG2A 4BLTA 2CHGA 4BWYA 3CRQA 2O8BB 1SQ5A 4US2R 1DAIA 4PHTA 4BLQA 2H1LA 3V4FA 2BCJQ 2J87A 4IJMA 3VU9A 1CRQA 4B75A 4YMVA 2O8BA 1P75A 1XMSA 3OE7D 2YNMA 3H84A 2IYSA 4OK3A 1Q1BA 3DZDA 3WNBA 3E5HA 5L3VA 4FD2A 3B1VA 1H8HA 2J0VA 1IQPA 2HJGA 4CEJB 1CULC 1UF9A 1HH4A 5FOXA 2JLWA 1CR1A 1RC8A 2XSZA 2AHOA 4URXR 2P2LA 3AF1A 4FCWA 3TIFA 2HYIC 4CEJA 4A2WA 1BS1A 1N25A 2QE7D 4L9SA 2XNSA 3RC3A 2BDTA 1Z6TA 3A4MA 3OEED 3C15C 4WZ6A 4U02A 1Z6AA 2MMGA 3WNCA 4I1SA 3CLVA 3GLGB 3W9YA 2IHBA 3AVXA 4HLCA 4XIGS 5JEEA 4TYWA 2FG5A 3HPQA 1NG1A 2GKSA 3GLGA 1OH6A 1AQUA 1V43A 1W48A 2Q9AA 2OCYC 4PAQA 2GRJA 5FTNA 4PQFA 1OXXK 2B7BA 4AYTA 1C4OA 1Z0AA 3TJZA 4Q01A 2BCGY 2QM8A 2VHCA 3IKJA 1VG0B 4JLMA 2YYZA 3OIWA 3AP3A 3RANA 2WMNB 3WNDA 2V54A 5CIQA 1VTKA 1XTQA 2P6NA 2QMEA 1OFUX 2ZRMA 3I3SR 1TU4A 2FPLA 3QKTA 4DLRA 3FHCB 3KJGA 1QF9A 3EZ9A 3C41J 4P0TA 3BIFA 1CJUC 1SKQA 1GZSA 3P20A 4B3DA 1N6PA 3AKEA 4C0BA 1US8B 2HXSA 1AM4D 1D9XA 1DTSA 1JALA 1XZQA 1Z07A 2JAQA 3NVAA 3P26A 2Y8EA 4KCGA 4OBEA 4DEXA 2WWXA 1P6XA 2IS6A 1G6HA 1E1QD 4QBFA 2WPDA 4QC2A 5EP1A 4B44A 3CPEA 2EFHB 3ND8A 2J1LA 3SQWA 4HB0A 2CK3D 4PC2A 4EPTA 1DAFA 3LO5A 4MDEA 2Z43A 2LWIA 3VX3A 3PUVA 5AK0A 2ANBA 4FI3C 1MKYA 1Z47A 1IXZA 1NN5A 3DM5A 4LCBA 3PVSA 5JS8A 3W3ZB 2JIZD 4HLUA 1WBBA 5EE0A 5DSZA 2GZHA 3CWZA 1ZIPA 1FX0B 2F1IA 4DLVA 4UNRA 4A6XA 4K46A 1FX0A 4Q4JB 2HYDA 4ZDIA 4TTPA 4Q5IA 2P6UA 3FVQA 5HCIA 1R8QA 5KNDA 4RKEA 4TT3A 3BD9A 3I1FA 1U9IA 3K0AB 4ASUD 4O25A 1F2UB 1ZMXA 1YZGA 4NONA 5KOYA 4TYQA 5HCNA 5JHGB 3K0AA 3WRYC 1OV4A 2QE7A 3QKSA 4JJZA 2GZDA 1GNRA 3DVLA 2WKQA 4HUQA 1UBEA 3BH0A 4I99A 4KJZA 1MO3A 5EP4A 1II0A 5FPHA 2RHDA 4B3FX 3GLIE 5FBWB 2JLZA 2XXAB 4QJ3A 4DLTA 4HLQB 4AI6A 3L2OB 2CXXA 5EQTA 5C4MA 2AFIE 1Q12A 4RKFA 5HTKA 3NBZC 5J4LA 4AWXA 2XXAA 3RAPR 1N3BA 2A9KA 2F9MA 1Q1QA 4TLDA 2ZRIA 3T5GA 4GPTA 4CF7A 3M1IA 1G8YA 3Q3JB 2F9LA 2CL6X 4FWIB 4H1VA 5KPJA 1J8YF 3LQQA 4IKEA 2ZRPA 3OZXA 1ZJ6A 1XMVA 3G82C 2GEVA 5FBQB 2A7QA 1SKYB 4FMCF 5M04A 2IS2A 4WAUA 2V3CC 2QSYA 3Q5EA 4C0LA 1G291 1VG8A 5JWHA 4DHEA 2X19A 2ZE6A 1PUIA 1BIFA 1XTKA 2WWHA 2QROA 2OCPA 5KSPA 4NTZA 1IXRC 1TQ4A 2AK2A 2IW3A 3AVOA 3QPUA 4PSAA 4Q7MB 5JJIA 1HYQA 1LS1A 4XWOA 1AS0A 1GVNB 2WJGA 4LYAA 2AXNA 3MJHA 4NCIA 5FOVA 2DR3A 1KI7A 2QORA 1F5NA 3MWYW 1TMKA 3QF7A 4V0MA 2BBWA 2PZEA 4C2UA 2ANCA 4LBYA 4ABYA 2LKCA 1EFHA 4JMPA 2CK3A 3WMFA 4M1SA 4JBWA 2PEYA 1EWQA 3B5JA 2EFDB 2XAUA 3A36A 1OB2A 3LBHA 4DDVA 4EFMA 3CPHA 5IHPA 4A2PA 4QGHA 2FEMA 2NZ8A 1Z5ZA 3CZPA 4B3BA 2OLKA 5SZJA 2CBZA 4M8NE 2IWRA 1QHHB 2JJ2A 1KMQA 2GJ8A 3C14C 2W0SA 3GJXC 3AVYA 3LV8A 2RGDA 1E79D 2ERYA 1U8ZA 1G18A 4US0R 3EPHA 1M34E 2C03A 1IHUA 1XB2A 2IC5A 3TSOA 1ZUHA 4YMSA 4A4DA 4KODA 1I4LD 2ZRFA 5K8LA 1KI2A 4B43A 1YZQA 2ZE7A 1R2QA 1SXJE 4MKGA 5SZIA 3A1VA 2EQBA 2XZPA 3RRNA 2A78A 4ARZB 4D26A 3DMDA 2GZAA 2P0EA 5B58C 1VDZA 1WBDA 1GKYA 4LHYA 2NPFA 4ARZA 3A1WA 1YRBA 1AS3A 1J70A 2VA8A 2VP0A 3H2YA 4DT1B 2IBMA 1OH8A 3K0EA 1P61B 1P60A 4PAMA 4UNPA 3THYB 4WZBE 4DT1A 5A0FA 2DCUA 2WSSD 4C0QC 4TMWA 4N0DA 1W2HA 3UK6A 2G83A 1G7SA 2NTYC 1OE0A 5EXPA 2PJRA 1RFLA 4PX9A 4ZIRB 4F92B 4D80A 4JLOA 2GVDC 3ASZA 5K8IA 3AGQA 1RPZA 4B6EA 4XVQA 1E9AA 1R6BX 2E9SA 1CU1A 4ZIRA 3ZVMA 4LOAA 2YZ2A 4W9MC 2OUKA 1E99A 1KI3A 2AD5A 4C4PA 3DOFA 1CJMA 5CJPA 1LNZA 1Z63A 2VTKA 1Z6GA 3A6PC 4JKIA 4DB2A 2QUZA 4L8GA 4PPGA 4WVFA 1KI4A 3EW9A 4HLUC 4Q9JA 1VG9B 3HU2A 3W6NA 3W5JA 1W36B 3LVRE 4BLPA 3ZLJA 1OW3B 2N1BA 1HURA 3RSOA 2IYUA 5KDLA 1A82A 3J81k 1FQKA 5L3QB 5AJXA 4N3NA 2JATA 4M22A 3EIHA 3KUCA 3EX7C 1EXMA 1KDPA 3RS2A 5L3QA 2YV5A 1D8TA 2Q3HA 3TQFA 2HT6A 2CEAA 2ZM5A 3SJAA 3K0CA 2AD1A 2BV3A 4GMXA 2ZSDA 3QBVA 4RD0A 3T35A 3EXAA 5FOUA 4BFVA 1FQJA 2R62A 1ZD1A 3X1DA 4DLSA 2D4HA 2CNWA 2ZS9A 1K5DA 1YRAA 2BBTA 4OHWA 1E79A 4B34A 3LBNA 2G1JA 4F4IA 4M21A 1NLZA 1P7CA 1TUIA 3SN6A 3CO5A 2VP2A 4A0HA 2IX3A 2BC9A 5AR1A 1GSIA 2OV2A 4ILEA 3T1TA 1D2EA 2FFQA 3R9IA 3K9LA 5H8WA 1ESMA 3ZS8A 1DPFA 2QMHA 2WJJA 1UPTA 1KYIA 2IYRA 3PUZA 1JPNA 3GLFB 4PHGA 3WYAA 1NBMD 2AR7A 2BOVA 4A8JA 2IXEA 3GLFA 4AD8A 1QHNA 3QXXA 3X1XA 2Q9BA 821PA 1OIWA 1TF7A 4JYBA 2OAP1 4RD4A 2P6RA 2RGNA 4JLDA 5KDDA 3F0TA 3NC1C 2ZRDA 4OHZA 2W6JD 2ODNA 1NVUQ 2GEUA 3N2EA 1PLKA 2O8EB 1JNYA 4L5BA 3EASA 4PZYA 5A5GA 4Z8YA 4JVSB 3TR5A 2O8EA 3AUYA 3U3OA 4DSUA 1KO5A 2ZI9A 2GHIA 3R7WB 3KKQA 4Q47A 2JJ1D 2DWOA 3KDSE 4U5XA 4C0SA 1BMFA 4NP6A 3TRFA 1G20E 1NLFA 2KBEA 5EZ5A 1E2EA 3K70D 4RZUA 1SVWA 2FX3A 4CRWB 2J0QA 3KB2A 3UKDA 1TEVA 5AUQA 1T4GA 3SJBA 2FJUA 2KB0A 1WB9A 4M53A 4OL0A 5C1BA 3X2SA 3QG1A 4J0QA 4LYJA 4KXFB 1DVRA 3AB3A 1KO7A 2A5YB 3SS8A 4IDHA 2QEQA 3SFZA 3ZYCA 3U3RA 2XB2A 1DO2A 1L4UA 2IHYA 4ZPXA 4IDNA 3FKSA 2XTMA 3QG5A 3CNLA 1A5TA 3ZVLA 3B82A 2LKDA 3VR2A 1KSJA 1NNEA 4Z51A 4C7OA 2ZSBA 3ICEA 4A15A 1AKEA 1E1RA 4V0KA 4L9WA 3BH7A 4CDGA 1KK1A 3BBPA 1JEEA 3T06B 1R8SA 1YHNA 1TQ6A 3MG9A 3KKOA 3D31A 3FHTA 3FPAA 1GL9B 4PC3A 2ZI4A 3T34A 2G0NA 3K0FB 2QAGC 3RHFA 1QHXA 5E7IA 3VHLB 4MKFA 1E2MA 4TTQA 3AQ4A 3K0FA 3LWNA 4M1YA 4GRAA 4M1WA 4F38A 1CR4A 4ZDWA 4CZ2A 1NBMA 3CM0A 5BYKA 5GJBA 4RJLA 4HYYA 4C30A 4RVCA 2REBA 1ZC4A 2UZ3A 5IRCD 2ZRAA 3AEZA 3UMFA 1S1MA 3SEAA 2ATVA 2C77A 4MITA 2ZJAA 1KSGA 1I4DD 2VPPA 1H8EA 2HLDA 4DDWA 1SVLA 1G9XA 3KQNA 3OEHD 1TF5A 1E2QA 1N6IA 2FOLA 2VSFA 1XD8A 3U60B 3NDPA 4QJ5A 1YZTA 3DKPA 4XTRA 5G3YA 2WM9B 4A6PA 3SE0A 4DKXA 4P32A 4LUCA 2CL0X 4PZZA 3O8CA 1W36C 1LY1A 2JLQA 2V7QD 1QVRA 4KBGA 1VYVA 2IWHA 1OKKD 2GJKA 2NO9A 3D8BA 4JLKA 1PUJA 3SBDA 3PR1A 5JCZA 1T3LA 1EFUA 2UZIR 3K0CC 3QIAA 2MSDB 3AF0A 5EE5B 1EFCA 4CW7A 3QEJA 5GJVC 3U3MA 2LCFA 2QY9A 2YC4C 1XXHB 2EYQA 4KSBA 5IDVA 5FBVB 2Q0HA 1P5ZB 2CE7A 2ZVQX 5FI1B 3TVTA 3SJCA 1E9BA 3GLFE 1XXHA 2R6FA 2YWFA 2R9VA 1NMYA 4RFSB 2KE5A 3WXMA 4BEBA 3I5XA 3Q7PA 4Z1MD 4A9AA 4ZI2A 3B78A 3FFAA 2P65A 1J8MF 1JR3D 4GP6A 3RSLA 3O8DA 1DG3A 1S9DA 4Q7KA 1OXTA 1E0SA 3ZGXA 5GJWC 4HAVA 1T9HA 1DAGA 2EWVA 1N5IA 3H1TA 5JECA 5G3ZA 1NY6A 2GILA 1NJFA 4TMXA 3GPLA 2DY1A 3WRXC 3IEUA 3TE6A 4MYCA 1G17A 4MYTA 1GDDA 1NIJA 2WAYA 4HLDA 2ZXUA 3GEIA 1JR6A 4BFSA 4PZLA 1FOEB 5C2JB 3R9WA 4F4CA 1N6NA 3GQBA 4FXPA 1A1VA 4XWKA 4N1AA 2GESA 3GFTA 4BLSA 3MWLA 4TL9A 3MMPA 1UKYA 2TMKA 1L2TA 2V6IA 4LHWA 2F43B 1G3IA 3A58B 1OXUA 4KFSA 4U00A 1FNMA 3GJ3A 3FKQA 1C9KA 3Q85A 2PCLA 4B73A 1XU4A 1W4RA 4JZKA 5LD2B 4M2LA 2H16A 5AJVB 4IFEA 3A1SA 1XTJA 4OI1A 3OEHA 3ECCA 1B23P 4XWAA 4W5HA 1XCMA 2CJWB 1X3SA 2IT1A 2ZUDA 5AUPB 1WF3A 5BXQC 2NMVA 1XCPA 4QHYA 2GETA 1G5PA 3LW7A 2CJWA 3N5CA 4BEJA 2XITA 4PQRA 3RS5A 3TR0A 1KI6B 2YHSA 5J47A 3KJEA 2FFAA 1M2OB 4URWR 4AYXA 3GLHB 1JQJC 3ND9A 1KI6A 5K8TA 1N2CE 4QKQA 2RCNA 2MSCB 4X8MA 3GLHA 2PZFA 1UBCA 3PUWA 4DIEA 2WJIA 3ICQB 5EXXA 1NSTA 3N2IA 1KHTA 2I1VB 3AP2A 4PQYA 2BBOA 4PO9A 2GAOA 1W44A 1G21E 4FINA 2Q3MA 3SYNA 3UPUA 1D5CA 4KITB 3QVVA 4EPRA 1F60A 4V0OA 4ACBA 4QOSA 1FUKA 3TQCA 5CITA 5FH9A 2G77B 4HI0E 4Z1MA 1JR3A 4TZ0A 3WBKA 4GL2A 3SHFA 3ZJYA 6Q21A 2J5XA 1ELOA 1KO4A 3F3YA 2NOAA 3DMNA 2REXB 2YOHA 2Z0MA 3K9GA 1TL7C 1W46A 5FUXA 1II9A 1ZW6A 2DWQA 3GJ6A 1G4AE 3MRSA 4II7A 1XTIA 1QHGA 1ZM2A 3HR8A 4PPQA 4D0LB 2PMDA 4QNMA 3V00A 2R6CA 2C99A 4KHZA 1W0KD 3VAAA 4Q7LA 1XTSA 2KWIA 3RLFA 3W6PA 4IOLA 5GJCA 1WDTA 3KQUA 5JEDA 3CIOA 3LRPA 221PA 2E87A 1ZNWA 2ZTSA 2WJYA 1P62B 1VYUA 4LHZA 1F2TB 2I1QA 2YOFA 1ZM4A 1AIPA 1AQYA 1OHHD 5FBRB 2JLSA 4HAUA 4HEJA 4LJ9A 4XTCS 4IOMA 4E22A 3SC3A 1U8YA 4HB2A 4JLVA 4OI4A 4URUR 2O0JA 2HEIA 2VH5R 1XPUA 1TNDA 3FHOA 4DEYA 2C2HA 4DSNA 2Z4SA 5BW8A 1CTQA 1SXJD 4EJSB 3BE4A 3DPUA 3LLUA 4AURA 4GZLA 4D0GA 4EJSA 3B8HA 4LPKA 1GITA 2VP4A 1DAHA 3K1JA 3R8CA 3VNVA 2WWYA 5ANRB 1DS6A 3BOSA 4HB3A 3LAWA 4UKDA 3H0KA 5CB6A 3EZ2A 4CT5A 2JLUA 4BPBA 1UKZA 3UANA 4JL5A 4DCUA 2BEKA 2G6BA 1IJEA 3PEUA 621PA 1GP2A 5KHOC 2EYUA 3CF0A 4OKSA 1KZ7B 3IUYA 1FW6A 2OZEA 3DKVA 4RD2A 3L43A 5IF9A 1ZCAA 2R65A 4HZUA 3DM9B 1G3MA 1ZAKA 3QVUA 4TMTA 1W4CA 3PV0A 5HE9A 5E7JA 1KI9A 1FUUA 5B2ZA 3FMPB 4IDQA 3RWOA 3VKWA 1KSHA 4HZIA 3BK7A 1NY5A 3E1SA 2QQEA 4XSGA 3FE2A 1KDOA 4G01B 2IYWA 3KB1A 4TMVA 5DI9A 3U44B 1E96A 5LBIA 5EXTA 2C78A 2ZYTX 3NBFA 2PMKA 3OHMA 3CBQA 3CX6A 3B1WA 1Z6YA 3JZMA 1A7JA 3T1OA 3U44A 3FMOB 3QF4B 3SNHA 3TSWA 4C0AC 3PJRA 1Z2AA 2QA5A 2QPTA 4Q1DA 1J2JA 1Q1EA 1KAGA 1Y63A 2IXFA 1XFAA 5LB4A 5JBQA 1R7RA 2XJ9A 3QE0A 3QF4A 1W0JA 3CNOA 1Z8FA 2OO7A 1TADA 4G5OA 4PO1A 4ZKEA 4IXMA 3TUIC 2ASEA 4DDTA 1MR3F 1E4VA 3B1XA 4Q1CA 5F98A 1ZD9A 3MLEA 3DL0A 1BH2A 3EPLA 2C98A 3U6BA 4MRVA 5DN6D 1S1CA 3LA6A 4JBYA 2IF0A 4KAXA 3W34A 5LPNA 5F2EA 4EPWA 2EVWX 4R98A 2F1JA 4WOPA 2V9PA 1KKMA 1VECA 4MKHA 3KX2A 4MGKR 4Q02A 3D3QA 1EESA 2P5TB 3R20A 4BUJA 2VSXA 4RSGA 4LBZA 3B13B 2JEOA 1D2NA 5H70A 4Q1EA 1PLLA 1JEDA 1R5BA 3HPRA 3IQXA 1ZVQA 3LXRA 3W3AA 1FP6A 5KNBA 1I2DA 2X8AA 1U0LA 3B85A 1YZNA 3RVBA 2FA9A 3AF4A 3P1JA 3ADDA 2IUUA 1G3QA 3JVVA 1R0XA 3OE7A 1E2PA 4NZYA 2HDNB 5FOSA 2WSMA 2J7PD 4D4MA 3FB4A 2ZANA 3QKSB 2GJAA 2GWHA 2ZIAA 4TTRA 1QBKC 1U0JA 2BKUA 2QG6A 2V8OA 2Z83A 4HUQB 3EAQA 4R9UC 3BH6A 2REOA 4FCTA 4GP7A 1ANKA 4C0JA 3CH4B 1N6OA 3OEEA 3I62A 3PQCA 1IXSB 1X8JA 2JDID 4XSHA 2B8TA 3EA5A 2OFWA 1J99A 4BLOA 1FFHA 3O8RA 5CM9C 1E98A 3OIYA 1CRPA 4JYCA 3LLMA 3U7EB 4LRWA 4OQFA 2QBYB 4XD7D 2F7SA 2HXYA 1E2GA 4MH0R 2Z5FA 2GA8A 3RRYA 3WHLA 3U3KA 3THXB 5FUYA 2QBYA 5L8VA 2ZYUX 1AZSC 4B71A 2XZOA 4MKIA 2PEZA 4GMDA 1OF1A 3THXA 2HUPA 1W4AA 3SYLA 1KAOA 3BXZA 4IXNA 2JA1A 5BQ5A 3LW8A 4OQLA 1NI3A 2ZYWX 1RRGA 3T5DA 1HT1E 4LHXA 2BJWA 4HDQB 1SVIA 3PFIA 1ZC3A 4KVAA 4Z54A 3U7HB 2GEDA 5KU1A 3H86A 3MFYA 1WP9A 4LBWA 5CIWA 4D4KA 1OFHA 1UDWA 3LXXA 1GNPA 1E1QA 3KJIA 3FYHA 1M6NA 2D2FA 2ATXA 5AWFC 3C4JA 4EJSC 1YE8A 3LY5A 1G3RA 3QOFA 4CIDA 1N5LA 1PLJA 2BJVA 3H4MA 3RYTC 2XZLA 1U8AA 5DHFA 1KDRA 2FGJA 2F3RA 2GCNA 4Q4HB 1I2MA 1WQ1R 1SVOA 3V9PA 3GLGE 5EE1A 1NMXA 4YMTA 4RCZA 3NXSA 4OK5A 4Q4HA 2ZR0A 4TLCA 3AKDA 3B9QA 2JIZA 1SHZA 4TSFD 4CGZA 4TMKA 2YJTD 3CWQA 1LFDB 4QJ4A 3WBJA 1FPMA 2ZAMA 3TLXA 3O47A 3A8TA 4JLBA 3CX7A 2HCJB 5J5CA 2IK8A 2DWPA 2JLYA 4F93B 1E2LA 2J7PA 1Q21A 5FFMA 2VP9A 4KO8A 1ONBA 3LBIA 3I8XA 4ASUA 2A30A 4EQ6A 1UAAA 4M1OA 3GJ5A 4EFLA 2ZEJA 3AVVA 1KGDA 2CCKA 4URZR 4UXJA 4EKDA
chains in the Genus database with same CATH superfamily
2H7CA 1PCXA 2YCBA 3K4PA 5IJ0A 1HA3A 2Q1UA 4L5YA 1S3SA 4LGMA 3S28A 4BFLA 4P3KA 4MVWA 2IIBA 3G2MA 5DK6A 4JB2A 2BMEA 4HNUA 2R1ZA 4WKBA 2H54A 2OGWA 3BGSA 1MIOB 1G2PA 4L5IA 2B1IA 4PF1A 3CZMA 4ALLA 4R7GA 1FYXA 2EX1A 5DTIA 1EINA 1R6AA 2YRFA 3ICOA 5A4DA 3T5BA 4HSEA 1EP3B 3AEYA 3JPWA 1VZ3A 4FBGA 3LHSA 1DBRA 4XYGA 5DHTA 4NFSA 2HRBA 4OSPA 3RCBA 1F8FA 5A9RA 3PRHA 1SPBS 5JAIA 3Q9LA 1MRSA 1OGIA 2IDMA 4DM3A 3I72A 4DMUB 3EXG1 4LX8A 2VRWA 2WU8A 1P0IA 2ZBEA 1W581 3DTTA 3L8CA 4OBBA 4BKRA 3HV0A 6REQA 2YXPX 4TKUB 1PVOA 3P0EA 2I4NA 4DXHA 2XH8A 4YJKA 1C4XA 4JC4A 3RS9A 3TPFA 1DWQA 4RDHA 1EQ2A 3IILA 1PGPA 2ZJFA 4AB1A 4CM4A 1ZH6A 2W2XA 1D6MA 2BFDB 2PCJA 4LQLA 4NK5A 3NKLA 4HWSA 4RGBA 3T99A 4XYLA 1RYHA 1CRWG 1GADO 3CJQA 5DLYA 4YR7A 1U98A 3B1YA 3VR3D 1Q95A 3OY7A 3F8SA 421PA 4ZYWA 4U3JA 1G64A 1V5EA 2WDZA 3ZZUA 1DG1G 3MOGA 5ALYA 1H0SA 3IIEA 4NDAA 2ZCJA 4O4JA 3C3EA 3L1UA 1VRWA 3UJBA 3JQ7B 4Q3KA 1HE8B 3OX1A 2NYUA 2Q5QA 3DL4A 1UXJA 4R01A 1D7AA 1NNUA 2HM7A 3JVIA 2PLFA 5DI3A 5A7FA 2HPVA 2V4UA 3UB4A 1DX4A 1OI3A 3CN7A 4C4RA 5BMVF 4GMFA 4DREA 4P83A 1UDBA 5BWLA 3DYVA 3M34A 1W4BA 1EE9A 1Z13A 2QL7A 4A36A 2WTAA 1Z2EA 4HUTA 1HETA 2RB5A 3MIZA 3ONNA 4JJGA 4M89A 3FFBA 5D51S 3W7VA 1V5FA 4RIFA 2KLHA 2O4UX 1F6BA 2HDWA 4Y9SA 1Z0KA 4TWBA 1YD7A 3UH1A 4V2IA 3A04A 1PGOA 3EVBA 2A33A 3K31A 1J1IA 3WAJA 3H8JA 1BEEA 3F5QA 3PXBA 1M1YE 1NX6A 1JHYA 5B57C 3GT0A 3D54D 4JT2A 1OT3A 1AZLA 4LWZA 4YJ2A 3C39A 4YXFA 3TK1A 1Y9DA 4LGVA 1Q20A 2WWWA 4ZVMA 4LTMA 1EK0A 4M1MA 1TCAA 4J16A 1B76A 3KSDO 3LCVB 4Q1FA 5H1YA 4A0GA 2P2DA 4PPFA 5AJWA 1Z82A 4IQ8A 5AVWA 1SC6A 2FPWA 1ZSYA 1SG9A 1HMYA 3FZNA 3IC5A 4N6GA 1CPYA 4NESA 4QO8A 4X1KA 5C7IO 1T29A 3VBEA 1BKDR 2G71A 1MF7A 4MWGA 3ESAA 4UM9D 3TKLA 1T0JB 2WG2A 4PNZA 4DARA 2BLLA 4GBMA 3FYSA 1J8QA 4MQUA 2XODA 4WXYB 2DWCA 2QR5A 5L53A 2Q0XA 2GASA 1E0KA 3BD7A 5LUAA 3A9RA 1XPRA 1HYGA 2JH8A 2ODEA 3P7MA 4K6KA 3TBKA 4GOXA 1R8XA 4FW8A 1WXQA 2GN0A 2XB4A 3CLUD 2C4WA 3M6LA 4LVOA 1C9EA 2AOUA 2C7VA 1HNXB 3K0BA 1E3QA 1GILA 2I5PO 2YHAA 5DX1A 3HCEA 3N28A 2H2HA 2QLLA 2VPWA 3I9MA 2PGOA 4QGAA 3TIIA 4WUTA 3AR7A 4I4TF 3EPPA 3Q0IA 4M8SA 4EWLA 1E3WA 4X64B 2PV0A 2FX2A 3D4BA 4UHKA 2JCSA 1DAEA 1TVEA 2H06A 5CT9A 5C53B 3UMBA 3AHGA 4ERNA 5JNVA 3CS3A 2B0JA 4YXWD 1JLLA 2I6FA 3M81A 4OHPA 4Q03A 2Z8YM 2MCFA 1BFKA 1IAQA 5TMBA 3BFXA 5G53C 3FPBA 1I33A 3JQGB 4WESA 3TLZA 1QO9A 1M8PA 1XDBA 5EUQB 1GUFA 3OPXA 4AY3A 3OO1A 2B6HA 1QMPA 2OHIA 3AERA 1SXHA 1VGVA 4G1BA 4Y2YA 2EDAA 3QVXA 4LFAB 2F3UA 3PR3A 3KWMA 3PITA 2AI3A 1U9CA 3GMTA 1RLMA 3VKFA 4ZV7A 1DBIA 3ZZTA 1OUMA 1QH0A 1EFPB 3CX3A 5E4FA 3HNOA 2GCEA 2WYVA 1SXQA 5G40A 1B26A 5CTAA 1ZEJA 4V0RA 1DAKA 2FEOA 2I29A 1YIDA 5CLQA 3G8CA 3U2QA 2IYTA 1TRKA 1QOPB 4MDFA 3EY4A 3FZYA 4YRAA 2R7AA 4UCXA 1V35A 1PNOA 4HPWA 3LLSA 1KMHA 3RVMA 4DRXA 2UUPA 4WLFA 1SZCA 4IIVA 4D6YA 3UCXA 3KOUA 4D5EA 4AO6A 3FF4A 1NFFA 3GDGA 4X3PA 5J23A 4HH0A 1UDRA 3E9NA 2QTBA 5AHWA 5DBOA 1Q92A 3TNFA 4R1PA 1M67A 2XUPA 2P2SA 1ZD8A 5I7HA 2JGDB 2B6NA 2UYGA 2ZJ4A 1BXRA 1JV2B 1VZ2A 2ETVA 2QNIA 2R60A 3AG6A 3HLTA 1U5BA 4WADA 3UXMA 1Z5VA 3TLJA 3VSBA 3I23A 3N6XA 4B7AA 5DCWA 2GBLA 4EDHA 1KDZA 4HEA6 5BN5A 3H2BA 1NXSA 3WLQA 4MV1A 1QK4A 2G3YA 2O4CA 3H4TA 2N75A 2ORED 3IAEA 4JLAA 4CTNA 1WUTA 1NQXA 2AXQA 3FOAA 3GGGA 3OFKA 1O9BA 1Y6QA 2VAXA 1LJLA 4HRAA 4QXAA 5E6SA 1HXHA 5EWMB 1BMDA 3WX0A 1ISHA 1MO4A 3AUXA 3I5MA 4ROTA 3ESYA 2OHGA 1TPZA 2P9YA 2XWSA 1EE2A 3EBPA 5AJTA 1TX4B 2WTBA 3BRWD 4EVRA 2FNAA 4JOSA 1FYEA 3PQFA 1KZHA 3L18A 2BZGA 2W6JA 3CZ4A 3QPWA 3ISVA 4KH0A 1KBZA 3A4IA 4V38A 5HNKA 5JD3A 2XXAA 1ESNA 1W0CA 1TEZA 1S01A 3DG9A 3RUIA 3R9XB 4FVTA 4F4JA 1KETA 1S96A 3KS9A 3LIIA 4CCAA 4ENPA 1VLJA 2ZBDA 1QX3A 3OCJA 2H1CA 4M36A 1ODSA 1PJ3A 2DQYA 4JASB 3HVKA 1NX9A 1Y98A 3NHLA 4JROA 4JUFA 3T7EA 4XPZA 1SXGA 1Y80A 3QHPA 5KJ6A 4D46A 1LB1B 1BS9A 3A2MA 2IJGX 4RENA 5BSVA 1X38A 2ZRCA 3RRZA 3T1QA 3PC8A 2XUJA 3UWOA 1G0NA 4CTJA 4MHTA 4JR0A 2MU1A 2VP3A 4X6YA 4DCSA 2W83A 3DE2X 1Z7WA 5DO9A 2NX2A 4G4JA 1PHPA 1Y4AE 2BUCA 3BGIA 1RJEA 4LZLA 4QOJA 2YJ3A 4N01A 1KMNA 2ERXA 1RXIA 2I6SA 5BN4B 1OTYA 1G41A 2O8FA 5AICA 3R9KA 1G5TA 5ALPA 1P1FA 2PWYA 3T7CA 4GDFA 1MC4A 2YMQA 4NYJR 2J0SA 1T8TA 1VHTA 2B2CA 4AJPA 1JBKA 2V96A 4IRXA 5HVNA 1IH8A 1DUIA 1Z0JA 2QAJA 4JWTA 3P0IA 1F48A 3N8HA 5KQPA 2MSLA 4BLWA 2QMYA 4R54A 1GA1A 1N5JA 2VYVD 3GFOA 3R6TA 4P5DA 5DHRA 4LJ8A 1MAAA 1Q0LA 2QQGA 4HDCA 4MR9B 4D6PA 1JKJB 2DHEA 4RK5A 3SBEA 1XO1A 3VZBA 1Y3CE 1MPXA 2J0UA 4OLFA 2QRVA 3TUJC 2NZYA 5A03A 4QUHA 3JVDA 1GQFA 1Z08A 1OH7A 4B79A 3PSAA 2JS7A 1XPUA 4K2AA 4B33A 3O8QA 2DPHA 3NHMA 4MLCA 3HP1A 3X1YA 2AG5A 721PA 1JB1A 2FF5A 2GZ3A 3H9UA 3BMOA 5DISB 1F0PA 1LPNA 4YT2A 4HQLA 2FYTA 3CRZA 2C42A 2C4UA 4XW2A 2O2DA 2V6JA 5JOQA 3FCEA 3TMYA 1H0RA 4ZRMA 3M49A 1WSWA 5IABA 3C5VA 3W9BA 4E5DA 1TCBA 3FGNA 1A7UA 1EBBA 1YR8A 2JFXA 3V8NA 4PPNA 3UNXA 4BVHA 3GFPA 1C3JA 4EL0A 4AM8A 2VHXA 3BAFA 4UMVA 1XMIA 2VDNB 1AK1A 3GFQA 4N5NA 4ZZ0A 1CBUA 1UM9B 1W85A 1XEXB 2FZWA 2GTPA 2W7TA 1IN4A 4L50A 3PJFA 4HQRA 2AXPA 2ZAYA 3GJ0A 5I4CA 2E6KA 3F96A 2AKYA 2G5TA 3PTZA 2EZTA 1R8YA 3WLFA 1L3BA 2IY9A 3NOVA 4ZHSA 1KEEA 3PGVA 1XYYA 5AW4A 5CLFA 1T0HB 1XLTA 3CF6R 3INGA 3MELA 2CMGA 5K8UA 5JMWA 5JZBA 3H13A 5KVQA 1WUHS 2DQZA 2CHEA 1J5XA 1MOZA 3PCRB 4TQAA 1FSPA 4IJ6A 3EAFA 3FWYA 4JL8A 3OZIA 2EP8A 4TL7A 4ZU6X 4RPCA 5G1PA 2ONJA 3B3FA 4PQGA 2J7KA 1HL3A 2AOXA 2RG1A 4GNKA 4KB5A 4ACAA 1E2HA 4X84A 4MQFB 2SKDA 5EXSA 1CK4A 2WJWA 4ODIA 3VU0A 3CE9A 2ODQA 5LLDA 4MTCA 2YNMD 4OPMA 5FJIA 2DTXA 3ETCA 1BJTA 4BO6A 3I73A 2O3JA 3TZKA 5K4GA 4JJFA 2E21A 3OPMA 2O7RA 2PSSA 4MV5A 4ZQFA 1IY0A 1UM8A 2IGBA 2RMKA 3IP3A 3WOHA 1B43A 3T5MA 1NRJB 1A9OA 2IP1A 2W2OA 3ZBUA 4YRIA 3SY8A 4DLPA 1RVDA 4JU9A 4JYMA 3G85A 1G55A 1OX5A 3JD2A 3NASA 2PUHA 4ZCMA 3MHPA 3MS2A 5KYYA 3E7XA 1SD1A 3DV0A 2HU2A 4TUYA 3IO5A 1G19A 5AI5A 3SU8A 3JQAB 3REGA 3FOFC 3GUVA 2OOKA 4EECA 3PDJA 1JJIA 4HDSB 2NIPA 2RAPA 2I03A 2CLOB 1X7XA 3OECA 2YIVX 4DM7A 1HX7A 1IL0A 1R10A 4IJ5A 4O2BF 4PYJA 2DBQA 1VE5A 2CJPA 4EZBA 5EFOA 2G7ZA 1P8AA 2ZTVA 3AOEA 3NAMA 4HGNA 5JC1A 4BCCA 3OWHA 3AVPA 4OH7A 2HXGA 3TAHA 4EO4A 1SBYA 1I6LA 3PDIB 4CT4B 2BAGA 4KUHA 5HPYB 4QYSA 4UU7A 3ADCA 3ETJA 3HJUA 4TS3A 4FYWA 3KUXA 4MWOA 1NKSA 2W6QA 1SCQA 1GTRA 2IIVA 1NP7A 2DPYA 1BXGB 2HCBA 2QTWB 1NLUA 2Q41A 4TWJA 3FUUA 2VK2A 4HXEB 2IA5A 3DHYA 1KZ6A 4N6NA 3H2JA 4EDFA 4AJIA 3SQNA 2PR2A 3HCDA 2DQSA 1YDEA 4NE2A 1U7XA 3FXAA 4BNKA 4YUXA 5JATA 2WSYB 4Q6WA 4FWBA 3FI9A 2XHZA 3QKRB 3GLIB 1GA4A 4X62B 1FB5A 2CJFA 5FI0B 1R3DA 2HWKA 2IHUA 1Q0QA 1TM2A 1XXHE 3CKKA 1ODIA 3GD5A 3A9WA 4QU8A 3JU3A 4RVFA 2R48A 3RBXA 1UP6A 4BQFA 1HTTA 1S2LA 2OQIA 3D2BA 3CR7A 4YRTA 2ZETA 4MWEA 3U16A 1MAHA 1SCBA 3U7RA 2D7DA 1UXOA 2OXEA 4C04A 2L0XA 2HZ7A 1UT6A 2XOXA 3DFZA 3FJOA 5B1HA 5K3OA 4AQ7A 4HBZA 5J4YA 3ZGZA 2BEVB 3ZCVA 5JH7B 4EW3A 4QGFA 3FPGA 3QEBZ 1Q22A 2ZBPA 4B3GA 1M6EX 4LJYA 4LY6A 1UPAA 2XEXA 3DHVA 5ECGC 3DLHA 5U4XA 5AD1A 2AQHA 1T5OA 3I5UA 5ALQA 3HVRA 5C8XA 3BJIC 2R7KA 4WMLA 4M8IA 1BX3A 3MINB 4EHKA 3ZDEA 4P98A 4TVOA 3M9XA 2HH9A 2HDOA 4BNFA 3BZBA 1KFCB 2WG0A 1SQ6A 4CU5A 1L5FA 2I7XA 2ATIA 4FMCB 3D2AA 5TF0A 3R7NA 1VKJA 2FMFA 2BM9A 5KNDD 2R4QA 3AHHA 3QW2A 1T8PA 5B1IA 1L5WA 5LXTF 1DNPA 2OBNA 2F2TA 1V1RB 3UAWA 5BSHA 3ZWNA 2DPLA 3EAGA 3UMMA 4YGXB 1W49A 2KSQA 4B81A 4CMIB 2NXCA 4IGFA 4UMDA 1LRJA 4BNYA 1SOAA 5BWMA 2YJ4A 1N6KA 1E1MA 3AFNA 4PHCA 4UAGA 3VJLA 1IHYA 1UEXC 4A92A 3MBKA 2ZSEA 4YQFA 3R5XA 2GUWA 4QVIA 1O5OA 1DC5A 4JB0A 1M7GA 1UC8A 2DLNA 2J08A 3BFVA 3CH5A 4AJ4A 1G16A 2R8ZA 5KSZA 4Z0PA 3Q3EA 2MSWA 3UHPA 3UGKA 4F4HA 1BAPA 4FEEA 1P4SA 5CB4A 2RB4A 1WIWA 4L3VA 3VBCA 3GA7A 3ABOB 5EYPB 4QGBA 4EI9A 2CLMB 3VKGA 1PT6A 1W0KA 3DEJA 1XTZA 4H4DA 1A2BA 3OPVA 2PLAA 1IIBA 2YN2A 3NNDA 3S5JA 3L4KA 1M34B 1Z06A 2BP7B 2JIRA 3IR6A 2B0CA 4RKYA 3TUZC 1E1DA 1UT8A 1VL8A 1H2AS 2DH6A 3PT5A 3GLHE 3EARA 2C04A 4CEIB 1OHHA 3BRSA 2GEFA 3NM6B 2NWQA 2IPAB 1QTIA 1JGTA 3DDCA 4W9NA 4RTNA 5I7AA 5IJAA 4GPD1 2R6AA 2GF2A 3M6UA 4MK4A 4MA4A 4PAGA 4LC0A 1JAIA 1KP2A 3DMTA 1R9MA 3KOWA 2OA0A 4PIVA 1SXJA 4MIYA 5ESWA 4AIIA 1PR1A 3GGOA 3L4BC 1E32A 4M7OA 5FR1A 3AJAA 1X1RA 2GCIA 2R8PA 1RIIA 2WQ6A 3IHWA 4H3SA 1US8A 2P2ZA 1UK9A 3HXPA 1GGFA 4M9ZA 1A72A 1KTVA 1EZ4A 2FP3A 3EG5A 3EIEA 3GJ8A 3OFJA 2UUAB 3QOWA 1JLSA 5K09A 3RIMA 2B7CA 3IEIA 3JWHA 4PPYA 2YH2A 4QQKA 1OU0A 3P2MA 3HYSA 2PUAA 1QHIA 1RRMA 3TSCA 1Q3TA 5JMTA 2C5AA 2L82A 3AG5A 3EXIA 3KTAA 3Q9NA 4QIHA 4RAQA 4D9MA 4AY4A 1FE8A 3LDHA 2LUOA 3DEAA 3OMXA 4IF6A 4B7XA 5GVSA 1D6NA 3OFSA 1XZEA 4FYVA 2AW5A 4A6EA 5E1DA 2V0GA 1L1QA 1JZSA 3FOCA 3PC4A 2RKOA 4D42A 3H5AA 3WQSB 4BFZA 3HC7A 7ADHA 4Q9LA 1VI6A 3KM0A 3OTHA 1Z9BA 1BS2A 2AR0A 1Y42X 4ED9A 3AWIA 2AJLI 2C3YA 1VMAA 3S40A 1J0XO 4ECEA 1KTIA 3AU9A 4NMMA 3BHIA 1P2VA 3V34A 1F2UA 4A5SA 1WMAA 1Y82A 3OCVA 1Z0FA 1XEWY 3RYHA 3QPAA 2F62A 3Q11A 4HD8A 1GPMA 3SK0A 1OLUA 4DJEC 4ZJPA 2W00A 4GT1A 3TYXA 4YV0A 1TMOA 4OHRA 2FSPA 2MYNA 2XA1A 1T1IA 4GI2A 2JBAA 2WPNA 1SHKA 4GQIA 1T2AA 4QG7A 3BXPA 1EK6A 5G0WA 3DO6A 4KREA 3IYLW 2DH5A 1YB7A 2MOKA 1H1LA 4LNUB 2C57A 1GZ6A 4Y1GA 3RIEA 1T6NA 1WR8A 3MJEA 4BIMA 5DEOA 4EHFA 4ZYLA 3OPYI 3UW1A 3E9QA 3ETHA 3W5BA 1XRJA 4INOA 4X7BA 2FQ1A 4RORA 2SNIE 2F55A 5GINE 2OT3B 4WKOA 3OE4A 4HKTA 1HT0A 5EJFA 3RYFB 4RCYA 3P5BA 5F9FA 3DOEA 1CVLA 3I61A 4WX2B 4EA9A 1RADA 2XUFA 2CB0A 3AIMA 4H3KB 1XTPA 5CP8A 1BFUA 3N8IA 6LDHA 3SHWA 1BE0A 1N2XA 1NE7A 1X14A 3DBIA 2N42A 2ID8A 4MYRA 5KCMA 3R23A 4L95C 1S0UA 2C95A 1P9RA 1KQFA 4XYEA 1AQLA 2ROQA 3NC0C 4HQKA 4D25A 3OZRA 4KR3A 4LVUA 3IE1A 1LDBA 4IUCS 1B73A 2JJMA 4PYNA 1N6LA 3TOSA 3ZV6A 3PKJA 4R3NA 1M73E 3GRZA 2CKMA 3C48A 4B8ZA 1HNWB 4XX1A 1JQAA 2P5SA 4DAOA 4A0FA 3LK7A 5EHQA 4O4HA 3ZNQA 3D5EA 3A32A 3QUSA 1U2PA 5LP1A 1D1SA 1W36D 1K3FA 5BN3B 1XP8A 5CR9A 3RRBA 3H2IA 2RH5A 3DZHA 4A16A 4RKQA 1HEIA 3QH4A 1Y4DE 2O0KA 4HADA 2NUTA 3UJ8A 3K8YA 1LRLA 3TIVA 5KAMA 4RHYA 3C24A 5C37A 4F7WA 2ZRGA 1J00A 5TQVA 4ZK6A 4DQ0A 2GCOA 2FUKA 1N0IA 2PX3A 1XE3A 2QNBA 4NPHA 3MCVA 1NVKA 4DS3A 1G20B 2ZI6A 3HEAA 2GM5A 3AVUA 1LBTA 5DJ5A 2I87A 3HMKA 3IV6A 1GRRA 4OKNA 1HR0B 1F4VA 3HE3A 5IXJA 1AOXA 3KETA 4BRWA 4IS2A 2G08A 1I1HA 1XCGB 4OQQA 5C4GB 3RRMA 1HQKA 1PT5A 2IVFA 2HRCA 4Z5XA 1T9CA 3GBPA 3VMFA 4R5MA 2YVLA 4D8YA 2B35A 3KQHA 1TFUA 4YUAA 5LOVB 1II8B 1L5HB 4HBGA 5FPTA 4TTVA 4QOFA 1W2WB 3NHZA 4JQCA 2GT1A 4OHUA 2QXYA 3RFCA 1X39A 3W8FA 5JVDA 2JFZA 4RPHA 4Q05A 1OZGA 1DIGA 2FWIA 1XZAA 1ZHOA 5I4IA 4LSZA 3AV0B 5BUCA 4OU5A 2CWDA 2HC9A 1E0JA 1QJCA 3OPQA 3MCZA 2VK4A 1TRHA 1E6LA 3VUEA 4UVGA 2DHCA 2QAGB 1E7WA 2F1RA 3LOUA 2BTQA 4PLWA 5DNDA 5CFZA 4REQB 2XTZA 4WK4B 2RGAA 3Q5DA 1SU8A 2PD6A 2D0DA 5CX1A 1A27A 1N36B 2YWXA 3D4NA 1K5PA 3RK1A 2YV3A 5BV2P 2QD1A 3ZXYA 5CCDA 1DO8A 2ESRA 4YMWA 1MGOA 4XAQA 5IKPA 1GAQA 2OWDA 2G9UA 4LXGA 3CUEF 3LBYA 1Z4KA 3VHQA 2H2AA 1O5IA 2HT1A 2D1RA 3IDZA 5KVSA 5FPKA 1IBKB 2C84A 1JXOA 3L7JA 2Y71A 5E4TA 1SVSA 1L7VC 2QL6A 3ZHUA 3RI3A 2PUWA 4DHWA 1NNSA 2NYVA 2IUYA 2FDCA 1F9AA 2JD1A 3LD9A 3NGXA 5E95A 2NQ8A 5KYWB 1HM5A 1M0SA 1U8EA 4GECA 5BWNA 2VBIA 5FF9A 1MJGA 2DFLA 3UATA 4LF9B 4C7MA 1UK7A 3KQKA 1IZ9A 4KI0A 3WWYA 1Y7TA 3SFVA 2XNDA 3S6JA 4R2WA 4AG6A 4F1WA 2O8CB 5CA1A 4TLBA 1EVYA 4XDZA 3EIWA 3BSYA 1FDVA 3WLMA 1HG0A 3BAZA 3V4LA 4AKEA 4BECA 1CUZA 3RK0A 3BORA 1RAHA 4FFWA 1IVYA 4ADSG 2PMBA 1B1CA 2X3YA 3EXFA 4LDJA 5HHTA 2ZI7A 4S3MA 5KPDA 3GLVA 3I52A 1EWKA 3OLVA 5PGMA 2J85A 2GLXA 3C1TA 1DJNA 4HXYA 5IDXA 3OZGA 3FKSD 2JHGA 4Z6KA 1PJ8A 1CQIA 3JRXA 4BE4A 4BZPA 5AQ1A 1E9DA 2I1WA 3FIUA 5C4IA 1E7SA 2EOAA 4G5QA 1PR6A 4RPJA 4HDNA 1VYHA 3CNHA 4NKRA 2FP4A 5IJ9B 1NVWQ 4Z3DA 1R5OA 4BU0A 3OPNA 3E6AA 2JD2A 4QUEA 5AJYA 2HU8A 1RAFA 3A37A 1HC7A 2BF7A 4ON9A 5HFJA 3OU6A 2FPXA 1M74A 2BFMA 1CUAA 3T7TA 3D6UA 4BS9A 1UBGA 2WIAA 3C6KA 3N8KA 4PR0A 3S2GA 3LL7A 2C7RA 3B1JA 1TZ2A 3R0XA 1TDJA 4J8PA 2EFGA 5TGTA 3JYLA 3EUWA 1UFKA 3DDOA 1GYPA 3KZVA 4RY8A 5FORA 5TQ2A 3V4VB 5CVTA 3KU1A 1ZD5A 5ICMA 3VC2A 4W5TA 1EXDA 5F9HA 4JYAB 4RZIA 1GVHA 3E27A 3TKAA 1SPXA 4AAYA 1XHFA 2Y1DA 2XGGA 2I66A 2JASA 5IKOA 1PZFA 2IPXA 4GXRA 1GPAA 2CHFA 2QZZA 2QUIA 3MLAA 3IESA 5DXFA 2E1PA 5CB0A 4G85A 3PVCA 7AT1A 3UTCA 1NFRA 3G5UA 4K88A 4CMIA 1EDOA 2FUG1 4CV0A 4HR7A 1S2OA 3DBLA 2FF7A 5C7LO 2WAOA 5EIXA 1LSOA 4YFVA 1AURA 3RIYA 1TLTA 3F5FA 2X0DA 3WWDA 3WQQA 4EK9A 2HBQA 1ZCJA 3ABSB 4YBRA 3PTAA 1GZVA 1Y8AA 1V25A 2NPIA 2OBLA 4P7BA 4XQ0A 5EUBA 1H4QA 3G2IA 5K3FA 1OILA 4S0XA 4CM9D 4UJ5A 2GBCA 2HLDD 1AXEA 1DEKA 3JZDA 4EY3A 2NPOA 2ZTMA 3PHGA 4A91A 4CEHB 1SM4A 2JI9A 2VS1A 4BMNA 5ARCA 5D86A 5J2TB 3PG5A 5FBZA 1T9KA 3TTVA 3EQ9A 4IEFB 2ZSJA 2VDWA 3OZ7A 1LTQA 5AKXA 3IBTA 4K0KB 3DBOB 1E2KA 3H8SA 2WWRA 4OUKX 1BDIA 4UOQA 4ZVQA 3R7WA 3F2IA 3CW9A 4DA4A 3QM1A 3DQZA 3EN0A 5FTMA 4FX5A 1JI3A 2EP5A 4UAUA 5AUNB 4YJ3B 4LZAA 4D96A 1X13A 3NBAA 5A4JA 5EPUA 4Q9DA 3SZ3A 2JEZA 2XTJA 3RWBA 3V1YA 5KSWB 5DB4A 2R87A 3BQ9A 2J30A 5IYZB 1TJYA 4NYIQ 1XAJA 1RNLA 5K0GA 1VJ0A 2QTCA 3DE5X 3GGPA 5HQ3A 5KTMA 1XU7A 2HBZA 3A4NA 2VEOA 2MIIA 3BF7A 2PUFA 3BX1A 4Y2QA 1ATZA 1PK7A 4RZXA 2H31A 5I9SA 4AJNA 3SMQA 5JWOA 1QV9A 1Z7EA 5CDTA 3CB4A 4ZQGA 1QQ6A 3VPXA 1YV9A 1ETUA 2EAUA 3MCUA 4C2TA 4ZT4A 5IMSA 1RM4A 1PFUA 1F12A 1HLFA 2FPGB 4PXSA 3C8ZA 3VYWA 3WB0A 3AQIA 2R00A 5DLQC 4BDTA 4F7DA 2WNIA 1E8NA 2PV7A 3C7AA 4G8CA 5IAJA 3WKDA 2BGNA 1ZOOA 5LJLA 1ZIYA 5DHSA 4AZ0B 2J41A 3PR2B 3VV2A 2F1HA 2X7JA 3DO5A 3VR4A 1NDHA 3OQBA 1KO1A 4UM9B 3T6KA 3CVVA 2XAAA 2Q5FA 1PL7A 3L6OO 5GZ1A 2DY0A 3CC8A 4OHVA 1JH9A 5MHTA 4HQOA 4P31A 1LV8A 2CNKA 2FPPB 1GNLA 2FXIA 4P4UA 1EVZA 1G5IA 3BWYA 4DLZA 4P5PA 3R6LA 4X8OA 4P53A 1OXKB 3IUJA 2WMOB 3P4YA 3BWDD 5DHAA 3SXUB 1RKXA 4DJ5X 5UKDA 5AVVA 3B7GA 1R6XA 2QTZA 3G2QA 1FBTA 3BJEA 4P4TA 4G09A 1Q1AA 1VI2A 4YX9A 1ZR4A 2RI6A 3L82B 4YC7A 4U2KA 3ROFA 3T61A 3SR3A 4Q21A 1ADGA 3RTBA 5FNVB 5TGDA 3NIDB 3HFSA 5LN1A 4FONA 3L0PA 3D8TA 4D0SA 2A67A 2HCFA 3WJ1A 3LC1O 3WYGA 1RS0A 1B16A 1U2RA 2HJWA 2PWAA 4AJ2A 2IHVA 3QUTA 4DIOA 1I80A 1R4NB 1JQ3A 4BRSA 5JBNA 1Z3IX 4O2RA 2OCAA 4P93A 2AMYA 2BI4A 3AY3A 1A8PA 4OFZA 3TW8B 3V2HA 1HDEA 2RGGA 2V4ZA 1KL7A 1J06A 4ZHQF 3K6SA 1DV1A 1KAHA 2GJSA 4XVRA 1BTOA 3IQIX 1ATIA 3G1UA 4UTNA 2PPVA 4AMGA 1JIXA 1XZHA 1QIDA 2XUOA 2B83A 3PNMA 4ISBA 4C0KA 2W2KB 1LW6E 2XMRA 3KOXA 4FGJA 4HQ6A 4JJAA 3FMFA 4FK8A 5DBEX 1E7YA 5I8ZA 3TLMA 4OLAA 4HTAA 4LQCA 2FSSA 1M1NA 4LJ6A 3BIOA 5JALA 5EL0A 5TX7A 4FOTA 1PF7E 2NU9A 1KEKA 3BDVA 4PG8A 1U7OA 5JR3A 2VR1A 1EMDA 3C1OA 3D64A 1CZNA 4LJ5A 3GJ7A 3UBTA 1O4WA 1U0HC 2VDKB 1D1PA 2IS1A 3L1HA 5EI5A 4PBTA 1XNGA 3W79A 2ZSFA 2E7ZA 4KQMA 3G0HA 3BIWA 2P35A 3F6CA 2G88A 2XKAA 1E8MA 5LLTA 2EF1A 2H8KA 3DJYA 3A9CA 1NN1A 3DBRB 3GEPA 1DFIA 4K6CA 4AKGA 1CLEA 2R751 3MWEA 2CDCA 4UTZA 3P27A 3O31A 4HF7A 2W6CX 1RJ9B 4ENSA 1D2RA 4MO2A 3I5YA 3ZD8A 1B2LA 4BCDA 2ZRBA 5EIFA 2ORWA 2CXPA 2VP5A 4BMXA 2R8RA 1JMVA 1E3IA 2GAJA 4LC9A 3F73A 3U1VA 4UNIA 2HWXA 1WRBA 2E4VA 4JVNA 5JG7A 1H2RS 2OCIA 2FPKA 3BFKA 4BNHA 4BE9A 2F3TA 3LP8A 3U31A 1XNHA 2A5DA 3IURA 4YYEA 1JDNA 4OHXA 1BD3A 2ICAA 2JBWA 1LDYA 1GG2A 2WJ6A 2DGDA 2YCLA 3D4LA 4HMOA 3I1IA 1DARA 4CL8A 3FAZA 2Z08A 4V0SA 3VR1A 1PV1A 1PRYA 5CT5A 3NDBB 3D7LA 2O3UA 2XF2A 1A77A 1FP7A 3F4LA 5LVAA 1NF3A 3P2YA 4RKRA 2JLCA 3AP1A 4UNQA 1IJBA 2Y2VA 2WZQA 3MILA 4MA0A 2HFKA 2WTNA 4Q4DA 2AG8A 5TPWB 4B9EA 4BFYA 2ZSAA 1QYWA 1OX4B 3P0JA 4R2XA 2NUPB 2Q5CA 2D5BA 3PENA 5C8YA 1MDBA 2VF5X 4CCYB 2AT1A 2WUGA 2P8SA 1SY7A 1TKBA 3N2LA 4NOJA 1DOAA 4MUAA 5D7BA 4GMKA 2QRPA 1NGSA 5JI2E 2JGNA 1QH8B 2GPTA 4V39A 4B76A 4X9XA 2XDYA 3VOTA 4OBWA 3GPCA 3CRNA 4BZZA 4ZOQI 1IEXA 3KXIA 4FOOA 1G7TA 5DTMA 4DPKA 1U90A 2BMFA 1RQNA 4Y0NA 5L3RA 5ENDA 1HNZB 5A6SB 4F6RB 2EX0A 4Q9KA 3VO2A 4LI0A 2JJYA 5ISMA 5F7JA 1ST2A 1ISSA 3BYZA 3K09C 4ZZ3A 1GGNA 3KUDA 1N78A 4K9RA 3QA9A 2X4GA 5EFZA 5IAAA 2IZ6A 3AFMA 4CLRB 2Q4OA 2JFUA 1J33A 3TW4A 4MZXA 3ZIUA 2OBBA 1GUBA 2IPMA 3QYJA 1OVMA 4INPA 2ZU6A 4IZOA 4QTTB 3UMVA 3K5HA 2P7HA 4IXWA 2GSWA 4DUGA 3OLZA 4BP8A 2BFAA 2CB9A 2L42A 5B7QA 4Q1AA 4YRDA 2P3LA 4LRQA 4RV9A 2BM1A 3UC9A 4GMGA 4YAJA 3ZX5A 3G02A 1XA3A 4DUYB 2NZJA 3WGGA 4LJSA 7YASA 1KY2A 1SKMA 1NVTA 2NAPA 3NTOA 2QN2A 1IK6A 1PVVA 4LAFA 2JCYA 3V1TC 2G6TA 4MUNA 8LDHA 1V6AA 3UAXA 3KWLA 3LBAA 3GEDA 4ZT7A 4Z3KA 4KPUA 2IUSA 5TT1A 2WVGA 3MZ0A 1V71A 3M6AA 3F7MA 3D3NA 3OTWA 5D8DA 4GXNA 1CCWA 1L8LA 3JD4A 1NC3A 3E3NA 4F3TA 3NBYC 5A4FS 4HAWA 1MCZA 3F90A 5F73A 3DAOA 1GPWB 4ALMA 1CVRA 4J94A 1PGJA 1AUQA 5BOVA 1W5AA 4N7RA 3TQRA 1Y8ZA 2WINI 3R8XA 5EWLA 1SCKA 3C3KA 1CUGA 4MA5A 1O87A 5FBLB 3G23A 2GLUA 5FWDA 4AJJA 4E33A 3H5TA 3QHQA 4N4AA 4NAVA 4YMUA 4JB8A 5L45A 2ZPUA 1JDBB 1K8XB 4HAXA 4X71A 5AI0A 1IPHA 5JFOA 2AFIA 3UVEA 1JI0A 3WWOA 2WPDD 1NDUA 1YDMA 1LLUA 1VCOA 1U3CA 3HYRA 3QQ5A 4L28A 4QBGB 1I51A 1NN3A 2YX1A 3FR8A 1CVIA 4DYHA 1F2TA 1HEYA 3RU2A 4F71A 1FFWA 3RS4A 3R74A 5KWIA 5KZMB 1FU8A 5DW3A 5ICFA 1X77A 4QWWA 2BE7A 3FNFA 2IH4A 2CD7A 4GSYA 1XJCA 3VZRA 1YXMA 3STVA 4KKXB 4BL5A 4CKWA 3EHDA 1G8GA 2WDPA 4BWYA 3CRQA 5K0ZA 4PHTA 3WS7A 1TO1E 2VNHA 2ODTX 1O94D 1QRDA 2CBXA 1WD7A 2BCJQ 1B00A 1CRQA 1UBOS 2G72A 2AOVA 2J87A 1ZJYA 3K20A 1LEHA 1N2IA 2O8BA 5B3KA 3EIUA 1WPGA 4I14A 1DQPA 4EYKA 2HQBA 3Q41A 3E5HA 2HJSA 4NHEA 2IZOA 3F78A 1IBCA 2B4TO 4XX0B 1T8RA 4CU2A 3RC1A 4ETIA 5LZ2A 1SBZA 2OV6A 5ALXA 3EGXA 1C0KA 2HJGA 3UWPA 2AI2A 3NJ4A 4S1VA 5FOXA 2JLWA 4NIMA 4JOQA 2I1LA 3IMCA 5IN4A 1RC8A 2GFQA 4URXR 4CEJA 1A5AB 4A2WA 5JCXA 3R0IA 2XNSA 3AEUA 3RC3A 2QD5A 4D8UA 3OEED 4NCAA 2FPUA 3N2GA 4JR1A 1SD2A 2P41A 3O93A 1JF8A 3CLVA 4WWHA 3W9YA 2IHBA 4CJXA 1Z4NA 3A4YA 4YAGA 3L6UA 5DGCA 1ZEMA 4TYWA 1HYEA 3F6RA 4N47A 4HQ0A 3DVQX 4P4GA 5REQB 5HS4A 1OH6A 2UAGA 2VSYA 3V48A 2RAFA 2JK0A 5FTNA 1UQUA 1OXXK 4U9IS 3RFFA 4UDXX 2B3DA 1Z0AA 4BVJA 2PRJA 4A8TA 4DMKA 4PGMA 1AUOA 2W11A 2BCGY 1J4AA 4Q01A 3E9MA 1PK9A 2VHCA 3IKJA 3UOGA 1I9CA 1NOKA 3AP3A 4XXHA 4CF6A 4JUAA 3TDMA 3DQQA 1ZL2A 1IU9A 1J0EA 1OI2A 3PXCX 3FNRA 2HB6A 2VK8A 2ENUA 1VTKA 5IARA 5ILQA 3DE1X 1R16A 2ZRMA 3RC7A 2FPLA 3T9EA 3E1GA 4XFDA 1DLIA 5ICCA 2KS6A 4KGVA 4Z9XA 3ITDA 3QEMB 3UTDA