2ATXA

Crystal structure of the tc10 gppnhp complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
186
structure length
186
Chain Sequence
SMAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords small GTP binding protein TC10
total genus 50
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2005-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2atxA00
1YR8A 2VRWA 2B8TA 1XZQA 3TK1A 4S2EA 1SVKA 3ASZA 1P3JA 4JLJA 1Z0DA 4KCGA 4DCTA 4CEHB 3RRZA 4MRSA 4Q4HA 3ZZUA 3ETLA 4FMDB 2C99A 2ZE5A 2ZE6A 4KYIB 2BM1A 2VHCA 5G53C 1AK2A 4B3GA 2EW1A 2IA5A 1EX6A 1Z0JA 1Z08A 1SKQA 1UFQA 2VSFA 4WZ6A 2JJ1D 3GJ4A 2P6NA 1W49A 2ZPTX 3LXXA 2HUPA 1ZU5A 3AB3A 3KJGA 2XTZA 3CPEA 3TR5A 2ZTSA 5CIWA 2X1VA 3U7HB 1PLJA 2BM0A 1GKYA 4KYUA 4IXNA 1J99A 2IX3A 3CNOA 2N1BA 3OEHD 3NH9A 2E87A 2FF7A 5EQTA 3B9QA 2OCAA 3PV0A 1GSIA 4BZXA 1W5SA 2CK3D 3FKSD 1E9EA 2ZUBA 3H4MA 4JBXA 4N0EA 2ZVPX 3SFZA 2VL7A 4KAXA 3PUZA 1NN0A 5J40A 2F6RA 1FZQA 2WJIA 2X8AA 4ABYA 4X8MA 2N46A 4JBYA 1N6KA 1HE1C 2C98A 4M9SA 3UXMA 4MKHA 5E7JA 4XVUA 1BYUA 1SXJA 1RJ9B 4GI7A 4NU0A 1IM2A 4ASUD 1SXJD 1XU4A 3KKMA 1L4UA 2ZUCA 4DCVA 4Q1CA 3CNNA 4Q18A 5EXSA 3VR1A 3SHFA 4QHYA 1CXZA 1C9KA 3B78A 2PMDA 1E32A 3RRNA 1XZPA 4OK6A 2QU8A 4A2WA 1B0UA 2ZSAA 3OF5A 4OHYA 2OESA 4HLQB 2GF0A 3UMRA 3CRVA 4M8NE 5BN4A 1K6MA 1G20E 3CRQA 3SYLA 5E4FA 2WWWA 3K0SA 1G8HA 2P67A 1OH7A 4IEIA 3GLFE 1YQTA 5DHFA 4Q4AA 1E99A 1R10A 1P9NA 3IQWA 1NLFA 2ZIAA 3LV8A 3DM9B 1ZYUA 1NJFA 1T0JB 4Q4HB 3LRPA 5C2JB 4PTLA 2C8VA 3HYTA 3AF0A 2KSQA 1RPZA 1WB9A 1JQLB 2F3RA 3K09C 1DS6A 3WNCA 4POAA 2OE2A 3W5JA 5IF9A 1NLYA 4FMCB 1D8TA 3W9YA 2I4IA 1NLZA 3VKGA 3IQXA 2D2EA 3I1FA 4ESHA 4DB2A 1Q22A 4XTCS 5DGXA 4Q7KA 2DWQA 1W48A 2NO7A 4LYHA 2R6FA 4HAVA 1T5IA 3EW9A 3TAHA 1FOEB 2JGNA 3CLVA 4RSGA 1YZUA 4BFXA 2QROA 1YHNA 3KQHA 4QGHA 4LYFA 2GRJA 4KFSA 1YU9A 4JVSB 2W83A 5TMPA 3THYB 1ZNWA 1EFHA 2ZI4A 4DWJA 4W7SA 1XDBA 4QBHA 2QBYA 4BUJA 4DBLC 1DTSA 3VNVA 1ESMA 2HXSA 3T1OA 3PUXA 3GLHA 4P4TA 4R9UC 5KSYA 4CEIB 2XB2A 1S2MA 1Z29A 4KSBA 1Z0FA 4CT4B 1HY3A 2IHYA 3CM0A 1RYFA 4KBGA 1AJEA 4GZMA 5FFMA 1KSHA 1LFDB 2QT1A 3PFIA 4R7ZA 2N42A 2RMKA 3SR0A 2LKDA 1MT0A 2O8FB 1EWQA 1II8A 2REOA 2JJ1A 1U2RA 2VP9A 1PJRA 2JJ8A 4WW0A 2QNRA 5TDHA 1U99A 1BMFD 3N2IA 1KAGA 3FGNA 4L16A 3RS0A 2WKRA 1IOZA 1OXTA 1XJCA 2Z4RA 3CBQA 5CYPA 1P61B 2CJWB 1COWD 1J8YF 4DDTA 1Z0KA 2Q6TA 5HTKA 1D6JA 2QP9X 2VH5R 4RZ3A 4OHWA 2FPLA 3CRMA 1X86B 1XJ0A 4IXMA 1OE0A 2AKAB 5FTLA 121PA 3LLMA 3W6PA 5JBQA 2ZM5A 2V4ZA 2O8BB 4Q9HA 4C0AC 4JZKA 4M0LA 4XH9B 1HE8B 2B6HA 4DXAA 4AC9A 2QSZA 3QE0A 4IKEA 1S9DA 2CL6X 1YZNA 2GXAA 5EXXA 3LW8A 4BFZA 3TE6A 4EUNA 5JZVA 5EP4A 2J0UA 3IILA 1XD9A 1AS3A 1N6RA 3WYAA 3AVYA 3B8HA 3VHXA 2V1UA 2ZYVX 1DAHA 2KWIA 1PLLA 2RGBA 4NH0A 2Z83A 4BGDA 3KQNA 3C5CA 5KUTA 1OF1A 3U4QA 4OQLA 1KI6A 4N0DA 3AVPA 1E2JA 5J4HA 4GBMA 4F7WA 1NVVQ 2ORWA 2YZ2A 1AS0A 1CEEA 1TUIA 3GP8A 1R8QA 1MRNA 3CR8A 5KU1A 1L4YA 4PX9A 3RWMB 2NG1A 1VIAA 4JL6A 3RAPR 4F4JA 4J0QA 4V0ME 5KYKA 3V4FA 1Q3HA 1XCMA 2GEDA 3E1SA 3AEZA 4OK3A 4Q7MB 4O3MA 1U8YA 2ANCA 1E2QA 5KSPA 3SNHA 3BXZA 2ZJ5A 4IDPA 1W36C 1YR6A 2PZEA 1GWNA 1UM8A 4QM6A 2ERXA 1Q1EA 2DCUA 2YC4C 3S1AB 3BFVA 4M1MA 2ZRKA 1TL7C 4F4CA 1Z2CA 3K70D 3L0OA 3OAAA 4A6XA 2ZSEA 3CR7A 4XVRA 1GNPA 1ZM4A 4L9SA 3GJ5A 4KITB 1OIVA 2REBA 1E1QD 4OHXA 1T0HB 1XCPA 4C30A 1E9CA 4F92B 1AM4D 3BOSA 3MWYW 1UBFA 1N6LA 2BCJQ 1O3YA 4JLAA 2J41A 3QF7A 5H1YA 2Z43A 1E2KA 2KJQA 3P4YA 2R6AA 5DHAA 4PC1A 2OFOA 3HU3A 1P9RA 2G77B 1Z6GA 4PHTA 2D62A 2ODBA 2K5UA 5KOYA 1OIXA 2GF9A 4HDQB 4WXPA 2W00A 1QVRA 3F0TA 4TYYA 3OFNA 2F1JA 2BCGY 5H68A 4JYBA 4KHZA 4QJ3A 2J7PA 1T8TA 2JLRA 3O8CA 1XMSA 1Z5ZA 1N0WA 1BO6A 4EJSC 4BLRA 1G9XA 4MRPA 4DCNA 2J46A 4NONA 1VKJA 2DY1A 2ZI6A 4A8JA 1QVAA 1PZNA 1W2GA 4QGFA 4YMUA 1XMVA 4D6PA 5FTKA 3TUZC 2VP6A 3IEVA 4G1UC 1E6CA 1IY1A 3WBKA 3LW7A 2RGAA 2CE2X 4HB4A 1ZP6A 2VYFA 3FTQA 1E1RA 5BWMA 4NYIR 3TR0A 5CITA 4LI0A 3FMPB 4DDWA 5EZ6B 4LHYA 3OIWA 1OFTA 2YWGA 1D9ZA 2IYWA 2JIZA 1XTQA 5JI3E 4IVPA 2D4HA 3SQWA 3F8TA 2FNAA 4Q1AA 3IPYA 1ZINA 1G8PA 1JR6A 2Z4SA 4PHHA 2WPDD 5FTNA 1Z83A 1XXHA 3ZDQA 5C4MA 1BH2A 2V54A 2V1XA 4LZZA 3B1VA 2F55A 2O8CB 1OW3B 3KJIA 1W5TA 4KLNA 1YVDA 3NVAA 4EJSB 4HLUC 2OBLA 1WXQA 1MABB 1DOAA 3K8YA 2IS1A 4DSTA 1T9HA 4WA7A 1XTKA 4Z54A 2ODNA 2QPAA 6Q21A 1JQJC 1ZM9A 4BRWA 3AKCA 3W6OA 2X2EA 3IHLA 1GP2A 2IYVA 1TQ2A 3RANA 1CR1A 2IF2A 1E1RD 4Q5IA 1YJ5A 3TSOA 1MO6A 2GK7A 2IS2A 1MRSA 2X19A 4EDHA 1JI0A 5D3MA 4ARZB 4F38A 4NP6A 2AWNA 3DVLA 4B32A 2HEIA 2H18A 2QG6A 2CMKA 4LJ6A 3HU2A 2BJWA 3SYNA 1GRQA 2F9MA 5JWOA 2QZ4A 1KJZA 1DO0A 2YC2C 4X8LA 1YZLA 2OFWA 3MJRA 4D0GA 2FPMA 1OSNA 1RRPA 4LHXA 4A6PA 1W4RA 1E0AA 4JT4A 3R8CA 4LOAA 4ZKEA 3C5HA 3M4YA 3U44A 3HPRA 5JSZB 3OIYA 2C96A 4D81A 1QHGA 5B57C 3GPLA 4JVMA 4W5HA 3I5XA 1Z0AA 4LJYA 2NPIA 4BFUA 1RC8A 4EFLA 1TF7A 2DFKB 1CRPA 1KZGB 4N1AA 4UXJA 3SYKA 3N70A 4BZPA 5DYIA 4Q1BA 2IUTA 1NG9A 2JLYA 1XF9A 4CT5A 4C2TA 1Z07A 2ODEA 4EPRA 2REXB 4G3XA 3UWOA 4O0MA 5IHPA 3GJ7A 1B23P 4A2PA 4G5QA 1G41A 3ZS9A 1NY6A 3ZD7A 4DIEA 3CRW1 1U9IC 2CLCX 4YDSA 3TIFA 2B8WA 3VQTA 4TYPA 4DLUA 1CR0A 1ZM3A 4GSYA 2R8RA 3OAAD 1A5TA 1XCGB 3GLHB 3WMEA 2P6UA 4E09A 1M2OB 2ZR9A 1RYHA 2CL0X 4ZO4A 1XEWX 3I32A 2P5SA 2IXFA 4FMBB 1AZSC 5E3HA 2YNMA 2QI9C 3L2OB 3QPVA 1W44A 4IOJA 2CBZA 1N5JA 1P6XA 3RNLA 1YR7A 1ODFA 2LKCA 2RGCA 2ZRDA 2CK3A 3FKSA 4CIDA 1G1MA 2WZQA 2O8DA 3EG5A 3OEHA 2PEYA 4DDUA 5J4KA 2Q0HA 2FA9A 1CJUC 4EPXA 4XOIA 4I99A 1MO4A 2J87A 1OH5A 2IYZA 3HR8A 1UBGA 1ZJ6A 2MMGA 3JZMA 4HAWA 4Z8XA 5FUXA 4C7OB 1RVDA 3X1XA 2JDIA 3L0IB 4RD2A 3KJHA 3AP2A 1E9RA 3FHTA 1E2HA 1N2CE 1ZUIA 3GJ3A 1TF5A 1JPJA 2Z5FA 1N6HA 3AUXA 1CULC 3C4JA 3KKOA 3T35A 3TQCA 4C9BA 4EQ6B 5ELXA 4ZDKA 2OAQ1 3A8TA 2MMCA 2GNOA 2AR7A 5E95A 3RRYA 1G3UA 3QKSB 4K8OA 1UEIA 3AKDA 4PZLA 3SZRA 4A2QA 1PV4A 3I62A 3EA0A 3U44B 1S3GA 1U8AA 1W7AA 4S35A 3GEHA 4NYMR 4KO8A 5TVKA 2R6CA 5A4JA 3CZQA 2H1LA 4LBZA 2VIIA 2QP3A 4BFWA 1X3SA 3T1VA 4HB0A 1CU1A 1E2EA 5HR5A 2QA5A 2WJGA 5BN3A 4LBYA 1W1WA 1JALA 2YYZA 2V3CC 3NEJA 5DISB 3AQ4A 2WIBA 2XZPA 3I3SR 4NE2A 3ICEA 2J0QA 2RAPA 4MKGA 1CR2A 4DJTA 2FZLA 2V6JA 2KB0A 4URXR 1J8MF 3K0AA 1P7CA 1T91A 3R7WA 4EPTA 5GVSA 1YRAA 2GETA 1KDPA 3RLFA 2W2XA 3G5UA 2PJRA 4AI6A 1XWIA 3SDZA 1OXVA 3W34A 2WWIA 3AGPA 4GPTA 3RHFA 3H86A 4CDGA 1A1VA 3TMKA 4EJSA 1N6OA 2VTKA 1NBME 1P72A 3CH5A 4RFVA 4TL7A 2AK2A 4CGZA 4QGGA 1S9HA 4PAMA 4MDEA 4UNQA 2YVUA 2J9RA 4FN5A 4FMCF 4PPQA 1VG9B 4F93B 4IOLA 3LQRA 3FPAA 4JJKA 5KNBA 4RKFA 1UKYA 3WMGA 4EPWA 4NPHA 1E94E 2ZS8A 4GOXA 1S4QA 4TZ0A 1G7CA 1XB2A 5HE8A 1Z22A 3CPHA 3U5ZB 4MA4A 1R0XA 2FOLA 2GCOA 3LBIA 4PQFA 1WDTA 2AXNA 4RD1A 4OK5A 3SOPA 4MYCA 3Q72A 4BEBA 2FFQA 4DHEA 4DLVA 2IYUA 4HAZA 1OFUX 1NSFA 4GP6A 1KJWA 2V55B 3GQBA 1II9A 4Q4JB 2XXAB 2HJVA 4HAUA 1M6NA 2ZROA 3EA5A 4XD7A 1NN3A 1AS2A 2HJGA 1GIAA 5L3QB 4PO8A 3O8RA 1Q1ZA 2GVDC 1UDWA 1SQ5A 3BH6A 4PHGA 2OBMA 2FN4A 4UNSA 5EP1A 4BFVA 4G0NA 2TMKA 2G88A 1KKLA 3A1VA 4HUTA 1KO7A 1RJ9A 3AVQA 4A1FA 5KDOA 1QHHB 4BRUA 1NN5A 1VG8A 1Q12A 1S1CA 1US8A 3W3ZB 2ZJ8A 4TLEA 1NMXA 2Q21A 5CYOA 3LWNA 2PZGA 4TLAA 2IS4A 1A7JA 3LLUA 3P27A 3QXHA 4ZIRB 2QGZA 3CONA 3CF0A 3MWJA 3UANA 1E69A 5IK2A 2IYLD 2A7QA 3QUSA 4KVAA 2O8EB 1BKDR 1ZU4A 1CF4A 1A2KC 4NYJR 2ZI5A 3KFVA 2Q3FA 3EIHA 4LK2A 3DM5A 4QHSA 4AY2A 1SVIA 2HCJB 4CF7A 3W8RA 1KJYA 3EZ6A 3HDTA 2FDCA 3AP3A 3B7GA 4CW7A 3D31A 5J4LA 4CZ2A 5FI0B 1UADA 2ZUDA 5H8WA 5TB5A 1HT1E 2IYYA 3B1WA 4KFRA 4P32A 4MITA 4YMSA 4ZPXA 4ASUA 4V03A 4W9MC 2YWFA 2IF0A 1OJLA 2BVNA 2WOJA 3AF2A 1MV5A 1SXJC 2NPFA 4H9GA 1M1YE 3L8YA 2ZRAA 3L0SA 3OHMA 4RFSA 1T3SA 4EPVA 1AZTA 2O8DB 3GFOA 1GTVA 3K9GA 2CCKA 2GBLC 2YOFA 4B2PA 1KSFX 2CL7X 4NBSA 3ECCA 3AVTA 2A5FA 2KI5A 5J4VA 2VLIA 1GITA 5JS7A 5AJYA 1K8RA 1SZPA 1UJ2A 2QBYB 1R0YA 4I1VA 2ANBA 1F2TA 5G40A 2FSFA 3B5JA 3I8SA 1AA9A 3K9LA 5KDDA 2GJSA 1T6NA 3GJXC 4G5SA 3VFDA 2A5JA 3I92A 2HDNB 3ZQJA 3OE7A 4GZLA 1JR3E 3K0CA 3TW8B 1OYWA 2BC9A 3LNCA 2IW3A 3KB2A 3QXJA 1KY2A 4RY2A 2HLDA 1FUUA 1E2GA 2NZJA 3WYGA 5A5GA 5FPKA 1I4LD 1GG2A 1R5OA 3KUCA 2B7CA 1W4BA 2ZI9A 1D2EA 4B6FA 1I4TD 2CDNA 4K81B 2GCPA 4HLCA 1NJGA 4OL0A 4B3CA 4M21A 1NVWQ 1LW7A 4IW3B 2CJWA 1W4AA 1LB1B 3IPXA 4PPFA 1WBDA 1IBRA 1WCV1 1IXSB 2XEXA 3O8DA 4BECA 3OEEA 1KDOA 5J5CA 3ND9A 4P0TA 5UKDA 3TKLA 4KFUA 4Q9JA 1MO5A 4OQFA 1W47A 1F3OA 4YMTA 1UAAA 1ZIOA 4LJ9A 4KV9A 3EPLA 1G3QA 1VHLA 1XD2B 2R2AA 1H65A 4GL2A 2QRNA 4HZUA 2QM8A 1TAGA 3DO6A 3Q85A 3WMFA 3CB4A 1TX4B 4B74A 3QKRB 3NBFA 2FZ4A 1DAFA 3LFUA 1EFTA 4TMTA 2F1IA 3FVQA 5H70A 2ZRNA 4OI4A 4D26A 3MSXA 1Z8FA 2Y8EA 3IBYA 2WICA 4GFDA 3B1YA 2HYIC 4YQFA 1HEIA 3EIQA 1TU4A 4HAYA 1KI3A 1NRJB 4M1YA 4RD3A 1KAOA 1G3IA 4JJZA 4TN1A 3PIRA 5LDDC 3RRMA 4URWR 2F43B 3AKEA 3GJ0A 4TLBA 1AKEA 1NN1A 5IT5A 3QOFA 1YKSA 2EFHB 2FX3A 3KX2A 1G3MA 4NCKA 4TQAA 3CNLA 4HZIA 3GCGA 4URVR 3EZ2A 1E79D 4DLYA 4OYHA 3AVOA 4PZZA 3QENA 4TMXA 1N0UA 2Q3MA 4A92A 1ZIPA 3BERA 3HYRA 2RB4A 1S3SA 1UKZA 2DFLA 4ZCIA 1U9IA 1OHHA 3U3MA 4M1WA 2WSSA 5EP2A 2J7PD 3UWKA 2XOKD 2R62A 4Z1MD 2PCLA 2P6RA 4DRZA 2VO1A 2ERYA 3S1AA 4U02A 2YKGA 1DVRA 4HB3A 2AX4A 5LD2C 4XWKA 4U00A 1GVNB 3G82C 3THWA 1DG3A 2GAAA 1Z06A 3CH4B 3TH5A 4OI2A 4EIWA 2P0EA 1P62B 3Q5DA 2DR3A 1W4CA 2ZSBA 1G4UR 3ZQ6A 1P4SA 1JNYA 1OIWA 2ZRCA 3WNBA 4M1KA 2ZRLA 5CB8A 3VU9B 3PVSA 5SZJA 1EG7A 1NF3A 3FHOA 1TU3A 2ORIA 3GLGA 3K0FA 3NHBA 2GVZC 4HSEA 2NO0A 1NI3A 2OHFA 3UMSA 5JRJA 1RZ3A 4KSCA 3HP1A 3BWDD 2IT1A 3H2YA 5HCNA 4TL9A 2IYXA 3TVDA 4ZDIA 2CNWA 3A4NA 3EPJA 2FEOA 2UKDA 4Q00A 3ZJYA 4NYIQ 1C4OA 3GLHE 2IYSA 2PMKA 4UKDA 1US8B 4P4SB 1AGPA 3GFPA 4V0MA 1AIPA 5DH9A 2GWHA 4DCUA 4EKDA 3FB4A 5IRCD 3VX3A 2OM2A 3PUVA 2WKQA 3FMIA 3UIEA 1T4GA 2BV3A 1M8PA 3NIBA 3RSOA 3EAQA 3A36A 5J4YA 1EFUA 1W0KA 4ZCMA 4AG6A 3O47A 2HT1A 1K5DA 3BB3A 1KTVA 1T3HA 4B33A 4C0LA 3K70B 3QVVA 3WNDA 1XTIA 2IYTA 4AKEA 1U94A 1FX0A 5DNYB 3GLGB 1Z0IA 1QG4A 2O52A 3KUDA 5JCPA 3RS5A 1CBUA 3VR3A 3MLEA 3GJ6A 1KMHB 1R8SA 3I5YA 1OKKA 1Q1BA 3A1TA 3QXSA 1J2JA 1E79A 2BBWA 1G18A 2NO1A 3SU8A 1II8B 1LS6A 1NKSA 2O8FA 3UK6A 1I4DD 1DADA 1BS1A 1KO8A 4RVCA 1XMIA 2BBSA 2ZU6A 1HA3A 5HE9A 3K70C 3I73A 1W36D 2PZFA 3LVRE 3IGFA 3T61A 4QBGB 5FBQB 5K8IA 5JJLA 1I2DA 2VBCA 1NL3A 2EFDB 3IEUA 4MH0R 4TL8A 4WZBE 3SJZA 3U4QB 2G83A 5GJCA 2CCJA 3W90A 4US2R 1MR3F 3B60A 3DKPA 1EESA 3AV0B 4P33A 1E0KA 4QJ4A 4YONB 5C4GB 1CJVC 1QF9A 4GNKA 4DZZA 1G6HA 1KIMA 3VAAA 1SKYB 1GL9B 4UNNA 2B92A 5BYJA 4DIDA 2FSHA 4JIMA 1XPOA 4MDFA 2EYUA 1TQ4A 5EJEA 4BWYA 2JJ2D 2I1VB 2B21A 2ZYTX 2ONKA 2VQSA 2WWGA 5HZKA 3CX6A 1ZM7A 3LQQA 1KK1A 4II7A 4A15A 1MABA 4BFTA 2JLXA 1JJ7A 1H8ED 3A58B 4MRNA 3R7WB 3SJBA 1A2BA 2D7DA 1F2TB 4PPGA 3J81k 1RKBA 5FUVA 1J90A 1KOFA 3BS4A 1OLOA 1XXHB 1EWRA 4YMVA 1G19A 1ZAKA 4A9AA 2ZRIA 2EWVA 2RGNC 4JVLA 1N6PA 2YHSA 1OFIA 2BEKA 1HQCA 3WY9A 4U5XA 1TMKA 4PSAA 1XTRA 4NMMA 4C0SA 1ZUNB 2HCBA 3P32A 1TF2A 3QEJA 4Q02A 4YXWA 4OQMA 1UPTA 1R0WA 1Q21A 2V7QD 1KDRA 4IJMA 1NMZA 4Q66C 5FPHA 2R6DA 3RS7A 4HZUB 2QP4A 4UQOA 3ZZTA 2OUKA 4MYHA 1KZ7B 4Q4AB 3RS3A 1E2MA 1HUQA 4WAUA 4U7DA 3AGQA 3KDSE 1EFCA 1EFRD 3TLXA 3SJCA 2L0XA 2VA8A 1H8HA 1SVMA 4CEIA 2IEYA 4BEJA 4Q1FA 1Z63A 1KI9A 1JAIA 1SVWA 2XITA 2ZRJA 3CX8A 3A4MA 1IJFA 1U0JA 3B1XA 3V9PA 2OLKA 4RD6A 1P5ZB 2P2LA 1V5WA 3F5FA 5SZHB 5K8UA 2XAUA 4LDJA 5JJIA 2FMXA 2ODWA 3MG9A 2FFHA 2XSZD 1ZD1A 2J1LA 1X1RA 2AD5A 4LHVA 1AGRA 1FP6A 1W0JD 5JI2E 2ZSDA 3CKLA 4TTQA 2OCBA 3ZZ0A 1WMSA 4BE7B 5FTJA 5L8VA 4FD2A 3IHWA 4P31A 1OH8A 1TADA 5AR1A 4V0KA 4B44A 1G8YA 2ATVA 1G6OA 1FQJA 3A1SA 1IN5A 1Z6YA 2J0SA 1T5LA 3K0FB 3PUYA 5JLJA 1VG1A 3H84A 5FBVB 1Z6XA 3VR2A 2ZAOA 4AKGA 2W58A 2ZE8A 5KSZA 2PLRA 3PR1A 4E22A 2W6JA 3BH7A 1Y63A 1X6VA 2QE7A 2QTVB 4G5OA 4URZR 2F7SA 5AJXA 3WBJA 2ZREA 4PO1A 1R7RA 2BJVA 3AF4A 3RSLA 4KODA 1IN4A 4PR0A 2WMNB 2VF8A 2YWEA 3BB1A 4Q47A 1IHUA 1L8QA 1FQKA 2QORA 1GFIA 1NG1A 4GOKA 5CDFA 5TV2A 3X2SA 1JECA 5JCZA 4OHZA 5C1BA 4IOMA 3VKWA 3DKVA 3QKTA 4PC3A 3D3QA 2Q3HA 2O8EA 1Q57A 1FNMA 3AVVA 3NWJA 1KKMA 2ZJZA 5FR2A 1X1SA 5C18A 3CUEF 2PX3A 2VHJA 2WWFA 4ZIRA 1E9DA 1UBCA 1TUEA 3NBZC 2QAGB 4UNPA 1JR3D 1XD8A 1NSTA 2C9OA 2ZR7A 4URYR 3VX4A 1WF3A 4YMWA 2C77A 2WAYA 2XX3A 4GOJA 1QHHA 4DSNA 1DAIA 3PITA 2GXQA 3B2EA 4QGAA 1YZGA 2GJ9A 4TSFA 4JLKA 2QN6A 2QAGA 4ZCLA 4ZKDA 3B1ZA 2NIPA 2Z6VA 3WRXC 2R65A 421PA 1XPUA 1ZNXA 2GXUA 1U0LA 3K0AB 3CRRA 2JLZA 1VDZA 2JEOA 2NQ2C 3TVTA 4DC9A 1TQDA 4LBWA 3KXIA 1RFLA 3MJHA 5JFGA 3U7FB 3MWLA 1NVXQ 1SVOA 1E9SA 1SKYE 2HT6A 4A4DA 2QENA 3VU9A 3AH8A 4C0HA 2ZRBA 1E2NA 2H92A 1H8EA 2WV9A 3FYHA 3KZ1E 2O8CA 2A30A 2RGEA 3VKHA 2BMEA 4M2LA 4GP7A 4TL6A 2EWWA 1CTQA 2BBTA 1GAJA 3CO5A 4BFYA 3DDCA 1IXZA 4E5UA 2OCYC 4LYJA 4G5GA 3KFXA 5DI3A 2AL7A 2V8OA 2CE7A 1Z47A 3D6TB 3L43A 3W3AA 2XGJA 4HEJA 2D3WA 1DG1G 1ZMXA 4KU4A 2WTUA 2HF8A 4JLDA 2JATA 2ZJOA 1II0A 1FFHA 3LO5A 1LTQA 1IJEA 4OQNA 3A37A 1CIPA 4IDOA 3LBHA 4M4SA 2OZEA 1RRFA 1F2UB 4KBFA 2C04A 4RJLA 5JJKA 4BLPA 2Q9BA 1GKUB 1Z6AA 2GDJA 1GL7A 2WWYA 2CHVA 1OYYA 3NC1C 3THOA 3M6AA 1E9FA 2QPOA 5L3SB 3VR4A 2HXYA 1M7HA 2GEUA 5BYKA 2GJAA 1P9WA 4PXAA 1W0JA 4B34A 4D4LA 4LX0A 1N25A 4QOSA 4Q9KA 4PC7A 3L82B 3R20A 2KBEA 3SE0A 3PQCA 4TSFD 4XJXA 1N3BA 4NCHA 1KI7A 3NDBB 5CM9C 5EUQB 4JKIA 2W6IA 5FPSA 3LH5A 1F2UA 1GZSA 3I8XA 2ZITA 4N3NA 1E3MA 3OIUA 2WIAA 2GEVA 4I1SA 2VSOA 1ZBDA 1KI1A 1VHTA 2GBLA 2JDID 3QY0A 2XZOA 2RGNA 2VHQA 4LJ4A 2RH5A 3B13B 3NBYC 3UATA 1DEKA 2OLJA 2SHKA 3C41J 4LJ8A 1OXUA 4L4UA 4F91B 1CJKC 4Q7JB 1Z6TA 5FOXA 1XEFA 3TUIC 2GJKA 3LX5A 5B30A 1QDEA 1ZC4A 3U7GA 3SJAA 4JSYA 3WXMA 2CLDX 2OCPA 1KDTA 2YJTD 4DT1B 4C0KA 4E03A 1EFRA 1HYQA 1SHKA 3DL0A 2EU8A 4QRHA 2EFGA 2ZRMA 2C9YA 1KMHA 4LC0A 2GKSA 4IRUB 2BIFA 2CVFA 1E96A 2WJJA 3A1WA 1VYTA 1N0VC 2ZJAA 1M7GA 1NMYA 2W6JD 1SXJE 4NCNA 4QFMA 1HH4A 4A0HA 1F5NA 2J0VA 3PEUA 4RD4A 5AJZA 4OI1A 1MO3A 1Q1QA 2AWOA 2O0KA 4TMWA 4KJZA 3BORA 4C7OA 4BPBA 2BDTA 1TEXA 4PANA 1G17A 4MGKR 1NIJA 1KO1A 2BOVA 3FDIA 1UKVY 5DO9A 4HLDA 2RKOA 3X1DA 2GTPA 2RGGA 2Q9AA 5D3MB 4ARZA 4JL5A 4HDCA 5FH9A 1FNNA 2ZJYA 2AFHE 1OPXA 2OXCA 2RGDA 2ZYUX 2R9VA 5CLLA 5G3YA 2AD1A 2ZS7A 4XTRA 3C8UA 1DAKA 2J45A 5GJBA 1GUAA 4BASA 1D2MA 4NYJQ 1YZQA 3L0PA 1JEDA 1LV7A 2VP2A 4Z1MA 1ESNA 2IXEA 2WAXA 2XJ4A 3BC1A 1UKEA 2WSSD 3SHWA 4I1UA 4TZ6A 4DVGA 1XEWY 3JVVA 4RFSB 1Q0UA 5DYGA 3T1TA 2EFCB 2XNDA 3IDQA 4LWZA 4MRRA 5F98A 1NVVR 4OKSA 2XTNA 4Q9IA 4XWOA 4NCJA 1G7RA 1JEEA 2AKYA 2QUZA 2WHXA 3E5HA 1TNDA 1OV4A 3DZ8A 4B6EA 5EE9A 2QQ0A 1H8HD 3WRYC 3A1UA 3CF6R 1CLUA 3TRFA 1MOZA 2ORVA 3CIOA 1V43A 3GMTA 4JS0A 4PZYA 3ZH9B 4DLRA 2FJUA 1E2PA 4DLXA 4D25A 3PG5A 4CEHA 3REFA 2G0TA 3VR5A 3UMFA 3GD7A 2OT3B 3B6EA 1QHIA 3MCAA 1FX0B 4PPNA 3SC3A 1ZNYA 3EZ7A 3NC0C 2XNDD 2WJHA 3OIVA 4DT1A 2IWRA 3IBGA 1D9XA 5AK0A 1XRJA 2DPXA 3MWKA 4JLVA 3I72A 4JBWA 5EE3A 1X8LA 3WP1B 4B35A 2ONJA 2X2FA 2A5YB 4B43A 1CR4A 3NTUA 4TQUS 3ZVRA 1N6IA 2WPDA 4TTRA 4A0RA 1AQYA 4IEEA 3QPUA 1G5TA 4DKXA 1R6BX 5LD2B 1QBKC 4RKEA 3C16C 4DUGD 4DUGA 2O5VA 2OEPA 1G7SA 1MKYA 3ZVLA 4OQXA 4WOPA 3T15A 1F48A 1ZVQA 2PT7A 2C2HA 3AF3A 3HJNA 4QJ5A 4B2IA 3B85A 3U3KA 3ZLJA 5L3QA 1VCIA 3P4XA 4PO9A 1WBBA 3LDAA 3X1WA 4IHQA 5JS8A 4FWTA 5FPTA 4D4KA 2P5TB 5FL3A 2ZRHA 2G9NA 3TNFA 4GT1A 3Q5EA 4LGMA 3QQ5A 3MRSA 2BMJA 1P2UA 4PAQA 3IO3A 1CJMA 2XTMA 4AYWA 3TSZA 2A5DA 1NBMD 2OFXA 4PSKA 5BXQC 5FL7A 3TSWA 3U6KA 3T12A 5LPNA 2F1RA 3D7MA 1E2LA 4M9ZA 2AK3A 4YLGA 3Q7PA 2A5GA 2WM9B 5G3ZA 3THXB 2WJVA 2C5LA 4TYQA 1W46A 1G3RA 4JSTA 1Q3TA 4DLWA 3OFND 5CLQA 5LB2A 4L8GA 3QBVA 2IWHA 3QKSA 5IDVA 1G7TA 4PQRA 3NBXX 5SZKB 4US0R 1OKKD 1Z2AA 4GMXA 4L9WA 4XSGA 3WHKA 3PEVA 1W36B 1TEVA 5TARA 2F1HA 5GJWC 2FH5B 2OG2A 5K8TA 1ZUHA 4DSUA 3AF1A 4RCZA 3CWQA 3N5CA 4X8OA 3T5GA 2FU5C 1LNZA 4Q01A 3ADCA 3ZVMA 5FBWB 5TXGA 3U3OA 4P4UA 3QXXA 4PC6A 2RCNA 4OI0A 5JMTA 3JVUA 3Q9LA 2W2VA 1LF0A 4Q19A 4JYCA 3WP0A 1ZNZA 5FOUA 3AP1A 2A3RA 2P65A 4HYYA 5B58C 8OHMA 5DSZA 1OB2A 4DDVA 4I81A 2CVHA 3BFKA 3PEWA 4W5JA 2DHRA 5FOSA 1EX7A 3TQFA 1IONA 1M74A 3GLFA 1OFHA 1C1YA 3R8FA 1FTNA 4MQBA 2F43A 5F2EA 2VP5A 4Q4LA 4TLDA 3FWYA 1KNXA 1GRNA 1SHZA 1GM5A 3AVXA 4LSGA 2QY9A 4NL4H 5FOTA 2JLUA 2WKPA 2QQEA 1S8FA 2ZU0C 4WVFA 5AJWA 1FTSA 1UBEA 1LY1A 3CPJB 3EZ9A 5JHHB 1HT2E 4JLPA 1KMQA 3UG7A 4AG5A 2ZXUA 4LV8B 2DFNA 1KSJA 2JASA 1T8UA 2UZ3A 4DLSA 4DSOA 3ZVNA 3LY5A 1E98A 2GCNA 4LHWA 821PA 3KXKA 2VHUA 3QEOA 2EVWX 2ZE7A 4ZI2A 5JSZA 3K9NA 3FE2A 3D8BA 1E9AA 4AURA 2ZEJA 4V02A 2D2FA 4LC1A 4UXHA 1J70A 5JWRA 3GFTA 4DEXA 1NNEA 1WQ1R 2ZI3A 1KSGA 2QAJA 2W6ID 4TT3D 2VPPA 1OHHD 4LRWA 1OB5A 2ECKA 1ZD9A 5F3WB 2HLDD 3WHLA 4LYAA 4LJ5A 5EXPA 1IN6A 3CF2A 3IUYA 3QPWA 4UJ3A 5CDFE 4HAXA 4ZV4A 1CKEA 5CJPA 1CJTC 3T06B 3FOZA 4B3BA 2O0JA 3SS8A 2RGXA 3T34A 4LY6A 2I1QA 4QC2A 2WVJA 3TUJC 5KSOA 1VG0B 2ZRFA 4TWZA 1NIPA 1N6NA 4AYXA 1T3LA 3FMFA 3R9WA 1L2TA 2FG5A 1N5IA 4QNRA 1JBKA 1ZC3A 4UXIA 1JJVA 2LCFA 4QKQA 3PENA 2WMOB 4ZDWA 3AVWA 2F3TA 1NP6A 4UNRA 2JLVA 2BKEA 4O2LA 4NYMQ 4XIGS 3DOFA 3IO5A 1O87A 1VYVA 4IDQA 3QIAA 4RZUA 4URUR 1KI8A 2QMUA 3RABA 3FMOB 4A82A 4NZYA 5KO2A 1KO5A 3BB4A 4KI0A 4B75A 1U98A 3U2QA 2ZQ5A 1IN8A 4B76A 5DN6D 2AFIE 621PA 1KK3A 2FFBA 4M1SA 5EE0A 3SQXA 4M9QA 3THWB 1DO2A 3JZAA 4LJ7A 3PCRB 4OJKA 3ADDA 5E7IA 3BGWA 5BN5A 5AUNB 4NCIA 2RHDA 1FPMA 1G21E 4M1OA 3GLGE 2BEJA 1XPRA 3KQUA 1UF9A 3LA6A 1YZTA 2G0NA 3K53A 3X1YA 3VNUA 2OBNA 2VP4A 5KHOC 1G16A 1CRQA 4WXRA 2G6BA 2GHIA 3BE4A 2ZETA 1HTWA 4MUAA 5EXTA 3CZPA 5IK2D 2A2ZA 4V0LA 1MH1A 2AN9A 1D5CA 4R2HA 5HKKD 3SEAA 3ICQB 1U0HC 4HLUA 4A0FA 5CK5A 3QSYA 4RCYA 4D82A 4MGIR 4IDHA 1A82A 3C7KA 2NGRA 1PVOA 3IKJA 3KQKA 3DOEA 3M1IA 1DAEA 1JR3A 5AWFC 2NZ8A 2MSDB 5LB4A 2OO7A 5L3SA 1RRCA 3BD9A 2WBLC 4US1R 4C0JA 721PA 3U60B 2QM7A 2BMDA 3Q3JB 4LV5B 3DEFA 3MUFA 3G0HA 3BK7A 4Q4JA 1R0ZA 4WZAE 5EE1A 2J3EA 4O25A 4PFSA 2QSYA 2JAQA 3NH6A 5KPDA 4KXFB 4BLQA 2R6GA 2JLSA 5FPYA 3MMPA 1KNQA 3KTAB 3QG1A 4LHZA 4MGYR 3TJZA 1DPFA 4AK9A 1DAGA 2QAGC 2XJ9A 3DHWC 1NKTA 2OAP1 1ZRHA 4PAOA 4QL3A 4MKIA 4ON9A 4D0LB 2QE7D 2LWIA 2VF7A 4WIAA 5AUOB 2V7QA 3U7EB 4A36A 2BHRA 4GMDA 4YXWD 2YV5A 4JLMA 5HKKA 4QBIA 3THXA 5F9FA 1AQUA 2IXGA 3N2EA 4TMVA 2OXRA 3NEYA 3W5IA 3ZD6A 1QHNA 3QBTA 4Z8YA 2KE5A 4KFTA 4TYNA 2PX0A 1IXRC 2V6IA 3MAAC 2HV8A 2H7VA 3EZFA 3SBEA 1YZKA 3CWZA 3IIJA 4FINA 1TQ6A 4R2IA 2ZJ2A 3RS4A 4BLOA 2OV2A 3QXCA 4PHFA 2IL1A 3LX8A 1HV8A 1NVUQ 4V0OA 4W5WA 1JXOA 3K9HA 2NO9A 1IQPA 5JRZA 3U6BA 5JWHA 3R9XA 2JJ2A 1FL9A 1VYUA 2CLSA 3QI2A 5DN6A 3EARA 4LPSA 4DLZA 1VIYA 5DIFA 4TTPA 4ITRC 5DLQC 5EP3A 1OH6A 1XTSA 3C15C 3B82A 3DZDA 4RZ2A 3MGCA 4P4SA 2CXXA 1P2SA 4YC7A 1EK0A 2C78A 1PLKA 1CP2A 3E2IA 4MUBA 1WA5A 2YOHA 3IIMA 2PL3A 3ONWA 4B2LA 2IYRA 3RWOA 3SI7A 3TBKA 3KQLA 2QGNA 5L3VA 2GA8A 5M04A 1E0JA 1UDXA 4OJQA 3RC3A 3EWAA 4LJAA 3L8ZA 1WP9A 4XSHA 2H57A 3GEIA 4EFNA 2ZI7A 4LPKA 5HCIA 3ND8A 4TQ9A 2A78A 2OSBA 3DMDA 1KK0A 1Z28A 2UZIR 3HWSA 1ZCAA 3P1JA 4EQ6A 3NHAA 4JKYA 2NO6A 2JCSA 1ZD8A 4I1OA 3M0EA 4ZDJA 2ZYWX 521PA 4FCWA 3ASYA 3TGPA 3C14C 2JLQA 4TT3A 2QRZA 1M34E 1DBSA 5KNCA 3NDPA 5EE5B 5CK4A 1J7KA 4HDOB 2DWOA 3PEYA 4ACBA 4M22A 1WE2A 1ETUA 3KJEA 4L5BA 1R5BA 1W0KD 2HF9A 1BYIA 1PUIA 3QKUA 1EGAA 2WJYA 2C03A 2AHOA 3ZGXA 4BLTA 4DCSA 3BJIC 2H16A 1JPNA 1RE0A 3R9IA 2PH1A 5A0FA 4Q48A 4AKHA 3HPQA 3W8NA 4ERNA 5GADl 5AUPB 2W0SA 1U8ZA 3OZXA 3RC8A 1DELA 1ELOA 3CW2A 4FXPA 1AKYA 4NKRA 4NHOA 4EPYA 2PJZA 4XWAA 2O8BA 1HQYE 4O2RA 3EC1A 4TYWA 2FSIA 3K0CC 4RZXA 1Q44A 2EFEB 2IYQA 3HU1A 1QHXA 2XXAA 3RDPA 1UEJA 4D2IA 2E1RA 3KKNA 3Q8XB 4XVQA 4IVQA 1SULA 5F9HA 1FMJA 2FFAA 3QNUA 1JAHA 2O0HA 1X8JA 1KK2A 3MD0A 5EUMA 1E0SA 1G4AE 3A4LA 4M53A 4PSVA 5BW8A 3GEEA 2NOAA 3LAWA 4MYTA 5CB6A 5DE3A 2G3YA 4HI0E 3DPUA 2QPTA 4DEYA 2ZRGA 4FMDF 3EPHA 4HUQA 2F9LA 1QZXA 2J59A 2YINC 2H17A 3ZIAA 3NXSA 4UJ5A 2GESA 4BFSA 1W2HA 2D7CA 5DI3B 2KBFA 3KKQA 3QKRA 3KTAA 1M7BA 2XSZA 4Q21A 3AVUA 2PLFA 4Q03A 3HR7A 3AKYA 5C46F 3BFXA 3W6NA 3VHLB 4GDFA 1JXMA 2MSCB 2C9CA 1PUJA 2IK8A 4C0QC 1KHTA 5KNDA 4Q1EA 3U3RA 2VSXA 1U90A 1XEXA 3KL4A 2IC5A 3KXLA 4B3XA 5CM8B 1RRGA 2FGJA 1E9BA 2ASEA 5J47A 1IY2A 2BBOA 4JVNA 1I2MA 4LV6A 4X8HA 2WWHA 3H1TA 3LBNA 3UKDA 3ADBA 2VP0A 2ZAMA 2Z0MA 1FUKA 2GK6A 4Z51A 4MGZR 4NTZA 4YDHB 5B2ZA 4GRAA 4EAQA 4Q7LA 5P21A 4B3DA 3THYA 4K46A 4Q9LA 3U3JA 1E2IA 2GZAA 4JLNA 3AM1A 1ZCBA 2ZR0A 4QG7A 5AUQA 1XP8A 4D0NA 4Y0AA 1CS4C 1R5NA 1VMAA 1F6BA 2CEAA 5FL7D 4PC2A 2FPKA 1NBMA 1GRRA 4IFEA 2CHGA 4KLZA 3PUWA 3UPUA 4CRWB 2VEDA 2JA1A 2H8KA 5GVRA 4CYMA 1XJQA 4V0NA 5FUYA 2GJ8A 3LXRA 1S96A 5FOWA 3EIEA 3ADKA 4IFBA 1KI2A 1AN0A 4FCVA 5ANRB 5GJVC 4DLTA 4B48A 2EYQA 2QL6A 3PJRA 3EWSA 2EQBA 1P2TA 4IOKA 2ZJBA 5HZHA 1DAMA 1GKIA 1Z3IX 2QMEA 4FCTA 5DI9A 3GLIA 2H5EA 1G291 4DB4A 3UG6A 3PXGA 2PEZA 4JMPA 4A0GA 1WRBA 4B73A 5FTMA 2DBYA 5LBIA 5FBLB 3EPKA 3OEED 2GXSA 1IN7A 4IVRA 3Q7QA 1ZW6A 1QHSA 1IY0A 2I3BA 1VTKA 5JECA 3GLIB 3VR6A 4HATA 4P3YA 2BKUA 2WWXA 1KO4A 5CIQA 1COWA 1LVGA 3RYTC 4ESVA 2GAOA 1RW4A 3I4LA 4TMZA 4NDZA 2XB4A 3FHCB 3O8BA 4L15A 2J7KA 4TLCA 5FOVA 5E7MA 1IAQA 2QMOA 2UVQA 2XZLA 5JEDA 5G41A 4QM7A 1KI4A 2J5XA 5JEEA 4A8JC 1TTTA 2J0UB 4H1UA 4D4MA 1GOTA 1Q20A 1SXJB 1OT3A 2FGKA 1OXXK 1P75A 1LS1A 1VCOA 1NY5A 3RS2A 1D2NA 3K09A 1G5PA 3OESA 3A6PC 1DARA 2DWPA 4KVGA 2CCGA 3B9PA 1XNJA 1BIFA 2NTYC 3LVQE 2IUUA 4D4JA 3V4RA 2DB3A 1P2VA 4JL8A 4LCBA 3VMFA 5FBRB 1G8GA 2A9KA 3TAUA 1E1QA 1VPLA 1G8FA 3CX7A 4H1VA 5FUWA 2FV8A 2ZVQX 3BIFA 1BOFA 1XXHE 5KTYA 1XEXB 4B47A 2GILA 2VHTA 1XMJA 4BQSA 1L7VC 1TPZA 2JIZD 1P60A 3GLIE 2MSEB 3REGA 4B3FX 3FFBA 2GCOB 2BMFA 3FKQA 1ZM2A 2V9PA 1GNQA 4ZI3A 5D3QA 1YRBA 3T5DA 3KB1A 5AJVB 2IBMA 3QF4B 4B71A 2CHQA 2FSGA 5SZIA 1KI6B 4RD0A 2CNWD 4C3ZA 3AUYA 4FI3C 4FW9A 3F3YA 4OBEA 3MFYA 4G5RA 3QVUA 2DYKA 1E4YA 1K5GA 1SGWA 2G1JA 1JB1A 1VCMA 5JHGB 5KPJA 3X1ZA 4M9XA 3OE7D 1G64A 5FI1B 2BWJA 2QTHA 2PCJA 4I4LA 4M1TA 2FEMA 221PA 4G01B 1QHYA 1E4VA 1R2QA 2FWRA 2OILA 3GLFB 3ZYCA 2NMVA 2WOOA 1RIFA 1HURA 1GILA 1F60A 1FMLA 1QG2A 1E2DA 2PBRA 2G1KA 2C95A 3H0KA 3K0EA 4EFMA 3TW4A 4CEJB 1N5LA 1R4AA 5TY0A 4D80A 2ZRPA 2YOGA 5K8LA 3U61B 4F4IA 1ANKA 2ZSFA 3ZIAD 4JLOA 4FWIB 1YR9A 1SVLA 2W0MA 1S0UA 1FP7A 4TMKA 1Y3AA 2D06A 3I61A 4BZQA 3K1JA 4MYUA 5KDLA 3RVBA 2XOKA 2QMHA 4C2UA 1ONBA 1X8KA 4ILEA 1YE8A 2X77A 4IDNA 3EXAA 3BRWD 1P73A 1XBTA 1GNRA 3NG1A 2GZHA 3QF4A 4LBVA 3DMNA 5FR1A 4C0BA 4WBSA 4AIIA 3VTKA 3BBPA 1A4RA 1N5KA 3EASA 5HPYB 3BH0A 1BMFA 5EZ5A 2QEQA 1XD2A 3EX7C 1S1MA 3IIKA 2ATXA 4Q1DA 5L3RA 4FIDA 4R71A 4A8JB 3P20A 4LUCA 2JLWA 1KY3A 1KYIA 1QRAA 4E07A 1XFAA 2Q9CA 4HUQB 5CJ2A 2ZS9A 4QBFA 5BQ5A 4AD8A 4Y0VA 1XTJA 3V00A 3SFVA 3BAFA 4ACAA 2ZANA 2IS6A 1EXMA 2HYDA 2XNSA 3QG5A 2DFTA 2RHMA 4C4PA 3SBDA 2W2TA 4QNMA 3LD9A 1E2FA 2D74A 2P3SA 4JLBA 1U81A 3WYFA 2WSMA 2IHBA 4CEJA 3E70C 2R44A 3FFAA 1SVSA 3GJ8A 4PQYA 1XX6A 2PT5A 1LF5A 2GZDA 4R98A 4AKIA 4OHVA 4HB2A 2QTFA 1KGDA 2IEZA 1G5RA 3KKPA 1GL6A 2QT0A 4QHTA 4AWXA 2FE4A 3T1QA 4XD7D 3SN6A 4MRVA 1VECA 2IUSA 3QJYA 4BLSA 1DE0A 1OXSC 5B64A 4CVNA 2B7BA 4JT2A 2E9SA 2AXPA 3NKVA 2YWHA 1VCNA 3ZS8A 1FW6A 1GDDA 3EC2A 3P26A 4QXAA 4AYTA 4MKFA
chains in the Genus database with same CATH superfamily
3F5QA 1M1YB 1ULAA 5ECYA 5F1KA 4CIVA 2MIIA 1XZQA 3TK1A 1VE6A 2FMIA 3H2ZA 3ZE7A 3HCDA 1TD1A 1Z0DA 2B9VA 3GG2A 4CN9A 1ZKMA 3A31A 5BY2A 2FP4A 1OWMA 1Q16A 3OKCA 4F3KA 2JFNA 3MAGA 4BVBA 1PJCA 2B37A 4JODA 1CV2A 2X13A 3UXEA 2CGEA 1Z0JA 3HGMA 3IQGX 3ENVA 4R9VA 1Z08A 2HRQA 1SKQA 3FD8A 4KOEC 3RUIA 1YR2A 1W49A 4KPYA 1X2BA 5FNVA 3OLWA 3T3DA 2Q3DA 3A6LA 3LUJA 2L18A 4F85A 3CPEA 1T9CA 1GU1A 2COEA 2X1VA 4FZ3A 2GD1O 1J99A 1NBIA 1T4DA 2BFWA 2FKAA 3CNOA 3LFTA 4FI3F 4BVGA 1EGHA 3NVKI 4TS1A 3H5WA 3A9RA 2BHSA 4N0QA 5EQTA 2OCAA 4UTNA 3ECSA 3FYDA 1GSIA 3CEPB 3WAGA 2ID9A 4QPJC 2WC1A 4N0EA 5KX5B 2ZVPX 5JD4A 4JP5A 5J40A 1N2EA 2HF2A 2I33A 2IXAA 2F6RA 3DGFC 3OLXA 4BO0A 1L4NA 2H1IA 4MYDA 2VR1A 5KCMA 5LBTA 1RWXA 2P9GA 4JBYA 3L7AA 1OTHA 1N6KA 1P0IA 2C98A 4YCAA 5CEJA 3L01A 5E7JA 5AK5A 1SXJA 4GI7A 4NU0A 4PRZA 2IKSA 1SXJD 3NNSA 1KYVA 2ZUCA 4Q1CA 3G8BA 3GLUA 5H81A 4EH1A 4GIBA 4QHYA 4XCQA 1GZVA 2PMDA 2H51A 1E32A 4YT2A 4WFIA 5JVDF 3CLUD 1ZOPA 3DLCA 5A7GA 4MK4A 4CUZA 1EUYA 5TVGA 3ZH2A 3OZIA 1PP4A 5LQRA 3HYCA 2GF0A 3UMRA 5C4IA 2EG5A 3MTDA 1FPQA 4LDQA 1T9DA 3V80A 1G20E 4R9RA 3GIWA 4CM6A 5BN4A 1I01A 3VGJA 2WWWA 1G2IA 2ZBVA 3K0SA 1NDQA 4M7PA 4MZDA 3IKTA 4IEIA 3G1UA 1FB5A 2N1MA 3RBZA 3UJBA 2GYYA 4R4JA 4FX2A 4RABA 1C9DB 2XWJI 2W8BA 2YASA 5CNJA 3DM9B 1EK5A 5HTOA 4EYEA 1ZYUA 1NJFA 4Q4HB 1L4HA 4XE5A 4DA7A 3QU2A 4EITA 5C2JB 2H85A 2ID7A 3VH1A 4RPIA 1J20A 3FPGA 3JV7A 4PTLA 5AO9A 4AULA 5I9LA 3FFWA 1RYBA 5TMEA 4BQIA 1DS6A 3MTEA 4Z53A 3NHPA 3W5JA 1ODTC 5AMXA 4FMCB 3LQ2A 3VH2A 1OA0A 1GTJ1 3W9YA 2I4IA 3LUAA 3F3KA 4B0OA 2BEUB 3VKGA 2HD4A 3I1FA 1XDDA 4B4OA 2ILVA 3MMNA 5DGXA 3LT4A 4ZVKA 4FMPA 2DWQA 1QO7A 3SQOA 1W48A 1WY7A 3SKXA 2VCHA 3LBYA 2NO7A 4LYHA 2CFSA 2R6FA 2JHGA 1C7QA 1O77A 4HAVA 2CFIA 1HORA 1F0KA 4Q3BA 1NUSA 4AJ2A 4CMEA 4EENA 3L8MA 2X4IA 3CKMA 1R4ZA 2AG1A 1FOEB 2PRYA 2JGNA 3TAHA 3CLVA 3AB7A 2HK6A 1DC8A 1MVNA 1FYVA 1I7NA 1ECGA 1KJQA 1BWRA 3M2PA 3PI7A 4LYFA 1KJ9A 2GRJA 3H9CA 3FR7A 4OHOA 1IHDA 5HIAA 2ZI4A 1G20B 3K9WA 4UUPA 5HQ3A 4BN0A 5AK4A 4D57A 4D45A 4W7SA 1XDBA 2Q46A 1XQWA 5CA1A 1E1KA 4DBLC 4IFTA 3LCUA 1ESMA 3PX7A 4YUXA 4U2BA 3AOEC 2XGOA 1Q7EA 1UOQA 2QRUA 1K7EB 3BCHA 4I8DA 4R9UC 3VDMA 4BMYA 2XB2A 5AJUA 2B94A 2YQ5A 4KZPA 1B73A 4CT4B 1HY3A 2IHYA 1RCFA 3P9RA 5EKUA 3HWX1 4YRRA 1RLOA 1SUBA 2CSUA 3AZOA 4ZO6A 2REQB 4IDDA 4PZDA 2QT1A 2B8NA 3L07A 4RAQA 4U7WA 6REQA 1BS9A 3OFJA 3HY4A 4JI5B 3CVYA 2LKDA 1TUBA 2R5FA 3JYLA 4KMSA 5L7WA 2MCFA 4DJJA 2O8FB 1EWQA 5K8CA 1TQ8A 4LZNA 3DWGA 4AMGA 1IHYA 2GBIA 1YNOA 4WN3A 1R6XA 2VWPA 4FFLA 1U99A 4ARAA 4BO9A 4F9FA 3RU7A 3H7IA 3ES9A 3G3EA 1IJBA 4PW0A 2FPOA 4XDHA 5BSVA 1IOZA 3ANLA 2XADA 1OXTA 2DH6A 2PKRA 3JYQA 2IZ7A 2GTHA 4KL8S 4MNTA 2W4IA 4PCVA 5EWMB 5G1NA 2CXUA 1J8YF 3HP7A 1U2SA 5HTKA 5AVUA 1EK2A 4FQ5A 3VR6D 5GZ1A 3MJFA 2FPLA 4OHWA 4YP7A 1I1OA 3FBGA 3O82A 1X86B 1XJ0A 1FCJA 3WLSA 3OZEA 1LSUA 3ZYZA 1MH9A 2V4ZA 4LZAA 3A6HA 3IIEA 3U13A 3T3MB 1SUDA 3PEFA 4DUYB 2GCEA 5TC4A 4TMYA 2EZ4A 4QLBA 2YTZA 2QSZA 1RP7A 3SXUA 4RA6A 1T4CA 2CXQA 3FTCA 3I2KA 2ZTUA 5JZVA 4ZXFA 3IQDB 5B2EA 3CF4A 2WE7A 4K6FA 2FRVA 3D7RA 3KSAC 2PLWA 2DUMA 1NUTA 4N5DA 3NVDA 2VJQA 1GZUA 1DAHA 1T4CB 2J3QA 3E4CA 2VAVA 1NV9A 4OUDB 1BVUA 3OVMA 3L92A 4UPVA 3UJ9A 3KQNA 3M81A 4YUWA 5KUTA 4MZXA 4DUZB 3U4QA 1CJCA 1L0BA 1OLSA 3IJPA 3PS9A 4M7OA 3DXXA 3PKIA 1WUIS 4DW8A 2YZ2A 1P3Y1 3RBVA 1TUIA 3GP8A 2J4FA 3QOYA 4DIMA 1YASA 3CR8A 4AZ0A 4CQJA 3C6BA 3I5MA 2IP2A 1L4YA 2PT9A 3P2KA 2NG1A 2VJAA 3EISA 3LVFO 1QCCA 4TUYA 4UAUA 4XVHA 5A9SB 5DGCA 5B5SA 4H1WA 2GEDA 2UYOA 3E1SA 4PLHA 3IRVA 3A2KA 3AEZA 1GGEA 1W88B 3K5WA 3OCUA 4PGGA 3AHIA 4Q7MB 2IIPA 1A69A 1M2GA 1DLJA 4ER5A 4IH4A 4I55A 4IDPA 4M7WA 5EFZA 1YR6A 1P8JA 1J22A 1U6JA 1GWNA 3JR3A 4KQMA 4QM6A 1Z39A 1MO2A 1AGYA 2Z2JA 2AA3A 2YC4C 5H9WA 3BFVA 3OP4A 2ZRKA 1XI2A 1TL7C 3OAAA 2HF7A 5TSDA 4GZ5A 3CR7A 2WA2A 4KWEA 2WZCA 3BCRA 3KWLA 4RVGA 1JZTA 4C1BA 1GNPA 4KITB 1OIVA 1E1QD 2P9FA 5DM70 1AM4D 2EHDA 5JAZA 3BDAA 3AV3A 4RACA 1UBFA 4EA7A 1E4EB 2BCJQ 1O3YA 5C5EA 2J41A 3V5NA 1NI4A 4L72A 1AVTA 2ATCA 2QSJA 1RZUA 3RJTA 1JTEA 3VU8A 1ST2A 3HZRA 4PZEA 3PYXA 5DHAA 4N82A 4IPTA 3LPNA 2C2GA 4DG9A 1NW4A 1D6MA 1XDZA 2D62A 2FVYA 2R2GA 3ROQA 3WJ1A 1QKJA 4GLBA 5KOYA 4RIGA 2GF9A 4WXPA 4ZVNA 2W00A 3T3IA 1ZITA 4IEFB 3OFNA 4B4VA 4RO0A 4F2GA 1YU6A 1P0PA 2JBAB 3ESQA 4MPDA 1J1UA 1P1CA 2W11A 4AN1A 3PF9A 3WLMA 2J7PA 1T8TA 3DE7X 2B4TO 4E5VA 3O8CA 1PQUA 3R7NA 2DOKA 3A9UA 3AWDA 2XMZA 1U3VA 3INNA 3RIYA 4B7CA 4DDHA 1S2DA 3UQZA 4C4TA 1DKQA 3DAFA 2J46A 2QNBA 1V7CA 1VKJA 2QTAA 4C2AA 1QVAA 1PZNA 1W2GA 2QL5A 5CEEA 5LMZA 4RJIA 4XX1A 5EI5A 2OHJA 2G06A 2GOYA 2ZB4A 1E6CA 2C7VA 1IY1A 1JIJA 2HSEA 2IU3A 2XDWA 4G1UC 4HB4A 1YS6A 1K68A 2HPHA 2AOTB 2Z1MA 2VYFA 3HXMA 4NAUA 3C3YA 3NTQA 5BWMA 3IAM1 1DJLA 2G5PA 2QHXA 3I1YA 4Z7NB 3FMPB 4JDUA 4EYKA 4EO9A 2AFRA 3RFXA 3PD0A 4K3VA 3PBKA 1QC5A 4FJ0A 1PZEA 3OM8A 4DA6A 3V7NA 1WHSB 3IOCA 4B31A 2CDBA 3AEKB 3AUJB 5JI3E 3QWIA 4RGBA 4N47A 1G8PA 2Y92A 1Q2XA 4HFMA 2IH4A 1PTKA 1MA0A 3O31A 5ICFA 3AQIA 3H5LA 3K8QA 2V54A 2O8CB 4BXOB 1OW3B 3I04A 3KJIA 4IXTA 4MP8A 1SZDA 3P0HA 1UXHA 4JCCA 4KJXA 2NZVG 3NVAA 3ZGNA 4AJEA 4EJSB 3AU8A 1BNCA 5JAOA 2OBLA 1QJ4A 3IJRA 1GCUA 1DOAA 1MABB 4KQGA 3SSOA 2DPMA 2IS1A 3BEOA 2BL4A 5F2KA 2WI8A 4WA7A 2NWQA 2ODNA 4D3YA 2MYTA 4XKJA 1L4EA 1ZM9A 1TA9A 3C6KA 3EH2A 3VNSA 2EKQA 4CLRA 3IHLA 4JP3A 4EKNB 5HGXA 4S04A 1R0BA 3HV2A 4NBKA 5JH7B 1GHTA 4MR9B 1TMGE 3HDQA 2CLLB 1BH6A 4IM7A 2GH1A 1P8AA 4DDMA 3AZQA 3L77A 4DLLA 1YCHA 2VG8A 1RMYA 2PPLA 1JJIA 1YJ5A 3BIWA 3EC7A 2YIMA 3H5IA 4W5QA 2FZCA 1XLTC 4FSHA 2PD4A 1EQUA 1OC4A 2CDAA 3ESYA 5DGIA 1CWUA 3UUWA 4EDHA 9MHTA 4TM8A 4B17A 4YYZA 4B32A 2O06A 2BF4A 3DZCA 2QG6A 3C98A 2CMKA 3IDOA 3TTTA 3WGQA 1C7EA 2P3QA 1X92A 5JO0A 3VZDA 3RIEA 4X8LA 4KN6A 4D0GA 1V6AA 1Z45A 4UFNA 4A6PA 1W4RA 1UBKS 3E1KA 3ELUA 3Q7IA 4JT4A 4DPLA 2O5CA 1HF3A 1BJRE 1RLMA 1JX6A 3U44A 3J7AC 5JSZB 3SK0A 3OIYA 4ER3A 3GPLA 1QHGA 3C3DA 5FNVB 3ON5A 4JVMA 4CLHA 5JAPA 4Z0TA 2YFHA 1MAVA 4DY4A 3THSA 1XNRB 2R7LA 4BFUA 3QWHA 1TC1A 3QU5A 2DFKB 1KKUA 3IYLW 4Q82A 1JXQA 3N70A 4ND8A 3VISA 3UYLA 1T0BA 4HFNA 1MPTA 4EELA 1I94B 2ZZKA 4GPBA 1GPWB 4EPRA 2P2SA 4NWIA 2ZCUA 1DDOA 4G3XA 3UMJA 1J2UA 1NU8A 4A2PA 1AO0A 2H06A 5KOHA 1CR6A 1A27A 1B0ZA 2ZWVA 3ZS9A 2VOJA 1U9IC 2CLCX 1NT4A 3FNGA 2ZWPA 4URFA 4FSXA 3DJYA 2AMLA 1CR0A 1ZM3A 4L1KA 1Y9ZA 2R8RA 1QK5A 3OAAD 1XCGB 1O95D 4CM7A 1M2OB 1P2BA 4J0DA 4RX1A 1YA4A 1L7DA 4K6KA 5DTMA 4CJXA 2Y0DA 1MJHA 1ISHA 4C20A 3R5TA 1AZSC 1WKCA 1VC2A 4IOJA 3L2OB 3JW8A 1YZHA 1J9EA 3QPVA 4GVPA 4D8WA 4A6EA 1Q3KA 5DBEX 1P6XA 2BDUA 2OENG 5EIOA 3RNLA 3V3TA 4Z3KA 4TVBA 5LQMA 3TN7A 2G04A 2CK3A 3FKSA 5IT4A 1T2CA 2O2CA 4CCAA 3GLSA 3MUNA 3MM4A 4LISA 3OEHA 2EL9A 3PNOA 2IPOA 2BI7A 2Q0HA 4KK3A 2AJDA 1V9LA 1K63A 2Q5CA 5EPEA 3UOWA 2WJZB 5ALDA 2RONA 3EG9B 1X7XB 4PVCA 1ETHA 1JGTA 4I99A 2YJ4A 4AUEA 4CIBA 3IAXA 1XF1A 3HGTA 2E4UA 2NZ2A 3WK4A 3F3MA 4KMRA 4Z8XA 5KJ6A 4OATA 4GMFA 3X1XA 1YQXA 1IUOA 3L0IB 3KBBA 3NAGA 3PPIA 1QOPB 3UWSA 5C1OA 2PS9A 1QUFA 1ZUIA 1JVBA 1TF5A 2WF7A 2Z5FA 3L4BC 3AUXA 1M2KA 1JEQA 3PGJA 5FLEX 3OX2A 4CDMA 2NSYA 4EL5A 1G0OA 3H97A 3DLTA 3MMZA 4ENVA 3I62A 1UEIA 5AHXA 1R4NA 2C4VA 1TRKA 2EIHA 1Q91A 3EA0A 3OOSA 4JEHA 2AN1A 1QTNA 4S35A 1G60A 3G2PA 2VJDA 2QVXX 2OO3A 4PLTA 5A4JA 1SOWA 3CZQA 3EH1A 2E5WA 1JQDA 4JXZA 1FXWA 1ZOOA 2H5IA 4C6HA 4BFWA 3QTBA 3T1VA 2C7PA 3IB3A 2AF3C 1DEXA 1LQUA 5CA1F 2WJGA 1GZ7A 2Q3LA 3VZBA 5D7BA 4LBYA 1HLFA 1EM6A 3ICVA 2WIFA 3LWZA 4G4SP 3OIFA 1M75A 4G5HA 3I9JA 5FBHA 5DHQA 1B00A 5EIBC 3RAJA 4RK4A 3AQ4A 2WIBA 4CMEC 1CUHA 3DB1A 1ZH4A 1CR2A 3C3KA 3TLJA 2JG3A 2WWRA 1V37A 1TIPA 1U65A 3K0AA 4FZVA 4ZXPA 3LKVA 4URXR 4EARA 3Q11A 4WCFA 5HMMA 5G2OA 3RLFA 1L5FA 4ADSG 2ZIFA 3OQHA 4BB0A 1C4WA 2RH4A 5L3ZA 4AI6A 1JYFA 1NMEA 1O58A 4C78A 2V97A 1ZDMA 2WWIA 1IVYA 4AL4A 1MW9X 4GPTA 1A9TA 1ODSA 2DJIA 2HQRA 3H86A 5SYMA 3SHQA 3CVJA 5DMXA 3WFJA 4GGOA 1N6OA 2F8LA 3C3EA 3FA2A 2CNLA 3UHOA 5CB4B 5JDCC 3ZHRA 4Z3OA 1JQ3A 1FLAA 4YJ3A 3A1CA 4QGGA 2V7WA 4PAMA 3ZZNA 2XH8A 1YS2X 1PD0A 1XL0A 3FHLA 2D54A 5HKOA 1I3NA 4IIJA 3W79A 1P1FA 3BVPA 4PPQA 4O5AA 4MV6A 4IOLA 1BG6A 4R0NA 5DBOA 4WUVA 5KNBA 5FV4A 4QO8A 3B20A 3VOBA 4EPWA 1DWUA 3G1WA 1GADO 5KMGA 4I2NA 5FWAA 1S4QA 3S2GA 3TL3A 4D9EA 1Z22A 5DFAA 1JZQA 5JAQA 4CV1A 5LXTA 3U5ZB 2VF2A 1KEUA 3I28A 1R0XA 2GCOA 4RTNA 1QGDA 4N12A 1RLUA 4F2PA 3P9CA 2WA1A 3SOPA 4ZYWA 3LKDA 3Q72A 5AW1A 3C7CB 1HYGA 2P6OA 3IJ5A 5IC4A 1NNSA 1NSFA 2HHLA 3R5XA 3B38A 4E1AA 3GQBA 3DWIA 2H52A 1M3SA 1UM9B 2Q3CA 4FXOA 4HDSB 4WY2A 1P2DA 4YECA 2I3AA 4ZV7A 1QLWA 3KTFA 5EAIA 3HB4X 3SHVA 1IZ7A 1U9CA 4IGIA 4LYYA 1BVYF 5AJTA 3W1WA 2C88A 4X93A 3TD2A 1WNTA 3CSSA 3MSCA 3IV7A 3VU1A 1UBNA 2HJGA 2PUWA 1DBQA 5A05A 4PO8A 3B52X 3BPSA 1X9IA 4Y9SA 3UN1A 1ZGCA 3BH6A 2HDHA 4PHGA 4KBYA 2GA9A 4DCGA 1JKJB 1KH1A 2GAJA 3ZY2A 3A1VA 4HUTA 4MO2A 3PGVA 4HNQA 3IUPA 4UHCA 2XA2A 2VPQA 2VAPA 5TRTA 4ISCA 4M0CA 3D3EA 1UIMA 3OA2A 5JNLA 4X91A 3K1YA 2M2IA 4IIFA 1D5WA 1S1CA 3QVSA 2GM5A 2OXFA 4FGZA 3JQ9A 4GE0A 4MQLA 1XMXA 4KNWA 4RETA 5CYOA 5K20A 2PZGA 1K66A 4TLAA 1SELA 3LLUA 4EB3A 2JK0A 2FZWA 1AHNA 3CF0A 3ILXA 3UANA 3T5PA 3FPEA 3M6LA 4D5GA 4G0ZA 5EY5B 2O8EB 1BKDR 1GUFA 5JMOA 3DFFA 2ONCA 1V7PC 1S8NA 2ZTMA 5EHIA 2Q3FA 1CSEE 1GTG1 3EIHA 3OEYA 3BWVA 3DM5A 4Y2JA 3TBHA 4AY2A 2RHCA 2EFYA 2ZG6A 4HNRA 4A5OA 2D5IA 1DEAA 1Y8AA 3EZ6A 4JJFA 3N8IA 4L0DA 1DKPA 1U0EA 1NF2A 3AP3A 5FLKA 4CW7A 3FDFA 1A9XA 1VA5A 4N7BA 2YX1A 1Y98A 1RQ7A 4BNVA 4MEBA 1Y3CE 2C20A 1QIGA 3K15A 1P0FA 4ZPXA 3UC9A 4U0KA 1WZCA 3UV6A 3IE2A 2AJTA 1ZLXA 4Y9RA 5IXSA 1ULUA 1M6HA 2HLPA 1O97C 3AWIA 1Z56C 4L8FA 4WKBA 1OJLA 1O0SA 1SCJA 1YDHA 1MDFA 4PZ9A 2OQVA 3VM6A 3Q9SA 4JC8A 3IOEA 3L8YA 3HUEA 3O83A 4N3GA 2F17A 2NU9A 3ZTWA 4NV3A 3IURA 3L0SA 3OHMA 3QRWA 4JA0A 1T3SA 3K30A 4ENUA 3OA0A 4FE3A 4HGZA 4NK5A 1GR1A 4XDZA 3VSCA 2GBLC 3SM9A 1K6IA 3KNZA 2R47A 2ZXEA 2A5FA 2YRXA 1P4GA 1LXCA 4UOEA 4R1QA 5JS7A 1PVDA 1K8RA 1UJ2A 4X61A 3DZGA 2A0YA 4FIZA 1J7JA 1E3EA 2MYNA 1KOLA 3GFFA 4D3XA 1MOQA 2BFCB 4NIMA 2IBSA 1NW8A 1T6NA 1N3IA 2A5JA 2WG2A 2A9VA 3ACDA 1JR3E 4GZLA 4ZO7A 3W04A 1SFRA 1W94A 1OYWA 1Y7LA 4K5QA 2C9DA 3R5SA 2BC9A 5GAJA 3AY0A 3ZGVA 3EVZA 4EB8A 4RY2A 1KY2A 1PTJC 4EVQA 1PJSA 3WYGA 1B42A 1QFXA 4TKUB 5FA5A 4E31A 5KOHB 1R5OA 4YROA 1TO2E 2P0YA 1JYEA 1W4BA 1Y48E 3E84A 3AR6A 3L93A 3GEGA 2O4UX 2A1TS 3PYLA 4K81B 3O6VA 4CLOB 1NJGA 3HBMA 1KBQA 4IW3B 2CJWA 2F4VB 3IPXA 3JD1A 1YUNA 1AN9A 1X9HA 4RF5A 2WKWA 1IBRA 4QQRA 3B3JA 3O8DA 3OCCA 3OLQA 4XGIA 1SM4A 3DMHA 3WLHA 3WWCA 5ETJA 3H87A 4J91A 2Q1SA 2EP8A 3TKLA 4CQLB 4D46A 1ZOIA 2ODQA 4AJOA 1VZ3A 1YDEA 3HDJA 4JI2B 2Q3EA 5H5JA 5BOSB 3WGTA 1NOKA 2CNDA 3IT1A 1G3QA 2NYUA 5EJFA 4GL2A 3LIPA 1TAGA 2CYCA 2BE9A 2PQMA 3WMFA 3VYTB 3M82A 3CVVA 2XCUA 3EGCA 3V4ZA 5EERA 4JC5A 3RM3A 4JFRA 3TNJA 5BOSA 4LAFA 5H70A 2F1IA 1QWOA 2C00A 2C2OA 2ZRNA 1QANA 4QPCA 2GR9A 3MSXA 2Y8EA 3PI6A 3LT2A 3QY9A 4OU5A 5E6UB 2I80A 3RYHA 4BUCA 1RZRA 3CLKA 1JSLA 3T0GA 2O2JA 2D00A 2OLEA 3EIQA 4KGZA 5C0OE 4ZOCA 3K3PA 4RWZA 3OT5A 3C5VA 3CUWA 3F96A 1DWQA 1YR3A 3OPVA 4UPEA 2QX6A 1Y0BA 1NRJB 2P6MA 3KWMA 2ESRA 4M1YA 3NASA 2QWXA 4S0XA 1GUZA 4RD3A 2AYXA 4U1RA 1LD3A 1FSGA 3PIRA 3BMNB 3IRUA 4JXJA 1GAXA 1I3OA 5EMMA 5CFPA 2DZDA 3QUTA 2PKQO 2F43B 4LGVA 1AKEA 1N2HA 1NN1A 4MVJP 5IFKA 2XYQA 2JIDA 3FPJA 3QHAA 4QTYA 3CG0A 4OVKA 2JAPA 3D0OA 4ZJZA 4F86A 2HY7A 4NCKA 1CUJA 2JL1A 3CNLA 3FPHA 4I66A 1U9JA 4GICA 1E79D 4N5MA 4YJ3F 5L4SA 3WA7A 2HHCA 2PSSA 5CT5A 5CW2A 3QENA 5AOCA 4TMXA 3NAZA 3AC0A 1G5HA 2QF7A 4HGNA 4DMLA 3CB2A 2W90A 4HN2A 5KX5F 3BYZA 1OX6A 5JS6A 4RAOA 1UPUA 3O7WA 3HZZA 5JSHA 4WD3A 3VV3A 3FNRA 3DCNA 3HQ4O 5EP2A 1V45E 4D9HA 2O2IA 2XOKD 4MPRA 4Y18A 4Z1MD 4K2HA 3AUKA 4RMJA 4HQFA 4TTVA 3MCWA 2ERYA 1ESEA 3QYPA 1U8EA 4HB3A 3TB4A 3WQBA 2YCBA 3WYEA 3B6KA 4AJ4A 2FPPB 1QYCA 2GAAA 2QR5A 3IL2A 2GVNA 1RNLA 2P0EA 1JKXA 3TX6A 5HYVA 2VYCA 1E59A 1M2WA 4HXEB 4PX2A 5JQWA 2ZSBA 4F72A 3HJFA 4QVGA 4OH1A 2O3SA 4OP3A 2BW0A 4B80A 1Z0UA 4FZJA 5SYNA 3GLQA 5REQB 2FW0A 2ZRCA 1W5FA 1NQUA 2GZ3A 4FE4A 4M1KA 3VU9B 3PVSA 4L7VA 1EG7A 1NF3A 3Q3GE 5DGHA 4UUBA 1TU3A 1KE1A 1TOAA 1PTJA 4HQKA 4PZCA 3H5VA 2WYOA 2ZB2A 3W2GA 2BGRA 5C7LO 5I3ZA 3IBSA 4HSEA 1OLSB 5D8DA 4EA9A 4EOGA 1QF6A 2XDYA 3H2YA 4GE3A 4RXMA 2JGDB 4X0EA 5J3JA 1E3DA 4ZDIA 2VKQA 4J2HA 2H1HA 1TM4E 2CNWA 3E05A 4GPEA 3U19A 3BAZA 5JR3A 4PG8A 4V1CI 2MINA 2FEOA 3ZJYA 2YYSA 4CODB 3GLHE 3HV0A 4BMPB 1ULBA 2IYSA 2PMKA 4UKDA 4KR3A 4V0MA 1RHJA 3HM2A 3M4NA 4EKDA 1PBTA 3PUVA 3TRDA 3RT7A 4M8IA 2WKQA 2CZGA 5JAIA 1ZX1A 3ST7A 2H2HA 1P1JA 4N8DA 3NIBA 4NX2A 1JKJA 2PL5A 2QRQA 4FUTA 5DVZA 3UW3A 3ZQ4A 2EJTA 3C7AA 4WWHA 1C30A 2X15A 4CR8A 4E2ZA 2OYSA 1W0KA 4D4IA 4ZVUA 2BM9A 2PU5A 3BB3A 3AI3A 3JARA 4PQGA 3HSYA 2PWBA 1VJTA 4LJSA 1XTIA 4AKEA 4KTVE 1Y9AA 3HVIA 1LNSA 4HDNA 1AZLA 2VPIA 2LNDA 3KUDA 1H2YA 4FFBB 1ZCJA 3RS5A 3ZHSA 1PT8A 1T2EA 1NNLA 3RSQA 4J43A 4IV8A 2WILA 4EVRA 4B79A 4IDGA 1QIFA 3PUJA 1OKKA 3QXSA 3SU8A 1J2JA 1E79A 2PO7A 2NO1A 3B7WA 3DAOA 3GCZA 4ZQFA 5AVOA 1II8B 5CH8A 3H65A 5DNAA 2O8FA 1DADA 3M5DA 1LPSA 5ULLA 2BGKA 1XMIA 4KOAA 1QPGA 1HA3A 1PFYA 1ZWLA 3TZLA 3M6UA 3SCZA 3ZCQA 2Q62A 2X9GA 4MMXB 1CERA 3V2HA 5FBQB 3AONB 1I2DA 4KQKA 5KTNA 3AW9A 2EFDB 5BPHA 4Y7DA 2GPJA 2YXDA 1Q0QA 3U4QB 4WERA 3W90A 4MS3A 3ZWQA 2GGSA 2FW6A 1RXVA 4M6WA 3GN2A 4P33A 1PEDA 4YONB 1GAWA 1QF9A 4GNKA 4KXYA 4DZZA 1G6HA 1YT5A 2PWZA 4XFKA 3VAAA 1RZRD 2QZ9A 5K0CA 2H3EA 5K4GA 1CHDA 1JG2A 2B92A 4KLCA 3EUAA 1JNXX 2ZT5A 1B74A 2FWMX 3QVOA 3DEIA 1TQ4A 1WXGA 2WPNA 1VPVA 5D85A 4KXUA 1PFVA 2B21A 4NLLA 2Q4BA 1KRHA 4RPCA 5KWEA 1N78A 1ZM7A 4EA6A 4A15A 3PC2A 3I83A 1MABA 4BFTA 1H8ED 3QWAA 1RKUA 3NTXA 4K6GA 3R7WB 4PYIA 3SJBA 3ZKAA 4YCCA 4D74A 5AKYA 3RK0A 1RKBA 4N49A 2Q6VA 4MW6A 4OP1A 1A9SA 4PYQA 5IWCA 1O0CA 4S2UA 2BONA 1ZJ5A 1H2ZA 2XE4A 4CTOA 1AOXA 4YMVA 3NRBA 1MJGA 4IDFA 2V0GA 1L4BA 1ZMOA 3IP3A 4D1YA 4IMJB 1G1AA 1QBGA 2YHSA 2OZVA 5KNCD 1A71A 1OFIA 2BEKA 4PIPA 2HMAA 3CXRA 5JY1A 5H3LA 2VC2B 2IXBA 1K4MA 1XTRA 4MQEB 4NMMA 3WLLA 3FOAA 4Q02A 4YXWA 1TF2A 1UPTA 1R0WA 2BEVB 4RE6A 2V7QD 4IJMA 3WQRA 5A0VA 4JB2A 2SKDA 4QARA 1TCAA 4TKVA 1KQOA 1N2BA 3ONFA 4WQMA 3G17A 4RMHA 3RRFA 4I4TB 4JOCA 2GUWA 1CVRA 3GGDA 3L6DA 3ZZTA 4Q4AB 1HG0A 3RARA 1VYHA 3HTXA 1ZA1A 4WEQA 1EFCA 3TLXA 1RHKA 2R48A 2CLEB 3WDMA 1WWKA 1SBNE 3D59A 2L0XA 3N59A 3UJ3X 3WV4A 1A2OA 4FJ2A 2IEYA 1UT8A 4HNSA 4OOEA 1T9KA 5I7RA 1U3UA 3U4HA 3DOJA 3SVLA 1KI9A 1JAIA 1SVWA 4IUBS 3HCOA 2XITA 4E08A 2ZRJA 4B75A 1ZESA 1I7LA 3OCZA 1EUCA 4ZVTA 4GKAA 1G20A 5K01A 1NXVA 2QUJA 3NB0A 2OLKA 3SKYA 2XECA 4TKZA 4C87A 5HUQA 4XDYA 3MQ2A 2P2LA 4HPXB 1V5WA 2R66A 3F5FA 3WX0A 4DHWA 5F3RA 1PZXA 5K8UA 2YH2A 2XAUA 2NO4A 1KAHA 3HABA 4CTMA 5J58A 4IKPA 3WLEA 1ULTA 3F7TA 3MG9A 4OQYA 4C5BA 3O9MA 2OZKA 3ISJA 1WUJS 1Y1RA 2AD5A 1OZHA 1EA7A 2AJBA 2SECE 3UTCA 1QHFA 3ZNQA 1FP6A 2X1HA 3EZYA 2ZYSA 3IEKA 1JHAA 3W4KA 4A0SA 5JI2E 1RDFA 1Z68A 2HU7A 3BZWA 1JQEA 2ZBGA 2OCBA 1WCIA 1WMSA 1UANA 3C74A 1SU6A 3WZ2A 1VLVA 2P1ZA 1XLVA 5AR1A 4V0KA 3KPWA 4TTSA 5B3JA 1G8YA 2ATVA 3K72B 3N9IA 1FQJA 5ESDA 4Z5XA 1KAEA 4QQNA 4NJEA 3UGJA 4JASB 4O4HB 1Z6YA 2WU0A 1VGRA 4LW8A 4TTJA 1P1RA 4Y0NA 3U3XA 3ZBPA 4ZHQA 3CJRA 3VR2A 1NVAA 3N2GA 1PT5A 1FYDA 1X1BA 2VYND 4KGVA 2VTBB 5KSZA 4R2WA 4EI7A 4W5OA 2W6JA 3BH7A 4KLRA 3PFHA 2QE7A 2ZIXB 4RFLA 4KXLA 4P53A 3FIUA 3GEDA 3WBJA 1YVEI 5CDUA 2KLBA 3QLVC 1R7RA 4BFCA 3AF4A 4HNVA 3CUSA 3BIOA 3L0CA 3ORFA 2VF8A 2IY8A 2I6GA 1PJ4A 3WLAA 3HCRA 2Q3BA 1EFKA 5I45A 4ZWNA 5TV2A 4XLTA 1RPTA 1ISMA 1XPJA 3UQYS 3OO1A 4YJFA 1GQOA 1O6BA 3KYCA 2Q3HA 2O8EA 1TK3A 1QQBA 1ZHOA 1Q57A 3D0KA 3SC2A 3LF2A 2FWJA 4RKQA 2Y93A 1B0AA 1BWQA 1TK2A 4ZIRA 4N03A 4H3KB 3BF7A 4FW8A 1SAYA 1JA0A 3I34X 1E1YA 1NSTA 1ZRMA 2DM6A 4R8SA 4LF9B 1BHO1 2XX3A 3AESA 1R6AA 1QGOA 3IAUA 1YAHA 1DAIA 2GYWA 3PITA 3N0TA 4QGAA 2Z2YA 3WXBA 1Z2EA 1L7PA 3M9LA 2QAGA 1PG2A 3S4YA 1BXGB 4DCMA 3B1ZA 3U0BA 3WRXC 1EXVA 2R65A 4I5EA 2ATIA 4E6EA 4MR9A 3FNHA 3ZK9A 1ZNXA 2Z2XA 1U0LA 1ODLA 1FDUA 1QYVA 2JI4A 2YMPA 3CRRA 3K0AB 2VKTA 3RFFA 4OA5A 5JPDA 1GGNA 4NBVA 4NE7A 2Q7OE 2DPHA 4MVJE 1TYDE 4DC9A 1DUVG 3L8DA 4D0SA 1TQDA 5EJAA 5P8WA 2GF2A 5JFGA 2IHUA 2IY7A 4LZOA 2AEFA 1N4DA 2YHAA 4NOLA 5IYZB 3HKDB 3U7FB 1GLVA 4RHUA 4V1CA 1MNAA 1SKYE 3WQHA 2XDQA 4BVJA 2QENA 4FEEA 4CKBA 1E2NA 2WV9A 4JJ7A 3KZ1E 1GCGA 2O8CA 2A30A 1ZHHA 2FG7C 2UXBB 1PW5A 1DIBA 2WTBA 4G8DA 4TL6A 1CTQA 5HQJA 4ER6A 4Y3UA 3TLBA 3OTGA 3EBOA 3EIFA 3P7MA 5F21A 3SF8B 3C8DA 1DQPA 1O96B 1VRWA 2C84A 2KW5A 4G5GA 4LYJA 4AUNA 1FFYA 4JUFA 4E2XA 4O8ZA 4F8JA 2JCYA 1RWVA 2G72A 3W3AA 4DQVA 1DG1G 1VI2A 4KU4A 4LVCA 4BNYA 2HF8A 5HIJA 3FSJX 5D1NA 2G9VA 2QJTA 1II0A 2EJCA 3HCNA 4E6PA 4OQNA 3A37A 5LQNA 4IDOA 3LBHA 1HNNA 5LOVF 4YBZA 3OC6A 4ARBA 3C3MA 3ABSB 4X63A 2I91A 1JIIA 1I2BA 4GHWA 2Q9BA 1GKUB 1SIOA 2NUTA 1H1TA 5A5VA 4LJKA 4G9EA 5LWHA 2QPOA 2XWBF 3A3NA 2HXYA 2OGTA 4XWTA 3VR4A 4WTOA 1TI7A 4J7UA 2C97A 3EW7A 2ZUWA 3LDFA 2GJAA 1RXEA 3OUZA 5BYKA 2PUCA 3I04M 1U2DA 5C1IA 1ZJJA 3IOYA 4QOSA 4FBGA 2ZJ4A 3TLAA 2BKAA 1GV1A 5DU2A 4DBLE 3E7FA 1LK0A 4NCHA 1KI7A 1PJLA 1D4AA 2X3UA 5CM9C 6PFKA 2W6IA 1ZKDA 3CQ9A 4AZWA 1FU7A 3RYCA 2FDXA 1JG6A 2JCGA 3FOFC 3VOAA 3QHPA 3DNMA 1E64A 3MERA 4GXTA 1NC3A 3B3QA 4F1JA 1VHTA 1YQWA 3QY0A 2WMDA 3WKBA 1CUFA 3RT9A 3FLEA 1WXWA 2YRWA 4P83A 4AUMA 3UATA 4M37A 3USZA 1WSDA 4F91B 1R18A 3ELBA 4DV3B 5JBNA 1GA6A 4ZVRA 1C3OA 3H9BA 4JELA 1XEFA 2IZ1A 3TUIC 3LX5A 5B30A 1QDEA 5CA0A 4U2KA 3UJPA 1CDDA 4JSYA 3V6LA 3UT0A 4X3PA 3RW9A 1AUPA 1TLLA 1KDTA 2EW2A 4C0KA 4KRXA 2FR0A 3I23A 2O3QA 2YXPX 4Y2YA 1DU4A 3AXTA 1DOZA 2EFGA 2W8BB 2ZRMA 5LP6F 1D2GA 2QUKA 4MWSA 5JNWA 3DAGA 1ODIA 2CVFA 1IE3A 2VQ6A 1E96A 3TJMA 2WP0A 2O5EA 3WWZA 2JJYA 2C57A 2VNIA 4EW3A 4FNGA 4HRXA 4NAVA 2W6JD 3W5SA 1SXJE 1SOUA 1HH4A 1YQGA 3B3AA 3DNFA 1PJ8A 3OCWA 5CLHA 3PEUA 3B7PA 4YRAA 3H11A 4R1MA 1SXPA 1MO3A 2AWOA 2H1RA 3C6QA 4R2KA 5L53A 4BPBA 2B3TA 2BFNA 1E1CA 1H0RA 3BJZA 4PANA 1LI4A 3TL6A 4MW7A 5HEKA 3VSEA 2FQ1A 5BRJA 1U8UA 2BOV