2ATXA

Crystal structure of the tc10 gppnhp complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
186
structure length
186
Chain Sequence
SMAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords small GTP binding protein TC10
publication title An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2005-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2atxA00
4I1OA 2GZDA 1MABA 2C5LA 4Z8YA 2YJTD 3P1JA 1J8YF 3PEUA 2NG1A 1VPLA 1AA9A 5KSOA 1W36B 5FR2A 4IVRA 4Z1MA 3WRXC 2E9SA 2QGZA 3OE7A 4DZZA 3AKEA 2X2EA 1KI1A 1OFIA 2JLXA 1M34E 4C0JA 3R8CA 1GTVA 2IEYA 3CF6R 2F43B 2CCGA 1Z6AA 1MV5A 2ONKA 5IDVA 3PJRA 4GI7A 4BFXA 5CB8A 1R6BX 1V43A 2UZIR 3OIWA 3OFNA 1GDDA 4TMVA 3OFND 3BFKA 1XD2B 4GPTA 4AURA 1AM4D 1XEXB 3RSLA 2DWOA 1E4VA 1HQCA 1P61B 3PITA 4E22A 4LYHA 3AB3A 1NF3A 5DI9A 2VHCA 5FPTA 3SFVA 1CR2A 1KGDA 1E2GA 2RGNC 3LVRE 1JJVA 1R8QA 2R6GA 2ATVA 3TSOA 2V54A 4JL8A 5FUXA 4DJTA 1EESA 1OIWA 1N5KA 1AIPA 3OIYA 4MRVA 4M0LA 3T1OA 4LC0A 4C0AC 4EPWA 2Z6VA 4XVQA 4MYCA 4DHEA 3PG5A 4M1TA 2ONJA 3FTQA 2ZUBA 4HUQA 1X1RA 2GEUA 2IW3A 3RDPA 1KK3A 1W36D 2HF9A 4PQYA 5IF9A 3JVUA 4NYMQ 1YE8A 1DG3A 2PLRA 5DIFA 721PA 1CJMA 2W0MA 1FZQA 2DB3A 2FWRA 1S1CA 1J2JA 2GXQA 4HAYA 4L9SA 1VHLA 1WDTA 2AKYA 2KJQA 4MA4A 3ASYA 5AJXA 1DAHA 2AFIE 1G1MA 2YOHA 3SDZA 1UBGA 2H17A 2ZI7A 5FOXA 3VAAA 2PEZA 3EZFA 4BLQA 3CH5A 4B6FA 1R2QA 3EPLA 3RC3A 1KO4A 1US8B 2JASA 3PEVA 4Q5IA 2FZLA 4BEBA 2RGEA 2XB4A 2ZS7A 2XXAB 5KPDA 2H57A 4HAVA 3W8RA 4ACAA 2ZJYA 2XNSA 3I3SR 4Q9HA 2KE5A 2WOOA 2ZETA 5J4KA 3THWA 4XJXA 1HURA 2XGJA 1N6PA 2H1LA 4TSFD 5CJ2A 3QG1A 3PENA 3KQHA 5F9FA 1GKIA 3K70B 2I1QA 2NIPA 1L8QA 1XMIA 2DY1A 4PFSA 3A37A 1VYTA 4RZXA 4QFMA 4BWYA 4EQ6A 4XWKA 3U60B 4QBFA 1XTKA 1G8GA 2W2XA 4KAXA 5LB4A 4Q48A 3MJHA 3THXA 2X19A 1E2EA 3IEUA 1X86B 4MQBA 3DOEA 1A1VA 5KDLA 2PCJA 2D2EA 1E2QA 3W3ZB 1OW3B 3SJAA 1UBCA 4OHXA 1YR7A 4Q4HB 1WP9A 2V55B 2MSCB 4KV9A 4UNNA 1G8PA 4IDHA 3RLFA 2AHOA 1ZNWA 4KU4A 3VR5A 4PC6A 4TT3A 2B7CA 4G5GA 4BFYA 4OQMA 4TT3D 4A8JB 1JBKA 1P2VA 3GPLA 1SZPA 3OAAA 4I1UA 2V4ZA 2YZ2A 1AGPA 2IYSA 3OAAD 1IY1A 1OE0A 4LJ9A 4QJ5A 3SEAA 3U7EB 2ZQ5A 2ZVPX 3KKPA 4DT1B 1F2TB 2ZI9A 5FBQB 3UG6A 4LHWA 4EPYA 3D31A 4EKDA 1UDXA 4Q4JB 2YWGA 2OFWA 3OF5A 1E6CA 1Z0IA 1RIFA 2D74A 2IUSA 1W46A 5AWFC 2CLCX 4PZZA 2GZHA 3QXSA 2J46A 3L0IB 4Q1CA 1LVGA 1G7SA 4PHTA 4YDSA 1ZBDA 4NL4H 1NVUQ 4FMCB 4KVAA 2GWHA 4P4UA 4B74A 2IS2A 4F4JA 4AI6A 4M1YA 1U8YA 3BFVA 1XF9A 3D6TB 3DOFA 4G3XA 1N6LA 4L8GA 2C03A 1JR6A 2IYQA 5TDHA 2LWIA 1CRQA 4FN5A 3V9PA 2WV9A 2WMNB 2XNDA 4GOJA 4XIGS 1F48A 4P32A 4DEYA 3LWNA 4G0NA 3U4QB 1SKQA 2ZRKA 4KSBA 5UKDA 3U3KA 2A30A 1O87A 2IC5A 3Q5DA 3L0PA 2IA5A 4DLWA 4LJAA 2AKAB 1F60A 2A5GA 2IXEA 4B76A 1FUUA 5CLLA 2G77B 2GEDA 3PQCA 1GSIA 1RYFA 3HP1A 3QKRB 2ZR7A 1P2TA 1GL6A 2OCAA 4NYIR 5KOYA 1G8FA 4F38A 4EJSC 3EPJA 2Z83A 4HAWA 3PEWA 1CIPA 3ZIAA 3TSZA 4GOXA 4CZ2A 2VRWA 1JI0A 3IPXA 3ZIAD 3CW2A 3MWJA 1Q12A 2IYUA 3CO5A 4HLQB 3IQXA 1ZW6A 4LPSA 3THYB 2J0UB 1D6JA 1DAGA 2QT1A 2FU5C 4XOIA 1DAIA 1X8LA 4NTZA 3UATA 5JECA 1D8TA 1E2MA 1SKYB 1G16A 2GXUA 1P3JA 1RJ9B 3DO6A 4RVCA 3H1TA 4DSTA 4NKRA 4C9BA 3AH8A 1TF7A 2BDTA 2I1VB 1I4TD 2VP6A 2R65A 3DMDA 3PV0A 5CK5A 1MR3F 1IXSB 1DBSA 1IXRC 2CK3A 2GXSA 4KFSA 3CR8A 1A2BA 4S2EA 3SZRA 2QSZA 4B32A 3ZQ6A 5JJIA 2ZROA 3DMNA 4NCHA 3AVTA 4FMDF 3SHFA 1OH8A 1XJ0A 3B13B 1CRPA 4OJQA 4YMTA 2Q9CA 5L8VA 2QORA 3VR3A 1YZNA 3IUYA 2BCJQ 2GJAA 1WQ1R 5HTKA 1W7AA 1W4BA 1XPUA 2BIFA 1L2TA 5BN3A 2C78A 4MH0R 4WOPA 4DKXA 1KK0A 2WVJA 4M9XA 2NO7A 4NDZA 3CWZA 1N25A 1RRGA 3MD0A 2KWIA 3RANA 2IX3A 2VLIA 4F91B 4YXWA 1QHGA 3FHTA 2VL7A 1CR4A 1OF1A 4YXWD 4GFDA 4LJ5A 4KLNA 1O3YA 4KYUA 1G3QA 3ONWA 5FI1B 4TMXA 4M1WA 3A1TA 5DH9A 2L0XA 3QKSB 4JJZA 2VTKA 4EFMA 3Q9LA 1XBTA 2PLFA 1G6OA 4ZDWA 3BXZA 3QKTA 4K81B 1AZSC 4KO8A 2H7VA 3W5JA 1VCIA 4HDCA 3ADBA 2XOKD 2O8CB 3VKHA 4ARZB 4TYNA 1DOAA 1P6XA 1GIAA 4WVFA 1GKYA 4TMWA 1MO6A 2QPTA 1RVDA 5JBQA 2ZJ2A 3LV8A 1N6IA 3C7KA 1AKYA 4LBWA 5FBWB 3OIVA 2CE7A 2Y8EA 5J40A 1KTVA 3EZ2A 5L3SA 4DDVA 3QF4B 4HZUB 1G41A 2HCBA 1E9DA 5KDOA 2PH1A 4JKIA 2G0TA 1DPFA 2IYLD 4IDOA 5E7JA 3KB2A 4XSGA 1PLLA 1YZUA 4HB0A 1OXVA 1N0VC 2PCLA 3KJEA 3KUDA 2GXAA 4O3MA 1H8EA 4LYAA 1WB9A 2ZSAA 2RAPA 2JJ1A 1H8ED 2IK8A 5JWOA 2G3YA 1E9RA 4PPQA 5FOSA 1HEIA 1KJWA 3Q85A 4RKEA 3D8BA 3AEZA 1N6OA 3CRVA 4PC2A 3I1FA 1LFDB 2Z0MA 4PO1A 3SFZA 2P65A 2IYRA 1E79A 5JI3E 3LFUA 2NZJA 3FKSA 3HPRA 4WA7A 4IDNA 3CRW1 4TTPA 3U7FB 3FKSD 4OK3A 4F7WA 3X1XA 2ZE8A 5AUNB 4GMDA 1G17A 4HATA 3B60A 4JT2A 5CM8B 2AXPA 1Q20A 1NMXA 3PUWA 4A1FA 5JI2E 4A0FA 4QJ4A 3GLIE 2HLDA 2D4HA 1W1WA 4Q1AA 4DB2A 2W6IA 5EE1A 1HQYE 3CRRA 1VCOA 1Z28A 4URXR 3UPUA 2YHSA 4XD7D 3KXIA 2QROA 4LDJA 2RCNA 4MYUA 5F98A 4AYTA 2ZR9A 4C0KA 1TQ4A 4EPXA 2HCJB 4QGHA 5DHAA 4V0NA 2XZOA 4A92A 2REBA 4UKDA 3GLHE 3QQ5A 1OYWA 4Q47A 3RRMA 1Z6TA 3KUCA 3ETLA 1KMQA 4UJ5A 3NHAA 4D0LB 2YV5A 5KNCA 3K0AA 1PLJA 1W48A 4N1AA 3A6PC 2QPOA 3A36A 4FCWA 2FZ4A 1EX7A 2JLZA 2AD5A 4RD2A 2TMKA 3EA5A 4MDFA 1ZC4A 2RKOA 2C9CA 3GLHA 2OAP1 3GEEA 4LV5B 1KO1A 3H0KA 3L8YA 4BRUA 3OESA 4PQFA 1NN5A 2ODEA 4UXIA 4BLRA 4LBZA 3BS4A 3SHWA 1KO7A 1SHZA 1GNRA 2HYDA 2O52A 3F0TA 2QENA 5EQTA 2IXFA 4CEJA 4TLAA 1N6RA 5CIQA 5GVSA 3K70C 4DDTA 3B1VA 3U3MA 2N1BA 4LOAA 3WBKA 1WRBA 3EWAA 2IUTA 3UMRA 2HYIC 3FYHA 1OB2A 4HUTA 2YWHA 3T5DA 1E9AA 2QUZA 1E0AA 1XPRA 2IF0A 2G0NA 3LA6A 5G3YA 2PX3A 4CEIA 4LJ8A 4QM6A 1II8B 3I61A 3KQNA 4CGZA 5DI3A 5G41A 5AUPB 1SXJB 5EJEA 3HYTA 4OHZA 3VMFA 2GJKA 2RGBA 4TMKA 1COWD 3TVDA 5BWMA 2F3TA 4DB4A 5TV2A 1YRAA 1E69A 4OK5A 4BLSA 4JMPA 2RGNA 4C0QC 2JLUA 1ETUA 2WWFA 4DCUA 3K09C 3CH4B 4QJ3A 3E2IA 5KSZA 2ZRJA 2KBEA 1P73A 2BMEA 5DNYB 4E5UA 1F2UB 4S35A 4TYPA 3LW8A 2VEDA 3QXXA 4TWZA 3B9QA 3CF0A 4B71A 4PX9A 2WJJA 2BBSA 3CB4A 3K0FA 4FMBB 1NG1A 3FGNA 3AP3A 3L8ZA 4IW3B 4M21A 4PHHA 4Z51A 4UNSA 4JKYA 2AX4A 4TLCA 1YU9A 1KSJA 2B6HA 3UWKA 1L4UA 4MGKR 5KU1A 4TYYA 2GILA 3TLXA 2CCJA 3WP0A 4LV8B 3B7GA 1CBUA 1OPXA 3TK1A 2REXB 3NDBB 2R8RA 1BIFA 2CHGA 1P60A 4HDQB 3KXLA 4O2RA 1AGRA 3U2QA 2ZSBA 4RCZA 3VHXA 2QBYB 5JJLA 4M22A 4W5HA 4JYBA 1UBEA 4B33A 3DZDA 3G5UA 1W0JD 1G8YA 1HY3A 1S4QA 3WBJA 1KAGA 4JLNA 2ZRDA 2R6CA 1A5TA 4PHFA 1BMFA 1QHHB 2Z5FA 3K9GA 3G82C 4JBXA 2WWGA 3W6NA 2JDIA 3NHBA 1BMFD 4JSYA 4D25A 1E2KA 1Z8FA 4Q1EA 4LPKA 2JDID 1Z0FA 4ZIRA 4CEHB 4YMVA 1KO5A 2D2FA 1YZQA 1Z0KA 4BFTA 4H1VA 1YJ5A 4ZKDA 2REOA 3U6BA 4U02A 4MUBA 3GLFE 4CW7A 2KSQA 3HWSA 2V7QA 1LV7A 2GZAA 4B44A 2P5TB 2J5XA 5KDDA 2BC9A 1LS6A 2XTNA 2YINC 2YC2C 1VG1A 3X1YA 2GAOA 2Z43A 1E2HA 2GVDC 4TTRA 2CDNA 3WMFA 1U0LA 3I8XA 2ZS9A 4GZMA 1G19A 4LZZA 4OI1A 3VU9B 2RH5A 3FHOA 1NN0A 4GMXA 1OXTA 2C95A 4WBSA 5LD2B 1U9IC 5C4MA 3H2YA 4DCSA 5DN6D 1KI2A 5J4LA 1XEFA 1OH6A 4AG6A 1NSTA 3EIEA 5HKKD 3BD9A 3B9PA 4PAOA 4HB2A 3HDTA 4NYJR 1MO5A 1M7GA 1OLOA 3SYNA 1KMHA 2QMUA 5FR1A 4V03A 5GJWC 4JBYA 1R0YA 4DRZA 4JYCA 1OHHD 4AYWA 1ZYUA 3AUXA 1WXQA 1ZNXA 3BB1A 5AK0A 1YRBA 4MGIR 3VHLB 3QPVA 2GKSA 2WPDD 1DE0A 4GSYA 4PZYA 1W5SA 1DAKA 2O5VA 2AN9A 1OJLA 4OQXA 3B6EA 1TX4B 1PUIA 4X8OA 3QPWA 2A5JA 3AGQA 1G6HA 5DE3A 1H8HA 2WSMA 3IIJA 1GKUB 1MRNA 4D4JA 4XTRA 2B8WA 3A4NA 1H8HD 1NY6A 2PMDA 3NH9A 1MABB 5TXGA 1YZKA 1X1SA 2CLSA 2V3CC 1LTQA 1GRQA 4NH0A 4D4LA 2VSOA 1ESMA 1N0WA 3V00A 3NBYC 4US0R 4D2IA 1FL9A 2ZRFA 3CX8A 1G3UA 3EIQA 5M04A 4AG5A 5LBIA 2ZEJA 1G64A 2XTZA 1S3GA 3GP8A 1CP2A 5CIWA 4NYJQ 1GFIA 4Q4LA 1A7JA 3IQWA 4MKFA 5GADl 1TAGA 1W47A 2GF9A 5CDFE 5KHOC 3TUJC 1Z0JA 3QOFA 3RVBA 1XMJA 5J4VA 1KSGA 2JLWA 1RRFA 1T0HB 1TMKA 1Q44A 3L0SA 2F1JA 1NJGA 1SULA 1WF3A 3N2IA 2FSFA 3K9HA 4LY6A 4Q4AA 5CDFA 1UKYA 3N2EA 3A4LA 5JSZB 1QVAA 5CITA 4RKFA 1MO4A 4W5WA 1M74A 1RKBA 2WWIA 3BGWA 4FIDA 3TQCA 1YZGA 3CRQA 1IAQA 1HV8A 1TPZA 4CVNA 1YQTA 121PA 5E4FA 4LHZA 1RFLA 2PL3A 2G83A 2VP2A 2V6IA 3LX8A 1CF4A 5BW8A 4GDFA 1D2NA 2ZS8A 3DHWC 1GNPA 2GVZC 4HUQB 4V02A 2NPIA 3DM9B 1R4AA 4RZUA 4BFWA 5EXXA 1E2LA 4IFEA 4Z1MD 3NKVA 3ADCA 1MOZA 1XMSA 3OE7D 4Q7MB 1G291 1OIXA 3QNUA 1ZCBA 1KI4A 3FPAA 1MKYA 1YR6A 2YOFA 1JR3E 2ZYUX 1Z2CA 2WAXA 2YKGA 2HXYA 3GD7A 3LBIA 4POAA 3EW9A 3SBDA 2A5FA 2RGCA 4MRPA 2Q3FA 3FWYA 5FBLB 4LK2A 2OV2A 3IDQA 3HPQA 2DFKB 1FX0B 2Q9AA 1BYUA 5EP2A 5FUVA 1E98A 4P33A 3ZGXA 4DVGA 1JR3A 2CVHA 3MWKA 4RJLA 5JZVA 1JR3D 3LX5A 2BMFA 2P2LA 5L3QA 3NBFA 3DL0A 4DLRA 1KY3A 2ODBA 1M6NA 1P72A 1YZLA 2WJYA 5B2ZA 4FCTA 4ESHA 1F6BA 5E7MA 2AK3A 2FG5A 4JL5A 3T1VA 2XSZA 4EQ6B 2WOJA 4OKSA 3TNFA 3OEEA 2WKQA 1T3SA 2XSZD 2AR7A 3NVAA 3JZAA 1KKMA 1P62B 1RZ3A 1NKTA 3THXB 1TQ6A 4DLTA 1FNMA 1TTTA 4D0NA 2ZRHA 1Z6YA 3DPUA 3GJ7A 3P32A 1RRPA 4ACBA 1NSFA 3SR0A 3X1ZA 4C0HA 2OESA 3E70C 2F1RA 2YC4C 3BOSA 4N0DA 3IBGA 1QHNA 3F5FA 3NWJA 1D2MA 3B1XA 3PFIA 4Q21A 3MLEA 4JT4A 3AF3A 3FB4A 4P4SA 1GL9B 4R7ZA 2BJWA 4M9SA 3QG5A 1PUJA 3EZ6A 5JEDA 2ZI3A 4YQFA 2BM0A 2QT0A 4XH9B 1NP6A 5FI0B 3GFPA 1YR8A 1UM8A 1U8ZA 1Z3IX 2C2HA 2KI5A 1ZCAA 2C96A 3A4MA 1D9ZA 3NH6A 2YYZA 1NG9A 4HLUC 2NZ8A 3CBQA 1JXOA 4ZDIA 5B64A 2YWFA 3WNBA 1K8RA 2J1LA 2RGDA 4LJ4A 1CR1A 1IXZA 4G01B 4C4PA 3AM1A 1BOFA 3QUSA 4LV6A 1LY1A 2X1VA 1XMVA 4JLBA 4IOKA 1I2MA 2B21A 1Q57A 2QZ4A 4G5RA 1TADA 2WWXA 1T8TA 4B48A 5A4JA 3RC8A 4U5XA 4OI4A 4PO9A 3RS5A 4YC7A 2G1JA 1Z6GA 4A6XA 1B0UA 4IEEA 2PJZA 1S2MA 4AKHA 3ZVLA 3ZS9A 1SXJC 2VHJA 2W58A 2WJGA 4BASA 5E3HA 3GLGE 1VTKA 1Z0DA 3SOPA 1JPJA 2WJVA 4NONA 4B3BA 3QXHA 5ANRB 1E2JA 2WM9B 1KZGB 4RD3A 1NRJB 1TF5A 3QE0A 1HUQA 2WKPA 1IN6A 5FPKA 3X1WA 1TQDA 1P4SA 1PVOA 1U99A 2Q6TA 2V9PA 3Q3JB 1IQPA 1NVWQ 2EVWX 3RAPR 3KFVA 2XX3A 5HZHA 4FXPA 3U3OA 3TRFA 4EFLA 5EE0A 2QP9X 3UMSA 4LSGA 4TZ0A 2ZYTX 1DTSA 3KDSE 3KKNA 3A1SA 5FTKA 5KO2A 1QHIA 1XU4A 3TQFA 1RPZA 1KI7A 4OK6A 4Q02A 1XX6A 2OSBA 2HDNB 3LVQE 3NXSA 1OKKA 2HUPA 3MGCA 1FPMA 1BYIA 4J0QA 4DCVA 4ZKEA 2P6RA 1Z0AA 1W2GA 1QDEA 4V0OA 1DO2A 1UKZA 5DGXA 1E9BA 4LRWA 3NEYA 4N0EA 4QC2A 2WWHA 2DFTA 2BV3A 2ORVA 4MRRA 2OBNA 2JLQA 3QIAA 4WXPA 4ASUA 3QXJA 3SN6A 5C18A 4A15A 1A2KC 2CXXA 4QBGB 4FW9A 4JVMA 1ESNA 2XNDD 2ZI4A 4K8OA 1DO0A 5F9HA 3F3YA 2H16A 2BKUA 5FPYA 4WZAE 4DWJA 2B92A 5LB2A 4B3CA 2GNOA 3R9XA 4URVR 1CLUA 2ZU6A 5CYPA 1NVXQ 1KI6A 2D62A 5KSPA 4B43A 5SZKB 3BWDD 4IKEA 1Q3HA 1NL3A 4KXFB 1VECA 1E9SA 5B57C 4LWZA 4TQAA 2FOLA 2JJ2A 3QVUA 2JJ8A 1UKEA 1Q1BA 2JJ2D 2CJWA 1NLFA 3CONA 4C7OA 3P4YA 3CPEA 3LD9A 4RD1A 1HE1C 3THOA 4BQSA 4LGMA 2Q3HA 2CLDX 3BH7A 3BH6A 2GA8A 3PXGA 4HAZA 4OYHA 5LD2C 3B85A 1KO8A 3K09A 1X8KA 2F9LA 1WBDA 2IS4A 1E9FA 3W6OA 3SBEA 3VTKA 4LJ7A 2CL6X 4TYQA 3RSOA 5AJZA 1W44A 2E1RA 3R9IA 1DG1G 3BK7A 1KJYA 2QMEA 4AD8A 1GRNA 2IYVA 1OXXK 1ZU4A 1QHXA 4KJZA 2D06A 1Z63A 1G4UR 4HAXA 1GAJA 3B1ZA 2PZEA 5EXSA 4B3XA 5GVRA 3K9NA 1P5ZB 5EXPA 4OQFA 1JECA 2VF7A 2AD1A 4TQUS 4F4CA 2AK2A 4DSNA 2EFCB 1S96A 1U8AA 4Q9IA 4W7SA 4I1VA 5C2JB 2I4IA 2CK3D 2YNMA 4D4MA 1VG8A 4PC1A 1RYHA 2WWYA 1CXZA 1XTRA 3K0CC 5FTNA 4OJKA 1G3MA 1ZM3A 2BBOA 4L5BA 4HSEA 3KQKA 1P2UA 3C4JA 3PR1A 4NYIQ 1UEJA 3L2OB 5L3SB 2PBRA 1GNQA 3IIMA 3K0EA 3H84A 1F5NA 1JNYA 2W2TA 3TR5A 1Z47A 3RHFA 4C0LA 2ODWA 1MO3A 1DAEA 1RW4A 2YVUA 4PC7A 1SVMA 1YKSA 3RWOA 2VP0A 1DEKA 6Q21A 3K0SA 1CJUC 3PVSA 1C1YA 1YZTA 3TE6A 1KZ7B 1IBRA 2X8AA 3KKOA 2FV8A 5KTYA 3I92A 4AK9A 2JEOA 2MMGA 1GG2A 4D26A 2XJ4A 2DPXA 3U44A 1UPTA 4DSOA 3GCGA 3VR6A 1NN3A 5D3QA 1TEXA 2QAGC 2IF2A 1SVOA 2GETA 2OHFA 3QKRA 2NOAA 1E0KA 3AVPA 1TF2A 2CBZA 1S9HA 2VP9A 4PPNA 4IDQA 1KI9A 1KOFA 5HCNA 1XDBA 1SKYE 1FUKA 4X8LA 4A82A 1Q1EA 4ZPXA 4B73A 1B23P 2BHRA 1AS3A 3W6PA 3CX6A 1U9IA 3P26A 3LO5A 1J8MF 2CVFA 4HI0E 4C0SA 1NBME 4G5OA 3REFA 3W90A 3TH5A 4V0KA 2ZRAA 1MRSA 5EP3A 4UNRA 5IRCD 2P6NA 1GILA 4QRHA 3WYAA 1KDOA 4JIMA 4KFRA 5EE9A 4PANA 2W6JA 3UK6A 4GL2A 1W36C 5LPNA 1L7VC 3NC0C 4O0MA 3WMEA 1A82A 2BCGY 2CEAA 3AF1A 1CU1A 3GJ8A 4FINA 4NCKA 2P6UA 4B2LA 5G3ZA 1NBMA 3EIHA 4NCJA 3ZJYA 5BQ5A 4A2QA 1G3RA 3B5JA 1E1RA 2ZUDA 3MWYW 2V1UA 3RRYA 1E1RD 1G7CA 4C2UA 4US2R 2FPMA 1X8JA 3K0AB 1R10A 3M1IA 3PUXA 4H1UA 3U7HB 2OCBA 1NJFA 3QVVA 1X6VA 1E94E 2JJ1D 3I73A 1KJZA 1CJKC 1U94A 3GMTA 4MYTA 4B2PA 3DZ8A 5J4HA 3GLHB 4KHZA 1NIJA 1SVLA 1W2HA 4DLUA 2DYKA 1KK2A 1BS1A 3CR7A 5CLQA 2JLRA 5L3RA 4MRSA 4TL8A 4NU0A 1E79D 3TIFA 5J47A 2ZSEA 2QMHA 3ASZA 3CM0A 4II7A 4RD4A 4AKIA 1IN5A 3ZZ0A 4DIEA 4OHVA 1XXHE 3R9WA 4CEJB 2CHQA 4BEJA 2WSSA 1AS0A 2QTHA 2WSSD 3MWLA 3NBZC 4JBWA 2ZYWX 4Q00A 2O8BB 3CZPA 3BERA 3KX2A 4L4UA 1OH7A 2JLVA 3LQRA 1MH1A 2CE2X 2HT6A 3S1AA 4B35A 2HLDD 4URZR 5BN5A 2W6ID 2ZE5A 2IYTA 2XZPA 1XXHA 4M9ZA 4ON9A 3KJGA 5FTMA 3EARA 1CR0A 4M53A 1GZSA 3RABA 1XEWX 4MGZR 1XJCA 3GLIA 2WAYA 3A58B 4LYJA 3C16C 1BKDR 3ZQJA 2O8CA 3CX7A 1FOEB 3QI2A 3U3RA 1GOTA 3B82A 2QM7A 3UWOA 3C15C 3UG7A 3HYRA 2FSHA 5EP1A 2J0SA 1W4AA 3QBTA 1N6KA 1JQLB 2UKDA 3O8RA 3VKWA 4AKEA 3K0FB 1RE0A 4GBMA 5DHFA 4TZ6A 1AKEA 1AK2A 1KK1A 2ZXUA 1E1QA 2ZJZA 1U98A 1E1QD 3GJ4A 2GK7A 2O8EA 3MRSA 1N3BA 2FX3A 5AUQA 1UF9A 5JCZA 5IK2A 621PA 2P67A 1GITA 5EZ5A 2ZRCA 4QHSA 1S9DA 2FGKA 4D6PA 2DBYA 1D9XA 1FNNA 1S1MA 3JZMA 4ZO4A 3WRYC 3PEYA 2NTYC 1XTJA 2OXCA 4TTQA 3EC2A 4ZDJA 4HB3A 1I4LD 4A6PA 4CF7A 5SZIA 2HV8A 2QTVB 5DISB 3SQWA 1EFRA 4EAQA 2OLKA 4PHGA 5HCIA 4XVRA 2P5SA 4GP6A 4JLMA 1EFRD 4C30A 4QM7A 3LBHA 1ZAKA 1HT1E 2JLYA 3UKDA 1T5LA 4BLOA 4EPRA 5D3MA 4FWIB 4ZIRB 3LXXA 1CKEA 1T3LA 4ZCLA 4R71A 1UAAA 3U3JA 4A8JC 5JWHA 2VF8A 3ZD7A 2O8DB 2OO7A 3MCAA 4YONB 4HDOB 5TB5A 1XD8A 4LHVA 1Z08A 2BEJA 3QSYA 2N42A 1EWRA 2NQ2C 5B30A 1AN0A 4YMSA 2ZRLA 4PPGA 3TBKA 1ZIPA 4Z54A 3BFXA 3DEFA 1KSFX 1UADA 2IHBA 4TLDA 3CNNA 1IN8A 1V5WA 3A1UA 4BLPA 4URYR 5FL3A 1DVRA 2WBLC 2ZYVX 3Q72A 4LHXA 2F6RA 3O8DA 3SU8A 4BGDA 5JCPA 2IYZA 1LNZA 2YOGA 5FPHA 4XWOA 2R44A 2OAQ1 4R2HA 4TL6A 4DLSA 3J81k 2ERYA 1CS4C 3CWQA 1ZUIA 1FQJA 1XZPA 2NO1A 1E9CA 2O8FA 2WIAA 4KYIB 4BPBA 2ANBA 4FCVA 4AKGA 2DHRA 4A2PA 5DLQC 3SS8A 5KNBA 2CL0X 2QPAA 1FW6A 1NLZA 2ZE7A 5A5GA 2JLSA 3FMIA 5JFGA 2QN6A 4HLUA 3DM5A 4HYYA 3DDCA 4TL7A 2HJGA 1NN1A 2ZJ8A 3ADDA 3P4XA 3GLGA 1VIAA 2A7QA 1R0XA 1E2DA 3BIFA 3NIBA 4LJYA 1M1YE 1NI3A 2V8OA 1SXJE 2V6JA 2R6DA 3FE2A 3KTAA 3FHCB 1IHUA 3EASA 5J4YA 2XJ9A 4KFUA 3M0EA 2YWEA 1K5DA 4URWR 1JB1A 4AIIA 4MYHA 3REGA 1S3SA 2V7QD 4O25A 5FUYA 3D3QA 4G5QA 4U00A 1AQYA 5FUWA 1SXJA 4JL6A 2GJ9A 3SJCA 1WBBA 5EUMA 4D82A 4HLCA 4FMDB 4CT5A 2FF7A 5JHHB 3GLFA 2IS6A 2BEKA 4U7DA 3Q7QA 1KNQA 1ZD8A 3RRZA 1N5LA 1R8SA 3AQ4A 4BFVA 2RHMA 3MUFA 2OCPA 1T4GA 221PA 5J5CA 2AWOA 4D4KA 1OXUA 3VKGA 3NBXX 2H8KA 1ELOA 2QI9C 2XB2A 1CTQA 1D2EA 1JAHA 4IOJA 4FWTA 1UFQA 1Y3AA 2VH5R 4FMCF 1ZJ6A 2VQSA 1R0WA 4JVSB 1II0A 1XD9A 1DS6A 4ZCMA 4RCYA 4DDWA 1OB5A 4BLTA 1WA5A 4Q4AB 2PJRA 2VA8A 4RFSB 3ND9A 1UKVY 2FEOA 2C99A 3P27A 1IN4A 5FH9A 1ZD1A 3ZH9B 2F7SA 2BKEA 2QTFA 3ZVMA 2FEMA 2QA5A 4IXNA 5E7IA 1P9RA 2J9RA 4PO8A 1ZM9A 4UJ3A 4P31A 4KITB 1YVDA 1QHHA 2P3SA 5JHGB 3BE4A 2FPKA 2ZI6A 4XVUA 1FTSA 2X2FA 2F1IA 3Q8XB 2IEZA 3HU1A 1Q3TA 2OM2A 5HE9A 3RS3A 5F2EA 1G8HA 1R5BA 4Q9LA 4DDUA 5KSYA 4RD6A 2QQ0A 5G40A 1VCMA 4I1SA 3WHLA 1UEIA 4PXAA 1EGAA 5TY0A 3TGPA 3I4LA 3LLMA 1N5JA 3W3AA 4TMZA 5ELXA 4A36A 3FKQA 3HJNA 1TU3A 4G1UC 2EYUA 4NPHA 4DLYA 4DC9A 3CRMA 2ZANA 3EAQA 3VR4A 1DAMA 2EU8A 1ONBA 4NHOA 2ZREA 4BUJA 1P9WA 2GCOA 2WICA 1DADA 4QGFA 4X8MA 4EJSA 3TW8B 2R6AA 1JXMA 2ZITA 4FI3C 3RNLA 3T5GA 5L3QB 4AWXA 1JAIA 2OBMA 4DBLC 1QG2A 2EW1A 2F9MA 4BFUA 3LW7A 3C5HA 1FP6A 3IIKA 2IYWA 4R98A 3R7WA 2QQEA 1X3SA 4LBYA 3B1YA 4BZQA 5JS7A 4BFSA 2FFHA 1NKSA 3NG1A 4MDEA 4NBSA 4M1OA 4EFNA 4QGAA 4JLVA 3T15A 4UQOA 2WJIA 4JVLA 2FE4A 4Q1FA 3GJ0A 1IY2A 2ZVQX 1J90A 4IOLA 4EPTA 1G9XA 2JATA 5GJCA 2F1HA 1GWNA 5AR1A 1E2PA 1KKLA 3HR8A 1DAFA 2VP5A 1CJVC 2ZR0A 4P4SB 4Q1DA 4C3ZA 5HPYB 2UVQA 3AVVA 3EZ9A 1SVSA 5FTJA 4BFZA 4PSKA 2ZRPA 5AJYA 3I5YA 4HEJA 4Q1BA 2UZ3A 1U81A 3EZ7A 2E87A 3FMOB 4Y0AA 1GM5A 3I5XA 2LKCA 3SC3A 1QHSA 3QBVA 1E2NA 4IDPA 2B8TA 3IILA 1J70A 3GJ3A 3THWB 4OQNA 1XTQA 3W34A 2EYQA 4LX0A 1LB1B 3AVUA 4QKQA 3AVXA 4NYMR 3UXMA 2QNRA 3LDAA 4TQ9A 2ODNA 3ADKA 3WYGA 5H8WA 1IJFA 3PCRB 3IPYA 4KFTA 2QAGA 1G7TA 1NNEA 2FH5B 3ICQB 3OEED 3TJZA 3MAAC 4I99A 1ZM7A 1KDPA 3ZS8A 3TVTA 3EWSA 2XTMA 1I2DA 1KNXA 2GJSA 2QMOA 2GBLC 5JSZA 2R2AA 2KB0A 1SVKA 2GRJA 3KB1A 1E3MA 2ZAOA 1G21E 1II9A 3CKLA 1Q1QA 2DWQA 3WP1B 1XZQA 2LKDA 1KIMA 3QY0A 3LAWA 4PSAA 4DXAA 3EC1A 4Q01A 1NY5A 1TL7C 3CLVA 4JSTA 1JJ7A 2QP3A 3IGFA 1L4YA 4TL9A 4IXMA 4A0GA 4KBFA 3PUZA 1TUEA 4JLOA 4LJ6A 3IO3A 2ZRIA 4W5JA 1OIVA 5DYIA 4LI0A 2CHVA 4CT4B 1WCV1 3IKJA 1SQ5A 4TLEA 1CULC 2F43A 4A2WA 1Z83A 1T9HA 4CIDA 4LYFA 1D5CA 2BWJA 4P4TA 3SNHA 3NEJA 4A9AA 2XITA 5K8LA 4M1SA 4PR0A 4Z8XA 3T12A 1PZNA 4R9UC 3VFDA 2D7DA 2V1XA 1N5IA 3ZZUA 1XD2A 4RZ3A 4LBVA 3CZQA 3X1DA 3M6AA 3WNCA 1XEXA 1FX0A 1W4RA 2QGNA 5G53C 2G9NA 2GTPA 5EUQB 2GESA 1JQJC 1ZC3A 2ZPTX 1G4AE 4TSFA 1EFCA 5EXTA 4EPVA 5AUOB 3RYTC 3LXRA 4GOKA 2A5YB 2J59A 4IRUB 2GF0A 2RGGA 1KI8A 2VSFA 3BC1A 1KI6B 4UXHA 3GEHA 3GFOA 1HE8B 1VIYA 4I4LA 4EIWA 3ND8A 2ORIA 1P7CA 4L16A 2ZM5A 1VCNA 1PLKA 3FDIA 1N0UA 2K5UA 1TQ2A 3BB3A 2Q3MA 2PX0A 4C7OB 1OV4A 2CJWB 2QL6A 2ZRGA 1NMYA 1F3OA 1E99A 3GJ6A 2OCYC 3AGPA 3PIRA 4A0HA 1VYVA 1GUAA 1OKKD 3VX3A 3QF7A 5FL7A 3SE0A 4TMTA 4IVPA 3QEJA 1N6HA 5FL7D 3E5HA 3VNUA 1US8A 1PJRA 2BMJA 2OBLA 2HT1A 2VO1A 3AVYA 3TUIC 3I72A 3AF4A 4IFBA 2XXAA 1CEEA 1UBFA 2CMKA 2FSIA 4OL0A 2OXRA 1AZTA 4Q19A 4ASUD 2ANCA 2WHXA 1ZINA 2AWNA 5FPSA 4CRWB 5BYJA 4L15A 1T0JB 3TAUA 4XWAA 1HTWA 4A0RA 3GEIA 4P3YA 3Q5EA 3DVLA 2EFHB 4KCGA 3TSWA 2C9YA 3K70D 1XCGB 1LF5A 3BAFA 5DO9A 1U0HC 4QNRA 4E09A 2QY9A 2XZLA 3TAHA 1WE2A 1QZXA 3E1SA 4QHTA 2VYFA 4WAUA 5TMPA 2AFHE 3OZXA 1U0JA 2ERXA 2FGJA 4BECA 4QNMA 1KY2A 4JLAA 4Q4HA 2OT3B 1OYYA 2ZSFA 4Q03A 4RZ2A 2ZTSA 5C4GB 1NLYA 4B6EA 4OHYA 2FN4A 1K6MA 3HU3A 5E95A 2F3RA 3FMFA 4M1KA 3UMFA 3VNVA 1YHNA 1Z22A 4OI0A 5JMTA 2DWPA 2GK6A 3IHLA 4WIAA 4A8JA 2W00A 1IONA 2ZJ5A 2RHDA 1E4YA 1BO6A 3C8UA 4DIDA 1BH2A 4L9WA 3DKPA 3BRWD 1IOZA 4V0ME 2QRZA 3U44B 3WY9A 2A9KA 2BJVA 2A3RA 3B78A 4DT1A 4JVNA 1OFHA 3TW4A 1F2TA 1ODFA 2QAJA 3GJXC 3IO5A 5DSZA 1QF9A 2QE7A 1RRCA 4Q4JA 2J0VA 2ZSDA 2QE7D 1N6NA 4DLVA 3TMKA 1G5TA 1HA3A 2XEXA 4V0MA 3I32A 521PA 4LHYA 4D0GA 4F92B 1K5GA 2H92A 3A1WA 4DLXA 2NO6A 3ZD6A 4JLKA 4NCIA 3L43A 2GDJA 4ZI3A 3H86A 2Q21A 1VMAA 2AL7A 5KYKA 1OFTA 1XNJA 3N70A 4Q9JA 4QG7A 2QRNA 2FSGA 2N46A 2VIIA 3M4YA 5FOUA 3U4QA 3ZVNA 5CYOA 4RFVA 2PEYA 2RB4A 3I8SA 3QPUA 1S8FA 1XRJA 1Y63A 1EFTA 3TKLA 3CPHA 1C9KA 4OHWA 3LBNA 3UANA 2BM1A 4QBHA 4KVGA 3MFYA 5IT5A 1M8PA 1TEVA 2C9OA 4XTCS 5H70A 4JLPA 5HZKA 3K53A 2JCSA 2ZU0C 3L0OA 5CM9C 2EFDB 3KJHA 3AP1A 2O0KA 2J0QA 1IN7A 1FP7A 3NDPA 3B1WA 5P21A 4E03A 1NMZA 1Z06A 2X77A 2FFBA 2MSEB 3GQBA 3MG9A 2FFQA 1P75A 4ITRC 1T3HA 2ZAMA 2IT1A 5GJVC 2CCKA 4YMWA 4KBGA 1EXMA 3R20A 5DYGA 3UIEA 2HXSA 2XAUA 3ICEA 2QM8A 1W49A 2PT5A 3AVQA 3FOZA 1LW7A 1XCMA 2VSXA 5JEEA 5C46F 5EP4A 1ZMXA 3THYA 2J0UA 3KL4A 1KI3A 4ZCIA 3S1AB 2D3WA 4NZYA 2R6FA 3B2EA 1RJ9A 2CNWA 4IOMA 2RMKA 1XXHB 2CNWD 2BBTA 3K8YA 4M1MA 2W6JD 4QGGA 3W8NA 5L3VA 5BXQC 2GAAA 2DFNA 3C41J 3N5CA 4JLJA 3WNDA 3FMPB 1E96A 3PUYA 4Y0VA 2XOKA 4D81A 3GLIB 2WMOB 1E0SA 2NO0A 4HB4A 4EDHA 1NBMD 2FJUA 1N2CE 3K1JA 3KKQA 4PC3A 2QSYA 3KZ1E 3KKMA 2NPFA 3GFTA 1G5RA 4O2LA 3HR7A 2H5EA 3L82B 3T35A 2OFOA 1RC8A 421PA 1QBKC 5B58C 1P9NA 2HEIA 4WZ6A 5FFMA 3ZLJA 2OLJA 4G5SA 1HYQA 3U6KA 1XJQA 4TLBA 4DCNA 5K8UA 1ZP6A 1Z5ZA 3AF0A 2G6BA 3K9LA 4QXAA 4OBEA 5JWRA 1Q0UA 3FFBA 2O8EB 1T5IA 4X8HA 4PAQA 3CNLA 1EFHA 1FFHA 1XTSA 4PQRA 1AS2A 4DSUA 3QXCA 5K8IA 3D7MA 1P2SA 3U5ZB 1VKJA 2C8VA 4MITA 1TU4A 4PPFA 4Q18A 5FOWA 3SYKA 2FFAA 1KDRA 1VDZA 2Z4RA 5CK4A 2O0JA 3KQLA 3OEHA 4PTLA 1KDTA 3QKSA 4DCTA 3OEHD 2OEPA 4WW0A 2R9VA 3WYFA 4CEIB 4DEXA 4KI0A 4UNPA 3JVVA 1XEWY 4B34A 3EPKA 3ZVRA 5DI3B 2ZE6A 2GCNA 2LCFA 3BB4A 2BBWA 3LRPA 1YR9A 3B8HA 4KODA 1GP2A 3MMPA 4ARZA 3T1QA 1QVRA 2ORWA 5D3MB 4F4IA 3A8TA 2NGRA 2IBMA 1JEDA 2QEQA 2P0EA 4TN1A 4XD7A 1XFAA 4H9GA 4MRNA 5K8TA 3ZDQA 2BMDA 2WZQA 4GP7A 5FBRB 1T8UA 4HAUA 5LDDC 3QF4A 3U7GA 4HZUA 3EA0A 2QG6A 4DLZA 1SVIA 3T61A 1EFUA 5KPJA 3AF2A 4HLDA 2IWHA 2ZRMA 4D80A 3T06B 4C2TA 5FOTA 4NCNA 2PMKA 1VHTA 4KSCA 3GJ5A 3T34A 1Q21A 3C14C 4EUNA 1IM2A 3KFXA 2IL1A 5JJKA 1JALA 1E32A 1JPNA 2IUUA 5IK2D 5BN4A 2NO9A 1OT3A 1G7RA 3U61B 1VG0B 1FTNA 4M8NE 1W4CA 4ZI2A 2O8FB 2SHKA 3I62A 3AVOA 2D7CA 2A5DA 4RD0A 2HJVA 1KSHA 3QEOA 5EE3A 3W9YA 3WHKA 1QHYA 1FMLA 3RS4A 4B47A 4LC1A 1Z07A 3GLGB 1ZVQA 4GRAA 1EX6A 3G0HA 4US1R 3VQTA 4YLGA 2DFLA 2O8BA 1EK0A 1GVNB 3P20A 1W5TA 1KHTA 4B3FX 1NIPA 1DARA 4MGYR 2OUKA 2OZEA 1EG7A 4B2IA 1EWQA 3KTAB 3PUVA 2H18A 1DELA 2AXNA 1IY0A 4GT1A 1HH4A 1IJEA 4MKGA 2J41A 1M7HA 2DR3A 2VPPA 2VHQA 2ECKA 1CJTC 2OFXA 2ZI5A 2ATXA 2JGNA 3AP2A 2W83A 2G1KA 1SGWA 2WJHA 5EE5B 4WXRA 1COWA 1QRAA 3ECCA 2J3EA 3LNCA 3CIOA 2G88A 3CNOA 3H4MA 1XCPA 5FOVA 3ZZTA 1E2IA 4GNKA 2GBLA 2VHTA 2ZJBA 1JEEA 1KYIA 3GLFB 4Q66C 4IHQA 2FNAA 1Z6XA 2Q0HA 3KQUA 1WMSA 4WZBE 4BRWA 2PZFA 1AJEA 2ZJOA 3SQXA 1J99A 2DCUA 4NMMA 5CJPA 4M2LA 2J87A 2QU8A 2R62A 4CYMA 1U90A 1LF0A 1E0JA 1H65A 3OIUA 2IS1A 1OXSC 1Q22A 4IVQA 4KLZA 4DUGA 821PA 3X2SA 3BORA 5JRJA 4DUGD 4OQLA 4PSVA 2EWWA 5SZHB 3RRNA 4B75A 2IWRA 1J7KA 2WTUA 1KMHB 3CUEF 3Q7PA 2IHYA 3HU2A 3WMGA 4RSGA 3BH0A 2J45A 2RGAA 1TUIA 5A0FA 2B7BA 1W0KA 2ZUCA 2J7PA 4MKIA 2A78A 4AYXA 1W0KD 2J7PD 4JZKA 3TUZC 1ZIOA 3F8TA 5F3WB 1NVVR 4B3DA 1A4RA 1Z2AA 1XB2A 4GZLA 4MKHA 5C1BA 4N3NA 1W0JA 2J7KA 3AKCA 3FFAA 2BOVA 3VX4A 2F55A 2NMVA 2O0HA 3A1VA 3AV0B 1VG9B 3BBPA 1II8A 3NC1C 3SJZA 2FPLA 4JJKA 1ZM4A 1T91A 4LUCA 4UXJA 3O8BA 5SZJA 3V4FA 1SXJD 2C77A 3QJYA 1R5OA 4QBIA 1M2OB 5BYKA 2ZIAA 3T1TA 2GCPA 2W0SA 1SHKA 1HT2E 3BJIC 2O8DA 1XP8A 1G5PA 4ZV4A 2W2VA 1F2UA 4M9QA 4CDGA 1R5NA 2IYYA 4NE2A 1MT0A 1G18A 2GEVA 2ZJAA 1G20E 5JLJA 2A2ZA 2JA1A 1E2FA 3CF2A 4PAMA 4RY2A 3AVWA 1XPOA 2PZGA 4I81A 3TR0A 3SI7A 1AQUA 4NP6A 4BZPA 1KAOA 4MUAA 2EFGA 2QP4A 3QKUA 4JLDA 4ABYA 1R0ZA 3O47A 3LQQA 2KBFA 3OHMA 2GCOB 5GJBA 1ZNYA 3V4RA 4Q7KA 2CL7X 1NVVQ 5TVKA 1XWIA 4EJSB 2MMCA 3AKDA 4FD2A 1S0UA 2RGXA 1G3IA 5DN6A 1Z29A 5JS8A 1ANKA 3DKVA 5HKKA 4AC9A 3LY5A 3SYLA 2QBYA 3VR2A 4UNQA 3QENA 3R7WB 3IEVA 4W9MC 1C4OA 1ZD9A 1UDWA 4Q7LA 4QL3A 1LS1A 1SVWA 1OH5A 2FMXA 1XTIA 1OHHA 3RS0A 4C0BA 3MSXA 2OILA 4LCBA 2BVNA 2EFEB 2WPDA 4JS0A 1GRRA 3RWMB 4M4SA 4B3GA 1Q1ZA 4CEHA 4Q7JB 3WXMA 3LLUA 3EX7C 3RS2A 2EQBA 4PZLA 3AUYA 4P0TA 3RS7A 3LH5A 1UJ2A 5IHPA 4QOSA 8OHMA 2ASEA 4ESVA 2MSDB 2ZRNA 3EXAA 4IJMA 5FTLA 5CB6A 3C5CA 4TYWA 2VHUA 2JAQA 2Z4SA 1FMJA 4YDHB 3O8CA 3R8FA 4OI2A 3KJIA 3EPHA 4AY2A 2VP4A 1ZNZA 2FDCA 4URUR 1OSNA 2EWVA 2C04A 3VR1A 3W5IA 5KUTA 1PV4A 5HR5A 5AJWA 1QG4A 3VU9A 1ZM2A 2IYXA 5JRZA 2C98A 3KXKA 1OFUX 2OG2A 3SJBA 4BZXA 2WIBA 5AJVB 4ZDKA 4HZIA 4YMUA 4F93B 2FA9A 2WWWA 4ILEA 3IBYA 5TARA 4A4DA 4XSHA 1ZUNB 5HE8A 2HF8A 3MJRA 1M7BA 1E9EA 2GJ8A 2JIZA 4Q9KA 1FQKA 3AKYA 2QAGB 4E07A 3FVQA 4R2IA 2JIZD 5FBVB 4IEIA 2IXGA 3IHWA 4ERNA 1R7RA 1GL7A 5EZ6B 2I3BA 3CPJB 3ZYCA 5H1YA 1T6NA 1U2RA 1ZUHA 2VBCA 2WKRA 3NTUA 1I4DD 5H68A 2ZRBA 3EG5A 4BE7B 1ZU5A 4RFSA 4K46A 1TNDA 1VYUA 4V0LA 1ZRHA 2GHIA 4QHYA 2OE2A 2Q9BA 5KNDA 2PT7A 3K0CA
chains in the Genus database with same CATH superfamily
2JKYA 3UFXB 1MABA 3BWCA 4HNRA 5KNDD 2YJTD 4F5YA 3MJDA 1J8YF 2FPIB 4C22A 3TMAA 2FLWA 1BVHA 3D5QA 4OO3A 5KSOA 4LE1A 3ONDA 3L3BA 1NU6A 3K4QA 2IUEA 4M7PA 4MS1B 5JDIC 1KI1A 3KWJA 4YAFA 2JLXA 2O2IA 1GFWA 3E3AA 2XVMA 3Q11A 1GTL1 1XVVA 5B1SA 1QRRA 1MV5A 2YHAA 2ONKA 3M6WA 4J4HA 5C34B 2XNHA 4GI7A 1U7OA 5ALYA 2GBCA 2PBFA 1QP0A 1JIIA 1LTKA 2RK3A 4MW0A 1V43A 1RHUA 2UZIR 3FGPA 1RWNA 3LK7A 2Y0DA 4C4AA 5JNRA 1GDDA 2AEMA 5EJMA 3LPCA 3OFND 4MV1A 4AURA 5AVWA 1HE3A 1XEXB 4QU9A 3STXA 1N2IA 4G09A 3DQZA 1OVGA 1TT5B 1CIVA 2NTJA 4ZQCB 3V6MA 3VU3A 4RM2A 4LYHA 2WF7A 4HDMB 2J08A 3PTZA 3G8CA 2VHCA 3BD6A 2ZR8A 3QLUC 4LN1A 5DRYA 5CD9A 1E2GA 4K0RA 1YDWA 4WX2B 4E7PA 2RGNC 2IBTA 3ZWWA 3KUKA 3OZGA 1R8QA 1F0KA 1UT8A 5JDCC 5T4FA 5AICA 3GUYA 1T3ZA 2R6HA 3TSOA 1OIWA 3MJTA 1ZEJA 1AIPA 3A1DA 3OIYA 4MRVA 4C0AC 3MJCA 2Z6VA 4MYCA 3D5EA 3ILVA 3PG5A 4O4IA 3U3ZA 1A9YA 3GJSA 1UPBA 1Q0HA 2ZUBA 4WMLA 5HIAA 4GYKA 4HUQA 1QBGA 1X1RA 1FFGA 5M3BA 4HNSA 4M8LA 5TMDA 1JHYA 3HXTA 3UJPA 4YMLA 3CLSC 2P40A 5IF9A 3JVUA 4NYMQ 3CRZA 1F6DA 1QIKA 5DIFA 2FWRA 1AV6A 2GXQA 1OTYA 3IMKA 4CV2A 1EJ6A 5KREA 3H0CA 4FDMA 2AFIE 3QK7A 1G1MA 1PHPA 3NP7A 2ZJFA 3QRWA 3ZKAA 2ZI7A 2DECA 1C0KA 4BLQA 3CH5A 4U7PB 3EPLA 2QN7A 1US8B 3IH5A 1AGYA 3H3JA 3HXKA 2XB4A 3IVMA 2QN2A 1HEUA 1UZUA 5EI5A 4HAVA 5EXDA 3V1MA 1QRTA 3W8RA 3LSTA 4Z7NB 3JWJA 2ZJYA 1ZR4A 3I53A 3OQJA 2AFIA 4Q9HA 5DCUA 1NUAA 3PC6A 2R1ZA 2ESRA 3VSEA 2ZETA 1J1ZA 2GM9A 3EVAA 5ERXA 2XGJA 4ZVUA 1PZEA 2C1EA 1Y9EA 2H1LA 1ZMTA 1PT7A 3QNWA 5EYPA 4TSFD 1JB9A 1HE4A 3P2IA 2JH9A 3UMJA 1VLQA 3EH1A 4DGQA 4FYXA 5F9FA 3LWZA 2DY1A 1E9VA 4G65A 5CW2A 2FWIA 2WD8A 2BZGA 1POWA 1TW2A 4EQ6A 4UE2A 3BGSA 4AS1A 3ZCPA 4XWKA 5ES3A 1H94A 4GD3Q 4JEMA 5AFSA 3V8BA 1E2EA 3WE7A 4TTTS 1HQDA 3LHKA 3LT4A 4NENA 5FADA 3HVJA 3DEAA 5IM4F 3W8EA 2HKIA 4J7XA 5AKZA 1RQGA 3EDRA 5PGMA 4YEDA 1P4JA 4PZAA 2V55B 3ROPA 4RDCA 1JTEA 3KZNA 3NKLA 3LDHA 5JSZB 5CYGA 4O2AA 4TT3A 2ZDGA 4ECEA 3UWMA 2B7CA 4OYLA 3VR5D 4ZYZA 1RKXA 5JYDA 1DAPA 4N5MA 1B8VA 3ZU4A 1LDNA 4MQFA 5B53A 4I1UA 3P9CA 2I7XA 1AGPA 1USKA 2IYSA 4H15A 2DFDA 1LH0A 4LJ9A 3UJ7A 2IEGA 2PQ2A 2YIMA 3CEAA 4K3UA 3VTFA 1NKVA 2QT9A 3ROQA 1QPZA 4MHSA 4WKBA 4UU0A 1ESZA 1MIOB 5LBUA 1FRVA 4Q6WA 4HF7A 4EPYA 4EKDA 2C2BA 3DVAA 1A4IA 4Q4JB 5U4QA 2WHPB 3DW3X 3P9XA 4IIYA 3HJTA 1E6CA 1UMDB 4DREA 1UAGA 2IUSA 3EY9A 2RH4A 3S2YA 4PZZA 4ND7A 4OMDA 4HWSA 3R7DA 5GONF 4Q1CA 2CSXA 1G7SA 4YDSA 2XMQA 4NL4H 3LXUX 5EESA 4KVAA 2VWPA 4HXYA 3DMHA 4M6WB 3WV4A 3H6KA 3LC1O 3QEMB 3RAFC 1U8YA 2I6XA 1XF9A 3BE5A 2BGLA 3BFVA 3F6PA 4HEA6 4G3XA 4II2A 5JAMA 3AL0C 2N1MA 3D2LA 4FYKA 4PHCA 5LXTA 5TDHA 4JBNA 3UOGA 4YB8A 3K0HA 2WV9A 1K98A 1P6QA 1ECPA 1PX2A 3LWNA 5CX4A 5BV0A 4KPUA 4F9FA 5I8WA 4X91A 2C9DA 5DPMA 4CMJA 3LU1A 4JNCA 4KSBA 3S6JA 3H5TA 4JYPA 3U9SA 2WM2A 3C7AA 1XQ9A 4NCBA 3Q5DA 1GGHA 2B4QA 1C3EA 5C0OE 1H5NA 1WMEA 2RJNA 4P1ZA 4PIPA 4BAUA 4DLWA 3ETGA 4LJAA 5TJ9A 3U81A 2M2IA 2MINB 2G77B 1XELA 2H1RA 3PQCA 3RV4A 3NYQA 1L7EA 3SCZA 1RYFA 4D0SA 3QKRB 1KQNA 3WXBA 1J9GA 3AYZB 5TLSA 4D3YA 1LPSA 3DSRA 2C2OA 2OCAA 5KOYA 1E6EA 3TG2A 2O1EA 3B6IA 1KOGA 1BDMA 3RI3A 3DTTA 2ZM6B 3IPLA 1MPXA 1GUFA 2O05A 1CIPA 2SCUB 3Q87B 3Q88A 3Q3EA 1E8MA 4CZ2A 3AM3A 3HI6A 3S99A 1OX5A 2XODA 3ZIAD 3JCZA 2VJBA 3MWJA 3PS9A 2IYUA 4OOFA 3I3OA 4Z0NA 1PR0A 1DIOB 2XCIA 3VMMA 4QOJA 1DAGA 2FU5C 2W43A 1V16B 2ZW9A 1DAIA 2G82A 3QUTA 4NTZA 3UVEA 3QU5A 4W6ZA 3RHTA 2WYVA 1D8TA 1DZIA 1E2MA 1SKYB 3BD8A 1DU4A 1RAHA 1T6XA 1X7XA 1MW9X 2O50A 1KMNA 4W5TA 1UK6A 3HHPA 4C9BA 1AG9A 3EFHA 2BDTA 1M8JA 2I1VB 3JATA 1I4TD 2CXNA 3OD1A 3VUFA 3ANXA 1MR3F 2PGDA 4DBZA 1IXSB 2GXSA 5K0ZA 4KFSA 4IIJF 3VKUA 3L4SO 3WISA 1GGMA 2JD2A 4I4TF 2JAPA 3K5PA 3VSAA 2BHTA 2ZROA 3DMNA 1UBNA 3J7TA 4M99A 4TTIA 2XB9A 3VPFA 2ZT6A 2VZ8A 4OJQA 1NXQA 2ADOA 3E03A 2QORA 2PN1A 3JS5A 1YZNA 4O4JB 5EMKA 3UZUA 1UOEA 3VOTA 2YXLA 1JVSA 1K5PA 3COZA 4QLAA 4K5QA 2Q4DA 1JFFA 2SKDA 5BN3A 3BXHA 2YMQA 1W6RA 2C78A 3PPVA 2IEDA 4G84A 3E3NA 4Q3AA 1Z2DA 1IY8A 1HETA 3O0TA 4FGWA 8AT1A 4KKXB 4FR5A 1RRGA 4BP3A 3GAMA 4DMHA 4INOA 5DK4A 2VJDA 1KARA 3PUKA 5U9CA 2BLLA 1QE5A 2VLIA 1ND6A 1P5JA 3ZXXA 1DXYA 3GB9A 2QZZA 3FHTA 4XPIA 5FWXA 2F3UA 3GD5A 3AT1A 3HDJA 2JFQA 3EBLA 1BVYF 3ONWA 3PFBA 4NR0A 2GM3A 4HGOA 4TMXA 5LMNB 1CWUA 1K0UA 2FEWB 3A1TA 4RVDA 4C4TA 2PUWA 5J58A 2JCXA 1T2AA 3QKSB 1Z8NA 2P3OA 3NTQA 4JJZA 1IOVA 5JO9A 3MBOA 1G6OA 3A1NA 4LGYA 1U80A 3QKTA 4U2GA 4K81B 3BICA 3L6DA 2PA3A 1AZSC 2VBFA 4KO8A 2H7VA 1W88A 3HKEB 3ZGVA 2R1TA 2P2YA 5IDXA 4IQ4A 1VCIA 3ADBA 3CY6A 4X7MA 2P7IA 4ARZB 1ZMOA 3K4HA 5A3QA 3MA0A 4UZEA 1K7EB 1SIWA 3BWXA 4WVFA 4XM2A 4D8YA 3C6XA 4TMWA 1MO6A 1T4CA 2HFKA 5JBQA 3LECA 3MJ4A 5EGNA 1N6IA 4U8HA 3NV7A 3U4DA 5FBWB 4K9RA 4HX9A 2QN1A 2R60A 1N2JA 3B53X 3ZEIA 3ZTTA 4PV7A 1Z18A 4DF3A 3IDAA 3KLNA 3UW1A 4DDVA 2FMIA 1ECBA 4HZUB 4UZSA 4YT5A 3OZSA 3RS8A 3V4LA 5JO0A 1ZXLA 4JKIA 4UDYX 1CY2A 2G0TA 3U40A 4MTCA 5AO9A 1D4FA 3MGBA 3SDSA 2PQ0A 3BWEA 3TAXA 1DUIA 5KKNB 2ISCA 2WHRA 4JSRA 4MV0A 3SC6A 4PNPA 5BW5A 2PCLA 3KUDA 5ER6A 1MDBA 2IXAA 3A6DA 4Q6BA 4LYAA 4WLUA 4WNCA 1WB9A 2ZSAA 1L5FA 4ZD6A 3AZPA 5FJJA 2IK8A 3DWFA 5FOSA 3C3JA 3TZQA 2CC2A 2AC4A 3AUFA 1H23A 2VCHA 4KQIA 4RXMA 1KEVA 1J8QA 5K03A 4XLZA 1JR4A 2JANA 1YKGA 1C14A 2G07A 1DQYA 1F06A 3I1JA 4MVJI 4UEQA 4NE9A 3QEKA 1NW5A 2NXEA 1Z2NX 1EVJA 5AXDA 1PK7A 3DWEX 3FKSA 3OQPA 2GR9A 4IDNA 1DIHA 5K0JA 3BA1A 5IU6A 4BNTA 4F7WA 2PG3A 2ZE8A 4ARVA 1UWLA 2VXCA 4HATA 4R40A 4RNDB 3WLQA 1ORDA 4JT2A 3I12A 4LZLA 4MP3A 3CQ9A 2DU8A 4TTVA 1Q20A 4Y2JA 1WD7A 3HJFA 4HYEA 1LBHA 2VPIA 3H8VA 4DB2A 1ZN8A 2EJWA 2GD2A 3COVA 3ZW9A 2W6IA 1E5LA 2RAFA 1KORA 4MWEA 2EZ8A 1T8WA 2YHSA 1A9XB 4XD7D 2QROA 4LDJA 2RCNA 3DEHA 2ZB7A 4R8RA 3ZDDA 2ODPA 1I1OA 2N75A 2AFRA 3GJZA 1IHYA 4PIVA 4AYTA 1MJGM 2GEBA 2OK7A 4C0KA 5HSGA 2HCJB 1OU4A 4DNQA 2XA1A 3JD1A 2FPRA 3T7KA 1OZAA 4AZVA 3H5OA 4TRNA 2XZOA 4Y8VA 4D9MA 2REBA 2O5EA 2EIHA 3GLHE 2JL1A 1YQXA 1OYWA 4B3FX 3RRMA 3SXUB 3OU2A 3ETLA 5HJ7A 5HXAA 2NUAA 2VXYA 3HB1A 1GO2A 4RMNA 4QSMA 1W48A 3S55A 2JHCA 1TXGA 1YFKA 2JLZA 1AA6A 5DBOA 4OFWA 2QXUA 2EBFX 3OCCA 5DGHA 4DAEA 4CL0A 3UK0A 2VYND 5HKBA 2I5PO 3KEGA 2FCAA 2E4ZA 2HK6A 2RKOA 3I9MA 1GDTA 1FNBA 3GLHA 5HQ3B 3GEEA 4L5IA 4BKUA 3KEOA 4BRUA 2PKWA 4BYMA 3RYFB 1EBFA 1JHVA 2Y3IA 3H8SA 2IVFA 4HV4A 4BLRA 5CJJA 1E2BA 3RYHB 2GI4A 3SHWA 1O77A 2XYRA 2PLAA 3Q0TA 1LPOA 4MTLA 1I9GA 2O52A 5EQTA 1IRIA 1EMDA 2X7JA 3FDXA 3FUXA 4TLAA 2AUNA 1N6RA 2PBLA 5LMCA 3F3SA 3ZE9A 1FC0A 4XCXA 3U3MA 1IZ9A 1KQFA 2RKBA 4TS3A 1VLLA 1WRBA 1G55A 2JGMA 3EWAA 3RAGA 1ZO8A 2NVUB 3BT7A 2YWHA 3P2OA 3R3JA 1C3OA 2GN8A 2DBVO 4MV7A 2P5UA 2I8CA 3H9QA 3T5DA 4LVOA 3ZWYA 3EVGA 2Q1XA 4BQOA 3D6FA 2XD4A 2G0NA 1D4ZA 2JIRA 2R00C 4IGAA 4B3TB 4EYEA 1JZQA 4Z2AA 3REOA 3VU1A 4EKNB 4QM6A 1T2EA 4D9KA 5EMNA 3DZJA 4JI3B 4C6TB 1VKHA 1F2VA 5CB4A 4OHZA 2RGBA 4TMKA 5LYJF 5BWMA 4MVJE 1EEXB 1VGRA 4P8RA 3SMVA 3OHSX 5TV2A 1YRAA 2JZOA 1WXDA 3BGVA 1JXAA 2FJ0A 3M5PA 1HZZA 4NOLA 4OHFA 4RPIA 5CURA 3ZDEA 2JLUA 3JWEA 1CZUA 3ZHUA 1L9XA 1X7HA 2WG0A 3K09C 4L75A 3DOCA 1MAHA 4QXMA 5KSZA 2KBEA 2BMEA 1YZVA 3IJPA 3E1GA 3M5WA 4E5UA 3DZGA 4S35A 8ABPA 3M81A 1Y5MA 4D46A 2CLKB 3QJ5A 1Z6PA 4MVJA 1HDGO 3OQVA 5FOQA 2HBRA 1CZNA 2WJJA 1C8VB 3EDYA 3GLSA 3B6MA 3ITNA 1B0PA 3K0FA 1QGUA 3KR1A 3PYMA 1ADFA 4JUDX 4MUNA 3L8ZA 3LUBA 4IW3B 4PHHA 1PR3A 3SM9A 1BJTA 5TQVA 5KWVA 5K0TA 4UNSA 4JKYA 1MZVA 4Z9YA 1YU9A 2B6HA 1LPAB 5EUBA 4ZOQI 5KU1A 4TYYA 1OAOC 5IARA 4CDRA 3TLXA 2FQYA 2CCJA 4LV8B 2GRUA 1I9CA 3A6EA 3L7DA 1VHJA 3LLCA 4J1SA 2DVMA 3T5PA 4Q3BA 1IK6A 5ESRA 4JXKA 1GNVA 3PI6A 4O2RA 3GLGE 1PQUA 3E2PA 4R1OA 1JBQA 4YDQA 1SOUA 1R4NA 3M9WA 4M22A 4W5HA 5FA6A 5JJLA 4JYBA 3GWZA 5AVJA 2RCYA 3DZDA 3BQNB 3MCZA 2X9VA 3OO0A 2C0CA 3AERB 3G5UA 1W0JD 1G8YA 2IU4A 4DAOA 2XNKA 1HY3A 4JMLA 1BA2A 1I33A 3H0EA 3R0QA 1PUXA 2VJNA 3VVBA 1W76A 1ZH4A 1N33B 4PHFA 3JAKA 4XB1A 1NP7A 4WACA 3PDCA 3G82C 4JBXA 5THXA 5T3UA 3ZYZA 3KP1A 3NHBA 4BVBA 2R4UA 1P7PA 4Q1EA 4CEHB 2JDID 1LK0A 1Z0FA 4MV8A 2COUA 3PF8A 4YMVA 2D2FA 1SZJG 2Q4BA 4TV8B 4BFTA 2EGGA 4L4YA 2PZKA 3FOWA 3EIXA 1GLNA 4OSOA 4H7EA 3TYXA 1KP3A 4E2FA 3JVIA 3U6BA 3GLFE 5JAQA 4CW7A 3OLZA 4Y2RA 1QIJA 3EQ9A 5J1TB 2AMYA 3HWSA 3DF9A 4OQDA 4TUYF 1V7CA 5F2OA 4B44A 4F6RB 4DIBA 2EBUA 1R00A 3UCEA 1LS6A 3B6ZA 4YGYA 1VG1A 5LZ8A 2GAOA 1XNQB 3HY4A 1M0TA 3HY3A 2EHDA 1KDYA 5K8CA 1UQUA 2CDNA 4JJFA 2IEIA 4OI1A 4IPTA 1G19A 2NX2A 5HZGA 3AUTA 1JSXA 3VU9B 4NX2A 2RH5A 3RYIB 1J9ZA 2C2XA 2E1PA 5FWAA 4HYQA 5I7VA 5MGNA 3A7DA 1J0BA 3NUQA 4CI0B 3UJ3X 2QN8A 2YRXA 1U9IC 4UMVA 1HYHA 4RQTA 4X94A 4G0VA 1XEFA 1OH6A 3TQIA 2AI1A 1GL3A 1P0CA 1UBRS 1NVGA 3A6HA 3EIEA 1XRSB 3C1TA 3L84A 4GR5A 3TNYA 4KWIA 4CUJA 4D5EA 5CVVA 4PAOA 4EG6A 2X1LA 5H3CA 2RGYA 4BTEA 1QGDA 2RHOA 5C81A 4QYIB 3ER9A 1MO5A 1DFHA 1OLOA 2A5LA 2Y0BA 2UV8A 3EVEA 2PV0A 4E08A 4ZYLA 5KB3A 4YJHB 1UJBA 3QTTA 1QVZA 2W4MA 4J3JA 1KBOA 5ILGA 4DRZA 1SVUA 4U7TB 3SEZA 1J0AA 3OPQA 1ZYUA 3AUXA 3VHLB 4AYWA 2F2TA 4XIYA 5K4AA 4L9AA 2WT9A 2C4KA 4JQOA 3ONEA 4ETNA 1DE0A 1E59A 3DXXA 5B3JA 4KGVA 4YBRA 1ZL2A 2NZWA 3B3AA 3D2BA 4KSYA 5FIUA 3TLZA 3U62A 3MOIA 1AK1A 3B6EA 1IWBB 1PUIA 2BFCA 1DWPA 2QTGA 5AM4A 3RU2A 3RW9A 1X14A 5JY6A 1JUDA 1OBHA 2BR4A 4P5EA 5B12A 1MRNA 4D4JA 4NS4A 4C43A 3A4NA 5JXWA 1GT6A 1MABB 1NV8A 1YZKA 1X1SA 1Z13A 2EKLA 4IWYA 2GO7A 3F1LA 3AONB 3NORA 1LTQA 1L8OA 3DMTC 1GRQA 3FAZA 4JH0A 4NICA 4NH0A 1PW5A 3LHFA 4PTZA 3ZKWA 1ESMA 2J6CA 4P9NA 3KETA 4U7DA 4D2IA 2ZB4A 3O4GA 2BZSA 5F78A 2NQ8A 4ZAGA 2C42A 3EIQA 1U8EA 2P62A 3HCPA 4AG5A 2ZEJA 3ESYA 3DZCA 4M1QA 5GIPE 2O59A 1CP2A 4FP9A 5DTIA 2VPQA 5CIWA 1Q77A 3R7LA 4NYJQ 4ZCTA 3CXUA 5SY9A 2Y67A 4E5DA 5F7OA 2H11A 3IQWA 1W5BA 4MKFA 4JR1A 4YP9A 5K6TA 2GF9A 2PO7A 3NZEA 3WI7A 2RAVA 2X3YA 1Z0JA 4JFAA 5AOVA 1X74A 1MAUA 2GZMA 2GYYA 4LZPA 1KSGA 4IUYA 3C39A 3O7WA 4MWZA 2JLWA 1RRFA 2VSQA 2RI1A 1R0RE 1TMKA 3CLHA 3O3NB 3Q6IA 2HA6A 2QVXX 2VH1A 3EF1A 3NGLA 4UATA 4UCWA 5G0VA 3N2IA 1H9AA 2FE1A 3G17A 4IJUA 1QQ7A 3E84A 2XCLA 4OFBA 1SUCA 1Y4UA 4ZAVA 3KHSA 4G0XA 1P1KA 1NP3A 1UKYA 2QRKA 2XDQB 4LRQA 3ESXA 1JA1A 3ZY4A 4C08A 3K71B 5HF8A 3OZUA 5LP6F 1RKBA 1SCNE 3I6ZA 4D44A 4TKVA 2JI9A 1BW9A 1R16A 4NFLA 2C8KA 3TQCA 4CI9A 1V6CA 1DG9A 1TPZA 3NETA 121PA 1XDWA 3L8FA 4OKNA 3Q8LA 5EKUA 3HCWA 1X1CA 4O4IB 2QJRA 2XWPA 3HRKA 1QFMA 3CYFA 4M88A 2X0FA 4D02A 4EK9A 5BW8A 4GDFA 4IIVA 1O5OA 4HUQB 1CFZA 2A8YA 3N8NA 3PZBA 2FY8A 4RZUA 2B99A 4V02A 3SY8A 4EG4A 3DCJA 4L8LA 4ZZ1A 1E2LA 2VA9A 4IFEA 2OBXA 2C9ZA 3T41A 4LOKA 3RBVA 3R4VA 1QKIA 4WBXC 2FWAA 2PVCA 4FS3A 2BCEA 4UHKA 1KI4A 2P27A 2GERA 4GQAA 1R15A 4ABTA 2GPWA 2KM1A 1Z2CA 2AEJA 4LF4B 4V3BA 2YKGA 4IM7A 3RSZA 3ZJUA 1NQAO 3W2HA 3EW9A 2QHXA 2YVLA 3U1VA 4RCVA 4X63A 2Q3FA 4F56A 4MQ5A 1M34A 4LNAA 4ES6A 1SKBA 2OV2A 3AOEA 5HIJA 3NIGB 3ZGXA 3SHTA 2DF8A 3KLBA 5IKMA 3FSEA 1RDFA 1XLWA 1DC6A 1DHTA 1SBQA 1BDJA 2P2LA 3BWYA 2BDEA 2QW8A 5EYPB 4CMEA 4DLRA 1ZMBA 3H2GA 2PKRA 5B2ZA 4ZRNA 2QYTA 1ZR2A 2EKQA 1WNFA 1ZUNA 2AK3A 3O4HA 4IMJB 4JL5A 1XO1A 5HFAA 4EQ6B 4OKSA 3S2GA 2WKQA 3AJDA 1FS5A 1GPWB 2AR7A 3JZAA 5ADHA 3ZDXB 1PT6A 3SJUA 1MC5A 1U3UA 2VDRB 4D0NA 1YBVA 2ZRHA 1AO3A 4ACBA 2DG2A 1XAIA 3AEQA 3SR0A 4NENB 1KJ8A 4UQLA 3K8ZA 1JDBB 4DA4A 3WQBA 2F1RA 4EG7A 1PCXA 1UDCA 3BOSA 3SX0A 1QHNA 1LVHA 2B0CA 3TI7A 3B1XA 2CKMA 1UMBA 4DVJA 4O2AB 3PFIA 1ZK4A 2IQIA 4EG3A 4F5ZA 3MLEA 1QGOA 3AF3A 3F2VA 3FB4A 1BWRA 1GTMA 2Q8QA 2ZT8A 4P4SA 4QOHA 5LN1A 4YP6A 3D81A 3QG5A 1GCIA 1I3LA 2IHTA 4HH4A 3GP3A 1QK3A 2BM0A 4HN9A 4MQFB 3KPUA 2C3PA 4HH3C 3OJXA 4EFKA 1U8ZA 2R86A 2EAUA 2C96A 3A4MA 4BNZA 1IVNA 5EZYA 1PK8A 2I33A 3HN2A 5AHWA 4COOA 3W5SA 4EO9A 2QYOA 3DVAB 3EPPA 2YWFA 4AMVA 4BJ6A 5B64A 1EXDA 4W5NA 1JPUA 3G79A 1XLTA 1FVHA 4MR7A 3G8BA 5CFRA 1I2CA 1V3VA 3FR8A 1D07A 2XYQA 3GN2A 4C4PA 1MD9A 2QLTA 4LV6A 1YS6A 3DV0A 4IQFA 5FEMA 2GYWA 1K86A 3G89A 1JDVA 3ZCUA 1KL7A 4X3CA 2J5KA 4ZOBA 2B21A 1Q57A 2QZ4A 2OGWA 4OQ4A 1TADA 2BEWA 2Q07A 1LLUA 2V96A 3Q9NA 3EHDA 1BXZA 4M46A 1QLJA 4D7AA 2V5VA 3RS5A 3WGLA 2G1JA 3FLBA 2VBIA 1Z6GA 2NSYA 5AVZA 4BXOA 2A94A 3SBXA 3N0TA 1S2MA 5LXTB 4KIFA 2WJGA 1PZGA 1ZXXA 3VU0A 4B9EA 4GO1A 4YCAA 1FUYB 2WJVA 4NONA 4HWOA 1OAAA 3LG2A 1AUOA 4RE6A 4KPUB 3R0ZA 2J8ZA 1KZGB 1V1RA 1NRJB 1FTYA 2YXPX 4TN5A 3ZCSA 1IN6A 1YNOA 2XOEA 1FUEA 3X1WA 2EL9A 1Y4AE 2FSSA 1TQDA 2RGRA 3G2PA 1UQRA 5ISMA 1PVOA 1EBBA 2V9PA 4R6XA 2AFHB 3KFVA 4UM9D 3ZCQA 3HKDA 2CFIA 1PKXA 3TRFA 1YR2A 3CUSA 4AZWA 4EFLA 2HU8A 4K40A 1UK9A 4XUEA 2QP9X 4Z4FA 2ZYTX 1DTSA 3WGQA 6ABPA 3R5HA 2I65A 3KDSE 1JKIA 2BE7A 3KKNA 3N7AA 4I4CA 1QHIA 4L0DA 5FTKA 5KO2A 3D3JA 2NUTA 1HDYA 1MVLA 3LOQA 4Q02A 2OSBA 1RR6A 4BNWA 3I52A 4XDHA 1K8QA 3KEMA 4LWQA 4M86A 5BQXA 2BHLA 3WLLA 3ANMA 3K4PA 5KQPA 2WHQA 4YFVA 4WJZA 4PX2A 1YVRA 2GZ2A 5LKAA 1YL7A 2I34A 4LRWA 1GRCA 2DP4E 3E1KA 3FVVA 1P1IA 2BV3A 3IESA 3QX7A 3R5SA 4N0EA 4MRRA 4EECA 3B89A 1JQ3A 1K2VN 2JLQA 4JA2A 1XGKA 4WXPA 3U19A 5KQMA 1N1DA 2R1VA 1VJCA 2SKEA 4QXPA 3WYNA 1X7XB 4HQRA 4QBGB 5EA2A 4CFZA 2DKOA 2ZI4A 4K8OA 1WL8A 5CCEA 1MB0A 3U4CA 2QS9A 4EY5A 2A88A 2BKUA 2LGJA 4YAGA 2MSNA 3GLRA 2XDAA 2B92A 3F6EX 4RHUA 2D5BA 2GNOA 2Q5CA 3K1TA 4URVR 5CYPA 4HO1X 2VC2B 2D62A 4BNUA 2YJ3A 3P19A 1KXZA 4DDHA 2WG2A 3O8LA 3VPSA 4KXFB 1PFKA 2X0RA 3FYUA 3NP9A 3WLMA 2FOLA 2JJ2A 4KQ2A 3KZVA 1LDMA 2J31A 1GU1A 4RZIA 4H0NA 3NNSA 3CONA 1CY4A 4YN3A 4EYKA 4F96A 1HM5A 3THOA 2QRHA 1JFFB 1DDOA 3BCHA 1WJGA 4RD1A 4BQFA 2C29D 4LGMA 1TA9A 3EAFA 2V6BA 3VNQA 5LP6A 4OM7A 3BH7A 2GA8A 1JLHA 1Z4MA 1SUBA 1FDWA 3G2KA 3B85A 3QVMA 1HKHA 1CG6A 1Y1PA 4RWZA 4E88A 1X8KA 2HQBA 1FX1A 1RLMA 3DOJA 5I7SA 3TKAA 2XBLA 3BRWA 3SBEA 4ID3A 4XPIB 2ZB2A 4LJ7A 4TYQA 5FWXB 5KWEA 3C43A 3L0CA 1X9GA 4F3CA 1W44A 1WHSA 1FYVA 5LQRA 2P0YA 2WABA 1DG1G 1EP9A 1QYVA 1MPTA 3FAKA 1HDXA 3VO2A 1DWQA 1OXXK 4KJZA 4KVZA 3ME5A 3TD2A 4GS5A 1G4UR 2IZ5A 4ZGGA 1KRWA 1RP1A 3K9NA 3OUUA 4J03A 2HFJA 5I9MA 3ZWNA 2VF7A 1A95A 1LSOA 1W88B 3IV9A 2R1TB 4DSNA 4DMKA 2XGMA 5EJ4A 2EFCB 4JC8A 2J85A 5C2JB 1P5HA 1ECJA 1CQXA 3C7CB 2CK3D 2YNMA 3IALA 4D4MA 3F4BA 4IEFB 1SU6A 4BMNA 4MAFA 3RBZA 3K0CC 3LGAA 5KYWA 4YRNA 4RL4A 1T4CB 1W9HA 1GQFA 4BO7A 1ZJWA 4HSEA 1QHEA 3KQKA 1FP2A 3C4JA 3PR1A 4MS3A 4R54A 1KZ9A 5KHLB 2C92A 3L2OB 1SOWA 1ZCJA 2P2NA 2FMUA 1P81A 1Y89A 1F5NA 2FR1A 1BU5A 2W2TA 5ENZA 1T0UA 4C0LA 1MO3A 1DAEA 1VHWA 2DUJA 3HYSA 3OTGA 1SVMA 4PC7A 5CTJA 5SV2A 1OY1A 4YJ2F 4ETMA 2DSNA 3PVSA 4PGMA 5DHPA 5EIOA 4FYJA 1MORA 2UYYA 1C3LA 1TD1A 2QPLA 3GDWA 4IDGA 2X8AA 4RJIA 4YYZA 1B14A 3RTAA 4C06A 1GADO 3EF0A 1T9ZA 3I92A 2ZBDA 3MTIA 5KTYA 4BMXA 1GG2A 4D26A 1EWTA 2XJ4A 1UBHS 2Y2UA 3B2QA 1YL5A 3VR6A 2ID8A 5D3QA 1TEXA 3WZ2A 2GETA 4R7TA 1L5ZA 3PHGA 4O5OA 2OVFA 3A9RA 4L8VA 5DXAA 5CAEA 2CBZA 1S9HA 1YBHA 1I5RA 1ZCFA 2QX9A 2XLCA 1K1EA 3KQYA 3MYYA 5TQJA 1XDBA 4G8CA 2Q5QA 2NSJA 2HCTA 3HKBB 2OHIA 1P7YA 4ZPXA 4GXNA 3GT7A 3K9CA 2BHRA 2Z2YA 5D8DA 1EHIA 4JC0A 3L8GA 1T5TA 2X1MA 2CMDA 5H3HA 4HI0E 1JDSA 3KAQA 1RXCA 3LP5A 3TH5A 1IMOA 2OBYA 2V7XA 1MRSA 2I9KA 2P6NA 4K9QA 1K8XB 2JC3A 2AG5A 4QRHA 1R12A 3WS7A 1KDOA 2AJ8A 1HC7A 1YMUA 2LRHA 3BDVA 4RSHA 1W36C 1L7VC 4O0MA 1MAWA 3D43A 2E4WA 4TOIA 2JFZA 5DRTA 2Z4TA 4WNYA 1CU1A 3A1EA 5AW2A 4B2LA 1QJ4A 3AR5A 2GPYA 2I2AA 3EIHA 4LGVA 3PR3A 2QLLA 2WVAA 1IY9A 4W7HA 1RJEA 4RZSA 1E1RA 1VPTA 5A4DA 1XCJA 3QYFA 2OR3A 4CU5A 2B78A 2NUAB 3AY6A 3EVDA 3RIXA 4M76B 1R10A 1ZMRA 4UFNA 2DPLA 1K3FA 1YNSA 4GPIB 2JRLA 4P0PB 4L1KA 4X5OA 1KJZA 3GMTA 3DZ8A 4B09A 3GLHB 2IOFA 4KHZA 4J91A 4Q34A 3ELUA 4QOGA 3TINA 3W77A 2DYKA 3DJYA 4KDEA 1KK2A 2WLSA 2EW2A 3ETNA 4KQKA 4RL6A 4EENA 1GG9A 5L3RA 3TIFA 4KO4S 2GHTA 4NU0A 4NZZA 2ZSEA 2QMHA 3ASZA 1Y5RA 3CM0A 4II7A 5FCDA 1JT2A 3FDJA 3JQ7A 4OOEA 5IP5A 1E3TA 1Y1QA 1ESCA 1TGYA 3AI7A 4HLNA 4K6OA 4HX5A 4OHVA 1VXOA 3QPAA 2HIAA 2I3AA 1L5HB 4FFLA 1UIMA 4NMXB 4BEJA 3USES 3EEYA 1YUMA 1LWNA 4P86A 2PGXA 4OFXA 1KDZA 4Z7QB 3OOYA 1NQ5A 5F4BA 3NU1A 1DSSG 2X5JO 4NY1A 3S1AA 1FSSA 4B35A 1PGJA 2B20A 5HBRA 3W2TA 5BN5A 3E5MA 1ZH6A 4WNIA 3VZBA 2ZE5A 3OJLA 2F64A 4RZQA 3A2KA 3C3AA 4G4SO 4JJ7A 1ZN2A 3CHYA 4LNUA 1KY5A 3MM4A 4WHMA 4OM8A 5H4HA 3RH0A 3ESRA 3TLGA 3A6JA 3ZOZA 2ZT7A 3K8QA 1J0DA 1PI3A 5IVIA 1F9EA 1XV5A 4PVDA 4K88A 1DIBA 1LK5A 4MGZR 2CBXA 5AYVA 2PPLA 1NOIA 3MELA 2F8SA 1G8JA 4MW7A 3IXLA 2ODQA 4BRSA 2FEKA 1YRQA 3RRFA 4PLPA 4YRCA 3NHKA 3QI2A 3HEAA 1AXGA 3AJ8A 5M5BA 5ELLA 3U7IA 3RGGA 1U0FA 4FOTA 3VNSA 1RVV1 4KMSA 4KIJA 4C78A 2J0SA 3HVKA 2AR0A 3R6DA 1CP3A 1JQLB 2R751 3GA5A 2OKCA 4AKEA 4KXQA 3K0FB 4GBED 1QGUB 3KYBA 4TZ6A 1SUWA 1AK2A 1KK1A 1KAHA 1E1QA 3WRXA 4R2XA 1UKBA 3A28A 4FHFA 1XZ8A 1O95A 2G70A 3F6CA 2GK7A 3GJ4A 3UJCA 1N3BA 5AVRA 2FX3A 2QG9A 5AUQA 1A4XA 4I0WB 2RI0A 5ICCA 3STUA 1HMPA 3RAEC 621PA 1KVQA 3D4NA 4ZICA 3AUJB 1GU0A 4HR7A 4WCDA 4D57A 2CZQA 2OCKA 4YMGA 3PNBA 4QHSA 1B76A 1QORA 1GPLA 3CGGA 4JX9A 4D6PA 2DBYA 1LX7A 1R4NB 4QTZA 3O8QA 4WKGA 4RHFA 4ZO4A 1Q7EA 4LQLA 3PEYA 2BW0A 2XVZA 1QCDA 4HAIA 3B2NA 1VBMA 4HB3A 1ZEMA 2P11A 3BSFA 3TCXB 3TNDA 1O2DA 5HMLA 3WNCA 2P6PA 5TQ2B 3HJRA 4NATA 1EFRA 4E5MA 4EAQA 1FZTA 4PHGA 5KNLA 2XHEA 4XVRA 3JAKB 4N41A 4G2NA 2OMEA 4ZN6A 3LBHA 4OKIA 3GNTA 3UKDA 1JSRA 1T5LA 2TECE 2Z1NA 4ZIRB 2JFYA 1A04A 1CKEA 1J4AA 1NF8A 2GBPA 3MCWA 2A3NA 3GXBA 1U0SY 2DTXA 2OO7A 3KHKA 4YONB 1DQSA 2XVYA 2F48A 1PJZA 3LDGA 4NJEA 2H6EA 5TB5A 3UQYS 5KJFA 3ETJA 1EM6A 3ECAA 4BIIA 5B6JA 4BMCA 4OMUA 1EWRA 5MN6A 2FPXA 1H05A 1SIOA 4PPGA 3V42A 5HJEA 1G5QA 1N2GA 3BXPA 5IAOA 4Y2VA 1PFQA 3H9UA 3DEFA 3PKJA 3KK0A 1T8SA 3V97A 4TLDA 4UM7A 1CQIA 3DH0A 5CGZA 1E5TA 3RS9A 3IIIA 4URYR 1YTLA 2YMLA 4G5FA 4EI7A 3Q72A 4LHXA 1X7DA 4LTNA 4U8GA 5JCPA 2YIVX 2XMPA 4BKQA 5KNCH 1EDOA 2YMPA 1E3IA 3K9WA 5ALJA 3J81k 2EW8A 3CWQA 3L4KA 1CDEA 3ZJ4A 1MRZA 4URHA 1DCMA 4QDOA 4NMWA 3VM6A 3D0RA 2BF4A 5DM4A 1A8HA 2CZGA 3T95A 4AKGA 3T38A 2AOTA 2D0DA 1VL6A 4R69A 1P9OA 3C5WP 1AT1A 4O4LF 3FSGA 1NLZA 5IYZF 4EARA 3F7TA 6GPBA 5KNBD 5A5GA 1DHRA 1SCUA 3FMIA 3DJFA 2Z6UA 2APJA 4HLUA 2I3GA 3FCSB 3DDCA 2WQZA 1QO0A 3ADDA 2YY6A 4TXNA 5I47A 5D6NA 1E2DA 2DUWA 1QSGA 3FRHA 1NSYA 3I9KA