2GHTA

Ctd-specific phosphatase scp1 in complex with peptide from c-terminal domain of rna polymerase ii
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
180
structure length
180
Chain Sequence
b'QYLLPEAKAQDSDKICVVINLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxy-terminal domain RNA polymerase II polypeptide A smal
publication title Determinants for dephosphorylation of the RNA polymerase II C-terminal domain by Scp1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 54
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ghtA00
3A1EA 3B8EA 3D6JA 1LTQA 3CZ4A 1LVHA 3OCZA 1O08A 2BY4A 3SKYA 1FEZA 4UW9A 5ALJA 2I55A 3WK7A 2ZBFA 2RARA 3SHQA 4DW8A 4EENA 2IOFK 2NYVA 4L6CA 3L7YA 3KOOA 1L7PA 3U13A 2HCFA 4UMDA 1EK2A 5ALDA 3QU7A 5ALIA 3L0BA 5AI5A 3ZVNA 4JB3A 4BX0A 4CNQA 2YMMA 3ED5A 2C8KA 4EX6A 2B82A 2I34A 1Z4LA 3WKDA 1L7MA 4YH1A 2WF9A 2DQSA 3L0CA 2FUCA 5AI6A 3E84A 3WK8A 1L7OA 2NO4A 3QUBA 4DWOA 3AR4A 3OPXA 5AW3A 4EZEA 1EK1A 3QGMA 3ZUPA 3W5DA 4Y2YA 1KYTA 3EPRA 4Y2PA 3NRJA 3ET5A 3MPOA 1AQ6A 4HAIA 3PGLA 5AW7A 1N8NA 1NF2A 4Y2UA 4BYGA 4UMVA 4EX7A 1RKQA 2B8EA 2O9JA 1Z4QA 3R4CA 1RDFA 5AI9A 5E0OA 1RKUA 3ESQA 1F5SA 2HO4A 5AM3A 3B9BA 1J97A 3WKCA 3N8GA 4UAUA 3J7TA 1RKVA 2ZBGA 4HGRA 2HSZA 2YJ3A 1RQLA 4I9GA 4UATA 5AKIA 1RLMA 2G80A 5ALYA 3ONNA 2YJ4A 3ESRA 3DV9A 5AW5A 5AVWA 1YJ5A 2HOQA 3FVVA 4B6JA 4F71A 2IYEA 5JJBA 4Y3UA 1RRCA 5AM1A 4FFDA 2ZBDA 5AKJA 3GYGA 2HX1A 4EEKA 2IOFA 1RC8A 2CFRA 4UARA 3VAYA 3U7GA 3L8HA 4YIKA 2WF8A 1Z4MA 2JARA 4MWOA 3UM9A 3WK5A 2G07A 3KZXA 2C8LA 4DFDA 4RESA 2I6XA 3U7HB 2W11A 3NAMA 2B30A 5A3SA 1SU4A 3KBBA 4BEVA 2GMWA 1WPGA 3KC2A 5T41A 4NFLA 2WF5A 3QUQA 2IOHA 3EF1A 3BA6A 4HGPA 4QQFA 5ALKA 3K1ZA 1WR8A 2YMLA 3I28A 2R8YA 3QU9A 1L8LA 1WVIA 1RLTA 1T9ZA 4XOUA 3UMCA 2P27A 4IG4A 3MC1A 5ALLA 5AM0A 3NIWA 1RMTA 3L8EA 2PR7A 2WHEA 3AR8A 3RF6A 2G09A 5ALQA 4E88A 2MU1A 2ZXEA 4Y2JA 5A3QA 3FM9A 3ZVLA 1TA0A 2EAUA 4UASA 1Z5UA 1ZS9A 1XP5A 2OBBA 3L5KA 4CF5A 3WKBA 4MUMA 5AICA 2RB5A 1U02A 4BNDB 2HF7A 4OCZA 2O2XA 3PCTA 3AR6A 1YNSA 4Y2XA 2B1QA 3BWVA 1MH9A 1WZCA 2B0CA 3FPSA 2RAVA 5AVVA 4BX2A 4Y2QA 2AUTA 2FPXA 4PNHA 2FPRA 5ALVA 3ZWKA 2AH5A 3WKAA 2YJ6A 2CFTA 5AIBA 2ZOSA 4HGNA 5AW0A 1QYIA 2YFYA 3OCWA 4G9BA 4Y2VA 4UM5A 2GFHA 2BDUA 5AVRA 4J03A 5AKXA 5IT4A 5AM2A 1TJ3A 3ZI4A 4NWIA 2P9JA 2G08A 2I33A 5AW2A 3EF0A 2JAUA 2W43A 1Z4PX 3QLEA 3L0YA 1QQ5A 1RPZA 4G63A 1J8DA 3IRUA 2MSNA 3I6BA 5ALOA 3E58A 1IWOA 3WGUA 5AHXA 1U7OA 1Z88A 2P11A 4I9FA 4KX5A 3NUQA 1S8OA 2GO7A 1JUDA 4AS2A 2B8JA 2YMQA 2OYCA 4C4SA 4CF3A 3IJ5A 1ZRNA 3WKEA 1ZD5A 4C4TA 2HDOA 2C9MA 4ZEWA 3DNPA 1Z4NA 1YS9A 5AVSA 1QQ7A 5ALPA 1VJ5A 5IS2A 3ZVMA 3I1YA 4KYTA 1T5SA 2PKEA 3WGVA 4L6AA 2X4DA 5FP0A 4O8CA 1ZD2P 5AM4A 5AK3A 5AW9A 4UU1A 2RBKA 1TJ5A 2GHQA 1NRWA 1ZOLA 1ZD4A 2FPUA 2P69A 3U19A 4FE3A 3NALA 2C4NA 4KNVA 2EATA 1Z5GA 1SWWA 5AVQA 4BKMA 3SF0A 1Z4KA 3CNHA 1U7PA 5AI8A 2VKQA 4EELA 1Q91A 5AK5A 4YCNA 3QXGA 4C4RA 2YBDA 5AKLA 3MN1A 3F9RA 3E8MA 2FUEA 2G06A 4NABA 5ALMA 5AVTA 4YCLA 1YV9A 2ZG6A 3FGOA 4JDPA 2QYHA 3HYCA 4YGYA 3OCYA 4BNDA 3ZTYA 3OCVA 3QU4A 2HHLA 5AKHA 2YJ5A 2OA0A 2QLTA 4UMFA 1XPJA 4KX3A 3KDPA 2JGAA 4AS3A 3OCXA 5ALTA 3SD7A 3PGVA 4YCMA 4J2TA 5AW4A 5ALRA 3S6JA 3WK4A 5AVYA 3QU5A 3ZWDA 3TLMA 3DAOA 4Y2SA 1U2TA 3WK6A 4UAVA 4HGOA 3WK9A 5AKYA 3R9KA 4AP9A 5AK4A 3ZW7A 3N5KA 1L7NA 4OD0A 1N9KA 4BX3A 2W4MA 4DCCA 2YMPA 1ZRMA 3AR2A 4GIBA 3B9RA 3I76A 1Q92A 2I54A 5ALWA 3AR5A 2YN4A 2R8XA 2CFSA 5AW6A 2Q4RA 3N28A 4BEWA 5A3RA 5ALSA 1NNLA 5AKGA 2IA5A 4KN8A 2Q5EA 3SMVA 2FPWA 2D2VA 3L1VA 3HLTA 2JAOA 2Q4TA 2CN1A 4UMEA 1VFPA 4FYPA 4ZEXA 1XVIA 3OTQA 4L57A 4UU0A 2WM8A 1RMQA 1YMQA 2B1RA 5ALEA 4H1WA 4IFTA 2WFAA 5AM5A 4NAVA 1CQZA 3U7EB 3L1UA 3MMZA 2HF2A 5AVUA 3U26A 2EARA 5ALFA 3W5BA 3AR9A 1YDFA 4OHFA 5ALZA 3EWIA 2R8EA 1S2OA 5AIAA 3AR3A 4Y2TA 3ET4A 5AI4A 4OFZA 2G0AA 4KNWA 2G1AA 5AVZA 3SLRA 2AMYA 2C88A 5AESA 1Z4JA 2FI1A 1K1EA 1ZD3A 4UM7A 1QQ6A 5AK6A 1CR6A 3QNMA 2HI0A 4Y2RA 5AKZA 1TE2A 3FPBA 3RFUA 5ALHA 3A1DA 1Z4IA 5ALUA 2WF7A 2PQ0A 4BBJA 3KD3A 4GXTA 2NO5A 1Y8AA 1PW5A 5AKEA 4F72A 2I7DA 3A1CA 3ZU6A 3L8FA 4XPZA 4XE5A 3M1YA 3ZX4A 3SKXA 4ZEVA 3E81A 2AGVA 5AKKA 2OM6A 4HYTA 3NASA 3UMBA 1X42A 1QH9A 1Z4OA 2FEAA 3A3YA 2BDEA 3QUCA 2R8ZA 4YIHA 3N07A 5ALXA 5AI0A 1SWVA 4QJBA 3QYPA 3QUTA 1O03A 2WF6A 5IT0A 4RETA 2YY6A 3IB6A 2ODAA 3QX7A 2HEGA 1L6RA 3OCUA 5AVXA 4CF4A 2GHTA 4NV0A 1RMYA 1VJRA 1ZJJA 3U7FB 3P96A 1T5TA 4CE6A 5ALGA 2JAWA 1U2SA 1L8OA 3R09A 4HGQA 2ZBEA 3ZX5A 3AR7A 2FDRA 3ZTWA 3DDHA 4XQ0A 5AW8A 3W5CA 2FPSA 3W5AA 3FZQA 5AW1A 1RLOA 3PDWA 3L8GA 1TJ4A 5ALNA 1RQNA 3M9LA 3N1UA 3NANA 3QU2A 3UMGA
chains in the Genus database with same CATH superfamily
3CBGA 4L4UA 4D82A 1I3KA 4NK5A 5JW6A 2Q8PA 4PYMA 5IAKA 1QH1B 1GXSB 3F4BA 4Z4GA 1DT3A 3N2YA 3W4KA 3L79A 2YQ4A 3E1GA 5E6RA 5CEFA 4DB4A 4EJSC 3UXEA 1PSWA 4NCKA 1DC5A 1N8TA 2CDRA 2RCYA 2GI4A 3NORA 3O9MA 4DIFA 1MO4A 2IGTA 3Q8KA 1MTOA 4LWZA 4ACBA 3FLMA 3Q9SA 3IESA 4B87A 3VX3A 2RMKA 2IOFK 3UAOA 5G4KA 1NNSA 2IEZA 4INAA 5BR1A 1RZVA 2PDAA 3H04A 4LNHA 4NECA 4TS4A 2X4LA 4JJGA 1HL3A 3HL4A 1C3JA 2PR2A 4Q4LA 3OLXA 4Q4AB 4DC1A 3OQ6A 5JCXA 3CPEA 3LLUA 2VT3A 1LDEA 2EYUA 4DV1B 1GSHA 1HR0B 5FQOA 4PHTA 4RVCA 1EQ2A 1ZBQA 2I34A 1TQ8A 3LY5A 4QQRA 5L40A 4RIGA 1MB4A 1YE8A 1LS1A 2VUHB 1L7MA 3JSXA 4UZEA 4KC0A 3SNHA 3KZMA 2BCJQ 2OECA 2PSJA 1E8NA 4WADA 1T4CB 5DHFA 2Q3FA 4CDMA 2NO4A 4Q34A 2VDOB 4EB0A 3MJVA 2JIQA 1XTRA 1JEEA 1WDWB 4OQMA 1JXOA 3EA4A 1QLWA 3NI2A 3IBFA 4EZEA 4FNGA 4UZSA 1QCCA 3QX9A 4FEAA 4Z1MA 1B14A 4OJQA 1ENOA 1SC4A 1HM5A 5DNYB 3HR4A 2VTBB 3GQBB 3LVFO 1W88B 3MPOA 5BQXA 4Q9KA 1G8YA 3LE8A 3VC3A 2P8SA 2CUKA 5LXTA 2EBWA 3RRNA 3ESCA 1F2VA 1ULZA 4X97A 1XNQB 1GR1A 1KJJA 3VHXA 1WHSA 4BNVA 2ACKA 1WXDA 3KQVA 4JUIA 2PX0A 2JZNA 4UNPA 1ZXLA 3K0FB 5KSYA 1P6XA 3L7LA 1OILA 1LI4A 3TKYA 3GW8A 3KXIA 3QVVA 1SUEA 3E9MA 1VM6A 1U3VA 1RKVA 1ISSA 1JAHA 4N0PA 1QOQB 5JS2A 2YW2A 4ZQGA 1V48A 3HDYA 3EUFA 4RELA 4UATA 2CXNA 3C45A 3GPCA 4C04A 4G65A 2YRWA 3TTYA 3AQIA 3HU2A 4BVFA 1GCIA 3V8EA 1GFSA 2GNOA 1WUYA 2Z4TA 4B4OA 4PG5A 5K3AA 2P9QA 4ZHSA 1KQGA 1OLSA 2AJBA 3BUSA 2G5CA 3CN7A 5HIAA 5EI5A 4AX4A 1KBZA 3E82A 4A2QA 4BO7A 4C4OA 2YICA 1CP3A 2OYRA 2PUGA 4TMWA 1NXOA 3WLEA 4H60A 3O8NA 3EEQA 2VK4A 5H59A 1W93A 2Q8QA 1DC6A 1FUKA 5J9FA 2KLHA 9LDBA 2HQOA 1YQQA 5LQSA 3WP0A 2O48X 2AJDA 5JG7A 1F7VA 4BQSA 3BCSA 1UJ2A 1PCXA 1SU6A 3Q7QA 4MW9A 1IMOA 3MWEB 3G89A 2EG9A 1PT5A 3DZDA 3K1JA 3IR6A 1SC3A 4RENA 2VYND 2XXJA 4KACA 3ZU4A 1XTVA 3N74A 2Y6VA 1USKA 2IPXA 4PZ9A 1O0BA 2D74A 2WJVA 4IVPA 5K99A 1VL0A 1AM4D 4B47A 1HH4A 2H9AA 3EWNA 4Y98A 4OA5A 2QNIA 3O5AA 4QQFA 2BMWA 4J1TC 1PYOA 4J6EA 4Z7NB 3GN2A 3K94A 1GP2A 4ZFNA 2Y71A 1ZZGA 3C7DB 3QU9A 3H4IA 1M2VB 1DVRA 3RK0A 4UOEA 1BYUA 1UM9B 4KO8A 2ZYGA 2I1WA 4QO8A 3F47A 2V7BA 2HKIA 1T5DX 4TTIA 3AJDA 5BW5A 1SXIA 4U0KA 3UB2A 2ZW9A 2EVWX 2X8AA 3MIIA 4B2PA 4HRAA 5KZMB 2JNWA 2RSLA 2FQ1A 3SZOA 2CDNA 3K2IA 3ORSA 1VPTA 2Q28A 1ADYA 1VJCA 3DDUA 3EH2A 2LE0A 3IBCA 4PBRA 3GHHA 3WJ2A 2G9RA 3ROGA 3OZWA 2GZAA 2VRWA 3E8XA 3FM9A 1TA0A 4I81A 4A1FA 1ZNYA 1Y4AE 1X87A 4M3NA 4PSAA 4OHYA 1XP5A 4AJNA 3RDPA 4D0LB 4OBBA 4L8LA 3PX7A 2FWMX 2XOXA 3MJFA 4LVOA 1LJ8A 4WXPA 2G71A 2WP0A 1EIWA 4CU2A 4OGFA 3Q88A 1MW8X 1SIBE 1YOVB 3C6KA 1HURA 2H2HA 1UIRA 4MEJA 3PUYA 3RAPR 1J22A 4L5CA 4PVCA 4QPZA 5EIBD 1F7UA 3KBOA 3NU1A 1UWLA 1GKYA 2FPXA 4YJ2B 5ARDA 2QMYA 3O1LA 3U7IA 3D02A 3GLFB 1KJQA 4R71A 5CA0A 4JGGA 3T99A 5DTQA 4YRAA 3H1PA 1QYIA 3SXJA 1WJGA 2L17A 4RIIA 2OCAA 1XI2A 2QA5A 4TMYA 2CB0A 1HK7A 3GK3A 1QRDA 1FJHA 2C8JA 3EDQA 3WRXC 1PT7A 4B5KA 4Y2VA 1P39A 5HQ3A 3R6WA 2B69A 3BCRA 1S8NA 3P9IA 3OJCA 1K6IA 1PFYA 4I50F 3SWWA 2ZAIA 2ZUTA 1X1BA 2BHSA 3EWAA 5IT4A 5ERXA 5EPUA 3DTVD 1K06A 1BDJA 2H06A 5AVKA 1OYOA 2AR7A 1TK9A 2CUZA 3QMMA 4NWIA 4YFYA 4ETNA 1OB2A 3GLVA 1NBME 3CVJA 1PUIA 3RGGA 2C2WA 3VRHA 1R00A 4F2PA 5AW2A 1HSZA 2OBXA 3IAS1 4H08A 1DIAA 3H87A 5IC6A 5C52B 2ENWA 2SKEA 3MM4A 4MYDA 4C87A 1OYYA 4NCHA 1Y1SA 2OFWA 2YNMD 3VMMA 3FBGA 2JFGA 3IAM6 3DBRB 3WGZA 4UE2A 1QZUA 4HFNA 1IWOA 2XD9A 2W2TA 1J2RA 1TM5E 5FOVA 3PBKA 5I7AA 5IH3A 3DR5A 3ASYA 1U7OA 4IKOA 2QGZA 2CB9A 3A9TA 3PDHA 4HHEA 4LXGA 1OH6A 4EUHA 4P98A 3F73A 1KS2A 2GO7A 5C81A 2Z83A 4FHCA 4KYUA 4F11A 1F8YA 3DEFA 4FX5A 2VUSA 4D8VA 2H51A 1RRPA 2HDOA 1NSTA 3BREA 2BPOA 2JASA 3MD9A 4TV9A 4KJZA 1IJFA 4F4DA 5B5SA 1QGAA 5L3VA 1JEYB 5EWMA 2ID4A 1Z4NA 1B93A 2FFRA 3I32A 1W5SA 2XUZA 1UBOS 4HDRA 4DE5A 1T1GA 1IEXA 2ZYDA 3KOXA 5LYYA 1YB5A 1W1WA 3L46A 4QT0A 2EHJA 3GLIE 1DINA 1HGXA 1E3WB 1U8TA 3EIWA 2FQYA 4KLRA 4X8LA 3ONVA 3UHAA 2EIXA 2OXEA 3OURA 5JHHB 3AP1A 2X4DA 1NUSA 4G26A 4CV3A 2WVAA 4EJFA 1TIPA 1Z2DA 2ZVDA 4L07A 4MO9A 4OSEA 1LV8A 1UADA 4EKGA 1XZGA 2P9CA 4UU1A 3JZMA 2YN0A 5KCZA 3SX0A 4V0OA 4PONA 5K3SA 4Q3EA 4RH3A 3OO0A 1E0SA 2FPOA 1PFWA 2OZLB 1J25A 3KSRA 4L72A 3FWYA 3RC3A 5IF3A 1YI8A 2F1KA 5K2MA 4DJFC 3MAGA 4IGEA 4F6LA 2YXBA 2GKSA 2C4NA 4IFBA 2IS1A 1KZ6A 3GJXC 5DASA 1NDHA 4YROA 5AVQA 4DGSA 1GZ5A 1Z4KA 2PMKA 2XTZA 5TF0A 2BWJA 4GOKA 4Z2YA 4C88A 1R8XA 1BEZA 2NXJA 2PAAA 1TQDA 1EDOA 3D4OA 1A97A 5M34A 1TTHA 1MAAA 2R66A 2G4CA 2LD4A 2YDYA 1T0PA 4INJA 4O5AA 4NZMA 3RSLA 5AVTA 3OEWA 5LMUB 2HHJA 3DGEC 5E6UB 2E4WA 2R6DA 2IDKA 1W1UA 3HYCA 4XRGA 2CLSA 3DE2X 1YZQA 3MUOA 4AWBA 1EVEA 1L8AA 3ZTYA 4C0XA 5CB4A 4GLFA 2PWYA 1YR6A 3JQAD 4UUOA 5H70A 4REMA 1U2ZA 3L8DA 1GTJ1 3KHSA 4OGLA 1HC7A 4M1YA 2UVDA 5I4KA 2H1VA 3LPCA 4YP9A 3MJ4A 5KKCA 4GX0A 2YJTD 2ZYVX 3H7IA 4BTLA 3QVGB 2X6TA 1UBJS 4A5SA 2IS2A 3V6LA 4M83A 1UJ5A 5HS6A 4WKNA 1SCKA 2BTOA 3KTOA 4ZIRA 4X85A 4D1YA 2Z4RA 4FCVA 5CYPA 4FNMA 1IN8A 1CUEA 5E3IA 3EPLA 3RG2A 3MXTA 3ZY4A 3HEMA 3TTSA 4Y2SA 1B8VA 1RWNA 1U2TA 3B48A 3IT0A 4LY0A 4M7OA 5JS7A 3SM3A 5D00A 3L18A 4HFJA 1G17A 1MX9A 1JIXA 2N9UA 4P93A 1Y3CE 1M1YA 1G3MA 1E7MA 1OR8A 5LP6B 2DMRA 4RHYA 1PZGA 3ZV7A 4YJ3F 3HU1A 2C5EA 3UH1A 1YRWA 4M1TA 5KWEA 4WESA 2H29A 3PXAA 3A1NA 2HK6A 3SMQA 1EU1A 2AQHA 2QZSA 5C4IA 2C9OA 4CG3A 3UUFA 1KYVA 1UEXC 1XQVA 1ZK1A 2Y1EA 5DZSA 5EXXA 2NU7A 4LF6B 3I3OA 1P29A 5HF5A 3LC1O 1LS6A 1H4QA 2CZQA 3LT0A 5IBPA 1P9LA 1BMFA 2W2KA 3OPYA 4XR9A 4OQZA 1EP9A 2XDYA 3VPXA 2NZ2A 4BEWA 2IP2A 4RD4A 5ALSA 5FTLA 5K3EA 1Q0ZA 1RD4A 4MXDA 3DDCA 4E6EA 2AA3A 3COJA 1CY1A 3I23A 4DAOA 3USES 2C9YA 3M2TA 1FU8A 2I03A 1NI4A 4GSYA 4ZXPA 3ZEAA 1F2TA 1KC1A 5JECA 1JIUA 2HIHA 3SR3A 1JHRA 1RAFA 1CEYA 2Z1DA 3RC1A 4QIHA 3KAKA 4H9GA 4LRWA 2H6EA 4UHFA 2I62A 2V4UA 4IGFA 2PT7A 1Y7PA 1T0UA 4MVJI 5A7HA 4A8JA 5HKAA 5ALEA 1IHUA 1SIUA 1XZFA 2X0JA 5BRNA 3T4UA 5KTKA 2WSLA 3MFQA 4ZC8A 2J6CA 4NAVA 3QXSA 2ZIGA 2EV9A 4QOIA 4Q6WA 1IU9A 2OZVA 5HEKA 4H7KA 2GZRA 1AB6A 3B6EA 5MF6A 1VJ0A 4WA7A 1BN7A 2VHQA 4J6FA 1W49A 3T0GA 3LUFA 1DTEA 4QUGA 1KORA 1E2KA 2GXUA 4E30A 3HEAA 2EARA 3WRYC 4DLKA 2WWYA 3BBPA 1TKAA 1KDVA 3W9SA 4TWIA 1CIVA 4EZIA 3VSDA 4DADA 2B2XA 4N0EA 5AI4A 4R2IA 1GKKA 1AXEA 3WLRA 5EVJA 5G4LA 4JLAA 4OQYA 3PZRA 3D9QX 4K26A 4ARIA 1ZQ9A 1DFGA 3DF7A 1BDHA 1GU0A 4J7AA 2DHRA 4OHPA 4O1HA 4YC7A 4EO4A 5ITWA 4AS1A 4PZEA 3AUXA 2BEVB 5IWCA 4S1PA 3B5EA 1ID1A 3HKBB 5ALHA 4ND8B 4ZT6A 2UZ4A 1ZN2A 4NNPA 5ED0A 1PZMA 4ER3A 1A5ZA 3MB8A 4OQNA 1P31A 1VHQA 1ZUWA 3AKYA 3RUFA 2BKAA 5A5DA 3KB6A 1I5OA 1TLFA 2H63A 4Q05A 3TQFA 4E03A 1N3LA 4KTVE 1OV4A 3LWNA 3C3AA 1TUBB 1VMKA 4XE5A 3U49A 5AR1A 4BL5A 4EA9A 2Z9DA 4C4YA 3JQBC 1XTZA 5EHGA 1D6SA 1DTSA 2QTHA 4HVAA 2BKLA 3ZDXB 4BU0A 1P2FA 4HJXA 1Z5WA 4D74A 5DW3A 4OSPA 2FEAA 3T61A 1V71A 2PFSA 3WP1B 4ZK2A 2VRBA 2B99A 1UKZA 2VZ8A 5C8YA 3CVWA 2C4TA 4R83A 2AOUB 3UXHA 1C9NA 1ZJ6A 2FW6A 2XZPA 2HJ9A 4FYKA 3JRNA 5A1JA 4K88A 3DE0X 3QYPA 2ZRDA 4KV7A 1JDSA 3UYLA 3O82A 3VU8A 2HJRA 1PQUA 1OVMA 2VATA 2WIAA 4PHFA 4CM7A 2KLBA 2OAEA 3TX2A 1N9GA 4UREA 4A8HA 2WMOB 3PDIA 2H1WA 2IEAA 3ECAA 3R5FA 4JJAA 4KPEC 5K4HA 2X2OA 1ZJJA 3ODPA 2BL4A 3BE6A 3TFWA 4CIWA 4MR7A 5CBPB 3Q7EA 5F76A 1KJZA 4OQFA 3H9BA 4X20B 1ZMXA 2VT7A 2AJCA 2V7QA 3KAQA 1MAVA 1HMPA 4KXYA 4RPGA 4Z3DA 2XW6A 4NTZA 4Y6LA 2J9FB 3K9BA 2HCJB 1TLLA 2WVHA 3L8GA 4OQPA 4CLOB 1GVHA 3CV3A 3DF9A 2XTNA 4UE3S 4L76A 1FP4A 4DBLE 3EXIB 1LQ2A 5J2UB 1B16A 1NG1A 1XMXA 1AGRA 4OQQA 5GADl 1MJGM 4LN1A 2RGEA 1WOYA 1TZ2A 3IUJA 3T3OA 2EJCA 2XRMA 3CIOA 3FFTA 1Q14A 3PPYA 2YYAA 1YJCA 1OAAA 2BY4A 2OUIA 4HLUC 1OW3B 5KDDA 1YO6A 2GAAA 3TLEA 4D02A 3X1MA 2Q9UA 2ZBFA 1TVEA 4LV5B 3HM9A 3DT6A 3DTTA 3IPYA 4EENA 1NBEA 4I8DA 1P7WA 1V0JA 3OTOB 5YASA 4CCWA 4JLWA 3PQ4A 3SQMA 1DTWB 3ZGVA 4BB6A 2WYUA 1U5BB 4JJ4A 1E58A 2A7QA 1Q0RA 2P9ZA 4GPTA 5A3VA 4AZ3B 3L0BA 1F8FA 2NLOA 4Q3CA 3KSBC 2QBYA 1CF2O 3D7KA 1SHUX 4P4LA 5DGIA 3ZVNA 1BVHA 3GUZA 4RVSA 1GEGA 4JMLA 3CRNA 4IIJF 2RG7A 4X6XA 4AP5A 2EW8A 4ALIA 3VNBA 1KMMA 3VDMA 4AJ9A 2NV0A 5ITZA 1NVGA 4LF4B 1QRTA 2EFJA 3GFVA 3LU1A 4M8LA 2I2FA 5A5EA 2R7AA 3NG1A 3BFVA 3NXSA 4NU0A 1QFZA 3GAFA 1C0IA 1EAMA 2C92A 5E9AA 2IXFA 1ZM3A 3AKDA 1Z82A 1JMKC 4HNGA 1JHQA 4PC6A 2R1ZA 4C08A 3WIEA 5CW1A 1K7CA 2YZGA 3LUHA 3LCUA 3BMQB 1NBOA 3EVCA 4N1AA 3ZXUB 1PK8A 4B3TB 4KXXA 4DNOA 5CFRA 3EVZA 3U3OA 2IYYA 3QGMA 4O33A 1QRUA 2GSWA 4PQFA 4QDTA 4JX9A 4Q16A 2V6IA 1IM2A 1IY1A 2OD7A 4GO1A 1JXMA 1GDDA 3CB2A 4N3NA 1YGPA 3KJGA 5EHQA 2LPMA 1JSXA 1LSOA 3DE1X 3W5HA 2WKQA 1N3BA 1ORDA 3QVKA 5A4FS 4NI5A 1N8SA 5D7BA 2HIMA 2GJ9A 1NWHA 2CEAA 4O2BB 3FDFA 5TMBA 1TAQA 5C5DA 2O7NA 4ZJYA 1NW6A 1VSBA 4XPIA 3T7IA 1NV9A 4AO8A 1F5SA 3ISTA 3MT9A 3LBHA 3QVSA 1N2HA 3PI6A 1ZHHA 1QGUB 3K1AA 4UEJA 3JYHA 4ECEA 3KSAC 2W2LD 2YYYA 3WLTA 2GCOA 1NATA 2O4UX 4JBLA 1WM1A 3C3XA 3TH5A 1KJWA 2CXUA 2V6JA 1TK3A 2YJ4A 3ONNA 4RV4A 4XWYA 4MH0R 2HA0A 2FWAA 1PHPA 1HQKA 3CF2A 4E2WA 4QOJA 3GEPA 3IAFA 3UATA 1OFUX 3HH8A 3SNKA 3BERA 2YS7A 3GH1A 5IT9A 5EN4A 1NTOA 3PQCA 1TZCA 1UM8A 1N2BA 1XEWY 3GJ3A 1A3CA 3HR7A 1SXPA 5GONB 1A4XA 1XWFA 1HI9A 4GOJA 5FNVA 4CR6A 5ICCA 2FFAA 4Y9DA 2NSLA 4MGEA 5T4HA 2OLJA 2VYNA 2HF9A 3CRVA 3UM9A 4AC9A 5BN3B 1XWIA 2B3DA 3Q5GA 3TDNA 2PGLA 4ZANA 2NUAB 3R74A 2ZYRA 3D4IA 2BI7A 5J58A 1CZOA 1FDOA 2ZJ2A 3HL0A 2Q1SA 2C7OA 4C0SA 1XSEA 5KNBD 5K0BA 4KR6A 2JIPA 2REQB 1NC1A 2I7CA 2OEPA 3L9WA 3PITA 1H1LB 1A69A 5FL7D 1AOXA 5MGNA 2AEJA 3M5WA 3KB2A 3TMAA 3N5CA 3I9V6 4CGZA 3QUQA 1CY2A 1OFUA 1TC1A 2OHJA 3B6MA 1TJYA 5SYNA 4KR3A 3BA6A 1L7RA 4RKQA 5ALKA 3BGOS 2C7PA 4IHQA 1R7RA 1CY4A 3KK0A 3LO5A 4JOSA 5BNWA 4XOUA 3UAYA 5F7ZA 5F23A 4H7DA 4LISA 5HRAA 1DC7A 1Y8RB 1NLZA 4RJJA 3GFPA 5BSUA 3UMCA 4D4MA 2RKWA 2VP2A 3OHPA 3QXHA 4IG4A 2AFHE 5DNWA 3KVYA 5I7UA 3MC1A 3QG1A 4KZPA 2UU9B 1AHIA 3ROZA 1XPRA 1P3DA 3HDGA 4RPHA 1G20A 1QMGA 1UDBA 2J3QA 3NIWA 4S1OA 2AOTB 3RF6A 3VV2A 7ABPA 1S2LA 2WAXA 2XCLA 3A1TA 3SY8A 2PZGA 4ODIA 2Q0HA 1VLHA 2VPQA 2I8CA 1ZSNA 4LZNA 4RU1A 4U7FA 1RLJA 1NBMD 1FYDA 1NXXA 3U5TA 2ZRGA 1XZ8A 4DDKA 1NHWA 4I6EA 4BN0A 4MVJG 4LJLA 4BGIA 2D7DA 1JBEA 2VDWA 1KI4A 4LJ4A 5DISB 4AG3A 4KE7A 1YDHA 1ZCFA 4RM2A 4TX1A 1JDTA 5KOIA 1AA6A 3AB8A 1CZNA 3GYBA 3EA0A 2FN4A 3AR6A 5TRTA 1FUEA 2QTVA 1E5DA 3QPUA 2EJBA 3K8QA 4Q48A 4TRNA 4LZZA 1X80B 1MH9A 3AI2A 2QWXA 5IP5A 3QX3A 1M0TA 2GHIA 4DM7A 2RAVA 3LCJA 3L02A 4GOXA 1JDBB 4Q3DA 5B36A 5D1NA 2W8BA 2CC2A 1XQWA 4QX6A 5J5AA 4KN5A 1SPXA 2DFKB 1RJ9B 4FCCA 1Q2XA 3VDXA 2A86A 3DC2A 5CHEA 1CUFA 2Q1UA 4G41A 1FFXA 5CXQA 3M7IA 2RGRA 1XTIA 3Q15C 3EW7A 2O07A 2YBEA 2PL3A 4KMOA 5KSPA 3DTVA 4IICA 3NTXA 4YR9A 3U09A 2FY8A 2FX2A 3NOVA 5JH7A 5EJIA 4NG5A 5CFQA 3FSEA 4V1CA 4HUQB 3ROEA 3WA6A 3T5AA 4YMIA 5JXHA 5HJ2A 5E6RB 2HMSA 2PCLA 4B74A 1UBGA 2YNMA 4I14A 3SEQA 3JR3A 3UJ6A 3WSVA 2PZMA 121PA 5KTNA 2C59A 4KQIA 4BC0A 5A4IS 1P0QA 5HRCA 3H84A 4L5IA 2NT3A 2XMPA 1KO8A 1O4VA 1XRLA 2RJOA 1J9GA 1YR7A 2HHCA 3GA5A 4P5DA 4TTJA 4JJ8A 1PIWA 5DN9A 4CL3A 4G9EA 3MTGA 5G4KB 5AQ1A 1RPZA 1YWGO 2YVLA 5IBCA 4ZTUB 4GR9A 1D5WA 2G0TA 5A5GA 4MUEA 2CK3D 1PTJC 2F3QA 4S3MA 2X5NA 3WB9A 2CLIB 2RHMA 4I9FA 1WCYA 2IZZA 1M2WA 1TMYA 2R65A 5FLYA 1B0UA 1OCEA 3O4FA 1M34E 4HK4A 4YCDA 4YRCA 3VV3A 2FMUA 4OGWA 3E4DA 3W2EA 3K09C 3K9WA 1F8GA 5CRIA 1V16B 2I6TA 5TQVA 5JDIC 3FOWA 1AU9A 3ZHYA 3WBJA 4KHZA 5F12A 2HBQA 3AHIA 4CVNA 2FDCA 3EPPA 5COBA 4MP6A 1NUQA 4JKOA 4GICA 4Q1FA 1FSFA 2IHVA 1NUUA 2OCBA 1T1EA 2QJWA 3A32A 2ZS9A 4RDCA 1MR3F 3TLJA 2QRGA 3DKIA 2X41A 3NHYA 4IKPA 4P80A 1XCOA 3O8DA 3M9XA 4C7JA 5JAUA 5IS2A 2ZJ1A 1L5FA 4CUJA 1GGMA 4X24A 2N46A 1C3VA 5K0GA 5JC1A 2HXYA 5IWAB 2E1RA 4GZLA 3OQMA 1Y4UA 3QE9Y 3CCBA 4Y1FA 3CUWA 4O8CA 3C8HA 4M98A 5LXTB 4HDMA 3GVIA 3TNFA 2EX4A 2W4QA 1RQ7A 4IOLA 4KQMA 2HQBA 2REXB 5FNZA 2GESA 1A71A 3DNMA 1L7VC 4U2DA 3LXUX 3QFSA 4AT1A 2VWPA 3B2QA 1G2OA 1I2AA 2X22A 3IS3A 3LQFA 1FOEB 1NUTA 1U1GA 4X6YA 3WNVA 1Q12A 1ADFA 1Z0UA 3GT7A 1PVVA 4OI1A 4CR8A 2XXAA 1GSAA 2EATA 4G01B 1RIFA 1WMSA 3KJNA 3Q7TA 4PYQA 5TQJA 2DQKA 3N0XA 3LGXA 1JJAA 1MIOA 4BZPA 4CQMD 1OXTA 2W90A 4ZDWA 1YTUA 4QATA 4MUIA 2V45A 1U7PA 3OFND 1QHIA 3HY3A 4HPJB 3LUGA 5JCOA 5JS6A 1M5UA 4R7GA 3U9LA 2MMGA 1OLSB 1EDBA 3PICA 5ALMA 3JQAA 1Y48E 4KQJA 1FYEA 4LJRA 4PYLA 4CKXA 2WIFA 3PIIA 4L7VA 1FBNA 1NT2A 2AYYA 2GJ4A 2NW6A 4LNAA 5EJFA 1GUBA 3ROXA 4L27A 1CHDA 4P3NA 1G8FA 4US2R 5KTYA 3H42B 4KIWA 4EG3A 5AKHA 2C5SA 1C3OA 1WUKS 2QAGC 1T6YA 2QLTA 1GZDA 4KGDA 5D86A 4N7MA 4ZYUA 4D97A 2FG6C 4HBZA 3H4TA 4YB8A 1DJLA 4DARA 4KX3A 5GGXA 2JFQA 3LKDA 2W22A 3ZZTA 2FFJA 5G40A 3SD7A 2HA4A 3HUDA 1P4RA 1M8KA 1TUIA 1XU4A 1WXXA 4ZMSA 3ZE6A 4JOBA 2JH8A 2RC5A 1DXYA 3CUVA 5AVYA 4BFLA 4PFSA 4TQUS 2Q0QA 3JWPA 2C83A 2RHOA 4P6VF 4F12A 1VG8A 3CR3C 3WK6A 4PYJA 4UAVA 3U7RA 3HB1A 3SJ7A 4PSUA 4RHTA 5BN1A 3CF0A 4CKBA 1CUSA 1EDDA 2X2FA 2WYWA 1PFQA 4MJLA 1ZWLA 1L1EA 4NU8X 3H9GA 1FDTA 3JZIA 2GS9A 1MJGA 2P3SA 2QXYA 3KAJA 1OX6A 4YMLA 1YBMA 5KJCA 5D87A 1WABA 3AR2A 3VOSA 4LYJA 2H31A 4M0UA 4RL6A 1QG2A 1IIBA 1Q92A 3CZ9A 3RUAA 2VPZA 1BS2A 4X60A 1XROA 2YN4A 5GWXA 4D45A 4EY8A 5LYJB 1SMKA 3R3HA 2Q4RA 2VDKB 4BCBA 4FSXA 4EJ2A 5AW6A 1GN8A 4U7HA 3I6MA 4JJ7A 1Y6QA 5AO9A 2XUAA 2XMDA 1W4ZA 2BBSA 3MS4A 5CTJA 3THOA 4DDTA 4N41A 2Q5EA 5KINB 5DTJA 2WPDD 1SVOA 1GPYA 5CVCA 3C0KA 2ZSKA 1E1YA 2QPLA 3GJ6A 5BW8A 5HS4A 1W6UA 4G4JA 4GKBA 1OXKB 2Q4TA 3L8YA 4WNCA 4DA8A 3IO5A 1O5IA 4ZEXA 4A5OA 2E87A 1C41A 4K46A 4L1KA 5DYIA 1N5DA 2NV2B 2WJ3A 5IBRA 1UPTA 4J43A 3GEGA 5KAMA 1UMDB 1ND6A 4BMYA 4D3YA 4F4IA 3MHTA 2Y1DA 1FDSA 4ARBA 1WKBA 2C9DA 4EKYA 4XIGS 5CA0B 2PWAA 3CSSA 1OHHD 4WACA 4H1UA 4UOQA 2O0LA 3VR6D 3GXOA 1IXYA 4URXR 3NBXX 1XF9A 4J0KA 4O1IA 3GGGA 1C7IA 4H7PA 5EPOA 1AKUA 4G5HA 2COEA 3DAFA 4LRQA 5HQ3B 4FCWA 3TAHA 4M1OA 4HYYA 1Q7GA 1KEVA 2ZITA 3SZMA 4RK6A 4PHHA 3ZWBA 2JD0A 2OKCA 3IH5A 2VDRB 4OBEA 4ACAA 1ACMA 2DCMA 3R0XA 4YPOA 2BFWA 4KHPB 3OJWA 2GN2A 1BO6A 2XKAA 2FRVA 2ZDHA 1U99A 3AF3A 3BS4A 3BZUA 4LSWA 4YR7A 3U56A 1NM5C 2JANA 5CVUA 1BA2A 4ZYVA 1IPFA 1FB5A 4D8WA 1VCOA 3GY0A 4QXMA 1KFCB 2JLRA 3LXXA 4B7UA 1J0DA 2J3KA 2YYSA 2J3LA 3QYFA 4GMXA 3FNQA 4B33A 1XZPA 3VR4D 1G9TA 3FUTA 1MJ5A 1YS6A 4BJ6A 3GLQA 4WV3A 1Z13A 1NJ1A 5A9TA 4GM4A 3BD8A 1O94C 4LJSA 3DD1A 5JJKA 1PW5A 4L02A 3KZ1E 3FY4A 1TQ2A 3T0FA 1YR3A 1ONNA 3T34A 1NDUA 2J0UB 2C4VA 5EJ5A 5KVAA 4L9AA 3AJ8A 3IT2A 4Q9IA 4X0EA 3ZU2A 1OJLA 4RD3A 5C8VA 2DLCX 1M8GA 3K9LA 1U8XX 1FLAA 3H6HA 4LXXA 1XMOB 2YVAA 3B60A 3KO8A 3QX8A 4INZA 4O4IB 1SG9A 2CBXA 4JBGA 4KV9A 4PLYA 4PZ0A 4R16A 4TV9B 5EE0A 3MUFA 2HWUA 2BEKA 3KAPA 4LZJA 4R8SA 3WWDA 4WBSA 1KI8A 3TD6A 4C7KA 2ZAGA 4HDRB 4PHCA 5AI0A 4ZZIA 5IG2A 4QJBA 4ZYZA 2ZXFA 5BSTA 4LY3A 3W7AA 2FEMA 3CNOA 3LBIA 2LKCA 2OM2A 4U2BA 4ER6A 2J9YB 2HEGA 1WETA 2WZCA 2ZRIA 2PA3A 4QDUA 4BNFA 3FDIA 3A0UA 4LFAB 1RQ2A 1PE0A 1B6RA 1CY0A 2JAPA 1RWVA 2P9GA 1RMYA 3B1KA 3MQ4A 2ZUEA 2B2CA 1XMIA 3DXYA 2I3AA 1T1SA 4R1OA 2IC5A 1YVEI 4YNBA 4ZVTA 4ZCLA 1C5KA 4CM8A 4BQOA 4CRWB 1E9AA 3H8SA 1EFRA 2QTFA 3I73A 1WP4A 3LY8A 3P19A 4BMOB 3FNGA 1S89A 3WIBA 5A4AA 3SEAA 2A2ZA 4K1LA 4LJKA 2VBGA 4YRQA 3I5AA 3CRQA 2YH2A 2FPSA 2ZJFA 2A9PA 4G2TA 4KK4A 4NESA 1SIOA 1YDGA 3AUTA 4IDAA 4XJVA 5DKFA 2EU8A 2HCTA 3DP7A 3ELBA 4EBBA 4L5BA 4DHEA 1I3OA 3H2HA 1Q0UA 3UMGA 2EQ5A 2E5FA 2DWCA 1NLYA 1WCIB 3IEXA 3QMVA 1IATA 4LEIA 4ZPXA 1A8IA 3D6JA 1LTQA 1ORRA 3EG9A 3GRCA 1P2DA 1KF0A 3T5BA 5BSFA 1UFRA 2AZDA 1WY7A 2HSWA 3Q87B 5JNUA 4H6WA 4H7JA 4HWSA 5AJZA 3QJYA 4LAFA 5H4GA 3NM4A 4A82A 2H92A 3KG2A 5JQGF 3E7WA 1W46A 2QTGA 2PRZA 3QF4B 4GOOD 4OF4A 3D0OA 2NYVA 2PKQP 1JH9A 1G7SA 2P35A 1AY0A 1H3EA 2OVFA 1G8PA 3PNYA 2JGNA 1CY8A 3HGMA 3KKMA 4E07A 1KFJB 4XLZA 1K89A 3M1LA 4IJUA 4E1VA 4PR3A 2ZJ7A 1NHGA 3UGKA 3FI0A 5I9SA 4AM8A 1HDCA 4CLEA 2JD2A 1IHYA 4HUTA 4H4DA 3GCDA 4M6WA 3CSUA 4EGCB 4YCSA 4X1KA 4DREA 4OXXA 2C96A 5BSHA 1H69A 3E5NA 4HZGA 3LOPA 5BSGA 3FYHA 2E85A 4DV5B 4FS3A 1ZIDA 3M0EA 4ETWA 1X0XA 4J1TA 2O20A 3AHJA 2RHHA 5A3JA 3HLKA 4DWOA 4TXLA 2W2QA 3I2YX 1CYEA 1VE6A 1B6TA 3DZJA 5UKDA 4WESB 1GG2A 3COWA 3BWYA 1K8ZB 1P62B 2P2DA 2Q3HA 2EYQA 2P7IA 1DKRA 2ZIXA 3EXAA 3IUSA 3B13B 4Y2PA 3AM3A 4DJ5X 3OWHA 3PGLA 3Q4GA 1VBFA 1ONBA 4ML3A 4Y6QA 1I1QB 4V0MA 3ZBQA 2W2KB 2HSJA 3CZ5A 3ZHCA 2JF0A 4BO0A 3NP9A 4QBFA 2GCIA 5ERGB 6CHYA 1KAOA 1RDFA 3AVTA 1PSZA 4JWTA 4PN3A 3LT5A 4EGFA 3R75A 2TRSB 1CW2B 3PLNA 2I3DA 1QF7A 3DQZA 2HO4A 1X7ZA 5AM3A 1B6GA 2VSYA 4R9NA 1WUHS 1KI2A 4RKYA 1U1CA 2PKQO 4UAUA 2QAJA 5AJTA 1DZ3A 5DSZA 1D3AA 3OX1A 2IHYA 3AESA 1EFVA 1U4SA 4LHWA 4PX3A 2ZUBA 4ZVUA 2FE4A 3W78A 1PQWA 4A8JB 4HX5A 5CJJA 4FR5A 1UBMS 4FFRA 4RD1A 3ESRA 4BJHB 2N47A 4IHJA 3ZCSA 3AH8A 4KRGA 4ZZ0A 5AVWA 1RRMA 4BCCA 2BGIA 1PYGA 2IYEA 2QP9X 2WTBA 1RRGA 4DLVA 5AM1A 3AFMA 3GDWA 3BN3A 3NTQA 4ID9A 1FFSA 2C2OA 5AKJA 3BX1A 3DW3X 3TR5A 2XJ4A 1DAHA 1JYFA 1GGHA 2H5JA 2FZGA 3WRXA 2F6RA 4RLQA 2WE7A 1AZLA 4MV4A 1YSCA 1B0ZA 3QKSB 1GV1A 1KIFA 1YJXA 3A28A 3YASA 3CZPA 5KNBA 2H1OA 3BT7A 3U4MA 4QNNA 4AZWA 2Q9BA 1QGDA 4UNQA 5FL7A 4W5QA 2DT5A 3A4NA 1UZAA 4K03A 1V7PC 4LRUA 4YRJA 1M3SA 1QHHA 2XUPA 1FLDA 3BWEA 2QYOA 1G60A 3L7CA 4GPAA 3UHJA 5GIPE 1EZZA 3OUZA 2AT1A 1HFJA 5AFSA 1WPGA 2ODWA 4AUKA 1YZVA 2OQVA 1A9PA 1NPDA 5F3WB 1O96A 1I10A 1NKSA 4ZCPA 3HYTA 3CG0A 2VOJA 3OQNA 1F1JA 5G1PA 2A9OA 3KZNA 5HGXA 2F4NA 1Y3HA 1L0BA 4G8DA 1DJOA 2GBCA 4Q7LA 3I30X 1P7ZA 4MUFA 3BGDA 3JAWB 4KQ2A 4R68A 5B7QA 1CUGA 3DB2A 4L85A 3VPSA 3FETA 3PNVA 1SUWA 2KWIA 1U7UA 4XUGB 5T6BA 3BDIA 4P7BA 4A10A 1IZZA 2WG1A 1H6BA 1NVBA 5KWSA 1NBMA 3LXMA 1NX9A 3MYYA 4AWXA 1Q7CA 3ST7A 2R68A 2KHZA 3I9LA 4GI1A 1J21A 1RMTA 4UXIA 3LD9A 3BB3A 4MQMA 5JLAA 4OLBA 5ALQA 1EINA 3CQ9A 3QSYA 5C8YB 4L4ZA 5FX2A 4OXYA 3DHEA 5A3QA 2VSNA 1NW8A 5U1PA 2MSCB 4I3GA 4V39A 5LOVF 2PKRA 2OWEA 1T9BA 1WCWA 2OV1A 3HI6A 1NXVA 5JEDA 3INNA 2D1SA 3AG5A 1FVHA 3VC7A 3TDMA 2RB5A 4FEYA 4N5NA 2DFTA 5J2UF 5C34B 3FSGA 2JFOA 2WU1A 3PDIB 4G1EB 2HNKA 2EQBA 3JQ9C 1R8QA 4NJEB 5G02A 2FN9A 3Q8LA 2AJ8A 1KK0A 3CX8A 3KLOA 1RYFA 3L0OA 4K6OA 2D62A 5T4EA 5GTDA 3GFRA 4KIUA 1CUCA 2RHTA 4MR7B 2DVMA 1RWKA 1PEAA 1PL7A 1UQUA 2AH5A 3K6KA 1JSLA 1LQUA 5DCYA 2BI4A 2VVTA 2BGWA 1JZTA 3U48A 1C1DB 2QUZA 5LBUA 1M6HA 3KYDA 1RJDA 3P4XA 2B2NA 1OYWA 3TEFA 4BP8A 5HVNA 2R97A 3ETEA 5K1ZA 2J46A 4UAJA 2BR4A 2O6LA 3H17A 4LTDA 4CR7A 3NIDB 4UJ3A 5FFFA 4J03A 4U7PB 3P9XA 1WDMA 2HUPA 2OXRA 1QANA 2XCIA 5EWLA 4HI0E 3ZWMA 2CLFB 3VYTB 5AM2A 1TXGA 3TQTA 1ZCAA 1GPH1 2AKEA 2EZ4A 3PPWA 1KGDA 4UUBA 3EUEA 3PC6A 3V33A 3VH4A 4M76B 3EF0A 5MN4A 5EPEA 5DTMA 2EKZA 2CK3A 3LBYA 2A30A 1K8QA 3CINA 2PX2A 1X94A 1ZY2A 3B1YA 4IMIB 4RTJA 2QOEA 4CEHA 3LPAA 4HNQA 4PC2A 3VU9A 3FB4A 2YV3A 2P9TA 1L4EA 3D3EA 3WGMA 1RXYA 4HWOA 2WW8A 3A4VA 3Q1KA 5AHXA 3IAEA 3O83A 5SV2A 4TS3A 5KYYA 3EGVA 1E64A 4J4TA 4JJEA 1Q57A 1Y80A 3A58B 1SVWA 3OA0A 4GWGA 5GJWC 3MBOA 1S8OA 2I99A 2JLYA 1EZ1A 3AEQB 2VBFA 4RDXA 1JDNA 3MHPA 1FW8A 1CUJA 1QZZA 2OGZA 4ADSG 2XQJA 3WNQA 2D6FA 2C94A 1D1SA 4IDCA 4YDSA 5T5QA 2RHCA 2IHBA 3NVKI 5IDYA 2QLMA 2X3YA 4HNVA 2ZLBA 2C9MA 4ZEWA 2YCBA 3OQOA 2HAEA 3BSWA 2EEPA 1Q1NA 2V0NA 3KB1A 4BO5A 1DWOA 3ETLA 1KEZA 1FTWA 3AI3A 3B38A 2R4QA 1RHKA 2CZGA 4REQA 5EKXA 5HKOA 2PVSA 3QELA 4LNUA 3S5UA 3RO7A 3HDTA 1O7JA 4XM1A 4EQ6A 5HKKD 3KZKA 4HNTA 4W4TA 1VJ5A 3NIBA 2B98A 3VI4B 3LDAA 2I2WA 1MVOA 1PUXA 1XRJA 2QXTA 4HSGA 1RXCA 3VR2A 5KBYA 1IVSA 5AOVA 3MTIA 4FYVA 4EYQA 3CEPB 1Z06A 4OHWA 5EXEA 3UUWA 3W34A 3VKGA 3PSHA 5EUMA 2V7VA 3RW9A 2BZSA 5G1NA 1XG5A 5GVSA 4ZU1X 1QIKA 5JXJA 3OE4A 3ZCRA 4Z9FA 3PQ2A 3F7MA 3IUYA 4XPIB 4K2HA 2E5WA 5AXAA 3Q40A 4QUDA 1LV7A 1PAUA 1ISFA 2XB9A 3KT0A 4BMSA 3Q2KA 4Y9TA 4Z54A 1EUZA 2J08A 3K1AB 3N8HA 3ENWA 2F3PA 1PT8A 4XSHA 1SQ5A 3IALA 2GCOB 3NYIA 1EZ4A 3C3WA 4I4TF 4OFWA 4IJVA 2IV2X 4CM9D 4TMZA 4CIXA 2P77A 3RREA 3KOMA 4L50A 1KJYA 1RVDA 1W47A 2FUEA 4YAJA 2DFDA 2FPMA 2KM1A 2ZG6A 3LH5A 4HWRA 4B4VA 2XOKD 3TOSA 4OYYA 3G7UA 4ZMBA 1SHKA 1T1IA 2DTXA 2FWPA 2QYHA 2RBGA 1R0WA 1TM7E 2DAPA 3E0QA 1E9FA 3IUMA 4HL6A 1ZISA 2XNJA 4IS2A 3DAGA 1J1UA 1C9KA 5FNVB 1WDKA 3WRYA 3WWEA 3Q6NA 1I01A 1YKSA 1ZW6A 1YB7A 1DHTA 3LPLA 4LZOA 5EKDA 5FUWA 4QASA 2B5VA 1R66A 2AEFA 1YUNA 2VP6A 5HE8A 3UEOA 5KHOC 1IBKB 5IVIA 3A37A 2HIGA 4M0MA 1DBWA 1QVWA 3KV1A 1MHPA 5LR6A 5DLEA 3V4SA 2I2CA 1G0NA 3CLTC 2C0CA 1PG0A 2BR3A 2DJIA 4RGYA 4TL6A 4TRJA 5FQNA 2PUEA 1NASA 1UWCA 4DLWA 4ETMA 3C1AA 3DE5X 4MV8A 4IJ6A 3G1TA 3O3OB 2X9LA 3P9QA 3A70A 5HFAA 2J0QA 1RM3A 4R7ZA 4ZA2A 3PHLA 4EHHA 2PQ6A 1USGA 4W7SA 5KQLA 2Z8ZA 3WL8A 1E92A 3WIVA 3F46A 4TV8F 3UQZA 2C99A 3P9YA 1WQ4A 2NSJA 3TBFA 4X7MA 1QCDA 5L6MB 1AKVA 2QNRA 5ILOA 3H83A 4FHZA 4JLDA 1YAHA 1E9VA 1PJAA 2JCVA 2RGCA 3WL4A 3DMPA 4TWRA 4KRFA 4QDOA 2FX3A 3GMIA 5AJHA 5KU7A 4BX3A 3G2JA 4URFA 1ESMA 4YONB 1O94D 3JQBA 5B3KA 2I1LA 2VOEA 4WERA 4WX2B 1G20B 1NLFA 1Z6QA 2R60A 1THGA 2WPDA 3ZWCA 1EA7A 3QEMA 1BGVA 3MSCA 1LVGA 4CLRB 4D8TA 2PU5A 1RI1A 1EWKA 1E2QA 3SG0A 1AV6A 2VWHA 3MXOA 3VKFA 3SSAA 1LF5A 1GTMA 2AFVA 1NJ6A 4DDUA 1V1MB 2WUVA 2QSYA 4Z5XA 1DQNA 3I6IA 1Q16A 4RO0A 1NMSA 2A8YA 4DV0B 4DNPA 1WSWA 3E9YA 4DQKA 4B6FA 3JYOA 5JQWA 1SGWA 4FYPA 3IVRA 3N7AA 4KR9A 1TI7A 2BMEA 2QTVB 2Q7DA 3ZE8A 3OTQA 1SVUA 1OHHA 1EH5A 3ITKA 1NFRA 2C2MA 2WM8A 1QBKC 3FHCB 4JT8A 1MDBA 3LOQA 2GYVA 3S27A 5EA2A 1M1ZA 3B5IA 1AQUA 2UDPA 4G4IA 5EZQA 1XZNA 2HPZA 5IMBA 4RJ2A 5C9ZA 4OX9B 4NAHA 3A4TA 5DP2A 2BR5A 3A7DA 4EFLA 1NW4A 2QUBA 3IBSA 4IV5A 3OE5A 1S96A 1XU7A 4CMIA 1FFXB 4JHXA 2EJWA 2G8NA 1KO7A 2ZPAA 4FZVA 2P1DA 4HZIA 4D4LA 4DIOA 1UC9A 3GMSA 3DTVB 4OHFA 3Q8XB 1ZPDA 4OHZA 4RTOA 3WLMA 2OB1A 1T4GA 3G9XA 4V1CB 4HX9A 4MUBA 4RQUA 3SC6A 3BWDD 3QKRA 3VBCA 4D98A 4OIFA 3L2OB 1C7QA 1P19A 3MTQA 1KZ4A 3VR4A 2QT0A 1YC2A 3TJZA 1BWQA 4II2A 1ORTA 4HLUA 1VKNA 2W0MA 3A9SA 3IEPA 1NVAA 1GKUB 1SCUA 5BWNA 5AK6A 3UV3A 1NQVA 5GV8A 3C2QA 3QNMA 2HI0A 4KDRA 5LVAA 2R7MA 2FW7A 1Q7RA 1K6EA 5ALUA 2DG2A 4DDWA 4X90A 3OMWA 3DDSA 4FMBB 1M75A 1T0JB 3BMCA 4HFRA 5ALLA 5DYWA 3AKZA 2ACWA 1ZGAA 2V96A 2ZR9A 3ZCVA 2X7JA 4XW2A 2G1PA 4PPNA 4DEYA 4N03A 3EGXA 4ZEVA 4IDNA 2K4MA 1Q0QA 2ZI5A 2FWIA 4AIIA 4C30A 1WDTA 1WX1A 2OGWA 1E9EA 1MPTA 3A0RB 1A0OA 2VNIA 3A2NA 3MMNA 4PLTA 2BFDB 4D3DA 3NDBB 1OH8A 3NHRA 3JXEA 4Z49A 2FQQA 1EBUA 1W4LA 4FDLA 3HVKA 2HJSA 4AIRA 1PWZA 4DB2A 2F7SA 2GNAA 2C95A 4GFDA 2Q45A 3I61A 1CRWG 1FTNA 3OEED 3DDOA 1U0RA 3NHLA 1TAGA 2OFOA 4C21A 4CIAA 1M1UA 1TU3A 1CNFA 3NHWA 4CGYA 3KKLA 3B1XA 2IGBA 4KQGA 5IULC 8ATCA 4QUJA 3OX4A 4M49A 5IDWA 4WFJA 2GHTA 3FXAA 4HDMB 1M0WA 4V03A 2DBRA 2HDNB 3D31A 3N9IA 4M89A 1VJRA 3RIGA 3SGLA 3KL4A 2PG3A 1AV7A 1G2QA 1LC0A 2BONA 3WJ7A 4EPTA 3ECSA 3AQ4A 4IILA 1L8OA 4UVEA 1M1NA 3PPXA 3GLSA 3PPIA 5CR9A 3ZX5A 5B4UA 2IXDA 3UG7A 3IPAA 1T9DA 4HWGA 4CKYA 2XXAB 1I8TA 4KQCA 1Y1LA 1I4EB 2EZTA 4GBED 4HH0A 2HK7A 2HEIA 1R0CA 3MWLA 4N5HX 1ZQ1A 5H80A 4ENSA 4FMPA 1FU7A 3HXKA 1KRWA 2VRNA 5J1TB 4G4SP 4HRVA 4YJGA 3O75A 3THWB 4H6XA 1KY3A 5EJ7A 1V8ZA 2G9VA 2F8SA 1QS0A 3G5LA 4U3JA 1ODCA 3TIXB 2W93A 4EAQA 4YJDA 4TM7A 1RXEA 2H7VA 2XV1A 2R0QC 1P5ZB 1MA3A 1UDRA 2ZRBA 3I12A 1ZMBA 4GBJA 4EP1A 5BV7A 2JEOA 4A03A 2P1RA 1LBHA 2ZKLA 2ZRQA 1U7XA 3IEKA 1A7AA 5FO1A 1C3OB 3KTAA 3TNYA 5BQPA 2PZAA 2VPWA 1BHSA 2QQFA 3O38A 1XZHA 2ZUUA 5KNCD 4HVCA 2VEDA 2IH4A 5ALDA 4R3NA 4G1VA 2GPNA 3N2EA 1HOTA 2V7TA 4MV9A 3A31A 5DSTA 5L3RA 5L6LB 1XCJA 1N2CE 3ANLA 1J5XA 3JZFA 5DULA 1IEVA 3KXPA 4P34A 4PU0A 1ECPA 4HO1X 1ORWA 4JT9A 3RJ9A 2POQX 1QJ4A 2C8KA 2RGGA 4UC0A 2CLLB 2AOVA 1D8TA 3R3WA 3ZN2A 1JU3A 1Z4LA 2G36A 2G7MC 5P21A 1GAWA 1KFBB 2Q6TA 4JMPA 3UK1A 5BV1A 4JLOA 4D9CA 5A4JA 3BIWA 3EFOA 1FQOA 4OI2A 2FFQA 2DPMA 3C74A 3WK8A 3MLAA 4LXQA 1KSGA 5IXSA 5F3DA 4CKBB 3CTMA 4GX2A 1JHMA 3JQGA 3DLPX 2NWQA 3OECA 5JAMA 3I01M 1J23A 2QTBA 1LNSA 3WLSA 2AXNA 1VHJA 3OPXA 1EGMB 3IPXA 4BZXA 3VZPA 4I1PA 1J4AA 3F9CA 1WU7A 3B1ZA 4DPMA 2XVMA 3HXTA 3U2QA 4HH1A 5J4LA 3R7DA 3S40A 2YTZA 2OHVA 4JU9A 4PLPA 3M70A 2XD4A 3OZTA 3EX7C 2FR0A 1X70A 3AFHA 1ZITA 4G4SO 4U63A 5DT9A 1ECLA 3RYIA 3KT3A 4AQYB 4PGMA 2DWUA 5JD6A 1P0PA 2A9VA 2Q21A 4K9DA 4PBSA 1USUA 3H0KA 2XUKA 5DOZA 1ZXXA 3I34X 4GXQA 2YJZA 4DA0A 3NIFB 1ISHA 1YZGA 2AXQA 2JHCA 2NXWA 3PC2A 2Z3WA 4MW1A 4NG4A 2HBZA 3TOVA 4EEZA 2OCPA 3INGA 4NU6A 3IP8A 5GMOA 5LDGA 5BW4A 2BEUA 3WKCA 1PZFA 8MHTA 3VPBA 4LVCA 4URVR 3B6IA 4I9NA 3NX4A 3A36A 3NWBA 4R5HA 2AEEA 3P5SA 5F2KA 1Q6ZA 1RLMA 2G80A 4DLZA 1T9KA 3WTBA 4D9HA 1D6NA 4DUGA 2V7GA 1L7DA 4ZAVA 3U3KA 3GCWA 4EW6A 1GLNA 4Y3UA 4WBXC 3B20A 1XCGB 3NRCA 3R9XA 4DR4B 1XZEA 1FXWA 1DG1G 2C2XA 4EI8A 4X92A 1UWKA 2IWHA 2FMXA 3TI9A 3ZE0B 4A15A 3T7CA 4WN9B 4K3UA 1O6ZA 1KI7A 2E5LB 2UZ1A 3E1SA 1I30A 2Q46A 1EIZA 4MWOA 1GN9A 3GL9A 3Q85A 5IK2D 3KZXA 2OV6A 2E37A 2IHTA 3ICPA 1B0PA 1GNLA 3LECA 2GH1A 3AHGA 4KH0A 4RMHA 1T35A 3FVWA 3IMKA 1UZMA 1QHFA 3CMMA 3N86A 3I4LA 4ZT3A 3UAWA 3REOA 3VVBA 2R1TA 4EHNA 3IP5A 2VHUA 3D6FA 1GITA 3OY2A 3V4PB 4DMGA 3C5WP 4MV5A 1IJKA 4ZOLA 4C6SA 2HL6A 1J2JA 1IWPB 1GRNA 1L4UA 2C00A 5TY0A 3J81A 5IAAA 1KKMA 4JI5B 5LQJA 3LO8A 4DMLA 4IDHA 3W2FA 1HXHA 1ZDMA 4E5UA 4DKJA 3HN7A 2GN1A 2AL7A 3JATA 1T5IA 5J40A 2C9BA 2LRHA 1CJBA 2WZBA 2VC2B 1PTJA 1I13A 3CJQA 4HEA6 3AB7A 2Y1OA 4RFSA 3IE1A 1U90A 1LZLA 2ZIZA 3IMCA 4CFSA 5CNMA 1KK2A 4HH4A 3U4QB 1ZR2A 2AYZA 4F60A 1JAYA 1AKNA 3D5QA 1E3IA 3HMQA 3OIWA 3WOHA 2VJBA 1M66A 3K09A 4O0LA 5EL0A 4B0PA 3OZBA 5JDIA 5CH3A 1W0CA 2PR7A 1G1AA 2WHEA 1C2YA 1A9XB 2JGFA 2O0HA 5H0IA 3LVRE 2MU1A 2ZXEA 4P4SB 4QHSA 4Y2JA 4DLRA 4QU8A 5HDBB 5LQMA 4J2OA 3B3GA 1K3TA 2QTMA 1JG4A 2O4CA 1JAXA 5A0FA 4LJ7A 4L22A 1GL6A 3UWSA 2RH4A 3GGOA 3AUKA 2JI9A 2OFXA 4ZVPA 1ARZA 4KBGA 3LQKA 3FVTA 4HJRA 3IXLA 3PCTA 1HDRA 3H86A 4XFKA 1CULC 1P9RA 1H2HA 4D3ZA 5K4GA 2QL7A 4UVDA 4JVLA 2C8VA 3TSAA 1FRFS 4YBZA 5AVVA 3S1AA 3WX0A 2QMQA 4CM8B 2AUTA 4MINA 1E6WA 3TQRA 3MWYW 1SKMA 5FA6A 5TQ2B 5JBIA 5L45A 2REBA 2CLKB 1T15A 1UK9A 3GNTA 5ES3A 5TE9A 1NVUQ 1I4DD 1SK9A 2YFYA 1YK1A 3M6MD 1VDZA 4PC3A 1IY8A 5EZYF 1YL6A 4X93A 1GTL1 4LZPA 4CTMA 2VCHA 1QTQA 3LA8A 4EWLA 3S28A 2PX6A 1J56A 4L8GA 4RSHA 2Q4BA 3C4QA 4G56A 2VTKA 1MN6A 3QSGA 3W2IA 1Q1QA 4TS9A 4DVJA 3IC5A 2PKYX 5KYKA 3VO9A 1QHYA 3BHMA 5ETJA 5EZYB 1JTFA 5CLJA 3ZBTA 2TMDA 3ROFA 3JSAA 1VKOA 4MVJD 4H17A 5HMLA 4BRZA 4MYRA 2IV3A 3QP9A 4H3KB 3UBMA 2NTVA 3CXUA 3SLGA 4NDZA 5CAEB 4G84A 3RYCA 2I22A 4WZ6A 4TVSA 4IJWA 4BFYA 1SOUA 2GK4A 4TT3D 1NYQA 2W43A 5JD3A 4LFCB 1BMDA 3BD9A 1Z4PX 3QLEA 4MHOA 1SQ6A 3W6NA 4C0LA 1QQ5A 4BQPA 4CL8A 1XTKA 1YZLA 2FN8A 3DKRA 1QHSA 2QAGA 3I6BA 4DCJA 3D8NA 3D3KA 3RRBA 1RHRA 3HXOA 6YASA 2FW8A 4PX5A 1SQSA 1Y5RA 2VLIA 1CJCA 3H05A 5BR7A 2IYPA 4AJHA 3M9WA 5GZ3A 3L6DA 1OKKA 1WF3A 3HA3A 2F9MA 1T25A 1U3DA 2B8JA 2OP0A 4AYWA 1CZRA 5F4ZA 2HWWA 1KZHA 1MAWA 3FMVA 3PIDA 3ZXXA 1PZEA 3FMIA 4AO7A 1VXRA 2JVIA 5KX5A 4GMFA 4X1KB 3KFLA 4RAOA 5AUOB 5HKKA 3CLTD 3TJRA 3FUCA 4MMXB 1EVKA 1UDCA 1Z5OA 2WWTA 2GDZA 4ND3A 5AVSA 3ZWQA 2XTAA 2XNKA 2QL6A 1XMVA 4KR0A 1SB8A 2A0WA 1T9CA 3EZ6A 3V1UA 3FUWA 2ZIXB 3SXUB 2JCXA 2P5UA 1PJRA 4PF1A 5F35A 1L5NA 4GI2A 1RPNA 1BMQA 1E2IA 1X1QA 2CXQA 2FKAA 1Y4ZA 2HMTA 1ZOSA 2VP5A 2WUWE 4FD2A 5T8KC 4DS3A 4RJTA 5JMTA 1P1JA 1H2XA 2VSOA 3KVOA 5AWFC 2ZPUA 1UXIA 1AXRA 3PEVA 4F4UA 2IIQA 2RBKA 2HK8A 3OTGA 2V5AA 7REQA 3AFOA 2A88A 2MSWA 3EISA 1A8QA 1E32A 1QH8A 3BXZA 4NBLA 3MCWA 2EL7A 3VKVA 1KDRA 5KVCA 2CV0A 3T94A 1OI4A 4B31A 1K7YA 4ZYTA 2H5IA 2XH8A 1VYHA 2AF3C 1IFXA 2NZJA 3GMDA 3I3SR 4U9HS 1FMTA 2V6GA 4QNRA 4WFIA 4CM9A 2IDJA 3T12A 3O8RA 1ST2A 2OK8A 5AVJA 4EG6A 4JB2A 4RK0A 3P2YA 3AESB 1EFVB 1UOEA 2BHTA 3KS9A 3ZOZA 4CJXA 3EGCA 5HP4A 1QQTA 2XOKA 5AI8A 4O2AF 5CEJA 3CPSA 1G16A 5EIEA 5FR2A 4CKEA 4XSVA 4GWKA 1R5OA 2HFKA 3DC7A 3M34A 4IHJB 1WE2A 4ZO9A 4DEVA 5DTEA 1ZVJA 3KHTA 2BLLA 4GGMX 4KXVA 2HGSA 1UQTA 2IDMA 2OMKA 4IH9A 4X5OA 1KEEA 1XZIA 4W9MC 2DB3A 2VNAA 3N7UA 2WMNB 5TVKA 2XA2A 4BNDA 4MAAA 5JAPA 3OCVA 1JEAA 4JFAA 3FUUA 4QJ4A 1PHRA 3DEJA 1QB8A 1LPOA 1GADO 2Y77A 1VYVA 3LC0A 2IYQA 1J24A 4LQDA 1MOZA 4LWPA 4ZDIA 2W83A 2ZIWB 2FETA 5BVGA 3NJ8A 5CT5A 4A27A 4E7OA 1F3OA 1U6JA 2HA3A 2GASA 1PR2A 5K3OA 1DAGA 1ZLYA 3AUJB 4NBRA 1PDVA 2BSAA 2ZRAA 3KKQA 4GECA 3Q2IA 1IBSA 2GM5A 3PKJA 4FQ5A 5EJAA 5L51A 5D5HA 3V8BA 4YT8A 3L0ZA 1QHHB 2QRKA 1NM5A 2GN0A 1FNBA 2GBGA 2RFLA 1NONA 4XGIA 4G81A 3L7MA 2F3RA 1HKHA 3VR1A 1KAHA 3UGTA 3DAOA 5JBNA 3KX2A 4XWAA 2VHEA 3P45A 1O77A 4GVPA 3KFVA 3OQ1A 2F2TA 3AL0C 1A9RA 3EZXA 3QKUA 3C6BA 3E9DA 4OL0A 4P84A 1D2MA 2Q3DA 4WIAA 5DDIP 5AXDA 1KPHA 1EGHA 4RZQA 4CN9A 4RF4A 4MVJM 4Q15A 3N5KA 3I6ZA 3NOXA 5A71A 4R84A 4HAZA 3TD2A 4QEKA 4QFDA 4CLHA 2D2XA 2PYDA 3GPLA 2W4MA 1MEJA 2CXSA 1NOKA 3VKWA 3HCWA 2R86A 1YDWA 3I76A 3OY7A 3UJ9A 2CNLA 3U37A 3VFDA 4DG9A 4EHFA 5I7SA 5EJMA 5DEIA 5DOVA 2QVBA 4OXNA 4ZYLA 4GZMA 1E7YA 1A4UA 1GEEA 2XADA 3FPKA 1SNYA 2XVYA 3HJBA 3I6YA 3HCEA 3L04A 3Q3VA 4KN8A 4B3HA 2X58A 3STTA 5B64A 5JLJA 3T3DA 4AQDA 1RACA 3R0JA 4QD3A 2Q2WA 5JROA 5K0NA 3DVQX 3LNCA 3D64A 4WZAA 3AWDA 4ND4A 5DXFA 5BWBA 4N6GA 3K1YA 5EXSA 4WE3A 1JPUA 3PEUA 1P3Y1 1U0OC 4UULA 3W4JA 4CV1A 5K4AA 1Y7LA 1AMOA 5BUSA 1TAHA 2O2SA 2VYFA 4R8LA 5BMVB 1MA0A 4DLPA 4QGBA 1NMXA 4Y0NA 1MQ9A 1PR4A 5DGDA 5AM5A 3JARA 4EDHA 3C5VA 3OLWA 1GTRA 2POCA 1KOGA 4QKQA 3GG2A 2RAFA 4MKRA 3I01A 4EUFA 1RYNA 4FNOA 4DMFA 2DHQA 3GLIB 3M3PA 3DEIA 4WBNB 1ZGGA 1ISGA 1DE0A 2JD1A 1AK2A 2O7QA 2RGUA 2XE6A 3S70A 3WLAA 3GRYA 3EYWA 4Z1OA 3LT1A 1AJEA 4RY0A 5EP1A 2PX4A 5BPHA 3IAUA 2IEBA 5EWLB 4KI0A 3ERCA 1HEYA 1ZG3A 2OMEA 2CVPA 2QRVB 4RZSA 5E0KB 3TM4A 2QQGA 3ZNOA 4S04A 3O4GA 2G63A 2WHRA 3ZV4A 1X7YB 4OM7A 4D80A 1RPAA 1JHXA 2J1LA 1CHNA 3QWBA 4MLDA 3JCZA 1X8JA 4OHUA 1BS9A 1I6LA 2GYYA 2L69A 1JFVA 3NB0A 3WXBA 4DBZA 4ZCQA 5EKTA 2P78A 1A5AB 5FPPA 2J7KA 1DIHA 4PY2A 3ID6C 2WWWA 3BXEA 3L82B 4P83A 5KDLA 1AF4A 2PQ0A 1WEHA 2FEWB 4L4SA 5ANRB 4X8MA 1I2MA 1S6YA 3EJ6A 1KFKB 1DO8A 1FFCA 5EGSA 4V0SA 3O92A 2Q6VA 4EF5A 5JHGB 2WIBA 3KETA 3ER8A 2QIPA 3O8LA 2H0RA 5MN5A 3TGPA 3F97A 2O2HA 5JARA 2WNIA 1YD7A 4X3CA 3W8EA 1CQJB 2AK2A 1KH2A 1VBNA 2NTNA 2Q6LA 2Z2XA 3JX9A 3NASA 3RT9A 3N3AC 3OEEA 3T7DA 3O90A 4M1QA 2O5RA 1QC5A 3LM8A 4MKFA 1Q1AA 3AUUA 3WB2A 4WNIA 1FP1D 4TKVA 2ZQYA 1JDJA 1PRYA 3OJLA 2UV8A 4R0VA 3TAUA 4ND2A 3ESDA 4REQB 5ALXA 5D5PA 1DWUA 3QELB 1C3EA 4LNUB 5ECGC 3DG9A 4EQ6B 4L3OA 2JIOA 5JCPA 1HYHA 1T2NA 2QENA 3IB6A 2C2KA 3FLAA 4HB0A 3BK7A 4LXUA 3JVDA 4NY1A 1Q44A 4RZUA 1RNLA 3S8EA 3UXMA 2ORYA 5KYXA 3ICQB 1T4MA 1Z7WA 3DMRA 3SYKA 2V9CA 5KSWB 5L3SA 3IKTA 1T5TA 4A9AA 3ESAA 2IZ1A 4AY3A 4EFNA 2Z2JA 1LBTA 1DAKA 3GA0A 4QRHA 2G9NA 2XE8A 4I4LA 1X0VA 3R7FA 4XR4A 5ENDA 3AR7A 2Y05A 2P1ZA 5G1OA 4Q6BA 5CB8A 2EX1A 3P9RA 2PM8A 2Z04A 1ZD1A 4ANFA 4WAUA 4GUDA 4LHSA 4RF5A 3I9KA 1JFLA 1ULHA 3X44A 2NV6A 1PS0A 2I3GA 1SZPA 3BG5A 3ND6A 4X8OA 3ISJA 2EJUA 2IQ5A 3DNFA 5CW2A 1TB4A 3GAZA 5DHUA 2ZWAA 2JB9A 5K0LA 5BN5B 1NXQA 3BGWA 4ZZ1A 3S8MA 3HYNA 2ZFUA 5CU7A 3D59A 5BXYA 1B4DA 1SCIA 4TZ0A 2GD2A 2P5TB 1RZ3A 1VOTA 3Q0TA 1OBHA 4LUCA 2HQSA 3RLIA 3QVJA 3Q7IA 2EFGA 1P80A 2Q5CA 3PNPA 4FYHA 3SHQA 3ZWNA 3HJTA 3LZDA 3IP3A 3HACA 4FGJA 4DABA 4MKZA 1Y1RA 2VNJA 3LSTA 3RAGA 2X3UA 3NBKA 3SYLA 5HCNA 3VO1A 2CF6A 3RRYA 4NLLA 2BT4A 2O8CA 4DM3A 4Y6OA 3HBMA 4LY9A 3QI7A 3HBNA 3QFCA 1A1SA 4BFZA 5J2UA 4PAOA 1MW9X 4M87A 3KEQA 3WKDA 3H0CA 1N5RA 2HCRA 4MR9A 4DDHA 2CVHA 3DO5A 1R9NA 4HDSA 4KITB 4IIVA 5CH8A 2N75A 3B6JA 5CDFA 1K86A 2IUYA 1EP2B 2H1CA 3OC0A 2XBUA 3IV6A 3AR4A 1BWSA 1D2EA 4XYEA 1XL0A 4JA0A 3W5DA 3T06B 2PTHA 3NRJA 2GYUA 2QZPA 2RH8A 2WJHA 2YRXA 1BOOA 3V6MA 5CBKA 1W36B 2ATIA 1KHTA 2RONA 3C3CA 3ZHSA 4XH9B 2HC9A 4F4CA 5AHOA 2J67A 3L49A 2IY8A 4URWR 2Q0XA 3SEFA 1NF2A 2V1UA 4J16C 2O9JA 4RSGA 2ZTHA 1AB5A 3B7WA 1X7GA 2QX9A 3PFHA 5FI1B 1W76A 4LYFA 3DVAA 4OVKA 4FGUA 5BPFA 4OI0A 1RWPA 3IKMB 2P4SA 4NBUA 1J1IA 2H4ZA 3GV0A 3G82C 3TUZC 2HRQA 4MP3A 1X7WA 3K5HA 1L4YA 2ADOA 1G4AE 4C2BA 4RBNA 7GPBA 1QUEA 3JQRA 4QFBA 2I9PA 3SM9A 2QUKA 5AKIA 2GRUA 2VXCA 4AFNA 2DT8A 5HM8A 3JQ9A 5ALYA 2BDTA 3I62A 3L6OO 4GOMD 1WB4A 4C7XA 3B9PA 3EOZA 1ESCA 3Q7PA 2I66A 3DJFA 3EEBA 1BXZA 1U81A 2HOQA 3IQHX 3C3YA 4G09A 2UYQA 4GE0A 4RDIA 3L1IA 4B7AA 2A5DA 2EFCB 2ETVA 1OGYA 3WB0A 4F71A 2WB2A 4E15A 4KQ9A 5U9CA 1MIHA 3Q7RA 4CMIB 2G9UA 2GOYA 1HMYA 2HPHA 2QD2A 2W9XA 1E18A 3EXFA 4PV7A 4ZCMA 3JRXA 4ABTA 3ZGOA 1KZ9A 2A5LA 3GRKA 4MUXA 1ZI6A 4FI3F 4N5DA 4TUYB 4UZFA 1C7FA 4N65A 1K5DA 3DYIA 1MRNA 2PQ2A 4GC5A 2O2JA 2OCYC 3ZD9A 4E32A 3I52A 1L5MA 1NW7A 5I7VA 5FIUA 4JEMA 3FNRA 1PD1A 4J2HA 3QKRB 3ZV5A 1RQXA 2C61A 2AMLA 2P4QA 1XQ1A 2I6XA 3S68A 3B9QA 1DRKA 1TPYA 4XEUA 1E6CA 1W2WB 1RAGA 1E2FA 2B30A 3NAMA 6Q21A 3REFA 4TKUA 4CMGA 3E7FA 3Q0IA 2QVGA 3RWMB 3NZEA 4B4UA 3GLGE 2XT0A 3PGA1 4U6NA 3TTWA 2ATVA 1JQ3A 3HB9A 1NVKA 4JI4B 2VJQA 3RIXA 2A1IA 3FUVA 2V65A 4JB8A 4NZ9A 4QYIB 2WF5A 3H99A 1SKQA 2M2IA 5AHKA 1HT0A 3ZHZA 1E2PA 3OC6A 4O25A 4U2KA 4Q1DA 4WJZA 4X45A 1GVNB 1KWGA 1FTQA 3BMCB 1HWYA 5FLXA 2ERYA 4E4RA 1DBVO 1YCGA 1K98A 2Z1MA 4KMMA 4PEVA 3O0DA 5LBIA 3CG4A 1YKFA 2P27A 1CETA 1IY9A 2P2GA 1T0HB 3PWSA 4QGAA 3TZHA 2VYVD 1JFTA 1TCAA 2WC1A 4IIHA 1BXRB 1CQIA 2QMOA 1QJCA 3STXA 4TLDA 3UQYS 1UP4A 4MAFA 5JWHA 4TM8A 4ERXA 1GO2A 3I5UA 1MC4A 2DH5A 1NYTA 1MO2A 1AHPA 4RY8A 4ZAYA 2A0XA 2BI8A 3MELA 5B37A 4Z7JA 1JDUA 3HCBA 3PZBA 2CZCA 4ENPA 2F17A 1HRKA 2EBHX 2F8LA 1SXQA 2OBBA 2W7TA 1JEJA 1SELA 2B37A 1SH7A 4KQWA 5P8WA 4D4HA 1U02A 4RK7A 3COSA 4LXIA 3VH2A 3DAYA 1PQYA 1JPJA 4G37A 3AHCA 3F5SA 1Z5ZA 3KZCA 4W9NC 2HA7A 4B75A 2F1OA 3AFNA 2HDWA 4ROSA 5CCBA 4LF8B 1XEWX 3TCNA 1OFGA 2HV9A 3V4RA 2VHTA 4BFSA 3TJMA 2FSVC 1NBHA 1ATIA 3KD2A 1ENZA 1EDZA 2V7UA 3OP1A 1ZRHA 4ZOAA 4DR7B 1JDZA 1M1NB 2JLZA 1QIGA 5AW0A 4FFPA 1LDYA 4DSOA 3MUEA 4QBHA 5JNSA 1XF1A 4JP1A 4WCFB 1E6UA 2GK3A 2Z5VA 4MVJA 4L73A 4BWYA 4ENQA 4N3AA 5JVDF 1H22A 2GM4A 3TBHA 4DQ0A 1TTPB 1E2DA 4LOLA 2C04A 1RE0A 4K6MA 1S3GA 4TT3A 3GU3A 1GUDA 2W2PA 3AM5A 3KWMA 3A25A 4DLLA 2OV4A 2CKDA 3EDYA 3I04M 3UWPA 4Q1VA 2DPYA 1OD6A 3FIUA 4M1SA 1XJQA 3BXFA 3WL6A 1PW7A 1XXLA 2V5UA 4D96A 1CE8A 2A1UA 2WYIA 4KWTA 5AQEA 5CFZA 1I94B 3KTAB 3ETHA 3WNZA 5J5VA 1GCUA 2PFGA 3OPMA 5ARCA 1VLVA 5IF9A 2VHJA 1QVVA 3CKYA 5JAHA 1SBQA 3V3KA 4EG7A 2AIRA 4V1CI 2WAYA 4RMNA 1Z88A 1G8AA 3D81A 4KX5A 3R4VA 2BGTA 4S2UA 4TWBA 4QEDA 3TM5A 5IAOA 2BFCB 4OJTA 3F67A 3DDZX 2F9FA 3T5DA 5D3ZA 3F3YA 1X3SA 1E3MA 3CMCO 1XFAA 4H7EA 1TYZA 4R2KA 2CNOA 3A1VA 1GPMA 5E3JA 1OJ7A 2VS1A 3PFKA 4HEQA 4ER0A 1MRZA 1RW4A 1HQDA 5FPKA 1GAQA 1E4OA 1LW7A 3TLAA 4TQ9A 2GM9A 1RXIA 1IRIA 3JQGB 1O54A 4MDYA 3U1TA 4EABA 5BSEA 3WL3A 3BCHA 3D7LA 2AN4A 1I7QB 5JNVA 1E5VA 3DHNA 4QPCA 1WB5A 1RXSA 4JL6A 3DP9A 1CYDA 1Z7YA 3T95A 4X65B 1N9ZA 5JS1A 1UJNA 5E2BA 1IE3A 4W5RA 1MH1A 2JJMA 2NVBA 1ZD2P 3H19A 4XARA 3RYIB 3RANA 1SUSA 3M4NA 3VU0A 4E2XA 4LMBA 2QYSA 4GM0A 5IABA 1VSQA 3MILA 2IEDA 4KKVA 2ZS8A 1SCNE 1J8YF 1FYFA 4ZT4A 2CNBA 4NFYA 1IH8A 4G0NA 1A9OA 1OAOC 4ME6A 2QTRA 5DNCA 3RT1A 4S0ZA 5J4VA 2B20A 4OAQA 1Y81A 1UANA 1IZYA 2QN2A 5CIWA 2BEUB 2GAIA 3ML1A 1N5KA 1DQPA 3VDRA 1ZD9A 2UUOA 3LC7O 1H8HD 1XR3A 1AC5A 2AFHB 4N12A 1GGNA 4L8VA 4PZPA 5DWDA 2CT8A 3D5EA 2HYDA 3EE6A 1UPCA 2EP8A 2ZTVA 3HCAA 2BRUA 2R11A 1KEUA 4W9RA 4BFCA 3SHWA 3DD5A 4TYPA 2YVUA 4ZVQA 2ZRMA 3LK6A 2JPDA 4XGKA 5EESA 5JMPA 4K9SA 3W90A 4YCNA 4NABA 4E12A 2G06A 4F45A 1CUAA 2AMVA 2YIJA 1E96A 1EB8A 4U6SA 5AHRA 1TNDA 3PFCA 2AK3A 2PUCA 4RQBA 2XZTA 2NXNA 1F9AA 1VP9A 2W2XA 3MT8A 1FYWA 5L4LA 2DULA 1CVRA 1ONPA 3K0AB 4M1MA 4RADA 4YJ3A 1ZBDA 4IF4A 2QTWB 1S3IA 4KXFB 2FF5A 4R6XA 1FS5A 3IP1A 4LHVA 1I4WA 2P40A 4TSFD 1N78A 3H0EA 2JGAA 2QW0X 4HXYA 3Q11A 2EW1A 3U62A 1XTJA 2RI6A 3CN9A 1L5HB 1RC0A 4BMCA 4DTIA 2BUAA 1JI3A 2R85A 3A11A 2HRBA 1B73A 2OESA 3NKVA 4ZOLB 3GEDA 3OKFA 4GKAA 4RYLA 3AUAA 3SYMA 3QU5A 3T52A 5KYUA 1H2YA 4JELA 1CP2A 5B58C 4EG0A 4JXXA 5HR5A 4Q82A 3STWA 2GT1A 1SBHA 2IXAA 3JATB 4HF7A 1I6KA 1N6NA 4JJZA 1JHYA 5EKUA 1AN0A 3NCHA 3R9KA 1U2GC 1E2GA 4EF6A 3PUXA 1H93A 2BHRA 3PTZA 4LTNA 4RFSB 2BUBA 2PUHA 5FTJA 4LSZA 3T7TA 1YR2A 4PQYA 3D8UA 3IVAA 5D5QA 3RROA 2JKZA 4RS4A 1AA9A 4DSAA 4NAUA 4DY4A 3WOVA 3TYXA 5EJ6A 4BNKA 4DXHA 3LQ1A 3CZCA 5B7PA 4EYEA 5JXWA 4NYJR 3RSGA 2YV1A 1DX9A 5J2TB 1QFMA 3K73O 3RT7A 3OZ7A 4RVUA 5BNTA 5KNBH 3AVWA 3IJEB 3W04A 3ABZA 3EIEA 4OHKA 1F6BA 1T3ZA 3B1VA 3SMVA 4UD2A 1B76A 4NBTA 4W5TA 1IB0A 3FOBA 2XXBA 5CH5A 1NP6A 3LTNC 3HLYA 1K2WA 2ANCA 4C4PA 5EMHA 3R5KA 1S7GA 4J0IA 1SEVA 1R2QA 2X7HA 3KZVA 3VTZA 2GWRA 1M34B 3FIJA 4YAOA 4QFCA 4HFMA 4QM7A 1GUZA 3RK1A 5F1KA 2XWQA 2O3JA 3T3HA 4NIMA 2IYXA 1NOJA 3S1AB 1KEWA 3GGSA 4OUKX 4FLEA 1LDBA 1MUUA 1ZEMA 3FNFA 5M7EA 1XQYA 3M6XA 2BGUA 1ZNXA 3FROA 3AUFA 1VL8A 5FAXA 3WQHA 2WJWA 1O6CA 4XAQA 5IUJC 3CYFA 3IAM1 1NP3A 2MINA 3ME5A 1PI3A 4M86A 1B2LA 2Z2YA 3TRIA 1VJGA 2P3QA 3MRSA 4QPDA 2H1FA 3UAGA 5C1IA 3EXEA 4I1IA 5HQJA 3W5BA 1NMYA