2GHTA

Ctd-specific phosphatase scp1 in complex with peptide from c-terminal domain of rna polymerase ii
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
180
structure length
180
Chain Sequence
b'QYLLPEAKAQDSDKICVVINLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxy-terminal domain RNA polymerase II polypeptide A smal
publication title Determinants for dephosphorylation of the RNA polymerase II C-terminal domain by Scp1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 54
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ghtA00
3QLEA 2G09A 1YMQA 2C88A 1SU4A 5AKLA 3ZVLA 3IRUA 3ET4A 4L6AA 2OBBA 2FPXA 3B9BA 3FZQA 5AW1A 3L8EA 5AVZA 4UW9A 3WK4A 2OA0A 5AIBA 2HDOA 2G0AA 1Z88A 3E58A 2C4NA 3FPSA 3PGVA 5ALQA 3N5KA 3U7GA 2YMMA 4FE3A 2HOQA 1Z4NA 4DFDA 3RF6A 3ZU6A 4NAVA 4Y2UA 4NV0A 1S2OA 5ALDA 1RRCA 3U19A 3QU4A 4UAVA 4ZEVA 4I9FA 5AI8A 2RB5A 3U7EB 1L8OA 2WHEA 3WGUA 4UMVA 3EF1A 3ESQA 3HLTA 2P9JA 2JAWA 5ALGA 3L8HA 4L6CA 4BBJA 3ET5A 4EZEA 1L7NA 3W5AA 3U7FB 5ALFA 4DCCA 3KC2A 2W4MA 3U13A 5AW3A 4UMEA 1ZRMA 2GHTA 2JAOA 3KBBA 5AW9A 1S8OA 4RESA 1WZCA 1RLTA 5AK4A 4HGNA 1N8NA 2ZBEA 2I33A 2FPRA 3AR7A 4BX0A 4OCZA 5ALTA 2EATA 3WK9A 4AP9A 2B30A 3K1ZA 4OHFA 2PQ0A 4HGQA 5AKKA 4F72A 1WPGA 2YJ6A 3M9LA 2FPUA 1QQ7A 5AI0A 2C8LA 2WF9A 5AVVA 3F9RA 3PDWA 4UMFA 1QQ5A 3KZXA 2C8KA 4BYGA 3RFUA 5AW7A 2FUEA 3WKAA 1QH9A 4AS3A 2ZG6A 3L1UA 5AVTA 5AKGA 2IOFA 2WM8A 1VJ5A 3OCYA 1IWOA 4G63A 2X4DA 2IYEA 3N28A 4E88A 1Z4LA 4Y2RA 2GO7A 5IT4A 3FVVA 2AUTA 5ALOA 1Q92A 3ZVNA 2HSZA 2O2XA 5AW5A 3GYGA 3AR4A 5AVQA 4BEVA 2GHQA 1ZD3A 3QXGA 4UATA 4Y2VA 4CNQA 3WGVA 2ZBGA 1F5SA 4Y2TA 1ZJJA 2G08A 3QUCA 4UM5A 3ZX5A 3WK5A 5JJBA 3J7TA 2CFRA 2YFYA 5ALVA 2HX1A 3UMBA 1T5SA 2IOFK 5AICA 1U02A 2FPSA 2PKEA 5AM3A 3AR8A 4UMDA 4GXTA 1NRWA 2WF8A 4YIHA 4UARA 2NO5A 1RQNA 2CFTA 5A3SA 1U7PA 4GIBA 3IB6A 5ALJA 4IFTA 2D2VA 5IS2A 2ZXEA 3ZW7A 4YGYA 4B6JA 1O08A 3A1DA 2IOHA 3DAOA 5ALLA 3ZI4A 2Q4RA 3I76A 2YMQA 4C4RA 4PNHA 2BY4A 1XVIA 3ONNA 2YJ5A 4HYTA 4EX6A 4XOUA 4OFZA 2Q5EA 4YH1A 2YJ3A 4AS2A 4BX3A 1RMYA 2W43A 3N1UA 4G9BA 3A1EA 3VAYA 5AM4A 1Z4QA 3NAMA 3WKCA 1RC8A 4O8CA 3MN1A 1TE2A 1Z5UA 1ZD5A 3A1CA 3HYCA 3KD3A 4NFLA 4UAUA 5AKJA 4CF5A 4CF3A 3FPBA 4QJBA 1K1EA 2AGVA 3L8FA 1Z4IA 3PCTA 4BX2A 1TJ5A 2JGAA 1Z4PX 5AM2A 4ZEWA 3WKEA 4MUMA 3U7HB 1EK2A 3I28A 3QU5A 2R8EA 5ALHA 3QNMA 1KYTA 2R8ZA 5ALUA 3L1VA 2HHLA 2QYHA 4KX5A 1U2TA 2B1RA 3B8EA 5FP0A 2HF2A 2RARA 3SKYA 3WK8A 4YCNA 4DWOA 5ALYA 3AR6A 3QU2A 1Z5GA 1ZOLA 4MWOA 5IT0A 3SHQA 3WK6A 5ALXA 2I7DA 2FI1A 2YY6A 3EWIA 5AI9A 5AVUA 3TLMA 2HI0A 2EARA 3CNHA 4XQ0A 1U2SA 2P11A 3AR2A 2QLTA 3KDPA 1RDFA 3E81A 2FPWA 1PW5A 4BNDB 1Z4KA 3DDHA 4EX7A 1RKVA 4H1WA 2WF5A 3MMZA 3OCXA 2B82A 3L0BA 4FFDA 3BA6A 3AR3A 3L0CA 1YJ5A 3L0YA 1MH9A 3OPXA 3QU7A 4BNDA 1YV9A 5ALSA 5T41A 2P69A 5AI4A 3QUTA 1JUDA 4UM7A 1RQLA 4KN8A 3SMVA 1ZD4A 1RKUA 3SD7A 1YDFA 2JAUA 5AVRA 5AI5A 1TJ4A 3MC1A 3N07A 4HGRA 4J03A 4QQFA 5AW0A 2CN1A 4C4TA 3ZWKA 1SWVA 1L7PA 2FEAA 5ALRA 3WKBA 5ALKA 4Y2QA 3CZ4A 3NASA 3FGOA 2OYCA 2Q4TA 5E0OA 1QQ6A 3E8MA 4ZEXA 4C4SA 4YCLA 2MSNA 2BDEA 1WVIA 3DV9A 5A3RA 2HEGA 4NABA 1LTQA 2RAVA 1RMTA 3NIWA 4Y3UA 2ZOSA 4UASA 3NRJA 4IG4A 2HF7A 4HAIA 5AKXA 3M1YA 4EEKA 1WR8A 3BWVA 4XPZA 3ZTWA 3R09A 1RMQA 2WF6A 2ZBFA 1Z4JA 4KYTA 3OCZA 3L5KA 3AR9A 4DW8A 3L7YA 2GMWA 3ZTYA 1T5TA 1AQ6A 2OM6A 2NO4A 2I54A 5ALEA 5AKIA 3ZWDA 1XPJA 1ZRNA 4Y2SA 2W11A 3ZX4A 1N9KA 5AK6A 3W5CA 4JDPA 3IJ5A 3NANA 1YS9A 4Y2YA 2I55A 2G80A 1Y8AA 2R8XA 3OCVA 2EAUA 3UMGA 3ZVMA 1NF2A 2B8EA 2P27A 5AK5A 2IA5A 3MPOA 4I9GA 5AHXA 1TA0A 1NNLA 5AK3A 3L8GA 3QYPA 5AW4A 1EK1A 3SLRA 1TJ3A 4J2TA 4YCMA 1Z4MA 5AKHA 2PR7A 3EPRA 5AI6A 1Q91A 4CF4A 4BEWA 4F71A 4BKMA 4L57A 2NYVA 1VFPA 3OCWA 3QX7A 1RLOA 3A3YA 1ZD2P 1LVHA 2R8YA 3QGMA 4EENA 2AMYA 2WF7A 3ESRA 4RETA 3D6JA 3UM9A 2DQSA 3QUQA 2CFSA 5AM1A 5AVXA 1J97A 2B1QA 2FDRA 5ALWA 1RLMA 3EF0A 5AW8A 4FYPA 4Y2PA 2I6XA 2I34A 3NALA 4HGOA 3E84A 5ALPA 3W5BA 5AVWA 3FM9A 4EELA 5AESA 3QUBA 5ALZA 1L7OA 3QU9A 3OTQA 4Y2JA 1CR6A 5ALNA 5AVSA 1FEZA 2MU1A 3I6BA 1O03A 1X42A 5AM0A 2WFAA 2ODAA 2G1AA 2GFHA 4JB3A 3B9RA 1J8DA 2G07A 3UMCA 2VKQA 5AKZA 3NUQA 1QYIA 4YIKA 3I1YA 5ALIA 3PGLA 3KOOA 1U7OA 3WK7A 2YBDA 1T9ZA 1L7MA 1ZS9A 2HCFA 2YMLA 2YN4A 2FUCA 5AVYA 1XP5A 5AW6A 2RBKA 1RPZA 1SWWA 2JARA 2O9JA 3SKXA 1RKQA 2ZBDA 2YJ4A 4NWIA 3R4CA 1L8LA 4XE5A 4OD0A 3DNPA 3WKDA 5AIAA 3R9KA 2YMPA 5AKEA 1Z4OA 4UU0A 5AKYA 4KNVA 4UU1A 3SF0A 1YNSA 2G06A 4HGPA 3W5DA 3P96A 2AH5A 4KX3A 2B0CA 1VJRA 5A3QA 5AW2A 3ZUPA 4KNWA 3U26A 3N8GA 2C9MA 4CE6A 4Y2XA 2BDUA 1L6RA 3ED5A 3S6JA 3OCUA 2B8JA 5ALMA 1CQZA 5AM5A 3AR5A 2HO4A
chains in the Genus database with same CATH superfamily
1ZJ5A 2WYUA 4DBZA 5IYZA 4FDLA 1S8NA 2IXEA 2C88A 3DB2A 4JEUA 1KVRA 3SSNA 4B4UA 5JI3E 1NJFA 3VFDA 4V0QA 1CUYA 2VTDA 3IBTA 3Q8XB 4DM7A 1S3SA 4M9QA 4CT5A 2QQEA 4LDJA 3HO1A 1GAJA 3T6KA 1A9OA 2ZRKA 3L8EA 1SEPA 4PG5A 1DAPA 3VC7A 4IRMA 2F1RA 5EP2A 1F2UB 2UZ3A 4HPXB 5B57C 4ZP1A 2CXSA 1UXOA 4EUHA 1WEKA 3FG9A 3W5SA 3KOXA 3GU3A 4MS3A 1E3MA 3KUCA 3CONA 1GNPA 1ZMXA 3Q9LA 2ERXA 2RONA 5EIHA 4BX9A 4D3YA 1VGQA 2O8EA 5LL6P 5KTRA 4BNDB 1CR2A 4B3IA 2C7GA 3OOEA 1CJSA 3E9YA 2X14A 5TGZA 3VSEA 3TF5A 4CLRB 1KE1A 1WB4A 3A1FA 5JNRA 5ALDA 3KOYA 3U19A 3Q98A 3MWDB 1SXGA 1GADO 4UCXA 5LUAA 1B16A 4ZCPA 3KQNA 1V9CA 5AI8A 1XAHA 4HOYA 2A7XA 4OV6B 2YCLA 3NFRA 1WBJB 3EEBA 2C07A 3N9IA 5B1YA 2CVHA 1U90A 4LGYA 1QFXA 3EF1A 4QDOA 1G38A 2QZJA 3KAKA 5MGNA 2AI2A 2G77B 4Q7JB 2NXCA 3RRZA 2Z6AA 4TT3A 1A1SA 1RAAA 5J58A 4S2UA 3GXOA 5KNCD 2BJHA 3QELB 4JJ8A 3A6GA 4OYYA 4XWWA 4WFJA 3E2IA 3ML1A 3C0KA 3OOJA 4CV1A 4U0JA 4BBPA 5L51A 2GHTA 2HV9A 1J8VA 4ZMSA 1UMCA 4BFUA 2BKLA 1AKNA 4CU2A 4TMXA 4X66B 4QXOA 4ZYXA 4FGSA 5IKMA 5AK4A 2KB0A 3LCJA 2F6RA 1DZ3A 5KYWA 3LLVA 1RI2A 4I2VA 2ODBA 2IDJA 5FF9A 4NYMQ 2C3MA 1Y42X 4XEHA 1NVXQ 1XZEA 1YKGA 4F3YA 1YTUA 1CP3A 3VU0A 3K72B 1ZSVA 2GUWA 2ILTA 2GZSA 4HXGA 3G7SA 4UTVA 1XTBA 3HCDA 4L4XA 3VDQA 2Z4RA 3U4GA 4TRRA 1G8HA 5IM4A 4FN4A 2SICE 3D1JA 2IYAA 1L5LA 2FE1A 1N6OA 4N7RA 5A5VA 1PTJA 3F96A 1WXGA 4BO0A 1WEHA 5KC9A 5LDHA 2C29D 2WIKA 2I1LA 4TS1A 2G9RA 1IBLB 1JEOA 3WDMA 4G0QA 4RIEA 2Z8ZA 2EIHA 4OHCA 1XZFA 1GKIA 4OAQA 4UMFA 1QP8A 1AA6A 5J63A 5CR9A 1WCIB 3IBFA 5FBQB 4DCSA 3D3WB 2CBZA 5EPOA 3BCHA 1YFLA 1CQXA 1PDWA 2VNIA 2BEWB 3K9WA 1NJ1A 4LJ5A 4QD3A 3CFYA 4FBGA 5G1OA 3M6VA 2VYFA 2OYRA 1EP2B 2Y68A 1YZHA 3OCYA 3RREA 3IV6A 5LA6F 2HEIA 3Q41A 2FPGB 1QC5B 2G5CA 4X1KA 3UYKA 8ABPA 1T4GA 3MSCA 4AMGA 1QK4A 3RIHA 4BEBA 3MLAA 1H2HA 4Y6QA 1NGSA 1NC3A 3OTIA 4X8OA 3DHWC 3TFQA 2JJMA 4R1NA 1CNFA 1JEDA 3NEYA 3RT9A 2Z2XA 2WSSA 3MELA 5I51A 4TXJA 2P9FA 4NLLA 1YAHA 2E5LB 2G71A 2Y27A 2IUFA 3LX6A 3N3AC 4ACBA 4QYIA 4LF9B 4L5YA 5CTAA 4BEVA 1VKZA 2W58A 4PIPA 1OLUA 2QRUA 2ZYIA 3CUUA 3KZOA 3A9WA 2V0NA 3LHIA 1ZM3A 1A2OA 1E61A 4NULA 3BRCA 4B7ZA 4BKRA 1E79D 2REOA 4JSTA 2I4OA 4NHEA 1KJYA 4BNTA 4HEQA 5D87A 3H2SA 1E3QA 5EMJA 3V1NA 5B58C 4HH3C 2HLNA 4ZAZA 4FNAA 1VP3A 1YHNA 4IL5A 4RFSB 1RYMA 3TLGA 2JLAA 1TVKB 1QO7A 4IGIA 3CT6A 1IM2A 1NUTA 3I3OA 2A5JA 2NSYA 1TAGA 3EH2A 4JJAA 1OC4A 4HDQB 3EZFA 2QRVA 1JR2A 2J3JA 2L18A 3A25A 4NV3A 3QA9A 2FLKA 3JQAB 4WCDA 4A5OA 4AZSA 4FU0A 9LDTA 4QBFA 3O8QB 2O14A 4NZNA 5JWRA 1BG6A 2H08A 1A8UA 2PRJA 3ROGA 4US2R 3K7EA 3ETLA 3U7JA 4C7BA 4F56A 4CEIB 4IFTA 3MCZA 4FS8A 4BRUA 1GFSA 1ZGAA 2FYTA 1W5FA 2BDTA 3JARB 1BVUA 4IIFA 4LSWA 1KQNA 3DQQA 4PHTA 1NUPA 2ADFA 2C54A 2WIGA 2ZXFA 5ALLA 1T3GA 2B8NA 5FR1A 5JJIA 2AN9A 1GCGA 2G1KA 3T7CA 3V1KA 3BGSA 3DOFA 4ZODA 1HTBA 2QRMA 3U3ZA 2WOOA 3QUAA 1RADA 2GNAA 2QNRA 2YJ5A 3F5FA 3I73A 4CNBA 4JJIA 2ICAA 4XOUA 1W4AA 5DGXA 2DFPA 5I9LA 4OBBA 2H2GA 2OXEA 3THWA 4R1OA 3DF9A 1FDWA 2DQKA 5HF9A 4NZOA 2ZSIA 2UV8A 1QJCA 1EXWA 2XB8A 4OHXA 2NO7A 3U39A 1MA3A 1XD9A 3UKDA 4AJJA 3TM4A 2Q3LA 4EBFA 4P84A 1RI1A 5K6AC 1E2HA 1F3OA 1S4QA 4HFJA 4J7AA 4C4YA 4PVCA 1PZGA 5D84A 1GPYA 2QTNA 1NULA 4HDAA 1Z5UA 1T13A 3A1CA 2BTQB 3WLMA 3ZZUA 3HCOA 4UD2A 4UEQA 3NW9A 3PEEA 3NUZA 4CZ2A 4P3YA 2HNAA 3KQWA 1T6XA 4TV9A 5DNEA 3KVRA 2K87A 4MDEA 3RYHA 5LM3A 1TW2A 2BI4A 3VPDA 5A06A 4OMUA 1FZTA 3LU1A 2X0NA 2WZQA 2PO5A 5ARDA 4X3PA 1LPAB 3VH2A 4Q3OA 1V1RA 2I9PA 3EG5A 4RHXA 2GBPA 4OL0A 3RRFA 4PF1A 1M2VB 1D1PA 3MFYA 3QU5A 4ADSG 4WCFB 3T7IA 4O4IA 4DEXA 4Q00A 3SY8A 4AIRA 4BZPA 1NBAA 1IBMB 3HYRA 1ZK4A 2F3PA 3B7GA 3LLCA 5ALUA 4UUAA 1QIJA 4JFRA 4NYJQ 3I1JA 1UCFA 3PLAE 4IVQA 4J3JA 3AWIA 3C87A 4YQYA 2HSWA 3TL2A 1Z33A 1KDVA 1X1BA 4KW7A 4DNQA 3SCZA 4IPTA 5IWCA 2XODA 2E89A 4Z6KA 1YNOA 1QV9A 1IB6A 4OSOA 1YQEA 4EMSA 4DA9A 5KINB 5B3AA 3DAGA 2JAHA 2P3LA 3HFRA 1N7HA 2YQZA 5ISMA 1G4AE 2EZUA 4M8NE 4GVXA 3JQGA 3V5NA 4AROA 2ZUTA 1L4HA 2G28A 4WJKB 3VZRA 4NOJA 4I3HA 3TLMA 2FSFA 2HK7A 4EG6A 4X20A 3ADCA 2BZGA 4XQ0A 4A0SA 3QLTA 4KR9A 4OFWA 1SXJA 2BMDA 3E5HA 1PJ3A 4AM8A 2DHQA 2O2CA 3FNQA 3T7DA 1G20A 1ULAA 2HIGA 5CIQA 2XNKA 4NQRA 2VP2A 3OD5A 4Y8VA 1Z4KA 4K5QA 4URFA 1YRAA 4HZGA 1TGYA 5LMCA 4IDGA 4RV4A 3L7JA 2ZE5A 3R8CA 1F9AA 4MB2A 3V34A 3OI7A 3GLVA 3BVPA 1NHGA 1UDAA 3PXBA 4W9MC 3L4JA 2RK4A 2QVZX 2OC9A 4QSHA 1DCFA 1GVHA 2AL7A 2C2GA 1R18A 4D43A 1Z36A 3QFRA 1YMVA 1IH8A 3DOHA 1NVWQ 1OBCA 5DK6A 4OIFA 3UAOA 1YFKA 4NPCA 2BZ1A 3KR0A 4RQBA 1MJ5A 1GR1A 2O5RA 3EZ7A 3GT3A 4L76A 2XCUA 1OROA 5JRZA 4OBXA 1KYIA 1ONSA 3VPBA 1IXSB 2BLLA 3AFIA 2HU5A 3HCAA 3BD8A 4WKCA 3DS8A 3ANYB 3HQ4O 4NARA 4UJ5A 2JDIA 3OQBA 1TJ4A 3PYLA 1EFRA 4J7UA 3IAM6 2C7QA 1K7EB 2W6JA 2IY8A 4G36A 3LT5A 4UVHA 4WLNA 4ALJA 4DCVA 3F90A 1E2KA 4NYMR 1AV6A 3G8BA 1L7PA 2JFWA 1SBNE 2VQEB 5ALRA 4JJZA 3CT4A 3MJEA 3TKLA 1A71A 1O94A 2P2GA 3QEBZ 1RKXA 3NASA 3HG7A 3AINA 4ZT2A 4UM9B 2PVCA 2GAFA 4V02A 3C4JA 4G1EB 3STWA 2VTBA 4RE6A 1BXGA 1EK0A 5DHTA 1NIJA 4KH0A 3K9QO 1MFPA 1PJLA 2NUPB 4QGGA 2DT5A 3CLRC 4RK1A 1XLTA 2AN3A 2V1XA 3TQFA 3W5HA 2YWEA 4UTOA 1CQIB 5CXXA 4BNMA 1TKRA 1ZOIA 2JC3A 2P77A 3INTA 4YGXB 3BMNB 3SHWA 2CV2A 2E87A 4NG5A 2D7CA 5E9AA 3SHVA 1QPGA 4OG2A 3HB1A 2VDWB 3NRJA 4UPEA 5F21A 3JYLA 4E4TA 1Y37A 4RKRA 3C6ZA 2KBFA 1YR2A 3EJWA 1H69A 4MPTA 2VAVA 1R0KA 2EX1A 2F8LA 4GMKA 2HK9A 4L74A 2UVQA 3JPWA 1CDOA 4NCJA 1FDIA 2WJYA 4J4HA 4F84A 1VHQA 5EZYF 1EK6A 2JI4A 2Y9PB 2K5UA 4G4IA 3FMGA 4K6CA 4MVCA 3JALA 5CVCA 2GBCA 5CDGA 1B26A 1PAUA 2A92A 3NT4A 5I4IA 4XSVA 2C3OA 4ETIA 4IEEA 3AF6A 3SXUA 3ZHYA 3FDZB 5BRAA 1PR1A 2DJIA 3VSAA 2WU1A 2V7WA 3HPRA 5FI5A 2IBMA 4RDHA 3DL7A 2XADA 3T3EA 1SIOA 5FORA 4DXAA 4JR2A 2I4RA 1YS9A 3ABQB 1WOMA 3VTAA 2PANA 1LRKA 3B5IA 5KTPA 3FOEC 5JSZB 5FH9A 4OXNA 4YAEA 4G07A 3OCVA 2EAUA 5KHOC 2QU8A 1I4DD 4JLOA 1MH1A 2F67A 4K40A 4QELA 2NU8B 1JPUA 721PA 5JDCC 2B8EA 4J07A 3SN6A 3E7DA 2A35A 3G3EA 5KS2A 4IO1A 1KMIY 2J7PA 5LQNA 2JD2A 3TNLA 3EFOA 2ACWA 5EFZA 5AK3A 1FP1D 3HSSA 1ZNWA 3ZDFA 5J59A 1XXHA 1EJ6A 4EPWA 3GA0A 2QRZA 4P2GA 2WVAA 1TM7E 2VHCA 4RFLA 4ZO8A 3RSQA 4LVNA 3GCGA 1ISJA 3IP1A 4NBVA 5TXGA 1E6WA 1JLLB 2ZU6A 2PH1A 2V6MA 3ANSA 1KAHA 4E7PA 3UUFA 4JJGA 1AGRA 5AI6A 1IXRC 1N4DA 4GO1A 4TKVB 4BEWA 1E2NA 4UUQA 3TQQA 1GV1A 3QVGA 1YZVA 3MSXA 1Y0BA 4ON9A 5H9WA 2I76A 1Y33E 4IH1A 1GGEA 2C95A 2H7YA 4KXNA 1YUNA 4EENA 5HVNA 4RETA 2WF7A 2PAFA 4XWGA 4LFBB 5B3LA 1NUUA 3X3HA 3T5MA 4EF5A 4ZIRB 2AC7A 3HDGA 2FDRA 5EJ5A 2G25A 3EF0A 6Q21A 3UGJA 1P39A 4DNFA 2OAGA 4U7FA 4Y2PA 4Q4LA 2Z95A 4BO5A 1UWCA 2EJUA 5CXQA 3Q7EA 4P8RA 3D7NA 1Q1QA 3GLGE 3FFWA 1RLUA 1N4AA 3FJOA 1J23A 1DIBA 2X1HA 2I3BA 4GHWA 4KE7A 1DJNA 1I4OA 2E1PA 2PT5A 4QUAA 3ROFA 5J3JA 4BZZA 4M60A 1LI4A 3FTCA 3UKJA 2AVNA 4B46A 2FH5B 3H1PA 3R5SA 4TQ9A 3UPDA 3CVWA 3UJHA 1CZNA 2JH9A 2QR2A 4PPNA 2A30A 2VP6A 3BJIC 3FPFA 4BQNA 4X93A 5TGDA 1ZM2A 4RPHA 4CR7A 4E46A 2G04A 1RWPA 3V8VA 1JR4A 4TTJA 8ADHA 4NBRA 4PLGA 3BXZA 1YQ9A 2HTEA 2DGDA 2ZW9A 1OGIA 3HRHA 2IS6A 2VSOA 4URHA 3A1UA 2FR0A 1Z7GA 4EUEA 3GIWA 4IJ6A 4PN7A 2HT1A 3KHKA 3LLSA 4KLRA 3ZLTA 3EPJA 1VPTA 1XZJA 4U2GA 4ER6A 1JB9A 1JJVA 5FTMA 2E49A 2G9ZA 3SJ7A 3EFEA 4FTWA 3WLJA 3PGLA 5CA0A 4LFAB 3BD9A 2VSNA 2AWNA 4KKXB 5EZQA 4CM5A 1XN1A 4UNPA 3SBOA 1H22A 2XT6A 3R8FA 5F78A 4DQXA 1I01A 3MWGA 4NE2A 4FEYA 4NYJR 4EB8A 1E5LA 3UF0A 2V5VA 1V2GA 3WDSA 4F5WA 3EY9A 4GZ3A 2YN2A 3FBGA 3JQBC 1FX0A 1G7TA 1E1RA 4X54A 3GIDA 3ROQA 4OOFA 3RTEA 4MR8A 3VSCA 4WNAB 5BMOA 1YZQA 5T57A 5FLYA 2IYFA 1F48A 1SY7A 5LQJA 3KHTA 4LY6A 2WJAA 5DX1A 4ND1A 1JFSA 3R9XA 1N2XA 1SU8A 4RZXA 1T2CA 1JHMA 1P9OA 2X8AA 4KQEA 4PXSA 1R16A 4WN3A 2AH5A 2BLNA 5CG1A 3OZAA 3VZSA 1BZYA 3FKSD 2J9FA 3SNKA 4AY6A 2EEPA 4J75A 4M0PA 3MINB 4RTJA 3TJMA 3FTDA 3GX1A 4UAGA 3WMWA 5KZMB 4ZTZB 3RFVA 2ECOA 3CQ9A 1BCSB 2HO4A 5ER9A 1O94C 1SZJG 1SU4A 1W73A 1JIQA 5DLQC 2JFFA 2V74B 4WZZA 3TQHA 4DRYA 2IBTA 4QVIA 2R85A 3HWSA 2Q0XA 1W0KD 3FOFC 3BK1A 4P86A 2B6HA 5AR1A 3BIOA 1TO6A 4H7IA 3DE2X 3N2ZB 5KTNA 4K0RA 1YUMA 3LYLA 3H0KA 3ZQ4A 5C7LO 3FROA 3SQWA 1NN1A 4RCYA 1AHHA 5E1MA 2WW8A 3HFSA 3WGTA 4BMVA 2R47A 1HPLA 3D6MA 2JANA 4LOJA 1R0CA 1OSNA 4MW1A 3JY6A 3LNCA 2CKMA 1F8FA 3WMFA 1C1XB 1M83A 1W93A 4YK7A 4AUNA 2VWPA 4PC6A 4NZ9A 3TE7A 1R37A 2IVFA 3DHYA 2I4IA 2EF0A 3NHLA 3OCJA 3IDSA 5U4QA 4BKUA 2AOUA 2CT8A 4ZEVA 1K8RA 1A9PA 2B1GA 3JQQA 4TMVA 1U7UA 5PGMA 2RB5A 4LV6A 4L5CA 5DBFA 1RP7A 1X3SA 4YRCA 4NONA 5GY7A 3ESQA 1GRRA 2ANCA 3UT0A 4A82A 5FOVA 3ACBA 4YP5A 3UJPA 5D3ZA 2AHOA 2BFWA 4H7PA 2ST1A 1B15A 4UZFA 3ZWQA 4YT2A 1P62B 4RPLA 5EJ7A 5SICE 4BBJA 5HFAA 4EZEA 1A9XA 2JCBA 1G21B 2V7QA 1PZNA 2C94A 4R2IA 2VXOA 4ZVVA 1LWNA 1YD7A 4CUZA 3GLIB 2B4KA 2ORVA 3KC2A 3O6VA 1L5OA 4TL8A 5U9CA 4BMOB 4N0PA 4N5HX 4OYHA 5CMLA 4EM6A 1VJTA 2PVSA 5GZ6A 5T3YA 3UPUA 1S8OA 2GAJA 4DA8A 2ADOA 2AX4A 4WH0A 2LPMA 4U02A 2YV1A 4B48A 2Z2ZA 1RYHA 5CAEA 1V3VA 4LXXA 1H9BA 2RFLA 1NOIA 3PPXA 1PWEA 1REQB 2WAOA 2WUVA 3DMGA 5EKUA 5BN5B 2NUTB 3TINA 1NBIA 4FHCA 6PFKA 4XRRA 3UUWA 1VPWA 3OTGA 1KQFA 4CTNA 3ZIUA 1PDOA 3VNBA 2Q4EA 1JR3A 3OP4A 3KTAA 2REQA 1EB9A 3BRWD 3O2NA 3N8DA 3QLUA 1FFSA 3WGGA 1NRXA 1NPDA 4GWGA 4I4LA 2A6PA 3IPXA 4RAQA 2GD6A 1P31A 1P3DA 3C3DA 3M4NA 4KQJA 2R6FA 4B6GA 5ITZA 1F2TA 2FZVA 3PTAA 1XDDA 4E21A 3EK2A 1YGPA 5AW7A 3LUGA 5HWSA 4JI5B 1EFDN 2Q5QA 3GF4A 4M1EA 5BPHA 3PGXA 2J5RA 1Q44A 1QP4A 2FSPA 4RJTA 1MJHA 3BGDA 4KOAA 4ZO7A 2JGMA 5AKGA 1C9KA 2PKRA 2XTNA 3OFKA 3AZQA 5LJLA 3SEZA 3GG2A 2WTEA 1Y5LA 1E3IA 1R27A 3AI1A 2ZB3A 2H7XA 1UJ5A 3NEJA 4FONA 1FQOA 5LWQA 4DLBA 1A9TA 2JAPA 1UJMA 3G0BA 3KLPX 4M0EA 4M9UA 4UKDA 4JJEA 1PGQA 1WO8A 2DULA 5K09A 1BHO1 2EFGA 2ZWAA 3O03A 4NOLA 1XD8A 1XRLA 2YV4A 5IMSA 1E0SA 1W6RA 2WFLA 1JHDA 5EL0A 3AYXB 5EVJA 4BE7B 4UDOA 2XRZA 1CK4A 2NPIA 2ZBGA 3EVCA 2DUNA 1F5SA 2PX6A 1KZ7B 1NSFA 3G89A 3Q7PA 3H75A 4R0MA 3KWMA 4LJLA 3CRVA 1V7QA 3NNDA 1AGPA 4I8XA 4OP2A 2QBYA 4G0VA 1NMSA 4UDXX 4II3A 4E5PA 4EMUA 3PB3A 1WV1A 3U0BA 3LRTA 3RBVA 1X7XA 4F8JA 2TMDA 3CRQA 4BNIA 3LUBA 3CCBA 5I7WA 4HH4A 2E37A 3GLTA 3G0DA 4DIKA 3VPHA 3GT4A 4R2XA 4Z4IA 3D02A 1CFJA 2VN8A 4PZZA 4UXJA 4V0RA 4DDUA 5I4CA 4UBLA 4MV9A 3T3DA 1NLFA 1IULA 3CSSA 3DC7A 1CULC 4A5SA 2XZOA 4FNOA 4MWCA 2C9CA 2QE7A 1P4AA 3G2NA 4A0RA 1CF9A 1E4VA 4QTUB 3KVYA 1U2QA 1MVOA 4CIVA 2MMGA 2HXSA 3VKVA 2OESA 1QRSA 5C8YA 1JYSA 5HZMA 3ZOZA 1N2HA 3E03A 1MC1A 4E5UA 1YJAA 4G8DA 1YVPA 4A2WA 3OZXA 3UJ6A 3ASVA 2HWWA 1KSFX 2J33A 4WGFA 1D04A 5LDGA 2IKQA 2CNNA 1U28A 5LLDA 2P35A 3BAFA 1GEEA 1M6NA 3DM5A 1YHZA 4D9KA 5B3JC 5FWYA 1LBQA 3GNQA 3TFWA 3TKYA 4F2DA 2OAEA 2QVYX 3IBYA 5KVCA 1BMFA 4AULA 2QL6A 3SZMA 3UAZA 1WQ1R 2FR8C 4F0JA 1IZ8A 3ROTA 4F4HA 1K8QA 5I47A 5EIWA 3RUEA 1CUEA 4AF6A 2B98A 1QIEA 1X7WA 3HP1A 1KEUA 1XTTA 4O8CA 4IGFA 1XUOA 5HF5A 3P2EA 4MWZA 4CGZA 1JJ7A 3SM9A 4YPOA 2AGVA 3L8FA 3TR0A 2NYAA 3A3PA 2WJJA 5KYWB 2V5UA 2UUBB 3AY6A 5EVCA 2C3PA 1ZGHA 3EXFA 3NHBA 4BX2A 1DIAA 4LRQA 2JGAA 3T9FA 5EWLB 4WXEA 5LP6F 3JZAA 4Z7QB 4KR7A 3KJXA 4CMEA 3V8NA 3ORYA 1A27A 3DZHA 3BFVA 4GL4A 2B34A 1P2GA 1RPNA 4NQZA 2GXQA 1XJWA 4PRZA 2DHDA 2W71A 1II8A 4ZI2A 3D1VA 1H93A 4WD3A 1VGRA 2Q0SA 3GVHA 4YLGA 3THYA 4DUYB 2C5FA 2ZTVA 4OHBA 3NT5A 2HYDA 4Q1FA 1QBGA 2DWCA 3P0EA 5FL3A 1M5TA 1AUQA 1VIMA 3D8BA 1H8EA 1QB8A 4QHTA 3R3XA 2XB4A 2Z2YA 4KK3A 4NYIQ 4Q21A 2FZKA 4U7WA 5TPWB 1JZTA 2FJUA 3AUSA 5D7NA 3B3JA 3REQA 4TTSA 3ZVKA 1Z07A 3G2JA 2MR5A 3PR3A 2X3FA 3TIIA 4I1UA 4PSUA 2P9CA 1E0AA 5AP9A 4CL0A 5LOVA 2R6DA 2X1VA 3GMSA 1PI3A 3ZG6A 4A03A 5IT0A 3Q10A 2ECFA 2FLWA 2G72A 3QXCA 5KIAA 1B76A 2L69A 4RY0A 4A36A 1YDWA 5AUPB 1KNQA 4X1KB 2ERCA 2AFIA 4AN4A 4OGGA 3TKAA 2D6FA 5KPDA 1V1MA 3LIPA 1AS0A 3IAS1 4MYCA 4YUAA 2AV6A 5EHQA 3CNHA 5H9VA 3R3WA 4J0GA 1YB1A 1K5PA 1U3CA 4E08A 1LPMA 3ABSB 3KQQA 1RYEA 3AFNA 2IITA 4BO9A 2CZGA 3IELA 2F3SA 2GUGA 4JKIA 3LW7A 1Y3HA 4QYIB 1CETA 5HA5A 1O8BA 3H2JA 1CUZA 4AMZA 1OLUB 3U49A 1H2FA 4G81A 4Q02A 5DNUA 3KKMA 4HAYA 1RC1A 4LCBA 5EIEA 4WWHA 4RVGA 5L3ZA 2FSIA 2COEA 3L0BA 4C88A 1I1QB 1PK9A 1DHTA 5J1TB 2X0FA 4MUEA 1FXWA 3HBMA 5JYDA 4ITRC 1OZ0A 2VXYA 1YV9A 5ALSA 1W8DA 1WW3A 2FN3A 3EDYA 3EMDA 2IIBA 3AUJB 3S2FA 1XCMA 5K2OA 4PGHA 1ZVQA 1UAYA 3TLGB 4EGAA 4TT8A 1XRPA 3TEFA 5JV5A 1QPBA 3H84A 1MJGM 5EIAA 1Y8QA 2C3UA 2ZJYA 4L50A 3TRKA 1Q6ZA 3D2LA 4F4FA 2H4YA 4YMLA 2QRVB 1LTKA 4U2CA 2O50A 2H8KA 1F5NA 1TEXA 1J1UA 4XYEA 3ZLJA 2H18A 2LUOA 3PD0A 4R6XA 1DGQA 1IY2A 1G2QA 2EKQA 3V1YA 3VNRA 2WABA 2XE7A 1VCIA 3BS4A 3INYA 4QDJA 4UE3S 2OR3A 3L4KA 7REQB 2ONJA 1NDQA 4K81B 2AWOA 2FK8A 1FNNA 1PR9A 3S0JA 1Q1ZA 4J76A 3KAJA 1EWKA 3GWZA 3GT7A 4NS1A 1U1IA 4H7JA 2FFQA 3CN7A 1OGYA 1WS6A 3JVVA 2WU3A 2HIHA 4KXQA 3ZGLA 2QMEA 3C5EA 3FGOA 2VDMB 2ZS7A 1W34A 1XYYA 2G36A 1X7HA 4B1FA 4LZLA 1RPTA 4QTXA 4JLMA 1ZOOA 4Y1RB 2NXNA 3OECA 3RKUA 4ENTA 5JSQA 1ENYA 1XCBA 2RHJA 2JG3A 2VPYA 2Q6IA 2HYIC 1NUHA 2Y0EA 3QWHA 1QQTA 1IG3A 2N1MA 3OE4A 2OSVA 4N3BA 1Z7YA 3RIEA 5K3DA 2FN8A 2W6NA 4OLBA 4QAQA 4LNUA 3SJAA 1EFTA 2NTJA 2RHBA 1A7UA 2F1HA 4RM2A 3NIWA 1ZD9A 1IN4A 3DMTA 4Y3UA 3LQFA 3H2BA 4HAVA 4EG7A 3LG2A 4CIYA 3MS7A 1P1FA 3GNSA 5ETJA 1M8GA 1L5MA 2P3SA 3JQ9C 3H8WA 4DSAA 3GY0A 4PRKA 3CX3A 3G0OA 3PL5A 4WKBA 2WIAA 4X1YA 2CJPA 2W70A 1VLLA 4TV9B 4F6LA 3FWHA 3MXTA 4FCWA 3C6BA 3RYHB 2J1LA 3FYCA 4GX2A 5KKAA 3ZWXA 3OZVA 1LF5A 4BO6A 2XE6A 1KBOA 2FUKA 1T6ZA 2VDQB 3AR9A 4DW8A 5H82A 3I6MA 5L6LB 1SD1A 3UJ8A 3A1WA 2ZRIA 1GG5A 3B3FA 4B3JA 2XZLA 3DFIA 4NRDA 1DUVG 3PXUA 3T1NA 3GJTA 3V8MA 3H0EA 4ZZ0A 1UEJA 3WOHA 2B6NA 4O4IB 4Y2SA 4LHYA 2Y05A 1PJAA 1XA0A 1JSXA 1AGYA 1GNTA 3I34X 1CLEA 1EHYA 1PS8A 4EG3A 5LMZA 2IXGA 2Z5GA 1JEEA 2HA0A 3S44A 1GPMA 1JG3A 1SQFA 5F98A 3ZDCA 1SHJA 2VWQA 2EKLA 4MVJF 4HWPA 4A6EA 1E0KA 2JFXA 2B2CA 4DUZB 3NTXA 4QBTA 4WASA 1QFJA 2WD8A 1ADBA 4TWZA 2CXOA 1H1TA 2AHRA 1QZXA 4NXNB 3RVOA 2DLCX 1TO1E 1W1IA 3PUXA 5DSZA 4AXBA 2BBWA 4FOSA 1TFRA 3K8ZA 2FWMX 3KVOA 2VI5A 2WMOB 3JQGB 3QPBA 2OKCA 2DTDA 4KNYA 2B8WA 4B3MB 2PR7A 2Q6TA 3NKLA 3PC8A 3AM1A 2VAPA 4X20B 2YIJA 3QOFA 2I4NA 3NO4A 5KSYA 1XFAA 1VMAA 2MSCB 1QH8B 3AU8A 3EGOA 4MTLA 3A04A 2GF9A 1BE8A 2V7UA 4LTMA 4N5LA 3EIXA 4CMHA 1G20B 1NTRA 4TWBA 1T6NA 2OYSA 3COYA 3D6JA 3NOVA 3S1AA 3OIVA 3H65A 4CMBA 2W4QA 5GGXA 1Y9AA 3PP8A 3C3YA 3PVCA 1O0SA 3M4JA 3N8HA 4NCXA 4EFMA 4G97A 2I6XA 3NALA 3RD5A 5JAIA 4M0MA 1MT0A 1XTJA 5EN4A 4L95C 2FQWA 2NWQA 4CCYA 3N0TA 4GI2A 4XGRA 5TS3A 2O2DA 3I39X 3A70A 3EGWA 4JIMA 1U65A 3MGCA 5ALZA 5BW8A 1ZI8A 1OLXA 3WHLA 2F8SA 3MWJA 2I1QA 4H77A 3KX2A 4QSMA 4EJ0A 1CCWA 2GJ8A 3G79A 1H5QA 3QF7A 4WAUA 4IRUB 1ST2A 3Q88A 4JUIA 1OXBB 3WYEA 1DO2A 1UJ4A 4J1TC 1FEZA 5KDOA 3L05A 2Z8YM 1BJTA 2GI4A 3C1UA 3H3FA 3NIDB 2H1OA 1JFFB 1PT9A 3A8TA 2PUFA 3S7TA 1A96A 1T2NA 4BQOA 4M86A 1NURA 4QATA 1GGHA 1JHQA 4YP9A 4F2GA 3FFAA 3B9RA 3LKDA 1IEWA 3OUUA 2I65A 3OQIA 1CUDA 2P0YA 1LC0A 3IUYA 5DM4A 1DS6A 1ZJWA 5IABA 1YCHA 4REOA 1QJ4A 2HAEA 3JZIA 1QH0A 5I9NA 4UBOA 3IIMA 3PSAA 4KQCA 4M1TA 1W48A 4ZOLA 3QEOA 1DO8A 5D85A 5EA2A 3ZV5A 4V1CI 5JWHA 2RAPA 2HCFA 5DX8A 4EQ6B 1B8PA 2BGMA 1IDN1 3L0SA 4IXWA 4LWZA 3IEXA 2WP8J 4DNXA 5CEJA 3DOEA 4V2UA 1C41A 3WIOA 1BVHA 2W42A 2WWTA 3RIMA 4S04A 2JVIA 1U98A 4RKQA 2CLHB 4H3SA 5G4LA 2WD9A 1EFLA 4D9HA 1FYWA 1F60A 2W6ZA 3GGSA 1YS6A 3OMLA 4G4SO 4YCJA 821PA 4YRLA 4D6PA 5DWVA 3NOQA 1UBMS 4HUQA 3KU1A 1K8YB 1GRCA 2O2HA 2DHCA 1RI5A 4MPRA 5EE0A 3K9GA 4MUAA 3WLPA 4LQCA 3WWYA 5C1OA 4MLZA 4KRYA 2OFOA 3GZJA 2Y1LA 3H8SA 4HATA 1MG5A 2R66A 4FNGA 4MZXA 1IL0A 3G6KA 3AG5A 3RWOA 2OCLA 3JALB 4YRSA 1FDSA 3OT4A 3ZHRA 1BEZA 4JUFA 4DKXA 1NVAA 4UNRA 2HMWA 2DUWA 1U0GA 1NPTO 2EBFX 2P2SA 1K5DA 2RH8A 4TZKA 5DM2A 4CKWA 3R2JA 1OH7A 4LF8B 4RTSA 4X0EA 1ZD8A 3DKVA 3Q3IA 4IH9A 4DMLA 4FC7A 4EF4A 4IDEA 1YQDA 4RS3A 4P4LA 4L6AA 3HY6A 1JIIA 2ZWPA 3PU6A 2I2DA 1JLHA 1XU4A 4JCOA 2HDOA 2G0AA 4RD0A 1EM8A 3FRJA 4JEIA 5DNWA 1CEYA 3N5KA 4QX6A 2YMMA 3SBDA 3SZOA 4D26A 4DB4A 1Z6XA 1AN0A 3EFOB 4KQGA 1LI7A 2A1TR 1J22A 4I5EA 2QX9A 1XXHB 4H0FA 4FI3C 3IESA 3ZUGA 3TBFA 1XZLA 3CR8A 3KPUA 1QIHA 1TKCA 3HO8A 4DLPA 3PZBA 3CH7A 4K9NA 1G18A 4KGDA 3A4IA 4OQZA 4BIMA 1R3DA 1SOMA 3KE8A 3RVKA 4EITA 2G1PA 3WGUA 3MYRA 1M2GA 3HZZA 1XJ0A 1NW9B 1N92A 2FGKA 3KSMA 1J70A 5EE5B 2VHZA 4CODB 1O0CA 1SIBE 5DEOA 4S3MA 1SC4A 1Y1RA 2W2NA 2X5KO 1YE8A 4P4SA 4PICA 1P4HA 2P40A 3S29A 4C3ZA 1L7NA 4FYMA 3RBXA 1M74A 3AEZA 4AQDA 2NIPA 3U48A 2H1SA 3KXKA 3RSHA 4D45A 3CF4A 1KP9A 2HPZA 3WGQA 3U7IA 4P98A 1N77A 5AW9A 1TYEB 2O8VA 1MV8A 1N2CB 4QLAA 3TM5A 5CTJA 4Z99A 4CV0A 2ZB7A 1AZLA 2B30A 4OXRA 1NATA 1YR9A 4OHFA 1Y8CA 3TZKA 3K0AB 1PT8A 1XMIA 4A23A 1JEYA 3SOZA 3FBWA 4RTNA 3G68A 3TEJA 1P60A 3M5CA 4B0OA 4PGMA 4U2EA 1WZEA 521PA 1VPDA 2HM7A 2NU6A 4XIYA 4RYDA 1PJ8A 3KM0A 1NNEA 3B6JA 1S4MA 2ZKIA 5KTKA 5AVVA 2EKDA 5F35A 4F46A 1XHFA 1MV5A 2ZSDA 1PG5A 2GRAA 3GCZA 4DV6B 3B78A 3LBFA 1GTJ1 4UVIA 1PR6A 3U3JA 5AVTA 4UBIA 4RPGA 5C1DA 2VRCA 2PS9A 1XZNA 2R6GA 1EHCA 2I2FA 4FKBA 3KWFA 3TE6A 4FM9A 4DR3B 4KAAA 3PRYA 5KUTA 2ZWIA 4D0LB 3A2LA 3AP3A 5IVKA 3F74A 1WF6A 2OORC 2EJCA 4M9XA 3BWBA 5KJ1A 1JA9A 3BULA 3FUCA 3G9ZA 4FJ2A 1Z4LA 1OY1A 1A8HA 1U1GA 4LYDA 1YR3A 4MR8B 2NGRA 1MDBA 1ZP6A 2H07A 2MDTA 3EXHC 3OZWA 2CUKA 5FIUA 4O2AF 2GYUA 1QYDA 2WKSA 5JDCA 3R9XB 1Y1TA 3FVVA 2UXCB 3IB3A 1MIOA 2IDZA 1HEUA 3SQLA 4J0DA 2FPIA 4RQTA 3ROEA 2PL5A 5DHQA 4IIVA 3OVMA 4YRIA 3VPAA 1N3YA 3NYIA 1O5OA 2NTYC 4H3VA 3A9UA 4R69A 3W2HA 1DKUA 2A1UA 4ND3A 1XMXA 1K92A 5HF6A 4HQRA 4XCXA 4YQFA 4WY5A 5E4JA 2G08A 4B45A 2IKSA 3AHIA 4X94A 3UHJA 1W0JD 3ESCA 4PSCA 1E58A 2XAUA 3G49A 1KI6A 1HUQA 3WB1A 2HMTA 4ZVTA 4ASUA 5KU1A 2OGSA 3N70A 3LUPA 4QUIA 2X5OA 3V2IA 3Q72A 4Q1BA 2JVKA 4HR7A 3LCUA 1JHYA 2WJHA 1G8KA 1U02A 1YTLA 2E5WA 1H2YA 1RRMA 2QPTA 2WDPA 3B5EA 3HVIA 3IVCA 3QWIA 3PG5A 4WESA 4XI9A 1U2GC 3HXOA 4LOHA 5LMNB 1QRAA 1SZCA 2CHUA 1BXKA 1T0IA 3DB1A 4N8EA 2Y0CA 5CPBA 4B32A 1W6UA 1UBKS 4DG9A 2OQIA 3IT3A 4Y6OA 3LW8A 1AE1A 1QV6A 3EXG1 1TK9A 1B3BA 4YAFA 3UMVA 2QMYA 1SQGA 5DCWA 5K4GA 3H1FA 4XDHA 4BZWA 2YOHA 3R0XA 4YGYA 3WIDA 1G21E 1QFYA 1VMEA 3AJ9A 4EDFA 2J9YB 2QW0X 4Q9JA 5IP5A 2H4WA 3GLIE 2J07A 3AHDA 3NZEA 3DL4A 5SYAA 3GAZA 3T5PA 5E3JA 3CVYA 2AOUB 1EYZA 1Z35A 1ZD1A 2C61A 2EGUA 4NI5A 4RKEA 3A58B 1EFAA 3IV7A 1QFMA 1ZK3A 5D5QA 5BV8A 2YC2C 3U5ZB 5EHZA 2AW3A 5GIOE 4JSRA 2X5NA 1GPKA 3N1UA 4G9BA 1A95A 1IB0A 1ZKDA 2QTAA 3V8QA 3LHFA 5DBIA 4DV2B 3T9EA 1EU1A 5JZ9A 3GFGA 1C3EA 3NAMA 4ZQHA 5ERYA 3KDSE 5JS8A 3I9V6 4JQOA 5L3QA 3MN1A 1Y8RA 1W0CA 4UNNA 4AJ9A 5JVDA 1XTKA 3CTMA 2WBLC 3HC7A 1F8UA 3FNRA 4R1QA 3PIDA 1K1EA 3AM3A 1QRDA 3GJ8A 1KBZA 2GD1O 2XA1A 3TUZC 4UTXA 1XSEA 1DMSA 3JQRA 1LNZA 1M8FA 2PYZA 2XUZA 4ILEA 1R4AA 4PGGA 3Q40A 4BFZA 2J0UB 3GFRA 4MQUA 1N0UA 1Q74A 2FWAA 2WT9A 1M8KA 1N75A 3OZDA 4IHJF 4QDZA 1DDOA 2GPSA 5CAEB 5L3RA 2ZUFA 2HHHB 3I9JA 2J45A 3JWGA 4HCJA 4N5DA 1ZCJA 1XEWX 4LZWA 5A7HA 4KHZA 3NWPA 2PWYA 5DGIA 1XCLA 3EPKA 4C0AC 3THSA 3NTQA 1T8PA 3V9AA 2PM8A 3SS8A 2WQ7A 4N7MA 4IJMA 2HHLA 1VSBA 2DRIA 3KTAB 1R15A 4N82A 4LVUA 3VU3A 3DR3A 1S8AA 3ZU2A 3P45A 4BGVA 1GUDA 2VHYA 1F2TB 3COVA 4ER0A 4Z49A 3FUXA 1KNXA 4WOBA 5ILOA 1AN9A 1SC3A 1PWHA 1RVV1 2GTIA 5ALYA 2IE8A 2GT1A 1I2MA 1T9HA 1DQPA 2IP2A 2QP3A 3B85A 3CYFA 3MTIA 3JRXA 1TUBA 4GDMA 3TLCA 5JD6A 1D4FA 1EFUA 2BHNA 1HNNA 1G5QA 3E61A 3GPDG 1NW6A 4ZHQA 3F5MA 4KB5A 5CCEA 1LVUA 5CJPA 3X0DA 4ND4A 1G63A 1V16A 3MOIA 3HADA 1G3UA 2VJPA 4RY9A 1L3CA 1RYYA 2XQJA 4ITUA 2Y1KA 3HABA 3RC3A 2WP0A 4I2NA 4EH1A 4F97A 1G64A 1S2MA 3F6EX 3QMMA 2C84A 1OAOC 4FSDA 2HA4A 1SZDA 5A5FA 2ZJ6A 1JE1A 3E15A 2WFLB 4YP6A 4JZYA 1UPXA 2D13A 3BTOA 4HI0E 1NR5A 3LX4A 4PLVA 4YDRA 5IXJA 5B1IA 1NF8A 2AC4A 4H6WA 1X9GA 4Z2YA 4ZEOA 5TF4A 3O3MB 2CYCA 3AL2A 3FPJA 3MD0A 3AX6A 2DLNA 3L40A 1R6AA 4KQ1A 4NJEA 3CLUC 1BEEA 1ZM9A 2B94A 3K2QA 4FDMA 3GUVA 4WXMA 5THXA 2X40A 4NSNA 4IYJA 3E35A 3K09C 4XIIA 1X7XB 3AY0A 2WC1A 1A0OA 2XLCA 2FVYA 3JXEA 2D0OB 4AF8A 1BN7A 4ZZIA 3VUFA 4ZKEA 4CM1A 1R5JA 2C4HA 4Q5IA 3UJ7A 2G9UA 4RVFA 5EHNA 3SD7A 3GW8A 3H2HA 1H5UA 4CKZA 4BXOA 2GXUA 2OY0A 1Q0PA 2NPFA 3D7RA 3RAPR 3TDNA 2IYYA 2A57A 2FEMA 3MC1A 5KCMA 1IM5A 1E0JA 1T91A 1WL8A 4HGRA 4JBXA 1IJFA 5AW0A 2CHEA 3GVIA 3RIGA 2JCGA 4C4TA 3HACA 1J9GA 5C8YB 3F67A 4O4JF 4Z4FA 2GO1A 3TEMA 3EEYA 1H3EA 4P81A 3GFTA 4PYOA 3WKBA 1GA4A 5CDSA 1O6ZA 2O2EA 1EIZA 4WMLA 2PMWB 4MEJA 1QRRA 2ZE8A 3CWQA 4HNVA 5HKKD 4HNUA 2INGX 2P9EA 5KQGA 1PFUA 3QTLA 1FPQA 2P9GA 2WOJA 3Q0TA 1O9GA 4OL9A 5FFFA 5FWYB 4C4PA 2A5DA 4RAOA 1EWVA 1G6HA 1KZ4A 2MSNA 3GJRA 4TLAA 4XQGA 3VH3A 3DV9A 1XROA 1OWLA 4H7KA 3MTGA 4NNJA 1GWNA 1JG1A 4RVCA 4EFKA 5FDFA 3L06A 4FGKA 1ZR4A 4HNHA 4EVIA 4HB2A 4IDCA 3V33A 3CKYA 5FUQA 3NWOA 3N75A 4JIGA 3SIPA 1X7WB 3TPZA 1WB5A 1YK1A 3NFYA 4JOQA 1GZ7A 4UASA 2PD6A 3T5TA 4D9EA 4C0HA 2Z6QA 1C30A 1WXWA 2A0XA 2V58A 2XVXA 4QUEA 4Y1FA 5FPQA 4IGEA 4ZDWA 4MV7A 3X1ZA 3FSGA 1GLVA 1SVWA 4H08A 1YB4A 1DKRA 1HT2E 3IKJA 3AIOA 2IHTA 5LZ5A 4N5IX 4F1JA 1QCZA 3EXFB 4PU0A 5I5EA 1Z6AA 2E7ZA 1KE2A 1ZDMA 4XSGA 5C1PA 4KFRA 5FV7A 3MXOA 1WG8A 5B1EA 4HTFB 2FEOA 2Q1YA 4ETNA 5K03A 1VSQA 4R31A 2G6TA 2IYUA 4KXXA 4M36A 3ZDZB 4UCQA 1I6MA 4BNNA 2YXLA 3BWYA 3N8NA 4FFPA 1N6IA 1SBZA 3HV2A 4KZPA 1NOKA 1WJGA 5JMOA 2GOYA 1II8B 3KO8A 3R7LA 1BKDR 1J49A 2I2BA 1EDOA 1S1CA 3F46A 1I24A 1XZIA 4NBLA 1MB3A 3EASA 3ZHOA 1IMOA 1JRLA 2GJSA 5J4KA 4RVHA 2CNBA 2PV7A 4ZVLA 4REQB 5BV1A 4CLOA 2NZUG 4MIYA 1OFUA 1UBTS 4WW0A 3CSDA 2R8BA 4GI5A 3WYNA 1TTTA 3RASA 1J0EA 1I3NA 1JGTA 2OO5C 3D8NA 4IDHA 4BTEA 1EUYA 2IBSA 2PZKA 3TOVA 5CG2A 5A02A 1N7GA 1YQQA 3KTDA 5JBNA 5LOVB 1XPRA 4OAPA 1Y82A 5L3SA 2P9YA 4OI0A 4GOKA 2E0IA 1XWIA 5AW4A 4LBYA 3UBMA 4BVBA 3PXDA 2AFIB 2GFQA 3TW4A 4DTIA 4YCMA 1DT5A 1V1MB 2RD2A 1NP3A 2PZEA 1KSJA 1XZGA 3L8CA 5EJ2A 5EY5B 3WYGA 4H0NA 3O2JA 4NFSA 5FLXA 1BDIA 1C7JA 4BP1A 3U0VA 4OJTA 5KNDD 3TGWA 1W47A 3TOSA 2Z09A 5EGSA 4Z5XA 2VDRB 4B4VA 1QO9A 2IHZA 2QTWB 3JR3A 4DWWA 2ZPUA 1MABA 4Q6WA 5JCJA 1I5OA 4G5XA 3W1VA 1K6EA 1NWHA 2LVBA 3UGQA 1DBWA 3ESZA 4ML3A 4NEHB 1MAWA 1P4GA 2ID8A 2GPTA 3INRA 3NDRA 1WMDA 3TSAA 2P5UA 1KDTA 2BAGA 3OJFA 4FYPA 4Y9RA 1JFTA 4LN1A 4KITB 2H9IA 4JQSA 4MW4A 3HDHA 1UZAA 4TMYA 4JYAB 4JQCA 2EV9A 3LOUA 4LV8B 1EZ1A 1DWUA 5SYMA 1L1RA 4YBRA 5HILA 1E1YA 5DHSA 1R6UA 3A4VA 5I8PA 1KPGA 3UWKA 2E4AA 2BHSA 1Y8QB 3OTQA 3CWCA 3IQWA 1J56A 4OQ4A 2VXBA 1K6IA 4YJ3F 4I9UA 3U3XA 4HDSB 3RB8A 1PNQA 3TNDA 3PWKA 3I2HA 1U3DA 4GF5A 3HJGA 4FOLA 4WBSA 1CJBA 1J5XA 2WJPA 3PE3A 4IHAA 3R4VA 5K0BA 1OI7A 1RI4A 4V3CA 1BE1A 2EF1A 1I7DA 2AOVA 1NA5A 4F8YA 1NXPA 1XQ6A 1RJ9A 1Z29A 1ZICA 3L7KA 3K9FC 1UBEA 2CDAA 3IQEA 1MKYA 1DEXA 1AS2A 2RGXA 4O02B 5AVOA 5ALIA 3A3OA 2G9NA 2E55A 2PGDA 5JJ5A 1IPEA 1O3YA 2CV1A 5FOXA 1C29B 1X7GA 3LHDA 4PW0A 2ZIXB 4BNJA 4YMGA 2I6QA 4L4SA 3BH6A 3TLXA 1OKKD 4DRXA 3M9WA 4WKOA 2XNDD 1XL1A 1EKXA 4DLKA 2YJ4A 5DJ5A 4B82A 1GRNA 3MPUA 3PRKE 1Z5VA 1INLA 3SP1A 2BRUA 3MLBA 3WDLA 1U3VA 4TMWA 5K8IA 4PZLA 5D01A 2GK6A 4R9NA 2GNOA 3FMFA 5D3MA 5FNVF 3R9KA 2CEAA 3TLEA 1N1GA 4RH3A 4BJHB 1E5TA 4BPBA 2QUJA 1CRQA 3RSZA 4CFSA 1YSCA 1XPOA 4LG1A 5CYFA 3FFTA 2I1VB 4X1YB 4HGPA 3ZV7A 3W5DA 4JXKA 2FLVA 3T9DA 5SY6A 5IRCD 2CSXA 1QF7A 2QSJA 1CYEA 1X77A 4KNWA 1KH1A 4TV8A 1QMGA 1BD4A 4RK6A 1TT5A 5DYYA 2BR3A 2XOKD 4AJEA 4YJHA 1IJEA 2DECA 2OV2A 3BMOA 3OJOA 4GVPA 4HQ6A 4KAFA 4NENA 4PXAA 4HS9A 4YONB 4CG3A 4D4JA 2PH3A 3H5IA 4FFSA 2DWOA 5I7EA 1ZVVA 2B8JA 5ALMA 5KHLB 1L7BA 4TYQA 2ZVDA 2HMVA 1NZDA 3ZXXA 4F9TA 5K4AA 4V3BA 3MWKA 5TV2A 1MX1A 1VBMA 2CHVA 2IS2A 3GVXA 5ESRA 2ZYSA 3ET4A 5LU9A 3P2KA 4AU1A 3IL2A 2WJ4A 4D3SA 3AIIA 1THZA 3PJFA 3EVAA 4EFLA 2VHJA 3ISTA 1HV8A 2PSJA 3PGJA 1QO0D 1DFHA 1QKKA 1SXJE 1ZHFA 2XWQA 2GCPA 5KKCA 4RORA 4Y0AA 1G20E 2Q1XA 4XD7D 4E14A 3QRWA 2CJFA 2WJZB 2Y1FA 4UEJA 4YDHB 3O82A 4OHZA 4C21A 2JLUA 3T12A 4BNXA 4RKYA 3BFKA 2Z3WA 3ZV3A 1CUWA 3BWMA 2FW6A 4BU1A 5JOQA 3I09A 3R3JA 1NM5A 2VSYA 2BF4A 2YX1A 5F76A 1CG6A 2IE0A 5K0JA 4R2LA 2ZRGA 3U4QB 3RSSA 2JHGA 3SBEA 5JRDS 1PJTA 1EQ2A 1TYBE 1U81A 2RAUA 1SURA 3G5MA 1QFSA 3MB5A 3CR3C 4RDCA 5LIRA 3D6UA 3UA4A 1QGZA 2EVWX 3IMCA 4KQ2A 4L7VA 5CP8A 5HG0A 2JZOA 2D59A 1LZLA 3S1AB 3VHXB 3RO7A 3ZGNA 4C0QC 3LBNA 4AJOA 4Q39A 4R54A 2BP7A 2Q50A 3LQKA 5TR9A 3MMNA 4EW6A 4ENVA 1QAMA 2CEKA 4FMBB 5JR3A 3BDVA 2GQ0A 3K1AA 3ZCVA 4CCYB 1ECPA 3RU9A 4PS1A 1O89A 2ORIA 5ECGC 2Z6UA 1NU6A 3HGMA 1BWSA 5JNLA 1SNYA 5FB3A 3IOBA 2F2TA 3R7SA 2FHSA 3LHKA 3DAYA 4RTQA 3ETHA 5T4EA 1X2BA 3GRKA 1P9NA 3O8BA 5CH5A 3T8YA 1K86A 3TIVA 3VNSA 4X1IA 2CHQA 3X1WA 1QTRA 2OCXA 1P9LA 2O2GA 3Q5GA 3E3OA 5IJAA 3DG9A 1Z74A 2UUOA 1P5FA 3BJRA 4F72A 5K20A 4ZU6X 5FNZA 4P08A 1HE5A 2YJ6A 3N0VA 3STVA 3AUYA 5CFOA 1F06A 1O2DA 1ODLA 3WZ2A 3OQIB 4MW0A 1X13A 4C3UA 4UVGA 1U5BB 3PRHA 5F1YA 2QA5A 4CRWB 4RVDA 2G1UA 4DUGD 1QQ5A 4HZIA 3CU5A 2C8KA 1Y9DA 1OFIA 4JI1B 1HI9A 1OTYA 3O84A 4ZOLB 4TRNA 1MA0A 1XQ9A 3FAKA 4M37A 5D1NA 3OPYA 3ITNA 1Y1KE 4KE6A 2POCA 3GGGA 1LDGA 2PBRA 2J4CA 2OTCA 3AL3A 1MEJA 3FCSB 4NJOA 2IRWA 4XJXA 4CU5A 1WD5A 2LR0A 4YP7A 4OIMA 5FTNA 4G25A 2KE5A 3FCXA 4XGQA 3P4XA 2MYUA 4JS0A 4L3WA 3JZFA 3LAWA 3QYAA 3U4IA 1HYHA 2ZROA 4MVXA 4L5JA 2COUA 3WLLA 2G5GX 2XF8A 1G7SA 1EK5A 4JX8A 4Z3KA 3H42B 1C1YA 1CE8A 4BOYA 3DFKA 5CVUA 2BZ0A 2YVLA 4HUQB 4B3FX 3K4PA 3LUKA 3B3GA 2AI1A 1QIMA 4DJ5X 2SKDA 4WPGA 2ZUVA 3TCKA 4CDMA 4M1WA 2PRSA 1J6UA 1SJ9A 2IYTA 5TDHA 2WLSA 2OWDA 3C8MA 1O1YA 3SDZA 1V96A 3WGVA 1JEAA 3OTOB 4UULA 5DF1A 2EP8A 3NDIA 3WK5A 4JC4A 1WDLA 5JMPA 1LUAA 1P4JA 1G2IA 1XXHE 4CKWB 1TFUA 3GLKA 1FNMA 2QQGA 1ZZEA 5HIKA 1LLDA 2P2DA 4PFJA 1U0JA 2V0CA 5JU6A 5SY4A 1XRRA 5FAKA 2P1DA 2WILA 3ZZ0A 2P30A 4FDVA 2R84A 4R3NA 3OH8A 2ZM5A 1CEEA 3K0CA 1N5KA 2WF8A 4LKRA 4PS0A 2WM2A 4Z0TA 2J0VA 2AN4A 5J2UF 1FRQA 1EM8B 2MIIA 1FW6A 1J00A 5JFTA 4JXXA 4O29A 3TCNA 3MAAC 1BW9A 1ZU5A 1Q0UA 3RAJA 1ATZA 3D7SA 3G82C 4JUAA 2QN9A 4PO9A 1FFWA 4RIFA 3VVMA 4BAZA 5IS2A 1GNLA 2DH5A 2YV2A 4LK3A 4NR0A 1ZJ4A 4X6LA 4BP9A 3QX3A 1E60A 3OEEA 3GJ6A 2WINI 1PT6A 2C5GA 2JW5A 4JLWA 4C4RA 3FNHA 3OHMA 4KGVA 1DBVO 5JZOA 2ZJ3A 1OLOA 1B4DA 3I37X 3LLMA 4EYOA 3ZJ5A 5F2NA 4K6KA 2Z3VA 2TECE 1HEIA 3Q4GA 4ZCMA 1N2CE 4WUTA 4BLOA 2O2SA 3CB2A 1MMFB 2J31A 2RGDA 3B12A 3OF5A 3V2UA 4DLRA 2J6CA 4PQYA 4HV4A 4N65A 2XUKA 4E5DA 1LI5A 2MJLA 2VK4A 3MNFA 4RV9A 1TF5A 3MTQA 2VDLB 3A4YA 1Z4QA 2OHOA 3V4OA 1R7RA 4P4GA 3PD7A 4C0BA 4MB6A 5HR5A 1EEXB 5HZKA 4UAUA 1LBHA 2GM3A 2PSDA 2ZKLA 5AJXA 4IOJA 3KBOA 3OOWA 3V8BA 1W35A 4QREA 4BO2A 1B0UA 1X80A 4F04A 1E6UA 3KQYA 4QYSA 5DCLA 3V7FA 4XB1A 1TJ5A 5FYDA 2VNHA 1Z4PX 3PQ3A 4M89A 3FUVA 3PDCA 2YNMD 3LWNA 4NV1A 3PR2B 5K3SA 1T1SA 1JEYB 4BIIA 5IG2A 1B41A 4WIAA 5ALHA 2XOXA 3LWDA 4WADA 4QULA 5C1BA 1TZMA 1IAQA 1CY7A 2ZRJA 3P5SA 1AGNA 2NU6B 2QYHA 3C5WP 4YO7A 3I04A 4OPMA 1JLMA 1H8HA 5ED4A 5BSRA 4MVYA 3DHVA 5GWXA 2RKBA 4IXTA 1NNSA 1SKBA 5C5IA 4KHPB 3SKYA 1MXHA 2I5PO 4MWBA 4XLTA 4EGJA 2UYYA 4DR5B 1JAZA 3W1WA 1X1QA 2ZRQA 3VKUA 1Z5GA 4JLAA 4DCJA 4PZAA 3S8EA 3DLBA 2ECPA 2AD5A 3O4VA 4QEDA 1C3VA 3SHQA 1XAGA 1WUYA 4OJQA 5T4HA 1E96A 1RWWA 4JT8A 4FWIB 4DJTA 1OBVA 3FW1A 5KX5B 1K97A 1T1JA 2WG2A 4JNCA 2QTVA 2JLQA 5K99A 3ODGA 3AW8A 1C7IA 2ISCA 3AR2A 3GD5A 3MRTA 3VPGA 2ZBPA 4IH4A 3L1HA 1ARZA 2QXUA 2OCPA 5DBOA 4B3SB 4GRAA 2FMKA 1X9HA 2FPIB 5MHTA 3FCEA 2AMLA 3VR6D 5K3AA 4QOIA 2QP4A 2HJRA 3CRW1 2ORED 3N0RA 4XFDA 3E2PA 1DKMA 1JWAB 3CUTA 1MO5A 1IOWA 1KI6B 3BA6A 3LDUA 1YJ5A 2LGJA 3COPA 1F1BA 6AT1A 3JAKA 3MZ0A 4BRZA 5BNZA 3FGZA 2APJA 4W99A 3ICOA 1OAAA 4GMXA 5AI4A 3VTZA 1RWQA 2JEZA 2CUNA 2P2LA 2KW5A 4FB5A 2CSUA 1JQKA 3EVZA 4QEKA 1Z9BA 4MPJA 3BF8A 4WESB 1KZGB 2PYDA 1Z5NA 3HCRA 5EPEA 1FDOA 4P35A 4HK4A 4RIIA 2PMEA 4Q3LA 3FVWA 5C2JB 6NULA 3JQ7A 2P3OA 1DLJA 1O5IA 3KWLA 4KXYA 3P2JA 1VKNA 1T1EA 3CO5A 3RJ9A 1AKMA 2BFDA 3LT4A 5D5PA 5HIIA 1RYFA 4LYAA 1DJMA 5IANA 2PWBA 1NBEA 1TM4E 1WHTB 2F59A 4HDOB 4NMMA 3KZNA 3EISA 1CT9A 3LI2A 4P5PA 5DOVA 3HUEA 3M3PA 4H4CA 3UB2A 5ICCA 4DV0B 4COKA 3D2CA 1P74A 2EZ4A 5NULA 4IKOA 4RMHA 3IULA 5HBRA 4TRJA 2Q3FA 4QU5A 1Z16A 4LF4B 4Z7JA 2W37A 1LFAA 1GAEO 1QQ6A 2AYZA 4JR1A 4XVHA 1GQ2A 1XMOB 3N2EA 4JKOA 1RWBA 1LSJA 3E2MA 4LXGA 1VXRA 3EGDB 3LF2A 4Y1GA 2PZLA 1OAKA 1OT5A 1BGWA 3CV3A 4BVJA 4NABA 1LTQA 5J40A 2RAVA 3WWCA 2Q07A 4TMFA 4C0XA 3RRYA 2Q4DA 5JCPA 1FRNA 1S8FA 4R01A 4LJYA 1AZWA 4J1SA 1NLYA 4H16A 2C1ZA 1SVSA 3RGWS 2KJQA 3R0JA 1MTOA 1PFGA 2EHDA 5DXAA 5JH7B 1RBZA 1XGKA 3U3KA 3H3JA 4WLUA 4BO7A 5KBYA 1B74A 1JR3E 3IAFA 2WYIA 4EEKA 2B61A 1ZZGA 3C7KA 3P0JA 4YMHA 5F64A 2WF6A 2ZBFA 1CS4C 3EF3A 4PGAA 4BATA 4C3VA 4ARCA 2ZWOA 3IEIA 3R75A 1BYUA 3GPIA 4MO9A 3EQ6A 1IZZA 2AB0A 3U1TA 4D3DA 3UWMA 4QTTB 3EZYA 4BHTA 1O95D 2WD7A 2R4TA 4DXHA 4E0BA 3TK1A 5CHYA 2EIXA 1G7CA 4F6RA 2ZRDA 1ZRNA 4YHBA 1QUEA 2YIDA 1OYWA 3G2PA 3M1LA 1QE0A 4REMA 3AOEA 1SUFA 5AK6A 3E8SA 3H8JA 1JQJC 1ATIA 1MB4A 2KI5A 3I83A 3N2IA 2ZE6A 4J7XA 4CCSA 5JNTA 3I5YA 2D5IA 1KSHA 3F9IA 1QX3A 4Q3AA 4W5HA 4X45A 2CXHA 2ZAYA 3W2FA 3F5SA 2E18A 4HVAA 3S81A 1QIKA 1EGVB 4XVCA 3PUZA 4ZT3A 4B3XA 1V25A 4QZVA 4F85A 2WHPA 3CEMA 4R3WA 3VDRA 2DQZA 2VSXA 3P71T 1YU9A 4P83A 4PN3A 3GRPA 3P7MA 2O2IA 4G89A 5JUWA 2F9FA 5KYXA 3PR1A 1WMBA 3PC7A 1IU9A 1FFHA 2HU2A 4DV4B 1XZHA 5IF9A 3R3VA 2M32A 1EK1A 2OOKA 2DPLA 4G5QA 4XTCS 3SLRA 4J2TA 1JHXA 1ONBA 3CUYA 3PHGA 3Q15C 1FVHA 2HADA 3TTSA 2AW5A 5IDWA 2HREA 5DM1A 3EPRA 1Q91A 4Y2GA 5BYJA 1Q0LA 3FYSA 5IULC 3ZLBA 5LQMA 4PSDA 4TL6A 1FFXA 2AR0A 1X1DA 4KV7A 1DOHA 5KOIA 3RS7A 1WULS 4HWRA 5PNTA 2ZSHA 5KTYA 4N48A 2B1QA 4DTCA 1WE2A 2AI3A 1NQVA 3L0IB 3OUTA 4L0QA 2DFLA 4TROA 2X9GA 4M1MA 2I3AA 1VQ1A 2IYLD 2WPNA 3DDSA 3LBAA 3OM8A 4NJEB 4R8MA 3CE6A 3VR3A 2F3QA 3FTEA 2C8JA 4DMUB 1SPXA 1JYEA 2DPGA 3CUSA 5A6VA 3JR7A 4IVPA 4XB2A 5DT2A 4ZRDA 1JZSA 2OFPA 4OTZA 4P33A 4W1SA 3RC1A 3RRMA 4CFZA 3B9QA 1G5TA 4BXOB 1X0XA 2NQ2C 3PE4A 3L6CA 3LWBA 4OFXA 4JR0A 2D54A 5HTKA 2RGNC 5I48A 3I6BA 1I7NA 1OV4A 1O03A 3IP3A 5J4HA 5KNCA 2XUPA 4H1UA 1MW8X 2PWAA 2QZ9A 2R2GA 2FPLA 4Y6LA 1G5IA 3UOGA 2QSYA 2G63A 1Z0IA 3L4SO 2BMWA 3BGWA 3O94A 2AEMA 2QJOA 4RF3A 4DABA 1HE4A 1MD9A 4KIUA 3DE4X 4UNQA 4A8JA 1ZU4A 3IODA 2DKOA 5FWXB 4Q4HB 2JJ8A 3UQZA 3IVGA 1QRTA 1C8LA 2HBYA 1Y3BE 3IQXA 3LS2A 1SWWA 3PFWO 4LC1A 1E2FA 3I0ZA 2IYOA 1O4WA 1ADJA 3DVAB 4QGHA 4DV7B 4YBZA 4G23A 2MMCA 3BAZA 1UKYA 2YHBA 1EI9A 4N6GA 2VDKB 2PJRA 4M7WA 4QUJA 4M21A 4B84A 4JGIA 1C0KA 3AB3A 4NXMB 2I78A 3JD3A 3D0OA 1VPLA 3H4TA 1YOBA 2QMUA 3C3MA 1OA0A 1C30B 3L07A 4KACA 2QAGA 3JS5A 1R6XA 3NI2A 5BXYA 3MILA 2O2JA 3GK3A 5LBUA 4J0JA 2XCRB 1KQ3A 3LXRA 3O7MA 1JXOA 3FLAA 2VP4A 2NZYA 4YREA 2O0KA 3SMQA 4N9QA 1Q11A 5JSFA 1XBTA 2HQ1A 2YVAA 4CQMB 1Y5MA 4BECA 3HB0A 4U7PB 4MVJG 1UBRS 4QOJA 3M5PA 1YA6A 4BVEA 3V4RA 4YA6A 2A5YB 4OP3A 4D3XA 2DQ4A 4ZARA 6ABPA 1A8SA 2CJYA 3KOZA 3MT9A 1E69A 3NHPA 1Z38A 1WB6A 2WKPA 4BAGA 4BP3A 3EGEA 1I80A 3RDPA 421PA 4BX8A 1KWKA 2AFIE 4D8YA 4PWZA 1M34A 4JSYA 3ZCPA 3U4MA 3MT7A 2A1TS 3B9BA 1W25A 2CMFA 5AW1A 2XDAA 4GXRA 3WK4A 4CLOB 2ZT6A 2A14A 1EXVA 4IMJB 2GN2A 5L7TA 1QP0A 4GSYA 5IC5A 3U6BA 2XQGA 2QG6A 1DC8A 3SC2B 1E79A 3DDUA 2HOQA 3LP6A 4WUVA 1RI3A 2CCJA 1P44A 2QJTA 3QXXA 5BW5A 4OLAA 1ULTA 3K5PA 4U63A 1E1CB 1UJCA 4JITA 2W8ZA 1Q15A 4Z4HA 4LDNA 2AZDA 3QE4A 4ZCLA 5B6JA 3TGLA 1VHJA 3WP1B 3L9WA 3BX1A 1ZQ1A 1LGYA 3I53A 5E8RA 4B7XA 1C1HA 3ZLUA 2WHEA 5A4JA 3K9NA 4YJFA 4KIGA 4IZ6A 2QRGA 3I6QA 3O4IA 1R12A 3A4MA 2GAIA 3NWEA 4FE4A 3RFTA 1J7KA 1U9ZA 4PC1A 4DIMA 3QTTA 1R8XA 4M54A 1K89A 1XKQA 3PITA 1TGVA 4GYWA 1FTNA 2AYXA 3E7FA 4L6CA 2QN7A 4OQEA 4DV3B 1OE0A 3WISA 1UR5A 4MMYB 5AYVA 3COWA 4LX8A 1FTQA 4DLXA 2V8OA 5ALFA 3W6OA 4O1IA 1NE2A 1QGOA 3PK0A 2G83A 1JQEA 2ADMA 4ND6A 5CM8B 2VAWA 3GOHA 3I6IA 1ZRMA 4QA9A 4CEHA 1U8YA 2R4QA 5K0ZA 5DGDA 1XG5A 1TF7A 4XJTA 3WVNA 4P5DA 3RQSA 5G1NA 1G3QA 2HC9A 2ID9A 2PX0A 3B1KA 4INPA 3ZK9A 3ADBA 1UBGA 1Y4UA 4A2PA 4UXHA 3H4VA 5EMHA 1EWTA 1Y7IA 3V8EA 4LVCA 3V7YA 4URZR 1UK7A 1HL3A 1FLVA 3PFGA 3RABA 1C50A 1E18A 1WMEA 5CD9A 4Q66C 4QXPA 5LP6A 1YXMA 2QLNA 2DPHA 3ZH2A 1DHRA 2E4YA 3LNTA 4D8WA 3QWFA 3D7MA 3REOA 4RHFA 2IOQA 3OO1A 1QQ7A 3GGOA 4WT7A 3BIWA 5F5NA 4I9NA 1D5CA 4QWMA 1N6RA 4K9SA 3ZQUA 1UWLA 2BGUA 5JNWA 1XMVA 3DFZA 3FH0A 4GKVA 1GIAA 3OFSA 1OUMA 1BWQA 3GAMA 1AJEA 3LCMA 3KEGA 1PYOA 1N8SA 2GX6A 5JXJA 2HGZA 4RNCA 1P8AA 1N2EA 2OCIA 2NTVA 2PIDA 2GESA 4QHYA 1F8XA 4ZQGA 4EECA 1X39A 1XTSA 3OT1A 4FMCF 4HDMA 4DRXB 2VQ6A 3GB9A 3H87A 2Z43A 1VJ5A 2ODPA 2OZPA 1IWOA 3E5MA 3EHDA 2RGYA 4E5SA 1YRWA 1G5HA 4G5FA 5AVKA 3PIIA 3OKFA 3C8ZA 4UE2A 3PC3A 3E0QA 3KVVA 3M2TA 5D3MB 4D96A 2HXYA 3E9RA 4DJAA 2B83A 1JP7A 3DL0A 4P3NA 1DT3A 1Z62A 1Z5WA 3HFGA 3O3CA 4ENSA 4BMDA 4CR6A 1GZUA 4XZ3A 2WKRA 1D0IA 4K9OA 2X0RA 3USES 4UHEA 2O2XA 3OC0A 4LDZA 5IVIA 3PQEA 4FFWA 1SVNA 3DWEX 2AFRA 4ZOEA 1F6BA 5DW3A 3NTLA 1QR2A 3AVQA 3DEJA 4TV8B 4RF5A 3TSWA 4BLQA 4BN0A 5AJVB 4ECAA 1ISHA 3DYBA 4UNSA 4EY6A 1TT5B 3HUTA 1MOSA 4YJHB 2GCIA 2F48A 3BMOB 5ILGA 1V47A 3BGVA 3CKMA 4MRRA 5LBTA 4AXXA 1WP9A 4GOXA 4J8PA 5JIBA 1D1QA 5CXSA 4O2BF 4MUXA 5FOTA 2WV7A 5AICA 3SJUA 1HDCA 1ZK2A 1GUFA 1XTUA 5T67A 3VV2A 3SYTA 1A98A 4RADA 1CB7A 2FRXA 2Q2OA 3HU3A 4J43A 4YCBA 5AM3A 4GWKA 2Y4OA 4NFYA 4AX4A 4BEJA 2J3HA 1PJQA 2IXAA 4DDTA 3OQNA 1HE3A 1H0HA 3EULA 2ZI7A 4RQUA 2NPOA 1CY1A 1DJQA 2GM5A 4E31A 3DQPA 1U0OC 3RYTC 1BU8A 1IM8A 3ZW7A 2AK3A 1NQWA 1VPVA 1O08A 4UU8A 3LY5A 1MNAA 1DAKA 1DRVA 4ITVA 5D6OA 3TW8A 2WNIA 1C1DA 2P9QA 2PBFA 4TMTA 4LE0A 4Z1MD 2BH2A 3R20A 3QHQA 1LBTA 4BLUA 4QG3A 2Q2WA 1DB3A 1U8AA 2W0MA 3EC7A 4POAA 4J0KA 1U8ZA 3A6HA 3S2IA 4H3HB 1SVKA 4D3FA 4WHMA 3DVSX 1AHIA 1TVCA 4I4IA 5LXTF 4Z0HO 1D8AA 1RWVA 2HD4A 4C6TB 2Z08A 1KMCA 1CDEA 1LB1B 1MTZA 3I05A 4FHEA 2Y1XA 2WZDA 2XA2A 4IKEA 4E4YA 1Y8ZA 4JXJA 4BLTA 1HLGA 1LF0A 4YAGA 1K27A 4CCAA 2GN4A 5AKJA 3G9XA 3VZCA 4BBZA 1V4NA 4LVOA 4CF5A 4EW2A 1PNRA 3HCNA 1R6VA 3BL6A 1ZXLA 3K1AB 1E8DA 1JMKC 3KT0A 4G0OA 4GR4A 4WBNB 2A0FA 3ZZNA 1Q14A 4FOOA 4BCCA 1ID1A 3AQIA 1P2VA 5A6SA 1KXZA 3N53A 2EGGA 1ACJA 3UAVA 1T2VA 2DTXA 3ABZA 3CGWA 3T3MB 3ZKAA 3VVBA 2PSSA 4EZBA 4LE1A 2J0QA 3IJEB 1KMQA 3RKSA 2ID7A 3JQFA 4PANA 3E9NA 4X1IB 4M0FA 3R0ZA 2FOLA 2Y67A 5INTA 2Y71A 2R60A 1G5PA 2OD7A 1R6DA 5BXQC 5D86A 4ERXA 2ONYA 3BT7A 3Q5EA 4BMCA 4UOQA 2WE7A 4MKXA 1BU5A 4FEEA 1JA0A 3ZQ6A 5DNCA 4UAJA 1FIUA 4OBEA 3SVTA 1JJBA 2FUNB 1HZZC 3OWHA 5JNUA 2IU0A 4YUZA 1IN1A 5DHAA 4Y30A 4Q3DA 5L7WA 1UJBA 5KNCH 1ZM7A 3HI6A 2Y0PA 3AR6A 4ZI7A 2J0SA 1GGKA 2QTFA 3OPYB 4F93B 2XQFA 1Q0ZA 1LDNA 4P58A 2ATXA 1Z0ZA 1FQWA 1CJMA 1NW8A 1PP4A 1UZMA 2AOTA 2R00C 3OWOA 3UB3A 5EEGA 1IQRA 1O6BA 1JHZA 3OA2A 4NVRA 4I4NA 2GEFA 5HRAA 2UU9B 3W2IA 1KJQA 4N7JA 4Q9NA 3NUGA 4GP6A 1MEOA 2CL7X 1Y1SA 3AMVA 4LTDA 4F2WA 1NLUA 2GZ2A 3SFVA 1CE8B 5E4TA 1QU3A 2W6CX 3QEJA 3G2OA 4ZK6A 1YZNA 3T4EA 4QGSA 1ISSA 3I9LA 2ZZMA 2Q6VA 1ZL2A 1BSVA 3RVBA 4MWEA 2A9KA 1X0VA 1XVAA 3HDTA 2WWHA 3U17A 3UWOA 3BTSA 5L3VA 1GGMA 1PN3A 1KY3A 1HFJA 3EZXA 1Z5PA 4MCHA 2XUAA 2HA5A 2WF5A 5EIFA 3T35A 3I12A 4C14A 4CKBB 2FEPA 3ZU5A 1JL3A 3AUKA 1HFWA 4PSKA 3WRWA 4KR6A 1BS1A 4LF6B 3CR7A 1SVOA 4MKFA 5C53B 4EB0A 2HBQA 4BWGA 3JWPA 4DA6A 3R6DA 1N5OX 4WECA 3SVZA 5BN4A 1PVDA 3HVJA 1GGNA 1IE3A 2C2ZA 2D4HA 3GC6A 3KYDA 3NWJA 5B5SA 1XNQB 1GZVA 3DOJA 3FHCB 1DRKA 4H3KB 1OI3A 4KMRA 1H2XA 5DDIP 5M5BA 1WAMA 3MCUA 1Z2PX 3D31A 1IJKA 3MD9A 2QK4A 5EGNA 3BBPA 3CS3A 1YR8A 3DE7X 4MUJA 3WGHA 5SY9A 4BN4A 2FQQA 3FB1A 2ASEA 4UHHA 3TG2A 1BW9B 2DTEA 4D0NA 5FL7D 4DJEC 2F4VB 1TQ8A 4MYHA 3ILHA 4PC2A 1GXSA 5HKLA 2QB5A 1VLHA 4G1MB 5KB3A 2CKDA 2A0YA 4QT0A 3RYIA 2KMLA 3VUEA 3ZNNA 2ZAGA 5DV9A 3W5UA 5DPMA 4YCCA 2A86A 1NRJB 1NSYA 1Z0AA 2A9RA 3D8HA 3MHTA 3P2MA 4C4SA 4YCLA 1UDWA 1Y3IA 2BDEA 4RSGA 2IP1A 4X63A 2QLMA 1PGJA 3GNTA 5EG5A 4GPTA 1U11A 2P6OA 4QFDA 5KVSA 3MERA 4WA8A 1OZAA 2JVJA 2BMAA 3M70A 5I7OA 1KI9A 1MQAA 1GVNB 2I91A 4K6FA 3CX4A 3H5RA 2L19A 2ZJ7A 1PNTA 4GUAA 1Z0FA 3D9QX 4L28A 1Z5OA 4MIOA 4HYEA 1RXVA 1JE0A 4ND7A 4E5KA 1JAXA 1VZ2A 1LY1A 2Z0MA 4RA9B 2Q5JA 3NBAA 3ZTWA 2PUEA 1NI4A 3R09A 4P53A 1RMQA 3O8DA 2O0LA 4RH1A 5I7AA 3KPVA 4AJLA 5JEDA 1MG0A 2F1IA 1X80B 2A58A 2KM1A 3AUAA 4HMOA 5GMOA 1KSGA 3TQIA 4JC8A 1HFEL 2GBIA 4C7OA 3C70A 4B9AA 1IQUA 2EJBA 3ZTYA 2PRYA 4TN5A 5E7JA 1CV2A 2H06A 2I54A 4JAVC 3T1QA 3NXKA 3TRJA 3ZWDA 2UUAB 4S24A 4WZAA 2V9ZA 2H5IA 3IXMA 5FWDA 5KCZA 2RKOA 1JXMA 1P6XA 4Q0MA 2OXRA 2VUSA 1L1QA 1S0UA 5CU7A 5F9FA 1UBJS 5ADUS 3DZBA 2ZRAA 1M67A 2GN9A 2ARKA 1K4MA 1Y8AA 2PU7A 4MQLA 3S99A 4JT4A 3R7WB 1EVLA 4BFSA 3FOZA 4G1UC 4HJRA 2FTKE 1VG9B 3H9BA 5DCYA 5P21A 1FP2A 5LZ9A 3TWOA 1NVVQ 1GZ4A 3PPWA 1JDBC 3UNXA 3TCXB 2CVOA 1TL7C 2GZAA 2CUZA 3O4GA 1TA0A 1KO4A 1X38A 2C9DA 3H1GA 4FUQA 4R2KA 5WRFA 3VYRB 1FW8A 4MHTA 1LDMA 1FF9A 1KBQA 1L7RA 3OPMA 3HDJA 5JPCA 4JC0A 4DDHA 4TTTS 3FCUB 1CUJA 1C81A