2GHTA

Ctd-specific phosphatase scp1 in complex with peptide from c-terminal domain of rna polymerase ii
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
180
structure length
180
Chain Sequence
QYLLPEAKAQDSDKICVVINLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Carboxy-terminal domain RNA polymerase II polypeptide A smal
publication title Determinants for dephosphorylation of the RNA polymerase II C-terminal domain by Scp1.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ghtA00
2GFHA 2G0AA 3EWIA 3QGMA 4FE3A 3MMZA 2ZG6A 2RAVA 2HEGA 4NV0A 2B8EA 2PKEA 1SWWA 2YMMA 3GYGA 4Y2XA 5AVYA 1L6RA 2C8KA 4EENA 5AK5A 3OCYA 2HF2A 5ALGA 4BX2A 3L8FA 3NANA 4BEVA 4ZEXA 3AR6A 5AKJA 4Y2JA 5IS2A 1MH9A 2HI0A 3L7YA 2AUTA 2O9JA 4C4RA 5ALJA 1N9KA 3AR8A 4BYGA 5AK3A 3A1DA 5ALHA 1RMYA 5AW1A 2FPXA 2B0CA 3KBBA 3EPRA 5AKEA 5AVSA 5AVUA 4F71A 5AVRA 5ALQA 1XVIA 3QYPA 3BWVA 3M9LA 3NIWA 5AKIA 1QQ7A 4NFLA 3ZTYA 2HOQA 3QU7A 5ALRA 3WGVA 3QUBA 5AI5A 4UM5A 3ET4A 3R09A 3OCXA 5ALLA 3N07A 2JARA 3NASA 3WKDA 1ZOLA 4DWOA 3DDHA 2AGVA 2YJ4A 4J03A 2BY4A 3I28A 2O2XA 2C9MA 4UU0A 2FDRA 2ZBEA 2C4NA 2DQSA 4CE6A 2I34A 4ZEVA 4HYTA 5AW4A 1NNLA 1AQ6A 3R9KA 5AVWA 5ALZA 3L0YA 2GO7A 2CFSA 2EATA 2NO4A 3N1UA 2RBKA 3SMVA 2B1QA 5AKXA 2G08A 1U7PA 5A3SA 1QQ5A 2AMYA 4BBJA 2CN1A 5AM1A 3QLEA 1U02A 1ZS9A 1LVHA 4UATA 3AR9A 4BX3A 2I6XA 3DAOA 2YJ5A 3ZW7A 2NO5A 1RQNA 3U19A 3I6BA 2P69A 3DV9A 5AHXA 2WF6A 4G63A 1RC8A 4YCLA 1NF2A 4YCMA 4L6CA 1L8LA 1QYIA 2HX1A 3K1ZA 4NABA 1RQLA 3AR2A 4F72A 2C8LA 4DCCA 4YIHA 3QXGA 5AI9A 1Z4OA 5AM0A 1RKQA 1L7MA 3MN1A 2ZBGA 5AVZA 1Z5GA 1CQZA 1VJRA 4L57A 3A3YA 2P27A 4L6AA 1K1EA 3B9RA 3SKXA 2YMLA 3ED5A 1VJ5A 4JDPA 1Z4QA 2R8ZA 3KZXA 3UMBA 2BDUA 2FPWA 3WKCA 1L8OA 1Z4IA 3W5AA 3TLMA 2R8EA 5ALWA 3ZWKA 4GXTA 3L5KA 3E58A 4XOUA 2P9JA 3FZQA 1TJ3A 4BKMA 5AW8A 3N5KA 4BNDB 5AKLA 2HHLA 1Z88A 3QU4A 1J8DA 2I55A 2ZBFA 4UMDA 3S6JA 5ALXA 2WF5A 4Y2RA 2Q4RA 1YJ5A 2FPRA 1X42A 3J7TA 3ZVMA 5ALKA 2ODAA 4UM7A 1Z4NA 2FPUA 3KDPA 3ESRA 3WGUA 2NYVA 3L1VA 3IRUA 4CF3A 4QJBA 3ZWDA 5T41A 1Z4KA 4KX5A 3OCWA 4CF4A 2IOFA 3AR5A 3QU9A 4B6JA 3EF1A 1YV9A 3ZI4A 4BX0A 4DW8A 3L0CA 1Y8AA 2OYCA 3U7EB 5IT4A 5E0OA 2P11A 2JAWA 4FFDA 4C4TA 2GMWA 4UAUA 1Z4JA 4Y2QA 3NRJA 2QLTA 4YH1A 4KYTA 4HGPA 3U13A 1Z5UA 2PQ0A 1YNSA 1ZD4A 2Q4TA 2YFYA 3L8EA 4RETA 3ESQA 5AW3A 4IFTA 1IWOA 3MPOA 3OTQA 1U7OA 1RLOA 1ZD2P 2B82A 5ALTA 4XQ0A 5AI0A 2FEAA 5ALSA 3WK6A 1CR6A 3PGLA 2HO4A 4GIBA 3QUTA 5AKKA 1WZCA 1T5TA 3W5BA 3L1UA 4HGNA 3VAYA 5AW2A 2I33A 2HDOA 2PR7A 3A1CA 3F9RA 4J2TA 3ZVNA 2EARA 2B8JA 3EF0A 1YMQA 3QUCA 1TA0A 5AM5A 4YIKA 2MU1A 1U2SA 4RESA 1JUDA 3SD7A 5ALUA 4OD0A 3IJ5A 2ZOSA 5AKZA 1S8OA 3PDWA 4FYPA 1ZD3A 2OA0A 2YJ6A 2FI1A 5AKGA 4Y2YA 4UARA 3CZ4A 3WK5A 4EZEA 2YBDA 3RF6A 4NAVA 3UMGA 5AW6A 4NWIA 4DFDA 3ZUPA 2BDEA 1TJ4A 4OCZA 4HGRA 4HAIA 1Z4MA 3DNPA 1XP5A 2I7DA 3W5DA 4UU1A 3FPBA 4O8CA 4I9FA 3P96A 2Q5EA 3HYCA 4ZEWA 5AM4A 4UASA 4Y2PA 4YGYA 4UAVA 2JAOA 2YJ3A 3QU2A 2FUEA 3N28A 3U7GA 2WHEA 3WKEA 4QQFA 2RARA 1QH9A 5AI6A 4AS3A 1ZRNA 3PGVA 4XPZA 1RMTA 1TE2A 4AP9A 2W11A 1FEZA 5AVTA 5ALDA 4Y2VA 4G9BA 5A3QA 4Y2UA 1L7PA 3HLTA 2W43A 2IYEA 2JAUA 3QUQA 4Y2TA 2HSZA 3SKYA 1ZRMA 1Z4LA 2IA5A 3W5CA 5ALMA 1RLMA 1L7NA 2WF9A 3NAMA 1O03A 3SF0A 3UM9A 3ZU6A 4YCNA 4EX6A 1N8NA 3BA6A 3U7FB 3SHQA 3A1EA 2WF7A 5AVXA 3L0BA 4C4SA 3D6JA 3WK4A 1WVIA 3NALA 2YY6A 5AW0A 3WKAA 4EX7A 3AR4A 4MUMA 1NRWA 4I9GA 3B9BA 5ALFA 5AW5A 4EELA 5FP0A 1Q91A 3QNMA 1SU4A 3L8HA 3ZVLA 5A3RA 3ET5A 1EK1A 2OBBA 2OM6A 5ALPA 1T9ZA 1ZD5A 2FUCA 5AIBA 2WFAA 2ZXEA 3U7HB 2VKQA 1S2OA 1RKVA 5AICA 4CF5A 3M1YA 3FM9A 3E8MA 2YMPA 1L7OA 1YDFA 3OPXA 3KOOA 3WK7A 1RPZA 1Q92A 3IB6A 3ZX4A 5ALIA 5AESA 1KYTA 2C88A 4UMVA 3E81A 5AM3A 1YS9A 1QQ6A 2QYHA 2ZBDA 1SWVA 2EAUA 5ALNA 3FVVA 1Z4PX 5JJBA 2G1AA 4PNHA 4KNWA 5AI8A 4Y2SA 4EEKA 4KX3A 3RFUA 3QX7A 1PW5A 2G07A 2X4DA 1U2TA 3N8GA 1F5SA 1O08A 4OFZA 4CNQA 4MWOA 2B30A 2HCFA 3AR3A 2YN4A 3UMCA 1EK2A 5IT0A 3CNHA 3I76A 4OHFA 1RRCA 5AI4A 2IOHA 4BNDA 3U26A 3KD3A 3SLRA 2CFRA 4XE5A 3FPSA 4H1WA 1RMQA 2YMQA 3OCZA 1ZJJA 5ALEA 4HGOA 3I1YA 2MSNA 2R8XA 3PCTA 4E88A 2GHTA 2JGAA 1WR8A 4BEWA 3QU5A 5AW9A 5ALYA 1T5SA 2IOFK 2RB5A 3FGOA 3OCUA 4KNVA 3ZX5A 2B1RA 3L8GA 1XPJA 1TJ5A 4UW9A 2WM8A 3E84A 4HGQA 2I54A 1J97A 4UMEA 3WK9A 1RDFA 5AKHA 4JB3A 2G06A 2G80A 2WF8A 3WKBA 5AVVA 1WPGA 5AK6A 2D2VA 4Y3UA 3NUQA 3R4CA 1LTQA 1VFPA 4AS2A 5AK4A 1RKUA 3KC2A 5AM2A 3MC1A 5AIAA 3ONNA 5AKYA 1RLTA 2G09A 4IG4A 3WK8A 5AW7A 2GHQA 3B8EA 3ZTWA 3OCVA 2AH5A 5ALOA 4UMFA 2FPSA 3AR7A 5AVQA 4KN8A 2CFTA 2HF7A 5ALVA 2R8YA 2W4MA
chains in the Genus database with same CATH superfamily
3HA2A 3UUEA 3BJRA 3JX9A 3QGMA 4WNAA 2V9ZA 2PUFA 4Y18A 1JFVA 3LQQA 1IDOA 3PCRB 1UPFA 4LK3A 3GJRA 1ZXBA 2O1XA 5JVDA 2XUZA 2BTQB 1M33A 1TA9A 1KP3A 1L6RA 3PX2A 1EE1A 5CLHA 4ZDWA 1XZBA 3ZHSA 3OE1A 4E1VA 2AJ8A 5DCLA 4CL8A 3ENVA 3JZIA 4JODA 4PWZA 4URZR 1QZUA 4OMCA 5AHOA 1ISPA 3RVLA 3TN7A 1E20A 3U7RA 5LM3A 2OHVA 1ODLA 4JI1B 5IHPA 1X8LA 2ZSHA 3WRXA 2H00A 1IWBB 2VK1A 3H99A 1XF1A 3M33A 4RMJA 2ET6A 2PGOA 3GC6A 3TQRA 4PIMA 2ONJA 3HY4A 3E5HA 4MW0A 3A1DA 2ODWA 2G88A 3AEKA 2V96A 2BGWA 3HFGA 3V7YA 5CDFE 4LOLA 1KMCA 1PG2A 5T5QA 3O94A 3TE6A 3E8XA 3VDQA 4EPVA 5IN4A 3ER8A 3QYPA 4A91A 4QYIB 2QP4A 2XNHA 3DNFA 4ONEA 4R1QA 4U9IS 4Z0HO 4DV6B 4UDOA 3WB9A 4GC5A 3WNZA 1IN1A 1ISIA 1V16B 4LY0A 3M6UA 4WV3A 4D2IA 5T6MA 1T9BA 2FWBA 2ZI7A 3T9FA 3V33A 4FB4A 2HOQA 2BHSA 3WHIA 1U80A 1VLMA 3OURA 4DZRA 2VBCA 4YAGA 1Y9AA 1E4VA 3UT5A 4PS0A 4TPKA 3OUUA 5I4CA 4LI3X 1J4AA 5AW1A 2NU7A 1J9EA 1RZVA 3T35A 4B43A 5JY1A 1I80A 1GPJA 1HC7A 1U9YA 1Z25A 2H0RA 4CKYA 4LY9A 4R8LA 2CCKA 5BT8A 3EG9B 2D7DA 2H2FA 3PC8C 4OAOA 4EHNA 1BXRB 5LOVF 1NURA 1AXGA 2HQBA 1ZOLA 2PX3A 1E7WA 2IV3A 3ZW9A 4V02A 1ODKA 5LL6P 3DR5A 4EDFA 4YY3B 2C1EA 4YRZA 3NBAA 3T06B 1KZ7B 3A1TA 3UHAA 1UBJS 2H1LA 4YRFA 3QV1A 4UEJA 1JVBA 3ROMA 1K4YA 1JXOA 2QNBA 3C3DA 2PAFA 4PAGA 2PNJA 5HS4A 2O2XA 1ULAA 2Y0PA 2FDRA 2EP5A 4PYNA 4LDZA 2MWMA 4FYWA 3NDBB 4MQBA 4MHOA 1BG6A 3V4LA 4QNRA 3NCTA 1U4SA 4Z54A 4Z4IA 3A1SA 2B69A 3R9KA 3E1KA 4GU5A 3SC6A 4E33A 1OH7A 4QUKA 2O5VA 4XJTA 1XQ6A 2CFSA 2VTBB 1QIIA 3UKOA 4EY4A 3MOSA 4AY5A 2XIJA 2P3QA 4LKOA 1C8LA 2GRAA 2O07A 2QF7A 3JARA 4HDSB 4JHLA 2DE0X 1NRJB 1SCJA 3H5LA 3DT9A 5HJ7A 2OQIA 1YOBA 1Q6ZA 2IEIA 4KB5A 1N7GA 3TBKA 1OQAA 3SFTA 2OCIA 5TQ0B 1FYVA 3F9CA 1OC2A 2YV5A 2FKAA 4HXEB 5HJ2A 1YQQA 3K70C 1E2JA 2GAIA 4ZT6A 2L17A 3GYBA 2ACWA 2V7XA 4FBMA 2Z98A 2EYUA 4BV9A 5I48A 1AUOA 4FFLA 1CS4C 2VJDA 2C3YA 2XRFA 4U8GA 4DDHA 3A2MA 1EFVB 4JJ8A 4KYUA 4NU6A 4C6TA 2BBOA 5HJ5A 2FZ4A 1GU0A 1TAGA 2H8GA 3I04M 3ECAA 1T9GS 3MRXA 2C8LA 5FL7D 3ZJ5A 3Q40A 3SWWA 3E3MA 4YWHA 3LGAA 3D7MA 1DTEA 3GOQA 4A8TA 3JY6A 4KAAA 1NTOA 4C20A 1FUUA 1QV9A 3DW3X 4JCCA 4M49A 1J8MF 2W70A 4ENSA 2P91A 4CKBB 1KO7A 2P41A 3UIEA 4NHOA 2DZDA 3BB1A 3GDWA 1Z34A 5HUHA 3PUYA 3SKXA 4P98A 2GOYA 2JLRA 1XIVA 2FN8A 2ZB2A 3B2QA 3FLBA 4U7PB 1V4BA 3GN1A 4ZODA 4YP7A 3TI7A 4P3NA 4B7UA 4Y7CA 4AX4A 3JVVA 1J0XO 4UEKA 4ERXA 4JI4B 3RVJA 4MYUA 4ZQGA 2LBPA 1DJOA 1Z4IA 4L5YA 3W5AA 3AIOA 3KPJA 3IVXA 2J4CA 3ZWKA 1UPXA 1XTBA 3H1GA 4U7WA 3ZCXA 1CQWA 5J2UF 2CL5A 3NIDB 3FCSB 4GZMA 1NAHA 1YCGA 2N42A 1G20A 1FK8A 2HHLA 4MW7A 1KE1A 4TXHA 3ZWCA 4RTOA 4REQB 2QLNA 3M4ZA 3SC2B 3T4EA 3QKWA 2IC5A 1UFRA 4YAOA 5DBIA 4D3YA 2V3VA 2NV6A 1J8VA 3NH6A 4BQOA 3OQVA 3I0MA 2B7LA 3KWLA 4X1OA 2O7RA 4PQGA 5FQOA 2HUNA 3GMIA 5BOSB 4YAIA 3ZHCA 1RC1A 1DAKA 1Y7HA 1DB3A 2V9CA 4P4SA 4HVAA 3R6TA 1V9SA 4OHPA 2EBWA 3HCFA 4U2GA 3DZIA 2FSPA 1QIDA 3PX3A 3UQZA 1VL1A 3M1IA 4QZVA 4XX0A 4OHRA 2JRCA 1BHSA 4OJTA 4CMEC 4QNNA 1E96A 3GA0A 4N6NA 4TS3A 2YVUA 4O4LB 1RPNA 3B48A 3T1TA 1UIRA 3L1VA 1UANA 3GX1A 3KT0A 3M3PA 3STYA 1ECCA 1USKA 4F3YA 4WE3A 3OHPA 1YQTA 4HDKB 2LE0A 1QANA 3EMDA 3QWBA 1MGPA 4H6XA 4IBOA 3AVOA 3C4VA 4K1LA 4OHXA 4WOJA 4ZGWA 1WULS 1E6MA 3FOFC 1AS3A 1EWRA 1Z6AA 3LT4A 3NU1A 3SAJA 3RIMA 3R3YA 3VC1A 1M8PA 3K4PA 1E9RA 3DMHA 1MDBA 5K45A 2JAWA 4PPYA 1KR5A 4YJKA 1GEGA 3PF8A 1H2BA 3DBLB 1QK4A 2AKAB 1OAOC 5L4SA 2JLUA 3UMVA 2VUIB 1GD1O 4HGPA 3HKBB 2HD4A 4L8WB 3N0WA 5KINB 3SC2A 3D4OA 4I3FA 4Q47A 4YJDA 5LLTA 4WXRA 1SKUA 3HJNA 3NT5A 3PWKA 1QKKA 2PGIA 3HCOA 1LDMA 2QIOA 2VPZA 3ODGA 4GEKA 4H31A 1P44A 4RKQA 5AWFC 1P1HA 2PSHA 2GK4A 3BGIA 3U61B 2FPGB 3FHOA 3T5BA 3H9UA 1UPAA 3UCFA 1G5RA 4IGIA 1D04A 1PUXA 1BS9A 2QAIA 5AT1A 1TKBA 3KSDO 4YMVA 3BE5A 5EKXA 3GARA 3H4MA 3WK6A 1T36B 2CLMB 3AOEA 1O87A 1ULBA 2JCGA 4R7GA 3FI9A 4BN0A 2FPIB 4LY6A 2PL9A 3ZWBA 4ZYTA 4GDFA 521PA 3LLCA 4F2GA 4XR4A 2XBUA 1LPPA 1Z06A 1FNSA 4DMKA 3BE8A 1Y8CA 5I45A 3WYEA 2OD2A 3Q72A 1Z5VA 3EF0A 4R8MA 2VVTA 2GJ4A 3FCOA 1L5LA 4IIXA 4LIPD 2NSYA 4LZAA 3WGYA 2W2LD 4D80A 4RWZA 1H8ED 4KQHA 1NNSA 2ZOSA 4GLBA 1E0SA 1KAHA 1S8OA 2NT3A 3IHLA 3S2IA 4U39A 1QMPA 3SLGA 4B79A 4CM5A 4HNTA 1DBIA 5DLYA 3ZV7A 4FNOA 3PC3A 3BSFA 3ZJUA 1NY5A 5C9ZA 2PS9A 1UF9A 2DTEA 4OQFA 4YUAA 4DLRA 1X80A 2VDPB 5EZQA 5I3ZA 2IHNA 3IKJA 2O8EA 4LJRA 2P9ZA 2P4HX 5BMVF 1FNBA 3AIMA 3GCXA 4BJ1A 5KTRA 1H4QA 3TYXA 1LDGA 5GIOE 3LIIA 1GUYA 5BV8A 1LA2A 5E6RA 4JBNA 3KEQA 4A0QA 2XT6A 2UYHA 4U5QA 2PK3A 3UG7A 3AVXA 3ZUPA 4OXIA 2GSDA 4G1MB 1QHNA 4MV7A 1H9BA 4XJVA 2Q29A 3V1UA 1BC5A 2V6BA 3E7FA 3I01M 2J7PD 1BVHA 2DFDA 2H9AA 4BFUA 1EK6A 3OF2A 5T4EA 3R7SA 3TLAA 4KTTE 4NJMA 3ZXYA 2FGJA 4DLSA 1ORIA 3PZBA 4DV5B 4ZEWA 1ZN7A 3M34A 1D8TA 4H1HA 5LZ2A 4WZAA 1XKTA 2WOOA 2YTZA 4QTUB 4KQWA 4EI7A 2QD4A 3K6RA 4CDNA 1DT5A 3E9NA 2PHZA 4G0ZA 4GWGA 4AP6A 2C54A 3T6KA 4BNIA 3PEWA 2HT6A 3CZAA 3KZVA 1FS4A 5KYXB 1LLCA 1ZRNA 3ORSA 4XDGA 3T1OA 1ECPA 1VXRA 3EY9A 2PLRA 1X1TA 3VHXB 5AUNB 5AJXA 1KPHA 2H31A 3FDIA 4J0IA 5BQOA 1NJ5A 5DXJA 3FOWA 1PR0A 1L5QA 1TQ4A 3D4IA 4N18A 4XSGA 3AESB 5C5CA 1FMJA 1GKIA 2GYVA 2W43A 2Y77A 3CJQA 2H7YA 3HHEA 4EVRA 1CVLA 4F3TA 1K98A 2JS7A 1ODIA 4N0PA 2JFPA 3UV6A 4Q7QA 3PE3A 1IOZA 5J43A 2WF9A 4MWZA 1O03A 4RFLA 2X9VA 1DOHA 4LJYA 2P2CA 2ERCA 4IXNA 2H0AA 1CLUA 2NNLD 2PMCA 1FNDA 4AF6A 3HFSA 1LSJA 4MTLA 4ALIA 4DF3A 2H63A 3H5NA 2FV8A 2RG1A 5LXTF 3IBSA 5EXSA 4HB4A 3DOIA 3ZD7A 1II9A 4WCVA 3WICA 1U90A 1M6YA 2P0EA 3ZWWA 1E98A 1WVIA 4KMMA 2EFHB 4ZCLA 4UEQA 1T24A 2ES4A 2AE2A 2QLJA 5AW0A 3Q8LA 3JZMA 3LPDA 4ZU6X 3UMRA 1REQB 3IIIA 4FBLA 1WNTA 2NSLA 3Q15C 5ENDA 1QTRA 3QFHA 1H1LA 4YCCA 2ZITA 1KJJA 3BOSA 3K9BA 1NRXA 3QNMA 5LB4A 4H2DA 3UK1A 5A62A 2HJ9A 2I66A 3RHZA 2H2WA 5J58A 4O4IF 4FLFA 2OM6A 5A3JA 5AIBA 1D1TA 4D7AA 1XRQA 1X2BA 3L93A 4UEOA 4C1NA 4XVUA 5LQAA 2GERA 4US0R 4X8HA 3CUTA 3PXUA 1GZVA 1VRCA 5BW8A 2XGJA 3FOCA 1L4LA 1Z0ZA 2YMPA 4X1YA 2R87A 1CVIA 2I2CA 4KRFA 5LZ4A 2BW0A 4OAQA 5JNSA 3N5CA 1XRLA 1U7WA 3TTVA 1O89A 3B6JA 1IOVA 1CR4A 1KYTA 3RVQA 4JEMA 1YS9A 1J5PA 4D3FA 3GLGE 2FX5A 3DZBA 1JE1A 2AMJA 2DPYA 4X8MA 1Z3IX 3U3OA 4CEHB 2O1SA 2VA8A 3FPGA 4XIGS 5DRYA 5EHGA 2H48A 5IH7A 3BWXA 3R7WA 3KALA 1YUMA 3ORYA 5EI5A 4J7CA 5BUSA 5BWOA 2IEAA 5FTLA 3W8NA 3QX7A 3C74A 2IT1A 4UHEA 4W63A 2P5YA 3ZU4A 1U2TA 4TVSA 1LY1A 4M8SA 4GLOA 5ITZB 4OFZA 2C5FA 2DU8A 3OPYA 3PWZA 4AW9A 2VOJA 5LIPA 4MICA 1XMJA 3DXZA 1PFKA 1HLDA 3THYB 3GAZA 2J59A 2TS1A 3RROA 3QXXA 4MYHA 1J1IA 3T52A 3RKUA 3QVUA 3HB7A 3ONFA 4G41A 2XHEA 1YQUA 2EFDB 1VBMA 2XKAA 4RIEA 4JJ7A 3ZY5A 1XFDA 2WK1A 1N8KA 4JYCA 3QVOA 1VKOA 1SC1A 4XUEA 1RMQA 4D9CA 1BDMA 4U2KA 5BURA 4XZ3A 1Y48E 1TYZA 4LGMA 3L7MA 4IHQA 4NRDA 3U31A 1U3FA 2CVOA 4F5YA 2O0HA 1SOWA 2GFIA 5LKRA 4YXWD 5B7GA 2WIFA 3ZU5A 1JE0A 4F97A 2I65A 2W2KA 1SUPA 3KV1A 2ZJBA 4FMDF 1VIMA 4E51A 1YE5A 2D0DA 2ZE5A 1ZR2A 4MP3A 2C97A 1VZ2A 2WJWA 5A7GA 4Z4EA 1AKMA 1COWD 1GTVA 2OB1A 3A4NA 1GQRA 2VATA 3P2YA 3AFOA 1UP4A 1PJ4A 3C6KA 5TF4A 2ZS9A 1V8FA 3VZSA 3FNFA 2O0LA 4LQDA 3WZ2A 1YE3A 1WUHS 2DWCA 3FYDA 3MRVA 2NUTA 4BLTA 1HDCA 2QUKA 3CVXA 1TO1E 4CU2A 1UWVA 4ALMA 1PTJC 2EKDA 1ID8A 1M1NA 1IWPB 4AMUA 1YIOA 3DLHA 4XD7D 4MGYR 3TGWA 2XTJA 4DQDA 2G06A 2H2DA 4AMVA 5JYCA 5FUMA 3TD9A 5AVVA 1YRHA 4DDWA 2BT4A 1NN0A 2WG2A 2A57A 2ATIA 1CUZA 2GI4A 4OQNA 3KDSE 4LVCA 3N2IA 4AS2A 3R2JA 4WAUA 5AM2A 5KB3A 1EGMB 2I29A 3QBJA 4TQUS 4JQZA 4BWVA 1LJ8A 4YRBA 2OT3B 1NDQA 3LXXA 4YAJA 1UAYA 2IYUA 1U4NA 4F7WA 5EQJB 5K0TA 2VJKA 4ND5A 5DNAA 4G6ZA 1H6AA 1JBQA 3PXXA 4YT8A 4MO9A 1OYYA 3QVGB 2JJYA 1QONA 4RA9B 2AMFA 3QVLA 2X4IA 3E05A 5FV4A 1N0WA 2QU8A 3NBFA 3OJCA 2FSHA 2QTAA 4KLAA 2HF7A 1W34A 2HDNB 5BR1A 2HDHA 1LSOA 1R8YA 3GP3A 1KEKA 3T5AA 3UT0A 1T2NA 1FP4A 3EIXA 1D6NA 5EY5B 2OY0A 3AI1A 2B34A 1GTG1 4Y9TA 4ZEOA 5FHQA 4IGAA 2RI1A 1MORA 4FCTA 2HT1A 5ALGA 4I81A 2P2SA 1EX9A 4BP9A 1NMYA 2WHRA 2AYYA 4F8YA 5JBQA 2H5IA 2NXCA 3DL2A 3U3MA 2M6RA 3C7CB 4HQLA 3VX3A 3AVVA 1XEWX 4Q05A 2B99A 2JFQA 2I62A 2B5VA 3V4VB 1CP3A 2ZCJA 2VP2A 5TXGA 1BGVA 4ZWNA 2PH7A 2OCPA 4IUYA 2NTJA 4NLLA 4QA9A 1PWXA 3GDHA 2VHTA 3KAKA 1OVMA 3LKZA 3CR8A 5EL0A 3NWBA 2W0MA 3WLQA 3GI1A 5TGDA 1JI0A 2G5GX 2E4WA 5B3AA 5BW6B 3BWVA 1MF7A 4RWEA 3LDFA 4JQCA 2I4MA 4M9XA 4E5MA 1P18A 4DSTA 4M7WA 1H2XA 3RSFA 3I72A 3AXSA 2CUNA 4UBKA 4D97A 1OZHA 5C5EA 4LXHA 5K3OA 3MINB 3RSGA 1H2HA 4CMGA 3IOMA 1UKYA 3BRWA 1UJ5A 3FBGA 5AXDA 3SBOA 3W2EA 1ODSA 1QR6A 4LV6A 4L9SA 3PVZA 4GPTA 4UQOA 5C0OE 4DCUA 4OI2A 4QOHA 4GAEA 1LS6A 3VR3D 4JX9A 1OXVA 3WLMA 4F4UA 1JU3A 1VL5A 3TD6A 4C3ZA 4Z53A 3IOYA 1CPYA 4BRZA 1WXDA 1PF7E 2H4WA 2H4XA 2WZBA 1L0BA 1MQAA 3SYLA 4CM9A 1DRVA 3GJ4A 2AYXA 3WKDA 1NVTA 2WU1A 3QEOA 2PXCA 3E2PA 4W1PA 4WZBE 4R2WA 3V4ZA 2I9PA 4NXNB 4FOPA 4D4JA 3CLKA 1MNQA 3DDHA 4BNFA 4HDRB 4GLFA 2X7XA 2V1UA 3I30X 1G2QA 3HK2A 2GF0A 1PEAA 1ZUWA 2HXYA 2ZRJA 5IN5A 1C4WA 1CRZA 1NWCA 3C15C 2EERA 3S68A 1ZUIA 2SKEA 1M5UA 4Y0NA 3TQOA 3VR1A 5KOHB 2XH8A 3HDYA 4E4YA 3R0JA 1KMIY 4HYTA 4FGKA 1SB8A 1J42A 1RFLA 2PMDA 5FOSA 3LY8A 5A71A 1U9JA 2DFTA 1IAVA 2RHCA 3DNMA 2WTMA 4EL5A 5KYTA 3JVEA 1ZLYA 3EVNA 2O14A 3W2IA 2CN1A 4OHOA 1UKAA 5EHXA 2HFKA 4S0XA 4JUDX 3PEUA 4YJ3B 2H7VA 2YR0A 3ESZA 1MQ8B 1ZG3A 2X0IA 3BB3A 4X45A 2ZIUB 3QX3A 3EXIB 1J24A 3T9DA 3GZTB 2GPYA 3I37X 1QGED 4BX3A 4QDOA 1ONNA 1Y1TA 4ZAYA 4K9KA 3G2OA 3A2LA 4YRQA 5KS2A 2NP6A 4UCQA 1Q7RA 2G6BA 4NYIR 1RQNA 3RYHA 4BKPA 2G7MC 1E61A 1Y33E 4RSGA 2QVLA 2JFHA 2QORA 1NF2A 1DC7A 2R47A 4WZZA 4YB8A 2X2OA 2YFQA 1B6TA 3IBTA 3OWOA 3KDAA 5H68A 5JUWA 3LV8A 1Q20A 4XLTA 3V4OA 2O5EA 4OM7A 4IMJB 4RACA 5BP7A 1RI5A 2WZCA 3BSWA 3RV3A 3S99A 4EQZA 1A9XA 4E2XA 3SPXA 3LCUA 3JQBC 2WIDA 1U2DC 1AOXA 4Q03A 1Z7YA 4TXLA 3QBDA 3V6MA 4B3DA 1CQZA 3OJLA 3QITA 1C3OA 5TY0A 4Q4HA 5LDHA 5CG2A 2ZAYA 3DC2A 3C24A 1GQFA 2C4VA 2W2XA 4UJ5A 3C8UA 3S2ZA 2WYOA 2YV4A 4J8PA 3ASZA 1IL0A 1S9HA 3IDSA 1BQEA 1ESZA 3KTDA 2XQFA 1L8OA 1A3CA 2NU6B 2NYUA 1XF9A 3MWDA 3OG9A 3RU7A 1J8YF 7ADHA 1BN7A 4X64B 3DOOA 4GUAA 3IEPA 4Q02A 3W90A 2AS0A 2GEVA 2G63A 2Y1FA 2WVAA 1SZCA 3ZDDA 4JP1A 4MR7A 3MYYA 2WUVA 3SYNA 5AW8A 1KI6A 5IYZB 4HAXA 1S7GA 2XNJA 3A3PA 4YROA 3N2KB 1G4UR 1CUWA 1J8DA 2CLLB 1WXHA 2XNDD 3QRWA 3OE4A 1G55A 4BNLA 1YR7A 1WBJB 5KTYA 1BE6A 1EI9A 1IJKA 2DQYA 3A2NA 1B41A 2WHYA 1X7ZA 1VHDA 1XHFA 1XZQA 2XGSA 2K2WA 3LVBA 4OQ4A 4Q1VA 3G8AA 4PZYA 2F9FA 1U1EA 2R7LA 2K4MA 4KWTA 3ZVRA 4EFLA 1P45A 3DKKA 3DYBA 5F4ZA 4N7BA 3RFCA 1GTZA 2OK7A 1LDNA 4F11A 3FNGA 4B6RA 5KYVA 5ELLA 1VE6A 5JOQA 3GL9A 5HBGA 5F7ZA 2HJHA 1ACMA 4CJXA 4ES6A 1E1RA 1T15A 1UMCB 2ZSDA 3GLHE 2F9MA 2IYTA 4PY2A 3T7IA 3TVYA 3F73A 3LUHA 3V1KA 1YB1A 3FYUA 4CF3A 2ZR8A 4AZTA 4WZBB 4Z3KA 3V1MA 4FW8A 1H85A 1VHJA 1W0JA 1XAGA 1YJAA 2FW7A 2ZUBA 3PVSA 5AJUA 1R15A 4CF4A 2MMCA 1CIJA 3ANSA 4KLCA 4CHTA 1E1DA 2Y1CA 1YA6A 5E3HA 3C3AA 1HWYA 1J90A 1YZUA 1Z38A 5DT9A 3GD7A 1GAWA 4Q4JB 3T3DA 3IUNA 3QEMA 5DXFA 4JBHA 4OREX 2QEQA 1TL7C 3KQQA 1JDJA 2PL1A 1WZNA 3HVIA 4G5FA 4CXMA 1N78A 3R5KA 4KQCA 4Q4DA 3PUWA 1Z4JA 1QCCA 1HSOA 1VHLA 4UAUA 3NHKA 1XZMA 5CT5A 3SIRA 1TKRA 4IFBA 4BNHA 3ND9A 3R8CA 4K9SA 3PHLA 4WGGA 5JTUA 2Q0SA 5KVSA 1MUUA 1ZD4A 3L8EA 1U1IA 1Z16A 3ABZA 2PLNA 3VU0A 2XADA 4UU7A 4C0JA 1C1YA 3JPYA 4J1QA 3RDPA 4TN1A 3ROEA 1F2TA 3CCFA 1R0ZA 1RLOA 3B9QA 5H9WA 2CHFA 4ZXPA 1Q2UA 4W8OA 4UM9B 5GTDA 4D8TA 2IYSA 2ZUFA 4S1WA 3RRFA 4D9IA 3VVBA 3GT4A 3X1DA 1PZHA 2IY9A 5TVKA 4CQMA 4FFNA 3OE7A 4RQTA 1ESCA 2R6JA 1RWXA 4ZICA 1C9EA 1JA0A 1R66A 4PO8A 2IUUA 1TD1A 4ZXFA 2YQ4A 5KPDA 1E3MA 1C2TA 4KQGA 1Z0DA 2GN9A 2NYAA 1Q0LA 1O96A 1YMQA 1AQLA 1TD9A 3KZMA 5FTJA 3TQFA 4ASUA 3KZCA 4LV8B 4CLEA 1YQ9A 1DJNA 2CXUA 3DLIA 3AJ8A 3M82A 4QVGA 1U99A 5IMBA 1WDWB 4L2IB 3G2HA 1H4VB 1MJFA 4AJNA 1PKXA 5JSYA 1PX2A 1RHQA 1JECA 3RTCA 4MKXA 2GM9A 3DKRA 4IDNA 2FSVC 4PIVA 2JFUA 1KDPA 4ZQBA 2HA3A 4J4TA 3L77A 1U8UA 1B15A 1EFKA 2NX2A 7YASA 3UWPA 4PX3A 5F51A 2ZRAA 3CKKA 2AEEA 3A6FA 3BHJA 3L4BC 4JOCA 4N3NA 1T1IA 2V58A 3TUJC 1ELOA 1V3TA 1P0PA 4NMLA 5G4LA 5KEIA 5C52B 3MOIA 2YV3A 2EW1A 2OLEA 3FWKA 4NWIA 2C7PA 1Y6GA 4XI9A 1WXIA 3G9XA 1SBIA 2DVMA 4LXIA 1AF4A 1KL7A 1UXJA 2DTXA 2QVYX 1TNDA 3ANYB 4QKQA 1C9NA 2XOEA 1UKBA 3BTVA 3FUUA 4OB7A 3ZIAA 1AG9A 4N5NA 1G7CA 1XP5A 2X8WA 1UZLA 2RIPA 3OOSA 5JPIA 4M53A 3SJZA 2WFLA 4I9FA 2CVFA 2EIHA 4YXFA 2ID7A 3IV9A 4N41A 2ADMA 4LMRA 2G1JA 1EVIA 4HAUA 1CRQA 2HMTA 1WW2A 2EOAA 1Y7TA 3QKSA 4A23A 2BFCB 3V42A 3VDMA 1YJCA 4FKBA 4XASA 3CY6A 4FFOA 4IJMA 4AU1A 3EIUA 1Y7PA 1FMFA 4REOA 2E4YA 4RD6A 1PZNA 3BMOA 4W5WA 1EP9A 1TE2A 2ZQYA 1NR1A 4Q9LA 3W5HA 4B74A 4Q7MB 1MOPA 1FEZA 4DANA 4O8ZA 4GYJA 3DEAA 3Q7PA 4M6WB 5GONA 3ZGVA 2CB9A 3QXHA 3ZE2B 3KBOA 3UUWA 1SC4A 3FHTA 3KUXA 3OWXA 1T5BA 3WMFA 4DIUA 3ISVA 2IITA 3SIPA 4DTCA 3FTNA 2HWKA 1UWLA 1ODTC 5FV7A 4MCIA 3LWNA 2BGJA 4I9NA 1SQSA 2R97A 2V6GA 1ZH4A 3KPYA 4ZCPA 4GH5A 5JVDF 4JXZA 3M6FA 3L7CA 5HDQA 1NLZA 1N8NA 1HY3A 1OGJA 4NI5A 1CY1A 1A88A 3FMGA 4JWKA 2QL9A 1U1FA 3AOGA 4FBGA 4HDNA 4MLZA 4CCWA 1SXJA 2O0KA 3L43A 3IUSA 2LCFA 3EUFA 4OF4A 2VNHA 2WP8J 1OFHA 3BCRA 1PQUA 5FFMA 4TKUB 1OI7A 1ZOIA 1KJIA 1WHSB 1RYDA 1O95A 4IEFB 4PQEA 3NALA 5DCUA 3TSZA 1R1DA 4CG0A 1A4UA 1AKTA 1AUPA 2VPIA 2ID8A 3NEYA 1NVAA 4EF5A 1DXOA 2PSSA 2YIMA 4HH3C 4MR9B 5IK2A 2IPAB 1L2TA 1JEJA 5A5DA 1AN0A 1Y3IA 3UF0A 1EFTA 5A3RA 5EEHA 3MD9A 4XOIA 1ZNYA 2FTKE 4GZ3A 2NOAA 1Z0SA 1VI5A 1K5DA 3BWBA 5JNWA 4UVGA 1DC3A 3I6IA 3U7HB 1CJVC 1JFSA 1S2OA 1MRNA 1I9GA 4P3YA 4V3BA 1NJ8A 3LC7O 2L2QA 2QU7A 3Q3VA 1RPZA 4GX2A 1DTWA 3UJAA 4FFRA 4B3IA 1KI7A 4GICA 1FVOA 3AP1A 4JUCA 1QWOA 2IYYA 1P81A 1OFTA 1SBQA 2NUPA 1ENPA 3L04A 1R10A 2WWIA 2HWXA 3VFDA 2M6KA 2EGHA 2VQSA 1M6WA 3P1JA 1FFAA 4OLHA 3MAGA 5THXA 4ND8A 4LRYA 4Y2GA 3RBZA 2NN3C 3D3WA 1VLZA 3VTAA 1NOJA 1BOOA 4U2DA 1X1EA 3GB9A 5EUBA 1X6VA 1HQKA 5I9MA 5JFOA 2H17A 4NNJA 1E5DA 5EWMA 3H2JA 3IURA 3BTSA 3ND8A 5DW0A 1A8HA 1PV1A 3ND5A 3K0FA 2AYZA 4YLYA 5EMHA 2O8DB 2OHFA 3UKDA 5IKEA 5KNDD 4MQ4A 1D7OA 2Y1DA 5TPWB 1CF4A 4S1OA 1H94A 1Y4UA 4QGBA 4KVFA 5JD3A 1P5ZB 3T0GA 2ZTUA 1D2AA 2RAUA 1RRCA 2VP9A 4QUJA 1I51A 3BMNA 3NTRA 2H1FA 3NHYA 4S1VA 1NW3A 2DCMA 1SCBA 1YQEA 3E15A 3M1LA 3FDZA 2GN6A 1OBHA 3KJQA 3MWGA 3Q3EA 1BOFA 1BRMA 1EAMA 2P8JA 2YCBA 4RHCA 4AZSA 4H77A 4XARA 5ICCA 5CNIA 1CJKC 1J06A 2I6TA 4TV8B 5BSWA 5HQ3B 1NMSA 1QH8A 1PYGA 4JBWA 1ADFA 3UA4A 5JAMA 5AFSA 4IWYA 3ZUGA 4J0FA 4JZKA 2LWIA 3ZWXA 4B3GA 4Q7EA 2EW2A 5KAMA 3AINA 2JGAA 1DWPA 3DVRX 5HRAA 1J7JA 1J9ZA 3DLCA 4ITRC 3R9XB 3ZD6A 4AKEA 4EKNB 1SCKA 1KJQA 5C81A 5IFKA 2OZLB 1UT5A 1R27A 4KUHA 4XM0A 1Z75A 1Z26A 3TEJA 5FWXA 3FMPB 3W2TA 2I7CA 5MFZA 3HCWA 4M1KA 5B1YA 3FWPA 3OPVA 2AFIE 1SKAA 2GKSA 5CGQB 4HR7A 1I0IA 1LJLA 3AUJB 3QVMA 2QW0X 3L84A 1RDFA 2GT1A 2WSMA 2BLNA 4O4HB 5A6SB 3ZD9A 4B2IA 2K7ZA 1JU4A 2VL7A 4CM4A 3TO5A 2P30A 1WB5A 3B2EA 2IZ1A 1IVYA 1NX9A 5JE8A 3VPAA 4F84A 5JY6A 5TMPA 2ZWOA 3SFZA 5LQNA 2E5WA 3AGQA 4YT5A 2VDLB 3IDOA 3IQHX 4UDXX 3FDFA 3UJPA 3WLKX 3FJ1A 4LX0A 3LKDA 1ZVMA 2IWHA 1GPAA 2GK6A 3A32A 4LFAB 2JIOA 2JI9A 1IJBA 1GSAA 2IP1A 4N7JA 5IPFA 4HLDA 2WSIA 4JN6B 4F6LA 1PZEA 1BFDA 3AKEA 2BEUA 3PL5A 4BFTA 1M7BA 1EPUA 4AI6A 4ZU3A 3R44A 4U4AA 4PRYA 4DMLA 3L9WA 3T3GA 2RHRA 2Y1KA 3HM2A 3SEQA 4BO9A 1GZ7A 1P4JA 3OQNA 1C14A 5FD8A 4FW9A 3O3CA 3CKMA 1MABB 4HSEA 2XVAA 2CZGA 4DLKA 1W36D 1MOQA 1DL5A 2QXYA 3O3NB 1Q0RA 2ZG6A 4CM6A 1GQ2A 3CEJA 3QKRA 3WWYA 3DSRA 1WW3A 2CKMA 2HYDA 4JLNA 1IBRA 3QW2A 3LFTA 4QGGA 4NG4A 1DAOA 1IUNA 4HUTA 2AT1A 3GJYA 4ZO8A 3RU3A 2JGNA 5AKJA 4BMZA 1R4ZA 4ER5A 4DG5A 2PUHA 1Q1QA 1RP1A 3E7XA 4PGMA 2BFFA 1S8NA 2VQFB 3B1VA 3DDZX 4QOSA 3ROQA 3KYIB 3LSTA 4K1XA 3NEJA 4IQGA 4B84A 1N6NA 3U09A 2QQGA 4M87A 1O5IA 3WS7A 4NCAA 1XTIA 5DBOA 2DH6A 5DE3A 2DKFA 3EPRA 1R00A 4ZPXA 3TD2A 1KAQA 5L3SA 5KNBA 1UQTA 2RHMA 4YC7A 5ALQA 4L28A 4KPFC 3E7DA 1PU2A 2IYWA 3K6SA 5GZ6A 4M60A 5TEVA 3DP9A 3LD9A 3UKJA 3DL7A 2ZSFA 4AICA 3SMQA 4DNOA 5CR9A 4JJ6A 1OAKA 3KJZA 1I7DA 4B31A 3IHKA 4B3CA 4DY4A 2N9UA 1SPXA 2A7XA 3R0IA 3VBEA 5GM2A 1B14A 3QFFA 3H87A 3ZV4A 2QY6A 5GJWC 1Z15A 1G41A 3R09A 5KUTA 2IXGA 4A82A 4LYAA 1UBRS 1CDZA 3EIEA 3NTLA 1PYOA 4J1TC 3MWEB 3ZR4B 1GTMA 4JBYA 3V00A 1TVEA 1E66A 3VOTA 2R7AA 4G1CA 4BAZA 1FFBA 3BT7A 3DTVA 3OVMA 4HWRA 1DG9A 4TYNA 3NBMA 5DWVA 3KJNA 4AJ4A 5KYGA 2CHQA 2WE7A 1LQTA 3BL6A 1YBVA 4RF5A 3HFRA 3NR2A 4MA5A 4ZVSA 1N5OX 1G17A 3L5OA 4WZ6A 5LQSA 2FP4B 2ZBPA 4L85A 3T1NA 1PJAA 2R2AA 3W9UA 2NUBA 4KXYA 4DARA 2ZS7A 5IAEA 1W19A 4KUGA 4Q9KA 1WZ2A 1Z56C 1W0KD 3F6RA 3KD2A 3RJTA 1BIFA 4QYSA 1DEAA 1POXA 2N75A 3AO0B 4FHEA 2BP7A 4HEA1 4HMOA 2ZULA 3H4VA 4OA8A 4Y1RA 3LPNA 3NT4A 3L7AA 5AW4A 1P9NA 4LJ7A 4YCDA 4BTVA 4ZAVA 1N5IA 2AFIB 1M7HA 3GH3A 4AZ0A 1T34A 3MYRA 3PFHA 4FKMA 3L18A 1RWQA 2NO4A 2VXYA 3FWNA 4MJ7A 3EGIA 5JHGB 1M1ZA 1N7JA 4HLCA 4I6EA 4WOBA 5DU2A 3S7TA 5C8YB 1Q0QA 1APBA 5ILQA 3H2KA 4IL5A 1OWPA 4LDNA 1C9JA 3F7OA 2DT8A 3TLGB 1E1QA 2OILA 1U02A 1KQPA 4XB1A 2IBSA 1K8XB 3L6BA 4JR2A 5MF6A 5F5LA 3RLFA 3DOFA 3UGTA 2CF5A 4FX5A 2OPHA 4GM4A 4G5RA 5JS7A 1EM6A 1D3AA 1NBMD 1ULHA 4MVJI 1CF2O 4GR9A 3CTMA 1F5NA 1CUUA 3ZWOA 5G02A 1C0KA 4C05A 4G63A 2QZPA 3NC0C 5B2FA 2IKQA 4YCMA 3RRBA 3GRKA 2O5RA 5F1YA 4S1NA 2WVGA 4BC0A 5A0TA 1KZ1A 5JDIC 3QXGA 2RK6A 2HCBA 2H11A 3EXEA 3GRCA 1ONPA 5H4GA 1XDGA 2WJHA 3BCHA 1G21A 3GMDA 2NQTA 1G2IA 3OLVA 4P34A 3D3KA 1QO0D 4K26A 1NP3A 1JSLA 4G25A 3H9GA 3T7SA 4D8UA 4F92B 1WBDA 4BJ3A 1EFLA 2W9XA 5MFPA 4TWAA 4CUJA 2VHEA 2OV6A 2BGMA 1HFKA 2QVXX 3OEYA 4HN4B 3HCBA 2EGGA 3O91A 4OP1A 3UXMA 4R83A 5CDUA 3K05A 1UM9A 1ND5A 1VYUA 3VV2A 2CDRA 1TW3A 4ZV9A 3LBAA 3KZXA 3WIBA 1TGVA 2HJSA 3C48A 3KOYA 1GXSB 5H3CA 3ELDA 1IHDA 5TLSA 4D0RA 5IXYA 3RU9A 1C9KA 1T6YA 1SCQA 1X70A 5BY2A 3PXCX 4OQPA 2CCGA 4M8KA 3JAMA 1J25A 3GUVA 4MYRA 3MELA 4BKMA 2E5LB 4G8DA 4BZZA 2ZRFA 1B8UA 2X40A 4ZVNA 3L1HA 1HQDA 2IU6A 1R0YA 1WZUA 1FS5A 5T41A 3CRW1 2XXJA 3GELA 3TNDA 4AKGA 1GVNB 121PA 5CDTA 3VR5A 1LZKA 2ZBFA 2R7NA 1V5GA 2O3SA 3IEIA 3K30A 1OYWA 3P94A 1Y3DE 2WSLA 2XF2A 3CW8X 1L5WA 1MC4A 4RYDA 3AW9A 3O2QB 5LP6C 3DFKA 5MN6A 4DLYA 3A6EA 4J7UA 2NO6A 3FVQA 4FLEA 3HH8A 4PHHA 3W9BA 4AKTA 3MPUA 5NLLA 3WFZA 3H5VA 2X8AA 1XXHE 3L7LA 4ARCA 5CA1B 5CVJA 1IN7A 3O47A 4PHFA 5ILOA 2QNRA 1U94A 3H11A 2HJWA 1PD0A 5C51B 1TM2A 3VOAA 2JLXA 1VC2A 1W88A 1X77A 5K0JA 1GFZA 1FVXA 4A6DA 4BNUA 1XAHA 1T5OA 3EPKA 2RK4A 4ZT5A 1WUTA 4FQ7A 3D6NB 1OLSB 4IJ5A 5U4QA 2RGAA 1P77A 1JRLA 3F3KA 3TEMA 3ZWDA 2VDKB 3LHDA 3TJRA 1WMAA 1SOVA 1IMJA 4FMPA 3DBOB 2IW3A 4WN9B 3RLIA 3EF1A 3QY9A 2XE8A 4RS4A 1GGHA 5E7MA 2Z5GA 3L0CA 4FMBB 5HIAA 1F9EA 5JJKA 4RKRA 1KO1A 1VTKA 1Y3AA 1S2LA 3MLAA 3EFEA 2WU0A 2YWXA 4J0HA 3T1QA 2WMNB 4ZCTA 1W4RA 2YKGA 1H2ZA 3LGXA 1EDEA 2EL9A 2Y68A 3NHAA 3I8OA 4YFYA 1WXQA 2GBGA 3LJKA 2WPDA 2Z2XA 1OROA 4MEBA 4NONA 3TIGA 3CEAA 2XCTB 3DDUA 2FZ5A 3UPUA 3P4UA 4JLBA 3LVRE 5HJEA 3ISJA 2YFYA 3GFBA 5CP8A 4ZOLA 1Z2CA 5LB2A 3LYLA 4KSBA 1GEEA 1E9AA 5DI3A 3VTZA 3CW2A 1A4IA 1PNQA 2NPIA 2OHGA 3MPOA 1WU8A 4XGKA 5LQMA 4UFOA 4B6QA 3QVWA 2KW5A 1YZQA 5TSDA 4HY3A 4EQ6A 5CB6A 4N5DA 7GPBA 3THWB 1F0PA 2QTVA 3QTBA 4DR4B 2DR0A 3RSSA 2QUHA 3MB8A 4XM2A 5EHQA 2R4QA 1NBME 3GEGA 1D1PA 3K0CA 4OIMA 3UGQA 5J23A 2HO4A 2YOFA 3AETB 3OMLA 1K92A 4KE6A 4MA4A 4XQCA 5HA5A 3FETA 4ZKDA 1O8BA 5CH3A 5E4TA 3VAYA 3RYCB 3Q3GE 3BXFA 4P92A 2VHUA 4H4DA 4ZT2A 5IBPA 1RE0A 2MHCA 2PUVA 4K0RA 4QGFA 3SE7A 4D6XA 1SUCA 4M1QA 1W36B 4CIDA 4B3MB 3MG9A 3AVQA 4P4SB 2VSNA 2XUAA 1LI7A 1YFKA 3B3GA 4JMLA 4K05A 1L7VC 1KZHA 1QZ3A 1USGA 3TQHA 4FMCF 3TTXA 4FFSA 2FLWA 4D0SA 5HM8A 3BIOA 3WIEA 2JLVA 1X1CA 5JNUA 2UVQA 1NVGA 5T67A 3EXG1 2ISSD 4H7PA 1QH1B 1TMYA 3EYAA 3MCVA 2Z43A 3OBIA 4WKCA 4ESVA 1SQGA 4FZ3A 2CUZA 1IZ0A 2A86A 4MKIA 4J16C 3NWOA 1ZJ5A 3EIOA 2XCSB 4QJIA 3FHCB 4JX8A 1JQ5A 1V7PC 3G17A 2PS0A 1KS2A 3OI7A 1TK9A 1I4WA 1J8QA 1ZH0A 3WQBA 4DEYA 4R71A 1QFMA 4E11A 5LP1A 4EY5A 1G2PA 1BN6A 3M5DA 4IINA 3LUAA 1OKKD 1UT8A 5DDIP 1EFPA 1O6ZA 1TO2E 3I05A 3O5AA 1YJQA 3OLWA 2QBYB 2PANA 3CLHA 1N5RA 2E85A 3LRXA 2PUTA 4HAIA 1KEEB 3HUUA 2KE5A 3N2LA 3GBSA 3E18A 2AN3A 3VU8A 4Y0AA 3GUCA 1JTVA 2E4ZA 4BGDA 2C7GA 1SZJG 4LGYA 2LP4Y 1JT2A 2V7TA 3Q1KA 4LNAA 1MOZA 4N0EA 5A2QA 2I8LA 2ZWPA 3H9BA 3ITEA 4H0NA 2O1WA 1GG9A 1Y3HA 4X3OA 1XZAA 1SM4A 1SK9A 2C0CA 5T3YA 4N0DA 4OHYA 3U3JA 1EYZA 1XXHB 1RRVA 3IKVA 3EVEA 3L7OA 4YBRA 4MCHA 3G59A 2WUFA 4G5OA 5AI6A 5C5IA 3WIDA 2MINB 3ZDCA 3IPLA 4B83A 4QEZA 3Q11A 3OZUA 3PLAE 4FHFA 4I2VA 3ZHVA 1QCDA 4RVSA 3D1LA 2WVHA 3C3CA 3ANNA 3RWOA 1EZ4A 1DCKA 1GPLA 1T2VA 1CIPA 1R5NA 1Z36A 4LMAA 1SD1A 3V9AA 2ZVJA 2WJ4A 1YL7A 2CF6A 3HB5X 4YO8A 3E70C 4KXXA 3V48A 5B58T 2HCJB 4I1SA 4YUXA 2IA5A 2OCGA 4RAOA 3IDZA 1C5KA 3UEOA 3D0KA 3JR7A 4ZVTA 3WLAA 5F9FA 3UFXB 1Z33A 2CNWD 1Q1BA 4RYLA 4CT4B 2Z08A 4NYMQ 3BA6A 4A2WA 2ECKA 3TNYA 3CE6A 4HEJA 3L0BA 3WWOA 4UQLA 3HJGA 1JSXA 3EHDA 3W2GA 1BWRA 3EPPA 1VCIA 3SJ7A 5IBQA 2WAAA 1AO3A 2BE7A 4N7MA 1X8JA 1CUIA 1I7QB 3D6FA 1T26A 3GLFE 3MTJA 4EGCB 1DIBA 3MWJA 1CZKA 2VP3A 3QH4A 4EDHA 4LMPA 4YPVA 1I6LA 3GZNA 4CG2A 1FLNA 4B3TB 3OFKA 3HN6A 2DPXA 1JXMA 3I9V6 1JFFB 4FOSA 2H4HA 1KY2A 3KVOA 2WFAA 3V5NA 1GDDA 2VA9A 4M0EA 4RBNA 1YUBA 4TVBA 5DH9A 3M1YA 3PRJA 3FM9A 1PGNA 4ZU1X 5C7LO 3K71B 1URPA 4N5MA 5EJ5A 3AEUB 3KKPA 1HEIA 3M3DA 2AEMA 3ACCA 3OPXA 2B1JA 3RYIB 4D4HA 1D1QA 1PSZA 3B5IA 1GKLA 2G9VA 3LP6A 3JWPA 4UE6A 1RJ9A 4KH1A 4QT0A 4D5EA 4NPCA 1QG4A 3I2KA 4OHKA 2OGZA 3PLNA 4S0ZA 1Z7WA 5IT9A 1S3FA 3KKMA 4XEUA 3UB2A 1SO8A 1YI0A 4M0PA 1U2GC 4PNHA 2FVYA 1JNXX 3M4NA 3W77A 2PJRA 3SK0A 9MHTA 3CT4A 5BN5B 4OTZA 1JR3D 4IDDA 3LBNA 5GVRA 3LSYA 4DIOA 5ITVA 1I24A 3O8DA 4BVAA 1IY1A 2V9PA 1XKLA 2IPMA 5A3VA 3O2SB 1UH5A 4QODA 4Z51A 5TVGA 5KYWA 4QHYA 3OCJA 5EIAA 1F6BA 4PTLA 1KWGA 5KI6A 2OFOA 1DPFA 4QSHA 1W6RA 3BSSA 4O2LA 2HPVA 4RQUA 2GO1A 1X1RA 3GQVA 5AI4A 1LPSA 3ZHUA 1YJBA 2XD4A 3BIJA 4NCHA 1PJQA 4HD8A 4O25A 2Z4RA 3UB3A 3EDMA 1UQUA 3F2IA 1P33A 2DHQA 1BGWA 3UGJA 5EQDA 4G0XA 3K72B 1LWNA 1X1SA 4NS4A 4PWYA 3NI2A 1WMSA 5FI1B 1CFJA 1BTOA 1Z5PA 3P26A 2XQGA 2V5VA 2PH1A 4HGYA 4ENQA 1STOA 4D1YA 2ZRIA 1FF9A 2GEBA 3JD1A 5HPYB 4BEWA 5IW8A 2OWEA 2IOFK 1I33A 1PFUA 3AJEA 2WM2A 4DUGD 3SXJA 3IYLW 1D8AA 1KSJA 4DRXB 5GAJA 4E21A 4J3NA 3WISA 4C1BA 4YMGA 1A27A 4WHMA 3EZGA 4CMAA 3UTDA 2E1RA 2GJ8A 3VDXA 1FYDA 1H5QA 1ZIXA 3R3JA 2P9CA 5DIZA 4BB5A 2Y4OA 3N8KA 1PL8A 3N8IA 4ILKA 4IYJA 5KQLA 1EUCA 2X5XA 3KU1A 2ANBA 3HCDA 1A4RA 4GXNA 5EN4A 1GM5A 4H1TA 5ISMA 4PAQA 1JS1X 1XR3A 4U1RA 1YDWA 3VV3A 1PJTA 3FGZA 3LUCA 4N03A 5IVIA 2XLCA 3HLYA 4ODIA 2J4FA 4MS4B 4C6HA 2Y92A 5H1YA 4M0UA 1MTOA 4MYCA 3VDNB 4EUSA 4QRHA 5L6LB 2X8BA 1N36B 1AKWA 1HK7A 4GOLD 4I1UA 5AKYA 1Q57A 2D5IA 3WK8A 2VP5A 3HFJA 1OI3A 2F3QA 3W6ZA 3KYJB 4Z4HA 3PXDA 4D6YA 1GUBA 1DBPA 2QQFA 2YJNA 3FX2A 3G5AA 2RSLA 2QI9C 4U6NA 2VKTA 3JAKB 2YZMA 4MV4A 3VPSA 2AXNA 3PEFA 2Q5HA 1U04A 5CGZA 4QTYA 4GOND 4PZEA 5H02A 3ND6A 1T8UA 2OPBA 3GLFB 2G77B 3DMRA 3ZOKA 2AZDA 4DIDA 3FI0A 2R1VA 2IWRA 4FJ1A 5JI2E 1A5AB 1JPUA 4A73A 5K8UA 1E18A 4GPAA 1V8BA 1PT8A 4Y2XA 4O2BA 4I4TB 4R31A 4BO8A 3AF3A 3OCYA 4TLEA 4BX2A 5A0FA 2XOXA 2QXUA 3AR6A 3O90A 1UFQA 3GROA 1YHNA 3H0KA 4JQSA 4BFZA 1GZ6A 2VCEA 1Z8NA 5B3KA 4MW2A 4M76B 4FCCA 1N9KA 2XXBA 3LRPA 4ARBA 2ALJA 4BL5A 4C06A 1OIXA 2GBCA 3AL0C 2D54A 4H3KB 1VGVA 2AUNA 5FA6A 4BYGA 1ES9A 3OMWA 3ZNPA 1KOFA 4EFDA 3HBMA 1J5XA 2QRJA 5ALHA 4EO4A 2DERA 2GQ0A 1VYTA 1QC5B 2C9ZA 5CURA 2YY5A 1W36C 1CDDA 1JJIA 3H5IA 1JR3E 3M9LA 5DHTA 3W5VA 5JZSA 4MKFA 1MT0A 4MYSA 3W8DA 4WLFA 2OMEA 2V6JA 4V2UA 4LF8B 2CXTA 2NUTB 1AIPA 2KBFA 1NXTA 2HDWA 3NBKA 4KFUA 4R3NA 4YJFB 3VU3A 4EGAA 1SCUB 4HH0A 3MM4A 3P9XA 1UJ4A 2WKPA 1Y8RB 4QOFA 5COBA 2OXTA 1QE3A 3DUWA 4PFSA 1UINA 3B7WA 3KZOA 3UJ6A 5DOVA 4ZZ2A 3WGLA 4XUCA 1N2HA 4IQ8A 5M2QA 2G17A 2J9GA 2PUGA 3WZLA 4CEIA 2E5FA 5L6MB 4HTFB 4KK4A 2QP9X 3T0IA 5L7YA 4BP1A 3HSSA 4JJAA 3K53A 5L7WA 4QXRA 2YWBA 3AHIA 3GXOA 3KTOA 4P7GA 3D7NA 3OCXA 3B2NA 5C4MA 4UTNA 3JWEA 2J0UB 3ROZA 1VHWA 3NASA 2C2KA 1NYQA 4MEAA 1PG0A 4UHDA 1OAAA 4EBBA 3A3KA 4AYXA 4F86A 2FR8A 4I36A 2ZSIA 2IEYA 4NCKA 1MO5A 1H2YA 2BFEB 4TYQA 4LHEA 4TS4A 3JATA 1BROA 4RUKA 2YXDA 1FXWA 4HATA 4KI7A 3IDAA 4EHLA 1V5EA 3GJ5A 4A26A 1YBFA 2QJRA 4L0MA 4AIRA 2C9MA 5KDOA 2H54A 3UXEA 2Z1DA 3KL2A 1W9MA 3BXPA 3MUNA 1P91A 3BRCA 3NC4A 4NCXA 3U48A 3TZKA 3OZAA 5KYKA 2ATCA 2GJAA 4XFJA 2W2NA 5C53B 2AXPA 3DPIA 3LQYA 1QK5A 4Q1DA 3T5PA 3I2GA 1V1MA 4I55A 2RGDA 2Y66A 1M5RA 5AKXA 5KSPA 3ZNNA 2ECQA 2IU4A 1WSAA 3ZCTA 1IBMB 4CTKA 1E3TA 2BZ1A 1YCHA 3OH8A 3DLPX 4Q01A 3AILA 1J2TA 4AJKA 5HR5A 2IBTA 1A50B 4TSKA 5F12A 3JWJA 3ZLBA 2JIPA 4O0MA 4G36A 2ZDGA 2C9OA 1ZS9A 4G09A 2EXXA 4KSYA 4IFIA 3ZTTA 1LUAA 4GKJB 4DCVA 2JGLA 3BMXA 4JY7A 4YRCA 3W7BA 3PUJA 2O06A 3FOBA 1PG5A 4NZYA 3CZ9A 3EVBA 1NJ1A 1MGOA 1CJCA 2IZZA 2WNHA 3IVRA 2AWOA 3PD0A 4JOSA 4OJMX 3T7KA 2OXCA 1HNXB 4F2DA 4JENA 1RLIA 2W6QA 3D1JA 1POWA 2HSEA 1ZNQO 4MULA 4DBZA 4Z1MA 1D6MA 1P0IA 2AFHE 4RKWA 1LK7A 3BWCA 2BE9A 4JIMA 2X2EA 4MP6A 3PUVA 2HWYA 2OORC 1ESMA 5C7YA 1T8SA 1SJ9A 3QVXA 4I5EA 1DV1A 5H4HA 4UUAA 2B3DA 3DDOA 4NBWA 1Z5GA 3AP3A 2CLKB 2QMOA 3I83A 4KHZA 1ZCJA 4BE7B 4EITA 4MQFA 1P4AA 4BLRA 1G5TA 3GG2A 4EYEA 1Q0UA 4FZ5A 3V4FA 5F1OA 1CC1S 4W5JA 2ISQA 3LCRA 2WVJA 2D6FA 3WFIA 4DCNA 4TUYA 1ODJA 3TLCA 1W29A 1COZA 3ZNOA 4QFDA 1SHJA 5GJBA 3H1AA 4B4UA 1JLRA 2I4LA 3P19A 1XJQA 1NV8A 4FZJA 4PS1A 2RIRA 4QX6A 4YAEA 3LPAA 2WAXA 3CN7A 3EXHC 1SC3A 4LF7B 1H3FA 1P6QA 4V0SA 1J2UA 3HHPA 5GONF 4IHKA 1C7ZA 4RJ2A 4W1SA 1INLA 3EWAA 4HFJA 1SR8A 4NFHA 1YDHA 2GEKA 5EWLA 3RANA 3S6JA 2MSKA 3TPZA 4E5NA 3T38A 2IHUA 1D0SA 3ZGXA 3WJ2A 4PLHA 2Z2JA 2RGXA 3TW4A 1V45E 1XMSA 3PNOA 4R2HA 2F4NA 3HWRA 1WEKA 3V1TC 2FEWB 2PGLA 3D0RA 4JZYA 1AKQA 1RAGA 3AUTA 1CNEA 3BIXA 4H59A 3BERA 4Y6RA 2WLTA 3ZDFA 1KVRA 1K8RA 3ELUA 3GNLA 5FPTA 3L9XA 1KS9A 3SSMA 3ABSB 2I4TA 1V4NA 1ONSA 3C3KA 3CCCA 4C03A 2FEOA 2CHVA 2D7CA 3RSHA 5DM70 2GYUA 4AWBA 3OF5A 1AA6A 2QSYA 3ID6C 3WIUA 4ZAGA 3KQMA 2HUPA 3ILHA 2ZBRA 4H7EA 4W8GA 1JEQA 3VSEA 4F9FA 1PIWA 3N3AC 3RFXA 1R8JA 2NW6A 4WA8A 3ZI4A 1I3OA 4QOGA 4OP2A 1O4VA 1YMUA 3NBXX 3P9QA 3NS7A 4JP8A 1DFGA 2DWPA 3U7EB 5JEDA 5LQUA 3TGPA 1VSUA 4P36A 1WF6A 1GZ4A 3U44A 3SI7A 2OC4A 3VBCA 2BHNA 4JP5A 5BV7A 2YZKA 5J2TB 3RC7A 1AQUA 2I76A 1L7AA 4DUZB 3QLUA 4ROSA 1LK5A 3T15A 3SJAA 1WXFA 3HZOA 4QTTB 2Z83A 4WTOA 4W5RA 3ESQA 1JIIA 4ATNA 5JD4A 2WWHA 2CNNA 4R69A 2WAOA 1U7OA 4E32A 3I9MA 5JPCA 4EZEA 4MS3B 4A8JC 5BN4A 2CV1A 3M6WA 1XKXA 1QHSA 2Y76A 3OLYA 2GETA 4OH7A 1ORRA 4XWTA 1IIRA 3WB2A 4INAA 2PZEA 1ZH6A 4ZCIA 2B35A 3P52A 4CN9A 4W9NA 1KRHA 1Z6ZA 3K0EA 4O2AA 2Q9AA 4FYKA 4X20B 1MO4A 3QE3A 3IHWA 1GL6A 1YAHA 2OUIA 2PXXA 3DJYA 4IJVA 4F1JA 1P2BA 2IEGA 1CQPA 4UXHA 2PR7A 1X7ZB 1LC3A 3B5EA 2YH2A 3C4JA 3U39A 2YVQA 1XOIA 5F52A 2G1UA 4MVJP 4PAWA 4D02A 3B20A 2E2WA 3M6XA 1DIGA 1ZM3A 2AFHB 1UMBA 3GEEA 2JKZA 4JJGA 5DX1A 4EFKA 1T8PA 4LS3A 3FY4A 5B1HA 4JI8B 1L5FA 1UCFA 1Z12A 3NP9A 3TW8B 1XRSB 3BGOS 3LZDA 4HXFB 1A76A 3CRRA 2Q1UA 3E53A 3I09A 5HILA 3O4JA 3PDWA 4QASA 5P21A 2OXIA 4ZHQA 5EJ6A 1GWNA 2YJ6A 4EKGA 1GA4A 3IJEB 2LCIA 4JLJA 3ZS9A 4CV3A 1Q2XA 3HYRA 1GPYA 1UC4B 2D2IA 2Q6OA 2PKRA 3RRMA 3B6KA 1P1RA 1WVMA 2Q4DA 5JHHB 2COUA 4C0KA 4L3VA 3HKEB 2J87A 3N75A 3K9FC 1TECE 2W6IA 2XITA 2H2IA 1FTGA 2ZRGA 4MPTA 5IDYA 2ORIA 4U9HS 3VO2A 2C8JA 1NIPA 4AMGA 1WSBA 4HRVA 3GH1A 3JQ7A 3MEQA 2BDEA 3WNDA 1SVUA 1RYBA 3SHVA 2MJLA 2CZQA 4ARZA 4JA2A 1Y89A 3I32A 4QT4A 1G7RA 3MQ2A 3S4YA 2VDQB 1A71A 2RI0A 1UAAA 5JEEA 1UZMA 3NHMA 5CYFA 4C7VA 2H4FA 4JJIA 1UBEA 5EZYB 5EMJA 1DJLA 5FKJA 4AF7A 5TV2A 4DR6B 3KCNA 5AUOB 2WUDA 2HY7A 3ASYA 4UTOA 4LNUA 2WILA 3I04A 2AQKA 3DBVO 1II0A 2BV3A 3CA8A 4LOHA 3GJ7A 4RA6A 4U3JA 1ZSVA 4BRWA 3ZBQA 3CB2A 1IB0A 4JB2A 4Q9JA 2ETXA 3Q7TA 3DW1X 1UDBA 2VQDA 3SCZA 4E3ZA 1MC1A 1UWKA 2EQ5A 2UZ1A 3CVVA 3GOHA 4DR2B 3FMFA 2VNKA 3O6VA 3OX2A 4QU8A 4IWNA 4Y2VA 5B4VA 3KJEA 1ZEJA 4ZZ0A 1TJYA 4CQNA 3DZJA 1R74A 3OEED 2QUAA 3PHJA 5AXAA 4C4AA 4ZCRA 2Y1OA 5JW6A 2G71A 3OBBA 1CLEA 5TF0A 4EPTA 2UXDB 5I9SA 3G23A 1AT1A 1OHHD 2J41A 2L42A 3N2GA 4IUDS 4WEQA 1PL6A 5I8ZA 2J3LA 3ELBA 1A8PA 2YWHA 3DTYA 4PZCA 3ADBA 2V45A 2C9BA 2IHTA 2LCQA 2UU9B 1BFUA 4KR3A 2XUKA 3IR5A 2WU3A 3SHQA 2R1ZA 1MFPA 4CLRA 3LQ2A 2DRIA 1G5QA 5C31A 4OUKX 2NVUB 1A96A 1XX6A 5JIBA 3N9IA 1SN7A 2WBLC 1AVTA 2YY6A 5JSQA 5KTMA 4A5OA 4HVTA 2VUSA 1IB6A 4MS1B 4E31A 4DPMA 5IAKA 4TWJA 2DFKB 1PK8A 1KIMA 3PG5A 5JRZA 5LFAA 1PWHA 2HB6A 4CQLA 1JZSA 4CMBA 1Q91A 1RQGA 2P2GA 2XVXA 4MH0R 2DFVA 3DH0A 4RHEA 3X3HA 2W7TA 3DLAA 4NYJR 4KGXA 3GMSA 2QJWA 4NP6A 3HU5A 2WJ3A 1UKEA 4JGGA 3D8UA 3U4DA 1L7EA 4GZLA 2I8CA 3WZMA 4L8FA 4AZ3A 3UUFA 1QO9A 2Q2OA 3ZVKA 4F2WA 1N75A 1CUYA 1FDUA 4RMHA 3USCS 2DR2A 3QLVA 3D81A 4RTQA 3L1IA 3BX1A 3NM4A 2Q5IA 2XCIA 5KO2A 1UUFA 2CD7A 5AM3A 4GGPA 2YOHA 3F8SA 2OE2A 4INZA 4A4DA 2FG7C 1QX4A 2ZB3A 3ASUA 1RQXA 4TN5A 4BNJA 4DV7B 1TUBB 5I5EA 2ZAMA 1H1TA 4N3CA 2HJRA 3GJTA 2MSEB 4RNCA 5CX4A 1Q44A 3SF8B 4HZUB 3N86A 2XUOA 1YZYA 5JRDS 1Y82A 1ILWA 3IUJA 4ZD6A 2ZI4A 3ZY4A 5EJ7A 4PYQA 5ESDA 2ON6A 4MUGA 2V7GA 2XNCA 5CT8A 4ESEA 4F60A 1F12A 2J09A 2Z30A 4MWOA 2EWVA 3H6KA 3O8QA 1XZDA 4PC7A 3Q41A 2VIIA 3OJ0A 2AD1A 4IEEA 1V6SA 1ZJZA 1TEHA 1TYBE 3O95A 3OQIB 4IUBS 3H04A 1RM0A 1WP4A 2DHEA 2JI4A 1ZJ6A 3R20A 4FOLA 1KGDA 1T6ZA 1NSTA 2B98A 1E79A 2WSSA 3BXGA 2H9YA 3DKIA 3NXKA 4RHUA 1Z0KA 3DD5A 3KU4A 3OFND 5DK6A 3R75A 4NSNA 2F3PA 4H4CA 3QEAZ 1M72A 1BEUB 2XZDA 3BJZA 4YVFA 2ID4A 3VKVA 1NW4A 3ETHA 1Y8QB 4MVCA 4ZARA 3VNAA 5EHZA 4XYLA 3U9LA 3LA6A 4PQYA 4MRPA 3QK7A 2F2TA 1ENYA 3BREA 4M4SA 5CK4A 5LUBA 5KTSA 5BRAA 4K9OA 2CYAA 2AK2A 3HUDA 1GGMA 2FSIA 3NV7A 4PANA 5HKKD 4UE3S 4KI0A 1XP8A 2PWAA 3LLVA 1VE3A 5FHRA 1DU4A 3FNRA 4GX0A 3SQXA 4WNIA 2XT9A 4NOJA 5IJ9B 2HLPA 4FDUA 5D01A 3D6VA 3P32A 1MPTA 2HNAA 2YIJA 4QU5A 3WR5A 3IBGA 1HTTA 3I2HA 4MINA 2VWHA 5DULA 5LQDA 1RM3A 1PBNA 5IHXA 1XAJA 2ZRBA 4NX2A 4PPGA 4S1PA 3VO9A 1U3TA 3HGMA 1FQJA 3CZPA 2C5SA 3M9WA 3NRBA 3LDGA 4JJZA 4MQ6A 1GNSA 4B3BA 2HMVA 2SCUB 3AFGA 3PRHA 4W7IA 4RD1A 1U6KA 1FX1A 4KLRA 4JI3B 1IUKA 2ACVA 2D2VA 3KAJA 1P19A 1TUEA 1XC7A 2VXCA 1JQJC 2WSYB 1HT3A 2SKCA 4Q7LA 1S7CA 2Z57A 2IXTA 1MJNA 4P84A 4PX5A 2CY0A 5E9WA 2GGSA 4KIUA 4UCXA 1CUHA 3SSOA 3U3XA 4CKEB 1QS0B 5DGDA 3QX9A 3I01A 2X0JA 3COYA 1K5GA 4P4LA 4AJLA 3FSEA 4JT4A 1SU8A 1MZPA 4IZHA 1L8QA 2P68A 3OZEA 4GMXA 4MV9A 3EGXA 1GPMA 2Y99A 3WNCA 3A9VA 3JQ9C 4MRVA 1XB2A 1JLLB 4MOWA 1YKSA 3D4PA 3DM9B 2MYUA 3FUTA 3IP5A 3QBEA 4TRNA 1UXOA 4HXYA 4OPMA 1VI2A 4HADA 1KK1A 4IVPA 2AZTA 4GDMA 1LB1B 4KLNA 1Y7IA 2VN8A 2VYNA 1LKZA 3GYGA 1FRFS 2JHCA 3KR2A 3QPWA 2C8KA 3DE3X 3VZDA 4BNNA 5HKAA 4IHAA 4UZSA 2QWXA 1QDUA 2H51A 2VC2B 2XUFA 4KXNA 1QBKC 3QVVA 1MH9A 1QK3A 1CY8A 1OGYA 4YP6A 5TE9A 3VPXA 4YRPA 3B85A 2FPLA 2XMZA 3W8RA 4E1AA 3L02A 3E22B 1JHUA 4KQJA 3BEDA 3HRKA 3RVPA 2AXQA 4G2NA 4WOCA 3THXB 1KC3A 1QRRA 1QZZA 5CYOA 2HA2A 1EFDN 4RQBA 1KYIA 2DPLA 1XTQA 4KQMA 4DA7A 5L9AA 5AVSA 1VHQA 3DDNA 4HEHA 5EJIA 3TG2A 5IWCA 2R9VA 2VJMB 1IU9A 4EVIA 2A7QA 3QPVA 1FS6A 2Z6QA 5DHPA 5EMNA 3U62A 4DV2B 1LNSA 5K8TA 2XB6A 1KPIA 3DE4X 3VTFA 1P6UA 4X0EA 2BKUA 5CAEB 3ZWNA 1NUTA 4ZIRB 4WOKA 3A9TA 2NUAA 3D02A 5JXHA 1U3CA 1CEYA 2HA0A 4MLDA 3KXLA 1T4GA 3CLTD 2H59A 4RZIA 1G5IA 3PC8A 3C1TA 2NZYA 1SBTA 2BR5A 2CJWB 5KOJA 2ZKIA 5HVNA 1FBNA 1T9CA 1EVYA 2JGEA 2JIZD 4IJUA 1E0DA 3BGVA 1XA0A 1WM1A 3T3PB 4E70A 5GADl 2LV8A 3BRQA 4OBWA 2V1XA 3HDTA 3L8CA 2FQWA 4B85A 4YJGA 4DMCA 2YZNA 3OQJA 3BS4A 4LZZA 5FFFA 3AIIA 5DTRA 5AJWA 1W25A 2MYPA 5MDHA 4RPGA 3O8CA 4JWTA 5FBLB 3MNFA 1FSFA 2BEUB 3MTEA 2GNPA 4PPQA 4ZOLF 4X1KB 5CA0A 1HOTA 5KVAA 2KS6A 1FFYA 3U3DA 2CSXA 1GPWB 3GN2A 2BZGA 5EOVA 3ICWA 2PRIA 1JA1A 1VJ0A 3M70A 3NPAA 4D8XA 3WHLA 5JCOA 3WSTA 1ZONA 4YFVA 5HFAA 5D2CA 1GP2A 4PLVA 1SKYB 3I28A 3PR3A 4HN2A 3KSRA 1AS2A 1LW6E 4A2CA 3BBPA 3SDBA 4BB9A 1SKMA 4BNWA 3NAZA 4IICA 3THRA 1C0IA 2BAGA 2Y0BA 2V0CA 2ZJYA 4MHSA 1JJVA 4GL2A 1IEXA 1HRKA 2AX3A 2GO7A 2B83A 3L0YA 1Z18A 1KBOA 2FZEA 5D5PA 5DLEA 4ZFNA 2FMTA 2HPZA 4JLOA 1NLMA 2QG4A 2NLOA 2AJDA 1OT5A 2JJ2D 2P9BA 3SEFA 4EVQA 7MHTA 1RYHA 4HWSA 5IJXA 2F1KA 4UVHA 4X6XA 1XTUA 4K6KA 3SXUA 2JHPA 5F5XA 1CEQA 2QMZA 4HSGA 1XFAA 3VJLA 1R9MA 4H35A 1Z0UA 2RMKA 4U7HA 2FR1A 3TPFA 1DAPA 3EOBI 4CODB 3U2QA 1NMXA 3H9JA 2IUEA 4I8IA 3MJDA 3SNKA 3PLRA 1PL0A 2ZJAA 5F21A 1MJGA 4D0LB 4PG5A 5KX5F 3KQKA 2W2VA 3OT5A 5KWVA 2VPQA 4IZOA 3I6BA 5AVOA 2VK8A 1GPKA 2OYRA 4CLDA 1A8SA 3D2CA 1IZYA 3FUWA 2O7NA 1X38A 4NAUA 2VTDA 4UNRA 4M9ZA 4QVKA 3SS9X 2FPPA 3K32A 4WK4B 3UQYS 1VL0A 1P7WA 2JFYA 4RLQA 1Z4OA 3SQWA 1XYGA 5DLQC 2QAGA 3O1LA 4FN5A 3STXA 4L4XA 3L0PA 2R6HA 1NJ2A 5AVZA 4F85A 1YJXA 5D84A 3EEYA 1PDWA 1YZVA 1K3UB 4M7PA 1FX0A 4XIIA 3D7LA 1JLKA 1YR9A 4X6LA 2YASA 3AM5A 1QTNA 2JIQA 4CBVA 5CJ2A 2G40A 4DYHA 2X9QA 3DOUA 3GT7A 4U2BA 4PPNA 4MQEA 3L4JA 1MA0A 4DV4B 1EFRD 2BDUA 1KHTA 4Z49A 1XZHA 2QS9A 2FK8A 4FYXA 1UK8A 2B78A 1XVUA 3Q88A 3SZRA 2PE5A 1A9ZA 4DCJA 2GZ2A 4OV6B 4QUBA 3E58A 2HIMA 3K9CA 1PLJA 3VO1A 1HNZB 1G8FA 2XXAB 2BWJA 4OEHA 4BYMA 2ATVA 5CPFA 3OZRA 3DDWA 3RTGA 3ZK9A 3HMQA 1HMPA 4GSKA 4NKRA 2J0VA 1HE5A 4QBHA 2AOUA 1ODCA 1J20A 1JV2B 2WWWA 3CNOA 4MAAA 2YXLA 2A0XA 1UBNA 3GVCA 1I6MA 1T3TA 4CMEA 1DBSA 1SULA 5HMMA 3KB6A 4EYQA 4L95C 1CVRA 1XTJA 2NM0A 1UFKA 3W5SA 2QE7A 1X42A 3KVVA 2J3IA 2XE7A 5DGIA 3SBEA 1N2JA 4I1PA 2F1RA 4JUFA 5G3YA 3GPLA 3FTEA 3B3FA 4CKZA 3QQ5A 4IOJA 2HK8A 5E3IA 1M34A 5FA5A 3KDPA 2Z56A 3I64A 2G0TA 1X1AA 3FOAA 1GT91 3HXTA 3AL3A 1W85A 5C5DA 5I9LA 3TMYA 4BQSA 3R7AA 2AZMA 2Q0QA 3PUZA 3JS5A 4TT8A 4EB6A 3OCWA 4EY8A 4WXEA 4BN5A 2BEVB 1CUDA 1G6Q1 2NG1A 2X3FA 3ONDA 4HDAA 4M8IA 4PYLA 4AT1A 4X65B 1ORHA 5THKA 2QM3A 2I71A 2X13A 1PT6A 4XQEA 1IY0A 3X1WA 4UBOA 4BVLA 2R25B 2E89A 5K4AA 1DADA 3QA3E 3UB4A 4RJLA 1NLYA 4Z8XA 3ROTA 1XVLA 4L08A 1Q0ZA 4N5HX 1T2UA 2NZ2A 4UOQA 4CCAA 1M2JA 4FFDA 1QYWA 3ZIDA 4KZPA 4ARIA 2KB0A 1UXHA 4LRQA 3ZCPA 1QVZA 3FNEA 4PSDA 1YNSA 4X7MA 3C39A 1EBUA 5BQ5A 5F2NA 2GESA 2YICA 2H7CA 2DULA 1T25A 2J9XB 3BH7A 4QDTA 3VAZA 4TWBA 4DR5B 3OLZA 4EHHA 4IFTA 4W9RA 1Y3CE 4Y0VA 3DZGA 4F12A 4Q4AA 1NMQA 1E9DA 1ZD2P 7AT1A 5KNBH 2WD7A 1T10A 1IK6A 5AQEA 4B71A 2XF8A 1ECBA 1G98A 3AQIA 3HWSA 5TJ9A 2IJGX 2V4ZA 3S5UA 4Z7JA 4C4YA 1H5NA 2H8KA 3SXPA 3T4XA 1BX3A 1BO6A 3V1NA 2BFBA 4WY8A 4DB4A 2JH8A 3QE0A 4EECA 3O8RA 1DUVG 4ZV4A 1E4EA 1WZCA 2LUOA 3H86A 4DQLA 5AR1A 3RUFA 1S4QA 4PRLA 1MRSA 4BQIA 2D5BA 4Z4GA 3EARA 2V54A 4J2TA 2J5RA 1N9ZA 1IY9A 1W44A 3PTZA 2WIBA 3GK3A 1T0JB 1NVEA 1OLXB 1EXNA 2GZMA 4YIKA 2AC4A 1KJ8A 2ZRNA 4Z0PA 2O4UX 3B6ZA 3LK7A 1IOWA 1Y37A 4R5HA 4M88A 2BTQA 1U8ZA 3EOZA 1ZRSA 3U80A 3TFOA 2CFIA 1U0EA 1NU8A 2FR0A 3UMFA 5ICSA 1C81A 4FFVA 4MW1A 2I1WA 5HS6A 4D3DA 4DXAA 1EESA 2HW8A 2O2EA 4K2AA 5ARDA 1QV7A 2WEKA 3HBFA 4DSAA 2FCAA 1HBJA 4J0JA 1BJKA 2AHOA 1ZCAA 4P7JA 3ZY2A 4CM1A 2PVCA 5IRCD 5A7FA 2H4ZA 1N1EA 3K2QA 4YI5A 5BT9A 1OFUA 2PD4A 4R7ZA 2FWIA 4UUBA 5H70A 4JVSB 4LZJA 3K4QA 5EMKA 5F2OA 2FMIA 2M2IA 5K2OA 5TMBA 4TQGA 4E2YA 1R0RE 2WJYA 4I0WB 1UZNA 4R54A 1Z2DA 1HPLA 1KY3A 4QYIA 1ZICA 1L5HB 4OI1A 2ZJ2A 1Q21A 3JAWB 2CNKA 3UJ3X 2DP4E 2RE8A 1W1UA 3W5DA 3D8HA 3MCUA 3U1VA 1V16A 1VB5A 2BKLA 4P4NA 3R8XA 2CLHB 3OJWA 3ZWYA 1Q3KA 5CH5A 1XK7A 1C8KA 1W46A 3THSA 3PGKA 2YN0A 3MLEA 4FUTA 4BOYA 1UODA 5JAUA 4C7XA 3NATA 5A1TA 3U7GA 1I4DD 1TYAE 3C2QA 3FCUB 5BN1A 1JYSA 1WLYA 4LDRA 3TOVA 4BGVA 4L8GA 5TIIA 2YN2A 1E6CA 5AJYA 4KODA 3EG9A 5T4FA 4RO0A 1LBHA 4US2R 1BXRA 4KVZA 2ZJZA 4LYFA 2P4UA 2FDXA 2PQMA 1NXSA 4FYVA 2O4CA 4JVMA 2EL7A 2I3ZA 1R37A 1YVUA 2FYTA 1UOEA 4Z4FA 2ZYSA 1XEWY 5E2AA 2JG3A 3QUQA 2VJCA 4KBYA 4BFCA 4M0KA 3ETLA 4GSLA 2BCGY 1UBMS 4J94A 3CB4A 3GFPA 5JI3E 2RGCA 4MX8A 3I9NA 3KSAC 1QORA 3DD1A 2QL6A 4XPIB 2CWWA 1GV1A 3NAMA 4PFKA 3AUSA 4KR9A 5JSZB 2ZRDA 1RHUA 3FVWA 1ZITA 4O2BF 2Z9DA 5AUQA 3CBQA 1QNFA 1RYMA 4JUAA 3RG2A 1KHHA 1PDVA 2X0KA 1K7XB 2GN4A 4Q00A 2I22A 2Q45A 1XDSA 1G3MA 3H1TA 4URFA 1Z35A 3I5AA 3ORRA 5JXJA 2VTBA 1G63A 4UUQA 3C8DA 1CUCA 4CR7A 4C4SA 5FUQA 2NTYC 4NOKA 4OHWA 1IZ9A 2JIRA 2QG6A 2YYAA 3ETGA 4HDSA 3ZBUA 2P3LA 1AU9A 1Y9ZA 2X8JB 4MUNA 3W0LB 2CL6X 4QBKA 4OI0A 2BH9A 2GTIA 3BJMA 3G5UA 4MUMA 1PV4A 3WYDA 3A4IA 2BRUC 2XZOA 4Q0MA 2D1FA 2IXBA 4D74A 5K8JB 5TQ0A 1NW5A 5EJ9A 3FVTA 3GGSA 1DOZA 1W47A 3RS8A 4DREA 4PZDA 1JFTA 4NCBA 2GD0A 3COWA 3FW1A 3KZKA 2KSQA 3N8HA 5ALPA 3VR5H 4EHIA 5JH7B 1E1YA 4ZI2A 2QGFA 2R85A 3KZ1E 4CW7A 1H42A 1PGOA 2VS1A 3UAXA 4GYKA 1EFVA 1I7NA 3R7DA 2NVBA 1M2OB 1YZTA 4EG7A 1M6VB 2FRDA 1I14A 1GZHB 4JB8A 2WAYA 4H16A 4P5DA 3CPJB 4RK0A 3ZE7A 1MT3A 2YDXA 1NR5A 2A2ZA 2I4NA 1M2VB 3DM5A 3SYTA 3PIDA 4D82A 3CPHA 4J4BA 3DXFA 3COPA 4PHGA 4CKBA 2C61A 2G1AA 1T13A 2Z9CA 3F90A 5CIWA 4FTWA 4EEKA 3C5WP 4U00A 2G07A 3G9TA 1KC1A 1V5FA <