1NW8A

Structure of l72p mutant beta class n6-adenine dna methyltransferase rsri
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
280
structure length
272
Chain Sequence
b'GTTRHVYDVCDCLDTLAKLPDDSVQLIICDPPYNIMPADWDDHMDYIGWAKRWLAEAERVLSPTGSIAIFGGLQYQGEAGSGDLISIISHMRQNSKMLLANLIIWNYPNGMSAQRFFANRHEEIAWFAKTKKYFFDLDAVREPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERLVRALSHPGSTVLDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLQRSYEIVEGAANFGAALQRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODIFICATION METHYLASE RSRI
molecule tags Transferase
source organism Rhodobacter sphaeroides
publication title Structures of liganded and unliganded RsrI N6-adenine DNA methyltransferase: a distinct orientation for active cofactor binding
pubmed doi rcsb
total genus 83
structure length 272
sequence length 280
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nw8A00
4V0RA 3R6TA 3GRUA 1TPYA 3BGDA 3ORHA 5H02A 3B5IA 4CKEA 4M36A 2XYRA 2YQZA 3KPUA 2AZTA 2JHAA 3IYLW 4M37A 3G8BA 3UWPA 2VDVE 2HNKA 3TFWA 1R8XA 5C1IA 3LDUA 1Y8CA 3EVCA 3I5UA 1KIAA 3FRHA 4PGGA 1NW7A 4BP1A 2A14A 5FA8A 4LWPA 3PX2A 4GF5A 2JH9A 1M6YA 2PXXA 2YVLA 1RI5A 3GRRA 3B7PA 3BUSA 1FP1D 2YX1A 3FPEA 4DZRA 3HCDA 4AZWA 3P2IA 1KP9A 5ICFA 5E8JA 5HEKA 1MHTA 2IDKA 3EMBA 2IIPA 1N2XA 3FTFA 2CL5A 5CVUA 2HWKA 4PCLA 2XVAA 3DH0A 2V7EA 3GXOA 3ELUA 1WXWA 4GC9A 1VE3A 3E8SA 1IY9A 2QRVA 3LKZA 5T67A 3NWBA 5BP7A 1NBIA 4C03A 3CJTA 3GWZA 2AS0A 2C7QA 5CVJA 4MIKA 4YMGA 2JG3A 2VZ9A 2CMHA 4RTSA 4DF3A 2IBSA 2BR4A 2R3SA 5CCXA 2ZULA 4QTUB 2P40A 2V74B 1HMYA 3B3GA 1V39A 3RODA 1VP9A 3R24A 3MTEA 5D1HA 1NW5A 3KHKA 3M4XA 4RX1A 5K0LA 4EQZA 2I7CA 3BWMA 3BWYA 1G6Q1 4LG1A 2ZIFA 3CC8A 3MTIA 3JWGA 4Y2HA 5E1BA 1O9HA 4CTKA 5LQCA 3SSMA 2YR0A 2VS1A 2H1RA 2OKCA 2ZIGA 3QOXA 2NXJA 5C0OE 5GOZA 2IGTA 4IV0A 5DM4A 1F3LA 3E05A 5EEGA 5EQJB 2CKDA 3SSNA 4PNEA 3EEOA 1YFLA 3GIWA 4P58A 4PIPA 2HR1A 2QM3A 3GRYA 2ZIEA 1SVUA 4RVDA 5K03A 1P1BA 1YFJA 3G5LA 4GOLD 1YB2A 2Z6QA 4OQEA 3TPZA 2EFJA 9MHTA 1EG2A 4M7RA 2AOTB 2PXAA 3C3PA 3G5TA 2UYOA 3LPMA 3BZBA 4MTLA 3TRKA 3BT7A 3G2OA 3MERA 2ONYA 3DP7A 3VC2A 3P9NA 1QZZA 2ZFUA 3DR5A 3KQPA 2ZWAA 3O7WA 2YXEA 5K0CA 5LQRA 2DULA 4ATNA 3HEMA 5FHQA 2FHPA 3GGDA 2E5WA 1RI3A 4K6MA 5FUBA 2R6ZA 5DTRA 2LD4A 3P97A 3THSA 5LR6A 4PINA 1L3IA 3GU3A 4YUVA 4E2ZA 4F85A 1I9GA 3FPGA 2AN3A 5GM1A 3H2BA 4PWYA 2GB4A 2ZW9A 1ZGAA 1SG9A 3UJ7A 2AOVA 4CTJA 1X1DA 3OE4A 4LECA 4V0QA 3DXYA 4E2WA 5HILA 3NTVA 3FYCA 5JUWA 5FQOA 5MHTA 1L9KA 1ZG3A 3C6MA 5EMKA 3NVMB 4EKIA 2ZZNA 1B42A 2OXTA 3SXJA 3MHTA 1JTFA 1XTPA 4RSRA 3P2EA 1Q0TA 4CKCA 5K0JA 3NWEA 2B25A 2IFTA 2OYRA 3K0BA 2ZBPA 2BH2A 3BGVA 3OCJA 4RTQA 3I64A 5EOVA 3EPPA 3G2MA 3KQTA 5DSXA 4Z2YA 4E70A 3R3HA 5ICGA 3T7TA 1EJ0A 2JHPA 2NXNA 3LECA 3OE5A 2FYTA 2O57A 3PX3A 1JQ3A 5DTQA 1XDSA 3HM2A 5E2AA 4AX8A 2PVCA 3O4FA 3UA4A 4BY9E 4RTKA 3A25A 4PGHA 5LQAA 2IH2A 4KW7A 5CVVA 5EIWA 4ER0A 5KVAA 1IM8A 5FA5A 3SM3A 1RI2A 2PX4A 2IPXA 4RVGA 1RJGA 2FK8A 4FP9A 3BKWA 3EVDA 2PY6A 4QPNA 5DPMA 1JG1A 2IDJA 3PVCA 2VP3A 3DLIA 4P7FA 3KU1A 3G2PA 2C7RA 4P7KA 5IH3A 1NV8A 1JSXA 2ZZMA 3A27A 3HVHA 3IV6A 1JG3A 5DM1A 5EHIA 1G60A 1NW6A 3FTDA 1SQGA 2PKWA 1XJ5A 2PX5A 4U7TB 3KQWA 4G56A 1BOOA 3DULA 2I6GA 5FQNA 5M5BA 3NJRA 1SUIA 4AZVA 2PX2A 3SSOA 3FPJA 3UJ8A 4PYNA 1R18A 3QV2A 4RVFA 4HTFA 3GRZA 2JJQA 3M70A 4X41A 5LQUA 1SUSA 2HV9A 2AVDA 4AZTA 4OQDA 3BWCA 4M38A 3OU2A 5T6BA 4E33A 4RTRA 5EKUA 2NP6A 2HTEA 1VPTA 3AXTA 4GEKA 3TMAA 2VDWA 3BKXA 3EMDA 1EAMA 1EJ6A 4EMSA 1XXLA 4E2XA 2JHCA 3FRIA 1RJDA 3A7DA 3T7RA 3NMUF 5HIIA 2QRVB 3IEIA 5DXJA 2ZTHA 3FPHA 4DQ0A 3G8AA 2AOWA 3CCFA 2ORED 2GH1A 4LWOA 3K6RA 1EIZA 2PGXA 5E1MA 5EKXA 1UIRA 4QVKA 2ZBQA 3C3YA 3Q87B 4QDKA 3B89A 3TOSA 4UOEA 2HMYB 2KW5A 2P3OA 3EGVA 3M33A 1I4WA 1QYRA 3ME5A 3LCCA 2AOUA 4PIMA 5CVEA 5DM0A 1KPGA 3HNRA 3VC1A 4C06A 1VBFA 1INLA 1X1AA 3GDHA 4Y30A 4GBED 5E1OA 3R0QA 1X1BA 3LCUA 4GUAA 4OBXA 3P2KA 2ADMA 1KPHA 4P7JA 5CVDA 4BLVA 4C08A 2ZZKA 5DXAA 4GC5A 1D2GA 3CJQA 3NDJA 4L7VA 3DUWA 5EPEA 2NXCA 2B3TA 1VIDA 4WVLA 1KPIA 2GS9A 3HCBA 4C04A 2H00A 3B3FA 4BLWA 2ZVJA 5DX8A 3PFGA 1SKMA 1L3CA 2FRXA 5K0NA 4GOND 2QE6A 5FHRA 3S68A 2NXEA 1UWVA 1O9GA 4R6WA 5KQSA 3DXZA 3MQ2A 2DPMA 1TW3A 4XUDA 5ICEA 3I53A 1JTEA 2YTZA 3P9IA 5GINE 4DCMA 1VP3A 3EVFA 2IH5A 5U4XA 5GWXA 4PCAA 2UYCA 1O54A 1JQDA 5LQKA 2IBTA 4E2YA 3FUXA 5FCDA 5B1SA 2I9KA 2P1DA 3RIEA 3VSEA 4KDRA 4C05A 5BW4A 3CVOA 3ER9A 7MHTA 3I58A 5P8WA 5CIYA 3EGIA 2XYQA 3GRVA 3LSTA 4OBWA 4ISCA 2FK7A 5KYGA 2XBMA 2G72A 1ZHFA 1ZGJA 5EMLA 3JWHA 3THRA 4RTMA 4AUKA 2Y1WA 4KIGA 4RTOA 2UZ4A 2AOXA 3OPNA 3KQMA 3Q7EA 1NBHA 3KQOA 3CBGA 3NW9A 2EX4A 2BR5A 3UJCA 4BP3A 1AF7A 1G55A 3F4KA 4PONA 3O31A 2OY0A 3LBFA 4ER6A 4X1OA 2C7OA 4H0NA 2ZBRA 2EG5A 4X63A 2OB2A 4RTLA 3PFHA 3G89A 3LDGA 3MCZA 5EZSA 2XVMA 4YV1A 3DOUA 3DTNA 5EIFA 4YUXA 8MHTA 1XVAA 2Z6UA 3ERCA 2AN4A 1RI1A 4HRAA 3LCVB 3FPFA 4PYQA 4YUZA 1KYWA 4F84A 2FCAA 3SX0A 3LKDA 4RV9A 3TM4A 5C9ZA 3HP7A 3L8DA 1R8YA 4PYMA 5CD1A 5DSTA 5KQRA 1R6AA 4PYOA 1D2HA 2GAFA 3G88A 3PT9A 4FSDA 3KQQA 3KPWA 3UJ9A 1QANA 3V8VA 2OPBA 5DTMA 3KQVA 5EG5A 5HIKA 4C4AA 4CWAA 4YUWA 3LL7A 5EVJA 2O07A 3PTAA 1QAQA 4R6XA 3SGLA 3NVKI 3LBYA 4FZVA 3FUVA 2UYHA 1PJZA 3QOWA 2B78A 2EJTA 4EKGA 2H11A 5HOQA 2FPOA 1MJFA 3EGEA 5EMJA 2ZSUA 3EVEA 4NECA 1I1NA 4OA5A 4RVHA 3KR9A 1KYZA 1RJEA 1G8AA 4DCGA 3FZGA 5DRYA 10MHA 3B3JA 1N7IA 3ELDA 5E9QA 1RJFA 1FP2A 1XDUA 2PV0A 2WA2A 2WK1A 5T64A 1WG8A 3AY0A 3V97A 3M6WA 3LDFA 1NT2A 1UFKA 5E9WA 4KWCA 4PYKA 1DUSA 2AN5A 1R00A 1R74A 3MGGA 1G8SA 4KIFA 3SMQA 3LX6A 2ONZA 3DMFA 5G02A 5FULA 4DMGA 4X61A 2GPYA 3TKAA 1HNNA 2NNWB 3FUTA 1BKYA 3KKZA 1SQFA 4FS8A 2NYUA 5DX0A 5F2OA 5LQJA 1ORHA 5K0GA 5EZQA 1YZ3A 2IH4A 5HZMA 5BXYA 2VDUE 4RYLA 1X19A 2I62A 3BXOA 4R8RA 3SR4A 4HGYA 2C7PA 2P3LA 4HGZA 2ZWVA 3A26A 3ANXA 2Y1XA 3AXSA 3HCCA 3I9FA 3TR6A 4YUYA 1X1CA 3HVJA 3MAGA 4QPPA 3UBTA 2BM8A 4QDJA 2PSSA 2Q41A 3HVIA 3UJAA 1ZKDA 4C07A 3DMGA 3IHTA 1F38A 2GLUA 2IP2A 4QQNA 1ZQ9A 4XCXA 3A7EA 1AQJA 4DA4A 5ICCA 4ER3A 1IXKA 1M6EX 2QY6A 3JWJA 3P9CA 4QTTB 2XYVA 4DM3A 3E7PA 1VL5A 2P7HA 5K01A 4IV8A 2YXDA 5HIJA 5GM2A 4HG2A 3CJRA 4ER5A 3ELWA 5GIOE 1BHJA 2JH8A 4RWZA 2AVNA 2PLWA 3NDIA 3FYDA 1NV9A 2B9EA 3KQYA 4POOA 2CWWA 3KQSA 3UJDA 5K05A 5DX1A 3CGGA 4MQ4A 2G70A 4PYLA 3TKYA 3LGAA 4A6DA 2BZGA 3ER8A 1BC5A 5EEHA 3HA3A 4BLUA 3M6XA 4JXJA 3D2LA 2BM9A 1WY7A 5HFJA 4YV0A 3OZRA 5EGSA 3UJ6A 3X0DA 1L3BA 3UFBA 1FPQA 4CKBA 3C6KA 2ERCA 1QAMA 3WSTA 3VYWA 3P71T 2P3QA 1T43A 2OB1A 5D1NA 4ZTBA 1FJXA 2PT9A 5E1DA 1ORIA 3M6VA 3FUUA 5E9JA 4FSXA 5F2NA 5K0EA 4E30A 3HVKA 1KXZA 2O0LA 3FTCA 4FT2A 3OU7A 1D2CA 4R05A 3HCEA 4WXHA 1NE2A 1P91A 1Z3CA 2CMGA 1NKVA 1AQIA 2F8LA 1VQ1A 3MCTA 5K0FA 2AOUB 4QVGA 3UJBA 3OZTA 1YZHA 5K0BA 2UYQA 3EVZA 2EJUA 2ESRA 4PYIA 4QQKA 2N47A 4OX9Y 1XCLA 3T0IA 1QAOA 4HSGA 2AR0A 2P8JA 2PX8A 2B2CA 2P35A 3OU6A 1DCTA 4E31A 4GQBA 1WS6A 4P7GA 3MB5A 4B17A 3SVZA 5HIMA 1PRYA 4A6EA 1Q0SA 3E23A 1XCJA 5BW5A 1L1EA 3C0KA 5EC8A 3U81A 5CM2Z 4MWZA 1YF3A 2QYOA 1JQEA 5K8VA 2OZVA 3RW9A 3LHDA 3GJYA 4HC4A 4YMHA 1VLMA 2GA9A 4ER7A 4U7PB 1JR4A 4EK9A 2G1PA 3HA5A 5FADA 5CCBA 4FGZA 1JG4A 5F2KA 1OR8A 1XDZA 4GOOD 5FTWA 3FUWA 1EQAA 4PYJA 2YUIA 4HTFB 5DM2A 2ZLBA 2PWPA 3HCFA 4R8SA 4RTJA 3HTXA 1NW8A 2ZCJA 5GP1A 3KR1A 3KR2A 3KR0A 2P7IA 3OZSA 3UZUA 4XUCA 5LQNA 3A4TA 2PBFA 1JSZA 4HH4A 4RTPA 3PLAE 3BWBA 5DLYA 4MHTA 2PXCA 2PT6A 3EVBA 5KS2A 2WA1A 3KPJA 3EVGA 5DRTA 3HA7A 3M6UA 4AZSA 4KDCA 3AWIA 2YXLA 3PS9A 3DXXA 4X60A 5K09A 3CKKA 4XUEA 1M0EA 5IKMA 3DLCA 3P9KA 4EVIA 2G8NA 5GIPE 1P1CA 2AOTA 1DL5A 4IKPA 3ID6C 3G2QA 1H1DA 2PWYA 1U2ZA 3BGIA 5CUQA 5DWQA 5FWAA 3T7SA 3TLJA 2PJDA 2O05A 4O29A 1FBNA 4OA8A 5E8RA 3GCZA 3JWIA 5JR3A 2O06A 3REOA 3R9XB 3DMHA 3OFKA 2OO3A 5ERGB 3KPVA 2G71A 3HCAA 1WZNA 2BR3A 3KPYA 4YV2A 5LSAA 3UA3A 3EEYA 3TM5A 5E2BA 4FR0A 4F86A 3GNLA 5EMMA 1RI4A 3P8ZA 1YUBA 4DKJA 3ELYA 5DT2A 5EHGA 3G7UA 1JG2A 3GO4A 1P39A 4GOMD 1G38A 2K4MA 4RTNA 1TW2A 1KHHA 2OBFA 4FT4A 3AJDA 3OFJA 5FWDA 3TQSA 4CXMA 2P41A 1WXXA 4IWNA 2Z6AA 1AV6A 4KRGA 3EVAA 3FTEA 4E32A 2NP7A 3PB3A 1N7JA 1KR5A 4KVZA 1NW3A
chains in the Genus database with same CATH superfamily
3A1WA 5FT9A 2JGRA 3FAKA 3QVMA 1UBNA 5JY1A 1K0FA 3B5IA 4HXYA 4Z0PA 5CFZA 3QVGB 1SVNA 3PGXA 3X44A 2IUEA 2XT6A 3GG2A 3MMPA 1PR2A 1U2SA 4BB6A 1M1YB 2UYYA 5B58T 3G8BA 2RHOA 3QEMB 4L07A 1TC1A 4OSEA 4J6FA 1NBEA 2BGMA 2C4TA 2YJGA 1LW7A 4JWKA 5ESDA 4AWAA 1ZVQA 4EYEA 1NW7A 1BH2A 4KEAA 4S2EA 1SCNE 4O4JF 4BKUA 3OCCA 3GLQA 4G0NA 1SC1A 3UJ3X 3L49A 4U7JA 5B3KA 4JEMA 4KKVA 6ABPA 2RBKA 5BV8A 1ND6A 3A1VA 2WG0A 3QFFA 4XASA 3HCDA 3VI4B 4OOFA 2IDKA 4UNIA 1NI5A 1OAAA 4GZ3A 3RUCA 4WXRA 5B6IA 1KK3A 1N2XA 2D5AA 3NP7A 1ISGA 1RCFA 3STVA 4EITA 4W6QA 5KIAA 2FQ1A 1T0PA 1FLDA 1JAIA 1YE5A 2W8BA 1BMQA 2XQIA 3GWZA 3N07A 4I08A 4N18A 4Z1MA 1ZMBA 3GRKA 2JVIA 1JR3D 2W6PA 1N2BA 1THGA 2WU1A 2XKAA 3OIUA 4QFBA 2ZYGA 5ADVA 1KAMA 5DULA 1WMBA 5FRDA 1AGRA 1Q1EA 1GKUB 2CLSA 5LLSA 2P4SA 2CJWA 4QIHA 2CNOA 2PKEA 1V5FA 2Y0EA 4E5SA 5HHTA 3IBGA 7MHTA 3MJEA 4H7DA 1W9HA 1YK1A 4GSLA 5K0LA 2WIDA 4X8MA 5TMDA 1WIWA 5J59A 3JWGA 3BCUA 4QWMA 3CNLA 3EXIA 3PNLA 4GLLA 2V6MA 1C1YA 4K7JA 1YOVB 1ZDMA 2JFFA 3A6ZA 2O14A 5BT9A 3U3DA 1I4DD 2Z9DA 4MW4A 3RUEA 3ZE9A 2E37A 4HNQA 5C7IO 3D7MA 2JFUA 4RENA 4IV0A 4I4IA 1VPWA 4PIVA 4U02A 4NMLA 4NOJA 4R3WA 2JEZA 3MOGA 1SC4A 4HQ0A 1N6RA 5C5DA 4M3NA 1B6GA 3H11B 4P58A 5IBRA 3CVWA 4M7OA 5FORA 3N8KA 4KOAA 4TTIA 2H1HA 1DCFA 1HC7A 4UBNA 3ANNA 3K8ZA 4MAMA 1LTHR 4M83A 5AI6A 5A0TA 1VYUA 2CF6A 2Q4EA 3IA7A 2EFJA 2PSEA 3GGGA 2IU4A 2ZRPA 3PKJA 2BBWA 2AKAB 3VVCA 5AUOB 2DZDA 4O3FA 5LNK1 3LPMA 3V8NA 3AMVA 2GILA 3T4EA 3TRKA 4ZP1A 4UE3S 1ZR4A 5HTOA 3KAQA 2W6ZA 5K0CA 1UBSB 3O7WA 5K99A 1F9EA 2CUNA 2DULA 2WKRA 4RCVA 4DLPA 2OAEA 1QVAA 3C48A 3E70C 3DOJA 1Y33E 3CPSA 3GAAA 2ZJ8A 1RVV1 3NXKA 3OZIA 3PXDA 4ZO7A 1NDQA 1APBA 1HLGA 2HMWA 3I09A 4R0NA 2HEIA 5TV2A 2DUNA 1TTQB 1I6MA 1S4QA 2AN3A 3PC6A 3VPSA 3J7AC 3KB2A 1GNTA 2ZI5A 1U7HA 1VCMA 3N2ZB 4J07A 1QIKA 4TZ0A 3OE4A 5IN5A 1JJ7A 2CLDX 4IO0A 5JUWA 1UK8A 5ED4A 2BIFA 2E4ZA 2XZPA 1PT7A 2G9ZA 4PM4A 3AVQA 3Q85A 4MVYA 2FFJA 2FFHA 3L0OA 1V3TA 5F1YA 5CLJA 5BUQA 5J4LA 3GLHB 3O8NA 1LQTA 2ATEA 1UBKS 1J2YA 1UP7A 2VYQA 3G2MA 4DDWA 1NA5A 2RH4A 2YS7A 2O23A 4P31A 3ZTYA 2J9YB 1ZH2A 4Y18A 3HM2A 4YEDA 4C21A 1Q0HA 1TM3E 3KKQA 2Z5GA 3Q1LA 4G1MB 2IXFA 3RC2A 3DB2A 1AKEA 2B37A 4LYHA 5CIQA 5KVQA 1A1SA 1GA6A 4ZVPA 3IV9A 1AS0A 3VR4D 2X6RA 2ZI4A 3DAOA 1P1JA 3FOZA 2AN9A 1ESEA 5AVYA 5I9IA 3TQFA 4OB8A 1OW3B 1SOUA 1DHRA 2I4NA 3AOEC 4WKPA 2JJ2A 1E4VA 2KBFA 2Q6VA 2YZGA 2F1KA 2IHBA 4S35A 3UK0A 4DLWA 2AK3A 1M1XB 3DKKA 4EZBA 2DE0X 1KL7A 2WP0A 5EMHA 5TQ0A 4BMCA 1T36A 4MRMA 2VSQA 3LGXA 3B1JA 4QYIB 1S0UA 3IAAA 2P4HX 4BEWA 4URHA 1B43A 1M67A 2LCQA 4B9EA 1USUA 1LPSA 1V1RA 1NVTA 4HFJA 1E9SA 3CLUC 5DLPA 3WKBA 5JSQA 3ONNA 3PQ5A 3PJGA 1H42A 1EINA 4JVNA 1T3LA 2BH9A 2WTAA 4WASA 3T35A 3EZLA 1B0PA 2AG0A 5FPHA 5YASA 4OI1A 5FD8A 4EENA 4C5AA 2WABA 1YC2A 4M38A 1RXUA 2B2NA 1ECBA 3E8XA 4RK1A 4YRCA 5AVOA 3PC7A 2NP6A 2Z8ZA 4X1YA 1KZ7B 2EDAA 3QUAA 3A1DA 3PC2A 1DAPA 3RAGA 1SCKA 1EXMA 4MROA 4OD0A 1NULA 2LCFA 2C54A 4KOEC 1L4UA 1UP6A 3HB9A 5TPZA 4GBGA 1F60A 1C7IA 1JFLA 1CQJA 3BFKA 2WE7A 3K9GA 3N8DA 1A8SA 2YYAA 4RKYA 2G06A 2GHQA 2JPDA 3O1JC 5JO0A 2AOWA 2YYYA 3CPHA 4J0FA 4NP6A 1BJTA 1T0UA 4OQFA 2EKZA 4R7GA 2RBGA 3B9QA 4TYWA 3PEUA 1VJ0A 1QIDA 1KE1A 4CKEB 4G2NA 4M21A 1T1JA 3ZX5A 4CV2A 4JHLA 5TGZA 2BWJA 3PHIA 2VH1A 3IUPA 4WBNB 4PIMA 1L5NA 3O2QB 3RKUA 1AUPA 1XNQB 2X0KA 5HXAA 1SXJC 3GDHA 5DEOA 3KXDA 2P1ZA 4GUAA 4R9UC 3HXMA 2YV5A 2QTLA 3GRAA 3NAGA 3R1IA 3TVYA 4KE6A 4CUJA 5J2UB 1XEXB 2OWEA 2UUCB 1KPIA 4FFBB 3KT0A 4XZ3A 3QKUA 2P91A 3FWHA 3O8OB 2E3JA 2YZ7A 5CT5A 1Q95A 1Y1TA 3DEFA 2DWCA 2HA0A 3S68A 2NXEA 4BNLA 1DQZA 1UWVA 1O9GA 4JLMA 3EXFA 4HY3A 4R9NA 5AVJA 3GZJA 1WM1A 1CB0A 4IHAA 5FKJA 1T0IA 3EVFA 3K71B 4V0ME 4BRUA 2VKQA 4WD3A 1DI0A 4WADA 2Y71A 4HDRA 2DHCA 4X66B 3KSDO 5BNTA 3CVOA 2E1PA 1L4FA 1RRVA 1C3OA 1XVUA 3IAUA 4Y1RB 4CDNA 2BGLA 5JTUA 1M7GA 2GRUA 3EZ7A 2F1HA 4A4DA 5AVZA 3RRZA 2Q9UA 2UV8A 4AIRA 3GJ3A 1VMEA 4PE5B 13PKA 3KELA 3W2FA 2G72A 3FVRA 2VAVA 1ZP6A 3EA5A 3H0EA 2IS4A 4OL0A 2UZ4A 2Q5HA 4IIBA 3Q8WA 4Z86A 4HB4A 4EY5A 1V11B 3DP9A 4JLVA 3U3KA 1U8EA 4I5EA 2G1KA 5ALSA 5HBRA 9ABPA 3LVQE 3V1KA 1G4UR 2LIPA 4G07A 4KMMA 2C7OA 4KHPB 4DMUB 3MMNA 4ARZA 3WFZA 2P1RA 3SYTA 3VX3A 1ODLA 2V03A 5AOCA 5I7OA 1N78A 1NR1A 5EZ6B 2ZUWA 3DVQX 5COQA 5GV7A 4MVXA 4NDAA 5CVCA 1BKSB 1UPCA 5ALDA 1WB5A 5T3YA 1Z4IA 1VPDA 1GO2A 2PNFA 5LU9A 1MVLA 1OLUB 3Q9NA 4ZQCB 1DINA 1TAQA 3CF2A 3L8DA 4INPA 4L5JA 4P8RA 2QQFA 2OPHA 3T34A 7MDHA 5L6MB 1N77A 4Q3OA 2PS0A 3UT5B 1JHPA 3IMEA 2OPBA 2I80A 3STXA 4DQUA 3O4HA 5HIKA 1K8XB 1E60A 2X4LA 3IXLA 4KE7A 4LYJA 5EVJA 2OO7A 4B3SB 1YJBA 2GESA 2VUHB 3R41A 1SKYE 2NUBA 3LP5A 3MTGA 3LCRA 3P0EA 1RU3A 1YIOA 3QU4A 4OJTA 5BRNA 4OLJA 1K2WA 4DV2B 2V9PA 1X14A 1ATZA 4RSGA 1KI9A 4TX1A 2ACVA 1JXAA 5J2TF 4AP6A 2UZ1A 2YV1A 2N46A 3E3AA 3FLBA 4L6CA 1Y7TA 3EULA 1SZCA 2H16A 1J2UA 3MOSA 4CM3A 4Q3EA 1NM5C 3WMRA 1ANKA 1E1DA 1U4NA 2VT2A 2PUVA 1SB8A 2IXTA 3G7NA 5GQSA 5CBKA 10MHA 1FRFS 3UGQA 3TNJA 3KYCA 3L0PA 1E2FA 4DLZA 3B1YA 2Z1MA 1MDBA 1B1CA 1U7ZA 4D25A 2P9GA 2ZK7A 4EG5A 1YB4A 3FLAA 4JB0A 2WM2A 2ONZA 1PS9A 2PMDA 2X7XA 3JARA 3MILA 1ECJA 4K3UA 4RQBA 5EJ6A 3A9UA 3O3MB 4ETMA 1SO8A 1A2QA 2BFPA 1KQPA 2M9MA 3D8UA 4TLAA 3X1MA 4NCNA 5EZQA 3KUKA 1OJLA 3HXKA 4JQZA 3LQQA 2PGJA 5SV2A 1H4VB 3DDNA 1P60A 3MINB 2H0AA 4ZFNA 3EPHA 3ESYA 2ZE8A 3GJ0A 3VSBA 2P3LA 4EG0A 2RIPA 3LQYA 1FDWA 4MA4A 4CEHA 4FCVA 2GN0A 4C4TA 1IY8A 3HVJA 3MJCA 2O5VA 3IIIA 2FNAA 4QDJA 1URPA 2BGIA 2Q41A 1FFXA 4OJMX 4CKYA 3A6PC 3UJAA 3LCMA 1MNAA 1UT5A 3DMGA 4R3NA 4XCXA 2BCEA 3W4IA 1GT6A 1E2UA 2FSPA 2IEGA 2EFCB 3EY9A 4RM2A 1PQPA 2QUIA 3UV3A 3QTLA 2NSDA 2RHJA 1CZLA 1Y9EA 2QY6A 4QHSA 1UR5A 1EGVB 4MKZA 1W52X 3RK1A 3TZHA 1DDGA 3QA9A 1OLXA 3D8TA 4QM6A 1E9FA 1Z6XA 4KVFA 5AK5A 3RYFA 4H35A 2IOQA 5KTKA 5GJBA 1WV0A 3RANA 2C07A 3CWCA 4NEGA 3BA6A 5EXEA 5JZSA 2WKWA 3WE7A 1AA9A 2PLWA 5EP2A 3AT1A 5B1DA 3PEWA 3RNOA 1P0QA 4QSMA 4BZWA 5D85A 1TCUA 2XA9A 3LJKA 3LWBA 3KQSA 3FOCA 5D86A 3ZS8A 5LWHA 5DM70 2IYAA 1ZUWA 5L7WA 5LU8A 3OT1A 1QV7A 3D5QA 4ID3A 2CLLB 3K0AB 3SKYA 2GAOA 4LF7B 3D2LA 4F2WA 4J0IA 3B3QA 5KNCA 3S8EA 1NSYA 3H1AA 3L92A 1UWCA 4P5DA 2P3QA 3ZBPA 4B34A 3KJZA 2Q6TA 3MXOA 2ZRBA 2BHSA 3M6VA 2GCOB 3N8NA 2VNKA 4Q3DA 1GTJ1 2XQFA 1PAUA 3ORFA 4YJHA 4B3DA 4E30A 5CXQA 2IHUA 2WNHA 4BTEA 4I3GA 5KB3A 7ADHA 3MGBA 2NNLD 5KNBH 1L4YA 4BQFA 1MZVA 4KIJA 1EX7A 3TSCA 3DYBA 4B8WA 3KEGA 2IIBA 5EYPB 2NTNA 2EFYA 2DWUA 3T0IA 1E92A 1TTHA 4X94A 4GECA 4BNVA 4ND8A 2WU4A 4A3SA 4F7DA 3CSSA 3ZVKA 4JLDA 1D6MA 5IZCC 5C7YA 2H3HA 4GQBA 5HOEA 2REXB 2B61A 4JT2A 4Y0VA 4ECAA 1W5SA 5BVHB 1XCJA 3KEMA 3Q3VA 1H23A 3PJDA 1JQAA 4LKOA 1W5EA 2NUTB 4N5LA 4WNAB 1QG2A 3GPIA 1MOSA 1QHGA 2Y9PB 3BDVA 4G0OA 3JD4A 3U81A 1Y0BA 1MGOA 5J5VA 2E6KA 3GLIB 1QPZA 2C5FA 1OYYA 4UQPA 5A9SA 1TA0A 3M1YA 1L5OA 1Y1RA 4MLPA 3QV1A 2YIMA 1BWSA 2YV4A 1N92A 1D5CA 3KSAC 4YQEA 4CMBA 1K7EB 3PNVA 2NU6A 1UKCA 5I48A 4J4BA 1XJQA 3BZUA 4TM7A 1XDZA 4F5YA 4OHFA 5U9CA 4KFCA 2ZIZA 4M1MA 2PUEA 4NS1A 2NU8B 3A1UA 3KZ1E 5ERYA 4ZQFA 1DP4A 1X8JA 3D7RA 1SQ5A 1QUEA 3HTXA 4MWOA 3JQGA 4RIEA 5GP1A 2FR1A 2P7IA 3A4MA 1W6RA 1Y5LA 3I9JA 4DB4A 4AUMA 2WHQA 3QENA 1G16A 1J39A 3KPJA 3WB1A 5EJ9A 2H63A 3BTUA 4M2LA 4CVNA 4G0UA 1QZTA 1JALA 2APJA 1UC9A 4F5WA 4MICA 5LPNA 1OT3A 1ORVA 2FN9A 4BMPB 4E7OA 4XSGA 2AOTA 3BSWA 3OSZA 1U1EA 2OXFA 4LV5B 5AHWA 4AY4A 3SPXA 3JRXA 1G19A 4GLJA 1H22A 4PAMA 2CUTA 3TPCA 1KI6B 2QG9A 1WVMA 3R7WA 3TLJA 3U3ZA 4A0RA 2O05A 3O91A 1T5HX 3AOGA 3ZHOA 1MIOB 1P0MA 4DCJA 1B0ZA 5ECWA 4F04A 2O8NA 5KX5F 4O4LB 1XCBA 4Q18A 1J6UA 2WM9B 1GGJA 3L46A 2HPHA 1PZFA 1RVDA 2I2CA 1Y7HA 1P7YA 1RQGA 2IODA 4GM4A 4WXYB 1RZRD 4IYRA 3K5PA 1ZJ4A 5EXDA 4HI0E 4MRSA 2OTCA 1AO3A 1X7HA 1BS1A 4BGIA 2V8OA 1KNXA 3NKFA 1YCGA 3RVLA 1ABEA 3GA0A 3ZXIA 2GEUA 4DUGA 2FUG1 4JFAA 4ZIRB 4FZ3A 2ATIA 3FTEA 1R8JA 4MV3A 3WNZA 2A9JA 3D54D 1FDOA 4GWLA 3TVTA 1QP0A 3ZDCA 1DAFA 4COOA 1GNQA 4KODA 5IS2A 3PF9A 3PUYA 4QATA 3AEKA 1XTQA 5KVSA 1LDBA 2AD5A 1IH8A 1XU7A 2F1IA 2C3PA 2XYRA 3IDQA 3KHUA 3DHWC 3KVRA 8GPBA 3GDWA 3AIMA 4ND4A 2HUNA 3F8TA 1TYDE 4G01B 3SJBA 5KSWB 3ENQA 4O2AA 4C2BA 4OYRA 2XOKD 1J0EA 1LS1A 3NEPX 5A4FS 4EY4A 1REQB 1XDBA 2WDZA 2WWHA 2PS3A 4ZPJA 1M7HA 3AC0A 1AHIA 3WKEA 2YVLA 3F96A 2CDRA 5EJ5A 1RBYA 4IINA 1VPEA 1P7VA 4XVRA 5FYDA 4AZWA 3DJFA 1KGSA 1XZJA 3DFUA 2YRFA 4RD2A 4YJGA 1JLLB 1GTG1 3EMBA 4DTCA 3V4RA 1QGDA 3FTFA 3I72A 1UMBA 5T8KA 3K1AA 4IOJA 1JZSA 2W2VA 3BH6A 1NC3A 2R2GA 1LPBB 4WACA 4D9HA 2HX1A 1U4SA 4YMGA 5JV5A 2JG3A 3TNFA 1BROA 3BMQB 3JATA 4JLBA 4M87A 3VYVA 2WUFA 3PWSA 1HPLA 2BR4A 2W2MA 3A14A 4FR2A 2ZULA 4QTUB 3EJ6A 1YS6A 4ARVA 1HMYA 4XWWA 5IDYA 4QO8A 5ALFA 2VN8A 3D2BA 3DOHA 4JYBA 2ZIFA 1X7YA 1M2EA 3TZLA 2ECPA 4RULA 4ND2A 2VQFB 3GJ5A 2XZDA 1AZSC 3NYIA 3RRXA 4ACBA 5JD4A 2VTKA 4HX5A 3E2IA 4DA0A 3IVCA 1BU8A 1QTIA 4HB2A 5GADl 3FI0A 1OI4A 5ITZB 2GHTA 3RSQA 4B7AA 3JWEA 5K45A 2CNKA 3S81A 1NUAA 3JYQA 4FYKA 2ZSDA 3D6MA 2OL4A 2PR2A 1P1BA 4R1MA 1QPGA 2EIHA 4NAUA 1FQKA 1C0PA 2AJBA 2Z3ZA 2FWJA 1PR1A 1OLXB 3UJNA 1B14A 2QL5A 3BGWA 2CDAA 1QU3A 1TO2E 1W47A 1ZBDA 4OQ4A 2QJWA 1WPXA 1JWAB 3E27A 2EGUA 2XEXA 4JDUA 1QZZA 1Z0DA 4MV4A 1GFZA 2ZWAA 9LDTA 4JLAA 5BN5B 3RB8A 4ZEMA 2I4OA 3ETHA 1U2GC 2VG8A 2W58A 4LFBB 3SM9A 2F90A 2HIAA 3AF6A 1IQPA 1FNSA 4R8VA 3SJ7A 4NHOA 3ZV7A 4LRXA 4JKYA 5E6SA 5JAUA 3M83A 2P9EA 2BPOA 1SIOA 3TINA 4E2ZA 4J90A 3MQ4A 1P9OA 1QSGA 3KV3O 4A1FA 3I73A 5FV4A 4L15A 1IHOA 5BMOA 2EG9A 1ACMA 2IDMA 3ZXYA 4BMVA 4URFA 4EGQA 2YL2A 1OZHA 3RFXA 4GBJA 4YMUA 3JAMA 1Z6GA 3PNKA 2HU7A 1SPBS 4LC0A 3QEJA 3PXGA 3TK1A 4AP5A 5HZHA 4UBIA 1Q1QA 3GPBA 2ZT7A 4YRSA 3FNBA 4RTQA 1A71A 1MO4A 1Y6FA 1NBWB 4Z2YA 4NBVA 3O83A 3HC7A 2C7BA 4CL8A 1IN4A 4HYEA 4MI1A 4RD4A 3LIPA 4DMHA 5REQA 2HIMA 1CWUA 1GN8A 1PIWA 1Z39A 2FMHA 3MGAA 1VJDA 3UA4A 1SVOA 4CL0A 5CDFE 4UPDA 4ZQBA 4ER0A 3WWCA 4I5DA 1ZM3A 3UHFA 2B6NA 2HK9A 2VJQA 2PX4A 4WVLA 3UMSA 1D4ZA 2GAIA 5AKYA 2B3DA 4HWSA 4BNGA 5L9AA 1OZAA 4O4HB 4YK7A 4BPBA 2CXHA 1ZUNA 1OBOA 2R4TA 1RYHA 4Q48A 5FPSA 3VJRA 4JYPA 1SMKA 3S1LA 2CZQA 1TK9A 2P4UA 2IYSA 2KBEA 1G2PA 4EG7A 3BN3A 2GN6A 5C4IA 1V6SA 4YJFB 5G0WA 5LFAA 2IKQA 2OHVA 4CLRA 4DIBA 2ZPUA 1FMTA 2ECQA 1Z7YA 2I87A 3ACCA 5LDHA 4WK4B 3QNWA 2DWOA 4M0FA 4NYMQ 3K7EA 1VL6A 3D8NA 5E3JA 3THWA 1EEHA 1X7XA 2PYZA 1MC5A 1V1RB 5TVGA 2FZWA 4YRAA 4RVFA 5AW7A 2FMKA 4LF5B 1KMHB 3LM8A 1IJEA 3ZV4A 2VIIA 3FGOA 5JU6A 1JVBA 1TMKA 1W4ZA 1YRLA 2OXRA 4UMFA 1Y34E 1YU6A 2X9LA 1KH3A 4R1TA 1M8FA 4ZAFA 3K94A 4O25A 2XCOA 1XE3A 3TUJC 1R9GA 2HTEA 3M5WA 1Y3BE 1SVKA 2XMCA 2ZVQX 5H1YA 2NU7B 3TI9A 4BKQA 4RD0A 3C4QA 1CDDA 4I66A 2XUPA 3MLBA 2IEZA 1ARZA 4L5AA 1AS2A 1UK9A 1YNSA 1GIAA 1PEDA 4KBYA 4BVHA 1K8ZB 3NHYA 2OHXA 3G0BA 1EIZA 1QYXA 2JKVA 1PHPA 2OO5A 2RB4A 2FQQA 2WC1A 3P0IA 1T3SA 1FMLA 4W7SA 3RUDA 1UODA 2PIDA 1NXTA 1KDYA 4BOYA 5EJ4A 4EY7A 1I7QB 3DBRA 2OA0A 1DCKA 5BQPA 1EFLA 4MINA 2XUQA 2W4IA 2VOJA 4GR4A 5BR7A 2Q5EA 4NMXB 4FYYA 3N6VA 2D1YA 1IQ0A 1DC5A 4CV0A 5I6DA 1RC0A 4FYIA 1L7MA 3NIBA 3TIVA 4F2PA 4MW6A 1GD1O 1OE0A 5DXAA 1T3HA 1NAIA 4O4HF 3M9XA 3RAFC 5BWLA 3WYFA 2DTEA 4OK6A 5THQA 4IUDS 3L7IA 4IBOA 5I7VA 2DLNA 4ZXPA 2PM8A 2IEAA 2VNAA 5AW0A 3HJTA 1HLDA 1BTOA 4OQMA 1DEAA 1ZNZA 1BO6A 2A7QA 2UXDB 2P2YA 2YTZA 5HKOA 2I2WA 3S8YA 3K31A 4IS3A 2QP3A 4WN9B 5IAAA 1FDVA 1T4BA 4V03A 3KZNA 1Z07A 3GUUA 4C6SA 2NUAA 1RCUA 7REQB 1PKXA 2RJ3A 3AR5A 3VSEA 5HCUA 1YO6A 2FPUA 3MW8A 4C05A 1R10A 2HMUA 5AVUA 3GAMA 3KKNA 5IK2D 2JIDA 2OAQ1 1HLFA 1M6HA 3LUFA 3NGLA 4JAVC 4LJSA 1LS6A 4IDDA 5IJ9A 2EXXA 1YRYE 3FCOA 4WA7A 5KYGA 1DJOA 1KFCB 3DM9B 3S2EA 3Q0TA 1A8QA 5TF0A 4X00A 4RTMA 1P0FA 3RT9A 4HT3B 2AOXA 1E0KA 2NIPA 4NOLA 4HPJB 2Y4OA 4PONA 1OBVA 3LWZA 3VOAA 3WYCA 4WE3A 5EINA 1DAOA 4ZHQB 3ESRA 1F8GA 3MSCA 2A6PA 3CE6A 4WVFA 5KAPA 1UBHS 3G1TA 1RM4A 4XUGB 4UQOA 4Y0NA 4DQLA 4EYKA 4OX9B 1IXZA 4CM4B 1YFKA 5EIFA 3UXEA 3VYTB 2F48A 3AEQA 1WDKA 2GJAA 1Z2EA 2V3VA 2AF3C 4PYQA 3DHNA 4X7PA 3SQWA 3AR9A 2OGWA 2W6IA 3EFEA 3HP7A 4Y2VA 3IIKA 2IYVA 2XE8A 3CN9A 4HBGA 4Y6QA 1CVLA 1WCIB 2GR9A 1TKBA 4PYOA 1E4OA 5G4KA 3WLJA 3KPWA 3LPCA 1C8LA 3NOQA 5WRFA 1ZHOA 1J2TA 3UK7A 5GGYA 3AUTA 4YUWA 1B73A 1BQ3A 4IIJF 4YAEA 3VTKA 3AUAA 1P2SA 5JWOA 1K3UB 3SGLA 2Z30A 3TLZA 4HAYA 3FUVA 4J29A 4RORA 1ZUNB 3V4FA 5C8XA 4PS0A 1Q0PA 5MN4A 4N3NA 1M2OA 1VHDA 2VK4A 3CN7A 2FPXA 4L8GA 3VPHA 1Z25A 5JHGB 3HYNA 2OGZA 1CBUA 3KSRA 2CDBA 1PQWA 5T7BA 3KETA 1PZEA 3W5UA 1XV5A 4GYWA 3VZCA 1KU6A 2RHCA 1QZUA 3GLSA 4MKHA 3IPLA 1QOZA 4LMRA 4OB7A 1L7QA 3GCDA 1SZJG 2AQKA 3EXG1 3JALA 1R00A 1M2WA 1U98A 5B57C 4JVOA 2W2LD 3OTOB 4JBIA 1N4AA 4ABTA 1JA1A 3LX6A 4L4ZA 4XYGA 3HBLA 3RWBA 2GYVA 3KFLA 3WGLA 4QEDA 4MYDA 5IFKA 2QU8A 1VLZA 4IICA 4JODA 1AQ6A 1TKAA 1WDLA 4DV3B 1X9GA 4GYYA 4C0WA 5LNK6 5C7OO 5I4BA 2QTTA 5GPBA 4Q1CA 3HRIA 4LNUB 1UDBA 4XWTA 3JRWA 3KKLA 1QFZA 4X62B 3AU8A 2JL1A 3LFHA 4RABA 3H84A 4MMYB 5IAKA 4WOCA 4ZXFA 5HKKA 3O9VA 2D5LA 2TECE 1WXHA 2IXAA 1AKQA 4ZCPA 3ANXA 3TR6A 4B6QA 1T15A 3J7TA 5LIRA 4DLAA 1XT6A 5JI3E 2C58A 4YRBA 3PYMA 4Q7MB 1XTIA 2QSJA 4G09A 1GLGA 5T4HA 3DDWA 2A8YA 2GLUA 2IP2A 2VYFA 4DIUA 3A7EA 4EIWA 2PH5A 3CYFA 4CI9A 3F97A 1TGVA 4P2GA 2WD7A 3S28A 3P9CA 5C80A 5I9LA 2EZ4A 2DU8A 2XYVA 3E7PA 1BGVA 2ONCA 3C98A 1GRVA 3DR3A 3KAPA 3W8EA 1RPZA 5TIIA 1UKYA 1XCPA 1ECLA 2CC2A 1FK8A 2W6NA 4YRTA 4F06A 4EMTA 3FR8A 4LBZA 2FW0A 3KEOA 3HUUA 1DU4A 3E48A 4DMCA 1IZYA 2B9EA 4DY4A 4PLZA 1R5NA 2QYHA 2ZRCA 3JAWA 4PNHA 2FPRA 2YN2A 3NT5A 3VSAA 5KZMB 5L51A 2UDPA 3X1DA 2FPSA 1N6NA 2Z4TA 5K8UA 3LCJA 3RR2A 1U0SY 4WK6A 4HQ6A 3S70A 3PA8A 3L5KA 5AI0A 4GE0A 5EIEA 1P2UA 2OQIA 3N0VA 1L5LA 4OKIA 3WNVA 1T43A 4AL4A 2ZTMA 2IU3A 3PHJA 3NHBA 5E1DA 3VR3A 3IUSA 3OIYA 2ORVA 4KQWA 3PEVA 4FSXA 4B3RB 3UXHA 2CMKA 1M2KA 1CLEA 3T9CA 4R41A 2QPLA 1FUIA 3RRJA 1RYEA 1PLJA 2Z2KA 3GEGA 4QXQA 2AFIB 5IAEA 5BYKA 3H5OA 2CV0A 1FP7A 3B1ZA 3FWPA 4IIFA 2H4JA 4HVCA 1NXQA 4TSRA 1IU9A 3ICQB 2QEQA 5HPYB 3L43A 4BN0A 1CX9B 3SBEA 4DIKA 3CM0A 4QREA 5CXSA 2I54A 1YE8A 2NUPB 4Z4HA 4ZEVA 3V4ZA 2QNRA 5HRCA 5JY6A 5L53A 2ZBFA 2JGJA 4GGPA 5AW2A 4BLPA 2MSWA 4ZT4A 4DGSA 4FHFA 1HYQA 1A2OA 3QLEA 4L3OA 1BE8A 2C94A 4DNQA 1CYEA 3IP9A 2AG1A 3AG6A 1UMCB 2PCJA 3QUQA 3C3DA 3TEJA 5JEEA 1FVXA 2YIJA 3LHDA 4AN1A 1GQYA 5K1ZA 3K0EA 1DC4A 2XV1A 2ZJAA 4P4NA 2HYIC 5B2FA 3OZXA 1QH0A 4YGYA 1UKAA 2PU5A 1ENZA 1ONSA 4CTMA 1D8AA 3ZGNA 4B76A 5DNEA 3ON5A 4YDQA 4DWJA 1BDIA 3K2BA 3ZWVA 1NLMA 5HQJA 1QQ6A 5KTRA 3IT0A 1JT9A 3LLUA 3GNQA 5HF9A 5B3AA 5TMPA 3H97A 2WG1A 4FTWA 3REGA 4O63O 5EWMB 4FHCA 1FX0B 2QJRA 4QYTA 4ZYWA 1K9VF 4EJFA 3KR0A 1E98A 3BMNA 2JLRA 5CCEA 1WBBA 3N2NA 3FYSA 3I23A 1VA4A 1FFBA 4I6EA 1N1MA 4QDXA 2WUEA 4LYYA 1NVMB 1OD6A 1YJ8A 5EFOA 4PF1A 2VHTA 1G8YA 2JAQA 4AAYA 2F1OA 3M6UA 2XUKA 4WGFA 1KAEA 4I7EA 4L72A 4TKUB 2IY9A 4CF7A 1J70A 3M82A 3P9KA 4LI3X 4F4FA 4KR2A 1XZKA 4Q05A 521PA 4HEA1 2CYBA 3KE9A 1IZ9A 1IHDA 3L6CA 3T7SA 1E2LA 4YB8A 1DJNA 2V9ZA 2HMSA 1EX1A 3B2QA 4PC1A 5IABA 1YAJA 2KPOA 4YI3A 4NJMA 3UV6A 2XZOA 2AKEA 4AN4A 3FF1A 4TV8B 3M1IA 4MZXA 4NENB 3B7WA 2OO5C 3UGKA 1XWFA 4G41A 4B7UA 1EDEA 1TYCA 2CNDA 4UE6A 3DZ8A 1RI4A 3M9LA 2F3TA 2GARA 3AINA 4LJAA 3EFBA 5HRUA 1F2TB 2VJOA 2JFWA 2X1MA 4BFYA 4ZCMA 1CRPA 3HJHA 1L5WA 3AVPA 2VCEA 4QKQA 1XRRA 1SHTX 2ASVA 2P41A 3H1FA 4BJHB 3FNGA 3OZGA 4DNFA 3BMOA 1WA5A 2I6UA 1DAEA 2RARA 4TQAA 4C0XA 4KFTA 2Q3FA 4V0RA 4ENUA 2EZ8A 1NVBA 4KXYA 5G1NA 5K3AA 1ULUA 3BGDA 3ZCQA 3W5DA 1ULAA 1GR1A 1QBGA 3ZS9A 5KTNA 1I13A 4MO9A 4YYZA 5DYYA 4M37A 2DUJA 4U2KA 4XCQA 3IPRA 1W6UA 2HNKA 2WPDD 4HAUA 3VRHA 1VKOA 3Q8XB 4ONEA 1UCFA 3II6X 4KNWA 3KBBA 4N7JA 3RBAA 5HFNA 1P1FA 2YV2A 3IOMA 5KC8A 3VZDA 4MVJG 3PFWO 3GC6A 2BI4A 4TL6A 5FBWB 3CG4A 3GRRA 1AA6A 2I03A 2YX1A 2VCYA 1D9XA 1XLWA 3ZWWA 3X43A 1M2HA 4PCVA 1RWQA 2OOKA 1SBTA 5CG1A 4BWFB 4A6XA 2F8SA 5JTTA 1WOYA 2QVYX 5BP7A 3Q0EA 4UEJA 5JMPA 4DJFC 3ITNA 2PFKA 3FBTA 1XZPA 2I8AA 4L8FA 3H65A 1C4KA 1HKHA 3KSUA 4K6CA 4B74A 1G8MA 3Q7RA 4YVFA 4J7CA 1CQIB 5AXAA 4AUEA 4BNHA 5TLSA 4ZC8A 3STUA 4HLUC 3WIBA 5AM2A 1X74A 5KQMA 1HDEA 2CXPA 3B3GA 1KI2A 1TZMA 3ORSA 5CR9A 3N6RA 3SF0A 1X7ZA 2X8LA 3DMRA 1WSBA 2PYDA 4DBVO 5KYXA 1RFLA 4JVLA 1DC6A 4XRRA 3MTIA 4BFVA 4DMKA 3TX6A 2MR5A 3GVHA 4LEIA 1KEWA 4BO1A 1T8SA 4AMZA 2BJVA 2EW2A 2ZKIA 3KKMA 4Q7KA 4TT3D 2RKBA 1M6NA 4LRSB 2RHMA 4AJ2A 4BMSA 1RXIA 4Q9AA 2JB9A 5ALOA 3SVTA 1VMKA 4FMCB 4O4JA 2CKMA 3Q15C 4UUAA 3UG6A 2Q5IA 4N6NA 3SSNA 2CKDA 4JP1A 5LP6A 1AKWA 3QKSA 2A0KA 1STOA 4JYAB 5TY0A 3B9BA 2HF9A 2AHOA 3R6LA 3IEVA 4XH9B 3VHQA 4PWZA 1DC8A 3L6BA 4GD3Q 1N7HA 3FKQA 2RHRA 1PJ2A 3OOHA 3HO1A 2PO5A 3A06A 3QPWA 4X95A 3HCPA 3FG9A 4WOBA 1RKXA 5LD2B 3EEQA 1WV1A 3NCHA 2IUUA 3NAZA 3UHPA 1FFAA 4PLYA 4ZO4A 2OFXA 1JECA 3COPA 2FG5A 2XIQA 4UUNA 4UU0A 3N3BC 1RS0A 4JL5A 3WL5A 1RSZA 2BDTA 1L1QA 3ACBA 3D2AA 4JSRA 4K6MA 2VHUA 4C7VA 2HDHA 2H59A 3EDRA 1JEQA 2LD4A 5E95A 4YMLA 4MVWA 4LVCA 3BRWD 4UTNA 1IK4A 2AW5A 4N5NA 3FDXA 1RE0A 3OMLA 4K26A 3W04A 4ENPA 5L3SA 2FE4A 2GB4A 4RPIA 3QU2A 1UL1X 2AOVA 3F0TA 1CV2A 4Z2AA 1QQ5A 1ZD4A 4CU5A 2DQ4A 5B1HA 1NRJB 3FCYA 4XGKA 1MQ9A 1JKXA 3IJRA 4Y1EA 1GU7A 3G0IA 3V5NA 2RHGB 1CR6A 4N12A 4X64B 3WZMA 1EJ2A 2B8TA 1YVPA 4ZDKA 1FMFA 1N2CA 2CVQA 1XA0A 1GL6A 2YOGA 4K1LA 5FEUA 2VRBA 5EJFA 4TV8A 4V2UA 3ZEAA 2C92A 4MPTA 2H7XA 4LDNA 2XMBA 5IM4F 1EKXA 1D2AA 5SZKB 3MS2A 3RBXA 1PVVA 3ICEA 1OXTA 1LVHA 1N3YA 3H04A 1TM1E 4RACA 1ZI6A 3UA3A 1E79D 2IEBA 4TLEA 4ZT2A 2GEBA 1WUTA 1CZHA 1E61A 2VP3A 3AERA 3DLIA 1XC7A 3TLXA 3QQPA 4DR2B 3V8MA 2O2YA 4MVCA 1K6IA 1PNVA 1PR4A 2UVQA 3ONDA 4FU0A 4E03A 1NNLA 4U9UA 1VG0B 3EWNA 5A7HA 2GN4A 3D8HA 3I2GA 4IJMA 3DCNA 3WLTA 1Y3DE 1XKXA 1ZMRA 3VR5D 1C30A 1JG3A 1L6RA 1G60A 1T4DA 3FTDA 4TTJA 3ZZNA 2FN7A 2RC5A 5IG2A 3OCUA 2IYUA 4QUAA 4QT4A 2I4LA 3F2VA 4E5PA 1EFRD 1BEEA 1VI6A 2NYRA 3U4HA 3DTVA 5KOHB 3IKLA 3SSOA 3BEDA 1T1EA 4AFNA 5H3LA 4RMNA 3JXEA 1QTQA 1NONA 3VV2A 1Z16A 4F6RB 1GPAA 3ROXA 5KYKA 4WN3A 4C9BA 3W7VA 1N8SA 1T2DA 2Q4OA 2GPAA 1S1CA 5SYMA 2Q5OA 2W2PA 1ZX1A 4IDFA 3F9IA 4RVUA 4LZZA 1EFAA 3A2NA 3UNXA 3BKXA 1E6KA 4BO8A 5GOTA 1IBSA 3F73A 2I7VA 3NU1A 3QTBA 4Z4GA 1RMYA 4DCTA 3RUHA 1Q1GA 4D92A 4URWR 4UEWA 4D8XA 1T5OA 4QELA 3CCFA 1N7GA 1Q16A 3SQMA 3WG9A 4EWLA 4F5DA 4YJ3A 1WD7A 4EHAA 3RF6A 1YV9A 1IJBA 3K2EA 3KOXA 1NLYA 4AURA 3EOAI 4UOEA 1QE0A 3R5XA 1SXJD 4BUZA 2XAUA 4KN8A 2X0DA 1VBFA 4DCSA 4DXHA 2NG1A 3OM1A 1X1AA 2XTMA 1XR3A 5FL7D 1NP7A 3HI6A 3GP5A 3DE6X 4C08A 1T4GA 1T1RA 2C20A 4H16A 2B3TA 2CBGA 3N8GA 2WUVA 3OKPA 5FO1A 3HPRA 3W77A 5EVCA 5HM6A 4HXGA 2GEDA 3H8WA 3AI2A 4XI9A 4YASA 3DOOA 3UOGA 4GH5A 5E6RA 5CURA 4C4SA 1C8KA 1S6YA 1L4EA 3K5HA 4EBFA 1GV1A 4TWZA 4TMKA 2XOXA 4OBEA 5KQSA 2O9JA 2V5AA 3EX7C 2PRKA 1UP4A 2F00A 4GXQA 4NMHA 1POWA 2VA9A 3WYEA 3HY4A 1D7AA 3Q4GA 1M5UA 4LSMA 2PGLA 2ZATA 4MNTA 4ZDWA 4Z4QA 4MQEB 3AVVA 3VO1A 2G4LA 1XJWA 4II2A 2ZGVA 1RHJA 4BO3A 3E0XA 2JI7A 3OECA 3TZKA 3PHGA 4NE7A 2IDZA 3IEXA 4PZAA 1NX6A 5HS6A 1KQ3A 3K0FB 1PHRA 2YWRA 3ZQUA 4YT5A 4KX3A 1K8YB 4FDLA 5EUCA 4KXWA 2YBEA 1CYDA 1J9ZA 2D4AA 4AULA 2G7MC 1LX6A 3DE5X 4B09A 2XUJA 3S7TA 2Y1WA 3IMCA 3DE4X 1ZOOA 3KQOA 1MG5A 2GVNA 2WJWA 2ZBVA 1NOIA 3LBFA 4ENTA 4ER6A 1NQUA 1TJ5A 1RDFA 1XAIA 2W5UA 1SKAA 4QGFA 3VVMA 3T5AA 3DEIA 4I8XA 5JAPA 2QM0A 4D8VA 4HDNB 2X6QA 2VJMB 1CR4A 4LMAA 3DMNA 2XJ4A 3N0RA 4NMMA 5EZSA 3LDHA 1ZXLA 3N6XA 1UH5A 2F62A 1MLDA 1QJ4A 1W96A 3M89A 5FLEX 2QV0A 4ZVQA 3GL9A 3ROPA 4B71A 3U4QB 3IP8A 3SX0A 1RT9A 1F4VA 4XJXA 2PUHA 2DX7A 2G67A 3HZRA 5SY6A 1YZFA 5DSTA 3QVLA 4YFYA 3V8PA 5KQRA 5BO5A 2GAFA 2YH2A 4JA2A 2D3TA 2O2IA 2CMFA 4CF6A 3F1LA 3VO2A 3AETA 1LRKA 1VRVA 2VSXA 3CBQA 3AP3A 3DLAA 4DLTA 2JLZA 4UDYX 1S2DA 1N2JA 1JHXA 4GX2A 4V1CA 3WQRA 1W36D 2BMAA 2JD2A 4LDQA 4LXXA 4YHBA 3JQEA 1V95A 4ALLA 4K1XA 1GSHA 2PMFA 2EJTA 4OLBA 3HU3A 1OA0A 4F96A 1C9NA 2BFBB 3RVBA 3MTDA 4B3GA 3EVEA 3UCFA 4OU5A 2WYUA 4QDOA 1I30A 4UXJA 4UVIA 3AY3A 4X20B 3B3JA 3R5KA 4C1BA 1Y89A 3IXQA 3CEMA 3ENWA 3TB6A 5ALTA 4PPQA 4WK2B 4WZAA 5COBA 3EXHC 1RWKA 1RQ7A 5CX1B 5KSPA 3A3YA 3T52A 1R9NA 4FGLA 4BX8A 3DD1A 3P94A 3BTVA 1UUFA 4J0CA 1E3DA 1QV6A 1EBBA 5GV8A 2XTJA 3QVSA 4RHYA 3UC9A 1U8CB 1EHIA 2YQ5A 3M0EA 2H48A 2G4CA 2OZPA 1JIQA 2O2DA 3N7AA 4F2DA 2TMGA 5CLIA 3GMSA 4PZ0A 5KI6A 2MYTA 1E20A 2O7NA 3LMKA 2A78A 3ZKWB 1YS4A 1N5IA 2EU8A 1BYIA 2AWOA 4GZ5A 4QFMA 2Y1KA 2VP6A 3T12A 5BWNA 3EA0A 2ZWVA 4KZKA 4F4JA 3HCCA 1TCAA 3NANA 3KCNA 2FPPA 4YRLA 1X1CA 4HX9A 4BN4A 4EZIA 4KQ6A 2BM8A 5KINB 3UT6A 3HMKA 1PW7A 4JBWA 1J20A 2EEZA 2IP4A 2VEDA 4IDCA 4MA5A 5ECDA 2EQBA 1NXXA 2ZAGA 3WAKA 1L4KA 4OOEA 4WEOA 4ZU1X 5ENVA 2O2ZA 4HWGA 4OQQA 1IPEA 4RO0A 5DCUA 3W1EA 1A4XA 1DARA 3K9CA 4IEEA 4PSKA 1DIGA 2B2XA 2WJ4A 1E6CA 4CETA 2C2KA 2HZBA 2FW8A 3A1CA 3JQBC 4HG2A 3DFMA 3HZZA 4L1KA 3NS7A 1O7JA 1EG7A 2IHJA 3L40A 3H2HA 3PUVA 1Y5RA 2ZR7A 4AICA 4AO8A 3L7CA 4K87A 5ITSA 1NV9A 4FB4A 1HEUA 4ISBA 4DKJA 1U94A 3CGGA 2LNDA 2ADOA 5H8WA 2R11A 1X80A 1XSEA 5BOVA 3I9OA 1TJPB 1WY7A 4TTRA 1Y1LA 4X1KA 3L8FA 1EFRA 1IRXA 2QN7A 3ABSB 1XTRA 3EC1A 1HSZA 4CF4A 2PT9A 3BC1A 1ORIA 1RMQA 2VA8A 1YDFA 2K2QB 5E9JA 4L50A 5AJYA 4XARA 5F73A 3HG7A 2Y1DA 1U31A 1MA0A 3HCEA 1A82A 2AF4C 3NV9A 2B5VA 4OSOA 3GWGA 5LDGA 3OZTA 3SJUA 5B7PA 5M29A 4XWYA 5HM8A 5MFPA 3GRPA 4AMYA 2SKCA 1E3WB 2J0UA 4GO1A 2EQAA 2QL6A 4NIMA 4PPFA 1U5BA 2WZDA 4YIHA 2HU8A 2FAXA 2QR2A 3BHJA 3F6SA 3U4AA 3ESZA 2HD4A 2H8GA 2PWAA 2FCRA 1K5PA 2ISQA 3KOZA 2TRSB 4R98A 1W1WA 4U2FA 4MUYA 4INOA 2PUCA 3Q7PA 5K8IA 3C0KA 5EC8A 1PVDA 1UXKA 4JBGA 4LWQA 2R84A 4I1RA 3T3EA 1W2GA 3H7IA 2RG7A 4TQ9A 1YF3A 1QXSA 1F6DA 2EF1A 3EWIA 2GLTA 2E4UA 2XWSA 4HVTA 5GONA 1KORA 3NT4A 4RZHA 3VYSB 2P6RA 4AQYB 3B1XA 3O4JA 1Q20A 2ZROA 3HFRA 4RAQA 4WI1A 1JPUA 3JD2A 5JAIA 2G1PA 2G76A 1YCFA 3AUXA 3BRWA 3MK31 3OZFA 4RV4A 5TARA 4BHTA 3AGPA 1AJEA 1DAGA 1RKQA 2VPTA 3CIFA 5FNVA 3ZWKA 5IM5A 1I4EB 1EFHA 1GLVA 2DVMA 2PSHA 1TK3A 3KTAB 5ARCA 2ZP1A 5FJIA 1RXVA 1FFGA 1GNRA 2XH8A 4V39A 1Q6YA 3Q9SA 1XU9A 3L8GA 4XIYA 3H1GA 3LUJA 1T9CA 4L8YA 3WGKA 1SBNE 4OK5A 3S55A 4FE7A 1OY1A 4PX5A 3LY8A 2WWRA 4CMCA 1CK4A 3RC3A 3OEYA 5GAJA 1ORRA 1U04A 4YR7A 5FOUA 3S44A 4L8VA 1V45E 1EK1A 1ML4A 1QQTA 4YNBA 5FTJA 3VR4H 1US8B 2Y66A 2W98A 2Q6LA 3UT0A 1P19A 5JJBA 1C3VA 4MB0A 2NQTA 4HNRA 1AXRA 3IKJA 2QVGA 3QUBA 3ILHA 3LI2A 1AKTA 2R7NA 1IHYA 3RK4A 4D2IA 4DPMA 1KMQA 1NJGA 1Y1KE 3CZ9A 1EFPB 2GA8A 3K0FA 3JWIA 3B51X 4NCHA 3DKVA 3DMHA 5HK9A 3G49A 2FKAA 5JS6A 3K1TA 3HUEA 5CFMA 5FH9A 1FLVA 2QTAA 3IHLA 4LDJA 2BTQB 2I5PO 3EMKA 4OKNA 4KO3S 3H2GA 4P84A 1D7OA 4TT3A 4Y2QA 3TNYA 4M7WA 5FYQA 4CMJA 4BBPA 5AW8A 4Z9BA 1P39A 4C0KA 4B4VA 1XO1A 2A67A 3B85A 3LF2A 3KT3A 3EW9A 1IE3A 1TZBA 3JD3A 4FT4A 4LOLA 3K9FC 1FTWA 3OX4A 5TGDA 2VTEA 1XA4A 1PL7A 2VPQA 2IZ6A 3BXPA 2O1WA 1Z2PX 3LL4A 2FMXA 3NOOA 3L82B 5F3DA 1C7JA 3IA2A 3WKDA 1KY3A 4KVZA 4BQQA 3WQSB 4BB9A 3SMVA 1NLZA 4GR9A 4M53A 4FM9A 1AUVA 4RS3A 4X6XA 1RRFA 4UQLA 2B9VA 2AEFA 2ZETA 4YY3B 4PV7A 5FUYA 3FHLA 2Q2QA 1K06A 2G7ZA 2JIBA 4OHOA 3FSEA 1Y8CA 4MEAA 3VBCA 1P5ZB 3I5UA 1MBZA 4TTAA 3DGFC 3I2JA 2VHYA 3FZYA 4F3CA 4HJRA 5HJ7A 4GF5A 1XROA 1GZ4A 2FEKA 2ZUUA 1KZ6A 4J0KA 4MVJE 2CV1A 3H6KA 1MHTA 1UMDB 3C7CB 1FCJA 4DBZA 3CNBA 3SBDA 2AYZA 2H5IA 2VP4A 4PCLA 4DAOA 3GXOA 4KGXA 3ELUA 1UMBB 1JIIA 5H83A 1DBVO 3NIFB 4KU4A 1XD9A 2G9QA 4FGKA 2WI8A 2PFSA 3G82C 4LRUA 4MYHA 1T0BA 3FPLA 4QD3A 3TLAA 2CGEA 3FFWA 1NIJA 2GXUA 2DTDA 1S1MA 3SHWA 1IUPA 3W4JA 2E0IA 2G1AA 1XAJA 2JGMA 3C5EA 4NI5A 4YH1A 3UH0A 1F48A 4TQUS 2OK7A 3R5SA 5AW6A 2HXGA 2W6ID 1NLUA 3MTEA 1ST2A 1F4PA 2ZITA 2W0MA 3C4JA 5EA2A 2XNKA 2OR3A 2F43B 2PX3A 4MSUA 4P38A 5B7GA 2QUJA 3AOEA 1E7YA 1N1GA 1O9HA 1BDMA 1HOXA 3CRQA 4I9HA 5JIBA 1Z0KA 3R3UA 4FYVA 3W9SA 4C01A 2BGNA 2WYWA 3HQ4O 4EI7A 2FN4A 5BVGA 3JV7A 2N75A 3C41J 4UDNA 3KOMA 4CMAA 5IJ9B 3NHPA 1GADO 3B1FA 4CV1A 3THYB 2FDCA 5IEJA 5F9MA 1AOXA 4A1OA 2QTGA 5EQJB 1OXVA 3PG5A 2J3QA 2VZ0A 3WMGA 3FFBA 2BJHA 4IIXA 3P9PA 1YZGA 2WU3A 5BSRA 1VIVA 5CYGA 2R1VB 2GFIA 3MA0A 1U6IA 2JFQA 1K7FB 4GMGA 4JBNA 3HXQA 3WLFA 1G3IA 2ODNA 2VBFA 5JBIA 1ZMOA 2Y8EA 3TG8A 3LTNC 1HMPA 2X76A 4AJKA 2ZAMA 2PXAA 3IGFA 2HJVA 3NATA 3AEQB 4J2OA 1UXOA 1VBNA 2HCFA 3VFDA 5LD2C 2Q0XA 3BQ9A 5JAHA 2ONYA 1GRCA 3AJ9A 4I36A 4K0KB 3D7NA 4ATNA 2C8VA 1JYSA 1GGHA 1Q77A 2J48A 3SC4A 5K4HA 4M8IA 3CMCO 1SEPA 3ZI4A 2R66A 4EHDA 4LFAB 2G25A 1DIRA 2AIRA 4QRIA 1UDAA 4DABA 2CYAA 3JYOA 1CF4A 2ZSIA 2M1ZA 5JNWA 4KQEA 5ESRA 3IC5A 4QASA 3ECCA 1THMA 3IVXA 4WY2A 1O96A 1LWNA 3EC7A 2H07A 2Z6VA 2B20A 5CT9A 5DHUA 3C6MA 3K9QO 3OWHA 4QUGA 5CH3A 3DLBA 1GG8A 3IERA 1Q0TA 2Y0DA 1VCOA 1ODJA 4CKCA 4EY8A 3OFND 1CB7A 2OUIA 3HB7A 1JAYA 4CG0A 3BMXA 3OPYA 4N41A 1P4AA 1MTZA 5FAXA 1R66A 2O57A 4CN8A 5CDGA 3GLIE 2A84A 4Q4JA 1MRSA 3C6XA 2WB4A 1F51E 3HBNA 4HFMA 3TL6A 4F46A 4LDAA 3BSFA 3FCAA 1AK9A 3EZGA 3CTMA 2OAP1 2P9QA 3DDSA 1RI2A 3WMXA 5DXFA 4FP9A 3ND7A 2WFLA 4OHRA 1OUMA 2BFDB 3SKVA 4B7CA 3CMMA 3LUBA 1WL8A 2VPZA 4Y98A 2DB3A 3KU1A 4KMRA 3W6NA 3OOEA 4Z0TA 3ZY3A 3BHIA 4YAOA 5AW3A 4DLBA 2NXWA 4I1OA 4D0GA 2C7RA 5EJAA 1LQ2A 2JLQA 3TRHA 3HVHA 3ZDRA 4CLRB 2BUBA 3OKCA 3T3OA 3C7KA 4RY9A 1OLUA 2X8BA 1Y5IA 3EXAA 3KQWA 3AONB 2I6GA 4MR7A 3PCXA 4NFHA 1AF4A 2NVBA 3SOPA 1E59A 4LCBA 4JOBA 4NU0A 3TW8B 4PLGA 2FLVA 3D3WB 4E4TA 3NBKA 1QIEA 3H5AA 3NHKA 1E2JA 3L8YA 3AB8A 1QX4A 2PX0A 1NNSA 4I4TF 1NDHA 4LE2A 4MDFA 1EWQA 3RO7A 2KB0A 1KYIA 3UOWA 2CXQA 1ZISA 2WMDA 3USES 2WSBA 1PSDA 4K40A 5IULC 3NGMA 3T1VA 1FUUA 5JVDB 1E9VA 4HYTA 1Y8RA 3ENZA 3HR4A 1E6LA 3OU2A 3PRKE 5CPFA 1YCDA 3ZIAA 4Z5XA 4EGCB 4RTRA 3HDHA 1V5GA 1PK7A 2GEKA 2JGLA 4CT0A 3KM0A 1K4MA 1W34A 1CUAA 1HBJA 2ZDGA 3DZHA 4PSCA 2VPIA 4HLQB 1ZPDA 1H69A 3BIOA 1UQUA 1DRVA 4B5LA 3MNFA 1KARA 4E51A 3CRRA 1HGXA 2AE2A 3D5TA 5HGJA 4GOKA 2FWPA 2C2ZA 3VXKA 5IDXA 1IEXA 4P54A 1W73A 4B6GA 3ITDA 5F3RA 2KW5A 3LPAA 3OAAA 4PO3X 4ZALA 4Z53A 1XZLA 2EZTA 2YHSA 3LCCA 1OBFO 4GVPA 1QJCA 1BA2A 4FFOA 4J16A 4URYR 5G0VA 1JDBB 2BTQA 4L16A 3JSXA 4P08A 1FRVA 2RHDA 3WX0A 2EBHX 3GVXA 1HT2E 5EPEA 2IE0A 3FNRA 3FHJA 2W2LA 4RE6A 2Q9BA 3ISTA 3QIVA 4C7XA 3JWPA 3SFVA 2ZCVA 1QLWA 1YB1A 4HUJA 2R6HA 4PXYA 1JXOA 5BYAA 1CS0A 4QPJC 4TSFD 3HRHA 4DYDA 5K3OA 5JBNA 2FX2A 2RAVA 1E1QD 3O8QB 2DPMA 3STHA 2F17A 1ECFA 1JTVA 1TB4A 2J3LA 5GINE 4P4LA 1O87A 2FOLA 2RG1A 5BSEA 3PJRA 2I3BA 3Q12A 3V00A 3DA8A 3FVTA 3SZ3A 4E1AA 2NTYC 4WA8A 1N3BA 4KDRA 4X6UA 1HYEA 5ALLA 4EECA 1E3MA 1WO8A 2OENG 3A1NA 3GA7A 3ER9A 5FTKA 4KQFA 3UK6A 1M0WA 1JNXX 2XYQA 3MPOA 1QONA 3O75A 3A36A 1G20B 2GVZC 4RFSA 4BLOA 4KO8A 3MGCA 4BNMA 4ISCA 3WHIA 3ILYA 2XBMA 5FBKA 1NIPA 1Q83A 1ZGJA 1OMOA 4WKNA 3I1YA 5FTNA 1DFIA 4KIGA 5ER6A 5M2QA 1Q19A 2QXTA 1NBHA 2H3EA 3F3KA 4LVOA 4QL3A 2BR5A 3UW3A 2X5OA 4DDTA 5JDIC 2O8EB 3U0BA 4AS2A 4DCUA 4BZQA 3OQ6A 2JIOA 3DMPA 1SG6A 1PKEA 1UBLS 2P2LA 4OI4A 4F4HA 2JGFA 3MCZA 2RAUA 4G67A 4RSHA 4Q9KA 4DA6A 2FGKA 3FPBA 3OETA 4L2IA 2IS2A 3G9UA 1E4EB 4F5ZA 4A2CA 4H0FA 1R0RE 2NADA 3B1WA 3LCVB 1XRJA 1P2GA 3KTFA 4U7FA 3QBTA 2AD1A 1N6IA 1XXHE 2XMSA 4Q9HA 2HSWA 3TSOA 1WPGA 2VAWA 4HPWA 4ML3A 5B3JA 5CD1A 5EESA 2HLDA 2ZYVX 1GTVA 4I4NA 4W1RA 5B58C 2X3FA 1QMGA 1W76A 2BL4A 1L4HA 2PLAA 1YOVA 2Q4TA 1ZCAA 3GHYA 4KYTA 3EQ2A 4RHUA 2GFHA 1DFHA 2IY7A 3GFTA 4JUFA 1WZ2A 2MINA 1WUKS 1VDMA 5H3HA 2XCTB 3ZDAA 2WVJA 1LSSA 1WHTB 4MP6A 5L4NA 2RD2A 2OWDA 1M8KA 2LKCA 3WDSA 2R6GA 1GKLA 2J5KA 4BMXA 3QOWA 1DOZA 7ABPA 3VH1A 4JU9A 5JPIA 1R9JA 2ZSUA 3MD9A 3SX2A 4BKOA 4UEKA 1AKUA 3BGSA 5FEMA 3RT1A 3G9XA 1NUSA 3D8BA 4BNDB 1XDUA 2GBCA 2IUSA 4KGVA 4AJ1A 5BQ3A 3HJCA 2XOKA 2RE8A 3DV9A 1X2BA 2J3KA 2V7QD 3SNHA 4F4IA 4X71A 3VVLA 2XCIA 3OE5A 2IVZA 4N6OA 2ZI7A 4KXVA 1KEKA 1G8SA 1PK8A 1YCHA 4JP3A 4NZOA 5EN4A 1EE1A 2JI8A 1DO8A 1PG2A 2UUOA 3E9YA 1VG1A 2CCJA 2RFLA 1O94C 1TRHA 1M34B 2H18A 4AY2A 3BJMA 2UXBB 1TKCA 3ZI0A 2YFKA 1CJSA 3OT4A 1ZONA 3D4NA 3G85A 4OFXA 4PZZA 4NS4A 1ZIDA 1PX0A 2R62A 1L7DA 3L1IA 4PZDA 3UYLA 5IANA 1J9GA 2ARKA 1TF2A 1Y4SA 4H3VA 4JUDX 1LPAB 2RHTA 1OCEA 4IW3B 5I9MA 3AXSA 1TC2A 2IPAB 2Z8XA 1YB6A 3QA3E 1TA4A 2IZ1A 2PGAA 4REQA 221PA 4TWBA 2LGJA 1TYBE 4D46A 3SICE 1RIFA 4GX5A 3IHTA 3PWKA 4QQNA 4TTPA 1Z17A 3PE4A 1H4TA 1UZAA 1VLHA 2O3JA 4INAA 1N2CE 1M6EX 1QHEA 5DBIA 4XX0A 3K8YA 3M49A 1Y5MA 3GR6A 3OPYB 2F3PA 2QTZA 4TKZA 3ZNPA 4FJ1A 4KLNA 2ZM6B 2LKDA 4Z9FA 2BELA 4OFWA 4QU5A 2RONA 4KLRA 4MKXA 3BREA 1PFYA 2HWYA 3Q7QA 3GJ7A 2H2FA 1PFGA 2GEJA 2PMCA 3EZFA 3PNBA 5HBGA 2BONA 3HABA 4HMPA 3SXUA 4IH4A 3AJ8A 4GL4A 2C59A 4Q4HA 4ZPXA 1UKZA 5CBPB 3PPYA 5K05A 3DFKA 3GUZA 2XUOA 1OROA 4IMJB 2C00A 2DFPA 3ER8A 4Z4IA 4YPOA 2ZBGA 3PDIA 4X1IA 1ULTA 3NM6B 4C6HA 5JZ9A 1QDLB 1TUBA 2P6OA 2ZS7A 1TUGA 4KFSA 5EGSA 1XVIA 2QPOA 2YINC 4JKIA 1YDEA 3WSTA 5LP6B 2VUSA 3DWFA 2A30A 1ZD2P 2OB1A 3HS3A 3IEMA 4BKRA 2D1QA 2Z4RA 5DNDA 3OQ1A 5CM8B 3UGTA 2P2GA 1E1CB 4GEGA 4EX7A 1P91A 3NNDA 1ZJZA 5K0FA 2A9PA 1E3LA 3SG0A 5K3FA 2FVXA 1AGXA 1HFKA 2FLWA 2IYOA 1I36A 1OXBB 1EGMB 5LVAA 2CZGA 3AESB 4KIUA 4G97A 5EXTA 4ARSA 3F1KA 4R1UA 1T9AA 2RH5A 1BXGA 1ZD8A 2G1UA 3MXTA 3WA6A 1ZK4A 3O1LA 2BP7B 2ZJ6A 2ZYDA 4K3VA 4YV7A 4E31A 3N2GB 4YALA 4P7GA 3V4LA 3SY8A 1DJPA 4B4KA 4CPDA 1W44A 3IVRA 5C34B 4CV3A 1GLNA 1GRRA 4NICA 4DPLA 3F74A 3U44A 2IUYA 4PU0A 4ZREA 2QYOA 2NZ2A 4CR6A 4CGYA 1BCSB 4DILA 4U7HA 3VUEA 2H0RA 4QGHA 1RQPA 3ZCSA 1MPTA 1DLIA 2J0QA 1JHOA 3LFTA 1YRHA 1IVSA 3OA2A 2PH7A 3ESBA 3O1IC 1JX6A 4QBFA 4YRRA 4BO4A 4DYVA 4JVMA 1FA9A 1UBJS 2GD1O 4QTYA 2OCIA 1U8YA 2OCBA 5T8KC 1G5IA 4HPXB 2PT5A 1XEXA 3W5CA 2XTNA 4QPZA 1XELA 3VR0A 4MW9A 2QAGB 1V4VA 1SG0A 2NVUB 1BWQA 3VKUA 1AUOA 1LBEA 1VE9A 4JU8A 2M98A 2MYPA 1XNJA 3UZUA 5AFSA 4AI6A 1IULA 4UBMA 3FMPB 2ZT5A 1F0PA 3PLAE 3QVUA 5CNKA 3PEFA 4YP1A 4RJTA 2E6UX 2QDXA 2H2HA 3HB5X 2OG1A 4BE4A 1A5BB 2PYIA 2GD0A 1XEAA 4KDCA 2AUTA 1NFFA 3JYHA 3PS9A 4O4LF 4X60A 1B0UA 1S2MA 3QJGA 4TXMA 2HSEA 3IQZA 2FFBA 3BJZA 4U9HS 5AXDA 2PK3A 3EG5A 3D4LA 3H6HA 4QHTA 2BFEB 5HNKA 2WV7A 2J5RA 1OTXA 1NXWA 2BDEA 1JEOA 2DWQA 2FY8A 2ZSJA 4S24A 1P4JA 2F1JA 4NJMB 5D3KA 4E09A 3UAGA 1MMFB 2HOQA 2QRHA 1GZ3A 5E2BA 3IRVA 1RTTA 1PGJA 3N2LA 3ENKA 4BFSA 3AYXB 3TD9A 5DT2A 3F8SA 1T3ZA 4P4UA 2O8EA 3SHVA 4BNIA 1ZBQA 2OV3A 1CEXA 2OZEA 1EX6A 1OTHA 2O8BA 5IT5A 1A8HA 1P61B 3EQZA 2EC5A 5CGQB 2LBPA 1R4MA 3H9GA 3ZWAA 3ZHYA 3QFTA 4XD7D 1ICEA 1NNUA 1DWUA 1U3VA 2P90A 4KRGA 3SE7A 2RKWA 4O4IB 2ZSEA 3ZY4A 1K89A 1F8XA 4JB8A 5SY4A 2D0IA 2F8MA 2HRRA 3GFPA 4GKAA 3WQBA 3LZDA 3OOYA 3W6ZA 2IZ0A 1PE0A 4RY2A 1JDVA 1TM5E 5CK4A 2IYWA 2PL5A 2YQZA 3A6FA 1U0HC 5T4BA 3ZWPA 5FBZA 4ZI7B 1BIFA 3O2SB 1YS9A 2EKLA 4HYQA 4LJ8A 2FPMA 4BJ6A 1PGNA 3D6FA 1AX9A 1V8DA 3KKOA 3I32A 1R2QA 3T3NA 3TAXA 1FJHA 5EXSA 1OH7A 4FI3F 4FLEA 4OYYA 1IFXA 4MDEA 3IMGA 1TFUA 3AJRA 2Q0SA 5K5EA 3FPEA 2CFIA 821PA 4AMVA 3CX7A 4KYIB 5D5HA 2JFNA 2O6HA 3PDIB 5AYVA 4BVLA 1KS2A 5DYTA 5EIOA 3N58A 4DCNA 1VE3A 2QRVA 3RNLA 4ITVA 4YI5A 4KWIA 5EI5A 3RIMA 4NK5A 2NO0A 4KVAA 1NPTO 5BV2P 4TRJA 3CVJA 4MVJP 2QTVA 3ASVA 4DF3A 3N0TA 1PGPA 1D4OA 4IQGA 2AT1A 1NJ6A 1C5KA 1LBSA 1G9XA 5A9RA 2AXPA 3R24A 5D1HA 5CB4F 1TT7A 1TECE 1M75A 3HM9A 4Z9XA 5B1IA 2PEZA 4JI4B 2A1IA 1E5QA 3FDZA 1GPH1 1V1JA 2XUIA 2VS1A 3AF4A 2V7XA 2X6TA 3SIRA 2E85A 2VK8A 4OXRA 1A77A 5H9VA 3QWAA 4GDMA 2C4WA 4RZSA 2DLCX 4A73A 2FSGA 5LYJF 2CXNA 5A4DA 4QTXA 1G9TA 2WF5A 2O19A 1OBHA 1GA1A 3G13A 3E9CA 2QX4A 1SUWA 2BI8A 1FUKA 4G1VA 4Q4AA 1AUQA 3KQHA 3BDAA 1E1NA 3I9LA 1WTCA 2IW1A 2O7VA 2XT9A 3TPFA 2ZIEA 4MA0A 3WK9A 4H0CA 4KXQA 3UYKA 4DR7B 2Z6QA 2DUMA 3NFYA 4FQ5A 4IL5A 4M8KA 4HGRA 1P81A 3TPZA 2JGKA 9MHTA 2DKOA 1XD8A 4FW9A 2E4YA 1CY6A 1P1RA 5IKPA 1NXPA 2YICA 4FFMA 2ZWPA 4MTLA 3WNDA 4B6SA 4LZAA 4IVRA 3ZWNA 1S8NA 5ES4B 5F7JA 1XJ0A 2CLIB 1COWA 1M6VA 2IVFA 1R0XA 3DR5A 1H2ZA 2GBGA 3GCWA 5IBPA 5BWOA 1UKEA 1CQWA 3HJNA 4PAOA 1ECPA 1QH1A 2GETA 2KWIA 2QNBA 2JKZA 5LB2A 3QEBZ 3H4TA 1GQOA 5DTRA 2Y1EA 1EDZA 1Q3TA 2JCSA 2C7GA 1TDJA 2AI1A 1I9GA 1C50A 1W581 2C9MA 2QAGC 2XXJA 3CNHA 3CCCA 4GXTA 4MWTA 1NJSA 5GM1A 1H5UA 2GXSA 2OORA 2XUFA 3AUYA 4PZLA 3QE3A 4LHSA 1AHNA 1T34A 2WD8A 1D0VA 4GPIB 5BQFA 1O94A 5BSGA 1LI7A 1G291 3UFXB 3QI7A 3AF3A 3AKEA 3PIDA 1QUFA 3NVMB 5ALEA 3ZW9A 1B42A 1OAKA 5COAA 1Z75A 3MPUA 3QWBA 1A95A 1MXHA 2WJPA 4WEQA 3UWDA 2CLFB 3DJYA 4CRWB 3PR1A 3OCWA 4ZZ1A 3DZFA 3KD2A 4UVEA 5DVZA 5C35A 2Y93A 2BFEA 2C99A 4MUGA 4MQUA 3TL2A 4BWGA 4D3FA 4ANFA 1XDSA 3IR7A 1HFJA 3FA2A 3PGLA 2R9VA 4J0GA 3PWTA 4BX0A 5JQGF 5LXTA 2YXPX 1O8CA 4Q4DA 4D3XA 2GF0A 1IHUA 3PC8C 2OHHA 1N5OX 5F2EA 3R7BA 1QR6A 3SM3A 4RVGA 3LZ6A 3SF8B 3RS5A 5K3CA 3P7MA 3QPDA 4EA7A 4ND5A 1HE4A 4JJIA 2E1RA 2IYQA 3OWXA 4G1UC 5AVTA 5I7SA 1W46A 5JCJD 1QNLA 4DMRA 2KJQA 4DSUA 1VJTA 4XDHA 1VSUA 1YQTA 3OG9A 4CMEC 4CM5A 3M2TA 2W43A 3V3KA 5EIXA 1XZIA 4GX1A 4N9WA 4RELA 3DHEA 5EHIA 1ACJA 1XRNA 4QU8A 4R8MA 4Y6RA 4II3A 2BV3A 4KJXA 5EQTA 1XGKA 3D59A 1NNI1 4RA9B 3E9QA 4A0QA 5I7RA 4UTVA 3R23A 3HYCA 1F2VA 2ZBUA 4ZZIA 1Y9JA 4JHXA 3CVYA 4UM7A 4M0DA 5KPDA 3FIJA 4HS9A 3UWKA 3VKHA 2JJQA 1J8DA 4QPCA 4ZDIA 1BNCA 1HDYA 4RIIA 4E21A 4EI9A 1MOQA 2IHZA 1LY1A 2Q1SA 3FW1A 5AXCA 5K8TA 3DB1A 1RFGE 3MHPA 3TAHA 3DV0B 4H1UA 4NYMR 5IXJA 1JHDA 1P6UA 5TMEA 2ZVPX 4TV8F 3UKDA 5J2UA 3EMDA 3O92A 4K6FA 1EAMA 5IM4A 1AZWA 1YR3A 5ILQA 1MB2A 3IJ5A 4F4DA 1X87A 3T7RA 4RJ2A 4LOIA 1BXZA 1X38A 5DXJA 2A9FA 4E6EA 3S5JA 1WUJS 1JAZA 3EJWA 2GH1A 3IALA 4PYRA 2TYSB 4EHNA 1LEHA 1P75A 2F9FA 3E82A 2ADFA 1VTKA 4XSVA 5EKXA 3G9QA 3UO8B 3ZD8A 4YT8A 4BVKA 3H05A 2JRLA 1FJXA 1JAHA 3ME5A 1DG1G 5DI3B 1G42A 3UUFA 3R7DA 1HQKA 1K3FA 2H08A 3QKRB 4WY8A 5FL3A 4JNKA 1T9HA 2R87A 2AQHA 3GDOA 2WILA