1NW8A

Structure of l72p mutant beta class n6-adenine dna methyltransferase rsri
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
280
structure length
272
Chain Sequence
GTTRHVYDVCDCLDTLAKLPDDSVQLIICDPPYNIMPADWDDHMDYIGWAKRWLAEAERVLSPTGSIAIFGGLQYQGEAGSGDLISIISHMRQNSKMLLANLIIWNYPNGMSAQRFFANRHEEIAWFAKTKKYFFDLDAVREPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERLVRALSHPGSTVLDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLQRSYEIVEGAANFGAALQRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MODIFICATION METHYLASE RSRI
publication title Structures of liganded and unliganded RsrI N6-adenine DNA methyltransferase: a distinct orientation for active cofactor binding
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 83
structure length 272
sequence length 280
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nw8A00
4CTKA 3TFWA 3TM4A 1TW2A 1N2XA 2GS9A 3LDUA 1O9HA 3OU7A 5LQAA 3A4TA 3B3JA 3MAGA 3SGLA 3G88A 3JWIA 3HP7A 4OQEA 3R24A 3M6UA 2XVAA 3AXTA 5EMKA 3D2LA 4EVIA 2ZWVA 1ZGAA 3UFBA 3FTFA 5DM1A 1UFKA 3UJ6A 2IFTA 2AOUB 3UJBA 3UA3A 2C7PA 5DLYA 2YUIA 3DTNA 1P1BA 1F38A 2CMGA 2HWKA 3M70A 1PRYA 1SG9A 5HIJA 3SSOA 2YQZA 3OZRA 3ER9A 2PV0A 2IH2A 1XDUA 3PS9A 4GOOD 2AS0A 1R74A 4ER7A 1Y8CA 4HH4A 5EZSA 4XUDA 4EQZA 4RTMA 3NWBA 5E1MA 5EZQA 1NT2A 4RTKA 5CCXA 4ATNA 3EMDA 4HTFA 5P8WA 3PVCA 1TPYA 3RW9A 5HIIA 3HA3A 2B9EA 3FZGA 1WG8A 2YXLA 2PKWA 3LCUA 3EVBA 2YTZA 2AVDA 3A7EA 3P2EA 1X1DA 3B7PA 5DXAA 2PVCA 3G5LA 1L3BA 3G89A 2YXEA 3K6RA 3FTEA 2AN5A 5CVVA 2IPXA 3OPNA 4LWOA 1P39A 2GLUA 3SMQA 3P9CA 2H1RA 3I64A 5DTMA 1NV8A 4MHTA 1L9KA 1SVUA 1F3LA 4X63A 5E1DA 1NW3A 1RI5A 3G2MA 4PIMA 3RIEA 2FHPA 4R8RA 5K0NA 2NXNA 1EG2A 3HA7A 4FGZA 1SQGA 3FUXA 4AZWA 4FSDA 3HVKA 1HMYA 2G70A 4OA8A 2CWWA 3CCFA 1MHTA 3IYLW 5E1BA 1QAMA 1P1CA 2PBFA 3R6TA 5C9ZA 2ZLBA 2R6ZA 4PYJA 1G6Q1 2Y1WA 3DMGA 2NXCA 5E2BA 2P41A 4V0QA 3F4KA 5GWXA 5U4XA 1WY7A 2PXCA 4L7VA 3QOXA 4E70A 8MHTA 2P3QA 2P7HA 3GWZA 2BH2A 4QVGA 3VC1A 4HTFB 5GINE 1TW3A 3KR2A 5LSAA 1NKVA 1AV6A 5DM0A 2BM9A 3EGVA 3AJDA 3LBFA 3WSTA 1AQJA 1VBFA 3TR6A 4AX8A 5CIYA 3KQYA 3THRA 2Y1XA 4LECA 2PX8A 3KPYA 3TLJA 2B3TA 3HTXA 5DM2A 1BOOA 5LR6A 1B42A 2I62A 2CL5A 5EEGA 5EHIA 3GU3A 2JHPA 3P2IA 4OBXA 4MIKA 3OFKA 4C05A 2ZFUA 4E33A 3SXJA 3HCEA 1JR4A 3UJCA 4E2ZA 3KKZA 2QRVA 3REOA 4EK9A 2UZ4A 5FWDA 5LQJA 3G2OA 2QE6A 2PT9A 1VLMA 2JJQA 4AZVA 4F84A 3DH0A 1JG4A 3LECA 5DX1A 2P3LA 5EKXA 3UJ9A 3OCJA 4R6XA 2PXAA 1YZ3A 1R18A 3FPHA 4RV9A 3FRIA 3Q87B 4BLVA 2BR5A 1KP9A 1INLA 3FYDA 3NJRA 5EVJA 4P7GA 2UYCA 4GOND 2V74B 5DT2A 4QTUB 2G71A 4QDJA 5H02A 3ELDA 4RTPA 4KVZA 2AOVA 5FQNA 3A7DA 2ZBRA 3I53A 3P71T 3QOWA 4BY9E 2BZGA 1UIRA 2Q41A 2PX5A 5KYGA 5E2AA 3FUUA 5FWAA 4F86A 3BKXA 4FT4A 2GB4A 3FPJA 4FR0A 1R00A 1NW5A 3FUTA 4HGYA 1RI2A 2ZTHA 4IKPA 1G38A 1M6YA 2HNKA 3EGIA 3BWBA 2AOWA 4G56A 3BGVA 5DX0A 4BLUA 2YVLA 3Q7EA 2XBMA 5MHTA 3HCAA 1WS6A 1EQAA 4U7TB 1WZNA 2QRVB 3G5TA 4IWNA 1D2HA 2O07A 3B89A 3E8SA 2VS1A 5K0LA 3I58A 3CJRA 3T7SA 2NYUA 5DSXA 1VP3A 2AN4A 3NTVA 4QDKA 3C3YA 4FZVA 2VDVE 4RVHA 2G8NA 2IBTA 1JG1A 1X1CA 2ZULA 2ADMA 2B2CA 3BUSA 1JQDA 2KW5A 4DCGA 4YV1A 2NP7A 3TQSA 2XYVA 5EGSA 5T6BA 4AZSA 3NW9A 3HCCA 1G60A 3EPPA 2E5WA 1D2CA 1JG2A 2ZW9A 4O29A 4OQDA 5T67A 5K05A 2P40A 4HG2A 2ZIGA 1FP1D 3BGIA 4GEKA 2XYQA 2O06A 5LQRA 4GC9A 1H1DA 3P2KA 3KPUA 5DSTA 4LG1A 3O4FA 1RI4A 2PWYA 5G02A 5HIMA 3P97A 4E2XA 2P8JA 2FK7A 3BGDA 3KR9A 3R0QA 4PYNA 1ORHA 4E32A 3DMHA 5K09A 4ISCA 4CXMA 2FYTA 4H0NA 1VL5A 4POOA 5F2OA 1G55A 5DRTA 4BLWA 2HV9A 2VDWA 5E1OA 2IP2A 3G8BA 3G7UA 3H2BA 4KRGA 1BKYA 1SQFA 4R8SA 3THSA 3I5UA 4DMGA 2LD4A 5ERGB 2QY6A 2OBFA 3IHTA 4PINA 5KQSA 2FPOA 5EEHA 1KIAA 5DTRA 3OZTA 4GOLD 5EG5A 4YV2A 2PT6A 1I4WA 1G8SA 3BKWA 2ORED 3A27A 5DWQA 2IH5A 3G2QA 2ONYA 4PGGA 5CVUA 3HCDA 3SSNA 4R05A 3HVIA 3OZSA 3UA4A 3GJYA 1JTEA 3LKZA 3ORHA 2FK8A 4HSGA 5F2KA 3LPMA 4PYIA 9MHTA 1M0EA 2EFJA 4F85A 2OYRA 1DUSA 4E2YA 4QTTB 4ER3A 3AWIA 3O31A 5D1HA 3EVGA 2O0LA 2XVMA 3BZBA 3E7PA 3HVHA 4PNEA 5GIPE 3DMFA 5EMJA 2IDKA 2IH4A 3VC2A 2V7EA 5K0BA 5E9WA 3T7RA 4MQ4A 3FUVA 3LCCA 1P91A 4OX9Y 3TOSA 3OE5A 2PX4A 3OU2A 2P7IA 4KIFA 4V0RA 5DX8A 4HC4A 5ICFA 4E2WA 5IH3A 3LDGA 3HCBA 1DCTA 4OBWA 4C07A 5EKUA 3KR1A 2ZIFA 3GO4A 3BWYA 3TMAA 4IV8A 4LWPA 1RJGA 2ESRA 3GIWA 3FTDA 3DULA 4KW7A 1I1NA 1QYRA 4GOMD 4X61A 1IY9A 3FUWA 3DUWA 1KYZA 4ER6A 3KHKA 1FBNA 5GOZA 4NECA 3E05A 2JHAA 3EMBA 4QPNA 4ER5A 1FJXA 1VE3A 1G8AA 3MB5A 4ER0A 2EG5A 4M7RA 5CVEA 3KPJA 1XVAA 3LDFA 3HCFA 3EVDA 2YX1A 3KQQA 4C06A 1SUSA 4PCAA 2HR1A 2O57A 3KQPA 4KWCA 3EEOA 5KS2A 4DA4A 10MHA 3CVOA 1QAOA 1JSXA 3GDHA 3HVJA 4HGZA 4RTJA 2JG3A 3FPEA 3GCZA 3UZUA 2P35A 5K0FA 1RI1A 4YUWA 1L1EA 1ZQ9A 1XCJA 5HOQA 5EHGA 1ZKDA 3K0BA 1QAQA 3A26A 2UYQA 4P7KA 1SUIA 1R8XA 4A6DA 2Z6QA 2IBSA 4RTRA 4RTNA 2GH1A 5EIWA 2IGTA 2ONZA 4P58A 3GRZA 5DXJA 4MWZA 1X19A 2I7CA 3BXOA 3C0KA 3CJTA 1XJ5A 3HNRA 5FCDA 2JHCA 1L3IA 3T0IA 1R8YA 3FPFA 3KQOA 4PONA 1BHJA 2N47A 4C03A 2AN3A 5M5BA 1QZZA 2PSSA 3I9FA 2O05A 4M36A 5FA8A 2P3OA 3C6MA 3JWGA 3X0DA 4KDCA 1YB2A 2C7QA 4PGHA 4PYMA 2BR4A 2OO3A 3B5IA 3EVZA 3PLAE 1I9GA 2PGXA 1JG3A 2K4MA 3GRVA 4FS8A 3LBYA 3TKAA 1NW6A 3CKKA 5FHQA 3SX0A 2IDJA 4PYOA 5C1IA 5KVAA 2BM8A 2A14A 2OB2A 1X1AA 3GRUA 4P7FA 3RODA 5FA5A 1D2GA 3MQ2A 2QM3A 3LX6A 4GBED 1YFLA 1RI3A 4RWZA 4DM3A 3R9XB 3EVCA 3HA5A 2B78A 4PWYA 4QVKA 4RTOA 5HIKA 4PYQA 2BR3A 3ELWA 5CM2Z 4PCLA 3A25A 1XDSA 4AUKA 4RVFA 2UYOA 2VDUE 4UOEA 3G8AA 1HNNA 3CBGA 3DXZA 3KQVA 4IV0A 2IIPA 3KQSA 3DXYA 4QQNA 3OE4A 5ICGA 5HILA 2PX2A 3KQMA 1ZHFA 3EVFA 2ZZKA 3UJ8A 3KQTA 3TKYA 2UYHA 2PWPA 3FPGA 3MCTA 4RYLA 1BC5A 3PX3A 4WVLA 1Z3CA 2CKDA 2ZBPA 2ZSUA 4CKCA 4JXJA 5E9QA 3PTAA 3AY0A 3S68A 1JQEA 1NBHA 3OU6A 1T43A 2AVNA 3GNLA 3UBTA 3ER8A 3C3PA 3UJAA 2OXTA 1YF3A 3DR5A 4OA5A 1UWVA 3CJQA 4RSRA 4XUEA 2ZIEA 1VP9A 3ERCA 2HMYB 2I6GA 5FTWA 2C7OA 2PY6A 5LQKA 5CCBA 1XDZA 3B3GA 3CC8A 3IV6A 5D1NA 4C08A 2QYOA 4P7JA 3HM2A 3NVKI 2EJUA 2VP3A 1WXXA 3KU1A 2Z6AA 3ME5A 4AZTA 1XCLA 1AF7A 2AOTB 5C0OE 3LKDA 3U81A 2NXEA 2I9KA 5EMMA 3G2PA 2YXDA 4PYKA 4QPPA 1EJ6A 4EKIA 3MHTA 4FP9A 3P9NA 3L8DA 5K03A 4X41A 2YR0A 3EVEA 1WXWA 2HTEA 5FHRA 2WK1A 3VSEA 5K0CA 4K6MA 2Z6UA 2ZZMA 4YUXA 3M6XA 4YMHA 3GXOA 4Y2HA 1NBIA 3TRKA 1N7IA 5EIFA 1KXZA 2AR0A 2G72A 2ZBQA 1KHHA 1NW8A 5FUBA 4EKGA 5K0JA 5K0GA 1N7JA 4ZTBA 1FP2A 4M37A 2AZTA 4DZRA 3KPWA 2PJDA 5B1SA 1XXLA 4CKEA 1RJDA 3NDJA 3SM3A 3SR4A 1EIZA 5E8JA 5IKMA 5BXYA 3PX2A 2OY0A 3ELUA 3P9IA 4RVDA 5K01A 5CUQA 5JUWA 1VIDA 1O54A 2OKCA 5CVJA 4GUAA 3E23A 2NXJA 3NVMB 2OB1A 5LQUA 5EMLA 3UJ7A 3MTIA 4GF5A 2JH8A 2F8LA 5K8VA 3UJDA 3M4XA 3MERA 3BWMA 2EJTA 3R3HA 5DTQA 4BP3A 2DPMA 4C04A 1Q0TA 4Y30A 1FPQA 2NNWB 1YZHA 3SVZA 5E9JA 3M6VA 2FRXA 2ZZNA 3DOUA 2H00A 4WXHA 1YUBA 5CVDA 5DRYA 2JH9A 5EPEA 3TPZA 4DKJA 1VQ1A 4CWAA 3LSTA 2GA9A 3ELYA 4YMGA 3GRYA 1XTPA 1RJEA 1NV9A 5ICEA 1X1BA 5EOVA 1KPGA 2GPYA 3CGGA 5EC8A 3ID6C 4DF3A 5ICCA 3HEMA 3KPVA 4GC5A 5CD1A 2FCAA 2PLWA 2PXXA 2XYRA 1KPHA 4EMSA 2DULA 2R3SA 2ZWAA 3PB3A 1Q0SA 2NP6A 4DQ0A 3MTEA 3FTCA 4FT2A 3UWPA 7MHTA 2GAFA 3M6WA 3PFHA 3NDIA 4GQBA 4R6WA 1NW7A 1ZG3A 5F2NA 4KDRA 3B3FA 1PJZA 1L3CA 4RX1A 5HEKA 3NWEA 5HFJA 4PYLA 5EQJB 4A6EA 4BP1A 3AXSA 3JWHA 1V39A 3GRRA 3P8ZA 4YV0A 3DXXA 4YUZA 5GM2A 1U2ZA 2OPBA 2VZ9A 3LCVB 2ZVJA 3DLCA 4XUCA 2B25A 3KQWA 1QANA 1O9GA 1EJ0A 3TM5A 2G1PA 1NE2A 2C7RA 3KR0A 3PT9A 3NMUF 4C4AA 1MJFA 3MCZA 1SKMA 1JSZA 2CMHA 2WA1A 2AOXA 4QQKA 5BW4A 3ANXA 3EVAA 3P9KA 3LHDA 4X1OA 5JR3A 2ERCA 5FQOA 4B17A 2OZVA 5FADA 4E30A 1RJFA 4KIGA 5KQRA 3SSMA 4RTQA 1IXKA 5DPMA 3IEIA 5BP7A 5BW5A 1R6AA 2P1DA 5GM1A 4DCMA 3OFJA 3EEYA 1ORIA 4Z2YA 1M6EX 1EAMA 3DLIA 2AOUA 3JWJA 5E8RA 4CKBA 1YFJA 2AOTA 3BT7A 3BWCA 3GGDA 2EX4A 3FYCA 4PIPA 3V8VA 4U7PB 1IM8A 1KR5A 5T64A 4X60A 4HRAA 4XCXA 3VYWA 3DP7A 4YUYA 5HZMA 1OR8A 3FRHA 1KYWA 3MGGA 5FULA 5LQNA 3LL7A 4RTLA 3LGAA 3T7TA 3QV2A 1ZGJA 4CTJA 3M33A 1AQIA 4FSXA 4M38A 2H11A 2WA2A 5GP1A 5GIOE 3EGEA 3PFGA 1KPIA 3V97A 2ZCJA 1JTFA 3O7WA 5LQCA 4RVGA 5K0EA 4MTLA 4RTSA 1VPTA 3C6KA 4E31A 4YUVA 1DL5A 1JQ3A 5DM4A
chains in the Genus database with same CATH superfamily
1X7WB 3TM4A 4B31A 4ENUA 2CZGA 3WYDA 1UBGA 3KEMA 3QW2A 4JVOA 3HP7A 1TKCA 1UOQA 3G0BA 3RD5A 5BV0A 1EDOA 3IXLA 3L43A 4W1SA 4XIYA 3ZOZA 4LBWA 2L2QA 4YRPA 3H6HA 3RKRA 2BHNA 4M1WA 2NVUA 2Y66A 4N3CA 5G0VA 3UA3A 4BBJA 4DCUA 2J41A 2RGWA 3GD5A 4C7OA 2XRFA 1DJNA 4CHTA 4GWGA 2ZDGA 1ZM3A 1YBMA 2HDHA 2NPIA 3UF0A 5JSZB 1OXBB 2PJRA 2F43A 1UPFA 3GD7A 4U7JA 4E5UA 1RHMA 1QS0B 1I6MA 1KZ4A 2CUZA 2ECOA 2O4CA 2OENG 2Y0DA 3GHYA 3MRTA 3QKSA 4G5QA 5EZQA 1S9DA 3OOYA 3FH0A 3A58B 3IAM6 3EMDA 4RY2A 1HDZA 1P2UA 2R7KA 2X14A 3KE9A 3R3UA 2XGSA 2B9EA 3ETLA 4XXHA 5H3HA 4YIKA 1LEHA 3LCUA 3L8HA 2YTZA 4Q7LA 2JFOA 1QIHA 3OZ7A 2PE5A 4WKCA 5DXAA 4N76A 3JQDA 1SEVA 3VUEA 1PLLA 2DTDA 4J7UA 4Y1FA 1EBUA 1JEDA 1FTWA 2AN5A 2HJGA 3ZCTA 3PIDA 3JU3A 1E2PA 1P39A 4J0EA 4RGYA 1CDOA 2V4UA 2IS4A 3D3NA 3P27A 1I4LD 3WBFA 3I2GA 2SKDA 3JARB 4U00A 4DHWA 3UV6A 3G2MA 2FWNA 1IU9A 4R1UA 3ZWQA 3S0JA 4F4FA 5HMMA 4FGZA 3ZI7A 3OICA 2QYTA 3T61A 4DLBA 1HMYA 5A4MS 4X3PA 3UAYA 1HE5A 1LPSA 4E14A 4O4HF 2NIPA 1P1CA 3C39A 2JLZA 3TLGB 1VHDA 1GEGA 2Z2ZA 3KUKA 5GWXA 2SECE 1CUEA 2WTNA 3B6MA 3D6MA 1AQ6A 3VPCA 1ZNZA 1K8ZB 3ZI0A 2PZKA 3L8ZA 4QVGA 1C81A 3LOUA 2CF6A 4G8JA 1FRZA 1QGUA 5GJBA 3KR2A 4L22A 3FCAA 1OLUA 3OCVA 4Q4JB 3JAWA 1Z5GA 1VBFA 3F49S 1M0TA 1W19A 2DT5A 2FETA 1I4TD 2P0YA 3IPLA 4MV7A 5HQJA 4CV2A 2Y1XA 1WUYA 4IG4A 5B64A 4DIEA 2B3TA 2V96A 8OHMA 1V8DA 1WD7A 4MAMA 5JJCA 2IHNA 1P6QA 2YICA 4IUBS 4M55A 3TG8A 1EWTA 3P2IA 3Q9LA 2GVNA 4UXJA 5AUQA 5FNVB 4WGFA 4TLLB 2QJTA 1KFEB 3SXJA 1Q0HA 4QXQA 2BMVA 3ONDA 3PPIA 3G23A 2BZSA 2OCXA 1EGAA 1KDRA 4MWDA 1ICEA 3WVNA 5IWAB 2UZ4A 1ZRHA 4Q39A 3N75A 5ALRA 1AN9A 2X9LA 1HUQA 2OBMA 3PXXA 3MBKA 3ZK8A 4HCJA 3TIGA 1IN6A 6GPBA 4L95C 1RRFA 2NN3C 4G8BA 4RV9A 2N46A 1K4MA 3BCUA 4IQ0A 5LDDC 1XZ8A 2JIOA 3JX9A 1UBEA 1YZTA 4OB8A 4AN1A 4CIDA 4TLMB 1LNSA 4J2OA 4F04A 2GO1A 6REQB 1DEKA 3GLUA 2K87A 4BU1A 1JR3D 4UBIA 1A5ZA 3O8OA 5EE0A 4ID3A 1G63A 4TV8B 2J4FA 2Y1CA 3SEFA 3KWFA 4HGYA 3ZDFA 4YROA 1WZ2A 1DJQA 4HX9A 4UQLA 4FUQA 4BFYA 4R9UC 1L6IA 4TWBA 2IHBA 2NTJA 4HDKB 1NXOA 3OIGA 3QTTA 1T9BA 5MHTA 3O93A 3U37A 2XR1A 3G5TA 3Q4GA 1B2LA 3U6KA 4EJSB 1F5NA 5DO9A 5EPOA 3OLZA 1CY0A 4ERXA 2Y6VA 1NR7A 2XUZA 1NJ8A 2LCIA 2YZ2A 1UANA 3VVLA 2PS9A 4WDQA 3M3HA 4MRPA 4CEJB 1E6UA 4K1LA 4A0QA 1V1JA 2AE2A 3TCNA 2F64A 5JS7A 1V11A 1HGXA 3EGDB 1FVHA 4DJDC 5IN5A 1WULS 5FIUA 4ZN6A 1QP8A 4E5VA 1KO5A 1W6UA 1XWWA 2ZW9A 5SV2A 3VAAA 1DQYA 3GAZA 5L95A 2B8WA 3KZKA 5LNK1 3KVRA 1MO2A 2YJTD 3EGXB 4BLRA 1JKJB 1RLJA 3AESA 4D8TA 1ES9A 3ZIAA 5JNRA 1QCDA 4CV0A 5CDYA 1JHRA 2PBRA 4FBGA 4O2BB 3ZNPA 4D9FA 5A5DA 4HQ0A 1EBFA 2H29A 3TRIA 4DUGD 4POOA 4WL0A 2WHQA 3K9LA 1K4YA 1NBOA 1QFXA 2B61A 2G1KA 2QS9A 4MMYB 2G1UA 4OXRA 3MB8A 4EX7A 4M6WA 5JS6A 2EERA 1MO4A 1V9LA 2AI1A 2JZOA 4DREA 3BSFA 4TGLA 3O3NB 2YHBA 2ZS8A 4S2EA 4NZPA 2NPFA 1ULUA 3SJ7A 4YRRA 3RVRA 1M8GA 1YMQA 4PINA 1BCRA 2RGYA 2W2KA 3PBKA 2Y1LA 4X92A 4REOA 5EJIA 3W06A 1BE0A 1YHNA 3QVVA 1K7YA 4G4GA 3UJPA 4A2CA 3EDOA 3DLBA 2H3EA 3V4VB 2MYNA 2IQ5A 1T5DX 1VHTA 2BZ1A 4J2TA 4OKIA 1JTEA 4DM4A 2ZWMA 3ZV4A 3W3ZB 3WSVA 4UUNA 3EFBA 1ND6A 5EXEA 3FYUC 2X7JA 4JR2A 1V6SA 4NYMR 1WDWB 3AWIA 3CZPA 3DBLA 1AZLA 2ZDQA 3DWGA 4FHEA 4OFWA 2XVMA 4DCPA 5BSKA 3KQLA 2I1VB 3ANNA 4B75A 2V7EA 4W9RA 1C4WA 5AI6A 3CF0A 1MEEA 4IVQA 4W8OA 4FKMA 5U9CA 3THWB 1DPGA 2X8AA 3KXPA 4KQ2A 3G82C 1Z4IA 3PTZA 1HQCA 3TZBA 2FJ0A 2QGFA 4ROSA 3EA0A 4XPIA 4DUZB 121PA 2FCRA 4LHSA 4TS4A 1LBSA 1LJ8A 3SJUA 1FEZA 3DR3A 4V03A 3ZN2A 2RK3A 1DBQA 1FVXA 2VK4A 3OKCA 2ESRA 5CNMA 3D5EA 1P4HA 1CUHA 1SVOA 5GVSA 4IHJA 4TVOA 1JZTA 1I2MA 4HADA 5B7NA 4ZI7B 1RYYA 4NJMA 3W8EA 3CU5A 5LYJB 4OQZA 3W6PA 3E5MA 1EFPA 1NE7A 2E4AA 2CBZA 3DMPA 5E0KB 2ATVA 4M54A 4WFQA 5BN5B 4G1FA 3TTSA 1F6DA 1TAGA 5D6OA 5H3CA 2QN3A 2VRWA 2H4XA 3KYIB 4UVHA 1ZH6A 1N6PA 2C4NA 1PEDA 1VL6A 3BGSA 4OTZA 4U7FA 2CLFB 3E03A 4YJ3A 4ZXPA 4A0FA 1D4AA 4L9AA 1IXSB 1FFCA 4JEHA 5BWMA 4DPMA 5JD5A 4WNIA 2WOJA 3L84A 1EBBA 5B2FA 1PSDA 1KQGA 1PFVA 5A9SA 4OYLA 3AI3A 3N2LA 2XCSB 1R0ZA 4CIYA 2J9FA 2CZCA 3O2SB 4NFLA 4R4JA 4YCBA 2YW9A 4PO8A 4Y2RA 1O96A 4B4OA 3GMSA 4XX0A 3H75A 1A7KA 1JHQA 1Z5ZA 4OO3A 5CGQB 4AN4A 5HOEA 2PUGA 1VIAA 1MLDA 4OG2A 1K5PA 1T6BY 3A1EA 3LD9A 4I9NA 2V0GA 1OZGA 3O6VA 1TECE 4O4JA 5G1OA 2AJLI 1X19A 4N7JA 3L4BA 3FVTA 3EQ7A 1S89A 1T25A 5JRDS 3R5HA 1GVHA 5KWSA 2G6TA 1OWPA 1KQNA 3PJRA 4JI3B 1G6OA 2W6QA 4G2TA 1V16A 3IS3A 5CH5A 4L5IA 1G8KA 2O05A 1KZ1A 1L7XA 1GZVA 3NANA 1Y4DE 1Y81A 3VGPA 4YPVA 4TKZA 5AW1A 1A1SA 5B1EA 1KI4A 2V6JA 1GPNA 1WOMA 1HDGO 2Z3WA 2XV1A 3WLQA 5BVGA 4K9RA 3SCZA 1ISMA 1BAPA 3BG5A 4TSFD 3C7AA 3ZCPA 1QG0A 1GITA 1VIMA 3CG4A 3CPJB 3S7ZA 4BAUA 3ZVNA 2FUEA 2LIVA 3KHTA 2ZYAA 1RP1A 4S3MA 3HYCA 4NHOA 3TUZC 1T9ZA 2R7LA 3H99A 4M0EA 3TMKA 4U6QA 1MX1A 4KLNA 3MQ2A 4GXTA 5IU6A 3A70A 2D4AA 3SNHA 4RWZA 4ZT2A 4RLHA 4IHQA 4DM3A 5A7FA 1DU4A 6LDHA 4CLOA 1PTJC 1D5CA 5DYTA 2PMFA 2JVKA 1S1CA 2Q2NA 3EWSA 4RF4A 3ABOB 5JMPA 1L5LA 4CCWA 1DRWA 1Z2DA 1HNNA 3UHOA 1GGJA 1N3LA 5A4AA 2BFMA 4FWIB 4H35A 3ROFA 2XWPA 1PZNA 1WV1A 2G67A 2NZJA 3ZJ5A 4NCIA 2O8CA 1C9YA 4HQLA 2NGRA 1U0RA 1U80A 4B46A 4KO8A 3L4JA 3G6KA 1Y4AE 4FX2A 1MOZA 1N2IA 2MCFA 2RMKA 4KAJA 3STWA 4Z7JA 3JYQA 2RGDA 3PX3A 3KB8A 3RIHA 3JQCA 2H2IA 1GYRA 1D2RA 3N5CA 4HN4B 3VR4D 1DQPA 4RF3A 4F2PA 4XM0A 1MBZA 1Q0UA 5CXSA 4H0CA 4RSRA 4DCTA 2A9JA 2G36A 1Z2EA 2NYVA 5GZ1A 3D6NB 4EG5A 2I6GA 3IPXA 4TUYB 1JZSA 2ZJ5A 4FNGA 3N5KA 1SNYA 4RFSA 5TQVA 2GEKA 3W0LB 1NJGA 2JRCA 1V7ZA 5J58A 1IEVA 2QYOA 2QBYA 3RU3A 3OFVA 4ZP1A 3MJTA 3RS7A 1SC9A 2HQSA 3O4HA 2F67A 4JLAA 1KDOA 1HKHA 2GTHA 2IYPA 2FLKA 2Q1YA 3KWMA 3RTAA 3ZWBA 4F3RA 3EOAI 1S2IA 5KNDA 4FP9A 2HA5A 1U7HA 2A3RA 1U1EA 1IZ8A 2FEMA 1LK5A 4C6SA 5K03A 1NUUA 1V2HE 1ZN9A 1QVAA 2BV3A 3LFTA 1M33A 3VSEA 4UCWA 2I0FA 1FYXA 1AF4A 2AZDA 1XC7A 4PS0A 1DT3A 1GZ4A 2R4QA 3ISJA 4WZAA 4U3JA 3W2FA 1K92A 5TLSA 1C30A 3B7GA 1R6BX 3HJTA 4MPDA 4GLOA 2GBLA 3ON5A 3PD0A 4PO9A 2VF5X 2AXEA 2QSJA 2IGBA 2W2OA 4OAOA 1QV9A 4MPTA 2CHEA 2NUAB 4XVHA 5KJCA 4GE3A 4Q3OA 3SICE 2X19A 4GM0A 1J39A 5IVIA 3VO1A 4NOJA 2PPVA 4M8LA 5AK5A 4CKWB 1NNEA 1GGFA 2Q0XA 4A1FA 3GNTA 1PK9A 1HYHA 2DHQA 3EW7A 3V4OA 5LQUA 4FDVA 3TGPA 2C78A 2AR9A 2OILA 2PGJA 2EJTA 2O52A 4RVSA 2VF2A 4C04A 1HORA 5AHOA 1OH6A 1YZHA 4OCZA 3VM6A 3K5PA 4K28A 4DG9A 2AI2A 1BXZA 4LX0A 1UDWA 5F77A 4YRBA 1ULHA 2WQZA 4B4DA 1EUZA 2WVGA 1YS7A 1DXHA 3FPBA 2CL0X 5F7OA 2IOHA 1FQKA 3OZVA 5LD2C 1RJEA 4BO8A 3GRFA 4O8ZA 3C7KA 4N4AA 1B0PA 3E9RA 2V0CA 1TYEB 4GC5A 2P0EA 3CH6A 2A59A 3Q9UA 3JATA 2Y76A 3S8YA 5C81A 2DULA 4EY3A 5DASA 1Q0SA 4MQFA 3RCBA 2IEAA 3WMFA 2OG2A 3TRHA 2GEDA 5I3CA 4X20A 2G17A 3NOOA 4A10A 2RH5A 1M34A 2GNPA 3AUTA 4C0LA 3ZW7A 1PSZA 1NW7A 4EMTA 4PWZA 1A2OA 1PJZA 3B3FA 1YC5A 3NBKA 1NR1A 1RM5A 4O4IF 2G3YA 3PTLA 4ZTUB 3AVWA 3GVIA 4EYGA 2FEKA 4U2EA 4F5EA 3L8YA 4QDUA 3BYZA 5IM5A 3EWAA 4DMMA 1EA7A 4IINA 4JX9A 3LCVB 5TB5A 2X0DA 5D3ZA 1V7PC 3E6AA 5BV1A 1CQJA 3TBFA 2R0QC 1SHUX 3M6IA 3R3JA 3KR0A 3UGJA 3GCWA 3EFOB 2C7RA 4BO2A 4JYAB 1KYYA 2KYRA 3O4GA 3X1WA 1CRWG 3UV7A 1NDHA 2Q6OA 3TKLA 4J1TC 3ROGA 1CZRA 1CJKC 5CLIA 5AK0A 4DG5A 4DTIA 3MCVA 3W78A 2JJYA 3KOXA 3M6AA 4S12A 3T1QA 4MRVA 1CRPA 1LVHA 4FHFA 3KYDB 3IEIA 5DPMA 3N70A 3EXIA 3BCSA 3DE6X 4QATA 4FONA 5C7OO 5C80A 2JCBA 5IC4A 2QD2A 3AM1A 2PGDA 1T13A 3QMMA 4PPFA 5ESDA 4FFBA 3UXEA 4BMNA 1JLSA 3P0RA 1KH2A 3QV1A 1AE1A 1YB5A 5DEOA 4QPCA 5CX1B 3FFWA 4PC2A 2CBXA 1MGPA 3SEAA 3NIGB 1SHTX 1JL3A 2NZ2A 3BL8A 1XCOA 3SPXA 3PQDA 3C3JA 2YCLA 1JJFA 1XTZA 3OFSA 1PWEA 1BE6A 1LRKA 2SBTA 3A6ZA 1JPVA 1Q83A 1D8AA 1UK6A 4DRYA 4JZYA 4LRYA 1U0OC 3SQMA 3ZE1B 1XMXA 1UKCA 4RH1A 4MW9A 4TS3A 3VHXB 1VCHA 1DBVO 1OXXK 2C84A 3NOXA 4C29A 2BBSA 4R1QA 1G5FA 1UKEA 1G20B 2X5JO 3CX6A 4XDZA 1Y3AA 1OBHA 1H22A 1YR3A 2KS6A 1ZGAA 2XXJA 3ASYA 3K0FB 4UBKA 2LRHA 3S7TA 1P29A 1U90A 1M2OA 1DWQA 4AROA 5CA0F 5HIAA 1OFTA 2BI8A 3ZJUA 2CMGA 1F38A 3SVTA 3CMMA 1DTSA 1RQXA 1SOAA 2FW7A 2JGIA 1C9EA 3HI6A 2AWOA 3I76A 1LPPA 1R74A 3OZDA 2RAPA 4IDFA 4ZJUA 4HH4A 3I9V6 1RWVA 4RK0A 4EFNA 4OHOA 1Y7TA 1COWA 1RXYA 1YRWA 4KE9A 4ATNA 4EABA 2IZ7A 2E6UX 4YJHB 4TRNA 4C87A 4YO8A 1SCQA 3HA3A 3N1UA 4NV0A 2Q3DA 3DOCA 3UNXA 1CUDA 1I13A 2WKRA 3I32A 1R10A 1GCIA 3Q12A 4EB0A 1DXYA 3RVDA 1WX1A 2ZSBA 5K2OA 3U3XA 3F78A 1W4BA 3AJ8A 1KYXA 1Z8DA 3G5LA 3A06A 2NAFA 2XQKA 1OIXA 1AJEA 5CVVA 2IUUA 2HJVA 2C94A 1J8DA 4A73A 1I24A 3B6JA 4KN8A 1PR1A 3L6RA 1T34A 1X7ZB 4U2GA 2VDPB 5IVKA 1KAOA 1GY8A 4YMWA 1P73A 2B0CA 4QOHA 2RK6A 1J1IA 4HATA 1XEWX 1XK7A 1SQGA 4GI1A 2H0QA 4MS4B 1XEFA 4ENPA 3COSA 2J07A 3LRXA 3A31A 1ECBA 3F3KA 5EQDA 3TQFA 1SOWA 1M7HA 2IHVA 3OKFA 4PNPA 1EWQA 3WP0A 1AGNA 1SQ5A 2H5LA 2FG7C 2IU3A 4L2IB 4V0QA 1NHWA 2H17A 2V8OA 1EX9A 3KAJA 4GR9A 5HF5A 4KYVA 1H5QA 4TYWA 3MAJA 4KQKA 3W6UA 3ZG6A 5F9FA 3CUVA 2YVKA 5EIXA 2PGNA 2QPAA 1QH1B 3G13A 4BU0A 3QJYA 4BFSA 1NKVA 1E1LA 1RQ2A 2R68A 2BM9A 2ONKA 4DJJA 4IIJA 1SKMA 2A35A 3PGA1 1ZO8A 3D3WA 1E99A 1W73A 3FPKA 3KOUA 4FWTA 5FDFA 3E0QA 4WOPA 4Z3DA 5JS8A 1Y6GA 3TLXA 2QZ4A 1NURA 3HU2A 3TTVA 4EDHA 1Q15A 4UTNA 5KNDH 4RPIA 2J4CA 1Z5WA 3K32A 1DMRA 3IAUA 2K7ZA 1E92A 1DRJA 1KO4A 1JR4A 5LJIA 3AR7A 1NM5A 2HSZA 2PCJA 3CLUC 3I45A 3LE8A 3MNFA 2BDTA 2QG9A 2O8EA 3FCOA 1P8JA 1AVTA 1Z6AA 5AW0A 1JMKC 2RKOA 4R69A 4QUAA 1G9TA 3GB9A 2VH5R 2WG2A 2QR3A 3A3PA 3AW8A 3C43A 4Y6SA 1I6LA 1UP4A 4XD7D 1GKLA 3S2YA 5LOVA 5AVQA 2VWGA 3EBLA 4GXNA 4X6YA 2CNBA 1Z7GA 1JAXA 4CF6A 1JMYA 2DETA 2Q3FA 2ZJ3A 1UBLS 2EWMA 3NHUA 5JXGA 3BGWA 3P52A 4TM7A 2GUGA 1X70A 5AIBA 4Q05A 1X7GA 3ABSB 1OIVA 5JBQA 3LH5A 1Z6XA 5IYZF 3VH4A 1WDKA 1MO5A 5FWAA 1C0LA 4HJXA 3AUAA 4EHAA 3O9MA 4FT4A 2GB4A 1Q0QA 3KEOA 5FO0A 1NW5A 1QCZA 4QNMA 1XDWA 2NT4A 3WJ7A 2I29A 4CMAA 3COWA 4GW3A 3OLWA 4RFVA 1G38A 3Q7PA 4OHFA 1V47A 4NV3A 2DKFA 2ORIA 4BLUA 3UT5A 4N3BA 2VNSA 3T4EA 4TWZA 3UHPA 1D2HA 5IWCA 2GF0A 1GQFA 4LZOA 5K0LA 3QXHA 2I33A 3CJRA 4FOLA 2YZKA 4IXDA 4LE0A 1UBMS 2NM0A 5AVYA 3U7QB 2XSZD 2AMJA 2C04A 3DUFA 2G8NA 1OX6A 3FNBA 4RVHA 1XDDA 1OI4A 4DZZA 1X7DA 2CSUA 4X45A 1Y89A 4JSRA 3DVSX 4OQYA 1XNJA 5JXHA 3P2MA 1UQTA 4L02A 1XTIA 2E4YA 3T9EA 4BEVA 3LYHA 4HDSA 3MTGA 1E66A 4RY9A 3LUAA 3L4SO 4CG0A 5HZKA 3ES9A 3HC7A 3DGEC 2EKPA 4LQDA 1JG2A 3R74A 3AM4A 1CJBA 5BWBA 1ZMOA 3PUZA 2ZIGA 4HG2A 2FMUA 2DECA 4JLBA 3I52A 1EZ4A 1F8GA 2H85A 3C1UA 2C5HA 2IYAA 4HLCA 4X9XA 5H16A 4N7MA 3TUIC 3RSSA 3CUSA 2Y1FA 3O8LA 3E9EA 3TRDA 5KAMA 1GPDG 1KA9H 2ZYVX 1QO7A 4K6HA 4QM6A 3AC0A 1GHTA 5EZYB 4IOJA 2B8EA 5C8YF 1CV2A 4J4HA 2AMLA 4RZHA 3V7YA 1VZ2A 2IYUA 3L5OA 3U09A 4R8SA 5DNAA 3E3OA 4G9BA 1O94C 2WU8A 5LA6B 3DS8A 3BCRA 3IE0A 4M86A 3USZA 1GPJA 3OHMA 1H8ED 5HA5A 4MUJA 4PZPA 5KQSA 2UZ0A 2UKDA 3CPHA 3OZBA 4DPKA 1LK7A 4Q9KA 1KTVA 1PL7A 2FUKA 2BFCB 2KLBA 1KZ9A 2OVFA 2R7MA 1GTL1 4X8OA 3U17A 2DFPA 4MR7B 5HUQA 2A7QA 1NWHA 3COYA 3JV7A 4DDKA 3ETCA 2BGUA 2OFOA 4HX2A 5CTJA 5JISA 5AUPB 3PJDA 4MKZA 5IAEA 4B0PA 3CUUA 4UZSA 3HRKA 4QTTB 4RNCA 3NBFA 4YC7A 2Z43A 3HJHA 3MD0A 1HV8A 3ILXA 3E7PA 3ZE2B 3T7JA 3GK3A 1PJ4A 2PFGA 2GRJA 1VI6A 2W6ID 1HL3A 4ADSG 2RBKA 1ZWKA 2J5RA 1JA1A 3AU8A 3VMMA 4OKSA 5EL0A 4MS1B 3HLTA 1S2GA 2REQB 1TGVA 3TWOA 2I6TA 4KGDA 4YCJA 4ZQGA 2XF8A 3BPSA 1TZKA 3IH5A 2R1ZA 3BDAA 3RYCB 2KI5A 4BLSA 4YQEA 4OV6B 2C8JA 3JWPA 4UM9D 3TSWA 5IDQA 4FSHA 1D0SA 5JYCA 3IDSA 2I4OA 5DULA 3W5VA 2NU6B 2HPZA 1EMDA 1VA4A 3R6DA 4H16A 4UCXA 4PXSA 1FBNA 3RHTA 4I9FA 4P1ZA 5AVXA 2H7YA 4NC9A 4X3OA 1RWMA 4X7MA 2C82A 5KUTA 3UPTA 5JNLA 1C4OA 4Q3NA 3G85A 3C8UA 3EQ2A 3JAKB 1KS2A 3H1GA 5L8VA 1ZMXA 4MCIA 2VSQA 3I9MA 1J49A 2HPHA 3DAPA 3W4IA 3MW8A 1E3TA 2XRMA 1LPMA 1V1MA 3DBVO 4DY6A 2E18A 4QC2A 1NIJA 1PV1A 2WAXA 2DQSA 4WAUA 3FMVA 4BFVA 4K9NA 3SQWA 4NH0A 2QZ9A 4OH7A 4PW0A 1XWIA 1QLHA 1VL2A 2A5FA 2C03A 2Y1DA 2BCGY 3KZXA 4NJEB 1N5IA 4PBTA 3RVLA 1KO7A 4RO0A 4I5EA 4ZOLB 1XJ0A 4ENQA 2JJ2D 3EEBA 4QUEA 3M3DA 4QJIA 1Z08A 3TRJA 1R8XA 4DEYA 4EW2A 1S8OA 1O9BA 2WFLA 4Y2QA 5LXTA 2AMFA 1XD2B 4JLKA 1N8SA 2C98A 5JVDB 1IBSA 4CMCA 3OJCA 3IOBA 5KVCA 4WHMA 3JALA 3K8YA 4HDAA 4Z0HO 1KDTA 1YZFA 3C0KA 2FWJA 4LPKA 2A0FA 1KI7A 1Y9JA 3GZTB 3GJ7A 2QGZA 1G0OA 1QKKA 4JHXA 5TS3A 1U8XX 1JT9A 2CDNA 3GEDA 1M2NA 2AN3A 3GH1A 3KKLA 3OAAA 5JWHA 1TEXA 4L85A 2ZM5A 4X84A 3ETHA 2PQ6A 4KDEA 1FTQA 1YB2A 2WWGA 3IKTA 4UPDA 3R7NA 3EVZA 4CGZA 3L8EA 1OGIA 1Y5RA 4QTXA 1Q12A 2VWPA 3K8QA 3WKEA 4JB0A 5KTSA 5HS4A 1RP7A 5K3FA 3DFZA 4KNVA 3D4NA 1L4YA 4BNZA 4ZKDA 2A9FA 3G8CA 3OPYI 1XTUA 2D4HA 4WLUA 1YGYA 2F1KA 3TNLA 3BL5A 5FBQB 3S2FA 4GBED 4JLWA 1AHHA 1YFLA 3L7AA 5ELXA 1XU9A 4IQFA 1J97A 5HIKA 2R9VA 1ZGCA 3O4VA 2J0EA 4AUKA 4RFLA 3ZC3A 4B3BA 3KJXA 5FUVA 3RFXA 5CNJA 3PNPA 1XZAA 1BVYF 3U44B 1EVJA 1FFXB 1WPXA 2PRSA 2XNDD 2M98A 4J29A 4AJEA 1HNXB 4YR7A 3EXHC 1T3LA 3EPKA 4WESB 1DXOA 1LX7A 1XXHA 1I6WA 1PDVA 3QX3A 1HE2A 1YDGA 1SULA 1V5EA 3QFFA 4B47A 1VJDA 1Z3CA 5DTEA 4I08A 4MINA 3NEAA 5BV8A 4G5RA 2AR7A 3PTAA 4LF5B 1ULAA 3OU6A 4QFBA 4B43A 2PAAA 3SXPA 3TE7A 5AVUA 1PJ2A 4YAEA 4XZ3A 3CJQA 3HR8A 2NQTA 2Q4OA 5JSQA 2WT4A 2QUHA 3QVUA 5BOSB 1J07A 2IOYA 1IOVA 3AMVA 4KNWA 1OKKD 1DDGA 3IERA 3LGSA 2VJLA 1IWOA 1S4QA 2ZI3A 3IQFA 4RDHA 2B99A 4DRZA 3FMGA 3KU1A 1Q1ZA 1EI9A 1XKTA 2FEAA 3BEOA 4X1IB 1QH8A 4MVJA 3PPYA 3ZKAA 1WVGA 3UAVA 1Y4UA 4YRAA 4G26A 2W93A 4OXNA 4UNIA 5DI3A 1TCAA 3HP1A 3HFRA 2DR2A 2OSVA 1AA6A 1AHPA 3UWDA 2DPYA 2IHJA 1OTYA 2ZUTA 3D43A 4MUHA 4JCCA 1Y3IA 4YMHA 4FMCB 4ZEMA 2AXQA 2K5UA 1KXZA 5KJ1A 2Y92A 1EK5A 3VU0A 4FEYA 3W4JA 4ZTBA 2UVDA 2O20A 2PZ8A 1UK9A 3TQOA 2P2CA 2QMOA 1YOVA 4LF9B 4QU9A 1G8YA 2LKDA 5LJLA 4AX4A 3WGLA 5DHQA 3HSSA 1KEWA 4RVDA 3QPAA 2JNWA 4JBYA 4BQOA 1G3UA 2ODBA 4M0FA 1YBFA 1E64A 2GNAA 2IHUA 2D5AA 2HXYA 3GFBA 4V0SA 5SY4A 1XF9A 2QR2A 5AXAA 1AB6A 4YRJA 2NVUB 4WPGA 2J09A 1OFUX 3LPDA 4C7OB 4G3XA 4G0ZA 2GYYA 2AUMA 4LJSA 4ASUD 4LJYA 1ND5A 2Z6VA 3IJ5A 2DPMA 3KAPA 4JI5B 4D4GA 4FN5A 1Y3CE 3CX7A 1VPDA 2AJBA 1Z4KA 4JN6B 4OK5A 3QKSB 3LMKA 2PT7A 3FBGA 3R5JA 4XYEA 2ZATA 3GT3A 5CVDA 2WY2D 1L7PA 4DKJA 1QPZA 1DRUA 2C7GA 3IUSA 4KXFB 4A8HA 2FWIA 1XTPA 2PJZA 4N5IX 3TLAA 1X1BA 1KVRA 2XE6A 1I3OA 1WR8A 5G53C 5JQGA 3GLGE 3HEMA 2JI8A 4YJ2A 2XB9A 2PUWA 3K0AA 3BIFA 1GAXA 2CN1A 3PC4A 3Q5EA 3U4QA 1KPHA 3CGWA 2GBPA 5J5AA 4JS0A 5EJ9A 5G3ZA 2NP6A 3MTEA 2XDYA 3JYLA 4ZC1A 3UGKA 3PFHA 2X6RA 3CEAA 1L1RA 4GBGA 1H8HD 1PL8A 2C5LA 2HHHB 4Y7CA 2A78A 2VHUA 3SKYA 3P9YA 5IRCD 2NACA 3WGIA 1QP7A 2R62A 4IRXA 5J59A 4NBVA 3F97A 1GTSA 2QGNA 2M1XA 2QN6A 4B7UA 4EITA 3RG2A 4IH4A 3EWNA 5EQTA 2C5EA 3D8TA 1XLVA 4RV5A 4CUJA 1NOKA 2ZXUA 2PLRA 3DBHA 3O8BA 4XVUA 3GLRA 2IYNA 5TMEA 5BSMA 2WA1A 4PANA 4EZIA 4J7XA 1AS3A 4B6PA 2CHQA 1ZJZA 2P68A 2Q0QA 2Y8EA 3LXXA 3PPXA 4XARA 4M21A 2YQ5A 1QGUB 2TMYA 4FTWA 4HEJA 2WG0A 3KCNA 1Z8NA 4B3FX 1OLUB 1P0QA 2ZB3A 3DEHA 3JAWB 1G6HA 2VTEA 1U3TA 4PGMA 3SSMA 4TKVA 3UW3A 1DJOA 5BW5A 1QLWA 1V8FA 3RAPR 3UQZA 1EDBA 1YS9A 1SBIA 2XI4A 3NIWA 1XZPA 3EEYA 3LM8A 2P9GA 1GAQA 1KY2A 2FFQA 1O87A 3I30X 3TL2A 4R1OA 1T1IA 3CLKA 1F20A 2C0PA 4MIYA 3FFBA 2HKIA 2MT9A 4GSYA 4U7PB 5CAEA 5HZMA 1KOJA 1SVLA 1R27A 3QU9A 4HRAA 3RYFA 1H9BA 3AKYA 4KZKA 3DCIA 2OLKA 1QONA 1EGHA 1EX1A 2R48A 3QV2A 4YDSA 4YRKA 3HJGA 3IBCA 3RHZA 2UUCB 4JR1A 4FILA 1QRAA 5GIOE 2A1UA 3U4AA 4E6PA 2KQUA 1K08A 3JTMA 1WEKA 4CUKA 3ZDRA 3IV9A 4EB6A 4D79A 1GA1A 2RHRA 3AONB 3O8OB 5FJIA 1RAHA 1E96A 2X7XA 3AI1A 3WHKA 3JASB 3IMGA 1LK0A 1FMJA 2CXUA 3F3MA 2AQIA 2B37A 3SGLA 7YASA 1OXMA 2M2IA 3AXTA 2ONCA 3BFVA 3OPVA 4J0IA 1S0UA 4IQ4A 4PO1A 4ETIA 2EP8A 1L7MA 4Q5IA 3SX2A 3G9XA 2HI0A 2UYYA 3X44A 3IAAA 3ZS9A 2PBZA 2XCOA 3T5DA 2FWPA 3TSOA 2TSYB 1VL8A 2TMDA 2PZGA 1C9KA 5JJLA 2PGAA 3MRVA 1O6BA 3SE0A 2C59A 5C8DA 1T1EA 3OF2A 3ZWXA 2WFZA 4DARA 2LBPA 4EUHA 3SEZA 4GLFA 3AF2A 1KYTA 4N7BA 1YBHA 4L50A 2ZU0C 2PL1A 3FZGA 4L8VA 1ZONA 3AKEA 1VCNA 3UTDA 4DSNA 4Z7OB 1LUAA 3A7EA 1V11B 3L6UA 4GMHA 4AZ0A 1IBMB 1DVRA 2Z2IA 3EIQA 1NVAA 4M0CA 2P1RA 2VBFA 1DAIA 1K63A 3Q5GA 2HCTA 3H16A 4J03A 3NJ8A 2MHCA 3IV7A 3LP6A 4ARSA 4TS1A 3ICVA 5C37A 4HXFB 1M0WA 3Q0EA 3KYCA 1TA0A 5G4LA 5GZ3A 5GQSA 1GTG1 5BYBA 3CXRA 1UXJA 3CZQA 1USWA 1RI5A 1RADA 2H2AA 4G4IA 2Z2KA 3CX8A 3V6MA 3ZV5A 1W9HA 3PNMA 2PEYA 1EVYA 5A3SA 1T9GS 2D2IA 3R5TA 1I2BA 1NAHA 4ZAXA 1QRTA 3HY4A 3OEED 5T4EA 4ECEA 2XGGA 2VDOB 3AG5A 4Q7KA 5K8CA 2QLJA 4CM7A 3IO3A 3D8SA 4M9RA 3STUA 1WB6A 2XNCA 5FTMA 1N4AA 4E70A 4R83A 4F2GA 1DJMA 2VJYA 4KVAA 4IX9A 2CLMB 1RPAA 1JZQA 4MO2A 2HCFA 1UC4B 3W3AA 1GPAA 2DWPA 3ICCA 2W2KB 1Y7HA 1RXUA 5DM0A 3S2UA 4I6JA 4EHBA 5C18A 2DERA 2E4XA 4MVJH 1E6EA 3R9XA 3KQYA 1Y7IA 3SFVA 3EC2A 4FHZA 3KPYA 4QDTA 2F6RA 3IMKA 1IUNA 1YZVA 3CZ5A 2WB4A 4FE7A 4M7PA 1BOOA 3SIWA 5KI6A 4C2AA 5JCJD 5LR6A 1ZDMA 2JDIA 3GU3A 3M49A 3JQRA 3KAKA 4L75A 3WP1B 2WM2A 3EYAA 4C05A 2FWBA 3NVAA 1P2BA 3CVWA 3ACCA 3UKDA 3SR3A 1WMFA 2RHGB 3AJRA 2HHCA 3DBLB 3I04M 1MRSA 3GPIA 5L40A 2A7XA 4PFKA 4R2IA 3R8FA 3M81A 3LECA 2CMDA 2WF6A 1A82A 3W5AA 2WJZB 3LFHA 1R18A 2EW2A 2O2XA 3TTYA 4BFXA 5HE8A 2Y9PB 5H59A 2PSDA 3NJRA 1IOZA 4XPIB 1GWNA 3RVKA 2UYCA 3E1GA 2O4UX 3EQZA 2ZUDA 1IJFA 3UAZA 1V3VA 1OGJA 2PKQP 5KHAA 2P9QA 4BDSA 1QF7A 3ZJVA 3FWHA 2VYVA 2AOVA 1MAUA 1H6CA 4YAJA 3P71T 2VHEA 4RH3A 3A6JA 2V4ZA 3LUKA 5DGXA 3MSCA 1GG8A 1UIRA 3MCUA 4RORA 1QH0A 1EK0A 5CT8A 2BC9A 5F2EA 2IU6A 4M89A 3TOZA 4NJMB 1AS2A 1W25A 1EFPB 1LZLA 1C80A 3ESQA 1ZIOA 5ALMA 4G56A 4L5JA 2J5KA 1CUIA 5AKKA 3BGVA 1IBKB 1YR2A 1F4PA 2WD7B 5BW6B 3IL2A 4PRLA 2R44A 2AZXA 1W0JD 2EJCA 4HGQA 4YJ3B 2QRVB 4D9MA 4JUIA 4QFMA 4BV8A 3UOWA 3KOOA 1OU0A 1WXEA 3LY9A 1NJ5A 2QAJA 3ZV6A 3LFUA 3GRPA 2IBTA 1PNTA 3D4PA 4RL6A 4G4SP 1A04A 4CG3A 1X3SA 3OBBA 4OK3A 4TTPA 2J9FB 3IAM1 4UEOA 3M5CA 1U0TA 3PLRA 1U9CA 2KW5A 4G1MB 2EWWA 3AW9A 3R9IA 2PUEA 3A4YA 2ZYRA 4CMGA 4UDYX 2Z9CA 3S8EA 3C8ZA 3G9ZA 2XYQA 5LQRA 3SHVA 1H1DA 4DRXA 4V1CA 3DKKA 3K5HA 3QGMA 1JLMA 4KX3A 2IU0A 4D8XA 5ESRA 4ZYUA 3CUKA 4WXMA 4R8LA 3CV3A 4P3PA 1K5HA 3VDNB 2I9PA 1XTSA 2FPGB 3AX6A 3C14C 3KR9A 1KSGA 5IUNC 2P6RA 3DMHA 3M34A 4ZXFA 4CXMA 3T1HB 1E0KA 4H0NA 4RH0A 4U6SA 2Z4RA 1D2MA 4KGVA 5AVJA 5BVGB 3OWOA 3FOEC 1K8QA 1VMAA 3FSRA 4CF4A 3MM4A 3CONA 4CLDA 5IM4A 2J67A 3CW8X 1ADCA 1KI6A 1F51E 1Q57A 1JFRA 1W85A 2EW1A 2ZQZA 2YNMC 3AZOA 2X9QA 2OBFA 1EQ2A 4TMTA 4V1CI 1KIAA 2B4QA 1NBAA 4O2AF 3UY4A 5CDTA 1SXJA 3BF8A 1E3WB 1TQ8A 4LV5B 2GM9A 4W9NC 5HJ7A 2WDPA 1GTJ1 2WWIA 5DIFA 1BX3A 3TLBA 1P1FA 3T5AA 1V41E 5BSHA 3ND6A 5CVUA 1HLFA 3VJKA 3ZXUB 3IQDB 5TY0A 4M1TA 3UK2A 3H9BA 5GMOA 3KC2A 2QTVA 3OA2A 4ZREA 5IFLA 2JLVA 1DUSA 2GFQA 1CEEA 2R5NA 1QO9A 2O8CB 3KBBA 4BX8A 3FHTA 3GQBA 3BZBA 1I0ZA 3A2MA 4BNVA 2LCFA 4IXWA 1YO6A 2H5IA 2JFYA 1KJQA 1Z74A 3PK0A 4F3YA 3BHNA 4XDGA 2Z8YM 2PX4A 1HNWB 4K9KA 1LQTA 2RGUA 2V6GA 2I66A 5DX8A 1WEHA 4AW9A 4BNMA 5K6AC 1JECA 2I1QA 2NSYA 3K7EA 2IZZA 3ZYCA 1L1QA 1E7MA 2HUNA 3VISA 1FC0A 2UAGA 2GWHA 2XWBF 2PAFA 2ZUSA 4IYJA 4RFSB 3EK2A 3NFRA 4FW8A 3RQSA 3AEZA 4U7HA 4MQEA 1UMCA 1QVVA 4LYYA 2QBYB 3KCQA 3KHKA 1D2EA 1MENA 1PI3A 3AERB 3M3PA 4F1KA 5FAXA 1BD4A 1G8AA 2L82A 4AJ9A 5BN3A 1QO0D 4M7RA 1GUDA 1I4OA 4NBLA 3U9TA 5EHQA 2CLLB 2ZJ0A 4FOTA 5L53A 3OPMA 3KQQA 2WTXA 4WFKA 3ZHSA 2BKUA 2I78A 4I50B 3H9GA 5IT9A 3HJBA 4X6LA 2HR1A 2DX7A 2O57A 2XTMA 2ECQA 1TYDE 2D7DA 3GYBA 1FS4A 1O89A 3GDHA 1YDFA 3NAGA 5M3BA 2JG3A 2EX0A 4U3JB 1KERA 1Y6RA 3F3YA 4LBVA 4YUWA 3HJCA 3PC2A 5ISMA 4J3NA 1FU8A 3TSAA 2CD9A 2XQJA 1I0LA 1M76A 1YIOA 4GL4A 4NEQA 4RDIA 4RJLA 3DE7X 5FYQA 4AAYA 4POAA 2F8TA 1E5LA 1QAQA 5DBHX 2J7KA 5KWIA 3JW8A 3A36A 4YCAA 1B2RA 3TSCA 4UULA 1H9CA 3DCJA 2HHJA 3KJZA 4GRIA 3N0WA 1ZHOA 1KMMA 2JZCA 4P4TA 3WL8A 3E5RA 1RR6A 3GRZA 3VYTB 1V6AA 1T6YA 2C0CA 3C6QA 3L7CA 1B0ZA 2XZTA 1KSFX 4IQ8A 5DXJA 4EW6A 4KSBA 2O8FA 3GGCA 2Q2OA 2VVTA 1JIQA 3KQOA 3LF2A 4C22A 2ADOA 4BFWA 5JLAA 1WPQA 4F4UA 1RWQA 1Z2NX 3F4BA 4II2A 5C31A 3C3AA 3G2IA 4JVSB 3JWGA 5SZHB 2Z2JA 3IOCA 3WMRA 2HLPA 1J9ZA 1WWKA 2WSMA 2C9YA 3H04A 4MB0A 1HEUA 4PC7A 3TSYA 2OO3A 3G9TA 3CLVA 3GY0A 5C3MA 4G0NA 3W3AH 3V8QA 1ADBA 5HDBB 1KETA 2X58A 1MPXA 1Y5NA 2AYXA 4RKRA 2BGKA 3EIFA 2ZTUA 4IFTA 4PZAA 1IOLA 5A02A 4MQ5A 4QELA 4RWEA 3DOHA 1A7AA 3OESA 4F2HA 2EQ5A 1JW9B 3JATB 4B85A 4HQFA 1MV5A 2QM3A 3C2QA 4ZQHA 2GCOA 4CT4B 1JU4A 4ENVA 4A4DA 1N8TA 1ZC4A 1M34B 3ZCVA 3F6CA 3GJTA 3L07A 4FCWA 4RVFA 3D8BA 4DDHA 1BH2A 2V58A 5BSUA 2Q29A 3ZD8A 4BDTA 2JGDA 5JV5A 3P94A 4K9PA 3B5JA 3NIBA 2IUEA 4U9IS 2P62A 2HK8A 3HRIA 1MB0A 2W4QA 5AW2A 2ZZKA 4R2HA 1E4VA 1D6SA 3FWPA 1CQJB 1MJHA 2YIVX 3H5IA 2CKMA 4RXMA 1HE3A 3AILA 1FOEB 1J0CA 4LY9A 4QQ8A 4M9QA 5ICSA 3PNLA 3UMMA 3H9QA 1ANKA 3FVQA 4ESVA 3F5SA 4YFYA 4NBWA 1CQIA 1NQWA 1KE2A 4UEWA 4IKEA 2OG1A 4LZPA 2GYVA 1JA9A 2NVWA 2XQFA 3OEYA 3QBJA 4KFRA 4M46A 1IXYA 3ERCA 5EUCA 5DE3A 2HF7A 1QV6A 1V43A 2G08A 5L6LB 3B3GA 1ZNXA 2I3GA 1GPKA 1ZS9A 3NHRA 1GZSA 1Z0FA 3I9OA 3WGMA 2H9YA 3CLRD 3JZDA 3WGUA 1ZOPA 3L0CA 4Q7JB 1NQ5A 5SZIA 3BEDA 2Z6AA 4C78A 4C0QC 2H5JA 1IDOA 2X76A 5HG0A 3C8MA 5BQFA 4WBNF 2P78A 3G2PA 4XB6B 1DC8A 1FFSA 1U7WA 4PCUA 4BN4A 3MHTA 1TPZA 5IJ9B 3CWZA 2DFVA 4RZQA 2GYUA 4YP7A 1N0VC 4UPEA 4EG8A 2W2VA 4DYDA 2VCYA 2I76A 2FUNB 1EFRA 4WZ6A 4C0AC 5AWFC 1SELA 1PDWA 7MDHA 3UT0A 3RBAA 1E1RD 2TYSB 4RM2A 1WSAA 4OGGA 4M76B 3SBXA 4BAZA 1UXKA 1R3UA 4IVPA 4JJ7A 2AZTA 2XYHA 1ZUIA 5A6VA 1JMVA 3IDAA 4Y2JA 2PUCA 4R9RA 1C29B 4B3JA 4D81A 1RU3A 2WSLA 1JEAA 3FOAA 3BD6A 2R1TB 5IX8A 2UZIR 1R0YA 3FDZA 3RAJA 4C4XA 5AKZA 1SPBS 4GUAA 3H8VA 3WAGA 3OM8A 2NXJA 4ZQCB 2QW0X 2PD6A 4R9VA 1M2OB 2VUTA 4II3A 3FVVA 4FI3C 4D8YA 2VTBB 5MFZA 3N2KB 1ISFA 1JDUA 3BWMA 4K8RB 4UHBA 5FTLA 1W5BA 1KWKA 4WA8A 2Q3CA 1PV2A 1XJQA 4ZCSA 4AFNA 3ZLJA 3OIWA 3BTUA 1E7WA 3IR7A 1Q0LA 4V39A 4XYBA 2VSOA 2A6PA 2XMRA 1JVBA 3GEPA 1IG0A 2FW9A 4ZT4A 4B4VA 2DFNA 1CB0A 2N3ZA 1N1DA 4K0KB 3CB4A 4KREA 1YQGA 3O0TA 3I05A 4NULA 5ICCA 3ZI4A 4DF3A 2GPBA 1FYEA 1M75A 4NL4H 3P0FA 3WRXA 2PKQO 4Z7QB 3HN7A 5FPKA 2VT2A 1U9JA 4KHPB 4PSAA 4PFJA 4X71A 1PT9A 2OAGA 5BT8A 3IKLA 2V59A 2G4LA 5L7YA 2B2NA 2GK4A 1MGOA 2CFIA 1SBNE 4PO3X 4H7EA 1HDCA 4KDRA 1QHNA 3VH3A 1QOQB 1ENOA 1U7PA 5JC8A 1C8VB 2WVJA 5FL7D 3RHSA 2H1CA 4I46A 3ETDA 4ICIA 5ENZA 3HJUA 4ARVA 5LWHA 2D2EA 1MXHA 2GHIA 4MZXA 1ID8A 4B5LA 1FS5A 3VR6H 3I6IA 1J8QA 2R5WA 1V25A 1NE2A 4X8HA 3AF0A 4A92A 3D5TA 3ZVKA 1E2NA 2CMHA 1KK0A 3HE3A 3KD3A 2BFNA 2QN9A 4I8XA 4LC9A 4Q9DA 1YBVA 4TMYA 3UCXA 5DN9A 3OE1A 2CMFA 4G4SO 2VF4X 5B58C 5H9WA 1NXPA 1GNQA 2D7CA 1MH1A 5FQOA 1QB8A 4LN1A 4F5ZA 2UVQA 4KIGA 1MAHA 4F8YA 3PFNA 4KV9A 3D3WB 4RTQA 2VJAA 3FVRA 1XTKA 5LLDA 4DY4A 1NN5A 2JB9A 3MUOA 4X7RA 1CWUA 3ZDDA 2JEOA 1Z4NA 4EEKA 3LIIA 4HRVA 2H4YA 4G84A 2H5EA 4WOCA 2G04A 1A50B 1T1RA 2G9QA 3JWJA 1EGMB 3EIHA 3NTUA 4FYMA 4UTXA 1GFWA 2H1FA 1SZJG 5JAIA 4HXGA 2EFGA 1UKAA 2FFAA 5EERA 5GPBA 2E7ZA 3BVPA 3K96A 5AP9A 3RQIA 2YJNA 1AUOA 1CDEA 2YRXA 1ZU5A 5KVSA 3R0ZA 1QQBA 4YUYA 3QLEA 5B37A 1ONOA 1U11A 5LMUB 1X9GA 5DLEA 5DT9A 4BN0A 3AVVA 3LZDA 2R25B 3INTA 1G59A 2ZQYA 1WBDA 3A6EA 5LOVB 2FMFA 1U5CA 5EIOA 1PLJA 5BMVA 5DWDA 2PZBA 1JFLA 4FSXA 1JKIA 3ZW8A 3TLCA 1PS9A 1ZN2A 1DX6A 4EW3A 3ZXIA 3PKJA 2ZCJA 1F9EA 1SBYA 1YHYA 8ATCA 4PQGA 2G28A 2W58A 2QY9A 1KYIA 4MR8A 3C85A 3P1JA 3UK0A 1BSVA 4MUEA 4NDNE 5AI0A 1E9AA 3F46A 4W7IA 1R6DA 3MINA 4BQNA 1W36B 4N0EA 4UBJA 2QUBA 3K0EA 4YMSA 5IBQA 3R24A 1NN3A 1EWRA 4NDZA 1WHSA 3K71B 1H3EA 3NKVA 1JDTA 3N0XA 3ZTYA 4G23A 1HFEL 4X1KB 2Z9BA 2OZEA 3JRNA 2QE7D 3VPGA 3OJLA 4NBRA 4O63O 2AN9A 2VXOA 1C8BA 1OZHA 2PUJA 2V98A 2CFSA 4B76A 1IBRA 4DYHA 4GZLA 5TQ0A 1WV0A 1C1HA 1U6KA 1OYYA 3KKEA 1E0AA 2RHLA 5EZSA 1C41A 4I6GA 1OFHA 2ZP1A 3ZEIA 1YRHA 2OFPA 1UT5A 2Y0BA 3V2UA 3ZGYA 5MFPA 1V4NA 2HA3A 5AKGA 5P8WA 2XXAA 4HWSA 3MJEA 2HRBA 4KE7A 3KZNA 1PR2A 3PU6A 4OBBA 4S24A 4HDSB 5L45A 5AHRA 1P9LA 3JQPA 1YS4A 1R0RE 3DBRB 2NTYC 4IJWA 3O03A 1W34A 3HLKA 3FPSA 5KHOC 2ZRPA 4IMIB 3PNKA 3KVYA 5DGIA 4ZHQA 3K3PA 4ZK6A 1TX4B 2C96A 4UUOA 3NI2A 3RIEA 1BWRA 1EP9A 4BO3A 2I1LA 1GTVA 3JZMA 1JI0A 3HA7A 4Q1AA 3DKPA 5JAQA 3KZMA 2DTEA 2ARKA 4IJVA 3V32A 1DC7A 1XD9A 3V8MA 3KOWA 3QHQA 4KQCA 5E1BA 1VG0B 5FFMA 1P7CA 4L8FA 1PD0A 5GONA 4HQRA 4GZ5A 5CLHA 3DZKA 3GW8A 2RHWA 2PXCA 4OSEA 1ZD5A 4L7VA 1IBLB 4LWQA 3QOXA 5I8ZA 4KLCA 5BNFA 3MWLA 3QWIA 4HEA1 4JYBA 4M83A 2RE8A 1Q7EA 4DV1B 5JI3E 3DLHA 2XT6A 1QQTA 1RE0A 2W2LD 3ZCSA 3K1AA 3D8HA 2YOHA 2QZSA 3GVCA 5CDFE 4AQDA 4GS5A 4A8JB 3TR6A 1JDPA 3ZLTA 1VB3A 3DFKA 1P9OA 2PS0A 4L8LA 1HT1E 1V26A 3C41J 4RMJA 3OUUA 1BVUA 4K26A 2A33A 2I62A 5EEGA 3ANMA 4QUIA 2QLFA 3OZXA 1DIHA 2FR1A 2DFTA 1NVVR 3T95A 1PGOA 2UUBB 3KU4A 2BW0A 1RD4A 3Q3JB 4NARA 2F90A 2GEVA 1XZHA 2ZSJA 1RWXA 1XQYA 2XEDA 3GP5A 3KSUA 2M6LA 4RY8A 1TTPB 1MC5A 1YVDA 3KFXA 4UD6A 1RWPA 3UHFA 3GFGA 4PLZA 3ZVLA 1N1GA 4DIUA 3Q87B 3IVXA 4KR2A 4F3CA 3KKPA 1ULBA 2WYHA 4TTVA 4BBPA 2FF5A 1W44A 2PXHA 3QVJA 4E94A 2QUKA 4GOND 5FX2A 1UPAA 3QIVA 4G0PA 4C6TA 2A5JA 1QE0A 4MDEA 3U7RA 2QG4A 1SN7A 2DHRA 1ZK3A 3RV4A 4DIOA 2Q41A 4NMXB 4MQ6A 5I4KA 4LF4B 4EG1A 3NFYA 5MN6A 2VK8A 1VJRA 3ESCA 2CL7X 3KJHA 4FR0A 1XLUA 1RI2A 1HFWA 4V0LA 1E77A 2I3DA 3VSBA 4MPRA 1I5EA 7GPBA 3FWNA 1UXIA 3H2JA 3RF6A 2OLEA 4RAQA 1IAQA 2QYHA 3OZUA 4WKGA 3A4IA 4HGNA 4MJ3A 4WKBA 3REGA 4G01B 2BP7A 3ENQA 5JS1A 2GFIA 1JR6A 3OOSA 4GP7A 1HZZC 1Y33E 3G2LA 3DBIA 1TTQB 4NFSA 5SZKB 2AA3A 3FYSA 5K45A 4LOLA 3VPBA 3O8NA 1BKDR 1H65A 2PZFA 3LKBA 5TEWA 1JG1A 2CK3D 4ZV9A 4OXYA 4BNUA 3DMYA 3TJMA 5LL6P 3EZYA 3K09A 1NASA 1Q1AA 3GFVA 5CPBA 3SZRA 5J2UF 1Z7EA 5T8KC 4EP1A 3LIPA 1KEPA 5ESWA 5T6BA 3W1EA 3GLIA 1QHFA 1UT6A 1W8IA 4UNQA 5EP2A 5J40A 1RAEA 4LFBB 2Q5QA 4KIWA 4BTVA 1SBZA 5B55A 1B23P 1VJ0A 5J2UA 2YMLA 1RRKA 3OPYB 2CD7A 1R9NA 3PI6A 4MP8A 1P19A 1SHZA 3AEUA 4PNZA 1SXHA 5UKDA 3GZJA 5IHPA 3RUEA 3WB2A 1PDOA 1ZK0A 2I4TA 5DYYA 3MIIA 2NXWA 2FK7A 1IK6A 4L73A 1AQUA 3A05A 4PQEA 2RGNC 4AJOA 2B1GA 4PAWA 4EDFA 3C6BA 1JWLA 1RZVA 3BULA 3N8HA 4ALMA 3IAEA 3V7WA 3IRUA 2B5WA 3MOGA 2XOKD 4JOCA 2NU8B 4RD2A 1Z8FA 3B38A 2JLCA 1MR3F 3ZHVA 1UBJS 5K3FB 2G7ZA 3I5UA 4MLCA 3ZU2A 3DMTC 4G1VA 4AT1A 2YRWA 3D8RA 1IPHA 1B8OA 4ZO7A 3WJ1A 4LV6A 5EEHA 4ALKA 3K6SA 1UFVA 3F7NA 3UPDA 3LC2O 4AM8A 4CG1A 3D54D 1VM6A 5M2QA 2YY5A 2VYNA 3GCDA 2FDCA 3TZCA 1SIOA 2HADA 5HF8A 5JYBA 3X1KA 4F72A 2IX3A 3HCDA 1V71A 3D0QA 2C2OA 3FTQA 3KKNA 3I6MA 1X7YB 2H8GA 3FDJA 3L05A 3ODGA 4I4TA 4MWOA 4RHYA 3O4JA 4TPKA 1VJ1A 3RRFA 4BXOA 5HKAA 2ZSKA 4NPCA 4BWFB 1H3NA 1JJIA 3GNQA 1Z82A 3DT8A 4FDAA 4BE4A 3HEAA 4PSKA 4JI2B 5GIPE 5IJ0B 5J1TB 2QU7A 3A14A 1XXHB 2GK7A 3G5MA 1W49A 2JLXA 4BLPA 1P91A 4UUBA 5DNEA 4UNNA 5CJJA 2ZRQA 1OH5A 1XNHA 2NO1A 1RC8A 4V0RA 1E59A 2GT1A 2B1QA 4TXNA 3T5CA 5C35A 4LDNA 2X0RA 4RZ2A 7REQA 1ZAYA 1MW9X 4UD2A 1G9XA 1JQKA 3GO4A 3PX7A 2GXUA 1V2GA 4JVNA 2DWQA 1AQLA 2AHOA 3GIWA 2MR5A 2IYEA 2F8MA 3N87A 2QA5A 1E9SA 3GLTA 3IMFA 3PWKA 1D1SA 2C4UA 1VG1A 3TTWA 1U5BA 1E32A 5F5NA 1ATZA 1DE0A 2JHAA 1NX9A 2IODA 1VE3A 4H1UA 4Y8VA 1QH8B 3ADCA 1E62A 1FFDA 3ASZA 4LI0A 2RHDA 3C15C 1AZSC 2QNBA 3N7AA 1FP7A 2L69A 3C70A 4LXTA 4R51A 1OHHD 5DI3B 4AKIA 5JCPA 5B1IA 2OXEA 1XZLA 3VZBA 1SUSA 5AT1A 1FNSA 1AUPA 4R1PA 1U2GC 3WRVA 4UUAA 10MHA 4XQGA 3VAZA 4K46A 4L4ZA 3SC4A 4DT1B 1UQUA 3AIKA 2IYQA 4GPEA 3HO6A 1G21A 5EIEA 1L1EA 3ENVA 3NBYC 3E3AA 5KYXA 4HZUA 1GA6A 1SKAA 3R3ZA 1FVOA 1G1AA 4IMRA 4IV5A 4UDOA 2GBFA 3OO0A 3UOAB 2MWMA 4CMIB 3COJA 1XNRB 5D7BA 1CYDA 5CHYA 5EIWA 3DLPX 2FKNA 5K4GA 2VRCA 2WWHA 3EMVA 4P31A 4HAYA 4LTNA 2HMSA 1KIFA 2G4VA 1FZTA 3IIKA 4XA8A 5JOQA 4MWZA 4XQCA 1UZMA 3BXOA 5FCDA 3E48A 5JI2E 1GSAA 4IXNA 4KZPA 4PXYA 1IQUA 2QXUA 3UXYA 3TEMA 1BHJA 2I6SA 3S99A 2CB0A 3DJYA 3VZQA 3Q2OA 2Y9MB 4B3MB 1IFXA 3DE4X 2PSSA 3I9FA 3M1AA 5ALEA 3SSNA 3O3CA 4AY6A 2FPWA 3MTDA 3O94A 5T57A 2UUAB 3EH2A 5A0VA 3ZWNA 3RNOA 4ZMRA 1UM8A 1XPJA 3Q6NA 4MVYA 4S05A 2NZ8A 4PLGA 5HK8A 1DWOA 1QVRA 3QYPA 4AS2A 4FHCA 1E2LA 1XBTA 1CR6A 3HCOA 5EJ6A 5JCOC 3WGOA 1MZPA 4HDRA 3RK1A 4DT1A 2WU4A 4YJ2B 4HV4A 3GRUA 1GNRA 5BWOA 2AFIE 2C54A 5HCUA 3X3HA 1FFYA 1IB0A 4HMQA 3CLHA 4H1TA 4HOYA 4DA6A 3DPSA 5CLQA 4PLYA 2XCUA 2JGEA 2UVPA 4TM8A 3ADDA 3LQYA 3PHHA 4FYWA 5G40A 4I2VA 1H42A 2BMJA 2VSXA 2YN0A 2FUCA 1Y3BE 2PH7A 2X6QA 2BGTA 2O0MA 1O58A 4OVKA 4Q1FA 2FPIA 1EK1A 3I72A 3ZNNA 3FMPB 5A9RA 1U0HC 1CUBA 1W2WB 1X1QA 3GIDA 4HLUC 1FX0A 3RPEA 5C51B 3A4VA 1IN1A 3QF4B 2AFHE 3T9DA 1VHQA 4PZ9A 2OYCA 2XRYA 3ZCQA 3DBHB 2PWPA 1PWZA 4RKFA 1QYDA 2VWHA 3FN4A 4CKCA 4JYCA 5M29A 2WP8J 4QOFA 4YRMA 2X9GA 2OHIA 1GUYA 4I55A 2XQGA 1S8NA 3IT1A 4FGKA 4LY3A 5CT4A 4D99A 3OQPA 1CUSA 1DCFA 4DW8A 4ETWA 5J4HA 3NO4A 2DBQA 4LZAA 4RA9A 4TKVB 2C7OA 3E61A 5FTKA 1XDZA 2OECA 2WF7A 4B4UA 3U4GA 3PPVA 1V45E 4N9WA 4Y67A 4CM8B 3GA7A 4J7AA 1TZ2A 3FNIA 1X87A 2Q6TA 1YMUA 1II9A 3DA8A 4D82A 1XCGB 4FJ0A 4INOA 1KEZA 1T5BA 4RKEA 3ZX4A 4LK2A 1J21A 2Q1SA 3OQHA 2YXDA 1U28C 1E5VA 4NZYA 3CUTA 4XYMA 5GAJA 3PXUA 4MWEA 1H2ZA 1VMEA 2DQYA 1EFCA 3EVEA 4KR9A 3GLQA 3RYFB 2HO4A 2YUTA 1NBWB 4ZRMA 4K0RA 4B7CA 1CPYA 3EDRA 5LZ9A 1KFKB 1XVTA 2IYXA 1H0HA 4J07A 1YTLA 3T3MB 3BE5A 3PJGA 1AC5A 5K0JA 3PLNA 6ADHA 4L9SA 4ZEXA 1H6DA 2DOKA 4CM1A 1JYSA 3SZLA 2FP3A 1Q6ZA 2A1UB 1DRVA 1IN8A 4CKEA 3F98A 1QFYA 1M2JA 1RXIA 1WM1A 3DCYA 2WIJA 4TLCA 4TQAA 5L3RA 3TF5A 3MS2A 2YWCA 4O08A 4BO1A 1XCMA 3CISA 3HA2A 4JFRA 3P9IA 4PLPA 1ACLA 2WUVA 1VPVA 3CTMA 4KI7A 4MW1A 4RPGA 5FOSA 4E07A 1ISJA 2NU9A 1S7GA 3FYTA 3NYRA 1W4LA 3DFMA 3ZDCA 2P4EA 3U4DA 1FFWA 2SCUB 4NLLA 3FYUA 5KKNB 1T2NA 4N54A 5B53A 3V4SA 1RWWA 1FDSA 3C48A 5G0TA 4A91A 1XJCA 3LUDA 1M8PA 4BCCA 3KSMA 3GVPA 3Q3GE 5BRJA 2YJ5A 3VNRA 4P80A 4MITA 1NONA 5CHEA 3OQJA 2W8BA 1A8HA 3UPUA 1SAYA 4WXHA 1YUBA 1VKZA 3MT7A 1E4YA 3V48A 1SD1A 4NRDA 4NNOA 2W9XA 3SNKA 2CLIB 5LDHA 4B3SB 2OUKA 1NV9A 4BQEA 5TDHA 3B1VA 4FFSA 3CWQA 5D5HA 4GD3Q 1D04A 2D59A 4AZ0B 1EJ2A 1B1AA 3TQRA 2OGSA 1A7JA 4ARUA 5ERYA 2R86A 2XUQA 3SJBA 4KBGA 3SYLA 4M9CA 2HMVA 4HDQB 3Q3CA 3M5DA 1E6MA 2GD1O 1YE3A 3FDIA 1F14A 2JLQA 2G0TA 2HQBA 3KYCB 2GAFA 1KBOA 4GQBA 1TKBA 2N42A 1QC5A 2BKVA 2CJWB 2PKXA 2ZJAA 3PYXA 4G0MA 2CXRA 4N5LA 3ZY5A 1TK2A 1T4CB 3A11A 4R2LA 1QUEA 4PQYA 1FSFA 2EC5A 2WWXA 1OX4A 2F9LA 1Z7WA 1YI8A 3DXXA 1DHTA 2HWUA 2ZCUA 4MVCA 4BMSA 2ZB2A 2G77B 1YONA 3QA3E 1N5OX 2E2WA 3FVWA 3L82B 3CWCA 2P65A 1Q91A 2IZ5A 3E2PA 4FN4A 2GOYA 1CP2A 3RROA 3U56A 3ANXA 3OY7A 3RRXA 3U9SA 3ZDQA 4N1AA 1CCWA 2XTAA 3SZGA 4A0GA 4YR9A 1EU1A 1GRCA 4F2WA 2ZYHA 1V3QE 2BTOA 3H5NA 4LSMA 2VNJA 5C8XA 5TVKA 1PJCA 1MUUA 4RW0A 5GM1A 4DNXA 2HV8A 3WBBA 4V2UA 1BMQA 5DSZA 5H82A 5I7EA 3EDQA 2AOUA 2QUIA 3GLFA 1TO2E 3B3AA 4A8JA 5C4MA 2VPTA 2C1EA 4TTIA 5DW3A 2VQ3A 5C8YA 4CT0A 2KHZA 4B35A 3SYMA 2IEIA 1D1TA 1EVEA 3A6GA 4D43A 1GUAA 1IM8A 5BRAA 3PC7A 3SHFA 3F8TA 1H2AS 4BWYA 3BSWA 4RLSA 3KXLA 1G1MA 4E3WA 4Z4CA 1ZVMA 1XI2A 3K9QO 4YMLA 2NTEA 5JCXA 5K7SA 5FF9A 3J80A 2JCYA 4FCTA 3U1VA 1R4ZA 1PJBA 3EBOA 2G9VA 4MYRA 2YC2C 3S8MA 3AK4A 4ENWA 1W29A 2JFZA 4ZAVA 3BWEA 3V97A 1KPIA 2VYVD 3TW0A 4JNKA 1PL6A 4ND6A 1AO0A 2FSGA 3NEPX 1KSJA 1PTJA 3I2KA 4P36A 5COAA 2PWZA 1P45A 1Z0AA 1HLGA 4JIMA 3RS2A 1GR0A 4EJ6A 3A4TA 3VAYA 4NCAA 2IXTA 3ZJYA 1EUDA 1NAIA 1E7RA 1D07A 3HY3A 4KXUA 4CQMD 2WYUA 1GNTA 1GADO 3O92A 1JKMA 2BFPA 8ADHA 1X8JA 1W59A 2R97A 5KTTA 5JE8A 1UM9A 2HWKA 3ZHZA 1F06A 1X2BA 2ICAA 1W4AA 1AUXA 3H83A 8LDHA 1XDUA 4GOOD 4Z8YA 1TM2A 4WXPA 2VHVA 3U7GA 3LT2A 1Z26A 2R6AA 1ZGZA 1WVMA 3HSYA 1CT9A 1U65A 2Y0PA 3VDQA 4EMBA 3MD9A 1XZNA 4PSUA 5FUXA 2P69A 5CCXA 1XX6A 3RC3A 4EYSA 5B6PA 5A6SA 3I12A 3PVCA 2QRHA 5A03A 2VBGA 4M60A 3AJAA 4LCEA 3R3YA 1AXRA 3P2EA 3WWDA 1HSOA 1F4VA 2AKEA 2O2YA 1PQYA 4AJ4A 3QBDA 3G89A 2XMCA 2G9RA 4BVGA 3H8WA 5MF6A 1TD1A 3P5SA 2IXDA 5KQPA 3MJCA 4DRXB 1DHRA 4V1CB 5TIIA 2RGGA 2NOAA 3ICPA 4RJTA 2JK0A 1YJAA 1SVUA 2N1BA 4F71A 1NUPA 4PIMA 2VUUA 1W5EA 5K0NA 2JRLA 1M2WA 5I8WA 4D8WA 2HYDA 1B26A 1M1NA 2QQEA 5KVQA 1QVZA 1W6RA 5DMHA 5A4IS 4QPDA 3MBIA 3PDHA 2EFHB 3X2FA 1JEEA 3WOHA 4MJXA 1EXNA 4EX6A 5EJ5A 3NXSA 2NXCA 3IEVA 1DBPA 4OJQA 4GXRA 1WY7A 3O8QA 3HKEA 1FB5A 2R1VA 1Z6GA 1IQ0A 3HYRA 2YWHA 4OQFA 3GWZA 4PHFA 1W85B 3JQGA 4HTFB 2ZIZA 4DJEC 4F9EA 5KAPA 3EF0A 1JS1X 3TEJA 1SXJB 1U5AA 4XDYA 1SVIA 1H2EA 3DEJA 3IO5A 4FNAA 5DM60 4BUZA 1AKQA 4DYVA 4EY8A 2NSHA 2PSHA 4AS1A 1BDBA 4ND2A 5JZMA 2XAAA 4B3CA 3AY6A 3H7AA 2QJOA 3FRJA 1A9SA 3AJ9A 4L7QA 4R81A 1YNSA 4RMIA 2H7CA 2IXAA 2VC2B 2G6BA 3DHVA 4UTOA 3UJCA 5B2EA 3WNBA 2QRMA 3WB9A 5HQ3A 2G25A 3AFNA 5A5VA 3BMQA 3GQBB 2VG8A 2Q9UA 3G2OA 3KJQA 2CMKA 1BA3A 1T2EA 3DH0A 4M22A 1XRPA 2XQIA 1CUFA 1IHPA 3OCJA 5CU7A 2OBLA 2IY9A 3ECAA 3VR6D 3PGJA 2ACVA 3FRIA 3LVBA 4ISBA 1QG6A 2I2DA 5FOUA 5AOAA 2BHLA 3HXMA 5ITZA 4KO4S 1INLA 2DU8A 4YALA 1LV8A 4FBMA 3ACBA 1SUDA 5L3SA 1WDTA 3QG5A 3ZZ0A 2BRUC 1S96A 4Y98A 4P0QB 3JQFC 4P93A 3I53A 4TKUA 1YL5A 4UTVA 3IPCA 4DWWA 1UMCB 1UBNA 1WJGA 4MKIA 3QEJA 4F86A 3SDZA 3QJGA 4DAOA 4YRFA 1MOQA 5BN3B 1G3IA 3CLRC 4PEVA 4GYYA 5DFAA 3SC3A 3PUIA 4DIMA 4YMUA 3N05A 2FPKA 2G8LA 4J0HA 4NH4A 3B51X 4JOBA 4UFOA 3RO7A 3ZY2A 1P1HA 2P5UA 4JROA 5ALKA 3Q7EA 3QZUA 1XU4A 2GK6A 2XUIA 4CR7A 1NJ2A 4B44A 3OLVA 1YIDA 3C6ZA 2MSEB 3DE1X 4G5GA 2QTFA 1E9FA 3WQRA 3VU8A 3CQ9A 4GGOA 3QWHA 3QPWA 1GZUA 4KQ1A 4J1TA 4FZVA 4JAVC 4WXRA 3RC8A 2BY4A 4IQGA 3JR7A 3QOWA 2PUTA 3Q41A 4UE2A 1CFJA 3AH8A 4HZGA 1N2CE 1YUNA 5C5IA 3CXUA 4ZYXA 4GKJB 5AIAA 4YV1A 1RQRA 2IJGX 1NSYA 5DLQC 3TQSA 1CETA 1X94A 2GPNA 4HZIA 4JVLA 4UBLA 4JLDA 4OIFA 5C5CA 1VRWA 3C3EA 2WHEA 2ODPA 3BGIA 3WHIA 1N8KA 1YZLA 2Z83A 3ZDZB 5IHXA 1Z16A 1TF7A 2BI4A 2WZBA 3B53X 1RLUA 3CBQA 3BN3A 4IGIA 1GA4A 4RQTA 4BZXA 5IKPA 3ZU6A 3WGQA 2D06A 1AOXA 3ESDA 4ZRDA 1KDYA 3LTEA 4AO7A 1QFZA 1SCKA 1UEXC 2HJRA 3MT8A 3R4VA 2FYTA 2IYVA 4OQQA 3S70A