1NW8A

Structure of l72p mutant beta class n6-adenine dna methyltransferase rsri
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
280
structure length
272
Chain Sequence
GTTRHVYDVCDCLDTLAKLPDDSVQLIICDPPYNIMPADWDDHMDYIGWAKRWLAEAERVLSPTGSIAIFGGLQYQGEAGSGDLISIISHMRQNSKMLLANLIIWNYPNGMSAQRFFANRHEEIAWFAKTKKYFFDLDAVREPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERLVRALSHPGSTVLDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLQRSYEIVEGAANFGAALQRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODIFICATION METHYLASE RSRI
publication title Structures of liganded and unliganded RsrI N6-adenine DNA methyltransferase: a distinct orientation for active cofactor binding
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transferase
total genus 83
structure length 272
sequence length 280
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nw8A00
2AOUB 3FUWA 1IY9A 4GBED 3SM3A 4ER3A 1RJEA 3CC8A 3GNLA 3LBYA 3SSOA 5ICEA 4QDKA 3HCFA 5CIYA 3HTXA 1KPHA 3BWMA 3GDHA 3LKDA 3VSEA 3TMAA 4BP1A 1G60A 2FHPA 5CUQA 4OQEA 4RTQA 5LQAA 2ZZNA 1JQDA 1TW3A 4LECA 5M5BA 8MHTA 2AS0A 2VDWA 3GXOA 3BGVA 3ORHA 5K05A 4V0QA 5GWXA 1ZKDA 1KYWA 4C06A 2I7CA 3LSTA 3G7UA 5CVEA 3E23A 4OA8A 4EK9A 3A25A 5DX1A 1WS6A 2OPBA 3R6TA 3MHTA 5KYGA 5EIWA 1VE3A 5K0BA 4RVGA 1INLA 1EQAA 2HNKA 3A27A 3DTNA 2H00A 4FSDA 3NDJA 2G8NA 3MTIA 4IKPA 1O9HA 1X1DA 2YR0A 1ORIA 4YUWA 2DPMA 1KHHA 1XDUA 1Y8CA 3HVIA 5EMLA 5EMKA 1U2ZA 5KVAA 5DRTA 4C04A 4BLUA 5C9ZA 1XCJA 3MCZA 5E9JA 1WY7A 4GEKA 4EMSA 2V74B 2YX1A 3DOUA 3MQ2A 4OQDA 5KS2A 2OB1A 1SKMA 3GRRA 3CCFA 3SGLA 3SSMA 2XBMA 1QAOA 2PT9A 2ZULA 3DP7A 2CWWA 3JWIA 4OBXA 4R05A 5FCDA 3G88A 5FADA 5E9QA 4XUEA 2QRVB 1VP3A 3BKWA 4RX1A 1VP9A 4EKGA 5BP7A 3UJCA 4GOMD 2AOXA 2DULA 3CKKA 2AR0A 2NXEA 3FPGA 5DRYA 4RTKA 4GOOD 1I1NA 3EVZA 4EKIA 4RTRA 4M37A 2I9KA 4GOLD 3BT7A 2UZ4A 2ZCJA 5CVDA 5DX0A 3EEOA 1RJFA 5FA8A 3UBTA 4C03A 1IM8A 2ZFUA 4YV0A 1D2HA 3GO4A 4GC9A 3FTDA 5HILA 3NVMB 3I53A 4AX8A 3DMGA 1N2XA 5EC8A 4ER6A 5F2KA 4YMHA 5JR3A 2XVMA 3KQWA 5FWDA 2BM9A 3P8ZA 5T6BA 2AOUA 2E5WA 3FUXA 2B25A 4HH4A 4AZTA 1YFJA 5E2AA 3GCZA 5B1SA 5HZMA 1R6AA 3UJBA 3OCJA 3Q7EA 5IH3A 1XCLA 2HMYB 2ONZA 4Z2YA 5D1HA 5K0FA 2AN5A 3F4KA 3P97A 3VC2A 1YF3A 3PS9A 1PJZA 2CL5A 3KPVA 1VL5A 4CWAA 5ICGA 4AZWA 3KQTA 1NW6A 2I62A 1EIZA 2PXAA 3SMQA 3BWCA 2Y1WA 1KR5A 5U4XA 1XVAA 5LQKA 2ZBQA 2PBFA 3K6RA 2HV9A 4QTTB 4JXJA 3TOSA 3UFBA 1DCTA 4ZTBA 3RW9A 4PYOA 2FPOA 2PWYA 2YVLA 3P2IA 1YZHA 3NWEA 5ERGB 1F3LA 5HIJA 3A4TA 3BUSA 1JSZA 3R3HA 4X60A 4AUKA 4E30A 3EMBA 3KQOA 5E1OA 3NMUF 1L3IA 3LCVB 4QQKA 3M33A 3NDIA 3TR6A 3OU7A 2ERCA 1VPTA 4V0RA 4X41A 4DM3A 4CKEA 3B89A 2O0LA 2HWKA 1TPYA 3H2BA 3TFWA 3CJTA 1T43A 4C4AA 4YUYA 5BW4A 5DX8A 5E2BA 3QOWA 3HCAA 3ME5A 5DTRA 3KR9A 4EQZA 2CMGA 4LWPA 2QRVA 3FTFA 3LL7A 2PLWA 3FYCA 1SQGA 2Z6UA 2BR4A 3VC1A 2ZIGA 2G71A 4Y2HA 4DCGA 3HVKA 3T7TA 2NNWB 4F84A 5HIKA 4DMGA 3ELDA 3M4XA 4X63A 2VP3A 3R0QA 4ATNA 1VIDA 3HA5A 3HM2A 4RTMA 5GIPE 2WA1A 3PVCA 5K8VA 5HFJA 3EVEA 3FRIA 2B9EA 4A6EA 4O29A 3BXOA 2C7QA 2IIPA 3BGDA 1SVUA 3ID6C 2Z6AA 2GB4A 4PINA 5K0JA 9MHTA 2GH1A 1X1AA 1RJDA 3UJ8A 3I9FA 3G2MA 5EKUA 1R8XA 3BWBA 3I64A 2NP7A 3DXYA 1P1CA 4FP9A 4E32A 3TM5A 3UZUA 5EG5A 2IP2A 3LECA 4PYMA 5K01A 4PYQA 2C7OA 3KQQA 3ELYA 2G70A 1L3CA 1UIRA 2JH9A 2ZW9A 1QZZA 3EVGA 3FPHA 2VZ9A 4FR0A 4LWOA 4OA5A 5CCXA 5E8JA 1G6Q1 5EIFA 3T7SA 3B3JA 4DZRA 3B5IA 4E33A 2PX4A 2IFTA 4OBWA 1RJGA 3T7RA 5EMJA 1KPGA 2PY6A 1WXXA 2YXDA 3CGGA 3I5UA 1EG2A 1SUSA 4AZVA 4P7GA 5FQNA 2JHCA 10MHA 2P3LA 4GQBA 3M70A 3OZSA 2ZBRA 4KW7A 3AY0A 1WXWA 3O4FA 3PTAA 2IBTA 3PX3A 4CKCA 2P7IA 2OKCA 3FUTA 3RODA 3ERCA 5LQUA 3UJDA 4DA4A 1EJ6A 1NBIA 4QTUB 4KWCA 1NW8A 4CTJA 3EVAA 2FK8A 5DXJA 3LKZA 1JTFA 2UYOA 2UYHA 5DTMA 2HR1A 4RYLA 5FULA 3JWHA 2YUIA 4G56A 1JTEA 5FHQA 3MB5A 1FJXA 1R74A 3OFKA 3U81A 2NP6A 2ZLBA 3HVJA 4QVGA 4RTOA 4PWYA 5F2NA 3Q87B 1NV8A 1WZNA 3JWJA 2OXTA 3SR4A 2ZZMA 1AF7A 1L9KA 1YZ3A 1ZHFA 5EPEA 4E70A 4KDRA 4NECA 2JHPA 2B2CA 1G8SA 2VDVE 3LDGA 3UA4A 4RTNA 3TPZA 3LCCA 5DWQA 5EHGA 2P8JA 3THSA 5ICCA 4C07A 5D1NA 2AN4A 2FK7A 5P8WA 4E31A 1JG2A 3FTCA 5DXAA 4K6MA 5GIOE 3OFJA 2EFJA 2C7PA 2VDUE 4IV8A 1P1BA 2BM8A 2PXXA 2JHAA 5E1MA 2QE6A 5ICFA 4RTLA 3HCEA 4HTFB 4KRGA 3OU2A 4PNEA 3CBGA 3DLIA 2AOTB 4PCLA 1QAQA 3L8DA 3C0KA 1I4WA 4FGZA 3NVKI 5FHRA 2PKWA 2BH2A 2AOVA 3MGGA 4AZSA 3FUUA 5DM1A 5EEGA 7MHTA 2NXNA 1R18A 1KXZA 2PXCA 1NW3A 3MAGA 3FPJA 4RVFA 4XUDA 2FRXA 2XYRA 5DM4A 1R00A 5C0OE 3KU1A 3DLCA 3GRVA 2UYQA 3G2OA 4E2XA 1ORHA 5DTQA 5E1BA 1V39A 1NT2A 3HP7A 2OB2A 3DH0A 1SUIA 4PYLA 3P2KA 2BZGA 3DUWA 3DR5A 3P9CA 4GUAA 5CCBA 5CM2Z 5DM0A 2G72A 3V97A 5FQOA 3K0BA 2ZWVA 5GP1A 3AXTA 3PX2A 3JWGA 1JQ3A 1B42A 1DL5A 5K0CA 1AQJA 4MWZA 1TW2A 2PX5A 3B3FA 4PYNA 3G8AA 3HNRA 5C1IA 3ER8A 5CVVA 3X0DA 5K0GA 2F8LA 1KP9A 2CMHA 3LX6A 3EEYA 3PFHA 4M38A 4X61A 5G02A 4YUVA 4MHTA 2EG5A 3GRYA 5FUBA 3T0IA 4E2ZA 2AZTA 3CVOA 3LGAA 1N7JA 3SX0A 3E05A 5IKMA 1JR4A 1BOOA 3OZTA 3G5LA 2FYTA 4HC4A 3LBFA 3C3PA 5EHIA 2GA9A 5HIIA 1X1BA 2ZTHA 1VLMA 3G2PA 3B3GA 4H0NA 3EVBA 3TKYA 4F86A 2GS9A 3P9NA 3OZRA 1Q0SA 2B78A 4FSXA 3MTEA 1PRYA 3G8BA 3S68A 3P71T 3UJ7A 1QAMA 4PONA 3UJ9A 1MJFA 2ADMA 4RTPA 4E2YA 4RTJA 4P7KA 3KQMA 3PB3A 4U7TB 3R9XB 1AV6A 3GWZA 4RSRA 5MHTA 2IDKA 3NWBA 2ZWAA 5EZSA 2O07A 3DXXA 4BY9E 1X1CA 2YXEA 1EAMA 5CVJA 3HEMA 4GOND 5CVUA 4BP3A 4POOA 2ZBPA 1L3BA 2Q41A 2AN3A 5EOVA 4YUXA 4QPPA 5H02A 4MIKA 3NW9A 4R8RA 4HTFA 3REOA 2XVAA 3M6UA 3KQPA 2P3QA 3BGIA 3R24A 3RIEA 4C05A 1O54A 3MERA 2AOTA 1NBHA 4IV0A 3TKAA 1N7IA 1FP1D 4FS8A 3KQYA 1I9GA 3GRUA 2P3OA 4CKBA 3LCUA 1SQFA 4HG2A 5EMMA 4B17A 3C3YA 3EVFA 2OBFA 4HRAA 3I58A 4QVKA 5FTWA 1JG4A 4DCMA 4WXHA 3GRZA 3HA7A 4RWZA 5E1DA 3C6KA 1JG1A 4ER7A 2PWPA 3KQVA 4P7JA 1BHJA 1NW7A 5LSAA 3ELUA 5EQJB 2O05A 1KIAA 1IXKA 3GU3A 1BKYA 3KQSA 4KVZA 1JG3A 4QDJA 1VBFA 1YUBA 3HCCA 4YV1A 2ZIFA 2JH8A 1L1EA 1M0EA 1M6YA 3FZGA 2HTEA 3IEIA 4QPNA 2PV0A 2EJTA 5K03A 2IBSA 2O57A 5LQRA 3SXJA 1AQIA 1ZG3A 3QOXA 4R8SA 2XYVA 1X19A 4P7FA 5JUWA 3OE4A 2R6ZA 3LDFA 5K0EA 3M6XA 1NV9A 5K0LA 3MCTA 4DF3A 1WG8A 3FUVA 4R6WA 4RVHA 3KKZA 1O9GA 2OZVA 3HVHA 3KPYA 5K0NA 3UWPA 4EVIA 2PX2A 5T67A 4RV9A 2A14A 2PJDA 5DT2A 2H11A 3D2LA 3KHKA 1G55A 2B3TA 2IGTA 3DXZA 3IYLW 5EGSA 4ER0A 1D2GA 1D2CA 2GLUA 1DUSA 3EPPA 4LG1A 1HNNA 1ZGJA 2P1DA 2QM3A 2XYQA 1RI5A 1XJ5A 3E8SA 4GF5A 2ZSUA 4XUCA 4HSGA 4PYJA 4HGYA 3FRHA 1P91A 3LPMA 4BLWA 5BW5A 2I6GA 3CJRA 3G89A 3O31A 4L7VA 5DPMA 3TRKA 2IDJA 3M6VA 2Y1XA 4HGZA 3P9IA 2H1RA 2PX8A 1P39A 3HCBA 1XTPA 2C7RA 1Z3CA 5CD1A 2YQZA 5GM2A 3BZBA 3OPNA 4M7RA 3EVCA 4Y30A 1FPQA 4UOEA 2P40A 2LD4A 1M6EX 1F38A 3FPFA 1RI3A 5EZQA 3M6WA 5KQSA 1NW5A 1XDZA 1UWVA 2P7HA 4CXMA 1MHTA 3EGIA 1RI1A 2YTZA 3EGVA 3VYWA 3A26A 5LQNA 5K09A 2QYOA 2P41A 1EJ0A 1G8AA 3FYDA 5GOZA 2OYRA 1YB2A 3E7PA 2ONYA 1HMYA 2FCAA 4QQNA 3GGDA 3NJRA 4MTLA 4R6XA 5BXYA 5KQRA 5FA5A 3B7PA 4OX9Y 1QYRA 5FWAA 4ISCA 3EGEA 3SVZA 3FTEA 2ORED 1SG9A 1JSXA 3WSTA 3AWIA 3HCDA 3NTVA 3O7WA 2ESRA 1JQEA 2IH2A 1FBNA 2NYUA 3PLAE 4IWNA 3UA3A 3LDUA 4RVDA 5GM1A 3TQSA 3EMDA 4ER5A 2ZVJA 4YV2A 1NKVA 5EKXA 3THRA 3TM4A 2KW5A 1XXLA 3AJDA 3KPWA 4FZVA 4KDCA 1NE2A 3DULA 4PGGA 1UFKA 5DSTA 1VQ1A 2EX4A 3BWYA 2QY6A 3C6MA 2GAFA 1RI2A 3LHDA 4WVLA 2JJQA 2OY0A 4PGHA 2ZZKA 5HOQA 4PIMA 5LQCA 5EEHA 3OE5A 3GJYA 2R3SA 3P2EA 2P35A 3UJ6A 1YFLA 4F85A 1ZQ9A 3A7DA 3UJAA 2IH4A 5GINE 4YMGA 3KR2A 3KPUA 4MQ4A 4RTSA 1R8YA 2WK1A 1BC5A 3KR1A 3SSNA 2AOWA 4XCXA 3KR0A 3OU6A 2N47A 4E2WA 3A7EA 3ELWA 3BKXA 2UYCA 2JG3A 4CTKA 2AVNA 2CKDA 5LQJA 1QANA 1FP2A 5E8RA 3G2QA 4M36A 4C08A 5LR6A 2PT6A 2WA2A 3ANXA 2VS1A 5DSXA 4DQ0A 3V8VA 3DMFA 1KPIA 2OO3A 3PFGA 5E9WA 5DLYA 2NXCA 2V7EA 4PIPA 5F2OA 1KYZA 1XDSA 3G5TA 3GIWA 4FT2A 4BLVA 4YUZA 3DMHA 4FT4A 4U7PB 3FPEA 3HA3A 2YXLA 3QV2A 4X1OA 3KPJA 2PVCA 2G1PA 5HEKA 5T64A 2GPYA 2EJUA 4DKJA 1H1DA 2IPXA 1OR8A 3TLJA 1Q0TA 4KIGA 2Z6QA 4A6DA 4PYKA 2BR5A 4PCAA 2IH5A 2PSSA 2PGXA 3EVDA 4PYIA 2AVDA 5HIMA 4P58A 3AXSA 1G38A 3PT9A 2NXJA 2ZIEA 2K4MA 1RI4A 1ZGAA 2O06A 3IV6A 3IHTA 5EVJA 3CJQA 5DM2A 3ER9A 4KIFA 4GC5A 2BR3A 3P9KA
chains in the Genus database with same CATH superfamily
4CFYA 4AUEA 3A9TA 3LRPA 1VKNA 2DRIA 3E18A 3OT4A 4PE5B 4JJGA 4EZBA 4U7DA 3HCFA 3MOIA 3BWMA 1W48A 3M2PA 2ETVA 2R1UA 1WR8A 3OZVA 3STVA 4XJTA 2Q5FA 5AM5A 5GAJA 2VUSA 2RGEA 3VKVA 5LMNB 3PRHA 3GP3A 1QS0B 1NJ6A 2GPTA 1MRZA 4QL3A 3F90A 1GUZA 5GV7A 2YJ3A 1XEWY 3GLFA 2XAUA 1KSFX 1NDHA 1KYWA 1THGA 1U0RA 1WP4A 2ADOA 4XTCS 5GWXA 3AJAA 3RIGA 1XL1A 3WLPA 3OQVA 1OBOA 3T7IA 3E23A 3DM9B 4WINA 1C3OA 3WXBA 3FPLA 1SOWA 1TUGA 3LFUA 3RTGA 3UANA 1BDBA 4B8ZA 4DLWA 1QBGA 4RVGA 4OHMA 3NDPA 5IEJA 3P5SA 4MR8B 3NDJA 5HM6A 3FZEA 1E3MA 1CULC 3MIZA 3PX7A 1JHYA 3K1AA 3KZMA 2V98A 2BVNA 1WD5A 3RV4A 3SXUB 5BUSA 1OFHA 5CLGA 1PP4A 4NEGA 5L9AA 3JQ9C 4ZVMA 4D9EA 1DJMA 1QC5A 4AIIA 1TGVA 3CMMA 3NTUA 1MPXA 4DDTA 2BHLA 2E48A 4N7BA 1KI6A 3LF2A 4JK3A 1DKNA 1C4KA 2RAUA 4N3BA 1AVTA 4OQDA 2G1AA 2HJVA 3SF8B 5I3CA 1HETA 3E9MA 3E84A 5TARA 4PRZA 1MEOA 2Q7XA 5FLEX 5BYBA 1MTZA 1QR6A 1WSAA 4QOSA 3TN7A 2MT9A 2GKOA 3I9JA 2R1TA 3VNBA 1B6GA 2X1LA 2A84A 2HPAA 5A2QA 4AKTA 1G17A 3W5BA 3IEVA 1NE7A 5DIFA 2PRIA 4GOOD 2HA2A 4IRUB 3MOGA 4GI5A 3AEUA 4NYIR 1JJFA 1SBQA 2QN9A 3Q3VA 4Z1OA 3ESZA 1ND5A 1KO7A 1IUPA 2OCPA 3L1KA 2PWAA 3L8FA 1B6TA 4G97A 3AHIA 5CXXA 5HNKA 2HN9A 2O8CA 1H2HA 2QVGA 4J0DA 2ZRIA 2AEFA 2Y6UA 1LNZA 3SYLA 1SO8A 4HX5A 4L2IA 3VMMA 5CBPA 5GONA 2FDCA 1XZBA 3M6MD 2PBRA 3NALA 4Y2RA 4CQMD 3FUXA 4AZTA 4AURA 5BSEA 2PEZA 1T2EA 3RAPR 3OQOA 3OC6A 1HOXA 1KI8A 4QFMA 4IQ4A 4JJEA 4YBRA 1BTOA 2HEIA 5K4HA 2IS4A 1GDDA 5K3OA 1J70A 3SZOA 3RGWS 1LLFA 2W58A 3B7GA 1K9SA 1P9RA 3KYCB 4G5HA 4GLLA 4G8JA 3E2IA 1E2HA 1LQUA 2O7VA 3DWEX 1ZIOA 1WPGA 1SMKA 2IOFK 4QWMA 4AZWA 4CWAA 1C1XA 3WVNA 2J0EA 5KAPA 5CH3A 1HKUA 1YVEI 2FZ4A 1JA0A 3GFSA 5FKJA 3WHKA 4TXMA 2PNJA 3QKSB 4ZODA 4CQMA 4CKCB 2HA6A 2NZ2A 1SWWA 4YNBA 5HUHA 1VPWA 3QNUA 1UF9A 2VP9A 4N3AA 3GJXC 3HR4A 3AKEA 1EVYA 3I0NA 3R0VA 4WOBA 3RC1A 2C9BA 5HRUA 1YZHA 2ECPA 1F2UA 1G5IA 1NN0A 4LV8B 5CD9A 1TKBA 2M1XA 2Q6VA 2WUFA 4EFNA 4LCEA 4GPEA 1HK7A 3CNHA 1KH1A 1HM5A 3I5YA 3T94A 3Q7QA 4OMFG 3HBNA 1OUMA 2ERCA 2X23A 4MYDA 1WZ2A 2R00C 3S1AB 1N5JA 1APBA 4JJ6A 4YP1A 1PT6A 1YCDA 4YLGA 4YUYA 3KVNA 3Q3JB 4JNKA 4PQRA 3TCXB 3OFVA 1FNNA 2DUWA 1ZH8A 3IKJA 4UVGA 1K4KA 2A1IA 2QTHA 1P81A 2WWWA 1LLDA 2JANA 2GNPA 3A2LA 3TVYA 1J8VA 5IJ0A 5LWQA 3AIMA 3HV2A 4R40A 1PBTA 5BN5B 4D8UA 5KOHA 4X63A 3IQZA 1SUWA 1YMVA 2O3JA 1IJFA 1AKYA 1FP6A 3O8QB 3R0QA 1YGPA 1KJIA 2JAQA 2X77A 4KKXB 3IEKA 3A1EA 4YRAA 5K3SA 4H7IA 2B9EA 4M8IA 1KP2A 4ES6A 5JYCA 4OOEA 1QZ3A 1JMYA 2DBYA 2XYPA 4WV3A 1B4DA 2AK2A 1P4JA 1TK3A 2J9YB 3TSOA 4LRWA 3WP0A 4BC0A 1R8XA 4EB8A 4P0QB 1RWOA 1PK9A 1BQ4A 2H1SA 4YLYA 2Q2VA 2XMQA 1VJ5A 1BEUB 1N5KA 3LKVA 2BTQA 2AR9A 3PYXA 2TMKA 1L7EA 1QZZA 3LUKA 5BT9A 2ZI9A 3OJXA 1VI5A 3O92A 1G6Q1 3N8GA 1Q0RA 4TMTA 3IE2A 2QPTA 3P1JA 5DISB 4DDKA 1EDZA 2XGSA 4YP0A 3M4JA 4IJ6A 4LZNA 3NAMA 4PR3A 3T7RA 3WNQA 5FWYA 3TTSA 5JZ9A 4K40A 2NU8A 3MCWA 4H7FA 1IJBA 3H9GA 3WJAA 5IT5A 3FTNA 4KW7A 1RLMA 2V96A 2VP0A 1PZFA 3H5LA 4MW7A 3PQ6A 4FNOA 4DDVA 5JSZA 1XDDA 3EQ9A 3ROZA 3V3KA 2P7IA 4DPKA 4YMLA 2C94A 2AIRA 2ASEA 2F7SA 3AR2A 2WMOB 3GWGA 4Y6GB 1NBIA 3AU9A 3LXUX 2XJ4A 3QJYA 1K7YA 3RE1A 4AZ3B 4B34A 2YINC 2ZSAA 3AYXB 5LPNA 1QFZA 3OOYA 3BVPA 1PR9A 2TS1A 4NYJR 4EL0A 4QUAA 1SURA 4EM6A 2HUNA 2O54A 1SA0B 4UU7A 3UAOA 3RS3A 3NWOA 3NUQA 5LDHA 4RV4A 4W9NA 5JI2E 1TVCA 4CL3A 3UO8B 1Y4AE 2QSUA 1JLKA 1LPNA 1YZ3A 4RLFA 4GPBA 4J1QA 5KO2A 4QHTA 1OB2A 1MGPA 3O1LA 5CJPA 2NVBA 1NOKA 3UA4A 2QGFA 4N6GA 4EFLA 2WM3A 3UHPA 5EHGA 5KOJB 2P9GA 5BSTA 4KU4A 2FOXA 1ZVVA 5IKOA 1FUKA 2P67A 4MR7A 2RIPA 4WKBA 1CDEA 3G23A 2WF9A 2VCHA 2X5XA 1A88A 4OSEA 2EQ5A 3PPVA 4LXHA 3K4HA 4RGYA 2GN9A 1SELA 2J6CA 3IERA 1GARA 5ICFA 4YUAA 4RTLA 2VZEA 5BN3A 1DS6A 2EJCA 4HZUB 5AW1A 3K70C 1SKMA 4QUKA 4WPGA 1G2OA 1JJBA 2ICAA 3ROPA 3PFWO 1KEWA 4PCLA 2P68A 3P4YA 4RVCA 3DM5A 5KNDH 4CKBB 4UNSA 1AHNA 2A2ZA 1USIA 2P9EA 2Q2OA 2GASA 3THXA 3IQDB 4AZSA 7ADHA 1T9DA 2VNIA 3JASB 3EBOA 2A9QA 2MMGA 1BRMA 1R18A 1JPUA 1ZWKA 4KGZA 4IIBA 5JS1A 1E0DA 1XLUA 3AHJA 1TM3E 1H65A 1UJBA 2KMLA 4LHXA 4H0CA 1NT2A 4KE9A 1DKPA 3MMPA 4JGBA 3GOQA 2HSJA 3P9CA 2VFAA 2JAXA 2X8BA 3FIUA 4R7ZA 5KI6A 3WK6A 5HRCA 1C7RA 2Z95A 1F9EA 3IURA 4OOFA 4QAQA 5F3RA 1P4GA 1YVDA 4OGLA 2Q2WA 4HAVA 4HEQA 2J5XA 3N2KA 4Q02A 4BNWA 5AW0A 4DV7B 1OC4A 1OSNA 2O23A 5C18A 2OHFA 2WLSA 4H1VA 4PHGA 1V3QE 3DQPA 3GG9A 4JKOA 2X8JB 2XNHA 3M9XA 3Q4GA 4N6OA 1RWBA 4BAZA 2CMHA 1J97A 5J3JA 4BGUA 3OAAD 2YZNA 2HWXA 4E2ZA 5C31A 3GEPA 3ZWBA 4OIFA 4EUEA 3QNWA 4RHYA 3ZXYA 1OAKA 4Y67A 2ARKA 3Q3HA 1K2VN 1EFLA 5DE3A 5L7WA 1YB7A 1DX9A 3LBFA 2XMZA 4UCQA 1TF5A 5FPHA 4WX2B 3ETLA 1VLMA 4OP1A 5IBRA 3SHWA 2HBRA 1YTUA 2WJZB 1W5BA 2IGBA 1VSBA 1J7KA 4IGFA 3MTEA 1NONA 2QLMA 2Q1TA 5TRTA 2GEDA 1P33A 1ISSA 3A4YA 3CSUA 5ADHA 3U4CA 1LBHA 3JQFC 3JVEA 1D03A 5EVCA 4MYRA 4RTJA 4WZZA 4Q66C 3JR3A 3LIIA 1FEZA 3OAAA 1R6VA 2GRJA 3IRUA 3N2LA 4G1CA 4ERXA 3QFRA 2Q9CA 3DXXA 2F55A 1K7SN 3K0CA 2IHNA 2NO7A 1L1FA 1NBME 1MMFB 1XCBA 4RDIA 4AVYA 4BP3A 1EE1A 1K97A 2ZDQA 3TOVA 3KD3A 3N05A 4MJ7A 3SHQA 1E4VA 3L79A 4QPPA 5DF1A 4R8RA 5DGCA 3EA4A 1VLZA 2HU2A 3KQPA 5ALKA 4BX8A 2VH5R 2XWBF 4YROA 1SY7A 4URHA 5AH0A 2F4VB 2QRKA 1JDUA 1YS7A 4CKWB 3CZ5A 2X0JA 3PPXA 4YFVA 3TMKA 1Q83A 1EK2A 4RABA 3SG0A 1AO0A 1RS0A 4LYJA 3BAZA 5HTKA 2C8VA 3EVFA 4RJ2A 1JIUA 3RRBA 2IK8A 3MWDA 3K2EA 3N6RA 3MT9A 4FR5A 4URWR 1ZMOA 4WXHA 3SM9A 1E4OA 5J4LA 2GZ1A 1U4NA 3ADKA 3GB9A 4MUMA 3PPYA 3W8EA 2C5BA 4RE6A 1IL0A 1AK1A 2G17A 1H2XA 4PHHA 4OJNA 1JLLA 5AJYA 1ZM9A 3VKHA 3HCCA 1AHHA 4LRYA 1RWXA 4C4XA 2AQIA 2FW6A 2J6HA 3O8BA 5H1YA 2PV0A 1NHWA 3GFGA 4PTZA 3WXMA 3N6XA 2IBSA 3SXJA 2CFCA 1WXGA 2OM2A 3NNNA 5ER6A 5LBTA 4TRNA 2OORA 2XMDA 4ND2A 4J7CA 4QELA 2AYXA 2XOXA 4H16A 5CDYA 2IHUA 5EJEA 3HGQA 4M76B 5CGQB 2W2MA 1GNQA 2GRAA 4AD8A 5K0EA 2OENG 1EFAA 2FMKA 1E8MA 4PYRA 2QZJA 1OVMA 3H5NA 3QLJA 4XVHA 2I6XA 3UWPA 4YRGA 3MS4A 2IEDA 2WWRA 2A14A 4M1OA 4Y2GA 2CL7X 2W90A 4B3XA 1Z62A 3ESRA 1W88B 3WLJA 4ER0A 5EGSA 4RKQA 1Y6GA 2ZB2A 4AJLA 5H9VA 3EPPA 4DUGD 1EFDN 2VT2A 4Q9HA 1ZN7A 3FWNA 4UAJA 1RI5A 1XJ5A 3TOCA 4YV7A 2ACKA 5K6AC 5AI6A 5F1KA 5CT4A 5LLDA 4YYEA 3I9V6 3GAMA 4MQUA 3MYYA 5BR4A 1R8QA 4KK3A 4J1TA 1L4FA 2ZT5A 1OZAA 4N12A 2GF9A 1SXJB 2ZS8A 1GL6A 1QDEA 2ZIXA 1JR3E 3NPAA 1BE1A 2GZMA 2Z3VA 4HGZA 4M0CA 4QBKA 4AULA 1SUCA 1XTPA 4O3FA 1CS0B 5KU7A 1H2BA 2NSHA 2CLFB 2IYNA 5ESDA 5D84A 3UWMA 2H8GA 5DBHX 3W3ZB 4L76A 1KWGA 4YJ2A 4DUGA 1NRWA 4UHJA 4ZV7A 3RNLA 4TYMA 3CSDA 3RRFA 3ZGLA 4A5OA 4CXMA 1RWKA 2QT0A 3NBMA 3QMVA 1IUOA 3IULA 3RBZA 2OHHA 3BQNB 1UDBA 3NJRA 1DJNA 1P44A 3DLBA 4LZJA 1P9LA 3OTGA 3L07A 1KMHB 2JGMA 3EFEA 1N1EA 2VHXA 3W0LB 2ZUVA 2Z4SA 1IMOA 1U7UA 5L3SA 4MRPA 1JQEA 4Q4HB 2O2CA 3PNVA 4AJ4A 1C7ZA 2WIGA 5F52A 4DHEA 2O5RA 2PTGA 4C22A 1JSCA 4B8YA 1ABFA 3B1WA 5BR7A 1F4VA 1GKUB 1ZI9A 2HQOA 2PCLA 3KNZA 3NOOA 2ZS9A 3TL6A 5MFZA 2JLYA 4DR7B 1NE2A 2Q46A 4P08A 2FWIA 4OUDB 1F06A 1OZHA 4I9UA 4LDZA 4EA9A 2Y67A 3GFFA 2NQ2C 2IUSA 3KSAC 1UZMA 2QTTA 1C3JA 5CFLA 1CR6A 3NONA 3WAGA 4LYHA 1GTJ1 2HA3A 3ZJ5A 3O90A 2HDNB 5CT6A 3EYWA 4DYVA 3NHBA 4MQ4A 2MDTA 5HR5A 1A98A 3TLBA 5JQGB 5TQ0B 3ZOZA 4E2WA 4UFNA 1K8RA 1ZJ4A 1SVKA 4LSZA 1N1MA 3IXLA 5E8RA 3QITA 5F3DA 4QEKA 4TROA 4P4SA 3CUWA 4R1PA 2V5VA 1NIPA 1D1SA 4Y7DA 3UUFA 1OB5A 1EESA 3FWKA 2PKYX 1KOJA 4F91B 3GJQA 1XDSA 1O96A 1U8YA 4N9WA 1YDWA 4XRRA 4KGDA 2QJWA 1FTQA 4F6RA 2IPMA 1ADGA 2PMFA 1EFPA 1O97D 2LIVA 3QYAA 4W5RA 3WE7A 4L22A 2CB9A 3LVRE 1U63A 2RG7A 2Y9MB 1FBTA 5DNWA 2PL3A 4OREX 5K3EA 3OEHD 2QN2A 2RK6A 1PI3A 2ZSDA 4S35A 9ATCA 2ONKA 4D4JA 1KWKA 1L7OA 1DEXA 4XVUA 1A2BA 1T4CB 1ZGAA 2ZE7A 3LPLA 3GVXA 4NE7A 4JYAB 2N0SA 4UHCA 5HMMA 2HHAA 3NM6B 3TLGA 3V34A 2QRQA 4LXYA 2FETA 4ZC8A 4KIFA 4AG6A 1RQ7A 2BR3A 3SIRA 2JD1A 1R15A 2ZYHA 1PEDA 1GQQA 4IWYA 4O1HA 1ONOA 1Z56C 4I8DA 1HL7A 5TPZD 2YZ7A 5KTYA 5CIYA 2EOAA 3GDHA 3D5EA 3SLRA 3ZD9A 1HZJA 1RYFA 2M6RA 4ZJPA 3EQZA 3OEHA 1OQAA 2F1IA 5D5HA 4E5UA 1EJBA 3QBVA 3GPIA 2GN4A 3C45A 8MHTA 2AS0A 2XB8A 1SCIA 1ADJA 1SR8A 3BGVA 3IDFA 3RG8A 3WK8A 2ZYUX 1ZGHA 2WWHA 5AICA 3CVUA 1SD2A 1M2VA 2C8JA 2XD4A 3G7UA 4OLHA 3UENA 4FHCA 4DQKA 3AHHA 2VPPA 1N5OX 3TEFA 1WS6A 3MHTA 1DQZA 3LLUA 3MMNA 1X7XB 5AHRA 1U0GA 1XRLA 2GM9A 2OYSA 4IY1A 4UHEA 5TPZA 2NVUB 5K0BA 1XNQB 2I1QA 4CF7A 1JE0A 4WNAB 4R7GA 3NTLA 1JNXX 2VDPB 4IKPA 1GAJA 1G4UR 3CUKA 1BJRE 3Q3CA 4KI7A 3HE3A 4H6XA 1P0QA 1EHCA 4K6GA 5DRTA 1SBZA 1V0JA 2FF7A 2H48A 3B1YA 4I9NA 1GQYA 2INGX 1P8JA 3M4NA 4XTRA 4WZBA 5TEVA 2JF0A 4WK0B 2W6JA 1PFYA 1PD1A 2AHOA 2H7YA 1OBFO 3A2NA 1COZA 4NMMA 4CKEB 4Q47A 3SSMA 5B1EA 4GHWA 1O0SA 3B6MA 1NC1A 3MG9A 3OKPA 3OIVA 4V0MA 5HZHA 3NEYA 3IBCA 4RX1A 3IB3A 1NDQA 4HRXA 1G7TA 1UUFA 2F8MA 3QEKA 1M75A 2P5UA 2ZJ3A 1MXHA 1EVLA 1NMEA 3C74A 2PDAA 1LDGA 3ASVA 4G2TA 1CQJB 1M1ZA 5E6SB 1I3NA 1F51E 4EI8A 1H8HD 4EKIA 4P35A 4AKGA 4URFA 1DG9A 1V5GA 2XHZA 4RTRA 1RBZA 4KP7A 1OILA 4HMOA 3M89A 2GTIA 1XZMA 3ORFA 4YT5A 5L8VA 4BKPA 3LOQA 3TDNA 1GKYA 1V5WA 3NHZA 3WYAA 1E1DA 4LS3A 1BMDA 5ER9A 2XB9A 1FTYA 4MPPA 4AY6A 3DMPA 1IIBA 3JAMA 1PJ2A 3DVLA 5KTMA 1E2BA 3PHHA 2A9JA 4HH4A 4PM4A 5B2EA 1MNQA 2REQB 3SDBA 3VH4A 3PC7A 1OX6A 1WB9A 5EQDA 1E32A 4L8VA 1QG4A 2BEWA 4JXXA 1M5RA 4DILA 1NJ2A 4B3IA 4UARA 2WMNB 2DVMA 1O58A 4QYMA 2GAAA 4L9RA 3WKCA 4JZYA 1ZBQA 1G8MA 2BJWA 5ALQA 4UTVA 3ZGNA 3VNUA 4HN4B 4UUNA 2UZ1A 1EM8A 1ZVMA 2MWMA 1Z2DA 1GZDA 1NVGA 1IEQA 1BCRA 1LSJA 2DQ4A 3FI9A 1C0PA 3D8TA 2MSNA 3ORYA 5AKJA 3FA2A 3OJ0A 3IJ5A 5CLJA 2HJHA 2RHLA 2SCUB 1XL0A 4RD4A 2NWQA 3UXYA 2XD9A 3VVMA 1CKEA 4IIJA 4EI7A 4OB7A 3RS8A 1KK0A 2VT6A 4ZTBA 1W85A 2JARA 2OCKA 5FUYA 5JCJD 2WLTA 5GQSA 3A36A 4WCVA 1E98A 1YRHA 4EYKA 1I3CA 3LY5A 3VNQA 4X60A 4QGSA 4E30A 1XYGA 1A9PA 5HKAA 4ARZA 1A9ZA 3ZH2A 5AVYA 1DTSA 3GX1A 1ZCBA 3AERA 5AVUA 1F8XA 3OT1A 3N76A 5T57A 1VPTA 5C37A 2AQHA 2DTDA 1XA3A 1DAGA 2RHMA 4FFSA 1SU8A 3F6CA 1P0CA 4Y3UA 4EA7A 3DE0X 4UXHA 1XMSA 1OHHD 3FE2A 4I6GA 4QT0A 2QMOA 3AY3A 3HLTA 1NGSA 1Y6RA 2GI4A 1X7WB 2BFMA 3ACBA 2WVJA 3EODA 2V45A 3P9XA 4LTMA 4E21A 3EISA 4QVIA 2PLWA 4QBHA 1U31A 4A6XA 5T6MA 1OH7A 1L5SA 4FMDB 2PMCA 2NZUG 3FPSA 2JFBA 1T1RA 1G9XA 3F96A 1M0WA 4EFDA 4ZCSA 4UKDA 1FDTA 2P9YA 2PLRA 3ZWWA 5JSQA 3FFXA 2JLBA 2V59A 2Z30A 2HZBA 3EVEA 3NGXA 5DB4A 5FOVA 2XCQA 5AVZA 1FJGB 1O03A 5IARA 4A6EA 4QLAA 4AQYB 1UT5A 1ZCZA 2BGTA 2DU8A 4PINA 4TL6A 4UTRA 4NENA 2CJWA 4F9FA 4RH1A 2CXUA 2RAPA 1WBDA 2RBKA 3TNLA 2ZVQX 2WWYA 3QX3A 2VWPA 2XQGA 4HNSA 1PHPA 3MWJA 3Q0TA 2XQIA 2J0UA 5BUCA 4R3WA 3AT1A 3A1TA 3DR3A 2WSBA 4L50A 4KGVA 2VNKA 4MQBA 1BD4A 5AM1A 3OEED 2YHUA 2BBTA 2D06A 2O7QA 3PF9A 3EVGA 1VI2A 5EQTA 3UYLA 5IABA 4CM8A 2AFIA 4GPIB 5A9TA 1QNFA 4JOCA 4KPGA 1QVRA 3U0VA 3DD5A 4EF4A 5TV2A 5I7EA 2EEPA 2X0RA 2BIFA 2JW5A 2C42A 3BRSA 4D9JA 1UBLS 3LOUA 4UHKA 1O6BA 3U9SA 3B6JA 1E9EA 5JLJA 1BVHA 4S2UA 5C32A 1CK4A 1QIHA 4V3BA 4FEYA 4R2KA 3KELA 1JDTA 1W93A 4L3VA 4FHDA 1DJQA 1KMMA 1V8ZA 3CUVA 4O0LA 1M2KA 3FUTA 3RODA 1KEPA 2HGSA 3I3OA 4N5HX 1QTIA 3OEEA 1M34B 2XR1A 3PL1A 1A5BB 4QG7A 3O4JA 1GG5A 3CT6A 3V4RA 3F5DA 4RQAA 2BMFA 4NKRA 1CIVA 1T1GA 4TLAA 4C4OA 5FLXA 4KIWA 2JRCA 4F4IA 3LX5A 1L5FA 1VPEA 1T5SA 4MUFA 4P4LA 2GYVA 1J33A 1GPBA 3OFKA 1F4PA 5C3MA 3HNPA 3FFAA 4OSOA 4XSVA 5K51A 4ZKDA 5BMOA 1IOVA 7AT1A 4R8LA 5C8YB 1W5EA 3NHPA 1O77A 1XXHE 3OTHA 1DO2A 4IDDA 1TLLA 1JI3A 1I6KA 3ETNA 4QSHA 2QGNA 4XE5A 4ZI7B 5CFNA 2JFHA 4LK3A 4FYMA 4I1YA 1S8OA 5AJHA 2GZ3A 4XWTA 3VKUA 4QOIA 1IPEA 1Y7IA 2ZYIA 4C07A 1NF9A 3FY4A 3RS9A 4AN4A 2KWIA 1F48A 2GEJA 5FI3A 2VJMB 3ICEA 4DJJA 1JG2A 5KYUA 3A3OA 1SC9A 2C7PA 2VDUE 4JVOA 3WHIA 2XNJA 1SU4A 4BJ3A 1A2QA 1DCFA 3PLNA 5CHEA 2G09A 2W11A 3OQIA 3QVKA 4FPXA 1NA5A 3BE6A 2QE6A 3H3JA 5EHZA 3DE3X 2NZVG 5IKEA 5JNSA 3PG5A 3AI2A 4PNEA 2PZJA 1O2DA 3MK31 1MPTA 1H3EA 4J76A 3KAKA 4J91A 1H2WA 3ILSA 1QK5A 2Y0CA 1H94A 2X4GA 4FGZA 1HLPA 5EZYB 1V1MA 5A5EA 1DDGA 2OV1A 1QXSA 2XF8A 4BFLA 2FSSA 2PWBA 5LA6A 1XBTA 1A2OA 3IO5A 5HDQA 3JYPA 3USCS 4MAMA 2PUGA 3NGMA 1L5LA 1LBIA 2OB2A 3VR4D 1V8OA 3NEPX 3D64A 4YQYA 2ZJ0A 4OYHA 4BKRA 3PWSA 1F2VA 2CXQA 1NSTA 3E9QA 1HNWB 1HPLA 5BWOA 3GJ3A 3BQ9A 5CNKA 1KU0A 1NUHA 2NVUA 4OK3A 1VYVA 4M0PA 3BMOA 4X1KB 2GYWA 1HE5A 3WMGA 4PHTA 3EGCA 3W06A 2CL0X 5K9ZA 1SCAA 4MWZA 3U7HB 1P5ZB 1SBTA 3KWFA 2C95A 2IYXA 4MVXA 1FYVA 4WVFA 1TB4A 3GZ4A 1YMUA 2H1CA 3PENA 4IAOA 2YWCA 4KQFA 4QLOA 5REQB 2V5AA 2GCIA 2HDHA 3KJZA 4HPWA 4LX0A 3VR4A 4R0MA 3PHBE 1KP3A 3LD9A 1HDYA 1MU0A 1XMPA 1JR4A 1WV0A 3M6AA 3GLFE 2FYTA 2H7CA 3RWOA 3H18A 3FZNA 4PEVA 1T9AA 2GA9A 4AWBA 1KFEB 4IH4A 3HCRA 3SIPA 4DCVA 2ZROA 3EA0A 3M6LA 2FWAA 3COVA 4FSXA 4HVTA 5I9BA 5DSZA 2LV8A 3WGOA 1G4AE 2G08A 2GEUA 2FZCA 1R9GA 1NF3A 4I4TB 4M86A 2OGUA 3ONNA 4OI0A 1TYBE 3VPBA 4HBZA 4HL6A 4EGJA 1DRWA 3DDOA 3ULKA 5AW6A 3GWZA 3LZDA 1FXWF 1KQNA 3H11A 5EZSA 4C7OA 1R0WA 3HDYA 3BMXA 3JQGB 1V8DA 3DO8A 2SBTA 1EB9A 3H9JA 4HWTA 3RVPA 3SEQA 2EKPA 1USVA 1QIMA 2IITA 2D5IA 1B23P 2AN3A 3WQRA 2IX9A 3MGBA 4L07A 4AI6A 2H2AA 5JSHA 4NI5A 4S1NA 3OZ7A 3R24A 3A2KA 4ZVNA 1DWPA 2I2AA 2PBLA 2AOTA 4KN9S 3VYRB 1CHNA 1SCQA 1DQRA 2ZUFA 3HB9A 3ONEA 2D1QA 3I2FA 1DKUA 3C2QA 5SY6A 5AW3A 3IBTA 3AR5A 1DXQA 3K0FB 5ALVA 2CHUA 4YCBA 3LUBA 4QG3A 5M04A 5LL6P 1EFVB 4UCFA 5T4HA 5FAKA 4DCMA 3HA7A 1VM6A 5FNVA 2LCQA 4RPIA 1RDFA 1SC6A 5K8JB 2Q27A 2SECE 2AC7A 1NRXA 1W76A 3DBRA 1G21B 1KSGA 3ELUA 3IQFA 4GS5A 3WGMA 5B12A 4P92A 1ELOA 2G82A 4OL0A 4AMZA 2FR8C 2IDMA 2Z2YA 3EXHA 2JFOA 2ZIFA 5JC8A 4QQRA 1QO0D 3F4BA 4GQAA 4ZGBA 2QF7A 1RVV1 1TEHA 2J48A 2LKDA 4HWOA 3VJKA 4ZRNA 2G0TA 3TMYA 4OXQA 1BFDA 4D9BA 1DBPA 1T3TA 1QYDA 1RQNA 2HK9A 2A1UB 5EESA 1VIVA 3M6XA 2FUG1 2IP4A 3F1KA 3H1PA 1O3YA 3I9OA 1W4RA 3JZAA 1YTLA 4NFSA 2AG5A 2O2EA 3H7AA 4JI0B 5DHFA 3SYNA 2V1UA 2GUWA 1GY8A 4HY3A 3ZD6A 4LSGA 4XIFA 4EFKA 2EZ9A 5HF6A 3DKPA 2C00A 1QO0A 2AE2A 2HJ9A 3QUQA 4RVOA 3D2LA 3VU8A 1BWPA 4GR9A 4TKUB 2RJ3A 1D2GA 2W42A 5C7YA 1P7PA 1EUCA 1ZGJA 3RC2A 5KNBD 1EG7A 2FUCA 4D6YA 3QQ5A 2FR0A 4OVKA 1BO6A 4KH1A 4TT8A 3FXAA 1H5UA 5HUQA 2H9AA 4CETA 1Y9DA 3IS3A 1IJKA 4MS3A 3BMCB 2RHTA 1KMQA 2XRFA 3HCPA 2H9IA 1VLHA 3HJUA 2FZWA 3PQ5A 4L0MA 3SWWA 1U7DA 1MGOA 1L5NA 1ZPDA 1M6NA 1JA1A 3BZBA 2P90A 4B4UA 5LVAA 1YIOA 4JL8A 3M5PA 4WESB 3QVXA 4XIJA 1X1QA 5JAMA 5KNBA 1N2EA 4R9SA 5BMVF 3RRXA 1XZEA 2ZYTX 4EGFA 4ETNA 5GZ3A 1T34A 1J8YF 1G8AA 1RQPA 5BY2A 5TLSA 2DPHA 1HMYA 4CQLB 1Z47A 3F8TA 1RXWA 4PLTA 2E6KA 1FU8A 4XGQA 3F9RA 1YA6A 2QT9A 2RHJA 4YT2A 2OGWA 1EWKA 2A9KA 3J80A 5JSFA 1V5IA 2C20A 2IZZA 2VTDA 1DXYA 1Z75A 3GA0A 3KM0A 4GYWA 4RVDA 4X62B 3L4KA 4PVDA 4ZYLA 1WU7A 1E2PA 4QECA 3ZUGA 5G4KB 3OQMA 2BYTA 5JEDA 2J85A 2QW0X 2R8RA 3L7BA 2QV7A 3T34A 3Q0IA 1DAPA 1NYRA 3CH5A 1RI2A 5KYTA 4XWWA 3C3BA 4JVSB 1LY1A 2Z1DA 1QFYA 4MSUA 2BMJA 5KPDA 5MFPA 2G9UA 3W9SA 3LY7A 2AI1A 1SCJA 2K5UA 1KAOA 3MAAC 1PG2A 1ZQ9A 3UJAA 3K9NA 1CR2A 5GINE 1E6CA 4QT4A 1E5QA 3EBPA 2VJBA 1E99A 2ORYA 2ZTUA 1Q91A 4LJYA 3GRAA 4PO8A 3WGKA 7GPBA 2UYCA 3SOPA 2P9ZA 1E4EB 5EUMA 1AF4A 1ESDA 4BBZA 3CLTD 4QYIA 5LNK1 5H16A 1E64A 4JHLA 1W0JD 3IIIA 4MW0A 5KDOA 5E9WA 3MRVA 3PGLA 4ND5A 5DLYA 2NXCA 2Q6IA 2G7MC 3HSYA 3K5WA 1HMPA 2VJMA 2XHEA 5F2OA 3T95A 4FMCF 4AS2A 5KVCA 1JH9A 3TTXA 4ZI2A 2IUUA 1CSEE 1NU6A 3OKFA 4PZUA 1ZCAA 4H59A 4PS0A 4DSAA 3D8HA 2G1PA 1UMKA 2AX4A 1N2CB 2EU8A 4K9KA 4RS3A 1AB5A 6PFKA 1Q0TA 1P73A 4BV9A 5JJLA 4H0FA 5H4GA 3C3EA 2VOEA 4BECA 4PYKA 1T0UA 2BR5A 4A9AA 2Q1XA 4QO8A 2PYZA 4G1MB 2JAPA 4HJXA 1RLOA 3D2AA 3UCFA 2ZI4A 2IWHA 4ZI5A 1W0JA 5G4LA 3I8SA 1WOYA 4CQNA 2I55A 4INPA 2IXAA 1V96A 4LCBA 6YASA 5EJ6A 4X3CA 3N07A 4GZ3A 1FE8A 1K86A 1QGUA 2RH9B 4IR7A 4REMA 3FX2A 5BNTA 1AKEA 5C1IA 4HO1X 2ZJZA 1IPHA 3FYUA 3TYXA 3S70A 2ZREA 2W48A 5KIAA 4AF7A 3RSSA 2GMWA 3RWBA 3WKBA 2DYKA 2QTMA 3MUEA 1H2FA 4RA9A 3DBVO 4EEXA 1DTWA 5FF9A 4BP1A 2LWIA 1TJNA 3PA6A 3AHDA 1PJ3A 1Y37A 1CUAA 2XEDA 2HSEA 1CLEA 4W7SA 5M5BA 1NJ8A 3NIGB 4KWIA 4Q39A 4WOKA 2OKGA 4X20A 1B00A 3IC5A 4YAJA 3EEQA 5DGTA 3L41A 5JAZA 1UBMS 1DC4A 3HBJA 1CVRA 2DG2A 2R1VB 2P6OA 3O26A 3VX4A 1QUEA 3R3VA 4IJKA 4RK5A 3DS8A 1MW8X 3QYPA 4UD6A 3QLVA 1XNGA 3FMIA 4AJJA 3QA3E 1Z8DA 4WXMA 3UGQA 3FTQA 8GPBA 2H00A 2AHRA 2PKEA 1XQ1A 1TYZA 3DWFA 1NXPA 4HAZA 2BGMA 4YUWA 2CBGA 3AY6A 4HUQB 2EFGA 2ZRKA 3CXUA 3IGFA 3QVGA 3L8ZA 3QXJA 4BLUA 2IV7A 4EF6A 1XN1A 3DOUA 4CE6A 2A30A 2Z1MA 2DUJA 3CCFA 5AI5A 4J3NA 5SICE 3N39C 5L95A 1QHHA 2G0NA 4QJBA 1WHSB 5CJJA 5IKXA 4E4YA 3WO0A 3JQBA 2E4AA 4EKGA 3X2SA 4QXOA 2AOXA 4G4SP 3O1HB 4QEDA 4MWSA 3C85A 1YRYE 4XM0A 1CT9A 5JMPA 3DB2A 4BYMA 4D92A 3RK0A 3KKLA 5LU9A 3W7AA 1I30A 1JUDA 4RPGA 3VGJA 5JJCA 2XNDD 3UBTA 1EMDA 2Y4OA 3E82A 3AOGA 1FP4B 1WXIA 3A04A 2G6TA 1GVHA 5KWEA 3KCQA 1O8BA 3FSRA 4YMHA 1RKBA 4IIFA 5EC8A 4D9GA 1QIIA 1EWVA 3MLAA 4A8JC 5T6BA 3VHQA 2RAFA 1G21A 1IWBB 1WZIA 3EZGA 4M9QA 5CW1A 4KPYA 3A6ZA 2GEVA 4AO8A 5ITZA 4R9NA 4G01B 1Y42X 1D6SA 4GKVA 4CG3A 4EO4A 1G0NA 4C30A 1H4TA 1URPA 3H1EA 1Y1QA 3KYBA 1KY4A 3K16A 4KR6A 3T54A 2I62A 1FTNA 2B4YA 4X91A 2V9CA 3V1LA 4KXYA 1YRQA 4Y9SA 1K8QA 3HKCB 4X95A 3VDRA 3WP1B 3IL2A 2C78A 4BMDA 1XAJA 1O5TA 2XKKA 1GU0A 3VXKA 4LFBB 2JBWA 5GJWC 1LF5A 2VHWA 4U7FA 1NRJB 1DCTA 3NBKA 4BUZA 4OX9B 1E3JA 3ZHUA 1BHO1 2HO4A 4R5HA 1QVWA 2OYCA 3GEMA 3S5UA 2AQ8A 2J3HA 4NONA 4EY3A 1Q0LA 3IEXA 4A0HA 4QFCA 2YMLA 2REOA 2CVQA 1OWPA 3HJHA 4BNNA 1L5HA 3NMUF 1XYYA 3M33A 4FDMA 3PQ8A 5JAHA 2Y3IA 4V0RA 5IAOA 1S96A 2C5FA 2MR6A 1EKXA 3OMWA 4LC1A 2FN3A 3I39X 3BMCA 5EUQB 5GPBA 4EUKA 4NQZA 4YBZA 5A4IS 4R5MA 2X58A 3KR9A 1YZNA 1SBCA 3PDUA 2FMUA 1GGKA 4C3UA 3ZWVA 3VC1A 4YCAA 2YN2A 1FXWA 2VP3A 4AY5A 4QQFA 3GW8A 1PJRA 3BFKA 2H52A 2VXCA 4LY0A 2BMAA 1WIWA 3CX3A 4RIIA 3BK1A 3LUCA 4D56A 2WTNA 3O73A 4AYXA 2WV7A 1X80B 2VCYA 3DOEA 2IIPA 2QB5A 3N8HA 4D7AA 2Q49A 5DFAA 4I9HA 2YFYA 4EKNB 2GNOA 5G1NA 4ENSA 1UPTA 3I9KA 3IP8A 3T8YA 5EKUA 1RCTE 3AIIA 3TBFA 4MQ5A 5LDGA 3DAGA 1XZFA 5EHNA 4IJMA 5LKRA 3UZUA 5IT9A 3GLGE 1HE2A 1QYIA 4TMWA 4J1SA 2YHSA 4BJHB 2FPGB 3NT5A 4LDJA 3T3EA 3L04A 5AOBA 2HGZA 4HQNA 3FPHA 4IUDS 4NBWA 4NCXA 4QDTA 4PBTA 2CBZA 3SJBA 3ZHOA 2RJNA 3UK0A 4BDTA 3ESYA 2ZPTX 3GJ8A 1SQ0A 4N8DA 3OG9A 4XX0B 6REQB 1K7EB 2XGJA 1R10A 1TZBA 1MIHA 3JALB 2XUFA 3GD5A 2ONJA 2EP7A 4K9QA 4D6PA 2CZGA 4NY1A 5FTNA 1SUSA 4BFWA 2AWNA 3EUEA 4II2A 1LNSA 2WEKA 5DYGA 5JNTA 1YL7A 1YE8A 5JC1A 1ZX1A 2QJOA 4ZVSA 2H4XA 4B7XA 1R1DA 3EZYA 1VPLA 2FPXA 3OHMA 3K9WA 2HMUA 4KVFA 4KQJA 4Z3OA 1PV2A 2GTPA 2C4KA 4NDZA 1EJ6A 3OT5A 3PWZA 4C4TA 2A59A 1NW8A 4UCXA 1E2MA 1VL1A 4NZOA 5AXDA 5IHXA 2GYYA 1V1RA 4HHEA 4ZT2A 4CKXA 4XXHA 3K8ZA 2H1IA 3S55A 3HUUA 5AW2A 1L5QA 3FVWA 1UKAA 1ZHOA 1WB4A 2I7TA 3KLBA 3VISA 4DDUA 2X4LA 4GI7A 4PWYA 2J30A 5F2NA 1W25A 3FMVA 4DR1B 3QXSA 5I9TA 3TD6A 3WZMA 1DELA 5JDIA 2APJA 2R96A 4LE1A 3SHTA 2IU4A 5FJJA 2QUKA 4GMFA 3RYCB 1N2CA 4TUYB 4DADA 3AKZA 5JROA 2NMVA 4GLJA 5AW9A 3SQXA 2C2ZA 2Q9BA 4EGQA 1YK0A 1XIVA 4Z49A 4EG6A 1OI7A 4RF5A 1XPUA 4JQOA 1AZTA 3CF0A 3FMOB 2N42A 1FS4A 2Z6VA 4E31A 5GIOE 2OAGA 4YXWD 2EFJA 4G5GA 1G2IA 1TTQB 4IV8A 3QKUA 4GICA 3S7TA 3WMRA 4R2JA 2VQ3A 2HUPA 3QJ5A 1H42A 5E1MA 4RMHA 2ZJAA 2XV1A 4UEJA 2FPPB 3ZHQA 2HV8A 2CD7A 4UOQA 5F1PA 3ZLUA 1G59A 2DWQA 1TCVA 3JQ8B 1DC7A 3VZBA 4K87A 4C01A 3ZTWA 2P2YA 4Q1BA 2AOVA 2VNJA 1KBOA 4MCAA 1P74A 4OD0A 5DM1A 3ZCPA 4ALJA 1EFTA 1VKZA 2C7GA 3PWKA 3JY6A 3RO7A 3ZK8A 5DM4A 3IDOA 4YXWA 4PS1A 5C0OE 3V33A 4BZWA 5JTUA 4NWIA 1UBFA 1OOEA 3MWKA 2G6BA 3E8XA 4N0QA 1RE1A 2WSLA 3K3PA 4PC2A 4GUAA 4PYLA 4QUIA 5COAA 4LYGA 3GNQA 4LXUA 4NMLA 2DOKA 4KITB 2Q4EA 1EFHA 3HHPA 4W1RA 3AFNA 3SZMA 3V80A 4Z6KA 1M1UA 1YBMA 1YOVB 4OM7A 2P0EA 4U7JA 2PO5A 3I01A 4NOJA 3G8AA 4JLJA 2NLOA 1YJBA 3PC2A 4RY0A 1SKQA 2WJYA 5M34A 1DRKA 1XK6A 2F1OA 4YUVA 2RHDA 1L4YA 3T9DA 2B4KA 3P4UA 2IXDA 5ALIA 2WYHA 1UANA 5BV1A 3BS4A 1Q7GA 3U1VA 2D13A 3DF9A 3H05A 3SBXA 4FUTA 5CDFA 4YTEA 3RYFA 4IQGA 1HX7A 3KJFA 1DARA 2H2FA 2QJRA 4YAIA 1BXKA 2BGJA 3G49A 2E1PA 1YRAA 3GZJA 4H0NA 1PQUA 1T4DA 3LT4A 3K0KA 1WHSA 3KK0A 3RF7A 2FRVA 2WNIA 1SOMA 1K7CA 3LY9A 3S68A 4A27A 4RJLA 2PAAA 5MN4A 1Z0SA 2WI8A 4N5LA 2UVPA 1WM1A 2H5EA 3LDAA 2WIAA 4UHBA 3IR5A 3NYRA 5ERXA 1GP2A 4B6QA 3N53A 1AV6A 4BGDA 1KNXA 3W1EA 4FLFA 3TZHA 4YRQA 2EF0A 1J0DA 5CT8A 3X1DA 1G8GA 4CIXA 1JKJB 1QF7A 4DT1B 1Q1EA 4WZBE 4POOA 1LS1A 1E4YA 3OWXA 1TIKA 4M46A 4NL4H 1FRFS 2O4UX 2YWDA 2WOOA 1AKNA 2B1GA 3E4CA 2X0DA 4GWKA 4MA5A 1WCV1 3EPJA 3E9CA 4C05A 1EX7A 4OQZA 4KSYA 5EWMB 1OXSC 4V0ME 3KZNA 4AROA 3QKIA 1XUOA 1MT3A 1V4BA 2G5TA 1G2PA 2P3OA 2BJVA 2VT3A 3R3WA 1ZNWA 1C41A 3WDMA 3G9QA 3UH1A 1C4OA 2I2FA 4FMBB 4CLRA 3C3YA 2B0CA 4MWCA 3ZXSA 1Z5UA 3K09A 4HRAA 4D4LA 5IUNC 1G18A 2HQ1A 4WY5A 2XOKD 2VJQA 1BCSB 3OUTA 1JW9B 2HIGA 3C6KA 4KLZA 1B7GO 2FP3A 1KYQA 3OQ6A 4XLLA 4V0LA 3VM6A 3AI7A 1GPH1 4MICA 5EQJB 3CX4A 5BWBA 2ZUCA 4TM7A 4XQCA 1NXTA 1KEVA 4BC1A 1TT5A 2DFNA 3MD0A 4ISBA 2P4SA 5BQOA 4QKQA 5ITSA 3ICVA 4OMUA 2A94A 4A10A 4YMTA 1IG3A 3QVUA 4B9AA 1ZXXA 4WXEA 2PVPA 4R1LA 4O2BB 3SBOA 3GI1A 4TQUS 3RANA 3ICQB 2CLLB 4TLMB 4B48A 4RZQA 5D5PA 4RH0A 3OPXA 3I01M 5IAGA 2QRMA 4ARAA 2Q4TA 2VYFA 3AK4A 4BFCA 2QWXA 4ADSG 3KS9A 5LZ8A 1CUXA 3KFLA 2C4VA 2OZVA 2XDQA 1GLGA 3ENWA 3ECCA 3MUNA 1TMYA 4GZ5A 3E9ZA 1G55A 1T9GR 2H54A 3Q8KA 3GUYA 2OXEA 1PWYE 2XWQA 2QOEA 4US0R 1J5PA 5CFPA 1HG1A 1IN4A 1EUDA 1XMXA 2FSVA 3EXIB 3IAS1 4BMZA 2G5PA 4ZQBA 2B4TO 4L7VA 1VHQA 4HWKA 3G7NA 4PLWA 4Y0VA 3GEGA 3L46A 1VSUA 1MOPA 5CJ2A 1R4MA 1Y9AA 4KTTE 1WP9A 5JXGA 2NXWA 5GM2A 3RYHA 1YDMA 1F38A 2VI5A 3VJMA 2QTLA 4X71A 5EZQA 3ZCVA 1RMYA 5LQMA 5C46F 2BJHA 4CZ2A 1BWSA 2YL2A 1Z45A 2ENUA 2ZJ1A 3EGIA 4GPD1 5JSYA 4EGAA 4WD3A 5HIAA 2OWDA 3INTA 1HQCA 5FA5A 3ZW9A 3SQNA 4TZKA 5D8DA 4OAOA 4LOKA 2RB4A 4Q4JB 5IU6A 3P32A 4Y6OA 2JGFA 1NFRA 2HQRA 2QU7A 3B1KA 4EW2A 3HLYA 3DOIA 2ZJBA 4MR9B 5HF5A 4BIMA 2BFCA 1R4ZA 1NKVA 3CH7A 3TAUA 5LXTA 1M8FA 1D4FA 2ZU0C 1IZ8A 1GPAA 3A4IA 4B3HA 4M7PA 5AK3A 4MYHA 3C6MA 1W1UA 3VFDA 2D62A 1ZONA 4V1CA 4QGBA 4JQCA 2ZZKA 4UMVA 3QWBA 2RIRA 2DPXA 3IVCA 3ZJYA 4DNOA 1RU3A 4MROA 4I9FA 2AFIE 4EI9A 4HDRB 5ERYA 1MD9A 2R3SA 2J5RA 4LF8B 1K8XB 1YRLA 2VH2A 4B0PA 2JC3A 1YL6A 1I1OA 2OAEA 3Q6MA 1RD4A 4LPKA 2CE2X 4Q37A 1WLYA 4UBOA 4UOZA 5B6IA 4ITUA 5CNJA 4BFUA 3C3DA 4WOPA 4MLDA 3O0DA 4EA8A 4YDRA 2V0GA 2NTJA 1NOIA 3BKXA 4R71A 1YR6A 3RYCA 2HLHA 2WM2A 1MW9X 2PJZA 3AI1A 3CY6A 4R1MA 3INNA 3JARA 3OZGA 4DV6B 2OUIA 4X7RA 3IUNA 1V7PC 3OJOA 4MKRA 4EG7A 4PXAA 3V9AA 4F97A 2YXPX 3F71A 1NI4B 3DLPX 4RZXA 3TG8A 1S2DA 4X1OA 4YGYA 5K3AA 4ENTA 1CUHA 2JGDB 1TU4A 3GBPA 4LYYA 5EUBA 4AECA 5DHRA 5HEKA 2FQXA 3R4VA 4M54A 2AEEA 2VPTA 4RULA 2JFGA 2G4LA 2YWHA 1GVNB 3DHYA 3T12A 4LYAA 4NJMB 5DV9A 1FYFA 2DGDA 1XD2A 4XDGA 3RAFC 3BA6A 4P58A 4PSCA 1U3DA 3L0ZA 1S2LA 2QQ0A 4PAOA 3H75A 4A2PA 5LOVB 4MB0A 3G5UA 4MMZB 2XE4A 4GPTA 4HNGA 5IN5A 3E9RA 3O83A 1U8AA 3OO0A 1Q3TA 1UWLA 4M0UA 5AI0A 5DXFA 1PTKA 3A1SA 2HA0A 3FSEA 3L2OB 3MTQA 4RCZA 2D00A 1YV9A 1I36A 3QA9A 1WHTA 4PTLA 3KSZO 2H4HA 3HHEA 1Y4DE 1NBAA 3RLFA 4F71A 1Z16A 1W9MA 1Y8AA 3FDXA 2GO1A 4HKTA 4N54A 4WRRA 1FX0B 3E53A 2K6GA 2Q5CA 4QDXA 1L5OA 3ZE2B 4J03A 4RE5A 2AJTA 3EHEA 2GWHA 1NNSA 1SOAA 2HFKA 2HJWA 3AM5A 3FNGA 4R69A 5CUQA 3ZY5A 1RLUA 2DJIA 4CEIA 4Q3CA 1EA7A 3H6HA 1DRJA 4Q1EA 1Y7TA 1F6WA 1Z0ZA 3DE1X 4HLCA 1IXYA 4E5SA 4PBSA 3D4BA 1FSFA 2PFSA 4XDZA 3EAFA 1S1MA 3NNSA 4J4HA 2I7CA 3ZDEA 4EJFA 1AS2A 3HP1A 2WRZA 4M1EA 4MQEB 5CVEA 4YJGB 4DQUA 2CXHA 3C7AA 4Y2PA 3ILHA 1TXGA 5LWHA 1DEAA 2MU1A 3LX4A 3U56A 1XEAA 1XWIA 1XTSA 3SEAA 2H4FA 5I4BA 1P4AA 3KWLA 1LLQA 1ONBA 3F3KA 3LO8A 3R7DA 3WL7A 5A4DA 4Y2JA 1TZCA 3N2GB 4ZHQA 4CN8A 2KBFA 2PUJA 1LNQA 1Y8CA 2X9LA 2VPWA 3GA7A 1C1DB 2FEOA 2PZGA 3DZJA 1UQUA 1XCJA 1EWYA 2QMHA 4UJ5A 5E4FA 5H4HA 3U7JA 3VBCA 5SY4A 3WIEA 4Q9AA 1M5UA 4RHXA 1W59A 2DFPA 4N03A 3V3TA 4BRZA 3VDMA 2EDAA 2V5UA 4KO4S 4CBVA 1G9TA 3RIXA 2W8BA 3T9BA 4RZIA 1PJ8A 3TW0A 1QAOA 2DMRA 3DE2X 1W9HA 2JK1A 3CLUC 3O3NB 5E9QA 3GF4A 1U02A 3GAFA 2PCJA 2O2YA 4R9UC 4KPEC 1E1CB 2R65A 3ZVMA 1Z7EA 4IIYA 4ZEWA 2ZRPA 1RHRA 4HN9A 3M4ZA 2VSYA 8AT1A 4DR5B 2O4CA 3KUKA 3RQIA 1WVIA 5AW7A 1L4LA 3EFOB 4UASA 4WXRA 2DB3A 2C96A 4QU5A 2C2GA 2MYPA 4D96A 2OCIA 2GKGA 1TYCA 1C7FA 1K2WA 1V7CA 5G41A 3TAHA 1YHNA 2ZCJA 4QARA 1XC7A 1A8IA 3MJEA 1CQIB 4GC9A 3OIGA 5ED4A 1ZEMA 1TO1E 3CLSC 4TTQA 5HILA 4WZAA 1JWAB 2J4DA 4MV0A 4PW0A 3GGJA 3H5RA 1Q1BA 5ALDA 1OFUA 5A1JA 1MX3A 3ADPA 2ZXEA 4IJQA 3DUFA 1R6AA 2JKZA 4CMCA 1G8KA 1PGQA 4JOSA 1BAPA 3GGOA 3HDVA 2P6MA 3L49A 1XJ0A 3P97A 4CR6A 2A88A 1WY5A 4JL5A 5F5XA 3EXEB 3T4UA 1XKXA 4O2BA 1UXIA 3K6JA 4NBVA 4ASUD 4DNPA 4E22A 3SMQA 3H2YA 5C4GB 5D3QA 2A58A 1XLTA 1S3GA 4BE9A 5TY0A 2C5EA 3U4QB 4NG4A 5ALHA 5F64A 1ZU5A 4BO9A 4JZKA 3ER6A 3FWHA 4S2EA 5J4KA 2G67A 3GDFA 5K3DA 4YX9A 3WJ7A 3TLXA 5AKEA 5FAXA 1AE1A 1ML4A 1WUYA 3L8MA 3CO5A 3RW9A 1D4OA 4YPFA 5JCXA 2EKBA 1DBSA 2G4CA 2RHGB 5HIJA 4O8CA 1HZZC 2ZR8A 3NR2A 4M1MA 3QFCA 5GV8A 1PEKE 3TIIA 1KNQA 4XB1A 3TQTA 3NAGA 1L3IA 4ASUA 5CA0B 2WABA 1CFZA 1W19A 3E2MA 4IDHA 3CFYA 4DMKA 4GX1A 5ESXA 4E12A 4EJSB 2AXPA 5I7FA 4TMXA 1AC5A 3GDWA 2P6PA 1A4UA 1SOVA 2ZOSA 3BHIA 3DGEC 1BVRA 2QXTA 4YEDA 5E2BA 4Z0TA 3TI7A 4M87A 1LK0A 4ZWNA 4JLUA 5COQA 4OBBA 1KRHA 2FWRA 2QRVA 2Z83A 3LY8A 3HSKA 2FB9A 5C4IA 2X13A 4DG8A 4TM8A 2BR4A 2F43B 4YJFB 2Z6UA 4OJKA 3VVBA 3S2ZA 2WTXA 1R3DA 2XSZD 4IJVA 3PHIA 1NMQA 3T38A 5I8WA 4Q34A 5A6VA 4L15A 4JHXA 1C9DB 1ZDMA 2VWGA 5A7GA 4V2UA 4D0GA 1MN6A 1KI9A 4XJXA 1F5NA 4W6ZA 3VVCA 1T2CA 2F3TA 3AHCA 3KHTA 1AM4D 3B6EA 3N7AA 3OJCA 1ZOIA 3QKRB 3R5JA 4DG5A 2SKDA 4Q21A 2Q3FA 2HYDA 2Y1KA 4I5FA 2J3DA 1QGYA 4DLLA 3PPWA 4DV3B 4A2CA 1A1VA 1G5PA 1PV4A 3I64A 3IBGA 2XZOA 1KH3A 2WKPA 1DX4A 3TLYA 4OF4A 1J20A 4D9IA 4ZYUA 4JUDX 3W8FA 2AZ4A 4DJAA 4GNRA 4UUPA 1FDVA 3PNOA 2XSZA 1V7QA 1R16A 2PR7A 1I7LA 1L3CA 2G70A 3ML1A 3KDSE 2VZ9A 4JLSA 4PCUA 3Q9NA 4PO1A 2BFBA 3ABOB 4COOA 5JD3A 2H1FA 4G07A 1GG8A 3VGPA 2YHBA 4Q1VA 2Y1CA 1B15A 4NVRA 1U0TA 2O3TA 4OQQA 4YJHB 5EWLB 4D9CA 4DG9A 4DR2B 2OORC 2WICA 1KPGA 2IZ0A 1GLVA 5F9MA 1EG2A 4P7GA 3UK7A 2BEVA 1NULA 4D3XA 3OICA 2VYQA 5JDCA 2IC5A 4U8HA 2C9DA 3U1BA 4CM7A 2FPIA 2R79A 5LZ7A 1MVLA 4QBGB 3IR6A 2OKCA 2PT7A 1CY4A 5DW3A 3W3AD 4X44A 5KHLB 4BKOA 3NTQA 3FUCA 4PNHA 1RXSA 4RMIA 2WE7A 3ZU3A 4BO4A 1KKLA 2YC4C 1A8PA 1E59A 2FK8A 5DI9A 2FW9A 1U2GC 1L5VA 2FHSA 3OA0A 1H9BA 2X6TA 1QYVA 1DCMA 4JDPA 2F1KA 3DEFA 3VOSA 3FNFA 1RYBA 4LSWA 5BN3B 1QRUA 4RTOA 1NI4A 1NV8A 2ZKIA 5FPSA 1AKTA 5G53C 4EY7A 4DXHA 3MZ0A 2A0WA 3M82A 3PR1A 1OBCA 4KTVE 1NIJA 3NRBA 2FU5C 2G9ZA 3W3AA 4J0CA 1C3EA 1MQSA 1AURA 1VMAA 2OLEA 3BXZA 5JD6A 3OD1A 4RTNA 2WILA 2IXEA 2QLJA 4E09A 2JIPA 1K06A 5KWVA 3WGVA 1WQ4A 3PU6A 3OPYB 5BWCA 5K5EA 3N0WA 5DK6A 4DJTA 2ID8A 5FOUA 4B33A 3EZNA 1VCNA 3CNBA 2BBWA 2PMDA 4IGIA 1NM5A 1P1BA 2WIJA 1KQGA 3NAQA 2CD9A 4DVJA 2JHAA 1N7GA 1E9VA 2IEBA 1TJ5A 4EFMA 2C5GA 3MTBA 4HFMA 4HXEB 1MNAA 5LCXA 3AV3A 3HZOA 3IDQA 2YQ5A 1QAQA 2GXQA 4ZYTA 1ZXBA 2CSUA 2WJJA 1SIOA 3DT9A 1WPXA 4WJZA 4HEHA 4BBJA 2WHPB 3HY4A 1CJCA 2R7LA 3JVDA 4OAPA 3TSAA 4AFNA 5KMGB 5MN5A 4NNJA 7MHTA 1YQDA 3TZBA 1JHOA 2QRUA 2VHCA 4NTZA 1FLAA 2FPSA 3KJQA 3C5HA 3G2OA 3M5DA 5B7GA 4D80A 3ZY3A 3IMGA 5AVRA 4S0ZA 4PLVA 2X3YA 4JASB 4ZIRA 5C1BA 1KC3A 1QFMA 2NO9A 1OX4A 3QXGA 5DM0A 5BQPA 3VR4H 5F7XA 5K45A 5LDDC 4ITRC 3T1YB 4MV1A 1J24A 3LI2A 2C29D 1OYYA 1CUJA 5A71A 4QD3A 2BLNA 1O4WA 1P77A 4N3GA 1T8TA 1DL5A 2ZXFA 4R01A 4X6LA 5IBCA 2FUKA 4PYNA 1QONA 5A06A 3K9QO 4FFBB 3D81A 4O2AA 1O95D 3OZXA 1EXDA 5HS4A 4TTJA 1U90A 1WF6A 1EZZA 1F0YA 3D3EA 1GFSA 3RT7A 3EA5A 2ZE8A 3WJ1A 2ZIUB 5JNLA 1E0AA 1J6UA 4LXQA 4TV8A 3GYBA 1ZR4A 3K94A 5CLIA 1VL0A 4ZARA 4FZ3A 5ALSA 3UHAA 3OZTA 3IP1A 3AFHA 4HRYA 4MCJA 1RQ2A 2Y27A 3G2PA 2C59A 1ZH0A 2NN3C 2YCLA 3R41A 3UMYA 4ARUA 1V43A 5KYXA 4Q6BA 1P2TA 3ZHXA 2MYNA 4ZAXA 1O95A 3JQCA 4NZ9A 3A3KA 5ALYA 2CFRA 4A0GA 2A78A 1KEEA 4FDLA 2ORVA 4RORA 3C4VA 1JF8A 4KE6A 3ZXXA 1THTA 2J9XB 3ISVA 3SKYA 4FWTA 3FRJA 4EYEA 1FDWA 4X8OA 1AUOA 4EBBA 3DAHA 4C0HA 4I4IA 2C61A 1R0CA 2B36A 1E0JA 2PS9A 4D41A 3TWOA 1UXJA 1ZVKA 4OFWA 4K0RA 3A31A 2ZJ6A 4BMSA 4IV0A 3ZDDA 3FNEA 1W30A 2C5SA 1X7YB 5DGIA 3PGA1 1J8DA 2C9MA 4RHCA 4Q9KA 5ILQA 3UCXA 2QN3A 4BVFA 1Z2PX 1GZ7A 1EUZA 2H7VA 3HG7A 2EFHB 4BVBA 1L2TA 3ASZA 3L7YA 1D4AA 3BXGA 1EK1A 4WCFA 2NADA 2QKYA 3AILA 3UC5A 3IQIX 1NN5A 4R1NA 3T5TA 5L3QB 1L5ZA 3ND6A 3SQLA 3RJTA 4ZDJA 1XJWA 3E7WA 3QZUA 3ZDRA 5A3JA 5DNYB 1Z25A 2QTZA 1S2MA 3F9IA 3A0RB 1VMDA 4WY2A 1OPRA 3EIXA 4Z54A 4RSMA 2IYFA 4H4EA 5F7ZA 1M1YB 3M9WA 4IDNA 3R5XA 4IMJB 3VHXB 3X1WA 1UKZA 2MINB 3ILXA 4HB0A 4UNQA 1UJNA 2Y71A 1Z06A 3KSMA 1ZJJA 3KL2A 3C98A 4B32A 4JBXA 4ZDIA 3GGPA 5K0LA 5C51B 5CB6A 3MT8A 3AEKA 3LW8A 3ZQJA 3FJ1A 2QR5A 3MS7A 3N2IA 3NWJA 4FJ1A 4LF7B 4NBLA 5SZJA 3LOPA 1PWEA 3ND7A 1MA3A 1JSRA 2O0KA 1DXHA 2C84A 3DP9A 2X42A 3DXZA 3IV9A 1EWTA 3QEOA 2ZBGA 2PKQP 2FUG6 3JRWA 3K9CA 2QM3A 1F9AA 4JSYA 4NF2A 1KYXA 2FPUA 1YZTA 3H9EO 4GOXA 2HK8A 1JALA 5KNBH 4Y6PA 4MLCA 3D3JA 1NN3A 2I33A 3IVRA 3K20A 1RPNA 4HSGA 1P91A 4M1KA 3VYVA 2ZUEA 3A4VA 4MQFB 4NAHA 4TXNA 4K3UA 1GTVA 4A15A 3U39A 1Q74A 4KVAA 2QUIA 2Q3EA 1JVNA 4M60A 2C7RA 1FK8A 1TQ6A 1TC1A 4K88A 3WZ2A 2GZ2A 4BLRA 5A3RA 4LJSA 3AF0A 3WMEA 3PBKA 4R9RA 2A92A 4S1WA 1TU3A 1ESNA 1VMKA 1RI3A 3UMRA 4MTCA 4B85A 4EG8A 4AZ0A 2ZYAA 1NP3A 2H29A 1MJ5A 3EDMA 1UMBB 3RLIA 2J4FA 2X7JA 4OQ4A 1IVYA 3FYDA 1FTGA 1EJ0A 1K9VF 2IUFA 4AXBA 3IUEA 3O74A 1J7JA 1ECPA 1OXXK 3ABSB 4H3HB 4QQNA 1Y9JA 1ZGZA 3HZZA 4QRDA 4GMDA 4LVCA 2O6HA 2QDKA 1JSXA 2YV3A 4Y9RA 2QRGA 4YDHB 4X7MA 5DBIA 2PA3A 1D7AA 1VB3A 4G4SO 2H4ZA 4YRIA 3K2QA 1EQ2A 1KAEA 2IHYA 4U3JA 2IYOA 3R7WA 3P2YA 4J6FA 2FW0A 3HCOA 1W46A 4HXFB 1HA3A 3IUMA 4BPRA 5DCUA 4FDUA 3GGCA 5EKXA 5DSTA 3AJDA 4QBFA 4FZVA 4PC3A 5FIUA 3NORA 2HIHA 5INTA 3R9WA 2QY6A 3BD8A 1IBRA 2QTWB 3LA6A 4YAOA 3W9BA 1X70A 3ZJ4A 1VDZA 3RM3A 3V1TC 3QLUA 4WH0A 3UXMA 2H1LA 4FFMA 4ZI3A 1T9BA 2REXB 1JPVA 3HM9A 4P53A 2OZLA 2ZBUA 1YS2X 2IW1A 3A7DA 4F2PA 1E5TA 3K8YA 3T9FA 1AS0A 5IC4A 4YMGA 2H18A 3BJEA 2IH4A 2WK1A 2PAFA 1M8GA 3GJ5A 4FEEA 1WD7A 5KTNA 1ZAYA 1GGMA 1SXJC 3O4IA 5LR6A 1QANA 1WDTA 2JLXA 1UAGA 4F4UA 2RGDA 2WA2A 3ANXA 5KKNB 1M2GA 2G07A 2XZTA 2GNAA 3DMFA 4KYUA 4DRXB 4FBGA 3OPYA 2C54A 2NAPA 2QVCA 4YHHB 1IZYA 4OHRA 4RKWA 5EHQA 5BQFA 4CM3A 3UATA 1E60A 1LSSA 4PZAA 4O5OA 1CBUA 3C4QA 4HQ0A 1H6DA 5AJTA 5LNK6 4JLDA 2EKLA 5CA1F 2FP4A 3L7KA 4U6SA 2ODTX 4CCYB 2PS3A 1MVNA 2BUBA 3AFGA 3O0TA 4HXGA 2V6BA 1I7SB 1WB6A 3K0EA 2W2KA 1ETHA 3AXSA 2RH8A 4Y2QA 3AUFA 5JWOA 3SE7A 3IV6A 3KEGA 1LQTA 4LJKA 4CIVA 3PNQA 4JOBA 1ACJA 1CB0A 4FINA 4F8JA 2OCAA 5ISMA 1RMQA 3NQ41 1IY2A 2RHBA 1ZL2A 3L8EA 1Z36A 1CQZA 1LI4A 3FWPA 3CEHA 3PZRA 1Y48E 3ZQKA 3AF2A 3GL9A 3LBYA 3JQDA 3SSOA 3UC9A 4EP1A 1TCUA 1O08A 1VE6A 2W71A 4IIVA 2BTEA 1P9OA 4CHTA 5CFQA 5CB4A 2R8OA 1YVRA 3ETGA 3PUZA 1TW3A 3PJFA 1T2NA 1UBOS 2IOQA 4ZJUA 2FCRA 1A5AB 3ZS8A 5K05A 2X41A 4ZKEA 2PLNA 4M6WA 4C06A 1RPTA 4FJ2A 4CEHB 5M2QA 3C7KA 3I9LA 2QL6A 3RFFA 1US8B 3KLMX 2Q0HA 3MMZA 3OOWA 5DTIA 5BSGA 2R25B 1M6HA 3TNJA 5LLTA 4B09A 2XCSB 5JXIA 3OX3A 2HU5A 3GJ0A 4AK9A 1CR0A 4WN9B 1O6ZA 3UPTA 4IHQA 1U7OA 4ZT4A 4LNUB 5EIOA 2NACA 2B99A 4OCZA 4PX5A 1UDXA 2DKFA 1LRLA 3EEBA 1DLJA 1KAGA 1QE5A 3A1CA 1JQAA 1O87A 3LC1O 4G0MA 5E9JA 3PE3A 3OLZA 1GSHA 3OA2A 2IJGX 2RGNC 2ZUDA 5D3ZA 4F72A 1ZHHA 4LC0A 2OD2A 3KOOA 5EAIA 3V1KA 4Q5IA 1TJ4A 1WTCA 3GROA 4R05A 3KDPA 3F7OA 3ZX5A 3DVRX 4XR4A 4DV5B 1DBQA 1SM4A 4JP5A 2JFQA 2V03A 4B4DA 3EEFA 5BP7A 1JDJA 3FYSA 5CDFE 3H9QA 1UMCA 3PXBA 4DY4A 1RHQA 1X7ZB 1SZJG 2BBOA 2WOJA 1FIUA 3L8CA 2WJ6A 1BKDR 5I5GA 1RW4A 3B13B 4Q16A 4TS3A 1RZRA 1I4EB 4GOLD 1I2DA 3CRW1 4XW2A 5HWSA 3NXKA 5CVDA 5JQGA 1PNRA 4INJA 5FA8A 3GPBA 4LDPA 3FGOA 1KH2A 5AKHA 4EX6A 3NVMB 4O4LF 3L0YA 1XTVA 5HGXA 4MVJD 4N49A 4EUSA 1U9ZA 1ZICA 3DTVB 4AJ1A 4C4PA 2Q1UA 2PRSA 2Z98A 2EVWX 1T8RA 1Z4JA 3WRYA 4CT5A 5IVKA 4NXMB 5HZMA 4YK7A 3WGZA 3CUTA 2R2AA 1JEDA 5E7JA 4XB6B 5D00A 2ONZA 1QH1B 3WWYA 3VC2A 1AQYA 1B16A 3L93A 3U4GA 4RXMA 3HYTA 1VL5A 5ICGA 2WIDA 3IPYA 3TQQA 4GL4A 4EHIA 4YRSA 4NMXB 3FG9A 2DHDA 4JFAA 1N0IA 3KBOA 3O8LA 4C4YA 4MVJA 3BHNA 2HSWA 4CEJA 5ECDA 1W29A 2VJYA 2D3WA 2IDZA 3PNBA 3WLHA 2QRLA 2EGGA 3K53A 4YAFA 4BTEA 3STYA 5LZ4A 4N7MA 3H8JA 1B0ZA 3EIOA 3IHKA 4GD3Q 4AY3A 3OBBA 2QYSA 4OB6A 2O2JA 3WA7A 4ZREA 1H4QA 2C2BA 3S0JA 4GM4A 4F4CA 1I5RA 4Z4GA 5FWNA 4YPOA 3A3PA 2WC1A 2X5KO 1YQQA 3A6KA 4I19A 2J4CA 4DM3A 3KSDO 3VI3B 3MUFA 3WWEA 3B70A 1QHSA 2EARA 3W5HA 4A3SA 2VF2A 3CJTA 4TKVB 4WLOA 5DOVA 2O5EA 3AQ4A 3CPEA 3K32A 1TTPB 3T7DA 4LWPA 1Y7HA 1XP5A 3K71B 3DWGA 3N9IA 1L7MA 5DYIA 3ONVA 4C5BA 4AJEA 5ITWA 4X66B 4FB4A 3T4PA 1CP2A 1W49A 2A0KA 3M4XA 3E8MA 4L27A 3DBLB 2IY9A 1XEWX 5EUCA 3S2IA 5C53B 3DDSA 1H23A 3SC3A 1M67A 2G9VA 2R00A 4NYMQ 4PO3X 3RAJA 1R0RE 2ORWA 3EW7A 2PM8A 2C4MA 1RXYA 1W0CA 3BC1A 2C7QA 1HSOA 4E5NA 2PPLA 3EH2A 1F0KA 2GB4A 4B6FA 4V02A 1VKHA 2O8DA 3NPMA 3F3MA 3BWBA 4OHOA 5EMHA 1P0IA 1QVVA 4IDFA 1ZH6A 4QICA 4YMSA 5AHKA 3S7ZA 3ZE9A 1YA8A 2G36A 1T1SA 3Q9SA 4KQIA 4ALLA 1E9BA 5HKBA 3EXHC 2A5YB 4ALKA 3KRTA 3RVQA 1UIRA 2DBZA 4F9TA 1RPJA 1KI1A 1USKA 3TG2A 1PVOA 2BEJA 2R6GA 2JDID 3WIBA 3D4OA 4MWGA 1YFKA 4WA8A 1GWNA 1OYWA 1A9XB 2HKIA 2FI1A 3OHSX 4K28A 4OMDA 1H2YA 1CUEA 1XZHA 2I4TA 2JHCA 2X2OA 3AUAA 2WKQA 3CURA 3PCXA 2Y0PA 4XDHA 1GZ5A 5A5VA 3GN2A 3A9VA 4HYYA 4AJ9A 1HORA 1SXIA 5I7OA 4MVJM 1EIWA 1WZEA 1M66A 5ADVA 2I6FA 1MOSA 1P72A 2BCJQ 3UJDA 1SOUA 5EIHA 4X84A 4NESA 5CAEA 1ICEA 1F2TA 5KSPA 3FBWA 4FGWA 3WL8A 2JDIA 1RXCA 4XUGB 2BTOA 2ACVA 2Q0QA 4F8EA 4QGAA 3UJNA 2EAUA 3ABRB 1TVKB 4TSRA 1ORWA 4B5LA 4RYLA