1U8TA

Crystal structure of chey d13k y106w alone and in complex with a flim peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
125
structure length
125
Chain Sequence
b'ADKELKFLVVDKFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
publication title Structure of the Constitutively Active Double Mutant CheY(D13K Y106W) Alone and in Complex with a FliM Peptide
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 40
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1u8tA00
1NXVA 2A9PA 4EYGA 3H5TA 4MQEB 3JPYA 4KRFA 3H1GA 2ZWMA 3M9XA 3M9WA 1EFAA 3N0XA 3HJFA 4W5TA 1S8NA 3H5VA 4LX8A 3HXMA 5TQ2A 3TD9A 4Z4IA 1Z15A 4G0QA 3N6VA 5T7BA 3LUGA 4Y9TA 4MR9B 1DC8A 4KVFA 4MQFA 4NV3A 3O2JA 2H0AA 2VYCA 2H3HA 5TQJA 3KLOA 3H75A 4PZ0A 3QEMA 4QPJC 5IULC 2PUCA 1RXEA 4OG2A 2GKGA 4W5NA 4OLBA 3LUFA 5TPZD 3RVPA 2FVYA 5CNMA 1Z2DA 2JVJA 3LUCA 1M5UA 2WMYA 4EY3A 1BDIA 4Z4GA 4F06A 1ZESA 5C5EA 2GX6A 1YIOA 4O5AA 2E4UA 2QXYA 2MYNA 3RVRA 1ZVVA 2JBAA 1YMVA 2FEPA 4MQFB 3NHMA 1PEAA 3E3MA 3GV0A 2JRLA 2NZVG 2ZAYA 3DGEC 4KZKA 5CNKA 2A9OA 1EWVA 5B3JA 4RKQA 2QVGA 4H3KB 5IUKC 5JNRA 3UKJA 3HUTA 5JNUA 1DP4A 2E4VA 4TN5A 4Z9BA 3SG0A 1OXKB 4IMIB 1DCKA 2R25B 3O2SB 1XHFA 4MRMB 4MS3A 3CKMA 4S05A 4MPTA 1RPJA 1E6LA 4KNYA 1YTUA 4Z4EA 2E4XA 1JL3A 3S99A 2M1ZA 4LE2A 4RWEA 3NNNA 3OQMA 1LBHA 3MM4A 1M2EA 3IP5A 2PJUA 2PUBA 2PUGA 1QQBA 3MA0A 1Z25A 4TLLB 4EGSA 3OM1A 2HQBA 2DRIA 2FKAA 3C97A 1JYEA 4MLCA 3A3KA 2MYPA 2O20A 4Q6BA 5BQ3A 2PUDA 1EHCA 3NHZA 2P4UA 2GBPA 2FTKE 3LUAA 2WRZA 4ETMA 2IYNA 1QO0D 1ZGZA 5DKFA 3RVMA 2JB9A 4KFCA 3CTPA 2CHFA 2E4WA 3HSYA 1AB5A 4MS3B 4Z4HA 1JFSA 3OLWA 1NTRA 1ZDMA 2IKSA 4LDZA 5KQGA 1WETA 3N0RA 1SXIA 3HDVA 1W25A 4KPYA 4OBBA 4IILA 1CEYA 1ZN2A 2F8TA 4XFKA 4G0MA 4H60A 4M88A 5BRJA 3OQOA 1D1PA 2KYRA 4N76A 3ILHA 3EODA 4MGEA 1C0EA 4QYMA 1M5TA 1D2AA 2VK2A 4N03A 4ML3A 3KKEA 2PLNA 2PUFA 3JVDA 3I45A 3SM9A 3TX6A 4RXTA 3B2NA 3JTEA 4PE5B 5FBKA 3VNBA 2PUAA 4RY9A 2E4YA 2PKXA 1U04A 1DRJA 2IPNA 1U0SY 1BVHA 1MB0A 2HQRA 1TM2A 4WXEA 4MQEA 3KYJB 4WUTA 3A10A 4WZZA 1U2PA 4YRZA 1W9HA 3CHYA 4RDCA 1SD5A 4ETIA 3KG2A 3QELB 3F73A 3FFWA 1PNTA 9ABPA 3GBVA 4XLTA 1C4WA 3I42A 2JVKA 2OQRA 4NCBA 1U2QA 5IC5A 7ABPA 3DLHA 5ABPA 2IOYA 3IPCA 4N41A 4EYQA 1HEYA 4RZSA 2FMIA 3O1HB 4YLEA 3HZHA 2FEKA 1Z18A 5I4CA 1EAYA 3LOPA 4JB2A 3G85A 1H9CA 4L4UA 5IUNC 4MR8A 4Z4CA 2FQYA 2A9QA 3I5AA 3N8IA 1Z26A 2XDYA 1GUDA 2QSJA 5F64A 5ED4A 3HK2A 1JLKA 1PEYA 3UUGA 2V0NA 1LBIA 5CNIA 4W5QA 1EWKA 1ZITA 3GT7A 2LP4Y 3ILYA 2HPHA 3QLVC 1QP0A 1M2FA 1XHEA 5EWMA 4D74A 1RXIA 1NXTA 4S04A 4L85A 4YWHA 2PL9A 1D1QA 4G0PA 2FMFA 3EJWA 1ISSA 3HDGA 4MRMA 4RU1A 3H6GA 3T8YA 2LUOA 5KI6A 3CZ5A 4NICA 3KLNA 4EYOA 4F11A 1QQAA 3L6UA 3URMA 4MR8B 4RK7A 1YK1A 2MSKA 4OTZA 4JA2A 4FE7A 2RGYA 1USIA 3KTOA 4MR7A 1PNRA 3O74A 1YK0A 3MIZA 4QYWA 3KJXA 3LTEA 4G0YA 1SXHA 4E7PA 5KC9A 2AYXA 4F3TA 3QLTA 3NBMA 4RK0A 1U8TA 4UHKA 2FQWA 4MS4B 3LUHA 3N0WA 5EWMB 5IEJA 1DRKA 6CHYA 5CNJA 1Z12A 4EVQA 4YS6A 2FQXA 2HJ9A 2VUIB 4WXMA 2FLKA 3QX9A 4MLDA 3RVSA 5BRAA 3CRNA 3MYYA 3SQNA 3HO1A 4MYRA 5KQPA 3QLUA 4ZJPA 3HM9A 2RDMA 2WB4A 3CFYA 1BAPA 1URPA 3MMNA 1A0OA 4JAVC 1JBEA 3F6PA 3C3MA 3HCWA 1FFWA 4MR7B 4PEVA 3OQNA 4HYEA 1BA2A 5TPWA 4ZMSA 1B00A 4LZLA 2QV0A 2JCGA 1BDHA 5GOTA 1YS7A 1VKRA 3QEKA 4HNQA 4QICA 4UHJA 2AYZA 4H3HB 4D6XA 1DZ3A 2B1JA 4YR7A 4GPAA 4P98A 3DGFC 3OMXA 1VRVA 4TLMB 4YCSA 4XASA 5JNTA 2W42A 1VPWA 1OXBB 1D4ZA 2L17A 2QZJA 3F7NA 5DTEA 4KREA 1ZH4A 5TPWB 4IMJB 4Z9AA 4IF4A 2ID7A 4GNRA 4NQRA 3QELA 4O1HA 3M6MD 4XARA 3H1FA 2YHBA 1QP7A 1NXOA 1ISRA 1KGSA 2YHAA 1L5ZA 5FWYB 5E3JA 1ZHHA 3T6KA 4E7OA 1T34A 2QU7A 5KC8A 1SRRA 1GCGA 1J56A 3K4HA 3MF4A 4ZMRA 1JH9A 3FDFA 3K9CA 4KQCA 3SNKA 2WJWA 1F51E 5EWLA 4G0ZA 1DG9A 1ABFA 1VLZA 3IP6A 3SAJA 3D02A 1ZGGA 4G86A 1QP4A 2HQOA 5JNSA 3H5IA 1DCFA 1MB3A 3H5LA 3HV2A 1LJUA 3EAFA 8ABPA 1SXGA 2WJAA 4RXUA 4W5OA 4Q7EA 1YS6A 2LIVA 3LFTA 5DLEA 3OO1A 3H5OA 3D8UA 1ZY2A 3TMYA 2PE5A 3ROFA 4HNRA 1XWWA 1QKKA 2MYTA 1TMYA 1Y1LA 2PMCA 2LPMA 3IP9A 1RNLA 2FSPA 2OENG 5EWJB 3E61A 3QX8A 5JS1A 4PICA 5EWLB 2JK1A 2FXIA 2F8SA 2B4AA 1LK0A 2PAFA 3EDCA 3JPWA 4JP1A 1JHZA 3I09A 4G97A 5TQ0A 4P1ZA 1E6MA 1JDPA 3BRQA 3KS9A 5TPZA 3LUKA 4TMYA 1A04A 1DBQA 1NATA 3O1JC 1DCMA 3Q7RA 3CZCA 2HSGA 1KRWA 4G0XA 3Q15C 4DQDA 2IPLA 2L19A 4MS4A 1UDRA 2Q5CA 3Q9SA 5HQJA 5BR1A 4KMRA 3FFTA 1USGA 2FEWB 2RJOA 3OLXA 1GUBA 4WWHA 3A0UA 5DCLA 1P6UA 1DC7A 1ZH2A 3JS5A 3BREA 3N75A 4IGAA 1CHNA 4KK3A 4OATA 4ZYLA 4EVSA 5IX8A 6ABPA 3HVRA 2WY2D 1IIBA 3IPAA 1FSPA 4PYRA 4N47A 3RVJA 1YMUA 1DBWA 3OLVA 3SY8A 5TQ0B 1DBPA 3CNBA 4D6YA 3O2QB 4CBVA 3T95A 1RZRA 3Q41A 4JOQA 3MQ4A 4KQ9A 3TO5A 4KV7A 3UK0A 2MSWA 2LBPA 3KCNA 3NNDA 4MS1A 3C3WA 4RSMA 1KRXA 3H1EA 3L49A 1Z17A 1QPZA 3GBPA 4RK5A 4F12A 1D5WA 3LUDA 1K66A 5FBHA 1QMPA 4DADA 1ZAYA 3DZDA 1JDNA 4FB4A 3RVNA 3OMWA 1QO0A 2J48A 1LJLA 1A2OA 5JS2A 3Q7SA 2E4ZA 4O1IA 1E2BA 2N9UA 1NXWA 2QVCA 3R0JA 3JY6A 5TQ2B 4B09A 1P2FA 1PUXA 3LMKA 4N0QA 3N53A 1APBA 1MAVA 1NXPA 3W9SA 4RK1A 4RV5A 2IPAB 1FFGA 1NY5A 3G1WA 3RVOA 4F8JA 4MS1B 5KQMA 4OLAA 2JVIA 1JFVA 2X7XA 3GYBA 3QEMB 4RK4A 1EWTA 3T38A 4YV7A 5FWYA 4EYKA 4N0PA 2R4QA 1F4VA 1R8JA 2R48A 3GRCA 3EULA 2CD7A 1USKA 2FN8A 4RXMA 4WT7A 3KYIB 3CG4A 4G0OA 5FWXA 3RVKA 1MVOA 2NT3A 4ETNA 1RZRD 4LRQA 5KWSA 2A9RA 2GWRA 1KMIY 3LUJA 3OLZA 2MSLA 3BILA 3LKVA 5IBQA 5C5CA 1JX6A 2IPMA 5D2CA 4MAAA 1E6KA 2JBAB 4ZPJA 5TE9A 2QR3A 5HKOA 3Q7TA 2ID9A 1I3CA 1GCAA 1TJYA 2M98A 1Z13A 3HS3A 1CYEA 4RY8A 5B3JC 4DN6A 5KQLA 3O75A 3C6QA 3RVLA 4EUKA 3GWGA 5IEBA 3OLYA 3O1IC 2VUHB 1P6QA 1QNLA 5EWJA 2NZUG 2TMYA 5T3YA 5JNVA 3LKBA 5FWXB 2QW1A 1FFSA 4HNSA 2FMHA 3RH0A 4RKRA 3O21A 3QLUC 4Z99A 3BRSA 1K68A 2PL1A 3KHTA 2IDMA 3IP7A 3HUUA 3JVIA 3EGCA 1FQWA 5IUJC 1BDJA 4NCAA 2FW0A 4YO7A 3VNAA 1Z16A 3CU5A 4RY0A 4LDAA 2BGGA 2FLWA 5HSGA 3OM0A 2FN9A 3RVQA 4RS3A 1Z2EA 3CLKA 3QLVA 5JNWA 4XAQA 2L2QA 3FFXA 2CHEA 2CWDA 3CS3A 1P8AA 1L5YA 3F6CA 3GA5A 4FE4A 4KK4A 3ROTA 1YVUA 1TVMA 2PUEA 3GL9A 3EQ2A 1MIHA 4IRXA 2WWVD 2R47A 1JWLA 4Q6WA 3DBIA 1PHRA 2L18A 2RJNA 4RK6A 1NXXA 1AB6A 3NNSA 1JF8A 2P9HA 3FMVA 5CHYA 4YGXB 3C3KA 3H5WA 3QK7A 4LE0A 1JYFA 5HM6A 1NXSA 3KSMA 4YP9A 3RQIA 2GI4A 4MR9A 1GLGA 3OO0A 2MYUA 3HEBA 4XXHA 5PNTA 3TB6A 4Z4FA 5GQSA 4JB0A 5DGCA 4EVRA 3BBLA 2FMKA 3DLBA 1ABEA 4Z0NA 3FGZA 4W5RA 2NT4A 2NUBA 4LE1A 3P9YA 1TLFA 3EQZA 4JASB 3H6HA 1DJMA 1JFTA 3IDOA 2I6FA 3CG0A 3A0RB
chains in the Genus database with same CATH superfamily
3PGMA 3BUSA 2JLAA 1SK9A 3H8SA 3KAKA 3Q5GA 3R4CA 4JLMA 5KNDH 3CRQA 3FMGA 3HXPA 1GN9A 2YTZA 4E4TA 5FTLA 1TU3A 5E1DA 3COJA 2R1VB 2DWOA 2J0UA 3OHMA 3TD9A 4KVZA 3F6YA 1RYYA 4KI7A 5KYGA 1N7JA 1HG1A 1OXMA 2W37A 3EA4A 1K7FB 4Q18A 5EC8A 1E8MA 2FSVC 5DULA 5J5CA 4CM8A 5LUAA 4YTEA 5LFAA 2CEAA 2VH1A 1BYIA 4DLUA 5FP0A 1FFYA 1SBTA 1OILA 3ESXA 4MRNA 5ALKA 2H2DA 3AUYA 4YT4A 4QEZA 2QENA 2BCJQ 5IARA 2I7VA 4DMKA 1ZO8A 2OGWA 2GBIA 1GTMA 2QT0A 4YNBA 2J9ZB 4ZCRA 5ADVA 2JLUA 1GPLA 1N6IA 1RBYA 5F5NA 3WB9A 2V7QD 5FJIA 4D56A 1CSEE 1QQTA 4EIWA 2GZRA 1T9HA 3WB0A 2Q5IA 2WZDA 3O0TA 5CNMA 2VG8A 1B1CA 3UFXA 3ZWOA 1WY5A 2PRJA 4BO2A 5K8CA 2AOVA 2POQX 4BATA 3ZHCA 2HRDA 2XIJA 3WKAA 4OKSA 2LDBA 5EKDA 1H2ZA 4IHJA 2R6FA 2H7VA 2MYNA 4LJ4A 1D07A 3F7TA 4NZPA 2Q3EA 3WIEA 4PCUA 4LJRA 2I2BA 4HS4A 2OXCA 5DLDA 2VJBA 3RC9A 2GBFA 5BNZA 4FIZA 1RE1A 4F91B 3INYA 1WQ1R 3KJNA 1QV9A 2WVHA 5EE5B 1UFOA 3A8TA 2Q3DA 3RUPA 1H9AA 3AHEA 3FNBA 3W2FA 2QRLA 4F2DA 1JL3A 2P0EA 1PX2A 3PUZA 2FHSA 5CM2Z 3UJNA 1X2BA 2ZRCA 2PD3A 4EZEA 4R1PA 4GP7A 1KSGA 5EUMA 1II9A 2IA5A 1XAGA 3AY6A 3AINA 4QD3A 3SJAA 1QAQA 2V9ZA 4NLLA 4PHFA 2HQBA 4RD6A 4TLLB 5EFZA 2BFAA 2NG1A 2VF5X 3VPCA 2WUGA 3ER9A 3BHJA 3MB5A 5LZ5A 4AFNA 2Q0XA 4QAJA 3FOAA 4O2AF 2TRSB 5B3LA 4HHEA 1RHUA 4K9OA 3WLRA 4B79A 5HKKD 4ZOCA 4EUEA 3EC2A 4L02A 1F7UA 1XTVA 4MVJE 5CRIA 3U44B 1NJ5A 2VLBA 1O6ZA 4CLXA 2FR0A 4F86A 3CTPA 1BGWA 2R0QC 3GELA 1YZLA 2WG2A 2ZRJA 2Q6IA 1FUUA 4IIJA 1ND5A 4QWMA 3AHIA 3HY6A 3TXAA 1XA0A 3COWA 3CKYA 4W7SA 3FOWA 4G0MA 1FVHA 3P7MA 4JITA 4M88A 1EK0A 2QRMA 2X1MA 2JLCA 4CMEC 2FDXA 1A69A 1SXPA 3V4ZA 2R85A 3SBOA 6YASA 2B2CA 2NYVA 3LHDA 4UHHA 3HHPA 3WK4A 2PRSA 3UAYA 2ZSAA 2CMFA 3CLSD 4YAGA 3SM9A 2FUEA 2Q8QA 1EIZA 4N5IX 1WUHS 2FZEA 3I5UA 3U1BA 1R8YA 4H0FA 4JJIA 1QK3A 4TZ0A 1GDHA 1G5FA 2QN3A 3LLUA 2WE8A 2C00A 1RXYA 3OJ0A 2E2WA 1IY1A 2PKXA 3WZLA 5KSZA 2ZBVA 4ALMA 2OAQ1 3DYVA 3M70A 3PEUA 1SQSA 2QLLA 2X8JA 3E53A 3LL4A 5M34A 3K6JA 2G04A 1BVHA 1DIBA 2X9GA 5HCUA 1I7DA 2JG3A 3DZCA 3KYJB 2W8BB 1VCNA 2W90A 1BE6A 3C7TA 3ZV3A 2C59A 1H3NA 4CQJA 1R5JA 2Y1WA 3ADKA 4DNXA 3PDHA 2ZRDA 2A2ZA 2X40A 4QPDA 1UDBA 5BN5B 3OD5A 4D97A 4E1AA 4JFRA 1OZHA 5ESRA 1L5HB 4A15A 1PR5A 3GHYA 1AC5A 1C4WA 3DO6A 3W3AA 4U39A 4ZI7B 1RYEA 1BWRA 5U4QA 5KJCA 3MFYA 3OTHA 2IWRA 2MR6A 3LYLA 2VKQA 5AI9A 3A2NA 4DV5B 4HNVA 1CQJA 1AM4D 1CRLA 2QN6A 1PP4A 2G3YA 4RGBA 5LQSA 1HDOA 2IXTA 1LY1A 4HDQB 1C1XA 2ZVDA 4BMZA 3EW9A 2O8CA 5IM4F 3ZLJA 5FYQA 3I5AA 2YL2A 4BFSA 2KBFA 2Q99A 2V4UA 3A27A 4X62B 1XPUA 4A8PA 4FWIB 3HC7A 1E94E 3NKVA 4ZEMA 3NPAA 5DN9A 4NXNB 1JIJA 3I4CA 4IVPA 1OHHA 3EVFA 4LCBA 2JF0A 1VPEA 1II8A 3LHSA 5TGZA 2O2JA 1QF7A 2WKWA 2XA1A 3NBAA 3MRVA 4L72A 4X7RA 4W9NA 2H51A 3CN7A 3RABA 3T1OA 3X1JA 2I3DA 1T4DA 3H0EA 3H2ZA 1DUVG 4GR9A 5HUHA 1B0PA 1QRAA 1MQAA 4DVGA 1LPMA 4L22A 2AW5A 1I10A 1XFDA 2C1XA 2XMBA 3MOIA 3T61A 2B7LA 4QDOA 1S9HA 1WZUA 2FCRA 3SIPA 2CHQA 3CZPA 3ZYCA 2AJ8A 3UPDA 1EXMA 1ECCA 4QGSA 5E6RB 5G2OA 1PQWA 3IDZA 4ZGGA 2PWYA 4MJLA 3Q3GE 3KXPA 1QZUA 4PZAA 4PLZA 3STUA 2CGEA 1T8PA 1YZKA 4RQUA 2AYXA 4F3TA 4R8MA 1DG3A 4X24A 1XLWA 3LUHA 2VNIA 2W6IA 3GUVA 4GMXA 2M6SA 3VDMA 5ICSA 2EATA 4G2TA 2PR7A 1Z12A 4PONA 2IXEA 1IY0A 2VUIB 4G5QA 3B5EA 3R3VA 2FLKA 4B71A 1HE4A 1FMLA 1H6CA 1XP5A 2JK0A 2QZPA 4ZVPA 2OQVA 4YXFA 4YRBA 1RRPA 1X14A 3LSYA 3EEQA 4G1MB 2B9EA 3EDMA 3TLMA 1NIPA 3P0JA 3TBKA 3UGQA 4RY2A 4A5SA 1NBHA 2IV3A 4IXDA 3AJEA 3C6ZA 3R8XA 4OHMA 5KKNB 2WUWE 2BF7A 4OYHA 5BUQA 3FYUA 1MOQA 2PU7A 3LS2A 3TTSA 4UNNA 3ZU4A 5CEJA 1UMCB 3VDNB 4GUDA 2BJWA 3LUBA 2YYAA 3WDSA 5CLIA 2N75A 5LP6B 3R3HA 4QUGA 1UDXA 1TW3A 1VJ5A 4KGVA 4OP1A 4R2IA 1B1AA 5TQVA 4BKPA 2BT4A 3M6AA 3BS4A 2PWPA 3UBMA 3I9KA 3HTXA 4RTOA 2VK4A 1MRZA 2FX3A 2HXGA 2IH5A 2W42A 3EH1A 3F8SA 4FJ2A 3LQRA 5LYYA 1OXBB 3UOGA 1O77A 4EZIA 1RC8A 4NEHB 3DOCA 4UJ5A 4E30A 1MA3A 3I76A 1YZYA 3CNEA 2V7GA 2K87A 2X1LA 3F9IA 4KREA 3PNOA 2OO5A 4NC9A 3QELA 2ZAMA 1DX4A 5CCDA 2AEEA 2YWXA 2IYAA 4OXYA 3D4NA 4HFMA 3NWOA 1F2DA 1VHDA 1L5FA 4R0NA 4TQUS 1A9YA 3EMDA 1JVSA 3HWWA 2ALJA 4QECA 3VC7A 1QX4A 3OOWA 4PINA 4ZC1A 4CKEA 4E7OA 3KKLA 3T9AA 4RF2A 2R8YA 3O6VA 4HDNB 4BNHA 1WIWA 1P0IA 4Q3DA 4HI0E 1SD1A 2ZYRA 1DAMA 4MV5A 2X0IA 4AIRA 4HNTA 2AOUB 2AYYA 3D3JA 3DEFA 4LY9A 4K6OA 1TZKA 4RO0A 2OZEA 4FOTA 5EIOA 3PLRA 3UMYA 4FMBB 4TTIA 5K3EA 2P9TA 5JNSA 4O8ZA 2BDUA 5IDQA 5CDYA 1C7IA 1QANA 1VJCA 2QI9C 4B4DA 1DQPA 3U9SA 3VH1A 4H77A 4GXRA 2QEQA 4CTNA 3BG5A 3WJ2A 4CM6A 4OHFA 3T3PB 3RS7A 1XZBA 2FSVA 5DLEA 4YRKA 1IWPB 1QF6A 2K6GA 1I7QB 2OR3A 4JJEA 5KO2A 2QTMA 3NVMB 3M33A 1XC7A 1LPOA 4HNRA 3KVRA 3WQBA 5AW8A 4Y6RA 2MYTA 2PD4A 2R6DA 2ZYWX 3R40A 4G5RA 4DLNA 3T15A 4RM3A 1N2OA 4B82A 1Y8AA 3S27A 1WV0A 4NYMR 5JZSA 4IJUA 1NBOA 4UE6A 2GCNA 2L69A 1BGXT 1PD1A 1H3EA 3IXMA 4O2BA 1RLUA 4J6FA 3JQ7A 3CRRA 2CB0A 3SF0A 1B0AA 4TL7A 2WU0A 2WMOB 3DBHA 3EA5A 4R9NA 1ZN8A 2ZUFA 3HPRA 3IOBA 1R66A 3OZSA 3E3OA 3GFTA 4HWKA 2ORVA 2VQ3A 1CJBA 2Q2QA 4F6CA 4JWTA 3RG2A 1K7XB 1RZ3A 3O4VA 4QWWA 5LB4A 3PJRA 4UXJA 1WCYA 1Z5PA 3FGNA 1M8PA 1QS0A 5TC4A 3D7LA 5H4HA 1XCBA 3ZD6A 4BEVA 4KMRA 4BX8A 4FLMA 2ZI3A 3DKKA 3AUFA 4HDRA 4TWBA 3P8ZA 3IUJA 1UZNA 2GTPA 3HVRA 2YW9A 3UJ6A 3E8SA 3M4JA 1KDRA 1WPGA 4Y6GB 3Q7EA 5FBLB 5H0IA 2H2FA 1L3CA 3MEQA 5IVIA 3O47A 2ZJZA 3L46A 3VHQA 3MPUA 4P4UA 1HWYA 5J4LA 1YMUA 4OGKA 1DOAA 5AQEA 5L3QB 3QWIA 2WIAA 3TIXB 1RRGA 3EPPA 2FFQA 2REQB 4TXNA 3AY0A 3W3AD 4UARA 2EJVA 3NRBA 3KP1A 3P32A 4ZA2A 5AOCA 1KVRA 1G66A 2CNKA 1AMOA 4HAVA 4CM5A 5T4BA 4B3SB 3IAEA 4BMSA 1LC3A 5CU7A 2CYAA 4FFLA 5JRDS 5DNWA 3FR7A 4EQ6B 1VIAA 4RKEA 3IB6A 1SUSA 1XJ5A 2PV0A 4W1QA 1ZU4A 3RVNA 5BOSB 1KO5A 3WGGA 2C8LA 5DYNA 1XAHA 1H2FA 3FKJA 1E2BA 3G0IA 3AM3A 1R4ZA 1CYDA 1GYQA 4AMBA 3LX4A 1IZ8A 4RKYA 1GILA 1I0LA 1IUPA 4NOLA 4BN0A 4DC9A 3HNRA 3M6IA 1DQRA 1OHHD 1DOHA 5KVQA 1LLCA 3LMKA 3WLLA 2CCGA 4CMEA 5B6JA 5BMOA 1GPWB 3W9SA 1Z88A 3O8NA 3O95A 4MINA 4BVGA 1JHQA 4B8WA 3DCYA 5DT2A 5HTKA 1PN3A 2WPNA 1R8SA 3GFVA 1CNMA 2B21A 3QPCA 3F6SA 4EKNB 3HN2A 1IOLA 1D8AA 1TI7A 4XCXA 2WZQA 3W79A 5L45A 3IBFA 4I7EA 5LUBA 5K0FA 4FDLA 2CXHA 4HS9A 4H4DA 3LZDA 5CLHA 4IHKA 3GRCA 4BWFB 2I6TA 4CM4A 3EULA 4RXMA 4A36A 1II0A 1SC9A 4URXR 2DH6A 2R2AA 4F3KA 3W4JA 1FSSA 4RZ3A 1DZIA 1A5BB 1UKZA 1XJWA 1ZL2A 2ODTX 4PZZA 5HF8A 3ZU5A 1XMQB 3MTIA 1ZEJA 4FMCB 2LCIA 4WY8A 3QFHA 1YJ8A 1G0OA 4FFBB 1HQCA 1UAGA 1CUCA 3V8NA 1NN5A 3D3NA 2EBFX 2W6ID 1XTJA 3E70C 4P32A 1TZMA 3G8YA 5K01A 1B8OA 5C4GB 1CCWA 4RTMA 3D0RA 3JR7A 1ISHA 2LVBA 3HSKA 3M4XA 2NXWA 3SN6A 5B7PA 2R7KA 1KR2A 3DWEX 3UWMA 3HN7A 1XXHA 1A5TA 2B4TO 2OBBA 4KWCA 4ZO9A 4MI9A 3C48A 1U0EA 2ZBGA 2VTBA 1T5SA 2X5OA 3O8OA 4FDUA 5K3CA 4U2FA 5KNDA 1I3KA 1AUVA 4RZUA 1P4AA 3NAGA 4Z1OA 4C7VA 3BMNA 2ZJ8A 2AV6A 1Z0KA 3CPSA 4JP5A 4N9QA 4B4WA 3O3CA 4GYYA 1O9GA 2GPWA 3F98A 4YO7A 3PRHA 2Y1EA 3B1JA 1T3LA 2VCEA 5KOJA 2OV2A 1SHUX 2SKCA 3ZE6A 2QZ9A 3RVQA 4CMIB 5JXWA 4J3JA 4HGNA 3CISA 2IOQA 3I8XA 1R6TA 4LV8B 3HBAA 2CHEA 3ILXA 3OFJA 3NHUA 4C0KA 4HQ0A 5CA0A 2JFVA 1KJNA 1LNQA 4F1JA 2GNAA 4TV9B 3TSAA 1JWLA 3LIPA 1LU9A 4X8MA 3RSZA 3EG9A 4LYJA 4A3SA 3FNEA 3D0QA 3R77A 2GNPA 4C43A 3IJ5A 5MGNA 5MF6A 1R0RE 1JU4A 2NOAA 2QL7A 2YJ4A 2NPIA 1PGOA 3BJRA 1Z34A 1JFLA 2P4SA 3PX2A 4C21A 4LXTA 1P0QA 3PC6A 2G0AA 1W8IA 2ZR9A 1GGEA 4C4PA 1G7TA 1SIWA 4X41A 4Z4FA 1QFYA 1TRKA 3O4RA 2UZAA 1JG6A 4JP2A 3MILA 3RS4A 4ZHSA 5A6SA 4BNMA 4L7VA 3NJ4A 3ETEA 2BYTA 3NEAA 2Z6QA 5IAOA 1U9CA 3LD9A 4KO1S 5CYOA 4JASB 1XQWA 2EWVA 3FLEA 4MP6A 4NPCA 4CV3A 1XQVA 5G3YA 3TLXA 1T3HA 4JLKA 4WPGA 4DJTA 2JFXA 3M9WA 4J0QA 1TJ5A 1F5SA 1JPUA 1WLSA 3HXMA 4KR3A 4BTLA 2ACWA 1U8YA 1RXWA 3K53A 4Q4AB 1NW6A 1ZSNA 1BDMA 1KHHA 4NYIQ 1XCOA 2K2QB 1E79D 2W6MA 1FU8A 3AC0A 3FPEA 2ZSHA 3NYWA 1CRWG 4Z1MA 3WMWA 1Q0TA 2FOXA 2ZXFA 1IVSA 1VJDA 2JANA 2XQFA 4ZVQA 1UPCA 4AWXA 4PG4A 1RBMA 1SG9A 3LC0A 1M2HA 2HDWA 1YSCA 4IXNA 4XE5A 2EKZA 1I3NA 2OUIA 5LZ7A 4D4JA 4EW3A 3LDFA 2BGWA 3UAVA 4KL8S 4U7JA 2VOEA 1PGJA 2HO5A 4LPSA 1WCIA 4WXPA 5JD3A 4OAPA 3LCVB 1BD3A 5LBIA 4V24A 5FLKA 2V3CC 3WWZA 3FTFA 3A9TA 4E4RA 3X1WA 1M6EX 4DCJA 1CQZA 1HYHA 4B8YA 4OYLA 3SIWA 2J0UB 4EY3A 1HNWB 4D92A 2GX6A 3BFPA 1ODIA 4TV8B 3PR1A 1NAHA 2JAOA 1OI4A 3WWCA 4IXMA 1W4CA 4N6GA 3WK9A 4FYJA 4CM8B 2YV4A 1PEAA 3DH0A 1VZ3A 4IIXA 1E5VA 4B4KA 4RTNA 1KZHA 5ICEA 1T26A 4AF8A 1L7XA 4L5IA 4M7OA 2JIPA 4ZOEA 5FTWA 2QPLA 3FOCA 3JVEA 1A9TA 5JLAA 4XUEA 1WCV1 3GXBA 3QPVA 3TEFA 5LWHA 1ZFNA 5G40A 4BQOA 4HNUA 5COAA 1NQ5A 3AM4A 4GL4A 2SKEA 4Q01A 5JQGF 4KNYA 2JAXA 4Q3LA 1YTUA 2V5VA 2XOKD 1SKYE 5F3DA 5HBGA 4D1YA 5IG2A 3PHHA 3B89A 3SJ7A 5C52B 1GZ5A 1K0FA 2JKZA 2RBGA 3NUZA 2PEZA 2I7DA 4MZDA 3RUEA 3UC5A 3KZMA 5AJWA 5FWNA 1F8YA 2BFPA 4Y2GA 2GZAA 2J30A 3MZ0A 1QIKA 4IHJB 2R86A 3RFCA 1DDOA 1A96A 1TVEA 2RCNA 4ND5A 1U0JA 2PVPA 4Q34A 3U3OA 3CNHA 1W30A 3CXUA 4KV9A 4L74A 1IN7A 3PC8C 3OE1A 1OMOA 1T1JA 1QDLB 1QGUB 2YMPA 2I3GA 3IHWA 4Q16A 3SDZA 1ZP6A 2HL6A 1RXVA 1VIDA 2DKFA 3UB4A 2ZYDA 1NVVR 3U09A 4LOIA 2O2XA 3K0CC 2C3PA 3LP5A 2HC9A 1XN1A 2KM1A 3DS8A 2ABWA 1VPDA 4MWGA 1TU0A 1VIVA 4TXHA 3H4TA 4WERA 4AUKA 1IUNA 4QGFA 4FCTA 4AN1A 3B9PA 2Z6UA 3ACDA 4DCPA 2O4CA 1GN8A 3JVDA 4YCNA 1ATZA 1N78A 4RUKA 4XWAA 4ZVMA 5A06A 4XZ3A 1CQXA 2JLYA 3NC1C 1BVYF 2OVBA 1P0PA 1AO3A 4OJNA 5AVQA 1MKYA 2IUYA 4S1TA 1UR5A 1NIJA 4K6FA 5SYMA 3QBJA 4XQEA 1U04A 4FOSA 2J3DA 3E9QA 2C42A 2IPNA 3A6GA 3BXHA 3S2ZA 1HI9A 1U0FA 2XGSA 1MB0A 1V43A 2HQRA 1YJQA 2MSDB 4PQGA 5JTTA 4N7RA 2CYBA 1J6UA 1T0BA 4MQEA 4WUTA 2XB6A 3VKGA 3ZBPA 4WZZA 4YRZA 2WHYA 2I7XA 2YMMA 4CDRA 1ZZEA 4L28A 5MN5A 3MC1A 3SP1A 4EDHA 4ESHA 4X97A 5JCOC 1BU5A 1VFNA 5HTOA 3BKWA 1I13A 3IXQA 2J0EA 4DV6B 4LJSA 2QN1A 1LKZA 1RU3A 3TINA 1SBCA 2DSTA 1CS0A 2QGFA 3L1KA 4NIMA 1PTJC 2ZPAA 3F46A 4OMCA 2ACVA 4CMHA 3AHCA 5KU7A 4Z2AA 1VZ2A 4IIFA 3EEYA 5KNDD 2OSVA 3I6ZA 3QYAA 4UDYX 4YLEA 2DHQA 1Z4IA 4J4HA 2CFSA 3H18A 3N8NA 2N0SA 2ET6A 2XY4A 1DC4A 1T4BA 4XIIA 4E15A 2RGUA 3L06A 1Z18A 2CCKA 2PN1A 4E2ZA 2VATA 4Z8YA 4HN2A 1ZQ1A 1V6SA 1P0MA 3TTUA 3HHEA 3PA6A 1VL5A 4NH0A 4EPYA 4XWYA 4LC9A 4JOCA 2G28A 4AK9A 1HE8B 3CF2A 2FWJA 2QSJA 2NZ2A 4IDNA 3U3DA 5E4JA 5C32A 3GPDG 2RKWA 2R7MA 1V3UA 3WV4A 1I8TA 3TYXA 1LBIA 1LV8A 4AY3A 5HX7A 1DXOA 1LH0A 4G84A 1EZZA 2PJDA 3PU6A 3A1TA 2Y0EA 3OP1A 2WJZB 3HBNA 3PFNA 4MIOA 2PL9A 3C3JA 4JUAA 2W2KA 3EJWA 1D1TA 3MN1A 3GVHA 2OD2A 4FTWA 4OJQA 3SHVA 3T8YA 5CJ2A 2H1CA 2D3TA 1V26A 4KN5A 4ND1A 3WGLA 3FHCB 1CZUA 3AKEA 1PJQA 1R4NB 3L92A 4EL5A 5KWVA 4XEUA 1GYPA 3V4OA 2B8WA 4KODA 1YONA 4YRPA 2BF4A 2BMVA 1Q44A 3S55A 1A50B 1MD9A 3F3YA 4M8KA 2RGNC 4YCBA 3B20A 2FPSA 3L0PA 1FLAA 4GRDA 4ZMBA 1R0XA 2JCXA 3THYA 4QG7A 3THXB 1BIFA 2VTKA 1U8TA 2C4KA 2OV1A 2VHCA 3BMXA 1II8B 1T9BA 3D3WB 3PUJA 4IVQA 5DK4A 5ALJA 4FW9A 4QXQA 1M73E 5FWAA 1SR8A 4EHBA 5CNJA 3MJSA 4YS6A 2C4HA 2GBGA 2HJ9A 4IS2A 1CUGA 4IDBA 4C0BA 4DCGA 3GRAA 1R50A 2A7XA 3AJDA 3RVSA 2GF9A 1ZGAA 1T3TA 3E4CA 4JBLA 1W87A 4XA8A 3OF3A 1GSAA 4ZJPA 2VXYA 1URPA 4BWVA 2P2YA 3EIFA 1R6DA 2VJDA 1IUKA 4QUBA 4WEOA 1PGQA 1FFWA 3OQNA 4QU0A 3IKVA 3MB8A 4A6DA 2I6XA 3E9RA 3QEJA 3KTDA 4UTPA 4Z1MD 1IWOA 1JV2B 1CFZA 1F8XA 1VHQA 1X7GA 2BKEA 1ZNYA 2IU3A 3DVSX 4QBGB 1XEAA 1NPDA 4QICA 3VC3A 4IDCA 5KNBH 4YMLA 4CIWA 4OX9Y 1P9LA 3IDQA 3LA8A 1AHHA 3UQZA 3UAWA 2J32A 3W9BA 3B8EA 4ZK2A 1I94B 4OXKA 4G9BA 2OFXA 2Q1TA 4OQNA 5C8YF 3RIEA 4TLMB 3OIDA 4X54A 3S2GA 1Y4ZA 4ICIA 5HUQA 1XWIA 2IUSA 3E23A 2BMJA 2BTOA 1SZCA 2O2IA 3DMRA 2FZ5A 1PLKA 4Q37A 3FYUB 1QGED 1R9GA 1H4QA 3M6MD 1MX5A 3D4PA 5JI3E 5BYKA 3CJRA 3P9KA 3I3SR 1PQPA 4M1OA 4EJ0A 1GAQA 2ZJBA 2AZDA 5CFLA 4A82A 3U9TA 1IN6A 4ER3A 1VGRA 1WTCA 4R1UA 3EZ2A 1R0CA 1AKTA 1I4TD 3LQFA 1Z6AA 4IX1A 1XTZA 3AETA 5TEWA 1D0VA 3TSZA 3S7TA 1SHLA 5LQMA 3E58A 2XDQB 3WA7A 3NTVA 1R0KA 3OPQA 4GX0A 5KHLB 2JARA 4NCKA 1FTQA 3GJZA 4J7UA 5F7JA 5A02A 3FB1A 3AJ8A 3E4DA 4QU8A 4ZO7A 1FUEA 5K4AA 1C1DB 1XLVA 3OETA 1FTGA 1KTVA 1ZY2A 4HTAA 5AXDA 3FVTA 2BFOA 4GZMA 1U5BA 1JZQA 2LCFA 3DW1X 3EVGA 1NMSA 2QE6A 4UBOA 3ZUGA 4YMGA 2IU0A 2JKYA 4FLEA 4L27A 4XVRA 1M8FA 1WVMA 1SB8A 3H6KA 4RHEA 4YJ2F 2OENG 2SECE 4KIFA 4LZJA 4PZEA 5K0SA 1V41E 3KOXA 4EAQA 4L8FA 2FXIA 2ASVA 3D8TA 4N7JA 5ITZB 3EPJA 4M8IA 3EY4A 4GWKA 1T0PA 3F1KA 4JP1A 4S12A 5AM4A 4BQSA 4B3IA 2FWBA 2ZXEA 5HK9A 5EKXA 1YJAA 2BP7B 2C4UA 3KS9A 4H17A 2XVAA 1XZ8A 4TMYA 3DM9B 1A04A 5IBPA 2V5UA 2ZVQX 3L82B 5EG5A 3PV0A 4UJ3A 1C4XA 3LF2A 5JNLA 1HFKA 3UKDA 4D42A 1U0RA 3GI1A 5G41A 5K09A 2NV6A 3CNOA 5DH9A 3KELA 4UUQA 1DELA 4OXXA 4Q47A 4RHYA 4AM8A 1IAVA 1NT2A 4NBVA 4Z9XA 2DFNA 2ORWA 3LUPA 4XWWA 2QORA 2IHKA 1ZGHA 3ZBQA 1M6VB 1DC7A 3RAGA 4B33A 4KQXA 1QOZA 4P35A 2ZYGA 2RGCA 3CCFA 3TOVA 3WZ2A 2WY2D 2D1TA 3Q9NA 4D3FA 3K6RA 1YZTA 3RVJA 2HK7A 1U99A 3JQ7B 5JS7A 3GZNA 5C35A 1TCCA 1F20A 2K7ZA 3GN2A 2ZCJA 1YASA 5T4EA 4HL6A 1FIUA 3OH8A 3G8BA 2RARA 5D8DA 1W0CA 1YL5A 3V8VA 1H8HA 3R44A 2ZJAA 3I6YA 4AX4A 3PNLA 1A95A 3L4SO 4WZBE 3A6PC 3HJRA 5AHWA 4B80A 2B2NA 3I32A 4FP9A 1QS0B 1AQUA 5DYWA 4QU5A 5ILGA 2PGLA 4XX0B 3OQMA 4LPKA 4MVJH 1CHDA 4FLFA 4KW7A 4RTRA 3IE1A 1KF0A 1OCEA 4QO8A 4RVHA 1ONNA 4XDGA 4ZCQA 4F1KA 1GKYA 2HHLA 3H04A 4HF7A 4TZKA 2V98A 3DEKA 2IYVA 3FF1A 3OU2A 4JL8A 3WMGA 1JR3A 1JT9A 2VT7A 4MUEA 4Q24A 2ZIEA 3Q3CA 3U5ZB 3CURA 4IMRA 1NVFA 2BR3A 3IR7A 1RKVA 1V1MB 2BTQB 2XXJA 3OFSA 4LZPA 1GD1O 1KYZA 4TL8A 4TUYA 5JCJA 2C2KA 3FNRA 3D5TA 3SEZA 3VU9B 1SD2A 5FR1A 4DARA 4IG9A 2O52A 4CIYA 1JFVA 2ZANA 3VTZA 4EJMA 1Q0LA 4UVGA 3ZJYA 3U1TA 1WZEA 4QBTA 1EB8A 3ZK7A 4YRNA 4HPWA 2F8MA 1YOVA 4BGVA 1WV1A 2IY9A 3C5WP 4G0OA 5J2UF 1MVOA 2NT3A 4H6PA 2VSYA 5EXDA 4DJDC 1FCJA 4DREA 4X7MA 5J63A 4YUYA 1X86B 1N5LA 2GWRA 3A32A 4CR8A 5K2OA 2OK7A 4M60A 4EW1A 3CX4A 3L7JA 1ZI9A 1O95A 2YQ4A 1PF7E 3HKEA 5JCOA 4ER5A 4B4OA 4KIUA 4CN8A 3BTVA 1PRYA 1S96A 3HXTA 4ZEWA 1UINA 4WLEA 1H4TA 3OZUA 5TEVA 4UTVA 1XNQB 2FA9A 3HS3A 1XKLA 1PTJA 1UPBA 3L04A 4NZOA 4M0UA 3SR4A 2ZTMA 3I92A 3AGPA 3O75A 5FHRA 4WN9B 1DX9A 2QMZA 3TUIC 4EUKA 5IEBA 2GJAA 4EABA 1C8LA 1JNXX 4CI9A 4XRGA 4YLYA 2EFEB 1QC5A 4GVPA 3R09A 3LX8A 3KYBA 4NX2A 4QHYA 5M2QA 3C98A 3OTOB 1ZJYA 1MABB 2PL1A 2B8JA 4MEJA 4O4LA 5H16A 5B1IA 1C7RA 3W6ZA 1EM6A 4AUMA 1GGKA 3DB2A 2AXQA 3A6LA 3HY3A 3AHGA 4H4CA 4Q4HB 1Z5GA 1LV7A 3Q2KA 1I2CA 2IYOA 1JEOA 1X8KA 2DVMA 4P31A 1PJLA 3NO4A 4FMDF 3PXAA 4FEEA 1Z0IA 4JLBA 3ASZA 3SXUB 1OFUX 3CEAA 1L3BA 1G8SA 3THSA 1U9YA 4DPLA 3V2UA 4UW9A 4AKEA 2QAIA 4DUGA 4C05A 1XV5A 2W2QA 4AMZA 2P9BA 3QE2A 3RDPA 3VDRA 2WWVD 3K71B 1V1RA 4CKYA 3PCTA 3B60A 3OURA 1JQKA 1LS6A 4Q6WA 1OV6A 3O8OB 2FWRA 1L4EA 4FFMA 3SJCA 1Y3DE 3D5QA 4HVCA 1G5QA 3BF8A 3HB5X 2ZG6A 4LHVA 4LXYA 2G77B 1GEEA 1ZA2A 4V38A 2CMDA 3VO1A 3TQFA 4GPBA 5BSKA 2PG3A 3IUYA 1R10A 1ZS9A 1J8MF 1PO7A 1XJ0A 2DQKA 3LNCA 3Q85A 3DO8A 5J59A 2QM8A 3TZEA 2O0JA 3GCDA 5BURA 2RGNA 2ZBRA 1NXSA 3QW4B 1EESA 1RYDA 5KOJB 4FZVA 1BDBA 2GZSA 4C87A 2Q4TA 2AUTA 2BMAA 4ALJA 4YDRA 4X95A 1G5TA 5CFOA 2R1TB 1NQAO 1QIDA 5CA0B 5DFAA 4B0OA 3OKAA 1XL0A 2NPFA 3E9NA 4OQEA 3FCEA 5K0LA 4EYGA 3JD4A 4R2JA 3EG9B 3W5UA 1YDFA 4IRUB 3RUHA 3T4XA 4YMTA 1T0HB 3JPYA 1EVEA 3K1AA 1E9DA 3LK6A 4UHCA 3DNFA 1L5QA 4WOKA 2G07A 4RD0A 4QM6A 3NC0C 4JC0A 1ORDA 3Q9UA 2PRIA 3NRCA 4HQLA 4KFSA 4M0LA 3ZWXA 4HGPA 4Y9TA 3A28A 4FYPA 1XZFA 3PHIA 2CLIB 3LLMA 3KVVA 1FX0A 2DE0X 3ADBA 4GS5A 2CNNA 2FE1A 3MJEA 5TQJA 1VKHA 2G1PA 3HWX1 2D1SA 4ZCPA 3VVMA 3HDHA 5EL0A 1USWA 4AWBA 2YZGA 2BMEA 5CAEA 2IYPA 4OG2A 2JFGA 3IT1A 4G1FA 3RTCA 1W46A 4M1KA 4X1YA 4RGYA 3HQ4O 4ZZ2A 4LHXA 2UYOA 4ZCTA 3A1UA 4JU9A 1N33B 1TYAE 4Q82A 1RZVA 4G8JA 2IBTA 2O7SA 4Y2RA 4G23A 3LUCA 5IKXA 5A0TA 1K86A 1M5UA 1TFUA 1W6UA 1BDIA 4Z4GA 4XSGA 1TUIA 2F1OA 2SCUA 1IIRA 2Q8PA 3GVCA 4REOA 2HGZA 4RCVA 2VHUA 5TF4A 3RJ9A 2X2PA 3O91A 3QKUA 1A8SA 2JBAA 2FPUA 2GNOA 2NO1A 3CLUD 3G2QA 3C1TA 3QG5A 1Y9DA 2XYGA 3G68A 6PFKA 3OCWA 2E4VA 3GCZA 1XHLA 4C1NA 3QPAA 1K4KA 4BXOB 3BERA 3STYA 3W7AA 1WCIB 5ICGA 4S05A 2I62A 1C3OA 3VHXA 4YUWA 3A11A 3PRYA 5CB4B 1IPFA 4MJ3A 4LF4B 3ER8A 4HY3A 3KQMA 3IBCA 1IBSA 4FHCA 4LK3A 4BMPB 5BMVF 1F6BA 1H8HD 4UAUA 1EK2A 1AK9A 1RM5A 3UM9A 3IUQA 4PHHA 2PUGA 2DWUA 3I6BA 5A5GA 1OY1A 4LHEA 3T7CA 5MHTA 1P1IA 1UZUA 2OLKA 3H3FA 1XAIA 3BMQB 2W6QA 4ND7A 1QZ3A 1PFUA 4D26A 2QM3A 1BE8A 4L08A 1ZK4A 1SUWA 1A7AA 2ZS9A 4ZAVA 3B3GA 4N9WA 5EE1A 1SRQA 2OORA 4C30A 3TOZA 2GXAA 4IGEA 3PZBA 4Y2YA 4E13A 3C4JA 3NHJA 1N6RA 4PZYA 5FXMA 3K9FC 5DM1A 1DIHA 3OLWA 2IKSA 1GP2A 1IN8A 3ZOKA 1YDMA 2P6RA 1W0KA 1FRZA 2IZ1A 3GLQA 3GT4A 3ZDZB 6GPBA 2F8TA 5DSXA 2IX9A 4MXDA 5JCJD 3MAGA 3DL4A 2B37A 1AIPA 3FIJA 1D1PA 4QAQA 4RH0A 2Y2UA 3V46A 3DMFA 4FYHA 4Y8VA 3B5JA 3L6RA 3AR9A 1ODKA 1M5TA 2AMJA 2A35A 1T5HX 2D4HA 3T0IA 4WBXC 3V1YA 2CLCX 2R4UA 2YWGA 5IP5A 1DHRA 1YQ9A 2JEZA 3PNVA 3U3KA 1H85A 3UPTA 4J16C 13PKA 2Z2JA 1DPFA 1F38A 2Q4EA 2EX0A 2QGNA 4Q1DA 4WKBA 1TIPA 3CF4G 3H19A 2PUAA 3VNUA 1F3OA 1PV4A 5FBWB 3W2IA 1NG1A 4PPQA 1FTNA 2QW0X 1RSZA 3A6ZA 2XYVA 3EVDA 3N74A 3RUDA 3WYGA 1MB9A 2P5UA 3ICQB 1O95D 3JASA 4R8VA 2JI9A 2R8RA 4PS0A 2IUUA 4MWSA 4RPHA 2GVNA 2UZIR 3HCCA 1CB0A 2JI7A 1B14A 3MXTA 3OSUA 4PF1A 2R6HA 5LLSA 3T1NA 1C3JA 1DBVO 4ETIA 5K05A 1P44A 1IEXA 3H9QA 2QK4A 2WIJA 4N7MA 3LA6A 4IBOA 3LGXA 1KI6A 1J25A 4ZXFA 5JMOA 2VIIA 4ZYXA 5IM4A 1MT0A 3CVYA 1RTKA 2ZUSA 1BKSB 2P4QA 3H2IA 4QJ5A 1ISGA 2QTVA 1QH9A 5CDTA 1JJ7A 2O19A 1EXNA 1L7QA 2CWWA 4P54A 3W8DA 5JUWA 4LFBB 3NXKA 4TM7A 1U1IA 1E2MA 4NFSA 5FV4A 1F8GA 1DIRA 1E5XA 4YROA 2ZTHA 4FDAA 1M1UA 2C95A 3L7YA 1DO2A 4MGYR 3B6KA 1GJRA 5DNEA 1KJQA 2WQ6A 2GN6A 4R8SA 5LMNB 2NAFA 2AG5A 4MR8A 4YDSA 2ZI7A 2XBLA 2EG9A 3AWIA 3NAZA 5D6NA 5B2ZA 3TZ6A 3QVUA 4Z7NB 1P1JA 2Z8ZA 2VSQA 3I2FA 3RT9A 2J3LA 5JVDF 3HK2A 3QQ5A 4B5KA 2C3UA 3R0XA 4DUGD 4P9NA 4NH4A 5EMNA 1R0BA 4YACA 4ZZIA 3W5VA 2VQEB 3ZI4A 1RM3A 2HPHA 1I9CA 2OO3A 3P0IA 5CVJA 3UXMA 4NJMA 1FU7A 2J08A 2P7HA 2PFKA 3OJLA 4ZV4A 5HVNA 2GARA 4GX2A 4S1PA 5EEGA 4TTAA 2VUTA 3IAM1 1YFKA 5HCNA 1M0SA 1OWNA 1PJBA 3KHKA 4FHEA 1ISSA 5H7XA 4DV0B 3PLAE 3H6GA 3PC4A 1T25A 4I9UA 3HA2A 3ZY3A 1QQAA 2VDJA 1JSXA 5KX5A 1HDCA 3P97A 1MJ5A 5BN4B 1GZUA 2HNKA 2MSKA 3L8YA 4K9MA 4O4IF 3JAWA 4Y6QA 2SBTA 3K7EA 3OZ7A 4DTIA 3R0VA 5M29A 1HFEL 2B1QA 4QA9A 2EC5A 1QGOA 5DISB 4CM1A 4CUKA 3ROXA 4E7PA 5BV7A 2FMTA 5T64A 2WEKA 2WDPA 1GPKA 3EVTA 2PKQP 4ZARA 2RE8A 2WJVA 2YX1A 2GLTA 3HYTA 3L40A 1WXQA 2HXYA 3JATA 2XUKA 3IAFA 6CHYA 5I7SA 2FQXA 6Q21A 2HY7A 1P60A 1NF9A 2DTDA 3H99A 3K9BA 5LZ8A 4A6XA 1NJ2A 2W2KB 4W5HA 4BVJA 3UTDA 2WU8A 3EDYA 1XCJA 3PJEA 1I6LA 4PSDA 2CJWB 2X4DA 1MX3A 3X1KA 4A4DA 1Y89A 2YRFA 2ZULA 1IATA 2GERA 2QTGA 4EENA 3FCOA 1T5OA 3HCDA 3MMNA 3VR4A 3CIFA 4ECAA 1DJNA 3SQWA 2I76A 2FI1A 3AF6A 2GVDC 3HCWA 3Q2IA 4TM8A 1UXIA 4MVWA 5HKBA 3B1XA 4KFRA 1DUSA 1DWOA 2XNCA 1SWVA 3PDUA 4Y1FA 4YCAA 3WSTA 4XVQA 2IYRA 3K2IA 1YS4A 3VR5D 2NVBA 1E6CA 4I81A 5EXSA 1DRUA 3IVAA 1EEXB 1DZ3A 4LECA 1P8JA 1D6SA 4KX5A 4S35A 2G4CA 2I3BA 3JRWA 4RMGA 4DYDA 5CVVA 5IKOA 3DGFC 5AJYA 4KQGA 1DNPA 4YMUA 2XNDA 2GEBA 1O0BA 2FUG1 4YCSA 5BWNA 1BKYA 2OPBA 1XQ6A 3EUAA 4R31A 2OGZA 3MSCA 3ES9A 3Q8XB 4C3OB 1I32A 1KEUA 3D3KA 3HBJA 4ROSA 3SMQA 4F4FA 1Y3HA 1PT9A 4LA4A 1G4HA 4WADA 1RJGA 3EIWA 5K20A 2ORED 4LJAA 4GNRA 4RVOA 3WR5A 5C7IO 3KWJA 2WWGA 4HXYA 4P33A 2R6R1 2HJGA 3O03A 4L51A 3FZQA 3BSYA 2DETA 3E7WA 4U63A 2YHBA 3FI0A 3ME5A 5BN3A 1OXTA 1T1RA 4NYJR 1HLPA 3R5XA 1QTRA 3QTBA 2QU7A 4RA6A 1GOTA 4M1QA 3CR8A 4M6WA 4ZI3A 5E6UA 3NTOA 3KCQA 2UAGA 3DW3X 2BMFA 5ICFA 4Q39A 2EX1A 4IFIA 4WIAA 1I80A 1Q0HA 4G8BA 4EFLA 5HUJA 1YCDA 1ZICA 2NW6A 1T1SA 1WABA 1NJSA 2OL4A 4IQGA 2QLNA 1TTHA 2WJPA 4RLFA 2GAIA 3KXKA 4QU9A 4BX3A 1OAKA 1RWNA 4X5OA 2ENWA 2OXEA 5AHXA 5EUQB 1IK6A 2WILA 4FGJA 4QVKA 3AR8A 3LDAA 3U4CA 1CVLA 1BHSA 3JQGB 1NVAA 3WKCA 4GPTA 2ENUA 5JZMA 3CRW1 2Z2YA 4LOLA 4ECEA 2UVPA 3I0MA 3ACCA 3JV7A 2M9MA 1WP9A 3O3MB 1F6WA 4Y1EA 1A2BA 1UAYA 5BR4A 1QGYA 2BI8A 2G72A 5H02A 1UCFA 1W0KD 5FUMA 5KDDA 4MVJA 4C7MA 4YRTA 2YIJA 1V3TA 5C9ZA 1VL8A 5KYYA 4HQ6A 3M4NA 5EIWA 2QMQA 1EK6A 4ZO6A 2IV7A 2QTWB 3LTNC 1SQ6A 4QYXA 1LQ2A 2W58A 1Q11A 4MTCA 3VQTA 2CNDA 1E9SA 5G1PA 5GVSA 4I5GA 2EBWA 2CK3D 4LN1A 1C2YA 4G89A 1HE3A 4JJFA 3SKYA 4UUBA 4L5BA 2D3WA 3I2GA 4G0XA 1RYHA 3K94A 1U5BB 5C34B 2H5EA 1IWBB 1UDRA 1W9MA 7MDHA 3LYAA 1EK1A 5JMWA 2H7YA 4KUGA 4CF5A 3C24A 1H9BA 1E2EA 5IKPA 2EKPA 1P6UA 2RHJA 2WFMA 1TM4E 3R20A 2INGX 5JEDA 3L7LA 1Y3BE 1Z35A 3IPAA 4R0MA 4CHTA 3CZAA 2NU9A 3I8OA 3UYLA 2NZXA 3LRTA 1SQGA 2YS6A 3KXLA 1A1SA 4YFVA 4XUCA 5CYPA 2A5YB 1UPXA 3L93A 3IVRA 2IBSA 3A4VA 3PEWA 1PUIA 1AQIA 4HZGA 2MSWA 4I1OA 1MJNA 2VT6A 2ZRQA 1WZNA 1YKFA 1VSVA 1CR4A 2FY8A 3HFJA 4L1KA 1FBNA 4ZO4A 4ZT2A 3VR0A 3QNMA 1Z22A 1BVRA 3LUDA 2XNSA 1KZGB 4X6UA 2MTBA 2G1AA 1OX4B 3OMWA 1E4EA 3HO6A 2F3QA 1A2OA 3G9QA 4LIPD 4BVEA 5HQ3B 3DVAA 4MUHA 5L4SA 4UM5A 1RLOA 5CYFA 2DHDA 3R7WB 2QVCA 2IW3A 3ABRB 3SSAA 2GDJA 3I4LA 3PE4A 1UBFA 1WUYA 2O48X 3MD0A 5HIAA 4OSPA 3R74A 1T29A 1ZLYA 4BO6A 1NC3A 3CZ4A 4GZ5A 3NORA 5B57C 1AT1A 1KYYA 5EZYA 3UW1A 5JSKA 4FNAA 1AV6A 4HB0A 2NUPB 4J16A 3SVTA 2PIAA 3O93A 1QYDA 5JT1A 1I1HA 4RDHA 1DC6A 2R48A 3OE7A 4GI1A 1GEGA 1QOQB 4FSDA 5I8PA 3UWPA 2H92A 1N0UA 2VBIA 1QVAA 1Z0SA 3K72B 3N2YA 3S2UA 4ETNA 4BNDA 2PJRA 5JFGA 1WHSA 1HR0B 1NDHA 2HU2A 4M0KA 1OIXA 4B45A 1P5FA 4NATA 2JFWA 2EBUA 3P9PA 2VJCA 5DV9A 2RHRA 2JDID 1UP7A 4KZPA 5D2CA 1KQNA 2QOEA 4UM9D 5DIFA 3UT6A 3DVLA 1AD2A 5LA6F 2R11A 4QJIA 2BFMA 1GL9B 1RD4A 1EGAA 3GMDA 3ADDA 3R6LA 3DOJA 3G1UA 4D79A 1Q15A 3F5SA 3MJHA 3OFVA 1V9SA 4FVTA 4DNPA 1R2QA 1ZVQA 3KB6A 3PUHA 3VBEA 1HQKA 3QXSA 4G07A 2CXRA 1A8UA 3GCGA 3FROA 1OJ7A 1M6YA 3ED5A 5TGDA 3BE4A 1YOVB 2ZIZA 3VR4D 1L7MA 1J4AA 4HQRA 3DFKA 5I3CA 5C1OA 1TDJA 3H3JA 2PWZA 3S40A 1H1DA 5KNLA 4NF2A 2Z3WA 1VG9B 2B3DA 2Y1DA 4XFJA 5HZGA 2AFIE 3JVVA 1U7TA 2B7BA 5G1OA 3DJFA 1P9RA 1XALA 2EW2A 2C5FA 2ZSFA 1K3FA 1RHJA 4ZDIA 4FZ3A 2PH3A 3Q3VA 3ZE2B 1F0PA 1ZXBA 4AAYA 3L6CA 4MPRA 5HSGA 1J9ZA 3PD0A 1KORA 4JKOA 5HJ7A 3L8EA 2P2GA 3X3HA 5JYCA 4JJKA 5JNWA 2FWMX 1NQUA 4XAQA 3HDYA 4RYLA 2IYYA 2GQ0A 2XNDD 5H59A 1J21A 4D80A 2CXNA 4HDCA 1C9YA 1RM4A 3K0KA 2FPPB 2JLSA 2HCJB 1LVHA 4JVNA 1L5VA 5DP2A 5F1OA 1UXJA 1XRLA 2W2OA 2AW3A 3D6HA 3DBIA 2PH7A 3R6TA 1S2MA 1A9XB 4MUNA 3UK7A 5JJ5A 1XK7A 5DCYA 3ERCA 1VYVA 2GS9A 3TTWA 4ARZA 3F71A 1XLUA 2OCBA 2PU5A 3QHAA 4DGSA 4KACA 3F6EX 4DIOA 8OHMA 4RMJA 3OA2A 3AOEC 1WG8A 4TQ9A 4M9ZA 4UNQA 1JIUA 4EO4A 4ZZ0A 3ZNOA 4MR9A 2AK2A 4DLSA 2IYFA 1VHJA 3HEBA 3TB6A 1M1NA 1VG0B 1CQWA 1VSUA 3NATA 4IDPA 4RESA 4RNCA 4K6GA 4BDSA 1Q6ZA 3L5OA 1P17A 3UJ8A 3WNDA 4TKMA 4OEHA 1IZ7A 3DMTC 5E8JA 3P5SA 4EHLA 3BL6A 1RQPA 2YDXA 2AKAB 1Y98A 4OKIA 3K6SB 2I6FA 2WI8A 4MRVA 4S1OA 5SY9A 3SC3A 1NXVA 1Z06A 1P7YA 4E07A 2EGGA 3ZOZA 4KRFA 4BUJA 2YR0A 2ZWMA 2ZUUA 1C9EA 1N1MA 2I2CA 3BGIA 3DBLA 4I4TF 4DFDA 4BAZA 3A4NA 5GY7A 1ZHOA 2A0XA 1JEQB 3N0TA 3TRKA 3UGKA 1D2NA 4N3CA 1R37A 3KEMA 3MERA 3LPAA 4F45A 1IM5A 4NQZA 4GIBA 1F0KA 4QEKA 2VJQA 3A2LA 3WLEA 1WKCA 1WD5A 2NX2A 2VRBA 3EMKA 1RC1A 2PWAA 4IOMA 1D04A 2DG2A 4LHSA 3HJNA 1KK2A 4ABTA 2AXEA 3IEVA 4FNGA 1M8JA 1V5IA 5BSVA 1NJ6A 1X92A 3FUXA 5AVJA 2FUNB 2CUTA 2KBEA 4JLJA 6LDHA 3B7WA 2DAPA 2AZMA 3QHQA 2F1IA 2Q27A 4NBWA 5CA1F 1UH5A 1Z7YA 3NM4A 3LWBA 3OZIA 5DTJA 2OCKA 3NBYC 5AD1A 3T12A 5K6AC 4L8YA 5B6IA 4KXUA 2PPVA 3LBHA 3DUWA 1JMKC 4HGQA 2FSFA 4NULA 5CX4A 3V1TC 5IZCC 4H6VA 5JQGA 3SK0A 4A8JA 4BB0A 5LJLA 1VFPA 4QLOA 4H7EA 1FTWA 5I7HA 3AUKA 5CEFA 3GV0A 3U3JA 5B3JA 2QTLA 3RTGA 3RWMB 5KJ1A 1Y6QA 1R8XA 2QRJA 5JSFA 1TC1A 1X1TA 3ZCRA 4Z9BA 2UUBB 5KJEA 1L1QA 3CINA 2IGBA 5AM1A 621PA 1G21E 4EI9A 1W36D 4Y9RA 1NVTA 2BAGA 2ZWOA 1L5SA 1J9GA 1RPJA 3AVQA 3E2IA 4YMSA 3AQ4A 2O8VA 4Z4EA 1S8OA 2EFCB 1W47A 4ZICA 1A82A 2YVAA 4CTKA 4YJFB 1LBHA 1IDN1 3LCJA 3SQMA 3EMBA 4RFSB 3GZTB 3HBLA 3MCTA 1XRSB 1ZNXA 3OM1A 5C7OO 3WLJA 3O4GA 1C9KA 2NGRA 1Y82A 1JYEA 2AQIA 3M5DA 4QE3A 3GN1A 4UU7A 5CLFA 2Y1FA 4DZZA 3B2QA 2CLOB 2ZBEA 1A4XA 2P4UA 3AY3A 1ZD3A 1UT6A 3L3BA 3N3AC 3ROEA 2DZDA 1OKKD 3U62A 1ZSVA 2HUPA 4LWPA 1FY2A 5C46F 5DWVA 5B4VA 2WWHA 1W581 3FTCA 4UAVA 3VHXB 2IUEA 1XVVA 3ENZA 4O2AB 1RJDA 1ESDA 4BNYA 4GAEA 3RS2A 1GPBA 3BTSA 4DJEC 4YCCA 3L7CA 4EHAA 3TKAA 5BRJA 2O1SA 2R00A 1Z38A 3F0TA 3OPYB 3LT1A 1H0HA 1L5OA 2Z4RA 3B70A 5AIAA 3E2MA 3NRJA 1R6BX 4DMLA 4XW2A 3REQB 2E5LB 4DA7A 5C1BA 3ZDAA 3GGGA 2QVXX 3EW7A 2AUMA 2QKYA 1NASA 1ZUNA 2O3RA 2QT9A 1IZZA 3OE7D 5H82A 1W76A 5LBUA 4PBSA 5ARDA 4KTTE 5K0BA 3ROQA 4KQIA 3NI2A 4P5EA 5FULA 3SVZA 3ZZ0A 3TECE 3IALA 5B64A 1Z07A 4HNAA 2NTJA 4J49A 4YDHB 3KQUA 3AL0C 3DP7A 3HFRA 4JB8A 4XM2A 2BFFA 4MCJA 4NABA 1XQXA 4W1SA 4WVFA 3QW2A 1P1HA 3OOYA 4A6PA 2XVZA 3QOWA 4V3BA 5FL3A 4NJOA 2Y92A 1GAEO 2A6PA 2F2TA 3NBFA 4MWDA 2PGAA 2O2DA 3FPGA 4B6EA 3V8QA 2RHTA 1GZDA 2BI4A 2IITA 3M4ZA 3L0OA 4ZAGA 7ABPA 1P0CA 4ER6A 3IPCA 2QF7A 3AFNA 1LZLA 3ZCPA 4QZVA 5KPDA 3AFMA 3TVTA 3NMUF 1F4PA 1VBKA 1AX9A 3SM3A 3QVWA 3K73O 3LOUA 1YXMA 2NSLA 3LCMA 4ALKA 1RYMA 1C4OA 2BBTA 3GXOA 2ZU0C 1MJFA 1Y6RA 1ZOOA 4LC1A 5D7BA 1A77A 2Q3MA 4I1RA 3JASB 4I6EA 1B6SA 5ALEA 4AKHA 2WIKA 4MARA 4QL3A 3OICA 4RIHA 4BQPA 2GETA 1FNNA 1E2NA 2I1WA 2H9IA 3TPCA 4AVYA 3O8CA 5ANRB 3ZEIA 3EXG2 5EHIA 1GSHA 4P0TA 4GT1A 3U81A 5C4IA 8ADHA 1QH0A 5FX2A 5FOTA 1NI3A 1PEYA 1NE2A 2H1WA 1C7ZA 1U0GA 4LVUA 4PX2A 5DX1A 2VK8A 5BQOA 3FOEC 3VKUA 3N8GA 2QTAA 4TMWA 4D9JA 5EWMA 1U1CA 4LV6A 1WXHA 3ZH2A 4M9CA 2LW7A 4RHXA 3VH2A 5JISA 5LMUB 3IAS1 1ZRSA 4X8OA 3QVTA 4URVR 2OHHA 4NCXA 4DILA 2Z9DA 3F2VA 3OQ1A 1DJLA 2LUOA 1EDOA 3AF3A 1U7PA 4JBNA 3W7BA 1NVEA 4XM1A 1QHEA 4P3XA 1KZYC 4MR8B 1PVDA 4XQ9A 4F5YA 4GYKA 3TNLA 3WOHA 5BUCA 5LIRA 1CZRA 2C5GA 2QMOA 3I61A 1NN1A 3ABSB 4MCIA 1EUYA 5DZSA 3ASYA 3C6KA 3FE2A 5AOAA 2PRYA 3GDFA 1EG7A 2VNAA 4OI0A 3PE3A 2D5IA 3TFQA 4BRUA 2IHNA 1M72A 3G2OA 3BE5A 3O26A 1OFIA 4CQNA 4LSMA 5JAZA 3H1PA 1CE8A 3PT9A 4HLDA 1XJQA 2VDWA 5FPTA 3P9NA 4OP3A 5EP3A 3LC2O 4ZD6A 2FSUA 2HJRA 4WZ6A 2P75A 3BEDA 2PQMA 1OXVA 3TIIA 2GPJA 3SQNA 2QX7A 5ER6A 2MR5A 5TS2A 3U37A 4ENTA 2E87A 3BCSA 3KNZA 3L0ZA 1TQ6A 3MWEB 1FS5A 1Q1EA 5D00A 1TL7C 3D9QX 3KYCB 4FKBA 2A1TR 1Q0UA 3USES 2GEVA 5GOTA 5F98A 4PAGA 1SQ5A 4FBMA 4XX1A 1XE3A 3W06A 2BFWA 5FV7A 2ZROA 3LPLA 4B84A 2AYZA 4XGIA 5C1IA 3ONNA 5L53A 3PXDA 1L9KA 1H2YA 2FPWA 3JATB 3KYDA 4TL6A 3TDMA 3ZV4A 4JEMA 3L9XA 1CF2O 3ROMA 4RTPA 2V3VA 2HDNB 1ZA1A 4XRRA 3ZIDA 3NR2A 4C76A 3MGGA 4L57A 2IE0A 4K0RA 5JO0A 1P1RA 3DEYX 4O25A 4X3OA 3FRHA 5DT9A 5JNTA 4ZANA 3NIBA 4DV4B 2BGNA 1IZYA 3AF4A 4LJ5A 3AVUA 2WAAA 2FFHA 3KU4A 4PTLA 4OHKA 3G9TA 5FT9A 3QHPA 1E5LA 4FEYA 3AOEA 3ND8A 4IMJB 4XWTA 3MBIA 2HWYA 2JHFA 3CLVA 3I23A 1KGDA 1BMTA 1OR8A 3HGTA 4YEDA 5KNCD 3B6ZA 1QP7A 5HIKA 1KJYA 4DMCA 1NVMB 2W93A 3ZUPA 2DOKA 2V7EA 2QRZA 2WAMA 4Q3EA 2IWHA 1SRRA 4DKXA 3TAUA 2VXCA 2DSNA 1JSRA 2OVFA 3B7GA 2FWAA 1E1LA 2RH8A 3K16A 2GLUA 4K9SA 1M2NA 4KIWA 1ECGA 3SNKA 3M3DA 3K32A 1L7PA 2WUVA 2ZRNA 4E94A 4YPOA 4EI2A 3SQXA 3EF1A 3PNQA 4J29A 3ML1A 2XZDA 1NYLA 2I34A 3KLMX 2HQOA 3GRVA 1EXWA 4WI1A 4YJ2A 2QYSA 2O07A 2ONKA 5LL6P 4NYMQ 2GD0A 1LJUA 2GILA 4HRYA 4P5DA 2G9VA 3G59A 4WFIA 1E1KA 4AP6A 4LGCA 4UQPA 3DDHA 5B7NA 1P4JA 1JNYA 4PY2A 4CLRB 4OHXA 4PZLA 4C2TA 3AVWA 1Y1KE 1JB9A 5JRZA 3JQBA 1P39A 1ULBA 4IGFA 4KEAA 4N82A 1J0XO 2G4VA 5BN3B 5ELLA 3D4OA 3V1LA 3R9KA 3IQGX 3O8QA 1CJCA 3WLHA 3VZRA 1CY8A 4WY5A 5EHQA 4JI8B 4CT4B 2O1XA 2LPMA 3PVSA 4NBTA 3ZD8A 5E6UB 2FSPA 3DAGA 4OI2A 1YR8A 5H3HA 1G0NA 3SGLA 3LH5A 4ZT7A 2H63A 2DXIA 1P3Y1 3PXEA 1KEEA 2B4AA 2H4YA 4QPPA 4WJKB 4I1SA 1QIHA 3QI2A 4XLLA 3C3CA 1CY4A 2PT5A 4UU0A 3S1LA 5DCUA 5EJ4A 3R9XA 2F7SA 3EJ6A 1F17A 3I09A 4H1HA 5TQ0A 1GKLA 4LXXA 3QSYA 4BLSA 3N87A 4DCCA 3ZJTA 1F3LA 3LUKA 3R75A 3AK4A 2O3QA 5DHRA 5IZCA 1E5QA 1U02A 1T2VA 2YUIA 1GQRA 4LYFA 5I4KA 1O96A 3ASUA 4DYVA 4M8SA 4BNGA 1NVBA 3R5KA 4LJ7A 3CN9A 1OD6A 3W4KA 4BV8A 4O08A 3GDGA 5JDIA 4Q9NA 4KDEA 4ITVA 5AJXA 3AYXB 1BKDR 1USGA 1AUOA 4WCFC 4ARVA 1KO8A 3FWZA 5G0TA 5KYYB 2OBMA 2ZOSA 3CW8X 3QYFA 4JEHA 1PTKA 2GZMA 3UICA 1R16A 1NI4A 1U5AA 1DBWA 2HMAA 4NESA 2X5KO 4AROA 1F48A 1DBPA 1UFKA 2C31A 3GPIA 3RUCA 4CM3A 7REQB 1G8KA 3TZHA 2PLWA 2OECA 4JOQA 1L5MA 1W4LA 5FO1A 3O4IA 5REQA 1KBQA 1TM5E 3OZAA 3KCNA 3BB1A 4PSAA 3OD1A 1Z17A 3K1JA 2VDRB 5A1JA 2AJTA 1QRUA 1M2VA 4YJGB 4JYMA 2H06A 4IIVA 4TMKA 1OGYA 1WDKA 4QUKA 1OXXK 4ZQFA 2XKKA 4UZSA 3P27A 2NZYA 2P2DA 1I6MA 1C81A 1VI2A 3IVMA 2Q46A 2E4ZA 2GZHA 4JX9A 3RU3A 1IMOA 3ANYB 1ECLA 1HYBA 1KEPA 3NBUA 5LIPA 1W36B 2W7TA 2NU9B 3TW6A 5I7RA 2W2MA 4US0R 2IZ5A 1O89A 1U8UA 4LUCA 3WLIA 3X2FA 1VIYA 3N3BC 3PNSA 4N5NA 1IB0A 2FUG6 5BWCA 5C8DA 3MWDA 3ZWCA 3N1UA 5KWEA 1APBA 3G0OA 3QNWA 4PZ9A 3SFZA 5HE9A 2WC1A 3THOA 4BCDA 1V6CA 2AH5A 4CODB 4UFPA 1X38A 1BX0A 3FVWA 1UT5A 3TR0A 4CJXA 2HHJA 4Q4JA 1TAGA 5T4FA 1YRBA 3WLPA 3IOYA 3FCCA 3P2EA 3WHKA 3CX6A 2QD5A 1XA4A 5IYZB 2NZJA 4N0PA 4X6LA 2R4QA 1HBJA 3OEYA 2XUJA 4Q9HA 4C07A 1FZTA 1UZAA 1Q1GA 3D8BA 3KYIB 2X77A 1RHRA 3CG4A 4K9QA 4NK4A 5IVPA 5DBIA 1XZPA 1V4NA 1T8WA 1RZRD 3LP6A 1P0FA 2DBVO 1SUAA 4MAMA 4QTUB 4G9GA 4RHCA 3TSCA 5JAIA 4X65B 2YHIA 3JQCA 1TUBA 3B9BA 3LUJA 1KY3A 3LKVA 4FS8A 1JX6A 1GTG1 1ORRA 2Q0QA 4ZOQI 2BH2A 5L7WA 4MGHA 5FO0A 3ZDYB 1OZAA 2QP9X 3PFHA 1ZUHA 3HCFA 2QIPA 4QIHA 3ZV7A 3GLHE 3AX6A 5AJHA 4DXDA 3DTVA 1GCAA 2WWIA 4HH1A 3OHSX 5EI5A 1CXZA 1Y6JA 4FFOA 1SVNA 1WKBA 4XB2A 3QYJA 3BWVA 2YXBA 5A71A 3ZHZA 4LI3X 3BE6A 1OBVA 5K0GA 5EIXA 2F59A 5EWJA 2CBZA 4V03A 2ORYA 2AXPA 1K9SA 4P6VF 2J09A 5IVDA 4FT4A 4HWSA 3RH0A 4BNDB 4Z99A 4RJTA 1KFJB 1QF9A 4REQB 1K68A 3IOEA 4XGNA 1WHSB 5EJ5A 1N5RA 3MAJA 1KVUA 3JVIA 2QTNA 1X2EA 1EH5A 4H1TA 4JLAA 2HH9A 2UV8A 1AK2A 3KR0A 3SX2A 2H1RA 5JQWA 1U7HA 2O3UA 4II3A 2FN9A 4PAMA 1QAOA 3HVHA 3R3YA 1P73A 2Z95A 2BFDB 2FPMA 3ZW8A 3FFXA 1FPQA 3KEGA 4WHMA 4IOLA 1MOZA 3GGSA 3IA2A 3LHFA 4AYTA 4M46A 1IE3A 2J6IA 1DBIA 5KTKA 1LD3A 2P27A 3HB7A 3QBDA 5GP1A 4B3TB 4II7A 4TLAA 4B85A 1SG0A 5ALIA 1NUPA 5NLLA 5EIBC 3H86A 5HOEA 2OXFA 4LY0A 4B46A 1WQ4A 1R3UA 2YVKA 1O6CA 5A3RA 2Z3ZA 1EUDB 2Q1XA 4Q3NA 5KU1A 5DOVA 3N2GB 3RQIA 4I2NA 5CX1A 5TMDA 3HWSA 5E95A 1POWA 3AHJA 5EJ7A 1E7MA 4JGIA 4QOIA 2NQ2C 1P5RA 3D4IA 4NZYA 4ALNA 2ZJ4A 1AHIA 2JH3A 2ZU6A 1D6NA 4QFBA 1XZMA 1MT3A 5ALLA 1AZTA 3G0BA 1WKVA 1K8XB 1F4LA 5CFZA 3ITKA 4EYSA 1FF9A 2G67A 3N6RA 4YRAA 3H2HA 3K1TA 3V4VB 3G13A 4R41A 5EKTA 5JYEA 1T1EA 3L0BA 3QVOA 5HIJA 1BD4A 3HL4A 1Y81A 3GRPA 2IEDA 3ASVA 4S1WA 5JC1A 3DD5A 8ATCA 3H5VA 5TQ2A 4DA6A 3L5KA 5LDHA 3V4RA 1N0WA 2I66A 2OHJA 2PUTA 3FBGA 1TK2A 2EZ9A 2PBFA 2VRCA 4PNPA 5DM0A 3U4DA 5KYTA 4MR9B 2H2AA 4KVFA 2PCJA 1X70A 1DOZA 4K9LA 1JDBC 4HOYA 5DM60 3I34X 5IC6A 4QPJC 4YRQA 5DBHX 3ANSA 3DXZA 4HAOA 1JLHA 2C2WA 2DB3A 2VTEA 3LBNA 4EKGA 4NFHA 1RAHA 2X5NA 3FY4A 2X9NA 3P9IA 2NUAA 7YASA 3VPHA 3ZCVA 1KP9A 2W4IA 2XVXA 1DV1A 4MCHA 4N39A 3SZ3A 2EWWA 4KO2S 3HR4A 5BRNA 4LF8B 5DNDA 3VTAA 4PG7A 1H4SA 1VYTA 1QM5A 2AX3A 3LBFA 4PQEA 1QB8A 1CUFA 3NCHA 3RSHA 1UWLA 3LT0A 2O0LA 3C4VA 1UBNA 4K81B 4FYXA 4Q9AA 4ASUA 2E4UA 1NX6A 1G20A 1X80A 4HQOA 4KXVA 3G7UA 3MCAA 3RVRA 3EARA 2QRVA 3EVZA 3NC4A 4OM7A 4ZAXA 3PTAA 3B3JA 3DGEC 1S2NA 4V0RA 4WNAB 2FGJA 3EIOA 2BC9A 1YJBA 2ZT6A 2ZYVX 3FSEA 3GA0A 4N3NA 4IY1A 2GWHA 4NNJA 1J09A 1OXKB 2O8EA 1FLDA 4Z54A 4L4SA 5HPYB 3CKMA 3LE8A 5IF9A 3JQPA 1MXHA 2ZRGA 4UDXX 4BZPA 5CCXA 1R0YA 4LVNA 2ZIAA 1IVNA 1CZHA 3GT3A 5HF5A 5I9LA 1T9GR 5EXXA 2ZUWA 4POOA 3S1AA 4CKBA 5JAHA 1H5UA 4G5OA 1M1YE 4XM0A 5JMTA 3T3GA 1N34B 3GH1A 4PVCA 2OLEA 4QRDA 3Q8WA 1P80A 5JQGB 2ZCUA 4F4DA 1D5CA 1NVVQ 5I01A 1L5KA 3AI3A 2PX4A 5A2QA 4LZWA 3V4SA 3WTBA 1KXJA 3GVIA 2ACEA 3DZJA 3HMKA 4M98A 4WZBA 5FNVF 1QU3A 5FUWA 4DMHA 4LKRA 2J5QA 1SJ9A 1UIMA 1VGQA 1M2JA 3FJYA 4JI5B 2A5DA 2PAAA 4DDMA 4ZDJA 4KFCA 1JEDA 4W63A 3HSYA 4AXXA 1HFJA 1U1FA 3A6KA 3GAZA 1ACLA 3FYCA 4LMBA 1YBAA 2P1DA 1WETA 3DL2A 4Q93A 1HOTA 1IEVA 1W25A 4LQ4A 4NG5A 3BRCA 5AXBA 1AQ6A 5CDHA 5DN6A 2WPDD 1US8B 2VA8A 2O23A 1FQKA 1TLLA 3GJ3A 4R2MA 5AKXA 3UG6A 3WA6A 3MT0A 4JVSB 3EODA 2D0OB 4B43A 5KJFA 1C0EA 2PZFA 3PDCA 1CIJA 3QA3E 5HFNA 2IUTA 3UJCA 4AW9A 4F4CA 3L4JA 2WWFA 1E2QA 1GPYA 1E1MA 1X1DA 5HRUA 2YJGA 2FHPA 1E3WA 5BN1A 3QFFA 4RVNA 3VNBA 4O1MA 3F4KA 1W1UA 4WCFA 1ISJA 1EFVA 1UZMA 3AVOA 3QVJA 2DWCA 4FFSA 2QA5A 3IP3A 1M76A 1GPMA 1EWRA 2BEKA 1OI2A 3FKQA 1CETA 1Z39A 5EZQA 4RVGA 1AZLA 3M6VA 3WP1B 3WJAA 3E9DA 4ALLA 2GRUA 3OHPA 1VCHA 2IEZA 4XQCA 4CIAA 3Q8KA 1L8AA 4BFYA 3CHYA 3ELWA 5A03A 1C9DB 3MUEA 2FKNA 4WCDA 2MU1A 3EZFA 1SD5A 1CV2A 2X0KA 2PMDA 3DTVD 3MGAA 3MW8A 1EX1A 4BB5A 4DW8A 3O9ZA 5H9WA 3CQ9A 3OF2A 3MINA 4WNCA 5AI6A 4KXYA 5IC5A 2ZIWB 1P2VA 1WTAA 1CFJA 5CD9A 4Y0AA 4UXIA 2AZ4A 3NM6B 1ULSA 3NB0A 1YS1X 1ESCA 3SBEA 3RJ5A 2A9FA 1T3SA 4ZAYA 4N12A 2REBA 4DIEA 3O1HB 3GAAA 3KZCA 5JVDA 4HFRA 1WDLA 1AF4A 1NKVA 2AL7A 2C96A 2ZS8A 3V1MA 3GFOA 5I4CA 4JJ8A 4EH1A 4H6XA 1E62A 3V5NA 3N5CA 1OB5A 1V5GA 4BHTA 5CVCA 5ESWA 3VBCA 3BGVA 2BFFB 4QQKA 4I0WB 4WBNF 2EF0A 4EA8A 2XDYA 1L2TA 3DZ8A 1XMPA 4DV2B 1FS4A 3AFIA 1QQ7A 3PPVA 1UC4B 4YAIA 5BW8A 1XRRA 5CNIA 5ALZA 3LPNA 1ZITA 4ZDKA 5A4DA 1Y1RA 4LI0A 1H8EA 4LQLA 2HF9A 4M7PA 1X1CA 3HKDA 2ATXA 2JKVA 3K9GA 3KQOA 4UUAA 2X3YA 5T4HA 1XZNA 4MP8A 3RYTC 1V3QE 3HDGA 4L9RA 1PDWA 2PRZA 2H4JA 3FTEA 4RYDA 2WABA 1R8QA 3VYTB 3TTTA 4N65A 4N6OA 2OCXA 4FX2A 3MCWA 3CX8A 3L6UA 1W85A 4H3SA 2WTEA 3ND9A 4L16A 3DKIA 4O4HF 3PFFA 1C1HA 3M83A 3SNHA 5K6RA 4XQ0A 2OHGA 3IJEB 2H2IA 1JPVA 4PFSA 2ZB7A 4CVNA 4TKUB 4EZBA 4G0YA 4CPDA 1E7QA 1NRJB 2DJIA 1G7RA 3K8QA 1WXFA 3NBMA 2QRKA 3AKZA 4RA9A 1UZLA 2D13A 3FUWA 4UUPA 3K9WA 1NJFA 5EWMB 1K98A 1EFLA 5LZ9A 3PKZA 1UBUS 4MYHA 3OPNA 4HZIA 1UXHA 4FILA 1H1LB 3FWPA 1F8UA 2Z8YM 3SSMA 2OKCA 3QSGA 3C70A 3AGQA 3LJKA 3A1SA 2V5AA 2VP4A 3LXMA 2WM2A 2YC4C 4RVSA 3RFVA 1JBEA 2PGIA 3KQYA 1TM7E 5AHOA 1B6RA 2B99A 1JB1A 3QEAZ 3PUXA 4COKA 1UKVY 2OMKA 3AMVA 2HJSA 1T3GA 2DUNA 1AS0A 2PT7A 1MUUA 1IBRA 2J9YB 3QEKA 3LM8A 4PW0A 1L4NA 1LLFA 3GJ0A 2DT8A 2DY0A 3D54D 3U39A 1CZKA 4RENA 3T1VA 1SXJD 3QVMA 1OH8A 1FRFS 1FK8A 1K3TA 1MO4A 1N5KA 3I0NA 3AJAA 5NULA 4CL2A 2GO1A 4WKGA 2OBNA 5JAMA 2ZUVA 1HE5A 4HJRA 4WINA 4K9PA 4RQTA 1L4FA 1TCAA 3HKBA 1RAFA 4J7CA 4ZV9A 3T3MB 1PYDA 1YKGA 2O57A 2OV4A 4ASUD 1ZRHA 2G1KA 3BFXA 3ONFA 1JGTA 1BQEA 1O2DA 5ITVA 4UD2A 2WU3A 4NDNE 4XD7A 2E89A 3TMKA 2HHHB 5AVSA 2EHJA 4CEJB 3AVYA 2YYSA 5C8YB 3NJRA 1BXKA 4XOIA 4L07A 4RLSA 1BFDA 1FNBA 2W70A 2R6JA 5KQSA 4F4JA 3MRSA 3OZRA 3I2IA 3PB3A 4Q9DA 4UULA 1PEKE 3ZDRA 1X1RA 1XRQA 1G9TA 5LBTA 1Z2CA 2VN8A 2NZWA 2RC5A 3NHRA 4NEGA 2WU1A 3PWKA 4DR2B 3K4HA 4BLOA 2NYRA 3KSBC 1UBMS 3RODA 3STVA 1UDCA 4LDQA 4B3BA 2WJWA 3EEIA 3O8BA 3WL4A 1DG9A 4U6NA 3DV2A 2KLBA 4G86A 2M32A 4IDHA 4RQAA 2C1EA 5AW9A 5CXSA 3G2JA 3MMSA 4GBGA 4BPRA 3PQ2A 3GBSA 2JASA 3U7RA 4Q1CA 3FR8A 3NT5A 1EXDA 1MOPA 2WUFA 4Q7EA 2WWWA 2AXNA 1VXRA 3Q10A 2LIVA 5JPCA 3WYDA 3A6EA 3E9YA 4RVCA 1I14A 5MGBA 1UBTS 4YONB 5H68A 3L4KA 4HB3A 1O8BA 3RLIA 1ADGA 4B6JA 3CPJB 3WRYC