1U8TA

Crystal structure of chey d13k y106w alone and in complex with a flim peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
125
structure length
125
Chain Sequence
ADKELKFLVVDKFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
publication title Structure of the Constitutively Active Double Mutant CheY(D13K Y106W) Alone and in Complex with a FliM Peptide
pubmed doi rcsb
source organism Escherichia coli
total genus 40
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1u8tA00
2FN8A 2IPNA 1Z15A 5FBKA 3MIZA 3Q7RA 5TQJA 3JS5A 1QP4A 4MLDA 2QR3A 1D2AA 3HXMA 1KMIY 3HUTA 1JYEA 2LPMA 1M5TA 2QU7A 3KLOA 3BILA 4RK0A 1Z25A 1OXKB 2JVJA 2TMYA 4O1HA 1KRXA 1FFGA 4MR7B 3H5WA 1PUXA 3KJXA 4Z4EA 3K4HA 6CHYA 2FW0A 2FTKE 2IDMA 3GL9A 1QPZA 4NCAA 1JYFA 3BBLA 1VKRA 1URPA 1DJMA 3ROTA 4MR8B 4MS3B 4Z9BA 4PZ0A 4LX8A 3LUFA 5B3JC 3A0UA 1DRJA 2P9HA 1XHEA 3F6PA 1P2FA 2ID9A 4M88A 1MB3A 4Y9TA 3UK0A 5KWSA 1W9HA 3HDVA 1L5YA 4FE4A 2WWVD 4RSMA 4LE2A 4KVFA 1JF8A 3IDOA 3RVSA 3HV2A 1RPJA 5IC5A 5FWYA 4RV5A 1JFTA 1HEYA 3EJWA 4LRQA 1D1QA 3A0RB 3CTPA 5C5EA 5BQ3A 5IUJC 3HZHA 3RVOA 5JNWA 5KC9A 2WJAA 4IMJB 5CNIA 2FEKA 3O2SB 5DTEA 1FFWA 2RJNA 4HNRA 4Z0NA 3URMA 4KK4A 2ZAYA 3LUGA 2M98A 2FQWA 3EGCA 3JPWA 3O1JC 1U04A 1E6LA 4MRMB 5TPZA 2IKSA 3JVDA 1Z12A 3G85A 3Q7TA 3IPAA 3KYIB 3RVKA 2A9RA 5DCLA 1AB5A 1TLFA 2PL1A 2FQXA 4N47A 1ZN2A 2WJWA 1RNLA 3CKMA 3RVJA 4ZYLA 3OM0A 1SRRA 3T8YA 2R4QA 3Q41A 2KYRA 3Q7SA 4YO7A 5JNRA 1BAPA 1A04A 4TLMB 1USGA 2PUCA 2GWRA 3QEMA 3GYBA 4RXUA 3CLKA 1EAYA 1DC8A 4G0XA 4F06A 4W5RA 4OTZA 3LTEA 3LUCA 1YTUA 4W5OA 4F12A 2FEWB 3F7NA 4OBBA 2R25B 2W42A 1IIBA 1FSPA 1JDPA 2HQRA 1TVMA 3H6GA 2JVIA 1ZGGA 4TLLB 4QICA 3KYJB 4G0YA 1USIA 4MAAA 2F8SA 1D4ZA 1Z18A 1VPWA 3KS9A 5KC8A 1DCKA 4L4UA 4PEVA 4QPJC 1C0EA 2VYCA 1M5UA 3SM9A 3DBIA 3CZ5A 4XARA 1QNLA 3O2QB 1JBEA 4EGSA 5KQPA 2HJ9A 1RXEA 1YS7A 1MAVA 3VNAA 4Z4FA 4LZLA 2RDMA 1C4WA 3NHMA 5EWJA 5JNUA 1BVHA 2LBPA 1W25A 3JY6A 2JBAA 1QMPA 3O74A 3KCNA 2PMCA 3IP5A 3LKVA 3T38A 5JNVA 4WT7A 4MQEB 1H9CA 1SXHA 3FFWA 4S04A 1Z2EA 1JDNA 1MB0A 2CHFA 1P8AA 2JK1A 5IUNC 4YS6A 5JNSA 2PUFA 4W5TA 2PLNA 4Q6BA 1GUBA 3N53A 4TMYA 3H75A 4HNQA 3QLUA 3OQNA 1K66A 2A9PA 5EWMA 1Z2DA 3NNSA 3O21A 1TJYA 1ISRA 5IBQA 3TMYA 4RXMA 5TQ2B 2GKGA 2HPHA 1ABFA 4MS4B 2QW1A 4MQFA 2FQYA 1CHNA 1YK1A 2IPAB 4N03A 2PKXA 4DN6A 1NXTA 1BA2A 1MIHA 3OO1A 2Q5CA 4LDZA 4ZPJA 1YVUA 3EULA 4G0ZA 5FWXB 2O20A 2E4ZA 4KPYA 4FB4A 1YIOA 1ZGZA 3B2NA 5HKOA 5CNMA 4L85A 4QYWA 1D1PA 3G1WA 4YWHA 1B00A 2R48A 1CEYA 4UHKA 2ZWMA 1EHCA 4G0OA 3H1FA 4G0PA 2E4UA 3H1GA 1XWWA 4RK4A 5PNTA 2FLWA 3RVRA 5IEJA 2ID7A 3TX6A 3OLXA 5BRJA 1Z17A 4EVRA 1QP0A 3DZDA 3CZCA 3QLTA 1ZESA 3HVRA 5TQ0B 4IILA 2MYTA 1YK0A 4NV3A 4E7OA 2B4AA 2DRIA 4DADA 4RKRA 1SXGA 1NXOA 3L49A 3LMKA 3OMXA 1ZH4A 4HYEA 5F64A 2XDYA 3M6MD 4KREA 4N76A 4KQCA 4KRFA 2JRLA 4YR7A 1E6MA 2FXIA 2OQRA 4WUTA 4RS3A 1YS6A 3ILYA 2FEPA 4G0QA 2NZVG 3TO5A 2FMHA 2MSWA 5TE9A 4IMIB 1M2FA 2AYXA 4MPTA 4ML3A 1RZRA 3C6QA 3HM9A 4F3TA 3T6KA 3KLNA 3RVMA 1ISSA 3KSMA 3LKBA 4D74A 1U8TA 4G0MA 1DCMA 1QO0D 4Z4HA 1U2QA 2FMFA 5ABPA 4LE0A 2GBPA 1LK0A 2LP4Y 2YHAA 5HSGA 1R8JA 4YGXB 4KFCA 1JFVA 3A3KA 4O1IA 1NXXA 3FGZA 3LUKA 1NTRA 3KKEA 3M9WA 3O1IC 3R0JA 4MS1A 4RU1A 3LUDA 1WETA 1NXWA 3QLVC 1VRVA 2NZUG 3O75A 7ABPA 1GCAA 1DRKA 2FMIA 3E61A 1NXSA 1ZHHA 2LUOA 3BRQA 4WXMA 1JLKA 4JA2A 4WXEA 4YV7A 5BR1A 3F73A 3SG0A 3TD9A 3SQNA 3LOPA 3UKJA 4XLTA 2CHEA 3Q9SA 5KQMA 2WMYA 4XASA 1MVOA 3LFTA 1JX6A 3QX8A 3JPYA 4EYOA 4MYRA 1Z16A 3D8UA 1DBQA 3GBPA 3IP7A 3KHTA 1BDJA 3RVPA 4CBVA 3S99A 4OLBA 3W9SA 2MYUA 5CNKA 4YCSA 2FLKA 3QEMB 2NT3A 4N0QA 5CHYA 4RXTA 3GV0A 1DBPA 3JTEA 3OLYA 3GA5A 5DGCA 3EAFA 2IOYA 2MYNA 2OENG 4GNRA 5C5CA 3OQMA 2GX6A 1D5WA 3UUGA 5KI6A 3DLHA 3H5TA 4YRZA 1LBIA 2BGGA 1DZ3A 5JS1A 3H5VA 1GUDA 6ABPA 5EWLB 4YLEA 5T3YA 3RQIA 3DGFC 1L5ZA 2E4WA 3A10A 2PL9A 1ZDMA 1BDHA 2MSLA 3DLBA 2L17A 1LJUA 1USKA 3CG4A 3CS3A 2H3HA 3C3KA 5BRAA 3VNBA 4QYMA 2MYPA 5ED4A 1S8NA 3MQ4A 8ABPA 3RH0A 1EWKA 2PJUA 3E3MA 4JP1A 2J48A 4F8JA 1P6UA 4ETMA 5JS2A 1PHRA 3OO0A 2IPMA 1SD5A 1YMUA 3HO1A 5B3JA 5TPZD 4Z4GA 1TM2A 2QXYA 4G86A 3JVIA 5D2CA 4W5QA 2HSGA 4ZMSA 4Z4IA 3QEKA 2JBAB 2NT4A 2N9UA 1AB6A 3H5LA 1KGSA 3LUHA 3EDCA 3QK7A 3HK2A 1PEYA 2VUIB 3C97A 3SAJA 4RWEA 3GWGA 4XXHA 4MQEA 1QP7A 2GI4A 2JB9A 5IUKC 3CG0A 9ABPA 1KRWA 3HDGA 2FMKA 3QELA 2M1ZA 4Z9AA 3NNDA 2CD7A 5EWMB 3KG2A 3OM1A 3SY8A 1A2OA 3L6UA 3OLWA 3QX9A 4MR9B 4ZJPA 5IX8A 2PUBA 1YMVA 1ZH2A 4EYGA 2IYNA 5TPWB 3BREA 1U0SY 4P98A 4MQFB 1FFSA 3N6VA 3QLVA 4MS4A 3CHYA 3F6CA 2E4YA 1NY5A 1K68A 1E2BA 3TB6A 4Q7EA 2WY2D 4KNYA 2RJOA 3RVNA 5HQJA 5HM6A 2E4XA 4MGEA 1DG9A 5IULC 4RK1A 4ETNA 4NCBA 4ZMRA 4IF4A 4MLCA 4KMRA 4NQRA 4RK5A 1Y1LA 3I42A 4Z99A 3T95A 1BDIA 2V0NA 1P6QA 2HQOA 4MR7A 4RY0A 3HJFA 1JL3A 2QV0A 5DKFA 5GQSA 5I4CA 3CRNA 4PYRA 1UDRA 1Z26A 3I5AA 4HNSA 4KZKA 4XAQA 4PE5B 3MYYA 5KQGA 5TQ0A 4F11A 2PUAA 4MR8A 4MS3A 3N0XA 1T34A 5KQLA 4JAVC 1PEAA 3IP9A 1GCGA 1DP4A 3BRSA 4EY3A 1J56A 5FWYB 3DGEC 2PUGA 1ZAYA 3C3WA 4EUKA 2R47A 2QSJA 2QZJA 2AYZA 5GOTA 3ILHA 5E3JA 2VUHB 4E7PA 1GLGA 2FN9A 4RZSA 4OATA 3FMVA 4FE7A 3NHZA 1A0OA 1LBHA 3QLUC 4TN5A 2CWDA 1QQAA 5DLEA 4OLAA 3FFXA 3CFYA 4LE1A 1VLZA 4W5NA 2B1JA 1QQBA 3HS3A 3HEBA 4MS1B 1PNTA 1DC7A 4MRMA 4JASB 5FBHA 2FVYA 4N0PA 3D02A 1F51E 4LDAA 3K9CA 4RY9A 1APBA 4H3HB 3H5IA 2VK2A 3NNNA 1JHZA 4JOQA 3N0RA 2FSPA 2E4VA 2IPLA 3GRCA 3MM4A 4IGAA 2JCGA 4ETIA 4Q6WA 1OXBB 3H5OA 3LUJA 1ABEA 2H0AA 2A9QA 3RVLA 1F4VA 3EQZA 4D6YA 1LJLA 3OLVA 2PUEA 4RKQA 1RXIA 3P9YA 2PAFA 4Z4CA 3N8IA 3HUUA 1RZRD 3I45A 1CYEA 1XHFA 4PICA 3FFTA 4JB0A 4NICA 3RVQA 5T7BA 1JH9A 1SXIA 4KQ9A 2L19A 3EODA 2YHBA 3IPCA 4WWHA 2LIVA 3EQ2A 2X7XA 3SNKA 1NXPA 2WB4A 3FDFA 4XFKA 5EWLA 4RY8A 1I3CA 1FQWA 2L18A 3CU5A 2PE5A 2I6FA 2HQBA 4H3KB 4D6XA 1JFSA 5EWJB 4B09A 1EFAA 3H6HA 4DQDA 1EWVA 1DBWA 4KK3A 4UHJA 3OLZA 3Q15C 1QKKA 4WZZA 3LUAA 4GPAA 4RK7A 1TMYA 3O1HB 2MSKA 4YP9A 2F8TA 3KTOA 3MA0A 1ZVVA 2FKAA 1NATA 4IRXA 2A9OA 3HSYA 1Z13A 1JWLA 4EVQA 4S05A 3GBVA 3O2JA 3OQOA 3IP6A 2JVKA 4JB2A 3HCWA 4EVSA 3N0WA 3C3MA 4OG2A 3CNBA 1DCFA 1U2PA 2QVGA 2RGYA 3MF4A 1NXVA 4G97A 5TQ2A 1PNRA 2P4UA 3QELB 1M2EA 3I09A 3N75A 1EWTA 2NUBA 3ROFA 3OMWA 5JNTA 3M9XA 1ZITA 4EYKA 1E6KA 2PUDA 3H1EA 4RK6A 4MR9A 4RDCA 2QVCA 5CNJA 3MMNA 4P1ZA 5IEBA 5FWXA 5TPWA 4KV7A 4N41A 4EYQA 3GT7A 1ZY2A 1QO0A 3NBMA 4O5AA 2L2QA 4H60A 2WRZA
chains in the Genus database with same CATH superfamily
4YYEA 4NESA 3MIZA 4MRAA 5TS3A 4C4ZA 4DWJA 3PLAE 3KFXA 1HTWA 4MGIR 4P53A 1XL1A 2XNSA 1KF0A 2FZLA 2IHBA 4A6DA 3IIMA 5FL3A 3VAAA 1NKVA 2IUFA 2QORA 3CKKA 3NHSA 4Q66C 4RF4A 3UCXA 5AVKA 4RK0A 2XGJA 2IF2A 1KEWA 4J1NA 4DW8A 1YNOA 1W4AA 2O1SA 1Z5WA 2W5UA 3EEBA 1CHDA 1ESCA 1SC3A 2KM1A 2PVSA 3JQ6A 2TSYB 2NU7A 2HQSA 1IXSB 3A6GA 2FP3A 3L01A 3MPOA 3SPXA 3VSBA 2IEYA 2IOHA 1AX9A 3ZWOA 2D0DA 5JYBA 1JAHA 1F8YA 1IN7A 2BSXA 2CZQA 2LIPA 1JYFA 3COPA 3DZFA 4RMJA 3UAXA 4YPVA 4AO8A 5EAIA 1P29A 3ROTA 2Q5LA 5F7XA 4UZEA 4WSOA 1DJMA 4DKXA 3D8HA 4JC5A 5K09A 3EXEA 3MTDA 1RRVA 1NF9A 1FX0A 1UOQA 1W0JA 2CDCA 2CE7A 2FMUA 2BBOA 4K28A 5E7MA 3CO5A 4YFYA 2Q9CA 2V45A 1R8SA 4JLUA 5A05A 2OYCA 3CCFA 5AVYA 3D8NA 4TS1A 1I94B 5DI3A 4LTNA 3ADDA 1A76A 1MOSA 2A4MA 3PD1A 1G9TA 2XMQA 3OZWA 3VR1A 3I3OA 4M9RA 4Q37A 1YFLA 2OV3A 2X14A 2ZM6B 1IEVA 4N1AA 4M21A 4B43A 4BS9A 3ETNA 2Y1EA 3R3ZA 3SSNA 4IDQA 4CIWA 1YQEA 3IUMA 5LVAA 3EXFA 4FZ5A 1A7JA 3PRKE 2DT5A 3DKKA 4J3FA 4UEOA 1FFHA 2ZBPA 3AFOA 4K6HA 1DXQA 3UCFA 4GL4A 4QM6A 4KK4A 5KTKA 2OHHA 1U3CA 3IBTA 3PC4A 4M8NE 5F2OA 3GLFA 3RVKA 2ADOA 3OG9A 2A9RA 4ZVVA 4E1AA 4F6LA 1JIXA 1XRLA 2JA1A 2RH9B 1UFOA 4Q82A 4QJ4A 3TGLA 3HA3A 5C8YF 4YLYA 5IM4A 5LMUB 3U61B 1K7CA 4RFVA 3RKRA 1X14A 4LNAA 4H7KA 4J43A 3AKYA 5HIKA 5BWNA 3U19A 5AUOB 3O9MA 2BI7A 2G76A 3ZG6A 5L6MB 4W5RA 2YXPX 2V0GA 1X1QA 2WG2A 4PCAA 2RBKA 1OXMA 1GPDG 3MCAA 4B79A 1GCIA 4CEHB 2PMWB 5IN5A 1C3XA 2IY8A 5DGDA 4EB6A 4TL8A 4ARAA 2GAFA 1DKOA 1JT2A 1OFHA 4ZCSA 4ZI2A 3PTAA 2MHCA 2VF8A 3FA2A 1KYQA 2NXJA 1G21B 4QICA 2F8SA 4D92A 1EK5A 4U5XA 3EWSA 5K0JA 1NRWA 2NMVA 5T64A 3ONWA 1WM1A 1DWUA 3A1NA 3WVNA 4O29A 4J7AA 4Z7QB 4Q3CA 1JMVA 1G8HA 3QKIA 4P3OA 1F20A 1F9AA 3VDMA 5KOJA 1FFBA 3QW2A 1W2WB 4G37A 3WWYA 5AIBA 3HL4A 3D1JA 1TF7A 2PT6A 4C78A 1NYTA 5B7QA 4EZIA 2G07A 2JC3A 4FDVA 2WJIA 3NM4A 4O2LA 1XAIA 1WF3A 1ENZA 4URYR 2GWHA 1YB4A 1HQDA 1KJNA 1D4OA 3E5HA 5IAKA 1B26A 1VIAA 2W6IA 1EP9A 1CTQA 5K3SA 2ECQA 2BGLA 2QAGA 3FOAA 5SY9A 2AW5A 2QPTA 4D4JA 3O31A 1OLXA 5EWJA 3T0FA 4JLPA 3PE3A 3K5WA 1W25A 1WQ3A 3MXOA 2C5HA 4IUCS 1H1LB 2ZYTX 4JJGA 1CU1A 1HK7A 5BY2A 4CM9D 3SZOA 1FBNA 4PGFA 3AZPA 1C1DA 4R1UA 3CURA 5JCJD 2CHFA 3QOYA 3E84A 2I1LA 3BSYA 4QQRA 1OAAA 1GL6A 4TZ0A 2IZ7A 1P2VA 5CIWA 2QR2A 3H13A 1EFTA 1K66A 5HEKA 4PC7A 1QK4A 2WTEA 3RT1A 4JBYA 1CY2A 4QOGA 1NBHA 1P81A 5KINB 1GD1O 4Q1CA 1N36B 4RD2A 5IASA 1RM0A 5KWEA 4KAFA 4TL9A 1CXZA 3KAJA 5DWDA 1A9OA 2HC9A 4HLCA 2Z8XA 2G08A 1Y3BE 1UJ5A 3VU9B 2LD4A 2QKYA 3U4IA 4GRAA 4LDZA 4LYJA 2QMOA 2WHQA 1YVUA 2JF0A 2PA3A 2Q5FA 4Z9FA 1TIBA 3C6MA 2HMSA 1WF6A 3ZDCA 4E1VA 4WPGA 3LBYA 3MN1A 1PR4A 4EL5A 1ZGZA 2W2QA 1O6BA 2BOVA 5D3MB 4E2YA 3IR5A 2VL7A 3VNRA 5K3FB 4ZWNA 3PNLA 3R7NA 3UKOA 3QVWA 3KSZO 1NN0A 4MRNA 5JBNA 4TYYA 3JATA 1W5AA 1U7OA 4HN2A 3WL8A 2MOKA 3RI3A 1YAHA 4G0PA 1JAYA 2X42A 2W2KB 1VPLA 5C1IA 5JUWA 2O2ZA 2XUIA 4WK0B 5HJEA 4D80A 1R0ZA 2GVZC 2MSEB 3I9V1 1I4EB 3AU9A 3BMOB 3OTWA 3WKCA 1D9XA 4EPYA 5I7FA 2Y0CA 1E61A 2YXDA 3G2NA 3L5OA 3MGGA 3QYPA 4JEHA 2B4AA 2CJXA 3K2BA 1N2GA 3EBPA 1M2OB 4MICA 3RSCA 1GZVA 3DE3X 1HYEA 1X6VA 1DXYA 4IHJA 3V34A 5COAA 4BU0A 2H4YA 2HQ1A 4GYKA 3I4FA 4AJJA 3GRAA 5I3CA 2AFHE 4QTZA 2FXIA 3KP1A 1F0KA 4V2IA 1JNXX 4S1PA 4BO8A 5J2TA 3ZQUA 4DMRA 3GMIA 3I39X 4K46A 5FUQA 2E87A 4O2AB 3QNWA 4B6JA 3AC0A 5HQTA 4MPTA 3WRVA 1YJBA 3SF8A 2JKVA 1M74A 1VPDA 3LVFO 1JFFB 1O96B 1J4AA 1JHUA 1DKRA 4HBGA 4UBLA 1ISSA 3N76A 3PT5A 1PZNA 4MMXB 3WDKA 2G04A 1XPOA 3L0SA 4OUDA 4BKRA 1U5BA 2WM8A 1E1CB 1VBNA 1X7ZA 2DGDA 2NPFA 1KFBB 2QMYA 1TQ4A 1JQJC 3ZU5A 3LHSA 2BGJA 3MRXA 1NPTO 2P79A 3M9WA 2DQ4A 3DP7A 4ND2A 1F17A 2DKNA 1HRDA 1XCMA 2ZRIA 2FPIB 3MJTA 3IXQA 3R3VA 1T8WA 5ALLA 4ZA2A 1UAGA 5ICFA 1O89A 1YRHA 3O75A 5IH3A 3U6KA 5DK6A 3DFFA 1T1EA 1Q11A 1K1EA 5AOVA 2WD8A 1M2VA 4Y98A 2PX8A 3G13A 3WQHA 4M0PA 2QG6A 3GJ8A 4XASA 1JPNA 1J0BA 1FP2A 3KLMX 3KJHA 3M2PA 4KN6A 3H19A 5AVRA 2HWXA 1ZJ5A 1SXJB 1BDJA 2UVQA 3KE9A 3N7AA 3QIVA 4MI6A 4LUCA 1XKTA 2YMLA 3NUGA 5LZ5A 1CJUC 1E20A 1N4AA 4L0CA 2EDAA 2HMYB 5DGCA 3H97A 2F1HA 2C82A 2EBUA 2ZIUB 2WFLB 4M37A 5FQNA 1IBSA 4KVGA 5G3ZA 5JMOA 3LX4A 3UMJA 4A8PA 5G3YA 4YLEA 5EHNA 5F35A 1QSGA 1Z4IA 4KXXA 1CJBA 3C5WP 5FBZA 1C4OA 1GPUA 3H11B 3UXHA 5LJIA 4QPDA 4PSDA 1W46A 3U40A 4GP7A 3L8CA 1EX6A 2H3HA 4LQ4A 1QLHA 4TKVB 1PZXA 4XD2A 1J5XA 5EP1A 3TVTA 3V33A 4FZVA 3RAEC 1WKBA 1P6UA 4NG5A 3MJDA 1NJ2A 4FIZA 5J43A 4XWGA 5BW5A 3AJEA 5BN3A 3DOUA 3E22B 4PCUA 1BDMA 2OC4A 3TOSA 2BFDA 2QRZA 2EZUA 3K3PA 5AXDA 4Q4JB 4UXIA 4BLOA 4II2A 5LKAA 2Q9AA 1Q20A 4MZDA 3W4IA 1GL7A 3RG2A 2VUIB 5AJZA 1P7PA 4RWEA 3SAJA 1QRSA 1Z6YA 1EQ2A 2AXPA 1QYDA 4TL6A 2BBTA 5IUKC 3M5DA 3OFJA 3MAGA 1WV0A 4J75A 4KPFC 1E4OA 1PG2A 3LT2A 4YIHA 3HDTA 1YOVA 4R8KA 2ZUBA 4QNMA 2EXXA 4A8JB 1WUKS 1XXHE 2VP5A 4P38A 2VWQA 3T41A 3QELA 1H8ED 2I8AA 3HRHA 1PV2A 3IA2A 3UTDA 3IDFA 3P32A 4BGUA 1LD3A 1GA6A 1HKUA 4ZOLF 2VF7A 1JSRA 3TF5A 1MCZA 2RCYA 3IEIA 3MOSA 4P98A 1DQYA 3NI2A 4F5ZA 4CM4B 4LI0A 3R6GA 3DUFB 2G25A 5L3SB 1A9TA 1ULTA 4MEBA 3JQ8B 3QBEA 4FCWA 3ZEIA 5K1ZA 1P73A 2JI4A 1NY5A 2OGZA 1AF4A 4AU1A 5JAMA 1HLDA 3AIKA 3O38A 1A9SA 1BCRA 1JRLA 4TXNA 4ZOQI 3EPHA 4H4DA 3UWSA 3OIVA 1ZNXA 1LQUA 3IPLA 4NZMA 4AJIA 2G40A 3LLUA 2E4AA 2R97A 2QG4A 3UB2A 3FZYA 3UOWA 2CSXA 2WD7B 3A1DA 2A94A 1XDUA 3EVAA 5CDGA 1XPJA 1S89A 3QGMA 2AXEA 2HDOA 1N8NA 1QF7A 2V0NA 3OX3A 1NJSA 1XALA 4QGBA 4QULA 3ROXA 4JSTA 4RF2A 1HNZB 1KIMA 3DKVA 3HA7A 5I7OA 1XCBA 1JKXA 1UDRA 2L42A 4GQAA 1UXKA 4UE2A 2XMDA 2TMKA 1JEDA 3N70A 5EQJB 4ZVPA 3TAHA 3D8TA 3VVBA 5BSEA 1QTRA 4GX0A 4JOSA 2RH8A 2HD4A 4UOQA 1EIZA 5CLHA 4KR2A 4PSAA 1XZQA 2C8LA 3RAJA 1ECJA 4UD6A 5TGDA 3USZA 1ZU4A 4RL6A 5JEDA 4XR9A 4WDRA 4P32A 5LKRA 1DP4A 1CUWA 4M1SA 3UBMA 1AO0A 5E1BA 2PR7A 4L76A 5KIAA 1YO6A 2JJ1A 4MQ6A 4XJSA 3FBWA 1KY2A 1OFIA 4LECA 1VLVA 1VTKA 3WBKA 2FDCA 4Q34A 3U3ZA 4ZYUA 3B1KA 3UH0A 1GPAA 1RCUA 1OT5A 3ILHA 2BFEB 3TGWA 3JAMA 5KTSA 3ZVMA 2I2DA 5KMGA 3ZD7A 3SFTA 4FE7A 4WW0A 3A1CA 3R4VA 1TEZA 3BXPA 4DV1B 2SBTA 2CXXA 1ETUA 3CISA 4PTLA 5A9SA 3G9XA 1WUTA 1YQQA 1QQBA 3QX3A 4MW1A 4E4TA 4YMUA 3P9SA 5K5EA 4UU8A 3F6SA 4JXKA 4QL3A 3HR8A 3QMPA 4I2VA 1AKEA 1WP4A 2ZJ1A 2R5NA 4BTVA 4LVCA 4C6HA 2HX1A 3LG2A 3BCSA 3M4JA 4Q3DA 3TI7A 3VU1A 3HDJA 3NNNA 2BEUA 1NJ1A 5FADA 3KQQA 3H9UA 3KZMA 3JARA 4RHXA 1XOIA 3GRCA 3MM4A 1BEUB 4QFCA 3MJ4A 2Q2NA 3DCIA 4OAQA 4FOSA 1BYUA 2D5LA 4F56A 2HT6A 3ZCQA 4GKJB 2FSHA 5C8ZA 3MTBA 4WNAB 1XUOA 4LS3A 7AT1A 4FYYA 3GLRA 4RTNA 2FRDA 4NMHA 3G0CA 3N58A 5CVVA 3K1AA 3M7IA 2D0IA 3QUBA 4TVOA 3UOGA 2GCOA 4KYUA 4RKQA 3FFAA 4UMEA 5LB2A 1RXIA 1SULA 4QJ3A 4TLAA 2R11A 5JSZB 1YB5A 2VVTA 1V8BA 3I64A 5E0KB 1LBQA 5B1SA 2JFGA 1ARZA 2X0RA 3I34X 4X3PA 1X0XA 3PD7A 5E7QA 3O8NA 1GSIA 2Y66A 3L92A 4LYGA 1N34B 1UBMS 2PHZA 3VPCA 2XRFA 4TTPA 1JU4A 4M22A 4TV8B 3B48A 5A4JA 5K8UA 2LIVA 5MGBA 2X7XA 3RRZA 1JEAA 1EDDA 5JI3E 1MHTA 1RRPA 3PGJA 4BP8A 4V39A 4DA7A 2RMKA 4WRRA 1DEAA 2BFFA 2B4YA 1KOJA 1V1RA 2JW5A 1XCOA 4MVJF 4NWIA 2Q7DA 4AROA 2YASA 1PVOA 2I87A 3C3YA 4MWDA 3IFSA 5K0NA 1W4BA 2EIHA 2H11A 1HOTA 3F96A 1GU0A 3ZI7A 2V9ZA 2D1RA 4HDRB 2AKEA 3RUFA 5IU6A 5HPYB 2PFKA 1BZYA 1U3UA 2Q6VA 3CSDA 1Z37A 2BSAA 3DBHA 3NTRA 5TEWA 5ER6A 2HWKA 1XMIA 3M0EA 3ZK8A 2IK8A 4D9KA 4X71A 5FCDA 4YASA 1BXGB 4BX3A 1C50A 1CB0A 4IJUA 1XNRB 5JLJA 3KVNA 1W8IA 1K2VN 4DDTA 2ACVA 1TU4A 3KUXA 3NP9A 1U2EA 4I3HA 1MEEA 3DMHA 3I09A 5BVGB 3K70C 1EWTA 3NXKA 2X2FA 4TRRA 3ULKA 4M7OA 4IDAA 2RHMA 1Y8QB 1E0AA 4L7QA 1UK7A 2B9VA 5I9SA 2VS1A 2GHRA 5JOQA 1H0KA 2OR3A 2PPVA 5CDFA 3QYFA 5ARCA 3WSTA 1AVTA 2DQSA 2R66A 5COQA 5KAMA 1JJ7A 4ABYA 3I0NA 3GN1A 1Y3HA 3FTCA 3NBXX 3O3NB 4TSRA 4ATNA 4DJJA 1SU6A 3CONA 3EZYA 1WMDA 4OSOA 3IDSA 3TRDA 4KXMA 4BJ3A 3VI3B 2CV2A 2CLSA 3ICQB 3WTBA 2E55A 4A0SA 2N3ZA 2R62A 2FQQA 5JY6A 4S12A 3QMVA 4L8WB 4LZZA 2ZRHA 4DEVA 4EJSC 2Z6QA 4MWZA 4CYMA 5ETJA 1Q21A 1PUJA 4DMHA 3VU3A 1HM5A 4P33A 3E5NA 4HH0A 2FWIA 4YJGB 2D1TA 4MVCA 4OYYA 4V3CA 2A5GA 2V7BA 4YJ3A 1L6IA 1FFGA 2HREA 3PHCA 4GGPA 4KAAA 1BFKA 4JL5A 1GTJ1 4R3WA 4YCNA 4IV0A 5KJ1A 1WPRA 2AVDA 1E3SA 2OQIA 2XOKD 2ZSFA 4G85A 3M4XA 3DV2A 3BBLA 3JYPA 2BGMA 4AD8A 1X1RA 5IFKA 1H66A 1U4SA 1TZJA 3BD8A 5LOVF 5LQJA 4WK4B 1ZRHA 3GEHA 2PV7A 3V6LA 5BUSA 1I0LA 3T5AA 3AEUB 4GR4A 5A0VA 1MR3F 1MX3A 2H2AA 4GRDA 2JIZD 1GOTA 3QKUA 1J0CA 1U2GA 3UVEA 3MMSA 2F8TA 1LPAB 1E18A 4II3A 2PBFA 3RRMA 3VR5H 4OL9A 3OBBA 3AKDA 4K1LA 4Q7JB 2UVPB 5IHPA 3KYBA 1MB2A 2XQKA 1JF8A 3MJHA 3OQ6A 4P4GA 5LZ2A 5E2IA 2BFPA 1R74A 1Z56C 1ODSA 2E9SA 3T3EA 2HUPA 2F8LA 4A2QA 5A4IS 4YUYA 5K0GA 2ZRDA 3HYCA 4F2DA 5BQ3A 1SOVA 1GRVA 3NTXA 4Q9NA 3K0CA 2CFOA 5KX5A 1OHHA 3V3TA 1LV8A 3ZXUB 5EZ6B 1S8OA 3AHFA 2HK7A 4OI2A 2RGCA 1V6AA 1B3RA 2RBEA 2ORIA 2C7GA 3EC1A 4G36A 4J76A 4MQUA 2NW6A 2ZB2A 4GE0A 4B4DA 4PNHA 1Z12A 4IOMA 1QO7A 1PR3A 3IILA 3JZAA 4WI1A 5F3RA 5JD3A 3C14C 3OX4A 1Z5NA 4URXR 3A7EA 2GPWA 1ZD2P 3CKMA 3HXKA 3DFMA 3U3MA 1Z62A 3OM0A 3SIRA 2ZJ6A 1IBKB 3AHEA 2V03A 1R0KA 1ZD4A 1HL7A 1V8DA 2ANCA 4NONA 2VNAA 3KB2A 1USGA 1HDCA 3OVMA 1I36A 3PJGA 4HZUA 4HDKA 1MW8X 1AKTA 1RQ7A 1P80A 3CLKA 4WKBA 5ECDA 5DXFA 3AEKA 4E51A 3O8OB 2UXCB 2QRVB 3TB4A 4EJSB 1NR1A 1EFRA 4JJ6A 4Y7CA 1CZKA 2VZEA 2XUHA 5EQDA 2SNIE 3ZBUA 1NJFA 5LP6A 3WLKX 1PJ8A 2D4HA 3UT5A 1PZGA 3I6MA 3P2KA 2GR9A 4MLZA 5IVDA 1OZFA 4G4SO 2VPIA 2ZIWB 3BDVA 3H6GA 3P2OA 4A9AA 5IZCA 4TLLB 1HFWA 5L4NA 2UZ0A 3T3MB 1IUOA 4BC0A 5E1OA 2YVAA 1ISMA 2CF5A 3NKVA 4QOEA 1QYIA 5KTYA 5KSYA 1DARA 1V39A 2WF6A 4LHWA 3V46A 2WF9A 4AKHA 1X8XA 3LK7A 5F51A 3VYSB 1PWEA 3LIPA 5FNVA 2GNAA 2HGZA 2QGFA 5F1YA 3C0KA 2B8NA 2NM0A 2PKQO 4OQXA 5JVDA 4FNMA 1IVSA 1JBEA 3P9ZA 1L5MA 1GFSA 3THYB 4J7UA 2AEJA 3EBLA 5ALFA 3VRHA 4WZBB 1KEUA 4CIVA 1HL3A 4LZLA 4RIEA 1L8LA 1IQPA 1W5TA 3LUBA 3QTTA 4JI4B 2BEWB 5JJIA 1FPMA 2Q2VA 2OC9A 2JBHA 3QX7A 4PRYA 5T4BA 4M0KA 3ZDZB 5CA1B 3G0HA 1U80A 2CNOA 4JCOA 3E82A 4U6NA 2PMCA 1W1UA 1E5LA 2IU3A 3OEEA 4BMYA 4G1EB 3A4TA 2YWFA 1G8MA 3L0ZA 1L4NA 1YZGA 4RFSA 4NBSA 3CEPB 1N5MA 2JJ8A 5JNSA 3N2LA 1IUKA 1IQRA 2C4MA 5BQOA 2G7MC 3ICOA 1UZUA 2HWWA 1GNRA 1OH6A 1KZ1A 4LF6B 3RWMB 2ETVA 2QTGA 3MT9A 4K40A 2HHLA 1A9XA 3VR6D 4HDMA 4XFJA 3VNUA 5CFPA 1LDMA 3HCDA 1SUFA 3SC3A 5IBCA 1C7JA 5DHAA 5H5JA 1Y98A 3DHWC 1CHNA 1O6CA 2AZ4A 2IPAB 4KN5A 4N03A 4GICA 2X0NA 3D64A 1JHQA 1MIHA 3U39A 1Z0ZA 2BRUA 1GRCA 2ZIZA 4ZPJA 2IWHA 3WKEA 5BURA 2O1WA 4MUFA 4QHYA 4TMKA 2A2ZA 5L53A 3T1QA 2YNMD 1YIOA 3LV8A 5CB4B 3GLTA 1K8XB 2VFAA 4IDOA 1Q19A 3T94A 3DXYA 4MVJM 3J7AC 1B00A 2I6SA 5YASA 3SR0A 1Q3KA 3A6FA 4UHKA 4ZOLB 1EFDN 1NVWQ 2A1TR 1PJBA 2QMEA 2ZWMA 4G0OA 3H1FA 3NHAA 3NVAA 4AM8A 2VEOA 5B1YA 5K3EA 3D2BA 2XKBA 5BRJA 1M6YA 1T6BY 3PZBA 4XGKA 4PNPA 1XLTA 4RADA 4ADSG 4IJWA 2ZVDA 1L3IA 2AG8A 2GPBA 1E79A 4H6XA 3U09A 1HBJA 1RE0A 2BMEA 2MYTA 3KXIA 1LI5A 4QBHA 5AR1A 1KK3A 1PRYA 2YV5A 1HFEL 1GQQA 3LW8A 4RKRA 3ECCA 2AZDA 3DJYA 4N5LA 3V8MA 1SVOA 2QVLA 1TJ5A 1QIEA 3IKLA 1E9EA 2PXAA 5JTUA 1XA3A 3NBKA 1GITA 1XQWA 1K3FA 3ZBTA 2JRLA 3MG9A 5J1TB 3VPBA 1OOEA 3FD8A 5BPHA 4JLSA 4AJOA 1XQ1A 5AFSA 1AS0A 1B43A 1Z0DA 3ETLA 3I9JA 3W5SA 4HDNA 4NOMA 4OH7A 4R2MA 4EI8A 4L4SA 1UR5A 2OCDA 4DV0B 1M2FA 3OP1A 1FUIA 3SNHA 3CXUA 3FF4A 5DV9A 3UKDA 3AIMA 4E2FA 3D3JA 3RVMA 1Y6RA 3NIWA 1FZQA 4C0SA 1NLMA 3KSMA 1JAZA 5KHOC 2FFBA 1R27A 1I13A 1YA4A 1L5NA 2X0EA 4HLUC 4RGQA 5WRFA 3EW7A 2JGEA 2EEZA 3VC1A 4AJPA 1LK0A 2JFQA 2ZITA 5ABPA 5KYUB 4FYPA 5IN4A 5JWHA 4B74A 2XB2A 2PGAA 4B85A 4OXIA 1EI9A 3ORFA 1ZX1A 3M81A 3V1LA 4LZNA 2X0KA 5SZKB 3I2IA 1XN4A 4CT5A 4ZVQA 3RF6A 4KSCA 5EXXA 5AJXA 4DLSA 3RC1A 5TT0A 1NXSA 3IUNA 2BMJA 2HA7A 2BFMA 1VI6A 1IOZA 1JB1A 4JUDX 2XYPA 3SVLA 4IGEA 1MBZA 4WL0A 4F91B 5KQMA 3KYDA 4CCYA 3FMGA 3LFTA 3I2JA 5HP4A 3PU6A 1X9IA 1I01A 1QDEA 1Y1KE 2YVKA 3CN7A 3ZUPA 2H4ZA 4LF9B 1SK9A 4JQOA 1EMDA 3W9SA 2IX3A 3PICA 3LPDA 5CNKA 3FKSD 1I1NA 3RYTC 3HACA 4R2WA 4DUPA 2HWUA 3PHHA 1YWGO 2V5VA 3AVOA 1Y6QA 2F43B 1TVKA 4IRUB 5AK4A 4BECA 2XB6A 1GZ4A 1HKHA 3BPSA 3IUQA 3Q98A 3DEKA 5B57C 5L9AA 4PG7A 5AJYA 5J3JA 3U60B 1NLYA 4OB6A 3E18A 3UC5A 3PA6A 1P4GA 9LDBA 3HCFA 4AB1A 4Z3KA 3NJRA 3DJFA 2QNBA 2ZQZA 2YXLA 4ZQBA 3PCTA 1VLLA 2CKDA 4MV3A 5IDYA 4WD3A 1H42A 3ZLTA 2DM6A 1WHTB 3DGFC 4TVKA 5BT8A 5TJHA 2FSIA 1CP3A 1I2BA 1CY8A 2YJ4A 3WGKA 5LD2B 3IQDB 5BRAA 3ZY5A 3UUFA 4HEA6 4WGGA 4XD7D 3PD0A 4JC0A 4HQRA 4S1NA 5KHAA 3WL7A 4JS0A 3P9NA 4H59A 1KU6A 2W9XA 1XCJA 2ZB8A 3G2OA 3EVFA 4GWGA 1W44A 3FHCB 5C31A 2ONJA 4CKWA 3WAGA 4X20A 5TPZD 4TYQA 3ZE1B 4AJ4A 3F47A 5J58A 1YXMA 2Q50A 1GQFA 1L4UA 1U8EA 3LQ4A 2QYTA 2PNFA 2AT1A 3WNBA 2QXYA 2ONCA 2E5LB 3VDRA 3AVUA 2ODPA 5DHQA 5BUCA 1YQDA 1VL1A 1PHPA 2JBAB 3Q4GA 1HNWB 1Z6AA 5J23A 2DUJA 5C8VA 4TWZA 3HK2A 2FWJA 4FHDA 4WXPA 1X8LA 2PIDA 1SXJD 4YH1A 2OFOA 2VHJA 1QQ5A 2WPDD 3E7WA 4WLUA 3A37A 4BMXA 1CIVA 4BBPA 3C6YA 1VCOA 2DHCA 2M6LA 1KAQA 3I2HA 3T4UA 4DZZA 2NUPA 1W7AA 2JEYA 3QPUA 2VPYA 2IX9A 4ZZ1A 2XTAA 4YCAA 3OM1A 5BN4A 3W5BA 2QQ0A 3HY6A 5EEHA 1ZH2A 2JFUA 2ZI6A 2IYNA 5SV2A 3V9PA 4CG0A 2QUHA 3AETB 1L8OA 3LY7A 3P0HA 3N2NA 3G5UA 1OTXA 3TLEA 3DDUA 3SFZA 2OV1A 2Q9BA 2XB9A 3PEWA 1KQNA 2BE7A 1FDUA 1D0SA 3C41J 1JR3D 1X7YA 2JHAA 1WW8A 2QW8A 2WV7A 2ZYWX 3U4QA 4MWGA 2W2NA 5AMXA 4PPFA 5J2UB 4DLKA 5L3VA 1TU3A 3ET5A 4KNYA 4CKEA 2OG1A 4GBJA 1GYRA 1R9NA 1TOAA 1Y1QA 3D3NA 4JU9A 4L02A 5CMLA 3BHMA 3GEPA 4BVHA 2JJ2D 2WBLC 1NAIA 5IULC 2RONA 1YDFA 3NRCA 2Q5QA 3KXPA 1ESEA 1QE5A 2O3SA 4ILEA 1NVEA 1IHYA 4LNUA 4MCJA 5EL0A 5SICE 2XUDA 1K63A 4EZEA 1JSLA 1RYEA 3EA5A 2D5AA 4F21A 5BYAA 3W2IA 1FFDA 1HY3A 1D04A 4GFDA 4Q47A 2F7SA 2DHQA 2CK3A 5EUQB 1U0GA 3TLBA 3OQHA 4OSEA 4C3OB 3QFHA 4YRRA 1JHPA 1MAUA 3SYMA 1S2IA 3PE4A 1FRQA 1IMJA 4AMBA 4DV2B 121PA 2YOHA 4O4IF 2GN6A 1UIMA 3MW8A 5PGMA 3TBHA 1P4SA 2FMXA 1TUBA 3OZEA 4DMFA 4Y30A 4KR7A 3TL3A 3D5QA 3W04A 1G2QA 2DWQA 1Z63A 4YUAA 1T0IA 4H31A 1W2GA 3GJXC 4X7MA 1KE1A 1TEHA 3C48A 2OAP1 1ZM9A 2ZDGA 1RJ9B 1JTFA 3OUTA 2SECE 2BEVB 4E22A 4AMVA 2ZDHA 3C3WA 3EGWA 4K9QA 5BT9A 4CQLB 3CLRC 4IDDA 4ZYZA 2HHHB 3T3GA 1Y48E 4HH3C 5GOTA 3E23A 5E3JA 2IODA 3CX7A 1YZLA 4EW1A 4QDOA 3K5HA 4IVPA 4I4TA 4F04A 2JKYA 4JITA 1UXJA 1BX0A 1BMQA 2GNPA 3I6IA 3LPCA 1VMDA 3K8ZA 1Y89A 2XXJA 1GYQA 3G7SA 3WJAA 1Q91A 4X00A 4R1NA 1PNQA 4K6FA 2PWZA 4ZC8A 1Z4PX 3RV3A 2W2TA 2FW6A 3QH4A 5FUMA 3EEYA 4BO5A 4DJAA 1MHPA 4UVEA 1QGOA 5EKSA 4UBOA 1K8ZB 5CPFA 3AFIA 1JIKA 3IAAA 4UAGA 1ITZA 4R0NA 2CLLB 2HOQA 4MW9A 1O57A 3DG9A 1WXIA 1V16B 4KPEC 4OJQA 5E6RB 3GUYA 4B3TB 1RWOA 4XWTA 1TM4E 3HNPA 4R2JA 3U62A 4E5YA 1K3TA 1U3TA 1W5SA 1Y7HA 1RZUA 3ZHOA 1ZLYA 1QBKC 3HM2A 5HRAA 3H4MA 3K6SB 3GUUA 4RQTA 2FSVA 5CEFA 3KPYA 2ZPUA 4CVNA 1OVGA 2EW1A 4DV7B 3FFBA 2Q2QA 3WY9A 2XZDA 4R81A 1LPNA 3GOHA 4EMBA 1YE8A 3I72A 2ETXA 1C0IA 4G5XA 5IPFA 5JSQA 4NNJA 3OPNA 2PMEA 1Q0LA 2L19A 3ZZ1A 2LCIA 3JAKB 3C6KA 1Z2OX 1W47A 3GLVA 3MWGA 4ENTA 2L18A 5JAHA 1HQKA 4C0AC 1B6RA 5KNCA 4C7MA 2OORC 3V7WA 2GF9A 4NK5A 5F1PA 1S01A 2X8JA 1FNMA 3DCJA 2QGZA 5K0LA 2EKBA 1ORDA 2RHLA 1C29B 4JUBA 4O08A 5H9VA 4OHBA 3U5ZB 1O77A 4JHXA 1EBUA 1QFYA 2XVAA 1BXZA 3H18A 2H9YA 1GVHA 4QRDA 1SBTA 2FR0A 3CY6A 1BX3A 1JEEA 4XQGA 1BVUA 4YMSA 3TN7A 2NZ8A 4EW3A 1CRLA 3U37A 4BY9E 1HETA 2FFQA 2WEKA 2HJSA 4GZ5A 1ZVQA 3WIBA 3ZIUA 4DL9A 3GD5A 2QJFA 4YMHA 3LU1A 1UBSB 3OUZA 3O73A 1V37A 3SBDA 4BB0A 4JB2A 1YU6A 3DCYA 2R1VA 1NDUA 4TPKA 4YRSA 3VH3A 2DWUA 5DBOA 4JQYA 4BAZA 5KNDA 3Q9NA 4KGDA 1Y9DA 4TTAA 1TJPB 4R8MA 4XX1A 5F9HA 1UKVY 1G2PA 3E1GA 3MLEA 5SZHB 5A2GA 1ISPA 2ZQYA 1ILWA 1FXSA 2PU5A 4ERNA 5E6SB 1AT1A 3T3OA 4Z2AA 1V8ZA 4UHBA 3T5TA 4YAKA 1L4LA 4UQLA 4EG1A 5CCEA 2HDWA 2NZJA 4HRAA 1NBME 3A3PA 1RI4A 4HQLA 1FX1A 4RVFA 4O5AA 1Z4MA 4BFVA 4R01A 1J07A 1RWNA 3HBLA 3OEHD 2E5WA 2P91A 3EGEA 4FS8A 4L16A 4AZ3B 2J5KA 1FXWA 4MW5A 3PXEA 1IN6A 3OURA 3ZD9A 2RH5A 2VNKA 4KODA 5EKUA 5GGXA 4QKQA 3AMVA 2CXSA 4PX5A 1QHYA 3C7CB 4LVOA 4ME6A 3D8SA 3R9KA 4F8YA 1MJFA 3LPMA 2X58A 4LMAA 5DLYA 1GPJA 2A88A 1IM8A 2QK4A 3KKQA 2HCTA 1OF1A 4KP7A 4Y6PA 5EIBD 4KQMA 1PVDA 1YRQA 4JYMA 1KDOA 1GG9A 2O3RA 3A4VA 4JK3A 2DBZA 3JR7A 4IIEA 4RMGA 3VTKA 3M6VA 3K4HA 3AUJB 2FW0A 3Q7QA 4FBGA 4ZU6X 4B6RA 3H86A 3GL9A 3HRIA 4HD8A 1GA1A 4FHCA 6YASA 4DLAA 3M82A 4BFLA 1N5JA 2Q4OA 1ND6A 2HTEA 4A91A 3H1AA 4INPA 3UBTA 1KDPA 2AC4A 2AOWA 4PZ0A 3L04A 4EG6A 3W6UA 2O06A 3RHTA 4HQ0A 2K2QB 4NS1A 1FQJA 4TMZA 1O0CA 3LXXA 1T9ZA 1VGQA 1C9NA 1VLHA 2IXAA 1FFXA 1GZHB 5HUJA 1VFNA 3HB7A 5AVSA 2C8VA 1K97A 3ER8A 1GEGA 4KQWA 4FE4A 5AUNB 2HBRA 2ZIXA 5G41A 1E3IA 1U8UA 1WIWA 1UMCB 3Q0TA 4RSMA 4RDXA 3IDOA 3CUUA 2XZOA 3G23A 1U8AA 2MSNA 3OJCA 1EESA 1NVXQ 2WU4A 1F12A 2QD1A 4RHFA 5ELMA 2ZYDA 4G41A 4HEJA 3ETDA 2PSDA 3LBHA 1R37A 4LRQA 3WXMA 1JVBA 2RGDA 3F4BA 2BEKA 4N39A 2LTAA 3D59A 5AUQA 3ZNOA 3R6TA 2O2SA 3N9IA 1FYEA 3C3EA 1MFPA 1OXVA 3JD0A 4KBGA 5DTEA 3LDFA 2C9CA 2FPPA 5B1IA 3H9CA 1QFJA 2VZ9A 4FJ2A 1SVKA 3LUGA 3EGCA 3DE1X 3JPWA 4MRMB 1E6LA 3ZXYA 4B6EA 3P97A 2XXAB 4Y0VA 3IPAA 2W6JA 4IVRA 4C1BA 5CGQB 3JVVA 1OFGA 4E2ZA 1H1DA 1RM5A 2XPCA 3CGGA 1U7XA 1YZNA 3HP7A 3IOYA 1RXCA 2XI4A 3N28A 3PDCA 1V35A 4P3YA 1N2CB 1I30A 1G8JA 3CEMA 3DPUA 4EA7A 5JADA 1I7LA 2GSWA 2VJBA 5B3LA 1A04A 1TC1A 3MJRA 3KVYA 2FGJA 4OYRA 3W5VA 3HKEA 1W0KD 1JBQA 4ZREA 1Y82A 4G0XA 4O6VA 3ZE7A 1M1NA 4WKOA 4N5NA 3GEBA 3ZV6A 2EP5A 1K8RA 1HX7A 4BBAA 2QRPA 4N9WA 5HKLA 3K5PA 3QI7A 4LV8B 2R8ZA 1V9LA 4FDTA 4J2OA 3V2UA 2WWHA 2VNJA 4OQEA 5C46F 1XVAA 2HF9A 3R0QA 2JVIA 2RHGB 2B8JA 2WTXA 3BIOA 3QWBA 4XX0B 3A6KA 1NU6A 4TWJA 2C54A 5K3AA 4KLAA 5KTMA 2HCRA 4I99A 5IJXA 5I4BA 3DR3A 1DEKA 2K7ZA 2VPTA 2DLCX 2CNDA 3MD9A 3MGBA 3U1VA 3WK5A 3ZHVA 3WNCA 5KQSA 3ANNA 1QQAA 1C3EA 4HLQB 4S35A 1OYOA 3W5HA 1RYMA 4CJXA 5EJAA 2WLTA 4ZVRA 1KDZA 2GTIA 2G5TA 2GQ0A 4HX9A 4MV4A 4JGGA 4K3VA 4IJMA 4FCTA 4X6UA 3CGWA 4YJHA 3ZE9A 3L0YA 3CWZA 1RYFA 1TF2A 3VO2A 6GPBA 4MYSA 4CUJA 5DLPA 1NYQA 2UZAA 5JNUA 4ZV7A 1OU4A 1Q0PA 3AUUA 1SUEA 1LK5A 1S5PA 3A4NA 3FRHA 3JY6A 4DBLC 3S2FA 5CFOA 3IP5A 1N6HA 3DR5A 4Q19A 4FB5A 1IN1A 3FFWA 4E4YA 1FU8A 4OBEA 1ZWLA 3BM5A 1ODIA 1C1YA 4XIGS 3DEAA 1OVMA 1NONA 2GEFA 4RPCA 4C2AA 3S8YA 6LDHA 3PVZA 4KO8A 4MRRA 3ZXIA 3AKCA 1N77A 1GPLA 3MJFA 1P0QA 3OQ1A 2OGTA 4QQKA 3E1SA 1RAAA 1WKVA 2AOTB 2VOJA 1SUWA 3PV0A 4H77A 4ZO4A 3UK1A 4JX8A 4BNGA 1Q7GA 2KB0A 3GPBA 5A5VA 1KI2A 5FUWA 3FOZA 1N7HA 3B1VA 1RLUA 2NSLA 2VJMB 3IXLA 2Q5CA 3OBIA 1Y8RA 1KZ4A 2EFGA 2O2YA 4Y6RA 1KS2A 4YO8A 3IO5A 4UOEA 4C6TB 2V6BA 4UMDA 1G3UA 1M1YA 1ZUHA 2CNNA 2E4ZA 1Q0ZA 2P9GA 2WAYA 2Z4RA 3IVMA 1Z5GA 5TRTA 1CE8B 1U7ZA 1ZSVA 2FG7C 3B2NA 4Q39A 1Y7LA 5CNMA 3N2GA 3EVGA 4RS4A 2XHEA 4HGRA 3SZMA 2GCEA 2PSHA 4DGQA 3SXUA 4MO2A 2IYYA 3DNFA 5JDCC 4FP9A 1KJYA 1IY0A 2X76A 3GB9A 3KR0A 1A8SA 4HH1A 4MW7A 4W9NC 3U44B 5LNK6 4BX9A 1WO8A 3STXA 3RTEA 3X1ZA 5LYJF 1CRZA 2Z56A 2XQIA 4GLLA 4N9QA 4RTRA 1M76A 2FF5A 1PSZA 2FX5A 1UPXA 4TUYA 3S1LA 5CVTA 1IHOA 4UD2A 4UPEA 4I7EA 4IHKA 1U8FO 3DL7A 1Z38A 1ZH4A 4WVLA 3M5PA 1FDTA 1QX4A 3KZNA 3TUZC 4RULA 1P5JA 3JD4A 4C0BA 4BUZA 4FONA 1RBMA 3VR4H 5JQGA 1U4OA 1GO2A 2C88A 2J9FA 2WM3A 2IYZA 2FX3A 2WC1A 4F3YA 1YZKA 4FYWA 3BT7A 5TE9A 3DAPA 2AHRA 2ZI4A 3A9UA 4ZRNA 1H6AA 1Y0BA 2MWMA 3D6UA 2FK7A 3PPIA 4M1KA 3TRJA 5MHTA 3OAAA 3FHLA 3T6KA 1F2UB 1XYYA 2V98A 4EH1A 4EJ0A 3KSDO 5CDHA 5DM60 3LKBA 4DNOA 2G71A 4LF8B 4YWJA 4BNDA 2KI5A 4G9EA 1U2QA 1U28A 4R84A 1D2CA 2OBLA 4LE0A 2GBPA 1LF0A 1M8JA 3RJTA 4YONB 1JFVA 3W5UA 3O94A 1AGPA 1SK8A 2IYWA 1L7NA 3QE2A 3GQBA 4MS1A 1WU8A 2XE7A 1VP9A 4HGOA 4I9NA 1V9CA 1VJ0A 3NW9A 2EZ8A 3HGQA 3PUIA 4Q4HA 4ENRA 3FI9A 1D03A 1U2ZA 2GHIA 4D0RA 1P75A 1MDFA 4EMTA 5AD1A 2BGWA 3VKGA 1YONA 2DERA 1P7VA 1II9A 1Z4JA 3I4LA 1N2JA 1O94C 3DV9A 1R4NB 2OHVA 4ZJUA 1H5QA 2B4KA 1IONA 1YCGA 3PHJA 3QX8A 2AWOA 2O59A 2WE7A 1YA8A 5EERA 4Q1AA 1YTLA 2P0YA 3BAFA 4J1TC 2C4TA 4MDFA 1H22A 3QU5A 1TB4A 1Z5PA 3BDIA 5ADHA 3OIDA 4YCSA 3QEMB 1X77A 5CFZA 4U7WA 1L4KA 2QP3A 3PGKA 1NHGA 2IITA 3U7GA 3EQ7A 1JHMA 2M6KA 1LWNA 3OLYA 2FFAA 1QH8A 1NQVA 1G8PA 3AONB 4QFMA 3CE9A 4UDNA 1RJFA 3SLKA 5K8JB 2P1RA 2X0FA 5F4BA 5AK3A 3DBOB 2BISA 1AQYA 1CQJA 2KLBA 4ZQCB 4WOBA 2ZUCA 4OA5A 1BXRB 3H17A 1N1MA 4K03A 3LCVB 1E7QA 1NZJA 1ZIOA 3BL5A 2AOUB 4MUKA 4DLLA 2I2WA 3S8EA 5H59A 3W1WA 1K86A 1XNJA 4GAEA 5K7SA 4L28A 3IOMA 1Q6ZA 5DHRA 3EF3A 5CHEA 3C6XA 3SHQA 4OX9Y 3ZWMA 1KY4A 4KIFA 1S2OA 3JQDA 1I7PA 2MCFA 3D7KA 2D0PB 3I5XA 3A9RA 4FYKA 4NG4A 1YDGA 3GF4A 3FVTA 4DCNA 1JHXA 5B2ZA 2C2YA 3SYTA 3LBFA 1GL3A 1SCDA 3PDIB 3QVVA 5D85A 3EG9A 3WGHA 3AUAA 1H3EA 1P9RA 1EBBA 2E85A 5F3DA 2Z0MA 4K9KA 1T5TA 3W9UA 5FOXA 3QEKA 2B37A 4OU5A 2QAJA 2ZIVB 2AFHB 1SELA 3EDCA 3GT4A 3VYTB 1GG2A 1R5JA 3GWGA 2J87A 1WZEA 2QRGA 3D3WA 4S3MA 1V43A 3A6EA 2GYVA 4ZYTA 2FR1A 1GWNA 1WXGA 1QRAA 1RU3A 4V1CI 2O5EA 1DDGA 2XJ9A 5AQEA 5C4IA 2QBYB 2DPGA 1UOOA 4P4LA 3GDGA 4MR9B 2ST1A 2P6NA 3FMIA 4LK2A 4WBXC 3O91A 4EYGA 1ACLA 5F77A 1VRWA 1H94A 1XYGA 5AW7A 4QXRA 4R54A 1M2KA 2QUIA 3OECA 1EVIA 1QG2A 1TK2A 3N8GA 1FFAA 2VRWA 3M4ZA 3AO0B 4I66A 2DF8A 3KQHA 4ZAYA 3AU8A 3TB6A 4Q7EA 4ZOBA 4BFWA 5L7TA 2PANA 2FPRA 4LJSA 3HRKA 4O4JB 3JD2A 4D4HA 3IHWA 1P1BA 3LRXA 4FDLA 2GBFA 4OGFA 4NCBA 1BMFD 2GMWA 3C4QA 1ZEMA 5HUQA 5KYGA 4M36A 4B46A 4EFLA 2UV8A 1SQ6A 1C8BA 2YNMC 3OESA 4NPCA 4X7RA 5B37A 3RRJA 3WG9A 5JANA 3FYUC 1AJEA 2P5UA 3W5AA 5DEOA 2FXVA 5H3LA 2Y1XA 2XQJA 3GJ3A 4MR8A 4NMWA 4ZXPA 3RJ5A 3LT5A 1P7YA 4XOUA 2WYUA 4X1KB 4TVSA 3CUTA 4IMRA 4AJLA 1R8XA 1BS2A 2P2DA 1EGQA 2HSEA 4WFJA 3E7DA 2HV9A 5TR9A 2QDKA 3ND7A 3EOBI 3ENWA 2V1XA 4P82A 1AXGA 4NPHA 2F8MA 3BB3A 3TCNA 4AL4A 1JZSA 1B41A 2P4QA 3W2GA 1OI2A 3W6PA 5CAEA 2P6RA 3E2MA 3UM9A 2D4AA 2AWNA 2PUGA 1XCLA 2BMFA 2J59A 5JAIA 1GNPA 1TZCA 5D87A 3F4LA 1KHTA 1QHSA 5I9NA 1USUA 3QWFA 3A7DA 5DSTA 3UF0A 4HAVA 1GLGA 2VHEA 3C8MA 1RPZA 3AK4A 3ACBA 3QLUC 1P5FA 4WA7A 4EG5A 4QNNA 3FFXA 3K9BA 1JLHA 3N0VA 3IUJA 3KHSA 4K81B 1SCIA 3ADKA 4LZWA 4HNHA 5EXTA 5H3CA 4E5UA 4W5NA 4D8TA 3HN2A 5C8DA 2VZLA 4BB6A 4PZLA 5DHPA 3L84A 1Z6GA 1XA0A 2FVYA 1P18A 3KD3A 3U48A 1IXRC 2M2IA 1X7DA 5JSFA 1N7JA 1NV9A 1QR2A 1VPEA 4WZAB 3R7WB 1FZTA 3WNVA 3OX1A 3EGDA 3IUPA 2GETA 4BLRA 1K88A 4IM7A 4JROA 1Y34E 2GD0A 2Z08A 3IODA 4KIWA 5DH9A 2XB4A 3D3QA 1TECE 1T2AA 4G5SA 5DHUA 3UIEA 4QREA 4D8YA 3QJYA 3L4JA 2NO4A 3GDHA 1SEVA 4MUGA 2C4UA 4MIOA 4Q4DA 5H16A 1E92A 4PS1A 3LA8A 2OM2A 2AN5A 1BE8A 1P5ZB 1XU9A 3EQZA 4JYPA 3L6DA 4E5MA 3OLVA 4KQJA 4KOEC 2VDMB 5DASA 4DV5B 1XD2B 4P0QB 3P9YA 2B9EA 2PAFA 2XWSA 2QJWA 4BOYA 1QVVA 3JRNA 3H9JA 2VTBB 2Z6AA 3HTXA 2HK6A 2Q6LA 4M8IA 4OP3A 4R8LA 1QHEA 2AUMA 4CDMA 1AIPA 2NTEA 1V96A 4TS4A 3GLHE 1F4LA 4AQ7A 3BH0A 3D1LA 2VUSA 4L4YA 2WR8A 4NVRA 5EWLA 1KL7A 1I3CA 3CLSD 2R6R1 2VF5X 3BVPA 4ASUD 2YIDA 4DCSA 2JCSA 1UKZA 4ALIA 2A3RA 2XT6A 4HYYA 4M60A 4XQ0A 1BEEA 3B2EA 4DDKA 2NYUA 3NWOA 1NVKA 1XAHA 1UT8A 3DEIA 1E2LA 5IBRA 4UZSA 1UBHS 3F7TA 1J33A 2CHUA 3LD9A 4KUGA 4BVEA 4I6EA 2WT8A 1A27A 3F5DA 1LLCA 1VHJA 4HB0A 1IOLA 1XDDA 2DUWA 1J2UA 2OE2A 5I7EA 1E5XA 1ORIA 4GT1A 1QOPB 3A6ZA 5CVCA 2Q28A 3JD1A 1KSJA 1N9GA 3AB3A 3MEQA 1JHDA 4N3BA 3LDAA 1VA4A 1PZFA 5EKXA 3FJ1A 3IMEA 2BDTA 3O2JA 2A57A 4B4OA 2BSQA 1S7CA 2BL4A 4PRLA 2BR5A 2I9PA 1V5FA 3PNQA 4FGJA 4QYTA 4UZFA 1UDXA 3R7DA 4I55A 3DZKA 4EGJA 4JT9A 5ER9A 4G97A 2VHQA 3V5NA 5F52A 4I5IA 1WW3A 3PXAA 1XROA 4NV1A 1YR7A 4FZJA 2BCEA 1RJEA 4WOJA 2GGSA 5ERYA 5A04A 1YHZA 2H2IA 3E9YA 4LTMA 5AVVA 1H2ZA 2NUBA 4Z7NB 1GKKA 1XQXA 1MOPA 3I9LA 4JUFA 3GEMA 4PQGA 2FZ4A 2UVDA 1M67A 3GFBA 3V7YA 5ICCA 5FPQA 3MMNA 1OC2A 3TXYA 1Q7BA 4MGYR 3SE0A 4CV1A 3TJRA 5JY1A 1SMKA 1YCFA 2N1MA 1TT5A 3IR6A 3TNYA 3RUCA 1BCSB 3FXAA 4G4GA 3NBMA 2QN8A 2P9FA 4H4CA 2JD2A 4MULA 4H60A 4A1OA 1A96A 1G20B 2QRKA 5FWAA 5JAUA 3TQHA 3NWBA 2P8JA 1V1MA 1XU7A 1YGPA 4FMDB 4HDAA 4I4NA 1ZH8A 1JSXA 1FB5A 1J06A 1JLRA 2DX7A 2O7RA 3AESA 3NTUA 1QP4A 3NB0A 1ZUIA 3KT0A 1K5DA 3C16C 1NSFA 4I9UA 2X9LA 4LMRA 2C2ZA 4GBED 4II7A 4JVSB 4KFUA 5E7IA 4FHFA 3TRKA 3MC1A 4BQFA 3NMUF 2AW3A 1LDEA 3DE6X 1ESNA 1QQTA 5EINA 1JKIA 4C3UA 1K08A 4KWTA 1ICEA 4JJ8A 1YCHA 5KVVA 4YRIA 2GPAA 5CX1A 4MDHA 4DQLA 3EPRA 3OF2A 2I4NA 2VYVD 3ZJTA 2RK6A 4HADA 2P6OA 2KMLA 2J3KA 2QX7A 1O2DA 3QQ5A 2QT1A 2PJRA 1MA0A 4PLZA 1NOJA 2ID4A 1EEHA 1GUAA 1OI7A 3OY2A 3A05A 4QARA 4ZANA 3B7PA 3REQB 3V97A 4JJZA 3WRXA 4MI3A 1XB2A 1OFUX 1N7GA 4RZIA 4XQCA 3ZW8A 2ID9A 4LY9A 1MB3A 1LFAA 3NU1A 4JC4A 4NU6A 1W9HA 3E9QA 2XIQA 3E9ZA 3JRWA 5F2EA 5FI3A 3RADC 2R60A 4UAVA 1CQIA 3Q0IA 4G2TA 4I1SA 3RVSA 5IM4F 1H3NA 4WKCA 1O9BA 1KNQA 4RABA 3F6YA 5FWYA 3CEJA 3AUFA 1HA3A 1HEYA 1LVGA 1PYGA 5H4GA 3CTPA 4ZP1A 4D41A 1QFZA 4EG4A 2BZSA 5LZ9A 4GMXA 5H82A 4IMJB 5CNIA 5J5VA 3NRJA 4ND6A 1B15A 1DC5A 1RHQA 1VPVA 2AR9A 3RIEA 1UJ2A 2H85A 3SQDA 4DUGA 1FF9A 2GKOA 2NZYA 1H2EA 4KNVA 3A36A 4DY6A 2V7WA 3BEDA 4NAVA 3V48A 4DWOA 3ZU3A 3IV6A 2DB3A 1KZHA 5BYKA 3AG5A 1NDQA 3IPXA 2VPWA 1XZDA 2BF7A 3Q3IA 4EECA 4XR4A 3QNUA 4MKRA 4PSKA 1Z0IA 1Z0FA 4CL3A 1T0PA 3WOVA 4CCWA 3KR2A 4TLMB 4LI3X 3VR5A 1U2RA 1H8HA 4RXUA 3L4EA 1TRKA 3BKWA 5JV5A 2J45A 3B70A 3PUYA 4W5OA 1L1QA 2FE1A 5CG1A 1V8OA 2JGJA 2XMPA 4CL8A 5M2QA 1KAEA 2ATIA 2H57A 2IELA 3AM3A 1DUSA 5LIRA 1JPUA 1T3GA 3JQGA 1QRTA 2UAGA 4R41A 5DN6A 3ZDEA 5AM3A 3IQWA 4I1VA 2YQ4A 2XNDA 2AX3A 3WQRA 1Z18A 3FNRA 5FJIA 1WCXA 1NW4A 4XUCA 1DCKA 5AI0A 3QG1A 2WMNB 1DJQA 4L4UA 3ZJ5A 4BUJA 4EA6A 4NDZA 4QPJC 4O3MA 1FMLA 1VSTA 3X0DA 3BMNA 1SQ5A 3FMFA 4RYLA 2FNAA 4QATA 4J9UE 2EX0A 3PL1A 4WTOA 1WMFA 4GI3A 1SCQA 5DNDA 5AOAA 1FRFS 3DE0X 2BELA 4J3NA 3Q3JB 3A06A 1G19A 1NMQA 4LMPA 1VKHA 3WK8A 3D1VA 3NHMA 4HPWA 4YCMA 3ZJVA 2ZG6A 3FDIA 4P83A 4UCQA 4BLWA 1EG2A 2NYVA 3B36A 4KLZA 4ND4A 3UWOA 4AP9A 2C98A 3WWPA 4PIMA 3FB1A 3HYSA 4FHGA 1JQDA 4GMDA 4HEA1 2CHVA 4OA8A 2R85A 4R6XA 1RC0A 4PIVA 1NNI1 3HN6A 1VCIA 4WJKB 4L27A 3KVVA 1VHWA 1SA0A 4A23A 3AVXA 3AB8A 1XTBA 4WK2B 4P7KA 2V7QA 1P72A 1L3BA 1V8FA 3KYCA 4FGUA 4P34A 4AICA 4QVGA 1NN5A 3MT7A 4RXMA 1VHTA 5FPYA 4BJHB 2F55A 1KP2A 1U3WA 4IGIA 4FHZA 4RA9A 1XBTA 4JUAA 4RM3A 4F72A 1XRNA 1ZSYA 2XMRA 2PKXA 4XPIA 1NXTA 1ZM3A 3O9VA 1YI8A 1RFGE 2X9VA 2H2WA 4FHEA 4Q5IA 3FOFC 1GP2A 2BMVA 3B12A 3UQZA 2O20A 3PWKA 4GSKA 4IHJF 5HRUA 2B5VA 3LX6A 2C5FA 1CR6A 3MILA 3NFYA 2I1VB 4KXFB 3VYWA 1ZCAA 3WGYA 4C7XA 3ASZA 3GU3A 3DLTA 4QU8A 1HO3A 4X90A 1X7XA 3W34A 5J2TF 3ED5A 3N3AC 1UFRA 3EFOB 2QLBA 4QDZA 4PPYA 4D98A 3N8NA 5JNLA 3NVKI 3GROA 2XHZA 3FTEA 1M6VB 2E4UA 2H51A 5J5CA 1WXHA 5BOSB 4WCDA 1ABBA 2IF0A 4X85A 1IU9A 4MRSA 3QLTA 1OAOA 4X1YB 3QTBA 3H05A 5DIFA 3AR3A 3ESAA 2A58A 4WN9B 2DRIA 3P2EA 3LMKA 1GPMA 1NQUA 4Q7MB 4KTTE 3BWMA 1FU4A 1ZK1A 2FPGB 1PN3A 2O7VA 3H9EO 4M9ZA 2J9ZB 5HRCA 5AHXA 4A92A 5EIBC 1IHPA 3DTYA 4YR7A 1XLVA 1TQ6A 2PSJA 2QU8A 5JC8A 4I36A 4CQMB 2OWDA 3CPJB 3WOHA 2VHUA 2OGSA 3MZ0A 4EO9A 4JZKA 2IV2X 1MG0A 2E3JA 3U81A 2C7QA 5D1NA 4S1VA 1P9NA 2AJDA 5ALSA 4H3SA 4ZOEA 4HQOA 2NUTA 1T2VA 5H3HA 3R3YA 3KLNA 3PUZA 5H4HA 4BFYA 2JLAA 4JXJA 2X0DA 5EI5A 4CLOB 1O95D 4DT1A 2NO1A 3BB4A 3TG2A 1EHYA 4B7XA 3I01A 4X84A 3WBFA 4D74A 5JEEA 1A9RA 1YMQA 1V2HE 3NT4A 1EWRA 5IG2A 1WXEA 3B3JA 3O3MB 2GDJA 2ATXA 4IW3B 1W30A 3RUIA 3AY6A 4G56A 4YGXB 4B73A 5AP9A 3NG1A 4BDSA 1RC8A 4UHHA 1CVIA 1I3LA 3LUKA 4M1WA 2TRSB 1AXRA 1Y5LA 2QVYX 3BTSA 4M3NA 1GY8A 4G5YA 1EJBA 4A16A 4OHKA 4ZFNA 3ZYZA 1KYWA 1ONSA 3Q11A 4A27A 4UUAA 5CEJA 2IY9A 3EVNA 4XWWA 2HMAA 4CFYA 4WXEA 4D9JA 4Q1EA 3T61A 1M2HA 1QC5B 1CEXA 3H8WA 5IYZA 5JR3A 4EG7A 3FNQA 5FPSA 1M0EA 4HBZA 4UBNA 3LOPA 2HF7A 3MBKA 1BWSA 3T1TA 1FDVA 2WE8A 3DE4X 4PAWA 5FEMA 5KJ6A 3HU3A 4IEIA 1YR6A 3IQGX 3JQAA 2NSYA 3KHTA 2JA2A 5I45A 1LNSA 4DR7B 4ZGWA 3U3DA 4MITA 2XADA 2FLKA 4N3AA 3ZTYA 3GRRA 1L5FA 4KRXA 4RHCA 2XMBA 3JYLA 2X3YA 3MFQA 3A27A 2I29A 4CKCA 5IAOA 3ZV3A 2DQYA 3I73A 4UM8B 3VM6A 4GNRA 1FYDA 4WECA 3WGTA 1VGVA 3L8MA 5C5CA 4PZAA 4US1R 3R9WA 4NULA 1E8MA 3KT3A 1G6KA 4HPXB 1AV7A 1WXQA 1NQ5A 3UTCA 3QHPA 2D7DA 1KXZA 1F2DA 4TKUB 2BLNA 5BWBA 2IJGX 3DFKA 4LRXA 3LX8A 2QZSA 4R68A 3BD9A 5JD6A 1EFVA 3QEBZ 1RE1A 1CR1A 1XMXA 1FRNA 1KARA 5FFMA 4H16A 3ZJYA 1S8NA 1B8NA 4OQZA 2PJUA 2E82A 3CLUC 1XMPA 1ZQ1A 3FGPA 1MJNA 3JQ9C 2C94A 2CCKA 2PZLA 3IVAA 4JQZA 4LC0A 4X1OA 5B3JA 3RHSA 4YCJA 1CQXA 4EMSA 3KOXA 4LFAB 5HIIA 2YINC 5LP1A 1Z7BA 4K1XA 5I48A 5K3DA 2XYQA 2VSYA 4G5QA 2YV4A 4Z4IA 1EUCA 4ARZB 1G7SA 1KGSA 2IHVA 3ZWQA 2O4CA 3DBVO 2Q7OE 2W6QA 4B6QA 3EVDA 4EGFA 3QG5A 1S9DA 4N0EA 4N40A 4D4GA 2Y27A 3EC7A 5E38A 1PJCA 4E30A 3FVRA 2UDPA 2ABWA 3EEQA 4Y0NA 1RLJA 4CMCA 1XK6A 2RHBA 4R3NA 4A0RA 3KVOA 5HF9A 5REQB 5KYWB 1UDBA 1GG8A 3O6VA 4YJFA 3F6RA 4B4KA 4BNFA 1D8TA 3GFFA 4HYQA 1PX2A 5HKKD 3BZBA 3RYFB 1E62A 3H6KA 4UEKA 3T54A 4ZJPA 2EWVA 4FFBA 4IQ8A 1M2JA 3CRQA 3QEAZ 1TQ8A 3OICA 2EKZA 1H2XA 1C1XA 4CV3A 2OXFA 1JG7A 1F9EA 3WYDA 3M6UA 3TRIA 4MS4A 5A5GA 1G8YA 1G3MA 3DLIA 5TXGA 1VMIA 2XNKA 2GO1A 5FORA 4B3DA 1LPBB 1N7IA 1QH1B 4DWVA 3L46A 2YJ3A 3EZ2A 2OMKA 5DNVA 1CY1A 4CEIA 3KJGA 2ZJAA 1FMJA 3CE6A 2E21A 2I78A 1IZZA 4EY6A 3FTDA 1O8CA 4UNQA 4AX8A 4RIHA 1JEQA 3ITKA 5J40A 2B3DA 2NU7B 4MLCA 2VZ8A 4C5CA 5JARA 1Y1LA 1SBHA 1AN0A 1S1CA 1U0FA 1J7KA 2O5RA 3I42A 3KJNA 3QPWA 3SR4A 1N33B 1IHDA 1KFEB 2HQOA 2OO5C 3MJEA 4IH9A 5E4TA 2QV0A 4MYDA 1T0BA 3JYHA 3TZHA 2XVZA 2P30A 4BNMA 5CBKA 1YS2X 1UCFA 2DWOA 2PGJA 3HKDB 1W581 3EMDA 3MWEA 1NMXA 5KZMB 3CUWA 4BBZA 3QWAA 2ZANA 2IUTA 2OP1A 4JP2A 5LMCA 1U0TA 2BHLA 2YWGA 3DTNA 3FB4A 4PGAA 1SOWA 1O7JA 1JUDA 1TAQA 5AKHA 4JAVC 4FSDA 4BFUA 4GD3Q 1L1RA 1HFJA 1TLLA 2QAGC 4HXEB 4NZ9A 4UCFA 5FAXA 1E9RA 1E96A 1UQUA 4L74A 4ZKEA 3BRSA 2O3TA 4ZYXA 2OXEA 1ZJ6A 4UM7A 1FVHA 4LG1A 1B74A 4DBZA 2B4QA 3OE7A 4H7FA 1I3NA 1QWSA 4HPJB 3SGLA 1EBFA 1YVDA 2IYTA 1ZVKA 2R47A 4FBLA 4OHUA 1M7GA 2W6PA 5IABA 3L8DA 3WYGA 3OFSA 1R64A 3D8RA 3VR6H 2A78A 4MEJA 5JO9A 3PQDA 4BMCA 2FUNB 3S7ZA 1EK6A 3A26A 3PIIA 3H5RA 2YOGA 3CLTD 3TMKA 5LFAA 1C0LA 1XPUA 4FK8A 3DBRA 3HO6A 2WUEA 2Q3HA 3C2QA 2E2WA 4FFRA 1DAIA 1DC7A 2XSZD 5JATA 3VJKA 4OB8A 2VSFA 2NVUB 3DFIA 4G65A 3RTGA 1Z8DA 4PFKA 4D26A 2GM5A 4MARA 2P4SA 3NHUA 2BKLA 4MYHA 3BH6A 4CLEA 1PT5A 2HMUA 4OQMA 4FZRA 3CH4B 1V48A 5F5NA 2E4VA 4ZO6A 2X3FA 2W11A 1W36B 4V03A 2GCGA 3JSXA 1J24A 4EB6B 3AV3A 1TKRA 3WJ2A 4OJNA 4RPIA 4IKOA 1QORA 4L3WA 1EGMB 1UEJA 2PY6A 3HU5A 4HK4A 1IY8A 3JASA 4LQDA 1J8QA 1HDRA 3PCXA 3OU7A 4RHUA 1CUJA 2DT8A 1IVYA 4XE5A 5BRNA 2Y9MB 4ZVUA 3DLCA 4J0IA 4PSUA 4HVTA 2C4VA 2QD3A 2F1OA 3R3UA 2G83A 3P45A 3TFWA 4FI3F 3VKWA 4PICA 2I33A 2DLNA 4NBUA 2D2FA 2FSFA 2ORED 5BQ5A 4AZ0A 4DMLA 1YC5A 2QEQA 3R5TA 13PKA 2PQ0A 1PKEA 1W4CA 3B1ZA 4HTFB 1HXHA 1PW7A 3IEKA 4ER6A 1Z3IX 2J6IA 4OQQA 1KAOA 1H0HA 4IIHA 3T9DA 3VO9A 2GRJA 4GOXA 1WBJB 2QLFA 5C1DA 4JBGA 2EZTA 4YRQA 3KFVA 4JUIA 4EPWA 2YKGA 1LSOA 3ZX5A 1J8MF 4C07A 2MSCB 3RJMA 2QAGB 1NY6A 4MQBA 2OK8A 3L9XA 4D6XA 1SUIA 2YMQA 5EWJB 3ADOA 2DJIA 1TGVA 1DAPA 4RJJA 2A59A 3DVAB 5E3IA 3OPVA 5LWQA 3FDJA 4IZ6A 2JG3A 3O1HB 3PTLA 4I8IA 4K6GA 1LGYA 1QAMA 4AO7A 5K45A 3CEHA 5AT1A 1UZAA 1YRYE 4Q9IA 1SUBA 1UJNA 4MUAA 3ZKAA 4BKUA 1Y7IA 1XRJA 4DVJA 4YT4A 3DYVA 1YI0A 2C29D 1TKCA 4HFRA 5GADl 1II8B 1JWLA 3T06B 1SRQA 4PF1A 3TL2A 3U4CA 4KO1S 4JLKA 3NBQA 4N8SA 5TX7A 3WYCA 3K4QA 4WVFA 1FQOA 3ORSA 1K75A 4CLHA 1S8FA 3S68A 3QFSA 2QX4A 3C8HA 4FKBA 4BBJA 2P4UA 4U63A 4QU0A 3OOSA 2GF0A 3UHFA 2Z2IA 4BO9A 3OOHA 4X41A 3LC2O 4YROA 4HGZA 4HNAA 4YJ3F 2B2NA 4RTSA 5G1NA 3G1UA 1IZ8A 2C2XA 5IEBA 3SKXA 2WG1A 1O3YA 1XMOB 5LCXA 1GFWA 4R4JA 3VOTA 2YYZA 3HJRA 1X3SA 2G0NA 1CUBA 1M73E 4PQEA 4WCVA 4YAFA 1S8AA 4ZDKA 3JATB 4IYRA 2DPHA 4JDPA 4ER5A 1JG1A 1M9NA 3MS2A 2IYVA 3OSZA 2BIFA 5TF4A 1NVMB 3KOZA 3FR8A 4QQFA 4YIKA 2VO1A 3MJVA 4J29A 1W29A 5DE3A 3DB1A 3PNSA 4LRUA 4CF4A 4IKEA 4EHHA 3RSHA 5KNCD 4FNGA 1YUMA 3CNOA 2KBEA 3QUAA 2I6QA 5CUQA 4DNFA 2A35A 3MAAC 3VDNB 5AI8A 3U31A 5CTAA 3TNDA 3ZWBA 1ZR4A 2R8YA 1KMNA 1V4NA 4IHJB 5HF6A 4G4IA 5DISB 5J1SB 1ADGA 1VJ1A 4RMNA 2B36A 4C14A 2HEGA 3LQKA 4Q1FA 4KR6A 5KX5F 1FVOA 1EDZA 1VKRA 3LP5A 3PKJA 1SY7A 2WU8A 3FGOA 3LHDA 1ZK4A 3Q3HA 5J2TB 4PPQA 3ETHA 3OA0A 4XI9A 2RHTA 2XR1A 3SHTA 1ADFA 1F3LA 3PQ3A 4DILA 3LKZA 2GLXA 1YACA 2X3UA 3PC3A 3B9BA 3F6PA 2BN4A 1VLQA 4OGWA 5LZ8A 4A5OA 5A1JA 3OTOB 1WUIS 2C9OA 2RAPA 4C4AA 4CMIA 5FV4A 5KWSA 1RRMA 1Y42X 1Y5IA 3EDOA 5KNDD 1YF3A 4Z49A 3E8XA 3RU7A 3RFXA 1K8YB 5K51A 2DULA 1RPJA 4PLFA 1UWVA 2ISCA 3PFIA 1M34E 2HHJA 5DXAA 3WO0A 5CP8A 4CG1A 4NSNA 2VJAA 2QS9A 2X9QA 2H7XA 5BSVA 4FN5A 1LTHR 4O2BA 5JNWA 2J9RA 3ZWPA 1E98A 1LDGA 2H2DA 3Q2OA 5HXAA 2KJQA 2UXDB 2P9YA 1XMQB 2XWBF 5LP6F 5IF3A 3M6IA 2X7HA 3NV9A 3RU2A 3EA0A 2GM3A 4HV4A 1XNGA 1XF9A 4I19A 1M2VB 1OREA 2ZSKA 1MX5A 4L8GA 3RS5A 4NJOA 2JGNA 1XQYA 3V4SA 2BAGA 1EGVB 1A5SB 2H9AA 2WKRA 3BL6A 1DB3A 3M6LA 3SS8A 1P0CA 3FPFA 1CUVA 1A9ZA 1HURA 5KOYA 1YDMA 2RHWA 3QF4A 1LPPA 4BFTA 2PGDA 1MOQA 2QJOA 2ZBUA 3G8CA 3AXSA 2GWRA 2PBZA 2UUPA 5AJTA 5FNVF 5M7EA 2ZWVA 3AWIA 3KQUA 4LJ5A 3JV7A 4RQBA 5JVDF 3LTEA 4JJKA 3K9FC 2G9UA 3QU4A 3QVMA 1BEZA 1GGJA 1QIHA 2AC2A 4QDJA 4BZWA 5AM2A 3NEJA 4BFCA 3G2HA 4CI0B 1L8AA 4I0WB 3GJ6A 1JDPA 4TXLA 5DGIA 4E6PA 4XWOA 1RXVA 4Q3BA 4D44A 1T6ZA 2QI9F 2CXPA 3DTVD 4HAYA 4ENSA 1PP4A 2CL0X 4M7WA 2P9CA 1D4ZA 4RACA 2I22A 4RTQA 3UA4A 4B6FA 3MUEA 2IH2A 1ISJA 3L06A 1GTMA 2FRVA 2QLMA 3WGJA 3KXDA 4ES6A 4RA6B 1KIAA 2C8JA 4E13A 2EOAA 1WXDA 3HYLA 3KHKA 4LCBA 1RIIA 1SR8A 1EB8A 1XLUA 2HZ7A 4N0MA 4YDQA 4NL4H 3T7RA 3O2QB 1QTNA 5IT9A 4DR2B 2D0OB 4NF2A 4JXXA 2I8CA 2BFDB 2QQ5A 3L02A 3PDHA 2JFHA 4Z4FA 2OO7A 2ZBVA 3K7EA 5AKJA 3PTZA 4OJTA 3CLSC 4TLEA 2DOKA 3MTJA 1T3HA 2YC2C 1J6UA 1U8CB 4M9QA 2VP4A 1PJTA 4EI7A 4AXXA 1H93A 2W98A 1VKNA 2AH5A 2GESA 2ZIEA 3T5GA 3GZ4A 1GTRA 3P7MA 4LISA 1YBAA 2QTZA 4QYXA 1YOVB 1ZOPA 2AUTA 2JK1A 4KE7A 5AVOA 1G0NA 4G81A 1M2WA 1MJGM 1V7CA 3WR5A 4HDOB 2VEDA 1VQ1A 3WGQA 2F67A 1T5IA 3NNSA 4HAUA 1NF8A 4G63A 5TQ2B 2XZTA 1FYVA 3JW8A 4YDHB 4CKBA 2ZRMA 1VL8A 5HFNA 3HFJA 2HPHA 3AHDA 4H1TA 5EQTA 2QW1A 1IK4A 3FJYA 3A6LA 3CVJA 1I1HA 3IAM1 2JFZA 3LPNA 3NQ41 4MZXA 4UTXA 2BM0A 5B58T 4F1JA 3FVVA 4KGVA 4W1PA 2RHJA 2PXHA 4IPTA 1CQZA 1M2GA 1L4GA 2YMMA 2Z2XA 4IUYA 3DYBA 3NEAA 2FRDC 3LP6A 1UANA 2MR6A 4AMZA 5LLTA 5L8VA 1AZLA 4ZK6A 1XTUA 4FPXA 1LNQA 4KE8A 4HWRA 5BR8B 3USES 2ZJ7A 1ZUNB 5IAAA 1VHLA 4AN4A 1OD6A 4UHEA 5JSKA 1AA9A 5PNTA 1WCIB 4LY3A 1CEQA 3OLXA 5ELXA 2I65A 2IEDA 3WB1A 1IJFA 2EC5A 1G7RA 4KAJA 4L5BA 1KEEA 3PRJA 2AEEA 3TQRA 3HVRA 2C7RA 3T7SA 2QE6A 1B4DA 4NX2A 4YRPA 3BSSA 4IIXA 3CV3A 4K2AA 1LVHA 1SXGA 2X41A 2W2OA 2EP7A 3REOA 5AIAA 3TLAA 5KSWB 2ORYA 4Q4AB 5HIAA 4GC9A 2YFHA 1EE2A 3DOHA 4QECA 3U4GA 4PPNA 4KREA 4N76A 4LRYA 3LC1O 5EP3A 3QM1A 1EVKA 5G4KA 2HIHA 2PZKA 2ZAMA 2ZVJA 4R1LA 4AKIA 4R5MA 4KACA 3AH8A 3NT5A 5H83A 4EAQA 4B3MB 1TQDA 2WAMA 3ZH9B 1E6WA 4UASA 4FI3C 3TO5A 3DMPA 4BO7A 3NCHA 3UXEA 3VOAA 1UOEA 4GO1A 3HM9A 2VHZA 3L7JA 2Z09A 2NGRA 2EFYA 5AK5A 1EA5A 5KMGB 4EP1A 3DHYA 4OXXA 5KYVA 4KQ6A 2C83A 3NEYA 5AI5A 4IDGA 2OHJA 3IVXA 4MEAA 4DA8A 5A9SB 2YYAA 1FMFA 4PLYA 4BQRA