1U8TA

Crystal structure of chey d13k y106w alone and in complex with a flim peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
125
structure length
125
Chain Sequence
ADKELKFLVVDKFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Constitutively Active Double Mutant CheY(D13K Y106W) Alone and in Complex with a FliM Peptide
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
total genus 40
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1u8tA00
2VK2A 2FQXA 4GNRA 1NXVA 4LDAA 4YWHA 3RVSA 4KVFA 5FWYB 4ZMRA 1DBQA 3CRNA 3GA5A 5TPZD 3HK2A 1QNLA 3Q7RA 4FE7A 4MQFB 4KV7A 4RK0A 2FVYA 4MR9B 4Z4HA 4HNRA 2IPLA 5T7BA 3IP6A 4E7OA 3HXMA 3OQOA 5IEJA 2A9RA 4MRMB 5JNTA 3O21A 2JVJA 5IUNC 5JNWA 2A9OA 2L17A 2JCGA 5EWLA 2PLNA 2E4WA 4UHKA 3L6UA 4EGSA 4OG2A 1EWKA 4JOQA 1ZH2A 3UKJA 2GWRA 1YMUA 2MSWA 3CZ5A 3N6VA 2MSLA 4IMJB 2QSJA 4MRMA 5IULC 3FFWA 3IDOA 5CNJA 1NXSA 3SG0A 1USGA 4W5RA 4G0XA 1DRJA 1JWLA 3KYJB 1SXIA 1JL3A 2O20A 2QVGA 2R25B 2IPMA 3GBVA 3H5VA 3K4HA 3O1HB 4XARA 4IGAA 1WETA 3E61A 4YV7A 1GUBA 3P9YA 1EWVA 4E7PA 2B1JA 3VNAA 3ROTA 3LUAA 4MS1B 3NHZA 5ABPA 4Q6BA 5CNKA 5E3JA 3RVQA 4ZPJA 3HV2A 4YO7A 2CHEA 3LUHA 3GV0A 1YK0A 4TN5A 4N47A 2PUFA 2M98A 3QK7A 3H6GA 3LOPA 3LUDA 1ZY2A 1OXKB 4M88A 1GUDA 1USIA 2PJUA 4LZLA 5TPWB 1NTRA 2PUCA 1RNLA 3M9XA 4KQCA 2J48A 2XDYA 3C3KA 1TLFA 3BRQA 1TMYA 4XXHA 4KNYA 2L2QA 3NHMA 4RK6A 2RJNA 2JK1A 4FE4A 4IF4A 3KLOA 4QYMA 3H5LA 1NXPA 4G0QA 4RK4A 1SRRA 2B4AA 2YHBA 5KQPA 4DN6A 2PE5A 4CBVA 2WB4A 1KMIY 2ZWMA 5JNVA 3O2QB 5FWXA 3KSMA 2LP4Y 2JBAA 4HNSA 3OM1A 3C97A 1D1QA 3T8YA 4EYKA 1DRKA 1MB0A 3FMVA 3HUUA 3GBPA 1NXTA 5TPZA 1M5UA 4N03A 4Z4CA 4F12A 1YS7A 4Z9AA 3CLKA 2H3HA 5IC5A 1JDPA 4F06A 2P9HA 3N0RA 5TQ2A 1GLGA 2JVKA 2A9PA 2NT4A 2KYRA 3OLXA 2JBAB 4ETMA 4RDCA 4ETIA 1U04A 2NUBA 3CG4A 4ZMSA 1D5WA 3RVNA 1NXOA 4LDZA 3OM0A 2WWVD 1JFSA 6ABPA 1AB5A 4RXTA 1VRVA 4FB4A 1TJYA 4Z99A 2QXYA 5TPWA 3RQIA 4YGXB 1Z18A 3O2JA 4MYRA 2IPAB 4OATA 5TQJA 3A10A 1OXBB 3I42A 4MS4A 1XWWA 2HPHA 3CHYA 3SAJA 1RZRD 3A0UA 3QX8A 4MLCA 3Q41A 4JAVC 3RVJA 3UUGA 1JFTA 8ABPA 1ZVVA 1E2BA 4P1ZA 5EWMA 2FMKA 5JNRA 3F73A 3D02A 3C3WA 4QYWA 5BRAA 1SD5A 4LE0A 4WT7A 2GX6A 5DGCA 3T38A 5FWYA 3KS9A 3H5WA 5D2CA 3Q7TA 2JB9A 2AYZA 3F6CA 4RU1A 4RSMA 4Z0NA 3GWGA 2TMYA 5JS2A 3HCWA 2WMYA 3A3KA 3TO5A 1KRWA 2HSGA 4P98A 2GKGA 1L5ZA 4GPAA 4YCSA 4W5QA 1LJUA 3MM4A 4L4UA 4RK5A 1AB6A 1JYEA 1Z12A 4G0YA 4Q7EA 5KC8A 1A04A 3CFYA 4NICA 1PEYA 5KI6A 1BAPA 1PEAA 2IKSA 4LX8A 5GQSA 4N41A 3TD9A 3QELB 4MQEA 4F11A 5BRJA 1VPWA 3Q15C 5KWSA 4RK1A 2FQYA 2ID9A 1ZHHA 2VUIB 4EY3A 3EULA 2LIVA 4EYOA 3OLZA 5FWXB 1QP0A 3GL9A 1Z15A 4KK4A 2MYUA 1C0EA 2E4XA 3HZHA 1QPZA 3KTOA 1EWTA 2RJOA 3FFTA 3NNNA 4XFKA 2VUHB 4S04A 1QP4A 3B2NA 4RK7A 4D74A 1YVUA 4KK3A 5EWMB 3CU5A 1ZN2A 1JYFA 3GYBA 4RS3A 1DBWA 1ZGGA 3G85A 3IP7A 4MR7B 2FEPA 1ISSA 3JPYA 4PEVA 1BDHA 3Q7SA 1R8JA 3EGCA 1NXWA 3IP9A 1UDRA 2MYNA 2HJ9A 5CHYA 1RXEA 4D6XA 1QQBA 3M6MD 1CEYA 4RV5A 2FMIA 1M2EA 1W9HA 2FSPA 1DCKA 1J56A 5B3JA 4JB0A 1U8TA 1P8AA 1YMVA 3BRSA 4NQRA 3RVPA 1P2FA 3QEMA 3W9SA 2FXIA 1S8NA 3RVMA 4MQFA 4O1IA 1MAVA 2AYXA 4MS1A 4WXMA 1E6LA 2WY2D 5HM6A 3BILA 4EVSA 1ZAYA 3C3MA 3OQNA 3QLVC 1EFAA 5KQLA 1C4WA 2PL9A 3EQ2A 1DJMA 2H0AA 1U0SY 2OQRA 4JA2A 3JPWA 3HDGA 4RY0A 1RXIA 1GCGA 3DGFC 4EYQA 1FSPA 3LUGA 1ZGZA 3R0JA 5BQ3A 2CWDA 1P6QA 3DBIA 1U2PA 4EUKA 2R48A 2L19A 3KYIB 3MQ4A 1JDNA 3H5IA 3LUKA 4B09A 1APBA 3ILYA 4OTZA 3BREA 2FEWB 5HSGA 4WUTA 4KQ9A 3MYYA 1TM2A 1QP7A 1BDJA 1D1PA 3KCNA 4MLDA 4RWEA 2GBPA 3BBLA 1M2FA 3FDFA 1GCAA 1MVOA 3DZDA 4LE2A 2BGGA 4KRFA 3SY8A 2HQRA 3N8IA 1CHNA 4IRXA 3C6QA 4YP9A 1A0OA 5CNIA 1M5TA 3I09A 5F64A 1DP4A 4RXMA 3T6KA 2CHFA 1KGSA 2IOYA 2P4UA 3H6HA 4JASB 4KZKA 4LRQA 1PNTA 2HQOA 1JH9A 1MB3A 4KPYA 2A9QA 1DCMA 2OENG 4MS3B 5IBQA 2LUOA 3CNBA 3HM9A 4H3HB 3LMKA 1DBPA 4PE5B 1EHCA 3CS3A 4G0MA 4KREA 4RXUA 4LE1A 1ABFA 3CG0A 1FQWA 4MR8B 5EWJA 1JX6A 2GI4A 3M9WA 2QVCA 5FBKA 4Z9BA 4RKQA 3RVKA 2PUGA 4EVQA 4G0PA 2W42A 3OLWA 3SQNA 1F4VA 1Z17A 1JLKA 3H1EA 3TB6A 2DRIA 1JFVA 3QLUC 4PICA 4MR9A 5DTEA 5TQ2B 4YLEA 3SM9A 4S05A 1NXXA 2F8SA 3HS3A 4XAQA 4Z4EA 2QZJA 3HVRA 2WJAA 1XHEA 4W5NA 1FFWA 3K9CA 5TQ0B 4MPTA 2CD7A 2FLWA 4L85A 4JB2A 1W25A 3ILHA 2RGYA 3GT7A 4OLAA 3MMNA 3LTEA 1KRXA 3O1JC 1YS6A 5I4CA 5JNSA 1YK1A 3RVLA 4W5TA 3S99A 2QW1A 1ZH4A 2FTKE 4Z4FA 1A2OA 1D2AA 1T34A 2NZVG 5TQ0A 3NBMA 1DCFA 3N0WA 5C5EA 1Y1LA 3H1GA 2E4UA 5KQGA 2FMFA 3OO1A 3O74A 3H5OA 4G86A 4WZZA 5ED4A 4QPJC 5C5CA 4EYGA 3QEMB 3HDVA 3MF4A 1TVMA 3N0XA 3FGZA 3H75A 5FBHA 2VYCA 2R47A 1K66A 3TMYA 3F7NA 5EWJB 4ZJPA 2RDMA 2FMHA 3KHTA 3H1FA 3LKBA 1RZRA 3URMA 3RVRA 2WJWA 1EAYA 1ZITA 3VNBA 1JHZA 3QLUA 4TLLB 4ETNA 3JTEA 3E3MA 3N53A 2YHAA 1YIOA 3QX9A 1P6UA 4WWHA 1PHRA 2FW0A 2I6FA 3G1WA 5CNMA 2PUEA 3H5TA 5KQMA 2X7XA 3F6PA 1Z16A 3LFTA 3QELA 4MQEB 1D4ZA 3RH0A 1VKRA 3SNKA 4RKRA 1IIBA 1XHFA 3D8UA 4Z4IA 3KG2A 1Z26A 3JS5A 4QICA 4XASA 1CYEA 2PAFA 3OLYA 1NATA 3MIZA 3A0RB 4UHJA 2ZAYA 1QMPA 2ID7A 4IMIB 2F8TA 2FQWA 4NV3A 4HNQA 3IPCA 3CZCA 4TLMB 1BDIA 4G0ZA 3RVOA 4YR7A 5DKFA 2MYPA 4O1HA 4YRZA 4DADA 3I5AA 4N0PA 5IUKC 3NNDA 1SXGA 1DG9A 4ZYLA 5JNUA 1Z13A 3KKEA 4TMYA 5TE9A 4XLTA 4N0QA 4WXEA 4RZSA 4DQDA 3HSYA 4H3KB 2M1ZA 3T95A 3O2SB 3LUCA 4JP1A 1H9CA 1LBIA 2FN8A 2E4ZA 2LPMA 2FEKA 2V0NA 3EQZA 1QQAA 4NCAA 1E6KA 1QKKA 1Z2EA 3EODA 4Y9TA 4MS3A 2FKAA 4NCBA 1DZ3A 2PMCA 1URPA 3DGEC 1Z2DA 2JRLA 3KLNA 4G97A 3JVIA 3JY6A 3OLVA 4KFCA 2QU7A 2IYNA 2QR3A 3L49A 3LUFA 5DCLA 1F51E 5GOTA 3EAFA 2PUBA 2MYTA 3JVDA 4F3TA 5EWLB 4F8JA 2NZUG 3UK0A 5B3JC 5DLEA 3I45A 3OMWA 3HJFA 1L5YA 7ABPA 1BA2A 3ROFA 1LJLA 2FLKA 4PYRA 3DLHA 3HEBA 2R4QA 4ML3A 2PL1A 5PNTA 6CHYA 1ZESA 1PUXA 5HKOA 3IPAA 4RY9A 1DC7A 3EDCA 1MIHA 1QO0A 9ABPA 3QLVA 3OQMA 1NY5A 1FFSA 2FN9A 1VLZA 3CKMA 5IUJC 3DLBA 4MGEA 3Q9SA 2LBPA 4Q6WA 5IX8A 4N76A 4IILA 1FFGA 1YTUA 4PZ0A 1B00A 4KMRA 1SXHA 2N9UA 3LKVA 3N75A 1E6MA 3O1IC 2WRZA 4HYEA 2E4VA 3OO0A 1JF8A 2JVIA 1HEYA 4EVRA 2MSKA 1DC8A 1JBEA 1LK0A 4D6YA 3GRCA 2PKXA 1RPJA 2PUDA 1Z25A 1BVHA 3HO1A 3TX6A 2NT3A 2E4YA 1I3CA 3CTPA 4MAAA 3IP5A 5HQJA 5IEBA 3QEKA 3O75A 5BR1A 3FFXA 4W5OA 4H60A 3OMXA 1PNRA 4OLBA 2L18A 4O5AA 3QLTA 4G0OA 4MR7A 5T3YA 1K68A 3EJWA 2IPNA 1QO0D 3LUJA 3MA0A 3NNSA 4MS4B 2HQBA 1ABEA 2IDMA 1USKA 5JS1A 4Z4GA 1LBHA 3HUTA 4RY8A 5KC9A 1ISRA 2Q5CA 1ZDMA 1U2QA 4MR8A 4OBBA 4YS6A 2PUAA 2QV0A 3KJXA
chains in the Genus database with same CATH superfamily
1LTHR 2VK2A 4G67A 4B7UA 1MEEA 2OXEA 1T91A 1FPQA 4O2RA 1KY2A 3EWNA 3L4KA 1GYRA 3NW9A 3S4YA 3BEDA 1SIOA 4MR9B 2LDXA 4MI3A 4KVZA 5F23A 1AX9A 3FB1A 1O0BA 2UUBB 2I4NA 3HXMA 2CUNA 3PGVA 2A9RA 3AY6A 1N7JA 3GRAA 2JAHA 2QTZA 4URXR 3LT0A 4CR7A 2L17A 1XRNA 3IC5A 2ZQ5A 2H4XA 1N7HA 4UD6A 2PS0A 3B12A 4QU9A 1L5GB 4Y6PA 3DR3A 1YFZA 2XD4A 1XPUA 4AJJA 1UWVA 1HT1E 4TSFD 4XCVA 5LA6F 1Z2CA 3CZ5A 2FPGB 4K9DA 1WZCA 3HDQA 5H16A 2YZGA 3UPUA 2CUKA 4J1SA 5AICA 1H42A 2B99A 5LNK6 1VE6A 2JI6A 4YP6A 4AF6A 1CY7A 3NHJA 3R76A 5LL6P 3K6SA 1YZGA 2IPMA 1NA5A 4MVJP 2IF2A 1RAFA 2LIPA 1SURA 1LVGA 2WF7A 1Y8RB 3AV3A 1JJAA 3TL2A 4EFLA 3HPQA 3ZV6A 1TEVA 4FILA 5ALYA 3RAGA 1KEUA 4JEIA 1ZRNA 1DJOA 4Q6BA 1FX1A 2Q5JA 1US8B 2VH1A 2GD1O 3FHJA 3G6KA 4JBWA 4BKQA 2YOFA 1PJ8A 5DWDA 3ZCUA 3FKJA 2XWBF 5HQ3A 1XN4A 4D4IA 2HGZA 4OCZA 5F7OA 4MWBA 3Q98A 3UUFA 1NTRA 2QSYA 4M7RA 1ZN8A 2IYPA 3M9XA 3H2YA 1XCJA 5AJWA 3ND9A 2VIIA 1TLFA 1M66A 4MTCA 4LG1A 1M0EA 3AF3A 4IR7A 4WKBA 3GGPA 3TRKA 5ILGA 4H1TA 2FPWA 1KPIA 1XZ8A 2ODNA 5LD2C 4DHEA 3N6XA 5E1BA 1NW8A 3FOBA 1NXPA 1G9TA 2MJLA 4HEHA 4WINA 2EVWX 4TRMA 4QT4A 3I3SR 3K2BA 3MQ2A 2XMQA 4DN6A 5LIRA 1Z63A 4GFDA 2E87A 1N0IA 1XKQA 5KQLA 4O08A 1JDZA 2BEUB 3DP9A 5ICMA 4E5KA 4X54A 2OVBA 2PWYA 4OUKX 2P35A 4M1QA 4OMCA 5BYAA 1FCJA 1DRKA 1MB0A 2X5KO 5K99A 2XZLA 1QHHA 2O7VA 5EE1A 1GO2A 4L7QA 3L84A 5BQPA 1IY1A 3NETA 2MU1A 4PBTA 3D2LA 1Z4PX 2VJBA 3CLKA 3GJ5A 3REGA 3EVAA 4IZHA 4N65A 3QP9A 4C7OB 5JE8A 1DGQA 3RTGA 4M2LA 2HMTA 2P9HA 2RHLA 4F6LA 2PH7A 1NTOA 2BEVA 1NF8A 3SLGA 4MP8A 1U1GA 2DHCA 3G8YA 1XYYA 1QCZA 1II8B 1NN3A 3MJDA 5GMOA 4DCJA 5BNTA 4EWLA 2QUBA 3GZTB 2ZVJA 3WGTA 4F1JA 2DUUA 2OKGA 3FJ1A 2VCHA 4H7PA 4MVYA 3GQBA 4W9MC 5TJ9A 2B92A 3EXFB 4LI0A 4GOOD 4QDKA 6ABPA 1AB5A 2QN2A 3DEIA 1N33B 1VJDA 1ZK3A 3VH1A 2Z1NA 3B8EA 2WU8A 3CSDA 4AMZA 1GADO 4CKWB 4GMKA 3NHFA 4P35A 1S3IA 1L7NA 1E60A 1GZDA 4PX2A 2Q7DA 2YXEA 2QMQA 5TQJA 4A1OA 1H2AS 2UAGA 3QX7A 2PX2A 2QAGA 1X74A 3U4QA 1QX4A 4YR9A 1RWOA 2CXRA 3C41J 3L7JA 4D4GA 3BC1A 3DEZA 2ZUVA 4UFNA 2X5NA 3QVVA 3W7VA 1I7PA 4ZD6A 4EFMA 3SF8A 2QR5A 3D6VA 3VPSA 4M1WA 2FMKA 4RC9A 1G6OA 3SWWA 2VAMA 2ET6A 3LCRA 2ZDGA 4RSRA 5B37A 2G9UA 4JT9A 4LE0A 3WJAA 2I6UA 2QGFA 1MF7A 3PXUA 4P34A 1YE5A 3GHHA 1XNJA 2VXCA 3AJDA 4HAWA 4RSMA 4XFDA 3H0KA 4V0RA 4MYHA 3FE2A 3HZOA 4G8BA 4C0QC 1PFUA 3V4OA 1TM3E 2PAAA 2YXPX 5A7HA 3CW8X 2FYTA 3AUKA 5C1DA 1UQTA 2ZUBA 4M8KA 4MP6A 5CVCA 4BN0A 1QUEA 2JJQA 3LUPA 4YCSA 5B1YA 1K92A 3ETDA 2H1OA 3HRKA 1KPGA 4OV6B 1SQGA 2GRJA 2MDTA 1EDBA 4GLLA 1L5HB 3M7IA 5JZ9A 1DEAA 3ETCA 5ICEA 4BV3A 1XVUA 4YO8A 5EUMA 2WJ4A 2IEZA 2YYAA 3KQVA 4KWEA 3RO7A 3DOHA 4P9NA 1OI4A 1I30A 1EHIA 2G72A 3JR7A 4D9NA 1A4XA 4GHWA 1RQPA 4MULA 4Q1CA 5EMHA 4EYOA 1RKBA 2OGSA 3FBWA 3MCAA 3ST7A 4LC9A 1ZJJA 1JUDA 2EDAA 2W6QA 4FMBB 4IL5A 3NFRA 4X94A 5A7GA 1OLUA 1XD2B 4CV3A 4TTIA 1WUIS 2W6ZA 2HH9A 4GAEA 1G1MA 1MJNA 3OI7A 1VKZA 1E6EA 3WISA 3FFTA 1Y1RA 4BFZA 1F4LA 2OAEA 2WR8A 4NNJA 3ZKAA 1KQFA 2VZEA 2X2PA 4JU9A 5EL0A 2Q0SA 4DKXA 4S04A 4WLFA 4CIVA 1OKKA 4U0KA 1DVRA 2AZTA 3CLVA 3AL0C 5JTTA 1CLUA 3IXLA 3JZIA 5DRYA 4B4DA 1ZGGA 2C96A 1IU9A 4A7PA 2IH2A 3GJTA 2Z04A 1TFRA 2HA0A 4U39A 4XIYA 4Z7NB 4BNJA 1O6GA 3TUJC 3IVMA 1UDRA 3H2ZA 5A4JA 1UBKS 2BCJQ 1GPH1 1KFEB 2HMYB 4H27A 4RH1A 1VG8A 2QY9A 4UNRA 4HP8A 2R65A 3RSCA 4PTYA 2GD0A 1BS2A 2WILA 4WCDA 2QYSA 4MH0R 2C94A 4AY6A 4DRXA 3W9SA 1Y5MA 3HL4A 3IFSA 4UHCA 2B5WA 4JBGA 3G89A 1OX6A 1A4IA 3HGMA 5DDIP 1FY2A 3KHSA 1AHPA 2CLEB 3GRFA 1RQGA 1VMDA 2J3IA 1F8XA 5FPYA 2RE8A 1AKQA 3FUCA 3O7WA 1IZ7A 2ZYRA 4G63A 4PS1A 2PA0A 4PQFA 1QZUA 1REQA 1SA0A 2ACEA 1EB8A 2WFAA 3QTLA 4K05A 3A1CA 4L9WA 5H9WA 3TJRA 1SBQA 1JHOA 1GSHA 2PQ6A 2XIQA 3JALA 1TT5A 2G5TA 4BZZA 1IOLA 1PQYA 2WICA 3ZY2A 1DBVO 3IKMB 5LXTB 1JIIA 5E1DA 1C3JA 1JAYA 1N2XA 2HMUA 1DWOA 4OGLA 4WLOA 4EG4A 5G0SA 2IT1A 2AOUB 2CL0X 4WASA 1VA4A 1VHQA 2IP4A 4NDNE 5B4TA 1IB6A 4NPCA 2C5BA 1L7BA 1QYIA 4DVGA 2MTBA 4WN9A 4DLAA 1GTMA 3EGXB 3U4HA 3HBAA 3X2SA 1T5HX 1SBTA 1N3IA 5DLQC 1FP6A 1SB8A 5ES3A 4BMYA 4F4DA 1GKYA 1JAZA 1OAOA 3AJAA 3FWKA 4KDCA 1X13A 5HNKA 2FDRA 1SUEA 4GGOA 4GH5A 1U2SA 2QLBA 4TTQA 2XT0A 1ZX1A 3R3XA 4JP3A 4L5CA 1JG6A 2FF5A 1A2KC 3BBLA 5KTNA 3OHMA 1DCTA 1UFOA 3VPHA 3GFTA 1TW2A 3M6WA 2HCRA 3DBRB 5E6SA 3LKZA 4RJTA 2BGGA 2Y1OA 1RPZA 1G19A 3L4EA 4D8VA 3VRHA 2RGBA 1GN9A 4D2IA 2Q4RA 1KGSA 4JASB 4X1YA 4LHVA 4IWNA 2W4IA 5DHPA 1VMKA 4KVAA 4BLUA 3WL4A 1RR6A 2ODAA 1DBPA 2IVZA 1PL7A 1T8YA 2QK4A 2SKDA 3P2JA 1DAHA 5CDFE 3LQFA 5FA5A 1I80A 2FHPA 2Y1FA 3T3DA 5AVUA 4JV5B 3MD9A 4V24A 1MT0A 4DLRA 5HX7A 4MV8A 4RKQA 1COZA 2W9XA 1E66A 2GAJA 3BK1A 4A10A 2IE8A 2L69A 3ES9A 4QDOA 5HBGA 5TVGA 5AVKA 3U26A 3CUEF 2VWQA 1R6AA 3DCNA 1VHTA 3PL5A 3AINA 3QVLA 4JELA 5CIQA 2OXIA 3PYXA 3CZQA 3GNTA 4PICA 3PFHA 3U7IA 3LYLA 4EPYA 4CQMA 2ZVQX 3W34A 4ZQBA 1XTTA 2BP7B 2H4YA 3MSXA 3QFRA 5LCXA 4CCSA 2O3QA 4F5DA 1WMDA 4K81B 2C00A 4K5QA 1EUCA 1D1SA 3E5MA 3VR5D 2BEVB 4JQYA 2IEAA 5ENVA 5SYNA 3FNIA 4OJTA 2JIQA 1HTWA 3ABQB 4O6VA 4DBLC 1WE2A 5BXYA 4LF9B 2HLHA 4HMOA 4OYHA 5JI2E 2RHOA 3H87A 4QYTA 5DNCA 1S2GA 4C2AA 2H07A 3OEWA 1UXIA 2V0CA 3BAZA 1UKAA 1WRBA 1GZHB 1XJ5A 1YK1A 4NFLA 4TMZA 3DJFA 3ESRA 3GA0A 2RKOA 4P6VF 4URZR 1T8TA 2FTKE 1X1EA 3AOGA 1FRQA 4BNZA 1NT4A 2QLJA 3FETA 1NN0A 3W77A 4BCDA 5KOJB 2H0QA 1SKUA 3AEQB 3G2KA 5C5EA 1EE2A 3T94A 5DHSA 2CYBA 2NN3C 3CCBA 4G89A 2AMJA 1PFYA 2O1WA 2FMFA 3MXOA 4FFNA 2EJUA 1JFFA 3TEMA 4TTTS 1W0JA 4I5EA 4DA8A 1JEYA 5JG7A 3L7CA 1YJXA 4ZHQB 1DBRA 1K27A 2VT6A 3I8XA 1PZFA 3IDAA 3C45A 3MF4A 1F06A 1GA6A 1PK8A 2JI9A 2QJRA 3BSFA 3OJEA 4IUDS 2QRNA 4KO2S 5I7WA 3WYEA 3AR7A 4LZPA 1P31A 1QYCA 1T5LA 3FZYA 5T3UA 4YRNA 1E69A 1JDVA 3C1TA 3H1FA 1ZNQO 4JBHA 4MQ5A 3ZPXA 1IPHA 2UDPA 3HNPA 2M6LA 4XX0A 2R11A 3HYTA 1EAYA 3Q7EA 4ABTA 4NK5A 3M2PA 4KAXA 1SOUA 1USUA 5EJFA 4Q3EA 4BU0A 3M1AA 1MTOA 1IDOA 1SXJC 4UTRA 1I7DA 1KYWA 1MMFB 2ZQZA 4HDNA 3QBJA 3B53X 4R8KA 5CNMA 2BKVA 5GV7A 5AI0A 2DLCX 3CF4A 3E9EA 1DADA 4IOLA 4MQEB 4KWHA 4BNNA 1HUQA 1CQPA 3UV6A 4O4JB 4EF4A 3H13A 3HQ4O 3IB6A 2I91A 2P4EA 1CD5A 2ZWVA 2VH2A 1XD8A 1E79D 4C9BA 5EJ4A 1SVUA 2I4IA 4JYZA 2PX6A 4A82A 1YMQA 3H9BA 1WX1A 3Q5DA 4YAWA 1CYEA 2D2EA 4WK4B 1NI4B 4L0DA 1Z68A 4IMIB 3QA9A 5YASA 4MV3A 1ONNA 3DULA 1B74A 1CFZA 5EJ5A 1MC4A 4CT5A 1M8FA 4RH0A 2PD3A 5AKZA 4DMCA 5BYJA 3JAWB 3PEWA 1WEKA 1P9LA 3NHAA 4L76A 1XD2A 5AW0A 3CR3C 3UB3A 4A26A 4LJ6A 5EMJA 4DSTA 4ER7A 2GYUA 2Q4DA 3MGCA 4TMYA 3KCQA 4CM1A 4I3GA 2IX3A 3LYAA 2BFDA 2AFVA 1XDBA 3CEAA 3ESBA 4MLZA 1UBSB 1LDYA 2WC1A 1G20A 2JGMA 1SOVA 2NU7B 3W8EA 2NYUA 4W9NA 4MQ4A 3OOEA 2VJKA 4FYXA 4O4IA 4CN9A 3FAZA 1JDBC 3C1OA 5K3EA 1PZEA 3L1IA 3MTBA 1TW3A 4FONA 4U6SA 1KI8A 4ZCQA 4AYTA 4CUKA 3JVIA 3RUAA 3GAFA 3LUFA 5DCLA 5GOTA 5E1OA 4PYMA 4R0VA 3UGQA 2BY4A 3KQUA 2TMDA 1R3UA 3R3HA 1EP3B 3HY3A 1XDUA 3RT1A 3H2SA 4FR0A 3CB2A 1BA2A 4WY8A 2PGIA 1G17A 1WHSB 4QOHA 4F85A 5HYVA 2V9PA 1ZVQA 3HU1A 1ZJYA 2H85A 3K1TA 2IBTA 4YCCA 4OHFA 4OHKA 5K0EA 1QDLB 2B2NA 2CXNA 2QUZA 1Y48E 3C3YA 3IA7A 4HEA6 1M75A 4QE3A 4QTZA 5IW8A 5A9SA 2XBLA 3UJAA 1TKAA 3IPAA 3S2GA 2VWHA 4D99A 4EPVA 5HKOA 4Z9XA 3RV4A 1JSXA 2XI4A 4EBBA 5LUAA 1BZYA 1ECGA 2PL3A 5TEVA 3DO5A 3OJFA 3DE1X 1KJQA 1OIWA 2MCFA 3RASA 4AWXA 3ROQA 2BONA 2JEYA 3K6JA 1WW3A 4LSZA 1AXGA 4WVFA 3TLKA 2AXEA 1B16A 3ANMA 1SH7A 5K0NA 1H3EA 1E6MA 1BJRE 3AEKB 3PWKA 4QPDA 1IHOA 2ZQYA 3DFMA 5FFFA 1FSGA 2Y6VA 1LF0A 3A4MA 3LA8A 4LISA 4DMRA 1B42A 2RAPA 2W6OA 3I2YX 4R2WA 3UUWA 1CEXA 1DUSA 1Q77A 5DMHA 3ZKWB 1H4VB 2W2KA 5EEHA 2C99A 2QVYX 2PUDA 1L7EA 3UQZA 2XXBA 2LE0A 2XCUA 4N5HX 5EIWA 1ZVKA 3GFGA 3D43A 3AT1A 3HCCA 3P4YA 4WZBA 4R0MA 4NJMA 3INGA 2BOVA 5HQJA 3L8DA 4Z86A 3LY5A 1Q7BA 4LWZA 4MNTA 3CN7A 4CLXA 3I8OA 5KTYA 3PNQA 3OMXA 9ATCA 4KYTA 2XCQA 4XCQA 2BCEA 4C0XA 5T5QA 1H8ED 1QCYA 2HL6A 3V1LA 4B47A 4TUYB 5JZSA 4N39A 5E6UB 1FYFA 3IEPA 3GK3A 2E3JA 4RM3A 3AHCA 3NNSA 4UMFA 4XD2A 5DT2A 3IL2A 1RKQA 4J0EA 1XD9A 5A6VA 2EGUA 4IJQA 2VFAA 3KHKA 1CJVC 1JMYA 3AONB 4PRYA 1M2WA 3ZWNA 3HA2A 4UZSA 3L0DA 2RHRA 3PEEA 4B3IA 3WRWA 4AZ3A 2Y93A 4HGOA 5C4MA 4YONB 2RHWA 1FDVA 2AFHA 3O4JA 3W9YA 1M2OA 5HCNA 5DM70 1D2MA 5I9LA 2XUDA 4DQKA 3GJYA 2HW8A 2WTBA 1GGEA 4HI0E 3PPYA 3DF9A 5K3FA 3L0OA 5JATA 5BSVA 5F9FA 3ECCA 2R96A 4K86A 3JYHA 3UUEA 2VLIA 3E8SA 3TCXB 3OQOA 4HGYA 1J0BA 3PQ5A 4BFWA 2E89A 2JCGA 4X84A 1W35A 2RI0A 2RHGB 4I5FA 4M8SA 4MQLA 4INOA 3VU0A 4IGIA 2IYXA 4I50A 4W63A 3DG9A 1SGWA 3VOTA 4MKXA 3DMRA 4OHPA 5IBPA 1OTHA 2J59A 1D07A 5TMPA 3ZNNA 3VSEA 2D5AA 3HI4A 4Z0PA 1QMGA 4X3CA 2CC2A 1TUEA 4G0XA 4BLQA 4NV1A 3UCXA 5JYDA 3T5MA 4BQFA 2R25B 2ZJ7A 3CF4G 4FMCB 1YGPA 4RQTA 4PN7A 2AJDA 2ZVPX 3L9WA 2PV7A 5GONA 4QOJA 4YBRA 1Y4DE 1L4EA 1VIDA 3S3TA 3AEQA 5A06A 2GEJA 3I0MA 1E7YA 1MT3A 5K8LA 1PX2A 3PQEA 1PVVA 2UVPA 3QVTA 4LMRA 3V8RA 9LDTA 1RT9A 2X8LA 3M4JA 5DN9A 3IXMA 2VC2B 3EVZA 1YXMA 3NUZA 2HI0A 4N47A 1K6JA 2B6HA 5LZ5A 2CVQA 3GDFA 5JBNA 1A4UA 2OV2A 4ZCPA 1I24A 3IDZA 2G9VA 4EHLA 1ZY2A 1TJPB 2JFGA 2D3TA 5TPWB 2C2ZA 4NDZA 1Y5NA 4KQCA 4U8HA 2R3SA 8AT1A 1SUWA 4FYVA 5FEMA 1Z36A 2VDMB 4FVTA 3NHMA 3ERCA 4X5OA 3SR3A 3G2MA 2ZIXA 1IXZA 2FSIA 2H2GA 1X70A 2KS6A 1UBNA 3E9ZA 4JJ4A 1WXGA 4C5CA 2R8BA 5KOIA 3BAFA 4A91A 4BMXA 3MGBA 5DRTA 4QBGB 2FEMA 3ND6A 2R68A 2WB4A 4WKPA 3RUPA 5I4BA 2IYAA 2YVKA 4M1OA 5BR7A 4KIGA 3BXHA 4UZFA 1T3SA 4K9OA 4P86A 3AVPA 4C78A 3BH0A 1QLWA 1AS3A 4JHLA 4RF3A 4EYKA 1CYDA 3I4FA 3NX4A 4G5OA 4RKYA 1DFGA 3AFOA 3A37A 3BFVA 3GUZA 3O3NB 1L9KA 3SQXA 5FO1A 4N03A 3JD0A 4EP1A 2C2KA 3KIPA 2QAGC 1SVSA 2XE4A 4J16A 4Z9AA 1L5KA 3ONNA 2AXQA 1HSZA 4GBGA 1UXKA 3VNVA 5AK0A 5J9FA 2OV6A 4AG6A 5L4LA 3GXBA 3KYDA 4C0KA 1FDSA 3Q0EA 5JAZA 4EPRA 4D9MA 4PPFA 5A5EA 1TT7A 3GUYA 2A58A 3CF6R 4CKBB 4BGDA 2POCA 4OFWA 1GQSA 5EIFA 4BP1A 1E7SA 1NHGA 1DKMA 1I01A 3AIOA 3NJ4A 1XI2A 2X8JA 2PY6A 4GXQA 4LWQA 5K4AA 4CF3A 5EE9A 2B35A 4FB4A 5AT1A 3Q9NA 4U2CA 5KWJA 5LQAA 3G0DA 3T1QA 4BFUA 2GYVA 2DETA 4RIIA 1CVLA 4XPIA 3CSUA 2JANA 2XKJE 1PTJC 2WT9A 3MS2A 4KEAA 2B8TA 4MA4A 2WJYA 4NIMA 3ZGNA 1E2MA 2FR0A 2OOSA 3VYUB 1NM5C 3CHYA 4CI9A 3A04A 1X8KA 3HA5A 3QNWA 3V2UA 4HMPA 5KNDD 4PYOA 5TVKA 2NUAA 4ZFNA 4UDOA 2ZBQA 3F73A 5CK5A 5IKOA 1VCIA 1JDTA 2C2YA 4IBOA 3G5AA 4MJLA 4LFCB 4EAAA 1XNQB 3RC8A 1Y6ZA 2ODQA 5I7FA 5D2CA 1TAGA 1RWVA 3JSXA 3H3JA 4D8XA 3KVVA 4B80A 1TJ3A 4L16A 1YJ5A 4PIMA 1CR4A 2VDOB 3QG1A 4E51A 4E07A 4MVJH 4O4LB 3NDRA 3WLPA 1YIDA 1C7QA 3CE6A 4K6FA 1RWKA 2WMNB 1OQAA 2Z6AA 1FLNA 2HLDD 4A8JC 1LJUA 4L9AA 1G60A 4HLQB 3W8NA 3R7WB 1DUVG 3TE6A 1Z5PA 4MK4A 1R50A 4LY9A 1YR8A 1YL7A 1ZP6A 3QELB 1U3DA 5TMBA 5TRTA 5CFMA 3GG9A 1PEKE 3OFJA 1AKRA 3Q15C 1MIOA 3ZOKA 4CTMA 4RDXA 2A1UA 4H0NA 3DVLA 4OL9A 2M6KA 4CMJA 1AU9A 1WB5A 5EIEA 3T7RA 4KGZA 4UVGA 4L0QA 1K5HA 5EE5B 3T3OA 4D25A 4LF5B 1U80A 1XEAA 4ND5A 2PR7A 3IP8A 2H16A 4TVOA 3FHCB 1SKBA 1T9CA 4GKAA 1PFWA 2XOKA 4LOKA 1EWTA 2AK2A 2Q8QA 2BTEA 2Z2KA 1JTFA 2IYRA 3WYGA 4BHTA 1Y1QA 1HE2A 5GZ6A 4D0SA 4QPZA 2JLQA 2HDWA 4UM7A 3THXA 3L7MA 1Y33E 1E1MA 6YASA 3RB8A 3GYBA 2X19A 1AKUA 2AWOA 3HA7A 3B9PA 4YY3B 1WLSA 4E4TA 2PIAA 1ESDA 5JY6A 4L07A 1W0JD 5BSRA 2OXRA 3IEXA 3V2GA 4ZDKA 4PLYA 5KQSA 3EZYA 2BCGY 1AMUA 4QL3A 1Q0SA 1I14A 5CHYA 1GDTA 1W59A 4HAOA 4PFJA 1DL5A 3FB4A 3AI3A 2UZ4A 1FFYA 1HDEA 5KKAA 1V8ZA 3FNQA 3PJDA 4ENVA 2QSZA 4PZCA 3RVPA 1D2RA 2B1IA 2I62A 3KAKA 4DM7A 4M21A 5ISMA 3A1DA 2AR7A 2XMRA 1VMAA 5HZGA 1MJFA 4L6IA 5IG2A 1GTVA 4AUEA 2AFHB 1AKMA 4O1IA 4P5DA 1RYNA 4QSHA 1OX4B 3KM0A 1TUBA 1TMKA 2FE4A 3GEGA 3R0QA 4HRYA 1E6LA 2JH8A 2HIAA 2CYAA 1UT8A 2A0XA 2X77A 4W8GA 1G7CA 4KXUA 3LT2A 5JCPA 4BO1A 3QLVC 3E6AA 4KPUB 3NTOA 4YUYA 3FG9A 2AN3A 2DKOA 1XEFA 1FFEA 4O4JF 4BMPB 2YXBA 5IKEA 3RW9A 5C9ZA 1CE8A 2NVUA 3RTEA 3GNLA 5AM5A 3KETA 4CEJA 5TEWA 3O4VA 3REFA 4FBGA 4YA6A 2D2FA 3ZCSA 5B57C 1U8EA 2PT7A 2CWDA 5LBUA 2YICA 1UOEA 4C3OB 1OMOA 3TOXA 3VKUA 2NZXA 2QN1A 4Q7KA 1ZD3A 4PG4A 3ILSA 4GX1A 4IDHA 4BNHA 3IBYA 3RFFA 1PV2A 4KX3A 5G4KA 1THTA 1X19A 3BXGA 1CV2A 1OHHA 3R1IA 2ZR0A 5HZHA 5CIYA 4GMXA 4BJ6A 1CB7A 4FZ5A 4NZNA 4WH0A 2B8NA 5IVHA 1IM8A 1SXJD 4X7RA 4BGEA 1MEJA 1O58A 2V7PA 3FNGA 4FMCF 4WUTA 1JHDA 4H2DA 5JS7A 1UANA 4PN3A 4H16A 5K0TA 4F8EA 2JDID 4DG8A 1BD3A 4J6EA 1YJCA 3U39A 3EXIA 5JBIA 4FFVA 1M2FA 3GRKA 4JR1A 4DTIA 1YR3A 4GMDA 2ANCA 4L73A 4DIEA 3PGMA 3SDBA 4B4OA 2HN9A 4KAJA 4WNAA 4QRDA 2Y9PB 1O5TA 4URWR 2EW8A 1PNTA 3H2GA 3NATA 3P2YA 5BV8A 3BKWA 5J4LA 4I99A 4U2DA 3R7NA 1Q0RA 4TYWA 1WKVA 3VSBA 1U3TA 4HPWA 2OYRA 2CVFA 3FNFA 1CPYA 1CUZA 1J42A 4XUGB 3EF1A 5LQMA 3MGKA 4LJ8A 2ZI7A 3HEAA 5IVIA 3REQA 3T3PB 3VHLB 1PQPA 4G84A 4PAOA 5FTNA 4MWCA 2QTVB 1YA4A 2GI4A 2QVCA 3K8YA 1LSOA 1KYZA 4P82A 3RVKA 1PT7A 3V32A 8ATCA 2XCRB 4HGPA 3L6DA 5JI3E 5KMGB 3OEED 3MT9A 4G0PA 2G1UA 4JLOA 1LPAB 1T1IA 4XTCS 5IDWA 4PBRA 3CRZA 2LDBA 1HPLA 4HJXA 2DFTA 1EQ2A 2VHZA 3M4YA 4MR9A 4R2MA 4ZQFA 3BM5A 3TZEA 4A0SA 1GCUA 2D0IA 2YZ2A 1PJAA 3WYCA 3GJXC 421PA 4H3VA 3PEYA 3HVRA 2WJAA 3ZHZA 3DWGA 4A8JA 1PJCA 2V7BA 2WUVA 3DM5A 4YMVA 3KYDB 1WXHA 4J03A 2NNLD 3GH1A 2HRBA 4KITB 3BGDA 3OPVA 2C31A 1E2UA 1UZNA 3ILHA 1ZWLA 4DSNA 4C20A 5A4AA 1Q7EA 1YE8A 4H18A 5KJCA 3KOYA 1NNI1 3MFQA 3MMNA 3OCJA 1L4KA 4LTDA 3KTAB 3QENA 4MYTA 4O4IF 1M2KA 1UXGA 2WF9A 4MGIR 3A6EA 5HM8A 2GN8A 221PA 1JTVA 2IRWA 4WA7A 4ZZ0A 3DHNA 2Q99A 4LHWA 1Z6QA 1YUMA 4WKGA 3OVMA 1A7KA 3HABA 4HPJB 1T3ZA 3H5OA 4J16C 1W2GA 4WZZA 4X8MA 5JANA 2C8JA 2V4MA 2P3OA 1W34A 5JHHB 3GEMA 1MXFA 2NGRA 3COZA 3COYA 3UHOA 3AVWA 1X6VA 4JUIA 1TJ5A 4R5HA 3RSGA 2KI5A 3O3CA 3DZHA 1YRYE 3ABIA 3N76A 1ZIDA 4GKKB 3QJ5A 1KYQA 3IH5A 3ZH2A 4EW3A 3RVRA 4EHFA 3L5OA 1HQDA 1QOQB 4UMVA 4AJHA 1CEEA 1P2DA 2FPUA 3VKHA 4P4SB 2GF2A 3O6VA 3CX4A 3ECAA 3E3MA 1CNMA 3I9V1 2O2EA 2QXUA 1XZNA 3M6FA 1Y89A 4J3NA 1XYGA 1Y3DE 3H0CA 3O9VA 4ALJA 4RVUA 2YS7A 4B74A 3EY4A 2WTUA 3ODGA 2ZWPA 1Z28A 3S29A 3P26A 1MZPA 2G7ZA 2QQEA 1GITA 4FFMA 4G8DA 2I7VA 1AF7A 1GNLA 3GGSA 4KOAA 3ASYA 2H7YA 1PCXA 1TMGE 4M1SA 5F5XA 4QICA 1OH5A 4FDUA 2Z09A 3EEFA 3JWIA 1KYIA 3BE4A 5CIWA 4TZKA 2H2AA 1KH2A 4BQEA 4AJEA 2HLDA 1NKSA 4PS0A 5DYYA 1SQSA 1EDZA 2HWKA 1RE0A 2ZUUA 1U0GA 2ZSBA 1RD4A 4HNQA 5AVZA 3NDBB 3RJMA 3RK1A 4B4UA 2Z43A 1BS9A 1CJMA 1QDUA 1T36A 2VVTA 2WA2A 3EBLA 3FYCA 1II8A 4JLVA 1MO5A 4N0PA 1IL0A 4N49A 3DAOA 1HDYA 3QVGB 2IH5A 4HO1X 4BV8A 2HIGA 2YVAA 2W22A 1SCKA 2LKCA 3I6BA 3IBTA 1S7CA 4DDWA 2FZKA 1QS0B 4RZSA 2GGSA 3E3NA 2HA4A 3F8WA 2PV0A 2PKEA 4YT2A 2QJWA 3A1SA 1RZVA 2E4ZA 2J9FA 5CT8A 1H22A 1TADA 3E1GA 1CJCA 3IEUA 4KYVA 4RQBA 4CLRA 3B52X 2VOEA 3FF1A 1E18A 2ASVA 2Z0MA 5DBIA 5HIIA 4B3JA 1Q20A 1RQ7A 5ILOA 1M2JA 3CVUA 1OBHA 2YFHA 2JRLA 3KLNA 4HL6A 3ZGVA 5BMVF 4BC0A 3QWBA 4IH1A 1T5TA 4RHTA 4LXYA 3SF8B 5IDVA 5HHTA 5JPCA 4BFVA 1SXPA 4ER3A 2GN0A 4BNWA 5EWLB 4MVJF 4MV0A 1VCHA 4HB0A 5A5DA 1CRQA 4DANA 3KKKA 5EUBA 1EHYA 3WLSA 5LMZA 4R8RA 3G5UA 4CM6A 1S8AA 1VHWA 1DINA 1HE5A 4BNVA 1SIWA 3QEOA 1Y5LA 3RNLA 3QBDA 1OJ7A 1TYDE 4AVYA 3R9KA 4GX0A 1UK6A 3BULA 4I50F 3Q3JB 2FKNA 3CRVA 1OB2A 3E9NA 5MDHA 5TXGA 3C7TA 4HBZA 2VF7A 2OILA 2ZIEA 3EC7A 4E2YA 4BO7A 4CIAA 1P1KA 3U7QB 3A6HA 4B2IA 2SKCA 1TM4E 3C7KA 3TZHA 1JBQA 3N05A 1T9GR 4QRHA 2V45A 1PI3A 4BFSA 4C76A 4CKEB 3ZLJA 2ZYSA 1S7GA 1QUFA 1M1YB 2VNHA 3DE7X 3DMFA 5EVJA 1K06A 4N0MA 2H4FA 3OECA 3RPEA 4EUNA 4RORA 4BPBA 1A9TA 1IXKA 4YRKA 1MW8X 3ZJYA 5AK5A 5HKAA 2HWXA 1AA9A 3O4RA 5U4QA 3IMKA 3U37A 1FNBA 4A0QA 3GJ0A 4I3HA 1HF3A 4X66B 2RKWA 1F14A 4RVCA 5IJZA 2H9AA 1CC1S 3ORSA 4Y6QA 3LP6A 4F2GA 1XTKA 1V1RB 2OECA 2ODEA 2QI9C 2J0VA 3JD1A 3K0HA 3OESA 1OXSC 3HLKA 3QXSA 5CGQB 5CLFA 4N5MA 4XWGA 5JXIA 2BHTA 4ENWA 2PSSA 2GCNA 4MV9A 1E8MA 3NAGA 1PR9A 1CW2B 2YRXA 4MRSA 4Y9SA 2Z2YA 1JG3A 2J30A 4D97A 2HXYA 3HU5A 3FCXA 4J0GA 4O5AA 4F5ZA 5K8JB 2Q5QA 4RTNA 1CIPA 3F71A 3CX6A 5J47A 4MSUA 2QMYA 1YQWA 5I9SA 1E1QA 2BMVA 2HIMA 1E2EA 1JTEA 4HB2A 3VOAA 5BOSA 5GIPE 1J1IA 3JYOA 3ORRA 3ZWMA 3KOXA 4DMHA 1UPCA 5KU1A 4Q7QA 1QTQA 2R4TA 4QODA 4PYJA 5IFKA 2BGNA 1OAOC 1D04A 3SOPA 3U19A 4P7JA 3GC6A 1KE2A 4WN3A 5LU8A 1G59A 4ZVKA 3GA5A 3V42A 2J0SA 2QTVA 1JDSA 1RYDA 1Q95A 2H00A 4FE3A 3KX2A 4KXLA 3WSTA 4E1VA 4AMBA 2Q2VA 1U7WA 1L3IA 4PNHA 4B6PA 4C21A 3AR6A 3HJGA 3DEHA 5A62A 1U0BB 5LM3A 3RHTA 1M6NA 2XQJA 3O21A 3A2MA 3DC2A 1Z73A 3NHUA 4ZOQI 4W5JA 3HCDA 2AVDA 3HB9A 4BV2A 4Z0HO 4HEQA 4F93B 5B36A 5JRDS 4AN4A 3WK8A 2QYOA 4OG2A 4D8UA 4EGSA 3DT8A 1MQ8B 5CCDA 1B8UA 4EPTA 3RC7A 3RU2A 4EHDA 3OEEA 2C0QA 3VV3A 4EMUA 5AQEA 1E9DA 3A1VA 2IXDA 3HUFA 3P9IA 2IZZA 5G1PA 4CM4B 4DIMA 4R1NA 1RYBA 3R7AA 1NVBA 5JEEA 3T0GA 4M0MA 1EBFA 1I5RA 1DKRA 5HCUA 3UGTA 4Z3OA 3EFEA 3BFKA 3GVIA 2DFLA 1I6MA 1SXQA 5ESDA 2WJPA 4I55A 1KP2A 4F1WA 3R3VA 4M6WB 2HFJA 3IBGA 3KWLA 3RUEA 1OCEA 1JHPA 2W6CX 3GDHA 4GQIA 1FFBA 5L3SA 2ZRPA 3A2LA 4R31A 1Q3HA 4JT4A 4D3DA 1ZL0A 3L2OB 1G3QA 1EPUA 2C8KA 3CX8A 3ZV7A 3QUAA 1T3GA 1OXKB 5F76A 5IANA 1R4ZA 4FHEA 3AF5A 5A7FA 1CU1A 3IODA 4HQNA 1W2HA 1VPLA 2WZDA 2D0PB 4PHGA 1T0BA 1NGSA 1TMYA 1WOYA 4PZAA 5I7AA 3AETA 2ZUEA 2DCUA 3TLJA 4JJFA 2RJNA 1U5BA 4JXJA 5ARDA 1WS6A 4DLNA 4RV4A 3D6AA 1LPMA 3QXGA 1GFIA 3D2CA 2VA9A 1NF9A 3FF4A 4P0TA 4JBIA 5DXAA 3SZOA 2I22A 1K5DA 4TT8A 4GGMX 1GU1A 2H52A 4QXRA 3SHWA 1ST2A 2CBGA 1BWPA 3KFVA 1JSCA 3OM1A 4GR5A 1ORDA 1HX7A 1IWPB 1OC2A 1YB1A 2ZE8A 1EVQA 3ZZ1A 3GBPA 2QXTA 3AXTA 1FYDA 3MJSA 5LP6A 1C7EA 4OXIA 2XBUA 5FPSA 2X0KA 1EFPA 4O0LA 3V7WA 1TOAA 3LY8A 3WLNA 1U7XA 4NAHA 5CB4F 1B14A 4KXNA 1XG5A 3ZWAA 4Y8VA 1DAGA 5FCDA 2YWJA 2Q3DA 2XDWA 1WXEA 2VT3A 4FJ0A 4B6QA 3W6ZA 1U04A 4QUAA 4WBXC 6LDHA 3RVNA 2EP7A 2PUWA 2FZ4A 3B7GA 4UVEA 1PJLA 3FWYA 2RHTA 4UNNA 1H8HA 4GEGA 2BM8A 5E3IA 3U7HB 4MARA 4B3HA 1N5RA 1SEPA 2E55A 3PQ7A 5D01A 2EX1A 2GN6A 3TQFA 2XNHA 3FOEC 3FZEA 3KPUA 2CHVA 3KJNA 3NM6B 4FPXA 4QEKA 5GVRA 4Z1MD 2AR9A 2IU0A 1ZYUA 4OATA 4X3PA 2GSDA 2R6GA 2ZANA 3TGWA 4R84A 3P5SA 1U8XX 2GCEA 1V5EA 3D2BA 1Z56C 3QMVA 1OZ0A 2ZYDA 3Q41A 4XQGA 3CCFA 2Z2ZA 1EFTA 1VHLA 1W73A 3GAZA 1G2QA 1U1CA 3PF9A 4C4PA 4OXKA 5J4YA 2GPBA 2HAEA 3OKCA 4PPYA 1U3UA 4ZHQA 3ISJA 1H66A 2Q2QA 5D8DA 2CVZA 3AILA 5LB2A 1GV1A 1ST3A 4X62B 3N7AA 1KJ8A 4OI2A 1KDVA 3G13A 4QVKA 2ZJ0A 2E6KA 3GWGA 3Q2IA 4FS8A 4J75A 4P36A 4Y2PA 3VUEA 1E9RA 1G8YA 4Y6RA 1JR6A 1V16B 3ZD7A 5DHFA 3GN2A 1BJKA 3VBCA 4E2WA 4P98A 4UDYX 3SS8A 1F1JA 4AX4A 5ALVA 1O94A 1YR9A 4PIVA 1NUQA 2I1VB 2RGNA 4RPHA 3G0HA 2WF5A 2Z1DA 3EHEA 1MXHA 4UQPA 1BU8A 1XZIA 2QHXA 1O6FA 1PQ4A 1ISIA 1JXQA 4ZV7A 1YACA 4P38A 5AJVB 2YMLA 1E2PA 4IICA 1EM6A 3KQYA 4QLBA 3WHPA 4MQEA 1LPPA 4QTUB 2Q6IA 4QM6A 1JW9B 4KIWA 1CUVA 4ZA2A 4UAGA 1ECBA 3MTIA 2B8WA 1TIBA 2AYYA 2VUIB 3QKSB 1N9GB 2B78A 1YZFA 2EFJA 3ICPA 3B2QA 4RPLA 2IY8A 5C7LO 4QGFA 1AK9A 3ADDA 2R87A 4ZK6A 3ZGZA 2P4QA 1YF3A 2B2CA 3G59A 1NZDA 1W0KA 2GILA 3PHHA 4K87A 1A7AA 3PWSA 4XVUA 3K09C 1CB0A 1C0EA 1AGPA 3BT7A 5ALQA 4ALKA 1A8IA 2FMXA 4AY2A 1T1EA 3VKFA 3X1DA 5AIBA 1NWCA 3OWOA 4IKOA 1L5OA 1N7GA 3GJZA 5IDYA 5LP1A 4AS1A 3FROA 1OH8A 4D0GA 1SUCA 2N0SA 2AKEA 3CU5A 4JHXA 2GN1A 1O9HA 4ZT4A 1S02A 1IY9A 1YZKA 5AP9A 4ZO7A 4YMLA 5EPUA 1CJUC 3ABSB 3Q7SA 3EGCA 1Q1QA 4RLQA 4IQ0A 1TK2A 2CSXA 3L05A 4XJXA 4BTEA 1OBFO 4NBLA 1VQ1A 2EQ5A 4FOOA 1H9BA 4N5DA 2O50A 4Q48A 3URKA 2BELA 1XO1A 3DZ8A 2PCLA 5I8PA 1QQBA 2ONYA 4R0NA 3QPAA 3F46A 1CEYA 3CLUD 4PLTA 4R1UA 3ZV3A 3EZGA 3QIAA 3KALA 1R6VA 4I9UA 3BWYA 3G17A 1JKJA 2YJZA 2NYVA 3DHWC 3KUCA 3VR4H 5EZYB 4A03A 3IIEA 2G70A 1KI7A 4H1UA 2QTNA 3M1IA 3KV1A 4BNLA 2F59A 1ZK0A 1QLHA 3JTMA 3CUVA 4NCIA 3RAEC 3DMDA 2JFBA 5JSYA 2PEZA 3RHZA 2CLSA 2FFBA 1UAYA 4DA4A 4BLWA 4DQXA 1RJDA 2QI9F 4GRDA 4YMTA 4JQCA 5F3RA 3NCHA 2K4MA 2XUFA 3TRDA 3ZIUA 1C4WA 2PL9A 3V4RA 1UWKA 2GRAA 5AVWA 2PH3A 5J2UF 3R44A 4MUJA 1VGQA 3WHLA 1PT5A 1XAJA 2FWNA 2J5RA 4ZI3A 5JSZA 3JCZA 5KJFA 4D43A 4LX0A 1FLAA 5SZJA 5DNUA 2OSBA 2BC9A 2O9JA 3SN6A 1T9AA 5I8WA 3W4KA 3VR5H 2VJAA 3K0AA 3KYIB 2NIPA 3RABA 2E5LB 4WFQA 5DBHX 1NJ6A 3EGIA 3G2QA 4GZLA 3LBNA 1X0XA 1ISHA 5E2IA 2R9VA 1GR0A 4GXNA 3A14A 3L8YA 3PLAE 1QHXA 4XWTA 4P4UA 5BSMA 4KQ9A 3MYYA 2HPZA 1LLFA 3R77A 4M6WA 5I3ZA 1NDQA 1QH1B 3B70A 3CPSA 3O4IA 4DJEC 3E3AA 1NRXA 3ROMA 2CLIB 2BZGA 2YS6A 1D3AA 2QTHA 4B8YA 4L8FA 4Q03A 4WZBB 3ZX4A 2DBYA 9MHTA 3C8DA 3BMQA 3L8EA 4PWZA 1E4EB 2XB9A 1LVHA 2O14A 1X42A 2DZDA 5EKSA 2O8EA 1EXWA 3PUHA 4RK1A 1W5SA 1NW9B 2PMBA 4JOCA 4WXPA 1V5GA 4F6RB 1D9XA 1I0ZA 4CN8A 2NX2A 1UFVA 5AKLA 5FI1B 4R8VA 2D62A 3WG9A 4B3CA 4XYEA 3VZSA 5KYWB 1H23A 3LJKA 1C7FA 2PBLA 4RCVA 1LNQA 1KQNA 1PDWA 4PPQA 5JY1A 2IPXA 1UDBA 1ULBA 1V39A 2X8WA 5KVQA 5AW2A 1G63A 3OQHA 3VHRA 4GI7A 4AJOA 3TLZA 2FPOA 3ENQA 3IQGX 5IRCD 3DBHA 1KZHA 5B30A 5FL3A 5C8ZA 1Z17A 3WICA 3T7SA 3NRJA 2R1UA 3ZU5A 3EOBI 4BWGA 5DTEA 3PDIB 5B2ZA 3PYLA 1QKJA 3HFGA 4S05A 2FFAA 5B53A 4UPVA 2ZJ1A 4FSHA 5CB6A 1LFDB 5FEUA 1JVNA 1SKYE 3RRMA 1Q6YA 1GD1O 1GZVA 1P7ZA 1MX5A 1ZO8A 2GM3A 3ASZA 3LU1A 3N2EA 5TQ0B 4DMFA 4F5EA 4FX5A 3NP7A 3VXKA 3OCXA 2GZ2A 2H06A 4L85A 1M1YE 5EERA 4YN3A 4B6OA 1VJ5A 2QRHA 2ZS7A 2Q29A 1NE7A 2NPIA 3BMCA 3L7IA 3W8DA 4Q66C 4H9GA 4C01A 5JNSA 3HDHA 2PRKA 3USES 1GARA 3ETNA 3QXXA 1R74A 4YC7A 2NZVG 1VLVA 4HDOB 5BMVA 1IAVA 1VPVA 1VSTA 3HLTA 1T9HA 2I7TA 3WWEA 4CMGA 4NFYA 1T5BA 1Y9ZA 2X3FA 2DOKA 1R4NB 2J46A 4L4YA 2Y71A 1KNQA 2B61A 2YJNA 3B1KA 2CVPA 5JZMA 1PJSA 2NUPA 2QU8A 1XF1A 1WZNA 2UVPB 3A6FA 1EUZA 3O2NA 1CULC 5JU6A 1ODIA 2JGDB 2QTTA 4FDTA 1E1QD 3HWX1 2HWWA 2KWIA 1JBKA 2WLSA 3BGIA 3NI2A 3VU3A 1V3QE 3WYBA 2FCRA 4YRIA 3D31A 2EZTA 2RHBA 4OO3A 2VT2A 1VLMA 4DQVA 3RKRA 3QU9A 4GG1A 4A73A 2R97A 1EX6A 1RHKA 4DY4A 4EF5A 5JQGF 3EOAI 4TV8F 1B4DA 2YW9A 1V1MA 1G18A 2ZIXB 4HF7A 1Z3CA 1O97D 2DUWA 2O5VA 1JPNA 5JAMA 1FQJA 2FPIA 1CZRA 3C43A 4EHAA 4PSKA 3CW9A 3JVUA 1NP7A 4YDRA 5JJKA 2PMDA 1Z16A 1KEEA 3B8HA 4EGQA 2W93A 4J4HA 4NMWA 1VKRA 5HE8A 1EE9A 4Z4IA 4LCJA 1F5NA 3I2FA 3CA8A 5BO5A 2DP4E 5K3BA 3UA4A 2J67A 1R5NA 1RVV1 2ERCA 3TI9A 3TW4A 3WQRA 1VHDA 1Z0DA 3WVNA 4KQEA 2E49A 2F9FA 4LZZA 4K9SA 4EECA 1R4AA 1UK7A 2PANA 2HDOA 2GJ4A 4XWAA 5IWAB 1ZW1A 5B4VA 5EGNA 2YH2A 5ESWA 4A2WA 1JJVA 2MYPA 1VIVA 4O1HA 3E2IA 2F3RA 4MOWA 5ALDA 3VX4A 1J1UA 1T26A 2XMBA 1W1WA 1VBFA 3DSRA 3OX4A 4NWIA 3FOWA 4IJWA 3KKEA 1OBCA 2OOKA 3HUDA 3R3ZA 5AKGA 3TTTA 3W05A 4JFRA 4XLTA 5K6RA 2HNBA 2ZREA 3N8HA 4EH1A 3PDWA 4N48A 2QLFA 3IR7A 4Q1FA 2JLSA 1HFWA 1NQWA 2XNKA 1YQGA 3PI7A 4OLHA 2Q3LA 3RJZA 2VSNA 2FEKA 3GZ4A 4JC8A 4EA8A 4EJFA 1RWBA 3ZE8A 1DFIA 1QKKA 3QSGA 2W6PA 2X7HA 2OCLA 3ADCA 4GBJA 1QPGA 4FJ1A 4EHBA 3U3MA 2BFWA 3WGUA 1OWMA 4LFBB 2XB8A 4PIPA 1US8A 2QUIA 2G17A 2QR3A 4KXWA 3PJRA 4J2OA 4C22A 3DP7A 4L3WA 1K4KA 3DMGA 2XUZA 1YDWA 2HA7A 3IERA 3HPRA 3W5HA 5JSKA 1BDMA 1NJ2A 2TECE 4H35A 4ND4A 3UCFA 1M1XB 2I4MA 2RGNC 3KXDA 3F3MA 3UQYS 1PS0A 4E33A 1X9HA 2XE8A 4C08A 4GKBA 3CXUA 3D4BA 1ZOLA 1QIJA 1FRZA 2PL1A 2GEFA 2IBMA 3NEPX 4I0WB 4LHZA 3TQTA 1ZLYA 1Z38A 1YZYA 1H2ZA 1J09A 1OTYA 1F0NA 2NO5A 2GK7A 2VAPA 4HS9A 5F52A 5CBPA 5MN6A 4FFWA 2CCGA 3QZUA 5AKEA 3DQZA 4Y98A 5HK9A 1VLZA 3TLEA 2AN5A 1J49A 1PG2A 3MTQA 1KHHA 4J29A 3IBFA 2F1HA 3DOUA 4P32A 2IUEA 3MLAA 4OHRA 4Q3BA 2IIBA 3MYRA 4F71A 1E5LA 1T2AA 1L7OA 1QVZA 3PEVA 1X86B 2O7QA 4B4KA 3KVYA 2A1UB 3L46A 3NUGA 1LPBB 1M73E 1W48A 4ND6A 4GI3A 4PO9A 2BN4A 3O8OB 3DTVB 4HYEA 2W0SA 4BKOA 1SHUX 3OU6A 2JVIA 3ICEA 1V6AA 4OQMA 3MHTA 2JD0A 3KZMA 3ACBA 4M9UA 4Q3KA 5FWDA 4OAPA 2IYFA 4NVRA 5H81A 1YS1X 5AD1A 2FUG1 3E22B 3OPNA 2FPGA 2XDQA 2X1HA 2WG0A 3A7DA 1X2BA 2GTPA 3HBMA 3IX7A 4KSCA 1JKMA 2PH1A 4XDGA 1I51A 2YQ5A 1PUIA 1O03A 4RWZA 5SY4A 2W8BA 3NP9A 2VTEA 3K71B 4YCNA 1I94B 4WUVA 1RWNA 2QD3A 3QUSA 1ZCAA 4KHPB 2FGKA 4K6OA 4JR2A 3VNUA 1EFHA 1WLYA 1MX1A 3OCWA 1YNOA 3C5EA 1M10A 4JROA 4ND2A 3LUJA 1YQXA 2G6BA 5CGZA 1FTYA 3RFVA 3T1TA 4QUEA 2FI1A 4D3YA 5CD9A 1YAJA 1NJFA 1Z2OX 1E3JA 1Z82A 3RG2A 4OH1A 4X91A 1ULHA 2C3PA 3DKPA 3LZCA 3W2IA 1NRIA 3ZDYB 1LY1A 3DUFB 4LXXA 4GPEA 1ZUHA 1YDHA 4AQDA 3T1OA 4D26A 2WAXA 1ZCFA 1N2OA 1W8IA 1HE1C 2XVAA 3COVA 1T2FA 3RRNA 3WWYA 2BLLA 5TPZD 1L4HA 2FWIA 4YX9A 3GVXA 3SSAA 3NRBA 3CWQA 1M9NA 2C2BA 1DBIA 3F7MA 3PHLA 4HNRA 3A3PA 4IOKA 3GEDA 2C5LA 1R0SA 4NEGA 1ZNWA 5HE9A 2OP0A 3LC7O 3O8BA 1YU6A 2ZRQA 1G3UA 2AN4A 3AUJB 1ZXXA 2PSFA 3K1ZA 1L9XA 2Y3IA 3HO8A 1E9BA 1Z4OA 4L8LA 5B3AA 5I48A 3I5XA 2AV6A 5LUBA 4UJ3A 3IB3A 4AN1A 2OFPA 4KLNA 2HR1A 1RQNA 3S40A 1XDSA 1ZI6A 4FEEA 1Z2NX 3KB1A 2C2GA 4PRZA 3DE6X 5F35A 3BWMA 1QIDA 5C35A 1I33A 2QTLA 1G5RA 5FBWB 3TXXA 2O8FA 1HK7A 2XYHA 2WSMA 2ZIWB 4V1CA 4K9RA 2DTXA 2H1VA 1Z6ZA 2J85A 4R83A 1PK9A 5JWOA 4P4NA 5CM8B 5K8IA 2ZJ2A 1AN9A 1QNFA 3UJDA 1KAEA 1OWLA 1P4SA 3OD1A 1RJFA 1O9GA 3SVZA 4YXWA 5FPHA 2X0RA 5K0FA 1Y8QB 4XCXA 1EXDA 1EUDA 1W4CA 3MNFA 4LXUA 1K86A 2ECPA 4PNZA 3CUSA 4ZHQF 1VCNA 3EWAA 4LOLA 4UQOA 1UJ6A 4EDFA 4ZPJA 3TZ6A 1X14A 1LPSA 2N3ZA 5CFLA 5KYKA 4KKXB 3GI1A 5JUWA 2HYIC 4RO0A 4L51A 1W1UA 2ZK7A 2R79A 3DNMA 4Q3OA 3Q9UA 5JARA 4TMTA 1ZQ9A 3A6PC 5H8WA 1KFKB 3OOYA 2BT4A 4AQ7A 2G4CA 2V7UA 4PZPA 2GPTA 3PT5A 4J91A 1NIPA 4LSGA 4CDRA 4Z7OB 5BWLA 1W5TA 3DOEA 1CUYA 1SBHA 1XMPA 3NBAA 4X6LA 5EHIA 1ODFA 3GDOA 3W2HA 1B8VA 5FL7D 1WXWA 3T7KA 3JWGA 4BNDB 5KTTA 1WR8A 3T3IA 4HH3C 3U0BA 4G1FA 4P83A 4EG7A 1P9WA 1CJTC 3BK7A 4U4AA 2MSCB 1JZQA 4JMPA 4QIHA 4ZZ3A 5JNLA 2QTCA 1WEHA 3C7CB 1JAHA 4L08A 5H80A 3E9YA 3W2FA 3WMGA 3ZE6A 5IWCA 1Z0AA 2CZQA 1L1RA 1IZ9A 2NU6B 2AQKA 3JQ8B 3HB0A 4QBKA 4Y9UA 3TX2A 3VDXA 3T1HB 3HTXA 4FOLA 5AOBA 1NQOA 3A8TA 3H1TA 2WM8A 4MA5A 1HYHA 1V26A 2OK8A 4OU5A 2JGRA 1H2RS 3GDWA 3MQFA 3ZY5A 2HLPA 2C9CA 1J33A 2OCXA 3IIKA 3S5UA 3S2ZA 3VDMA 1P3DA 3AJ8A 2JGNA 3E7FA 4RZ2A 4ZAGA 4WLUA 4JYMA 3B3JA 1FLVA 3R6TA 2Y1CA 4PC1A 4CKXA 2Q5HA 3KUDA 4YLYA 1YB4A 3TIIA 4E5NA 4YRMA 4EG6A 1CRWG 1A5AB 1XFDA 3AUXA 3DLAA 1AQ6A 4X97A 1GP2A 1OE0A 2GAFA 5BVGB 5JMOA 1OXBB 2QL6A 5A02A 3L7DA 2RI1A 4I5IA 2EKDA 3BUSA 1WBDA 3I9JA 1K08A 5GV8A 4GYWA 4TYPA 3AU9A 5WRFA 4TM7A 1SVWA 3G5LA 1W4ZA 3PCTA 1NIJA 4G4SO 3KZXA 4YHBA 5AJTA 2QM8A 3PWZA 1KKUA 3QMWA 4J1QA 1UMKA 1V8OA 5COQA 4P8RA 2JFVA 3BDAA 1SVMA 2RHHA 4REQA 2AN9A 2BM9A 4F56A 2BFMA 4F7WA 2YJ6A 1V11B 3DDOA 2XWJI 5LDHA 4YP0A 4RU1A 2EFYA 1AZTA 4PCUA 2IU3A 3VPFA 2KW5A 5G0WA 1A69A 1T43A 5J2TB 3ZWKA 3PSHA 5GOZA 1A71A 1MV8A 3A1TA 4M1KA 4RZXA 2VWGA 3OIFA 4E0BA 3T0FA 4TS9A 3RANA 5JH7F 7GPBA 2P40A 3D8RA 3SJ7A 4GMGA 2I8AA 1Y7HA 1J7JA 2OBLA 3K5PA 1PIWA 2FB9A 3MWEB 5COBA 3CFYA 1XAIA 3PPXA 4I9FA 5FO0A 3TQHA 4AZWA 1XL1A 4KJXA 4TL7A 1T10A 2Z98A 3C6YA 2EFHB 3RC9A 1MV5A 3WOVA 4F11A 1QHNA 3TRHA 1AO0A 3F49S 1CIJA 1VPWA 4RX1A 4Z2YA 3OETA 4TQAA 3QKRB 3EULA 4ZICA 1MNAA 4F4CA 9GPBA 4CQMB 4M0KA 4LY6A 2DPGA 2PX8A 5FWXB 1SXJA 1TKBA 4GVLA 3MCVA 1PNQA 5FUMA 4NU6A 5ERGB 2IYQA 1HDCA 2CLCX 1G6Q1 2QEQA 2YV2A 3TZCA 1BROA 1KAHA 2R1VB 4RMNA 4DSOA 3LOQA 4JJZA 4WJZA 1UJ5A 2XOXA 5DN6A 2EBUA 4QFDA 1XTZA 1NN5A 3BX1A 4BB6A 2PLRA 2R7KA 1XEWX 3LVBA 3MT7A 2JLRA 5J59A 4B3BA 2P68A 3AKCA 5ADUS 3AF0A 4ESVA 1A9RA 2DJIA 1RI5A 1ZINA 2DWCA 1C1XA 4LJ4A 4MR7B 1J8DA 2CB0A 1NLFA 1Z0SA 3NBKA 1I3OA 1PZNA 4NYIR 4R9UC 4X1KB 3KSZO 3QUQA 1Z29A 2WT8A 3AV0B 3QF4A 3WGYA 2XQVA 3UV7A 1NC3A 1T5SA 1WB9A 2HU7A 5DTJA 2JH3A 3C85A 1QG2A 1IPEA 1NUUA 2CJYA 2FSPA 2PRJA 1KXZA 1IK6A 1I1OA 2RBEA 5KINB 1PBTA 3B1YA 3QE3A 3AY3A 4TV9A 2XCLA 4ZIRA 2FXIA 2WJVA 3L01A 1AF4A 2KHZA 4MQFA 5HR5A 1TAUA 1Y1PA 2BV3A 3MJEA 4TV8B 1J8YF 1YO6A 3DKRA 1GRCA 4WFJA 2ENUA 1J2RA 2X9GA 3BB3A 3BIOA 4HWOA 4PG7A 4IKEA 5CYGA 4EJ2A 3PPIA 1IPFA 5HFNA 3ZHQA 2Q0QA 1EFAA 4QASA 4TS3A 1FDTA 1EFKA 1J0CA 3EQ2A 4GM4A 3HNRA 4NDAA 3S1AA 5JIBA 2VZ9A 3JPWA 1RYFA 4OU4A 4ZYTA 3DAGA 3TSCA 1N34B 3HB4X 3BXZA 2I2DA 2BTQA 1AS0A 4TYMA 4UDNA 3TLBA 4ZDWA 3R0JA 3WKBA 4CQJA 1W8DA 2Y66A 3A26A 2QZPA 3CONA 3BJEA 4HMQA 1Y1TA 2OPHA 5EMMA 3L0YA 5KVSA 3GG2A 3L1VA 1X8XA 1TJ4A 3H5IA 3HJHA 4XRGA 3VO2A 3UEOA 5EC8A 1MGPA 1XJQA 2JCSA 2Y99A 1M2VB 1TTPB 2YIJA 3GT3A 2WV7A 3MW8A 1W46A 4ZRDA 3U4DA 4EB6B 1N0UA 3IAFA 1FK8A 1VI5A 5C7YA 1I8TA 5DLPA 2PUHA 3W3AD 1IBMB 2IX9A 1HZZC 3Q88A 3EUWA 2QN6A 1HT2E 2OD7A 5CCBA 2XVXA 2G1PA 1ORHA 2BGWA 4WDQA 2H1IA 1GTSA 2ZDHA 4AKGA 1DRVA 4K6MA 4GZ5A 4AU1A 3FCAA 1QYVA 5KOJA 1IYZA 1XBTA 3A27A 2G04A 1YVPA 2FZ5A 2JCXA 5HJEA 5J4VA 1UKZA 1DB3A 4O4IB 3WYDA 4QU5A 4KPYA 1NF2A 2JJ1D 4R9RA 1DMRA 4U2KA 4FX2A 3R7FA 1EMDA 2A14A 3BICA 3H8WA 4ARSA 4F2PA 2VYNA 2DFDA 4WAUA 1RHRA 3DTTA 2VZ8A 2IWRA 4CCYB 4RXUA 2X8BA 3OY2A 1N2IA 1F9EA 1Z4IA 2EKZA 2EWMA 3O31A 2ONCA 5TARA 3RUIA 1X7DA 3ZQKA 3I04A 4KPEC 4FFBB 2WIGA 1QB8A 4C7KA 4IHAA 1T1RA 3B3GA 1VJ1A 4K7JA 4MDFA 5IDXA 3OLWA 3ZD9A 2PRIA 2DRIA 1FMFA 3TNYA 3T1VA 3KR0A 4YLEA 4ZMBA 1EVZA 3KP1A 2RH9B 2RMKA 3PFWO 3WKEA 3S2EA 3TS1A 4B5KA 3FCUB 4W5NA 3HLYA 4PC7A 2R6R1 4U7FA 1MPXA 2RGRA 1L7XA 2OAP1 4LJAA 2G5GX 1FB5A 3PHIA 3S2FA 4OQPA 3UH1A 3ZXYA 2XTNA 1C50A 1W96A 2KX7A 1VM6A 2AMLA 1IXRC 4BO5A 1L8XA 1WF3A 3TRIA 4IUBS 1BKSB 2IP1A 4R9SA 5IVPA 1H0HA 4S0XA 1SKYB 4MJ7A 4ZCLA 2G7MC 5L3SB 4GMHA 1GZ7A 1HTBA 1QAQA 2VYVD 3FZGA 4GOLD 4HDMB 2CKDA 4NMMA 3DDNA 4ASUA 5AM0A 4WFIA 4S0ZA 4IDOA 3QVUA 4TKVB 2EQBA 4F9GA 1QFZA 4JI4B 1T0UA 3DHVA 3KBOA 3PGXA 3QE2A 4LOJA 5AI5A 5KPJA 1XMXA 2VSXA 1OWNA 3CUUA 3LCJA 1SJ9A 3RS8A 2J0UA 2Z8ZA 4P7GA 2NZ8A 1UODA 1TE2A 3FPGA 2GJAA 2YKGA 2RAUA 3OCCA 2JIPA 4O2LA 3BMNA 4N82A 3RROA 3W2GA 5GZ1A 1KZ9A 3V1KA 2LCFA 4X44A 5KTSA 1FSZA 4FNMA 4IQGA 1HDGO 3WL7A 4PLWA 4PZEA 3BXOA 3R09A 3T7TA 5EP2A 1DRWA 3O90A 4WD3A 5T7BA 1NW4A 3RUHA 2E0IA 1MJHA 1ZM3A 3B38A 2P6MA 3WNBA 4X71A 2QRUA 3ZDQA 3IHTA 2W2QA 2VDKB 1XTVA 3QU5A 3DW1X 2GDZA 2VQDA 4V3BA 2JFQA 5BSEA 3N53A 3AF4A 2FP3A 1FZTA 4X61A 4B9EA 2O3JA 3KB6A 2C20A 2OWEA 1IG3A 4QXAA 4KDEA 3F6PA 1HV8A 5AUPB 2KB0A 4IIDA 2FWJA 3ZHOA 1WDTA 4P3PA 5ESRA 3UAZA 4JQZA 1B76A 4ASUD 4YV1A 2JFZA 2ZT7A 3TL6A 4DV2B 2CXUA 1LS6A 4DR5B 2XPCA 3KZNA 1KU6A 1YCFA 4DAEA 1UK8A 3G3EA 3PTZA 3ZDZB 4MKHA 4XWYA 3C8HA 1ORVA 3EDRA 5KKCA 1Q0TA 4JBXA 4KGDA 1ESMA 3BWXA 4Y7DA 4LRXA 2A88A 3VR3D 4EG5A 2UZAA 3DKIA 5CDFA 1Z6GA 2WNIA 1DMSA 3KLMX 4FC7A 1PWXA 4XOUA 2ZRGA 3R3YA 1QTIA 1U7UA 4I1VA 3A4VA 2XKKA 3AVXA 4HGNA 1Z13A 1ZVMA 4DREA 3NPAA 4A36A 3MJVA 1VFPA 2K2WA 1KH3A 4OHBA 4D4KA 4F9FA 4ZGGA 4PXYA 3AXSA 1M1NB 1KZ4A 3TF5A 4H3SA 3P97A 4WKCA 3CH6A 1XLTC 2ADOA 3VDNB 2V0NA 1A7JA 2HQ1A 3DKVA 2PLAA 3EQZA 5KHAA 3RYTC 3KB8A 3VTAA 4ZAXA 4J6FA 1JR2A 1H2FA 1S5PA 1L3BA 1DX9A 3IOEA 1EXMA 1U0NA 4KE9A 4REMA 4XVQA 3B6IA 4I1RA 1YE3A 1NAIA 1DIAA 2D7CA 2P9QA 3D1VA 2PRYA 2ZUTA 3O47A 3JY6A 3QI7A 1K7SN 2NO7A 4QNNA 3CJTA 1TVKB 3VNRA 3MG9A 1RWQA 3DLTA 5KJ1A 1GVNB 1RJ9A 1BE0A 1FXWF 1PR5A 2AHOA 2JIRA 4IX1A 2VDRB 4JD5A 4GQBA 5G1NA 1LDNA 2HPVA 2M6SA 3DWIA 1TQ6A 2ZR7A 3O93A 5A2QA 3SBEA 2GD2A 4GLBA 4DDTA 3VVMA 3V00A 1JHAA 1F1BA 5EPEA 2OC4A 2HSJA 4EO7A 1PJRA 1S6YA 2ZSEA 2ZYTX 3I1JA 4KR7A 4IX9A 3F6RA 2VDLB 6Q21A 3UG6A 2VAXA 4WSOA 1RYHA 3TXYA 1DAFA 2DUNA 3KWJA 1B8OA 1VB3A 3KKNA 4BVAA 4F86A 4PYLA 2IOHA 4KXXA 3S1AB 4YRAA 2OY0A 1YKFA 2EBFX 1VOTA 3EVBA 3G8BA 1O96B 4MGEA 4N9QA 2I0FA 3GNQA 3FPJA 2ZBGA 4IW3B 1PF7E 1DEKA 3CLTC 1U02A 1J2JA 4PX9A 1P75A 1SHZA 4PLCA 2IEGA 2YV3A 5G02A 3ICQB 3QKSA 3UWOA 1M76A 2RC5A 4MPJA 3U80A 3P9RA 4JLMA 2I8CA 4A2QA 4D9JA 4EYSA 1HT3A 1HEYA 1YQDA 3E4DA 3WL8A 2NLOA 5CT5A 2G1JA 2YJGA 3E1SA 3NUQA 5AK6A 2YASA 2AIRA 2DY0A 4G5SA 4B3RB 3ZDCA 1QRAA 3RUDA 3UMBA 3UYLA 1QSGA 5ICGA 4YAJA 2X8JB 3QSYA 4DR1B 1W94A 2H2DA 4N7MA 4MV4A 2OXCA 1E7MA 4BE7B 4Q3AA 2Q4BA 2EKBA 5DCYA 5AVVA 1ECFA 1Z4JA 1Y42X 2PYZA 5FADA 5IM5A 1X9GA 5BW8A 2ZT8A 1QO0D 1KP9A 1SU8A 1ZM4A 2FX3A 2X76A 3FLMA 2IPOA 4P2BA 4HVLA 3V4LA 5FJIA 4BIMA 2ZB4A 4I4TF 4IDEA 4BVJA 2X6RA 3RIXA 2PU5A 3EVEA 4QX6A 1TM7E 3ZYCA 4ADSG 1NW5A 1THMA 3LWDA 2R1TB 4UATA 1QP8A 4XB1A 4JLPA 4A0RA 4YT5A 1IUOA 1JKJB 4XAQA 2BGLA 1H6CA 4KQXA 2O0MA 3NMUF 4GKVA 3EF0A 1IOWA 1I4OA 4KVFA 1RDFA 4UXHA 4B6JA 4ZMRA 7REQA 3Q7RA 2XCIA 1N2CE 3KYCB 1YH3A 3WYAA 3KT3A 3HCEA 5LD2B 1J07A 4KQJA 1QGDA 3CEPB 1MC8A 2VBFA 3R5KA 3Q7IA 3HE3A 4H17A 1B26A 1P5ZB 1WD7A 2RONA 3H4TA 4IMPA 2F1RA 2P27A 3KEGA 1DX6A 1YUBA 4BAGA 4L78A 3OM8A 3VHQA 1AV6A 5NULA 4LVNA 5A1JA 2WKRA 3FWNA 1SHTX 3LDFA 4RVOA 2IUTA 4RMGA 3TLAA 2MSWA 5ECWA 4JGGA 3O91A 2MSLA 5CJJA 1I1HA 3HHPA 4OEHA 2BISA 1IQRA 3B1JA 2PD4A 1OF1A 1U7HA 5ERXA 1JHUA 3ISTA 2ZWOA 4W5RA 3BL5A 3BH6A 1Q1AA 4B7AA 5LZ4A 2FETA 4JLJA 3C4QA 1MH1A 1U2DC 1VKHA 3LL4A 4G41A 4I7EA 1PLJA 2B34A 4ER0A 3F4KA 4KB5A 2WSSA 5IASA 1ZC3A 3G8AA 5I9MA 1TJNA 4Y2XA 4OB8A 3QYPA 2ZYAA 5EIOA 4TKVA 2XH8A 2GEVA 3C16C 3ZY6A 3ED1A 4HH0A 5EIXA 4ZVTA 5JASA 5DNAA 2AKAB 2GPJA 4A4DA 3RVDA 1ZLXA 4LQ4A 1P81A 2ZIGA 4DIFA 3RYIB 2UZ1B 2YVQA 2PJUA 1D2CA 1DHTA 3G2IA 2V7XA 1RNLA 3BIWA 3HY6A 5D7NA 3CEMA 2XDYA 3E5RA 1NXQA 2EGHA 3BRQA 1H65A 1VE9A 4IUYA 4BEBA 3THYA 2L2QA 3KOZA 3NH9A 4LCEA 1O4WA 1NASA 2SICE 3CBQA 2G1AA 4IXTA 1R16A 3Q3CA 2R1ZA 3EISA 4OM7A 1J20A 5AI9A 4K26A 5J4HA 1C30A 2B5VA 3PEUA 5FWNA 5JNVA 2DBRA 4F3RA 2GKOA 3CVWA 1H0RA 3BZUA 3OFND 2C9YA 1E4OA 3H16A 3AEXA 5H9VA 2W4QA 3T7JA 1D0VA 1QQ5A 2IUSA 3FMVA 5L3RA 2AZMA 3UHJA 4I4TB 4ZVNA 3CQ9A 1NXTA 5DW3A 5EIAA 2QOEA 1J24A 3NWOA 4Z4CA 1R66A 1BMQA 4E4RA 4BNYA 2CLLB 4F96A 5IC5A 2DCMA 2XF8A 1NL3A 3QXHA 3PDIA 4MHTA 3HC7A 4KQKA 3HXTA 1I2AA 1YJQA 3I37X 1TO2E 1NDUA 3OLXA 1RAIA 1K5GA 1SU6A 2QZ9A 1NZJA 5EHXA 1YRBA 5CB4B 1KC3A 1NFRA 4HDKA 4WLEA 3NHWA 1DTWA 1UINA 2C83A 1D8AA 4CEJB 5FBRB 5HKKA 2CUZA 3HWWA 1OJLA 2Q3JA 3D81A 4ATNA 4HYQA 1U2RA 2I78A 2XZPA 3ENZA 4Q9IA 3HBFA 5DJ5A 2J0QA 3TKYA 1A98A 3RS5A 3ZZTA 1V48A 3FVQA 3TRFA 3WB9A 3I6ZA 1XWWA 2EG5A 4HRXA 3SKXA 1B6TA 4M1MA 4EG8A 4JAVC 5HJ7A 2UKDA 2IEIA 5B64A 2AXPA 5KYUB 2QA5A 3LX8A 2GH1A 4QG7A 3TDKA 3HXOA 4AC9A 1GR1A 4ZQGA 4PFKA 5A71A 3DT6A 5EIBD 5DW0A 3T38A 1ZQ1A 2EERA 1T9GS 3OPYA 1IQPA 4ANFA 4ALLA 1P4GA 4JC0A 2AYZA 4NBTA 3S2SA 2CNOA 3OOWA 3L7NA 5HJ5A 3B5EA 1U0LA 1E79A 1NU6A 2K7ZA 3DMYA 3E2MA 4IYJA 1KRWA 3PUJA 1ZHFA 4B3FX 1E3IA 1BCSA 1MEOA 2YBEA 5D3MB 3IT2A 4L7VA 3SC2B 4BNGA 4RK5A 3Q3VA 2C59A 1AB6A 5AW1A 1Z83A 2COUA 3ROKA 4BMOB 4MUNA 4Q7EA 4JYCA 3LHDA 4HAZA 5I9TA 3ZIAD 3EK2A 1NKTA 2BUAA 4CPDA 2VI5A 3LG2A 3TD9A 5M2QA 1WCXA 2YVUA 1WM1A 1C81A 1KZ6A 1SVKA 1T8UA 1UDAA 2HXSA 1ZHHA 2PS3A 1PG0A 1FE8A 3A9WA 2REXB 4IPTA 4B6GA 4BNUA 4EA9A 2QG4A 2WFLB 3AG5A 4BMCA 4WECA 4URHA 1QLJA 4FFPA 1C8LA 2UYQA 4D8YA 3EXEA 3UPTA 5GZ3A 1U8FO 1Y7LA 4A8JB 4F2WA 3FSRA 3KTOA 4ITUA 2VNIA 4QYSA 3ROZA 5IBCA 4RFLA 3WNQA 1QP4A 2ZJ6A 3VAZA 3WRXA 1A8HA 3DOFA 4JZYA 3FDJA 1HO3A 2QM0A 3GMSA 3NG1A 2HJWA 1ZN7A 1YBVA 2H1WA 1OLUB 5DX8A 5KOHB 3W5DA 3HR7A 1ISSA 2NO1A 5AVJA 3GT0A 3OWHA 1NXWA 1RZ3A 2FJPA 3UK7A 4MZXA 3NV9A 4AKEA 2HD4A 1FUKA 1ZRMA 2Z5GA 4EA7A 1VBNA 3QUTA 2J32A 4NHOA 3SKYA 1U0RA 4IDPA 4L27A 4Q1BA 4RJIA 4ESHA 5E4FA 5CTJA 3FRJA 3BRSA 3I1IA 1YMVA 2E4AA 4MIYA 4MRVA 5FLKA 4TPKA 4RENA 4FM9A 1NE2A 4OBEA 4OI0A 3QFSA 3GCZA 4ZP1A 2R1TA 3TNDA 2P7HA 1J25A 1VIAA 2VP3A 3DAPA 3DJYA 3SX4A 2YHSA 1V41E 5AW9A 2QQ5A 2AYXA 3ROGA 2DULA 1F8UA 2PGOA 2CNKA 2QQGA