1U8TA

Crystal structure of chey d13k y106w alone and in complex with a flim peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
125
structure length
125
Chain Sequence
ADKELKFLVVDKFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
publication title Structure of the Constitutively Active Double Mutant CheY(D13K Y106W) Alone and in Complex with a FliM Peptide
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 40
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1u8tA00
4IGAA 2QVCA 1J56A 4D6XA 4EYOA 4M88A 2F8TA 2FMFA 5EWMB 2MSWA 2QVGA 5EWJB 5TPWA 4F12A 3RVSA 1ZESA 3F6PA 2JB9A 1RZRD 3RVNA 3HSYA 2PUCA 1MB3A 1QQBA 4MR9B 4B09A 3SAJA 1E6KA 3MF4A 2OQRA 5I4CA 1F4VA 1URPA 3L49A 1Z13A 2MYTA 4DQDA 1QP4A 2FXIA 5IEBA 1WETA 4FB4A 2XDYA 3CS3A 4OBBA 5TPZA 4ZMSA 2O20A 4RKQA 2RDMA 3HDGA 3K9CA 5CNJA 5KQMA 4D6YA 4G0OA 1BA2A 2HJ9A 1GUBA 4PYRA 5IC5A 4KPYA 5BQ3A 2CD7A 2FMKA 3Q7RA 3SG0A 3RVOA 3OLXA 3UUGA 4F3TA 2MYPA 3IPAA 3NNSA 1QKKA 4HNSA 2HSGA 4KQ9A 1RPJA 3QELB 2QW1A 3CKMA 3MM4A 3OQOA 3H6GA 4MR7A 1P2FA 1LBIA 1ZVVA 3IP7A 4Z4EA 2P9HA 4MR8A 1PNRA 4MQFA 3KLOA 2PUEA 4WXMA 4NCBA 1NXWA 4MYRA 3I5AA 3CU5A 4EYKA 3LUKA 2CWDA 2VUHB 4XAQA 4YP9A 3LKBA 4H3KB 4HNRA 4L85A 5CNKA 3QLVC 3UKJA 4ZYLA 1YS7A 1YMVA 4Y9TA 1S8NA 5HKOA 4Q6BA 4TLMB 4RZSA 1R8JA 1CHNA 3QLUA 3Q41A 2FEPA 1XHFA 2PE5A 3T6KA 2ZAYA 3I45A 1NTRA 1USGA 2MSKA 2GWRA 1BVHA 5HSGA 4Q7EA 4GPAA 4N0QA 3N8IA 2ID7A 1F51E 1U04A 2E4YA 5CHYA 3H1GA 3GYBA 2R4QA 2E4XA 3Q15C 2IPNA 2QV0A 5FWXB 3BRQA 4Z4IA 3OM1A 4Z9BA 4OLBA 3P9YA 2PLNA 4PEVA 3H6HA 1U0SY 1MB0A 4DN6A 2JBAA 3HS3A 4MS3B 5BRJA 6CHYA 5KQGA 5DCLA 1KRWA 4OATA 5IUNC 1Z2EA 1KGSA 3HZHA 1EHCA 3I09A 3H5OA 4JAVC 2LP4Y 4MR9A 2A9QA 4OLAA 5GQSA 4D74A 4LZLA 1SXIA 3EGCA 1BDHA 3T8YA 3K4HA 3URMA 4F11A 1DC7A 2GKGA 3JTEA 3SQNA 2M98A 2GBPA 4MS1B 3CHYA 3H5LA 3D02A 4PICA 3N53A 4LDZA 5EWLB 3QX8A 4MS4B 2ZWMA 3UK0A 1YK1A 4YRZA 4HYEA 1QQAA 3MQ4A 1QO0D 1Z18A 3CZ5A 5TQ2B 3T95A 3M6MD 1FFSA 1VLZA 3Q7TA 1ZHHA 4G0XA 4W5QA 4FE7A 5TQJA 3A3KA 1U2PA 3LUAA 1GCAA 1M2FA 3HUUA 2PJUA 3LTEA 2QU7A 3NBMA 5TE9A 4RY0A 4N47A 3TB6A 4YR7A 5JNVA 3QLUC 3RVJA 1A2OA 3QELA 3F73A 3HK2A 1DBQA 2JK1A 1JFVA 3EQ2A 3O1HB 4YLEA 5JNUA 4H60A 3H75A 4MLDA 3GL9A 4G0QA 2MYNA 4L4UA 1UDRA 3ROFA 3BILA 3FDFA 4EYQA 1JH9A 2JVJA 2DRIA 3H5TA 4Z0NA 3QLVA 4EGSA 3CG0A 2VK2A 4QYMA 1XHEA 4DADA 2E4ZA 3E61A 2RJNA 1Z15A 2CHEA 3C97A 3RVQA 4EVSA 4Z4CA 3O75A 2VYCA 1TVMA 4JASB 2FW0A 3OO0A 4ETNA 3N0RA 3OMWA 2LPMA 1D1QA 3SY8A 4ML3A 4RDCA 4LE0A 4NV3A 4WT7A 3DGFC 1ZGZA 3Q7SA 4E7OA 4N76A 4MRMA 1YMUA 1JYFA 3HO1A 4CBVA 1ZY2A 2JVIA 4KFCA 2L18A 3C3KA 2FQWA 3EAFA 3H5VA 5C5EA 1YVUA 1GCGA 3GA5A 3H5WA 1DCMA 1JLKA 3IDOA 3A10A 1ABEA 4RK6A 3RVLA 5FWYB 1W25A 2IDMA 1ZITA 2FN9A 3MA0A 4H3HB 5F64A 3LUDA 1PHRA 4RY8A 5TQ0B 1FSPA 3L6UA 1FQWA 4HNQA 2R25B 4XXHA 3OLVA 1DRKA 2LBPA 5B3JA 1RNLA 3EULA 3OLYA 3O21A 4MQEA 4F06A 2QR3A 3FGZA 4S04A 2PUAA 1MVOA 4IF4A 5CNIA 2WY2D 1ZN2A 4W5OA 3H1EA 3OQMA 1SRRA 1TJYA 3HM9A 3QEMA 1BAPA 5DKFA 1A0OA 4N41A 5ED4A 3IP6A 2M1ZA 2NT4A 5TQ2A 4G0YA 5T7BA 3DLBA 1Z25A 1VPWA 3VNBA 3DGEC 2HQRA 1K68A 1P6UA 5JNWA 4W5RA 2FN8A 4RV5A 3KS9A 1Z17A 4UHKA 1DBPA 1XWWA 3H5IA 4KV7A 4OTZA 3SM9A 5KC9A 4ZMRA 1TLFA 4S05A 3RH0A 3C6QA 3ILHA 1APBA 2FSPA 3RVRA 4N0PA 3NHZA 5IBQA 4RY9A 3KHTA 5DTEA 3OO1A 3OM0A 5FBHA 2QXYA 1RXIA 1D1PA 3VNAA 1SXGA 3HV2A 3O74A 3QEKA 4KQCA 4G97A 1NXOA 2LIVA 1Y1LA 4G0ZA 3A0UA 3FMVA 4LE1A 1L5YA 2WJAA 4KK3A 5TPWB 4Q6WA 3G1WA 5EWMA 5EWJA 1ZGGA 5ABPA 1P8AA 1RZRA 1BDIA 3QK7A 4JP1A 4RK5A 1T34A 3OLZA 1B00A 2PUGA 1USIA 1CYEA 5HM6A 3JS5A 1GLGA 4NICA 3GRCA 1C4WA 3QLTA 1L5ZA 1OXBB 1QMPA 1U8TA 5TPZD 4EVQA 2IOYA 3N75A 4ZJPA 1TMYA 1W9HA 2HPHA 2PUDA 2FQYA 3CTPA 5B3JC 3KSMA 4NQRA 3DBIA 2FTKE 2WRZA 1SD5A 4MPTA 4PZ0A 2HQBA 3LUGA 1USKA 3CLKA 1ZH2A 3QX9A 4KREA 1LBHA 2PMCA 2TMYA 3O1IC 1DC8A 3Q9SA 1PNTA 1JBEA 1A04A 4QICA 2IKSA 5TQ0A 2X7XA 1U2QA 1LJUA 3EDCA 3O2SB 2AYXA 4QYWA 3S99A 1OXKB 4RK4A 1QP0A 1JL3A 3DLHA 4G0PA 1E6MA 4N03A 4MR8B 3NNNA 4JA2A 4O5AA 5JS2A 4NCAA 2FVYA 4KNYA 5T3YA 1DG9A 4MQFB 4EY3A 4MGEA 2FMHA 2RJOA 3RVKA 4P1ZA 2I6FA 1JDPA 1JDNA 1EWTA 3BBLA 2FLKA 4RWEA 2V0NA 4RXMA 4JB0A 4LRQA 1ABFA 3N6VA 4IILA 2MYUA 4G86A 1YIOA 1AB5A 1PEAA 2PL9A 2IPAB 4RK0A 3T38A 3IPCA 2BGGA 2L2QA 1BDJA 3JPWA 1QP7A 1EFAA 3JVDA 2GI4A 2B4AA 2B1JA 3FFXA 1NXSA 2E4VA 5IUJC 1SXHA 6ABPA 3C3WA 3ROTA 1ISRA 1JX6A 3M9WA 2AYZA 5IX8A 2J48A 2A9OA 3LMKA 4IRXA 5BRAA 2N9UA 2RGYA 3F7NA 4FE4A 5HQJA 2NT3A 1YK0A 4ETMA 3TMYA 4LDAA 3CG4A 2Q5CA 4IMJB 4YCSA 5FWXA 2FEKA 3FFWA 4YWHA 2WB4A 2PL1A 1JFTA 4OG2A 8ABPA 4F8JA 3GT7A 3LOPA 1DRJA 2JBAB 5KQPA 1EWKA 2WJWA 3NHMA 4MS3A 3ILYA 3LUHA 2PUBA 2WWVD 2FEWB 1I3CA 1E2BA 4Z4FA 2IPLA 2E4WA 3MYYA 3RQIA 3JVIA 1QNLA 4YV7A 1JYEA 2GX6A 4YS6A 5JS1A 4RXTA 1Z26A 2IPMA 4MAAA 3KYIB 3N0WA 3KG2A 5JNSA 2P4UA 2FMIA 1D2AA 3EODA 4EVRA 1NXTA 1ISSA 4XLTA 2MSLA 4MS1A 4GNRA 2VUIB 2YHAA 5IULC 3F6CA 3HDVA 4MLCA 5EWLA 5KWSA 4MS4A 3IP9A 3R0JA 4RKRA 9ABPA 2R47A 3DZDA 1QO0A 1JHZA 1JF8A 3M9XA 4XFKA 5PNTA 4RU1A 1CEYA 4WUTA 2A9RA 5GOTA 3SNKA 5BR1A 5C5CA 4TLLB 3HXMA 1AB6A 1DJMA 5KQLA 1LJLA 2NZUG 1FFGA 2JCGA 2H3HA 3CRNA 1M5UA 4Z9AA 2E4UA 3KYJB 3OLWA 2PAFA 3GV0A 2HQOA 3LUFA 7ABPA 1JWLA 2FQXA 3IP5A 1C0EA 3D8UA 3HUTA 1DCKA 1MAVA 2JRLA 1PUXA 1DZ3A 3LUCA 4Z4GA 4ZPJA 3RVMA 2PKXA 4WXEA 5DLEA 1D5WA 3C3MA 4WWHA 1VKRA 3TD9A 3B2NA 1QPZA 3HEBA 3LKVA 2PUFA 3MIZA 1H9CA 2NZVG 1VRVA 3JY6A 3NNDA 1JFSA 3TO5A 1NXPA 3EQZA 1ZAYA 4RS3A 5KC8A 3LFTA 1DCFA 3N0XA 3GWGA 2W42A 5CNMA 4JB2A 1YS6A 2H0AA 4XARA 1TM2A 4ETIA 2IYNA 4MRMB 3TX6A 1M2EA 2CHFA 3HCWA 4E7PA 1IIBA 1EWVA 2KYRA 2F8SA 1M5TA 5JNRA 3HVRA 1DBWA 4KRFA 1D4ZA 3BRSA 5IUKC 4KMRA 3KJXA 3CNBA 3KKEA 1NATA 3FFTA 3BREA 5FWYA 5FBKA 4Z4HA 3KTOA 4RSMA 4UHJA 3KCNA 1ZH4A 2YHBA 3O2JA 4EUKA 2A9PA 3I42A 2R48A 3G85A 4TN5A 4MQEB 4TMYA 3O1JC 4MR7B 2NUBA 5D2CA 2WMYA 3HJFA 2L19A 4QPJC 2L17A 4EYGA 1GUDA 3OQNA 3QEMB 3E3MA 3OMXA 1K66A 4WZZA 1LK0A 3H1FA 2JVKA 4XASA 3W9SA 5IEJA 4O1HA 3JPYA 2OENG 3LUJA 4O1IA 3EJWA 1YTUA 1DP4A 1E6LA 1Z12A 1ZDMA 3KLNA 2FLWA 4KK4A 4KVFA 4RXUA 2LUOA 1NXVA 1Z16A 4IMIB 3GBPA 4PE5B 1FFWA 1HEYA 4RK7A 2ID9A 1NXXA 4LX8A 1KMIY 2QSJA 4W5NA 1RXEA 1Z2DA 5DGCA 4YGXB 1EAYA 1P6QA 1NY5A 3CZCA 2QZJA 5E3JA 3RVPA 5JNTA 1KRXA 4KZKA 4JOQA 3GBVA 3O2QB 3CFYA 4RK1A 1MIHA 4W5TA 4LE2A 4P98A 1PEYA 4G0MA 4YO7A 4Z99A 2FKAA 5KI6A 3A0RB 3MMNA
chains in the Genus database with same CATH superfamily
3IT2A 4IGAA 4R2HA 1MB2A 4AN4A 5IXJA 1EGVB 3AKZA 1IVYA 1TEVA 4LOJA 2H7XA 2CW5A 5E9WA 1TYZA 4WN9A 2BE9A 10MHA 4TSFD 3ESDA 1F6BA 2J09A 3EIEA 3KR0A 4M0CA 1ZSYA 2Q5QA 3HCBA 4G5SA 1T0JB 1RMYA 3N70A 3GZTB 2H54A 2YOGA 5CP8A 3ZC3A 1VL0A 5IWAB 2WE8A 1R15A 3ANLA 3N07A 2F1RA 1I6KA 3REGA 3RROA 4V1CB 2QMEA 2GAAA 2F8MA 3KWFA 4XIIA 3HUEA 1W19A 1GHTA 1OI4A 2FFAA 1C0KA 4ZEXA 4CV1A 1J7JA 1PX0A 4ZOLF 3FYCA 2IZ1A 1XZHA 4LQLA 4XWGA 1TB4A 2GZ2A 4QEKA 5GADl 5D3QA 4Z7OB 5CNJA 1K7XB 1W9MA 4BCCA 2FPRA 2NO1A 3RWOA 1PV1A 1PJSA 3I2KA 5AVYA 4MMXB 5ILQA 4FW9A 3VMMA 4IL5A 2OLKA 1FW8A 3H5NA 4MP8A 4PYRA 1ADYA 3EC1A 4YRDA 2HGSA 1N0VC 5E6SB 4AO8A 1TO6A 2FMKA 5AO9A 1G21A 5BQ3A 5BVHB 3V7NA 2PV7A 2D0DA 2GNOA 1P74A 3FWZA 4WVFA 5T8KA 3VOBA 3WWPA 3SLRA 5EEGA 4X24A 5BRNA 1KY5A 1RVV1 2FDCA 2KSQA 3L6OO 4JR2A 5FKJA 1RXWA 3H19A 4GLFA 4POAA 1O96A 4YYZA 1Y3DE 1PZHA 2R6JA 4E2XA 3OE7A 5BN1A 4X65B 1LWOA 4JU8A 1KIMA 2DSTA 1IY1A 1J7KA 2QN8A 3ON5A 5BN4A 3KLOA 1YC5A 4WXMA 2PKQP 5FA5A 4ER7A 4DDMA 4MYRA 3HMQA 4NOMA 2AX3A 5JYBA 1WTCA 1RM3A 4RMGA 1RWKA 3IQDB 2DUUA 5DBOA 4H3KB 1YMVA 3OEYA 5HKOA 3BXGA 4G8DA 4YJKA 5BNIA 2B78A 3BJIC 4PSAA 4L4YA 4BP9A 5H3CA 3BXHA 3HP7A 2Y0BA 2GXAA 1V7CA 4P86A 3F3YA 4PNHA 5KJEA 4CG2A 4YCDA 2PX6A 1F51E 2OECA 3OX4A 2QROA 4DY4A 4K88A 4RPGA 3IUNA 4MKZA 3U2QA 2XTNA 3LPLA 7YASA 3H8VA 1KP9A 3L1UA 3Q1KA 4HEHA 3CMCO 4AD8A 4YIHA 3LW8A 5HHTA 5JBIA 2DWUA 4XM2A 2O8FB 3OU2A 1GSIA 3Q3CA 2AJCA 1A7AA 4KB5A 3DQPA 2J5BA 3ISVA 3BB3A 2FF5A 3LUBA 1DE0A 3M5CA 1RYYA 4PO8A 4Q3AA 3ADCA 2CK3D 1Q5PA 4ZOLB 4CMBA 3MAJA 2VJDA 4DC9A 3A11A 3SBXA 4Q4LA 3HS3A 3QXCA 2J3EA 2IV2X 3G5LA 3M49A 4AVYA 1J97A 3NFYA 1KGSA 3EVFA 4KQEA 1H3FA 1ODTC 4JU9A 4PXAA 3V4VB 1NPTO 1NGSA 1XJWA 3VRHA 5L4SA 1CB0A 1XBTA 2ABWA 3CRVA 3DLIA 2BGWA 3LRTA 3R5HA 2ZPAA 4YDHB 1WUKS 3K4HA 4KSYA 4BFWA 1MG5A 3PDUA 3PQ8A 4F4DA 1FDIA 1F6WA 5H4HA 2VATA 3AEYA 3ZCSA 4P83A 2JGJA 5HQ3B 3KTAB 4HPJB 4LDZA 3RRJA 4EF4A 5ICSA 2BUCA 2EBWA 2F6RA 4HYEA 1RABA 4KDCA 1Z7BA 3W2HA 1QZTA 4TMWA 1Z63A 1QQ6A 2ERYA 3H1BA 3RVDA 3VI4B 5E1BA 2I6UA 1SQ5A 3M1LA 3LC7O 4R1OA 1EJ6A 2JKYA 4HY3A 4I6GA 3WZMA 2PEZA 4CKBB 1ZHHA 4DABA 4FN5A 1T2UA 2VNJA 3HJNA 2GJ9A 4XYLA 1Q1GA 1BXRA 2I1QA 3C3JA 4Y2XA 3VPBA 3R9WA 2HWKA 3KCQA 4AJLA 1T26A 1NVAA 4A73A 3GJQA 1TQ6A 1QX4A 4QUIA 5DW3A 4D3DA 2B5VA 2ZIFA 3KEOA 1PWHA 3BAFA 3JZMA 4QPCA 3AI7A 1DBQA 4BE4A 2JG3A 3IAS6 1C1DB 3RODA 1X87A 2XRFA 4IIUA 1AU9A 2W48A 5TMDA 3NP7A 4Z4QA 4I4TF 2PX4A 2RHWA 3P26A 3PEYA 3QFTA 1AX9A 5P21A 4HLUA 2C04A 1RJWA 1Y1RA 1MO2A 1GPAA 3K9GA 4EGSA 3IMGA 3CG0A 3OA2A 1E1QA 1P5RA 1XZFA 2ZRFA 4ZQGA 4N18A 1UP7A 3F74A 3FGNA 4Q18A 5JQGB 3LG2A 2VTBA 1I9CA 1FU8A 2QE6A 4OQZA 2XOXA 4EJ6A 1UXIA 4AX8A 2ATEA 2W2LA 4IAOA 2FN7A 3R0XA 4Z8XA 5LZ9A 3OMWA 4NPHA 2QVBA 2X8LA 3SY8A 2VNSA 4REQB 2JARA 1F9EA 2IF2A 3PXDA 4NV3A 3UY4A 4Q3CA 3BMCA 3ROKA 3I9LA 3EVZA 1MOQA 1O7JA 4JJ6A 4YAEA 3OCCA 3SX4A 4CM4B 4AF7A 2Y9MB 2CEKA 4M1QA 4E0BA 2GTPA 3ZWKA 3GFFA 2W2KB 1H1LB 4KPGA 1NR1A 1SBCA 4KX5A 4R7ZA 4A1OA 1GYRA 4MUNA 3NBYC 2O8FA 1Z5PA 3IXQA 2PR2A 3AK4A 3F90A 3PIRA 1I30A 1QVZA 1Q0ZA 3OQ6A 1QZ3A 1B3BA 1R0WA 3G7SA 3S1SA 3OSZA 3MW8A 3COVA 4MRRA 4O4HF 5LQDA 1Q57A 2C97A 2WHXA 4ZCQA 3BIXA 3K4PA 3O9ZA 4OYYA 1N2HA 4CT5A 3MQFA 2PGDA 2QQFA 2AS0A 3IR7A 1Y42X 3QFHA 5MN4A 3KETA 4JI8B 4HNQA 2BCEA 1EWRA 1GL9B 1E9CA 2AR7A 3P4UA 4FINA 2C1ZA 4L1KA 1NW9B 2O52A 1RHQA 3O21A 2RKOA 2YVLA 4GGPA 2I80A 3Q0EA 3DBRB 4OL9A 5DBHX 4RD1A 1PJ2A 5LZ5A 2W2XA 5HQ3A 3KTAA 4GMFA 4INJA 2J5KA 4XYEA 3GLGE 1NZDA 4YP7A 3MS2A 1NN1A 4P22A 4Z54A 3VDRA 5KYXB 4I4TB 4MA0A 1X77A 3PS9A 1OIWA 4HLUC 1KTVA 4H16A 2VLIA 5CYGA 4ATNA 4RA9B 4F4UA 1P77A 1U9JA 4W5RA 4RV5A 2ZP1A 4PYNA 3EIXA 3WLHA 4CEJB 2EARA 1KAOA 1W4BA 5HEKA 4EFKA 3RC1A 4AJ1A 2LKCA 3AR7A 4TQGA 4QXMA 4RHTA 4BX2A 3KFLA 4S1WA 2B4YA 2YN2A 3FROA 4DCGA 3VNUA 2W0SA 2FWMX 1C1DA 2ZYDA 2FUCA 4U2FA 2C2MA 3QPUA 4FNGA 1PT6A 5DEOA 4MW7A 5G4KA 3TLBA 3N8DA 4C5AA 1WDTA 4RF4A 5DXJA 2QM3A 4L07A 4BJHB 4C06A 1V37A 4L8GA 4DA4A 4CM9D 4QUDA 2AH5A 3FDXA 2BFFB 1QHHA 3WBKA 2FPIB 5JQGA 4KK3A 4DG9A 1R0YA 2OFXA 1P8JA 4IOKA 2HIAA 1UJ6A 4PU0A 3SF0A 4HUTA 4R51A 2Z2JA 3RJZA 1TUEA 3NHBA 4NLLA 1T9ZA 1P8AA 2YMMA 1PNVA 3BRCA 2A9JA 3LX4A 3PUYA 3R09A 5G0SA 3DF9A 4O4HB 2Z1NA 1KC3A 4REQA 1BYIA 1WDLA 2IU6A 2Q4BA 1TQ8A 3KZKA 4XRRA 5IJ0A 3ZTYA 5E9QA 1XZQA 4PTLA 2H06A 1II9A 4O29A 5EA2A 1R88A 5J5VA 4BUJA 3QG5A 4F86A 4QGBA 1ICEA 1BKSB 1U2GA 1W9HA 3GRKA 4NE9A 2JH3A 2WVJA 2WRZA 4NEQA 3G1UA 2ZI4A 1D6JA 5EQTA 3OPMA 4N12A 2ZYHA 2YJZA 5JSHA 1QHGA 4LDQA 2EBHX 1CK4A 3UKDA 4EG7A 4UDYX 1KBZA 3AY6A 4DBVO 4WEQA 2G36A 4I4NA 3A9RA 4TZKA 1GU1A 4GBJA 2GZ1A 3DHNA 4FFSA 1G8GA 4JT8A 1ZM9A 1GWNA 4WK6A 3KSAC 4OYRA 3K8ZA 4WY2A 3P19A 4QX6A 5COQA 5A1JA 5FOQA 1R6BX 3Q2OA 1EP2B 4AURA 1K3UB 4GPBA 4KR9A 3INYA 2ZM6B 1JECA 1HSZA 2RHCA 1H85A 4IX1A 3VU1A 3CUUA 2KB0A 3L0PA 1QQ7A 2Q8PA 3K0CA 3NWJA 4I4TA 4Q3OA 4L8VA 3QWIA 4BZPA 3CX8A 1AKYA 1GQSA 3FVVA 4RA9A 2PL9A 1YB4A 4CCWA 5ICMA 1RAHA 5JFOA 2IXDA 3ETLA 4HAXA 1T24A 2QSUA 4NBWA 4WBXC 5GM2A 4IEEA 1JDJA 3T38A 3FCCA 3P2MA 4YAUA 5JCPA 4CEJA 1GKLA 1BRMA 4D98A 3FFXA 3SICE 2KBEA 1VZ2A 5LQJA 1JEJA 5AVVA 2ZDHA 3U5TA 2B69A 3DE6X 3GRPA 2RBKA 3UOGA 2YJ3A 4EW1A 4KQWA 2Q3BA 1P4HA 3PZRA 4OGGA 4LFBB 4J2OA 4ZA2A 3KKMA 1M0WA 2CFCA 2QYHA 1UKAA 3IKMB 4BBZA 2VJCA 5DEIA 2PL5A 2J4FA 3LQ4A 2F1KA 1PL0A 1QOQB 2DEUA 4IJUA 3HXQA 1YVEI 4WZ6A 3RF7A 1CUDA 3FPCA 3PR3A 4BO3A 1U2GC 5KYTA 2O8CB 4IR7A 3EPJA 1EH5A 1IPHA 1W0KD 1PJTA 1Z73A 4HQKA 3AEQB 3L92A 4LJ4A 1AN9A 3ZE2B 3ZJUA 1BXGA 3EDOA 4BHTA 4DM7A 1CFJA 1CJVC 2JCXA 2BUAA 1WSDA 2CUTA 2ZE8A 3CQ9A 3QE2A 4FYKA 4UKDA 2A4KA 5DMXA 2IPLA 1E2BA 3EHEA 3C8DA 4A23A 4B9AA 3I1FA 5UKDA 4UPDA 2REBA 3COYA 5ESDA 3MWYW 5IASA 1TADA 1IH8A 1UM9B 1Z26A 1ZD3A 3IUEA 3MJ4A 4L5IA 2FN4A 1V25A 3DDSA 2COEA 3VHQA 3ZHTA 5JNSA 1GFIA 5EZSA 1YNOA 4KQIA 1THMA 4H27A 1SZPA 2NWQA 4OHKA 4GNRA 2OD2A 1M9NA 4WOKA 3TGWA 4MLCA 2C7BA 2XCUA 1PSDA 3BD7A 2VNAA 4M1OA 4MS4A 4PZDA 3T3GA 2V7BA 4AYXA 4BGVA 3UWSA 1TNDA 2WVAA 5DN6A 5C1OA 3O91A 4EA7A 4LHXA 1Y4UA 3QNWA 4TXMA 1GFSA 4RJ2A 4MQLA 4AZWA 2NGRA 1USWA 4M1EA 3HDTA 2Z4SA 4IQ0A 3ZNPA 3K0CC 1KVQA 1OZAA 4ZCSA 2OA0A 3AYZB 1LLCA 2OXFA 2RHGB 2VT2A 1NP7A 2Y3IA 3EIOA 2F59A 1FLVA 4BQEA 1G17A 1P1RA 1P1IA 2UVPB 3GBSA 1S4QA 3K9FC 2AC7A 4JVSB 1Z83A 4UHCA 1NR5A 2D2IA 3NPMA 3AP2A 2WLSA 3ZY6A 2BEVB 2IHJA 3X44A 1GNRA 2R6R1 2AFHB 3IL2A 1QRTA 3JAWA 4I46A 5DASA 1Q7RA 3U4GA 5ESWA 3VH3A 1MD9A 2XXAA 5EIBC 4HXEB 1WW3A 4KEAA 5EPUA 3TIIA 1TEXA 1PNQA 2DWOA 2NZ8A 1ZD1A 1JG3A 3OE1A 2PRJA 1SQSA 4PLHA 2EEZA 1PD0A 2JD0A 3B2NA 4M8NE 1GGKA 1XU9A 3HEBA 5TX7A 2WU0A 1U7OA 3JALA 5CX1A 1ONBA 3U3MA 1BKDR 4XSVA 1RADA 4HTFB 3T5GA 1K6IA 5AK3A 5KOIA 5KQSA 1ZD2P 3N0XA 5CB4F 2AK2A 4MVXA 4HVAA 1QTNA 2HU7A 2IYTA 4QOHA 3V4SA 2I4LA 2M2IA 4RJKA 5DDIP 2ZTUA 4DCSA 3MD0A 2FCAA 4FUTA 3GCDA 3ZXSA 3TX6A 3PYXA 4H7HA 2QLFA 1TAQA 4U7TB 1YD7A 3STXA 1G4UR 1OPXA 1YRHA 1EP9A 2A9KA 2OM2A 3FPAA 3MCTA 3JQBA 3RHTA 1AGXA 1YB2A 2QXUA 3B20A 3II6X 1EWVA 3EPLA 2OV6A 1R00A 2X9QA 2QX4A 3GEHA 1IY9A 3VHXB 1ARZA 5IUKC 4X41A 3CF4A 3HCEA 2YXEA 3VDQA 5CA0F 4E5SA 1EEXB 3CNBA 3QFFA 2O14A 4BQQA 4A0QA 3PTZA 3I61A 2C3YA 3GFRA 4QGHA 2Q1TA 4OM8A 1DRWA 5FI0B 4KGXA 1J8YF 1M1YA 3KCNA 4URFA 2QSZA 4OGFA 4M83A 3TL2A 1HI9A 4UCXA 1QP8A 4IPTA 1TC1A 3RPEA 1QX3A 5I7FA 2CV2A 1E1RD 2HOQA 2AT1A 4PHCA 1UM9A 1RYHA 5JHGB 1J4AA 3A4TA 3M89A 5LPNA 1H2RS 1FLDA 4LMBA 3E0QA 3LL7A 1R8YA 2L19A 4AMYA 2WVGA 4BN0A 1QZXA 2HV9A 5TGTA 1LK0A 5FYDA 3RG2A 3R24A 4B7AA 4AJIA 4TYPA 3FX2A 4HH1A 1PS0A 4TMFA 5JAPA 1GTJ1 5E1DA 3A6LA 1M8PA 1MPXA 3W06A 3UAWA 4PE5B 3HXOA 1XK6A 2VH5R 2O2HA 5AKZA 4G37A 1Q0LA 2ID9A 2VHYA 3R9IA 3RW9A 1CX9B 5CAEA 1KMIY 2WOOA 2D3WA 2VRCD 2R00A 3AEKB 4YGXB 4DCUA 4XIYA 4D4MA 2UVPA 2WG0A 2QZJA 3H5RA 2H9AA 1ZRHA 4CIXA 3F0TA 1QS0B 3GFOA 2A4MA 1GAWA 2Q1WA 3GA0A 4QJ3A 5H59A 1R37A 5IH7A 2BEVA 3DDOA 3DHEA 2VUUA 1A7JA 3DOIA 1OV4A 3MMNA 1YUBA 4F5ZA 3AJRA 1BW9B 4L9AA 5LBIA 4I3GA 1T1IA 3RU2A 3I6MA 4YRQA 1REQB 3UBTA 2H4WA 1SUDA 1SZJG 1Y3CE 3A05A 1M2VA 5ICCA 1E58A 3RIMA 3ZBPA 4IIJA 1FFBA 5JMOA 4HTFA 3EFEA 2SKEA 1FMJA 4RCVA 3AF3A 5CA0B 5A4KA 1DU4A 1MB3A 2GFQA 1K6EA 1CUJA 3GNLA 3I9OA 5K99A 1QQBA 3O4HA 1BGXT 1ZX1A 2XADA 3MK31 4IVRA 1C30B 2BHNA 4JIGA 4UU8A 4IV8A 3ZQ4A 2I0FA 3UNXA 1WL8A 2A92A 1GRCA 4UUPA 2DR3A 2FUG6 2L69A 1X74A 1Y9DA 2OQIA 2ZBFA 3KQTA 4G07A 1UBCA 2NYRA 4BVAA 4YT4A 5DE3A 5DF1A 4BFXA 2NVOA 4U7HA 3VR4A 4GM1A 3A1DA 3W9YA 4B2PA 3L0DA 4PZZA 2W9XA 3H8WA 4G5OA 1O9HA 5IC5A 5K3BA 1NNLA 1VG0B 5SICE 1KQGA 3UAGA 2FPUA 4GOLD 4X63A 3SI7A 3IDFA 4PFJA 4QAJA 2ZDGA 1PNOA 1T4MA 2IU4A 2JZNA 1QFSA 3AZPA 1Z0KA 3IAUA 4UMFA 3C0KA 2R00C 2A57A 4HFNA 2BGUA 2X8JA 4FGSA 1LBIA 5AFSA 5DIFA 4B6QA 1TZJA 4WRRA 4AQ7A 1ZJYA 1ZOPA 3GEGA 3CXRA 1A8PA 5IW8A 4E08A 3DM5A 2QRVB 3FKSD 3CU5A 1L5FA 1J39A 1WY7A 4G9BA 3TQIA 4HNRA 4L5CA 1HV8A 3QLVC 1T9CA 2YS7A 4X7MA 2J0VA 4BVJA 3M2TA 1XMQB 1DQYA 3NT2A 1VSBA 4DANA 3K2EA 1R8JA 1E0AA 1SFRA 3OTIA 3JQAB 5AXDA 1Q95A 3NTOA 1RE0A 3KV3O 5KHAA 1ZU5A 3ZEAA 5KYWA 1NX9A 3AEKA 3LQFA 3P9IA 1YWGO 2P35A 4QARA 3ZV6A 5KYYA 1UBMS 4N0QA 1CBUA 2J6IA 2NU7B 3UIEA 2ID7A 1UJCA 1Z39A 4ERXA 4YMHA 2B3TA 1XCJA 3BIFA 4HV4A 2Y1FA 5A9SA 5CB4A 4YMLA 2V9ZA 1GZ3A 1DTWA 4ISCA 2OGTA 3IEKA 4DIMA 2ZYGA 3FDZA 3UT6A 3G2IA 4GQAA 4BLUA 2POCA 2I8LA 4MLPA 3JQ9A 4BDTA 2GEKA 4Z4IA 1VLMA 4JC5A 2EC5A 2EXXA 2DT5A 1REQA 2QVLA 3GEMA 3CEPB 4TKUA 3SN6A 4AB1A 5IJ9B 3GN2A 3TDKA 1PL8A 4G1CA 3TZEA 3WB9A 4RA6B 1O0CA 3MHPA 3NT5A 3TZCA 2Y1CA 1ZOOA 2AG5A 3DV9A 2DCUA 1Y8RB 3EG9B 4UBKA 3UJHA 4C3UA 2P2ZA 3EEYA 2NP6A 1X2BA 3HBNA 1O87A 3GQBB 2FW8A 4EW2A 1XAJA 1EK1A 1P1KA 1R6TA 1DTEA 3KZVA 5SY9A 3T7RA 2IGBA 3SQNA 1NBMD 3NHWA 2VRWA 1JTVA 3NQ41 1MXHA 4DJFC 4CMEA 1TQ2A 1WIWA 4UZSA 1B0UA 1RPNA 1UC5B 4FPXA 1QK4A 3A7EA 1YE5A 3AB3A 4RJTA 1SCJA 1E79D 1TM7E 3R2JA 4JS0A 4QD3A 1VMIA 3KQUA 4EG8A 6PFKA 4JX8A 1D03A 2VLBA 2PMFA 1K9SA 2XUKA 1XYVA 4HH0A 1E0JA 1RYNA 2NYUA 4ZK6A 2R8YA 1V3VA 3N2GA 1YJ8A 1Z2AA 3HU3A 4NDAA 1GGNA 4R2WA 1YTLA 2RJ3A 2NTNA 4CFZA 3N2EA 1FFXB 4MW6A 3E1GA 4UUNA 2XXAB 5CRIA 1U98A 3F73A 4LF7B 1V16B 3M6UA 3VGPA 1SQ6A 4RLQA 1KPHA 1BN7A 1BU5A 4LBVA 3GLSA 3H0CA 1RIIA 1UDRA 2C83A 1H0RA 2XV1A 3L8ZA 3SZMA 1PBTA 2DRIA 4DV0B 3EWSA 4CKWA 4MVJF 1XTSA 2QRVA 1R0LA 3PPYA 1VPTA 3TRFA 2J45A 2JZCA 4LJ5A 1P3Y1 4RHEA 3TL6A 2Z56A 4F04A 1FIUA 2ESRA 3JQ9C 4AZ0B 2P6MA 5TMBA 4RTRA 4XD7D 2NU8B 3CT4A 2ZYAA 1S2LA 4HDSA 1XX6A 4C7VA 1HT3A 1U8FO 4EG6A 3FOEC 1RI5A 4YAJA 4FI3F 3P0FA 4EI8A 1S2IA 4CKCB 1B42A 1FJ2A 5H9VA 5AH0A 5J4HA 1T9GR 2FW6A 3AOGA 3DTNA 1O0BA 1ZC4A 2BGMA 2L18A 2HZBA 4PX3A 4I81A 5LNK1 3M7IA 2LWIA 4DLZA 2GKSA 2QBYB 4RVGA 4M22A 2YR0A 1D8TA 4W5WA 2GZRA 3A10A 1A5AB 2XWQA 1ZMRA 1EFTA 2ACEA 3SFZA 4ZI2A 1KH3A 3IURA 4M6WB 1Y8RA 4LZNA 4CUZA 1VMKA 3LUDA 1PFGA 3WLKX 2WB2A 1MB9A 2QN7A 1OTHA 2R8ZA 2ZREA 3INGA 4IWNA 4LS3A 5IH3A 2LCQA 2WU3A 2QPAA 3GLTA 3QPAA 3OU7A 2HH9A 1GAQA 2XNHA 1OVGA 4GU5A 1TYCA 2PUAA 4IF4A 2D2FA 3BGOS 2Z6AA 3L7CA 4F72A 4B46A 2EJWA 1MC1A 1XTTA 3E27A 4UU0A 2GCOA 4TKVB 2M1ZA 2HUNA 2NT4A 4OJMX 5A0TA 2HD4A 3TB4A 1Z25A 4ZVTA 5L40A 3T3NA 1E5XA 1ECBA 4DR1B 2XVAA 3PQEA 4GVLA 4GYWA 4OQFA 5A4FS 4HN9A 4D26A 1O8CA 2J3MA 5CG1A 4YONB 3K0KA 1T6ZA 1F2TB 1YB7A 3H5IA 3MWEA 4XEHA 3RQSA 4BO1A 1AQLA 4YAKA 3R3SA 1O08A 4J2TA 1INLA 1RLTA 2QTLA 3RH0A 4S05A 1U5CA 4ECAA 2PO7A 2GCPA 3CO5A 4Q3EA 3TK1A 4AIRA 1OIVA 2ZR0A 3O8LA 1ORHA 1OASA 4AP5A 3ZHUA 2IQ5A 3EVTA 3FTFA 2BPOA 3HP4A 2K2QB 1VLVA 1XZKA 2EEPA 1H1DA 1VDMA 1CUIA 1S02A 3GOQA 3KSBC 3ITDA 1K5HA 3O7WA 1DC6A 1L1QA 3A0UA 1XN4A 1MJ5A 1YONA 4PRZA 4AJOA 1L5YA 5KNCD 4DB4A 2ARKA 1I2CA 2C7QA 4Q6WA 3SJZA 1HQYE 1UKZA 1YJBA 1G3RA 2D74A 1UQRA 5EWJA 2FKNA 3WJ1A 4B2YA 1D0VA 1ZGGA 1KPIA 5ABPA 1SB9A 1W5TA 3K0BA 1SU4A 1R74A 1G5PA 3QXJA 1YJCA 2R8PA 3L0YA 4H6PA 3K0EA 1D2CA 3QNUA 3K8YA 3QJ5A 4PYIA 5KNDD 3U9TA 4OP3A 4XTRA 4B8ZA 5DB4A 4O4IF 1M7GA 1AH2A 3G9XA 4YUZA 3KAKA 1ID8A 3W3ZB 3MCWA 1U0OC 3RFCA 4WJLA 5CK4A 2FPLA 1OGIA 3EMDA 1QH8B 3BKXA 3SR0A 3V3KA 4D9JA 4QPNA 4ZO4A 4NG4A 2X13A 3ME5A 3MWGA 3OBBA 4GYKA 2ZJ7A 5HM8A 3KYBA 5JSKA 2H4XA 4CPDA 4HDNA 1G8MA 1JP7A 2BJVA 3EWNA 3KLMX 4MQ5A 5I48A 4YT8A 4OFBA 5KMGB 1ENOA 2H29A 4QICA 2FQ1A 4HC4A 2G7ZA 3LQ2A 1YQWA 2DKNA 2R5FA 2R97A 4RHXA 5D1NA 5KWVA 5LFAA 5EUMA 4BKMA 4C7BA 4R9VA 1J5EB 4Y2JA 3M9LA 4M0MA 3WTBA 2QL6A 2Q5IA 3QU5A 3BB1A 1N9GB 3D5TA 4HWOA 4U4AA 2BR5A 3B9PA 3IPYA 4MA5A 2EX4A 3EZXA 2Q0XA 3HZRA 3Q9UA 1XRQA 1B2RA 1Q3KA 3IIKA 3W79A 1UPCA 3ZE0B 3AVVA 4QU5A 3FCOA 3WRVA 3JWEA 1Z0SA 4LZZA 3P9PA 1MRZA 3GJYA 2W6QA 1JKXA 1E7YA 2V7XA 3AG6A 3F9RA 1MXFA 4MVJA 5HMLA 4BPRA 5F2NA 5HIAA 2D0OB 4II2A 4FT2A 3WNCA 5K8VA 1CVLA 3FMOB 3J81k 4NCNA 3UYKA 4E07A 1M2GA 3E1SA 4F4CA 3MC1A 1YCHA 3PPXA 5IAGA 1V5IA 2O7NA 5CG2A 2V3CC 3QH4A 2HZ7A 1U1GA 2HNKA 4A26A 2YWHA 2ZJFA 2PVPA 5EE3A 5C31A 5EIFA 1J70A 2CV0A 4G3XA 2KMLA 3FPJA 3FSEA 2GESA 4DE5A 3KXKA 2CVPA 4MUKA 4NYIQ 5K09A 4M7OA 4DQ0A 2AYZA 4PPQA 1Z9BA 3KM0A 1SXJD 2IW1A 1JXAA 3HR7A 4BE9A 2VRNA 4JCOA 4PG4A 3TQTA 1PJ4A 4V0RA 1XQWA 3LO5A 3OAAA 4LVUA 3WHLA 2QPLA 1XN1A 2NO9A 2FWJA 4LI0A 1E77A 1CEQA 4H18A 1DIHA 4MDFA 1HE2A 4B7CA 2CNLA 2P9EA 3HR8A 1SUAA 1WXEA 4G41A 3V8PA 4EAQA 1PZEA 2FPGB 2NSJA 1GDHA 4I4IA 2FEWB 4UHHA 4XFDA 3T61A 4B3DA 2QY9A 1K8ZB 4LWPA 1Q74A 1NUQA 1TTPB 2YFYA 3MMXA 4RUKA 1FTQA 1JYEA 1UQTA 4IDHA 4NMWA 1GZ4A 5FBRB 4B82A 4YRFA 5ARCA 3FUUA 5CLFA 1WB9A 3N0WA 3LY7A 5ICFA 4EMSA 2X40A 3HVIA 5C8XA 2BN4A 1L4BA 1Z33A 4G5QA 4MS1A 4LMRA 4ZAYA 3SJAA 1YFJA 3AUUA 2GETA 2H7VA 1Y98A 2HO4A 2ODBA 4PSKA 3I01A 1JHZA 4NFYA 2C7OA 1JT9A 3ZWOA 4MSUA 1BFUA 4I4CA 4P5PA 2QPTA 1NLMA 2V0CA 5AXBA 1Y33E 4HGZA 4RW0A 1UJBA 3NKFA 3TLKA 1VPEA 2DT8A 4WKOA 9MHTA 2JI7A 3MJFA 3OBIA 3RUFA 3PYLA 4EABA 5BMVB 1JWAB 4CNBA 2P9CA 1A3CA 1U0RA 1AQIA 2H48A 2R66A 1R9JA 1QTQA 1EK2A 1NMSA 3VZQA 2AN4A 4Y18A 4Q9JA 2OBFA 2VJPA 3NYIA 3LI2A 2FCRA 3JRNA 1NJ1A 1J0BA 3FETA 1P62B 4D2IA 5AOAA 5GVRA 3GJ6A 4GDFA 3AETA 4WXRA 3KKPA 2X58A 2H8KA 3B1JA 2R68A 4TXLA 4E4RA 3BSWA 4GXRA 3KEQA 1L4FA 1R8SA 3ZVLA 2JIBA 4NARA 4FI3C 4V0SA 3PPVA 5JG7A 1HYGA 3ABZA 2QTRA 2XDQB 1Y37A 1L7QA 2CF5A 1IG0A 3EQZA 1ENPA 3JXEA 1DCFA 5KJFA 2WSMA 1UKVY 1K97A 2ST1A 1PS9A 2ALJA 2EQ5A 2Z4TA 4JL8A 2RGBA 1U4SA 4O08A 1JA9A 1ZN8A 2C96A 4NMMA 2IU3A 4BEWA 4I50F 2QN2A 2FJUA 2KYRA 4GZMA 2DFLA 1JIUA 4IF6A 1L3BA 2ZIXB 4F91B 1OJ7A 4O4IA 1HF3A 3I8SA 4RD0A 1U5BA 1AQNA 1C41A 2EG9A 2ZVDA 2GPAA 4DLWA 3CUSA 4RZXA 3ROZA 1O89A 1OAOA 5IK2A 2OAEA 4LF5B 3JASB 3I01M 2IPXA 4QUEA 3K3PA 4RDXA 1OWMA 3LUPA 3OT4A 1Z8NA 5HJ2A 3D7MA 2OZPA 2AGVA 4IJWA 2LGJA 3BVPA 3U1VA 5A6SA 1GN8A 1VC2A 1KYTA 1T3LA 2QGNA 1QO9A 3ITNA 4RKWA 3U3RA 4BMOB 3LWDA 2GEUA 3CTMA 5TEVA 1Q0TA 4QLAA 4YCMA 4IM7A 4ASUD 2B4RO 4JB3A 3TZKA 4MCAA 1BGWA 4ROTA 1I1HA 1M2OA 1Q91A 2A8YA 1GUDA 4URZR 1FL9A 4KKVA 2Y99A 4HX9A 1QG6A 1QCZA 1OBHA 4M8LA 3JPYA 1DMSA 1IEWA 2QD5A 1ULUA 1KWKA 1A2KC 2DLNA 3DOHA 4OHFA 2ZB2A 1GNLA 5EE0A 1Y9AA 5T57A 5B4VA 4C4RA 2D1TA 4Y6SA 3UAXA 3I53A 3KT3A 2YC2C 2YL2A 1JI3A 2C7PA 1WHSB 4JEMA 3VH2A 3LGAA 4R3UC 2VBFA 2QVXX 1PZFA 2Q2VA 2ZAIA 1S96A 3RVPA 2QLLA 4KN9S 4A2WA 3EYAA 4YB8A 4Y98A 4RK1A 1I2BA 4E4YA 1XRNA 4K9NA 4EENA 5GIOE 2XCOA 2XNCA 1JFRA 5KI6A 4YP5A 2O59A 2AG1A 5ERYA 3ZWQA 4H4CA 4GPEA 2HWWA 1XZEA 2DPXA 2FWIA 2GWHA 1GCUA 4D6XA 1Q11A 1O77A 1WQ4A 2WPNA 1PR1A 2HBZA 2FW9A 4FGJA 3U44B 4JGIA 1L5NA 4LVCA 1AQ6A 4Z53A 4F12A 1E6CA 1RCFA 3TRHA 4CM7A 3IOCA 3WHIA 2XF2A 3UM9A 5LQKA 3R41A 4IKEA 3MXOA 1E5LA 2VL7A 1R9NA 1OAOC 3EUFA 3QU4A 2OQRA 4RANA 3OKFA 3PCRB 4UM9B 2VHXA 2ZT5A 3PFGA 4TS3A 1KMCA 3IBFA 2BTQB 3OOJA 5FR2A 5TQVA 3TTYA 1XFAA 2HA3A 4L8FA 4PQEA 3AFMA 4OBBA 4R4JA 4TM7A 2OQ2A 1NF3A 4YPVA 5CJJA 3HKEA 1UEXC 2FR0A 3K9CA 3GA7A 1NHGA 2ZIXA 3OWHA 3ZE9A 1YDHA 5G3YA 4BZQA 1KVUA 3MINB 3CLTD 4EG0A 5ULLA 1MA3A 1XG5A 3NC4A 3FWPA 2ZSUA 3TPFA 2OV2A 5T6MA 4A5OA 4KPYA 4DC0A 4C29A 4DBZA 4QQNA 4KR7A 3OLXA 2Q8NA 2JFVA 4RVFA 3ZW9A 2PV0A 3G89A 3QTBA 3MT7A 4TYNA 2MYPA 4JXJA 4QTZA 4GC9A 3WK5A 4ZVNA 1CP3A 3L7JA 5B3AA 4IGKA 1E5QA 1UC4B 3M4ZA 3S2ZA 4CM4A 4IBOA 4WNCA 4LNAA 1T6XA 3MLBA 3OX2A 2R44A 4QFCA 2WI8A 3ZZMA 3RRBA 4BO0A 5DNCA 2VDPB 2WTAA 3ZQUA 4MIKA 4X44A 4R1PA 4EYKA 1NDHA 1LDMA 1VHTA 1YBMA 3BWCA 3WNDA 1ST2A 1P39A 2X0FA 5I7VA 4MULA 3DFUA 1GA1A 1G4HA 4J3NA 3RR2A 1T8PA 2DOKA 1OAAA 4RMNA 1YRQA 3QLUA 2IJGX 4A82A 1LTKA 3KNZA 4QT0A 5A4JA 2R8EA 4KJXA 3DBOB 2DUJA 4MV3A 3ZOZA 4V39A 4Z7QB 1T8YA 2JHCA 3NAZA 4GPAA 3N8IA 1Z6XA 1QV7A 3RIGA 4H3VA 4DZRA 1I13A 1VL2A 4DGQA 1IJEA 2VO1A 1GZVA 1JHRA 4M9XA 5EFOA 1DWUA 4ND3A 1JAXA 1PW7A 1WNTA 1I5RA 2VP2A 4OUKX 2UV8A 3OIYA 4IOLA 3CIOA 4HLNA 1NSFA 1LS6A 1V47A 1YDWA 2XYVA 4UBNA 4ZC1A 2EFDB 2ORIA 2PFKA 3CZPA 4I50A 2XITA 2C9ZA 1XF9A 3FYUB 1PJAA 3VSBA 4ZI7A 1BD3A 1C2TA 4OATA 3BH0A 4YDQA 1LSJA 2ZRBA 3OE5A 2WC1A 1XPUA 2G83A 4ISBA 2A9QA 3HDQA 2B20A 5U9CA 4K6HA 1BMDA 5JR3A 4ENVA 4CMGA 1A5SB 3BCSA 3LCMA 5CA1F 5F21A 1NLFA 2KQUA 3KU1A 1EJ2A 4G6ZA 3UJPA 4ZAZA 2Y77A 1WZNA 3H3XA 4J0GA 3HADA 3C5WP 3D0RA 5JSYA 3MQ4A 5BSTA 5IXYA 4MKIA 3LYLA 2VUTA 5JLJA 2QI9F 2INGX 1SKMA 1I7NA 2W71A 3HYCA 2W4MA 3FH0A 3NKVA 2B0JA 2V96A 4FYJA 4S24A 3H8JA 3H99A 4TVSA 2B34A 5LWHA 4NXMB 1C9NA 2ZTLA 1NI5A 1HZZA 4I9FA 5DM60 1TUGA 2AMVA 3E8MA 4FYPA 5ADUS 1IYZA 2VKTA 1RQGA 4JQYA 4RZ2A 4P3XA 5L3VA 3SHQA 1AMNA 2AA3A 3STTA 5ALGA 3QLUC 3KKLA 1T2CA 3O47A 1PR9A 4UEWA 4PN3A 2AW3A 2WA2A 3OE7D 5EJ9A 3ZVMA 1OXUA 1IPEA 1AKUA 3F5DA 1BRTA 1Z7WA 3H75A 4DMRA 5LP1A 1DBVO 1OGJA 3AJ9A 4BP3A 2PWYA 1ZNQO 3KOMA 2C2WA 2AE1A 3DMFA 5JARA 1RYBA 1A71A 3GWZA 1U0NA 1JLHA 2G9QA 4E09A 4PRKA 3PF9A 5KZMB 5BSVA 3R3JA 1JEYB 1R9GA 1QRDA 3HFGA 4OMFG 3Q0TA 3A1SA 3WIUA 4DF3A 3W2TA 1OY1A 4MLZA 4IVPA 5GZ3A 2IPOA 3D4IA 4NYMR 5J5CA 3TSZA 4A36A 3OG9A 4QUKA 3WSWA 5KVSA 3B3JA 3N0RA 2BW0A 4QODA 3GIWA 4RD6A 2XSZA 2X3FA 4HNAB 4QHYA 3W5VA 3FSJX 3JZIA 4GE0A 4KITB 1ZCFA 2OC9A 4RDCA 4XYBA 2ZYIA 3H11B 2IXEA 3PNPA 1ZGZA 2EHDA 2ZE7A 3BE8A 5TARA 1R6DA 3ENNA 3TSOA 2Q41A 1FX0B 1G98A 5DYNA 5GVSA 3GUYA 2WFZA 1WU7A 1W59A 1QBGA 5EKXA 4LOLA 1O95C 5FFFA 3AL3A 1BXKA 4DLAA 3OICA 1YVUA 4RH1A 4M9RA 3EBPA 5CA1B 3U19A 3A6GA 1HLPA 3Q5EA 4R9UC 5J1TB 1F14A 2JDID 3NTUA 1XEXA 1WF3A 1GXSB 4K03A 4J1SA 3TRJA 2V6JA 3NV7A 3PHCA 3WMGA 3TDMA 4NATA 1BZYA 4MVJI 4N6GA 3X1JA 2BGNA 4MITA 5F64A 2IHNA 1W4ZA 1JDTA 1E2UA 4G4SP 3DFZA 4G9GA 3AOEC 1HZZC 3S7TA 3ICQB 3KUXA 4EG4A 3MUEA 3OQPA 3GAZA 1PWYE 2YWXA 1B43A 1I0IA 1MQ8B 2E6UX 2O2IA 1X70A 3FGZA 1NJGA 3V9PA 4MWCA 3IPXA 1ZA1A 3GJRA 1ZUNB 4OOFA 5FTKA 3ZW8A 1P9RA 4W5OA 2QMOA 4LYGA 4FSHA 4CM3A 3ANTA 3I05A 1GITA 1CCWA 1GG5A 2Q2QA 1W4AA 5B58C 5T7BA 3DLBA 2VP3A 1GQYA 1E60A 2I5PO 4CHTA 8OHMA 3H4TA 2CXPA 1XV5A 1N36B 5K0BA 5LIRA 1NUHA 3GZNB 1IHDA 4H7KA 4AUMA 5FR1A 4L75A 1B0AA 3IBTA 4FEYA 4GLBA 5JNWA 3NAQA 5KSYA 3VR5D 1N8SA 1BU8A 2BR3A 1Y7HA 4U9HS 3SM9A 5CLQA 4KU4A 4UUOA 1FYVA 4S1NA 3A8TA 4AJNA 1ZSNA 3C6QA 4CG1A 5JPDA 1HC7A 1MRSA 3H3JA 3LRPA 1PV2A 4U8GA 4YPFA 4BLWA 3BIOA 4H15A 3WIEA 2O54A 2W2NA 5AP9A 2ZSAA 3FWHA 3DAHA 2YICA 3H83A 2ZB4A 4QDZA 3V1KA 4LRXA 3PP8A 4O33A 3BB4A 3ZBQA 3VNAA 3RFFA 5KJ6A 1T8RA 3CF4G 3AIKA 1XTUA 1XL1A 2RHDA 2QZPA 3K5WA 4IP0A 4O4JF 4V0OA 1E1QD 4F4JA 2QD3A 1SXPA 1NU6A 1RQ2A 3FMVA 1Y3HA 3OJFA 5F98A 1P1CA 3Q5GA 1NW5A 3CRZA 4H7EA 5GONA 3LAWA 3W04A 4ZHQB 5ILOA 1C0PA 4PAOA 4LGMA 1Z0FA 1AXGA 3D3JA 1QLHA 2A1UA 1QTRA 1HFEL 1S9DA 2KI5A 2SKDA 3LIPA 2O5VA 1H2HA 3FYUC 1UPXA 1YS2X 4PWYA 2FPOA 3AFGA 5DYYA 2CLCX 3OPQA 5JWRA 2V0GA 1F9AA 5A71A 3MPOA 2C4HA 1DG1G 4HHEA 3SBEA 3HFSA 3WC4A 4WQMA 5CH5A 3N75A 4ZJPA 4KR2A 2QRQA 3UN1A 4YJGB 1X9HA 3EMKA 5BN5B 4Z3OA 4MPTA 4DTCA 5CA1A 2Z1DA 1KY3A 4QEZA 4ZVRA 3WLOA 5D01A 2FOXA 2A30A 4EPVA 4ES6A 2NZXA 3DPSA 3WB2A 5DHTA 3WL3A 1KEEB 1QF6A 1YZTA 3WWZA 2XCRB 4WJZA 1MC4A 1SHUX 4FEGA 1QGYA 1Y89A 4OBXA 5ITZB 1DOAA 3KL2A 3OD5A 1OXKB 4LY0A 3VX3A 1OYWA 1Y0BA 2GN0A 2WSYB 3D54D 1DDIA 4YMUA 2RHOA 1MH1A 4I6JA 4OHZA 3VU0A 3U4QA 3KKNA 1ADFA 4RCYA 3K1AA 4JA2A 4YI5A 1NUTA 5JS2A 3W4IA 2V8BA 4G0VA 1L7DA 5T3YA 5JDCA 1JG7A 4ZYYA 3GCGA 2I6FA 4P1ZA 1IB0A 1JDNA 1HFJA 2P9BA 3K9WA 3P9KA 4KVGA 2X23A 4FOSA 4BEVA 4NU6A 4LRQA 5IZCA 1HH4A 4JYBA 3VR2A 3JU3A 4IILA 1F1JA 1A9YA 3NJRA 3EG5A 4O4JB 3GZNA 3HCDA 2IPAB 5DGIA 3FA2A 3BH7A 1HDIA 2QUZA 5A0FA 3IPCA 4K28A 2DBQA 5SYMA 1T8SA 1QYWA 2WF7A 2JAOA 3BK7A 1RDFA 3CZRA 3OFKA 4M98A 1I0LA 4OIMA 4RAQA 1CJBA 2LNDA 1TAHA 1PL7A 3DLTA 4MUYA 4RZQA 5HJ7A 3LBIA 3FLEA 3I8XA 2D54A 3F4BA 2CE7A 1Q3TA 5GV8A 3RK1A 4NAVA 3WDMA 5JC1A 4P2GA 5A2QA 1QWSA 1WXIA 2KE5A 4YWJA 4AYTA 2F3QA 3NR2A 4UDXX 5KTKA 2VFAA 3BRWD 1Y4ZA 3M6VA 5HRCA 1K4YA 3FFWA 3JW8A 3DDCA 3NIGB 4EECA 2IEGA 3AILA 4C4XA 4ZIRB 1WVIA 1XVIA 3B13B 3C6BA 2VWHA 3V46A 4EJSB 2Q3MA 1W5FA 1KO4A 2BEUB 4QUAA 1ZUIA 4UU1A 4F9GA 1RCTE 2XNJA 1G9SA 2OGZA 5AD1A 1WB6A 2YWRA 4PONA 5EXDA 1VCOA 1X86B 2QI9C 3ZS9A 2Y93A 4CTMA 1UXKA 2IYPA 3MD9A 4QDUA 1U8XX 2C82A 4CLDA 5BV8A 2PYZA 1H42A 2H07A 4G5FA 4EB8A 3DE5X 3N2ZB 1QIHA 1YGPA 1S0UA 2PTGA 2PGOA 3A32A 4IJ6A 4CIYA 2B7CA 4K6GA 1POWA 1GZHB 3SIWA 1YVRA 4A0FA 4MKHA 4BV9A 1ZHFA 3M9XA 1AKVA 3GQVA 2X9LA 4Q12A 2DFTA 2X0DA 1UANA 1XMSA 1IBRA 3CBGA 4HATA 3TKLA 4KAFA 1O2DA 1LLUA 3M3HA 1NULA 2XUIA 2W6ZA 5ECYA 5IZCC 4KP7A 1MENA 1ULZA 2WPDA 2I4MA 1FP2A 2WFLB 3KYCB 3UEOA 5FTLA 1DJMA 5ITZA 3R4CA 3I58A 4L78A 1KFKB 5DU2A 5AVWA 2C0QA 3D8HA 3NBZC 1PL6A 3QWFA 4LXIA 4BS9A 4EATA 2V6FA 3PUIA 3G9UA 2UXBB 1HYHA 5K2OA 3QVKA 7ABPA 1G38A 4A1FA 3R6LA 1V41E 5GMOA 1MOSA 4DQVA 5SZIA 3PBKA 1PGJA 1UQUA 3K1ZA 4HVLA 1C81A 1TKCA 2JBWA 1DZ3A 3CX7A 3ORHA 4ZP1A 3UB3A 2NG1A 5J59A 4JSYA 2PKXA 1LLFA 3HI4A 1D5WA 4GVPA 3FUCA 1VKRA 4NAHA 1GEEA 3V34A 1GPWB 1K08A 2IA5A 4W9MC 3N3AC 5A4DA 3QVGB 3I1YA 4FD2A 4E22A 2AZ4A 1G5IA 4O4JA 2C9DA 5EAIA 2PKRA 4JYMA 4MCJA 5I7HA 1GG9A 4YRJA 2PXAA 3OQVA 3WYGA 5HOEA 5F1OA 2BFNA 5SY6A 4V03A 4XARA 4ETIA 2QMZA 4X5OA 4ZV7A 1CP2A 4F0JA 3PJGA 3BSSA 3ND9A 2PLWA 2CXUA 4WPGA 4DNOA 2HBYA 5D5HA 4D4GA 4JBIA 4NIMA 3EZ7A 4JLPA 3ABRB 3O90A 4N48A 4R0NA 4QRDA 1E3QA 2QN1A 2EG5A 3GT0A 1Y34E 4ACAA 3FJOA 3AUSA 3HWWA 2CVFA 5FTNA 3V8BA 4P31A 4E5KA 3MSCA 4KMRA 4XUDA 1W47A 1RC1A 5CGQB 3H2JA 5C9ZA 4OI0A 4CLEA 4XM0A 1NW8A 5DXFA 4EJSA 1E3JA 1Q12A 1UBEA 3FFBA 4URYR 2BEUA 4OYLA 2FMXA 1OTXA 2P78A 3K92A 3SC4A 2Q99A 1KHTA 3VR6D 1FYEA 3SJUA 2W2VA 2YHBA 3LX6A 2PRSA 3R3YA 2RKWA 4V02A 3ZH9B 3G85A 1J5XA 4GQIA 5ERXA 4F9EA 1W8IA 2DY0A 1Q7CA 2WM3A 1SJ9A 4OAQA 4MGYR 1XXHB 3WOVA 3DLCA 3AGPA 3E3MA 3OMXA 5CYOA 5DNDA 1T36A 4LJ9A 1WP4A 4AYWA 5IT5A 1SOUA 2NW6A 3G7UA 3U31A 4O1IA 4GPZA 4OFXA 3RIEA 2ZBPA 1X1RA 1WMEA 2PVCA 4WERA 1OFTA 1YZLA 1FOEB 5IF9A 2F3SA 3PXAA 4CODB 3EIFA 3G5AA 5EJEA 4E3WA 3EA0A 3H9CA 4W5NA 1C29B 1Z2DA 4PS0A 1KSHA 1GPBA 4OMUA 5GIPE 1X7YA 1DAKA 2W37A 1GNPA 1DAIA 1WXHA 4L08A 1TEHA 2ZVPX 4MGKR 2X22A 3EXHA 1QGDA 1E3IA 1DFGA 1KEPA 1PT8A 4XX1A 4YO7A 3BZUA 1Q1BA 3ONNA 3ZZUA 5C4IA 4B75A 1JIIA 5LQRA 2CLHB 3HWRA 3DOFA 3QF4A 4O3MA 2IUYA 3AY0A 3QITA 5DGDA 2FU5C 3CVVA 1YQ9A 1WHTB 2A5GA 4A9AA 5EWMB 2MSWA 3AESB 2G9UA 4QHTA 3A2NA 4KH0A 1TMGE 3BL5A 1R16A 5A7GA 1YCFA 1Z6PA 1W36B 3BM5A 3NG1A 3VJRA 3E03A 2EKQA 4I9NA 4XQ0A 3VO1A 1EUZA 3B3QA 3UT5A 1GTRA 4ZCRA 4EJSC 4C0LA 1UP4A 1J9ZA 3FZNA 3VFDA 1F4VA 1JQJC 2D13A 1F5NA 3GRRA 4ZQBA 3X43A 2E89A 4JCCA 4NFSA 4CLRB 4O1MA 3WAKA 3T9DA 3IMFA 1YI0A 1IXRC 1LTHR 2QD1A 3BWMA 1P0MA 5I8WA 4PX9A 3AO0B 2DFKB 3JR3A 4TV9F 4EL5A 5KQMA 4MQ4A 4ITVA 4R3NA 5HGJA 4KNVA 2JFOA 4U39A 4D46A 3N2NA 4JZYA 4I9UA 1SKQA 3ZCRA 2I22A 2HFJA 3ZDFA 4ZYXA 1PCXA 4UBJA 4JYCA 2GH1A 2OCDA 3KR9A 4LECA 2ADMA 4PTYA 1NVWQ 4L6AA 1Z6TA 4NY1A 1K2WA 3G0BA 2QZ9A 1Q14A 4INAA 2V65A 4HQOA 1CE8B 1O94A 3KPJA 3HJTA 1YR6A 3BCUA 4Z1MD 5K6AA 1T1GA 4KQ9A 4N5NA 5KTYA 3E0XA 2O4CA 1UOPA 2VPWA 2YUIA 3KHKA 3QYFA 4L7VA 4RGQA 2CYCA 3D0KA 1JIQA 2XYHA 3H87A 4L5BA 4RM3A 1YV9A 1ZVVA 1LU9A 1FRQA 1XXHA 4Z4EA 1CDZA 3AONB 1RWBA 4WLUA 3OZVA 5F2KA 1E2EA 2VSYA 3O3OB 2ZXFA 3WICA 3MWFA 4G5XA 1M6VB 3EXHC 4TVKA 5D7NA 3OFNA 4JOSA 3WMRA 4ND8B 2OXTA 1I3NA 4YCNA 3SYNA 1YR2A 2IT1A 4G1MB 2FPSA 3B1YA 3HYTA 4NI5A 4AJ2A 4OREX 2C2OA 4EIWA 1CS0B 1ML4A 2YVKA 2CN1A 3ILSA 2X3UA 2BY4A 2Y68A 4ZVQA 5F3WB 4J9UE 1TJNA 4KXNA 2ODQA 1HRDA 2OWEA 4FOPA 3P0IA 2XB6A 3DNMA 4ZQEA 4ZCMA 1FRVA 3T06B 3L4BA 1RAFA 2VT7A 3IBGA 5K8LA 1V6CA 1ZYUA 1GM5A 2KWIA 3AL2A 3TNYA 1JPUA 5GWXA 4EVIA 4RF2A 4F6CA 1NA5A 2OCXA 3IVXA 2B99A 4XDZA 5D86A 2X6TA 5LL6P 3P9YA 1LVGA 1T91A 2HCTA 4PO9A 5CH8A 1WHTA 1FQKA 5LDGA 1YR1A 3OVMA 2JFHA 5EIXA 1F06A 1PKXA 4H3SA 5REQA 4DNQA 1BQ4A 5DTRA 5JV5A 1SPXA 4CUJA 1P7WA 2W6OA 3HBFA 3KDSE 3RS0A 3UXHA 5WRFA 2AOTA 2GBIA 1QRAA 4E30A 2E48A 5ADVA 3OX1A 4XZ3A 4CLRA 1O94C 1U3WA 1YUNA 3K09A 4RQUA 5P8WA 1SKUA 3DMYA 1OUMA 3WBBA 2Q6KA 4RADA 2ZWMA 1OZGA 3V1UA 3DZHA 5BNZA 1EVJA 1WD7A 5JI2E 2HV8A 1ZJJA 3N7UA 4MVJG 4JVOA 3W6UA 4BB5A 1AGNA 1W6RA 3EQ6A 1NLZA 1KXZA 1HDXA 4RH3A 3M82A 5IWCA 3MILA 1OKKD 4H0FA 4R7GA 5I9TA 2VWGA 4QT4A 3B9BA 3WL8A 1SCUB 2RHBA 3HVKA 3LPAA 5HOQA 3NZEA 1CE8A 3TBFA 4JT2A 4UEKA 5H02A 4QUBA 1PVOA 5A7HA 3CUVA 5A62A 5IDQA 1BHJA 1CG6A 4YLEA 5K0EA 5C34B 3DDUA 1HDRA 1IE3A 3UW1A 3DQQA 1NI4B 4NONA 2ZBQA 4TKLA 2DHDA 3DVSX 2QGFA 1K3TA 4A8JA 4B33A 3PUJA 1OFVA 3N28A 2FEMA 4IXTA 1V7ZA 3D3EA 3PTLA 4P32A 5H7XA 3UB2A 4E1BA 2Z6QA 2FDRA 3L4BC 1Y3IA 4UNRA 1I7QB 1RAGA 1J2EA 1EE9A 2NAFA 4GBGA 4JD5A 5AI4A 2ZVQX 4WCFB 1DGQA 1DX9A 1I14A 2C98A 2IZ6A 4RIHA 4MEBA 4RIFA 3T5DA 1KJWA 5KNBH 2AQKA 2OR3A 2WF9A 3A9VA 3B8EA 4QVGA 2PM8A 5A7FA 5BYKA 2ZYTX 3L82B 3Q9LA 1SU6A 2GA9A 4J3JA 2RC5A 4FWBA 1UFQA 1CY4A 1WJGA 2XMCA 2WUVA 2NMVA 2IUFA 4B3FX 1L9XA 1W36C 3O8BA 4N6NA 1CRLA 5INTA 4ARBA 4BQPA 4I55F 1DC3A 4DIFA 3T3DA 2B9EA 1BC5A 5CR9A 3VOAA 4KFCA 3OF3A 4UE2A 1DDOA 1TQDA 2XH8A 2O0KA 3FMIA 3UFBA 4E4TA 3BTVA 3K09C 1IK4A 5JWHA 5GTDA 2H57A 5FBWB 2X9GA 4B6RA 3S7ZA 4D9EA 4XWWA 4P4SB 2BFCB 2AXPA 2ONCA 4TV9A 3P2EA 1XWFA 4Y9SA 3IQXA 2IDMA 4J4TA 3F1LA 3TMAA 2P0EA 2FN9A 4R0VA 4PHGA 4DYVA 4FKBA 1RRGA 2GFHA 2DWPA 2W0MA 3ESBA 1S7GA 1D4FA 4N5DA 4Q00A 1NKSA 2QA5A 3ITKA 3HB5X 1I24A 5DH9A 3L7OA 1AZTA 1TF7A 1RKUA 2EFGA 4QULA 4MCHA 4RHCA 3BXEA 5CNIA 3DF7A 4LKRA 4GMHA 3W6PA 4ZQFA 3IYLW 4XYMA 2J1LA 2V7VA 4LQCA 4EHDA 5CFQA 3AFOA 1J23A 1KMNA 1E3WA 4HAZA 4BJ1A 1L5KA 3QQ5A 1K7YA 1L4UA 4A8JC 1KWGA 1L4YA 4FNAA 5A5GA 3IE2A 4C1BA 3UAZA 1EINA 3LK7A 5HKKA 5FAKA 3KU4A 3WHPA 4CW7A 1NMQA 2FW1A 3MTBA 1JT2A 2YXDA 5JALA 3OPYA 4KV7A 5B53A 4ND7A 5CXQA 1O5TA 2YHUA 1QHFA 3PT5A 3TCXB 2HF7A 4TTTS 3ZY4A 1XDUA 4UBLA 1V9LA 4JC4A 1PTKA 2QQEA 3B5JA 3NHZA 1JR2A 1NI4A 1ZCZA 1IXSB 3PITA 4JP8A 2RD2A 2V7GA 1Z8HA 3NWEA 3EE6A 3BHMA 3FF4A 2CMFA 1WS6A 4I55B 1EFVB 3W8NA 5B5SA 1QK5A 3G9ZA 1NXOA 2E82A 4EFLA 1N8KA 2IYLD 1KDVA 2AFHE 5AT1A 2QLMA 4AKTA 1ADBA 3DMHA 4FDVA 1UZLA 3H3FA 4N9WA 4GHWA 4L02A 4WCFA 3R7BA 1ZR2A 2ZR7A 4QFDA 1QGOA 4F93B 1EAMA 1II8A 5JADA 3G0IA 1ODCA 1R1DA 2PFSA 4K7JA 1S3GA 6ADHA 2Q6OA 4MARA 2C94A 2FSHA 4BBJA 3B8HA 2WUEA 1C4KA 3VR0A 1WUTA 1YZ3A 2JCBA 4NRDA 4RLHA 4V0QA 3WADA 1U9YA 5IPFA 5HM6A 3JS5A 1P9WA 4BZZA 1IHXA 1BIFA 4I4LA 4KRGA 1R4NB 4FFNA 4P84A 5JZ9A 3ZDBA 1T9DA 1HK7A 1PK7A 1N2XA 2ZRAA 3W4JA 2IS6A 1UBHS 1U8TA 1NVVR 1SVSA 3IOMA 4B31A 2VAMA 3ECCA 2DMRA 1XQXA 2ZUVA 2FSSA 1WDMA 4ZOAA 4BVLA 2FZ4A 4PZ0A 1FB5A 5HZGA 5CIQA 2CDRA 1HA3A 5FT9A 5CLHA 3K70B 4CGYA 5I4BA 2JAWA 3KAJA 4KREA 4GDMA 3LS2A 1ND6A 4H6VA 4EGJA 1C0LA 3BG5A 2HTFA 1K98A 2TMYA 5AJWA 1K6XA 2FEAA 4LNUA 3HVJA 1ZJ5A 2I7VA 1YB6A 1RRVA 1U2QA 2OZLB 1AVTA 4CXMA 4HZIA 1JQ3A 2Q8QA 3VC3A 4BMZA 4UCQA 3BMQA 2OUIA 1GSAA 3DCJA 1IUNA 4IHAA 4A16A 1Y3FE 2Z3VA 5DRYA 1KJZA 4U2BA 5AOCA 1YSCA 1KF0A 1ISMA 3TNDA 3U4MA 1MVNA 1MO6A 2GOYA 3RSFA 4I5DA 2D4AA 2QENA 2VP9A 3KT8A 4GBMA 4U9UA 2R6DA 3LU1A 3WLIA 1Z56C 5KNCA 4ZVVA 2EL9A 3C1OA 2BDEA 1ZISA 5EJ5A 2W83A 2GZSA 2C4MA 1N6LA 2C92A 4DCNA 1X38A 4CZ2A 1QRSA 4X9XA 8GPBA 1DHTA 4FE3A 3I0NA 1HT1E 1PEAA 3HR4A 4U8HA 3VPXA 4S1TA 5L51A 4LNHA 3MWLA 1ZPDA 3X2SA 4RYDA 3K31A 4Y2TA 3E81A 3EZNA 4LG1A 4U7PB 1NT2A 4WCFC 2OXCA 1O97D 4TM8A 3AERB 2HADA 2VRBA 1YS1X 2AE2A 1OLOA 5HKLA 4NP6A 2GEBA 2XE4A 2PUWA 2UYYA 2PYIA 1KU6A 2Z2KA 3JQDA 4LN1A 3D7KA 1F6DA 3RUIA 2FPPB 1A72A 4QOSA 1WPRA 1YFZA 2P4HX 3T1NA 4X1OA 3UA3A 4UC0A 1BS9A 5IX8A 3RC8A 2A94A 1I8TA 2BM9A 3KTDA 2WNSA 4EHHA 1EFVA 3BGVA 4ENQA 4GKJB 2I4RA 4AICA 1JFTA 3WL5A 4JXZA 3VKFA 2VBGA 1AQUA 4B44A 4CL3A 2I71A 4B3JA 4V24A 3MWDB 3E2IA 3NPAA 4QJBA 2BMAA 3WLJA 5DTJA 4X64B 3ZJVA 4D97A 1A9RA 3GPDG 5J2TF 1WR8A 2P8SA 2Z8XA 2G0AA 2ZUWA 1FRZA 4ZV9A 3GLFE 3TUZC 4DDTA 1SRQA 4R68A 4KXFB 2R9VA 1R4NA 3I6QA 5KS2A 4URUR 1OAKA 5HF6A 1H2WA 1OTYA 2VF8A 5FUBA 5TNXA 3OECA 4MB0A 2BP7B 2EZUA 2FMIA 3OQIB 1GAXA 5EZYF 2XRZA 4UTXA 3H2BA 3Q87B 3WWEA 3HDVA 2D2VA 4IIBA 2BBWA 4MHSA 1QB7A 1FTGA 5AKYA 5IFKA 2H4HA 5L4LA 3ZV3A 1V26A 1N6PA 4PANA 5HRUA 4HMPA 3JYPA 4KWIA 4QQFA 2YHSA 1KOGA 2WMOB 4Y1RB 8MHTA 2AIRA 2EFHB 2J0EA 2O05A 3P94A 5E6RA 1ZGJA 1GFWA 2PBLA 1OD6A 3PDIB 5H83A 3B3AA 3N6RA 2Q3EA 4P58A 4V38A 4WKGA 3TZLA 3THYB 1FBTA 1JEAA 2JIZD 2KHZA 2OZLA 5JU6A 3GJZA 3IVAA 3OLWA 4MUHA 5AYVA 3WYAA 1WKVA 3CSUA 3SIXA 5JISA 1G7RA 2R751 3CRMA 1ANKA 1PW5A 2AFIB 4J1QA 1WY5A 1LPAB 4R9RA 2RAVA 5FLKA 1T5OA 4WGFA 4I1IA 1MAHA 5L3QA 5BN3B 1VTKA 2QTVB 4YRKA 4NAUA 1NKVA 2J4CA 1TW3A 3P4YA 4BIIA 4DSAA 4I5IA 2Z04A 4IX9A 4A7PA 1C7JA 4X8MA 2VKQA 5DYWA 4OLJA 1Q0QA 4I99A 4MINA 4IFTA 1NNUA 2Q7DA 1S3SA 1JQBA 1O6FA 1T9HA 2HJSA 3MYRA 3I2JA 3U0BA 4US2R 3DUWA 3N0TA 5KNCH 4CIDA 5BR4A 3PIDA 4BLOA 1ZAYA 1Z82A 3T35A 1I6WA 2AUTA 4O4LF 4P33A 3V9AA 3ZZNA 1EE2A 4W1QA 4YRNA 1X8LA 3C3XA 4JB2A 4LV5B 4TWIA 1FUYB 1G8YA 3TWOA 1GGVA 4E6PA 1JV2B 4JQCA 4JBGA 5LBTA 4PRYA 3E8XA 3N7AA 4PC3A 4QM6A 2HJRA 4FDTA 1Y7PA 3SEQA 2BJHA 2J87A 1ZG3A 3UMYA 4JV5B 2BKLA 4YP0A 5HE8A 1T0UA 1MC8A 1YS9A 3C39A 2VXOA 4UUQA 2OO3A 2PTHA 3G6WA 5EZYB 4QNRA 4X1IB 5CH3A 2C4VA 2O3JA 3DFMA 2WJ4A 3E53A 4QNNA 3TZQA 3SDBA 1RZVA 1FUKA 3QXHA 3WSVA 3K70C 5HGXA 1K8XB 1HDZA 3AY3A 4H6WA 1KDYA 3KXLA 3PGKA 3QOFA 3UANA 3H8SA 4F2GA 2OO5A 1E1MA 4L74A 2A9PA 3IIJA 1HE4A 2BVNA 2CJWB 4XIJA 1EQUA 2BP7A 3IE0A 3IMKA 1CUWA 4AMUA 1KYZA 2YYSA 3DHYA 3O0TA 3TVYA 1BS1A 5AHKA 1CY2A 1I5EA 3U4AA 8ADHA 3RAFC 1GTG1 3EWIA 2Y0DA 2FDXA 2JL1A 5LCXA 1P2SA 2CYBA 3CE9A 1J0CA 1S3IA 5ALRA 4IXNA 3AKYA 4KVFA 4DIBA 5B4UA 2EIXA 3UJ6A 1X8XA 2OOSA 3OZFA 2UAGA 3WO0A 1XDDA 3CEJA 3PDIA 2R4UA 1DEXA 1YXMA 2NSDA 2XYGA 3QVSA 4HEJA 4HGYA 1PVVA 4QG7A 2EX1A 2CNWD 2GHQA 3MFYA 4RD3A 1I7SB 2ADFA 3ACDA 3GU3A 4IZIA 4OHMA 4W82A 4E11A 1LNQA 3CFYA 1A82A 1U65A 1TD1A 2AFIA 2YV4A 1FTYA 3IVMA 5HCNA 2DERA 2ZSJA 2I62A 4C5BA 3HYNA 4CR8A 2I1LA 4OSPA 2QTVA 4TZTA 2WLTA 3UMSA 2XZOA 5JJLA 2V9PA 3BTUA 1X39A 5HS6A 3V48A 5AW4A 1GA6A 2FMFA 2WZBA 4G63A 3KJHA 4CN8A 5BW8A 1OOEA 3AW8A 3G0OA 1E2MA 1UJ2A 3F6PA 4HVTA 4TYQA 4ZAXA 5JPCA 1U0EA 5D84A 1RRCA 4B35A 3TOXA 4ZGBA 1O5IA 2AMYA 4K5QA 4DEXA 4D0SA 4P0PB 4OI4A 3E5MA 3LY9A 2YY6A 3R7WB 1IBSA 1Z28A 1CJUC 3DE7X 1Z13A 5J2TA 1T6NA 2ZI7A 5B6JA 3S3TA 3WYNA 1KOFA 2OO5C 1N78A 3QG1A 4AY5A 2WKWA 3MRVA 4I1VA 5FCDA 4ZYVA 2BMFA 2NM0A 1RQPA 1CVRA 4DLNA 4J1NA 3H65A 4D4JA 1V1RB 1BA2A 4KXQA 5EZYA 2VZEA 2AEMA 3F9CA 2GCGA 4X1IA 2PG3A 2JW5A 3HPRA 3ZQKA 4BO6A 3RVOA 1EM8B 1KNQA 2XUQA 3WI7A 2CCKA 3HABA 3OJ0A 3T41A 1DWQA 1A2BA 1JPJA 1Z5VA 1RRMA 2IHYA 2WT9A 3CLHA 2AKYA 1QKKA 4L95C 4X20B 5LMCA 5I7SA 1UBJS 1GDTA 1JG1A 4L0QA 2XUHA 2ZUDA 5JMWA 1XZPA 5EZQA 2GZDA 1LFAA 1PTJA 3AHHA 3OF2A 1KO1A 1SN7A 1EFPA 3K32A 2EATA 2MINB 3OZRA 4EF5A 1LVUA 3UC5A 3IAXA 1DHRA 3Q85A 3FUTA 3M5DA 1DBSA 1FP1D 3DZIA 2LW7A 3K5HA 2WKPA 3Q3IA 3QLEA 4UNQA 5CXSA 1TPYA 4JEUA 3OZAA 2OMEA 3LFHA 3DKKA 3I2IA 1JR4A 1UKCA 3HGQA 4XAQA 4ZZ0A 3MCAA 1XMIA 4YASA 1Z0AA 3M3PA 4IIYA 1OI3A 2W6CX 4OHRA 3GVHA 2SCUA 3EFOB 3E35A 3UBMA 3W4KA 1I36A 1NU8A 2FEPA 4K3VA 3E5RA 4BYGA 3EFHA 4AWBA 4Y1EA 1HTBA 3BH6A 1OCEA 1J5PA 1C9MA 1E5VA 2K5UA 4GEGA 1UJNA 3WMWA 4CKEB 1SUSA 2HSZA 4A91A 2H2DA 3GDGA 4D3FA 2E4YA 3EXFA 3DJYA 4CV0A 2YJTD 1AKEA 1R3UA 4JMLA 4O4LA 2QX7A 1JPVA 5J1SB 3UMJA 4B48A 1VKOA 3EXG2 1IQ0A 3BWDD 3ASZA 4DLSA 5I45A 1HSOA 5FWXB 4R8VA 2XA1A 3FPSA 2A3RA 1OFUX 4MVYA 1ZOIA 3FBTA 5CT8A 4QOGA 5ALIA 3DB1A 4OXQA 4D5GA 5KPJA 5FOVA 4ALNA 3CCBA 4CR7A 3RIHA 5CIWA 1RLUA 2Z58A 3F2VA 3G82C 3KZMA 1X1EA 4M7WA 1X7WB 6CHYA 4IQ4A 5DWDA 1FF9A 5JEEA 1DXHA 4LTNA 1CZNA 3EB9A 2NZ2A 3OPYI 4C4TA 3ZI4A 2QW8A 1XTVA 4JAVC 3R7WA 1VKZA 1TO2E 3RYHB 4RLFA 4S3MA 1SXIA 3PI6A 4J0CA 3MJCA 5DO9A 3AWDA 3LTNC 2GKGA 4JUBA 4ZYTA 3X3HA 5K0LA 4RTKA 1NOJA 4L4ZA 4PICA 4S1VA 1E59A 3EW7A 3N53A 4YN3A 3W0LB 1UAAA 2F3PA 1CQPA 3DL7A 2UXCB 1PTJC 1YK1A 1DT3A 2ORYA 3LCVB 1HURA 1Q7EA 5G0TA 1Z7EA 1J8QA 1P3JA 1PN3A 3T3IA 1E20A 1CEXA 1OW3B 1EWQA 5ER9A 1F8FA 1ZVJA 2D5AA 2Y2VA 1Z47A 1LBSA 1J99A 3ES9A 1WXQA 1QRRA 1IZ7A 3JD3A 4BWFB 4FWTA 1F2UA 3D8RA 4C0WA 3UCEA 3GFSA 4I1OA 4HNTA 2RI1A 3K2BA 1VIMA 2DBYA 3DULA 4V0NA 1FCJA 4X20A 4DPLA 1M2FA 3M0EA 2R5WA 5DRTA 4CFYA 4RY0A 1ISJA 2IOHA 5FI3A 3ZCXA 1NBHA 2W6IA 3Q7EA 1F0YA 1U7HA 2GEDA 4GKAA 4LHYA 2ANCA 5GJCA 5HBGA 4D9HA 2C61A 1HX7A 4IUBS 1SA0B 1JIKA 1L4GA 1XC7A 2IY8A 4DQLA 2G5CA 4GKKB 4OHVA 2WUDA 1PFWA 3NHSA 2YFHA 1EGHA 4DMUB 2GBCA 5F52A 1W2HA 2AJDA 1QU3A 3M81A 1CLUA 1ODKA 5I3ZA 4ID3A 1FMFA 4HD8A 4DQKA 3W2EA 1LEHA 3T7KA 2OFPA 3ZI7A 4I9GA 4Q4HB 2HA4A 2X2FA 3EFOA 3UJBA 4J6EA 4CQJA 1KFJB 3MIIA 4KQFA 4D4LA 4NL4H 3JQGB 1LWNA 3SQWA 1C3JA 5JRJA 3UA4A 2BAGA 2FV8A 3A9TA 3WA7A 4AG6A 5AK6A 5IG2A 2EFJA 4RIIA 4CKEA 1HMYA 2J6CA 4QDXA 1J0EA 3TEFA 4CM6A 1ZIOA 2IODA 3AT1A 3WP0A 3ZY2A 5C0OE 4K46A 4M0FA 2XE8A 1X7XB 2TECE 4CBVA 2PIAA 3HLYA 1ETHA 5A05A 1GLNA 3P45A 3WLLA 1KMHA 3R7DA 5BURA 5JXGA 3CVUA 1K0UA 4RKEA 4TMTA 1TIKA 2OESA 3BS4A 4FLMA 5ES4B 5GM1A 8AT1A 2V7TA 3U1TA 5K0FA 3D8NA 3UHAA 1ZGHA 1XCPA 3TH5A 4RV9A 2XMBA 2YRFA 4YRTA 1PYGA 1BMTA 4NE2A 4Q3DA 1WMAA 1D6MA 2J9GA 4DHEA 1G5TA 3O84A 5CCXA 3GD5A 4YJHB 2LR0A 1GILA 1KMMA 3D6FA 4G5RA 3RYHA 2EP8A 5CVDA 3W1WA 2P4QA 3L7LA 2WG1A 2BC9A 3AKEA 3GRAA 4IDDA 3QMWA 4X1KB 4X0EA 3WAGA 1RHKA 1X3LA 2RB4A 1EVZA 4CMAA 3M6FA 1TJYA 2ZSIA 2C5SA 3HXPA 1R7RA 1KJJA 1J8DA 1C8LA 3TD2A 2YZMA 4CTNA 3A3NA 1L2TA 3VNBA 3B6JA 1DEHA 1X3SA 2RAUA 1G2OA 4FZVA 2TMKA 4XDYA 3QUBA 4KHZA 1J2UA 2GS9A 4IICA 1X2EA 4DUPA 2FN8A 3TQRA 1JIVA 1DBPA 4B0PA 4U7WA 1A97A 4OM7A 1LA2A 4BC1A 4NBVA 2VDOB 2QTTA 3D6MA 1RI2A 4HZUB 4Q7LA 3JD1A 4FCWA 1EWYA 2P8JA 3BEOA 4C08A 3RANA 3KKQA 1SA0A 3QIAA 2AR0A 2C54A 4U6NA 5JS6A 1D1PA 4FFLA 2E5WA 4PSCA 1W48A 3QEKA 5TXGA 3ER9A 2VHZA 5JYDA 3AHDA 1VGRA 1Z7GA 1FYXA 3K4QA 2GBLA 3FIUA 2KX7A 1J0DA 5IHXA 4D8YA 2QLBA 3EK2A 4NENB 3EGDB 4Q3BA 4N3BA 2JH8A 4TSFA 4LX0A 3WFIA 3DBHB 1JAZA 1VPLA 4GVXA 3I52A 3JQGA 4RK5A 4W8HA 2FRXA 1L7BA 2GJKA 1Y4SA 4JUFA 4NDZA 1AMOA 1CKEA 1XMJA 2X5JO 2H1IA 5AKEA