5BP7A

Crystal structure of sam-dependent methyltransferase from geobacter sulfurreducens in complex with s-adenosyl-l-homocysteine
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
249
Chain Sequence
MLDIPRIFTITESAHRIHNPITPEKLTTLGAALRLEPGTRVLDLGSGSGEMLCTWARDHGIIGTGIDMSQLFTAQAKLRAEELGVADRVTFIHGDASGYVSDDKAGVAACVGATWIGGGVAGTIELLARSLRPGGIILIGEPYWRQVPPTEDVARGCLANSTSDFLMLPELLASFGRLGYDVVEMVLADQDGWDRYEAAKWLTMRRWLEANPDDELAKEVRAQLTSEPGRYASYTREYLGWGVFALMPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM-dependent methyltransferase
publication title Crystal structure of SAM-dependent methyltransferase from Geobacter sulfurreducens in complex with S-Adenosyl-L-homocysteine
rcsb
source organism Geobacter sulfurreducens
molecule tags Transferase
total genus 81
structure length 249
sequence length 249
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5bp7A00
2G8NA 4BP1A 4PYJA 5FHRA 5EGSA 4X60A 3EGVA 2FRXA 2YR0A 3HNRA 3UJBA 1P1CA 2P3OA 3A26A 2BR5A 3ORHA 2I62A 1M6EX 2R6ZA 5FADA 5HIKA 4E2XA 1NKVA 3M33A 2OPBA 3MQ2A 4OQEA 3AXSA 3EVAA 4M38A 4QVGA 3A7DA 3IHTA 2P3QA 4R8RA 2PX4A 5EZQA 3T0IA 3OU7A 4PGGA 2O06A 3OZTA 2PX8A 3OE4A 4PYNA 1RI5A 3FUVA 3KQVA 5EIWA 4E31A 2ADMA 2ZWVA 3GRUA 3LECA 3A27A 4V0QA 3GWZA 3B7PA 5EVJA 5MHTA 3DMGA 2AR0A 5LQCA 2FPOA 2GAFA 1NV9A 2JHAA 2IH4A 3UFBA 1VBFA 2Z6UA 2YQZA 2VDWA 5GWXA 4PONA 2OKCA 3FZGA 4MTLA 1H1DA 5FA8A 2XYVA 1ORIA 1NBIA 2OBFA 4EKIA 4RTMA 5DX8A 5EKUA 3G5LA 2AOWA 4PGHA 1QAQA 5G02A 2PWYA 3HA3A 4CXMA 3E23A 3OZRA 5LQNA 3QV2A 2PWPA 2VP3A 3GCZA 3GU3A 1VE3A 5K0BA 3R9XB 1R8XA 3NJRA 1XDZA 1KIAA 2OO3A 3P97A 1X1DA 1QAMA 1YZ3A 2QM3A 4IWNA 4C08A 3EPPA 4O29A 4HG2A 2ZFUA 1JSZA 3S68A 1NW7A 4CTJA 2NP6A 3THRA 1KR5A 3R0QA 2AOTB 4YV0A 1G8SA 1EJ0A 1OR8A 5ICGA 3TMAA 4YUXA 1FBNA 5EMKA 4R6XA 5IH3A 4IV8A 2H00A 3PB3A 5GINE 2PY6A 3GGDA 4DCMA 4DQ0A 4E2WA 3EVDA 2GPYA 5HFJA 4RTQA 5CCXA 4F86A 1FP1D 3EVZA 2IDJA 4ER6A 2B2CA 2H11A 3G89A 2IH5A 3DXYA 3EEYA 2FYTA 5E1BA 4P7JA 3DLCA 3EVCA 1L3CA 3GRVA 1NE2A 5HIMA 4C03A 1Q0SA 3B89A 1N2XA 4QVKA 4XUCA 3M6XA 3TLJA 3TPZA 1RI1A 2P41A 3KPUA 3PLAE 4M36A 1G6Q1 4P7KA 4X1OA 4C4AA 1VP3A 1EG2A 3P2KA 1BC5A 3ELYA 1HMYA 3K0BA 2HNKA 5DSTA 3KPVA 5HEKA 1IY9A 3FPEA 3GIWA 4MWZA 3TKAA 3TM4A 2IH2A 1YB2A 3PFGA 4XCXA 2UYHA 1INLA 3CJTA 1O9HA 2Z6QA 3OFJA 4X61A 1FJXA 1IM8A 2AOXA 2PSSA 2GB4A 3G2OA 3G8AA 2UYQA 4DZRA 2IPXA 3DP7A 4FS8A 2CMHA 10MHA 4QPNA 5EEGA 1YF3A 3P71T 3LKDA 1R00A 4OX9Y 2CL5A 3F4KA 3NVKI 3BZBA 1UFKA 5F2OA 2ORED 5DWQA 2ZCJA 3B3GA 2ONZA 2JG3A 2HTEA 1KP9A 3DTNA 5K0EA 4RVDA 4GQBA 5ERGB 3GRZA 3MTEA 3SM3A 3G88A 1PJZA 3B3FA 4U7TB 3ELDA 3CVOA 2NXNA 1I1NA 2YXEA 5DRYA 3V8VA 3RODA 1ZG3A 2AS0A 4DCGA 4C05A 1Q0TA 3PFHA 1AQJA 3VC2A 5DLYA 5DSXA 1YUBA 2Y1WA 3BUSA 5CVDA 4FT2A 1WXWA 2FHPA 5K05A 3NW9A 1XCLA 2BZGA 4QPPA 4AZWA 3AY0A 4KIGA 3NDIA 4AZVA 2AN5A 3ER9A 3C3PA 2NNWB 3IEIA 3HCFA 3FTFA 2I9KA 2ERCA 3NWBA 3GRYA 4EQZA 1QAOA 4Z2YA 1WS6A 1G38A 2ZIFA 8MHTA 1QZZA 3FUTA 3KHKA 3SXJA 2UYOA 2P35A 3GXOA 4E2YA 3MGGA 1T43A 2AVDA 3ME5A 3QOXA 2NXEA 3RW9A 4E32A 2P7IA 4ER5A 4P7FA 4C06A 3NMUF 1EIZA 2PX2A 1EJ6A 2PV0A 3X0DA 3A25A 2BR3A 3DULA 5K0LA 3FTEA 4A6EA 3G8BA 1TW2A 3REOA 5F2NA 3H2BA 4R05A 2ZW9A 5FCDA 3ID6C 1VQ1A 4FP9A 5P8WA 2AN3A 1VIDA 3SSMA 4V0RA 3TRKA 5K09A 3PVCA 2ZBPA 3PS9A 4PYKA 1G8AA 1O54A 5KYGA 3P2EA 4EKGA 3UJAA 5BP7A 1M0EA 3M6UA 2JHPA 3C6MA 4QDKA 5ICFA 3ELWA 3KQQA 3UA3A 2ZZNA 3TQSA 1HNNA 4KWCA 4PYMA 1SUIA 4FSDA 2NXCA 1B42A 3KR0A 4YV1A 3R6TA 2O07A 5LQUA 2YXLA 2ZSUA 4FT4A 1ORHA 2F8LA 3I64A 2AOUB 3MB5A 3O4FA 4K6MA 3DLIA 5GP1A 3DOUA 5CVJA 1P91A 3FTDA 5DX0A 2K4MA 1DCTA 2IIPA 3GJYA 2PVCA 2YXDA 3CGGA 2VDUE 3BGIA 5JUWA 5FWAA 2YVLA 4NECA 3HCDA 5T67A 2YX1A 1RJGA 3IYLW 5EMMA 3EMDA 4GC5A 4PYLA 3LSTA 4RTOA 2N47A 4GC9A 3KPJA 3M6WA 1TW3A 3JWGA 5EKXA 2XYRA 4A6DA 3KKZA 2GLUA 1AQIA 3FUUA 1M6YA 2P40A 2QE6A 5ICCA 1P39A 4GF5A 5CVEA 2QRVB 3FPHA 5F2KA 3SSNA 1JQDA 5GM2A 1JG4A 1R74A 4F84A 2Z6AA 3SX0A 1RJFA 2XYQA 3KR2A 5CVUA 2V74B 3BWYA 5K0NA 4RVHA 5CM2Z 1BKYA 2LD4A 4HRAA 2ZBQA 3LBFA 4XUEA 5DM0A 5HIJA 1JQ3A 2DULA 3JWIA 2V7EA 3OCJA 4GOND 2QY6A 3UWPA 2YUIA 3TR6A 4QTTB 4HTFA 2HR1A 1R8YA 3Q7EA 2ZLBA 1WG8A 3FRIA 3R3HA 5C1IA 2GA9A 4EK9A 3CC8A 1XCJA 4X63A 1AF7A 2PGXA 5DM4A 3LGAA 1JTFA 1D2HA 1RI3A 2OY0A 2Y1XA 3O7WA 2ZZMA 3AWIA 1NV8A 1RI2A 2PXCA 5EHIA 1WY7A 3C3YA 4YUWA 1P1BA 2B78A 2XVAA 3HM2A 3OU2A 5E9QA 3FYDA 1XJ5A 3UJDA 2IBSA 5HIIA 4BLWA 4DMGA 3BKXA 1N7IA 1X1BA 2UYCA 5DPMA 3E05A 3FYCA 2B9EA 4ER7A 2NP7A 4YUYA 3CJQA 2PT9A 4RTNA 2WA1A 3IV6A 2QYOA 3LDUA 4GEKA 2ZWAA 5EC8A 2C7PA 2PXAA 4CWAA 2PKWA 1X1CA 5EIFA 1G55A 2JHCA 4IKPA 1D2GA 2G72A 2P1DA 4RTLA 3EEOA 3TKYA 2G70A 3HCCA 3Q87B 4AZSA 2E5WA 1XTPA 2Q41A 1X1AA 3TM5A 2AOVA 2ZIGA 3JWHA 3LDFA 4RYLA 4E30A 2IP2A 1MJFA 5DXJA 2GH1A 5EOVA 4PYIA 3PTAA 5E9JA 3UJ8A 2HV9A 4QQKA 4GBED 2FK7A 4XUDA 9MHTA 1JTEA 5KVAA 3G2PA 2HWKA 5FUBA 4MQ4A 3DUWA 3UJ9A 3HTXA 5FQOA 2IBTA 2PX5A 2AN4A 3BGDA 2I7CA 3D2LA 3E7PA 3VSEA 4PIPA 3CKKA 5IKMA 3KQWA 2PBFA 4UOEA 2NXJA 3HA7A 3KR9A 2FCAA 3ELUA 3MAGA 4OBWA 5K0FA 4IV0A 3FPJA 1SVUA 3DR5A 5FQNA 3SR4A 3EGIA 1JSXA 5E9WA 2WA2A 3LCUA 4KRGA 3UJCA 5C9ZA 3FUXA 3DXXA 4EMSA 1ZKDA 4RTKA 4HGZA 2C7OA 2H1RA 3B5IA 2AOUA 2VZ9A 1EAMA 4RV9A 5JR3A 5K0JA 2PJDA 1SQFA 2P8JA 2JH9A 2YTZA 4U7PB 2XBMA 3OE5A 1YFLA 5M5BA 5GOZA 1RI4A 2ZVJA 3M4XA 5EMJA 3HCAA 3OFKA 3BWCA 5FHQA 1SQGA 4RVFA 5EQJB 4RTSA 3EVFA 1YZHA 2OYRA 4CKEA 4YUZA 4GOMD 4JXJA 1R6AA 3G5TA 3PT9A 1I4WA 2I6GA 1TPYA 1JG3A 2EX4A 4WXHA 3MTIA 4QDJA 4B17A 1IXKA 3I53A 3I58A 2PXXA 5K03A 2EG5A 5CVVA 4PYOA 3TOSA 3DMFA 3LPMA 1ZGAA 1FPQA 1V39A 2AOTA 2R3SA 5E8JA 3BT7A 3LHDA 1KXZA 2XVMA 4KDCA 5EG5A 5U4XA 4L7VA 1XVAA 1L3BA 2GS9A 1WZNA 2BM8A 4M7RA 5DRTA 4BLVA 4RTPA 3ERCA 2P3LA 4X41A 2BH2A 3EMBA 5BW5A 5KQRA 4GUAA 5LQJA 2C7QA 3EVEA 5E2BA 1L3IA 2EJTA 5EHGA 5CD1A 5E1OA 4ER0A 4P58A 4BY9E 4POOA 3HP7A 4FSXA 3RIEA 1VP9A 5T64A 3SVZA 5FULA 4CTKA 3DXZA 4QTUB 5E2AA 5LQKA 5E8RA 2ZIEA 3E8SA 3GO4A 3P9NA 4OA8A 2OXTA 3R24A 4C04A 4LG1A 4ISCA 4R8SA 3FRHA 1UIRA 1QANA 2B25A 2G71A 2VDVE 3QOWA 1RJEA 4AZTA 2BR4A 1KPHA 2G1PA 1XDUA 2DPMA 3PX3A 3ER8A 2ESRA 4RX1A 1ZQ9A 3B3JA 3FTCA 5HZMA 1BOOA 3JWJA 5GIPE 3LBYA 3MCZA 4PINA 2OB1A 3C0KA 3HCBA 3LCVB 3CJRA 5BW4A 2ZTHA 3LCCA 4ZTBA 2EJUA 5ICEA 3OZSA 5DT2A 2IGTA 3HA5A 1O9GA 4HSGA 4DF3A 5DM1A 5EEHA 3M70A 3EGEA 4E33A 3BWBA 5LQRA 3GRRA 4DM3A 1RJDA 4CKBA 1U2ZA 3P9CA 2KW5A 1MHTA 1Y8CA 1JG2A 1KPIA 3P9IA 4RSRA 3HVHA 3KU1A 2ONYA 3UA4A 3OPNA 5DX1A 3THSA 4AX8A 1DL5A 5D1NA 3EVGA 4KIFA 3BXOA 4LWOA 5K01A 3P8ZA 3TFWA 3LL7A 3M6VA 2HMYB 3FPGA 3O31A 1KYZA 2IFTA 2AZTA 2BM9A 2P7HA 3SGLA 4RTJA 2AVNA 3UBTA 2UZ4A 4MIKA 1L1EA 5H02A 2WK1A 3NWEA 4HC4A 1EQAA 5EZSA 1F3LA 3WSTA 4PCLA 2NYUA 3I9FA 4FGZA 5B1SA 3LX6A 4G56A 4LECA 5DTMA 5CIYA 2FK8A 4F85A 5EMLA 5KQSA 4AUKA 5FTWA 4EVIA 4MHTA 4RVGA 5K0CA 1ZHFA 1JQEA 1FP2A 3BKWA 4FR0A 4R6WA 3LKZA 5CCBA 2PT6A 4PCAA 1SUSA 4PWYA 4RTRA 3FPFA 1NW5A 3GNLA 2ZBRA 3ANXA 3KPYA 1JG1A 3A7EA 3P9KA 4YV2A 2EFJA 4E2ZA 4E70A 3U81A 3KQMA 1QYRA 2OZVA 4OBXA 1UWVA 2IDKA 3HCEA 1PRYA 3KR1A 3UZUA 1R18A 3V97A 5EPEA 3EVBA 3T7TA 5KS2A 3HVKA 1WXXA 3G2MA 3BGVA 1XXLA 1BHJA 1Z3CA 5LR6A 3I5UA 3KQSA 5HILA 2OB2A 3KQOA 3MCTA 5DTQA 1ZGJA 3KQYA 3HEMA 5K8VA 1NBHA 1VLMA 2JH8A 4HTFB 4RWZA 2ZZKA 4PYQA 5BXYA 3A4TA 3LDGA 3L8DA 1L9KA 3AJDA 3AXTA 3BWMA 3T7SA 4ATNA 2CKDA 2CWWA 1SG9A 1KYWA 3UJ7A 1YFJA 1NW6A 5T6BA 1AV6A 4Y30A 3P2IA 5GM1A 3PX2A 5E1DA 3SSOA 5FA5A 3VC1A 4ER3A 3OU6A 2C7RA 4KVZA 1G60A 3CCFA 4HH4A 3NDJA 3FUWA 3MERA 3NTVA 5E1MA 4WVLA 4PIMA 4P7GA 3DMHA 1X19A 1VPTA 3NVMB 4M37A 4GOLD 5GIOE 1XDSA 2CMGA 3K6RA 4Y2HA 4YMGA 3VYWA 1SKMA 2O05A 2B3TA 4YMHA 5HOQA 1NW3A 3G2QA 2O0LA 5CUQA 3T7RA 4BLUA 4DKJA 2QRVA 4DA4A 3GDHA 1NT2A 3C6KA 4HGYA 3KPWA 1N7JA 3G7UA 5DTRA 2PLWA 4H0NA 4PNEA 1KHHA 3HVIA 3KQPA 4CKCA 5LQAA 3KQTA 5DXAA 4YUVA 2O57A 4KW7A 3DH0A 3SMQA 1VL5A 5C0OE 1F38A 3UJ6A 3HVJA 1D2CA 1I9GA 2A14A 1NW8A 2ZULA 4GOOD 4QQNA 1KPGA 4BP3A 5K0GA 5LSAA 7MHTA 4C07A 1DUSA 2JJQA 4LWPA 4OA5A 4FZVA 5FWDA 4KDRA 4OQDA 3MHTA 2VS1A 5D1HA 5DM2A 3CBGA 1JR4A
chains in the Genus database with same CATH superfamily
1C3JA 3O21A 5E2IA 3T9EA 1IAQA 4HEHA 4UAGA 5SZKB 5LBUA 2ZJ5A 1V96A 1ULTA 3BSSA 1SCQA 3GMDA 3S40A 2WF8A 3VMFA 4EH1A 3QUTA 4F6LA 1YDHA 3HS3A 4B83A 1TCAA 4WASA 4IDQA 3AXSA 4BDSA 2E49A 3AI2A 2UU9B 1RP1A 2QT1A 2P5TB 2FFHA 3RJZA 3PF8A 1D9ZA 4ZT4A 1LD3A 5FLKA 4I50B 2R1ZA 5B3JC 4D0GA 3VVCA 4BDTA 2QLNA 3DEIA 1K2WA 4B35A 4WNYA 1Y3FE 2JFXA 4BZZA 5KNBH 2VDWA 3TTWA 5J40A 1Z82A 4EAAA 3OTQA 2XYVA 1NBIA 5CFQA 3R8FA 1ADJA 2W22A 3K9CA 4OD0A 1WKCA 3ZY6A 4AG6A 2M9MA 5J2TF 5INTA 4G01B 4QTXA 3S1AB 1K9SA 2LTAA 3FVQA 2PMFA 2WM9B 3LHFA 4YT2A 3AY7A 4QKQA 4H7EA 5EFZA 1HR0B 4R2JA 2XZOA 2SKEA 3G7NA 3F73A 1U94A 2GN8A 4DJAA 2P4EA 2RGYA 4KPUA 4WK0B 3ESBA 2O2CA 1MGPA 1P8AA 2BFCB 3EPPA 4TTSA 3SSAA 4BEWA 1KEWA 3HB0A 4LHEA 4S04A 4D9FA 4OHXA 2B35A 1DMSA 3GQVA 3Q3VA 1HQKA 3CINA 5HE9A 3HJRA 1T2UA 1G8SA 5EVCA 1GPWB 4ERXA 5B6IA 1X80A 3EVTA 2Z1DA 4HR7A 2IVZA 4UC0A 2C4HA 2CV2A 3QLUA 5CD9A 3B5EA 4M3NA 1RVV1 5FOXA 1L7MA 4GPEA 2FWBA 4GGPA 1FL9A 3DZJA 3GGDA 4TWAA 4BLSA 4COOA 1AB6A 5ALVA 3H5IA 1DIOB 5FLXA 4LJ4A 1TO1E 1ZP6A 3BFKA 1K6XA 1BVUA 2NZYA 3QBDA 2CYAA 3TBFA 3EPJA 2H11A 1H22A 3R5FA 1SZJG 2OZEA 3EXIA 2IH5A 3K4HA 4GRDA 2ETVA 2PUGA 1J0DA 3PNYA 3L8CA 2WFAA 1E2LA 2Q1TA 4GYKA 3QVWA 2MYUA 3V8QA 4YJGA 1N3BA 1UT8A 4WRRA 5BVHA 2X4GA 4M0CA 1WHSA 1Y4ZA 3HU2A 1XROA 2G77B 4OB7A 3U2QA 1XA0A 3TCXB 3JARA 4PC2A 1ZBDA 4QG7A 1HMYA 5SZIA 2PSJA 4Q19A 3ZVRA 4F45A 5DGTA 4Z9BA 5HEKA 1PI3A 2WSBA 2QHXA 3IEPA 3RJ9A 4ISBA 4UM8B 1ODTC 4O0LA 2CB9A 2OILA 1E1MA 1O9HA 3LUBA 3OQBA 1V2HE 1L4HA 2HHJA 2NUTB 2H51A 1OLXA 3WIVA 1CQIA 2O6LA 1RFLA 1KZYC 4YRSA 2MSWA 4EBBA 4Q02A 4FWBA 4TVOA 3DT8A 4MRMA 1CXZA 3DKPA 1A2KC 1QPGA 1LDNA 4EA7A 5JBQA 3IVRA 4PPNA 1Z16A 3QM1A 1GNSA 3BZBA 1SU8A 4JLAA 4E1AA 2Q6IA 1Q0LA 1QYWA 3B3GA 4NKRA 4IL5A 4FFNA 2QGZA 4DNOA 4H16A 1R10A 4UM7A 5F1KA 2JFGA 2DHEA 1J97A 3M4ZA 3QF7A 2AFVA 3BD7A 3QYAA 1C9EA 2XHZA 1RXIA 2HIGA 4P4TA 3AJRA 3EQ8A 1Q16A 5DNAA 2PL5A 3W5DA 1Q6YA 1DCFA 1KA9H 4BLQA 2VTEA 1H5QA 1GPLA 4AKGA 1US8B 1NGSA 2XVZA 3OZGA 4XJVA 1DC5A 4FMCB 5I9SA 2DCMA 5H70A 4WOPA 5IN4A 4J07A 4L75A 4NFHA 4WY2A 3U40A 1EI9A 4LXGA 5NULA 3KSMA 4WN9A 2BZGA 1D03A 2FAXA 4IIJF 1ZRHA 2QX7A 2E0IA 1X39A 5FBKA 3G9UA 4HH1A 1A0OA 1W2HA 2EL9A 3BBPA 1A98A 1DBSA 2ZIFA 2QVGA 4RGYA 1JI0A 3C8ZA 5EUCA 2UYOA 3IUMA 1YMQA 1HZZC 2APJA 4P98A 4XJTA 1FFXA 1ULUA 1IXRC 2XOEA 2IQ5A 5I3CA 1NNLA 4ZT5A 4RDCA 3EGWA 1Y9EA 4A6EA 1EDBA 3G8BA 1UANA 3REOA 1WZEA 3RSLA 4BV2A 3MMZA 2QR3A 5BSHA 2P4SA 3DFMA 3GLHA 5DI9A 3UGQA 4E2WA 3H2KA 4N6GA 3IBYA 3N74A 1X2BA 1GPJA 1EPUA 1FUEA 1JQLB 1XRPA 3OC6A 2ZS7A 4URWR 5HTKA 3TPCA 1SCUA 5A04A 4PBSA 2B6HA 4REMA 4ZJZA 2R6CA 4HPWA 4L4ZA 5CIWA 3DL0A 1Z4OA 3PRYA 4ZU6X 3TCKA 4DVJA 3FNQA 2O5CA 4PYMA 3FVTA 1UKZA 1GL6A 4ZVPA 7GPBA 3PF9A 2A1UB 2P9QA 3HBLA 3DKIA 3QWIA 1HQCA 1ECFA 4WAUA 3ZV7A 3QLTA 2CUZA 4LRXA 2X0DA 3R8XA 4NCKA 4DC9A 4CEIB 2AEMA 4Q00A 4DZZA 3HB1A 4KLZA 5TJ9A 3UN1A 3A10A 1HDGO 2PWZA 3GJYA 1U5BB 1SBIA 1FFEA 5FWAA 4AURA 4OLBA 4NYIQ 5T67A 5CB8A 4G2TA 3EXHC 5FBHA 4X20B 3WJ7A 3T1NA 1DQPA 2IXDA 2N47A 1KVRA 4HNAB 3MT9A 2JGAA 3REFA 3BG5A 2XJ9A 1QQTA 1RU3A 3PJDA 4JYCA 4KVGA 3LLSA 4NMXB 1BWRA 3CB2A 4LXIA 5KEIA 3EBLA 2RHBA 4GI7A 4AF6A 1C7FA 2VXCA 3T1HB 1W88B 3FKSD 4UEQA 1U1CA 1P2FA 2FSVC 2LVBA 3BM5A 2VAXA 1ZCFA 2ZPTX 3QQPA 4M9QA 4YCCA 3KP1A 4PSUA 1I13A 2FN4A 1ZXXA 1ESEA 3VVLA 4OQXA 4GNRA 1KBOA 2NUTA 3AWDA 4TLEA 4Z3DA 4C0SA 2LCIA 4XFKA 4YDQA 3TIIA 3INYA 2GQ0A 4H7FA 5KWVA 2Y93A 1C3OA 4GIBA 1T5BA 2H4FA 4UXJA 2PL9A 2JL1A 2VVTA 5IJAA 4MWEA 4BOYA 3QI2A 4M86A 4EK9A 4S1NA 1YDWA 5LP6F 2O8CA 4J0KA 2PG3A 2XTJA 3D0OA 2Y1XA 3KG2A 1EDDA 1YZQA 4MQEA 4WZAB 4H27A 4DFDA 4RETA 2N75A 3OU2A 5ETJA 1ONBA 4RHEA 1M1NA 2GHIA 2D6FA 5IW8A 3ROXA 3WA7A 2VLBA 2XDYA 3L0ZA 4A2WA 3NC1C 3TI7A 3UUGA 1D1PA 3AVPA 2VHWA 4OYYA 4RA9B 2NO1A 3KT6A 4G5GA 1DIAA 3A4LA 3T3MB 3AKEA 2ASEA 1QB8A 2RHRA 1NVUQ 3JALB 1RRMA 1W5TA 2QZSA 2W6PA 3V42A 1RQGA 3RF7A 4TYPA 4GMXA 2OQVA 4F4FA 1R2QA 4LOIA 4IGKA 1CERA 3F90A 1D0IA 1ULBA 4JJZA 4BQOA 9ATCA 1UWCA 1Y3HA 1KFKB 4RSMA 5DFAA 1SGWA 2Z8YA 4GZLA 5A9RA 3CR3C 4ZOQI 2OHGA 2ICAA 3QFHA 4JROA 1IU9A 3ZD7A 1F14A 3UJ8A 4KTTE 3BD8A 1GLGA 3TOVA 5IJ9B 9MHTA 3SZOA 1JTEA 4OHWA 4RPGA 5AJXA 4C1NA 1QZTA 3I5XA 4UHKA 4HTAA 3O9MA 4JLUA 2G76A 3BFXA 3C14C 4HGQA 1GNVA 2I7CA 4EEXA 4L5YA 1SY7A 2QROA 1S89A 3I39X 1KMHA 4NCAA 1GSIA 5FUXA 3LA6A 2C2HA 5CTAA 5B2FA 5L7TA 4YRNA 4FNAA 2GHQA 4D4MA 1HDYA 1MX3A 3VO1A 1S1CA 2LXNA 1RHMA 3A4NA 2XQIA 4OGKA 4WCVA 5A71A 5KX5F 4YONB 3L7LA 2G06A 3WQSB 5DP2A 1Z8HA 4TT3A 1ANKA 1S2LA 2RHTA 1JQBA 3AONB 3AF1A 3ZKWA 5DHFA 3VHQA 4CMJA 1QR2A 2WT9A 3PHIA 4DRXA 3HU1A 5G40A 4CEIA 4S1WA 1AMNA 4LKRA 1SPXA 1RRVA 4U7PB 1GLNA 4BEVA 2BMAA 3OQJA 1PWXA 4L5AA 1HE5A 2PRYA 3KYBA 3TQFA 1SU6A 4DXAA 4X20A 5C32A 1JHPA 5HZGA 3T4XA 2WWTA 5IP5A 4ZYTA 2VNSA 2C83A 1SBTA 4FILA 2CVHA 3EISA 2NYVA 3VVBA 4R9VA 3RFTA 2W8BB 3PUJA 3RFXA 5BVGB 2QV0A 5AJVB 4GS5A 2XMQA 4X44A 4EAQA 2IY7A 2JK0A 3DOJA 5LN1A 4KUGA 4Q3DA 1X92A 1R6TA 4JUFA 1LCIA 1DT3A 2XGGA 3DW3X 3K8YA 3E22B 4HD8A 4UREA 3A2LA 4N8EA 4RVCA 1DWUA 4PZ0A 1V39A 3JVUA 1YTLA 1P31A 3LFHA 1Y8QA 2PIAA 1KXZA 4N0DA 4KDCA 4CLDA 2Q4DA 3D8UA 3IDAA 1NLZA 1Y9ZA 5IF9A 5DCWA 4EHDA 1U0FA 4BC0A 1O5TA 1Z4PX 2YXBA 3GUVA 3BWDD 2EKPA 4R0VA 4R0MA 5E2BA 5JYCA 2FVYA 4KR3A 4BQRA 1LV8A 2BH9A 4DGSA 2ECQA 3KXPA 4MWDA 1VLQA 4XWAA 3ZBQA 1Z9BA 4CTKA 2UYYA 2YJ4A 5GOZA 3SFTA 1QQ7A 3E8SA 4PM4A 1Z73A 2IYVA 5G0WA 5IXJA 3AF2A 3QTLA 4B4OA 3L7JA 4V1CI 2IPNA 1SC1A 4YQFA 1BMFD 3GN1A 4JU9A 1XDGA 4RA9A 3L1VA 2X0JA 1SXHA 3TEJA 2DPMA 3Q2IA 3BVPA 4RCYA 4EY6A 1H6CA 2XITA 4EJ0A 1WMFA 1YAHA 4YRJA 2G9NA 3RC1A 1VIVA 3LCVB 5C2JB 5H4GA 5JC8A 2PLFA 4WOJA 1U2EA 4Q9IA 6CHYA 3LCCA 3NALA 1RRGA 4UVEA 1XDBA 5BYJA 3X1JA 2HF9A 3DL2A 1DO8A 3HP1A 3EIXA 2HX1A 1N77A 3OCVA 4BVLA 3W2HA 2HFJA 4JL6A 3Q11A 4EG4A 6REQA 1U2ZA 2K2QB 2P11A 1XRNA 4ZOCA 5E6UA 3VDMA 5IJ9A 3P9YA 1G16A 3C74A 4Z4CA 1ZI6A 1NUHA 1TOAA 1MQAA 2AV6A 4LIPD 5EKSA 4JIMA 1BHSA 4L16A 3VR4H 2IYNA 4YFVA 1N8KA 1SBCA 2IBMA 5D1NA 2C5FA 5ERXA 3W1VA 3BXOA 4WA7A 4LV6A 2GASA 1USGA 2G9UA 3HYCA 3CN9A 3M9XA 1KKUA 3ZHRA 4IOMA 3O31A 4H7HA 1XJ0A 2AZTA 1IHUA 4RIIA 1KVUA 5HF8A 4OXKA 3W90A 1T5TA 1KAGA 1EVKA 1Y6GA 3N8HA 5BURA 4QSHA 4UEKA 4XZ3A 3ITKA 1JIJA 1SUEA 5DTMA 4BJHB 5KVQA 5EYPB 1E4EB 1L5KA 1N33B 1P1RA 3VZBA 2VAMA 5G0VA 5K45A 3R5SA 4MVJP 3BKWA 1HX7A 2PT6A 4YECA 1MEOA 1VG8A 3QWBA 5DIFA 3FWKA 5I9MA 1UC9A 3GK3A 3IBTA 3WJAA 1BDMA 1AZLA 1JLSA 1MIHA 3OE7D 3U81A 2BHRA 2CWDA 1Q0HA 3TNDA 3A1VA 3MGAA 3KZCA 1NBOA 1QIDA 2W8BA 1G9SA 2V59A 1S2MA 5D3QA 2BFWA 1PFUA 2YYAA 1PJLA 3RVKA 3UXYA 4CODB 1U0RA 3GPIA 1V41E 3H5LA 3EFOB 4JP2A 4YMWA 4ZFNA 3B53X 1IMOA 1Z39A 2MMGA 4TYNA 3ICPA 3BS4A 5TVGA 1WUKS 1EXMA 3DTVD 2HHAA 1TAQA 3W06A 3W4KA 3VAZA 5EINA 2B21A 5BXYA 2GJKA 4UUNA 1JU4A 1CUYA 1FTNA 1QGED 3AP2A 5AM0A 5LLTA 3IQEA 1CF4A 2C98A 3BGWA 3C3MA 3HJBA 3K4QA 1DXYA 2DBRA 3KZOA 4J0EA 4NBSA 2ODNA 1L5HA 3GHHA 3S2ZA 2ZSAA 3JV7A 5FL7A 3S6JA 2DSTA 3Q3HA 1AG9A 3JQDA 5LDDC 1G7RA 1VKZA 3CWCA 4WLFA 4EYGA 3IQWA 1KU6A 1SMKA 5ALGA 1P0QA 3DAYA 5EGNA 5FPQA 2ZUTA 1G60A 3RYFA 3EC2A 3DZIA 2GERA 1DPGA 2AMYA 3LBHA 4GOKA 2ZJFA 4P7GA 4WVLA 2XMSA 1XDSA 5LMCA 1MOQA 4YMGA 3G5MA 4YMHA 1A97A 3MJTA 3G2QA 2JFBA 4MOWA 1AF4A 3JAKB 1J24A 4ZXFA 1L5YA 2BM1A 3HQ4O 1P3Y1 3TTVA 1WU7A 2DOKA 4PZEA 1CKEA 4NLLA 4NU0A 4A0FA 1NONA 2EF1A 2ZREA 1DKMA 3KYDB 2VA9A 4URHA 5DXAA 2EP5A 2RHHA 3DH0A 3WDKA 2BTOA 1OBFO 2OCIA 4RMGA 3PPWA 2OUIA 2F9FA 2EQBA 3FSGD 1LTKA 4HWSA 1M73E 3V7UA 5CU7A 2W4MA 2R5NA 1NLUA 3UPDA 4P22A 3FMVA 1TGYA 2WPNA 4YAJA 3UG7A 5JNLA 4RHXA 1XKQA 4OMCA 1FPMA 4MIYA 1KSJA 1BW9A 3HXOA 5A4JA 5KU1A 2QRGA 5LYJA 5A4KA 3A6KA 1IZ7A 4Z7QB 4W8GA 3SIWA 1P2GA 3TW8A 2AFHB 5B58C 4UD2A 2X76A 3MK31 4Z8YA 2XGJA 5IC4A 3IL2A 1NKVA 1UADA 2J9XB 1NJ8A 4U3JA 2YH2A 3CO0S 2HUNA 2PWAA 2PX4A 1DG9A 1ZK1A 2V03A 3PSAA 1JLKA 2E3JA 2IELA 1GQQA 2PX8A 2Y2UA 4IJ6A 3SQOA 4DYHA 3UT5B 2QOEA 1Y98A 1O95A 2ECKA 2R8PA 3A27A 4V0QA 3ZIAA 4LY6A 1Y6JA 4R68A 4OQZA 1QGYA 1UQTA 2JD1A 2OORC 2ZSBA 3PDJA 1RYBA 3NAZA 3PD0A 1E4EA 2YWDA 3FFTA 5KIAA 3CIOA 3THXA 4F8YA 4H59A 3BE8A 4URFA 1NG1A 3P27A 4Y6LA 3GUCA 5K0BA 1ULSA 1U90A 1MN6A 3M2PA 4J16C 4NK4A 4V38A 3HNPA 3KTAA 3D0RA 2ZK7A 3VZDA 5LLDA 1BFDA 2OHOA 4GWKA 1G3UA 2HBQA 2AI1A 4B3JA 1YZ3A 4IWNA 3ER6A 3TLGB 4BZPA 2CSXA 2D59A 4L8VA 4BATA 2Z5VA 1FSFA 3EFOA 4OUDB 2SCUA 1F06A 2I66A 2JCYA 2WOOA 3THRA 4JAVC 3LUDA 1NDHA 1NVVR 2PLNA 1WRBA 3AR5A 1TAHA 4WFJA 1MAUA 1Z8NA 1FBNA 3ANLA 4UEOA 1NUAA 4Q7JB 2VHZA 6GPBA 3TPFA 1VJTA 5JYEA 2PEZA 1PEKE 2D0OB 3JQ7A 1CQZA 3RYIA 4MZDA 4CLXA 2OBYA 1NXTA 3K31A 4R3WA 4P3YA 3RWBA 4MRVA 2F67A 4EUEA 2CXHA 3DDOA 4WOCA 1FP1D 2C1XA 2IDJA 4YCAA 1UBKS 3R0IA 1H4TA 5D5HA 4BMCA 3MT8A 3I37X 3IT2A 3DXFA 4NSNA 5DH9A 3WY9A 2CY0A 3R3SA 3IJ5A 4W63A 5D7NA 1Y5IA 1QUEA 2YN0A 4MV9A 4JH0A 1UXHA 3JD4A 4FFDA 2NV6A 1N2XA 2VZEA 3OFND 3RO7A 5H4HA 2JIQA 3TRDA 1KH1A 3KPUA 4RD0A 3NHLA 4RXTA 3DE6X 4ZCSA 2C4MA 1EP1B 1NLMA 1XZBA 2GWRA 3FNRA 3PA8A 4LK2A 4MCHA 3CIFA 1F1BA 1JDBB 2B4RO 3MWKA 4WA8A 2ZRLA 4Y9SA 3WRYA 3GMIA 2QBYA 3IOCA 2OV8A 6Q21A 1ORVA 1RAGA 4UVIA 1CCWA 2C84A 4X85A 1OH7A 4N18A 2V3CC 1KZ4A 5AKKA 3CJTA 1FZQA 4X8MA 1OOEA 1GEEA 5ITSA 2QENA 3L6CA 4XTCS 4E07A 2WFLB 5I47A 4N3NA 1AKYA 4KNVA 1IPFA 3SBDA 3U4CA 3EWIA 5MF6A 2HREA 4QPNA 3JZAA 2EKZA 4EZEA 2BF4A 3R77A 5ESXA 3H13A 4EEKA 1XTTA 3QUAA 4YP5A 2ZPAA 3W05A 5GAJA 1SRRA 2OWEA 3ZWKA 5FOVA 1N6KA 2C4UA 3P9SA 4FEEA 1YJ5A 2C00A 2XGOA 3VYTB 4DSUA 3V2HA 1PDOA 4C78A 5JHGB 5K0EA 1P7ZA 3RK0A 2ZXEA 3AFMA 3IT0A 4HWPA 2CFTA 3AP1A 4UHDA 3W78A 4EKYA 1VSQA 5AVQA 2TRSB 2IDMA 2QL7A 4DCGA 4ND7A 4K1XA 2X5JO 3PFHA 3OY7A 9GPBA 1G4AE 4L57A 3DO5A 3GPBA 1XOIA 1X1EA 3HO6A 1OI2A 5BN3B 2HK8A 3HBJA 1QLHA 1HRDA 3PGLA 4FYMA 2IC5A 1U9YA 1XCLA 5GJBA 4ZK6A 5ENZA 2C9ZA 1UDRA 4KPEC 3OIVA 2VATA 4G0WA 1KP3A 1KETA 3GRYA 3COVA 1XQWA 3K4PA 5FJIA 3SS8A 2C94A 4F2PA 2W00A 3LUHA 4RW0A 1PV4A 1RKQA 5TQJA 4N12A 3SVTA 1Q6ZA 3DDUA 5FLEX 1CR2A 1T43A 2G1UA 1Q1GA 3GFOA 3ME5A 1AX9A 2CHUA 1GTL1 1QO7A 1WXDA 1EVJA 3AHFA 1GWNA 4O59O 4QXMA 2IU4A 5IEBA 1VB3A 3PQ2A 2WYHA 1E9EA 3DCJA 5FKJA 4BVGA 1TW2A 1SOAA 2FSSA 3C6QA 4GE0A 4HGNA 4BX2A 3HXTA 2XDAA 4DJ5X 2AXNA 4GX1A 5H3HA 4OHKA 1A8PA 2RGBA 5BP7A 1JA1A 3Q3EA 4OUDA 3HM9A 3QY0A 3GLIA 5BNZA 4LHWA 3NV7A 2X4IA 3FKQA 3UA3A 3TQSA 3VDRA 4DAEA 2GN6A 2NZUG 3EF3A 3SQDA 4Z1OA 5LQUA 3ZXIA 2YXLA 1ORHA 2VF2A 3GAMA 4AJIA 1B2LA 2YVUA 1S01A 3GJ6A 2RGEA 1JQJC 1XZDA 4HZUB 2FVXA 3NNNA 4JA0A 1GNQA 1HFWA 1I0IA 1YBFA 2NTNA 4HAVA 4J0CA 4N39A 4WBNA 1YR1A 3BGOS 1Z38A 2Z2YA 3IIIA 5BUSA 5CNIA 2XCOA 2O2IA 1ODSA 5M7EA 2W4IA 3VR4D 3V46A 1FFWA 2EWMA 2XYRA 3MPOA 4D8YA 4EYEA 1RKVA 2QE6A 1QSGA 4YRQA 4ZPJA 5EWLB 3PIRA 3N7TA 5D3MA 1M2FA 5HQJA 4DCCA 5F2KA 1UMDB 5EQTA 4GM4A 3T5DA 1XLVA 3T1OA 1ORRA 1TF2A 1PFWA 3A58B 1I2DA 4LZPA 2B99A 4TRRA 4IIGA 1TK2A 3NNSA 1YJCA 4QDOA 5D8DA 2Z1NA 4DQLA 4YI3A 1G9TA 1FIUA 2VN8A 1HNWB 4CKZA 4WERA 2YYSA 1F4VA 3VRHA 2V6IA 3VJLA 1RP7A 5E7QA 3NTUA 5AVJA 4TUYA 1AHHA 2QTNA 3CRW1 4QTTB 5AJZA 3TR6A 4EB3A 1YC5A 1PNQA 2D5IA 2JAHA 2JATA 3EDCA 1C7QA 1V5GA 2FSFA 3FNFA 3LU1A 1BO6A 4IGIA 4YJFA 4UM9B 5C7YA 2OV4A 2RGRA 4PEVA 2YJNA 4TTIA 2QRHA 2QRNA 4PX2A 3THOA 1UPCA 4ARAA 4OI0A 1Z6YA 2BP7B 3HJCA 3E8MA 2XADA 3JQRA 4KQWA 1JAYA 2W6ID 4DMKA 4O2AB 2H2FA 1VZ2A 1IZ8A 3WNDA 1KAHA 3ETJA 1I5RA 5CEEA 2NZVG 4D0NA 3L0YA 4DV2B 4UCQA 2CT8A 1P4JA 2D1FA 4YRLA 2CLFB 4B71A 1CZUA 4YUYA 2UVQA 2QK4A 4HLQB 1N7HA 4ALKA 1GR1A 1JAIA 4K6HA 4U6QA 3LT1A 3ASZA 3ONEA 4CL2A 1DRKA 1SVWA 3N0RA 4O5AA 1SQ5A 5IN5A 3NBXX 3JRXA 1KL7A 4UTXA 4F06A 4XYGA 3S3TA 1G55A 2GYYA 1M5RA 4A26A 2PO7A 4RTLA 4OXQA 3QWAA 4X93A 1Y6QA 2F3UA 1WZUA 3M9LA 5TX7A 1RYZA 2Q41A 1U63A 1VGRA 2GM4A 3RUCA 1XVLA 2MMCA 4QJBA 1NLFA 3HG7A 1QO0A 4AQDA 2PUEA 2CJXA 4RZXA 3KDPA 1IY0A 3IILA 1PHPA 3E5MA 3MCWA 3RSZA 5LIPA 4BWYA 3DUWA 4HQKA 4IJVA 3WWCA 3GPCA 2PKQP 1PT5A 5B1HA 2A58A 3DF7A 3UFXB 2V6MA 4OHZA 3OSUA 2BKUA 4YCJA 1QOQB 1Z7YA 3OCWA 2NXJA 5CHYA 4EDHA 3FNEA 1U3DA 1A1SA 3PNVA 1JSXA 3L0IB 3HXKA 5AESA 4JXXA 1CUWA 4WN3A 4C7OA 4GPZA 3QX8A 2YNMC 3CLKA 4IOLA 4DNFA 2R11A 4D4LA 2ZP1A 4HGZA 5IM4F 2VZ9A 1AUPA 2FDCA 4JX9A 1A50B 3SG0A 4YRIA 5REQA 3IPRA 3KKEA 5HJ2A 4HZUA 3ZXUB 1SQSA 1T26A 3EFBA 4CCYB 4I1OA 4Q39A 3QE0A 4ND5A 3IO5A 1T4MA 3VTZA 2PWBA 1C7EA 4B34A 2QXTA 3M81A 4ZQIA 1IVNA 3NGXA 4TYMA 3OFKA 3IX7A 3IDFA 5JXJA 1E0AA 1P4HA 3ANYB 4U0KA 1NM5C 5EQJB 3HLKA 2YRXA 1IN6A 2B8EA 3OPVA 5HK8A 3R9XA 4ZIRB 3AV0B 3OTIA 5AK3A 4PN7A 5DSZA 2OD7A 4OK5A 4BLRA 1ZLXA 2GNAA 3GMSA 4WXHA 1H9AA 2HRDA 3FFAA 4QDJA 3EDOA 3B1XA 3HB7A 3USZA 5FTKA 4DYDA 5DXFA 1T6ZA 2A5LA 2C0CA 4JHLA 1LDMA 4AXXA 3ND9A 3WFZA 2AOTA 4B84A 1UMCA 4RE5A 2WD8A 5TC4A 3WSVA 4QYMA 3AF6A 3W5IA 1PQUA 1WOYA 3SS7X 2X5XA 5K09A 3NDBB 2WFZA 1VPVA 1AHNA 2AWNA 4G5YA 4UE6A 4EA6A 2E48A 2PKEA 1RLJA 1JVNA 2FEKA 2IU0A 2RH4A 5GONB 2C7QA 2EFDB 3CPEA 4FZRA 3UGTA 3AHEA 1T3ZA 1NUPA 2J3JA 2Q46A 4N54A 1W0JA 4OIMA 3PYLA 2BP7A 1AM4D 4P08A 2CJYA 4PTYA 5AI0A 4Z4HA 1GYQA 1G2OA 4WKPA 1HKUA 4NBUA 4ZAGA 4CM6A 1JEQA 4XGRA 1MH9A 1PTJA 1RT9A 2YS6A 4DBZA 1E6UA 3UHAA 5J1SB 3ZV3A 4FD3A 1ZRSA 1EFLA 1OF1A 4LG1A 4MVJA 4D9EA 2D1YA 4QUGA 1XZIA 1XCBA 3FRHA 1SURA 2YOFA 3LZDA 4UXHA 4C2AA 1ACJA 1DZ3A 1JLLB 1Y1LA 2B8NA 3H65A 3DOOA 2LZ0A 3I09A 3LKBA 1E3LA 4FIZA 4G1EB 4NU8X 3WGQA 1PS8A 4QHTA 3PD7A 1IOVA 3LRTA 2A78A 4KQ6A 4P5EA 1ISSA 3QA9A 4PINA 5BQOA 2XT9A 4Y2GA 4BFSA 1W75A 1K8ZB 2W2NA 2JJ2D 4L3OA 4BE7B 3VNRA 5DISB 4QSMA 4JY7A 2O2YA 4P4LA 4MPRA 2OL4A 1X6VA 4MW5A 4P34A 1E58A 2R8RA 4JIGA 3L3BA 3NUGA 1Z06A 5JZVA 3KLBA 2ZTMA 3IUJA 1P77A 1LC0A 3DF9A 2CL0X 5GZ1A 1DS6A 3UFXA 1JBEA 1PCXA 4ZA2A 1W19A 3LVQE 4LWOA 2ZRJA 3MCAA 3RC2A 1CS0A 4UUOA 2BBSA 4NF2A 1VHQA 1XA4A 1Z36A 1QHHA 2ZTVA 2B9VA 2NUAA 3PU6A 2IW1A 3NEPX 4DWOA 3FNGA 3IEXA 1T1SA 2OGUA 3PUZA 1N1MA 4XJXA 4MQUA 3RHZA 4J3JA 5CFOA 1KO5A 1R3DA 4MR8A 5AOBA 3RUEA 1P72A 1H8HA 1DAIA 2XZTA 3H1EA 4DC1A 1EDEA 2C8KA 2QNRA 3ADCA 1E63A 3E61A 1E2UA 1PAUA 4BB0A 1FLAA 2Z98A 3CLSC 1T9CA 2Q3LA 3DKVA 3KZVA 4AJNA 4EB6A 1OROA 3D6UA 1WZIA 4PX5A 3TRFA 4C0LA 4F5YA 3CH4B 4DOMA 1YO6A 2ZBRA 4AW9A 5EQDA 3TINA 9ABPA 3N0TA 3QW4B 2JEZA 4M1ZA 5ES4B 3SVLA 2FI1A 1GIAA 3WXMA 4DR2B 1UWVA 3ISJA 3HCEA 1PRYA 2GZ3A 2WVJA 3K96A 4RANA 3SXUB 2FOIA 4G1MB 1HXHA 2QD1A 3FJ1A 1WMAA 4FDTA 4GPBA 4EX6A 4MHSA 3C8DA 1UPFA 3HVKA 5ESRA 3BGVA 5JJIA 1XXLA 4BGVA 3WRWA 3HB4X 1HYBA 1KYIA 3AM5A 3BD6A 1DXOA 1MNQA 2MSKA 1Z37A 3AUJB 3F2VA 4RZQA 3V4ZA 4DG9A 1MZVA 4TXNA 3I9LA 4CI9A 2R87A 2HBZA 4BB5A 1U31A 4LCEA 3T7SA 4J0FA 4WNAB 2HF7A 1KJJA 3BB1A 5GONA 2GK4A 1KZHA 2FWNA 2R00C 1TMYA 1Y89A 3IUBA 1AU9A 1RJWA 4IF6A 2H9AA 2X0RA 4CFYA 1SB8A 1GGNA 4P32A 1YB1A 4QNNA 4X3CA 3TEFA 3OU6A 3BTOA 3U1TA 1E77A 1N5KA 1H3NA 4IIUA 4KVZA 1RRCA 1NYQA 5KDOA 1RYNA 1BKDR 4NZZA 1F7UA 3UANA 4AP5A 2WNHA 3CE9A 3C45A 1OU0A 1MV5A 3JWEA 1GCUA 3U7JA 1OXTA 3VR5H 1JR3D 1PQYA 1U04A 5LIRA 1T5HX 1V43A 1SHUX 2XUKA 4ODIA 3V33A 3YASA 3ZDXB 5LBTA 3E1KA 2IF0A 3IRVA 3P9RA 2O52A 2V7BA 1RM0A 4KRYA 2WSSD 2WG2A 3G7UA 1OGJA 4MV4A 5KQPA 2XDWA 1XYVA 2OM2A 2PLRA 3CLHA 1VYUA 1KHTA 3D64A 3O83A 4K81B 4PYRA 3E5HA 4KW7A 3SF8B 3UHJA 4EG3A 5LD2C 2MT9A 4OHMA 2IUFA 3L40A 2X6TA 4MUNA 1D2CA 3Q41A 1NR7A 2WD9A 5IAKA 4KOEC 5LSAA 5KNCA 4UBLA 5DHPA 4HDRB 3RV3A 4AMYA 2VAPA 1K6EA 2D1SA 4DG8A 4LJ5A 4CNBA 3FKJA 4COKA 4HDMA 2G0NA 4RVNA 1P2TA 2E55A 4Y6RA 3DBLA 3CBGA 1PJAA 1V9CA 3NNDA 2H1OA 1B26A 2CZCA 3HACA 3KJQA 1CZNA 5FHRA 1O6CA 1H0RA 1RM3A 4D0RA 1Z2DA 2NTVA 3NVAA 3M6IA 1PJCA 5TDHA 3HZHA 4H08A 1H9CA 2BGLA 2CEAA 2NPIA 5F5NA 7AT1A 1LNQA 1C7RA 2ZYWX 4R16A 1HORA 3K1AB 4EVRA 3I1YA 2FLKA 2AR9A 2C42A 3U16A 3GF4A 4Z0TA 4AZ0A 5IAOA 4ZO7A 3EGXA 3OE4A 2PL3A 2XIJA 4ZVRA 3V2UA 1LPMA 1GUZA 2UV8A 2N1MA 3ZJYA 3LECA 3CXUA 3ZHSA 4BWVA 1DUVG 1XIVA 4H7PA 4LBZA 4KXUA 3WGNA 1A7AA 5G41A 3UFBA 3MTGA 4TVBA 1KZ6A 1VCHA 2G25A 3M34A 1AS3A 4GXTA 4ZU3A 3TZKA 1LLUA 3WB0A 1ZK2A 2WV7A 2HXGA 3P9QA 2VDPB 4OXRA 1CDOA 4QHSA 4WECA 3BE4A 3MWEA 4AYTA 3VC3A 5KKCA 1YT5A 4AO6A 5BMOA 2PWYA 4OO3A 3RROA 1VGQA 4M0MA 2BHTA 1KZ7B 1A5SB 1NY5A 4YB8A 3RKRA 3PCTA 2PRSA 4BQSA 2O59A 1V7CA 1WL8A 3GCZA 1VE3A 2PM8A 5BWMA 1CJBA 1R8XA 5KTTA 2NT3A 3KVYA 4FN4A 2NO4A 5AI9A 3P97A 3EPHA 3RIYA 4QXQA 1CV2A 5JALA 3SXUA 1AK2A 1GPKA 2QS9A 1OFTA 2DHCA 2FKNA 2V9PA 1F12A 3O73A 3GRAA 2Y05A 2NU8B 2OYCA 4M9UA 3C5EA 4AMUA 4G5XA 5IZCA 5KHOC 5GQSA 2NG1A 2EFYA 5BWBA 3ZIUA 2Q5QA 1U1EA 5AXDA 1T6YA 2RHDA 4E4YA 3VPHA 1PJ2A 4HF7A 5K8UA 5TV2A 2PT7A 1ZISA 5IBQA 5BQPA 3RS2A 4N7RA 5GINE 5FUWA 4DABA 4JI4B 1C4XA 1EE2A 4DQ0A 1T0BA 5KSWB 3R7AA 4QATA 4IXTA 4FBGA 3COSA 5KOJA 4FD2A 3EE6A 5GPBA 4BKOA 4MI9A 2HH9A 3VOSA 1JHZA 3W6OA 3ESRA 4QYWA 2ZIAA 2ROQA 4MYTA 3G0OA 4AX4A 3GPLA 1SIUA 3HK2A 1QV6A 3L4JA 2YIVX 3E9EA 3N87A 5L3QB 4DV6B 4HH0A 1P7WA 4KXYA 4YRTA 3UGJA 4KTVE 3HR4A 1YL5A 2I80A 3JAMA 2PUFA 5CFZA 2WV9A 5JRDS 2E2WA 1Q7TA 1Z0AA 3F2IA 4S0XA 5FV7A 5K3FB 4MGZR 4YY3B 2JVIA 2HNKA 2XR1A 1Y37A 3F7TA 3K0BA 3R5TA 4FW9A 4P54A 1QGUA 1KFCB 3FPEA 4R1OA 5B4VA 2ZRNA 4JJ7A 1KORA 4H2DA 1IOWA 3CX3A 2JH3A 5TMDA 4F04A 5JAHA 4NMHA 4PHFA 3L7AA 4G5QA 4F4HA 1QVRA 1YZFA 3AHIA 1ZW6A 2PUWA 1KQOA 3LPDA 3NIBA 1BS1A 5BWLA 4R7TA 4EJMA 3PDUA 5JJKA 3SIXA 2PTHA 3PC4A 5FNVB 1TRKA 8ATCA 4FMPA 3CU5A 3FD8A 4NOLA 4X71A 2ORED 4XEHA 2IHYA 4LDNA 2PFSA 2L82A 5I9LA 3GLUA 2DT8A 4Y8VA 5EE0A 4QGSA 1UK8A 2HO4A 3DGFC 4HUQA 4G65A 4YDRA 4RVDA 5ERYA 4PHCA 3PC2A 4I9GA 3HBMA 4URUR 2AKAB 2OTCA 2Y1KA 1MV8A 2Z08A 3JQ9A 3JQCA 4U7TB 3WGZA 1I1NA 1R16A 4W5JA 1WWKA 3BH0A 3K1AA 3MIIA 4HWOA 4AJKA 2J7PA 3OPYB 1KE1A 2BHLA 2OCXA 3EIQA 4J4HA 1GAQA 2EFHB 3A1CA 3N76A 4TV9F 1ONPA 4BCCA 2CJFA 4KGZA 2G6TA 3WTCA 4ZTUB 4OXNA 2YHIA 3GYBA 3ZY2A 1ZL0A 1UJ5A 3PC6A 1BMDA 1D2MA 1XRSB 2VK2A 1EVLA 1U0NA 2CVOA 2VT6A 3LSYA 4KIGA 4X3OA 1RACA 5JE8A 1NMQA 2FEXA 3IEIA 4KO2S 1KGSA 1ORWA 4IDGA 4LYYA 1PZXA 1B4DA 4AUMA 4MMZB 2I1QA 3K0KA 2X41A 3SXPA 4RDHA 3SHVA 3HE3A 3AEUB 4KE9A 1POWA 2Y1FA 4FYHA 1VI2A 1BOFA 1Q3HA 4P33A 1GU7A 4LVUA 2ODAA 2UXDB 4RK5A 2FSIA 1Z0JA 1L1QA 3X0DA 3W7BA 2FJUA 3MBKA 1YQUA 3SBOA 4KI0A 1MMFB 3MJSA 2NWQA 4BV9A 3D7RA 1Z62A 1DXHA 2XLBA 1EB8A 1VQ1A 2ZI9A 3FFWA 3HWSA 1TF7A 3IIEA 3QU7A 4I3HA 1WLSA 2IOFA 3CVWA 1EQUA 3KWFA 4ROTA 1CVLA 3BMNB 4OPMA 3P2EA 2R7KA 1T5IA 1FRNA 2DSNA 1ZH0A 1YQEA 3M6UA 2BTQA 3M83A 3MEQA 5ICFA 3UUFA 4WESB 4TTRA 4DLRA 1GTSA 1HNNA 3N8GA 3BDIA 1BE6A 3V4SA 3H1AA 3WIUA 3F74A 3E2PA 5TGTA 3RREA 4LHSA 2F8LA 5IF3A 3O4FA 2PSFA 1RWKA 4KODA 2I9PA 5FEMA 3DE0X 5IDXA 5IDVA 3DOUA 1XTVA 1NVAA 2GJ8A 3BORA 5DX0A 4BMYA 4LGVA 4XD7A 4BB9A 2D3TA 2IEDA 2QXUA 5F1OA 3BGIA 3RTCA 2QTLA 4ZYLA 3S2YA 3TLMA 2B30A 2JLWA 4MINA 4P3XA 2O8FA 1XRMA 1BA3A 1D4AA 1GG2A 2HMUA 3K72B 4HAWA 1Z4NA 5DBOA 3RTAA 3SMVA 1W48A 3UF0A 2IT1A 5BYAA 2R6HA 2BKAA 3WG9A 1BRMA 1FRZA 2VCEA 2IUTA 1TD9A 3EWSA 5L3QA 4F97A 5HKKA 5CVEA 2G8LA 1Y33E 2EJBA 1Z5OA 2JLCA 1ZQ1A 4I55B 3IUPA 2JD2A 4GNKA 4NCXA 4ZCLA 4F84A 4P81A 5AHKA 4B3MB 5TPWA 5IU6A 4FR2A 4DCOA 2VJDA 4XUEA 4EB0A 2V9ZA 5F5LA 2VYVA 1I1QB 2QQEA 4K3VA 1JKXA 4LQ4A 2QLFA 3A70A 3F7NA 4BMDA 2AD1A 2GEKA 4OQPA 3K0HA 5ENVA 5I5EA 1CRZA 4ZQCB 1WG8A 3T9CA 3DHWC 4N1AA 1V8DA 4KZKA 3GVHA 4B3DA 4FYVA 2PGXA 2OBMA 1HL7A 3I4LA 4F2WA 1MO5A 2H4ZA 2QX6A 1NVEA 2I2AA 1RBYA 2X8WA 5EHIA 4NXNB 3RHSA 3NO4A 1P1BA 5FL3A 3STHA 3KNZA 5EKTA 1CETA 2J3IA 4JC8A 2JLBA 3AR2A 3KB1A 5COAA 3NHMA 5HIIA 1PWYE 3L02A 4PLHA 3ZK8A 1I36A 3CN7A 4M1QA 1XKTA 1EUZA 3OPYA 4UMDA 2FEAA 5GV7A 5A9TA 1HUQA 3AEZA 2QSYA 3IP8A 4B47A 3NB0A 4P6VF 4BNIA 2QYOA 2FMIA 4TYYA 3D43A 5B3KA 2XOKD 5C35A 3MJHA 5AXBA 5JMPA 3T7AA 4G0UA 1OBVA 2IYTA 2R2GA 5DP1A 1E61A 4EY5A 1XHLA 3DNPA 4H1VA 4O4LB 3V4PB 5IWAB 1KI3A 3EY4A 2FOXA 4FFMA 5C31A 4DIKA 1EJBA 3AEQB 4GI5A 2Y0EA 1M6WA 2C2KA 3TIVA 4QDUA 4ZJPA 1E79A 1TEXA 1QMPA 5J4LA 1BHO1 1TGVA 3OLXA 3KJFA 3S8MA 4C4YA 4XUDA 1NJGA 1W5AA 1NTRA 5AO9A 5ALEA 3T0FA 3MMPA 2BLLA 1EGVB 3R4CA 1YZLA 3RASA 3O1JC 4BMXA 3T9BA 2PX5A 5AVWA 2FW1A 5DLQC 3TL3A 1Z75A 4TT3D 1VHWA 3EEIA 2QD4A 3HV0A 3CMCO 1H2ZA 1A2OA 1U3FA 3BMCB 1TEVA 3FWHA 3CLUD 2HOQA 4G07A 1M0TA 5DGHA 1FNCA 1TF5A 1ZNYA 1P17A 1RAHA 1LLQA 4TOIA 3J80A 3PEVA 3R6DA 2V7PA 5HUQA 5D87A 4LDPA 1U4OA 3DVAB 1JFTA 1M1YE 1YGPA 5TGDA 1W4BA 2A5FA 3F46A 4OFXA 3QU2A 3RNLA 2ZBEA 4E5NA 2R68A 1M8GA 1QHEA 2GPBA 2OHIA 2VRWA 1JSCA 1E3JA 2HA5A 3ZHTA 4DREA 4TZKA 3A0RB 4CKWA 2PZ8A 4H3VA 4N0EA 3RRZA 1FJHA 3F6EX 5F4BA 5KOIA 3QXJA 1F17A 2B92A 1JLMA 3V7YA 4JXJA 4JS0A 4MA0A 1R6AA 4Y1EA 3SEAA 3AK4A 3MS2A 4QUKA 4C6SA 4EHBA 1GZ5A 4R7ZA 4LXHA 4BNJA 2JIZA 1OIWA 1EVIA 4H17A 4HVLA 3DMFA 1B7GO 2OE2A 2BKEA 1RXSA 1QVZA 1NXVA 2PJZA 2R1TA 1C1YA 2XUQA 2ZTLA 3AJ8A 5FV4A 1O4VA 1XDDA 2QT0A 3NIGB 3ADBA 2CZQA 3ZVLA 4C76A 1T13A 4JL8A 4RO0A 1RFGE 2I33A 1XE3A 1WZNA 1KBQA 2Y0DA 1VMIA 4I4TB 1V9SA 1PEAA 1FUUA 3MW8A 3TIGA 5KCMA 2O2ZA 3LXXA 4L6CA 3NBUA 4JP8A 2I4RA 4JWTA 3AYZB 2BD0A 1ZH6A 2FZ4A 3LQ4A 1L5VA 2VQ6A 1DQYA 2YFQA 4K9QA 4C7BA 3HLYA 5FPSA 2FUCA 5CX1B 3HKEB 3SHWA 4B82A 1NL3A 3GQBA 3E70C 1K5PA 4GOJA 3BULA 4HN9A 1ND6A 4P83A 2DWCA 4YWJA 1GPDG 3TR0A 1IEQA 2Q4OA 5E2AA 2MCFA 4DV4B 2PH5A 5FR2A 4L6IA 4A15A 1XSEA 3Q8KA 4Y98A 4UTVA 3AFNA 3B36A 2W6JD 1OUMA 3IP6A 4GZ5A 4C4ZA 2DWUA 1RHUA 3SYMA 3FA2A 1ZICA 5JD5A 1OX6A 1P2DA 1RBMA 2OLEA 4XM1A 3WP0A 5EJEA 5AH0A 3GG2A 1LK0A 1VGVA 3CEHA 3PHBE 3K20A 2D7CA 1G7SA 1YQGA 4AYWA 4BNMA 4HB4A 1QKJA 2F3QA 3JWJA 5A9SB 3VNVA 3HDHA 4RKYA 3MCZA 3U44B 1E6KA 1EHIA 1PG2A 2Q1XA 1C50A 3CJRA 4MX8A 5FOUA 3W9SA 5FDFA 1GZHB 2WU4A 4XR9A 3UCEA 2GZDA 1CS4C 1I3KA 3AEQA 5FA6A 3GBSA 5LJLA 2E85A 1WBDA 5EEHA 6ABPA 4GEGA 1EEHA 2QIOA 4E33A 2NVOA 3JTMA 4K9KA 4KLNA 4F9FA 4Q4LA 1X3LA 3T3GA 5KYTA 1U2QA 1Y8CA 2ECFA 1HLPA 2ZWPA 1CX9B 1J07A 2TSYB 4JJKA 4PZPA 2C2XA 4GAEA 3UJHA 3IE1A 4OGWA 3OG9A 4B6RA 3D1LA 3BIOA 1L4KA 2HYIC 1C8VB 2JPDA 1S1MA 2RKOA 2V6BA 3DFUA 3NDRA 4WMLA 3DVQX 4BNWA 5JCOC 1PLJA 3BMCA 1TUGA 2IYFA 3HGMA 3B3QA 3I23A 3PE4A 4L1KA 4FMCF 2AVNA 2BW0A 2VJCA 4YP6A 4RTJA 5I51A 3ZGZA 1TZJA 3K5IA 4DLNA 3A2MA 2K7ZA 5H02A 4N47A 2V3WA 2O0JA 3U3KA 5L3RA 4QYIA 1Q95A 2WE8A 3T54A 4C43A 4KXLA 1GVHA 1U8AA 1FP4B 1VLHA 1ESCA 1XEXA 3PCRB 1LRLA 2TMGA 3O0DA 3FSJX 1B15A 1E98A 1LRKA 2QX9A 2FK8A 3OQHA 5T4EA 2XRMA 1C7JA 4UBNA 2BRUA 1C1XA 1VCIA 3AUAA 2AUTA 1D3AA 1U9ZA 2BL4A 2J48A 4XVHA 3GFVA 1MU0A 1WD5A 3NT5A 3FROA 4GOXA 3NRBA 4OKNA 4ACBA 3GNLA 3ODPA 1YDMA 3B3AA 1T4CA 2ZANA 4WKCA 3O82A 4E2ZA 1OVGA 3V2IA 4FHCA 2IU6A 5CYGA 2CNKA 3KEMA 1BCSB 5H9VA 5TE9A 4D57A 4C3OB 2XMCA 3H2YA 3TTSA 4DA6A 1YULA 3BXEA 5TT1A 1YJ8A 4W8OA 1U28A 5T57A 1VYTA 4WLVA 4DA7A 5B55A 1SAYA 1OHHD 4QXAA 4YV7A 1IN1A 5FL7D 4BQFA 2C9YA 5JAIA 3SDBA 3QZUA 3ZDDA 1K0UA 1MVLA 4JB2A 4X97A 2I76A 3UZUA 4LK3A 3WGYA 4EO9A 1RQ7A 2OMEA 3EODA 2GAJA 1WNTA 4FFOA 1KQFA 4IIXA 4R84A 4I4TA 3R5JA 3RRYA 1T2EA 1HLFA 3N2GB 3TIXB 2DFNA 3ROQA 3L0BA 2C99A 2VRCD 3IKTA 4JB3A 1VG9B 1X3SA 5EWJA 3VHXA 5FD8A 1TVEA 4BBAA 4IYJA 5E1MA 2MYNA 4JV5B 1NBME 3CVVA 4NS1A 3NVMB 3OM8A 3PWSA 2JBWA 1U8YA 3EDRA 3DE5X 2Q9CA 2C3OA 1KS9A 4L4UA 1J99A 3HZZA 5ALRA 4NESA 4ARZA 4XXHA 1G5RA 1HE1C 1IAVA 3C6KA 1OAAA 1BN6A 3CUTA 3MAJA 4J7AA 4N3GA 5U1PA 4CR7A 4AZVA 2BV3A 4E13A 3HVIA 3KVNA 2HJRA 3W5AA 5A9SA 3U44A 4Z8XA 1WO8A 5I7AA 3HY3A 3K0EA 3SZMA 3TQTA 4UOQA 4YAOA 3T3DA 4MPTA 1T2FA 1MQ8B 1Z4IA 4HOYA 2REQA 4MI6A 1VYVA 1HZJA 1Y5MA 3SFZA 1UFRA 4GXRA 1EP9A 4M1MA 3LUKA 2VS1A 3I5MA 2V8BA 3KJXA 3GN2A 2M2IA 4QJ3A 4CBVA 5LC1A 1HYEA 1UK7A 4PYJA 1DLIA 3AHCA 3I92A 3LFTA 2MOKA 3KJGA 4OI2A 2VH1A 3JQ6A 3L05A 4E5KA 2FPPB 4ZDIA 4TKVA 3PC3A 3ZIAD 1UP6A 2FP3A 3WE7A 2I62A 1M6EX 2WKWA 1IQUA 2XSZA 3U09A 1V1MB 1AUOA 4CF4A 4M38A 4M0KA 3T0IA 4A7PA 5EKDA 1LJ8A 2PMWB 3EYWA 3K9GA 4YJDA 4O2LA 1ZEMA 1EA7A 1E69A 3MJFA 3QVOA 4DIEA 1NPTO 1ZA1A 2BFFA 3B7PA 1NVFA 3G6KA 3OJ0A 1KAEA 4JUDX 2BEKA 4MUMA 1NV9A 4RPCA 4KO8A 5NLLA 2XEDA 4NPCA 2WDPA 3FNBA 4NCJA 4V3BA 4CFZA 2G1JA 4WWHA 4MNTA 2OKCA 3D2AA 2X86A 1KJ9A 3E9ZA 3F47A 4GECA 3RU9A 3RS7A 4CHGA 1RLIA 1QTNA 1EXWA 3NYQA 4IDEA 2XMDA 4LJKA 5DW0A 2HCBA 2FMUA 3HA3A 5A7FA 2G28A 4N41A 5LQNA 1LF0A 3CURA 1JHDA 1LI4A 2AEEA 4MVJH 4IXDA 1L5LA 3ANTA 1N92A 4TV8B 4CKEB 4DJFC 4B46A 5CFMA 3H04A 4LYGA 2AHOA 3IVAA 2ZSDA 3LNCA 3KBOA 2PFKA 3LVRE 4Z7NB 4ZYXA 4TSFD 6ADHA 3E9DA 4BL5A 4C88A 1QAMA 3HDYA 3W7VA 3AEYA 2PCLA 3Q7SA 3TNJA 2VAVA 3S2IA 8ABPA 2EX0A 4FIDA 3WRXA 3TLEA 2OXIA 1BSVA 3WLFA 1KE2A 3RFCA 2FP4A 3R0QA 4G81A 5CCDA 2PKXA 4Q3BA 1M67A 5BWNA 1JDPA 1RMQA 3LQRA 4G85A 2QVLA 4YUXA 4PWZA 2J3MA 4PC6A 2VWGA 3V8NA 3N07A 3P52A 4ZYWA 2ZUUA 4ZOLB 2C4NA 2HCJB 2PY6A 3MS4A 3WJ1A 4KZPA 4V39A 3HWX1 3DJYA 1E7QA 1T3LA 3O74A 4HI0E 1P0FA 1QHNA 3U19A 5UKDA 2JGDB 5KMGB 4UU1A 4D46A 5EJGA 5I7OA 4F7WA 2CVFA 4LYAA 3WTBA 5L45A 1N6RA 3ZZNA 3P26A 3DD1A 4Q3LA 1I3OA 5J58A 3I8OA 3NXSA 1YB4A 5IS2A 3LT0A 4LMAA 1R88A 3BPSA 2Q62A 1X8JA 1FVHA 2BAGA 2EGUA 2WF6A 4W8HA 5BOSA 1JYFA 5IFLA 2ZBUA 3ELYA 5JC1A 3E2IA 4OG2A 3ZVMA 2IOYA 1IY9A 2OGWA 3ZWCA 3B13B 1V8ZA 1NMEA 1OLUB 2R9VA 1PJSA 3CNOA 1N8TA 3JQPA 4IDBA 4R9UC 1LUAA 2F1JA 2HK7A 2QGNA 3W2FA 4B6SA 4C3UA 5AVTA 1TMKA 2PSSA 2A57A 2QUJA 4QXOA 4UHCA 1JMYA 3ZU5A 2X4LA 3FBGA 5K3SA 1JJIA 2J7KA 3ABOB 3COWA 3H6HA 3R0ZA 1IUNA 1Q7EA 3P71T 5EEGA 3V8MA 5FI3A 1F2DA 1H23A 3GFQA 4RY9A 1FQOA 2G09A 2I8AA 1SKQA 4GMHA 2YHAA 4AJ1A 5DULA 3HRKA 1XPJA 1ZJ6A 2NTJA 3W0LB 1T8PA 1CQPA 3UK0A 3DT9A 1ZYUA 3MQFA 2OPHA 3ZHVA 4EG1A 1ZR2A 2FLWA 2HZBA 3H9CA 4KMMA 1H4QA 3AL0C 5ERGB 2Q27A 3SM3A 2FPPA 1M76A 4NICA 3KALA 1VL1A 3DE4X 3CVOA 3HFGA 2C4WA 4Q1VA 1V1MA 1Z2PX 2H3HA 3DM9B 3I45A 4CM1A 1VA5A 4D3YA 5BQXA 2E5LB 4KMSA 3AM4A 3BXFA 2JJ1A 4UBIA 1QP4A 3R0XA 2VH5R 1SH7A 2X14A 3R3WA 4MAAA 1THZA 1RHQA 2A84A 2FHPA 3PDIA 4YBZA 2PN1A 5K05A 2WRZA 3K3PA 3F8WA 1ZW1A 1J70A 3KLPX 5J4KA 3C3PA 1GZ4A 3BJEA 3WLHA 1FQJA 2Y71A 2NVWA 3D4PA 2H07A 1QWOA 4TS4A 3FUTA 4XCVA 3UHFA 3WIBA 1ZIOA 4B7XA 1HDRA 1UJ2A 4XR4A 4GWLA 2GM9A 1CR6A 1ETUA 4XLLA 4C6RA 1KC1A 4YJ2A 3ONFA 3B12A 4ZO4A 4K9MA 4TV8A 5I7RA 1GTVA 5KYVA 3U1BA 1Q12A 3W1WA 5HSGA 5JO9A 3ZWDA 4FBMA 1JGTA 1II9A 3NHFA 4BV3A 1KP2A 4GPD1 2BOVA 3ID6C 5A5DA 3FYHA 3OA0A 5L40A 4YRDA 4R51A 4RGBA 5H68A 5FWNA 1AZTA 1FDTA 1O54A 4DIMA 3C6BA 5KTNA 1PQ4A 4NJMB 1XP8A 2JHPA 1VE1A 4EECA 2FJ0A 1TUIA 5KNCH 3VR1A 2VT2A 4LTDA 2JCGA 3TS1A 4QHYA 1ARZA 1ISRA 3JVVA 3K2EA 4ZV7A 4EY4A 2O8EB 1DUIA 1NJ1A 2ZSUA 1VECA 1XMJA 3EPKA 2FQWA 2XRZA 3MB5A 3FPLA 4GGOA 4XVCA 4F5ZA 3JD1A 1USUA 3EIEA 4NFYA 3OQMA 2G80A 2I7TA 4HN4B 3BXHA 1G41A 4TLMB 4ZQEA 4FEYA 2A6PA 5DNEA 2WINI 2D54A 5DLDA 4RZIA 2YXDA 1W6UA 2J0VA 5TR9A 4MUBA 1B8OA 4BVHA 3VU0A 3G5UA 5IM5A 4X3PA 1OKKA 3ONVA 1X77A 5HKOA 3H5RA 2BGGA 2IOHA 3KPJA 4TT8A 3PJRA 5IT4A 2YY7A 1JQAA 3Q7IA 3R41A 5LDHA 3QSYA 1QVWA 2GLUA 1XUOA 4DCVA 4KOAA 4HNSA 4PVDA 1SKUA 3IMFA 4TKUB 1OAOC 2GHTA 3ETEA 1JQDA 1ONOA 5C52B 1IM5A 1M8JA 3RBXA 1LPSA 3U9TA 3QPCA 4MUYA 5K0NA 1R4NB 1SO8A 4ZKDA 4ZAVA 3ST7A 3SZ3A 1FYFA 4H1WA 3LBFA 4Q7LA 3F6CA 1WDWB 3PHCA 1QIMA 5GJCA 1U0LA 1FFBA 4EGQA 3OQOA 4Y0VA 3B6MA 3HPQA 4DNXA 1DEAA 1WXQA 1TYCA 3FFBA 3A9CA 2WU3A 4B6OA 1J5EB 4TXMA 2WIBA 1JHOA 2A3NA 4PZDA 1U8TA 3FRIA 4UCWA 5BNFA 3NHZA 3H1BA 2ZE8A 4V0NA 3IP9A 4RPLA 1NI5A 4ARBA 1VZ3A 1PE0A 2WHEA 1AF7A 4EEZA 5JV5A 3U7EB 1IBLB 1MT3A 3L6DA 4MRPA 5JY1A 5H16A 1NV8A 2ZIUB 1MHPA 1VJGA 3GNSA 3OI7A 3N28A 4NENB 4BLWA 3BKXA 1P7CA 2M6RA 1Y8RB 1YL6A 2I6UA 2R8BA 2VUUA 3DHEA 4OXXA 4XEUA 2UYCA 1EZ1A 1T9KA 2IYAA 3ENQA 1H4VB 4ND8B 1OX5A 3I2JA 1ZHHA 3M49A 4BMPB 5EXTA 1F8FA 3OEHD 5C8YB 5DK4A 3W8EA 2ZIWB 5A0FA 5JYBA 1DBPA 2QVBA 1E2JA 1WY5A 3QMPA 5IANA 2O8NA 3B82A 3CNEA 5IJZA 1J90A 4QE3A 5FTMA 1C0LA 2F43B 2QQ0A 5LD2B 3EJ6A 3WAGA 1RVDA 3BXGA 3L43A 5HHTA 2I71A 4TWZA 4YRPA 2OSBA 2HSJA 3I3SR 1W9HA 3W3AD 1YGYA 1AN0A 1NI3A 3MWYW 2OG1A 3I1IA 1J00A 2VTBB 2W42A 4DR5B 2WF9A 5FUBA 4IF4A 1DWQA 4X9XA 3UJ9A 3HZRA 3K6KA 1YZGA 1IRIA 3D2LA 3RTDA 3ABRB 5CFPA 1WHTB 4DLBA 5IEJA 1LW7A 4ZHQB 3I01A 2C04A 3W6UA 4EY3A 2IW3A 2G82A 1UQRA 4J2OA 1NQVA 1ISGA 1K7YA 4NJMA 3DR5A 4RY2A 5FQNA 3EGIA 1HFEL 5A3JA 3LLUA 2TYSB 2AXPA 3CRMA 4LFBB 2JK1A 3FF4A 1XAGA 3FUXA 1Q11A 5AKEA 2HFKA 3K1TA 1C8LA 3QVSA 4EGSA 1HDCA 4RIEA 3MYYA 3I61A 1JWAB 4UHHA 1JJ7A 5JR3A 1FOEB 3EUFA 2VHVA 2UUPA 1KDRA 2R1VB 1F8UA 2PKRA 3OE5A 1GQOA 1Y5NA 1Z7WA 3HCNA 1THGA 3HUTA 4WY5A 4WXRA 2DBYA 2YZ2A 4IDPA 5D84A 3QKRB 4Y2VA 5I9NA 3JYHA 5FHQA 3I2KA 1TM2A 5JPIA 1EU1A 2C1ZA 5CK5A 3V1UA 3BRCA 4L0MA 3PNLA 2ZUDA 5B53A 1UXKA 3X1DA 4DT1B 4G8BA 5BUQA 2IVFA 1XQVA 3LO5A 3WNCA 5ALFA 2UVPB 1KEUA 2QVYX 3I5AA 3ZIDA 3MLAA 1A95A 3KKKA 2GPSA 2EZTA 1R4NA 1V0JA 3JR3A 4GDFA 1E3MA 3N8IA 3I53A 4WE3A 2WR8A 4DTIA 3TTUA 3F6YA 4UM9D 5AJUA 5JVDB 2F1OA 4LNHA 3UMBA 3WLEA 4CF3A 5JSZA 4CUZA 1DTWA 1P1FA 2IYEA 4I2NA 1E6EA 4ICIA 4IQGA 4TS9A 2JFUA 1O6ZA 2I4OA 1B43A 4X6XA 4X1KB 2MSNA 4D9MA 1G66A 2HYDA 2Y1CA 3JPYA 1VE6A 1MJGA 2B94A 2J32A 2VCYA 1C1DB 3ESDA 4AJOA 5C8VA 1HNXB 2ZPUA 1GGKA 4GSKA 3Q7PA 4WBNF 2DC1A 3GEIA 2JIPA 4BKPA 1U0HC 1VCNA 2DLNA 2ERYA 4L5IA 1U3CA 2P2LA 2Z9CA 3RVQA 5ALLA 3KZNA 1QYXA 5L8VA 1D6JA 4NENA 5LQKA 1E5XA 1XRLA 1Y8RA 3PVSA 2E4AA 1JFLA 1Q21A 2QXYA 3RVBA 2HXSA 3ZD8A 4DBLE 1Z5NA 2I7XA 3OF5A 3L7BA 2PD3A 3L7NA 4NABA 3S44A 1JT9A 3UEOA 3ZHOA 1LBSA 2HJHA 1WCXA 1RJEA 3ZTTA 4B8WA 4IFIA 1KPHA 1FRVA 3PX3A 5DCLA 4DARA 1C3XA 2IYZA 4DCPA 2J3KA 4BQPA 5FOQA 2GBLC 2G5TA 3AT1A 3Q0IA 4UBOA 2HPVA 1GUYA 3GH3A 4OM7A 1PYOA 4BO9A 2F43A 1CJKC 4MAMA 3W5SA 4EPVA 4JUIA 4TUYF 4CCSA 5DNUA 4AXBA 4J1TC 3HJHA 3KTFA 1Q1QA 4UMFA 3HA5A 3PHHA 4MS3A 1CYEA 4TWBA 5DM1A 1PN3A 3K7EA 3P9CA 1NBWB 3F5MA 2O7QA 3G0DA 1MHTA 2I03A 4I4NA 4TTVA 1M5TA 3MWDB 2ONYA 3GFRA 4AJ2A 1IL0A 3RS5A 3OPNA 4XQ0A 2F59A 1RPZA 4QTYA 2ZBVA 3C8HA 4K7JA 3TB4A 4FFLA 1H3EA 1EFHA 4FCVA 1POXA 1PT7A 3PPIA 4U2KA 1KBZA 5J23A 1U3GA 2MU1A 4ZHQA 1T34A 1J9ZA 4RIFA 4FKBA 4IQ0A 1Q1ZA 5F35A 1OTXA 5DIZA 1H8HD 3UBMA 2FRVA 4L50A 2IFTA 5TXGA 2J0SA 4DDUA 4OVKA 2I6QA 5IXSA 2Q9AA 2ODPA 3ACDA 1HYHA 1W0KA 1IBRA 1LFDB 3PVZA 1GQYA 4LQDA 4C7JA 1FVOA 4NL4H 4CGYA 3H6GA 1AZWA 3CPHA 2ZRFA 4HWTA 3DWEX 5HJEA 3ND5A 1CU1A 3IAM6 3GHYA 2HDNB 4M8IA 1OREA 4KFTA 1EFRA 1NVMB 4N49A 3CKLA 3TUJC 1SD1A 3AF5A 2IYSA 1KEVA 3EXG1 3ETNA 4MB2A 1D4ZA 1XJWA 2AKYA 1C0IA 1FRFS 1XFAA 2WSYB 3NTRA 2I87A 3WP1B 1GZSA 2VJPA 2HLHA 1HE8B 1SC3A 1VL8A 4KWEA 4LI0A 4M9CA 4OBEA 3OOHA 1QHSA 4KKVA 3OLQA 3KPYA 3GI1A 4MA4A 4RF5A 3E4DA 1M1YB 2D3WA 4DT1A 4Q7EA 3N1UA 2ZI4A 4DAOA 2FZ5A 4IWYA 3IERA 3PHGA 4OMUA 2QTVB 3OIFA 1VHJA 2QI9F 2XECA 4JUCA 1RZRA 2DH6A 2BJHA 2XNCA 3NOQA 4AN4A 1WXXA 5KS2A 1YR8A 4FDMA 1OA0A 2OFXA 5TLSA 2FF7A 5LR6A 2RI6A 2GR9A 3OIYA 3CWZA 4BYGA 3L7MA 5CLLA 1HMPA 1K7CA 4CW7A 2QTTA 2HWYA 2PU5A 5JPDA 3WLQA 1ID8A 4DCSA 4NFLA 4L9WA 5K8VA 2QSUA 3OPMA 4UDNA 2ID4A 4IHAA 1I2ZA 1PNOA 1C1DA 3L6UA 4NBTA 2TMKA 4Y6OA 1EM6A 2X2FA 1YKGA 2YWGA 1KYQA 1A2QA 1IONA 2VP9A 1LC3A 3ZUPA 2VWQA 3K8OE 2I7DA 3V1TC 1KDTA 4ER3A 1GKLA 1XJQA 1F2TB 1VFPA 1ZI9A 1K3FA 4NY1A 4Z3KA 5B36A 3DHYA 2FE4A 4BN5A 1L5MA 5AXAA 1ND5A 4GOLD 4A73A 2KX7A 5JNUA 2UAGA 2QR5A 2CMKA 1YRLA 1SCJA 2HPAA 4BZQA 2IXTA 3FCUB 3IAUA 1NDUA 1MOZA 4DKJA 5JS7A 4BQEA 3TX2A 5KNCD 4QUJA 2VJNA 4HB0A 2D2EA 1NQ5A 3VR6A 2PH3A 4EMUA 1ENYA 4YUVA 4GL4A 2PAAA 1CJSA 1P44A 3R3ZA 3R44A 1U1DA 2FR0A 4EB8A 1MW9X 4MP6A 2ZRAA 4MYCA 1W4CA 1OZFA 4OIFA 3BEOA 1NJSA 1SUCA 1XMSA 4OA5A 2CDCA 1JHMA 5HRUA 2IHNA 3SY8A 5G3ZA 1E3SA 2P2ZA 1NVVQ 2C3UA 1WTCA 4URVR 5AW6A 3BQMB 1CP2A 4LYFA 1VRCA 2GDZA 4DV1B 3ASUA 3OJLA 3OUZA 3Q2KA 2GCOB 4O2AF 3IKMB 1UOPA 3E0XA 1PJRA 1EH5A 3PXEA 2BR5A 1VE9A 1E0DA 3GDWA 2R6ZA 4B7ZA 3RTBA 4R8RA 1R3UA 2GPNA 2XYPA 4LVOA 3CH5A 5EZQA 4P1ZA 1FMTA 3OU7A 3A6JA 4J9UE 3J7TA 3V6MA 1RQRA 2OMKA 4OJNA 2JLAA 1SXJE 4LYDA 2RHMA 3P4XA 5LQCA 3F49S 4EITA 2IH4A 1CUVA 1GGFA 2DH5A 2WKQA 4FCTA 4ZZ0A 2E37A 2NIPA 3G1WA 4BMOB 2QA5A 2H4YA 1WIWA 1YQWA 1BVRA 4UHFA 3RF6A 2QQFA 2GRAA 3T7DA 1ORIA 1TC1A 1N5RA 2H1CA 2VEOA 3GARA 4YGYA 3T9DA 1RYYA 5AVZA 1IN7A 7REQB 1K63A 2JA2A 3UAYA 2AQ8A 4L07A 4MIOA 2H6EA 4MR7B 4CXMA 1RLMA 1MBZA 1F8YA 2MINA 2JBAB 1HDXA 4E4RA 1XDZA 2DWQA 1SOMA 1DRUA 2QQGA 3HJNA 2YOHA 1U2SA 2IQIA 4PAWA 4QU8A 1QC5A 3LE8A 4KWIA 4Q9LA 4Z4QA 1Q0ZA 1R4ZA 1ZVMA 3CLVA 3O8QB 4IOKA 3HBNA 1KERA 3WHPA 3DMPA 4C08A 2ORVA 3FPCA 3O26A 3GCGA 3PG5A 3U3XA 4BAGA 4UHBA 4JI2B 3JQFC 1VRWA 3GZ4A 1E5VA 3B52X 2VPYA 2HIHA 1G18A 5ICGA 1A5TA 5KJEA 3VUFA 1I4LD 3G6WA 2B37A 4RF4A 1JEYB 5E4TA 3PB3A 3U7FB 2FFQA 4CF5A 4KPGA 1AMOA 1RWVA 3V8PA 2XYGA 3W5JA 4ZZ3A 2GLTA 1VG1A 4ER6A 2QVCA 3D5QA 4QUDA 4HCJA 5FF9A 3ZWNA 1QGDA 1BWQA 1U6KA 4Q34A 1W52X 2VYCA 2H4HA 4UFPA 1Z2CA 4IZHA 3SOZA 3OOSA 2HIAA 1O5IA 1NFRA 3TVTA 2CHGA 4A0RA 4EZBA 4MUJA 3PLAE 4X1OA 4UNNA 1MVOA 1QDEA 1FDVA 1YH3A 1QGZA 3AR7A 4J0IA 2XB6A 4BHTA 1E1RA 3DAOA 1NWCA 2G0AA 3TQRA 4GRIA 5JFTA 1DKNA 4JA2A 3K9LA 4XYLA 2NQ2C 1U3TA 4D2IA 4EJSC 4V0ME 1ZL2A 5JBNA 2QLMA 3OFJA 3EGDB 4KE8A 2Z6VA 4G6ZA 3ZN2A 1PUXA 4DG5A 2AOXA 2O7RA 1J9GA 2OA0A 4EW2A 1STOA 2GB4A 2ISSD 2AR7A 3WV4A 5M34A 1M1ZA 2XE4A 10MHA 4X7MA 1MJNA 3NQ41 3NATA 4N5HX 5J2TB 3I34X 1P19A 5J63A 2D4HA 3F4KA 3PZRA 2G5CA 4L51A 1YZVA 2FRDC 5GONF 3K6SA 4BO3A 3JASB 1P6QA 1CC1S 1ESZA 1E5LA 4XSGA 4GO1A 4MDYA 3TQHA 2KQUA 4R98A 2LIPA 3N2LA 3ZWYA 1PSZA 1JDJA 2KS6A 2JZCA 2ZETA 2NU6B 3LUFA 3QMMA 3FOAA 2LGJA 5BO5A 2G17A 3N2ZB 3PQEA 5DRYA 1E1YA 3JTEA 1P4RA 2H0AA 5KWJA 1UZAA 1VJ5A 1EFPB 1WMEA 1L4GA 2XY4A 2BLNA 3DEZA 3KO8A 4J7CA 1JA9A 1PKXA 4Q9NA 1SHJA 3RVMA 4ZN6A 1KWKA 3KOWA 4KU4A 1UBFA 3AOEC