5BP7A

Crystal structure of sam-dependent methyltransferase from geobacter sulfurreducens in complex with s-adenosyl-l-homocysteine
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
249
Chain Sequence
MLDIPRIFTITESAHRIHNPITPEKLTTLGAALRLEPGTRVLDLGSGSGEMLCTWARDHGIIGTGIDMSQLFTAQAKLRAEELGVADRVTFIHGDASGYVSDDKAGVAACVGATWIGGGVAGTIELLARSLRPGGIILIGEPYWRQVPPTEDVARGCLANSTSDFLMLPELLASFGRLGYDVVEMVLADQDGWDRYEAAKWLTMRRWLEANPDDELAKEVRAQLTSEPGRYASYTREYLGWGVFALMPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SAM-dependent methyltransferase from Geobacter sulfurreducens in complex with S-Adenosyl-L-homocysteine
rcsb
source organism Geobacter sulfurreducens
molecule tags Transferase
molecule keywords SAM-dependent methyltransferase
total genus 81
structure length 249
sequence length 249
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5bp7A00
2NXEA 1NW5A 2AVNA 1NT2A 3GRVA 3VC2A 4EK9A 2ZWAA 2BM8A 3NTVA 3RODA 2OPBA 3LCCA 3TPZA 5K05A 1MHTA 4HGZA 3FPJA 1Q0TA 4POOA 5F2NA 4GUAA 1KYZA 5HIIA 3HA7A 5EZSA 5LQUA 4PINA 3CGGA 2FRXA 3E8SA 4RTJA 4PGGA 5BXYA 1UFKA 3VC1A 4LG1A 5LR6A 5KVAA 3OU2A 3FUTA 2ZVJA 2NP6A 3PFHA 1X19A 2KW5A 3SGLA 4V0RA 3HA5A 1AV6A 3NMUF 1NKVA 3EVEA 4HRAA 1R8YA 2YR0A 3B3GA 2B25A 3P2EA 4C03A 4YUZA 5ICGA 5LSAA 5EGSA 5FCDA 1EQAA 3FPEA 3FTFA 3AXTA 4C04A 3AY0A 5E8RA 2GPYA 2I7CA 3FPGA 2ONZA 5K03A 2UYOA 4F86A 5MHTA 1R18A 3OZRA 3L8DA 2IH4A 2P40A 3A25A 3KQMA 2Y1WA 3P9KA 4RVHA 3UJDA 2HMYB 1VLMA 4AZVA 3FPFA 2G71A 3V97A 2ZIGA 1R74A 3AXSA 4M36A 4BY9E 5T67A 2PX2A 2UYHA 3KR0A 3I64A 3CBGA 3OE5A 5FTWA 5G02A 5K0BA 4OBWA 1M0EA 4GC9A 3G8AA 4QQKA 3MQ2A 3OCJA 5GM1A 2P3OA 1F38A 3UJBA 4YUYA 3A7DA 2XBMA 4E30A 4RVFA 1RJFA 5EOVA 2HV9A 1XDZA 1HNNA 3KPUA 4DMGA 4F85A 2G70A 4RTNA 4EQZA 4F84A 3JWGA 2WA2A 3MERA 4DKJA 3G2MA 5K8VA 1NBIA 4RSRA 1PJZA 4GOOD 5ICFA 4QDJA 1JQEA 3OFKA 3P71T 5EIWA 5FWDA 4QVKA 3GNLA 3UA3A 2PSSA 3HTXA 3TLJA 4GF5A 1UIRA 5BP7A 5HIJA 2WK1A 1I4WA 3EPPA 2GLUA 2ZLBA 4XUCA 4YMHA 4HGYA 3P8ZA 2C7OA 1JSXA 2FK8A 5FA5A 3FYCA 4QVGA 4RTMA 4FGZA 1TW3A 1YFJA 3DXYA 4CWAA 3GU3A 1NV8A 2IH2A 3LGAA 3H2BA 3BKXA 1P39A 3K0BA 3BGVA 2E5WA 4KDCA 4EKIA 4ER6A 1WS6A 4QDKA 5EIFA 2PXXA 3SX0A 3SMQA 3R24A 5IKMA 2JHPA 3NDJA 3M33A 4X63A 1L9KA 3UBTA 2ZTHA 1JQDA 3G88A 5EMJA 4DA4A 2V7EA 1N7JA 4YV0A 1SKMA 2GS9A 2BZGA 1RI4A 1QZZA 4YUXA 2C7PA 4PWYA 5DRTA 1X1DA 3I5UA 2EG5A 1TPYA 3DLIA 5BW4A 2JH8A 3CJQA 5D1NA 1JG4A 2PWPA 5HFJA 1R8XA 3TOSA 3B89A 3P9IA 4PYNA 5CVVA 5K0GA 3GCZA 5EKUA 5EMLA 5FWAA 2PT9A 3BKWA 1U2ZA 3FRIA 3HNRA 5DTMA 2B3TA 1KPIA 3GRUA 3IEIA 3FUVA 3FTEA 3GXOA 3A26A 2G1PA 1NE2A 2AVDA 1EJ0A 3BXOA 5K0CA 2IGTA 1FPQA 1AQIA 3GRZA 3KQSA 4DQ0A 3C6MA 4JXJA 2PXCA 3K6RA 3ANXA 1AF7A 3KQVA 1SQGA 4R6XA 3SM3A 4CKCA 3HCDA 1JSZA 4LWOA 5GWXA 2H1RA 4P7FA 5ICEA 3LCVB 1ORIA 4DCMA 3MB5A 4PCLA 5IH3A 2CMGA 3PB3A 2R6ZA 2GH1A 4XCXA 1DL5A 3QOWA 2EJTA 5E2BA 4PGHA 2XYRA 3X0DA 1RJDA 2CWWA 3GDHA 4U7TB 5JUWA 2QYOA 3EVBA 3KR2A 5LQJA 1JG1A 2O06A 2P3QA 3UJ8A 2FHPA 2PGXA 4Y2HA 5FUBA 4ER5A 1P91A 4YV2A 5DM2A 4PIMA 2JHAA 2Y1XA 5HEKA 3MHTA 2I9KA 3DP7A 5GINE 4YV1A 4KIFA 2IPXA 2CL5A 3MCTA 2VZ9A 2G72A 2AOUB 2AOTB 3ELDA 2IBTA 2HNKA 4C07A 3KPWA 1XCJA 2PKWA 3CJTA 3CJRA 4C06A 3TM5A 5K01A 1Y8CA 4R05A 2JG3A 1NBHA 4MWZA 4X41A 3GGDA 5HZMA 1BC5A 3DLCA 5E1MA 2UYCA 3I53A 3OU6A 3SSNA 3A4TA 1O9HA 3LCUA 2NXCA 3KPVA 4P58A 5K0NA 2ZCJA 2ZIEA 2P7HA 3NDIA 3PVCA 2YX1A 5E9QA 1JTEA 3O4FA 4DF3A 2JH9A 2QM3A 4XUDA 3WSTA 5EEHA 3PS9A 4E32A 3VSEA 3SSOA 1KIAA 1EAMA 2GAFA 3LHDA 3NJRA 5DM0A 3IHTA 5E2AA 4X1OA 1B42A 2IFTA 3DMHA 3JWJA 4CTJA 4FP9A 4P7KA 3PX2A 1BHJA 2PBFA 3P2IA 3HVHA 4YUVA 4E2ZA 1ZQ9A 2ZBRA 1JR4A 3EEOA 2H11A 1JQ3A 5CCBA 3G5LA 3UJ9A 4V0QA 4R8RA 3PLAE 5DWQA 2AOVA 1ZHFA 3IYLW 4WVLA 3C3PA 5KYGA 2LD4A 5FA8A 5EQJB 1KP9A 3CCFA 4DM3A 3BZBA 3HA3A 3JWHA 3G2QA 4DZRA 1JG2A 5DT2A 3ERCA 3GO4A 5GOZA 1ORHA 2N47A 1G8AA 3EMDA 3KQYA 2YXLA 4PYJA 4MTLA 3P2KA 2QE6A 2WA1A 1G38A 2P1DA 4A6EA 5EG5A 2AOXA 2Z6AA 4H0NA 3TFWA 3UJCA 2R3SA 4M38A 1DCTA 1T43A 3UJ7A 2AN5A 2OB2A 5H02A 3G2OA 5DXJA 2ORED 5E1OA 2Z6UA 1QAQA 2IH5A 3ELWA 2BR3A 2P41A 3HEMA 5LQCA 3B7PA 4OA5A 3HM2A 4P7JA 5D1HA 2YXEA 2VP3A 4KWCA 5GP1A 4QTUB 1D2CA 1VPTA 4KIGA 2O57A 5DM1A 4PYIA 2PVCA 1RI1A 4WXHA 1G6Q1 5CVEA 3TKAA 5KS2A 4RTPA 2HTEA 2EFJA 1VE3A 5B1SA 2PJDA 4ER3A 1L1EA 1SG9A 4C05A 3A27A 2DPMA 3ELYA 5HOQA 1N7IA 5DXAA 5CUQA 5CD1A 2P7IA 3EGIA 2QRVB 1XCLA 2IP2A 3O7WA 4E70A 3GJYA 5ICCA 2ZIFA 4PYKA 1VP3A 2QRVA 4R6WA 5LQRA 1WG8A 3UWPA 3HVKA 5EHGA 4CXMA 2G8NA 4GOLD 3Q87B 5FADA 5EC8A 5LQKA 1QAOA 4QPNA 3LKZA 2IDJA 2P8JA 2YQZA 3G7UA 5LQAA 2ZFUA 1UWVA 4HH4A 4HTFB 3DMFA 1P1BA 2XVAA 3DR5A 3HCFA 2B78A 3M6WA 2ERCA 3FUXA 4O29A 3LECA 4OBXA 2VS1A 4EVIA 3QV2A 2VDWA 3TRKA 1I1NA 1ZG3A 4E33A 1XVAA 4BLUA 1D2HA 4PYOA 3DH0A 5GM2A 1L3CA 3E05A 3FTCA 5DLYA 1WXXA 3KQOA 3LKDA 4RTSA 2FYTA 3HCEA 1TW2A 2BH2A 4B17A 1FP1D 4FR0A 2B9EA 2PLWA 2ZZNA 3EGVA 5GIPE 1RI3A 3DUWA 2ZSUA 2F8LA 3OFJA 3R3HA 3NVKI 3M4XA 2EJUA 1INLA 4BLWA 3MAGA 3KKZA 4FS8A 4XUEA 4MQ4A 5T64A 3LDGA 4GOMD 5F2KA 3DXZA 4PIPA 3SVZA 1YF3A 3BGDA 3O31A 1ZKDA 3ELUA 2O0LA 5FQOA 1HMYA 1XXLA 1G55A 1YZ3A 4LECA 5DTRA 2OKCA 3ID6C 3SSMA 3CVOA 4FZVA 4E2XA 3OZSA 3BWYA 2OB1A 5FHRA 3G8BA 5E1BA 3DULA 2B2CA 3JWIA 3ER8A 1KPHA 4PYQA 1VQ1A 3R6TA 4U7PB 5EKXA 5K0EA 3Q7EA 1ZGAA 1M6EX 3FZGA 4KW7A 1RI5A 3MTIA 5EHIA 5FQNA 2AOWA 1X1AA 4FSXA 1BKYA 4IV8A 3TM4A 4HG2A 5E9WA 5HIKA 2C7QA 1SVUA 1KYWA 2AS0A 3OE4A 3ORHA 4KVZA 1P1CA 1KXZA 4PONA 4RX1A 5EPEA 3BGIA 2AN4A 2NP7A 4GBED 3VYWA 2PY6A 3FYDA 3MCZA 3P9CA 3TMAA 5E9JA 4YMGA 2VDUE 5C1IA 3GWZA 5DX0A 2K4MA 2ZULA 1G8SA 3B5IA 3EGEA 3HCBA 4M37A 2IBSA 2ONYA 1N2XA 2GA9A 3EVFA 2ADMA 2OZVA 2IDKA 2PXAA 3DXXA 2AR0A 4BP1A 2FCAA 2VDVE 2C7RA 5C9ZA 3G5TA 1RI2A 2DULA 2XYQA 3I9FA 3T7TA 1FJXA 3UZUA 3LPMA 3AJDA 5DM4A 3CKKA 4PYLA 3OZTA 1I9GA 1H1DA 1SUSA 2NNWB 3BWCA 3EMBA 5K0LA 1JTFA 3EVDA 5CVUA 2AZTA 2I6GA 4BP3A 3EVGA 4ER0A 4G56A 1QYRA 3HVJA 1KPGA 1IM8A 2PX5A 5LQNA 3V8VA 3G89A 1NV9A 4RYLA 3HP7A 5T6BA 4RTOA 5CCXA 3KR9A 4RTRA 1QAMA 3LDFA 5CVDA 4C08A 4GEKA 4ZTBA 3T7RA 2O05A 4RWZA 2BM9A 3TQSA 2XVMA 4GOND 4X61A 4AZTA 5EEGA 3BUSA 1VBFA 1XTPA 5K09A 1VIDA 1R6AA 3F4KA 7MHTA 1YUBA 3LBYA 3T0IA 2PX4A 4EMSA 1NW7A 3BT7A 1KHHA 1SUIA 3SXJA 4QPPA 1SQFA 1NW3A 2V74B 1FBNA 3CC8A 5DPMA 4M7RA 1XDUA 5EMMA 10MHA 4CKEA 3KHKA 5DX8A 1ZGJA 2GB4A 2NXNA 3MGGA 4QQNA 3I58A 5DRYA 3A7EA 2JJQA 1IXKA 3M6XA 4Y30A 3KU1A 5EZQA 4MIKA 3HCCA 4EKGA 4RTKA 3FTDA 4FSDA 4Z2YA 2O07A 3HVIA 4HSGA 1VL5A 4K6MA 4YUWA 3AWIA 3PX3A 3NW9A 5F2OA 3EVZA 1D2GA 4L7VA 5CIYA 3G2PA 3LX6A 3M6UA 3M70A 4P7GA 2IIPA 3KPJA 3C0KA 4OA8A 4OQDA 3LDUA 5K0FA 5C0OE 4IV0A 3HCAA 2Q41A 3P97A 2BR5A 3OU7A 2AN3A 3UJ6A 2EX4A 3R9XB 1R00A 3GRYA 3D2LA 1O9GA 5HILA 5EVJA 2CMHA 2ZBPA 3THRA 3SR4A 2PT6A 3GIWA 4HTFA 4OQEA 4ER7A 5U4XA 3KR1A 3EVAA 2YUIA 5DX1A 4RTLA 3U81A 5HIMA 3DTNA 1NW6A 1Z3CA 5FULA 5E1DA 3UA4A 1Q0SA 4E31A 4AX8A 1YZHA 4GQBA 4UOEA 1EIZA 8MHTA 4IWNA 1NW8A 2OY0A 3E23A 3RW9A 3KQWA 3DMGA 4E2WA 2P35A 4QTTB 1QANA 1WXWA 4DCGA 4IKPA 3OPNA 3PFGA 5BW5A 2JHCA 1PRYA 2PX8A 3QOXA 3GRRA 3BWBA 3TKYA 1OR8A 2Z6QA 4A6DA 3PT9A 1V39A 2YXDA 2FPOA 3KQQA 3KQPA 5M5BA 3C6KA 3PTAA 4OX9Y 3BWMA 2YVLA 4FT4A 5CVJA 2ZWVA 2ZW9A 3FPHA 1WY7A 3EVCA 4NECA 4RVDA 2OBFA 5EMKA 2QY6A 4RVGA 1XDSA 1JG3A 5E8JA 4PCAA 5JR3A 3RIEA 3LSTA 1X1BA 4HC4A 2ESRA 4C4AA 2ZZMA 1RJEA 5ERGB 3NWEA 1O54A 4RV9A 2ZZKA 4GC5A 2FK7A 1WZNA 4AUKA 9MHTA 3B3JA 3DOUA 4KDRA 3REOA 1DUSA 3EEYA 3LBFA 4FT2A 4R8SA 1EJ6A 2HWKA 3KQTA 1L3IA 1F3LA 5DSTA 1L3BA 1VP9A 3FRHA 4LWPA 5P8WA 3THSA 4AZWA 5GIOE 1YB2A 2YTZA 3C3YA 3MTEA 3TR6A 5KQRA 2ZBQA 2HR1A 4BLVA 3FUWA 1EG2A 3E7PA 3ER9A 1X1CA 2PV0A 1AQJA 1MJFA 2NYUA 4ISCA 4RTQA 3UJAA 1G60A 4PNEA 5DTQA 4ATNA 3R0QA 2CKDA 2P3LA 2I62A 2PWYA 4KRGA 4X60A 3T7SA 3P9NA 3M6VA 5CM2Z 5FHQA 4PYMA 1FP2A 2NXJA 2UYQA 3NVMB 5K0JA 1YFLA 4MHTA 3B3FA 2XYVA 3S68A 4E2YA 1RJGA 2BR4A 1IY9A 3NWBA 2OYRA 1XJ5A 4AZSA 2OO3A 3IV6A 5DSXA 4CTKA 4CKBA 1M6YA 2H00A 5KQSA 3KPYA 2OXTA 1KR5A 2A14A 2AOUA 2AOTA 3LL7A 3FUUA 1BOOA 2UZ4A 3ME5A 3UFBA
chains in the Genus database with same CATH superfamily
4UMFA 2JKVA 4B3FX 2VAVA 1E3QA 3CX3A 1EX1A 1I94B 3QKUA 2C07A 5JATA 4JUIA 5DLPA 1L7AA 2PUBA 4FFWA 1ID1A 3MINA 4HGZA 4W99A 4Q18A 3WYCA 2TECE 4GMKA 1VM6A 4L75A 1C9MA 2AXQA 3IRVA 3IVCA 4OLJA 1IZYA 4ZJYA 3E8SA 2CHFA 2DWQA 3I04M 1V6SA 3RSGA 4YXFA 1YBVA 5F7OA 3KHSA 4TV9F 3VR3A 5KEIA 4PC2A 1XA3A 1W48A 5KYTA 1SCDA 3DTYA 1QYCA 4HDOB 4ZI7A 1AQLA 3CPSA 4D0SA 2NADA 3ZXXA 5G0SA 1REQA 1U2GA 5H68A 1L7QA 3EVEA 4NRDA 1R8YA 2P2DA 2YR0A 2JLWA 1U2DC 2JDID 4N54A 2XSZA 1OHHD 3X1MA 2P0YA 2Y0PA 4ZKEA 1G2IA 1JSLA 5EIBC 2I6UA 4GGOA 4U2CA 1TUBA 3TW8A 2IHUA 5F4BA 4KIWA 1EIWA 2A0UA 4I55F 5ESRA 1NSYA 1C0KA 5M2QA 4NG5A 1IUNA 4RIEA 2PNFA 4XA8A 4D9BA 3QY0A 4DBLC 1DV2A 1A1SA 5IM4A 2Q2VA 3GLFA 4G63A 1GTMA 3QI2A 1F5SA 2FGJA 1VKNA 1ZSVA 2GBCA 2M32A 5K0BA 1XLUA 2E3JA 4M6WA 3RC3A 4DCVA 4LDPA 1CUGA 2ETXA 1G5RA 4NYJQ 2ZB2A 1VA5A 3CU5A 1E2PA 1M8JA 3NHMA 5E3JA 5LP6F 3I2JA 1RJFA 4EX7A 2F1JA 2O2SA 4ENUA 1DKUA 2UUPA 3TDMA 2VHWA 2ZP1A 1ONOA 4O4LA 3G79A 4DMFA 2C2MA 3G6WA 3H87A 4CKWB 2FN8A 3AFGA 3FDFA 4MEBA 3QJ5A 3LLVA 1MBZA 1E2BA 2PIAA 2H52A 1OC2A 1CY7A 2PSSA 4BQOA 5LJIA 2V7UA 2NPOA 4YJ2A 4JQZA 1BEUB 3NCHA 1M3SA 1U1EA 4L02A 3WFIA 1OY1A 4GD3Q 4UHJA 4H15A 4XUCA 5G40A 2EWVA 4YMHA 2C7OA 4INJA 2DFTA 3OH8A 1KI1A 1P7VA 1T2CA 2G9QA 1K88A 1E1CA 3WVNA 3BKXA 4U2BA 2ZB3A 2QMYA 5K20A 4F9TA 3B5JA 3IA2A 3PFKA 2IUYA 3RASA 1KVQA 2R66A 5EIFA 3UH1A 1CB7A 1Z5PA 2QRLA 3AOEA 4O4LB 1N78A 4RZ3A 5EJ5A 4YRDA 5AVXA 1Z6YA 2LVBA 3D0KA 3DW1X 4Q3CA 1AMOA 1U2SA 1PP4A 2OQ2A 1RWWA 1YZLA 2Q3EA 4L8VA 5CH3A 5FF9A 3T7EA 4CL2A 1OGYA 2BMDA 1UDAA 1YZTA 1NASA 4ZREA 1X1DA 1HDGO 3WMFA 3CJQA 2PGJA 1KS9A 2Y0BA 3MJHA 4JLBA 3MBOA 2IY8A 3DZBA 4N5NA 2BC9A 2PEYA 2CXQA 1JS1X 4OGLA 3EZLA 4AN4A 5BPFA 1UC5B 1LPMA 3H5NA 2B5VA 5EWJB 1N9GA 1U0HC 4QRIA 5TEVA 4DUGA 1B73A 1B8NA 1U2ZA 1WBJB 2FUNB 3FRIA 3HNRA 3IJPA 4Q16A 4Q66C 4Z8XA 1KPIA 1LTHR 4Z9YA 4G1CA 2FPXA 1Z73A 2OC9A 1IATA 3S27A 4B87A 2O8BA 1JWLA 2CCGA 3LAWA 1UADA 3NOXA 1EJ0A 1L5SA 3GMSA 1HE5A 4LE1A 3OI7A 5HPYB 1SKUA 5FD8A 3GRZA 2VZ0A 3IPXA 3WMGA 5IJZA 3PJGA 5CD9A 2VC2B 2O14A 4Z7NB 1RHQA 3PV0A 1D6SA 2ODNA 4P8RA 1U9CA 4FGJA 2IXDA 3B8HA 1Z2OX 5CLFA 1A98A 5HF6A 5JJKA 4CIVA 1E3SA 4H17A 4DCPA 1CBUA 4XXHA 1W4AA 3GY0A 4JODA 5CYFA 1TFRA 5E4TA 3T3MB 3DAHA 1TPZA 1ZKMA 3ZE9A 1DX4A 1WPQA 3GDHA 2VYQA 1CIVA 2P3QA 3EDOA 4LTDA 4REQA 5FUBA 4QFDA 2Q5JA 4U5QA 3T5AA 1J99A 3I34X 1H2XA 2ARKA 2C5GA 3WTCA 1GPDG 4D0NA 1YWGO 2JI8A 1V8DA 2ZCUA 5AKJA 4M7OA 4C3OB 2RDMA 5FL3A 4AU1A 5CFZA 3ANNA 3CJTA 1YCGA 3N58A 1SIWA 4JWTA 4FB5A 4TYMA 4WBNF 2ODAA 621PA 1UJMA 1FDVA 3DF9A 1JDVA 5HZKA 2C9YA 4M7WA 1E18A 4AS1A 1IEWA 1PQWA 1U98A 1BWSA 5FBHA 3QU4A 2BEWA 2J0UB 2AT1A 1JXAA 3ADPA 4C3UA 1RXCA 2DAPA 2I6QA 4ARVA 1VJ1A 2XT0A 1L5HA 3WL6A 3II6X 3UWSA 1W59A 1U5BA 5HK8A 1BH6A 4PPNA 1IZ0A 2OESA 2R85A 5AI0A 4HDCA 3NJRA 2QG9A 3DMRA 1M1YB 1Y1RA 3KZNA 1N5DA 2DUMA 4WA7A 4PY2A 2IYAA 1RXIA 2EW2A 4UU8A 3CLTD 3F6YA 3VX4A 1WB4A 1L6RA 3D5TA 5GONB 3AILA 4MWGA 5KQGA 4AI6A 4D42A 3C3DA 5JAHA 3NM6B 1QO9A 4EGAA 3AVTA 1HI9A 1W1WA 4NV1A 5ITSA 3IAFA 3S2ZA 4CDNA 3RYCA 3HA3A 4MKFA 4UD6A 4LCJA 3MTGA 4PLYA 4WN9B 5GOZA 4A73A 5L3SB 3PD1A 5CM8B 4EY7A 1Y7TA 2ZEJA 1CS0B 1TCUA 1VKJA 1Q83A 2Z1DA 3GQBB 4WERA 2QJOA 1NF3A 2JAWA 4QTXA 1G4HA 3M6FA 3OUUA 2IZ5A 1FUKA 5EMHA 3INYA 1K9VF 4KSCA 3RVDA 4W1PA 3TXYA 4Q00A 2RGDA 3A4NA 4ZU1X 1H3NA 2BHRA 4D41A 4ECAA 1RRFA 3I92A 4B48A 5KOHA 3MOGA 3TLAA 3R7LA 1SD5A 2FA9A 2B4YA 4IEIA 3FGZA 1KZ1A 3FFTA 2W8ZA 3HM2A 3UYLA 2YXEA 1NXPA 3JASA 1OWMA 3EHDA 1TFUA 4I9NA 2P9HA 1P1KA 1AO3A 4GVXA 1A9RA 3AHIA 3BXFA 4JB0A 2IPAB 1GNTA 2Q1XA 5E4JA 1X70A 3B48A 2D1YA 3EDRA 3EE6A 5B55A 2JD1A 4KDFA 5I4CA 4DC1A 4BO0A 4GMGA 2AKAB 5CUQA 4TL6A 1U7HA 5CD1A 1PYGA 4MQBA 5EMNA 4EPTA 2VPQA 4BNNA 4P2BA 2I6XA 5EVCA 2QBYB 4WXYB 5DULA 1GQOA 2BWJA 3D4LA 3SQNA 1Z6TA 3ACCA 3B2QA 4XDZA 3IEUA 3J7TA 4M54A 4FMCB 4HDNA 2RBEA 5AUOB 3SQOA 1JJ7A 1G16A 2I1WA 1GG2A 3NXSA 3Q87B 4NEGA 4ZOLF 1V5IA 1AH2A 4FHCA 3RUAA 3IH5A 3G2HA 5ERXA 5K8JB 3SVLA 3UOWA 4IH1A 2VWPA 1RHKA 2LWIA 4FLEA 3F8SA 3JAKB 3LNTA 4BFWA 4MI3A 4M55A 3FTNA 1NHGA 1WB9A 4V38A 2H29A 2QOEA 2V6GA 4MUFA 3NHZA 3OOEA 1JEQA 5DSZA 2EG9A 3O5AA 3PNYA 3EF3A 5KVQA 1WZUA 2JJ8A 3L07A 2IBMA 4GLOA 4XQGA 4Q4AB 3MSXA 3DO5A 4UW9A 1X14A 3EGDA 4IRUB 2NUAB 1M34E 2HUPA 2W0MA 5EYPB 3EFEA 5GZ6A 2OCYC 4M8LA 3GIDA 1NVEA 2PUWA 1LSOA 2QSZA 4F4IA 1AKUA 1QE0A 5JZVA 4DREA 2Y1GA 3C8ZA 1J00A 1Z36A 4ZPJA 3EZ6A 3OFJA 2VAWA 1KJZA 4OXIA 5G2OA 1EWYA 1K5HA 1NFFA 2GK3A 2FSIA 4NJEB 1TUGA 4KYVA 5CJ2A 1R6DA 2O7VA 2VSOA 4QOHA 3TQRA 5LYJF 1AUOA 2IL1A 1IJKA 3DXZA 2CVPA 3HCNA 1K68A 4HR7A 3RGWS 4FWTA 2XDAA 4I1YA 3O31A 4E4RA 1JEDA 3AOEC 1KF0A 1C41A 4N1AA 2CZQA 2HY7A 2RIRA 4PG8A 3X2SA 2FSHA 2GPTA 2GZAA 1VI2A 2Q62A 4ACBA 1U28A 3L0PA 4I1RA 1DEAA 4OO3A 4RPGA 5FO0A 3NGLA 1XEXB 3U44B 1E2LA 1TYEB 1VMKA 2B2CA 3P96A 3SIXA 1YS1X 1PK7A 1GITA 2ZAIA 4HHEA 4ENPA 4PFJA 1WM1A 4X64B 2CD7A 1Y5NA 1RI5A 3CW8X 3H1BA 3NALA 4KW7A 1SXJE 4RJIA 5DCYA 1JR3A 3MWGA 4X8MA 1CTQA 1HFEL 1MC5A 3D5EA 4K9RA 4TTAA 1KXZA 5EJ9A 4CG2A 3ZHUA 2AN4A 2ZTVA 5CLIA 1Z07A 2Z2XA 1DTWA 3CY6A 2QXTA 3K3PA 5FB3A 3RVKA 4KJXA 4AJ2A 3TZBA 1QQ5A 5B1DA 3ZU6A 3GWZA 3RUHA 3VTKA 2JFVA 3EGEA 4Q3DA 2IW3A 5AVJA 1KMMA 3SEZA 3TCNA 1OILA 3FZQA 3G5TA 1BW9B 5DK4A 1JLRA 2DKOA 4ABTA 2R97A 2R00A 3KEGA 1Q7CA 4NNOA 1JNXX 5CH5A 3GARA 5IMBA 4Q6WA 3KSDO 2A57A 2C5SA 3DCYA 3QLVA 3TLEA 5KREA 4N8EA 3DTVD 4ZDIA 4IMJB 5LJLA 2I91A 3EFHA 4Q1DA 3AI2A 5THQA 3L0SA 1QYRA 4DMUB 1JU3A 1QHYA 1DXHA 3BXGA 4G26A 3IIIA 3IB3A 4UHDA 4BYMA 5SZKB 3CZRA 5CITA 2W2KB 2WJVA 2XITA 3QYJA 3ZHXA 4C08A 5FWXB 5G0WA 1USUA 4RWZA 3IKMB 2VP6A 3DMTC 1U2DA 1YR1A 3WP1B 1XWWA 2JGDB 2XYHA 4FDTA 1JR2A 4ONEA 3RS5A 3LHFA 3RRMA 3W5SA 1KHHA 5NULA 5C5CA 3W2TA 1D4FA 1O94D 2WLTA 3SXJA 5F7JA 3D8TA 2V96A 4HMQA 3UV3A 3EDYA 3GT0A 4PHHA 4O0MA 2MDTA 4A6XA 3DOEA 1ACJA 2VUHB 3F8TA 3OX4A 4NICA 4U8GA 4DQKA 3DE1X 1UWCA 4LRWA 2GB4A 4CNBA 5BXQC 4LOJA 5TGTA 1G59A 1W6UA 5TPZD 2F67A 1R10A 2JFHA 3WMRA 4CIYA 1QB8A 1Z2PX 2X3YA 3EAGA 2O07A 4FSDA 2FZEA 2GSWA 3JQPA 3NW9A 2B61A 1R50A 3GGSA 5EKDA 3M6UA 2VHVA 4MITA 3A3YA 4IH9A 3OQ1A 1YA8A 4KGXA 2HBQA 3HDYA 4RPKA 5C0OE 2OQVA 2ZJBA 1VFPA 4IHJF 2IV3A 4MROA 3FNIA 1QF9A 3C8HA 2AEEA 3A2KA 1NOKA 1QV6A 2PT6A 1DKRA 3R3ZA 3HS3A 1PSZA 3DL7A 2Z5VA 1JWBB 1L4LA 1Z39A 1V8PA 2F62A 2YIJA 3EYAA 1E2UA 3OZIA 5CT9A 5G4KA 3TQCA 4LTMA 3UC9A 1WQ4A 2YS7A 2ZUVA 4L3WA 4M49A 3VYTB 3GLIE 2G09A 2OY0A 1QP0A 5A7GA 3RW9A 3LLCA 3CNNA 3HMQA 4E2WA 1Z8HA 1E1NA 5DNUA 2SHKA 3Q7RA 1IBKB 1U0RA 3KKLA 1EM8A 3ZVLA 2Y76A 4A6DA 4DIOA 3CB2A 2XA1A 3AHDA 4CL0A 3IT2A 2QD5A 1NKTA 1TCCA 5AJTA 3UCFA 4EZIA 3IJ5A 4FS3A 5HJ7A 3B78A 4JB2A 4XVHA 4B7CA 5ICMA 2ROQA 4DA6A 1PGNA 3FIUA 4D98A 1VHDA 4HBZA 4ND1A 1JIUA 2VAXA 2VBCA 3PUYA 3MLAA 1OU0A 2Q3JA 3GFBA 4JA2A 4TLAA 1LTQA 4ZCPA 5IAAA 3EDCA 3K6SB 3FPSA 2ZZKA 1QYWA 2FW1A 2RAVA 4WLFA 4BX0A 1JHYA 3C8DA 3VR5H 2OENG 4KTTE 4QHYA 2HRZA 3RANA 1QWSA 1KP2A 1TEVA 1Y1LA 2ZYIA 3UPTA 1L7DA 2C8KA 3BHMA 5DDIP 5JSFA 2A59A 3SYTA 4A8JC 4CMKA 2E4XA 1KJNA 1JP7A 3INTA 1C7RA 4U6NA 3C3YA 1RKQA 5AOAA 2IEZA 4W1RA 1R16A 1UBUS 2NVBA 1US8A 3AUYA 4I14A 3L7MA 5DI9A 3WA7A 2WKWA 2WG2A 3PPYA 1U7TA 1Y1QA 2FDRA 1J2EA 5FH9A 4NJOA 4IDQA 5DB4A 5INTA 4YP7A 1L5WA 4G8DA 1AA9A 1J70A 1PG5A 2BFFB 1F48A 5H82A 5HCUA 2PWYA 4DJJA 1RYDA 4LXYA 4PSKA 3PU6A 1IXRC 3W8DA 1QHXA 2UYQA 5EJFA 1NVXQ 4G4IA 3OD1A 1YI8A 4YAKA 5LMCA 2C96A 2UUAB 4XX0B 1X8JA 4CN8A 2RG1A 1NDHA 4Q9IA 2OYRA 2YINC 4LRQA 2FG5A 2FW6A 1OAKA 2GF2A 2HQRA 3EQ2A 4QU9A 3UIEA 1GA6A 2H1SA 4X6YA 4PZDA 1GR0A 3RC9A 1Y33E 1E8MA 3I32A 3TW8B 4C4PA 4F3TA 1EU1A 2WTBA 1WCYA 3VAAA 1X15A 2WDPA 2VDWB 3BMNB 1I9CA 1H22A 2OXTA 5ALJA 2AOTA 2VH1A 1CF2O 3ZXUB 2OBXA 3ME5A 2YJZA 2X4GA 4BKQA 1N77A 1TADA 4ENWA 4Z9BA 1N7GA 1S1CA 2DBVO 2OQIA 3VR4D 3LU1A 4U0KA 5IT5A 3K5WA 3OF3A 1WUIS 4C21A 4UNQA 1S2DA 3K0AA 1ECBA 3FPJA 2CXOA 4LZAA 1ZI8A 4C6RA 1NW4A 1E1QA 4ZZ3A 2VDJA 1MABB 2H3HA 2HPHA 2PJZA 1DCFA 1L4HA 2YY7A 2WMOB 3CSDA 3IQXA 1CDZA 3GJ6A 5HKOA 5EJ6A 1I1HA 2EWMA 3FUTA 3GD7A 4FNMA 2YHAA 5GOTA 3LI2A 2YVUA 2Q2QA 2WYUA 1Z33A 1AA6A 4J0JA 1TAUA 1COZA 2E4WA 2ZIZA 2PNJA 2EFYA 5TJ9A 3BREA 5CMLA 4NTZA 2GHQA 3I9V1 3E4DA 3CUUA 3FPEA 3NP7A 2ZM6B 1VL6A 1NRJB 1JAYA 1SKAA 3LYUA 5E8RA 4GP7A 5BSUA 1XRLA 3EOZA 3NVAA 1C8VB 3HYNA 3FJYA 1XZQA 4NC9A 1E0DA 5LLDA 2WHQA 2ZYTX 5GTDA 4RVHA 4OH7A 1Q1QA 4A7PA 2DTDA 4YAIA 1W7AA 2EBWA 4HDKA 1ZMBA 3AXSA 4AF8A 5JJCA 5SYMA 4NBSA 1T8TA 3SC6A 1G7TA 3GP3A 2DFLA 2H1LA 4CEIB 2ID7A 3BDIA 4XQ9A 5LU9A 2YOGA 2G40A 3H65A 4LSGA 4MVJD 4E4YA 5FWNA 5JEEA 2JIRA 4EG7A 4IAOA 4Y9TA 3SN6A 4OKSA 3HLKA 3F3MA 1CS0A 3G3EA 3IFSA 4H77A 3L9XA 4C76A 1HNNA 1XDWA 4RQBA 3UUWA 4MA0A 2GWHA 4JVNA 2G1JA 4WA8A 4H7DA 1GAJA 3IBTA 2HK7A 2AQIA 1H0RA 3JQAA 4I5FA 3G2MA 1P9WA 2R7KA 3H13A 4RHYA 3U7JA 4E03A 2G5PA 4PGAA 2AWNA 4YCCA 7GPBA 1HG1A 3C1UA 2E0IA 2AYZA 4BV2A 2WKQA 1J90A 3B6ZA 4PBSA 5EKSA 5BP7A 5HVNA 3H18A 4B47A 3CZMA 4H4DA 2X0KA 3CONA 2GLUA 2O59A 2X4IA 3OE7D 4WV3A 4X0EA 3W5UA 4K6OA 1DQPA 3VH2A 5CH8A 4P3XA 1BE8A 1EM8B 1DDGA 1SGWA 4OP1A 4QVGA 3A2NA 2VSQA 1W73A 1FDOA 2YFHA 4C4RA 4DYDA 4H3VA 1LDNA 1FFGA 1I14A 2G1KA 3K1JA 5AKZA 2GQ0A 4OATA 1FYVA 1WS6A 2PGOA 1UM8A 5EIEA 1Z6ZA 3J7AC 4B4DA 3SMQA 1JEOA 3FMOB 2OBLA 7REQB 2Y67A 1DX6A 1ZH4A 2JHPA 2QN2A 2XVZA 3LUKA 2I2AA 3BWVA 3UQZA 3V46A 3OETA 2HCJB 4B6SA 1LCIA 1E7RA 3QEMB 1U0BB 2XD4A 1RI4A 1QZZA 1RWPA 1NTRA 3WGQA 3EIWA 1RYYA 4CMGA 4EENA 4IFBA 1USVA 3NVDA 1XVUA 1YI0A 4QAQA 3VHXA 1K2VN 5FNVF 4F0JA 5JD5A 1HYHA 1DLJA 3GRAA 2AN9A 4FLMA 3QYFA 4WKCA 5MFPA 2BKVA 4JI2B 3H1GA 3UAYA 5KYXB 1DAKA 3IVGA 4E5MA 2BGLA 1UCFA 4J0KA 1SVKA 2SCUB 4JCOA 3LPLA 5K0SA 4DHEA 3GXOA 4PICA 4ZP1A 4CHGA 5IKXA 3IAXA 4I4TA 3WL4A 3KB1A 4K88A 4R2LA 1WXIA 4P3OA 4YJFB 1UKZA 4CKBB 1GDTA 4JXJA 4AP6A 1S3GA 3G0IA 1ZOSA 2G0NA 3NHWA 4KXWA 1XU7A 1I5RA 1NJFA 5FO1A 1Z6QA 4G9GA 3L2OB 5EJIA 1H6CA 5AUQA 1NN0A 1RAIA 2A4MA 1C0EA 3RV3A 3F4LA 4A16A 2EQBA 3B6MA 4TMFA 3UGKA 4G5XA 2CMGA 1KZ4A 4TRMA 3PGVA 3NC0C 4DJ5X 1LBTA 3HNPA 2W2KA 4Y2JA 5K3BA 2CLSA 1RJDA 1J1UA 1UKAA 3INRA 1C30B 4N8DA 1BS9A 1JG1A 1BVUA 3AM3A 2FHPA 4PU0A 5IVKA 1VRVA 2KM1A 1YNSA 5H59A 4INPA 1M2WA 3VC3A 1FXUA 2Y1XA 4A9AA 3PL5A 2QTFA 3BIXA 3W7BA 4OHBA 3SC4A 3TSZA 5GINE 2AE1A 4YV1A 4LZNA 1T15A 1DWUA 2IBTA 2IYRA 4K0RA 1EVIA 2HNKA 2O3UA 2BFEB 1JHQA 1SN7A 3IAS6 1WP4A 3FTPA 3R1IA 4FGUA 1DRVA 1TZMA 5BT9A 1JYFA 5E1MA 2IV7A 4Q21A 3SHOA 3TLXA 2B2XA 3AIIA 3D2CA 3R20A 4YO7A 1SHUX 4L5IA 1PFUA 1DMSA 2FH5B 2X8JA 4JLDA 1VYHA 5K0NA 1QIHA 3UT5B 5LOVA 5JZMA 1B0PA 4DG9A 1JTEA 4LV6A 3ZCVA 2GVDC 3WSTA 2M6LA 1B8PA 3KD3A 3IO5A 3SJAA 1L5LA 3N5CA 2ZAOA 4M0DA 3ZYCA 1ZNWA 3LHDA 1S8NA 3K1YA 3B1ZA 3IHTA 1JHUA 2RARA 1N6RA 4L4RA 4LZLA 3U80A 3GHHA 3JYHA 2O4CA 3ECSA 3KXPA 1MOPA 1E2QA 3W4JA 4CCYB 4H18A 4E2ZA 1O6BA 2BFBB 1JR4A 1XHEA 2GGSA 3NAGA 4XARA 2ZUEA 2C3OA 3AMVA 4P38A 3UJ9A 3ZI7A 3BB4A 5DWQA 4K6HA 1L7NA 4QULA 3EH1A 1SCAA 3QKRA 5KVVA 1BD4A 4YT5A 4CZ2A 1NXXA 4DZRA 4ZPXA 4D6XA 2P9EA 4PHTA 4DTIA 4WCVA 1QM5A 1PVVA 3SKYA 1EA5A 2YXLA 3NWPA 1NNLA 1OREA 2P5TB 4E5PA 3CH7A 5BO5A 3AIKA 3A37A 1JDUA 5I7RA 4D8TA 1LV7A 3RS8A 1CCWA 3BA1A 3E7FA 3OIUA 4O2AF 5EXDA 1A9ZA 3ES9A 3GPDG 1ZD4A 1X7XA 3STWA 2Z6UA 4Q4AA 2I4MA 1MCZA 3MW8A 3DE2X 1N57A 5JVDA 2PO5A 4OGKA 1HKUA 2I03A 1K6JA 3AU9A 4QTUB 1OA1A 3F1KA 4B3DA 5FA6A 1PL8A 4QU8A 3MBIA 2QNRA 1RI1A 3PFWO 5JMOA 3B9PA 1II8A 2YV3A 4XDGA 3QGMA 4V0ME 1M6VA 4IV5A 3QQ5A 1L1EA 1XTKA 3EIFA 4G0XA 4B79A 1REQB 4YIHA 1CERA 2BL4A 1BKDR 4JD5A 4XPZA 3KSBC 4XM2A 2GM4A 4FW9A 1RAHA 5LU8A 4JP2A 3WBBA 1OBVA 1KDZA 4Z7QB 4CM7A 3LUCA 2FAXA 1X1RA 2EKPA 4IJ5A 4Q9KA 2D00A 3NTRA 2ATIA 3HC7A 3HYSA 5FADA 1AKWA 2JFXA 3G6KA 3LQFA 1PZEA 4DIMA 2YIMA 4DG5A 4P4SB 4MW5A 4BN5A 2P11A 2R8BA 3C4JA 2BHLA 3KB2A 3WQSB 2R8XA 1OI7A 4EFMA 1BU5A 4HH4A 1DUIA 3ZE7A 1RPAA 3C48A 5AW9A 3PF8A 4M83A 1QK4A 3O4RA 4GI1A 2W2LD 1F9EA 1KXJA 1SQ5A 2DX7A 4Y6SA 3VBCA 4H0FA 4BLUA 1L3CA 1UJ2A 3W2HA 5KOJB 3HXMA 5KPJA 3HB9A 1QGYA 3CX7A 5EYPA 3VI4B 1CUAA 2V8OA 2A0XA 2Y1OA 3QX7A 4IGKA 3FMVA 1RYMA 3E5HA 2FSUA 3K9BA 1VL1A 2F8LA 3NUZA 4A23A 4X8HA 3H1PA 4EEXA 2V6BA 3E9YA 3O2QB 4FS8A 3RD5A 4DARA 4EGJA 1I3KA 3KCQA 3OT1A 4GL4A 4FGLA 1VPWA 4EZBA 5MN5A 4R31A 1F8YA 2VEDA 3KVVA 5K2MA 3FSJX 5LYYA 1RLMA 3RUPA 1KI6A 3I2IA 4KYUA 1L2TA 3AR7A 3FVWA 1A5ZA 4HN9A 3ID6C 3W5AA 2ZT7A 1NC3A 2QQGA 3WGLA 3UMCA 4RMGA 2EV9A 4BB0A 3G8BA 5C1PA 4XIJA 1DQSA 2ZAMA 1IVNA 1T2EA 1VQ1A 2QBYA 2KHZA 1ULSA 4FFVA 5A2QA 2WJIA 4IIEA 4AECA 3H0EA 2GJ4A 2MT9A 1BKYA 1JZSA 4FSXA 3MTJA 1NJ1A 1O8CA 3OT1B 4WNYA 4MS4B 5IKOA 1L5QA 3DWFA 2WYIA 1KK0A 1FMJA 1KYWA 2EP5A 2QHXA 3O75A 3OE4A 3S2EA 3R5KA 2C9CA 3KQLA 1H65A 4MRNA 4W9RA 3ZCRA 4N40A 2KX7A 4W63A 5JWHA 3W79A 3DFMA 3J81k 1U9YA 4YRPA 4K2AA 2HNBA 1UXIA 2YMPA 4A2PA 5AXAA 3ZW7A 4BP1A 2BTEA 1O9BA 1GGNA 1ODSA 5T8KA 4CI0B 5CB0A 5C9ZA 1MLDA 1IZ7A 1RADA 3I39X 1FJXA 4F2GA 2HU2A 5KU7A 2FX5A 2O48X 1X1TA 1QFSA 3DLPX 3LDHA 1DB3A 1M2VB 2WWXA 1SCJA 4JYBA 2ZUUA 2P78A 1JTFA 4GMDA 2QVYX 1BO6A 3G0CA 2QQFA 5CVUA 121PA 5KJEA 1APBA 1FFYA 3I6QA 1YE3A 3LF1A 1MRSA 5FNVA 1SCIA 3OPXA 1SC1A 3H1FA 3AVVA 1WXQA 4WLEA 5T6BA 3UHFA 2NU7B 4MHOA 1QHSA 2XJ9A 2BI8A 2Q7XA 2QAIA 1HURA 2FFJA 2Y0EA 2Y4NA 3BDAA 2AGVA 1X7WB 2XVMA 3CSSA 1LPOA 2QXYA 3ZDZB 3A70A 2YZGA 3NDPA 1ZU5A 3M83A 5BR8B 2VF7A 1SPXA 2ZBFA 3AP1A 4LYHA 4P36A 3TIFA 5LA6A 3DM9B 1PSDA 4BXOB 3F6EX 1JKJB 2FUCA 2NUBA 3TLKA 3LY9A 3N07A 4XWAA 8AT1A 1XDUA 1I4LD 4P5DA 3SX2A 2Z2YA 5EIAA 4JB3A 3KETA 1YS7A 2QJRA 2WQ7A 2HCRA 5BQXA 3E9QA 2O1EA 1L5HB 1T6BY 1XXHB 3B9QA 1MO2A 4G8BA 4MW6A 2NO4A 4QEDA 4Y30A 5EZQA 3OA0A 3WFZA 2AN1A 4D4IA 3K9WA 4XTRA 1ESDA 3WHLA 4D3YA 1N9GB 5C35A 1PDOA 3D6AA 4F4CA 3HCWA 3MM4A 4X7MA 3PQ6A 2OV3A 3QWIA 4HGOA 4LYYA 5DTIA 4RHUA 3RK0A 2VJDA 4A0HA 2WV7A 3QPUA 4AG3A 3RAFC 1GRCA 1JHRA 3KTAB 3OU7A 3IQWA 3P97A 4KWTA 4QELA 4B3IA 4M1EA 1SK9A 3U4QB 4DDTA 3LOPA 3FCSB 1VJGA 1Y5MA 1PYDA 1UDRA 2JBAB 3I8XA 1DHRA 3HUTA 4LRTB 5EVJA 3ZDFA 1KO8A 4L3OA 4E11A 4EJ6A 2OGWA 1SEPA 2AEJA 3E4CA 3L7KA 4G37A 4KHPB 1EWKA 1GZ6A 3D3QA 3TAXA 1MJNA 3N8DA 4I19A 5FULA 4ZCMA 5LBIA 4B43A 1L4EA 1W29A 1RLUA 1EIZA 4HYEA 8MHTA 3FZYA 4XQCA 4GZ6A 3THYA 1TU3A 1JIKA 2J3IA 3FVRA 2XZLA 1NOIA 3TFQA 4DG8A 2IF2A 1VJTA 3IAM1 3QOXA 4KQMA 1JH9A 1L7EA 1DIHA 2OFWA 2ZRMA 4OX9Y 2QAJA 1ZUHA 2NM0A 3H9QA 4I8DA 3FNGA 4LK3A 5LXTB 4PC3A 3HE3A 3FTEA 3H97A 4NABA 4P3PA 4TV8F 5EUQB 1RAFA 4RVGA 1JJVA 3DOIA 1VBMA 4QGAA 1KKLA 1U99A 4ZXPA 3EWNA 4FDLA 3BGSA 2VF5X 2ZKIA 4HC4A 2AD1A 2OAGA 4FIDA 4XM1A 5AWFC 1FNNA 1UT5A 3RUCA 5D3MA 4DCNA 2I7TA 5J47A 1MGPA 4TSRA 3WRXC 1LI5A 3GRCA 1VIAA 1J56A 2TMGA 3QENA 4CCWA 1W36C 1I7PA 2B82A 1OJ7A 3PVSA 4W7SA 3SF8B 4C88A 4AZWA 1Y7IA 3TWOA 2H1CA 1X8LA 4I6EA 5JCJA 1G8HA 4XWTA 1P7WA 3C16C 4JJ8A 3RROA 2HR1A 2PUFA 2WU3A 3GJ3A 1W0JA 1OYOA 1TX4B 2CXTA 4LKOA 5DFAA 5C4GB 4UQOA 3MCVA 1G98A 2ECFA 3D3JA 5ABPA 4FKZA 1AQ6A 2WSYB 1AQJA 3D6UA 3C1TA 1MJFA 1FJHA 2QUJA 1VA4A 2EDAA 1ADFA 1X2BA 5A4KA 3UATA 1CZKA 2PLRA 3UK7A 4DE5A 1UIMA 1QO7A 3WWYA 4EJ0A 3BX1A 2I62A 5EJEA 2P9TA 3WQHA 4OFXA 1OASA 4WGFA 5DF1A 5K0JA 4TYQA 4NCKA 4YYEA 1FP2A 1SJ9A 5J58A 4ZYLA 1T10A 1B74A 3AUSA 2ZJYA 3KWMA 4MHTA 3PUVA 1ZUNA 4CEHB 2XRYA 3OPYB 5DYGA 1TXGA 1KDVA 5ALKA 1JLLB 4AJHA 1I01A 3KDPA 3RC1A 4CKBA 5IJWA 3HBFA 1K3FA 1O4WA 4XASA 1IPEA 1G5TA 4YJ2B 1A7JA 3K05A 5L3QA 2A14A 5FWYA 3DZ8A 2C54A 5ES3A 4P83A 4RGBA 3RHTA 1DC8A 2AJCA 3KL2A 2P4SA 4MICA 4OXRA 5E3IA 1NUTA 4ZDJA 1E3JA 3AUKA 4TS3A 4W5WA 1EFCA 4PGFA 4ECEA 5BWCA 8GPBA 3QVTA 4RHTA 4DCTA 1EFVA 2DCMA 1PFKA 1L5OA 1WCXA 2R6JA 3BG5A 4TWRA 2XQGA 3PDIB 3ZK7A 1MP0A 1T2DA 4M0PA 5K05A 5DI3B 1V43A 4CF3A 5KQMA 1SQ6A 3AR9A 3ETLA 1D9XA 3I2GA 3KKQA 4EEZA 2ZJ8A 1KYZA 5F2NA 2GESA 4RKFA 1DCMA 1XC7A 4BTVA 4P82A 5ECWA 2B69A 2ZUDA 3BJEA 1P17A 3FYUA 3ER6A 3OU2A 2NQ8A 2OECA 3CZPA 3H2KA 3HWRA 3R41A 2X0EA 4WZAE 2Z8YA 1SULA 3FR7A 4WLNA 3LUDA 4E2FA 1Q57A 3AVPA 4XJXA 1B1AA 5I01A 1ECLA 4RDHA 5LSAA 3O84A 2P2LA 2VNKA 4KKVA 4DZZA 1XMOB 4KR2A 4C04A 3QLVC 1V9LA 1GEGA 4U7HA 2NU9A 1W5EA 1K6XA 1XD2A 1SCBA 4F86A 3L5OA 3GG2A 2WV9A 5J2UA 4LMAA 1DNPA 4YWHA 3U26A 4FM9A 1ECFA 1MJ5A 3FCEA 2WU0A 4FFLA 2G71A 2CSXA 4B85A 3O1LA 4W82A 2ZIGA 2I80A 5IPFA 1GM5A 1NBMA 3TG8A 4NH4A 4OHZA 2HLPA 4G4GA 4HDMA 3IDFA 3UJPA 2Q3DA 2H7VA 2Q9BA 4S1NA 1YGPA 3D2AA 2NU7A 4BB9A 2CNKA 2H1VA 4E30A 1B93A 4GWLA 4P93A 4U8HA 1MPXA 2HA2A 3VVBA 1YK0A 4MA5A 3K8QA 4LAFA 3M6MD 1SFRA 1ZOLA 4F85A 2G70A 5KOIA 4M86A 2J7KA 5REQA 3I0NA 2C84A 3TLYA 2KLHA 4MVJE 4EUFA 4FHGA 4C0AC 5HZHA 3S7TA 2IX3A 5BRAA 1SHTX 4ZCTA 2BGGA 4GOOD 3RTCA 3L9WA 1T26A 1WF3A 2PGAA 1V1JA 4P3KA 3D3WA 4QU5A 3GNLA 3EIUA 3UA3A 1HKHA 4UDYX 1M1NB 3JRWA 3CTMA 3CMMA 4M8NE 3T9AA 1Y89A 3A28A 1HUQA 4U5XA 3R3XA 4CR6A 1MA0A 3A6EA 1E9FA 3ENNA 4KQCA 4DV3B 3T3HA 1GVNB 3NM5A 1CQXA 2A3NA 3ZXYA 2ECPA 2OV4A 5AVSA 2ERXA 5JFOA 4JGBA 1RXSA 5C8VA 4XRRA 2IOHA 3B6EA 4TKLA 3VYVA 5BYKA 1T36B 2GKGA 2P69A 5F12A 2XHEA 1P39A 2XGOA 4TROA 5I7VA 4X91A 3NPMA 1T1GA 3PITA 4ZCLA 3WBFA 5AI5A 3SX0A 2WWGA 3ZLUA 5REQB 1JA0A 3NDJA 5JMWA 1GU0A 1ONPA 3MTDA 4RJLA 2QENA 4I1PA 3K32A 2VNSA 3K0FB 1GL7A 1TYBE 2DWPA 2Q5FA 1TQ6A 3RFCA 1B76A 2CB0A 2AHRA 2B7CA 2H9IA 2V7EA 2VJPA 4QDXA 5FPSA 4B7AA 5BN3B 2OYSA 1D2AA 2VAMA 2JATA 3AVOA 5KSOA 2E21A 4ARAA 4YAGA 1IBSA 1C1YA 1H3EA 3OOWA 3U4AA 5DMHA 4IGIA 5I45A 4EY3A 1C80A 1XKXA 4UMVA 4W1SA 3QTTA 3PYLA 1XN1A 3DLBA 4G8CA 4JP1A 4GP9A 3PXGA 2GSDA 1RKBA 4R01A 5KKCA 1AXEA 4PPYA 1F9AA 3ZCTA 2HHHB 4RF3A 3C5WP 4KXFB 4H4CA 5LCXA 2AYYA 3W6ZA 1FSFA 1NE2A 2FQYA 2V4ZA 1RU3A 4TTVA 3P9RA 3S4YA 1TVMA 2HA4A 4TXHA 4YRLA 4YRAA 2E7ZA 4JVMA 2GEBA 3B1KA 2ZYGA 1TLFA 2O5VA 2ZITA 3E18A 4NSNA 2PGIA 1Y8AA 3DA8A 3P9ZA 3X1JA 1Y7HA 2C03A 1DP4A 5BR1A 3HDQA 2I66A 3LCVB 3PQFA 4XJSA 2JFYA 4MI9A 4RD2A 5KDLA 4RELA 2GYVA 1DL5A 2X15A 3DE7X 3I2YX 2WU1A 4O1MA 1K7SN 3R8FA 3Q3VA 3IUEA 2J9FA 3RVBA 1G8KA 3E0XA 4IIBA 2ONKA 3AR5A 3GJSA 5DM2A 5JZBA 1JDBC 1CVIA 5HJEA 3D4NA 4IMPA 4MJXA 1K2WA 3FSGA 1QLWA 3LYHA 3LPCA 1JB1A 2C98A 2O2JA 4J4BA 4KIFA 3PJDA 4UHBA 3T9CA 3LV8A 3H4TA 1MVLA 2GDJA 3DLAA 3MUEA 4ZVKA 4Q01A 4CLHA 3PWSA 5B2EA 3L8EA 4TM7A 5HE9A 1KEPA 2UYCA 2MIIA 4WESA 3VR0A 5CEJA 1MO5A 4ERXA 1GFIA 4JYAB 1ODFA 2UKDA 2XMGA 3CUKA 3KPVA 2ZCJA 4EWLA 4Q39A 3UJHA 4Z9AA 4OQNA 3UWMA 2BAGA 4H9GA 2QJWA 4DF3A 1EFAA 1QFYA 5DO9A 2KMLA 4EVQA 4LCBA 1UOPA 4C6TB 3H6HA 1U3TA 1P9OA 4JZKA 4E32A 3D3NA 2Q27A 3O8QA 3S99A 5L4SA 3ITNA 2XDQB 5ESXA 1EAMA 5JASA 1CEYA 5BN4B 4HKTA 4BO2A 3HJRA 1U3FA 2XUQA 4Q4JB 1DBIA 2IFTA 3GEEA 4KWHA 5DYWA 5A6VA 1E0AA 1KEEA 4K40A 1BHJA 1KMCA 1ABFA 5DBEX 1J8FA 5A0FA 5B1YA 1G8FA 1GLGA 1OSNA 4D8UA 3N7AA 4B81A 2Y68A 3ADKA 4MUBA 3VU3A 5BT8A 3PLAE 1EVYA 1TZJA 5ULLA 2PKEA 1MQ8B 3GZJA 3A6JA 4MVWA 2WP0A 1L4MA 2P2SA 2BE7A 4J91A 1NBWB 4A27A 3HKDA 3DE3X 3TZLA 3I8SA 5KJ6A 1VZ2A 4KK4A 2H4FA 3W7AA 3NIFB 3KS9A 1G8AA 3ZQUA 2A92A 2IZOA 5IC5A 5JI2E 4R2XA 3WGHA 3O3MB 2R8RA 5H81A 3DPUA 3JATA 2VBFA 1DAMA 3FYTA 2C7GA 3DB1A 3GN1A 4B73A 1ZJWA 3OQIA 5AM3A 2YV1A 1P1IA 1U7UA 2I76A 2WM8A 1QV9A 2ZBEA 1QAQA 1GSHA 1RQ7A 4I50A 4L15A 4UE6A 3T5CA 4XWWA 3LVQE 2HQBA 2X2EA 1X7YA 4MPRA 3C24A 4OA5A 4ICIA 5D1HA 1Z4JA 2XCUA 4IKEA 1IH8A 2ZI9A 3L7CA 3U5TA 2CCJA 3HLTA 3EVTA 2QAGB 2YVKA 4YI3A 2QVXX 1TA4A 3ZHOA 3TEJA 4E94A 2A1IA 4KDEA 1UM9B 3GLGA 2BFPA 1AXGA 1G6Q1 1U0NA 2E6UX 4MQLA 3S2FA 2HTEA 2JCBA 4KUHA 4F6RB 5I7HA 2L42A 2SICE 3Q40A 1RXYA 3W2IA 4URYR 4JEIA 4BLRA 1GVHA 1KYYA 2IP2A 4XDHA 4LJAA 3QUTA 4KXQA 1OZFA 3QIAA 1UP7A 4ZAFA 1JDSA 3WK4A 5GJBA 1AHNA 1MRNA 2CDBA 1LU9A 2QRVA 2XMPA 5HQ3A 2DCUA 2EGUA 2FOLA 2IKQA 4QEKA 4YBZA 4RE5A 3WRXA 4EG6A 2G8NA 4BAGA 4HNRA 3ETDA 4FZ5A 2QB5A 3IT3A 4IXTA 5IW8A 2V03A 1D7OA 4HZGA 2IDJA 4MQFA 4QFBA 2H2FA 3SXPA 3K20A 4XB6B 1BN6A 3K5PA 5ALSA 4EPXA 4HS9A 1KQOA 4IMRA 3ZNOA 4KODA 3HVUA 1T4GA 1V5WA 3OX1A 5CFPA 2J0SA 4CKCB 1Y6ZA 1M7GA 1UDXA 2JLSA 4D26A 1I1NA 1Q3TA 4E33A 3UJNA 5E6RA 1GPYA 3NHPA 4RTSA 4LPKA 3G23A 4HNAA 3ZDRA 3C3AA 3KOOA 3AL3A 4M9RA 1ZCFA 3RAGA 2OLKA 5I8WA 4LQDA 1FK8A 1V25A 4OG2A 2ZGVA 1U1CA 3DBOB 4LFBB 5JXGA 3GDFA 3ZHRA 1RACA 4NBUA 1JFVA 2HK8A 1BS2A 1CX9B 2OQRA 2XXBA 4KMRA 4MARA 2F55A 2FP4A 2QGZA 1JB9A 2WKPA 4DLSA 1XJWA 5CX1B 4I81A 2WYOA 4HZUB 4D6PA 1U4NA 1K8QA 1XXLA 1RZVA 2PZFA 3T1QA 5KB3A 3JYQA 1N2GA 2CCKA 2YFQA 3SSMA 1Z4OA 1PVDA 3OZSA 1G17A 2F64A 2VHXA 3B53X 3KVRA 4W7IA 5DGTA 1FVXA 1HTBA 2Y2UA 1HE1C 1KZ6A 4HB3A 5AVZA 2B1QA 1HO3A 4PYQA 1G6OA 3R6TA 5EJMA 2C5AA 2PG3A 2C9MA 3DTVA 4GQIA 3W5HA 3KKKA 1YR3A 1G3QA 5EHIA 5BMOA 1X1AA 3G9UA 3OQPA 2MYTA 3ZQ4A 3QKWA 4TS4A 1NQTA 2O8NA 4BMXA 5M7EA 3QEBZ 5U1PA 3FWZA 3JQCA 3ZQ6A 3OO1A 3OTWA 4MGHA 4X84A 5KZMB 3KQKA 3AONB 4IIGA 1VDZA 4J4HA 1F8GA 1Q44A 3NGXA 2BI7A 3GCWA 2VDUE 3PDUA 1W44A 3RBZA 3BZUA 1YRAA 2ZPTX 4J0QA 3OJOA 2V59A 2GA9A 3WB0A 2LCIA 2YMLA 3EGDB 4ENVA 2CNWD 3RHSA 2YHIA 2BCGY 1Z15A 3TOZA 3TGLA 1UPBA 1GQ2A 4C6TA 1SO8A 1J8DA 5FYQA 2IGBA 3RBVA 2QN6A 2NNWB 3CEJA 5I51A 5JCOC 1IAQA 3LQRA 4G1MB 1MVOA 2I6GA 3LS2A 4NENA 3SZRA 4R0MA 3MUFA 2AUTA 4I0WB 1AMUA 3HVJA 4JBXA 5SY6A 3QFSA 3ROZA 2UXDB 1E32A 4AXXA 1UK9A 4A0SA 5FP0A 2OZLA 3I09A 3VU9A 4OKIA 2ST1A 1IG0A 3UT0A 1Z0IA 1T0JB 3LDFA 5LUAA 2RH4A 4ND3A 3VU0A 2P9QA 1NVVQ 1RZRD 2AYXA 3PQ8A 3H4MA 3C14C 5BQ3A 1J8YF 1ODCA 2HRRA 5LA6F 4A8PA 1N8NA 4QM6A 4NCXA 3TR0A 4ITUA 3CUYA 1H5QA 1WCIB 3LBHA 3H9JA 4TKUA 2C2ZA 3U3KA 3DAFA 5DPMA 2N9UA 1OLUA 2CXNA 3GBSA 4NFYA 4XSVA 4BX9A 5EIOA 4GU5A 4UD2A 1NJ5A 2IYVA 1XTRA 1Z5WA 5IJ9B 1J8QA 2JASA 1P31A 4HFRA 2WJWA 1XB2A 4KOEC 4OUDA 4DCCA 3FOZA 3HCCA 2HL6A 3AKYA 3HVIA 2VO1A 4JFAA 4YUWA 3EISA 4L7VA 2IWHA 1K66A 3N8GA 1YL5A 2W6JA 1Z4IA 3WA6A 4MEAA 3FSGD 4GZ5A 4WLUA 4WVFA 2WFLB 1NQWA 1RHMA 1PTKA 1XAGA 1WOMA 3ANYB 1FXSA 2BR5A 3H11A 5HDBB 4KP7A 3SS8A 4C89A 3HYLA 3IQEA 4L95C 4ZIRB 2HRQA 5LZ2A 4DIUA 1PHPA 2FN3A 4OQEA 2IU6A 2M98A 3JAKA 1P4GA 4EHNA 1QXSA 3GCGA 5C51B 1RWXA 4ZZ2A 1ZIYA 1FTQA 2VJMB 1PEDA 3BMNA 2RHWA 3BL6A 3MEQA 2XDWA 5F1KA 2Q4TA 2D3TA 4PN7A 5ELLA 2VSFA 3COWA 1OI3A 1J0CA 3BWBA 1OE0A 3CISA 2FZCA 4MYTA 5ESDA 2GVNA 1G20A 4IJMA 3I30X 4EYSA 4DCUA 3PTAA 3IP3A 3HZRA 3MXOA 1Q7EA 2WTNA 3FCUB 4LW8A 1U5BB 2FQXA 4NOJA 3I73A 1ONBA 3BB1A 4AQ7A 4NZPA 3T54A 4WEQA 4PCAA 2A9OA 2DPGA 2N46A 2I8LA 1M2EA 3TL2A 4C4AA 1K08A 1QZUA 4IXWA 5AM0A 3SCZA 4RQTA 1WDMA 3T3IA 3QRWA 3QUAA 3T0FA 2IS2A 4MGZR 5LWQA 1VG0B 2XF2A 1F6DA 1H94A 2I4LA 2OP1A 3AV3A 3L79A 4LYGA 3STTA 1ZWKA 2H17A 1HYQA 3UAXA 2DEUA 3SHVA 3HR8A 2DQKA 4M8SA 4N7BA 2YTZA 4FXPA 5A4IS 1C7QA 3PUIA 4ND4A 1A5SB 2BKUA 1Z75A 2VP5A 3RRZA 1YVEI 1S9HA 1ZRSA 2DHRA 2BFBA 3OFND 5H9WA 1TYDE 4D9JA 1NY6A 2FNAA 2Q5HA 3DV0B 3Q3IA 3JVUA 4MR7A 4N6OA 3WLKX 3QLUC 4WN9A 1THMA 1Q91A 3NHSA 4AMYA 4GI5A 1G21E 1KAGA 5L40A 1ENYA 2GBPA 1MW8X 1V1MB 2EATA 4PZ0A 1VGQA 3U3RA 4K6FA 3K2IA 2MINA 3CR8A 4G85A 4AMUA 1XZDA 2CUTA 3RU9A 3MRSA 1ISPA 1A9OA 1Y3CE 4BLQA 4I5IA 2FG6C 5AK5A 1N5JA 1TJYA 4C5AA 3NWBA 1GGHA 5BORA 5LNK6 3QX9A 3IV6A 1P0PA 5EHNA 4BJ6A 4M1ZA 4P31A 2P77A 1QF6A 1P29A 3MGKA 3RM3A 5DLQC 2R1VA 4HY3A 2QR5A 3WADA 1FFCA 3H6KA 5E7QA 4AJNA 2WLSA 4JL5A 4O63O 3T34A 4BGVA 1RWKA 4BECA 4BLTA 1WO8A 3BQ9A 4H60A 3W1WA 1NBMD 2FMKA 2PO7A 2P1RA 4IUDS 3SZMA 5F3DA 4EPVA 5CEFA 1Q22A 2AVNA 4J7UA 4MVJF 1MXFA 1Q0TA 3SYRA 3LPNA 4U00A 2GRAA 4NS1A 4GVLA 2D7CA 5CXQA 3L84A 2PZJA 1UFKA 3KTDA 3DCJA 1MZPA 1ZW6A 4BAUA 1IFXA 1GAEO 5L4NA 1H85A 4XJVA 4RD4A 5A04A 4MP6A 1YZKA 4YRTA 5BSKA 5LWHA 3W5BA 5HBGA 2X5JO 4NV0A 4CIWA 1CQJA 2OAQ1 4IOLA 4UEOA 4NDNE 1R0XA 4M4SA 3FTFA 5BV7A 4IZOA 1ENZA 3LCJA 3JYOA 2YICA 3U7HB 2A5GA 4TMVA 2P65A 1MORA 2WUDA 1JPNA 4CG1A 5K03A 5BSTA 1T9CA 4EUEA 2P40A 3A25A 1RQPA 2IOFK 2IOYA 3P9KA 4PXSA 3IOBA 4X97A 3WMXA 3G1WA 5KYXA 4CEHA 2RAFA 4JDUA 1K8ZB 2V55B 1ID8A 1IM5A 3K9GA 4Q5IA 3SI7A 2I54A 2J9XB 4CIDA 2ODBA 3GH1A 2PGNA 3HNOA 5FWXA 4CIBA 4WX2B 1M0EA 2P3OA 3A7DA 4QBKA 3RI3A 1XTTA 4PAOA 1MJGM 1ZCJA 2ODPA 3P2MA 1T6YA 3LDAA 2HV9A 2ZRCA 1EHYA 2YXPX 2D4HA 2FMUA 3OZXA 4G6ZA 4OYHA 1AC5A 5L7WA 3C45A 1JIXA 4I5GA 3L6DA 3MERA 3N2ZB 2IHNA 1D5WA 1UDCA 3SU8A 3W6OA 5AXBA 3N39C 4QDJA 5FWDA 4S1VA 1MQAA 1R5NA 3D6MA 3G9TA 3NORA 3C5HA 3P0RA 2QX9A 4GF5A 4PWZA 2XQJA 3ENKA 4BQIA 3ZK9A 3BAZA 4PPQA 3L1JA 1U81A 4KH0A 4JEHA 3LE8A 3WYEA 1JSXA 2YXBA 4KB5A 3PPIA 2IUUA 4CMIB 3FGOA 2WNSA 3DMYA 1I8TA 4A92A 2FPIA 2GOYA 2IC5A 1IXSB 2PYIA 1NV8A 3A3KA 4OSEA 4U7GA 4B0OA 2YWFA 2BT4A 3IEKA 3UWDA 5I7OA 2A7QA 5D85A 5DMXA 3V4VB 1C8LA 1FIUA 3I0ZA 4C4ZA 2P4HX 3HP1A 4GRAA 4IVNA 5IKMA 3JYNA 4P98A 1XT6A 4PO1A 5I7AA 3ZG6A 4F04A 5HJ5A 1YKSA 2DFDA 1PHRA 4JSYA 1XNGA 2P6OA 3IXQA 4N5MA 4F5ZA 1PWYE 4F97A 1N7JA 1EFPA 4HWGA 1XPRA 4N3GA 2ORVA 2BZGA 1T5DX 2EF0A 3HUEA 4NOLA 2GF9A 2J87A 4E5VA 1J33A 3OZBA 3AL0C 4JWKA 5GVSA 2DFVA 1HXHA 3KZMA 1PKEA 2VOJA 3CE9A 3AF5A 4FQ8A 2Y0DA 5F52A 3QFRA 1DJPA 3WB1A 4GDMA 3BKWA 2WF8A 3IJEB 2WINI 4Y6GB 3DG9A 3D2BA 4RA6A 3U17A 3K16A 5F5XA 3GRUA 1RWNA 1R6BX 2JBAA 2Z2IA 2HIHA 3EY9A 3QVOA 4TV9B 3AVYA 4KGVA 2WYWA 3IPCA 3ZBUA 2HTFA 3U4QA 2VXCA 2IGTA 2W6JD 1QVRA 4EF4A 4WK6A 3JSAA 3ZWBA 3JQFA 1A9PA 1OC4A 3CTPA 4JLAA 5SV2A 2QTNA 1JEQB 2ZTLA 1YQUA 3DR3A 1VRWA 4DA7A 1M75A 2ATXA 1NXOA 3IP8A 5I7UA 3T7AA 4KQ9A 1HQDA 3QK7A 3MB5A 5MDHA 3LUHA 1KI8A 4JLMA 1UDWA 3PB3A 1TA9A 1NMEA 2R6ZA 4C4TA 4EL5A 3QOWA 1XKQA 2J33A 4GXNA 4V03A 1ZH8A 1K4MA 1SVWA 1N92A 1SXJB 3GLTA 4BWGA 3A1NA 1R3UA 1KSHA 1Z08A 1X92A 1E1QD 2XRMA 3Q1KA 1R0CA 3WI7A 2QK4A 3ZCQA 1XSEA 2PSDA 2NVUB 4EG5A 5LPNA 3QVSA 1GKYA 2F43B 3DONA 2PKWA 4H4EA 2FFQA 2I2XB 1U2PA 4WK0B 1W93A 4G89A 1WSDA 4X7BA 1ZL0A 4WXEA 1R6UA 4OJTA 3K0CA 4J0EA 3I53A 1K7CA 2UXBB 4YQYA 1TU4A 1YL6A 2G9ZA 3GDGA 1Y6QA 2SKEA 1L5VA 3GZNB 4S1TA 1V3TA 4R1UA 4Q0MA 1XLVA 1FJ2A 3JAWB 1B7GO 1TAQA 2EFDB 1P2TA 3EOBI 4OUDB 2PPVA 5IS2A 3O74A 2QR2A 4NNJA 2JLBA 3JWPA 2X1LA 4HUJA 3REGA 4D6YA 2TSYB 4S12A 3SSOA 4C0LA 4Q7JB 1QMGA 1SUPA 1M0WA 1VBKA 3I42A 1E7QA 2O20A 2BZ0A 3I4CA 3R77A 4PAGA 1G5HA 1UOOA 4TMWA 4WGGA 1CEXA 3TH5A 4MQMA 1LNZA 2HA3A 3X1DA 1EUQA 3GLVA 4P4LA 4YUVA 1PNTA 2ZSIA 4U7JA 3I83A 3PQ7A 2NG1A 1G2OA 1W4CA 3IURA 3E0QA 4R8RA 4Z2AA 1JU9A 5LDDC 2BHSA 1ZHFA 4JJAA 4OAOA 1A9SA 2XZDA 3CCFA 4ZT7A 3G2QA 2ZI7A 3EARA 3ET4A 2OHFA 4Z4CA 3GVXA 1BQEA 1YDGA 1J9EA 1MMFB 3KJXA 3L49A 4DLXA 1G38A 1MC4A 4TMZA 3K9QO 4II2A 2BMWA 3UV7A 2R3SA 2GERA 1IU9A 4CQMA 1DCTA 1FC0A 3E3LA 2WVJA 1QS0A 2EFCB 2V7VA 3KX2A 3VJRA 4AP9A 3ESZA 5MF6A 4ZO9A 1MO4A 5AD1A 1U3UA 1H8EA 1O6GA 4K9PA 1LK5A 3ASVA 5ALDA 2OM6A 1DOZA 2X40A 3N8IA 1BE6A 4FWBA 2QQ0A 4OM7A 4TKVA 3U4MA 1BKSB 4X71A 2Q0HA 1U9IA 3CVXA 1P0CA 1QTQA 2QW8A 3G59A 1UODA 1ZIOA 1TAGA 4RWEA 3E8XA 5TQ2A 1V1RA 4MS3B 4WZBE 4XYGA 3R5HA 4UFPA 4Y0NA 3AR6A 4C05A 2OGTA 1XAJA 2PN1A 1OOEA 1GL3A 1RZUA 5CT8A 5DXAA 1TEHA 2QRVB 1ESEA 1ISFA 1TZBA 2GBIA 2HI0A 2QNBA 1H5UA 3F5SA 3ZI4A 2O2YA 2B7LA 4XEUA 1K3TA 3GLGB 4RMNA 1X9HA 2NUTB 2DUNA 2ZIFA 5AESA 1UZNA 2BZSA 1YQTA 4EAQA 3VR3D 3PD7A 2GXUA 4W9NA 5EHGA 1AQNA 4CXMA 2KB0A 2A35A 1ZSYA 2RCNA 5BN5A 5FUVA 4ALKA 2UYYA 5I47A 2PMKA 4XWOA 2AG6A 2J4DA 4RGQA 2V7BA 1OLSA 3BRWD 4EQ6A 4U6QA 5CLLA 4R1LA 2WPDA 2ZJ2A 3QPVA 3U49A 3D6NB 2IEBA 4PSCA 5DGHA 3W5JA 4F91B 2Z4RA 1AGXA 4D3ZA 7ABPA 4HS4A 3ZTYA 3NKVA 4I50B 3VI3B 1A1VA 3IL2A 2FGKA 3CSUA 1X2EA 2MOKA 3I76A 1V11A 2IITA 3PE6A 1YDMA 3GFRA 1GXSA 1JQLB 3HCEA 3OIGA 3GEPA 1IXZA 3BERA 2PH3A 4YJHB 1HDZA 4FD3A 1AKRA 4FR0A 4LNAA 3QQPA 4TRRA 3F3SA 1E7SA 3EGVA 3W5CA 4DLVA 1MJGA 1TECE 4DDKA 1QOPB 5FTNA 3JU3A 3COZA 5H4GA 4M1TA 1AGPA 3LSYA 4X54A 4YRFA 5JALA 3I61A 4U2FA 4AX4A 5B7QA 3KJNA 1CUJA 5CIWA 2ZRGA 3JQFC 2QP3A 2JD0A 1ZKDA 2CUNA 2ZAGA 3PUZA 1UMDB 4MINA 4FFNA 3MQFA 3W04A 4A82A 5AW8A 1HOTA 1XBTA 1Z6GA 3BCHA 3P9YA 3WLIA 2JBWA 3CLUD 4LY0A 1O3YA 3NBQA 3FPBA 4HNGA 3J81A 3D0RA 4UZEA 1UFQA 4UBJA 4EGQA 1KEEB 2O2EA 3CVUA 1E9RA 3ER8A 1I7LA 4MUEA 4O4JB 1N2CB 3HJNA 1S02A 1EBBA 3EQZA 4G1BA 1I0ZA 4RESA 5CGZA 1MU0A 2D13A 5AJUA 2FEMA 4F60A 2WHPB 4CQNA 1E6MA 5ECGC 1AS3A 3SOZA 4CRWB 2C7QA 1P1CA 1YQXA 3ICOA 4JGIA 2QIPA 1FTYA 1GHTA 1CUDA 2QRMA 3V33A 3HGMA 3KQHA 5EXPA 1BDMA 2O5CA 1M33A 2WSSA 2B34A 4UDNA 3B6KA 1ZO8A 4R81A 2UZ3A 1CT9A 3CG4A 1ORRA 2OZVA 3Q15C 2E85A 3UUGA 4C4SA 1OU4A 3LCMA 5PGMA 1H6DA 3S55A 3WSVA 1X6VA 2H5EA 1O08A 1KA9H 3ZGVA 2GJ9A 3I4LA 3IUMA 3UNXA 3C4QA 1P4RA 1TTHA 3OKAA 4N9QA 3RVJA 3WNBA 2DB3A 4RVUA 3DLTA 4QA9A 3EVGA 1IEVA 3IHLA 3QXSA 4HRXA 3RJTA 3RV4A 4A1OA 3CV3A 2AMFA 4HAZA 3OQMA 3KR9A 4UZSA 3MJSA 3EULA 4V1CI 5J5AA 1RLJA 4LUCA 4GEKA 1JQAA 3VKGA 2O05A 3TQSA 1CIJA 2ES4A 3U62A 4C01A 3K70D 4NJEA 2I4NA 2FW7A 1VG1A 1E8NA 2WR8A 2B4AA 5CFOA 1NLFA 1MENA 1C2TA 4DRXB 1ISJA 2GCGA 4DNFA 2UVPA 2E4YA 4MPTA 4XPIA 1E6UA 1JIJA 2AQKA 5JCJD 2OAEA 5DX8A 2OK7A 4Q3AA 1MFPA 3HB1A 4LQ4A 3ND8A 3MS7A 2JJQA 1IXKA 3F5DA 1O95C 5LFAA 4G0VA 3CIFA 2AC2A 3IERA 3DC7A 3CH6A 3HM9A 5BQ5A 3E53A 1GV1A 2W70A 2CB9A 2ZJ4A 3AEYA 3EVZA 1T91A 3S1AB 5F35A 4RZUA 3STYA 2QL7A 3K9HA 4WLOA 1Y4SA 3C43A 4DFDA 1JFTA 1I36A 3ABSB 1DO0A 1BRTA 3F3YA 4RXMA 3ZX5A 2HEGA 3RUIA 1ZUD1 4V1CB 2BEUA 1FJGB 3BXEA 1DAIA 3QBTA 3HB0A 2OILA 1SVNA 3FNEA 2O0JA 1BX0A 1TKRA 1V3UA 1ZOPA 2BSAA 1XQ1A 5GADl 1J7KA 4J3FA 2QVCA 5CNKA 3VOBA 5DX1A 3JX9A 1U3DA 2VCHA 4HUTA 4R16A 4E12A 2B4QA 5AW5A 5ED4A 1OBCA 3QTBA 2W48A 1U8FO 3DDOA 4R8KA 2R1UA 1FW8A 4J07A 1ENOA 2IKSA 4K6CA 3SYNA 4O2AB 2BONA 1WMBA 3FDIA 1R88A 3QEMA 4L28A 4KXXA 3WGNA 5L8VA 4AY6A 5AKGA 4U7DA 1PL0A 1NU8A 2JZCA 4HVAA 2NUPA 4WUTA 2VYND 4IG4A 4EW6A 4YRIA 2EOAA 1RAGA 2QA5A 3K73O 5KBYA 2IHBA 1PZNA 4R8MA 1I7QB 1WY7A 4QYMA 2A2ZA 4RVDA 4S04A 4KPGA 1V1RB 1RW4A 4PLTA 2XZTA 5HBRA 2CVQA 2AQHA 1GPWB 5ALOA 1O54A 4B8YA 4ZYZA 2B4TO 4GC5A 3BD7A 3LKVA 3PICA 2M6KA 4UULA 4XYLA 5AM2A 3OESA 5B12A 3KAJA 1ZUIA 1LC3A 5KYWB 3HRKA 4A3SA 3WWZA 2IU4A 3THSA 5J3JA 1Q3KA 3X1KA 1KZGB 1SUEA 4B6EA 1AXRA 1I2CA 3FM9A 3GUHA 1MIOA 2P9CA 3ZY3A 3F6BX 3KAQA 2QDKA 3L93A 2ISCA 4EB3A 2GN6A 2HKIA 2ZJ6A 3OCUA 5EFZA 1WVIA 2M9MA 2IA5A 2IW1A 2ETVA 1UKEA 2JAXA 1RQXA 3E7XA 4HWPA 3HA2A 5B37A 3OTOB 2YXNA 3CX8A 4IDHA 4P4TA 3PZBA 4F2HA 3CLUC 4Z7JA 1U7OA 3GAMA 1Q20A 4H6PA 2P3LA 3Q8KA 2FWAA 2XT9A 3Q8MA 1ORDA 2GI4A 2GVZC 3Q8XB 3QBEA 4E07A 4IZ6A 4M3NA 4F11A 5F1YA 1G7CA 2O7NA 5GVRA 4FYKA 4NLLA 3AHGA 4S1PA 5LDGA 3DFIA 2DTEA 3GRFA 2YMQA 4KREA 5H16A 2FN9A 5I4KA 3BTSA 1TRHA 4AZSA 3DFUA 5D51S 4X8LA 1DADA 3UMFA 2IYUA 4D99A 2N75A 1LWOA 5F51A 2H00A 4I3FA 2PL1A 1I3MA 1IULA 2PS9A 3EIXA 3M1YA 4FX2A 4G0NA 3PVZA 4DILA 5EJ4A 2GARA 1TD9A 5C1DA 1T2NA 1WAMA 3ANLA 1D4ZA 3IULA 2QTVB 1D2RA 3SQMA 1TMOA 5TDHA 3LYAA 2JIQA 1CVRA 2PT7A 3CA8A 2OHIA 2B8NA 3KYBA 1PFWA 5HRCA 1TIBA 4CV1A 1GPH1 4P4SA 3F67A 3D8BA 4ZAZA 1FP4A 2IY7A 5ILGA 4CNQA 1J5EB 3G2LA 3PFCA 3NTVA 3LCCA 3FFWA 2LE0A 1P7YA 5AVRA 1KQGA 2BEUB 2I4IA 5SZHB 3VZSA 2VDMB 5TS2A 2ZYWX 3VPDA 3BF7A 2FRXA 4FBGA 2CLHB 4INOA 4OFWA 4E21A 4LG1A 2QX4A 3CINA 1KY2A 3Q4GA 3VR6H 3RUFA 3OX3A 2XQFA 4I9UA 4Q3KA 3O0TA 4IOKA 1T5BA 4L8GA 2C31A 4UC0A 5J2UB 5IZCC 3JD3A 4I3GA 3C3JA 2I7DA 3SGLA 1R0KA 2F3SA 1NKVA 1M72A 3NNSA 1IL0A 3H2HA 4HAXA 1CQPA 1QCZA 1F6BA 5A6SB 3N2EA 4BWFB 1T3ZA 2C2GA 3TG2A 4F46A 1GAWA 5COBA 3EA4A 2JJ1D 4H6VA 4WXPA 4ZAVA 2P90A 1W9HA 3FPGA 1BHQ1 1QHIA 2JGNA 2DQZA 3VA7A 3QPBA 1OUMA 1HH4A 1XHFA 2D0PB 3H5IA 4LHYA 4YGYA 3GFPA 1WXHA 2Z5FA 1VECA 3O9MA 5EWJA 5FL7A 2ZJ0A 2O3TA 4QUKA 2JL1A 2Z6VA 3LWBA 4IHJA 1OXTA 3DM5A 5A9SA 3QEAZ 5G02A 1SK8A 4GNKA 3DMPA 3ZWYA 5BQFA 4EDHA 1CJTC 2J08A 4QJBA 1TQ2A 2FEOA 4EVSA 5AIAA 2VT2A 1L7RA 1UQUA 1O7JA 3GUUA 4B4KA 1LK7A 1UPFA 1XDZA 2X0RA 3FVVA 4O2BF 4B45A 2BP7B 3PYXA 2CLCX 3O82A 4NU6A 2CY0A 2DOKA 2WIDA 1I32A 3ONEA 5KNDH 2PL3A 3MXTA 1B6GA 2JI6A 4MGIR 1E3LA 4MRMA 5JYCA 1RWMA 4IJKA 2BHTA 4AZ3A 5IFKA 2DHQA 3DAYA 1JEYA 2WK1A 1OB2A 4QSHA 1CQIA 4K03A 4XR9A 4YRRA 2OCDA 3P8ZA 5FR1A 1ZYUA 2WUFA 4O1HA 1P1RA 4IWXA 3WNVA 2F8MA 1BDIA 1SXQA 4AB1A 5JZOA 1YA6A 3WWDA 2YUTA 4EB8A 1Q17A 1K5GA 2VDLB 3N74A 2IH2A 4BO9A 3CX6A 3IXLA 3VXKA 4XCVA 4KDCA 4PLHA 1Y9EA 4CDGA 4FCTA 1YAHA 5EWMB 4ENQA 2OTCA 4B6GA 5D8DA 4IQGA 1QVZA 3L5KA 3DCIA 13PKA 3L6RA 3PNKA 4O2LA 4U9HS 4CUKA 1I4TD 1KYIA 5ED0A 4X3CA 1NVGA 4PR0A 3W1VA 4HEQA 2GS9A 4BO1A 3WO0A 3OZGA 1T4MA 5JJ5A 1M7HA 1LBHA 4UVHA 3RIMA 1QIFA 4YQFA 1D2EA 2IYNA 3OPMA 3W9YA 5F5NA 1W94A 3B89A 3QHAA 4GI3A 4NZYA 3D3EA 1QDUA 5DH9A 3CEPB 1O8BA 1IVYA 3Q10A 5AKXA 1UMBA 4JXXA 1AGYA 2XW6A 1Y1SA 2AXPA 3DF7A 2ZT6A 3FUVA 4HSEA 3BMCA 4IY1A 4LHVA 2J9YB 4FHFA 1ONSA 1BDHA 5KTNA 4X3PA 1UK8A 4FYMA 5ESWA 2B0JA 2QU7A 2V3CC 5FTJA 2BJHA 3IPAA 1SBTA 3CZQA 2ADFA 4J1TA 2BUCA 2ZPUA 3KQVA 4KRXA 2C0PA 5DNVA 2O8EB 1C5KA 1TMYA 5CB4B 5IK2A 4LNHA 2AFRA 5B1IA 3TBFA 3F73A 1I2MA 1A8SA 1P9LA 4GR9A 5B53A 2GPAA 2W0SA 3ZJYA 1SU6A 2JIDA 4YRJA 1Z4QA 2BM1A 2X8AA 1IQPA 1CF9A 3C3CA 4MKXA 3SIWA 3WMWA 5JUWA 2JIZD 3N53A 4ER5A 1DZIA 4YV2A 4NBWA 3INNA 2R6FA 3EIHA 3SQLA 3PDCA 1SRRA 3GJXC 2GT1A 4KMOA 1T9GS 4ZRMA 3FPCA 2Y1LA 2YBEA 3ABIA 1BX3A 3L4JA 4QUAA 1HDOA 1EVQA 4HYYA 5TXGA 3IMCA 2VZ9A 2GDZA 3KWLA 3MCTA 4IFTA 3RAPR 3WNCA 3F98A 2AG5A 2Y77A 3I01A 4DLPA 1XZNA 4F2DA 3KCNA 4N39A 3THOA 1X7ZA 3WAKA 2R2GA 1M67A 1CETA 1D4AA 3LWNA 4MWZA 5CNJA 3V32A 4CEJA 5FBWB 1ZZEA 1M8KA 2Y2VA 4GYKA 3SSNA 2QLTA 3A4TA 4O4LF 2XXJA 2J3LA 4DSZA 1NVFA 5LC1A 4LF4B 3PC6A 4JP8A 2YASA 2ACVA 4FUTA 2V6FA 3NDIA 5CFQA 3QHQA 1PV4A 1YQ9A 4LNUA 4WN3A 4AC9A 1PE0A 4RETA 4ZAWA 2ZR8A 1Y9JA 4G3XA 3OQNA 4LHZA 2FRDC 4KAAA 4RKWA 4BJ5A 4K8OA 1TKCA 3I45A 4Y7CA 4URXR 4X45A 3JY6A 4ZODA 4DR6B 4GRDA 5JYBA 4FYIA 2F1RA 3DMHA