5BP7A

Crystal structure of sam-dependent methyltransferase from geobacter sulfurreducens in complex with s-adenosyl-l-homocysteine
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
249
Chain Sequence
MLDIPRIFTITESAHRIHNPITPEKLTTLGAALRLEPGTRVLDLGSGSGEMLCTWARDHGIIGTGIDMSQLFTAQAKLRAEELGVADRVTFIHGDASGYVSDDKAGVAACVGATWIGGGVAGTIELLARSLRPGGIILIGEPYWRQVPPTEDVARGCLANSTSDFLMLPELLASFGRLGYDVVEMVLADQDGWDRYEAAKWLTMRRWLEANPDDELAKEVRAQLTSEPGRYASYTREYLGWGVFALMPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SAM-dependent methyltransferase from Geobacter sulfurreducens in complex with S-Adenosyl-L-homocysteine
rcsb
source organism Geobacter sulfurreducens
molecule tags Transferase
molecule keywords SAM-dependent methyltransferase
total genus 81
structure length 249
sequence length 249
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5bp7A00
3ER8A 1VBFA 4WXHA 2O05A 5HZMA 5BXYA 1O9GA 5DXJA 1VIDA 3PS9A 4IV8A 4X1OA 1P1BA 3BT7A 3CJTA 1QAOA 3C6MA 4OQDA 5LR6A 3A7DA 5DRTA 4R6XA 3NVKI 2FK8A 5CIYA 1F3LA 2P41A 2NNWB 1T43A 3EPPA 4LECA 2VZ9A 1Q0SA 4GOND 4RTNA 4GOOD 2BR4A 3KQSA 5ICFA 2EG5A 2VDVE 1G60A 5FWDA 2CWWA 2P3QA 2QM3A 2AR0A 1WG8A 2G8NA 5D1HA 3UJ8A 3R0QA 5K8VA 2AOVA 3SSNA 1R8XA 1PJZA 1KR5A 2R3SA 3GWZA 1R74A 3KQMA 4RX1A 5DT2A 2XVAA 3KQQA 3PB3A 4YUZA 1R6AA 2XYRA 2DPMA 2BM8A 2ONZA 5HIMA 3LDGA 2PVCA 5E1OA 4C4AA 3P8ZA 4X41A 2YXDA 3PX3A 4KW7A 2P40A 5F2OA 1BKYA 3CVOA 3GXOA 2Q41A 1WY7A 4LWOA 2PXCA 3E7PA 3KQYA 4RYLA 3L8DA 3LDUA 1MHTA 1L3CA 5GWXA 1KPIA 1QYRA 2O57A 3FTEA 3GIWA 4PNEA 3THRA 5F2NA 5LSAA 4HTFB 4EKGA 4AUKA 1HNNA 3P2IA 1NBHA 3C0KA 5GOZA 2AOXA 2N47A 2UYHA 3R9XB 3UJBA 3K0BA 2PBFA 3ID6C 4HGYA 5FTWA 4E2XA 5KQSA 4RTJA 4RVDA 4PYQA 4DA4A 2E5WA 1JG4A 3FPHA 3BKWA 3HVJA 2HV9A 3NDJA 5MHTA 3ELWA 4H0NA 5E1DA 3I5UA 3UZUA 5GIOE 3FUWA 3NWBA 4P7FA 1IM8A 4G56A 2F8LA 4EQZA 3GRYA 2P1DA 3UA3A 3KPWA 3NDIA 2YUIA 2BR3A 1L9KA 4GUAA 1G8AA 4PINA 3FPGA 5C1IA 2IBTA 3SSMA 3KHKA 3O31A 3EMDA 3FPFA 1P1CA 3DTNA 1NE2A 5DM0A 4QVGA 3BKXA 4HRAA 2HMYB 4DM3A 3A4TA 2H1RA 3CKKA 4DZRA 3P9CA 4CTKA 2C7RA 1XVAA 1O54A 1KYZA 4POOA 3DULA 5EVJA 1JTFA 4DCGA 3KQOA 5EKXA 4C08A 1XJ5A 3PTAA 3BGIA 5GINE 2GS9A 1XDZA 5EIFA 1EJ6A 3DP7A 3DXYA 3LDFA 3OZSA 2ZZMA 2ZTHA 3G2MA 2B25A 1G38A 4P7JA 1IXKA 1FPQA 3WSTA 1SKMA 2OPBA 4BLUA 1JQ3A 4GC9A 4CKCA 2Z6QA 2OYRA 3MTEA 3KPUA 3PVCA 1SG9A 1WZNA 2I62A 3FZGA 3NTVA 5ERGB 2BR5A 2OO3A 2ESRA 1I1NA 2NP7A 3AXSA 3G8BA 2IP2A 4M7RA 3A7EA 4FS8A 4M38A 3BWCA 4AZTA 1R00A 1VP9A 4DKJA 3MGGA 1NW8A 3LPMA 5C0OE 2LD4A 4RVGA 8MHTA 4U7PB 3CGGA 5GIPE 2PX4A 1G55A 2YXEA 5DLYA 1N7IA 5JR3A 10MHA 3G88A 4RV9A 3DR5A 4PIMA 4RVHA 3I64A 4GOMD 3TMAA 1NW6A 1D2HA 3LKZA 5K01A 1RI1A 2EJTA 3BZBA 2UYCA 2PSSA 2P3OA 3TPZA 4AX8A 4CTJA 3MTIA 2GH1A 4GOLD 4ER6A 2NP6A 1EIZA 5F2KA 4YMHA 4Y2HA 3HTXA 2AZTA 2G71A 4ER3A 2AOUB 2FYTA 3UJAA 9MHTA 2GA9A 2FCAA 2PX5A 5CVVA 1DUSA 4E2YA 3VYWA 4BLVA 4IWNA 1L3BA 4NECA 3LCVB 3OU6A 1INLA 2QRVA 2OB2A 1ZGJA 4V0RA 3C3PA 4XUEA 4BLWA 2O0LA 4FGZA 3ME5A 4MWZA 5DM2A 4ZTBA 2V74B 3S68A 4RTMA 3EMBA 2I6GA 3FRIA 2G70A 1YB2A 1MJFA 3LCCA 2AVDA 2B78A 2ONYA 3IEIA 1NW7A 4B17A 2I9KA 1L1EA 5GP1A 2Y1WA 1RI3A 3CC8A 3FTCA 4Y30A 1IY9A 2O06A 5HILA 1H1DA 4IKPA 2PWPA 3HNRA 2P8JA 3JWIA 5EZSA 3KQWA 1KP9A 3VC1A 1I4WA 3GU3A 4R8SA 1KYWA 2YXLA 2ZBQA 3B89A 4GC5A 3AXTA 4C05A 3CBGA 4YUXA 3OU7A 1EG2A 1ZQ9A 2BH2A 5D1NA 4QPPA 5CVDA 2V7EA 5EOVA 5EMLA 3UFBA 2PLWA 3HVIA 3MERA 3HCFA 4HH4A 2B9EA 4DF3A 2PGXA 3HCEA 3ORHA 2P35A 3G8AA 5EHIA 4QQKA 2OY0A 4E2WA 3G5TA 5DM1A 2IPXA 2GB4A 1YFJA 4OQEA 3LBYA 1RJDA 4M37A 5DSTA 5KVAA 4HGZA 2HNKA 5FHQA 1PRYA 5FCDA 1M6EX 3EVGA 3OCJA 1RJGA 3P9IA 4M36A 2Y1XA 5DM4A 5IH3A 2EX4A 3IV6A 3M6XA 5K09A 1YFLA 2C7OA 4RVFA 3G5LA 2ZBPA 1BC5A 2QRVB 3KR1A 5K0GA 1YUBA 5LQJA 2JHAA 1RJFA 3D2LA 4OA8A 3HCDA 3EVZA 3B5IA 3PFGA 4YMGA 1NBIA 2AOUA 1QANA 5KS2A 1P39A 3TM4A 1M6YA 1OR8A 1AQIA 2DULA 4F86A 5GM1A 3P2KA 2ZZKA 4YUYA 3DOUA 3UA4A 1YF3A 1VE3A 2VS1A 3FUTA 5E1BA 5EMKA 1M0EA 1WXWA 3ELUA 1XCLA 2ZWAA 3BGDA 3ER9A 1U2ZA 4BP1A 3GRRA 5ICEA 1XXLA 3PT9A 4FSDA 2OB1A 1XDUA 3TFWA 3HA3A 4CKBA 1VL5A 2ZZNA 1UIRA 3H2BA 4ER0A 1DCTA 2GPYA 2NXCA 3TRKA 3IHTA 4KIGA 4F85A 5DTQA 2OZVA 5K0BA 5G02A 1NKVA 2HWKA 1AF7A 2ZSUA 5M5BA 5CUQA 2H00A 2K4MA 2O07A 1NT2A 3GNLA 2PKWA 3E23A 4E31A 4CXMA 1FP1D 3ELDA 3MHTA 3EVCA 3M6UA 5EHGA 4QTTB 2JG3A 1AV6A 4P7GA 4RTSA 3KQVA 1I9GA 5FQNA 1X1DA 2P3LA 4KWCA 3KR2A 4QDKA 2PWYA 2PT9A 3R24A 2C7PA 2PJDA 4GEKA 5C9ZA 4AZVA 1KIAA 2IGTA 5EMJA 5EPEA 4FT4A 4QDJA 1TW2A 2G72A 2XYQA 3KPJA 4PGGA 4YUVA 4LG1A 3ELYA 2EJUA 3C6KA 3OFJA 5P8WA 1Z3CA 3FPEA 2C7QA 2NYUA 2ZLBA 2NXEA 1N2XA 3AWIA 4OBXA 3OU2A 4YUWA 2FK7A 3B7PA 5LQCA 3ERCA 1QZZA 3IYLW 3QOXA 1FP2A 2JJQA 2ZVJA 3FRHA 3JWGA 1Q0TA 4BY9E 2ZBRA 1JG3A 3DMHA 3DH0A 3LHDA 5DX8A 3NWEA 4HSGA 3EVEA 1UWVA 3PFHA 3HM2A 3HCBA 3NVMB 4DQ0A 3PX2A 4QQNA 2B3TA 3THSA 4JXJA 4GF5A 5HEKA 2AN4A 2IH2A 5H02A 3OFKA 5CD1A 2QYOA 4FSXA 1KXZA 2YX1A 3O7WA 1JTEA 3HCAA 4MQ4A 5FA5A 5CCXA 1G8SA 4AZSA 5EQJB 5GM2A 3EEYA 3P9KA 3DXXA 3LECA 1EAMA 1NV8A 1ORHA 3HCCA 4PYNA 5DXAA 5LQKA 2IDKA 2IBSA 3FTDA 1NW3A 4HTFA 1BHJA 2NXNA 3R3HA 4PWYA 5FADA 3VSEA 4YV2A 3LBFA 5K0EA 2UYQA 2B2CA 4PYIA 2YR0A 4XUDA 5DPMA 3V97A 3KQTA 5E1MA 1ZG3A 4DCMA 1G6Q1 1JSZA 2BM9A 3SXJA 4EKIA 3A26A 1R8YA 3RIEA 1YZHA 3BWMA 4OBWA 4E70A 5HOQA 5E8RA 4KIFA 2ZIEA 3K6RA 2R6ZA 4ATNA 2FPOA 2H11A 4PONA 4LWPA 3X0DA 2XYVA 5EIWA 3UJ9A 1EQAA 4QPNA 4CKEA 1FJXA 2JHCA 4R05A 2ZWVA 3RW9A 1D2CA 2ZIGA 3G2QA 3G2OA 3JWJA 3NJRA 2FRXA 2JH8A 4RTQA 3M33A 3EEOA 3U81A 5FUBA 7MHTA 4RSRA 4C04A 3B3FA 4RTKA 4O29A 1SUIA 2ZFUA 5K0NA 3EVDA 4Z2YA 3T0IA 2UYOA 3M70A 4PIPA 1TW3A 5EG5A 1SQFA 3A27A 4QVKA 3UJ6A 5E9WA 3NW9A 3Q7EA 5CVJA 1NV9A 3EGIA 5EGSA 4RWZA 1L3IA 3E05A 4RTPA 3SMQA 4X61A 1ZKDA 3BGVA 5FQOA 3KPYA 5HIIA 3MCTA 1HMYA 5T6BA 4E32A 2JHPA 1JR4A 2BZGA 3KPVA 5DTRA 5EC8A 2ZULA 5CVUA 5FULA 1WXXA 2AS0A 1F38A 3GRVA 3JWHA 3DLIA 1RI4A 3OE5A 3G2PA 2AOWA 3QV2A 5K05A 2AOTB 2YQZA 2XBMA 4PGHA 2ZW9A 3M6VA 1ZGAA 5ICGA 2P7IA 3B3GA 4RTRA 1BOOA 2FHPA 1TPYA 3B3JA 3MCZA 3M6WA 3KKZA 2HTEA 2QY6A 5FHRA 4FZVA 4MIKA 5K0FA 2IH4A 1VQ1A 2WK1A 3P71T 1JSXA 4R6WA 1VPTA 3HEMA 5DTMA 3CJRA 5EEGA 4EMSA 5E9JA 5HFJA 3BUSA 1VLMA 4PYLA 5FA8A 3UJCA 2XVMA 5FWAA 1XDSA 5T64A 1NW5A 4RTLA 1JQDA 5EZQA 1N7JA 2PXXA 3HVKA 2CMHA 3DLCA 3O4FA 3T7RA 3UWPA 3QOWA 2A14A 2YTZA 2AN5A 5DX1A 3I9FA 1XTPA 3LX6A 4X63A 3BWBA 3GJYA 1KPHA 4XCXA 5EEHA 5K0CA 3OZTA 3EGEA 3ANXA 2I7CA 3C3YA 5DSXA 3CJQA 2CKDA 1Y8CA 2AVNA 3REOA 3V8VA 3F4KA 2QE6A 2ZIFA 2WA1A 1SUSA 3FUUA 1YZ3A 3LCUA 2JH9A 3AY0A 3DMFA 1QAQA 5LQRA 3FUXA 4V0QA 4OX9Y 3SX0A 1EJ0A 1SQGA 5E8JA 4UOEA 5EMMA 1B42A 1KHHA 3KQPA 2CMGA 3OZRA 1X19A 3OPNA 4KRGA 4CWAA 3DUWA 4MHTA 1WS6A 2KW5A 3FYDA 3MQ2A 4PYKA 4E30A 1AQJA 1DL5A 4L7VA 3HVHA 4P7KA 5T67A 3BWYA 4PCLA 4WVLA 5DX0A 5EKUA 1RI5A 2ZCJA 2OBFA 3E8SA 4ISCA 1P91A 4HG2A 3EGVA 3EVAA 5B1SA 3T7SA 2ERCA 3UJDA 2IH5A 1JG1A 4C03A 4U7TB 1QAMA 3FYCA 3P9NA 3UJ7A 3KR9A 1JQEA 2HR1A 4FT2A 2PT6A 3LKDA 5CCBA 1R18A 5DWQA 3P97A 3PLAE 3TOSA 4AZWA 4PCAA 4EVIA 2P7HA 4P58A 3VC2A 4E2ZA 5LQUA 4K6MA 4ER7A 1X1BA 3I53A 3HP7A 4XUCA 3GGDA 4FP9A 3TM5A 3SM3A 4E33A 2IIPA 1KPGA 3FUVA 5HIJA 4YV0A 5BW4A 5BP7A 3GRUA 3MAGA 3RODA 4QTUB 2OKCA 2VP3A 4A6DA 5HIKA 1FBNA 1X1CA 3GCZA 3TKYA 5E2BA 3GRZA 3UBTA 3R6TA 1XCJA 3LSTA 4X60A 4GBED 5CM2Z 2PV0A 3P2EA 4EK9A 1X1AA 3DMGA 3OE4A 3CCFA 4KDRA 5E2AA 3LL7A 3G89A 2Z6UA 1ORIA 4PYOA 2PX8A 3A25A 3EVFA 5ICCA 5CVEA 2UZ4A 2IDJA 2VDUE 3Q87B 5DRYA 4R8RA 4C06A 5JUWA 1D2GA 3SGLA 5LQNA 1ZHFA 4KVZA 2GLUA 1RI2A 3EVBA 2Z6AA 4YV1A 1V39A 4BP3A 4PYMA 2G1PA 1VP3A 3HA7A 3TQSA 2PY6A 5K03A 3T7TA 2PX2A 3FPJA 4MTLA 2NXJA 3GO4A 5BW5A 4OA5A 3HA5A 3G7UA 3NMUF 2ADMA 3SSOA 4IV0A 1UFKA 4F84A 1JG2A 4KDCA 3M4XA 5E9QA 2GAFA 2EFJA 2CL5A 3BXOA 4FR0A 3TKAA 5IKMA 3MB5A 4GQBA 3TLJA 5KYGA 3LGAA 5U4XA 4RTOA 4HC4A 2AN3A 2WA2A 5KQRA 3KR0A 3KU1A 2VDWA 2AOTA 3TR6A 1SVUA 5K0LA 2OXTA 1RJEA 2IFTA 4ER5A 2PXAA 4C07A 4DMGA 1O9HA 3I58A 4A6EA 3GDHA 2ORED 3SR4A 2YVLA 3DXZA 5LQAA 3SVZA 3FTFA 4PYJA 3AJDA 5K0JA
chains in the Genus database with same CATH superfamily
3PKIA 1CJKC 1P8JA 1VBFA 2PQ0A 1M2VB 3AEYA 1O9GA 4KQCA 5DXJA 3PS9A 4F71A 4PICA 1I5RA 2PANA 1WXGA 2BFBB 1DINA 3FCXA 1SXJB 3UMRA 1GGNA 2JGDA 2XDYA 3FYHA 4AS2A 5J23A 5CIYA 3O6VA 3H4IA 3EC2A 1LPAB 4ZU1X 3R44A 4I36A 3IOBA 3KQSA 3V8RA 4Z0TA 2VJPA 4II7A 4DWWA 2Q5IA 1F06A 3CW8X 2IUFA 3GVCA 3WRVA 1OYVA 1H2YA 4AJPA 1T91A 3TQFA 5LJIA 1K8ZB 4NV1A 3UHAA 5JSZB 3TRIA 1WCIB 4UJ3A 3PB3A 2G07A 3URKA 5IDVA 2ZJFA 3G0IA 4GMKA 4PQGA 5H83A 5IWCA 1L5HB 2RK4A 3GVIA 4MWDA 5F2OA 1T5IA 1U02A 1VFPA 2Z9BA 5THXA 3SQLA 3UC9A 3L8DA 2OBXA 1SVKA 2PVPA 1ODTC 2EQ5A 1JLRA 1VL0A 3LP8A 2X5KO 1BVUA 5LBUA 4AUKA 2QX8A 3H9EO 4U7DA 2NO0A 1QRUA 4CIVA 3NBFA 1JXMA 3VO8A 3IT1A 2XT0A 4TWZA 4RENA 3ID6C 4RKRA 4NBWA 4IVNA 3DPUA 1ZH6A 4RHUA 3K05A 4OY3A 2R4UA 4MVJP 4X7MA 5AXAA 5B53A 4JX9A 3OQHA 2EFGA 3NWBA 4LE0A 4C30A 3VKUA 5E6UB 1M54A 4G56A 1XEWX 4HWOA 5EP1A 1KMHA 2FUG1 3KJZA 3PD7A 3QFCA 3OCVA 4MAAA 5E4TA 3W0LB 1L9KA 5L7TA 3DLHA 2Q4BA 4ZVLA 1YE5A 3C1TA 3ZQKA 3KJGA 2XNDD 1EHYA 1ENYA 2HM7A 4OMUA 4B81A 4BKPA 4ZGGA 4XDHA 4DY6A 1JMYA 2VF8A 3LX5A 1N2EA 4G25A 2ZKIA 3GARA 4KBGA 2ICAA 2Q27A 1O95D 1WQ1R 1O54A 1XVAA 1YQUA 1VJ5A 2FSVC 2J09A 2JRLA 2VEDA 1HY3A 2YQ5A 3DFKA 3QVGB 3R5JA 4RVOA 5KYUB 3V00A 1ORWA 4U4AA 2J3HA 3GPIA 1G8JA 1U2RA 4ZOLF 4Q12A 2L42A 3GJ5A 4KPUA 4Q1DA 3V7YA 2LKDA 2FRDC 1D5WA 3C8UA 1TADA 5A71A 2Q0XA 3PGXA 5B57C 2E6UX 4GKKB 2DSTA 4BLUA 1EFTA 4MPRA 3MZ0A 2PZBA 2I62A 3W5CA 2DVMA 1OQAA 3DEHA 3OMXA 3B13B 1QP8A 3ZNPA 4EUKA 4TTQA 3WLFA 5A05A 2JGNA 2QT9A 2NP7A 1O9BA 3FNBA 3HU3A 4BVKA 4LYEA 1H5QA 5BV0A 1TEZA 3OMLA 4FS8A 2RHRA 2ZXFA 4XJSA 1UJ6A 1KJ8A 5JSUA 4CMIA 4XQEA 2VHVA 3AOGA 3U7HB 5FRDA 3UB4A 3GCGA 4AJNA 3HGTA 4Z4HA 2FX3A 4EGQA 3A1EA 3ETLA 3QITA 3ZBUA 4P22A 1WMAA 3HYCA 3QEBZ 3UHOA 4XASA 1EBFA 4PIMA 2Y1KA 5IARA 3BCUA 3TZHA 3EQ6A 4GYJA 1C1XB 2AF3C 5ED0A 2P9CA 5IK2A 4BRUA 2P3OA 3NHSA 3KB1A 3HUUA 2OHJA 3CX6A 5TB5A 4CUZA 3A6EA 4ER6A 2NP6A 1J99A 1SKQA 3LKBA 4ZVNA 2PLAA 5LWHA 2PO5A 1NGSA 3W7VA 2FW9A 3PCXA 1DO2A 3T5MA 5F3WB 1AK1A 3LFHA 1Y6QA 2W6MA 4QFBA 4P98A 1VCMA 2Q4TA 2EL7A 3RVNA 1CZUA 2FUG6 4FR2A 5THQA 4FGZA 3TKLA 4Z4IA 5F3RA 5ADWA 1G4HA 2AG8A 4PC2A 5JWRA 2FR0A 4CHGA 1JIUA 1W0JD 3DYIA 3IAFA 1AGRA 3DWIA 2NNLD 3GLFA 1VE5A 3GCWA 4JQSA 3TEJA 2O7SA 1XZ8A 1CR2A 4LHVA 4NRDA 2XXAB 4XQGA 4C14A 1XQ9A 2IYLD 2H6EA 2YY5A 1GSHA 3GH1A 1CRLA 3THYB 3PDCA 2HCJB 4BMXA 1MOZA 2FJUA 4P4LA 1FVHA 4V03A 3SNKA 1A8QA 3OE1A 1PJ8A 1KP9A 1XRSB 4L9WA 1SC4A 4X8HA 3UG7A 1U7UA 1OY1A 1EIWA 3KZKA 1PNOA 3M4ZA 4PTLA 4HOYA 3MSCA 1EG2A 3H3JA 3OU7A 2PG3A 1JJIA 1ZQ9A 4R1UA 1UMKA 2Y05A 4ROSA 1WMBA 5LYJB 5EOVA 1WAMA 4RMHA 1XCPA 3WYAA 1FNCA 1JDJA 2JD1A 1CEYA 1Q57A 4UTVA 5K8IA 1DIHA 3TUZC 4QQKA 5CEFA 2WE7A 2P4EA 2EEZA 5IM5A 4DJAA 5FUQA 2ENWA 5EJFA 1RWPA 3HR8A 4W7IA 5FTMA 1OKKD 5IYZF 4BKMA 1PX0A 1YI8A 2GESA 5HPYB 2FP3A 3DD5A 3E03A 4IOJA 3BD6A 2BTQA 3VR2A 3DAFA 1VLJA 2ZJ4A 3D4LA 3DHWC 3MS7A 2MSEB 2QRVB 3NOOA 1I14A 1MB4A 2GYYA 3AK4A 2ZIWB 2X9LA 4B3CA 2OC4A 3LUJA 2MSCB 3K1AB 1KERA 4MV6A 1JJFA 1N1GA 3ROPA 1RAFA 1YAJA 1GRVA 1RIFA 2CNOA 3B70A 3K9HA 3W3AD 3D64A 8GPBA 3ZHXA 5FJJA 1KKMA 2CUTA 3JQ8B 3KP1A 4MH0R 1AKNA 4YPVA 4Z49A 1T1RA 4ZCRA 4YUYA 1J2YA 3HFGA 1XROA 4RW0A 2H7XA 2VS1A 5AVRA 1M0EA 4DC0A 1W1UA 2ZWAA 1PAUA 3UV6A 5GGYA 2WVHA 1OV6A 2VTKA 2H4HA 4K6CA 3D6HA 4YMIA 4LDRA 4QWMA 5D87A 3YASA 4B3BA 1GTSA 4M6WA 3G59A 3WWCA 4HQNA 4ZAVA 2IS4A 2R2AA 1W75A 2W6JA 2RGCA 1QV9A 2HSZA 3Q5EA 4A0GA 2GNAA 3FFWA 5AKHA 3LZDA 2HRCA 3ITEA 4WPGA 2SNIE 2OZKA 4ZAGA 4YAIA 4OIMA 1H5NA 3SKXA 5IUKC 2OZEA 4JGBA 3W6ZA 4DLBA 2BSQA 4JSTA 3PC8A 1L5MA 1RFLA 2AMFA 1QS0A 4F6CA 1ADGA 4DM3A 4ETIA 4K9NA 3I52A 3H9QA 5DNAA 2VHUA 1N2IA 2J3JA 1VTKA 2GBCA 2O19A 3AM4A 1NF8A 5B30A 1IJFA 2FN7A 4M53A 3KYJB 3I6MA 4YXWA 4NU8X 4YI5A 3BSSA 1Z15A 2LW7A 1QH8B 2FFQA 2VT6A 4V0OA 3V4FA 5BNZA 1FF9A 3N2GB 3IMCA 1AK9A 2F1IA 4KKVA 4BDTA 2QP9X 4PSUA 4LYFA 3MWLA 4Q4AA 1IIRA 3SYRA 4BCCA 1DFHA 2HWYA 3ZCSA 1UP6A 4AYTA 3NWEA 4LF4B 4ZYVA 3L0YA 3Q9NA 2BRUA 1ESNA 1UBLS 1IY2A 1JQAA 1Z8DA 5JEEA 3AIOA 1F7UA 2B3TA 2CL0X 1UODA 3LK6A 3CUYA 4UNSA 5H02A 1JU4A 1GPKA 2PKQP 5AI5A 4LOJA 5CD1A 3ANYB 1RWWA 4PV7A 3PGMA 4EW1A 1DPGA 4XSHA 2P2NA 2CE2X 4MULA 2QVCA 2DT5A 3BFKA 3ILHA 3JQQA 1FVFA 5AK4A 3W1WA 3DMPA 4AMUA 1QZ3A 1VHDA 4RV4A 4BO4A 2X9VA 4COKA 4F96A 4W1RA 3R9XA 5EQJB 4JYZA 5K3OA 4R8LA 3IUNA 1ZL0A 4AKEA 3Q8MA 3BTVA 5JD5A 4AN0A 4E1BA 2I22A 1PZFA 1ISJA 2CXXA 2GXSA 1BHJA 3R3HA 1XVLA 1B8PA 1PKEA 2PSJA 1ADYA 5DPMA 4ESVA 3MOSA 4UPEA 1WMEA 4V3BA 1E4YA 3RIEA 5KOJA 3D6JA 1KSJA 1TUBB 3MBKA 3A04A 4KQXA 1QIDA 3KT0A 3COWA 4LWPA 4CCAA 1L5OA 2PZ8A 4P2GA 2E4AA 3VU3A 4M55A 2IHYA 1D2CA 2VXYA 4DCVA 2YVUA 1MR3F 4LF9B 1WSAA 1BU8A 1JNXX 4GBMA 4AULA 1NR7A 3ETEA 3LXRA 4D8TA 4ZC1A 1XTKA 4YRDA 5ARCA 5IAGA 3UGKA 4M0UA 5F98A 1KK2A 2A7QA 3DLAA 4FM9A 2NVOA 3N07A 2WUVA 2LKCA 2RHBA 4AS1A 1SQFA 4XLTA 4FINA 2IHNA 1N6LA 1XYVA 1T4BA 2W6QA 3E05A 3WYEA 2VCHA 3TI9A 5FQOA 2FW6A 3B2NA 3L05A 1NQUA 5ALXA 5CVTA 4DEXA 1T1IA 1IONA 1MU0A 2ZULA 4JEMA 5FULA 1F38A 1NLFA 5DWVA 3RKUA 4CF4A 3G2PA 2GCIA 4GZMA 5FEMA 1NMQA 2PN1A 2QJTA 5SV2A 3VPDA 4AP9A 3F5MA 1MN6A 2CEKA 1ABFA 5ALMA 1DRJA 3GUCA 3LG2A 1W5EA 3DTVA 1O3YA 2CVQA 3MCAA 3EVNA 4ZO8A 3H5LA 4QA9A 4B44A 5JTTA 1Z4NA 2GXQA 3NIWA 2ZS7A 3JAWA 1QIMA 1AO3A 3LQ2A 5D7BA 3UAVA 3OUUA 3CF2A 5KKNB 3L5KA 4RO0A 5AHOA 2GLXA 1XU9A 3OX1A 2FPIA 3TUJC 2D5CA 3NM6B 3G5AA 3ZCTA 2Y1LA 2WHPB 5I3ZA 3FJ1A 3HEMA 3KAKA 1G3QA 2RGNC 3T7CA 3PSHA 2Q6LA 1UJ4A 1JU3A 1P1IA 3WGGA 2VHZA 4A5OA 3UJCA 1WA5A 3HR7A 2Q3CA 4EW3A 4FWIB 5T64A 1XAJA 1NW5A 2WC1A 1C4KA 3PGVA 1BXRA 4QEZA 4WN9B 1W88A 3V9AA 2J3MA 3Q7SA 5TMPA 1CZLA 1E20A 4HRVA 3RUEA 3O2QB 4RD4A 2A14A 5DIFA 2DFDA 2BFWA 1EUDB 2JF0A 3N58A 1XEWY 2J6HA 2Z1NA 4N65A 1QV6A 1ULZA 3WLMA 1DTEA 4ZQHA 3E18A 1C0LA 2HA5A 4CG1A 3M6MD 1ZJJA 5B7GA 1KORA 1LNZA 2VJKA 3EB9A 4PGFA 4RK0A 1YRYE 3E61A 4ARAA 1FC0A 4D3XA 1HI9A 5AOVA 3F4KA 3LUBA 1R9GA 2AZMA 2E0IA 1C7JA 1IC6A 4MVXA 3ROXA 1X13A 3LY9A 3RS0A 4PG8A 1KI4A 1U8XX 4O63O 1B0ZA 1JR2A 2MR5A 1NNUA 1NULA 2HQ1A 4ZYWA 2MJLA 2H06A 2ILTA 1DIOB 3Q11A 1OI4A 2CXPA 5JG7A 3VNSA 2GCGA 1NVGA 1T8YA 4E30A 5DNEA 2W8BA 4ZYTA 1DP4A 2CFCA 2XRYA 1JH8A 1G3UA 2XVZA 4G5GA 5BW8A 4MA4A 2J3IA 4CI9A 3OTIA 2LNDA 2C0QA 3TB4A 4BFZA 2EG9A 3OPVA 3WJ7A 1YIOA 4D3YA 4E21A 4AZ0B 2JLSA 4Q9AA 2NU7B 1NLZA 1QCCA 3L3BA 1QHFA 1TUIA 4RKYA 3N3AC 1S96A 2NX2A 1Z5NA 3DEZA 3V2HA 3NWOA 4LQDA 5H4GA 1MXHA 5GVSA 1BDJA 4GL2A 3UC5A 3Q4GA 4MQEB 3D6NB 3K8OE 3WIVA 2PBRA 1R8SA 3TCNA 4NBSA 3CH5A 1CEXA 3VR4H 4E1AA 2I2CA 4HK4A 3DNFA 4WZBB 2HT1A 5G53C 1E6MA 2MT9A 5FXMA 1OOEA 1F2UA 1ZHHA 4D3FA 5EJ8A 6ABPA 2OVFA 3CRMA 2FLVA 5FBHA 3OZGA 3ENWA 4TUYB 3V1MA 3WFJA 5TMDA 3I23A 4N7JA 2CE7A 1TCAA 5FBWB 1LF5A 3OE4A 5A4IS 5HMMA 2PU5A 3LL7A 4GX1A 2Z6UA 3AM3A 5JFOA 2I03A 2IPAB 1PE0A 2FGJA 1EUDA 2JKYA 3WYCA 4AAYA 3EEBA 3GEMA 4UCXA 5CVEA 2R44A 4UHFA 3IVRA 1VHJA 1QOPB 5EHXA 2X5XA 4YJFB 4J07A 2GLUA 3OQVA 2R2GA 4GKVA 2HF8A 2HSGA 1XMPA 5JH7F 2H4JA 1Q0RA 1GUYA 2VWHA 4BP3A 1UMDB 4RQTA 3GEPA 1AKUA 4A82A 1SZCA 1CZHA 2FX5A 5K03A 1J07A 2AYXA 2Q9CA 3HEBA 1PBTA 2FPIB 4O1HA 2E3JA 1AQUA 4ZP1A 4OREX 1YQDA 2JFPA 1WCWA 3NHUA 4Q1CA 3UUWA 4F4IA 4ZYZA 1CY4A 3W8DA 3AY6A 4I2VA 1A95A 1LTKA 3NT2A 4FR0A 5FUVA 5LP6C 3W7BA 5IZCA 2N46A 2VYQA 2PA3A 3H9GA 1ZUD1 1QO0D 5BURA 2O4CA 4WFJA 5CAEB 2VDWA 3S1AA 2R66A 3LGSA 4FHGA 4N5LA 5F64A 1TIPA 1OX6A 3NJ8A 5HIAA 1GPDG 1LJUA 5I6DA 5JOQA 3BMOA 3O0DA 4KQIA 1C7EA 2V6BA 1OXBB 1U98A 4I1RA 4BTEA 5CB4F 4PYJA 1KEPA 4L73A 1A4XA 1U2TA 1YCDA 4I6EA 3HO1A 1Z36A 1GDDA 3BT7A 4M21A 1EFDN 1Q0PA 3CQ9A 4DWOA 1E61A 3B1VA 3WQQA 3U60B 4JHXA 4ETMA 4JUBA 1Z3IX 5DOVA 1GXSB 1V37A 1ZAKA 4S1VA 4YCSA 5AI6A 3H18A 2XZOA 4IG9A 4CFSA 1GRRA 1FRVA 3KLMX 2IITA 4MO2A 2JIMA 4YO8A 4CPDA 1M6VA 2I34A 3CV3A 4W63A 2XWPA 4XJVA 1OWLA 5HZGA 4HUJA 1BFDA 2G8NA 2QAIA 3RLIA 3W5HA 1QCZA 2X0DA 1HYHA 1LW6E 4FGKA 3PNBA 1L5RA 4EPWA 2X2FA 2BGTA 1Q91A 4YUZA 5ALOA 2BEJA 3FPLA 5B2FA 2AKAB 2ONZA 4R2KA 4YRCA 3SXUB 3MCWA 2CJPA 2I7XA 1TUBA 1E5QA 5CH3A 5EE3A 4ZO7A 2NPIA 2PGIA 5GY7A 3RREA 5HK9A 3VKFA 4RHCA 3VO9A 2QYTA 1PK9A 2X1HA 4QNRA 1QHHB 4ENUA 1PLJA 5EXSA 1CJVC 4GM1A 1B74A 4YRLA 3FI0A 2PBFA 2VYFA 3KYIB 5CX1A 3E3NA 4MI6A 4PYQA 1G42A 4FEYA 3T4XA 1I0ZA 2JFVA 1ZD8A 1P62B 3WNDA 3EFEA 4PZEA 4RVNA 2AZDA 3KEFA 3R7FA 1NUTA 3I0ZA 3L82B 1DT3A 3N28A 5J4KA 9LDTA 3EFBA 4B31A 2OK8A 2PH1A 2FSHA 3FVVA 2QUHA 1BKDR 3NDIA 1QQ7A 4KPFC 4PM4A 5A06A 3HJUA 4XTRA 4B80A 4TZTA 1Y0BA 4Q4AB 1J8VA 4LE1A 4R84A 1G1AA 2EVWX 1KI3A 3JVIA 4HQFA 2HMYB 2ZTMA 3PITA 5M2QA 1UZNA 3IVGA 2FEXA 2JJ1A 4NMWA 4BUJA 4G1MB 1FNNA 1YVRA 1XHEA 2I4TA 4DYVA 5HJ2A 1E0AA 3ZI0A 2ZQYA 5EZYF 3TEFA 1SB8A 1P4HA 3E5NA 2X13A 3DP7A 5FBQB 2IHKA 1XK7A 5F78A 3IURA 1QYIA 1XLTC 3CLSC 1ODFA 3IUSA 4YJKA 1QS0B 1L4LA 3EUAA 2OYRA 5AW3A 1QFYA 3T94A 3IKMB 1RLTA 4A0RA 5JS6A 1MMFB 2NUTB 2QUAA 2YHUA 1VYVA 3COZA 4UTPA 3I1FA 1JHXA 3JD4A 1TIBA 1I1NA 3X2FA 1JIJA 1PEYA 5DLQC 4G4IA 3UHPA 4D0RA 3QNUA 5AVWA 2QYSA 3ZOZA 2NACA 3HWWA 4ND2A 3NNNA 1RKQA 3WKBA 3F67A 5J59A 1XA0A 5JAMA 3K8QA 2CYBA 1XRNA 1U0EA 4JIGA 5JNTA 2E4ZA 1UL1X 3DMYA 3DKKA 2PX4A 1K7SN 4BFVA 2PZGA 5J2UB 1AK2A 3D02A 2A1IA 3D3JA 3MOGA 4K3UA 2ZJ6A 2GSWA 4OTZA 4GOMD 3QZUA 2QRZA 2FZ4A 5LZ7A 4X8LA 4MLCA 5B4TA 3HC7A 3W5SA 4ZRNA 4Y2HA 2KQUA 2QR3A 3EXFA 3FZQA 1XCBA 4FE7A 1FQOA 2OG1A 4EGJA 9MHTA 3EDQA 1MPTA 3IDAA 3K1AA 4MKIA 1ONNA 1DKOA 1JQBA 3J81A 3K9FC 2REOA 1L3BA 2QUJA 3N8HA 3CW9A 2R00A 1DAFA 3CZ9A 2C98A 3D0OA 1PQUA 3EDMA 4K40A 4NECA 4YJGA 4ZCMA 2ON6A 4BLWA 3CN9A 2BTQB 1PHPA 3F1LA 1CS4C 1KR2A 5GZ1A 1Z16A 1LQ2A 2P90A 2UVDA 1RHJA 4R2LA 1X3LA 2ONYA 1BDMA 2Y9PB 2I99A 1P5FA 5IFKA 1XCGB 4II3A 3IRUA 4OHPA 3OTWA 3UMJA 1Z82A 3DO5A 4RJKA 3DPIA 2EP7A 4BZPA 1KA9H 3WGUA 4A0FA 1U1EA 1XD8A 3GBSA 4WX2B 2GF9A 2NZXA 1W46A 4NTZA 1P5HA 1CQJB 4MVCA 5EZSA 2RIPA 3KELA 1LB1B 3WJ2A 3K9NA 1G8GA 1JDBB 3JX9A 4LQLA 4NMMA 4EEZA 4N7BA 3O2JA 2PSEA 3D5EA 3HXMA 3PWKA 1DKMA 4P35A 4NU5A 5HZHA 3UFBA 4MVWA 3EG9A 4MROA 1TLTA 2CL7X 1JAIA 3DONA 3THYA 3G23A 4G67A 3RYFA 3UUEA 1NAIA 3CW2A 1NNEA 1K7YA 5T8KC 4FFPA 5HDBB 1ZVQA 2XXAA 1RJDA 2AB0A 1CDEA 4QHYA 2DPYA 3E7DA 5A3SA 3CXUA 3IDQA 1FBTA 2ZUDA 3AZPA 4XX0A 3O8RA 3ANMA 3U13A 3FBGA 4JWTA 1XQ1A 1GQQA 1M33A 5IVKA 1H8HA 3P0RA 3AOEA 3WLHA 2ZDHA 4NBTA 2Z58A 2HD4A 1T35A 4ND1A 1NFFA 3KJEA 3X1MA 2ZJZA 1TJNA 3O1JC 3EVZA 5BSWA 1WKVA 3AUFA 3D6FA 1S6YA 1SCUB 4G9BA 4CLOB 2P91A 2HX1A 1DIGA 1Z6TA 2J6CA 2VPYA 3OZXA 2HF2A 4KJZA 1VSBA 2OOKA 4W4TA 2F1OA 1XO1A 4F86A 1Q50A 1A7KA 3MINB 5C7YA 1M0WA 4CIYA 3KOZA 2HY7A 5JI2E 5YASA 1MIHA 4A6XA 4Y1EA 2K87A 1W5BA 3H3FA 1OROA 2OZPA 3N70A 3QVSA 5TEWA 4QOEA 1R6DA 3AV3A 1HURA 2OB1A 2ZZNA 5C1OA 1F1JA 2JVIA 2MSKA 1Z4QA 1UBSB 1ZGHA 4G4GA 3JQ7A 1F2TA 5INTA 3DE0X 5CLIA 4IWYA 5DW3A 1G16A 1Y4DE 1SWWA 4QTZA 3ZIDA 1WTCA 5JANA 1F6WA 1XDBA 1GN9A 2IYRA 5BQ5A 2YBDA 4C3OB 3AWDA 3EISA 5FDFA 2ECFA 1QNFA 2B4TO 2OCLA 3T1OA 4CIXA 2H07A 4WLFA 2R8OA 3LL4A 4QU5A 2V3WA 1FFEA 4JWKA 4YCBA 5F4BA 1SQ6A 1GR1A 3N0WA 3H5AA 4IKEA 4V0LA 3SXPA 1I2CA 1ZOOA 4M7PA 4R71A 1G5IA 2C8VA 2P0YA 1G9XA 4FFRA 4QDJA 4QODA 3WQRA 1PJ4A 1TW2A 2G72A 5M04A 2Y4OA 3SZGA 1E2MA 3TOVA 1YJQA 4IYJA 1YVUA 5FAKA 3KKPA 5HJ7A 1F4VA 3PHBE 4IIFA 4YUWA 4GKBA 1CC1S 1OAOC 1V11A 2CLDX 4P5EA 3PQ4A 1UANA 2IV7A 3JWGA 2ZVJA 1BDIA 3DBHB 1WV1A 5IYZB 2Z5GA 1VXRA 3ZQ4A 4K9LA 1KI9A 1MDBA 2OV6A 3LYAA 4FDLA 4IHJA 1KS2A 1MJGA 2B98A 4AJIA 2HWXA 3CZQA 5ITZA 4D9JA 4RLQA 4N76A 1COWD 1R9JA 1V8ZA 3PNPA 4QQNA 3LVRE 3IODA 3AIMA 1RWXA 3KS9A 3MS2A 1E6LA 2IH2A 1UP4A 1UPCA 5LLTA 1DLJA 1IB0A 2I8CA 1AUOA 1LLFA 2C5GA 3M81A 4TS9A 4V38A 3U3KA 5IJ0B 2AG1A 1Z73A 2H54A 5C37A 3IEMA 4XWTA 4Q3AA 1VZ3A 3IJRA 3WSWA 4LDAA 2QORA 1H85A 3ZG6A 4DSAA 4M1YA 1JHOA 4D9CA 2E4VA 4YRNA 1JH9A 2IU3A 4TTJA 1C30A 3C43A 2J6BA 1SU4A 3RU2A 4CLRB 5JHGB 3GHHA 3ZN2A 1TA0A 5KYWB 2R65A 5CPBA 1LRKA 4WUVA 2V45A 4JEHA 4ZVKA 2B5VA 3MG9A 3FN4A 1E92A 1VL8A 4UHCA 3BWXA 2VSQA 1XGKA 2IODA 3AI1A 3IKVA 2QZ4A 1PSWA 2C5AA 1P5RA 3LIPA 4ZODA 5E8RA 3AHFA 4IDHA 2ZIEA 2A6PA 2XUKA 3MMZA 2Z8YA 1Q0LA 2FPOA 2DQZA 2G67A 3S5JA 5EIWA 2PUFA 3K96A 1DAGA 4DLSA 5JSZA 3AR2A 2XUZA 4KNVA 4MWEA 4A4DA 1K7FB 3G2QA 1IOZA 3JWJA 1CUJA 4LVUA 3BB1A 3M1YA 1JQKA 3C3XA 4I9NA 1RHMA 5KSPA 3WK7A 5EJ7A 1M2OB 1WUHS 2E7ZA 1U8TA 4OFZA 1N8NA 1D8AA 3DW3X 3JPYA 3DTYA 1GSIA 2B7LA 2CLMB 2CSUA 3QXHA 1JKJB 1U31A 2CV1A 5ILQA 3UJ6A 2BFBA 3V4VB 4D92A 4PQFA 4BBAA 5TT0A 5CBPA 1D4OA 5IH7A 1NBME 3MM4A 2ALJA 3HPRA 4X1IB 1EWRA 3BGVA 2WIAA 2EIXA 3D0RA 1PR2A 5C7IO 1KTVA 4Z0NA 4KR7A 5CIQA 1U8CB 4ITUA 4A8JA 1X7WA 5JCPA 3PXCX 2NU8A 3A6GA 3PR1A 1F3OA 4AFNA 4RQAA 3JWHA 1IDOA 1FW8A 2ZE8A 3EBLA 4ZJYA 2VYND 4OATA 5EN4A 2ARKA 1TVMA 3TXAA 1PFKA 3WSVA 4CQJA 3ADBA 2HWUA 3G49A 4J0JA 4BEWA 2H4WA 4K28A 1A8IA 3WWPA 1U9IC 4CM4B 2GZAA 4RY2A 4B3IA 1L4GA 1T9GR 1KI6A 3BE8A 3MEQA 1JXAA 3MCZA 3GGGA 3R09A 3NHYA 4L4XA 5BSEA 3MWFA 2HLHA 1PR6A 4YEDA 4TRJA 4KVFA 4EHKA 4F5WA 2QZPA 3D5TA 4FGWA 4R6WA 4RLFA 4TYPA 2FU5C 4IPTA 4NABA 5I9LA 4XWWA 4J1TA 3NANA 4AYXA 1JA1A 2V7PA 2FDRA 1W85A 4RKEA 5JMOA 3RFTA 4H27A 1PGNA 5AJWA 2R6HA 4HB2A 1ISIA 2BEVB 3QFRA 3ZD6A 1FXWF 3KJXA 1WOYA 3DBLA 2GPWA 3DUFB 5IT0A 5IKXA 3IKTA 4EB6A 3FHLA 3ZZTA 5KJ6A 2DBZA 1KDTA 3Q88A 2AN5A 4BTVA 1MAHA 1XRMA 3KAJA 3K1ZA 3TOXA 1ECCA 1X80A 5D51S 3HDYA 2F3UA 3KVVA 3ED5A 3HZHA 1XKQA 4KFCA 1XTVA 2HPZA 3O8LA 4N6OA 3KSMA 4B6JA 5U1PA 1KAGA 1HA3A 4ARCA 3R3VA 2ID8A 2ZPAA 4TGLA 1ICIA 3Q40A 4EABA 3NBYC 4FLEA 1SZJG 1FSPA 2A0FA 2AFIB 3CUWA 3O82A 3CF6R 2AD1A 5ILOA 5JZOA 4XIGS 3C5WP 3KV1A 1W34A 1K97A 4HYEA 1XZNA 4MWSA 5AKKA 1G21A 5EWLA 1ZEJA 3F73A 1HRKA 3CRNA 3O2NA 1PL6A 3B36A 3H1PA 1AT1A 1KAQA 3JD1A 3E8SA 1U7WA 4MB2A 5KHAA 2W4MA 3GLTA 3RIHA 2FWJA 3GNSA 2PKYX 1CVRA 2VKTA 3RO7A 2PWZA 2FJPA 3DF9A 4EYSA 1KHTA 1P33A 3HZZA 1QM5A 3AJ9A 4QYIA 3GJ8A 1P31A 1YD7A 4QUBA 3STVA 4Q3BA 4UXHA 1BU5A 2R5NA 4AJEA 2P7HA 4HGNA 1YV9A 4ZO4A 3R8FA 1VG9B 2NYVA 3K8ZA 2VQ6A 3LLVA 3J80A 3CVYA 3D2CA 3UYKA 1GL7A 1CQIA 4M87A 3HP7A 4TYYA 1IHXA 3PR2B 4W5QA 4BQOA 4HYYA 3UAYA 1RMYA 2VF5X 4F6RA 1Z0KA 1XZJA 4NH0A 1TJ5A 3LW7A 1U65A 3IRVA 3RF6A 4Y67A 1HKUA 1LF0A 4CDNA 1Z6GA 4EJSB 2KB0A 4KDRA 1BX0A 1IU9A 3BDVA 5D2CA 1E7MA 1UBRS 4OXQA 5KINB 1RYDA 1I1OA 2EKPA 2WD9A 5FD8A 4JOSA 4X91A 5CA1A 3B5EA 1EDBA 4RD3A 5JY6A 3HGMA 4YPFA 4CGZA 2A5GA 1OREA 5C34B 1I94B 2WTMA 1V1JA 1EVEA 1TZJA 3NPAA 2WAXA 3W9UA 2JLRA 2C3UA 3I2KA 1S8OA 3SU8A 1VP3A 5AIAA 1BS1A 2RK3A 3UMSA 2C59A 1HLDA 1GPYA 3T7TA 1PJ2A 5EZ5A 2G9VA 3SJCA 4DV0B 4BC0A 5A9SA 2W43A 2AXEA 3IQIX 5IKOA 1SVMA 3ZWPA 2FXVA 3AGPA 3WFIA 1BCSA 1SM4A 2RG7A 1NU6A 2R79A 4KEAA 3RNLA 4HAZA 3WGYA 1CWUA 4MEAA 2P79A 3QMWA 1N3IA 3T5BA 1VE7A 2X7XA 1U0RA 3OZFA 5BVGA 2HDOA 4J49A 3FNGA 1SUCA 1FMJA 2HBYA 3ZVRA 2G1AA 3S8YA 3M49A 4IXTA 2OXTA 4FNMA 2N75A 5IU6A 3OAAD 4EMUA 3JQCA 1E2LA 3U0BA 5H1YA 2D7DA 1ZPDA 2G0TA 3USZA 1J2EA 4L9AA 1J2TA 3AJDA 4G37A 5FR2A 2H4XA 3R9IA 2WKQA 5EQFA 3TBFA 4BCDA 1YQTA 4IV8A 2QRHA 1E3WA 3LWZA 1OF1A 5LR6A 1Z17A 5DRTA 2A9KA 3Q1LA 4MGEA 5E3IA 2FK8A 5C2JB 1UAGA 5KYTA 1VLVA 3NVKI 5CLQA 1QK5A 3SHVA 4GOND 3PNMA 4X6YA 1GKLA 1ZD9A 4TV9B 4C1NA 3PVZA 4EPVA 1QIGA 3OT1B 4INAA 3ZHYA 4P3OA 1WU7A 4DEYA 2CCKA 2FPLA 4INJA 3NCHA 4BEBA 2UZIR 4BKUA 3JWEA 4ZIRA 3GWZA 2GFIA 4HH3C 4QDXA 4MS1B 3KKOA 3G85A 1PS9A 3P8ZA 4X41A 5CLHA 5F4ZA 5LWQA 4XGKA 1GL3A 3JR3A 1EP2B 3MJHA 3LDUA 4J4TA 2ZWMA 1RSZA 2IEBA 3A2NA 4PNEA 1R4NA 3CZPA 1MB3A 3E9QA 1YI0A 3S99A 1CXZA 3B1XA 2C97A 1YDFA 2H31A 1R37A 3DVQX 4MKGA 4BLPA 1NZDA 2ZWPA 1TK3A 4H3HB 4NFLA 4UM9D 2X76A 4M0PA 1EXVA 1DI0A 3W2TA 1KO5A 2BUCA 4PHCA 4BFLA 3D8BA 2IJGX 3ENNA 3FHTA 4E2FA 1VL1A 3HGQA 4LV6A 4XXHA 4U7FA 1ORVA 5DE3A 3RRYA 3VOAA 2R6CA 3Q9SA 4H0NA 3AHEA 4G5YA 1ZC3A 3U5ZB 3AR3A 3VPXA 3DFFA 4P86A 2C2ZA 1TL7C 4IFIA 1E96A 2BIFA 2VJLA 3CVJA 4JA2A 1Y8ZA 1CYEA 1WB6A 1T4MA 1VG8A 2VOJA 4RLSA 2JGMA 3QPDA 4BEVA 2IBTA 4B2IA 4PHHA 6PFKA 4QC2A 3DZCA 1P2DA 4MVYA 2FETA 2FE1A 3UWOA 3BKXA 4XD7A 3BA6A 4DREA 3ABRB 4EGCB 3DC7A 3IVAA 2FI1A 7REQB 3IPAA 4GLJA 2XOKD 1IN6A 4N0PA 2CT8A 4A2QA 1BVHA 1JWBB 3RVBA 5BWLA 1UK9A 3E8XA 3OLXA 5KC9A 2HHLA 3H5OA 3D6AA 4IDNA 4L8WB 2JJYA 3R5TA 1J1IA 4K7JA 1P2GA 4NCIA 3U9LA 3IMGA 4JLAA 4TMFA 5C51B 2ZM6B 2WI8A 1HO3A 4YP7A 1UC8A 4HBGA 2OPBA 3E9MA 5LNK1 2Z6QA 1HTWA 2AMVA 3R5XA 4XWAA 4MCJA 1GGVA 1JBEA 2VBCA 4UVIA 3BD9A 3A0RB 1AGPA 1GUZA 1KEWA 2WWIA 4KX5A 5GQSA 3DV2A 3BE5A 5BRJA 1L7EA 3MGGA 1A4UA 3CU5A 3VDNB 2CJWA 3EDRA 3VVBA 4E5PA 2YHSA 5A3RA 4GPAA 3F7NA 4UMEA 3S2SA 5JR3A 1NI3A 4AUEA 4L2IA 3GPLA 1R0SA 1KJZA 2JCSA 5B1EA 3I37X 2CYAA 3VOTA 1D2HA 3LKZA 1P2VA 2EP5A 3A10A 4HGPA 2P11A 4RL4A 4DLVA 2V3VA 4FONA 4Q21A 1NTOA 4LXXA 1AKWA 2HFKA 4MR9B 4PSVA 1E7SA 2CCGA 4M46A 3MRVA 4PXSA 1NM5A 1T6ZA 4IM7A 5F2KA 3WDLA 5I7SA 1AKQA 1OC2A 1YJAA 3ETJA 4HLNA 3TMYA 3THWA 3UWMA 2I1LA 3BICA 3MQFA 1BE1A 2C8KA 4TWJA 2PYDA 3KB8A 3UG6A 1NLYA 2ADFA 1I9CA 3RARA 3GEHA 4UMFA 2CXQA 3I42A 5ALSA 3C3AA 2HQOA 1KBZA 3QKUA 3QJ5A 3ONEA 3ZDZB 4LZNA 4RTMA 2W2OA 3ANLA 1QLHA 3L0BA 4IIJA 4F38A 1BCRA 4JB2A 5CU7A 3U7JA 4FX5A 1U3FA 4HDMB 2VBFA 3RS2A 4F12A 1TDJA 3HKCB 4ZJZA 2Q9AA 2Y1WA 4LXQA 3OZWA 3C8DA 4CEHA 3MSXA 4R81A 2M2IA 4BMPB 4X1YB 2VRWA 4PLTA 3GP3A 2PUCA 1K92A 4IKPA 2DM6A 4G89A 2PMWB 1G3MA 3BS4A 4O4JB 1JVNA 5HF8A 3UB2A 5BYAA 3CVUA 2YW2A 2B20A 3EEIA 3JYLA 1NSFA 2CVHA 3I09A 4MMYB 1IXZA 1Z2PX 2C95A 1U94A 1JEQB 2MHCA 1QO7A 2RAUA 3RRNA 5A5GA 4ND3A 121PA 3O3MB 2Y8EA 2ZRBA 5I7EA 5CVDA 2B61A 2H9IA 1OGYA 3DJFA 4LK2A 1ECGA 3X1JA 4EHIA 5G1OA 4HP8A 1UMBB 2UKDA 2VK8A 1E5LA 5JBIA 4IJVA 2P35A 3JARB 5F51A 7MDHA 2ETVA 1AMUA 2XMDA 5JADA 2DFKB 4A15A 2HNKA 5ECYA 4JI6B 3HSSA 2O5EA 1RHQA 4OHKA 3CB2A 3E4CA 4NE9A 4RLHA 1G2IA 5K09A 1EA7A 4RVFA 5L4LA 3AF2A 3Q8WA 4IOKA 4JQYA 1I5OA 3C3KA 1VPDA 3KYDB 2Z5FA 3VNVA 3STXA 5K4GA 2R7AA 3HCDA 3VMFA 4ZZ1A 1T5HX 3BM5A 2J7PA 2WU8A 4KREA 2BAGA 1J0XO 1DZ3A 2GZHA 1AQIA 4ZALA 5JECA 3C7AA 5ADHA 3D3WB 4KPYA 3I9NA 3UB3A 1MORA 4LHSA 2R97A 2RCYA 3DVAA 1N6IA 1L8QA 3ITDA 2PGDA 2GPJA 2H1VA 4R31A 3GAFA 2IW1A 4FQ8A 4GLFA 4OXXA 2M98A 4DNQA 1JFFB 4BO6A 3KVYA 5HBRA 3A31A 4PCUA 4QG3A 1P0IA 2XSZA 4F0JA 2WVJA 4U7JA 5EYPA 3L8FA 4I3FA 2JI8A 2J5XA 3QE4A 2WR8A 2F1KA 2C1ZA 2ZB2A 2WHRA 3IUPA 3Q6NA 4P34A 3QLUC 4W5OA 2RAFA 3DB1A 1X2BA 2QOEA 4NWIA 1N5RA 2ISSD 3ONDA 4V0NA 5JC8A 1ZN2A 3D81A 2ZBUA 3DV0A 1NC3A 3GUUA 1RJ9B 4B40A 1EM6A 4XGQA 4YY3B 1DC6A 3DB2A 3EBOA 4JKOA 1J25A 2ZPTX 2GAIA 4N0MA 2BZSA 3FNQA 3KR2A 2WWYA 4MP6A 5J40A 2PT9A 3DWFA 1IBKB 4P32A 3VC3A 2PJDA 4DJDC 3CEHA 2OHXA 1ZH0A 3V7NA 1A3CA 1QUFA 1YL7A 5FORA 1VSTA 3UY4A 1HTBA 1REQA 2G25A 2NN3C 3CISA 3H1EA 4KXVA 4NFYA 2GBLC 2ZI9A 3M1IA 1L4HA 4MITA 2QD2A 3GLHA 4Z0HO 4AJ1A 4PN3A 1DQYA 2CEAA 2C96A 4GPD1 2O6LA 3AUTA 4I19A 4ND8A 4O2RA 1CY0A 1ZW1A 2AUNA 5IEBA 4E6PA 3AWIA 3FCYA 1KGDA 5IJ9A 1QQ5A 3RKRA 1KXJA 2XBLA 1XOIA 3QOXA 4RKWA 1FRQA 2JJQA 4W8OA 1MV8A 2PMCA 4O5AA 3H84A 3GJXC 1C7QA 2YV4A 5IFLA 3ZCRA 3HCBA 3MTAA 4GPBA 4W1PA 5GONF 1JVSA 4EJFA 4EYEA 3EMVA 1L5SA 1D6SA 1G6OA 2CMKA 2R1TA 1RM4A 3EASA 1MJ5A 2MINB 1WPRA 3HXPA 3CPHA 1AUVA 3J7TA 2B5OA 5EXEA 1Z4JA 1SH7A 2VNKA 1A1SA 1DBIA 5FR1A 5CCXA 3QUSA 4DWJA 3W6NA 1V9SA 3FR7A 2OM6A 3V1NA 4R1LA 6GPBA 5KBYA 1H94A 1F20A 5IVPA 5HNKA 4GP6A 1OZGA 4TKVB 3WOVA 4ETWA 1YA6A 3IQZA 4J91A 4Z86A 5B6JA 1FW6A 2NTNA 4NULA 2WUFA 2ZZMA 3ISJA 4X94A 1BYUA 1N3LA 3UFXB 3U6BA 4FJ2A 3WWOA 4NOJA 2QJRA 3X43A 1E2EA 1BJTA 3CSSA 3HB9A 3JQ9C 1Y8AA 2CC2A 4KU4A 4BO5A 4ENWA 4M1SA 2BFDA 4OXRA 3IILA 4Q6WA 4QPNA 4Q3OA 4FDVA 3ZXSA 3MJEA 3EX7C 4FFMA 1S2LA 2W2KA 2FRXA 3DDZX 3AI7A 3VHXA 1DLIA 1KIMA 1XLWA 3EDCA 1PV2A 4WFQA 3GEIA 1C7FA 3SEQA 4RTKA 3PRYA 1EVZA 1C41A 1U4NA 2C31A 3KTFA 1CDOA 1BHQ1 3C7CB 3WZ2A 2ZSFA 1J33A 3IR6A 1ESCA 3OSZA 1Y3IA 4I4NA 2GPSA 2J0EA 4LFCB 4C29A 1RTKA 4JYCA 3EGIA 4NZPA 3GLFE 5EGSA 1S3FA 2RHJA 2VZ8A 5BQFA 2BSXA 3MCTA 4R1PA 1HMYA 3RRZA 1JJAA 1DE0A 3LA8A 4F2WA 1GARA 5ADUS 5DTRA 4X62B 2QTBA 3MBIA 1FL9A 4MVJI 5F9FA 4W6QA 3CNEA 1YRWA 2XMZA 2ZBGA 1RU3A 1QF9A 1ZD3A 3TQCA 1PW7A 2AOTB 3MJTA 4R2XA 3VJKA 4M1TA 5E95A 3FLMA 4QM6A 3A36A 2ZW9A 1FX1A 2VAMA 1P2SA 2O8DB 5KCZA 3EF3A 3KSZO 3AETA 4HNHA 2I2DA 4QL3A 4KV9A 1CJBA 2A9FA 3WFZA 2INGX 2PRIA 2EERA 3HH8A 2WJ6A 3CNQS 3DE6X 1U2DC 4D9FA 3LWBA 4RH1A 5FWNA 3Q0EA 5DXFA 1C29B 2ZUEA 4HR7A 2HJHA 3IS3A 3ZD9A 5KSYA 2Q6VA 4JR2A 1FDOA 5GPBA 4FFVA 3ADDA 1C3EA 2W37A 4N41A 3A14A 3ORRA 4XVUA 1M34A 3NYWA 1QKKA 2GETA 3I0MA 4GR5A 3HN7A 5DHSA 4FYKA 1N78A 4XQCA 1DDOA 2DB3A 1K6MA 2W42A 4RDXA 1DG3A 3CEMA 1R50A 2JFUA 1OBOA 4K9DA 4MS4A 1NJ2A 4XDYA 1UBHS 3KDPA 4IDCA 3THOA 3OZTA 4HWRA 3ZBPA 2QP3A 1T2EA 3MJSA 4LN1A 4J94A 3JQAB 1CBUA 3FWPA 4HDKB 2X1LA 4QFDA 1I3NA 3EGXA 4PX2A 3PEWA 4F9FA 4O3MA 4CIAA 3RVPA 4ND4A 3HUEA 4KDFA 5JXGA 3U4DA 1QAQA 2V7BA 2XMCA 3L6OO 3O73A 1ZY2A 4UOEA 4JR0A 1CZRA 1TTQB 3WLKX 5CG2A 4JXZA 4IBOA 4EY8A 1I0IA 1KZGB 1E9DA 1XR3A 2QNBA 1GZ3A 3QW2A 1H4VB 1WCXA 1NQVA 1V7CA 3KXLA 3LVBA 4FS3A 2QVGA 1UM9B 5ALTA 5DYIA 5T67A 3V4SA 3PQ5A 4AM8A 4E3WA 4G0YA 1XWFA 1IJBA 3EWIA 3PHJA 4ISCA 5FA6A 3EGVA 1J5XA 1NP6A 5HJ5A 5K9ZA 5F2EA 5F9HA 3EGDA 3CUUA 1Y1RA 1JHRA 1GAQA 1UM9A 3HHEA 3KR9A 5KNCA 1QP7A 1U11A 4FKZA 5FPYA 1FTNA 5DWQA 4Z6KA 3JYPA 2XMQA 1M34E 3JQBC 3WLQA 2NV2B 4IVQA 4P58A 5CDGA 2YMLA 4EUEA 1WNFA 5ALKA 4RKFA 1YAHA 1LX7A 3VYRB 1SOMA 1BFKA 1FOEB 4L3OA 1X1TA 2P27A 2AC7A 4JNKA 1FE8A 3ZU2A 1JL3A 3RODA 4EEXA 3EQ7A 5BVHB 3A11A 1BIFA 1O6ZA 4KE6A 2ES4A 3L8YA 4LHWA 1QFMA 5DGHA 3GLGE 5FO0A 4TROA 1OLXA 2PIAA 1N2OA 3BZUA 2QNRA 4KXNA 4QBFA 3WGKA 3W9BA 1KC3A 2YWGA 3OLVA 1S02A 1OYYA 2H65A 3G89A 2PEYA 1V96A 1AC5A 3QV1A 4LJ5A 5H3LA 4D6XA 5KTYA 4OP2A 2NO9A 2WD8A 3DL2A 3OZBA 2IDJA 3Q15C 4M86A 1O8CA 3QK7A 5DRYA 2ZDQA 2ZCVA 2XTJA 3EWNA 2KM1A 3WYBA 2JPDA 1RP7A 3ZY6A 4R68A 1Z37A 2JI9A 3Q12A 5BV7A 2IP1A 3BSYA 3IIKA 1KZHA 2ZI7A 5HUHA 1EVLA 1YO6A 3NTRA 4Y2UA 3T0FA 5FI1B 1H2ZA 1IRIA 2ZSAA 1Y1KE 2CFSA 3Q2KA 4GPZA 1J9EA 1DS6A 2BCEA 2ZB4A 4ILKA 5MDHA 1R0KA 4YONB 1BH6A 4G6ZA 2Q5LA 2Z56A 3CLHA 2DBYA 3ITKA 3RFFA 2VOEA 4QOGA 4WTOA 1HT0A 2Q1YA 2WICA 2CL5A 4B85A 4CTOA 5CLFA 3ETNA 3T5CA 2QT1A 2YJZA 3R7WA 5IAEA 1EUYA 2XE6A 5IT5A 1I7NA 2C5SA 1NBWB 4NBVA 3TR6A 1RKBA 2J48A 2HIHA 4TX1A 3RVJA 1JKXA 3U7QB 3UK1A 3ORSA 3VAAA 4TXLA 2YVLA 4KRFA 4IO1A 1J8YF 2TMGA 2VL7A 3IB6A 5AKEA 4CYMA 4WV3A 4BFUA 5CEJA 2B82A 2JFZA 2DTEA 4I6JA 4MUNA 4UTXA 4ID9A 1VJCA 4C0BA 4C7KA 5BXYA 1QE3A 2AK3A 5CH5A 1FS5A 1EGQA 3NTLA 5AUNB 2VATA 3GAZA 2IDZA 3EK2A 3RUAA 2C4TA 1FXSA 1KH3A 3N2KA 4JC0A 4RK5A 2J41A 1NVEA 1U7HA 1ZUNA 5IZ4A 3QW4B 3U9TA 2BT4A 1AKRA 1SR8A 3FPSA 4IXDA 2CF5A 1UWKA 3F9CA 3NM4A 1IOWA 2JIOA 1BYIA 2QWXA 2XOXA 2O2YA 1PGJA 4KGVA 4JKIA 4YJHB 5D1HA 5I7UA 3V7UA 3X1KA 1CJUC 3SSNA 1PJZA 4OV6B 2XRMA 4FI3C 1TE2A 3C3JA 3TEMA 4CG3A 1JE0A 3I83A 4C4AA 4FI3F 3CZRA 1Z4LA 1CZKA 1ZC4A 1C50A 4HEHA 4C88A 2PTGA 2VJBA 2ZJBA 4I8IA 1VKZA 1DAIA 1O08A 1UJCA 1I3OA 2PXCA 3MXOA 2AUTA 5BSUA 3FTEA 1H1LB 2IHTA 1Z0IA 1LA2A 2E9SA 2O57A 4TWAA 3ENVA 4LJSA 1XTBA 4D8UA 1Z0JA 1HNNA 1G21E 1YBFA 2BFOA 4WK6A 4MUKA 1EB9A 3B6EA 3GT7A 4BX8A 2VPIA 4WNAB 5FV7A 2BISA 3KJQA 1HXHA 4HUQB 2A86A 3HJBA 1S3IA 3VR6A 4CF6A 5KNCH 1E2QA 2F64A 2GBPA 3FY4A 4Q7KA 1KQGA 1H6BA 4DANA 2K6GA 3OPYB 4CDMA 2GZ3A 3Q7TA 1JNYA 1QGUA 4NQRA 5LUBA 1IPEA 4KNWA 1LWNA 4KPEC 1RYYA 3AGQA 3HU5A 4JLWA 3K2IA 4UMDA 3U4IA 1GN8A 1UZMA 3AG6A 4NLLA 2Q3BA 4F56A 3M6LA 3TE6A 3GI1A 3ZWKA 3ZZ0A 5JPIA 4TLLB 1ECJA 2Y3IA 4L9RA 4NSNA 5ALFA 3SEFA 1GLNA 2EX0A 5IJ9B 4GGOA 1SVLA 4QO8A 1ZNYA 3STHA 1ZH8A 3S70A 1U0NA 1O97C 4GGMX 2C4NA 1XJ5A 3CTPA 1REQB 4MOWA 4CR8A 1XALA 4KK3A 5I8WA 1YI1A 5G4LA 3LO8A 4DJJA 2RHLA 1T1GA 1UPBA 1TGVA 3G2MA 4HVAA 4L5YA 4R1MA 4UUMA 1IXKA 2EL9A 1O95C 4IMJB 4NONA 1PCXA 3HYRA 4EI7A 3E7XA 4WBNB 1AB5A 3PGKA 1R3DA 1VHQA 3BDIA 4HRYA 5A6VA 5AW4A 1JYEA 4MXDA 5K3FA 2BR5A 3PX7A 4EVSA 3P0JA 1G3RA 2CUNA 3AEQA 4HEQA 5DKFA 3CWZA 3BORA 5DISB 4N5DA 1KJ9A 3NOXA 1LJLA 3ZWDA 4TTVA 4BQSA 4YJ3B 1HKHA 3V2GA 1APBA 4HPJB 5IVIA 3CR8A 1JHDA 1GNSA 2H52A 4BGDA 5EERA 5DLYA 1I0LA 4XPZA 4FLMA 2WYHA 2LRHA 5JSQA 4B84A 4ALNA 1CQPA 4FWBA 3I8XA 3OZIA 3WLSA 3DOCA 2HJSA 2HSDA 3L7YA 4GOLD 1C8LA 1GTVA 1OWOA 2Q4DA 3KWFA 4YMHA 3I9LA 2PGAA 5EJ2A 5MFZA 4PZAA 1SU6A 1XLTA 2OMEA 3ASZA 3KE8A 1FK8A 2I33A 1DKNA 2QTMA 1TJYA 4DB4A 1Z56C 1DELA 3AHHA 3NIGB 4EUSA 3TNDA 5FBLB 4YUAA 2RI0A 1MGPA 5AT1A 3GXBA 3QVKA 4XUEA 2IDMA 3ZVMA 3DAHA 3H2ZA 3QP9A 4NPHA 4TXMA 4HDSB 3AINA 4CEIA 1M2WA 2X2OA 2XF8A 4I9UA 2FQXA 5DIZA 1BVYF 5EWJB 1A72A 2IUUA 3L0OA 4FDMA 1RXUA 2AJDA 4B3SB 1TKRA 2ZB7A 3FDFA 1A2KC 2OBYA 2I5PO 3KXIA 3O8OB 1QIEA 4FILA 2DYKA 3SF8A 3O3OB 3NEYA 4WXYB 3TNLA 1E7WA 1OTYA 4K6FA 3JARA 1DVRA 2VP2A 3L79A 1H1DA 4R40A 3T99A 3ZYZA 1T1SA 3M7IA 2PWPA 2BHSA 2VK2A 3PUHA 1ZICA 2QTFA 4NK4A 3D8UA 2GDZA 2BF4A 3GFTA 4JI3B 3CZMA 3VX4A 3LCRA 1JJBA 3QG1A 2BTOA 4HDNB 4YR9A 2CLLB 2VSNA 5EUCA 3TFOA 4W1QA 5ALDA 3R7BA 2CB9A 3W4KA 4QTYA 2VJMA 3H8SA 2B1JA 3A05A 4C5BA 1ZNWA 3KQNA 4C4PA 1XFAA 2P5SA 5TQJA 2EFCB 3THXA 1GV1A 3H0KA 1KFBB 3F8WA 3U4QB 2Y99A 2WJHA 3KSRA 3RWBA 1QUEA 2VHWA 4IIVA 4WADA 2PSFA 4M0KA 1RXEA 3SIWA 2ATVA 1PEKE 2L0XA 2ZE6A 1NSYA 4HGZA 3B9PA 3ZVNA 4R16A 2Y0EA 3DQQA 3IT2A 2PS3A 3IV6A 2ZSDA 4N5MA 4BRZA 1ODSA 3OOHA 2QYHA 4LJ4A 4CU2A 4PRKA 5HKKA 5JCZA 3KXKA 2RGUA 3SVTA 2ZS9A 2WIKA 3F5SA 3FTNA 5CEEA 1G8HA 4KAAA 1VYTA 3KALA 2IYXA 4GW3A 1R0XA 4J29A 1GKKA 2WT4A 4TYQA 5C8YB 3USES 2NSLA 3VZCA 1X3SA 2OGTA 3MWDB 1YR8A 3IMFA 2I4RA 1A69A 4ND6A 4OYLA 1YT5A 4HN4B 3U5TA 1NONA 1A9TA 1CY2A 2BL4A 3HMQA 1I36A 2GKSA 4QXOA 1XPRA 3OQ1A 4QPZA 1NY5A 4UHEA 5AHRA 3W5DA 4NYMQ 2ZUTA 1ZIOA 3VFDA 1N8TA 3K71B 2GN9A 3TTYA 2N9UA 4RK6A 3FZYA 3IGFA 1D0VA 2FEOA 2JI4A 1R2QA 3MMXA 1VL5A 3NHAA 4X93A 3PKZA 4J7CA 4QFMA 1DCTA 2EU8A 2GPYA 4X6LA 1AGXA 1J2RA 3K0EA 3OEHA 5DZSA 2ZSUA 5IJXA 3RSOA 2XMGA 4LKRA 5CA1F 1UIMA 4NJEB 5M5BA 4PLFA 2CXNA 4KN6A 2Q7OE 2C2WA 4N5HX 3SOZA 2JG3A 4OH1A 3SE7A 1SCQA 1CHNA 1JSRA 1KBQA 1XXHE 2FSSA 2NSJA 2X58A 1KJQA 4UKDA 2ZYDA 5CA0A 1Y9AA 4JQOA 3UK6A 4BXOA 3RSHA 4NCBA 3A1UA 1DCMA 2TMYA 3NCTA 4MV4A 5C5CA 3SVLA 3PD1A 3ZDXB 5E3HA 1SCIA 1ZLYA 3P4XA 4A2CA 2ZIVB 3ZWOA 4DYHA 3KTAB 1VI5A 4KRYA 2ZLBA 1VCHA 4PR0A 5LQCA 3B7PA 4DM4A 1THMA 4MV8A 5FWXA 2NTYC 1HYGA 4OGFA 3IVMA 3ND5A 1EFKA 1E66A 5I9NA 3D7LA 3GV0A 4IIJF 2I3DA 1JLHA 4K6HA 3F6SA 1D2AA 2RHCA 4KWEA 2PUDA 1A8PA 3QVJA 4MR7A 1PX2A 1B1AA 3NVAA 2IXDA 1DX6A 4JXJA 5FFFA 3T06B 3THSA 3VGJA 1G18A 2PL9A 4AB1A 3FOFC 3OFKA 2WJZB 2XHZA 1FEZA 4A92A 2UUCB 2AUMA 2CV2A 2ZYRA 4I1UA 3KUUA 1GG9A 3HCAA 3P27A 4OAOA 3QEMB 4G5RA 3V33A 4OKNA 4EPYA 4UNPA 1LK0A 1GQYA 2FWRA 2YJ6A 3CKMA 1CP3A 3LGXA 8ADHA 3M0EA 2H3EA 4PWYA 3PEEA 4B47A 3NRCA 3RV3A 2D59A 4PSCA 3KKEA 4FGSA 2DUNA 3PTLA 1JSZA 2H0RA 1PWHA 2O2DA 5HK8A 4LXGA 3T34A 1E99A 4WVFA 5JXWA 4QBKA 3VUEA 3DVLA 2BJWA 3Q7IA 1RBQA 2QRPA 4FMPA 2C2OA 5TPWB 1KO4A 1PD0A 3DP9A 3R2JA 3DKVA 1FXWA 3EY9A 3P9RA 4H16A 4TMKA 2IV2X 4ZIRB 1FLNA 5K6AC 3TGPA 4UHBA 2ATEA 2H7CA 5BV2P 1X9GA 2IY7A 5JWOA 4Y6PA 4TV9A 4BEJA 3BHMA 7MHTA 1AUQA 1NM5C 3JS5A 4AF6A 4Y1RA 1H1TA 3N0XA 1RRPA 3CH4B 4GMDA 4GSYA 4RY8A 3V6MA 1USWA 2EZ9A 4WWHA 3ZE8A 2ZUFA 2O2ZA 1E3WB 1P9LA 3NW9A 5KYVA 3NIFB 1ODCA 1JDSA 2NT4A 3S7ZA 4ZJPA 1EFRD 1T6YA 2KLBA 4WINA 3T7DA 4U9IS 1UK8A 3HCWA 4IIXA 5EP3A 2B92A 3ND6A 4O59O 5HIIA 3QEAZ 4GE0A 3KPVA 5AJVB 2A1UA 4INOA 4QYSA 2FY8A 3MD0A 2UXBB 1I7PA 4TLCA 3O9VA 3BB3A 4YS6A 5LVAA 4TL8A 4RK4A 3A2MA 5D3ZA 3AF5A 4XLZA 3ZLTA 5JAHA 1GG5A 3I2IA 3NYQA 2AKYA 3HFSA 4IP0A 5BVGB 1GZSA 4K9PA 5T4BA 2DFNA 4Y7DA 2WJYA 1HQDA 2EKLA 3FJYA 4HQLA 2ST1A 4RIHA 1PQPA 5BN1A 3DAOA 2F1RA 2R96A 4GP9A 1OLOA 2Z8XA 3F7OA 4MAMA 1W7AA 1BMDA 1CQZA 1JJVA 1O03A 3E3MA 3OF2A 3HQ4O 4KP7A 4N12A 5E9JA 4DVJA 4C2AA 4OX9B 1DDIA 4QX6A 4U6NA 3B1ZA 2OD2A 1I30A 5EIBD 4F93B 5K99A 3L07A 3TMKA 1PT5A 1VPLA 2QU7A 1M7BA 1W48A 2CMHA 2WSSD 2PCLA 3JATA 4I14A 3RVOA 3R41A 5A1JA 2WKPA 4KQMA 3U1BA 1Q20A 5DB4A 4EG8A 2WKSA 4H7EA 3FE2A 4HFRA 2P9EA 1LV8A 2EC5A 4Y2YA 3SC2B 1Q12A 5L3VA 3B38A 1N57A 1KKLA 4U9HS 3PC6A 1KJJA 3CLVA 4I1YA 2VJQA 3RUCA 3OJCA 1X0VA 4EFNA 4UBIA 4DMLA 1XQXA 3BHJA 4J76A 3FW1A 2P6NA 2GZMA 4MYSA 3WL6A 1UWCA 5BUSA 2ET6A 1MUUA 3R8XA 1YZ3A 5B7NA 2JH9A 3O8DA 3K1TA 1TMKA 1NOIA 4N3NA 5NLLA 1KIFA 4FZRA 1JPNA 5AI9A 1HQYE 3MWYW 1MT0A 3EXHC 3HRIA 4KRGA 4PHGA 4Z99A 1MQ9A 2NTVA 4WT7A 1ORRA 3NR2A 3NV7A 3VDXA 1N1DA 1EX7A 3IIMA 5JNWA 1DRVA 2J9XB 3WL5A 2B35A 3ZDBA 3ZWQA 3DDHA 2Y0PA 4BV9A 1UM8A 3SICE 3IP8A 1XMOB 1POWA 3IPYA 1JA9A 1NTRA 1XTSA 2IUTA 4D74A 2JFYA 3H6GA 5FLKA 4B71A 4C0XA 1ST3A 4DV5B 1MQSA 2RSLA 4Y9DA 3U3XA 6LDHA 4I1OA 5LOVF 1Y1QA 1BGWA 4PZ9A 5LJLA 5CRIA 4HX9A 1N5DA 2A9QA 4X7BA 3R5KA 1E1LA 4ER7A 1CY6A 1T1JA 3GZ4A 4KK4A 4MVJD 3N74A 1RC8A 1MJHA 4ECAA 1Q84A 5IAJA 3TS1A 1XE3A 2PSDA 2EHDA 1DEKA 2VAXA 2NLOA 1E5TA 3OP1A 5J5CA 4A6DA 4A8TA 2PS9A 5B12A 5JASA 5L95A 2Z98A 3OP4A 3N5CA 2X19A 3JPWA 1X7ZB 3QQ5A 3R6TA 1K63A 2FSVA 1X80B 4GBED 1Q5PA 5CXSA 3ZVLA 2RI6A 2ANBA 1LS1A 3ZHVA 3NG1A 3G02A 4W5NA 4IG4A 5A7FA 4PC3A 2G7MC 1J97A 4K0KB 3DUFA 2WF7A 5FO1A 3WBBA 5CYOA 3PXUA 5U4QA 2Z6AA 3GRKA 3A2KA 3CNLA 4LV5B 1DT5A 1V7PC 3Q0TA 2Z8ZA 1MJNA 2SBTA 2C7VA 3G5UA 1W85B 1IH8A 3VAZA 4CTNA 2FTKE 3H1AA 4XYLA 4CMGA 4YC7A 5AJXA 2W58A 4ZHQA 1HT1E 3NGMA 4US0R 4JBXA 5GMOA 3ZWXA 3I9KA 2B21A 2VN8A 4EUFA 5AVZA 4CCYB 1ENPA 4YFYA 1JKMA 1TA9A 2YRFA 2Q6KA 4HH0A 3NMUF 2ZRDA 2M6RA 1RZUA 3EXEA 4PBTA 1E0JA 3HXKA 2VC2B 5AESA 2C42A 5ITVA 3BXOA 3TD2A 1KI6B 4RPLA 2RJNA 4BMDA 5IKMA 1HOTA 1E62A 2XDWA 5LU8A 4IXMA 2P6RA 2FOXA 1VRWA 1WKBA 5TMEA 2W83A 2WA2A 4ZANA 3VSBA 2ZIZA 2GN1A 1YASA 2Z5LA 3EWAA 4E6EA 4XB6B 5J4VA 5AP9A 1JUDA 2QPAA 2B6HA 3AIKA 2L82A 1DAPA 3QFHA 4HPWA 5G40A 3IPXA 3ZH2A 4DARA 3LOQA 2ZYUX 1SCDA 1X7WB 1VG0B 1NMXA 2EQBA 4TQGA 3EUWA 5A7HA 5JH7B 3Q6MA 4RHTA 4BQIA 1SWVA 4LX0A 4BJ5A 4MLZA 1NUAA 1NBOA 1V9CA 1P9WA 2BDEA 2M1ZA 2A3RA 3GGSA 4S1TA 3S28A 1G2PA 1HDGO 2YINC 5CBPB 3ZY4A 4IS3A 1ZD4A 4NL4H 2QX6A 2QUIA 4EGAA 4IQFA 3A7DA 1JKJA 1RLOA 2A1TS 2JLBA 4HQOA 1PEAA 1HC7A 4FHCA 3C3DA 3QKRA 2VZ9A 4QECA 4E5YA 2DJ5A 5CLLA 1UT6A 3B12A 2BR4A 2WBLC 4GLBA 3MLEA 7ABPA 3W06A 4O2BB 4EX7A 3DNMA 3QF7A 4PHTA 5A03A 3NDPA 2ZBDA 1R8XA 3Q10A 3HYTA 2IHVA 2R1ZA 3FDJA 4LVOA 3ZE7A 1ACLA 1TKBA 1UQRA 2F59A 3TOCA 1C0KA 3UJNA 2WJJA 2C2YA 2IX9A 3BE6A 3SZ3A 4DPMA 4KOAA 3IUQA 4YMLA 2P40A 4KMSA 3PXGA 1BKYA 1LRLA 3EAGA 3GXOA 5IC5A 1P45A 1ZLXA 2E1PA 3E7PA 3F90A 3UGJA 1MHTA 1OB2A 2VT7A 3N8NA 3ADPA 2BGUA 2CY0A 3K9CA 3MJRA 6ADHA 1NLMA 5CFRA 5KWVA 2WPNA 1CDDA 4R1QA 2HJWA 4R83A 1MH1A 5H3HA 3PZBA 2FXIA 3WTBA 4JXKA 5AOBA 2DWQA 3BTUA 3DR3A 1G0NA 3TSWA 3JYNA 4F46A 3LUGA 1G5RA 3BGOS 1UJNA 4Q3KA 1II9A 4FYYA 3B6KA 2O3UA 5IJ0A 1QRSA 3A9VA 2XZTA 3L1IA 3TTWA 4DRXB 5GIOE 5DHQA 1NMEA 2HYDA 4J2HA 2R7NA 1XEFA 4GZ3A 1DUIA 2CL6X 3PSAA 1QQ6A 4YYZA 1EWYA 2P1DA 4XCVA 1B7GO 1TYBE 4D8VA 5ITZB 1R6BX 1C3OA 1NRIA 2HW8A 1K3FA 2DAPA 5IYZA 2VTDA 3SSMA 4MEJA 3T95A 4D4LA 4WIAA 3VZDA 1P1CA 2BFEB 3K5HA 3R5SA 3W5VA 1V8PA 1DQNA 1WF6A 2O8NA 2GTIA 3P2JA 4RYDA 3LF2A 3E9EA 1SBQA 3S1LA 4DNPA 3TBHA 3SQWA 2RGWA 2H1RA 4R7ZA 2RK6A 3TPFA 2QSJA 2C7RA 3K9WA 2XLCA 5DBOA 3W8EA 2VDRB 1A7UA 3AYXB 3IP7A 5AXBA 1W4AA 3KQOA 5ESRA 3KZOA 4BNHA 3U3MA 5CB0A 3KX2A 2D2EA 2JARA 1U6IA 2FR8A 5ARBA 4KPGA 1ZM2A 4CEJA 3BVPA 1GFIA 3UPTA 3I28A 2WRZA 4LDPA 3T9CA 2V8BA 4DUYB 2UXDB 3IQGX 4W5HA 3WSTA 2ACKA 4EHLA 1NC1A 3ORQA 4LCEA 3TLKA 2IX3A 2FPWA 3WG9A 2O1EA 4Y8VA 4JBHA 1L7XA 1IVYA 1TKAA 3KETA 1FU7A 3AIIA 3I30X 1DQSA 3PG5A 4JOBA 4MAFA 1M66A 4MIOA 2FUCA 3HVUA 3G9QA 2ZRAA 4X5OA 1ISSA 1FQJA 5AVUA 4XX1A 2IUSA 4TN1A 2HI0A 4G07A 4M38A 3QGMA 4MQUA 1V47A 2FWNA 5KJCA 2YDYA 3WIEA 5HTKA 1XF1A 2XTZA 4MGHA 1PDOA 1IBCA 4I4TF 1W30A 1EDDA 3G88A 4RV9A 5TY0A 2P0EA 4TLDA 3WRXC 4E7OA 2O5VA 1XN1A 4AQ7A 1E2BA 4Z3DA 1XWIA 1G2OA 2X41A 2DR2A 4DWVA 2D4HA 1S8AA 2BGKA 2FZKA 4JY7A 4JL5A 4HB3A 3C6BA 1ZGGA 4MYTA 4WGFA 5KOHA 4B7CA 1SIBE 2NV6A 3MWDA 4OGKA 1E79D 2J6IA 2ZETA 4CLOA 1SCUA 4RJTA 4QQ8A 4D6YA 1D9ZA 2FN3A 8LDHA 2QXUA 1MFPA 2RBEA 1YQQA 2RHMA 3VX3A 5JNSA 3L7DA 3C1OA 2ACVA 1Z22A 1BTOA 1E59A 2FEKA 1C1HA 2KYRA 1DXOA 2W6ZA 1BG6A 3ANSA 3DKPA 4P4GA 4YJ2F 4EZEA 2O0LA 1QGOA 3QWIA 1RC0A 4QUIA 3P20A 2AVDA 5HF9A 5FLYA 3ZWVA 1L1FA 3CINA 2IU4A 2UYGA 3A4VA 1MA0A 3PFIA 4WOJA 2I4NA 3RM3A 5HVNA 5AVKA 2CZQA 4C22A 4RD1A 1V4VA 1V8FA 3VM6A 3U4QA 4D43A 1KYQA 4IDGA 2O1SA 5E0KB 4TXHA 4BHTA 3EG9B 3HNRA 3OD1A 2R8XA 3THXB 2G76A 1X14A 2QVLA 1TAGA 3O9ZA 3SIPA 3ZE1B 3OFND 5KDOA 3V4RA 4NYIR 3ZCXA 4L6IA 4BVLA 4EPRA 4POAA 1CZNA 2YYZA 2HXSA 1H8ED 3FVTA 4L85A 4TV8B 3T1TA 1K6JA 1W4CA 3FSJX 4WZ6A 5LP6B 1HUQA 4B0OA 3RJMA 2A30A 4FDAA 2EW8A 2A94A 3EIEA 1KEVA 4PFQA 2I2WA 2AFIE 1VJRA 3GAMA 3OECA 5KMGB 4YH1A 3W1EA 3K5PA 3OTGA 1EI9A 4CODB 2HREA 4Y0AA 3IDSA 4Z9BA 4X65B 4OK6A 3PC4A 3UQZA 3O8OA 1Y7TA 2TS1A 4WKBA 2I54A 3WMXA 1GY8A 1NWCA 3LBHA 1XZAA 4IRUB 5IMBA 5EWJA 4JP1A 1T5BA 1RJGA 4FCWA 1M7GA 1Y3AA 2JLAA 4QXPA 2X5OA 3VTZA 4CEIB 2WTAA 4HDSA 5I5EA 1P6UA 1IHOA 3W2FA 1N0IA 1XRPA 3LIIA 4RM3A 1SXJE 2ACEA 1BC5A 4DUGD 5IEJA 1U9CA 3KR1A 3U4MA 1YBMA 1HDOA 4UHHA 4CMBA 1G7RA 1KYIA 1NQOA 2D0PB 4JOCA 1XU7A 4IVPA 1Z6QA 4AG3A 5JLJA 3COVA 1V5WA 1G8MA 4V02A 5H59A 2ZUVA 3EIXA 1TEVA 3L41A 3TD9A 2ZJYA 2O2GA 1AZWA 4V0KA 1KQFA 3P2KA 5KPJA 1USKA 4MUYA 4YDQA 3IPCA 3H5WA 1KTIA 1N8KA 1N6RA 5EMKA 3LBAA 4RZHA 4G23A 1J09A 2QBYA 1SMKA 3NEAA 3QY0A 2C8JA 2P9QA 1M8KA 2JGRA 1E3LA 4KE9A 2R6R1 3RADC 1CIJA 5FOVA 1DAOA