5TS2A

Crystal structure of a phosphopantetheine adenylyltransferase (coad, ppat) from pseudomonas aeruginosa bound to dephospho coenzyme a
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
165
structure length
165
Chain Sequence
b'AHHHHHHMNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
molecule tags Transferase
source organism Pseudomonas aeruginosa (strain lesb58)
publication title Crystal structure of a phosphopantetheine adenylyltransferase (CoaD, PPAT) from Pseudomonas aeruginosa bound to dephospho coenzyme A
rcsb
total genus 59
structure length 165
sequence length 165
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2016-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 5ts2A00
1GPMA 3ND5A 2QUHA 1QRSA 3HZRA 4MUNA 1VL2A 1J20A 1PFYA 2YWBA 3DV2A 1ZJWA 1KP3A 1NUQA 3CVYA 3COVA 3KFLA 1PFVA 2YY5A 3K32A 1M8JA 4G5FA 1I6KA 1T6XA 2H2AA 2H29A 3MMXA 3S3TA 2QJOA 3N8HA 4MLPA 1O97C 2R5WA 3QTTA 2E89A 1GTSA 1O96A 5H16A 2WQ6A 3COYA 3MXTA 2DLCX 4KR6A 2DERA 4ARCA 1N3LA 2XRZA 2IJGX 3MLBA 1IFXA 3LOQA 4PY2A 3GMIA 3H05A 2CYAA 4MVXA 2IELA 4MUGA 1EFVA 1I6LA 4OJMX 2BTEA 5HUJA 1OWPA 2Z08A 3CLRC 1J1ZA 3SP1A 1IRXA 1TQ8A 4KPUB 1JGTA 3IOCA 1WOYA 3VGJA 3CVWA 5EKDA 1LW7A 2PZBA 3AKZA 2A1UA 3ILVA 3KT8A 4MW5A 3FG9A 1YUNA 1O95C 1IVSA 1A8HA 1O0BA 2RE8A 5KWVA 1M83A 1MBZA 3CLRD 1O94C 1N75A 1TYCA 1H3NA 1QJCA 4R2LA 4XFJA 3TQOA 2OV4A 2QTRA 2CUZA 2PG3A 4QBTA 3SEQA 3IH5A 3HMQA 1EE1A 1KP2A 2GKSA 3IVGA 1EUQA 1KH2A 1M8PA 1PFWA 1EFPA 1QU2A 3OP1A 1WQ3A 2DUMA 2ZUEA 2DR2A 1PFUA 3IUEA 3UOWA 1O0CA 1K97A 1R6XA 2JA2A 2QJFA 2PZ8A 4A91A 4QRDA 1PG2A 3DPIA 1XNJA 4MW0A 4ZCSA 3SZGA 4EG1A 1NYLA 5BNZA 2AG6A 2J5BA 4K03A 1T9GR 4EG6A 1F7VA 4NATA 3COWA 4MUIA 3D6UA 1N78A 4MAFA 4ND6A 1FFYA 3FH0A 2DPLA 1WXGA 1XNGA 3K9WA 1DNPA 3A4IA 2JAXA 3A04A 4EFKA 3L92A 1X8XA 2V0CA 3H9BA 2PXHA 3GLVA 1YUMA 3IVCA 4YMIA 1NI5A 1U7DA 4L2IA 3X1JA 2HMAA 4MUEA 3IDFA 1WXEA 3CLUC 1OWNA 3G59A 5KHAA 3SYTA 1I6MA 2E0IA 1FYDA 3NV7A 1T6ZA 1YI8A 2QTNA 5FO0A 2AKEA 1J21A 1J1UA 1JIJA 4KKVA 3H99A 3H9CA 1QNFA 1JILA 1KKUA 2A1TR 3MUEA 4XFDA 2DEUA 4U7JA 4KR7A 1X6VA 3HL4A 4G5YA 1U7XA 1G59A 3SZ3A 3ZXIA 1OBCA 3I05A 4KPUA 1VBKA 1GLNA 2PZAA 5F23A 3AIIA 3IVXA 1J70A 1WY5A 2QUKA 3OTWA 4RPIA 5TEVA 1Q77A 2Z3VA 1R6UA 3TZEA 4K0RA 1OD6A 3ZJUA 3FHJA 5LM3A 4HJXA 1N1DA 1MC1A 1MAUA 4EG5A 3ND7A 1YIAA 2CV2A 1VBMA 2A7XA 2NSYA 1KQOA 1MOPA 1IQ0A 1IQUA 4AS1A 2E21A 1KORA 4JZYA 3MLAA 1K4MA 4TS1A 3RBAA 1U3CA 4S1OA 3CVUA 3CLSC 1S4MA 3IMEA 4ZT7A 3P52A 4MW6A 4Q93A 3ZJTA 2GM3A 4FZJA 4MW7A 1B6TA 3Q10A 1NSYA 3P0JA 4ZT5A 2I1LA 2XRYA 1OBHA 1YIDA 5KCMA 1TYDE 4PBSA 3X1MA 2B7LA 2G36A 2C5SA 2D13A 1JECA 1VBNA 1O5TA 1RQGA 3ISJA 3PXUA 2EJCA 2X3FA 1O97D 2CYBA 2CFOA 1H3EA 3LE8A 1P7PA 4CDMA 1TEZA 1ZUNA 1NURA 1R6TA 1KAQA 1KAMA 1V8FA 2EL7A 1WXHA 5IJXA 3KT0A 1ULHA 4GU5A 3CLTC 4MWBA 4OUDB 3INNA 1LI7A 3IUBA 2QTMA 5TEWA 1EJ2A 3TZLA 1KH3A 3QE4A 1WZ2A 3A2KA 3G5AA 1COZA 1KH1A 3SEZA 3PRHA 4R0NA 4EG4A 1F7UA 1JEEA 2GOYA 1EXDA 2X1LA 4MWEA 1O95D 1CT9A 4P2BA 3FDXA 2V0GA 4PBRA 3IOBA 2J09A 3RJZA 2WQ7A 3D6VA 2O5RA 4NX2A 3FI0A 4L2IB 3Q4GA 1M8FA 1M8KA 4KR9A 3TNJA 3P0IA 1TYBE 4NDAA 3ZUGA 4MQ6A 3ZXSA 5FO1A 5JBNA 4HPWA 2AZXA 2X1MA 4JFAA 4DDMA 1MB2A 2YXNA 1O96B 2X0KA 4ZT2A 2J08A 4AQ7A 3PNYA 3CVVA 4ARIA 3CLSD 4MVWA 1ZH0A 1O94D 4XSVA 1SURA 2WSIA 1G8FA 3HFJA 4MUJA 4NZPA 1IH8A 4WNYA 3VRHA 3N05A 2CT8A 3AFHA 1QQTA 4J76A 4ZCQA 4CQNA 1T6YA 4CDNA 1QRUA 1GAXA 4RUKA 1N77A 5AHWA 4G6ZA 2QUIA 3IMCA 1KQNA 3HGMA 3RK1A 1EFVB 3F3MA 1Q19A 1XNHA 4HK4A 4DNXA 3FY4A 2A84A 3UY4A 3NBAA 4JYZA 3RFFA 2RD2A 3QTBA 1Q15A 2A86A 4YP6A 4MVYA 3A05A 1H3FA 4YP7A 4H3SA 1F4LA 5J58A 1QU3A 5J59A 4MW2A 1GN8A 4PBTA 2A1TS 4DLPA 2E18A 1JZQA 1MRZA 2VXOA 5DEOA 5J5AA 1K92A 4OUDA 2WB2A 4X0EA 3SDBA 3FIUA 4ZT3A 1MAWA 3HV0A 3ZIUA 4WSOA 4I6GA 3N9IA 1WXFA 3L93A 1EFPB 3ZGZA 4JXXA 1N2IA 5H7XA 2JANA 4NAHA 2QJTA 4J75A 4QREA 2Z09A 3PNVA 5LLTA 2BYTA 1N2OA 3CA8A 3E27A 3IODA 4MULA 1QRTA 4EG3A 3FETA 5HG0A 5K0SA 2J07A 2TS1A 5TS2A 2A88A 1IHOA 2CSXA 1KR2A 2CYCA 3DLAA 3C8ZA 1MJHA 1MB9A 1H1TA 4ZCRA 3DO8A 3FNRA 4ZT6A 1BS2A 4DDHA 2PFSA 2CV1A 1HYBA 4ZT4A 1J09A 2D54A 1QTQA 1EUYA 5DB4A 3FWKA 1OWMA 3RK0A 1WJGA 3BL5A 5LFAA 2VTBB 4YBRA 3UK2A 1NUUA 1N2BA 2DETA 1JIKA 1N2GA 3TQIA 5IHXA 3JXEA 3M5WA 4MUHA 3U1VA 3ZJVA 3CR8A 1I2DA 3X1KA 4F4HA 3ELBA 4I6JA 3COZA 2ZP1A 1ZH6A 4ND7A 1N2JA 5DASA 1JZSA 3Q12A 1NP7A 1NUPA 1VLHA 4F3RA 3CVXA 3IMGA 1WXIA 2J4DA 1XJQA 4MWCA 4U63A 1N2HA 3CLUD 3GUZA 1JEDA 3VU8A 4EGAA 1JIIA 2QUJA 4NAUA 2VTBA 1V47A 4DE5A 2OQ2A 3UC5A 1Q11A 1JMVA 1NZJA 1TYAE 2HGZA 1M8GA 4MUKA 1PG0A 1NUSA 3TS1A 1N2EA 3ND6A 4MUFA 3KT6A 2PIDA 4YP5A 3P0HA 2NZ2A 4ZCTA 4EF6A 2YWCA 5HUHA 4JXZA 4DDKA 4Q16A 4DJAA 1WKBA 4EG7A 2DXIA 1JHDA 2A1UB 2A4MA 1LI5A 1U3DA 2IP1A 4UZFA 1D2RA 1K4KA 1U0BB 1TFUA 3NBKA 4EG8A 3FOCA 1F9AA 1G8GA 4MW1A 1ILEA 1GTRA 1GZUA 4R2MA 2O8VA 4CT0A 1O6BA 4U8HA 3IOEA 1WQ4A 2D5BA 1T9GS 1YULA 5TGTA 1OWLA 5K0TA 3H97A 2CV0A 3PNBA 3AL0C 3CLTD 3N2YA 3KT3A 2ZUFA 3LCJA 1Y42X 3RHSA 4MVCA 4MW4A 4GRIA 1NUTA 3AG5A 3AG6A 4BWVA 2HZ7A 1IQRA 3G6KA 4E1AA 1G8HA 5FNZA 5DK4A 4I6EA 1OWOA 4UZEA 3UMVA 1M1ZA 4HJRA 4MW9A 1UFVA 1KQPA 4MWDA 4ZCPA
chains in the Genus database with same CATH superfamily
2ZUTA 2AUTA 3ND5A 4OMFG 4HO1X 5EIBC 1FRFS 1TD1A 4BNDB 3N07A 2Q62A 4DQ0A 4U2EA 2EIXA 1P7YA 3GD5A 2EJWA 1JS1X 4UU7A 1BXZA 2Y0PA 1B0PA 3V4ZA 3EVDA 4Q4AA 4DUYB 1OXKB 4GNKA 3H2HA 3ZV4A 2PVPA 3JPYA 4QU8A 3U39A 1DQRA 1QWSA 4IXTA 3WZLA 1M1YB 4HRAA 3KQYA 4NYJQ 3EUAA 5K3CA 5KJCA 1H2EA 2FRXA 4WKGA 1FUKA 3DFUA 1FRQA 4DG8A 2DFKB 3V2UA 4EFNA 1CULC 3S2IA 5CCEA 5CB4F 2FF7A 4ZOLF 4N0EA 3N7UA 1SXGA 3H2YA 1O6FA 2QLBA 4ZYLA 4M0LA 2O4CA 3T0IA 1AS2A 4MRPA 5I9MA 4N01A 1Z45A 3Q8WA 3UWSA 5BSGA 4O4JF 3VX4A 4JCOA 4ASUA 4C1BA 1XMSA 4B6RA 3F71A 3F98A 4NHOA 4DDVA 2KE5A 3WI7A 4J2OA 5A5EA 1I6LA 1NHWA 5AW8A 4L16A 5AJUA 4NJMA 2VKTA 4DANA 1UBOS 2VF5X 4LPKA 4EW3A 5BNWA 3IUPA 4JLSA 3PUHA 2CL0X 3CUTA 5D3QA 5TMPA 3UH1A 3AILA 1IG3A 1EFUA 3OCWA 3LVBA 3IEPA 3M3HA 5KWIA 3HCDA 4DL9A 1KO4A 2AOUB 2V7VA 3AKZA 5ES4B 2BH9A 1K8YB 3V1TC 6NULA 3FMFA 2CBXA 2P79A 1PWYE 1ZNQO 4LBVA 1PZFA 4U9UA 4DCSA 2RGGA 2ZIWB 3UJBA 3WISA 3QUBA 4DXDA 2FZ5A 4TL7A 5DYGA 2PL5A 3G2IA 2RGNC 2V7WA 1E9DA 4EUFA 5CPBA 1G5PA 4EG0A 3EYAA 3BDAA 3V1UA 2M6KA 3PQDA 1FYEA 2PG3A 2PSEA 2YWDA 2G71A 1BJRE 2GESA 1F9EA 3CC8A 3I73A 5D3ZA 3SEQA 2XUQA 4GXNA 2DHEA 2GKSA 3BGOS 4HYEA 2GKOA 1KH2A 4ODIA 4XOIA 3VDNB 2IEGA 3KLPX 1CDEA 4LK3A 2QKYA 3A9UA 4DJTA 4WA7A 2NU6A 4QOGA 1B6RA 4D5EA 1QVWA 3BHIA 5FTNA 3TD2A 1XDBA 1XROA 3SXPA 1YRHA 3PC4A 1KJ9A 3HCOA 2HK9A 3P9RA 3THRA 1N2ZA 1WHTB 1A4XA 4TMVA 4RH1A 4Z8YA 1PFGA 5EJ9A 3AHGA 2XXBA 2CE2X 4P5PA 3AUXA 1NZDA 4NCNA 5CT9A 1KI6B 5EWJA 4UCWA 4P31A 5LMZA 3NUQA 2I4IA 2C2YA 5K51A 3PIRA 1ZN9A 2ZRFA 4PC6A 4BGDA 3FAZA 2YV5A 2FG7C 4P3XA 4DILA 4O8ZA 3GJ6A 4OAQA 1OLUA 5G2OA 4EPWA 2QZJA 3LNTA 4FZRA 5FPTA 4OREX 3UYLA 4ARZB 5LP1A 3DW1X 3UMJA 1IRIA 1JLHA 5AM3A 1WABA 3M4ZA 3DONA 2E5WA 5CM8B 3U48A 5G0UA 2VEDA 4RVFA 3IXQA 3VDRA 3N70A 1EM6A 4PYRA 2V0CA 1U4OA 2LCFA 3FA2A 3G82C 3GFQA 1AG9A 2BMAA 1YUMA 2Q2WA 2R2AA 4HB2A 4HGPA 4H1WA 5AUPB 4ZVNA 4ZHQF 4CV2A 4DJ5X 1K6IA 1TCCA 3THYA 4UMDA 1S9HA 1XPJA 2CZQA 2DVMA 3GEBA 3KQTA 1WX1A 3LOUA 4EZIA 1GYRA 3NV7A 4N0QA 4M6WB 1YDMA 3I6QA 3MHPA 4R6XA 3IVMA 3UKDA 1C0IA 3L07A 3VOAA 3U9LA 4PN3A 3Q3VA 5HZGA 4EYQA 4DB4A 4M8LA 5IT4A 4XFDA 4NCJA 1GRQA 4KR7A 4XIIA 4HTFA 3LMKA 2A7QA 2XRMA 2ZANA 2ZBPA 3E5HA 4ID3A 1E1KA 4IQ4A 4Y67A 4XCQA 3WZ2A 3BQMB 3CLVA 3E9QA 3PKJA 3GGCA 1KEEB 1F8FA 3AIIA 3UJ3X 5ECGC 2W2VA 4FWIB 4AKGA 1K68A 5HCUA 4TMXA 2C5GA 5ABPA 4OQLA 4J07A 2B2NA 1ODCA 4V2UA 1E60A 4D79A 2DU8A 3QLUC 2Q7OE 1REQA 3L01A 4JA0A 3RABA 3KEGA 2ZWPA 4YYZA 4XJXA 3I4CA 5TQ2A 3WYGA 3TGWA 3VSBA 1JVNA 2PL3A 1WMEA 3UA3A 4MX8A 5C80A 2IV3A 2R7MA 2JFQA 3SIXA 2F8LA 1ZISA 2JD2A 4CKEB 3DNMA 4KXQA 3N58A 2WPDD 2R60A 2PUCA 1IQUA 4L4YA 1OBOA 3ESBA 2A94A 1Y8CA 4ZAZA 4PZZA 5EPOA 4XGRA 4NP6A 1IOWA 1XVIA 4C2UA 1QGOA 3NXKA 4RMHA 4YCJA 1XEFA 1NNEA 1XQVA 1DG9A 1L7VC 4B46A 4HX9A 5IJ9B 1QHFA 1SAYA 4MW7A 5EXPA 3HI4A 3H0KA 3MJHA 4LX8A 4Q3EA 5EJIA 5L53A 1IN8A 5FQOA 4Z0TA 3BMNA 2F9LA 2CVQA 4QGFA 1H9CA 1TD9A 1SG0A 1WAMA 4ENRA 1QE3A 5ALLA 3GYGA 3OBIA 3IALA 2HCRA 4PSKA 1UFKA 2Q4EA 5LLSA 4CHTA 3WWZA 1I0ZA 2WDZA 1D07A 3OQBA 1NX9A 4KSBA 5C9ZA 1PT8A 1W581 2JARA 1T5OA 2OFOA 3EG9B 1Q3HA 1LPMA 4TYQA 1UM9A 4LJ6A 1M75A 2F1JA 5THXA 2FN9A 2IPOA 3L46A 2BMJA 1IJEA 1C7JA 3TSYA 1U0EA 2SNIE 3DR3A 4RSHA 7MDHA 3U5TA 4UPDA 4M0UA 1WHTA 1DLIA 2JGIA 2IUSA 3OLWA 2ODWA 4OBXA 2O07A 4GU5A 4C7KA 1YA8A 5BR8B 5AKKA 1A8PA 1MVOA 1UOEA 2A3NA 3QMVA 3KQSA 4Z1MA 2V55B 3TSWA 3UWKA 1FYWA 4G8CA 2QMHA 3TWOA 1JVBA 3EVAA 1EI9A 4V0MA 2W2LD 1YSCA 3JD4A 5FLXA 2AFHE 4DM7A 4DT1A 2G40A 5L3QB 1KHHA 2XGSA 1HDXA 3Q85A 5JS7A 1CIPA 1LI4A 4DPLA 3S29A 2W48A 5C51B 3IE1A 1I94B 4GYWA 4HDNA 2FPSA 4PHCA 4BCCA 1GA1A 5T41A 2E3JA 3RRFA 3MIZA 3FDXA 3EVEA 3TR5A 4O33A 1MJGA 1KO5A 1NLYA 2PBFA 2Q99A 4O6VA 4XYEA 2YXLA 4E30A 3ZU3A 4TUYB 3WWEA 4UUMA 1C1HA 1CKEA 2HZBA 1Q95A 1ZVMA 4L2IB 5DHPA 3NDBB 3DL0A 3ICWA 4U7WA 5KOHB 4A82A 4PF1A 4BU0A 3MWDA 4KODA 3KR2A 3DBHB 2WDPA 1AD2A 2W93A 3GT3A 3NBQA 1C3JA 1GPH1 3N7AA 5FOVA 1NQAO 2QRGA 5AKGA 1THZA 3RU7A 4CI0B 3VBCA 4CR7A 3SG0A 5HK9A 4LMRA 2Q2VA 2QX7A 1C4XA 3ZYCA 3AL3A 1EAMA 1JR3E 2F64A 1Z06A 1DE0A 2XVXA 4KRXA 1A2BA 3D59A 3CQ9A 1P1FA 1QUEA 4DREA 3BZBA 2YVLA 1IH8A 3D3EA 4YY3B 4CEHA 5HJ2A 2ZSHA 5T4BA 4AKTA 5CA0F 2IUYA 2I33A 1PT5A 2SCUB 3ISTA 5IKMA 2P9QA 3FWHA 3PNQA 4QAQA 1EXMA 5GJWC 3A70A 3ZE0B 3QTLA 2D2FA 4YO8A 4JMPA 2XYRA 5E9AA 4ZHSA 3VDQA 1PF7E 4M9XA 3RK1A 3H5AA 5CR9A 1EDOA 1E0SA 2HQSA 3T1VA 3M4XA 3FTPA 1R5OA 2W8BA 5A6SB 2B3DA 3FKSA 4JX8A 5IJWA 3RVLA 4X54A 2RHHA 4IDBA 5B3JA 1ECLA 1NR5A 3BGDA 2V3CC 1EX9A 1NONA 4N12A 1Q15A 2PWBA 2ZVJA 1GHTA 2CDNA 1VRCA 1M67A 2YZGA 2YQZA 3AETA 3CUUA 3EK2A 4DQXA 2LCQA 1A96A 4EQZA 1J49A 4UFNA 3TIGA 3U9TA 1F4LA 2GBGA 5G4KA 4I4NA 5J59A 1PX0A 1A5ZA 2VJLA 5AJWA 1AJEA 5DT9A 5E0OA 4LRQA 4P5DA 1IL0A 5AM4A 4ZTBA 1YL7A 3IAM6 1CF9A 1JBQA 1KYYA 4GSLA 3KKKA 4UUPA 3AU9A 1RM4A 2W2XA 2PGJA 4WCFB 3OI7A 3VXKA 4FNMA 2V7GA 4QECA 4KC0A 1K9VF 3O84A 1XKLA 2PRKA 3CJRA 2ZB7A 1M1XB 2AUMA 3ABSB 2OORA 1QANA 3PHCA 4V0ME 5AYVA 2FUG1 2NVUA 3ZHQA 4Q01A 3P4XA 3T12A 5E7JA 1ISSA 4KQCA 1EWRA 3AH8A 1V5GA 4HQLA 4E88A 1SUFA 1YRAA 2GKGA 2NO5A 1KU0A 2XUAA 5CYOA 4CI9A 3ZW7A 5CITA 4KXVA 4JC4A 4YJ2B 3CX8A 4WZBE 2FP3A 3OTGA 4R98A 4AY4A 4ZPJA 4B47A 1BE0A 1XR3A 2QORA 3T99A 1BEEA 1T4DA 2Z5VA 3G2HA 1Z4PX 3OO1A 4JLOA 4TRMA 5IC5A 1MFPA 2OGWA 3FUXA 2ZOSA 3RE1A 4QVIA 1VCOA 4YRIA 1AUPA 5HG0A 3UWPA 3WBKA 1IEQA 3H1GA 5KOJB 3CPJB 2VP2A 4QL3A 1FFHA 3DPSA 5F12A 1PWHA 1V37A 1TNDA 1GL7A 4BV2A 3UW3A 1P9NA 2DT8A 1Y4SA 3LLUA 4C4AA 4R1NA 4BMPB 4ENPA 2OD7A 1R5BA 5ALIA 2OE2A 1BVUA 1D7AA 1MB9A 3AFMA 3PGA1 4NESA 3ESAA 3X43A 4HEHA 4IHJF 1HYBA 2DFVA 4D42A 5DOZA 4YMGA 5JIBA 1CUDA 2C3MA 3IP7A 2JD1A 2G4CA 1GEEA 3W9YA 5LQMA 4D8XA 1AKEA 2AG8A 3E3LA 2BGMA 4IG9A 4R9VA 3S70A 4E46A 4JZKA 5FBHA 3INYA 5JPCA 1NLZA 1XCMA 1U1DA 4NECA 3WGMA 2NO9A 4LTNA 2DOKA 2GHRA 3WQHA 3FPLA 1IZZA 1W88A 8LDHA 4TM8A 1ANKA 2PNFA 1EWQA 2GXQA 1NKTA 2QX8A 3WICA 3QKRA 3GNQA 4M87A 3WGQA 4KDRA 4F4HA 5ALZA 1BD4A 3O75A 4NKRA 2AFIA 1U0SY 3Q7EA 2WZQA 2HU7A 4RGVA 4AY2A 1BGXT 3U4GA 1D09A 1NP3A 2C9MA 4HYYA 5H02A 3ZY2A 5I48A 1A98A 4Z4GA 2OBLA 4KO4S 5IBPA 3NETA 4FGUA 5LN1A 2WTMA 3VSAA 2ZJOA 4HN2A 3BZUA 4R1TA 1J7KA 5H70A 1E2IA 1ZI8A 3PC7A 2C4WA 3K0FB 3IELA 2HWWA 4FW8A 2DLNA 3AUUA 1A8SA 4ROTA 4OQFA 5I7AA 3VR5D 5D7NA 1MO5A 1EGMB 1X74A 3HRIA 3HCPA 2NZ2A 3MSXA 3ZCQA 3DZHA 3MFYA 4O4IB 3TI9A 2OO5A 1JDNA 1WMAA 2OO3A 3DCJA 4JJ7A 4PO1A 5FBWB 4OGWA 1QJ4A 1SCNE 3BWYA 4MQFB 3F6RA 2F1IA 1E3EA 3EGWA 2VZEA 4IO1A 4RHXA 4UASA 3HB7A 4HWPA 2EGGA 5E1OA 1E9EA 5KYGA 1M2VA 1A9PA 1G63A 2I03A 2CJPA 1NC1A 2FTKE 3U4QA 3GIDA 5MN4A 4Z7QB 1L1EA 5KNLA 1YMVA 2QR5A 2IT1A 3NNSA 3OT4A 4OHOA 5C4GB 4CIBA 5LB4A 4RE5A 4D3SA 3IPLA 1ISFA 3C6YA 3DE6X 4KXLA 4MRSA 1H2ZA 1KXJA 1GNLA 5IANA 3O4IA 4Q03A 1HC7A 2R00A 1TCVA 1WQ4A 3H2SA 3AOEC 1FUEA 5B64A 2H54A 4JP1A 4LOJA 5A9SA 4ZRMA 3AEUA 3DJFA 1VIVA 2ZRGA 5AJVB 4AO8A 5JVDA 3D5EA 3WK9A 3BVPA 1OXVA 5MF6A 3I0MA 3OQIA 3WLSA 3I61A 2M6RA 4LF5B 1E64A 1Z36A 4Q7KA 3QVGA 3KR0A 1OVMA 2GPTA 3ROXA 3TPCA 4CTOA 3UK7A 4G97A 2GDJA 2VDQB 3O8RA 3SLRA 4BP9A 4YFYA 4DVJA 4J1SA 3HJAA 5BQ3A 4I19A 4JVSB 5FLYA 3RSFA 3ZU2A 1R6DA 2R6GA 2YKGA 3SEFA 4BFZA 4N39A 1BVHA 5EJEA 4G0MA 5HMLA 3ZBQA 1Y1RA 1ZIYA 1LWNA 1NULA 3CKKA 1VJ1A 3AV0B 1G6HA 2QLFA 5ALDA 4ZAFA 1SQ6A 4DEXA 1VLJA 2J30A 3QPUA 2H16A 3UTCA 3DTYA 1U5BB 5BPFA 1GPMA 2NPIA 3N6XA 5HOEA 4MUNA 5CEEA 5JCJA 4Y7DA 3B7GA 1FE8A 4LE2A 3RTGA 4ZHQA 4OV6B 3TIIA 5HPYB 3D8BA 2OCDA 1K0FA 1W5TA 3EXHC 1MHPA 2D1RA 4RPJA 3WA6A 4EA6A 1DQYA 2XTAA 1H2RS 3CZ9A 4KKXB 5ICMA 4XQ9A 3VISA 2SKCA 5CYFA 3UG7A 4RESA 2AEJA 1O95A 3ZWKA 4C3VA 4QTYA 4RMIA 2NU7A 2PKWA 4HH3C 4G5FA 4EA9A 1XZJA 3DA8A 4TV8A 4F9FA 5BNFA 2QJOA 4TSFD 3OBBA 1GTSA 16PKA 4ZANA 5DGXA 1NJ8A 4FYHA 1N5DA 4BS9A 1E8MA 2NYUA 4B83A 1EUDB 4LHEA 2WQ6A 1GPUA 1SRQA 3GJ3A 3JSXA 2XNDA 2L18A 4UXIA 3EVZA 3UVEA 4BVKA 2VIIA 4E09A 5CT5A 3SIWA 3WYNA 1F2DA 4LXUA 4BY9E 3W2FA 4FD2A 4QU5A 3VR1A 2O8BA 1GPYA 4CLOA 3G5MA 4UM8B 5JMOA 4DCTA 3VZCA 1UDRA 4O2BB 2WHXA 4MVXA 2Z56A 1AO3A 4S1WA 1EFHA 3GRAA 2VVTA 4HWKA 4N49A 2IIQA 4S35A 3RFXA 4ZI7B 4XGQA 3FTFA 4IDHA 1LJUA 3SC4A 1IBKB 4YT4A 5JOQA 4G2NA 2HJ9A 2YOHA 4HFRA 4K46A 2F7SA 2OP1A 4IG4A 3IOCA 1WOYA 4UNNA 3TB4A 4ZVRA 3VJMA 4AZ3A 4F46A 2B1IA 5I4CA 4B32A 2A2ZA 3NVMB 3UT6A 1PN3A 2ZZMA 4JUAA 2H2IA 2X5KO 1J00A 3S8EA 1DG3A 3G5LA 3KC2A 4I4LA 3AI3A 2ICAA 2VJMB 4RIIA 4DLNA 1YJXA 3LUAA 3C2QA 4PANA 3WC4A 3K71B 3FPCA 3ICCA 2EQAA 1BKDR 3HY3A 1SXJB 1CY6A 4LWZA 2IS1A 1TPYA 3CLRD 3BCUA 1TYCA 5EWJB 4FIZA 4F06A 4H77A 3WV4A 4D4KA 3Q6NA 3D6AA 5GINE 2F17A 5EJFA 1CR0A 4CUKA 3DDWA 3O1IC 4D57A 3BERA 3TRIA 5JYCA 1JT9A 1DELA 2E1RA 3EDCA 3VPDA 4BGEA 3JRXA 4GD3Q 1XALA 3SWWA 4A16A 3BQ9A 3HBFA 3KZVA 1WQ3A 2O2CA 2DBVO 1GLGA 2DR2A 4LYYA 4UTRA 3BS4A 4GPTA 2BMWA 2ZIVB 3BT7A 5LB2A 5E9QA 5CFRA 1RIIA 5KTTA 1ESZA 5EQFA 2PX4A 4A91A 1RMTA 3GLGB 4OXNA 2FUG6 3L02A 4NFHA 1YDWA 3U7JA 3UGKA 4KGXA 2Y1FA 3A1FA 2Q3EA 5BMVA 2CLIB 3D8UA 4NFLA 4F96A 2ZXFA 2WWFA 2A9PA 1ULAA 4LV6A 3SIPA 4BNUA 5F78A 1A97A 1NYLA 3IOYA 2SHKA 5CGZA 2JGEA 3R7WB 3VC1A 4UFPA 3MT8A 4TKVA 3KQHA 1M34B 3TXAA 5KS2A 2OBFA 4W7HA 4BECA 4PG6A 5B57C 3JQGB 4MS4A 3W9BA 5C32A 1LD3A 3HB4X 2QJRA 4Q02A 5IDVA 3S1AA 5JFGA 3WKCA 1TA4A 2Z30A 1H42A 3RIYA 4ZIRA 3H04A 1ZAKA 3NGLA 3GBSA 3E70C 4TVKA 5AKLA 1IZ9A 1O03A 3BMCA 3WK5A 3HJTA 3WWOA 1GG5A 4NK5A 2WTEA 4DV6B 3B7PA 1XK6A 3CMMA 3GLVA 5DI9A 3QMPA 1P33A 1Q3TA 3WRWA 3EVBA 2OBBA 5REQA 3FNBA 4W5JA 1M0EA 2JASA 1FZQA 3NI2A 3AEZA 4Q6WA 4QQFA 5ERGB 2RGDA 3AWIA 5JMPA 5CLLA 3I04A 3HN2A 3OZGA 4W9MC 4WDRA 4ENTA 1X86B 1CHNA 1LLFA 4P4SA 3L6BA 5AM0A 1QG6A 5C1OA 1ESMA 1ZUD1 3Q88A 3PRKE 3OZFA 4OLHA 4MDHA 4JWTA 3ZWCA 2DEUA 4JHXA 2PYZA 3VGPA 4A8JC 2P0EA 2IV7A 1U90A 1UPTA 1EVJA 1GV1A 1Y5NA 5C53B 5G0WA 4KX5A 1F2TA 4O4HF 1QE5A 1OCEA 3G0GA 4B5LA 5JXIA 1HDGO 1NFFA 3LPDA 1OX6A 3W2GA 3VNAA 5CK5A 4C4TA 5EHXA 2YXDA 2C9CA 5C8XA 3EY4A 2C2KA 5JS2A 5KVSA 1EB8A 4PFJA 1AE1A 5JTTA 4KZPA 4MAAA 4YTEA 1LPBB 1RYZA 3RRNA 3L7LA 1KEZA 4FFRA 3TW6A 1RPZA 2J0EA 2JVIA 2MMGA 2Y93A 3H9JA 3KALA 1B6GA 4EG5A 5KYTA 5KHOC 4LDAA 5CYPA 3UUEA 4GS5A 4QUAA 4RJLA 2GPJA 1KBQA 3V4VB 3GMTA 2H2WA 5K4HA 4DMRA 5I3ZA 3KDSE 4CL8A 2AQKA 1YFLA 3PI6A 3L77A 4X6YA 4E15A 3MLAA 3QI7A 1SCKA 3SZMA 2HF9A 4H7HA 1U3CA 2C97A 4CKZA 2DG2A 1F60A 3TBFA 1CQXA 1ZDMA 1DARA 3GEGA 2P27A 4LDNA 1MLDA 4KQGA 4ND4A 4EA7A 3JAWB 4F86A 4OJNA 2VPZA 2XBLA 4GI2A 4MS1B 4XGNA 1L8XA 1Z5ZA 3LP8A 4M1ZA 4RY0A 1JXMA 2ZJZA 2JB9A 4DLYA 3RSHA 3CG0A 1HNZB 2BHNA 3GEEA 1XAIA 2O3UA 4GDFA 1KMNA 1YL6A 5ECWA 2VJCA 5KNDD 2B4TO 2BEWA 4H1VA 1P4RA 1G42A 2GASA 4UD2A 3W6OA 1QTRA 3BWBA 3KHUA 3DVSX 3NYWA 1TF7A 2WM3A 3BBLA 1INLA 4J0QA 3IDOA 1IK6A 4MUYA 3LW7A 4Q1EA 3ROQA 3H19A 1ZUNA 3HR4A 3OVMA 1TJ5A 2H11A 1U99A 4E5UA 2HFJA 4MSUA 4Q47A 2DF8A 5AM5A 3BSYA 2GYWA 1J25A 4AIRA 1VJTA 4CCWA 5JEEA 4B3TB 2ZRBA 1SD1A 2G06A 4JENA 3WRXA 3L7DA 3QP9A 1E58A 5JNRA 4LXYA 5TEWA 2R9VA 1T9CA 1QM5A 1WBDA 1WZ2A 2ZTHA 3V2HA 2WYUA 2D8AA 2IHVA 2C5LA 3ZX5A 1U5AA 1XTTA 3IXLA 4IZOA 4QHSA 4UMVA 5JMTA 1IXZA 1M2KA 9LDTA 2C03A 4YJFB 4YRFA 1NXVA 3PUIA 1IXSB 3L41A 1VXOA 2OHOA 3K9FC 5KTYA 3MC1A 3SC6A 4BLQA 4P36A 4FBLA 2NZVG 5KNCH 1OQAA 4TSRA 5MGNA 3QXGA 4XM1A 1H2BA 4NONA 1KETA 3IAEA 1NUAA 1YZTA 2C0CA 4LZOA 5FUXA 1QFSA 2WF7A 3PEUA 4JQYA 4GLOA 5EHNA 1KGSA 2P4UA 4MGEA 3RNLA 4GI3A 4QTXA 5IBRA 1YHNA 4C5BA 4V0QA 1GY8A 3UCEA 2QUZA 4RLSA 1YS1X 3IQDB 1LRJA 4MIOA 3MWGA 5EKTA 1UC5B 4GYYA 1TQDA 3CLSD 3NNDA 4D3DA 4Y2VA 1WV0A 3WK7A 2P5TB 2QL5A 1GZ5A 3K53A 1N2SA 3MGAA 3JAMA 1UANA 1ZN2A 2B1RA 4Y2XA 5GVSA 1J9GA 3GVCA 4MR7A 1BC5A 3AP3A 1Y9DA 5ALPA 4YRKA 3GLFE 3B20A 1OTXA 1OYYA 1DAPA 1P1JA 3ITNA 3SJUA 4EFLA 4F1KA 3TUZC 4JBHA 2R7KA 4LYGA 1FNCA 3G9XA 4O1MA 4AMBA 1IOLA 1M6VB 1RC1A 1YB5A 5CVVA 4EB6A 2Z2YA 2PMCA 2HRDA 2MYNA 3NBMA 5HF9A 3G68A 5JDIC 1TTPB 1Y1KE 1E1QD 2RMKA 1AXEA 3C41J 1QKJA 4YAJA 4B3RB 1SZPA 1ZOLA 3B1ZA 3GVHA 1RP7A 2O0MA 3A9RA 3DBLB 2CLEB 2WMNB 3AW9A 1QIDA 1RVV1 2VWGA 1ZR2A 5ICEA 3MK31 4YCNA 1JEYA 1OLSA 4MQ5A 3F5SA 4BVLA 4LYJA 1W5EA 2FHPA 4TLBA 5GTDA 3CXRA 3KKMA 1GGMA 4TWJA 3TFQA 2OZLA 1R0CA 2XLBA 3V7WA 4ED9A 5A5VA 1WDKA 5FYDA 4ZOLA 5JEDA 3WE7A 2KSQA 2HK7A 4GZ6A 4L4SA 5A4DA 3L4BA 1U1EA 2N75A 3PGLA 4QRIA 4HRXA 1IAQA 4MVJE 5DTJA 3EF1A 4A5OA 4LJYA 2PRSA 3MN1A 4IJMA 4MW2A 1UEIA 1OVGA 2E18A 2FW1A 1VHDA 2Q8PA 2V4MA 4JP3A 5CT6A 5ELLA 3NYQA 1KNXA 5K0CA 4YAFA 3FGZA 4H60A 1N32B 1PGJA 4ZZIA 1YJAA 3E22A 2MINB 2JGLA 3F74A 1L3CA 2Q46A 1WXXA 2X8WA 3TN7A 1PRYA 4J9UE 2X8JB 2DWQA 1MAWA 3B3JA 3VO1A 5IFLA 3JS5A 4WSOA 5DX8A 4PLFA 3JAKB 3EVGA 4JYPA 1XTRA 1VB5A 2PO5A 1A4UA 1EFPB 1FQWA 5K3SA 3W78A 4EJMA 4HXGA 4WLUA 3OE4A 4ZXFA 3BILA 1W93A 3HCEA 1NYTA 1MH9A 1SCAA 4PX5A 4QQ8A 1ODSA 1S2GA 1X7WB 2HMTA 4FKZA 4KMSA 4XM2A 2GZMA 3R5TA 3BG5A 1AKVA 2WAMA 4FEYA 4IVRA 4JJFA 4XWYA 3OKCA 2UZ1B 1DX4A 1P72A 3UK1A 4B74A 3I5XA 1MN6A 1AZWA 1GG2A 2COEA 2EOAA 3VR6H 1JJBA 3Q98A 2LBPA 2I76A 4AECA 4MOWA 4CG1A 1EEXB 2RGAA 2VO1A 1NQ5A 3DR5A 4IIFA 1U11A 3BDVA 2EG5A 4MZDA 4PFKA 1PP4A 1CERA 2ZVPX 3NS7A 4GT1A 1XLWA 1ZSVA 5FBRB 5DNVA 4URUR 5GPBA 4A6PA 4QGSA 5C5EA 1O7JA 3M8KA 3PC6A 3H75A 3RB8A 2OM2A 4Z3OA 2JAQA 2VUUA 2Y71A 4TYWA 3DFZA 2VH2A 1V16A 4YMSA 3L82B 4EUHA 4QM6A 4U00A 4RCVA 1TYEB 1TVKA 2A0YA 1KR5A 1ZL0A 3P20A 4QDKA 1H8EA 3CEHA 4BCDA 3HJUA 3TUIC 1X1EA 2AI1A 1Z6ZA 3C3CA 4XTCS 3LX5A 3RC2A 4B2LA 4M0EA 2ZYSA 5E2IA 4JBNA 5A7FA 4E5SA 2AKYA 3GAFA 5AVKA 1FLNA 3EXFA 3TQIA 4AYWA 1H2WA 4XX1A 3ZJVA 4LDQA 1DXOA 2F43A 3AFOA 3RROA 1EUCB 1G2OA 2ZE8A 2XY4A 4RTLA 4RXTA 3M6MD 4F72A 4TSFA 3TD9A 3SJ7A 4I6JA 1U5BA 4MYHA 1OF1A 1DSSG 1PZHA 2FFJA 5JROA 2GM9A 2W2PA 5JZVA 4UBMA 1YAHA 3SF8A 4J2HA 1XJQA 2W00A 3NNNA 4NOMA 5H80A 1GVHA 4X20B 5F35A 1JHZA 4YRSA 2VTBA 3ERCA 1Q22A 2IIPA 2OQ2A 3V1NA 5DCUA 3VH2A 3VKHA 1YHZA 1Q11A 2FLWA 3TEFA 4RA9A 1U0GA 3Q3IA 4XD7D 1M6VA 1Q7TA 4GO1A 2VDLB 4GLLA 2KPOA 3LUDA 4EIWA 1VP3A 4FYKA 5L3RA 3D0KA 3VOTA 1R88A 2J9ZB 5CBKA 4Z99A 2QWXA 4WV3A 1EUDA 3F73A 1P0QA 3OU2A 4ZCTA 4FZ3A 3KB1A 5IAGA 1T2AA 4H0CA 4RDXA 1LBSA 1L8AA 2P40A 1L4MA 4K7JA 4TZ0A 4H4EA 2EFJA 1KS9A 3QG1A 4LTMA 2B8TA 4ZQFA 1NXOA 3RSOA 3UBMA 1R50A 4DR7B 5A9SB 3ZEIA 3K5WA 2H6EA 4PYQA 4X7RA 3T0FA 3I23A 3PQ5A 1KC1A 5K05A 2XF2A 3BMOA 4F4CA 1U0BB 2QRQA 3NBKA 1XSEA 3Q7TA 3SOZA 1MAHA 3MJEA 4GBJA 3N7TA 3ZZNA 4RGYA 2DBYA 4R84A 1TJYA 1XEXA 5CIWA 2FVYA 4KVAA 3ROPA 5F4BA 3A37A 4PPNA 1WD7A 5I3CA 1Y3IA 4P08A 5HW0A 3BOSA 3SSMA 4YCBA 1E9AA 1CV2A 5GONA 1TKCA 2B4KA 2FOXA 1WKVA 2GSDA 4MPRA 1T3TA 2BSAA 4DLZA 5EMLA 4RDHA 1C9NA 1IY9A 3ZYZA 4BQQA 1Z6TA 3KKPA 3ELWA 2VZLA 1QGYA 3K96A 1YOVB 4BO2A 1BEZA 1L4HA 1UODA 1M73E 3LNCA 1UBMS 1RHJA 2IX9A 1IN6A 2ZSFA 4G8BA 3MAGA 4FSXA 4QUKA 4X71A 1HQYE 2VT3A 5ER6A 2NTYC 5FADA 3ENQA 5BWNA 4I5EA 3UOAB 5IC4A 4NCHA 4G0QA 4GLFA 1J2JA 4EEZA 3V8RA 1R16A 1B2RA 3BRCA 4BWVA 1IQRA 2HM7A 1K8XB 1DAOA 2J85A 2A35A 3PEEA 3QHAA 3RV3A 2WD7A 3VTAA 2FEAA 2V4UA 3F6SA 4EFMA 1DKRA 1XLTC 2ID9A 4DDTA 5JNLA 2YICA 4LCEA 3F6PA 2BKEA 2GNPA 3KKEA 1GKUB 3QVWA 4WY2A 5T6BA 2APJA 3RG2A 2C3PA 3RS8A 3TK1A 4RIFA 5LUAA 1QRSA 4WNAA 1PFYA 3PXEA 1J9ZA 4BP1A 2HU8A 4HZIA 2UUAB 2MYPA 4D8YA 5DEIA 3L7YA 4TUYA 2Y05A 2G04A 4LWOA 3NFRA 4RQUA 2WP8J 2REOA 4EEKA 3BA1A 4OBEA 4GOXA 1YQXA 1UOQA 3I5MA 1NUHA 4HAYA 3T7JA 2QRNA 1T6XA 2WMOB 3AQ4A 5CJPA 1ODLA 2OA0A 3KQVA 3GOHA 1Q7BA 4UKDA 4HAIA 3ZWMA 4F92B 5T8KC 4CKXA 5JARA 5KNCA 1EMDA 2P7HA 2X76A 1UC4B 5BN4B 4L0CA 2QQGA 3WV5A 3KFVA 3WXBA 4MVJM 1SG6A 3PZRA 4RENA 1DBVO 4WFQA 4R2HA 3Q3GE 2R44A 4II3A 2ADFA 3R3WA 4OQ4A 4ARBA 4KDCA 3DUWA 5A62A 2Q6IA 2IJGX 4L0QA 3EEOA 5DNEA 3EASA 3Q9NA 4WBNA 5AI6A 1GPKA 4KIWA 4YLGA 2DFPA 4P4SB 3D3QA 1A7AA 1TKBA 1BE6A 2COUA 2WSBA 2BF4A 3BYZA 4QUGA 2AQIA 1AMNA 2GCGA 5EZ6B 1G6KA 3DQZA 2H2DA 3TOVA 3TKLA 3AHEA 3VC3A 1Y5IA 4J6EA 2BISA 4XR4A 1IBLB 5TNXA 2FOLA 2EP7A 3VGJA 1L8LA 1ABBA 2XADA 3CB2A 5CB6A 2OD9A 2OCIA 5ICGA 4XI9A 5NLLA 1SKBA 5M29A 3S44A 3ZGOA 2FZWA 1AZSC 4TQ9A 1AC5A 5C18A 1GUZA 2IHTA 1DDGA 1HH4A 2HV9A 2OOSA 1SKYE 2UYGA 4Z1OA 3E1KA 4PGMA 2BHSA 2F67A 1W6RA 3NC4A 1MVLA 4U4AA 4KPFC 3G6WA 1QJCA 4FHEA 4RH3A 2R62A 2UYHA 1U4NA 1KOLA 5KX5A 1Z7YA 1F17A 4O8CA 2GN1A 4BKQA 2C29D 3PNLA 5H9VA 2VK2A 2HBQA 3AVVA 4KDFA 5LZ2A 3TCNA 1KDOA 3ZWWA 4O2LA 4Q9IA 1N8KA 2R85A 3R9WA 4JJIA 5ARCA 4L02A 4X7BA 4BX8A 5BVHB 4O0LA 1JHUA 5HSGA 3BTUA 2YMPA 1E7RA 4H7PA 4ZIRB 1RMQA 1K97A 1UWVA 4OMCA 4YHBA 3KFXA 2H2GA 2XF8A 4QWWA 1O08A 1U7HA 2ATIA 3DPIA 3WSTA 1CZRA 1RAAA 3T7KA 5CCBA 3KPUA 1L3IA 3TRJA 4AMVA 1G8MA 1G20E 3MWJA 3PUJA 4BNDA 4ENSA 2D1SA 1OFVA 1YRBA 1U0LA 3NTXA 1K08A 1UT6A 3IEUA 2AG6A 5FI5A 4ESVA 2VXBA 1BE1A 1DBIA 1F1JA 4Z4HA 1EK5A 1K5PA 1RLUA 2DP4E 2Z2KA 3U09A 3NTVA 4N82A 3VR6A 3ZGYA 1Z2CA 1A9TA 2I4OA 2RH8A 3Q2OA 4OOFA 4DARA 1X1CA 3V80A 1NMYA 3QBEA 3T5BA 5ALUA 3L92A 4C2BA 1UJ4A 5KYKA 4QLAA 4BB6A 1CZNA 3DVAA 2ATXA 1RM3A 3DDNA 3I04M 3CNBA 1BTOA 1KAOA 3EQ8A 3OSUA 5LBUA 3ITKA 3OCZA 4HDCA 4YMIA 4S1TA 1U7DA 2WLTA 3GN1A 5BUQA 4B6QA 3QEBZ 2WINI 4PC2A 3FHCB 4HS4A 1J8FA 2IXGA 2NZWA 1T8WA 2J48A 5FTJA 4DUGD 3TG8A 1OLUB 3LY5A 4UDOA 3SICE 3RD5A 3IRUA 3VO9A 2A1TR 4PYLA 2Q0QA 4PO9A 5TPWA 4C0AC 1ZO8A 3PJGA 2FWAA 1U2DC 3QKRB 5LJLA 2FE1A 4MA5A 4BRWA 2QMUA 5GOZA 1HTTA 1POXA 1WF3A 1OBCA 5HDBB 1MD9A 3V48A 4Q3CA 1WQ1R 2E1PA 3PF9A 2FRDC 1UFQA 3BWCA 4DHWA 2FSIA 2UYQA 5NULA 4YUAA 5HUQA 1SXIA 4G1BA 4B81A 4C0QC 4KBGA 4Q4HB 3SEAA 4OM8A 1UKBA 1ZSNA 2AHOA 4JT9A 3TZEA 5TR9A 1Z22A 3NW9A 1MKYA 3T0GA 1CZUA 4JJAA 4K0RA 5LD2B 4DUGA 4L9WA 1GVNB 1Z2DA 2ZB4A 5A9TA 3OT1B 2OXIA 1E79D 1M0TA 5AVYA 1XF1A 1SU4A 3G8DA 1C1DB 1RCFA 2E82A 2LDXA 4LC9A 3MTAA 1DLJA 3QKSB 4FCCA 4HVAA 1SK8A 1ODFA 3ZV3A 2AC4A 5FB3A 5BWBA 2V8BA 2Q7DA 3A4YA 4KO1S 4HNTA 1P0CA 1R9NA 1U2GA 2C2HA 3RUAA 3SQLA 4AUEA 4RE6A 2BJWA 3L0YA 5EWMA 2CJYA 1AGNA 1JYFA 5G53C 1H4QA 4EB6B 1II8A 1RQRA 1ZMBA 1GPAA 2D74A 1B15A 2I1WA 3GNSA 4FZJA 1XWWA 1PW7A 1KZYC 4C89A 4CQLA 1F1BA 3OESA 4BPRA 2P2GA 1N7GA 4POOA 3LQRA 1T0HB 1GD1O 3CGWA 4KR3A 1G20A 1V7ZA 3AQIA 2OK7A 1OBHA 5M2QA 2LIPA 5DIZA 2KYRA 1E2DA 3FTDA 3CVJA 1IXKA 2OZLB 3M1IA 5C5DA 1JECA 3BTVA 1Z8FA 3O94A 4KMMA 1YI1A 4CMIA 2WIAA 3A9VA 4AKEA 3JZDA 1R3DA 3H9UA 3VU0A 3BA6A 3E4CA 1CJUC 1J24A 3OFND 1P7CA 4TM7A 2X3FA 1O97D 2J59A 4DJEC 4E5YA 2HK6A 2HMSA 1NY6A 1IONA 4FT4A 5F4ZA 3EVTA 3UV7A 4ALIA 2PLAA 4X3OA 2VTKA 4YIKA 1CIJA 3L8YA 3M1AA 1NURA 5CLGA 1V8FA 5DNYB 5JS1A 2ST1A 5ITVA 1PNTA 2YMQA 1AB5A 1X7YA 1YB2A 2A30A 3FGPA 1G2IA 1ULHA 3L1UA 1UPUA 2DHCA 3KVVA 5A3SA 3PA6A 3TKAA 1A9YA 2NNWB 4YNBA 2PBZA 2D2EA 5FRDA 2J7PD 1T8TA 1KH3A 2VRWA 2QVXX 4R54A 2VDUE 1KH1A 2B94A 4NABA 1F7UA 1CJCA 3HXPA 4FSHA 4EK9A 1V7PC 3DE7X 4YT2A 4WX2B 3KK0A 4US2R 3BRSA 3G13A 1FVFA 4BBPA 3KSBC 1FSZA 3JWHA 1CT9A 4M0KA 4UNSA 3VC7A 4LOHA 4DW8A 3IOBA 5COBA 2EV9A 3TQTA 4YREA 4F91B 4CL0A 2FPMA 2B92A 3ITEA 4ZO8A 1FA9A 2VHEA 3OFKA 2H07A 3QHPA 1V9CA 4IMJB 3STXA 2TSYB 4MEAA 4MQ6A 1CY4A 3ZUGA 3ZXSA 5HDQA 5I8WA 1UKAA 5DM70 4Z4EA 3CSDA 3T1OA 4CFZA 1FS4A 2VUHB 2VF2A 3E61A 3IKMB 1SMKA 1KSGA 1MB2A 2YRFA 2XUJA 3ROZA 5ELXA 4JMLA 3W2EA 4AQ7A 5C8YB 4HDNB 1NVXQ 1OXMA 5THQA 3WAKA 2GPSA 4LNAA 1H4SA 1S3IA 2WSIA 3HFJA 4Z9AA 2EGHA 5H68A 4EO9A 2JLWA 5FTLA 1LSSA 2FMIA 4JVMA 4YROA 1XT6A 2GXAA 3RSCA 4GZ5A 1DC4A 4FBGA 1DRUA 3PD1A 4YMHA 1PNVA 2DJ5A 1WVIA 2VP9A 4J76A 2JVJA 1VLVA 3UUWA 4CJXA 5BQ5A 2BBOA 1T3LA 3PDJA 3A9WA 1W0KA 5ALEA 3SHFA 4DCUA 2ZTUA 2J4CA 3ICVA 4FCVA 2QN2A 3BCRA 4TV8F 4YAUA 1HDRA 2E87A 4DV3B 3MMSA 2XQGA 3ZK8A 3A14A 1E63A 5JPDA 4JU8A 3WRYC 3UH0A 4GG1A 4XJSA 5KVAA 2WHQA 4JYZA 2FKAA 1EDDA 2X7XA 3LRPA 4N03A 3JWJA 3V4PB 4DGQA 3CH4B 3P9XA 3ZWXA 3I92A 3WVNA 3R9XA 1NM5A 1O54A 3G8YA 1H3FA 1PL8A 3WBJA 5KNBD 3HFRA 3ABRB 3IR6A 3OHSX 1SBIA 4PONA 1U8AA 4HUTA 3U0BA 3H3FA 4GI1A 2J0UA 2J5XA 2QSZA 4NEHB 4FIDA 5CX1A 3V4SA 2RJ3A 4LXQA 3WGLA 3NC0C 3ZY4A 4CPDA 5I01A 3L43A 2W90A 3ER6A 3WX0A 1SOVA 3H7AA 3H11B 1OHHD 4DQLA 1XMOB 1DWQA 5E3IA 4GGPA 2WWHA 4U7GA 1FSFA 1K92A 1QYDA 1ZZEA 2FG5A 1G19A 3F8TA 1HZJA 1Q0PA 2FEMA 2M9MA 4FOSA 5B2ZA 2H18A 1QZ3A 2V58A 3M4JA 4X41A 2VSYA 1LC0A 2ID4A 1W4LA 3AZOA 3R7AA 4WOPA 3LGXA 3SQXA 2J7KA 2YJ4A 4B9EA 2G6TA 2WVJA 4OH7A 4CCSA 1N0WA 4DXHA 3FR8A 1RYFA 1N2IA 1NHGA 5SICE 3B6ZA 3V6MA 3OE7A 5ITSA 1E8DA 2JFFA 1RPAA 1TDJA 4IJVA 3TRDA 4D0RA 4U7DA 3ZJ5A 4EKYA 2YJGA 5EJ7A 4GR9A 4UHKA 1QK3A 2XB9A 4COKA 4QXMA 3ET5A 1E9BA 5T3UA 2AN3A 2WIFA 3F4KA 4PLVA 4TL9A 3ED1A 3SJZA 3SYKA 1ZKDA 2C5AA 3FB1A 3R8FA 4I50A 1BHO1 4JP2A 3WJ2A 4YMUA 4K1XA 1GGVA 4OK5A 1QQ5A 2B4QA 3V55A 3ECAA 4ITUA 4AZSA 1UCFA 1MO3A 4FMDB 2ODPA 1D8TA 1T9ZA 2VDJA 4X1YB 3TX6A 1E5TA 5CBPA 3VYVA 1GEGA 3E58A 2JA1A 3P26A 3PX3A 3RKSA 1S1CA 3MGKA 3LVRE 4ZQEA 1T29A 3DTNA 2GCPA 5FR2A 4Z7NB 1BHSA 2B5VA 3SF8B 2QE7A 5DB4A 3TSZA 2LGJA 1M3SA 2GHIA 4OA8A 5EP3A 1QLJA 4CMEC 5IK2A 4UNRA 5BMVF 4JJ4A 4LBZA 4NE2A 2VTBB 1XE3A 4NCKA 5KOJA 1QKIA 1ADCA 4TV9F 4TN1A 3D4OA 2I87A 2P2NA 2GPNA 3LBYA 3I53A 3C39A 3NJRA 4FMDF 4RAQA 1BFDA 3DAOA 3D8TA 1Q2UA 3F67A 3LCVB 5FLKA 3MPOA 1QYRA 3PFHA 3VR4A 2CXNA 5B7NA 3UMMA 4PC7A 1VMKA 3JVIA 3V7YA 2PLRA 4C6RA 1I51A 5A6SA 2X3YA 1R2QA 2QX4A 3LUGA 3ZHVA 3OFJA 5A5GA 2H92A 5ETJA 1D6JA 2J4DA 2JK1A 3AMVA 1II9A 3JVUA 3HJNA 4BQPA 4ETNA 2WSSA 5BPHA 2OMKA 4DTIA 2X9QA 4WOBA 2NXNA 4FOLA 1RRPA 4PYOA 4XJVA 3EJWA 5BXQC 2BFCB 3DEKA 4QBGB 3L1VA 1KQFA 4X44A 5B1SA 2P5YA 4B40A 3BMOB 2B9VA 1M8GA 3CO5A 3D3KA 4CODB 4J4BA 4MUKA 4PLCA 5LCXA 4YJGB 4MR9A 1YE3A 3OM8A 3WMFA 3JZAA 5CFOA 1X39A 2IYFA 4BP8A 4QHTA 3DCIA 2EZ8A 3T06B 2B9EA 3H1TA 4REOA 3BBPA 4MCIA 4YP5A 3RT1A 4EI9A 1MJNA 3C48A 3EF0A 4NPAA 2A5GA 1CEXA 1PEDA 2E4UA 2EW2A 3SC2B 3WYCA 4BZQA 5L4LA 2PJZA 4KE7A 1E1NA 4R3NA 5B58T 5IFKA 1YZGA 3MGCA 3K4QA 3ZIDA 4DSAA 1L7OA 1N5LA 3JATB 1XO1A 3E81A 4KR0A 3IIMA 4QYWA 1PYOA 1PQWA 1D2RA 2ZZKA 1QHEA 4LHSA 3A3YA 4RWZA 4Y30A 4IGAA 1OA1A 2ON6A 1YD7A 1S8OA 2EGUA 2EARA 4HNRA 4H3HB 1F9AA 4DMGA 1ILEA 5F33A 2RHRA 4KACA 3UKJA 1ECPA 1SVSA 3KJIA 3LHDA 1GKLA 2IY7A 3F5DA 5FULA 2CNDA 3K70C 4C4YA 3EPLA 3P2IA 1O6BA 3EEQA 3F3YA 4TLMB 3QFTA 1NMSA 3D7NA 3DF9A 1O5OA 1V1RA 3F6BX 4Z5XA 2B8JA 3QI2A 2AWNA 1JUDA 2JD0A 4OIFA 3RUHA 1BXRB 1JR4A 2C59A 2DBZA 3K1AB 1L5NA 4MPPA 2ZS9A 1DADA 5AH0A 3QIVA 4U2CA 3H6HA 3AL0C 1L5KA 4NV0A 3ROKA 2W6MA 4R2WA 3R3JA 5EN4A 3IDSA 2ZUFA 1UBNA 4WJZA 3OIVA 3VPBA 1E3JA 1O9GA 2OAGA 1RYEA 2HZ7A 3LA6A 1ODKA 2XMPA 5A71A 3KYDB 2YR0A 1P7ZA 3B9QA 4MLZA 1K3UB 4GKVA 1Z4JA 4LTDA 4PIMA 3RUFA 1XGKA 2HTEA 3BFVA 2WYIA 1OWOA 4FK8A 3C14C 4UZEA 1KDRA 3HE3A 1M1ZA 1SPBS 1T4MA 1YC5A 3KVOA 3MF4A 3NX4A 4TRNA 4YJFA 1T5HX 2FA9A 1XQ1A 2CXRA 1Z4IA 2X0RA 2N1MA 3T3HA 5JC8A 1HLPA 1EH5A 1RZ3A 5K6AC 4CM7A 1TLTA 2WJPA 3EC2A 1E18A 2VPPA 3D1LA 1KAHA 3TLKA 1JPJA 1NBOA 2X5JO 5AICA 3SYMA 3W5HA 1CQZA 3WNQA 3CVYA 3I45A 4WCFC 3ID6C 3MWKA 1BYIA 1PFVA 1B00A 2YY5A 3UENA 4C9BA 2WU3A 2HBYA 4KGVA 4DHEA 2YNMD 3ANXA 3SQNA 3K0FA 5IXJA 2G72A 1Y8RA 2CFRA 3MMXA 5J2TF 3S3TA 4XYGA 4OFWA 4XPIB 3QTTA 2QN3A 1VL8A 2FX5A 2RSLA 1D7OA 4PYKA 4XIFA 4B33A 3T7CA 3DE2X 4FHCA 2NUTB 4AP9A 2HU5A 3DVAB 3VKUA 4EL5A 2Y4NA 2RHWA 5CLFA 2DLCX 1YR6A 1DJLA 4MV9A 5FOXA 4BTVA 3C45A 1G7RA 4MI9A 1QVVA 4QBIA 2I7DA 5JSHA 1SUAA 1IHYA 2IDZA 3ZD8A 1JEJA 3GPIA 4L8VA 4HV4A 5L4SA 1KJNA 1YCFA 2BEUB 3K9CA 4DA4A 2HN9A 4UJ5A 2GAFA 2XUOA 2AXQA 2NVOA 2O2YA 3S28A 3U37A 1IIBA 3VI3B 5I7SA 1GDTA 3P2MA 2QTGA 3PIDA 2ZYWX 1VCIA 4BE4A 5FBVB 3INGA 2AFVA 1BMTA 4UVEA 3ZGNA 2ZIXA 3WSVA 4RBNA 1P61B 3FR7A 1NPDA 1ORRA 1XVLA 2GUGA 1RWPA 3Q5GA 5LBTA 1YR8A 5LR6A 4RIEA 1OILA 3T7SA 1SVIA 3JQFA 4M0CA 4RFSA 1HZZC 2WSLA 1KJIA 2X9LA 1L7NA 4IJ5A 3BCHA 2GJAA 2AFIE 4IUCS 1Q14A 2JH3A 4MV5A 4NU0A 4Y9TA 3SSAA 3KT8A 3ODGA 2HOQA 4X24A 4UZSA 1E3SA 4AK9A 1W85A 1KO1A 1CJMA 4QJ4A 3I1JA 4P4UA 2RC5A 1M2WA 3JWPA 4J0IA 4AF7A 1AMOA 1CVIA 4L7VA 3A8TA 1H6CA 3QXSA 5KWVA 1W36D 4PSAA 5DRYA 2C94A 1C30B 3EPRA 3L05A 1PQPA 3AF5A 3KX2A 3R6TA 1WBBA 1E1RD 5ER9A 2Q5JA 1LJLA 2VSFA 2XRFA 4NU5A 1I8TA 2CUZA 4P58A 4F04A 3FTQA 3GT0A 3EAQA 3IH5A 3DMFA 3KVRA 3LWNA 1K3FA 4LG1A 3LWBA 9LDBA 2JGDB 4BVJA 1Z34A 1NF8A 2FQXA 1JMKC 2ZBUA 4RL6A 3H1BA 4JR2A 1S89A 4NV1A 2HDOA 3UMCA 2JGKA 4CLEA 1LF0A 2CNWD 1SEVA 3QYPA 1XLTA 1FJHA 3L7MA 4OYYA 3PFIA 3QWAA 1P1BA 1XVVA 3FVRA 3WIVA 4YGXB 2HDNB 3PDCA 3DP7A 2GEBA 1GG8A 5FPSA 5AIBA 1AT1A 1FP1D 4MW0A 4GYJA 4DBLC 5BR7A 5K8LA 2QG6A 5CGQB 4XVCA 3PFWO 5D5HA 1RT9A 1Y34E 3B48A 3VR0A 1KRWA 5FPPA 4RABA 3H2IA 2AX4A 1UBRS 3WLIA 2GCIA 2J5BA 3PNSA 1R4MB 1ZEMA 4K9PA 5TIIA 1WTAA 5HJ5A 5C7OO 2WJ6A 1XWFA 2X0DA 2CNBA 3TTUA 3GGPA 1P6QA 1J8DA 4NDNE 4UBJA 6REQA 1AKWA 4OXRA 5U9CA 5CCXA 4QPZA 1J7JA 1QBKC 4NARA 1UXHA 5FUQA 3BDIA 2EAUA 3DXZA 3PDWA 1KI2A 4IHJB 4C7VA 2PXHA 5DSTA 5FORA 3M82A 4AY5A 3E9MA 3JTEA 4L2IA 4JVNA 4EYGA 3UXHA 4A5SA 2ANBA 1T8YA 3DBOB 1Z15A 1FDWA 4LQ4A 1RPNA 1RI3A 1WSDA 2QTNA 1CQJA 1R0SA 1SVKA 4G86A 2DKOA 4TS9A 4RV9A 1WSAA 3IVAA 4JNKA 4KKVA 3H9CA 5L40A 3I5AA 3NYRA 4OYLA 1EE2A 3AY3A 2HF7A 1NBAA 4H6PA 2BM8A 1FUIA 2RHLA 4C01A 2K2QB 1C1DA 2SICE 1JJAA 3EEFA 3H8SA 5EIHA 4CQMB 2XMBA 3DQPA 1XTVA 4X92A 5JNTA 4TTIA 1ZLXA 3DUFA 5AQ1A 3ECCA 3IVXA 3BH0A 3FCYA 2IU6A 4YACA 5G41A 3RNOA 5CVTA 1P81A 2NZ8A 1XD2A 3DVQX 4MWGA 1OA0A 3QW2A 1NIPA 4RPIA 1QNLA 1Q77A 5JHGB 5C8DA 2X15A 3K6SA 3Q3CA 3O9VA 1PZXA 4QPJC 3NM6B 4WN3A 3UHPA 1A9XA 2BW0A 4JUDX 4ZK6A 1MQ8B 1X7HA 3QNMA 1WPGA 3LBHA 2JJ2D 4PZ0A 3DOIA 4HDAA 2FMHA 1OW3B 1ST2A 2PZEA 3B9BA 3BD8A 1ORVA 3ND7A 2BFOA 4TMTA 2NSYA 2AW3A 2HQBA 3NGXA 4U6NA 3EA0A 4YALA 2ZCVA 3CNHA 1R9MA 2QL9A 4DCPA 3BEDA 5L4NA 2J41A 2E21A 3FNFA 3USCS 1RD4A 2I1QA 4NAVA 2EEPA 3O7WA 3ZNOA 4F8EA 4TS1A 5AVSA 5HM8A 2BN4A 3PE4A 4W99A 4DIEA 2QBYA 1HF3A 3IESA 2W98A 2Q1SA 4WNIA 3RSZA 4XYMA 3V5NA 4QOEA 1CF4A 5KHLB 3G0BA 2RK6A 3EAFA 3ZW8A 1EGAA 1EWTA 4JSRA 2IH5A 2CDAA 5EZSA 1XEXB 4QDTA 2IU0A 3TBKA 5CDTA 5BP7A 5MN5A 1AQIA 3DYBA 1WB5A 2I7XA 3CBGA 1P7WA 1RABA 2Q6VA 4KQWA 4R9UC 5GV7A 4PBSA 2AOTA 3G9QA 1O9HA 3QM1A 1EESA 3EODA 1SD5A 2PH5A 2QV0A 3BXXA 2VQSA 2HXGA 3PXUA 1XXHB 4TXHA 2PZKA 3ND8A 4KQMA 3TZHA 4BO0A 3RH0A 5GZ3A 2DH6A 4TLAA 2QDXA 3KQUA 3UYKA 3HYRA 1M2EA 4FS3A 4GZMA 4RM3A 5DHAA 2J46A 1HE5A 5CX1B 5EMHA 4BASA 4CM5A 3BMCB 3KZXA 4I9UA 3WA7A 4LRUA 5EP2A 5IAJA 4IMRA 2X6RA 2XH8A 3B1FA 4C0KA 4ZJUA 3U44B 3IMFA 1YFJA 3TL3A 1HE2A 4PNEA 4F1WA 1JG1A 1RYBA 1SC1A 2NZYA 1TM4E 1FCJA 3KPJA 3FFXA 1Y3CE 3K1JA 1ZC4A 1DIOB 2JLBA 1U94A 3TJZA 3Q72A 5GIPE 1ZFNA 3MA0A 1TZKA 1Y8QB 2HO4A 1RWNA 4YN3A 3SR0A 5K8JB 1LPAB 1QGUA 3JV7A 5CCDA 1EXDA 2YIJA 2QMQA 2JKYA 5EMJA 8OHMA 4OP3A 1ZUNB 1ZVJA 1JQEA 3MWFA 4P2BA 4D3YA 3L40A 4HDMA 5HQ3B 2FK8A 3O1HB 1RFGE 2C00A 1X1DA 4M8KA 4LQCA 1BS9A 3NJ8A 2EDAA 3WAJA 1XI2A 3D6VA 3E8SA 2VPYA 2R1VA 4J8PA 4DBLE 3Q4GA 1EA5A 5F7XA 1KMQA 2RG1A 2WJ3A 3DLIA 3QPAA 4NDAA 4OQMA 4FU0A 1OH5A 1YHYA 3PQCA 1Y1LA 1AKMA 3WK6A 3JQAD 1G8YA 2XNJA 3DDCA 5FJJA 1KZ7B 2PQ6A 2PRIA 1IN5A 3CN7A 3FD8A 5IAKA 3RLIA 1KU6A 1YU6A 4EKIA 1RQLA 2OQIA 3CVVA 1XTBA 3C0KA 4WEOA 4AICA 4L5IA 3TLZA 1A04A 3BMQA 4JH0A 1PBTA 1LS6A 3COSA 3N5CA 5L9AA 3IJPA 4KQFA 4MYRA 1Q21A 1WCIA 1YQUA 4UTZA 4YXWD 1L4KA 2DUNA 1WDLA 1JIUA 4IJQA 4EO4A 2PXXA 5ILGA 3FNIA 3GLFB 4LF7B 4L0MA 2ZRJA 2JIQA 3AFHA 3JY6A 4XSGA 5U1PA 1CCWA 1LBQA 4CQNA 1LB1B 1NOJA 1XWIA 1G18A 4CDNA 5JDIA 1SOWA 1VSVA 1M6HA 3AY0A 3ETNA 1CJTC 3CRW1 3NHUA 4FFOA 1X7ZA 4JGGA 2EF1A 1HSZA 2B34A 3HGMA 1ISRA 1RKQA 5E4FA 1DKUA 1T5BA 2NYAA 3SR4A 1E1MA 1JDVA 2JCXA 2PKRA 3J81A 5LP6F 4UHFA 2BWJA 5G0VA 1HUQA 2VBIA 4PN7A 1WMBA 2JLXA 3C3AA 1G8SA 1FMJA 1TVMA 4MWSA 2CKDA 1OC2A 2ZSAA 2PZGA 5HKOA 2ZWMA 4JA2A 4YXWA 5DHUA 5LOVA 2C3OA 4N6NA 3L8HA 4RKYA 3S2YA 4YRGA 4EW1A 3A1NA 2GVZC 4JDPA 3UB2A 3FJOA 5FJIA 2TYSB 2XOXA 4MTCA 1SWWA 4GZLA 4P53A 4CU5A 3C6XA 3RVBA 5FV4A 1XNRB 2G08A 1W5BA 2XE6A 1DEAA 1DO2A 1ENPA 1NQTA 4YP1A 1V2GA 1HYEA 3PP8A 2KHZA 1XZAA 2OP0A 2PHZA 3KOZA 3QF4A 4O2AB 3A1SA 2FETA 4XX0A 2Q1WA 2WJ4A 4XDZA 2C95A 1T9AA 1Z74A 2WOJA 4I99A 1T1SA 5IEBA 2QIPA 3UANA 3ZE1B 1ECFA 5THKA 3E5RA 3BWEA 2JF0A 4CLDA 4E2WA 5AVTA 1WEKA 3ZIUA 1SR8A 3VYSB 1WA5A 5KTOA 3DF7A 4Q4DA 5TC4A 3FHTA 4JB0A 3E15A 1WXFA 1WUKS 2XA1A 3OJFA 4KYIB 4R6WA 2XDQA 4RTJA 1H0RA 4IIYA 3K5HA 3AUSA 2QVZX 2HL6A 5CEJA 4WLFA 3HKCB 1NY5A 1AUOA 4N6GA 5CJ2A 1U7TA 4KN8A 4J75A 1IIRA 1P0MA 3PXBA 2JI6A 1FXSA 4Y0NA 1TZCA 2IPMA 2D2VA 1C3XA 1OPXA 5ALHA 3O03A 1A9OA 1I2BA 1XDZA 2GF0A 4URFA 1UJNA 4KQJA 2BSQA 1R8YA 1Z4OA 2QTVB 2J33A 4MR8A 3EBPA 4OHUA 1GTMA 5CH3A 4TL6A 5CB4B 2F4VB 5C3UA 3VVLA 5CVUA 5DW0A 3TDMA 4B0OA 1KRHA 4E7PA 5K8IA 3UNXA 5LQAA 1RM0A 3DO8A 4ZVUA 2X4GA 4Q00A 2TMKA 2PFSA 2W4IA 2ZJ6A 1DRVA 3CW2A 5HEKA 5IHPA 2OXTA 2NT3A 5ALYA 2QW8A 2H1WA 4QBHA 1SWVA 4F4DA 2XNKA 1Z62A 1PZMA 2ZQ5A 1Y4AE 3MUFA 4H4DA 4LQDA 1UK6A 4OL0A 4G0VA 5IASA 1NWCA 2WIGA 4FNGA 1LLDA 2BOVA 5AOVA 3QE9Y 1X92A 4K9KA 1XXHE 3JYNA 4HEA6 5EZ5A 2F59A 1K75A 3O8QA 4G1UC 3VR5A 4BHTA 3V2GA 5HP4A 5J2TA 2O8DB 3ANMA 4AJNA 2ORVA 3FWYA 1ECCA 3OJCA 3CZRA 3M81A 3W77A 1XUOA 3Q1LA 4OB7A 3ZH2A 4KQ9A 3B9RA 3CEJA 4UEWA 4ZVSA 4FGJA 3VO8A 4WESB 5AUOB 2IHUA 2PANA 4G81A 4KZKA 4UULA 3U6BA 1GLVA 3DEFA 1PUXA 3DVLA 3KOYA 1P0PA 1DKOA 2I2FA 4FQ5A 4CEHB 4DCJA 3PSAA 4OB8A 1SQSA 2YXEA 3AR2A 3DSRA 3R7DA 1Y7TA 2B69A 4MIEA 1SQFA 3NO4A 4FTWA 4Q4HA 4WECA 5BVGB 4WGFA 1VG0B 1B8VA 2JHPA 2NN3C 4L8FA 4ZI7A 2VRCA 2D2IA 1B2LA 2Z3ZA 2W6IA 3I9V6 3PRYA 3I09A 3QKUA 4LEIA 4OG2A 1PWEA 3EWAA 4YAGA 5K3EA 5LU8A 3KVNA 1JR3D 3OC0A 3NP7A 4AW9A 3SLKA 1K98A 3F1LA 4ND8A 5GV8A 3WDLA 3R0XA 4EG7A 2R6DA 2J3IA 3IMKA 3P9NA 4KH0A 3K8OE 4L95C 2DXIA 1D0IA 3IP1A 4QXQA 1NFQA 1OFUA 3THOA 1E0KA 3WL8A 4YYEA 5T6MA 4XSHA 4CIWA 3QXJA 3EWSA 3C7TA 4G1CA 1T4GA 1TFUA 5A6VA 1ZGCA 3KXIA 1EX1A 5FTWA 2OCKA 2D5CA 4RHUA 5EI5A 4DRXA 2HIGA 4MW1A 1G8PA 2DLDA 2I66A 4JBXA 4TTVA 2HV8A 1WU8A 4DEVA 3PXAA 5M34A 3OZUA 2AUNA 9ATCA 5FWXB 4BJ6A 3Q9SA 4U1RA 2C9ZA 1PJ3A 4Q0MA 5EFOA 5IG2A 3SD7A 3ST7A 2CL7X 2I4NA 1G5QA 2VHUA 1JAYA 4MEBA 1B0AA 1X7DA 4OFBA 4O3MA 2WHYA 3T4UA 2IQ5A 3GJRA 1QIIA 1YS6A 2NLOA 4L3WA 4IYJA 4KWHA 4XDHA 1KI7A 2QLNA 4QSHA 2RDMA 5JCPA 3CW9A 3TAHA 1OZHA 4A23A 1GJRA 3W5UA 1WU7A 4IS3A 2X58A 1ZA2A 1L8OA 3N2YA 3LSYA 3U3JA 4J3NA 1U80A 4WKOA 1HKHA 1OGIA 2DMRA 4B3JA 5BW6B 4H6XA 2RHDA 4L5AA 5LQKA 4DCCA 3IKTA 4UTXA 4XARA 5COAA 2QVBA 2CVPA 3CN9A 3L8MA 4EKGA 7REQA 2HA2A 3LP6A 4IR7A 2HWYA 4E1AA 3T94A 1DIRA 2JGDA 3OT5A 1L8QA 4ZV9A 5C81A 1JJIA 3C3KA 4Y1FA 1RLTA 4HL6A 3U62A 3MERA 2PL1A 2VPQA 4B80A 4IJKA 3FOWA 4M7PA 1I2ZA 3AGQA 4U6SA 3JQDA 1KQPA 2DT5A 2QRHA 4HP8A 1UDXA 3B1XA 1N7JA 3A3KA 2IYVA 1VA5A 2PGIA 4MP3A 1R5NA 2MR6A 4GEGA 1UKZA 4XR9A 1SUCA 5EEHA 721PA 4URXR 4R2KA 1J9EA 3LLVA 1KI9A 4IF4A 2Y2VA 1CR4A 3BM5A 3F46A 3IAXA 3HZOA 3EIEA 3K0HA 3OX2A 4L9AA 5G1NA 3ZNPA 2JI9A 3DAGA 2QT1A 5DTEA 1VCNA 1R4MA 4Z0NA 2GZ2A 3MPUA 3RS4A 2JCYA 2QXYA 1DBWA 3EXIA 4PG5A 5BQXA 4TZKA 2H29A 4RKEA 1ZVQA 1NN3A 4MQLA 4NYJR 4O08A 2JIZD 2PKQO 2IBTA 3MTDA 3RS2A 2WZCA 4IZ6A 3MJSA 3TTTA 1Y6RA 4YXFA 3UT5A 4AZ0A 4KXUA 1CJBA 1X1TA 4GOOD 4G65A 5K3DA 4FEAA 1MAAA 3UMSA 5K9ZA 3GLRA 1KJZA 1JTFA 3T5PA 4LPSA 2ISQA 4RK6A 3TGLA 3PEYA 1YC2A 2JBAB 3CR3C 3TOZA 4REQB 4BIIA 4TOIA 2V7UA 1P3Y1 2VJOA 4KN5A 2PO7A 4MV8A 4AWXA 5JZOA 4HNVA 4RHEA 2NVBA 5FXMA 1P18A 3LU1A 1L5LA 2WKWA 2W58A 3K0CC 3QYJA 3R23A 4EARA 1Z2OX 2VPWA 3BREA 3ZH9B 3GJSA 5HFAA 1RRKA 4B44A 2B8EA 1C30A 4Y6RA 4DKXA 4C04A 4FI3C 1A88A 3GYBA 2VDKB 2QZ4A 3I9NA 2IVFA 3L3BA 3PHIA 2ZU0C 1MCZA 4CVNA 3O1LA 1A9QA 1E2FA 1JKXA 1ML4A 1MTZA 4UE6A 2ZUUA 1ZIOA 4WXPA 1AA6A 1VLLA 1OTHA 3PR2B 4FFSA 1QAMA 3K20A 4KHZA 1WUTA 4FGKA 2OLJA 2I22A 7MHTA 1M34E 2PA3A 1M2VB 3BHNA 3ANYB 1KSHA 3DL7A 2I6SA 3M6VA 1PK9A 3QELA 1E1LA 2Q5QA 3PQ8A 1ZNZA 1KJYA 3IO3A 3ZCSA 2OGUA 5EHQA 3F3KA 4R8KA 4D81A 1QF9A 1VQ1A 5FT9A 4EYOA 4YB8A 5DTRA 4R2LA 2QA5A 3H11A 3KZ1E 1VJ5A 1VLMA 3NEYA 1XA3A 3AESB 4EHHA 1HTBA 5BSTA 3HBMA 3LC0A 1K5HA 5BV7A 4AI6A 2NUAA 2CFIA 4TRJA 3TW4A 4IDEA 3W3AD 1P2FA 3GG9A 4L07A 4PWYA 5B6IA 2MU1A 4LDJA 3TIVA 3SU8A 3QEKA 1O5IA 3RU3A 1N2CB 1ZOPA 2G5GX 3ZK7A 3NIGB 4AQDA 1YIOA 1P39A 3NALA 3DBVO 4RYLA 1RJGA 2QDKA 3VA7A 3HCFA 3SHVA 1PEKE 3PFNA 4N54A 1G3IA 3FHLA 3JD3A 1RWOA 4I5GA 2AWOA 3PD0A 4N65A 1KE1A 4E1VA 4DZRA 1TMKA 3R75A 3E9CA 3LCRA 3DWIA 5BOVA 3PFKA 2IUTA 2OV6A 3QHQA 4Q24A 3RGWS 4PSCA 3BJEA 4MAFA 1L5FA 5TRTA 1L5ZA 4LYEA 5H3LA 1XNGA 2M1XA 2JAXA 1TU4A 1QB8A 5I5EA 1J2RA 4EJ2A 3CISA 2WAYA 3B3FA 5KZMB 3T1HB 4C6TB 1A2KC 1KA9H 1WULS 3EIFA 4KFTA 3RREA 5BSVA 5L95A 3U44A 1BA3A 1DO0A 2CUKA 3IRVA 3B2NA 3BK1A 1AF4A 4DV4B 2BGWA 1XA0A 2QTFA 4YJ2F 5LDHA 1EFCA 3H5NA 3DBRB 3OQ1A 1I6MA 2ZW9A 4FMBB 2YASA 1E32A 2ASEA 2OCBA 2O0LA 2VYQA 3NT2A 3NBZC 5FO0A 4Q12A 1B7GO 1Z5WA 1YXMA 3AM3A 1FNSA 3EZ9A 4HB0A 1HNWB 3A6FA 1AQJA 3TAUA 4RU1A 1ZS9A 4QEZA 1NBHA 4ALNA 3LC7O 4LZJA 5MDHA 3UN1A 1KOFA 4GM0A 3WGOA 1BRMA 3MTGA 1GTJ1 1ZOSA 2NO7A 2H9IA 4DIFA 1EXWA 4ZYTA 3MTEA 4DS3A 3K73O 4WBSA 2WV9A 3ZDAA 3U19A 1Z8NA 2GM5A 5AJZA 3O47A 4X1IB 1KHTA 4GP6A 1WKCA 1RLJA 1YH3A 2ZWAA 1TEXA 1IXYA 1SVMA 3GRCA 1URPA 1X1BA 3LIIA 3VH1A 5EE9A 3R74A 2YZKA 4P7FA 3LQ2A 1UEJA 1IZ8A 3PIIA 3WSWA 1L5HB 2XT0A 4PYJA 1Y89A 2FUEA 4LXHA 4MMZB 1OH7A 2Q5FA 4YAWA 3HQ4O 5IBCA 4KREA 1EM8B 1PSZA 3V3KA 1KQOA 1QO0A 4E08A 3QPVA 1SC9A 1EWYA 2HLDA 3I9LA 4FR5A 2WJIA 1HFJA 4KL8S 1QPZA 5IAOA 3DE3X 4MUAA 1H2XA 3WLOA 3AVXA 4GKJB 4KFUA 2WY2D 1UBUS 4KQ2A 1W59A 4J4HA 5EVCA 3PT9A 3QPWA 4PTLA 4J1NA 3PVZA 3Q6IA 4N41A 1KBZA 3P4UA 2FRVA 3UGTA 3R20A 3QE3A 1IN7A 1F2UA 1S01A 3L0CA 1W34A 3Q7QA 4IRMA 4AZTA 1SIWA 4EKDA 4TMWA 4WFKA 4BNVA 1I3CA 4HAVA 4KRFA 1BGVA 3CX7A 4HDOB 5HQJA 1T1GA 1XMIA 2JFHA 1BFKA 2OXRA 1PR9A 5KCMA 4J0CA 2OFFA 3UCXA 2RARA 1BDMA 2B2XA 2B7LA 5JZ9A 1GAQA 4QKQA 3CCFA 2FN8A 1UAAA 4Y9RA 2REBA 3RAFC 4LBYA 1A9SA 1JDZA 5LOVB 3OPXA 1OZAA 4I66A 1O1YA 4NS1A 5D3MA 5CDYA 4YAEA 4YRLA 1H9AA 1Z37A 4W6QA 5DULA 3BZWA 4PYNA 3OQNA 4YDHB 1ESNA 1II8B 3AUJB 5TT0A 1X7WA 2ODTX 4ZOAA 4B7XA 5LIPA 2VSOA 3CCCA 4ZCMA 4JQZA 4J94A 1PJSA 2RI1A 1DINA 2XUGA 5IZCC 3I1IA 5IJXA 4F5WA 1FFGA 2OV8A 3UIEA 4J1TA 2X7HA 3VR3D 1Z7WA 3IEIA 4U9IS 1UJ5A 2VT7A 1LI7A 3FSGD 3GLHA 3RVKA 1C4WA 2FZLA 1YJQA 3QE4A 3RS0A 3ZX4A 2WNSA 3ER9A 1KP9A 4B43A 1PL6A 4AT1A 3TSOA 3Q7RA 3IR5A 1NVGA 3OZEA 1GNSA 1Z5NA 3FPHA 4UBNA 5EMNA 2D7DA 1SZDA 2IP2A 4JROA 3QVJA 2HQRA 4X85A 4INPA 3VPAA 3WMXA 3ZE8A 3B1KA 3DMHA 5LZ9A 1R9GA 1NVAA 3CLHA 5AW9A 1A7UA 1PJ4A 2JCGA 3FZGA 2N0SA 5CRIA 2IOFA 3ZGXA 5JAMA 3CF0A 4NVRA 3OY2A 3QXXA 2LZ0A 2YHBA 1M8KA 4K05A 4QU0A 4BX9A 2IEAA 2CN1A 2WAAA 2CLMB 3FN4A 1PS0A 4MXDA 1O9BA 4BKOA 1K7FB 1JN0A 1EKXA 1X14A 1FPMA 4WOKA 1Z08A 3GQVA 2Q4RA 2XGJA 4GOJA 4N48A 3ZQ6A 4E2ZA 2NZUG 4CIVA 5HGJA 2GSWA 2WUGA 1ACJA 3DAPA 5B3JC 1UINA 4A03A 4LHZA 1O94D 1U7ZA 4QUDA 5DN9A 2OHJA 3T3PB 4AWAA 3U7EB 3P5SA 4N5IX 4MB6A 3ZXYA 1BSVA 3AR7A 4FYMA 1W46A 1LC3A 1TI7A 2HUNA 2Q29A 5EIFA 4A8JA 1GRNA 2YRXA 3OEED 4WNCA 4YCCA 2HXYA 1C81A 3Q15C 5H8WA 4M3NA 4CF5A 1LNSA 1QBGA 1N77A 3TB6A 1VA4A 1PDWA 4XLZA 4FDLA 3OFSA 1KQNA 3RU2A 1RRCA 1P1IA 4Z2AA 1ZL2A 2GXSA 3AJAA 3MSCA 1GZHB 5GZ1A 2W37A 1EVEA 1Z68A 2XMRA 3JWIA 4QARA 2BLNA 4Y9SA 2A84A 2XTNA 4FYPA 4P8RA 1C80A 5CX4A 3HXTA 4ID9A 3D6NB 1YNOA 1A1VA 2W9XA 1P9OA 2ZQZA 5EUMA 1I0LA 4HHEA 3RTEA 2RD2A 4Z54A 3OCVA 4RETA 3LRXA 2FLKA 3IIJA 3K09C 5KKNB 4MINA 1D4AA 1JB1A 4JYBA 4QQRA 3GFOA 5CAEB 4KN9S 4EGJA 5ADWA 4G1EB 4QA9A 4C6SA 5T3YA 1U6JA 2GR9A 1XHEA 3U5ZB 1PV1A 3R3ZA 2IV2X 4P22A 1RQ7A 4DLPA 2EX1A 1TEVA 2GAOA 4DSNA 4QFBA 3UZUA 1LPNA 1JDBB 4G9EA 4J0FA 3TQFA 4BATA 4EOGA 1W87A 4EY3A 3ZCVA 4MRAA 3L0IB 3IOMA 2KJQA 1SIBE 1YR1A 2WT4A 3I28A 4LGMA 4XGIA 1ZRNA 4CTMA 4XWAA 3FIUA 4ZT3A 3L1KA 5EZYA 4BGUA 3DOHA 5A05A 1H8HA 4JLBA 1AQUA 4IWXA 1L0BA 5IAAA 3AEQA 2IDMA 3B12A 3M33A 2ENWA 2WJYA 2ZU6A 2O8FB 2B6NA 3C24A 2W83A 1NR7A 5CK4A 4ZOQI 2PXAA 4JOBA 3M0EA 1MC5A 1JXQA 1B73A 1GAWA 2PA0A 1JSCA 2HH9A 3NQ41 4GE3A 1QAQA 5AW4A 3PD7A 1QG0A 4FWBA 1VKZA 2KMLA 4QYIA 3KQNA 3EDYA 3IBYA 2BYTA 1HOTA 3NIBA 2REQB 5DW3A 2DQKA 3MTBA 2P9YA 3D31A 2RHBA 4MIKA 4XB2A 3KHSA 3VJKA 3GLHB 1E7QA 2DPMA 2EG9A 3D3WA 3DD1A 3O82A 5IXYA 5BORA 2FF5A 3BFPA 1P5RA 5JLAA 3L0PA 5LQRA 5TQ0B 3VI4B 2P91A 4GE0A 3UJAA 5L3VA 3NLLA 1UP6A 1HYGA 1KR2A 4D56A 2I6QA 3RWOA 3VVCA 3LUCA 2ZTLA