5TS2A

Crystal structure of a phosphopantetheine adenylyltransferase (coad, ppat) from pseudomonas aeruginosa bound to dephospho coenzyme a
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
165
structure length
165
Chain Sequence
AHHHHHHMNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
publication title Crystal structure of a phosphopantetheine adenylyltransferase (CoaD, PPAT) from Pseudomonas aeruginosa bound to dephospho coenzyme A
rcsb
source organism Pseudomonas aeruginosa (strain lesb58)
total genus 59
structure length 165
sequence length 165
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2016-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 5ts2A00
4CDNA 3FHJA 2CYAA 1K92A 1KH2A 3P0IA 4MW2A 1U3DA 5J5AA 1JEDA 1O97C 3RFFA 3VRHA 3TZEA 1MC1A 3HL4A 1IFXA 3L92A 5LFAA 1NZJA 5DASA 3ZJTA 2D13A 2QTNA 5HG0A 3KT6A 3CLRC 3TQOA 4NAHA 1Q11A 1IH8A 3UMVA 1S4MA 5DK4A 1EFPB 1H3NA 4NX2A 3MLBA 4EG6A 2VTBB 1B6TA 5TS2A 3PXUA 3FETA 1U3CA 1J70A 1O94D 3G6KA 3QE4A 4JFAA 1JECA 1QTQA 2AKEA 1RQGA 3RHSA 3AIIA 2B7LA 2AG6A 4EG3A 1GAXA 4E1AA 3A4IA 2PXHA 4MW7A 1DNPA 3ZXSA 2J07A 1JIKA 2VXOA 3RK0A 2PIDA 1YIDA 2DLCX 1KR2A 4R2LA 4DJAA 2JA2A 3PRHA 4ND7A 1JEEA 1ZUNA 1F9AA 4MWDA 3SZGA 3OTWA 1IQUA 4U63A 3P0HA 3H99A 3A2KA 1MAWA 5KWVA 3GUZA 2TS1A 3X1KA 1JILA 5AHWA 1G8HA 3GMIA 2YWCA 1EFVA 4UZEA 3IUEA 4DNXA 1D2RA 2RE8A 1OWOA 1QRTA 5BNZA 4DLPA 1P7PA 2J08A 3S3TA 1J20A 1XNGA 1N77A 4JXZA 1MBZA 4OUDA 2E18A 4MWEA 1TYBE 5K0TA 1N2HA 1FFYA 1XNJA 3HV0A 3N2YA 2OV4A 2DERA 1JZSA 1QQTA 5H7XA 4X0EA 1TQ8A 2XRZA 3MUEA 4MW4A 4ARCA 1COZA 1EE1A 1JHDA 4HK4A 3IMEA 1H1TA 1NURA 1QJCA 5J59A 3CVXA 1R6XA 3MMXA 2DPLA 1GTSA 3ELBA 4YBRA 3CVYA 2X1MA 3MLAA 4DDKA 3LCJA 4HJRA 5TEVA 4AQ7A 1IQ0A 1OD6A 1M8JA 1N2OA 1XNHA 1YUNA 2PG3A 4ZT2A 2A88A 3CLSC 2DR2A 1QU2A 5LLTA 1KP2A 1VL2A 3FG9A 2X3FA 2IP1A 1IQRA 4ZT7A 2GM3A 4F3RA 1M8PA 1I6KA 3KT0A 4ZT4A 4UZFA 2DUMA 1WOYA 4PBSA 1N2JA 3FNRA 3LOQA 4MWBA 3FIUA 1O96B 1G8GA 3IOBA 4KPUB 3COVA 1OWLA 1GPMA 4J75A 1T6ZA 5KHAA 2DXIA 1Q77A 1KP3A 1KAQA 4WNYA 1V8FA 5JBNA 3UC5A 1VLHA 2QUJA 4F4HA 1PG0A 3RK1A 2PZ8A 5LM3A 1NYLA 1NUUA 4ZT3A 3DPIA 4EG8A 3VGJA 1TYDE 1M83A 2PZAA 3SZ3A 1H3FA 3CVVA 2RD2A 4MW6A 2PFSA 3ZXIA 1BS2A 1EUYA 4MLPA 2E21A 3GLVA 1O94C 3I05A 4BWVA 1ZH0A 3SDBA 2R5WA 2CV1A 2ZP1A 1X6VA 2CUZA 3VU8A 1GTRA 2CSXA 3IH5A 3PNVA 1F4LA 1WQ3A 3Q12A 3INNA 2HZ7A 4MUJA 1OWNA 4S1OA 4HPWA 1WXHA 3IODA 2V0CA 2WQ6A 1MAUA 2HGZA 3G5AA 1QU3A 1M8KA 1LW7A 4XFJA 1NUTA 1GLNA 2QUKA 4GRIA 1XJQA 3H05A 4NDAA 4JYZA 2X1LA 1EFVB 3BL5A 3FDXA 4KR6A 3ND5A 1K4KA 4JZYA 2A1UA 4DDMA 1U7DA 3F3MA 5KCMA 3AL0C 2ZUEA 4I6JA 1MB9A 3NBAA 4KR9A 4U8HA 4OUDB 1NI5A 4DE5A 5FO0A 2D54A 4MW0A 2IELA 1JIIA 2X0KA 1M8GA 1J1UA 2CYBA 3N8HA 5J58A 2J5BA 2E89A 3ND6A 1HYBA 3RBAA 4ZCRA 4PY2A 4U7JA 1NUPA 3IOCA 3AKZA 2NZ2A 1OBCA 2H29A 4JXXA 4MW1A 4WSOA 2A1TS 2A86A 1EJ2A 1G59A 1Q19A 1NUQA 3C8ZA 2GOYA 4XFDA 4K0RA 1JGTA 1TFUA 3CA8A 1U0BB 1ULHA 2A1TR 1O0CA 2IJGX 4GU5A 1WXGA 3H9CA 3NBKA 3H97A 1J21A 1TYAE 2QTMA 3HMQA 2DETA 1MJHA 1N78A 3PNYA 4MQ6A 3COYA 3PNBA 2Z09A 1N1DA 3QTBA 4OJMX 1JZQA 2O8VA 5TGTA 2CFOA 1KAMA 3FH0A 4ZCPA 4ZCSA 3N05A 4K03A 1OWMA 3E27A 3FY4A 1KH1A 1PFUA 1T6YA 2A4MA 5EKDA 3CLTD 3D6VA 3SEZA 4NATA 3DV2A 4EG7A 3OP1A 4ZT5A 3HZRA 2BYTA 3IVGA 1MB2A 1N2IA 1YI8A 5FO1A 3IMCA 2HMAA 1I2DA 2WB2A 2H2AA 3L93A 2JANA 4QREA 4XSVA 4CDMA 4EF6A 3A05A 3FI0A 1MRZA 2C5SA 3DO8A 4H3SA 1WZ2A 3SEQA 4MVCA 4MUFA 4EG5A 4YP5A 3CLUD 3FWKA 1WKBA 1KQOA 2CV0A 4PBRA 4MUHA 3KT3A 4L2IA 5TEWA 1NP7A 1ZJWA 4RPIA 1R6UA 3IUBA 4QBTA 4YP7A 1IVSA 2E0IA 3IDFA 1JMVA 1PG2A 1PFVA 1TYCA 1KQPA 3UOWA 1O95D 1G8FA 2J09A 4YP6A 2BTEA 3HGMA 5HUJA 1YULA 2CT8A 5HUHA 3TNJA 1T9GS 4MUEA 1MOPA 4R2MA 1O96A 3JXEA 2A7XA 3TS1A 2A1UB 4I6GA 1I6MA 3SYTA 1YIAA 4FZJA 2A84A 2QJFA 4MAFA 1A8HA 1TEZA 1T9GR 3Q4GA 4KKVA 4EG4A 2CYCA 1U7XA 3P52A 4KR7A 4ZT6A 3ND7A 4Q93A 3IVCA 4CQNA 1K97A 1M1ZA 3IMGA 3AG5A 5DEOA 2EL7A 3COWA 4R0NA 2NSYA 1EXDA 3ILVA 4AS1A 1WY5A 1PFWA 4MUNA 4G5FA 3HFJA 1OWPA 2I1LA 4QRDA 1QRSA 3G59A 4G5YA 2Z3VA 1Y42X 2D5BA 1N2GA 3P0JA 1GZUA 4MVWA 1O97D 4ND6A 3RJZA 4ARIA 1PFYA 1WXEA 1J09A 1WXIA 3U1VA 1JIJA 1CT9A 4CT0A 3UY4A 1OBHA 3N9IA 1O6BA 4MW9A 1EFPA 3CLRD 4A91A 5F23A 2VTBA 5H16A 5DB4A 2V0GA 4ZCQA 3KFLA 1WQ4A 3UK2A 2QJTA 3ZIUA 1KQNA 1UFVA 4EG1A 1LI7A 4EFKA 2G36A 4PBTA 4MUKA 1YUMA 1VBMA 3Q10A 3A04A 4TS1A 1M8FA 1O5TA 1T6XA 1V47A 4Q16A 5IJXA 3ZJUA 1H3EA 5K0SA 3CLTC 1O0BA 1R6TA 1N2EA 3AFHA 3NV7A 4MW5A 4I6EA 1I6LA 1LI5A 1VBNA 3D6UA 1F7VA 2QTRA 2O5RA 1NUSA 3M5WA 2GKSA 2AZXA 3QTTA 4MVYA 4MULA 3CLUC 3TQIA 3COZA 3X1MA 4DDHA 2ZUFA 1IHOA 3KT8A 4MVXA 2CV2A 4EGAA 3IOEA 1FYDA 3ISJA 2QUHA 2YXNA 1K4MA 4L2IB 1KORA 1F7UA 4NAUA 3H9BA 4RUKA 1NSYA 1ILEA 2PZBA 3TZLA 1O95C 1ZH6A 4G6ZA 2JAXA 2WQ7A 1KH3A 1KKUA 4ZCTA 3AG6A 3ZGZA 4HJXA 2YY5A 1WXFA 2J4DA 1QRUA 1Q15A 2EJCA 3CVUA 1EUQA 1J1ZA 3IVXA 4P2BA 3ZUGA 2QUIA 2DEUA 2YWBA 1IRXA 4MWCA 1X8XA 1QNFA 4NZPA 1N75A 3CLSD 4J76A 2OQ2A 4MUIA 3SP1A 3ZJVA 5FNZA 4YMIA 1VBKA 1WJGA 1N2BA 3CR8A 3FOCA 1GN8A 3K9WA 3LE8A 3X1JA 1N3LA 1SURA 2QJOA 5IHXA 3DLAA 3CVWA 2Z08A 3MXTA 2WSIA 4KPUA 4MUGA 2XRYA 3K32A
chains in the Genus database with same CATH superfamily
3UF0A 1E4EA 4DVJA 4KUGA 2IYWA 1C8LA 3RUFA 3OZEA 4KDCA 5G0TA 3S55A 3P19A 3UMFA 1AKTA 3GA0A 4NAVA 3WSTA 6AT1A 2DBYA 3EIQA 1R0KA 3CH7A 3H2BA 3PQFA 2VK1A 2X6QA 3HKDB 1CUXA 4UZSA 4KNVA 4M55A 3RR2A 3UUFA 3VSBA 3ZCVA 2X19A 3W3ZB 4LI3X 5LUAA 4TWZA 2IVFA 2TYSB 4UUBA 2F3QA 3DKIA 3KJGA 2QTNA 1GY8A 2GZDA 4LV8B 4OP2A 2JFWA 3H75A 3MQFA 5L3SA 1RE1A 2GN2A 3MMPA 1I13A 4Z7OB 4TL9A 4DXAA 2H9YA 1AQLA 1OZHA 3AUJB 3TOCA 1H3NA 2Y0PA 4NX2A 4WKGA 1RKBA 3OLVA 5ENVA 4Z7JA 1HGXA 4RMGA 1N2CA 2ZI5A 1PZHA 2RI0A 2PGAA 3G6KA 3TAHA 4B35A 2Z2JA 1KY4A 4L15A 4EECA 1UC5B 3GRVA 4GOND 4M38A 2O0HA 1E9EA 4NJEB 2IYRA 2PZKA 3GFRA 2VF5X 4LKOA 4Q3CA 2OHVA 1DNPA 5FOUA 4PV7A 5DWQA 5K1ZA 4JEHA 1PV1A 1TM7E 1S9HA 2B6NA 1A8UA 2FSPA 3AB8A 3W4IA 1FRQA 4COOA 1LFAA 5HUQA 1XQWA 1P3Y1 1QGYA 2BFFB 5KSZA 4I5EA 2D7JA 3DLHA 1Q1GA 1ZVVA 1CR2A 2JHCA 2WF5A 3H99A 4LYFA 5AI0A 1GM5A 5CJPA 4V38A 1MX3A 3I52A 3PF9A 4YAOA 3QBJA 3LOPA 1Q12A 4QOEA 4XLZA 4WCFA 3X1KA 3TINA 3ZI4A 4CGZA 2RCYA 1DWOA 2ZTVA 3GMIA 1CZKA 1ZD3A 4RDIA 2GYYA 4KRFA 1B8VA 3IUEA 1N25A 2AX4A 4DNXA 4E14A 5K8CA 1IULA 1UKBA 3LDHA 4YJHB 5FHRA 2Z5LA 1TXGA 1KZHA 3PEWA 1QIIA 2GZ3A 2WWTA 2EFJA 1P7PA 3B38A 3O6VA 3OPYI 4HZIA 3S3TA 3WO0A 2NVUB 1KQFA 4YCBA 4HAWA 1PV2A 3PVSA 5B1IA 1TZ2A 4K1XA 4WERA 3GRCA 3IP5A 3IB3A 1H9AA 1VCHA 3JD4A 4IOKA 1YA6A 2O4UX 1ZUHA 5C8DA 3QJGA 4UD6A 3N2YA 4LOIA 4Z0TA 2DERA 1FRZA 5FI5A 3BIXA 1XDGA 2VJAA 2YOFA 4DNQA 3MWDB 2JBWA 3OTHA 3QKSB 4U9HS 1P2GA 5A71A 5LZ2A 2CFCA 3I04M 3TBHA 5B57C 1WDWB 3I9NA 4FEEA 4K3VA 5K3CA 2XQVA 2YTZA 3FD8A 4DJEC 3LCRA 2N75A 3NTRA 3EHDA 2DWPA 2PX2A 2Q27A 1GU7A 1NYRA 2O8EB 4C2UA 1NURA 3P97A 3F74A 4TV8A 2LBPA 4S0XA 1P19A 3KL4A 4UUOA 1Y8AA 4YJFA 2C97A 4OLBA 4GMXA 3H18A 3UKDA 3DDZX 2BFEA 2ECOA 3OQPA 3R9WA 4H0FA 4BNIA 2C57A 1I6WA 1TKRA 2C88A 2DJ5A 1DRKA 1U1EA 1WB6A 1DX6A 2B37A 2Z57A 3BMCB 3EMBA 4HB2A 3TNYA 3H04A 5EHZA 1J0DA 3TSOA 4ZKDA 1THMA 3UTDA 4IXDA 3RRFA 2IY7A 5AVQA 5ITZA 3LCUA 1UBJS 1PGNA 2I71A 1OH7A 4ZVNA 3ASVA 2C00A 2HMYB 4ED9A 3ODPA 4ZC1A 1M8PA 1ZJYA 3UEOA 1Z2EA 4BGIA 4F97A 1QF6A 5KQMA 4KDEA 4JUCA 2ZBGA 2B99A 1QC5A 1VI2A 4QTUB 4GLLA 5D3ZA 3T5BA 3THXA 5T57A 1OSNA 1A7UA 5FTKA 2JAPA 3TQFA 1H4TA 4GMFA 5EFOA 3L49A 4DANA 3MAGA 2BE9A 2WWWA 3K31A 2WSSA 2DXIA 3I6ZA 2WYIA 3JZDA 4XJVA 1Q77A 3QVKA 3O8QA 3H8SA 4N8SA 1X0VA 3BRQA 2Q29A 3ZY4A 1MQAA 3KQHA 3G8CA 1KI6B 2Q6VA 5D01A 3OT4A 3CUUA 4LX8A 5H5JA 3VHRA 1RAFA 1IN6A 3I37X 3PWTA 1PZMA 3BZWA 1QS0B 3D7RA 3HLYA 3HJRA 3X2SA 2BKLA 2DQ4A 1ZK3A 5T4HA 5DNUA 2Y3IA 4M83A 3S7TA 4DV3B 1Q7EA 1EUDB 2VK8A 1IVYA 3GP3A 4E5DA 1IONA 5CGQB 3N86A 1W2HA 3CR7A 1NAIA 5LC1A 4II3A 2JGDA 1Y1KE 4PZDA 5D00A 1TD9A 4KAXA 2QUBA 5AOAA 4BAGA 4CFYA 4UPEA 2A3NA 2CXSA 2H1FA 1UOQA 4IQFA 5FI0B 5B58T 4B5KA 4CMCA 1ZJ5A 5L7WA 4G0XA 4JOCA 3RVMA 4BASA 1N92A 2OHOA 4B3HA 2A9JA 2I4TA 1QCDA 2Y93A 4YN3A 3V7NA 3K92A 5EIAA 1FOEB 2IYSA 4MUJA 3O5AA 2IPMA 3PE3A 1PT7A 4HUJA 5C31A 2HIMA 2LCQA 3ZX4A 4G8DA 3PQEA 2FWPA 2PCLA 3AM1A 1N9KA 4G1UC 1SQGA 4CV1A 3OQBA 3K6KA 3G5AA 4RMIA 1OH8A 2R97A 1AXGA 1OXVA 1BS9A 2HC9A 4RULA 1FEZA 1X1SA 3B1JA 4TMVA 5KYGA 4LZJA 1I7NA 1A27A 2OZKA 2WAOA 1FFAA 3L07A 5HGXA 5IAGA 4B76A 1ZKMA 2FDCA 2E3JA 2A9RA 1ZMXA 2Y1XA 4EG0A 1YSCA 1FMTA 4RL6A 4MLDA 3CRMA 2FZ4A 1LZKA 3HJTA 5JH7F 1J07A 1O2DA 2XQKA 2AOWA 2UZ1B 3DOUA 3HUDA 1LPNA 4HTFA 2DR0A 4QJ3A 3HKBA 5JIBA 2WSYB 1RBZA 1GRRA 1SXJE 3PX7A 1EK5A 3DBHA 4UHDA 1OLUA 4WACA 2BKEA 4YECA 1M3SA 3SNHA 1R3DA 4KQWA 3BMQB 2X1HA 3FDZA 3QLUC 5T64A 4JD5A 2OYCA 3QY9A 4ZOCA 5TV2A 2O3RA 4EGQA 1EAYA 3UMCA 4HBGA 3ZDFA 1UCFA 4AF6A 5KOHA 3SSNA 5B4UA 3LFUA 1XHFA 4ZO8A 1YDGA 4RVHA 2DTDA 4NP6A 3UKOA 1L5QA 3PPYA 3CEAA 1Z4IA 2OWDA 3GVXA 1Q14A 3R6WA 5DWDA 4TLLB 3RVDA 3RBAA 1E4OA 3N28A 4L78A 4WY8A 4ZV4A 3OTIA 1QOPB 1E0SA 2N9UA 2JFHA 2ETXA 1ZIXA 3DFUA 5WRFA 2YWHA 1YI1A 2EFDB 5IK2D 4X6LA 4RKFA 3FUXA 4S24A 1SG0A 1H65A 1UBUS 1WUYA 1XZNA 4FGKA 2X0EA 2I67A 3BG5A 2CVPA 3OZXA 4UDNA 3L7BA 1II8A 1E3WA 4JJGA 1KGDA 1DUIA 2IYUA 2WB4A 3BGWA 1AA9A 3H42B 1ADCA 4BNTA 4F5DA 5BW6B 2X8WA 1DIRA 2HA7A 3RT1A 1E18A 5BOVA 5HR5A 1Z4OA 4XRRA 3BWXA 3KQUA 3INYA 4B8ZA 1RKXA 2QMHA 3NBKA 5GM1A 4KDFA 4CTKA 5I4KA 3VNQA 2WV9A 3EZYA 5HRCA 2ONZA 4O5OA 3U3MA 1EX9A 2NX2A 4OYLA 3BEDA 1JKJA 2Z9DA 3DEHA 2H07A 4LTMA 2Z09A 1VHJA 4XJXA 1KL7A 5NLLA 2G07A 1JR4A 3NTLA 2QZZA 4UU0A 5CNMA 1FNSA 2JF0A 4CNBA 2GPYA 3M89A 4JL8A 1UOPA 1GRQA 4ZCPA 1B6SA 3FAZA 4GBGA 5FTLA 1T6YA 1XA3A 4HYQA 3UB2A 1J97A 2XPCA 2G04A 4DYVA 2P6UA 4TV9F 4FZ3A 1I4EB 2PR2A 1VJ5A 2XTZA 3K30A 4UAUA 5KNBD 2EW1A 1VL0A 3L6OO 3OMWA 3CW2A 2FJUA 3H11B 2RGNC 2GN4A 4JL6A 3ITNA 1LBSA 5KNLA 3ZPXA 1AUPA 4O4LA 1E0KA 1S2NA 1I3KA 4H27A 5M3BA 4YRCA 1WLYA 4J2TA 2JATA 4N82A 1LD3A 5GOTA 1FUEA 1NOIA 4AY5A 1XDWA 1XEWX 3DO8A 1WUIS 2DHRA 3FDJA 3KWJA 4IH4A 5LA6A 2X9LA 4CT5A 4I1OA 2WKQA 4HYTA 2RGUA 4HY3A 4CV2A 5CA1B 5F5NA 5K0JA 5KHLB 3I62A 1MJNA 2EATA 2RHOA 1V6CA 2DKOA 5MHTA 3RI3A 1UWVA 4MUHA 2KMLA 1BWPA 3RKUA 2IV3A 3IIKA 4H7IA 3L43A 2WMDA 1PFGA 4NBRA 3DMFA 3DCNA 3TOVA 3UC9A 3R4VA 3TSYA 2FE1A 2IDZA 2PA0A 1H8EA 2NSLA 1PG2A 1T8YA 5L4LA 2BONA 3BL6A 5AT1A 4H6VA 2ERCA 4RYLA 4YJGB 3PGKA 1Q16A 1VG8A 3HL0A 1WMAA 2C7BA 1Z0AA 1X7WA 2AZMA 4RKQA 3PDHA 3E81A 3RTAA 2LIPA 3GVIA 1OYWA 3JW8A 5I7VA 5DO9A 1TIBA 1JJFA 4YRNA 3OQIB 4XRGA 2FX3A 4AP6A 4UW9A 3DCJA 2NXCA 4N40A 5LQMA 4EQ6B 2W6NA 1GG5A 1J39A 1O96A 1W581 4R2MA 2Q2OA 1Z0FA 4ND2A 3I01A 2BBTA 3O9ZA 4W1PA 5FWYB 3VPDA 1D9XA 1HORA 2D5CA 1PJAA 1G9SA 3VU3A 1L9KA 3OAAA 1HOTA 2FR1A 2WAYA 1P91A 3GT0A 3NCHA 4JNCA 4MGKR 4WHMA 3U3OA 4CKZA 4UQLA 1L4FA 4U4AA 4GG1A 3OPQA 3DKPA 2H2GA 3G1TA 3CS3A 1PHRA 3ECSA 3P9IA 3PL5A 4YTEA 5JCXA 5LNK6 4CF4A 5A6SB 3L9WA 3DYBA 4ZRDA 2DJIA 4Y6OA 1FP6A 5KO2A 3ZWKA 1GGNA 3EEOA 2TMDA 4B6JA 2DPYA 5D3QA 3IMGA 1ORDA 2JRLA 2UZ3A 2WMYA 2HLDA 3DL0A 1IUKA 3ONEA 1FFXB 1TI7A 1SGWA 3GEBA 2GBGA 3EGEA 4KE9A 3VMFA 2G09A 4XYBA 3R5KA 2RHHA 4S1TA 3HJCA 5IXSA 2G70A 5G0UA 1DG1G 1H69A 4GYWA 4CHGA 1M1XB 3QEKA 4M99A 1L7XA 4GNKA 3QVSA 1CQIA 5F2OA 1NQTA 2C2XA 1VA5A 2FG7C 1WULS 4Q66C 4ESOA 2XIQA 1ZXLA 2ZBEA 4IYJA 2GBCA 3D0RA 1YVEI 3KP1A 1E89A 5TNXA 3MJFA 3TCXB 1CLEA 1Q5PA 2ZATA 2A0KA 4RWEA 4HWGA 1W1UA 4FKBA 2HXSA 3ABIA 5FLYA 2MMCA 2C0PA 3FHOA 2ZBDA 1GN9A 2PANA 3IUJA 2D1YA 4MQBA 2XUJA 1VC2A 4DA0A 3R8XA 2CNBA 2OLJA 2VWHA 4UEWA 3RC2A 1XFAA 3X0DA 4EOGA 3EVEA 3GUHA 2OCKA 1FPMA 1G3RA 1AH2A 1O5OA 3R3HA 2I6GA 3C4QA 2PSFA 5IAEA 4XPIA 2QL7A 2N42A 4BX3A 1RRPA 1CBUA 1RI2A 2YUTA 4OHYA 1NASA 1GPBA 5TX7A 4M8SA 2IOYA 2FDRA 2ZI9A 3TFWA 1VDMA 1GDHA 4K6FA 2B6HA 2X40A 3WICA 1P6UA 2BLNA 2IEAA 1NUAA 3CKLA 3KVYA 3JZIA 1BEZA 1S8AA 3P1JA 4G09A 4PQYA 2GJKA 4W9NC 4YYEA 1QFXA 2O0LA 3AR8A 3KQVA 3OKFA 1IDOA 1U2RA 1XXHB 2BFCB 2ONKA 2J59A 4HGRA 4GGPA 4IO0A 1DAMA 1I3LA 3I1JA 3SSMA 2D62A 3Q7EA 1YASA 3FM9A 4JWKA 3TJRA 1P5HA 1K8QA 3RIEA 4XVRA 3MBIA 5AOBA 3QTTA 3PQ6A 2O0KA 4IDCA 5ICMA 3JQFA 1PNOA 3FMVA 2HTFA 4ZV7A 2JI7A 3SM9A 3SS9X 5BOSB 1WF3A 3MINB 1NJ2A 2ATXA 3H4TA 3WYDA 1Z5ZA 1SXPA 1T8WA 3FROA 2AWNA 5BV2P 3D31A 1SXJD 1GP2A 4L2IB 1SUBA 5I9MA 4P86A 3IRVA 3RJ9A 4D82A 4QDKA 1WY7A 5JMTA 1C8VB 1CE8A 4IMRA 4IHJB 1E77A 2REQB 5AI9A 1Z45A 3SHQA 4I9GA 3VUFA 4BMYA 5JQGA 3RAGA 1PSDA 1DDGA 5CG2A 1KVRA 2NZJA 2I91A 1L5HB 2OOKA 3GLGA 5DLEA 1NN3A 2F1HA 4OF4A 2D2IA 2G25A 2PMEA 3ZCUA 3AHFA 1NT4A 1HFJA 1YRWA 2DUUA 2R7AA 2ARKA 2B25A 2ZRCA 3FZEA 1ZAKA 3F1KA 2OQRA 4MWCA 2ASVA 3BRSA 4V39A 4H0CA 1E1KA 5CT6A 5EY5B 3X1YA 3SN6A 2UVDA 1QDEA 5EMKA 3HABA 2ONYA 2BGNA 4IG4A 4WOJA 5KTOA 3H5WA 4BNMA 2YNMA 2KQUA 4D81A 1IPHA 3FPJA 3GT7A 3O8LA 1TCVA 4JBHA 4EFMA 4UU8A 4MS1B 1E6CA 2Y05A 4NESA 1IPEA 3S99A 1J8VA 5F21A 1EJBA 4JEUA 3DLAA 4N3GA 4LISA 2I22A 4BO0A 2PM8A 4RA6B 3NHYA 5ALFA 1U0EA 5LUBA 4FDUA 1C8KA 3WY9A 1E5VA 4WNAB 1E3MA 4K26A 1JDTA 3H0CA 1RVV1 4IDDA 4P7GA 3R7WB 1P9OA 1CJUC 1FJHA 1Q1QA 4DBLC 1QH8A 2I03A 5EHXA 2BAGA 1N9ZA 2NMVA 4OAOA 2YWDA 1P9WA 4HPXB 1P5FA 4BVLA 4ER7A 4DLUA 4ARBA 3W77A 4QDZA 5DW0A 3KPVA 4PANA 4DRXB 4K05A 4XEHA 1KU0A 3NM4A 3ZH9B 1P0CA 2B69A 2HUNA 4M9RA 3C3KA 3MUNA 3NEPX 4L4XA 4K88A 4F4UA 5LP6B 4P7BA 1MB3A 2ZW9A 1QYDA 1S4MA 1W73A 3QYPA 1Y6RA 1K8ZB 3GRAA 1H1LB 2AMJA 3FWHA 3UO8B 3ANYB 4YAIA 1B41A 3G0CA 4OMUA 3ZLBA 1L7AA 1OQAA 3G7SA 1YVDA 3SBDA 4UKDA 5D7BA 4MJ7A 2QS9A 4BPRA 1BOFA 3TKAA 5BUSA 5DCLA 1V6SA 1FY2A 2QMEA 3U3XA 1L3CA 1QG6A 1R4MA 1CUJA 5ICEA 3A4IA 4B7ZA 4WLOA 1ADJA 4M0EA 4LWZA 4HRAA 1KRWA 3GIDA 1NQXA 4JA0A 4YROA 3RVNA 4BMVA 4RIIA 4CDRA 5JY6A 1G2QA 4DDVA 3LW8A 3EBLA 3USZA 3R24A 4FIDA 4IH9A 4QVKA 4UVIA 1K6XA 4BN4A 3M6VA 3C6BA 3BFXA 2OCDA 3JR7A 1YVUA 4BO9A 4WPGA 5KWVA 2JVIA 2N0SA 3L6EA 4G8JA 2H7VA 1KJZA 1Z5UA 1XTBA 1LNZA 2AXQA 3AI1A 4RSMA 2I54A 1T1RA 3NYWA 1Q74A 2WWVD 1XQXA 5AHWA 4N3NA 3CX4A 4WVFA 1DC4A 3ICPA 2VUIB 4JGBA 4YASA 1G20B 3SK0A 2OGZA 5B7QA 1H4QA 4LF6B 1H9BA 1OWOA 2V6MA 4AUEA 2OAQ1 2O2XA 4BB9A 1T0PA 1YZVA 5BWBA 2A5GA 3EY9A 1MX9A 2VYND 2XWPA 3BJRA 5JVDF 2V7GA 3UAXA 3ZU4A 4BVFA 4QBHA 5K0TA 4KR3A 2ZOSA 4RMJA 3ME5A 1NKVA 1WMFA 2WUEA 3DFMA 2EFGA 1N5KA 1PT6A 3EF1A 4WFJA 2AR7A 1L0BA 3MMSA 1D9ZA 2BP7A 1LV8A 2MSDB 3LSTA 1IY1A 2FSVC 1X3SA 2ZJBA 2GAOA 3BA1A 4P8RA 4RAOA 3N2NA 2QRZA 4PFSA 4IICA 1C0KA 4HK4A 1RM5A 2AC2A 2ECQA 2Y9MB 3KQMA 5P8WA 3RS2A 1IXYA 4OHBA 1QH0A 1NOJA 4TT8A 3S2EA 2FSSA 5C8YA 5DI9A 2GLXA 5KYXB 5IJZA 2CZQA 3KOYA 3U37A 3DLIA 4B6GA 3CVYA 2ZIXA 1STOA 1O3YA 1O89A 4A36A 4BJ6A 5JXJA 1JEAA 3MRTA 4EBFA 1GG9A 4FX5A 3EEQA 2FPPA 1A9XB 3KHKA 5FPHA 2P0EA 5ILOA 4Y8VA 2OLEA 3C5EA 4CL3A 4HNUA 1R5JA 1GFZA 3KUKA 4ZT2A 2A88A 1Y4SA 2PUAA 3O21A 3PCTA 4PIPA 1KP2A 4CF7A 3DO6A 3T5AA 2WU4A 2IP1A 1IQRA 1E0DA 3IBFA 1ZA1A 3W2FA 3PENA 3R9KA 3WRVA 4CM7A 3SYKA 4J0GA 1OHHA 5E38A 1FVXA 3AY0A 3ZDCA 2IHYA 1AHNA 5DULA 3CNEA 4OQ4A 1UMDB 1BSVA 4BNWA 2JNWA 1U4SA 2G06A 1BCRA 2R8OA 3IAM6 4DR4B 2QTAA 4UXJA 3COVA 3KPYA 2J67A 5I7EA 1OWLA 4J75A 1YOBA 4PLTA 2C7PA 4ZWNA 4A0FA 2OZVA 2HPZA 4EGCB 4ZYXA 4HB0A 1IM8A 1VECA 1WHSA 4HX2A 4C05A 1KAQA 2C4WA 2FP4B 3WAJA 2O50A 2XOKA 1P9LA 1TECE 3FE2A 1EFTA 4RK0A 2BTQB 2C2HA 3JY6A 2QUJA 3HBNA 3P8ZA 3VH1A 1UJ5A 1E59A 1QYXA 3FB4A 4URXR 1UIRA 5A9TA 4UNRA 5EXXA 1U04A 3P9RA 4YV0A 5J4KA 1Z3IX 4RH0A 2W7TA 1X7XA 2PL5A 1Z6AA 3EOAI 1M83A 1ZM3A 3PNMA 5A03A 2REXB 2AOXA 3WLRA 4Z9XA 3ONWA 4FFRA 1F2UA 4H6WA 4TLMB 4UDYX 1CB0A 5E7IA 3RD5A 4IY1A 5FPPA 9LDTA 3W1WA 3L1KA 1GGJA 4LEIA 3FYHA 4IJQA 2I7XA 4KTVE 1C3OA 4OQEA 3HVHA 1LI4A 4I8DA 3O4RA 5DPMA 3AF1A 1JJ7A 1TU0A 1E62A 2CLCX 2YIJA 1K3FA 4LZZA 1FLDA 2YMPA 3OJFA 1OFUX 4WCVA 2D5AA 3NWPA 4M21A 4A2PA 3EXIB 1AUXA 4ARUA 2QLBA 1PWYE 1BA2A 2FZVA 1P1CA 3GFPA 1C1HA 3HVIA 3FOAA 3VU1A 1BFKA 2VHCA 2WTXA 2WDPA 5DMXA 3N3BC 4M6WB 4BLQA 4Z3KA 3B5JA 2XUOA 2J3KA 3JATB 2R8XA 1AO0A 5DMHA 5DNWA 3UJDA 1KYYA 2FWAA 2Q9BA 3DMTA 2XTAA 5B2ZA 1K6MA 2YQ5A 4JLWA 5DZSA 4MTCA 3NATA 3B1FA 1UJMA 3DWIA 3DZIA 4QHSA 2V6IA 3IP6A 3LHFA 4NDAA 5IN4A 4RA9A 3I73A 1MKYA 4CIAA 4KR6A 1KO8A 2RGDA 4NCKA 2GHTA 3DBOB 3TRJA 2WMNB 4H15A 4H1WA 3P9KA 2LKCA 3GNSA 4I6JA 4CM4B 1WTCA 1Z5VA 4TRMA 3GGPA 2QTTA 5I6DA 1X1EA 4OUDB 2VTEA 1CY2A 3QUQA 1NRJB 2HJHA 4QUAA 1Y80A 3PJDA 3TR0A 3KQLA 2KJQA 1GG8A 2JGMA 2O8CA 1F5NA 2J3HA 2DFNA 2YJTD 3QVWA 4CN8A 3DVLA 5B6JA 3C3BA 2JEZA 2VHEA 3OHSX 4MMXB 3UYLA 1BA3A 1WB4A 1H2ZA 4A5SA 3H3XA 1XTIA 1ECLA 1GZDA 1OXBB 2QTWB 4Q4HA 5NULA 4B82A 4PZCA 5KDOA 3NASA 4FUTA 3MJRA 3OURA 2BEVB 1P4HA 2PZEA 5AKXA 5HCNA 1L4EA 1K66A 4B80A 3D8NA 1NMEA 1SEPA 3ZHZA 2NZ2A 2ZROA 4GBED 1U7TA 4UM7A 3NG1A 3ABRB 1NW9B 4WSOA 4B2YA 1IB6A 2FF5A 3GAFA 1E4YA 3MSXA 5C34B 2RHDA 5JJCA 1U8YA 4CV0A 1Z5OA 3HUEA 3VNUA 3C8ZA 3HJNA 2V6GA 4HH0A 3IJ5A 2P5SA 1YB6A 2OB2A 1EVIA 2OFPA 4C0BA 3HCNA 2J9ZB 1X86B 2NGRA 3NO4A 4OHVA 1O0CA 5HX7A 2ZAYA 4CE6A 3LECA 1GUAA 4WAUA 1WB5A 2H5EA 1E3DA 1HL7A 1YV9A 4EB6A 3T99A 1ONOA 2N47A 5F1KA 4K9QA 4GYJA 1DCFA 3JQDA 4TMTA 1KEWA 4XSGA 4GH5A 3UCFA 4B87A 4GFDA 3AQ4A 4ZVSA 2AD5A 1XTRA 4EHHA 2EDAA 4LRXA 3KXIA 4IXTA 1TFRA 1FLNA 4OJMX 2ZIWB 4RKRA 3SM3A 4JLSA 1S2DA 3ACDA 1GNLA 4HWSA 5HPYB 3FCYA 2Z6UA 1D6NA 1KEKA 3ZQKA 1N5MA 1GQYA 2IYNA 4R69A 2AFHB 1CP2A 1PFUA 3BVPA 2B4KA 4MPJA 3GOQA 1TK2A 2EZTA 1C1XA 2R7KA 4B3XA 1WETA 3WNQA 1T9DA 2P77A 5B3LA 4CEIA 1KFBB 2FG5A 3TD9A 3WWOA 1DIHA 4LVCA 4C0QC 5IH7A 4TT3D 3A37A 3ZBQA 2QAIA 1GLGA 2CNWD 2H0QA 2NIPA 4P31A 1WZ2A 1EGQA 4UVHA 2IPOA 3T7IA 1DBQA 1UMBA 3DHVA 2XQJA 2Q41A 4Q3KA 3V1KA 5L6MB 2AMFA 3CPHA 4YNBA 4D5GA 4N7MA 5LN1A 3L4EA 3EA0A 5BWNA 1A9ZA 3KVNA 1Q57A 2B61A 2FFQA 4OHWA 2FEXA 1P2VA 1HNZB 5AICA 1YKSA 2NADA 1HYGA 2OHHA 3D8BA 3DAYA 2K2WA 3HVKA 3IUBA 4GR4A 5EGNA 4BU0A 1L5FA 3WK7A 3ZR4B 2CVFA 2FPMA 3GRKA 5A5EA 1HDEA 2C2WA 4R1SA 1KZGB 4ZXFA 1VE5A 2DQZA 1HDIA 1GXSA 3VKUA 2E6UX 3D1LA 2BFOA 2FKNA 3KEGA 1IZ7A 1VGQA 4EYEA 1F0YA 2AE1A 2HO5A 4IWXA 3FW1A 5ALQA 2CMGA 3LLMA 3NGMA 4A6PA 3UW1A 5E4FA 4R9VA 2BFMA 4BQNA 2JA1A 4ZOLB 1GKIA 4B83A 2Z56A 4FOSA 4DMLA 2OZPA 3GLIA 4ESEA 5BR7A 4JDUA 1YJXA 4ERNA 4MR7B 3IPAA 5GY7A 4FYHA 4PR0A 4Q0MA 5BSRA 5IAOA 4ZYUA 3GY0A 3ESXA 2A0XA 2ZI7A 4S35A 4EO4A 3R7LA 3M4JA 2ZZMA 4C20A 3JQRA 4P35A 4AMZA 1H6CA 4RH1A 3AY7A 3AW8A 4D8XA 2Z9BA 1KKMA 5AM4A 2ENWA 2C5FA 4YH1A 1I10A 3DOIA 1H2HA 3B5EA 2H1OA 5KMGB 3ZHBA 3AHHA 4D0LB 1TCUA 1PE0A 2A78A 2EKDA 2JCBA 2NWQA 4Q93A 4EHKA 3O4HA 4MV0A 1WHTA 3ADKA 3VVBA 3WLSA 4ZO6A 1XRPA 3JPYA 2FR0A 4ER5A 2FW1A 1SRRA 1NN0A 1CUHA 1PFWA 5AWFC 1XA0A 3QQ5A 4M9QA 5TC4A 3LUGA 4NOJA 4XGRA 2OB1A 2WBLC 2O2JA 4HX9A 2GVNA 2V8OA 5HE9A 2JBAA 3ABOB 1DWPA 2VP5A 1ISGA 5AHOA 5A02A 2CJWA 1HZZC 4AWAA 1B1CA 4MA4A 4R8RA 2Q5QA 2FZWA 1WXIA 3IIJA 4WOPA 3URMA 4EB0A 5C5DA 4LFAB 1KYVA 3QG1A 2O2YA 5HOQA 3U1VA 4NJMB 1K5GA 1CT9A 3QXHA 4OJQA 4C7OB 4G0UA 2Y1CA 4GI5A 2YL2A 3CKYA 3GFQA 2HSZA 2ZYSA 1TA9A 1L8AA 1E96A 3KEOA 4MV7A 2FQXA 1DUSA 2I62A 2I55A 3R0IA 4MDHA 3TZBA 5AW2A 4KQ6A 4C30A 3F6RA 2BSAA 3ZGNA 2NYAA 4M1WA 5IK2A 1G8YA 1GU1A 1ZEJA 2OD7A 4OHFA 5JD6A 4L6CA 3S1AA 3F78A 5CVJA 2H7XA 2GBPA 2FZEA 3EXG1 4M3NA 5JS7A 4PC7A 3IXMA 1TD1A 4TOIA 2OHGA 4RTQA 1VBMA 3NFRA 2CGEA 2OYSA 1F5SA 2AEMA 1MAVA 1NW8A 1JR6A 4Q16A 1M2NA 1XMOB 1TX4B 4JCOA 3GFSA 3RVKA 2C4VA 5LXTA 1NMZA 2GKOA 1O1YA 2ZGVA 4ZODA 1QV9A 1YJ8A 3A1FA 2WUGA 3C14C 4EDHA 4MS3B 4IAOA 2VZEA 1CXZA 1JDJA 4DWWA 5CA1F 4DSZA 4K0KB 3PFWO 1VRCA 1I6LA 1R6BX 2DFVA 3HDJA 2O1EA 5DWVA 4D8VA 1SY7A 2QTRA 4YV1A 3FDIA 1JBQA 4LVNA 4PSAA 5J5CA 1M6YA 2Y1KA 3A06A 3FJYA 4NYMQ 4OSOA 5CM9C 3T5DA 1UBLS 3BHNA 4AC9A 4B71A 5EGSA 3CSDA 2ZT6A 1P2UA 4LTNA 2Q0SA 3LXMA 4Y2VA 3TDKA 3UUWA 1HT0A 1O4VA 1SIUA 1VPVA 3L4KA 2EQAA 3S2IA 3T5PA 1WR8A 1GD1O 2VF4X 3H2ZA 1HOXA 1IHOA 1FYVA 4E4TA 5KNBA 1S5PA 1U8ZA 1FYDA 4LSZA 1TLLA 3QLEA 4QOSA 5EQDA 1H22A 3F98A 1ZCBA 2AK2A 3D7LA 5FX2A 5JG7A 3RHTA 4IJ5A 4KI0A 4AAYA 1PCXA 4G3XA 2Z2IA 4JJ7A 4D0GA 5CJJA 2YRWA 3N8DA 3DTTA 1SBHA 2YN2A 1QQAA 5HKBA 4P4UA 4CKYA 1YZQA 4LDNA 4YXFA 3NORA 4E2YA 5B1DA 2NV6A 1TF7A 2G1UA 2ZK7A 1YR2A 2X4DA 1I5EA 3TM5A 8MHTA 2GB4A 3HVJA 1DADA 4R2KA 5ARCA 2O5CA 5JDCA 3HBAA 2RHRA 4KQIA 3QE0A 1Z62A 1RWMA 5UKDA 5ESXA 5FR1A 3RAPR 2VKQA 1OU4A 1F1JA 4ND3A 3FSJX 3N6RA 4NMHA 3ZUGA 1WUKS 5JLJA 1XCBA 3C3XA 4EPTA 3WBFA 3CF4A 3B89A 4REQB 1Q1NA 5C8XA 2JFPA 1R16A 4AECA 2WM9B 2PYIA 3UJ7A 4KVZA 3MOGA 2O20A 4JKYA 4S0ZA 4V1CI 3CF4G 4YMIA 3MCAA 1ZCJA 4I3FA 3G8BA 4IHQA 3TI7A 1EFKA 2BEUA 1F38A 2CDBA 3LE8A 4WJLA 5CCEA 2HA3A 1QGZA 3RARA 2R84A 3AI7A 2CXXA 4PLCA 4MI6A 4WN9B 3U48A 2XUHA 1XMSA 4P5EA 1M2OA 4UBMA 1EHCA 4PW0A 1V41E 3ENQA 3UK6A 1L5MA 3VHXA 3X1XA 4BEVA 4BLUA 1VG0B 4EKEA 1K92A 1KH2A 4BRSA 3WFJA 3I5MA 1EESA 4C9BA 5BVHB 4GM4A 5T3UA 1HA3A 1P18A 4RWZA 4GF5A 1WW8A 1XRSB 1UM9B 1V3QE 3KYIB 3QVUA 4Q1DA 3KOZA 3KJFA 3L92A 4KR0A 1PUXA 2HXYA 2QGZA 1R4NA 4JYMA 1RMYA 4R01A 4BLOA 4G0QA 5BT8A 4AKGA 1X15A 5FXMA 3VZQA 5DN6A 3KYDB 4TZKA 4BP9A 2A9PA 2B1GA 3AETB 2OSBA 3WHLA 1J23A 1NBHA 1DAHA 3TQOA 2EKQA 2PSHA 3DLBA 3HCCA 3D8RA 1M6WA 2GAFA 5C1OA 2ZJ0A 1OLXB 1U3WA 4QLOA 3FWNA 4CTJA 1NLUA 3CSSA 5CVTA 3LX5A 4RCYA 1O94D 4AS3A 3PZBA 4RSRA 3CMCO 1I4TD 1AMNA 1OFVA 1G8MA 2B7LA 4O59O 2E4XA 2GA9A 1DARA 4E1AA 4EG3A 1FXWF 2X1VA 4FSXA 2H1IA 4MV9A 1XTZA 1TYZA 4HFMA 3V42A 2I3ZA 4IUCS 4U9UA 3QUCA 2ZSUA 4JBWA 1LPPA 4M7PA 3NALA 3OIWA 1D4FA 5JCJA 1PSWA 3K0HA 2GK3A 1PLJA 3TB6A 1X8LA 1ST3A 4OQZA 3VSEA 4R68A 2R47A 5C3UA 2QR5A 4G1VA 3SQLA 3BGIA 3SQNA 1MV8A 3AERA 2NZVG 3QV1A 1A04A 1PD0A 4AUMA 3WISA 1QP7A 3BB4A 2IV7A 1VFPA 4HXEB 3D8UA 1VYHA 4J3JA 5A5GA 3QYFA 4FXOA 3D3EA 4N03A 4N6NA 4RK4A 4IHJF 3EARA 4FK8A 3SXUA 4EKDA 3PTZA 4RE5A 1P7ZA 1HBJA 2OV3A 2QOEA 2WDZA 4INZA 2M2IA 2IIBA 5IZCA 3KC2A 1L4GA 5DGXA 2M1ZA 2VJMA 3V8QA 1NZFA 1LB1B 1TYBE 2X3YA 4EITA 2VKTA 1N0HA 3T38A 1XRRA 4BTEA 1QQTA 1ZVQA 4AMBA 2WTBA 2ZRMA 3HXKA 4QA9A 3REFA 4JBLA 1ONNA 5K0ZA 5AI8A 4ZQIA 1Y37A 1C5KA 5P21A 3W5AA 4C6SA 4MW4A 1T13A 1AZTA 2YV1A 5C81A 4YWHA 5LDHA 1WD7A 3WKAA 4QSMA 3A27A 1QAMA 3DTNA 3G82C 1PTJC 1RWPA 1BRTA 2PL3A 2WWYA 4ZAYA 4HWOA 2GZ1A 2J4FA 2IIPA 2LRHA 1QK4A 2AHRA 2P68A 2OESA 2Q8NA 4EHLA 1SXJA 1HTTA 3ELBA 2RSLA 4G5SA 1XC7A 2X1MA 4PIMA 1YS9A 3QBTA 2FPRA 3ZE0B 1LA2A 2IC5A 3NMUF 3A2MA 5D6OA 5K2OA 1IQ0A 1UPTA 3ZV7A 4IPTA 2H2FA 4ZZIA 3EY4A 1RC0A 4GWGA 1ZPDA 3ZCXA 3EH2A 2TMGA 3LUAA 1SBIA 1U2PA 1G7CA 3OT5A 4IXNA 4Q34A 1EM6A 2YFHA 2QSUA 3WO1A 3KUXA 3R7AA 3RE1A 3SLRA 5ADHA 4QQFA 4FJ1A 4JYCA 4GE0A 4ARVA 2VP2A 3ROZA 1PYOA 4WDQA 1DRUA 4PIVA 4Z8YA 1C3XA 2HF7A 3FIUA 3OKCA 5KSWB 4Z4FA 1PD1A 4CVNA 4D9IA 2EV9A 4LXIA 3IPRA 1TEXA 3D6JA 3BXEA 5EP3A 3MHPA 3AZOA 5EL0A 3V8VA 4X60A 4I1UA 3JARB 1SVIA 5PNTA 5LP6F 4JX9A 2HT1A 1C30A 1NJGA 2IUYA 4W7IA 3JAKA 4O02B 2GF0A 3U9LA 4DEXA 2QP9X 1POWA 1RHQA 621PA 3WAKA 1WBJB 1ZGBA 2PZ8A 1UDBA 4JC0A 3ZDYB 1SVNA 4MKXA 1NUUA 2NO6A 3L8HA 3LT2A 3ZYZA 3SMQA 1BWRA 1MLDA 4FDVA 3PRJA 1V43A 4PM4A 2PZAA 2GJAA 2ZJ8A 4LGMA 4XYLA 2MU1A 1H3FA 2XA1A 4IIJA 2RGBA 2GBIA 2H5IA 3MS2A 3PUYA 2A1IA 2XHZA 1C9EA 1P31A 3HB7A 3PNKA 4L5YA 1MOQA 3RF6A 5K6TA 3VPBA 3W3AH 1MO3A 4NZMA 5JVDA 1VIVA 3H2IA 5DNAA 3I05A 4PICA 3QELA 3B82A 2D0PB 2JJMA 4Y2UA 1Z83A 2NUAA 3F2VA 3CNOA 5AW9A 3T9AA 1ZR4A 4AO6A 5AUNB 3I4LA 1V1MB 4GQBA 3DCYA 2XBLA 4X8MA 4F5WA 5IYZA 3ZE7A 1WMBA 4P0QB 2R7LA 2VDNB 5I9TA 1GPYA 5DYGA 4CR7A 1US8B 4GBJA 1R1DA 5CLIA 1GQQA 4L8LA 1QLWA 4GC9A 3LPCA 1H2EA 3NDJA 2NU8A 5TMPA 4P3XA 4WRRA 3ZBPA 5I9NA 1YWGO 3E82A 2D2FA 1YS7A 3IEXA 3DULA 3IEPA 3SSOA 4CMKA 4KVGA 1FXUA 3T4PA 4CMGA 3ETJA 4KPGA 2WT4A 2BHLA 1IHXA 1ECGA 1M8KA 3CE6A 4OIFA 4RC9A 2AWOA 4W9RA 2G9UA 5DBOA 5B1SA 4UE3S 3S2ZA 4DNPA 4YT4A 1YZTA 3BQ9A 3JQ6A 2O07A 2ZUWA 1M2JA 3AIKA 3B70A 1FBNA 2OL4A 4J49A 2X1LA 4FYXA 4O2AB 3EZLA 4QDUA 3TI9A 4MYDA 2Q5HA 3N8IA 1F17A 4QARA 2YC4C 3IPCA 2JLWA 1ZI8A 2X9NA 1IY8A 1GGVA 3N7TA 3T7TA 1YBAA 1M34B 1TJ3A 1CUUA 4KI7A 3EIOA 1TF5A 1I2ZA 1SVKA 3EXEB 1HEIA 1F1BA 3F7TA 1NF2A 2JIMA 3LOUA 2Z6VA 3HXLA 1U2QA 2GXUA 3NANA 1DT5A 1JIIA 5DM0A 4D3FA 3M2PA 1JPUA 2WZQA 1SVMA 2HYDA 2CYBA 3BDIA 1G9TA 3ILHA 5JI3E 4TTVA 3MBOA 4I8XA 5FNVA 2AYXA 4YPOA 3NBUA 2R8RA 4H7DA 1XCPA 3U7EB 2Y0EA 3WMRA 3M4YA 1A9YA 2ERXA 2O1XA 3GCWA 4RPCA 2ZJ2A 3CF6R 2ONJA 3KR0A 4DRYA 2AZDA 2HBYA 1QHGA 2AN9A 1P1RA 3C8HA 3WRXC 5DNVA 4AMVA 1GT6A 1CWUA 4HZUA 2P75A 1ZOSA 3LUFA 2O9JA 1KJJA 4Q9JA 1JRLA 3QPCA 2GNOA 1XJ5A 3OJ0A 4IFIA 2PD4A 4BKQA 2ZUTA 1UEJA 3RQIA 5HYVA 3GPDG 1CVLA 3NKVA 1QRDA 2EEZA 4JQYA 2W4IA 3EAFA 2BZSA 4FDTA 4K0RA 4ZC8A 3RVRA 1GHTA 3NOXA 1A7JA 3DVQX 3EGDB 4BAZA 4YIHA 1Y33E 4RTMA 1Z8FA 2WJ6A 4MUYA 1QHSA 3KTAA 4DIKA 4DCVA 3R7SA 2ZYUX 4BXOA 3AM5A 2I2DA 3CRZA 4R84A 1PK9A 5CITA 3TKYA 4GHWA 1JQEA 5EE9A 4H7KA 1PRYA 4OMFG 3LRPA 4H17A 3WIBA 2RDMA 3KU1A 4CHTA 3TIGA 1ADBA 5J4YA 2XNHA 3RABA 4A1OA 3ZLJA 1XSEA 1LBEA 1YR6A 3SEAA 3QVVA 1NY6A 1QGED 1KAMA 2OUIA 4GI1A 5DM1A 2C7GA 2BV3A 2DBVO 3G8YA 5CVCA 3UAGA 1QQBA 2BMEA 2C4KA 4OBBA 5IT9A 3E35A 3IDSA 4YJKA 3U7FB 1OKKD 1DXHA 2XMGA 4G67A 5EMJA 2YMMA 4YLGA 4BZWA 5M04A 4UTRA 3PVCA 2RGYA 4UUPA 1L5OA 3GYBA 3K05A 4UEOA 2H2AA 3L93A 4OATA 2IYLD 2OO5A 2R44A 3RVSA 1Z22A 3ZY6A 2BFWA 4CDMA 1SZDA 2FB9A 4S12A 4I5FA 2ZRKA 2OORA 3FCSB 3FKQA 4KGDA 4A27A 3FI0A 3MVEA 2O8EA 1ZQ9A 4FSHA 4PYIA 4PONA 3MJTA 2WYHA 1J42A 4J0HA 3FUCA 4LK3A 3T9DA 1RJFA 4I1RA 2W00A 1A69A 1OYOA 5F2EA 5B1HA 1BKYA 3CRVA 4IJWA 5HTKA 4CLRB 4ALNA 5HIKA 3FPHA 3IVRA 1JSZA 1ARZA 5J1TB 2C1XA 3OTOB 2XYPA 3EFOA 3LKVA 2B92A 2VHYA 4DMFA 2PIAA 2GPNA 1XE3A 3F3YA 3PC6A 5FD8A 2I9KA 7ADHA 1KEEB 2A94A 4CKBA 1A77A 2F43A 3ZXUB 1BH2A 5B3AA 2RBKA 3TMYA 3OFVA 2OZEA 3V8EA 1NQAO 2VA8A 4I3GA 2FUEA 2VSXA 2UZ0A 1ORHA 3IP1A 4J0FA 1VJRA 1EK0A 3TWOA 1P2BA 8GPBA 1HNXB 2O3SA 3OLYA 2VDJA 4JQOA 5I7AA 5F4BA 4HFJA 3RG8A 1N2ZA 5ALIA 1XAJA 1BDHA 1D6MA 3WV5A 3NBZC 3LD9A 3M4XA 1EVYA 4F06A 3N2KA 1JAXA 2H4WA 2FOXA 2PEZA 1I1HA 2H8GA 3ANLA 5FADA 1N0UA 4LMAA 3L7DA 3A1NA 3Q7IA 3PC2A 4XM0A 4ZJZA 4NZOA 3R6DA 1VCOA 1BD3A 4Q4AA 2BHRA 2V9CA 2EBFX 1ZJ4A 1T9GR 2RK6A 4ZYYA 3LBYA 4PLZA 3M5PA 3S5UA 2JZOA 4OM7A 1OGIA 1Z25A 2C9OA 2IODA 2AKAB 2CYCA 1JLKA 1JT9A 2X13A 3HCDA 4XB2A 4EW1A 1ACMA 3P52A 1QFZA 2BFDA 3D2CA 3PVZA 4X54A 3QKRA 1KJ8A 1ES9A 2Y6UA 4QC2A 3FYSA 3W5VA 4MIKA 3COWA 2PFGA 2A5DA 1ADFA 2ZB2A 3C8MA 4DSNA 2WG1A 4HLCA 1LC0A 5AW6A 4GSLA 3TL3A 5HRAA 5E6UA 2BM8A 4QT4A 1R12A 4OHZA 1P60A 1J25A 2AE2A 4QRDA 4ZYTA 1J2JA 1NQOA 3BK7A 4AZVA 1CDDA 3CX8A 1I4OA 3B13B 3U9TA 4BNFA 1MNAA 1Q7GA 1MXHA 2D5BA 3RHZA 3V2HA 2AFIB 2JI9A 2FFAA 1Z2DA 4HVAA 4LNHA 3GZNB 2DY0A 3QRWA 4D9GA 2PMCA 2R6CA 4RM2A 4AKEA 1PL6A 4LJYA 4GUAA 3DG9A 3EIXA 2EGHA 4E5VA 5JCPA 5T5QA 5JASA 1LLQA 5LU9A 1QPZA 3WLNA 5FP0A 5E8JA 2FLKA 1DVRA 1EFPA 3CLRD 4B2LA 2G4VA 4O1IA 2FF7A 3DWFA 3RGGA 2ZSJA 3VZBA 2GPSA 2DPGA 4DAOA 2KBEA 4JT2A 4HHEA 4K87A 1CY6A 1Y7LA 3RRYA 1QSGA 3T3MB 4BY9E 1T10A 3MK31 4XSHA 2YFYA 1CRPA 2G36A 5BNTA 4Y6QA 1CERA 4MWTA 3HZHA 1MIOA 4ZEXA 5LU8A 1O0SA 1OI4A 3T3IA 1GNPA 1E2PA 1T36A 4QTXA 3BQNB 3NW9A 2KE5A 4F96A 5DI3A 1NE7A 3NHWA 1IXZA 1VOTA 3C98A 3D81A 1MNQA 5ALWA 3IBYA 1Z5NA 2IXGA 3DE6X 4NENA 5ESWA 4G37A 5G0WA 1XYGA 4UXIA 5K0SA 1R10A 1DEXA 3KHTA 2LPMA 4Z1OA 2XQFA 4D4GA 2HGSA 4JGGA 3BXXA 4NOLA 2BD0A 3T3PB 3ZKWB 3O93A 1H05A 5GADl 5KTKA 1ANKA 1YTLA 1NR1A 4BZZA 3UBTA 3HRHA 1IOLA 1DL5A 4ZDKA 1JL3A 2AJBA 2ZIVB 1I7PA 3RKRA 1JYFA 2Y1FA 4EMSA 1O03A 4YMWA 5CDTA 3LP8A 1DWUA 4TZ0A 4MVYA 4MULA 1L2TA 4E2FA 1W1WA 4NFYA 1VJGA 4Q7JB 1K2VN 4XIFA 2CDNA 5AKEA 5HCIA 4DDHA 1HI9A 5HRUA 4HEA6 2OVBA 2WE8A 1HE8B 3USES 1V7CA 2G1JA 2PD6A 4ZOLF 4W5WA 5COBA 3Q9SA 3NHKA 5JMWA 2B8JA 2I1WA 3QSGA 4P83A 2IHKA 4TT3A 1KE2A 1VCIA 1O6GA 4YK7A 4HBZA 5EUCA 1G42A 3TLMA 1O95C 1NY5A 1BXZA 1KO7A 1WA5A 5LWQA 1DEKA 2W9XA 4DSAA 3EZ7A 1YBMA 4G2NA 1U11A 3GFTA 2HHHB 3DO5A 5A7FA 2JFYA 2PH7A 1LGYA 3OIDA 4K6MA 1Q7BA 1ENOA 1L4UA 1PL7A 2ODBA 2QEQA 2C2YA 3LC0A 4MB0A 5DTQA 5I9BA 4BBPA 2ZT5A 1CX9B 1M67A 1Q15A 2ZE7A 4FD2A 5EZ6B 2QSZA 1E6KA 4CM8B 4A9AA 1QO9A 2Q3EA 4F46A 4NG5A 4H31A 1PAUA 4HDNB 4HDOB 1CDZA 1DHRA 4BMXA 1PJ4A 3VZPA 4NZPA 3KKPA 3O38A 4UHEA 2VL7A 4AD8A 3SP1A 1ZUWA 4YCAA 2Z8ZA 1N2BA 3C1TA 3V8NA 5DM60 1QQ5A 1P4AA 2BZ0A 1PLLA 3EWAA 3TTXA 2FCRA 5C5CA 1Y9EA 3H2GA 2C20A 4FYPA 3VO9A 4ZJUA 3RC7A 5B7NA 3W6PA 1JG4A 1F6BA 1TQ4A 3DUFA 4HS9A 1JIVA 4BE9A 1ETHA 1WL8A 3ONDA 1DBRA 2JJ1D 2FQWA 3CF0A 3DPUA 3P0IA 5EIWA 4ZVPA 1U3DA 1EQ2A 2FE4A 4RL4A 1RJGA 2QT9A 3M5CA 2IIVA 1IE3A 5H80A 3KSAC 4M22A 1VLVA 2ATEA 3OFJA 2XH8A 2BM1A 3CNBA 4JKOA 4A92A 4KU4A 1V4BA 1OGYA 1SKYB 2QQFA 5EJ6A 4IRXA 1MC1A 4E2WA 1Q83A 4MRRA 3RAEC 4BFLA 3ZJTA 5EJ4A 3CN9A 3IYLW 2IWRA 4GR5A 1NX9A 5LSAA 4EYKA 3WQQA 5HIIA 4B32A 3NTXA 5BRJA 3I0NA 2EZ9A 2HH9A 1RXYA 1IH8A 4NAHA 3DZBA 2BRUC 2OQIA 3MLBA 3AR7A 4Q3OA 4OQQA 9ABPA 3AVQA 1BMQA 1V25A 2NXWA 4FMBB 2ZYTX 2D4HA 2EL9A 2XKJE 4G9BA 4GI7A 4HPJB 1JECA 4QPDA 4YAKA 1WZEA 1AUVA 3GCGA 2GEDA 3GJ4A 4QYWA 4D9BA 2HA4A 4LJSA 5IAJA 1RXWA 1P61B 4MW7A 2FG6C 5JS8A 1JI0A 4AZ0B 5KKCA 3D3WB 4WESA 1M0WA 1JIKA 3DVAA 1NF9A 1YIDA 5FB3A 4I7EA 5I8ZA 1B73A 4D0RA 2JFUA 1KXJA 4OXRA 1PQPA 1LUAA 5MFPA 3LPMA 1U81A 5B4VA 3KLPX 3H1TA 1VL8A 4QLBA 3OM1A 2CMKA 1JHYA 1JB9A 1ZK2A 4ER6A 3CO5A 3MAJA 2H3HA 4Y2SA 5EKSA 4JOQA 4XWTA 3RVQA 4I1IA 2BUCA 2F62A 1G8HA 2OHXA 1YOVB 2XDQB 1ZLYA 2PUFA 3EG5A 4L4UA 4DDUA 3QPWA 4JZKA 3VSCA 4UZEA 5AK4A 4F86A 1D2RA 1FFXA 3ORHA 2WHRA 4GE3A 5AJZA 4XDYA 1GPWB 1K8YB 2J33A 3VR4D 5JTTA 5IVHA 1TVKA 3ED5A 4JP1A 1YMQA 5AXAA 2FAXA 3D8TA 4D41A 1N77A 4M7WA 1AKNA 1I30A 2JI6A 2DSTA 3FTCA 3M9XA 3PC8C 1QIDA 4M7RA 4ZPJA 4A6XA 5GPBA 3NHZA 4Y2YA 5K3FB 1LQ2A 3MHTA 5EJGA 4E5KA 4OMCA 4ZMSA 2I6UA 5AW8A 2O0JA 3OPXA 2OV4A 1JZSA 4OCZA 5AHRA 5K0LA 3LUBA 3WGGA 3CZ5A 2X41A 3K09A 4XYEA 1M1YE 4YFYA 2GBLC 4HDMB 3ZQJA 3SNKA 1HDYA 4OK3A 4AZSA 1T3ZA 2JIZA 3JASB 3LUHA 5I9SA 4NBVA 2ETVA 5JZVA 4YR7A 3UPUA 1AGNA 4BVAA 2XRFA 3V00A 1AXEA 5CR9A 5BN3B 4B45A 2I7VA 2V97A 821PA 1G3UA 3IIEA 3PR1A 1PGJA 2HK7A 1QANA 4GQAA 4J16C 3N70A 2D8MA 4KSYA 4DDKA 1NUHA 2VYQA 1X7YA 2Q62A 3NDIA 4BOYA 4M9XA 4XM1A 1Q0QA 4AQ7A 2P7HA 4HWTA 1E9CA 1GPAA 2BM0A 2ZRAA 1ZFNA 1C7JA 1W2GA 1Q17A 2B4TO 2ORED 2PAFA 3NBXX 3TYXA 1AU9A 4FFBB 4GLBA 3DDUA 3V4LA 3FG9A 4RZXA 3BWVA 2QW1A 2XV1A 5EVCA 4NQRA 3BFVA 3CZQA 2GM3A 1FTGA 1TKCA 2KS6A 3JQBA 3KT0A 5TJ9A 1KK0A 4UVEA 3AEQA 3D64A 4QPPA 4URVR 5K0EA 3PJGA 1WOYA 1KC1A 2WI8A 1OIWA 4B43A 2C2OA 3ELWA 2Q0QA 3DEYX 1QX4A 1LSOA 3ON5A 1XVLA 4B3FX 4KPUB 2A67A 1NBEA 1KBOA 4OQFA 4LS3A 3O9MA 3I8SA 2IOHA 1M2VA 4PHFA 1YU6A 4H4DA 1ECFA 5JISA 3ROTA 2XMZA 1JA0A 3ORRA 3SD7A 4HF7A 1L7EA 1QP0A 3L0PA 3UJ8A 4B2IA 3X1DA 1WO8A 1NA5A 3JALA 1FDIA 1XPOA 1KK3A 1NYLA 1XZJA 3GFOA 5ILGA 3RHFA 3NHJA 3TDNA 4UTZA 3V5NA 4D79A 4FKMA 3E9CA 1DEOA 1ZJ6A 2HOQA 3LLCA 4RD0A 4PG8A 3CCCA 3EW7A 3WTCA 3WBJA 2PJRA 1N57A 3FPAA 1JE0A 3Q7TA 4RGVA 4AF7A 1C4OA 2G76A 1J4AA 2ORWA 4AWXA 4AQDA 4W99A 5AUOB 2PT6A 4O33A 4MLPA 3TW4A 5D5PA 5IP5A 4CI9A 2GK7A 2C2KA 2FZKA 3ICOA 4ICIA 9MHTA 4D9HA 2FPXA 1RWOA 3W8NA 1W36C 1VHQA 2H59A 2NYUA 4H1VA 2VUSA 4TTSA 3C0KA 4UMEA 4UM5A 4GRAA 5FOQA 1NP3A 1QYRA 3C39A 4D6YA 2JLUA 3H5VA 5HZMA 2AJ8A 4HNTA 3NS7A 5C1PA 5LR6A 3Q12A 1NRIA 2C5EA 3INNA 3U4DA 3G2JA 3FBTA 2Z5GA 1W52X 1YQTA 1B6GA 2JIOA 3I2KA 4IDHA 3UJHA 1O94A 2PUVA 3ZZTA 3EVDA 1S01A 2VT6A 5BR4A 5FUWA 1X7HA 3D4NA 1FLAA 3NWOA 1LPAB 3DOOA 5ALYA 3N0RA 3KSZO 3DDHA 1LW7A 1Z08A 4WCFC 1R5OA 3WOVA 4TVSA 4ZZ0A 5CDGA 4FYWA 2VZ9A 2H2IA 3FNHA 1HYEA 3MD0A 1UQTA 3DDNA 3DW3X 4NBTA 3V1YA 1BZYA 1K4KA 421PA 5DIZA 4C0JA 3AL0C 3GLRA 4RXTA 4US1R 5EWLA 3WNVA 1I9CA 2DCMA 5EERA 4XUCA 5KTTA 4P93A 4UAVA 1ULBA 2A6PA 2QIOA 1B2RA 1WCYA 2GNPA 2MTBA 3F6YA 4I1SA 3TLJA 3HU1A 3CZAA 2AS0A 3OZGA 1XTSA 1J8YF 4YJ3B 2P5UA 4BU1A 3VZCA 3R3YA 1DMRA 4ZZ2A 3WIEA 4BNLA 3C3JA 4BO8A 1M8GA 3F2IA 4X62B 3P32A 3UCXA 1YB4A 3VX4A 2AJTA 4BCCA 1SIBE 2XR1A 4N12A 1N36B 1QF7A 3K9CA 1Z3CA 3BBPA 1OYYA 3C2QA 4O4JA 1VSUA 5TB5A 2GBFA 2F59A 2O05A 3ETGA 1CYDA 4FVTA 5D8DA 5LMNB 3U4MA 4XVQA 1KRXA 3GDOA 2A5FA 4W63A 1RLTA 3C41J 4JJAA 4Y1FA 3KR2A 3VA7A 1GUZA 4BNYA 2OHIA 1R0YA 4LOJA 4ENSA 3L4JA 4K9LA 2RG1A 4IS2A 3BJMA 1ZGJA 1F20A 2B3DA 2TRSB 3HEAA 1AKQA 3IT0A 1BHSA 2HA5A 1VSBA 4M0MA 4EA7A 3B1ZA 1GVNB 2X8JA 1ZD4A 4AVYA 1PR2A 4I2NA 3DDWA 2E1RA 1ST2A 3CH5A 3KKQA 4EPVA 3GVPA 4C4PA 1SHLA 1TZKA 1KMHB 2IF0A 2ROQA 5GVSA 3OPMA 3NTQA 1M5UA 1C7EA 1TT5B 3T0GA 3CU5A 1MC4A 2HEGA 2VPQA 2YICA 4HLUC 2JLQA 2VOJA 4HMQA 3W34A 4EW2A 5IG2A 3LFTA 4FBLA 3QZUA 1DOHA 3C3AA 4DMRA 3H97A 3V46A 5E2IA 4JI2B 3I0MA 2HK9A 3N2GA 1HV8A 4XASA 4ZREA 4ENVA 2VRBA 3PPIA 2DY1A 3L8FA 1C1DB 5EPUA 3COYA 1CQJA 5D1NA 1MXFA 2AJCA 3W5UA 2CFSA 3PXGA 5GWXA 3STHA 5HJEA 3Q1KA 2I4LA 1BVRA 3WG9A 4G5RA 1NN5A 3D4BA 3ZUPA 4C03A 4I55B 1GZHB 1RHMA 2WAMA 5BW5A 4L72A 5EIBC 3KKEA 2UZAA 2MYPA 3GPCA 3K94A 5KQRA 3D0QA 1ZAYA 1OAOA 3D3KA 3S81A 4Q12A 2AOTB 3ANTA 4HDSA 5C46F 3WKCA 3EFEA 4C88A 2YZNA 1OLSB 3B8HA 4O4HA 5THKA 3AF5A 2VQ3A 3STUA 4J4BA 3RYFB 2CBGA 3Q9UA 3RH0A 1GSAA 1XMJA 2IH4A 1Q1EA 2ECPA 3V55A 3IPYA 3TL6A 1UBNA 5AI5A 1XVVA 3TQRA 4YA6A 5DX8A 3C15C 4DQ0A 5JR3A 2W2LA 1HURA 2H18A 4YP5A 3LGAA 5BRAA 1L8OA 1NLFA 3F7MA 4UUAA 1WKBA 1T4CA 4FZ5A 3NHUA 4UARA 4UMDA 3B1XA 3R9XB 5EE3A 2Z9CA 2PXAA 3MT9A 1GA4A 3W9SA 4YRGA 1U7OA 1RJDA 4PAMA 4D0SA 3HY6A 2Q5FA 4O2AF 4DVGA 2FQQA 1KKLA 3TZHA 2X7HA 3RRZA 5IUJC 3NCTA 3WADA 2WFZA 3FTDA 2HHJA 4FMPA 3SFZA 1TYCA 2J5QA 3IBGA 4Q9KA 2VNSA 3LVBA 1QRRA 4XR9A 4F9GA 4BMZA 1XQ6A 1YULA 5H3LA 3OE1A 1OT5A 1CUBA 2VBFA 4FHZA 4FOLA 2QQGA 3JWGA 3FA2A 3K0BA 2C5LA 2P4EA 1MOPA 2PYZA 3BK1A 3D4PA 1F2VA 1YR3A 2BKAA 2GJ8A 2GO7A 3EB9A 4EL0A 4YCLA 3U62A 1QDLB 2QM3A 3PGVA 2R5FA 4CM1A 2JS7A 1GFWA 1YUBA 2ZT7A 1JLHA 1EVQA 1N7GA 1MVOA 2H63A 4G36A 4LCBA 1HK7A 4XPZA 5F77A 5IVPA 1AKYA 2Z6AA 3FIJA 2PBZA 4FJ2A 4ETWA 3OSZA 3PS9A 1O9GA 4KYVA 1MX5A 1UBGA 3AC0A 1U7XA 1ESNA 3KTOA 3O4JA 4IFEA 4QUEA 1ZOOA 5AK3A 5TS3A 3WLHA 2B82A 3BE5A 3QF7A 3TEFA 4CZ2A 4CUZA 2HWUA 2H4ZA 1LQTA 3O8RA 2ZITA 1ZSYA 2XLBA 5DEOA 2O7RA 3VNVA 4K9SA 3B3FA 2OV1A 3ILVA 2P9EA 1WY5A 2C2GA 3L41A 3P4UA 4JWTA 4G5FA 1Z2OX 3KE9A 4IIDA 4KQEA 1FU8A 1OWPA 5F1YA 1N8KA 4Z99A 5A0FA 4RF5A 1V7PC 2FFRA 3HCWA 1A9RA 1XELA 1XRJA 3QPDA 1N2GA 1PNQA 1GZUA 2Y0DA 2W2TA 2YJ5A 4EZBA 4L0MA 4DEYA 4BATA 2NPIA 4X9XA 4TYNA 2G77B 2C9MA 1FMJA 2ZIGA 2OQVA 4Z86A 1W9HA 3H83A 3JQAB 2OP0A 3A6KA 4XQ0A 5ILQA 3UMSA 4JUDX 3O03A 5TVGA 1UK6A 2Y9PB 2KSQA 3KPJA 3S8MA 1EJ6A 2RHGB 4H3HB 4AUKA 1SIWA 1FDVA 2PQ0A 1UZUA 2CNOA 4K9DA 4M0DA 5AM1A 4QNNA 1U7HA 2GEFA 3L4BA 5HE8A 4MS4A 3JVVA 7MDHA 3WWCA 3E22B 1P6XA 4N01A 2GRJA 4FSDA 1U9JA 5C3MA 1W76A 3QJYA 1ISPA 1KWGA 1YMUA 2X0NA 4MCHA 5B36A 1M8FA 1T25A 2V7BA 4M9SA 3L46A 4L0QA 1UBTS 2ZJAA 3AY3A 3VJMA 4GR9A 3ZU6A 4LXTA 1YZ3A 1GGMA 4RJ2A 4FCWA 4XB1A 1RRKA 5F1OA 1Q91A 2HWXA 5CBPB 1N3BA 3U19A 1GG2A 4PPQA 1CJCA 5CMLA 5ED4A 2Q45A 4L3VA 2GN9A 4TX1A 4JBIA 1K88A 3MG9A 4Y1RB 4GVPA 3WLTA 4BFZA 2FSFA 4E08A 4BJHB 2QU8A 2V98A 2B2XA 5I8WA 2JFNA 4NHOA 3P9QA 4RQAA 1KTIA 521PA 4ZI7B 2XZOA 1PW7A 4GWKA 2EU8A 4UTXA 1NW5A 5ERYA 3QX7A 1L4MA 1EHIA 3QHAA 4HXYA 5CX1B 5EOVA 2CWDA 4I2VA 4BRUA 4D7AA 4HV4A 2X42A 1J33A 2IZ0A 3LYHA 1QDUA 3MTEA 4FNGA 4MR8A 3H4MA 2W6OA 3GN2A 4J2HA 5JUWA 2ZUFA 4L9WA 4YQFA 4Z6KA 5HOEA 4MINA 3HLKA 3IEMA 2WJZB 2OGWA 5HM6A 2XVZA 1INLA 1S2LA 1ONPA 3ISJA 1MHPA 3IOYA 1K4MA 5SYNA 3ADDA 5BP7A 2XEXA 3KXLA 4UCFA 3H0KA 3H9BA 2BT4A 2YVAA 4HN4B 5EIXA 3OEWA 1TLTA 5FV7A 5BSEA 5EZQA 1QB7A 3CB2A 3TH5A 4LV5B 1RIFA 2RAUA 4CT4B 2P1ZA 2W37A 4F6LA 1YI0A 3OQVA 3PGXA 1K5HA 2XNKA 2P27A 2GSWA 3CCBA 4C2AA 4E1VA 5C53B 3ZVLA 2BUBA 5A4JA 3GNQA 1FMLA 2PKQO 1GSHA 2H92A 1DRWA 1NKTA 3EGIA 5DEIA 1D1PA 3BIJA 4LX0A 4EEXA 1SELA 1KEVA 3AKDA 1QK5A 3CZ4A 1QBKC 4CKCB 3IUNA 5EINA 3THWB 3RS5A 3VYSB 2F4NA 1SCUB 4YRRA 4IFTA 2YV4A 2KX7A 2QUIA 3OPNA 3O8OA 1IRXA 3MTDA 1X8XA 2J0UB 4L8WB 4NU6A 5CVDA 3ZXYA 3UFXA 3ZHUA 1NFFA 3ZD9A 1FU7A 3DZ8A 3IE2A 3UKJA 4JAVC 3FCAA 3P0EA 1VBKA 1JAYA 3CR8A 1ACLA 1IVNA 1DKMA 2J6IA 2VN8A 3BIOA 3X1JA 3HJHA 1XEAA 2AG5A 4L3WA 1R8XA 4LDJA 3DOHA 2FZ5A 2WA1A 3R41A 4WKBA 4TS9A 1TA0A 1HM5A 3TR5A 5SY9A 3NT5A 5EP2A 2JIBA 3ZE6A 2LCFA 1QFYA 2GXAA 1FFSA 1W96A 3THYA 2Y99A 2B1JA 2I78A 1II0A 1W1IA 1DAFA 1ICIA 1X1AA 2G9ZA 3TBFA 3I58A 4KGZA 2GYUA 3X1ZA 1UC4B 5BWMA 5CFPA 2WHEA 4FILA 3WL3A 1MEJA 2ZBUA 4ZVKA 4DR5B 3PQ3A 5F9FA 3KDAA 3WLIA 2Y92A 2YXPX 1QE0A 2H52A 2ORIA 2QVCA 3A1WA 4R9RA 3TB4A 3VQTA 1NZJA 5EN4A 5HQJA 1JJIA 1WSDA 2GRUA 2QP3A 3O26A 3IAUA 3KSRA 3R77A 4I9UA 4KIWA 4TQUS 1NJ1A 1SKUA 1W4LA 5DGTA 5HG0A 2P9GA 3TZQA 2F8TA 5LJIA 1NIPA 2HF2A 1GQOA 3CIOA 3IDZA 1L3BA 2WILA 2WU0A 1Z0JA 4N5NA 1FSFA 4UM9D 1UPUA 5GGYA 1K6EA 4RELA 2CVHA 2XUKA 3GJ3A 3SI7A 3P7MA 4MLCA 4ZAWA 3JQ8B 3T7DA 2ECKA 1Q0HA 3E3LA 4LHSA 5TS2A 3TTYA 1P29A 3JV7A 2CXOA 3L7YA 2HRQA 2YIDA 3E23A 1EX1A 3V4OA 3AIIA 3OEYA 4AIIA 2YJ3A 1AKMA 3M81A 5HA5A 1EFCA 4U2GA 4NOMA 2G88A 4ACAA 4QFCA 1X70A 3D0KA 4H7HA 2DLCX 1JFLA 4E22A 4V0OA 4ND7A 1PO7A 1UDWA 1ZUNA 4MWDA 2JJYA 2YVUA 2P65A 1IQUA 3ROFA 1IXKA 1CJKC 1RRMA 3DR3A 1MA3A 3E53A 5A7GA 4A0RA 4DKXA 2BMAA 4DOMA 4B9AA 2VAXA 3ZCTA 1OBFO 2EKLA 4F8JA 2R1VA 3RU9A 4ME6A 1EHYA 4IO1A 3GUZA 2RAVA 2QAGA 3JQQA 2PEYA 5C0OE 3UH0A 4OX9B 3BTSA 1SVUA 1V11A 1Z17A 3D4OA 2IUUA 1MW8X 1MHTA 1I2CA 2QLFA 2Q4BA 3O1HB 1OXMA 5EIEA 1N6IA 3GLKA 1GTVA 4IGAA 4V2UA 4CKEA 3SZLA 5JJBA 5LMUB 1FDRA 3I9MA 4HMOA 5TPZD 4E13A 2CZCA 4F21A 5A2GA 1O9BA 3EQ2A 4R9UC 3CE9A 3OY7A 3GJ8A 3WYGA 2OECA 4ZU1X 4YCNA 4P22A 3KELA 1FFYA 2FUKA 2HK8A 2POCA 1NXQA 1K75A 10MHA 4EY6A 2IXBA 4LUCA 3OF5A 5CVVA 3U09A 2G4CA 2YWFA 3KHSA 4KXFB 4B8WA 3T94A 4Z4EA 1KK2A 4GKVA 2QROA 3GJXC 3TQHA 2ZI4A 1SCQA 2FWMX 4GYYA 3EPKA 3O7WA 5LP1A 1XTJA 5CLHA 1CPYA 2IHTA 2IS4A 4MVJM 2GFHA 1NVTA 5EJ7A 2Q4OA 1Y9JA 4FQ5A 1XFDA 4Q4CA 1GTSA 3I2FA 3C70A 4MA0A 4M46A 4PU0A 3DZKA 4YBRA 2XT6A 5J2UB 3UVEA 5B6IA 2WTEA 1OI2A 4HEHA 1DKOA 2JGAA 3IKLA 4W5JA 4WIAA 1OFHA 1YJCA 2HDOA 2VLBA 4XCQA 4YAWA 5LBUA 3T9EA 3WBBA 2HU7A 1UIMA 4L73A 4D4MA 1W5BA 2FN4A 1IQPA 3DL2A 4RQBA 2GETA 1PWZA 4RZUA 5DHUA 3H17A 4M9UA 3TAUA 5FL3A 1WU7A 3DCIA 1MJGM 1ZHFA 1LSJA 2GZRA 3U40A 4BIMA 4D80A 2HWWA 1UP7A 2C4MA 2J7PD 4FFMA 4LIPD 4JC4A 4LV6A 2WFAA 3VTKA 3RSFA 1MG5A 2DUMA 2G9RA 1B3RA 1J7KA 3JSAA 1XDUA 1C9YA 4J0QA 3V4FA 4A82A 3FNRA 4R83A 4WL0A 1JBKA 2B4QA 3IB6A 1U0RA 3W2HA 1SCNE 2ODNA 3K53A 4QPJC 2XNCA 2CB0A 5HKOA 1JR3D 2J48A 5CT9A 3T7SA 4PRYA 2Z83A 1E4EB 2FJ0A 1KERA 2MSWA 2V3VA 3PC7A 3LDAA 2V74B 3G2OA 2PBFA 3KRTA 2V7VA 1SG9A 5B55A 3GAAA 3G2LA 5KYUA 5JBNA 5K0FA 1GTG1 2AV6A 4IDQA 4RHUA 4MEAA 2UYQA 4GX2A 2HIGA 2NO9A 1DAOA 3TW8A 1DAKA 4KIFA 4HS4A 3O4IA 3LBHA 2OAP1 4FI3C 4PSVA 2JJ1A 2ZETA 3DHYA 1G291 2C2BA 1KY5A 2CNNA 2G6TA 2D7CA 3AEZA 1D0VA 3UB4A 5L3SB 4NCHA 4I46A 3TNDA 2CLLB 2ZBFA 2SKDA 5ULLA 1UXJA 4GNRA 1J22A 2JFOA 2DX7A 2WFLA 4MARA 2AVNA 4U2EA 1XKXA 3RCBA 4OAPA 3ROGA 3W05A 1N2CB 1Y5MA 4RAQA 4QRIA 1D7OA 3DZDA 1IUNA 1W36B 1XHEA 2JJQA 4WNIA 1MABA 4FZRA 1WNFA 4ZRMA 4A3SA 4YCMA 3BWBA 3E1KA 4QGBA 1Y1QA 5DX0A 4LC9A 2IUFA 2MSKA 3PNVA 1WQ3A 4I19A 2R85A 3QPBA 3RUCA 1BNCA 5ER6A 5JATA 2W2XA 1M2KA 4BNKA 1BJRE 4FLEA 4L8VA 4HPWA 1WIWA 5EZYF 3E3AA 5JAIA 1SUFA 4KFTA 3LIIA 3VTFA 4BYGA 3QWFA 4HRYA 4DAEA 1QYCA 2ALJA 1XBTA 5DBGA 3VC7A 4IGFA 4V3CA 1J0AA 4ER3A 4WCFB 2V1UA 1JNXX 1E7YA 1JWLA 2I6QA 3BL5A 3NOVA 4HAIA 2GX6A 2EWMA 4JJKA 4BNZA 4FGJA 3IVAA 1TYEB 2ANBA 3TRDA 4M89A 3VZSA 1TUBA 1LZLA 1SA0A 1BMFD 1MO4A 3OX4A 1BYIA 1O54A 3OMXA 4BN0A 2X0IA 2QB5A 2Q0HA 3TLKA 2HPHA 4EF4A 5I4IA 1RPJA 1ZSVA 2H4FA 3PT9A 5JCZA 3K5HA 4ISBA 3BDAA 1P1JA 2I4NA 2RCNA 2K7FA 5K4AA 1SJ9A 5JEDA 3ND6A 4B75A 3GEEA 2VC2B 3RTCA 1PEYA 5D1HA 3FOBA 1K4YA 4K6OA 3PFGA 3Q1LA 2NVBA 4R8SA 3RRNA 3TD2A 1L8LA 1I2MA 3D3JA 2V7UA 3I9KA 3QI2A 3VO8A 5JJKA 4TV8B 3IOCA 2F3RA 2YYZA 4YJFB 1FJ2A 4Y2JA 4QD3A 3VGPA 3QE3A 4BO2A 1WZIA 1VE3A 2VYVD 5EPOA 2BFEB 3FYCA 3OM0A 4WXRA 5F2KA 3ZY2A 2V4MA 1NONA 2K87A 4UU7A 3O92A 1BE1A 1UBOS 1NOKA 1L9XA 2OK8A 2D1RA 4LHEA 3F1LA 1J9ZA 3VKVA 4BC1A 1XU9A 4C3ZA 3EPLA 1QGUA 1JDPA 1U1IA 2CLKB 4BO5A 3FVQA 3BWDD 3Q8LA 1VHTA 3H4VA 1P74A 3L77A 2A1TR 1TAUA 1W9MA 2BDTA 2O8BA 1ZGGA 5GONA 4RSHA 4JQSA 4X44A 4BWYA 4ZEWA 2WUFA 5FOSA 2DETA 1YL5A 3RS3A 2I2FA 3RU7A 4R1LA 3UXEA 1QC5B 4LPKA 3UANA 3PNBA 3THXB 1PX0A 2J41A 3EZ6A 3HFGA 2NN3C 1S2IA 4Q3BA 3TUZC 1YONA 1GEEA 4TTQA 4UDOA 2OCXA 2PSDA 2F1RA 4M1OA 1PNVA 1JQDA 4CW7A 4DYHA 3SZRA 1H6BA 4CTOA 3AJDA 1TZCA 2ZJ4A 3FY4A 1ODKA 4II2A 4RADA 2GLUA 2OR3A 3AKCA 4S1PA 3V7UA 1W44A 3MWLA 2I4MA 2VH1A 2FR8A 1J5XA 1Y4DE 2FUNB 1Q7CA 3BCUA 4F0JA 2GAJA 1NPTO 3IVGA 1PZXA 4DLVA 2QMYA 1ML3A 1U2DA 4Y9TA 2M6KA 5I7OA 3QKIA 5AHKA 4IVRA 4MR9A 5TF0A 3HUTA 3QKWA 3OX1A 4JS0A 3UJPA 5KVAA 4IJVA 3I6IA 2I6FA 2HM7A 4H3KB 4UFOA 1P9RA 3UICA 2JLYA 2CXRA 1E3LA 2B8WA 3S7ZA 3ZTWA 1ESDA 2OCBA 3LX8A 4HXFB 2JHFA 4RVCA 1QVZA 3U16A 3CLUD 5JJLA 1U0SY 3CMMA 4KKXB 2JGDB 4J91A 4RQTA 4WXEA 3R44A 3VH4A 5BN5A 4KP7A 3GVHA 1QVAA 4LJ7A 1G5QA 1MQSA 1SRQA 1ZEMA 5M34A 4H1UA 4GPBA 3BD7A 1V7ZA 2X9GA 4YP7A 3TLAA 1MO2A 4KNWA 1MTOA 2IEDA 3TIVA 2QN3A 4LZNA 2KI5A 3EJWA 1IBRA 4DC0A 1U28C 2FEMA 2FX2A 2Q3DA 4CGYA 3I72A 3VR5D 4F3CA 1Y3BE 1YT5A 2A14A 2AXEA 3ZWCA 3JQ7A 5KTPA 4KOEC 3KEFA 4FHFA 4FR0A 4P4NA 4H6XA 5B3KA 5JD5A 1NNEA 1OCEA 4YJ3F 3K70D 1MV5A 2AD1A 2BMWA 1M7BA 2C83A 2QVXX 1OVMA 2JCYA 3CF2A 3KCQA 3E2IA 4QGGA 1SULA 1VYVA 1QLJA 2YBDA 4MUEA 2ZU0C 2VP3A 3PNQA 1G2OA 3W1VA