5TS2A

Crystal structure of a phosphopantetheine adenylyltransferase (coad, ppat) from pseudomonas aeruginosa bound to dephospho coenzyme a
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
165
structure length
165
Chain Sequence
AHHHHHHMNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Crystal structure of a phosphopantetheine adenylyltransferase (CoaD, PPAT) from Pseudomonas aeruginosa bound to dephospho coenzyme A
rcsb
source organism Pseudomonas aeruginosa (strain lesb58)
molecule tags Transferase
total genus 59
structure length 165
sequence length 165
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2016-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 5ts2A00
2IP1A 4HK4A 1V47A 1WJGA 2DETA 1PFWA 1TFUA 3CLSC 2J09A 3Q10A 2E18A 1JIJA 4H3SA 4R0NA 4MUHA 1UFVA 4X0EA 4QRDA 1U7XA 4YP5A 2V0GA 3Q12A 4CDNA 1IHOA 3F3MA 3AL0C 3OTWA 1IFXA 3K32A 5K0TA 1ULHA 1PG2A 1Q11A 3BL5A 4BWVA 1M8PA 5DK4A 1VBKA 3NBKA 1G8HA 1MC1A 1N2GA 3FDXA 4WNYA 2ZUFA 4S1OA 4F4HA 1A8HA 4HJXA 1J21A 4ND7A 1YIDA 2CYCA 2A88A 4R2MA 3IVGA 3ELBA 1F7UA 5HUJA 4XSVA 2YWBA 4KR6A 2G36A 1JGTA 1Y42X 2DLCX 3ZUGA 2CV2A 4G6ZA 4EF6A 3AIIA 4ZT3A 5J58A 2A1TR 3ZJVA 1QNFA 1M8KA 4MW0A 1TYCA 3ZJUA 3IMEA 3K9WA 4G5YA 1KR2A 5HUHA 1K97A 3DPIA 2D13A 1T6YA 1U0BB 2A86A 2EL7A 5H7XA 1NUQA 3TZLA 1NI5A 4KPUA 1N2HA 4MVYA 1KAQA 4ZCQA 5BNZA 1I6MA 2TS1A 3GLVA 3A4IA 3CVVA 4DLPA 3INNA 1N2JA 4WSOA 3VGJA 1KP2A 2VTBB 3SZGA 1OWLA 2Z08A 4ZT5A 2YY5A 4Q16A 3CLTC 3H9BA 3P0HA 4J76A 3FOCA 2J4DA 1I6KA 1MB9A 1R6TA 3KT6A 1F4LA 4ARCA 3CLRC 2OQ2A 2I1LA 4AS1A 3ZXSA 4NAHA 3ND5A 3DLAA 1KP3A 4PY2A 1GTSA 1GLNA 4QREA 1QRUA 3PRHA 2DR2A 1K92A 2A1UA 4DDMA 2RD2A 2DUMA 1R6XA 1WKBA 3FNRA 1CT9A 4U63A 4DNXA 1QRSA 1RQGA 1V8FA 4MUGA 1OWPA 4PBSA 3QE4A 4PBRA 5IHXA 1EFPA 2H2AA 2D5BA 2PXHA 1XNHA 2B7LA 5LFAA 4DDKA 3I05A 1QJCA 2PZAA 4F3RA 1O94D 3X1MA 4I6JA 3CLUC 3UC5A 1TYBE 1GAXA 5AHWA 4ZCPA 4YP7A 3CVXA 3MMXA 1JEDA 3FIUA 4EGAA 4YBRA 1O96A 2PZ8A 1N3LA 3ISJA 4OUDA 2H29A 1O95C 3CVYA 2ZP1A 4A91A 1O5TA 2J5BA 5H16A 1YIAA 2VXOA 1EJ2A 2QJOA 4KR9A 3P0IA 1O97D 4P2BA 4DDHA 2CSXA 3COZA 3SEQA 1ZUNA 4GRIA 4YP6A 1N75A 4DE5A 1T9GR 1LI5A 3SP1A 4KKVA 2PFSA 3RK0A 1GPMA 1OWNA 4GU5A 1TQ8A 1U3CA 4EG6A 2GM3A 2AG6A 1MOPA 1WXFA 3IOBA 2DPLA 3NBAA 3UMVA 1YUMA 4UZFA 4XFDA 3HFJA 1N2OA 1TYAE 3IMCA 1H1TA 2JAXA 4MVXA 1WXGA 4TS1A 1NYLA 4JXXA 1P7PA 2X3FA 1FYDA 1MRZA 2IELA 2YXNA 4MW5A 4MWCA 1WXIA 2WQ6A 4JYZA 1ZH6A 1VL2A 2CYAA 3VU8A 1Q19A 4L2IB 4ZT6A 1I6LA 1WXEA 3C8ZA 5TEWA 1MAUA 1NUUA 3RFFA 2PIDA 1MAWA 2QUHA 5F23A 1I2DA 4MW2A 1M83A 4MUJA 2JA2A 3P0JA 2JANA 4R2LA 2A7XA 2PZBA 3H9CA 3SZ3A 3IOEA 4DJAA 1G59A 1NUTA 2QJFA 3KT8A 4MW7A 2XRZA 3A04A 2DEUA 3FWKA 2GKSA 4ZT2A 1HYBA 4MLPA 1J09A 4Q93A 1M8JA 3MXTA 1R6UA 1PFVA 4ZCTA 3AKZA 1ZJWA 4U8HA 4MUNA 2Z09A 4MUKA 1H3NA 4YMIA 3SYTA 3HMQA 1J1UA 5TGTA 3E27A 1F7VA 2HZ7A 3GUZA 1NUPA 3CVUA 4E1AA 1NZJA 4AQ7A 2AZXA 1KH2A 1EUYA 1U7DA 1NSYA 1KH3A 3PNVA 3ZIUA 2DERA 1LI7A 3S3TA 1SURA 2PG3A 3LCJA 3PNYA 4MQ6A 1IQRA 3FY4A 1EE1A 2CYBA 2IJGX 1IQ0A 3D6UA 1KQNA 3U1VA 4MW1A 3IMGA 2CV1A 1T6ZA 4MW6A 2YWCA 1EFVA 1WXHA 2E21A 5DB4A 1COZA 2HGZA 1NP7A 3OP1A 1ILEA 3CR8A 3SDBA 3DV2A 5DEOA 1G8GA 4I6EA 2OV4A 4OJMX 1WQ4A 3G59A 3PXUA 3CLTD 2BYTA 1O97C 2A84A 2QJTA 4XFJA 1KH1A 1NURA 3CLRD 3IVCA 1KQPA 1YULA 3TNJA 2WSIA 3G6KA 2A1UB 4EG1A 3CA8A 4EG5A 3IVXA 1OD6A 3LE8A 3QTTA 1J70A 1TYDE 2RE8A 1N2IA 1XJQA 5FO1A 3HGMA 2QUKA 3JXEA 4MAFA 1IVSA 1OWMA 2XRYA 1KKUA 5KHAA 3IODA 1EFPB 3IOCA 4ND6A 1TEZA 3ZXIA 1H3FA 1K4MA 3A05A 1M8GA 3COWA 3Q4GA 5FO0A 2QTRA 5TS2A 4ARIA 1T6XA 1Q77A 3A2KA 3ZJTA 1M8FA 1OWOA 1KORA 1MB2A 2J07A 1JECA 4ZT7A 4JFAA 4NAUA 2R5WA 4JXZA 3IUBA 1EUQA 1M1ZA 1O96B 2CT8A 4OUDB 2CUZA 1BS2A 3RJZA 1N2BA 1JILA 3FI0A 4MW4A 1T9GS 4MUIA 3MLAA 1JMVA 1JIIA 4NDAA 3AG5A 4RPIA 1FFYA 3L92A 3RK1A 2CV0A 4QBTA 1IQUA 3TQOA 1S4MA 1YI8A 5HG0A 3D6VA 2D54A 3RHSA 1O0CA 3N2YA 1JEEA 1O0BA 1QQTA 3QTBA 1PFUA 2HMAA 3COYA 1WQ3A 1MJHA 3IDFA 1QU2A 3CLSD 3SEZA 1QU3A 3TZEA 1ZH0A 4NATA 4U7JA 2VTBA 1N78A 3FETA 1X8XA 3ND7A 3VRHA 1GZUA 4EG7A 3FHJA 4I6GA 3DO8A 3HL4A 5FNZA 2X1LA 4RUKA 3H99A 1QTQA 1D2RA 2ZUEA 1JZSA 3UY4A 3H97A 4ZCSA 1VBNA 3X1JA 1X6VA 2Z3VA 3FG9A 4MWBA 4HPWA 4CT0A 5LLTA 3FH0A 2A1TS 4EG8A 1DNPA 4MUEA 1PG0A 1G8FA 3AFHA 2E89A 2A4MA 4PBTA 4K0RA 1PFYA 3LOQA 1IH8A 1WY5A 4JZYA 3P52A 1XNGA 2J08A 2BTEA 4EFKA 1N77A 2V0CA 1B6TA 3UK2A 2WQ7A 3M5WA 3ND6A 4MUFA 3IUEA 1EXDA 3TS1A 4MW9A 1WZ2A 1NUSA 4FZJA 3N05A 3NV7A 4G5FA 5J59A 1GTRA 1O94C 1WOYA 2QUIA 3PNBA 4HJRA 4MVCA 5JBNA 4KPUB 5TEVA 1XNJA 4MWDA 1Q15A 1JIKA 1N1DA 1MBZA 3MUEA 2NSYA 1J1ZA 2X0KA 1KAMA 3CVWA 3GMIA 1JHDA 1F9AA 4MULA 3MLBA 2E0IA 4J75A 2O5RA 2X1MA 3HZRA 3KT3A 2AKEA 5EKDA 1IRXA 4NZPA 2DXIA 1KQOA 5DASA 4KR7A 3RBAA 2CFOA 1VBMA 1JZQA 1OBCA 2QTMA 3IH5A 1VLHA 2GOYA 3N8HA 4CDMA 2EJCA 5LM3A 2WB2A 1YUNA 4ZCRA 3X1KA 3COVA 4NX2A 4ZT4A 2QTNA 3HV0A 3AG6A 5J5AA 5KCMA 1GN8A 1J20A 1U3DA 3H05A 1EFVB 4MVWA 3KFLA 4CQNA 1H3EA 2NZ2A 1LW7A 5KWVA 1O6BA 3CLUD 4UZEA 1K4KA 3TQIA 2O8VA 3G5AA 5IJXA 4K03A 1QRTA 2QUJA 4EG4A 5K0SA 4EG3A 3KT0A 2C5SA 3L93A 1OBHA 3ILVA 4L2IA 4MWEA 3ZGZA 1N2EA 3N9IA 1O95D 3UOWA
chains in the Genus database with same CATH superfamily
3EH2A 1RI2A 2BM1A 1YDHA 1RI5A 5JDCC 4CIWA 2P1ZA 3O74A 4E30A 3N8GA 5DYWA 3E3AA 1R5BA 2E18A 4UUNA 2P9BA 1E7QA 1WTAA 1FTQA 3UKOA 2R65A 4M9ZA 3JR7A 3ZK7A 4DYHA 4MWSA 4N5NA 2RC6A 2PUHA 3PNMA 4YLEA 3Q12A 5F73A 3U7FB 5D84A 5REQA 6ADHA 2A5GA 3ADDA 3DEIA 3NGXA 1GAEO 3AKDA 2P9YA 5CLGA 4UTRA 3JD2A 4NV3A 3F3YA 1E3EA 1J7KA 4R69A 5HQJA 3QA9A 2D5AA 4IUCS 4MV8A 1Q74A 2HMUA 1P4GA 2J8ZA 1QQ7A 4CODB 2NXCA 1WUIS 2BKEA 1DMRA 1YZFA 3HYSA 3U37A 1S5PA 3QM1A 5IKOA 2XYGA 1V1MB 1K6IA 1TYZA 1VRCA 2J48A 2OTCA 5EJGA 5D87A 2MINA 4NV1A 3KLOA 4L4RA 4PQGA 2VZLA 1EWRA 1OFIA 3UMCA 1IXRC 1GUBA 2XE8A 2YWBA 4EJ0A 2FWAA 4OOEA 2FZKA 2NACA 1Y42X 4LJ5A 5H1YA 2VAMA 3VR0A 5JXJA 1II8A 4YRTA 2B8JA 1QO0A 2CV2A 2HI0A 4R2IA 1JPNA 1U2GC 4JCOA 1E2JA 1P2SA 1DL5A 1QG4A 2JS7A 1Q7EA 3NUGA 4IDEA 4Q6WA 3O9VA 1GFZA 4DIKA 2YX1A 3IXQA 1G6Q1 1BXRB 3AKCA 5DDIP 1M8KA 4AW9A 1H2WA 2C9YA 2JIRA 3K9WA 3FCSB 1L7OA 3LCRA 1BFUA 4UULA 5A9TA 1SHZA 3LK6A 4R1MA 2BZ0A 4F1WA 4MYUA 3U80A 5BPHA 3KR2A 1JHZA 5AICA 2IPXA 4AVYA 1VJRA 1FRZA 5EE9A 3NTVA 3GHHA 5AVVA 4DA9A 2VNSA 1G7SA 2QRVA 2JD2A 2VBFA 3GUCA 2FW7A 1K1EA 1N2JA 4XGKA 5AXDA 1YQTA 1P6UA 1LQUA 4PLVA 5CB4A 1JA0A 3GEIA 2Z08A 2QR2A 1P2VA 2HSWA 3A1SA 3HKDB 3PFWO 4P8RA 5EWLB 1U8XX 2AFRA 3HJFA 1YRBA 1XA0A 1KBZA 1T10A 3RS5A 4CEIB 1NHGA 4XWKA 1Z7WA 2WAMA 4ABTA 4LYAA 4MMZB 2F1HA 1PBTA 3EDMA 3PFHA 3T99A 3A2LA 5JAPA 4C9BA 1CETA 4UFOA 1KC1A 1CQZA 4EX7A 5KNDH 1HE1C 1T4GA 1ULSA 4KQCA 1ODSA 1R6BX 1ZMRA 3PDWA 3GCXA 4TLBA 5B1SA 1QVZA 4XIIA 2HK8A 2CVOA 4NBVA 4MAAA 1TLLA 2WVAA 4LJYA 4MO2A 1RYHA 4QNNA 1GKYA 3VSBA 4O2BA 1AKTA 1T29A 2NU7A 3H2YA 1TK2A 4NBRA 5AJVB 1P5ZB 1Y9ZA 3LQ2A 2OPHA 4CM5A 2ZZMA 4YRMA 4QUEA 1V5WA 3WHPA 2C2OA 1N6LA 1I2CA 5TQVA 5LKRA 3IUNA 3T7DA 3VR5A 2BZ1A 2HPZA 4WZ6A 5KSYA 1JR3A 3ZG6A 1QWSA 2H2AA 2PXHA 4B33A 2XKJE 4BGEA 1FSZA 4FS3A 3MIZA 3BXEA 3DD5A 5ENZA 5J4KA 3PPYA 2KMLA 2NTNA 4PVDA 2NNLD 4RE5A 3MTGA 3NW9A 2AYXA 3LS2A 4NAVA 4NC9A 1TYBE 2CFCA 3OOJA 4HAUA 4IWYA 4LNHA 4Z4GA 5TDHA 1VFPA 4DABA 4EY7A 1H8HA 4ZCPA 1C0IA 3N87A 2NV0A 2CJXA 2V59A 4W5RA 3WKBA 2CLDX 2I29A 3RFUA 4PSDA 1F5NA 2IYYA 4YBRA 3THXB 1OH8A 2P8SA 4WGFA 3JAWA 3QW4B 3L0OA 4QQRA 4REQA 4HDKA 3WGKA 2NTVA 4EBBA 1LQTA 4OF4A 2VYVA 4YONB 3EIEA 3I9KA 4LRTB 1O5TA 2XADA 5JMOA 2YJZA 4JBGA 3TQRA 1EJ2A 2VPIA 3W9SA 5FH9A 2VJQA 3OU7A 4OP1A 3SEQA 3HFSA 3WB0A 4DBVO 3WYEA 3FTNA 3GJ8A 4BFTA 2GHRA 1NR1A 3CGGA 1NQAO 1P9LA 3F2IA 4KAAA 3HZZA 4PSUA 4YMGA 1FPQA 2IYTA 3P19A 4AZ3A 2WTNA 2Q1SA 3DQQA 2LCQA 5EJ9A 2B4KA 2X42A 3CC8A 5AI9A 3SQNA 1W5EA 2D2EA 1VI5A 2E4YA 2HIGA 2ORED 3NORA 1TJNA 3SIRA 1GCAA 2OA0A 2R87A 5DGDA 4OFXA 4XDYA 3HBMA 2ZRMA 4RKRA 4EJ6A 4LZAA 4IV0A 2XTNA 5DBGA 3O73A 2BUAA 2Y2UA 2V7QD 4FCCA 1V5GA 1ORIA 2IF0A 4IMRA 4TS1A 3BRCA 1CNFA 1B0ZA 1QGZA 1OIXA 2QP9X 5A6SB 1P33A 4BASA 2C5AA 4LWQA 5B4UA 3T3GA 2BFEB 2CVPA 1PW5A 3A6LA 1HMYA 4X61A 4F4IA 3D8BA 2W6NA 4G09A 4Y6RA 1YTUA 4TX1A 5BPFA 1LSJA 1MP0A 3HBFA 5E3IA 3FMPB 3ZWWA 1IB6A 2O14A 1E2BA 1XI2A 1KJNA 1FB5A 1PCXA 3IEXA 3NH6A 4U8GA 5B57C 2MOKA 4GQBA 1Z5WA 2AN5A 4A23A 1BEEA 3Q6MA 2EGUA 3T9FA 4B3DA 2Z95A 1FZQA 1JR2A 3ECCA 5FL7D 4WPGA 1P73A 1QH9A 2FCRA 3N58A 3S27A 4UUOA 3KXPA 2PKQP 3SLKA 1S4QA 1SK8A 2FTKE 2ZYWX 1JMYA 5DNVA 3STUA 3PNPA 4EW6A 1M73E 4MO9A 1JJBA 1SOMA 1P0IA 3PD0A 4UTXA 5KWEA 5ED0A 3V1UA 1SH7A 2C2ZA 1XL1A 1EP1B 4J1SA 1SBYA 3GV0A 4X5OA 1BMTA 2JGMA 4P93A 2Q8QA 1R6UA 3PNQA 2HHAA 5CLJA 3TLZA 1NW4A 3UB4A 3LW8A 2VHYA 2GZ3A 4WLEA 3OZRA 3LHIA 3INYA 3DL7A 1HQYE 4QDUA 2ZBPA 4EBFA 4W82A 3ZQ4A 3LLSA 1XJ5A 3WK9A 1LPBB 3UTCA 2C3PA 2WG0A 1NP6A 4RCVA 5F3WB 5HJEA 5AESA 2BKXA 2GBPA 5J4LA 1JEYB 2A9FA 1T8UA 2C92A 1VHWA 2D2IA 4JHLA 5ALHA 4BXOB 1H4TA 1KEEB 4KLAA 4ND8A 3S28A 3W4JA 1W36B 1Z2CA 3DXXA 4FNMA 4MKGA 3SJCA 2WUGA 5GGXA 3NXKA 4X64B 4C5CA 2I7VA 2OGWA 3LY5A 4LISA 2WE8A 1XXLA 3MOIA 3NBQA 3OHSX 4M0MA 4DBZA 5JR3A 5GADl 5KOIA 3LWZA 4P7GA 2K87A 4TTJA 2HK9A 4LYGA 3C6MA 5T4FA 2VHJA 3WJAA 3VR5H 1TM7E 4CF7A 5KTNA 1IQRA 1QYRA 3MT7A 3GB9A 3HVKA 1O7JA 4OTZA 2IJGX 2WU8A 1PL6A 4PQEA 2CJWA 3MYYA 3HJNA 2H1CA 2HOQA 1Y89A 4NBUA 1SXQA 1MC4A 5JNRA 2DTDA 2YWCA 1UINA 3F4KA 1QO7A 2UVQA 2QUBA 1P0MA 4CQLA 4E33A 4D4MA 3PUXA 3QUSA 2LWIA 4D3SA 1ZMTA 3P2EA 4TV9A 5B30A 1L9KA 3H9GA 2ODWA 2YMQA 3QYJA 4KX3A 4MA4A 3THWB 3L8GA 1R0CA 5L4SA 3ISVA 3CLTD 1E9SA 2WI8A 2J31A 4KPGA 4NYJR 4HDAA 2BYTA 3EBLA 1MZPA 1VI2A 2YNMD 1G9XA 3CNLA 2D00A 2F7SA 2BN4A 3N2GB 4G9BA 4Z1MA 3PK0A 1L5HA 2OXIA 3UA3A 3ESDA 3T5PA 2A14A 1XROA 1TU0A 2R8BA 2JFOA 3R4CA 4Y2PA 2ZSDA 1QGDA 5T4BA 4F91B 2OD2A 4BE9A 3BRSA 1OKKA 4DM7A 4GI5A 5JTUA 5JNVA 1E4EA 1FTNA 2JFUA 5B58C 2VHCA 3D7RA 1NVVR 3IVXA 5BN3A 3H5TA 1GG8A 1BKSB 2PFGA 4AY5A 5CA1F 4U3JA 3O4JA 4CKEA 1KY2A 4F46A 5EJFA 1LFAA 2BEUA 2G1UA 3NEYA 4GM0A 4RZSA 5FBQB 5D85A 3IO3A 5MGNA 5GONA 1BVRA 1FFCA 3U3XA 4RSRA 5TQ2A 1ETHA 3L6CA 4CF4A 1CEQA 4X90A 4XSGA 4A2WA 1LDNA 1Z17A 1ZAYA 3GT0A 4ZPJA 3T61A 4BZXA 5A6VA 3A05A 4K3VA 2A5JA 3HLYA 4R84A 3UV7A 3EOBI 3H5IA 4ZIRA 4XEUA 3TXXA 1PL7A 4DCTA 1YZQA 3BDIA 4KXXA 2PMFA 3GAZA 3NHRA 1BVUA 1RS0A 4NFHA 3IC5A 2QMQA 3BKXA 1Z4LA 2JCGA 4FMDB 3FSJX 4JXZA 1PDOA 2E5WA 3GBVA 4M1QA 2GBLA 2FEXA 4P5PA 3HLKA 3LT2A 1UANA 2H00A 4BFSA 1GGVA 3DFIA 3BE5A 4CHTA 5DFAA 5IW8A 4DLBA 4TMTA 4NU8X 4XI9A 2X2PA 1FQWA 4ZO4A 1MB3A 4FYWA 1SXJB 4G8CA 3I5UA 4D82A 4K9DA 3GNTA 3K92A 1GA1A 2AWOA 2YZNA 1U65A 2JGRA 1AHPA 2EZTA 1GEGA 1W9HA 4INZA 4KK4A 3JQBA 2DAPA 1RQ2A 3J7TA 5MN5A 1EP3B 3U31A 3WFJA 2ZRHA 3HKEA 3RHFA 3U61B 1FC0A 2Z04A 1ZD3A 1QU2A 1VKNA 1IZYA 3KOZA 5KCZA 4WXHA 2GT1A 4QJ3A 1P6QA 1QYVA 1Y6RA 4NATA 1VPWA 3DVAB 1RBZA 1XRMA 4Q5IA 3RSSA 2J85A 1J22A 1V4VA 3W5AA 1E99A 3GWGA 3B70A 3NOQA 5JAUA 4GECA 2Z56A 1G3UA 1YB7A 3I42A 1TW2A 2X1LA 4ZZIA 3QJ5A 2CJFA 2IITA 2FFRA 2JBAA 1YJ8A 2OB1A 2JJ1A 1XD2A 1TLTA 3CURA 2O8NA 1MEOA 3FNEA 4FDAA 4AD8A 5EIFA 4B6SA 4EW1A 2Z3VA 1QORA 3KU4A 3AI2A 3MSXA 4IUBS 2PWAA 3IHTA 1D6MA 5LJIA 3GRYA 4MWGA 2A1TS 2Z2XA 2XMSA 5M3BA 4ZEVA 3W5HA 2DX7A 2FGKA 1UWKA 1LK0A 5L3RA 3ZW7A 3E9RA 3LRXA 3QLVA 1PFYA 2WWIA 3VYSB 1K3TA 1QGUB 4JP3A 3SC2B 1I2MA 2DQYA 1E64A 1B1AA 1LSUA 3P52A 4ARZA 2I6QA 3UK2A 3W05A 4NOKA 4Z9YA 3HCDA 1E18A 3VV2A 3WL5A 5CLLA 4BU1A 5HWSA 3GLGE 1DO8A 4RO0A 4TYPA 1LLDA 3W3AD 2ZYAA 3OZXA 5KOJA 3F96A 1YR8A 4OFZA 3OE7A 5TPZA 4XYLA 3GUHA 5JSZB 3VNAA 1D5CA 5EP3A 1K7SN 3WL6A 2XPCA 4ENUA 5KU7A 1NY5A 3RSCA 5IJZA 1V9LA 4IIEA 3NETA 2HEGA 2QN3A 3A6JA 2AFIE 1NXTA 1KO1A 1ORRA 2FUG1 4I1RA 1HLPA 4IHAA 4KQJA 4QODA 5FA8A 1KAHA 1YRQA 3O38A 1KYIA 4WADA 3A4TA 3GIWA 4Z51A 3R8CA 1J7JA 4BLSA 1C7ZA 3R74A 4QUHA 5SICE 5CVUA 4AJ1A 1LJUA 3TECE 3KVRA 4PZ0A 1GN9A 2WC1A 4HDQB 4C4PA 2ZJ8A 4CKYA 4LY6A 3N6XA 2VPPA 3KSBC 1E62A 3D31A 5B3JA 2BCJQ 3BBPA 2O0MA 3GFRA 3L40A 4K9NA 1SUSA 5J4YA 3UICA 2DZDA 4D4LA 1P0FA 2O59A 3RTDA 1TAUA 2XRFA 3AHGA 3P26A 1P1IA 3KQMA 4GX0A 4RVNA 3PGKA 1SULA 2C5HA 1SIWA 2WWGA 2VP6A 1WBJB 4XB1A 4YAIA 1EX9A 3H2ZA 2YRFA 1B16A 1L7VC 2WF8A 2G4LA 2ZYVX 1UDBA 2YW9A 1UKCA 3GEDA 1GUAA 3JQ9C 1N6RA 2OBYA 1VHJA 4UD2A 5C1DA 4US2R 1PK7A 3ZCRA 2RHLA 4LFAB 3HUUA 1VJDA 4IO1A 4HNSA 4PZEA 1GZ6A 4P1ZA 5KJEA 3TGPA 3JATB 4XQCA 1AVTA 2ZE8A 1A71A 3D3NA 1RXYA 2IZ6A 3EG5A 5KTTA 1W34A 3KFLA 3CLHA 4WCDA 4KQIA 5K8IA 2YASA 2EFDB 3M81A 4JMLA 3GLUA 4CMIB 1C2YA 4BNHA 4P58A 2H0RA 1U7WA 2JLSA 4YHHB 5CCBA 4EP1A 2ORYA 3IPYA 5JALA 1I2BA 1H2FA 2BEVB 2HNKA 3PL1A 5L6LB 1VLLA 3P97A 3C7CB 3GP8A 1B8NA 2GAJA 3KT0A 4RQUA 1THTA 1OBHA 2BFOA 3FPLA 4YXWA 3R7FA 5BYAA 3H2HA 4EY4A 5LQAA 1Z07A 1Z34A 1BWQA 1E6MA 2JL1A 1X1BA 3C3PA 4LV6A 2B7BA 2VNIA 2CJPA 3HZOA 4MQ4A 4Z4EA 2EU8A 1CHDA 1NC3A 1E8DA 2HSDA 1XZDA 4Q3BA 2M6LA 4BLQA 1ENPA 3GEEA 3QMPA 3ZJ5A 3A8TA 4IOKA 1NIJA 4R0NA 4Q3NA 4BLUA 4RFSB 5K0ZA 4X0EA 4MRPA 1F14A 1U7XA 1Y1TA 3SZUA 2O2SA 1P62B 2WKRA 1YQDA 2YINC 4N7RA 1EVZA 1SKYE 3NOXA 1W93A 6AT1A 1HT2E 1ZSNA 5K0TA 2WHXA 3I0ZA 4A8HA 2X0JA 2WJJA 3MWFA 5EQTA 1E5VA 4ZQEA 5CAEB 1L2TA 3L05A 3SICE 4BWVA 4XR4A 1OCEA 1N7HA 2AJDA 2WU1A 2I0FA 2WDPA 5FTJA 5F9HA 3WIVA 5IZ4A 5E4FA 2C9CA 2XQVA 2G1AA 1VJ0A 2OM6A 2V54A 2A0FA 2XWBF 4PO3X 2WSSA 4ZU1X 4C4YA 4P3OA 2NZVG 4CCYB 1XVLA 3M2PA 1TJPB 4P2GA 1RXCA 1CUZA 1W73A 2DR0A 4L9SA 4X8LA 3ADBA 2OXFA 2HJVA 3DUFB 2P9ZA 4WMLA 4EMTA 3ZDAA 2YWDA 4JL5A 2JLYA 1H93A 2G76A 2MDTA 3MJSA 5DGHA 2HLNA 2OFXA 1DIBA 1WU8A 3MMPA 4IIVA 2Q1UA 3RT7A 1AQYA 1U0LA 3Q3VA 1UBSB 2P3LA 4ER5A 5E95A 3PD7A 1XAHA 3AIIA 1Z45A 3CUUA 3O4RA 3UT5B 3K4HA 4YAGA 2OHHA 1PE0A 5IK2D 5DM70 2YXPX 4JI4B 1JJ7A 1JI0A 1J8YF 1KJIA 1M2OA 1QNFA 2YBDA 2QIPA 3EZFA 2HQBA 3PQ6A 4KXYA 4WFQA 3W2GA 1HDCA 1ZA1A 3RBZA 3ZDYB 4CM8B 2ZTUA 1I13A 1FNBA 2R8XA 2R7LA 2JARA 5HUHA 3AL3A 1HZZC 5DISB 4LK2A 1OYWA 1DMSA 1O03A 2QZ9A 2A86A 3GQBB 2A33A 1TQ2A 1EJ6A 2QQ0A 2JAOA 4HRXA 4EB3A 1DG3A 4HDRA 1MV8A 4XCXA 2ID4A 4RVHA 1E7WA 3P0RA 3QEMA 3JPWA 4BLVA 4E6PA 4MIEA 5ITVA 3LC1O 2PQMA 3VQTA 4O3MA 2JJMA 2PTHA 3B8HA 3BEDA 4ZT5A 3FPSA 1OU4A 3I2KA 3OZFA 5KYKA 2NU9A 3P0HA 1HTTA 2P91A 5AOCA 3PKJA 3PT9A 4GPAA 4I50F 4NE7A 5BVHB 5K1ZA 3ZHTA 1TIBA 4OA8A 1C41A 1DWUA 2WNSA 2V58A 3H86A 3AHDA 2C3YA 4MRSA 2N3ZA 1JSXA 2BRUA 4J43A 1YI0A 4OBBA 2ZULA 4P82A 4Q7LA 4W7HA 5ENDA 2GGSA 1AGNA 1JQBA 1PNQA 2GPJA 2W6JA 3AM3A 3HADA 3KE9A 3QWIA 1PV4A 3LRPA 4QU8A 5KNBD 1GIAA 2PSHA 2C0QA 4RX1A 4DAEA 5C8VA 4QKQA 4FI3F 2EP8A 5AI5A 3ANYB 4CL0A 2GZ1A 3DM9B 1MH9A 3RJ5A 4LJLA 5KC9A 3PHLA 3F6CA 1H69A 4F93B 3TMKA 4AU1A 1FZTA 4Y1RB 1ZK1A 2R4TA 2HPHA 3I1IA 4MKZA 4U2DA 2FW9A 4JI2B 3F7NA 1MX5A 3E8SA 4CEHB 1OWPA 4AG3A 5L9AA 3CTMA 2X4DA 3BXPA 4Q9DA 4D9GA 4EY6A 4KQWA 1UPFA 5LIPA 1N1GA 2JJ2A 1P91A 3GZJA 4PCLA 2JK0A 2WW8A 1PVDA 5EIOA 3U09A 4EUFA 2GZRA 1DIGA 1H0SA 2RI0A 4CR8A 1BROA 2VF5X 4ASUA 4CDRA 1C7QA 1FLDA 1GZSA 3C5CA 2F3TA 5AHWA 5LUAA 2ZRQA 2W2NA 3R7WB 2V7WA 1ZSVA 4DJEC 4H2DA 1E2DA 3MMXA 5K8UA 5JE8A 1SC9A 5T8KC 1WOMA 5EUMA 2F1IA 2OORC 1CQIA 4RQBA 4NBTA 2GKGA 5I9TA 3KQTA 4BYMA 4OUDA 4D0NA 2GTHA 2ZSBA 1HNXB 1T3SA 4Y9UA 2Y66A 2ZBDA 5FUQA 3GFQA 4JLKA 5IDQA 4JGGA 2VNKA 2P2ZA 2QJOA 4QLBA 2NTEA 3D2AA 1OX6A 4P2BA 5EINA 4C0KA 4E03A 2E4AA 3CG4A 2GPNA 1M6EX 2NQ2C 2EKPA 4REMA 3TTTA 1CDZA 4J1NA 4L0DA 4KOAA 1JG1A 3WS7A 1BFKA 1XP5A 1TMOA 1IYZA 4EG6A 4E2ZA 4EAAA 1GPNA 3F6BX 4L4YA 4RD6A 5BWBA 3BF8A 1WHSB 1PYGA 2A9PA 3EEQA 1OIVA 1ZJYA 1IC6A 4KR0A 3VH3A 3E2PA 1C30B 3UJ8A 1T3LA 4EHDA 3OTHA 3HCNA 1YUMA 3LUGA 1V8DA 2B0JA 5BNFA 1I7SB 5JAOA 1AA6A 2WJ3A 2IQIA 3ZGVA 3CZ4A 1WXGA 3Q7EA 2Q41A 2ROQA 4GBMA 2ZGVA 1UJCA 5ALSA 2RGNC 5BN5A 1R9NA 1EUDA 3O6VA 1P7PA 1U9YA 4BECA 2X3FA 3K4PA 2N47A 5HX7A 1MRZA 2C4TA 4TMVA 2XBMA 3KL4A 4KQEA 2O57A 4R1TA 5KYWB 1Z0SA 3FLEA 4LJ7A 4ZK2A 4MYDA 1NU8A 4UBKA 4CL8A 4MJLA 4KDRA 2P6NA 3KXDA 3VU8A 3ICCA 5EE0A 2ANBA 2JJYA 3DOIA 5FA6A 2QZPA 5FPHA 4BO6A 3UA4A 4EMSA 2VHTA 2EJWA 4JKYA 5K3SA 3CSSA 1TUBA 2H1IA 3CKMA 1I2DA 1R9MA 3GT4A 3G2LA 3ITNA 3OO1A 4MW2A 4UARA 2O8DB 4DQXA 3GRVA 4FJ2A 3L9WA 2JA2A 3ZWOA 1KAGA 3B2EA 3F4LA 3PKZA 2CLIB 3T3EA 5ECWA 2JANA 1ZNQO 3GRPA 4PNHA 3NTUA 4X84A 3D0KA 4PIMA 1Q6YA 1RMQA 1SC6A 2VJMB 3IIKA 4B87A 3G9QA 4L07A 3EMVA 1MJ5A 3OZ7A 4PZCA 3A1TA 2BC9A 1UF9A 2I76A 2ZVDA 2FPWA 4MQ5A 4N40A 3W2IA 4EAQA 1GG9A 2NPOA 3H6GA 3OH8A 2Q28A 3OPMA 3RB8A 1CUYA 1AQ6A 3GY0A 5FD8A 1CRWG 4PYIA 4CLRA 1JWLA 3WYNA 2X7JA 4AWBA 3CT4A 4G26A 5F78A 2ZUDA 5EIAA 1E96A 5TJ9A 1BIFA 3MXTA 2IDMA 4IVPA 4JU9A 5LA6B 1PFVA 1EX6A 2VP3A 1FDUA 1IMJA 5CGZA 3C1AA 4PF1A 4U8HA 3U3KA 2F8TA 2VDNB 4GKKB 2OV3A 3WBBA 2RJ3A 1IOLA 1JHQA 4O4LF 4F1KA 2YCBA 2PX3A 2ZRKA 3BC1A 3UTDA 4XM0A 2IBTA 3GJYA 3RHTA 4G4JA 3P9KA 1FFHA 1Y6GA 1OH5A 5ADWA 3IPCA 1G4UR 1WHTA 3AWDA 1OAOC 2WB4A 3GFVA 3GUZA 2H4YA 4ACBA 4DMUB 5JOQA 1JKJB 3KIPA 3SF8A 4BUJA 3ZD6A 2HR1A 3CSUA 4I50B 4CF6A 2NTJA 3RFCA 3RRZA 3VZBA 1AB6A 4M99A 4EUSA 5LYJF 1II0A 2SKEA 4IGEA 1UFKA 3ZYCA 4TL7A 1DOZA 3Q0TA 1Z7BA 3GMSA 4NJOA 2PG3A 1RIFA 2D1YA 4B84A 3OF3A 3C3MA 2P4EA 3UFBA 4A92A 3JQFA 3W4KA 5BW4A 4C6TB 5TIIA 1IQ0A 2JFXA 4KNWA 5KTRA 5JWOA 2FSVA 4W1PA 4EFDA 4G24A 1LBTA 2J0VA 1E32A 4BE7B 4P86A 2QTHA 4XAQA 4YQEA 1LC0A 3IJRA 4E4YA 2XOXA 3AJ8A 4QYMA 4CFZA 3Q8LA 5J4HA 5ARBA 1D0SA 5F3DA 4YMVA 4EPRA 3JASB 2V4ZA 1N5IA 3K6JA 2GLUA 2WVJA 3L4BC 5E6UB 1NTOA 2NO7A 4EA8A 3I39X 5JS2A 3EVZA 1OFUA 4NFSA 1SJ9A 1UM9A 4XFJA 4ZHSA 3GLGB 1HSZA 3RUEA 1Y3BE 3U5ZB 1Q83A 3WZ2A 2BDEA 2V9ZA 1CPYA 2YJ3A 1OW3B 4QUBA 4XPZA 3IV7A 4OQFA 3QXCA 1AA9A 4OFBA 1EX7A 2HT6A 3G6KA 2FB9A 1Z56C 1POWA 1G59A 4FWBA 1NKVA 3W2EA 4B3HA 3GMDA 4H1VA 2QN8A 2VQDA 3LSTA 1L1QA 2NO4A 3UH0A 1V6AA 2HC9A 5BVGA 1SXJC 2IPLA 2M6SA 3PGVA 2RE8A 5A4JA 3DNMA 2AYYA 2ASVA 5CVDA 4NMWA 2CLMB 2GJ9A 4HZUA 4XVUA 3QEJA 4DNPA 3UMRA 2OAGA 2JGKA 1AHIA 1QGED 3QMMA 4OOFA 4D3FA 4EVSA 3M6VA 3HVIA 3ZY2A 4KGXA 2I7XA 2ZB2A 5E6RB 3LHSA 4Y2YA 3RVNA 2ZXEA 3ZXIA 5BW6B 3T06B 4YAUA 2ZZKA 3OTQA 2PSSA 1H3FA 1M33A 4Y2UA 3H3FA 4AMBA 4JEUA 1SXPA 4V0SA 2XOKD 3LVQE 3N53A 5JH7F 2VXBA 3HG7A 2BKLA 1US8B 1HDIA 4TLLB 2D0OB 1T2DA 4XW2A 5B1EA 1QF6A 3UWMA 1ZNXA 2ZPUA 4JI1B 4RCZA 3RTEA 1ONPA 3TW8B 1KORA 1MB2A 2W8BA 1JECA 3OI7A 4ZI3A 4JFAA 4HRVA 4MEJA 2GCGA 4OK3A 3B1WA 4PCUA 4QFMA 4HUQB 3USZA 1CZOA 4BVAA 3WGGA 2F55A 1W96A 3TNDA 2CLKB 1VL6A 1U3VA 1KYVA 2C9OA 5CITA 1AKVA 3EGXB 3EAGA 2RGYA 4PAQA 1CJCA 1ZKMA 2BI7A 3NHPA 3QVKA 3TOSA 5AVQA 1NV8A 2EJVA 5KKCA 2X3YA 4IZOA 4L22A 2CV0A 3FVQA 4F0JA 5I45A 1I1OA 4C4ZA 1L4HA 5LB2A 3FDZB 1ZIDA 1GKKA 2VRBA 1WPXA 4E14A 3B8EA 2F17A 4F86A 4ZDKA 3D7SA 4EUNA 2DB3A 1Q1QA 2FVXA 4DNFA 1EGVB 1VLZA 2Z1NA 4RZ2A 5CA0A 3WWZA 1IY8A 4BX2A 5ES3A 1KAEA 3LX5A 2I7DA 2A57A 2H1VA 4WKCA 1PNVA 2SKCA 4FSDA 5EUBA 2P77A 2W2PA 3HDGA 4RZUA 1PI3A 1KI3A 1QZ3A 1EXNA 1GGFA 3R77A 4UMVA 1NXQA 3RC8A 3Q2OA 2NU8A 4L0CA 1KZGB 4DSNA 4EO7A 2IDZA 1P72A 1T2CA 3GT7A 1VP3A 1ZJ4A 3AT1A 1KJZA 1QLJA 4WZAB 4QPJC 1NOIA 4OB8A 5F2OA 3WKDA 4EY5A 3OSZA 3S2FA 2ANCA 4Y9SA 1U2GA 3QU7A 4ZVSA 4Y6GB 2HA6A 3FSGA 3I0MA 1TC2A 2QF7A 1B6GA 3FLAA 3N8IA 1PLKA 3ETDA 3FH0A 4Z54A 3E9NA 3D7NA 2B4QA 4MUEA 4QDTA 1UQTA 1C8VB 3I37X 5E6SB 1T3ZA 4IYJA 4XXHA 1U1CA 3PYMA 3GGCA 4HDOB 5C4MA 2BSXA 1BG6A 1QP4A 4O4LB 4EVQA 2RH5A 3BWEA 3FE2A 5AK0A 521PA 1GKUB 1OXMA 1AMNA 3H87A 4QU5A 4ZTZB 1QFMA 2NG1A 5BMVA 2QM3A 2PX2A 3QVGB 3AF5A 1SUWA 4UCWA 2VZEA 3AI3A 2ZYHA 4O0MA 5LMUB 1A76A 5IX8A 2GBCA 4BNIA 4Q1AA 1D7OA 4LWZA 2Y2VA 5L4LA 5LPNA 4I4IA 1XCOA 3C39A 4HJRA 4PU0A 4UUMA 3HO1A 1SPBS 1PZEA 4BVLA 1SBTA 2QMOA 5GZ3A 2P3SA 1GU1A 1NW7A 5CX1A 4B3JA 1RHJA 5IAGA 3MT9A 3EK2A 1XIVA 3D1JA 4IRUB 2ZT5A 4Q9LA 3SNHA 3PDUA 3DVQX 1JHDA 2WM3A 3LNCA 3HP7A 3FPAA 2I1WA 4EUHA 3D64A 1X7GA 3TINA 1KWKA 4HGPA 1XHEA 4AF7A 4BMVA 4ZRNA 1V35A 3FW1A 2I4TA 4AMYA 3GLFA 1S2DA 3AUYA 4D6XA 5HQTA 1IRXA 1Y4AE 4CLOB 5B12A 4JBWA 4PFKA 4CE6A 4BLTA 4XTRA 2QW0X 3RFTA 3HI4A 1E8MA 2B1RA 3QU9A 1F0YA 1OROA 5H02A 1N0IA 5LQRA 4N6GA 1QE0A 5KNCH 1V6CA 1J0XO 3GJ7A 4OI2A 3ZK9A 3M1YA 4E5SA 2JKVA 3COSA 3F6EX 4RSGA 4XPIB 1REQB 1W4AA 2P35A 3RUPA 3ZLBA 1DE0A 5FHRA 1WVIA 2A58A 3MAJA 3OBBA 4WXYB 2FRDA 1EB9A 3LT0A 3HV0A 1RXVA 1U1FA 2DPGA 4HLDA 2INGX 3WQSB 4IM7A 2CUTA 2AOWA 2DFNA 1PGNA 2OKGA 2AQHA 5JDIA 3EPJA 1E9RA 2EDAA 3ICQB 4WVFA 4X7PA 3AUJB 3E6AA 4ANFA 1F8YA 5AXAA 2PX5A 4MV6A 2WF5A 4HAYA 5CFRA 1VSTA 1S3IA 5THXA 1O6BA 1NNSA 1KU6A 3CLUD 3L1HA 2OZLA 5C4GB 3FCYA 3REQA 4YFYA 4EFMA 2O8VA 3LT5A 4Y7DA 2EWMA 5HFAA 2FNAA 2Q1YA 1UKYA 3U13A 4QPDA 5MGBA 4LIPD 2B8NA 1W19A 2I3GA 1SIUA 4GWKA 3H4IA 3KEQA 4L8VA 3S2IA 4A7PA 1W76A 5JH7B 5KYTA 4XD7A 2UYOA 2QVBA 4CXMA 1V3VA 5H9VA 4HYYA 1CCWA 4DDTA 1GSAA 1NVFA 4BP9A 4AXBA 3VZCA 4CU5A 2PIAA 2YXEA 4DIUA 1N4AA 3T5BA 3AUAA 3W5SA 4UBOA 4RETA 2JEZA 2Z6VA 3GG2A 1GAJA 5K3OA 1P7CA 3VH2A 3GFGA 3FKJA 1ND6A 2PRIA 1KS2A 5K51A 2D5LA 1N7IA 4RV5A 1XUOA 2N75A 1RAFA 4FOTA 1N5DA 1Z5VA 2MYUA 3PVZA 4Q4HB 4FOLA 4Y30A 4MH0R 1E66A 4CDNA 4PLPA 3WIEA 3TLEA 1OLXA 2HXYA 3ECSA 2OWDA 4IV8A 3WLMA 2XVYA 2IOYA 2CB9A 5EERA 5EJAA 4V3CA 3OLYA 4YMLA 3CMMA 1B0AA 4MI3A 2Q1XA 4XX0A 4AJ4A 1RWBA 1IBSA 4UEOA 4YUYA 3NBKA 2YVUA 1TIKA 4QWMA 3AR9A 3UMSA 5JEEA 2XLBA 1COWA 3H84A 1CIJA 1XF9A 2QTCA 4YMUA 5INTA 2XTAA 1DHRA 1GR0A 1PWXA 4Q9HA 4YMWA 3GJQA 3BFJA 3A1EA 3NHMA 2C7PA 4JLAA 2O1SA 2DLCX 5IJ0B 2W2KB 2EG9A 2V7VA 4V0MA 5JNSA 4JROA 1YKFA 2A0WA 2FOLA 4PM4A 5J2UA 3ZDXB 2Q5OA 1NWHA 2BEWB 3NB0A 4BKUA 3P96A 1SCQA 1U0RA 2CXOA 2RFLA 2VF4X 4DR1B 4HDNA 1ZNYA 4NHEA 4JI0B 2PH3A 2J5RA 4WESB 5EG5A 4EYSA 2YRWA 3QFFA 3DBIA 1J24A 4G81A 4DCJA 1U7TA 4GMGA 1AQJA 5HZMA 2R5FA 5AXBA 1VMDA 3EXFA 5KWSA 3HQ4O 4X63A 3QLTA 3HBNA 1CYDA 3LRTA 1AKRA 4J16A 1I6MA 4ERXA 3QBEA 4V39A 1YNOA 3OM0A 1WCYA 1L5QA 3VI4B 2VEDA 1EVQA 3KO8A 4EY8A 2OZEA 1MRSA 3NT2A 3SYKA 3DW1X 2DY0A 3ETGA 4N0PA 1Z5UA 1WD5A 1OWLA 4GPIB 1QS0B 2V45A 4WQMA 5G1OA 4LRUA 5DF1A 3WAKA 4R2JA 4E46A 5F33A 4ESEA 5BSHA 2QMEA 1OGIA 5EVJA 1KR5A 4ARCA 4DLUA 2PRSA 2I1LA 2Y0BA 2PLRA 4FT4A 3ACDA 3TJMA 3T9AA 2EP7A 3PR3A 2NUPB 4YJKA 4BJ3A 4KQGA 4GXTA 1DGQA 1FU8A 3TPFA 5JCOA 2I8LA 1GLNA 3G02A 1PJAA 4QREA 3RUCA 3V2IA 3ZHBA 1KYYA 4A6PA 4ER3A 3ZYZA 4ENTA 3RIYA 1W5SA 4IXDA 2H1FA 4R1QA 3PPIA 1AZSC 3E7XA 4HGOA 2J6CA 1RAHA 4HGRA 4G0NA 4DLVA 2CK3A 2FWJA 1MAVA 1X1RA 4L51A 5B37A 3L1IA 3IIEA 1H4QA 1QIEA 3U3RA 4PZYA 4E6EA 1QM5A 1AQIA 1GRQA 4GKVA 4B3RB 1OTYA 4K26A 1SCUB 2ZROA 1AOXA 1E3WB 2CNBA 2VNAA 1EFPA 1Q50A 3SC6A 2F3PA 4XIFA 2Q3MA 3TLXA 5K0JA 5D6OA 4ND4A 5HRUA 2IEIA 3OCZA 4JJEA 4Q4AA 3SK0A 1X7XB 5A04A 4B80A 1FFGA 3JQEA 4WN9A 5J5CA 1VJCA 1X15A 4E15A 3CZ9A 3LUPA 4PZLA 5IT0A 2V3WA 4WK6A 2R6CA 2VATA 2P4SA 3V46A 1KYZA 1BOOA 2G40A 3BKWA 5CBPB 4CKXA 3QI7A 4RHEA 5JCZA 1U2TA 3TSOA 5ER6A 2WG1A 1ZI8A 2JK1A 2PZ8A 3CBGA 1GOTA 5IM4A 1RAAA 2P7HA 3NDJA 5EJIA 3FRIA 2AUMA 4JC8A 5CD9A 3CBQA 2AMJA 1L9XA 2J5BA 1VE7A 3DXZA 3GOQA 4JL6A 2NW6A 4OSPA 5ALYA 3VPGA 3ZY4A 1R0YA 5COQA 1FUIA 4B7ZA 1KZYC 4PZAA 1TZCA 2IYZA 3WO0A 1SCBA 2VKTA 2PA0A 1GZ3A 4HWTA 4OMDA 3N2LA 4H4EA 5CCEA 1QQAA 1ORVA 3H65A 1I2ZA 1TVKA 3K9QO 4M1EA 3TNYA 3E9CA 2H4JA 3A1UA 4XA8A 3W7VA 3GRRA 2OHFA 2OR3A 1K4YA 3EJ6A 1HRDA 3SOZA 2QX8A 3D6HA 1UADA 2FPGB 3R3HA 1I80A 4HRAA 3PB3A 5KVQA 3DV0B 3FHOA 4W5TA 3H2KA 1OASA 3KJHA 3IESA 2IYNA 2PK3A 4EPWA 4ZHQF 2VDVE 3HJGA 2OOKA 1I1QB 1ZVMA 5AW6A 1AGXA 4HXYA 2D4HA 4UZFA 3S2YA 4A10A 2PZKA 4F2PA 4LZWA 2UZ1A 1FJXA 3O1HB 5DHSA 1QVRA 5TV2A 1A2QA 2GZAA 3E9DA 1DAGA 1ULTA 3PGXA 2O20A 5AI4A 2W58A 1X8JA 4H7HA 3ZHVA 3CEJA 1FYDA 4LSGA 3X2FA 3CG0A 4EMBA 3GAFA 3SXJA 3K0AA 5TARA 3ZGXA 1WR8A 1RZVA 3C6XA 4I4TA 5L3SB 1BN7A 4G5XA 1DJLA 3MWEA 2CYAA 1YUBA 3T0FA 2ZPAA 4HRYA 4Z2YA 4JVNA 1P2FA 3H2JA 4P7BA 1INLA 1I6LA 4URFA 4UDXX 4WBXC 3WZLA 4QU0A 1YBAA 4OGKA 1C3JA 1C9NA 1Y9DA 4PX2A 3H9EO 2X1VA 3VDRA 3AIMA 3C8UA 3K1YA 2ZJ7A 5LNK1 5EJMA 4MPPA 1RM3A 5EZYF 3Q8MA 1ISHA 3DD1A 4B8WA 4KR3A 4MUJA 2HCRA 4X20B 1Y8RA 4F9FA 3L8EA 1NRJB 1MC8A 3P0JA 3NTLA 3JV7A 4ZOLA 1G55A 4OQ4A 4QXQA 4I5EA 4X7RA 4B32A 1GTL1 1D3AA 3MW8A 2EGGA 2HSJA 3OA2A 3ZZNA 3WAGA 4GL2A 4TYNA 1SIOA 1A96A 2BHNA 2IP4A 3HPQA 1CY6A 2Y71A 2X3UA 3SSAA 4S0ZA 3Q7IA 3VU9A 4FI3C 2XRZA 1SVSA 1TZBA 3QLJA 3K96A 3ZE6A 3K1AA 1IG0A 3RSGA 3CZCA 1C9JA 3BREA 4LGVA 4Q3DA 3OCCA 4OHCA 4UNQA 3QELA 4OFWA 3VYUB 4CUJA 4FQ8A 3A3PA 1YFZA 3N0WA 2PBFA 3CJTA 5DPMA 1ZMBA 2VTKA 2FAXA 3FYUA 4YMIA 4LOKA 4CQMD 2COKA 5ERXA 4CV1A 4DC1A 2C2XA 2Z5LA 3E81A 3I4LA 4RW0A 4TOIA 5CLHA 5FTKA 4WZZA 2LV8A 1EM8B 2FN3A 4NCBA 3U56A 2CE2X 1Y33E 3VC2A 1TO1E 2C4UA 3JSXA 2XAUA 4L74A 4I1OA 2HAEA 4HDSA 4PHCA 2WYHA 1THZA 4MAMA 3X44A 1JALA 1RQNA 3EVEA 4N7JA 4NJMA 4X7BA 1KEZA 3L4KA 3FMFA 2XCUA 4L08A 4QBKA 3OUZA 1I1HA 2B37A 2FPIB 5KAPA 3BWDD 5TS3A 1YDGA 4X6UA 3CV3A 2DJ5A 3PHHA 4PRZA 4NEGA 3SHWA 5B6PA 2DHRA 1GGHA 1I7QB 3VYWA 1TEHA 4AKEA 2YV3A 2B5WA 1OHHA 3FUVA 1FYFA 4MTCA 2V7EA 2X8JB 1FNMA 2QENA 3QOXA 1JNYA 4MW1A 3PLAE 3NCTA 1ODLA 5EY5B 4H35A 4I1YA 4LKOA 1EFVA 1M1YA 2P6PA 5DHRA 3ZCSA 3O4GA 2PZMA 4ER0A 3TQTA 5B1YA 5D5PA 1DBWA 1RQLA 2G71A 2IEZA 4GRAA 4QPCA 1K7EB 1Z36A 3WGTA 3HKCB 4E5DA 3LBNA 1NRXA 1ISFA 1AK2A 1TVCA 4D79A 1UEXC 1WULS 5KAMA 4F6RA 4P3YA 4D9JA 2FGJA 1QPZA 1QHFA 3KBOA 1YZUA 2Y1GA 2ZCUA 3RWMB 1YULA 2DQKA 1Y37A 2AOVA 3K9NA 2DUJA 3FDJA 3FGPA 3SJAA 1GRRA 1A5AB 2HWUA 2AS0A 2EFEB 4NTZA 2C9DA 1TT7A 4B45A 4EB6A 1WZCA 1P4RA 3I30X 4CKBB 4CU2A 2XNSA 4KCGA 1ZW1A 1JSRA 2XE7A 2PUDA 1PHRA 3NV9A 3A6GA 2XDQB 5JMPA 3AZOA 1CIPA 1LFDB 3X1YA 1CQXA 3NAZA 3ZXXA 1AXEA 5BN4A 3I01M 4KIGA 3S44A 3JQ9A 1PNRA 3MUOA 1BE0A 2FP4B 2WJWA 3WIBA 2WPDA 5TT0A 4CGZA 3E22B 3V7UA 1TJ5A 5KDOA 1CZRA 2XOEA 2Q4EA 2XRYA 3DO6A 3ZTWA 4OQLA 4MV9A 2ATVA 4FYVA 3NJRA 5I9BA 1XNQB 1WW8A 1KY3A 1W35A 2HBZA 1VKZA 1PK8A 1M76A 3AP3A 4XJSA 2EW1A 5FO0A 221PA 2DTEA 4N82A 5IAEA 1VIYA 1G0OA 3FRJA 4YJ3F 5D7NA 4C3OB 4S24A 4TTSA 1K3UB 4K28A 4X65B 2O07A 2WMDA 4H17A 3R5HA 1UDWA 2J07A 4UTPA 2YH2A 1GYPA 1EFUA 4X60A 1XLTA 2WF6A 4HTFB 1HFKA 3H7AA 5K8TA 3MBKA 1K0FA 1UC5B 3LUJA 1WIWA 1Z15A 4PX9A 5EQJB 3ZHRA 2FWBA 2YY6A 1D2EA 4DIFA 1U9IA 5T6MA 4MQFB 2FMKA 1P2DA 5G0WA 3NNNA 1A4IA 3ET5A 3VPDA 4NDAA 2C2WA 4BGDA 5L51A 1Y5LA 4JWKA 3TZHA 2HX1A 3GH3A 5LQSA 4GWLA 3FB1A 1Q0HA 3RK1A 2XVAA 3IQWA 3K1TA 1YMUA 3E1SA 4AK9A 1XTVA 3W7BA 2QM8A 3I32A 1L4MA 3KHTA 4KL8S 1RC0A 4G01B 1CX9B 3DEKA 4F96A 1CY2A 1D4OA 2IPMA 3E9ZA 5JS1A 3DZKA 4I46A 4BKOA 3FNIA 3COYA 2H18A 5JNLA 1PD0A 3QVMA 4CNQA 3A37A 1BH6A 1O6GA 5B7GA 1UKBA 2BM0A 1FDOA 2W71A 3AI1A 2WSBA 2H2GA 5EZYB 4MKFA 1E0KA 5K05A 4JLPA 2FZ4A 5TLSA 1QUFA 1X14A 4QTUB 3HKDA 5EWLA 1VGVA 1GZUA 1OPXA 4RJKA 4Z99A 5GM1A 1MABB 5DM4A 3SHOA 4CI9A 1GG5A 1E3DA 3IKJA 5EPEA 1GQSA 4CM9D 4CEIA 1Y80A 3AFGA 1E2UA 3HI6A 2OL4A 4JBLA 4WTOA 2ZWOA 3KCQA 3N07A 4M1YA 4DTCA 4MQEB 1ZCBA 2W2VA 4LQLA 2GX6A 4L16A 5JISA 2L18A 3IA7A 1ESCA 1PHPA 3N5CA 3TRFA 5IJWA 2UZIR 1FP1D 4ENSA 4PBTA 4BRSA 2DWPA 3BH6A 4WRRA 1HZZA 2AJTA 4RK4A 4ZAVA 2XYHA 4ZP1A 1YASA 1CRPA 4QJIA 1QIJA 3MWGA 3T3OA 4YRZA 4MARA 3C4QA 5TMBA 3TR6A 3GJZA 5A4DA 1U4NA 4GKBA 4KFSA 1E3TA 5DLQC 1EXDA 3L1JA 3WGVA 4COOA 2JI4A 3IQXA 3BT7A 3NV7A 1CV2A 3W04A 2GPBA 2FLWA 3EUWA 4H18A 5CYOA 4BRWA 1NM5C 4C6RA 4DRXB 4DSAA 5BRAA 3R7SA 4HB0A 4D45A 2IU3A 1H85A 3AF4A 1FDTA 1Z68A 3H5WA 4FEGA 4LXQA 4N3BA 5DV9A 3V7FA 4XVQA 3THRA 3HEBA 2HMTA 2DCMA 2ID7A 2QD5A 2V74B 3OE1A 2FR8A 3FVVA 3M83A 5FADA 3REOA 1Y6JA 1DQPA 3KEFA 1RRPA 3E3MA 1DJOA 3UJHA 2VCYA 3THXA 3IUQA 1VIAA 1WPGA 5HDBB 3EC2A 3L6OO 3NONA 5DTQA 1K66A 1TGYA 2Q4RA 5TR9A 1AKEA 1W0JA 4BNNA 3WB9A 2GA9A 3HRIA 1N8TA 5IF9A 3AKYA 1PGQA 1BX0A 2VSXA 1L8OA 2X8WA 4YAFA 1AC5A 1LDGA 5FTNA 1GEEA 4HQRA 5J1SB 3ZVKA 3IAS6 3HXLA 3IH5A 2CSUA 1W5AA 2HO4A 2PMBA 4I8DA 1Y6FA 4UTNA 2C8KA 4MDYA 3ELWA 3P4YA 5EP4A 5AJHA 2ZI9A 5CH5A 5K0LA 5THQA 2RHTA 5TVGA 2I2CA 5LM3A 3TYXA 3HKBB 4GQAA 1BE8A 3O7WA 4K7JA 1ILWA 3T7CA 3ZNOA 4C21A 5B6IA 2AB0A 5ITWA 4PHTA 5C80A 4BB0A 4BN0A 4NX2A 2LXNA 3FVWA 3HB9A 4RDCA 4PAOA 4YIHA 3QBTA 5ULLA 2BSQA 2VSYA 3ESRA 2TYSB 4OHRA 3ZS9A 1XZKA 2HV9A 3SJBA 1P4SA 5T8KA 2O06A 2OORA 2ZJYA 5F35A 3W0LB 3GMTA 1PEKE 2LBPA 2PX4A 3BS4A 4TS3A 5IDYA 1UBNA 4EO4A 1VCMA 5TMPA 1NDQA 4UAVA 5ILGA 4NKRA 5DYNA 4AUMA 3CRZA 2A7QA 2VP5A 2J4FA 4D3XA 2O4UX 5A6SA 3W6UA 2BTOA 1AUQA 1EINA 4MI6A 4W1QA 1W8IA 4CIYA 2BFEA 2I1QA 1ES9A 3RG2A 2QM7A 2KX7A 1XALA 1CUAA 3NDPA 2QU8A 3L93A 4CMEC 4YJ3B 2VR1A 4G5HA 2WWHA 3PFBA 1RABA 5A3SA 4UCFA 4IDCA 4DOMA 1P4HA 1KI7A 2PJDA 4FDLA 3TI7A 4N48A 4IJ5A 1U7HA 1FE8A 1EQUA 3EQ2A 4H7JA 4LBWA 2ZQZA 1KDOA 2ZS9A 3C3JA 1Z2DA 3E58A 1FP7A 2OMKA 3CPEA 3EQ7A 3OZEA 1DBQA 3CLSC 5FWYB 2BP7B 2J09A 3FAKA 2FFAA 1TEVA 2BL4A 1EZ4A 2IZ1A 3ACBA 3GARA 1IU9A 2QUZA 4UVGA 4IHQA 5BW5A 5BXQC 2V0GA 3K9LA 3TOZA 1SGWA 2EV9A 4URHA 4OCZA 4JOQA 1MC5A 1IXKA 3OPQA 3RU3A 1YCHA 2ZUCA 6GPBA 3OX1A 2HBYA 2RGNA 4O25A 1MC1A 3HNOA 4FC6A 2WJ6A 2VIIA 3FDXA 2Q5HA 2ZSEA 1DOHA 5JPDA 4JKOA 2ZJZA 1A8HA 1WZUA 1J21A 3O90A 1MX1A 4ZAYA 5HPYB 2JIZA 4EX6A 3UW3A 1RPAA 2DQZA 3QFSA 1XPRA 2RGRA 2AYZA 3LWBA 4FR5A 1U28A 2BGUA 4W8HA 1LX7A 1AJEA 5AOBA 3FPBA 1JEYA 3KB1A 1FMLA 1QKIA 3OIDA 2FFQA 1BEZA 1I3OA 4OHUA 3SC4A 3I34X 3K1ZA 3M6AA 3ND9A 4J7AA 3F90A 1KEEA 4BXOA 3N2KA 1E1NA 1KI2A 1LTHR 2IZ5A 2VF8A 4KO2S 5HK9A 4JJIA 4JQSA 1RWVA 3QY0A 4BO7A 3ER9A 3G0OA 3LL4A 3WNCA 1RLUA 2C03A 1JW9B 2ZS8A 4HN9A 1EDZA 1N3YA 1QC5B 4NONA 2R79A 4Q1EA 4TV8B 5K8JB 4AJEA 1K8QA 3RYTC 2N46A 3IXLA 1ESMA 5HS6A 4CRWB 3NBZC 4QXRA 1NF9A 2CBZA 3EZYA 3QXJA 5DGXA 2QNRA 3PNLA 5JSYA 1JXQA 4U7GA 4LMRA 3DR3A 3OD1A 1S2GA 5I9SA 3VPHA 5TVKA 1Z08A 2B20A 1RE0A 1C3XA 1U8EA 4YTEA 2RGDA 1CUSA 1DEOA 4KSYA 3THWA 4E5YA 3MCUA 3AHHA 3UYKA 2OBNA 2VWPA 3BRQA 2W2QA 4AFNA 3L0BA 1PDVA 3L7LA 2IF2A 1ZD1A 2XA2A 3EBPA 3C87A 1JQAA 2OGUA 4IUYA 4PC2A 1Q84A 4LWPA 3QPUA 3ZR4B 1FRVA 3KP1A 3N2GA 3RYFB 4B3SB 2BMDA 2FWPA 3DE6X 4QXPA 4XRRA 1PR9A 1LF0A 1R12A 1S02A 3RUIA 3DAPA 3DZGA 4X71A 5JY6A 2XW6A 4JUBA 4I08A 3VBCA 2PGIA 1W75A 2Q7DA 5EA2A 3BD6A 4CEJB 1K8ZB 4X91A 2ATIA 2QBYB 1GNRA 5I01A 1OFUX 1O94A 5CYPA 3WL4A 2OV6A 2AMFA 1J0AA 3NX4A 4DMFA 3KL2A 3LLUA 3JX9A 1C1HA 2H52A 2JAQA 4FEYA 4N54A 4DAOA 5KQSA 3A1WA 4X7MA 4EB0A 3DJFA 4HWKA 2IPOA 2G9UA 1RWWA 2B1QA 2DJIA 3OQOA 3AC0A 1Z0AA 5JZVA 1F9EA 1YZYA 3JRWA 1KI9A 3X1MA 1Y7PA 4BJ1A 3RS4A 4DUGD 2ESRA 1HE4A 4P7FA 1IJFA 4GZ5A 3ONEA 3GEHA 4Y6LA 2BOVA 3HBJA 4FDTA 3DEJA 2BFCA 2PMDA 1XZHA 2QOEA 4NG5A 4DLKA 2BGJA 3DOCA 4ITUA 2P8JA 1LDBA 1D2GA 3D3JA 3AHFA 1RVV1 4IXMA 3K9FC 3VMFA 3LP5A 1N3LA 3NGLA 3PNOA 4MEBA 3UHAA 5MN6A 1O95C 4P33A 5F7XA 2AEEA 5EGSA 3DTNA 2VN8A 1O97D 4ZXFA 4GE3A 1SXJA 5B3AA 3G2NA 3ZU6A 1JYFA 3U62A 2GXSA 4CI0B 2F48A 3U9TA 3BUSA 1SR8A 4A0QA 1D8TA 4JB8A 1W1UA 3DCIA 1I3MA 1WD7A 2WHEA 3X1XA 2BBWA 2OCDA 4N5DA 5CR9A 2O8EB 4IX1A 4IIFA 3UQYS 3LDHA 2PV7A 5CHEA 4YYEA 4GU5A 3TBFA 4Z49A 5F5LA 1EK2A 3OETA 4F2DA 4ITRC 1X1CA 3A4NA 3C98A 5P8WA 2HHHB 3EASA 1AKUA 1MOPA 1QE5A 1W4CA 4QAJA 4C7JA 2R1VB 3UPDA 3P8ZA 2ZR9A 3DVAA 3OZWA 2B1IA 2HRQA 4PSCA 5FAXA 3SHQA 2XMBA 4ZEOA 2IKQA 4RPHA 3QVTA 3F5QA 2RARA 4YRSA 3DZ8A 5HILA 1QHEA 5ALZA 1AX9A 3VAAA 5K6TA 1H23A 1BEUB 1OXTA 1QDEA 3O91A 5TJHA 4ZV9A 3ZGOA 4HV4A 2PMCA 1GAWA 4Z6KA 4LF5B 1E2EA 3V3KA 4KE9A 3ILXA 2LTAA 4JJ6A 4KRXA 3ESYA 3OCUA 3HGQA 4G25A 4DL9A 3MMZA 2OV1A 4TZKA 1UJ2A 2IRWA 5J2TA 1EGHA 3K9BA 1S01A 2WTUA 3CISA 2OAP1 2VI5A 2GEBA 5G4LA 2JFBA 4IIJF 2Q8NA 1Y6QA 4Y67A 4EQ6B 2CKDA 1JR3E 2PIDA 3A9SA 4MRVA 1MAWA 4R8SA 5DEIA 1QGUA 3DWEX 1NJ6A 3L4SO 3IULA 3SC2A 4F7WA 1TKBA 1ZIOA 1NQWA 2H1OA 4TUYF 2QE6A 4IY1A 1DCTA 2GLXA 4KXNA 4R2LA 1BMFD 3KR9A 1DJPA 2I6SA 3KZKA 1NN5A 3KWLA 1OQAA 2OM2A 3L0DA 5FHQA 1I7DA 2G5TA 2BMJA 5BSVA 1M2HA 2E1RA 3KX2A 2C3UA 3CZMA 5GVRA 3RVRA 3DZBA 1IAVA 3EIQA 1T8RA 4RPJA 5TMDA 4ZODA 5H3HA 2Y3IA 3OFND 4EECA 1KPHA 4A0RA 1UXJA 1E1DA 1ZN7A 4HEQA 1MTZA 3JRXA 1OAAA 3LV8A 1KZ6A 2AX4A 4FHFA 2AJCA 2DECA 2QT0A 3KQUA 2Z8YM 4W5WA 2FQWA 1UXHA 1JAXA 2K4MA 2NO9A 4WE3A 2PH5A 3BD8A 1QO9A 2B6HA 3DF9A 1R6AA 1YXMA 2QN9A 3AXTA 3E27A 2YHIB 3L79A 4MJ7A 1IBKB 1BCRB 2EERA 1VM6A 4FLEA 4RORA 4DLTA 1F6WA 4HFMA 4F04A 3ZKWB 1AO3A 1GNVA 2X5XA 3KOXA 5HIKA 3PYXA 5JO0A 4LXGA 2IH5A 3ILYA 2Z4TA 5FUYA 1HXHA 1V43A 3VKWA 1D2MA 3SIPA 4K9KA 3M6WA 5KYUB 1ELOA 4H08A 3QLUA 3EIOA 3JQ6A 2IK8A 4HMOA 4D44A 2WUEA 3TOVA 3ORYA 2ZJAA 4X45A 4QUGA 5B64A 1YZLA 1U3TA 3HO6A 4H31A 2J0QA 3ABSB 2XB4A 2HO5A 4AJOA 3K8OE 3A3YA 5ECGC 3HFGA 5A7FA 5F7ZA 3IMGA 2R1UA 2ZAYA 2P4UA 1NE7A 2YOGA 4ZDWA 5ELXA 4PIVA 5DYTA 3MB5A 2JGNA 1TZ2A 4OHZA 3WLJA 3SDBA 4RC9A 4Q02A 4TRMA 4CMIA 1YVDA 4I6EA 4J7XA 1CHNA 1FFWA 1UXOA 1ML4A 3HDTA 4CF5A 3G9UA 5JSUA 4G0UA 3KK0A 4G5OA 1DEXA 3L82B 3INTA 3OU6A 1P2TA 1CZLA 4G3XA 4PHGA 4TN5A 3N76A 2BEVA 1NURA 2B5OA 3HVJA 1B42A 1F2UB 1BXZA 4DJAA 8LDHA 1ZR4A 1KSHA 3NPAA 5T67A 1SC3A 4AZSA 3FYCA 2Z5GA 3QF4B 1P19A 4HVCA 2XUHA 3IIMA 4Y2JA 5D3MB 2V6JA 5IAJA 1SBIA 1J4AA 2A1IA 2NZYA 2P6OA 1K08A 1RM4A 1Z0IA 3O9MA 4ZREA 5H3LA 4H1UA 5F1YA 3OHPA 1RI4A 4K05A 3DKRA 3RVJA 2XB6A 3NRBA 4LYHA 3DP7A 2HREA 3B9QA 4OXKA 5D5QA 4RFSA 4UBJA 2VH1A 1C4KA 3BE8A 3R6TA 3IT0A 4J0CA 4KFRA 4WECA 4GO1A 3F3KA 1UQRA 1UQUA 2YUTA 3JWPA 1PVOA 2VJYA 2GCIA 3HA2A 4K9PA 4YGYA 1XMXA 4Q4DA 3SM9A 1RWQA 1KYWA 1V8PA 2R85A 2X23A 4JOCA 4GPD1 5EMKA 3B3FA 1G5HA 5CAEA 2JIDA 1YZGA 4IMIB 4DCVA 3HC7A 3M6UA 3Q5EA 2R4UA 4H16A 5I7HA 4RBNA 5BWNA 3WGYA 1XZGA 1RACA 3AJAA 4B43A 1QV6A 4BNTA 3QVWA 3CKLA 1HC7A 5ALQA 3JARB 4Q1VA 4CG1A 3JQDA 1EHYA 4CCYA 5BSFA 1AZTA 2ACEA 5HRAA 1NJSA 4C20A 1EXMA 3AVWA 1T9ZA 1I14A 2BEJA 3DUFA 1SEPA 2GFIA 2FPXA 3ICVA 3QUCA 1U8AA 4UNSA 1P9WA 1RI3A 3RJZA 3UO8B 5FULA 1JILA 3EEOA 3UGJA 4JP2A 3R40A 3R3WA 1ONSA 4MP8A 3RSLA 2YVAA 3U60B 5DMHA 3G2JA 2HRBA 3UT5A 4D4KA 5HQ3A 2ZTLA 1ZR2A 1NYRA 2JIQA 5GVSA 2VSFA 3Q1KA 4Q21A 2H65A 3MF4A 1UDXA 4RHTA 3BMNB 1MHTA 1YI8A 1XQ1A 2R2AA 4PW0A 1PWZA 4HI0E 2UV8A 5EL0A 4CM8A 4CR7A 5C35A 1HURA 1RXWA 3ZDDA 2G0AA 4XVRA 4YCNA 3KKLA 2C95A 1Y6ZA 3MERA 4G4GA 4L6CA 2IU6A 1FOEB 4LZJA 5DX8A 5K09A 4N41A 4C7OB 3GLRA 2VSOA 3COPA 3GQBA 4HLUC 4NYIQ 4QWWA 3IEVA 2Z57A 2W8ZA 4IIJB 4ZQFA 2W6IA 2R2GA 3NHAA 3V9AA 4RH1A 4J2HA 1CRQA 3M9WA 4TUYB 5B6JA 1KQGA 4MV1A 1XDBA 2ZJ6A 4CYMA 1SZCA 4HH0A 3VNUA 3PFFA 2ZKIA 4ADSG 2F3UA 4I6GA 4NENB 5BVHA 1FYVA 3HL4A 3VO1A 2D7CA 5ETJA 3W1WA 3PFNA 1V7PC 5IDXA 1V11A 3UWKA 2WAOA 1DC7A 3QXXA 3FOFC 1U9CA 2M1XA 3X1JA 5CB0A 1HDOA 3RABA 1V6SA 2WHPB 2VA9A 3BWXA 3FPCA 4N1AA 4N12A 4TRJA 3RS2A 5LN1A 4V38A 4AJHA 3FWYA 1DNPA 4YV7A 1D1SA 3LYUA 3KM0A 3M4NA 1GGNA 4RZIA 4ZZ0A 3N1UA 2V65A 2C7QA 1NDHA 4Y1RA 1XA3A 3MMSA 4LHWA 2PUEA 1HL7A 3BMCA 1HE3A 5BV2P 3AK4A 4RK5A 1T2VA 3BCSA 2V0CA 3Q5DA 4V0LA 1N77A 4CEHA 3WP1B 1AKYA 4NNPA 3RC9A 1T1JA 4HWGA 1H94A 1JQLB 4NH0A 4OHOA 2AA3A 3KVOA 2HYIC 1X7ZA 3A0RB 2XWSA 4S1WA 1NUSA 4OQYA 5A1JA 4R3NA 1CLUA 3HB1A 8AT1A 4CCWA 2C7OA 3PRJA 1DFGA 2JLQA 2R0QC 2UVDA 1AKQA 2FYTA 1VKOA 3HHPA 3I6BA 3KKEA 4A5OA 4X8OA 1QHHB 3H75A 1GDDA 1THGA 1ZGJA 2V6MA 4GOLD 1KERA 4OQMA 5BYBA 1J9EA 4HXEB 3FTEA 2BELA 4UFNA 4LDAA 3R7WA 5EI5A 3GGSA 2AF3C 4J0IA 3FLMA 1SBQA 4PPFA 4ZFNA 1JS1X 1Z7GA 2R6FA 2VHQA 1FFBA 3B7GA 3E2MA 2B6NA 2XIQA 3EDRA 4ICIA 3H1BA 3OQ6A 1F9AA 1EVEA 1IIRA 3MLBA 3SLGA 2E0IA 1WB5A 4MB6A 3GL9A 3ERCA 2BLLA 3IPXA 2NV6A 3VZDA 2CLEB 1IEWA 5EP1A 2PWYA 4B79A 4HATA 2GHQA 1DADA 3EHEA 4IIGA 5T4EA 4EPTA 1U5AA 5JAZA 2DKFA 1J07A 3W9UA 4EJ2A 2WRZA 3LLVA 1K63A 2BAGA 3I6IA 1M10A 4NNOA 3RBAA 3WKCA 1SOWA 2VBCA 1MNAA 4XJTA 3ZH9B 4BVBA 3KCNA 4C7XA 3K31A 3KPYA 1CUWA 1ODJA 3ZI7A 3BMOB 5C5EA 2WB2A 2P3OA 2DKOA 3BGSA 2G3YA 1NBMA 3CEMA 2V98A 3OZIA 3FD8A 3I92A 3EPRA 3N75A 4M53A 1XBTA 4DWVA 1CRLA 3ZZ0A 5KNDD 1JHAA 1QB7A 4LRSB 1XK7A 3EGEA 3MEQA 2WA2A 2CHFA 3DSRA 5IC6A 3CU5A 4C30A 3D8SA 2O6LA 4ZANA 5FR1A 1C30A 1EH5A 2XZTA 3AF3A 1J20A 2GNPA 2VBIA 3L6EA 3LQYA 3SEFA 3VHRA 4BQEA 5ICGA 2H4HA 5E9WA 5AQEA 4LJRA 5FCDA 1NMSA 3CX4A 1HQDA 4KH0A 5LZ4A 2NZ2A 3G0DA 2XHZA 4M7RA 1T24A 1V9CA 2ZBRA 4AYTA 2ISCA 5BQ3A 5COAA 4DCOA 3EVFA 3D4IA 2XKAA 3HU2A 5EJ7A 1C7JA 2V55B 3QBDA 4KXLA 4XWYA 4BTLA 4H4CA 2OLKA 2R7AA 1HT3A 4URZR 5KYWA 4XLZA 3BSSA 4HZIA 1KKMA 4Y6OA 4BBJA 5IKXA 3T41A 3PUIA 2XDAA 2ZIWB 5IMBA 4DGQA 5K4GA 4F5WA 4RF5A 1Y3DE 2A30A 1LK5A 2G7MC 1IK4A 2O8DA 1G60A 3LX8A 3OEED 3DH0A 1CD5A 4HQOA 3L5KA 4IJKA 3FOZA 5IDWA 1RJWA 3KJGA 1RP7A 2I8AA 3VKVA 1FS5A 4HEA1 3HEMA 4LJ6A 2EKZA 3EJWA 1M0SA 3KPVA 2VJMA 4AAYA 4R2WA 5A9SB 3HWSA 3U1BA 1EG7A 1TD1A 1AKWA 1RLIA 2UUPA 3GNLA 3PWSA 4URXR 3KTFA 4O5OA 3E48A 4C0QC 1N36B 4N0DA 2Q0QA 3WK8A 3RLIA 1G7CA 1SUCA 1VXOA 4UHDA 3USCS 4FFWA 3CB2A 4O4IF 5LA6A 1G8PA 5JFOA 1N78A 1S3FA 1H2YA 4IINA 2II6A 4X44A 2I67A 1UMDB 1ZGAA 3EODA 1QMPA 2PGJA 3ESZA 5DO9A 4U7HA 2VS1A 1BJTA 2YC2C 1G42A 2A88A 3IVGA 5CVEA 5KNCA 2HQ1A 5HUJA 3RYIB 2OB2A 4EZEA 2GF0A 5JSFA 2WP0A 4WBNA 2LDBA 1C4OA 1DKOA 5CUQA 4TT3A 4FYPA 1NJ1A 5C7OO 1MHPA 4O33A 2QI9F 3GU3A 1LSOA 1O6FA 2UAGA 2YDXA 4G6ZA 4DUZB 2GVZC 2QGZA 1CS0B 2EWVA 1F4VA 1H65A 1UJNA 4FFBB 2GBFA 4I50A 4KQFA 1P9RA 1ZKDA 1K75A 2F64A 1G2IA 1I33A 4UM9B 2O23A 3IIIA 5CP8A 4ZA2A 2VQFB 2I4OA 2FPOA 4HX5A 4NZNA 5FFNA 3D4LA 4P92A 1DG1G 1DRVA 5JI2E 3STHA 4NARA 5G0TA 1Y5MA 1SQ5A 1U81A 2EL7A 3K8QA 1QO0D 4DM3A 3CF6R 1Q22A 5KTYA 1JG2A 4PVCA 4UD6A 2X7XA 4XIYA 3NFRA 4I55F 2VZ0A 3UYLA 1QVWA 3ZU4A 2FN4A 3DYBA 3OZBA 2VTBB 1JFSA 3SZGA 3EG9B 3O82A 2AJBA 4XM2A 1J39A 2VTEA 3CNQS 3GVCA 3CLTC 1VCIA 1HDGO 3D2LA 3F9RA 3JASA 4IW3B 4TKLA 4XIGS 5E6UA 5IMSA 1I6KA 3ASUA 4RL4A 3STVA 2LUOA 2F9FA 1DPGA 1AGPA 1YS4A 2G08A 3ZJYA 4QBHA 5DBOA 3V8VA 4F6LA 3PXEA 4QYIA 1PUJA 4MV7A 1QZXA 2J3KA 1XJWA 1FLNA 2Q46A 2G88A 3BTUA 4PHHA 3W4IA 4A6XA 1TX4B 4M54A 5ICCA 3PRHA 1UZMA 4ZU3A 3RC3A 3TD6A 1A9TA 4LS3A 5CDFA 1XKXA 4PLHA 3MJVA 4DC0A 4QQNA 1Z5ZA 4HYTA 3LHDA 2ZTVA 1A9XB 1V8FA 1ZGCA 1XDGA 2JVKA 2FE4A 3ORQA 4MR7B 5DX1A 4TWJA 3D3WB 4G63A 2Q2VA 4TN1A 4UAUA 1E2NA 3ULKA 4Y1EA 1E6KA 2HY7A 1U0GA 5T7BA 3TR5A 1PZHA 3VOAA 1KK0A 4QA9A 2AFVA 2FPPB 4NZ9A 2OXCA 2V5AA 4OKSA 5DTJA 2R3SA 2NPIA 3D8UA 4HNAB 2HMWA 5ALDA 3WQQA 1Z74A 4CMCA 4D4GA 2HFJA 4LVNA 1US8A 3I6MA 1IATA 4D8YA 3EZGA 5A02A 3TW8A 1JAZA 1SB9A 1IZZA 3OZDA 4YASA 3VR5D 3VXKA 5TGDA 3RAJA 1WMFA 3ISJA 3K09C 4HFRA 4C89A 3IQHX 1URPA 2OGTA 3EGXA 4RWEA 1JAYA 2HF7A 2VUTA 2HUNA 1NJ8A 3JYNA 1SBHA 4JLOA 4S2UA 1YNSA 3T9BA 3ASVA 3QE2A 1H8HD 2CL0X 2VHWA 2XGMA 4PLWA 1RXUA 3SYLA 1KP9A 4BKMA 2BFDA 3DLIA 3IR7A 5T3YA 3FDZA 3I2GA 1ECJA 4WASA 1E89A 4E2WA 4EMUA 3F46A 4DQ0A 5KJCA 4HF7A 2H5JA 3D7MA 4LPSA 4RKYA 1T9AA 4DY6A 4P4SB 2VYVD 4A0GA 5DIZA 1N32B 2D06A 4KBYA 3BFKA 3C70A 1Y7HA 1N2CA 2AG6A 3CGWA 5C3UA 3G1WA 4X85A 1IJKA 3W6OA 3UMFA 1R10A 5SZIA 1ZOIA 4GYJA 4F5DA 1Z4PX 3MGKA 2JHPA 4PSVA 2D6FA 4XFDA 3IILA 1G17A 2JAXA 4MVXA 4OKNA 3KKQA 4PXSA 5FWXB 3PNKA 5LU8A 1XYGA 1UMKA 1FRFS 5CTAA 5H59A 4U7PB 3VDQA 4UW9A 1KNXA 4WZAA 4XJVA 1L8QA 2QHXA 1SHKA 4HNUA 5E3JA 4LZNA 1SB8A 1TC1A 4NCNA 1I2AA 4RL6A 2AXPA 4GGOA 4FQ7A 1QK4A 4O4IB 1UODA 2RI6A 5G0UA 5D01A 5IVPA 1GLVA 4K81B 4KVFA 5TX7A 2G4VA 1R3UA 2XBLA 3TB4A 1E7MA 4BGIA 4RLFA 4TKMA 4M7WA 5E6SA 5C18A 1CF4A 2EX0A 4JYCA 4IS3A 2QUHA 3LBFA 4M9QA 1RXEA 4O4LA 3LPAA 1RYBA 2Y92A 1M83A 3DWGA 2CL7X 3O21A 2GVDC 2D7JA 3PEUA 4NU5A 4M88A 3GXOA 3WOVA 1ODCA 2A7XA 2DSTA 2QYHA 5B4TA 1Z3IX 4F4CA 2FZEA 4GBJA 4YP1A 1FFXB 3SZ3A 3GZNB 3PFIA 3H8VA 5SY6A 5KTOA 3S1SA 4WOKA 1L7DA 4MS3A 4BRZA 1R0SA 2D3WA 1YB4A 3G82C 3WJ2A 3AH8A 4D8XA 1DEKA 2FZWA 2OAQ1 2IGBA 1RJFA 1U2PA 3DBLA 3G3EA 3IB3A 4GBGA 5DNUA 2GILA 4GRDA 2ZT6A 4HAVA 4DC9A 5KQMA 1G5PA 3NVAA 4MYSA 3F6PA 1IONA 1NVVQ 2OD9A 1ESNA 1X86B 2AD1A 5CDTA 3EMDA 1AS2A 3FCEA 5B7NA 2EFHB 4L8LA 4PG4A 2AEJA 2W4QA 3DL2A 1T4MA 3OP4A 1LPPA 5D7BA 4I55B 4BB9A 4F5ZA 1KGDA 3MFYA 4KLCA 2UZ4A 1N34B 3Q11A 1EFRA 2P2YA 2ZU6A 2PD3A 3GEPA 2WYIA 3BB1A 4BQPA 4PN3A 4CLOA 4BJ5A 2YUIA 3R5FA 5DULA 1D9XA 1NZJA 5I9IA 3I23A 4YPOA 2Y9MB 1XV5A 3EGDB 3PVSA 4UNRA 5B3LA 3DC7A 4IWNA 4YXFA 2J32A 2GBGA 1BKYA 3FBGA 2JDIA 4XPIA 1ZEJA 3ZV3A 4AECA 1REQA 3E18A 1KI1A 4BLWA 1NM5A 4RQAA 3PNYA 3AL2A 3FY4A 3G0BA 4YRRA 3ZKAA 1TCUA 3I9OA 3RFXA 1PQ4A 3GGJA 3EEYA 3MHTA 1HE2A 5DYIA 3LO8A 1P0CA 3QGMA 3ZW8A 5IXYA 1EZZA 1BXKA 1LPOA 1SC4A 1U31A 1WXHA 2WIKA 3ICEA 4B0PA 1KVTA 2R751 5G53C 3KEOA 4U6QA 2PH1A 1R15A 5TF4A 4TSFA 1AUVA 4UHFA 2OY0A 3BK1A 5C7IO 3D6MA 2X9LA 4MGZR 4BKPA 3T7KA 3QKUA 5E9JA 4IDBA 2PRYA 1QIKA 3BCRA 3MA0A 4RIHA 4RZHA 3W8NA 1U0NA 1JE1A 4DA8A 2A84A 3P45A 3HK2A 5JZSA 4OLHA 3P2JA 5JH7A 2NWQA 3E3LA 2GM9A 4KNYA 1DINA 1D04A 3L7JA 2TMGA 2FUG6 1FX0A 2JH8A 2RBGA 2NTYC 2YVKA 3GBPA 3U3ZA 4CUKA 3AEXA 2J6BA 2XEXA 5H3CA 1CUGA 3EIXA 4WDRA 1OZFA 1Y98A 2FDRA 1L8LA 3B82A 1VGQA 4KLNA 2AEFA 3FROA 4YCBA 3HGMA 3PYLA 5LBTA 3UCFA 2QUKA 4Z1MD 5I7SA 4Y2GA 5JD6A 1JFTA 4BDTA 3PLNA 1CJUC 4EHIA 4Q4HA 4W5JA 5G02A 2B4RO 3OQBA 5K2OA 1V2GA 5KHAA 4K9OA 5IBCA 1PZXA 1OKKD 4MTLA 4P0QB 2Z2KA 2WD7A 4UM7A 3S8MA 1FXWA 2IWRA 5K0EA 2Z3WA 3DTTA 4B75A 2QRZA 2GFQA 1RQPA 3GLQA 1T8SA 4I9HA 2R62A 1Y4SA 1R0ZA 4WY2A 1NQTA 2WSYB 2H7YA 1I0IA 3CRMA 4IO0A 3V00A 3RQSA 3WDLA 1J42A 4AXXA 4F3YA 1IHXA 1Y1QA 2HQOA 3D0QA 3PUJA 4K0KB 3E5NA 1MEEA 3L41A 5B58T 2JLBA 4RIFA 3RYCB 1VRWA 2AD5A 4IOJA 4E51A 1SKAA 4UVDA 3QHAA 4OHWA 4XWWA 1EUQA 1SA0A 2HH9A 4X1KB 4TRRA 2OENG 4WLOA 2CUZA 1KF0A 2E4UA 2EDCA 3IDQA 3C1OA 2W2KA 4CQJA 2DM6A 2O7SA 4KMMA 4OYHA 1W4LA 2WNHA 5IFLA 4DT1B 3K05A 4Z4IA 3D1LA 1QANA 2BEWA 2HRDA 1DQRA 4WOJA 1NFFA 2RGWA 5EE3A 2XT9A 1U2SA 2G0TA 3VNSA 3RS3A 3PIIA 4WESA 3F47A 3I0NA 1TCCA