5TS2A

Crystal structure of a phosphopantetheine adenylyltransferase (coad, ppat) from pseudomonas aeruginosa bound to dephospho coenzyme a
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
165
structure length
165
Chain Sequence
AHHHHHHMNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a phosphopantetheine adenylyltransferase (CoaD, PPAT) from Pseudomonas aeruginosa bound to dephospho coenzyme A
rcsb
source organism Pseudomonas aeruginosa (strain lesb58)
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
total genus 59
structure length 165
sequence length 165
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2016-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 5ts2A00
1T6ZA 2A84A 4OJMX 1XJQA 2DEUA 1MOPA 1NUQA 4G6ZA 4YP7A 2VXOA 3RBAA 1PFYA 1ULHA 4NAUA 1KQOA 1R6XA 1OBCA 4EG1A 3Q12A 3UMVA 1OWPA 1F7VA 2CUZA 1J09A 2X1LA 1J70A 3CVVA 4ARCA 2PZBA 4MUJA 1PFWA 3FDXA 2PZAA 3K32A 4F3RA 2Z3VA 1KKUA 1J21A 2QTRA 2QUKA 1LI7A 2WB2A 4G5FA 4NATA 1ZH0A 4MUHA 3I05A 4HPWA 2C5SA 3CR8A 2TS1A 1QRUA 1KH1A 3IMCA 4R0NA 3COWA 1U3CA 2E18A 2NSYA 1T6XA 2H2AA 3K9WA 1G59A 1T9GR 2YWCA 3M5WA 1GPMA 3PXUA 5FO1A 3L92A 3CLSD 3IVCA 2ZUEA 1CT9A 4EG7A 3COVA 2VTBB 1U0BB 1F4LA 3X1MA 4F4HA 5TS2A 3G59A 3FHJA 5DK4A 4XSVA 1NP7A 2OV4A 1XNJA 3ZXIA 4DLPA 1IQ0A 3VRHA 1MAUA 3IDFA 5KHAA 1NSYA 3DPIA 1QRTA 4MQ6A 4Q16A 1JECA 2XRZA 4MUGA 1G8GA 4AS1A 5LLTA 3UOWA 2BTEA 1EUQA 1OWNA 2HZ7A 3UC5A 2WQ6A 2V0CA 3H97A 1TYBE 4OUDB 1JMVA 4EFKA 4CDMA 2YWBA 4JFAA 1N3LA 3ZGZA 1Q19A 4XFJA 3N2YA 4QREA 2RD2A 3D6UA 3RFFA 1JEDA 1LW7A 1PFVA 4EGAA 1N77A 1VBMA 3CLUC 5FO0A 4KPUA 4MWDA 3FY4A 3SYTA 2IP1A 2A1UA 4TS1A 3IOEA 1R6UA 3CVXA 1HYBA 3HMQA 2PIDA 1WXIA 1K92A 3RHSA 1I6LA 1I6MA 1N2GA 3NV7A 4UZEA 4ZCTA 1KR2A 1M8FA 1U7XA 5TEVA 3ZJTA 1COZA 2NZ2A 5KWVA 4DNXA 1KAMA 1PG2A 5LFAA 1N2BA 3JXEA 4NX2A 4KKVA 4CT0A 4CDNA 2QJOA 4I6GA 2QUIA 5HUHA 3C8ZA 3U1VA 3AL0C 4KR7A 1MB9A 4ZT3A 2CSXA 1IHOA 2EJCA 3IOBA 1QQTA 4U7JA 3FWKA 3ELBA 1VL2A 3N8HA 2IJGX 3ZUGA 5JBNA 3AG5A 2A88A 1KP2A 2CV1A 3VU8A 1N2HA 3FOCA 4HJXA 3HFJA 4NDAA 3PNVA 1GTSA 1GLNA 4HJRA 1YULA 1QJCA 4ZCSA 1A8HA 3COYA 4HK4A 1ZUNA 2RE8A 1I6KA 1M1ZA 1YUNA 5F23A 1FFYA 1GN8A 4UZFA 4Q93A 2X1MA 4MUEA 3FIUA 3TS1A 3MLBA 4BWVA 1OBHA 2J08A 4EG5A 2AKEA 4KPUB 3TQIA 4DDMA 1TEZA 2A86A 3GLVA 1WXGA 1N2OA 4P2BA 3X1KA 2CYAA 4ZT2A 4ZT6A 1ILEA 3E27A 1GZUA 3MXTA 1MAWA 1O6BA 1M8KA 1PFUA 2D54A 1K4MA 2X0KA 3DLAA 3ZJVA 2QTNA 4MVWA 3SZ3A 4MW5A 1WZ2A 5H16A 5AHWA 4WSOA 3IVXA 2DR2A 3NBAA 4MUNA 2DXIA 3H9BA 4ZT5A 1QU3A 2A4MA 1O97D 3AG6A 1JZSA 1N75A 1D2RA 1T9GS 2YXNA 2WQ7A 3KT3A 3KT6A 4RPIA 4J75A 3ILVA 1WJGA 3MUEA 3CVWA 1VBKA 4PBTA 5DEOA 4ZT7A 1QTQA 2HMAA 1JIIA 1O94D 2ZUFA 4MVCA 1V47A 4I6JA 4XFDA 1N78A 1LI5A 2E21A 2J09A 4MWEA 3ND6A 1H3EA 1NUTA 3IUEA 2DERA 4JXXA 3GUZA 3OTWA 1ZH6A 2O5RA 1TYAE 3HGMA 3GMIA 1MBZA 1G8HA 1VBNA 4YP5A 1X6VA 2D13A 1O0BA 1NYLA 3ND7A 4J76A 2G36A 4JXZA 3CVYA 4YP6A 4MVYA 4MW0A 4K03A 5FNZA 2Z09A 1OD6A 1XNHA 4MW2A 3UK2A 1X8XA 2D5BA 1TFUA 1GTRA 2CYCA 3A05A 3SP1A 3SZGA 1PG0A 1MC1A 1EUYA 4MWBA 1JIKA 1K4KA 4NZPA 1MB2A 3KT8A 4PBSA 3KT0A 3A2KA 4KR9A 1IH8A 2QTMA 3D6VA 4PBRA 4KR6A 5DB4A 1FYDA 2GKSA 4MW4A 4MW6A 2E89A 3OP1A 1Q11A 3RK1A 3SEQA 4E1AA 3S3TA 1JEEA 5J59A 1M83A 3CA8A 1YI8A 3FNRA 5BNZA 3AKZA 1MJHA 5J58A 3SEZA 3RJZA 3P0IA 4ZT4A 2Z08A 3N05A 2DETA 2JA2A 2E0IA 4MUFA 2ZP1A 1IQUA 2O8VA 4H3SA 1KH2A 1O94C 3FH0A 2WSIA 4RUKA 4S1OA 4K0RA 1IVSA 3HZRA 1O96A 1TQ8A 1WXHA 1TYDE 2HGZA 1JILA 3AFHA 3FI0A 3ISJA 1QRSA 2CFOA 1T6YA 3HL4A 1QU2A 4DDHA 1O97C 1OWMA 2PXHA 3PRHA 3CLTD 3QTBA 4EF6A 3DO8A 1WQ4A 1KAQA 3TNJA 4U8HA 5H7XA 3LE8A 3IOCA 3IODA 1H1TA 1WQ3A 3PNYA 1NUUA 1J20A 4L2IA 1EFPA 2QJTA 1V8FA 2A1TR 3H99A 4EG8A 2QJFA 1VLHA 1Q77A 1KORA 3CLRC 3QTTA 1QNFA 1EJ2A 4R2MA 1JGTA 2J07A 3IMEA 3IUBA 1KQNA 4NAHA 1J1ZA 3FG9A 5KCMA 2AZXA 4ZCQA 2I1LA 1EFVA 1KP3A 3DV2A 3MLAA 3ND5A 4MW9A 1F7UA 3P52A 3CLUD 1NUSA 4DJAA 4I6EA 3ZIUA 3AIIA 1WOYA 2CYBA 1O95C 3NBKA 4DE5A 5J5AA 4WNYA 3IVGA 1H3FA 1JZQA 3CVUA 2YY5A 3INNA 3LOQA 1WY5A 1TYCA 3MMXA 2BYTA 1JHDA 2DUMA 1Q15A 3CLSC 1O95D 2JAXA 4A91A 2QUHA 1KH3A 5IJXA 3X1JA 2IELA 3RK0A 2B7LA 1J1UA 3KFLA 4YMIA 3N9IA 4AQ7A 1DNPA 3F3MA 4ND7A 1OWOA 1R6TA 4X0EA 1S4MA 4GU5A 1UFVA 4QBTA 4MVXA 4CQNA 5HUJA 2OQ2A 1EFPB 5HG0A 1RQGA 4ND6A 1M8GA 2EL7A 1YUMA 1B6TA 2DLCX 5EKDA 1K97A 3IMGA 1N1DA 1N2EA 1OWLA 1WXFA 2J5BA 4DDKA 1IQRA 4EG3A 4ZCRA 3HV0A 2R5WA 1NURA 4PY2A 1EFVB 1EE1A 2X3FA 3SDBA 4MWCA 2PZ8A 3G6KA 3Q4GA 1BS2A 1U7DA 1P7PA 4EG6A 4OUDA 4G5YA 1O0CA 2GOYA 2PG3A 3L93A 1O5TA 2CV0A 2V0GA 3IH5A 1WXEA 1I2DA 3P0HA 4R2LA 1ZJWA 1YIDA 1MRZA 5TGTA 4FZJA 1U3DA 1NI5A 4MLPA 5K0SA 4QRDA 2CV2A 3H9CA 3G5AA 4GRIA 5TEWA 5K0TA 2A1UB 4MULA 1XNGA 3H05A 3BL5A 1G8FA 2J4DA 3VGJA 3LCJA 1O96B 2XRYA 4U63A 3PNBA 1GAXA 1Y42X 1NZJA 2A7XA 2PFSA 4MAFA 2A1TS 2DPLA 3FETA 5LM3A 5IHXA 1IRXA 1N2JA 3CLTC 3UY4A 5DASA 1M8PA 3ZXSA 3Q10A 3TZEA 1NUPA 3COZA 4YBRA 2VTBA 2JANA 4MW7A 3ZJUA 3P0JA 1EXDA 4L2IB 2H29A 1N2IA 4JYZA 3QE4A 3A4IA 1KQPA 1JIJA 3TQOA 3TZLA 4MW1A 4JZYA 1SURA 4EG4A 2AG6A 1WKBA 2GM3A 4ZCPA 2QUJA 4MUKA 3A04A 1H3NA 4ARIA 1IFXA 1YIAA 1F9AA 4MUIA 1M8JA 2CT8A 3CLRD
chains in the Genus database with same CATH superfamily
1ATIA 2XSZA 3LYLA 4GVXA 4L0MA 4M38A 2G71A 2FW6A 3JWPA 1OXMA 3VYVA 1DAHA 1G5QA 4ZK2A 4B43A 2W4IA 5I9BA 1OWPA 2BM8A 2CK3D 4ISBA 3MGGA 2UXCB 3E3OA 3EGVA 1PFWA 4QUIA 2O8FA 4IUBS 1R3DA 1EFHA 3JR3A 3HBNA 1KKUA 4CMHA 1H69A 5CRIA 4Y1RA 2QUKA 2IDJA 4UMEA 4P3OA 3KU1A 3TSAA 3VAYA 5AVVA 3MJEA 1E3DA 4DIBA 1VJ1A 4CI9A 4OHYA 3U5ZB 1PT7A 1DZ3A 3DONA 4OQMA 3MCZA 1XHLA 3GHHA 4Q1AA 3IMCA 3SBEA 3GCXA 4ISCA 1OV4A 2WM8A 4QRIA 1DUSA 3ZCSA 2IYWA 5H9WA 2ZXUA 2F3UA 4PFJA 2Z4TA 3PCRB 3QLTA 3SXPA 4RTRA 1GAJA 2FN3A 2GN8A 3T9BA 3T3OA 3AJAA 1H9AA 3A9CA 4FDAA 5G2OA 4CQLB 4E32A 4WRRA 3MMSA 4CM5A 2YHIB 5GGYA 3QU4A 2HDOA 4EQ6B 2VIIA 1UPXA 4CMCA 3EGXA 5EZSA 4KTTE 2HCFA 4EITA 3WYBA 2B1QA 4RJJA 4URZR 3VX4A 2YZNA 3B7PA 2BFDB 4BBZA 4JY7A 5DK4A 2V7XA 3ZXIA 5E2AA 4GDFA 1NKVA 4FR0A 3EXG1 1O4VA 1PJTA 1Q7BA 3MTDA 1CP3A 4HH3C 4IIFA 4ZA2A 3X1DA 5CA1A 1DBIA 3U17A 1NSYA 1GRRA 1N3BA 3TI7A 5AP9A 4JSTA 4C1NA 1VIAA 3JALA 4C0KA 3AL2A 2FR8A 1RI4A 1EX7A 1GPKA 3P2OA 1UXOA 2QUZA 3CBQA 1C0PA 4IF4A 1FRFS 4KNVA 4TTVA 4E22A 3FCUB 4GKJB 1GUZA 1W19A 2BGTA 3LHIA 2BBWA 1V25A 4FZ5A 1B23P 4JJZA 3OQPA 2ZVDA 1I2CA 3F5FA 4ZQEA 4EFKA 1QX3A 3GRYA 1PUXA 2E2WA 1XKTA 4GHWA 4PCAA 5JEDA 1U7PA 1XLTA 1Q19A 2O2CA 3UWSA 2E48A 2VDLB 1CJBA 5DMHA 3DKPA 4QREA 3K5PA 3FDIA 3QEJA 1H2AS 3ORHA 1LW7A 1NA5A 1NQOA 5JQGA 2EF1A 3Q72A 5LQAA 4BQFA 5EJAA 2QW8A 3O6VA 1XCMA 3I01M 1YE3A 1LC3A 4RADA 1PAUA 2LBPA 3KS9A 1VCIA 1F0YA 4EI2A 5BYAA 3LH5A 3CPHA 4F4JA 1GKUB 1XCLA 4QBFA 2IYLD 3N0RA 3OU6A 1GNLA 1WCV1 2R2GA 4IW3B 1RZUA 3HNOA 5HE9A 1W25A 2RK6A 3GRCA 2NXNA 1Z4NA 2I78A 3A1NA 2ZXEA 3VM6A 4FX2A 4X45A 1OIXA 5JAPA 1UDXA 5LMZA 2W8BA 1H2XA 1L4BA 4FW8A 3N2GB 1PLKA 2C0QA 3OQBA 1YDMA 3LXUX 4BB5A 1JA0A 4N3CA 3WSWA 4NNOA 2YV5A 1N5OX 1CPYA 2QD2A 3NP9A 4BWYA 2ZSJA 1R8YA 1HNNA 2W6ID 4XB6B 4WBXC 4BN4A 1TQDA 4JNCA 2XRMA 3EF0A 2DBVO 2BMEA 3G79A 4C0LA 4DA0A 3G1WA 1MVLA 1X1QA 1GGVA 4G5RA 1ZZEA 4QL3A 2LRHA 1PGQA 2Q50A 2NU7A 3CT4A 4F46A 1E61A 1IAVA 1RRGA 2VBCA 5EIBC 8ADHA 4O4JB 1R0LA 3T5GA 3WJ2A 1F5NA 3RI3A 1ZVJA 3FTNA 1HT2E 1QAQA 5A1JA 4KO3S 3V32A 1JDJA 1KP2A 1EFRD 2CV1A 5ENVA 2G09A 2OCAA 1QK3A 4GM4A 2M32A 1WZUA 1TPZA 4W9NA 1ZN8A 2CMFA 4ALJA 1FF9A 2EHDA 3PNVA 5IT4A 3G85A 2H7CA 2OL4A 3WMWA 1HPLA 3EWNA 4FW9A 1ZJZA 2FDRA 1MCZA 1ZGAA 4OLAA 3W5DA 2KSQA 3PUWA 1Y3IA 1ZX1A 2GVZC 3R3VA 3L7OA 4PZCA 2JIQA 4DXAA 5HOQA 3UFXA 1OR8A 4HXEB 1RHJA 1X7WB 4BY9E 3HEAA 2GZ1A 4CZ2A 3WKDA 5EZQA 2OZLA 5ANRB 2J08A 5HPYB 4OO3A 1J22A 1QAOA 1SVOA 3NWOA 2H1WA 5JT1A 1KYWA 4DR5B 1WF6A 2Q5CA 3RC7A 1KEZA 5KOYA 3L7MA 1FTYA 2WC1A 4W8GA 4ABYA 1UAAA 4LE2A 5AOCA 3GLGB 5H4HA 2VJOA 3HR7A 2FW7A 4Z2YA 1DG1G 1HM5A 1WXWA 1VP3A 2ASVA 3F2IA 4FGUA 4LBZA 1SNYA 1N2OA 2HCJB 3H3JA 1ND6A 4JUFA 4YR7A 4ZIRA 3TFOA 2D1RA 4IIXA 1P9LA 2HJ9A 2CNLA 3HWSA 4MPJA 2DOKA 2X5NA 2HJHA 3CRW1 821PA 4WFIA 3CEJA 2JRLA 1MAWA 1QR6A 2D54A 5CAEA 3M3PA 4B45A 3PC3A 2ZIWB 4I55B 2KE5A 2G40A 1N5IA 3LIIA 3TFWA 1NU6A 5FX2A 1CUUA 2HF2A 3IVXA 2DR2A 4BRWA 1RBZA 3OLXA 2OHXA 5J2UB 2RG7A 1CZNA 3CLHA 1AHNA 1NXSA 2LPMA 4TLAA 2WPDA 2ZDHA 1NF2A 3S99A 4TZKA 3TIFA 3VVBA 1LTKA 4KX3A 2XEDA 4FPXA 1JZSA 2WYHA 1KHHA 1C9NA 2DSNA 4FI3F 2WQ7A 3PXBA 1W4BA 4WDRA 5IP5A 4IDHA 1YTUA 3GPLA 4Y9DA 5D1NA 1JB9A 3ZY2A 1E4OA 3G1TA 3IA7A 3ZDEA 1G7SA 4NABA 1D0SA 3RJTA 3H7IA 1R0SA 4WQMA 1E7QA 3BA1A 5LQRA 2ZJ3A 3U4IA 4ARZB 4M22A 5KTKA 2VJMA 4MYCA 5D2CA 3RRJA 5ALVA 2IPLA 5MFPA 2HI0A 4YLYA 3EIQA 3V8NA 1CUIA 3AFGA 4J1NA 2FF7A 5BYJA 1B6GA 3QVKA 5TNXA 3KWJA 2CMDA 2HLDA 5GMOA 4LXUA 3SR4A 4UBKA 1GAWA 1DBQA 4EHJA 2PFGA 2QIOA 3F4KA 4I2NA 2XNCA 3EPHA 1EFCA 5JHHB 1NYLA 4WOPA 4WHMA 4PWZA 4DL9A 5I7UA 3R6LA 4W5RA 2HREA 4GP7A 5C32A 1C8VB 2QTFA 3CKMA 2O3TA 3M1YA 3NVMB 1PVVA 2VYNA 2X9QA 4OK5A 4K03A 4PO9A 2PSJA 3TCXB 5JSQA 3CH5A 3GRAA 1EK6A 4ECAA 1RQ2A 1JWAB 1Q14A 1Y1LA 1X8XA 3KZNA 2B98A 4LF8B 4ETIA 1GUFA 4CRWB 2BKVA 2EATA 5HJ7A 4MMYB 4P32A 3UMBA 2Q5LA 4KDFA 4OP1A 4HDQB 4OHWA 4JUIA 3GLUA 2OYSA 3KT0A 4HMOA 1KFCB 1LLUA 4PG4A 1ZHOA 5DHQA 3NWBA 4Z5XA 1ZM9A 3MSXA 4GSKA 1BX3A 3BXFA 4LXYA 1OI2A 4O4IB 4UJ5A 4L8LA 4CL0A 5GQSA 5J4YA 1D03A 1JYEA 1ZCFA 2W71A 5EERA 4KH1A 3EXFA 5JZSA 2FRDC 4DEVA 1H42A 2JFGA 3W5SA 2AVDA 1XEAA 5LPNA 3V3TA 1J2RA 1W5AA 1Z2DA 3KKLA 2O3RA 3E9YA 4QDUA 5KDLA 4BO2A 1OCEA 4GVPA 2Y76A 2HLDD 5LLSA 5BNZA 3AKZA 1JFTA 3IKLA 3ZGLA 3E8SA 4B6JA 3HCAA 4PZPA 2PX4A 2VEDA 2XA2A 3JTEA 4R1TA 4RHUA 5EI5A 1E0JA 2I33A 2XHZA 1F8FA 2JA2A 1G7RA 1BJTA 4Y0VA 1GPYA 1X2EA 2GN9A 3AW8A 3HI4A 1S89A 4DGSA 4H3SA 4D3ZA 1F0PA 2VHQA 4F6CA 3FH0A 5LQCA 1GKYA 3DD1A 4K3VA 1WUJS 1IEVA 3IBTA 2GLXA 2F8LA 4BX2A 3KYJB 3HM9A 4NYJQ 3CXUA 5GM2A 1NI3A 3CO0S 1QKJA 2R1VA 4PZAA 4OI4A 1EFUA 1DJNA 5B2ZA 5KNDA 5EXXA 1APBA 2GSWA 5A2QA 4HEA6 2C4MA 3CW9A 4BJ5A 2F48A 5JWRA 1AZLA 1ZMTA 1Y6JA 1Q57A 3LO5A 3PUHA 2HA0A 1RAAA 2HEIA 2ZS8A 2QLJA 1U7TA 1WHTA 3G13A 4MV5A 4WXEA 5E6RB 3G5TA 2RAPA 2LCFA 2KB0A 3T1YB 1NVWQ 2H1VA 2I8CA 4QXMA 4IWYA 4JBYA 5ILGA 5EXDA 4EA8A 1FC0A 4Y6QA 4GSYA 1YS1X 3QSGA 2N1BA 3UQYS 1U6IA 2JI7A 1VLJA 8AT1A 2FQXA 3UJNA 4X24A 2RSLA 1OA1A 1A69A 4JH0A 3DLBA 4IXDA 4LOAA 3ROMA 1Q77A 3TNYA 1QGZA 3U4QB 5DSXA 3MRXA 2DF8A 1IUOA 1HKUA 2FNAA 4UMDA 3SYRA 5CNKA 3WAKA 2QTHA 2UVDA 4ALNA 1UK6A 3B5JA 4EFDA 1GZ5A 4HAIA 2ASEA 3UHJA 3T8YA 1EFVA 1M2OA 1ZM7A 2ZAOA 4R1MA 1V1MA 1M2NA 1VHDA 5GVRA 4NYMQ 1BOOA 2BEUB 1BE0A 4Z51A 3ZW7A 3OM9A 4AG3A 2YWRA 3HZOA 4BP1A 2JH3A 2WA2A 3AEQB 4AY3A 2ZTLA 5FYDA 3D3KA 2PO7A 2WLTA 1E8DA 1K27A 1FE8A 1EFLA 2IEGA 2WM2A 4LZWA 5A5DA 3IUPA 3BZBA 2R44A 3TMKA 1F6BA 4TMXA 3S2FA 4BE9A 1T0HB 1L7QA 5MN5A 2ZS9A 3FR7A 4AXXA 2AWOA 1HG1A 2C8JA 3A3NA 5GZ6A 5ENDA 3TCKA 1KK2A 4CU2A 3AY0A 3BRWA 4D9BA 3STUA 3D43A 5DOVA 1U2SA 3ZWYA 1KK1A 1XN1A 3T3GA 4LRQA 1O95D 1SZPA 3OFVA 1X86B 2Q6OA 3VOAA 2GKGA 3AEKB 3FPHA 3UOGA 3WKCA 5FI0B 2QA5A 4AO8A 1LBEA 3HR4A 4P82A 2ZB8A 4TQ9A 4WBSA 1AX9A 3A4NA 3EMKA 3ZY4A 4F2WA 5I7FA 3HR8A 1XRNA 4Q3DA 1LW6E 1BCRA 3VNUA 1QVZA 5KPDA 4IS3A 4Q82A 3TLGB 1KPIA 3WISA 2X7HA 2Q8PA 1WXDA 4P3NA 2BJVA 3W8DA 5JDIC 3CINA 5KYTA 1A1SA 4XWTA 1CHNA 1GPBA 4KR3A 2ZROA 3V33A 2C8LA 4CIDA 3NPMA 4CQNA 5ALEA 4UVEA 2I3ZA 1VHTA 4I8XA 1P5FA 2GMWA 3BHNA 3O5AA 1RQGA 4K9RA 1E3IA 5DYGA 5JNLA 4F3TA 3VH3A 2B7BA 3FZGA 3U26A 1K97A 3DZ8A 4Q3OA 1U8ZA 2ZZKA 1WXFA 1PJBA 2WJVA 3H19A 3MOGA 4HB2A 2MOKA 4UDNA 4KOEC 2I8LA 1A7AA 2XE7A 3VC2A 3RIMA 2ZE8A 4C21A 1WEKA 2PJRA 4H6VA 2G8NA 1B2LA 2J5QA 4WUVA 4G4SP 5TLSA 1KIFA 2R5WA 1NURA 1JSCA 5HJ2A 2BAGA 3LUDA 1JLSA 3JYLA 1PZFA 1PWZA 3IJRA 4EPTA 3G6KA 5BQFA 4RYLA 3CGGA 2QIPA 1TAUA 2HA4A 5K1ZA 5T4FA 4FDTA 1NMXA 5G0VA 1LFDB 3M2TA 5JY1A 1BHO1 4IHJA 3HK2A 1ZCAA 3LLCA 4UUBA 2KJQA 5KJCA 3IH5A 1Q0UA 1TK2A 2BL4A 2WVJA 1FBNA 2MU1A 2ZIAA 4J0KA 4K88A 1G55A 1CR6A 1GQQA 1NNUA 1OLXA 2G8LA 3HNPA 3NGMA 1KFBB 1Z82A 4IGAA 4B7UA 2AC4A 3H9CA 3TQRA 2DQZA 1GNSA 3TAHA 5AQEA 1OHHD 4OP2A 3VSAA 4BLPA 4F2DA 4WK2B 3VGJA 1R6AA 3L1IA 2GJSA 1R66A 5TF0A 2EYUA 2AYXA 1RTTA 3OZEA 3H1AA 3PNBA 1WSBA 4FYXA 3GLGE 5CITA 3FVRA 5BPFA 1YA6A 4REOA 2EFHB 3PD0A 4KDRA 4LKRA 4YYZA 3TPCA 2UYHA 1OB2A 5BVGA 5FLEX 3KQYA 4IFTA 2GAIA 5C34B 1U9CA 5LXTB 5FQNA 8MHTA 2VCYA 2W2OA 4UQPA 4Y2VA 5DULA 1H6CA 1KDZA 1T5LA 1QB7A 4NFYA 1KVQA 3N8IA 4M8LA 1V48A 1ZHFA 3LX5A 3DWIA 1G20E 3JVVA 3ZKWA 5DPMA 1A98A 4AMGA 5ER6A 1JEQB 4GWLA 1E66A 1QPGA 4PWYA 2YJ5A 3LQQA 3SX2A 2Q9AA 4TXHA 5EJ5A 3OC0A 4J2OA 1K7XB 1U3WA 1Y4AE 5AUNB 1FX1A 4YV2A 4RTMA 3EX7C 4DA7A 1YQTA 3ZNQA 2Q3LA 2PMBA 1QK5A 3F5MA 4HF7A 4Y6PA 3FFAA 4CN9A 2VHZA 3KPYA 4IIDA 1T25A 4OUKX 1VDMA 4M7RA 4RXTA 4DSTA 5THXA 1W35A 1V7PC 4I7EA 2XECA 3A1TA 1KEUA 5HEKA 2FXIA 5AI8A 5CFZA 5TY0A 3WTBA 2CKDA 2GJ8A 3VHLB 3GJRA 5IASA 1ZC3A 4ZOLF 3IBCA 1P2SA 3N7TA 1Z38A 3N07A 1FZTA 2HMSA 4KXLA 1PR3A 1PEKE 1R6XA 3KKZA 1ZD2P 4ZALA 5GONA 2Q7XA 2PMKA 1UJ2A 1J09A 1IHUA 1TKRA 2HC9A 2G4CA 2RKWA 5HKAA 4A6DA 5CLIA 2C7GA 1IZ7A 2PZAA 3R0IA 4TS9A 3DR5A 3L7CA 4RKQA 1NR5A 2XCUA 3EHDA 4AX4A 1BGXT 3STWA 3FPLA 4G63A 5K0JA 4ENTA 1AG9A 2K4MA 5AHKA 2ZE7A 5EGSA 3GRKA 3K20A 5A7GA 1QFYA 3LFTA 5KJEA 4OX9Y 3LT0A 3IPRA 2O50A 3CG4A 3FBWA 4LSWA 3MZ0A 4FILA 2Y0DA 4Q1CA 3NETA 1TAHA 2R00A 1JTFA 3TRIA 3HVIA 3K1AB 4QBIA 3RK4A 5H5JA 4FNMA 4I55A 2OD7A 5DTEA 4Z6KA 1T9GR 1W2WB 4WD3A 3LVBA 4Y0NA 2OHVA 3EGWA 5JQGF 2NO0A 5LC1A 4TVBA 4OOFA 4YXWA 3D3EA 1EB8A 3K9CA 3TECE 2F8MA 2G1AA 1QK4A 1RWBA 2RHMA 4OL0A 2NUBA 5ESRA 4CLRB 1CT9A 4NCBA 5D01A 1K68A 4LAFA 2YV4A 4IOKA 2I7DA 1K66A 2CUTA 5KWSA 2YICA 3PPWA 2VHCA 3OE7D 3WIUA 3ZBUA 2QJRA 4NCIA 4EFNA 2JIBA 1WS6A 5EIBD 1GCGA 3LUAA 3OEHA 2B36A 4J2TA 3ZWXA 2AH5A 3A4VA 1LWNA 2OD2A 3MS7A 1SU6A 3A7EA 2QV7A 2QYHA 2XB9A 3OWOA 4C76A 2NNWB 5BN4A 4CMIA 1P7VA 1XZGA 4PCVA 4E1VA 2YKGA 2EJUA 3P32A 1H4VB 2HRCA 1JMVA 1O58A 2G5CA 4JU9A 4DJJA 2G9ZA 3UWMA 1ZSYA 3VFDA 1NBIA 5FV4A 3C3YA 4L8YA 1QH9A 4Z4GA 1Z6QA 2FUKA 3FZYA 2BZSA 3CSDA 5DHTA 3PXGA 1YDFA 1RZRD 2DFNA 3ZCTA 3FNGA 3FZNA 3RVSA 5KJ6A 3LPLA 2X19A 4JT4A 4PX2A 1N77A 1PFGA 3W7VA 4IH1A 3PYXA 2WYVA 4EGAA 5FO0A 1GQRA 4KPUA 2GJ9A 3AF0A 3PKZA 3A1CA 3L4SO 2JI4A 3HP1A 3PITA 3VR6H 5JROA 4OK3A 2DQKA 4JI0B 3L0ZA 1R6UA 2P2SA 1XZ8A 4G67A 3UAVA 4HFMA 1LPPA 3H84A 3HMQA 2Z2XA 2Z98A 3IUSA 2PZGA 3QPBA 4JB2A 1DO0A 4LUCA 4ND8A 4UCXA 4ZJUA 4BCDA 3FRIA 3D3NA 1C80A 2QP9X 3QNMA 4DCJA 3ZIAD 1HT0A 2P35A 3U40A 5D51S 1A9XB 1N6OA 1U31A 1TMYA 1FQKA 1V45E 1U94A 1FRZA 1M0WA 1U1FA 2GD6A 2RCYA 3HB1A 1CHDA 2L69A 1Q0RA 1ZAKA 2AFHB 2ZBUA 3QXSA 1N0IA 4J43A 5IAJA 4MUYA 1GRCA 1ML3A 4F1WA 2XV1A 2CY0A 1YQXA 4LZAA 4LDNA 1SU8A 3FCOA 5AVOA 1BROA 2W2NA 3U37A 2CXPA 1JKXA 2ZWVA 3RAEC 4KR7A 4HN9A 3OZVA 3KBBA 1A8PA 2B3TA 3N7AA 1SFRA 4F2PA 3R7FA 4Q37A 1D8TA 2GCNA 2SKCA 3PC6A 1YB5A 2PMEA 4AFNA 5C46F 3HUFA 5KCZA 2QZSA 1B1CA 2XYHA 1YMUA 1YB1A 4LMPA 4FOSA 1GUDA 1MJFA 4P86A 4Z3DA 1XO1A 1Z16A 4E15A 1Z75A 2I2AA 2WHPA 5JJKA 1HTTA 4C22A 1S8NA 4O2LA 5JH7A 5DBIA 3C16C 3Q0EA 4FSDA 4BNGA 5B3AA 1SUDA 4X93A 4M9XA 5KIAA 4OAPA 3E15A 3H1PA 4FFOA 5I7AA 1E5QA 1MLDA 2VAVA 3KYBA 4CT4B 1I7DA 4GMXA 1ULAA 4CFSA 1N6NA 1B76A 1YULA 3GN1A 5AI6A 1UP4A 3FDZA 3KJNA 1FDIA 4KR2A 2AR7A 5IUKC 3PV0A 5BSFA 2JFOA 4D4JA 3EXHC 4KQHA 3HQ4O 4KWHA 3IEVA 5ITWA 3FOBA 3MELA 4GI3A 3PTZA 1CZOA 2NT3A 2ZJZA 4AZSA 2E3JA 2RGRA 5UKDA 3EOZA 4D9EA 5CT9A 2UZ4A 5AVWA 4X1YA 1WZEA 4IZOA 1JQEA 4Q3BA 4XM0A 2ZI9A 3D02A 3RVJA 3LC7O 2ZB7A 3ZHUA 3FCCA 3FCXA 3THSA 4ESVA 4MQFA 4QOEA 3OPQA 2WRZA 1Q44A 2VA8A 1HT3A 2YHBA 4NYIQ 4TXJA 4F3NA 2JFBA 2AGVA 3FOEC 5AVRA 4DKXA 1EUZA 3UWDA 4C2AA 1U1GA 2HSWA 2R7MA 3NHZA 4EW6A 3UO8B 1PYOA 1PV1A 4MHTA 1QOZA 1CG6A 3UMFA 2GD1O 5EE1A 5HBGA 3U5TA 1LRLA 4CFYA 2R47A 3N58A 6NULA 1FQWA 3LBFA 3PUIA 2WP0A 5CCBA 5B2EA 1BH6A 4M7PA 4WECA 3VOTA 1DC7A 3MJCA 5DU2A 2JEYA 1QH1A 3IVAA 1JAHA 3QLUA 4NZNA 3IEUA 3NBAA 2OK7A 4Q4JB 5B37A 1PP4A 2Z2JA 3ESQA 4BXOB 2PA0A 1Z4QA 3GCWA 1XD2A 3AM4A 1KR5A 3LVRE 4BNDA 3RADC 2OYCA 2W90A 1XMSA 2DG2A 2FG7C 2H08A 3AG6A 3GZJA 2HRDA 2QM8A 3AEQA 3ROGA 3ZD6A 1CY2A 1JAYA 4HZIA 1TO1E 2X2FA 3KWFA 1L5WA 4BIIA 3PJRA 3WGHA 4Q19A 3O26A 1NQ5A 2AOTB 1T1SA 1SIWA 2D0PB 2VUIB 4PPNA 4CKEA 2JIZD 4RTNA 5L7WA 1NG1A 2VBGA 1IJEA 4BJHB 1RKXA 1SPBS 5DEOA 3NUZA 2C42A 1JPUA 2W7TA 3IPYA 4FGKA 4HBGA 2D0DA 3WZ2A 2EZ4A 4RSHA 4RTQA 4PAOA 1CUBA 3IVRA 4XIFA 3PB3A 1UOEA 4DYVA 4F8YA 5DBGA 3UV3A 5FB3A 1G3QA 4WJLA 2PZKA 1L3CA 4RJ2A 1NUTA 1C0EA 5LR6A 3WKBA 2BN4A 2IT1A 3P9NA 3ZIAA 1JPJA 2O5RA 1KSHA 1UKCA 4LTNA 2DCMA 3PJEA 3UW3A 6REQA 3KQKA 1G3MA 1DJPA 1JVNA 2EFDB 1K5DA 3K5IA 3SS8A 3I72A 1M2KA 1Z0JA 1YFKA 2BEWB 4G26A 1T4GA 1W0KD 2B7CA 4J76A 4S1VA 1M6WA 1LPOA 5DHUA 4YP6A 3AVQA 3DMTC 1XRQA 3PRJA 1ZJ6A 3VISA 2NIPA 4G1EB 4W99A 3UG7A 4GZMA 5K09A 1YI1A 4XUGB 4B4DA 1LPBB 4F06A 3ZEIA 1AIPA 4PU0A 1TT5B 1W93A 4KGZA 2CLHB 3B3GA 2VJDA 4MQ5A 3N0TA 4UHEA 4WCDA 5FTWA 5ICMA 5JCOA 1O54A 2QVYX 2FE4A 4DDUA 5BVHA 1ZQ9A 1TGVA 2YS6A 4YAJA 4B8YA 9ABPA 1IQPA 1DBWA 5L3SA 1X0XA 1OQAA 1KFJB 3PNMA 1E2LA 2WAAA 4HXYA 1L3BA 5CPBA 3JZMA 4X84A 4ILEA 2D7JA 3KKOA 4OYLA 1NLUA 5ALQA 1RDFA 2UYCA 1A8IA 3GXOA 2P68A 1C50A 4PC3A 2R6AA 4S0XA 3B82A 2ZJ0A 1A9ZA 3W90A 3WBFA 4JJGA 4IBOA 1G64A 1NUAA 5D1HA 3EOBI 1HEYA 4N12A 3CF2A 4KQ6A 4P4UA 4BZXA 1JFSA 2BH2A 5DNCA 2Q3EA 2A57A 3C3PA 3SQDA 3TZCA 3WRYC 4ND3A 1K0UA 2F43A 3CC8A 3FTQA 4ZC1A 3T41A 4CR8A 3I76A 2HM7A 2BKAA 3Q3VA 1QRAA 4DA8A 3QLVC 1G2OA 4KO1S 1RRPA 3T7JA 2EZUA 3D31A 3WOVA 4XAQA 3ER8A 3TEMA 3SC4A 3M6LA 2EERA 3GCZA 4KB5A 2A9QA 4ZVRA 3AF1A 1T9DA 2JAPA 3V1NA 1EEXB 4KIGA 5A62A 1FSPA 3O1JC 4NCJA 5KVQA 4CV1A 3PCTA 5AVSA 5M34A 4S1PA 3KZOA 2JJQA 3R5TA 1E2IA 3ISJA 1E4EB 2DPGA 3UV7A 4QAQA 6PFKA 2B30A 4F2HA 2VRNA 4M99A 4FOLA 2Q3FA 2WKSA 4K9KA 4P34A 2J9ZB 2XGJA 4HDKB 5LNK1 2JLXA 5D3ZA 1Y6ZA 1KERA 4V0SA 2V6MA 2J6IA 4DDHA 3I61A 4I55F 4QOGA 5B7PA 1OWMA 1YJQA 4X85A 2X23A 3A6ZA 3OHMA 3QTBA 5CJ2A 2OBXA 1RR6A 2RKOA 3NYIA 1ZL2A 1F1BA 1IY8A 2ZBPA 2IX3A 3QA3E 2QUAA 4CI0B 2PO5A 4A8HA 3GWZA 2JI8A 2PSDA 3LX4A 4NBNA 1FS5A 3KDPA 4MEJA 5F2EA 4QT4A 2XUFA 2B4RO 3IERA 1NBAA 1YRBA 2G6TA 1ZH8A 2ZBEA 4MQEB 4UARA 4LF7B 4BVEA 1QGUB 2CXQA 4L3WA 2ZYSA 3AU8A 3DBLA 3QFCA 3QPDA 4LYDA 3HWRA 3V7YA 4HRXA 5ITZB 1IIRA 1M6HA 1M1NB 2GILA 2EJVA 3AUJB 3P5BA 1P1BA 4L7QA 4QJBA 4TSFD 3VSCA 3E70C 1CFZA 1PJQA 4XQEA 2OV2A 3LBAA 4NL4H 2NZXA 2I1LA 1SXGA 5FUVA 4PVCA 3UYKA 1GAQA 3GNLA 5HFAA 3G9UA 2BRUC 2ZI4A 3HWWA 4MRRA 4YJHA 2QLLA 1WOYA 3AVOA 2HO5A 3L6OO 1MAHA 4MA0A 4PLTA 4DIEA 2NADA 2DUUA 2XYQA 3GYGA 5JXWA 1SXJE 2OOKA 1F14A 2DJ5A 1T2DA 4EX6A 1AGNA 1GGFA 2C03A 2IE8A 3MB5A 4RGYA 2JH9A 4Z2AA 1FDRA 1VECA 2BEVB 4J7XA 4FFLA 2GEFA 1FTQA 3K6SB 3KOOA 2DBYA 1SU7A 2GLTA 3D2BA 3IT1A 3LOQA 2Q3CA 4WOKA 2ZAMA 3PFGA 3S2UA 1TYCA 3Q6IA 4BFLA 1G8PA 3A4TA 3AOGA 3PXXA 4JI3B 3MS4A 2H0AA 2G08A 3GBVA 4AZTA 1Y7TA 5IUJC 1CERA 2C9CA 2NOAA 2IDMA 5L9AA 4EY6A 1R74A 2PVCA 4R5MA 4I4NA 3X1JA 1PJ3A 4MITA 4LCBA 1HDYA 4L3VA 1J1UA 3KFLA 1VG8A 4ALKA 3DOEA 4G5XA 4HUTA 3T1HB 1YFLA 1IBKB 4WUTA 1STOA 1J42A 1KSGA 4PO1A 5DEIA 3V4ZA 3OPYA 1TJPB 2HO4A 5DLEA 5K8VA 5A04A 1J8FA 4BHTA 1FDUA 1QKKA 3WGLA 1UFVA 4UBMA 1QZXA 1S3IA 4RK4A 3N70A 1W59A 1SUAA 2IYOA 5L6MB 1TMGE 2ZRDA 3L1KA 5ECWA 5BSGA 2EZ9A 2I4IA 1Q7GA 2IKQA 3EN0A 2EEPA 2WKWA 3B6IA 1XTIA 1XZBA 2OWDA 4D3DA 5HXAA 5DM4A 2H5IA 2HIGA 1W49A 2NU6B 4P7BA 4FD3A 4LFAB 2R87A 2BBSA 4L5CA 1GPLA 2KS6A 1ZIYA 4U2KA 2P75A 1RJEA 1W9MA 4KFCA 4DR4B 4UATA 4J3JA 5JJBA 4OI0A 4Q39A 2X6TA 3CNHA 3G8YA 5I7OA 4PY2A 3MFQA 4DSOA 3TLBA 3IGFA 2QL5A 3LX6A 3H0EA 2VRBA 3TPZA 4UM8B 3GZNA 2OVBA 1ZINA 1FJGB 1BS2A 1P2TA 2OO3A 1TU3A 2C58A 2QRVA 2HHJA 4M1YA 4CLHA 2XVZA 1QP7A 2ZT6A 1XJCA 3QQPA 4TKLA 1AGYA 3KSMA 3ETDA 1N7HA 3PC8C 2AC7A 4M0UA 3WOHA 1ETUA 2QSJA 3IURA 3QMMA 3HCEA 3S44A 4L72A 5GIOE 3B7WA 1O8CA 3JZDA 1D4ZA 5CM2Z 3SICE 3AEUB 4XX0B 1DRUA 2R5FA 1Z06A 3CZAA 4HVTA 2ZR9A 4MDYA 1JEYA 1QRDA 1P7YA 4R1OA 3HPRA 1E79D 4LXXA 4S24A 1U2EA 4KEAA 3URKA 4DMLA 2AI3A 3AR3A 3HCFA 1SK8A 3BGIA 2EGUA 2JS7A 1V37A 2C9MA 3H05A 1JA9A 4FFNA 4HNHA 4JN6B 4XCXA 5CNIA 3O47A 4PW0A 2QPAA 5F73A 4AY5A 2HKIA 1QIFA 3MWYW 1FSZA 3WA7A 2EBHX 4R7TA 1HE4A 5F9HA 1YHNA 4TTTS 2C9OA 3T7IA 3SSOA 3SPXA 5H68A 4BAZA 4ETWA 1LFAA 1OC4A 2PZLA 4KV9A 4WINA 4NARA 4W6QA 5SZHB 1DAGA 4JT8A 4HYQA 3U1TA 1MABA 4OV6B 2P6MA 1E2PA 4UMVA 4FDVA 2BR4A 2W2KB 1UDAA 4H27A 1KZ6A 3TNDA 1BA2A 4FS8A 1Q1GA 1US8B 4LMRA 2PH1A 4YWJA 4AF6A 3HB4X 1KK3A 3IEKA 3C48A 1OLUA 3CEPB 1D5CA 3SHOA 1VCMA 4N8EA 2H29A 4GQIA 3UVEA 4JYZA 2I55A 3GVHA 3L43A 1HZJA 2BP7A 3DAOA 4IR7A 2D7DA 2QNRA 4KE9A 3KEQA 1F8UA 2I2DA 2J6HA 3BTSA 1DXOA 4IOLA 2J1LA 4RF5A 4JVSB 4B0OA 1K8QA 3UQZA 3KPVA 5DYWA 5EQJB 4K28A 3LM8A 4F21A 1NOJA 2JFNA 3TLYA 3LNTA 5JIBA 3G0CA 4HWTA 3Q8KA 4X94A 3WVNA 4Y18A 3ZH9B 2IF2A 3C6XA 4FYVA 4I66A 1EJ0A 2B94A 2XUPA 2IPXA 1RBYA 4INAA 4KQIA 3BXGA 4HNGA 3OQNA 4R9NA 4OJMX 3GRFA 1A2BA 4DAOA 4JSYA 2C1ZA 2GESA 4TYNA 1JXQA 3NEPX 3VAZA 1KQOA 1QH8B 1UBFA 2C29D 3ILXA 3SF8A 3B9PA 1DV2A 1NQAO 3L0PA 3R7AA 1BQEA 2K7FA 4GI2A 1F2DA 1WX1A 2PZBA 3DVSX 3GLFA 2O1EA 3FGZA 3V97A 5A0TA 1EK5A 2Z3VA 1ZYUA 4FJ0A 4PXAA 3DQQA 5DNDA 1V43A 2XGSA 4NMMA 1VRCA 3OVMA 5BN1A 5LIPA 3GJ8A 3WG9A 2C2WA 4OXRA 3RS4A 3RAFC 1CB7A 4KLAA 4DJTA 4ER5A 1CQJB 1LPNA 1K7CA 2O2ZA 4FBGA 4FI3C 3JAKA 3TI9A 1CY0A 1XAJA 3NYQA 1GPH1 1RABA 2G70A 4C0BA 3WJAA 4BO8A 5BORA 5IDWA 3THXB 2YJGA 4CG2A 4V2UA 4RZXA 1ONPA 2H2HA 5EUBA 4K3UA 3FHCB 3S2YA 1MO5A 3B1XA 1T6XA 4HAVA 1XMQB 3CONA 2X0DA 4ENRA 2FCRA 2Q62A 2BHRA 2L18A 2ZVQX 3VPXA 2WG0A 4IWXA 5IVIA 1D0IA 2HRBA 2BF7A 5LWHA 5L4LA 3FNBA 4RAQA 1N5MA 3WHKA 1EE9A 3AZPA 4FCCA 3UJ6A 3RVMA 4ZAXA 3FUUA 2JL1A 3V34A 3KYCB 4EGCB 4ZI7F 2D7CA 1HDGO 4F3YA 3R23A 4DEYA 5LP1A 4HWSA 4IRUB 3W1EA 1I3MA 1JU4A 3G2KA 1YOVA 2CNBA 5JMPA 4O4HF 1RFGE 5LP6F 2Q5OA 3AJEA 1FFSA 3EXHA 3M6WA 3SVLA 4MUGA 3L6DA 3DULA 3N2LA 1EDOA 1QC5B 1ONSA 2FMKA 3DTVA 5LLTA 2Y3IA 4Q34A 5JJCA 1T43A 1P60A 3HXLA 4RPHA 3GJ5A 1M1YB 1XU4A 1GEGA 2GZDA 1HFEL 3OCZA 2WVAA 3GFTA 4M8IA 1F20A 1II8B 5ICEA 3A58B 4TS4A 3DTTA 3PZBA 2ZSFA 4EVIA 2YWBA 2ORVA 1U28A 1DOAA 1SCUA 4XGKA 2D06A 4MV7A 1PL8A 4GH5A 2MSKA 4ZQGA 1LDEA 2YUTA 3PXDA 5FPHA 3W1WA 3WGOA 7YASA 3E7WA 4OREX 1GXSB 1WXQA 2ZRIA 2KBFA 1OXKB 3MCWA 3RUPA 1W1WA 2GKOA 2X86A 4U3JB 1ATZA 1QYIA 3QKWA 4XQ9A 2X0RA 4ZCIA 2IP1A 2QSYA 1N4DA 5DYTA 2R1TA 5FWDA 3LF1A 3E61A 4NZ9A 4MVJP 5REQB 2D1QA 3ZD9A 1RAGA 2D4AA 4B4OA 1QM5A 4N8DA 2UZAA 5GONF 3UJDA 1KVUA 2REXB 5FDFA 8OHMA 5ELLA 4KDCA 3SQOA 1TT7A 1ZMBA 4OFXA 2NZ2A 4ICIA 3BQNB 5IC6A 2RH4A 3HO8A 4FJ1A 1KAMA 2BOVA 1JMKC 1VTKA 2BV3A 5E4JA 1GNQA 3D0OA 5HA5A 1ZNXA 1VJDA 4OKIA 1JR2A 1CS0B 3AJDA 1XEWY 3CIFA 4AD8A 5J2UA 5BT8A 1U8CB 5CLLA 2O14A 4J49A 4U5XA 4F9FA 1SRRA 4RLFA 4WZBE 5EFZA 2XCQA 3CJQA 3EGCA 5EEGA 3C39A 1KVRA 5KX5B 5LZ2A 5EJ4A 4HN2A 4YGYA 5FWYB 1Y48E 4MROA 2J6BA 3FYUC 2TMDA 2NZYA 4RWZA 4UNPA 4ND2A 3VGPA 4V1CI 2YZGA 4NBLA 5LQJA 3LQ1A 1DQSA 1JBQA 5HR5A 3H11A 1XU7A 2CHFA 4Y2QA 2POQX 3NVKI 3PVSA 3MWDB 4BLQA 1LB1B 4QPZA 5T5QA 2VWGA 1NC1A 1Z6ZA 4N3GA 4O3FA 2R7NA 5EUQB 1MB4A 4KXVA 3UWKA 4UNQA 3ZI7A 1DO2A 4ZICA 2IYPA 2J0UA 2AYYA 4TTJA 4XPZA 2V7WA 1PK7A 2VNKA 1GN8A 2Y0BA 2FSFA 2GN2A 2WWHA 4A7PA 1ECCA 4BO0A 3VPCA 1LSUA 2R6CA 2BTQB 2NZUG 4DMCA 3ZWPA 4W5OA 1NN0A 2QN7A 3DE6X 2DQSA 3FIUA 3MLBA 3PENA 4O59O 5ILQA 3VU9A 2Z2IA 4L76A 4PS0A 4B74A 3ZHOA 3P71T 1EGHA 2Q2QA 2GF0A 4TRRA 5T67A 1U7ZA 3SFTA 2ATXA 4K6CA 2R9VA 1G19A 1UDRA 4JYMA 4D1YA 4YX9A 4ZO6A 4CMGA 2JPDA 1E3JA 1JSLA 3DVAB 4BEWA 4EL0A 4ND5A 2JJ1D 3CZMA 1R4ZA 4C9BA 5CUQA 1PEYA 1B8VA 5IZ4A 1GZDA 2X2OA 1CVIA 4QQ8A 3LHKA 3TE7A 1KC1A 4NV3A 5E2BA 4XUDA 4LDZA 5ALOA 4C30A 3TOCA 2AN4A 2REQA 1KBQA 1X13A 3QNWA 1GCIA 3RJMA 2OQIA 1EX6A 2WJPA 3GGJA 4B1FA 3IE1A 1E9BA 1TTQB 3W3AH 5CT6A 1NM5C 4F45A 3ABOB 5BR4A 3IAUA 3P2JA 1PT9A 1Z28A 3L8HA 5DYNA 2QPOA 3ONEA 2B1GA 5FI3A 1XZEA 2G25A 4IRMA 1XDUA 4LXGA 4CEIB 1MZVA 1Y9JA 2QVCA 1AKRA 2ECQA 1H05A 1Z5UA 2I76A 5G1NA 3V48A 2PRSA 4OCZA 3TL3A 2IHNA 3EVGA 2DWQA 3IDQA 2EIHA 3TEFA 3PTAA 3ZDDA 3DWFA 1WJGA 4BNYA 2BFPA 1YVDA 3WBBA 2VO1A 1BDHA 1U28C 3PE3A 2BEVA 2FRXA 2YWXA 3OJWA 1TVKA 4OHRA 1T3SA 3Q0TA 4PR3A 1MXHA 2BDEA 1IWBB 2IX9A 3IJEB 2VCHA 3JQGB 4Q7JB 4WPGA 3SGLA 4CM6A 2UUAB 2A0KA 3BF7A 3F2VA 1N78A 2Z3WA 2B4QA 4IJQA 2GH1A 1RHKA 5KQPA 5KYXB 4KVGA 1MX3A 2IC5A 1YIOA 1U0RA 4JLBA 1KI6B 3OTWA 1UFKA 2AEJA 3CE9A 4L07A 3VC3A 3ZW9A 3AZQA 3P26A 4MXDA 4JI7B 3O4HA 1RYBA 1WDKA 2K7ZA 2RK4A 3RFTA 1JDPA 1P2BA 3EVEA 3W06A 1KJQA 3QELA 1MIHA 4FGWA 4ZK6A 1AB6A 3L01A 5LSAA 5I6DA 2OBMA 2A94A 3C3DA 2PIAA 1ZD9A 3LJKA 3NXSA 4H7JA 4HYTA 4RIGA 4B3SB 1PR0A 3ZCVA 5I48A 3RSGA 5DTJA 3V8BA 4YHHB 1I94B 1GZ4A 1Q7CA 1S2DA 3C1TA 1UPFA 2J3JA 3DOIA 1KMQA 3C4JA 4ZO9A 1MHPA 2EX0A 3QFHA 1ZM2A 2IK8A 2J30A 1Z0UA 2Z09A 5E3HA 5JYCA 2ERYA 5BQXA 1XNHA 4X3OA 1TCVA 1JT2A 1Y3HA 3F0TA 3QKRA 1TD9A 7ADHA 4YT2A 4JK3A 3SBDA 3PGA1 1J0DA 2YWEA 2R25B 4A8PA 1K1EA 1N8SA 1E2DA 1XMVA 5BXQC 1WPRA 2VJLA 2UVPA 3BH0A 1JNXX 2C4VA 2CL0X 5CXSA 1MV5A 4L0QA 1N57A 3MT8A 3WMXA 1XZPA 1ZNZA 2B4YA 3EVFA 5DI3A 1KFEB 4C4YA 1YHYA 3S2SA 2DKOA 2WQZA 1E1QA 4TPKA 3OP1A 4QPCA 5GVSA 4D6PA 2FPSA 2YV3A 3NT5A 2IYFA 1IWPB 3GQBA 1TQ6A 2G07A 3A37A 3PU6A 4JB8A 1EUDB 2RCNA 2VJQA 1MR3F 1EHYA 1R0WA 5FUXA 4Y6GB 1KJZA 2X4LA 3G2JA 3JSAA 4RSGA 2QYOA 4L0CA 4HAWA 2PRIA 4QXAA 4YVFA 1PN3A 3D3JA 3EIWA 3UBMA 4GD3Q 1ETHA 3ASVA 5J40A 4FP9A 1JEYB 3Q6NA 3N6XA 4MUFA 2ONZA 3TGWA 4KFTA 1J6UA 1WD5A 4NR0A 3OPVA 5LOVF 3M4JA 5DTQA 1WW2A 2AMLA 3ZHYA 3JD1A 3A9SA 5KREA 3LCUA 3QOFA 4O6VA 3U0BA 3NYRA 5JI3E 1OROA 4RHXA 5I7RA 1QTNA 5FKJA 2J3LA 1AKWA 3U7HB 1CY4A 3IEIA 1YL7A 4IGEA 4UHKA 4E2FA 4CPDA 4B09A 4KN9S 1X14A 1MC4A 4BQEA 3RD5A 3CRNA 1NLZA 3REQB 3KHSA 3QUCA 1U8TA 2WU4A 1F5SA 1O3YA 2OV3A 3EOAI 3PUZA 4QDTA 5COQA 1P4AA 4IICA 2Y6UA 1VL6A 4MEAA 3CG0A 3UXYA 1Y5MA 2CJWA 3IODA 1J5XA 3RSHA 1DG3A 3R44A 2OM2A 1KU0A 3GLSA 3D3WB 1XZJA 3LXMA 3GFBA 4IOMA 4QECA 5L7YA 1NY5A 4DM3A 3JQFA 5IG2A 3QEOA 2G77B 4IQ0A 5DM2A 1WHSB 3H99A 4HUQB 1JHUA 3PQ4A 4HRAA 4WAUA 5GJVC 2GZAA 3IQDB 4KYVA 3O91A 4A1FA 2HLNA 3Q3GE 4NYMR 4F9GA 1CE8A 1EJ2A 2RGNA 4GMKA 1ZRHA 4NMHA 1YDWA 3AILA 4B87A 4YAIA 1HTBA 4PGHA 4D4LA 2YR0A 3NVDA 3NHJA 4Z7NB 1N0HA 1I5OA 1USIA 1XXHE 3O21A 3LFUA 4FM9A 3GO4A 2LE0A 1KYZA 1DXHA 2JA1A 1EJ6A 4KFUA 5AK3A 3VPSA 2WHRA 3O94A 5KNDD 5I5GA 3KVRA 1Y6QA 4QGAA 1QGYA 3BKWA 4HPXB 3DFMA 1ADFA 4I46A 4RZUA 2XUGA 3NBKA 4B6EA 3PR2B 4V38A 4V0MA 5KMGB 4L8GA 2XUJA 1HFKA 3C3EA 4IRXA 4DE5A 2C20A 2PVPA 2F1KA 4WK6A 2ZDQA 1OVMA 4GX0A 1WUKS 2HD4A 5HP4A 1W0KA 5FOUA 3QX7A 4R3WA 3RSZA 3PQ2A 1NI4A 4K6KA 3STYA 2IFTA 2IKSA 3INNA 1NVDA 1YR2A 3B60A 2XCIA 1ACMA 4IJ6A 4L5AA 5E95A 2QNIA 1DC6A 1G6Q1 4FKBA 4DLYA 5C4MA 2QUBA 3TG2A 1QO0D 1XHFA 2I66A 3SK0A 3KKKA 4V0LA 2AG8A 5CLFA 5M5BA 1CCWA 1V35A 3AZOA 1FMCA 4P7JA 1JQ5A 3RK0A 4IUDS 2ACWA 2VVTA 4XPIB 3VR3A 4EJ0A 1GFZA 3TX6A 3RUFA 4QOJA 5K6TA 1M2EA 3BFJA 4L8VA 4OMCA 4IDBA 3RLIA 4DLZA 1QG0A 4MDHA 4OB6A 3NHLA 3NHPA 3B5IA 2I22A 5LXTA 2ZJYA 1N6HA 1BW9B 1JVSA 4P3KA 4AO6A 3DDUA 3F9CA 5FADA 4C0JA 3AL3A 3PXAA 2V3WA 5HUJA 1H5UA 3LUFA 4JJ6A 3O38A 2OORC 4KUGA 4Q7KA 5KSOA 4X65B 4ZVOA 1RWWA 4KRGA 4DMRA 3AM3A 3OQ1A 1DXQA 3UPDA 1IJKA 1II0A 1RMYA 5T6MA 4HDCA 4W1QA 5F1YA 1TCAA 4DDKA 2C88A 3NEJA 1W4AA 3O4GA 4AYWA 2ACVA 5AK5A 4IDFA 3T9CA 2B2NA 3IP7A 1KAGA 1X7HA 5CX4A 2H00A 1Z45A 3RROA 3ASUA 5LQUA 2X7JA 4AURA 3WGIA 3EEFA 2Q2VA 3ECCA 1GIAA 1AN9A 4BO6A 1SAYA 2OO7A 4UE6A 4IZIA 2P11A 3C7KA 1YQUA 4BX0A 1NLMA 3MINB 1Z74A 2FPMA 2Q4TA 5JATA 1ZD8A 3SC2A 2XQIA 2KPOA 4HDMA 3HJNA 4B76A 1JHRA 3BT7A 3K70C 2M98A 1YXMA 2I3AA 4HS9A 4JLMA 3PF8A 4FINA 1P9NA 2HK9A 2JJYA 3JYOA 3WZMA 5BRAA 5DNYB 1Z7YA 3AUUA 2XXAA 1DMSA 3QBTA 2WFLA 3LA6A 4I08A 2HYDA 4P6VF 4OIFA 5DK6A 1G8FA 4G4JA 3SHTA 2AQIA 4HGNA 4DG5A 1ODTC 2FPGB 4YDQA 3SI7A 1I7LA 3V2UA 4DWOA 1J00A 3HA2A 3CU5A 5JTUA 4DOMA 3A6JA 3EGOA 3I3OA 1CJKC 1LV7A 4P4GA 5LA6F 4H15A 4F72A 2ILVA 4UHHA 1ADJA 4KQFA 1XQVA 4X97A 3SFZA 3OTOB 1Z6AA 1MNQA 5LM3A 1V2GA 1YBHA 5EVCA 5FV7A 4BEBA 1N0WA 2CDNA 1Z5GA 3EQZA 3VQTA 5ETJA 1AKQA 5G0TA 1QQ7A 3ABQB 3A10A 1NUPA 1OAAA 3QUSA 1YQQA 3NHUA 3NALA 5DF1A 2CF6A 3VH2A 2PGOA 3F3KA 3IAHA 1AKNA 1U8EA 3L06A 5F7XA 4HEQA 3V3KA 2FAXA 1EX9A 5DP1A 1JKJA 1PZHA 3EAGA 3AF3A 3U19A 3MSCA 5J2TA 3J81A 5FNVF 2C7QA 1KQPA 3CZPA 3KHUA 4CKBA 1ST2A 5B1DA 2BHLA 4J7AA 5J4HA 1BHQ1 1R0KA 1Y4UA 2WD9A 2XMPA 4BNFA 1QUFA 1Y33E 4QVKA 4EA9A 5KQRA 4O3MA 1ISIA 3EULA 1Z5NA 3FNEA 5IWCA 2ZRFA 1P31A 1X70A 2DFDA 2VT6A 5THQA 5KNDH 4IVRA 1NRWA 3PSHA 2P9JA 4C07A 1YIAA 3JQRA 2A9PA 1LQTA 1B8UA 1H9BA 5B55A 5L40A 3R5SA 3H17A 1F2UB 2A84A 1PEDA 3PUYA 2EQAA 2PKRA 1SKAA 2OCLA 2QGFA 3DOJA 3LUPA 1EB9A 4R31A 3T7EA 1OIWA 4TSRA 1PFYA 5TRTA 4WY5A 4K86A 1P0PA 5KB3A 1YJ8A 4GI5A 1DWOA 1A88A 1JFRA 1V6AA 1ORVA 1NJ1A 3FLBA 4LQCA 3GT3A 3M4ZA 3ND9A 2FEKA 5LQDA 221PA 1JIUA 1RRMA 4XD7D 4MB2A 1U1IA 1J21A 5DHAA 2H06A 4H0FA 2H0QA 2SCUA 2WB2A 3NBUA 1ECFA 2AJTA 3M6VA 2ZG6A 2BHNA 3DAPA 5FTJA 2VATA 1QGAA 3L9XA 1P7ZA 4M83A 4R9UC 1EIZA 4G0PA 5BOVA 5JZOA 1IE3A 4GOXA 1EAYA 4W7IA 1HC7A 4UNNA 4OLJA 4EKGA 2QPTA 3GOQA 3HXTA 2Q8NA 2C7PA 2NSYA 2OBFA 4OLBA 4N5NA 3LHFA 3TLJA 4MIOA 3TLAA 3C14C 1GQSA 3L49A 1DKUA 2A6PA 2FY8A 4G0ZA 4PLWA 3B3AA 2MR5A 3ORSA 4PINA 5AVQA 2WG2A 2GPBA 3CTMA 1ZIDA 2WTBA 1J99A 2YYZA 5GJWC 5HQJA 2IHKA 3F47A 1GKIA 1O08A 1Z73A 3RRYA 4DQXA 4K46A 3DOCA 2BR5A 4OQQA 4I50A 5E0KB 3WO0A 2LDXA 4CEIA 5JYDA 4ZO4A 5BWBA 1E1LA 2JVJA 5CA1B 3CNBA 5CVDA 1F3OA 4AKGA 1BZYA 3M4YA 1XG5A 1LH0A 1DQRA 1RHRA 1ORDA 1N1EA 1U98A 2GAOA 2V03A 2I4LA 3BMOA 3KALA 1OGJA 1K08A 3QUTA 4OB8A 1X9HA 4WLOA 3VAAA 4DZTA 4FKMA 4WKOA 2ADOA 2H6EA 3H9UA 3LZ6A 2C5EA 1G8GA 4E70A 3QFRA 2AC2A 3JW8A 4NKRA 4W8HA 1OOEA 5K20A 5IAOA 2N3ZA 4HQRA 4G0VA 3ILSA 2LNDA 2WUWE 4F2GA 3DP7A 4KFSA 2R66A 3DKRA 3II6X 4J9VA 1XCOA 1HETA 4N4AA 3KCNA 4WASA 1QO7A 2E4YA 4IX1A 4OUDB 4Y2PA 1A96A 4FFRA 5AJXA 1VKOA 4WX2B 3AIKA 4Q0MA 3OLWA 4DY6A 1GHTA 1GSHA 4BNLA 3QELB 5ALHA 5IBRA 5BR7A 4IO1A 1ORWA 2NTEA 1Y8QA 4NAVA 3WGVA 3D6UA 3GFVA 1JEDA 3ZQ4A 4XTRA 3R1IA 3CLUC 4P5PA 3QHPA 3HGTA 4NXNB 1CRWG 1GA4A 5FA6A 4LNHA 3SYTA 3E3AA 1CRQA 1EGVB 3RODA 4C6SA 3RTDA 3KRTA 3Q7QA 1RWXA 3R4VA 1FJHA 4BNKA 3F1LA 5F5XA 2I8AA 4Q48A 2GZMA 2QPLA 5H02A 4HAYA 5C37A 1ZXBA 5C8XA 3L7AA 2Z8YA 1YE8A 2O3SA 3FTDA 1U7XA 4OA5A 2V6JA 4US1R 4A6XA 2JLWA 1N7IA 3DKIA 1PJ4A 2P2GA 2AOUB 3HXOA 3F8SA 1DC4A 4KIUA 3AP3A 2I29A 4H1VA 2HK6A 1E89A 1EM6A 4CT0A 4ITUA 3EQ6A 2ZUWA 2JBWA 5IX8A 4A1OA 3NDIA 2G1JA 2H4ZA 3ON5A 4RF4A 2X4DA 4F3CA 3R20A 5KPJA 1C7RA 1YS9A 3BXHA 3QGMA 1XCJA 4AY2A 2GPTA 2QG9A 1EUDA 3OE4A 4M89A 1ZIXA 3PNLA 3M83A 3D0RA 4V1CA 4YP9A 1L4UA 1LVHA 5CXXA 3VC7A 3RKUA 2PS3A 3JQ8A 5AW2A 1L5SA 1TA9A 1VL2A 3PPIA 3TOXA 1DJMA 2IJGX 1WKCA 4WK4B 3AG5A 2QU8A 4FCVA 1FS4A 2WIJA 3I34X 3TQCA 1UXKA 6AT1A 1WV0A 1OX5A 1PI3A 4J4HA 1G1AA 3U3XA 4O1HA 2RB4A 5EZ5A 2H9AA 3N74A 4K7JA 4NBWA 3ES9A 4YV1A 1V5IA 1G5IA 1LA2A 1O57A 1QJCA 1HDRA 1QO9A 2VJCA 5CFNA 5AH0A 3T34A 3D4IA 4KQCA 4NU6A 3DCJA 3HWX1 4C4XA 3B1VA 4BGIA 4UZFA 2Z58A 2JFWA 2YV1A 1KI2A 5BUSA 1H1LB 1SUCA 2FK7A 5D87A 1ESNA 2RAFA 3RHTA 4DUPA 1OBHA 5LD2B 1RXWA 3BB3A 2DTEA 1VKHA 1NPYA 3PNKA 3PQ7A 5IARA 1NMZA 4F0JA 2GETA 5IKPA 2YVLA 2W83A 3DO5A 3C41J 4DFDA 4QZVA 3JQCA 2IYNA 4X7PA 1XTBA 1HEIA 2DBRA 2D1FA 4K87A 3E05A 1EFAA 2GLUA 2IHVA 1PFQA 1XLUA 5GZ3A 5KOHB 5LDDC 1QQ6A 3DAHA 1DBSA 4R68A 1VB3A 3EK2A 1W36B 1MW8X 3FFTA 4MH0R 4DCVA 3LCVB 4G25A 1CY1A 1XZHA 3AKCA 3EQ2A 4HEA1 2YHUA 1M8KA 2A9RA 3AYZB 3FTFA 3DLAA 3HVUA 1IDOA 3O4RA 3OAAA 3H42B 2WM9B 3HADA 1X1RA 2BMJA 4U6NA 4EHLA 3PDIA 3A4MA 2JBHA 5CYGA 4LZZA 4LVUA 3SZLA 4AKHA 2DKFA 4WCFA 3C3BA 1WCIA 1YTLA 1QOPB 9ATCA 4I4TB 4KAAA 1FVXA 4ZDWA 2YXNA 1KTIA 1E0DA 1VZ2A 1WBJB 1Z8FA 2PL5A 2W2VA 2FEMA 1L7DA 4YGXB 1B16A 1THZA 2H9YA 2PHZA 4M7WA 4BLOA 1Z8HA 3JZAA 1F8GA 1N32B 4HWKA 3ZBPA 3P97A 5JHGB 2EARA 3RVKA 1KK0A 2CHQA 2HNBA 2QT1A 1CVLA 2GTPA 2X9GA 3BKXA 4H7IA 1DRVA 3L6BA 4K8RB 4U2BA 4YRBA 3NCTA 2XF8A 2XRFA 4GX1A 2W2LA 2E21A 3LUJA 3RS5A 3NUQA 4I9HA 3U7JA 1I1OA 4IDNA 2B8TA 1RXCA 1G8HA 4YP5A 2VI5A 4LDRA 1X7WA 2BWJA 3TIXB 5THKA 4FB4A 3CV3A 5EMLA 4AN0A 1XPRA 1C1HA 2FWRA 1WY7A 1NBMA 1TFRA 2FLVA 2C2HA 4M54A 1L5MA 3UMCA 1U81A 2ZI6A 2P3LA 4LOLA 4MW0A 1N6LA 3O3OB 4M6WA 3A2NA 2SBTA 4DXDA 5JADA 3INTA 2JJ8A 2YWFA 3SOPA 2JVKA 4J7CA 2QRHA 2CYCA 2NTYC 3OX1A 4LNUA 4B3IA 1I2MA 3C43A 1Y1RA 1PW7A 4LJ8A 1FDOA 1LPMA 1QV9A 3V1YA 3PHHA 5GZ1A 3QXHA 3MCTA 4GOLD 4PZZA 3IESA 4IAOA 1K4KA 4NMXB 4E5KA 1IOWA 1FLNA 2QJWA 3M4NA 4G81A 4PTYA 4Q6WA 4QGGA 4DLLA 2C7OA 4YPVA 4O2AF 4Q00A 1GUYA 4B34A 2ERXA 3PPXA 1GZ6A 4YECA 4A15A 2ZYDA 3KX2A 2YRWA 3IQWA 1RQXA 3HH8A 3T3PB 3SQMA 1Q11A 1B6RA 2YXEA 3ZDRA 3LTEA 4EUSA 1B7GO 2Y92A 5HDQA 4BV8A 3RT1A 4ZVSA 1J5EB 2QD3A 3AVWA 3H5AA 1XTRA 4L1KA 2ZT7A 2EG9A 1CLUA 4Y8VA 3PLRA 2ZIFA 1MJHA 2P8SA 2WTAA 4QAJA 4QU8A 5CD1A 5ALUA 3SC2B 4BB0A 4CEJB 2APJA 2GEVA 3AR4A 2CUNA 3ZDFA 4L4XA 2IEAA 3QV2A 4IIJB 3T5DA 1XTJA 2GN1A 2A5LA 4C89A 2HWWA 1QZ3A 5JCPA 1T4MA 3C45A 1E59A 3ZJ5A 1LCIA 2CE7A 2IYRA 4EKNB 2DFLA 3M6XA 1GZ7A 1P0IA 5DN6D 3EH2A 3GJSA 2BEKA 3H13A 3KDSE 3E84A 1NVMB 3M5DA 1EQAA 4BQRA 3PA6A 3TYXA 1Q0SA 2HMWA 3RARA 5FLXA 1RAIA 5IF9A 1V11A 2ZSKA 4CLOA 2ZJ4A 3BULA 1Y7LA 4QJ4A 5IN4A 1QPBA 3PF9A 1F4PA 2Z2YA 4EUFA 5CX1B 2FVXA 1XZAA 3CRZA 1CZHA 2W98A 4ND4A 4Y2TA 5BSEA 4EHIA 3OQHA 2AE2A 1L4MA 1JQ3A 1RVDA 2HTFA 2ZSUA 2GUWA 2N1MA 1P91A 3DF9A 3NZEA 2MMGA 5EQTA 1DRWA 1ZNQO 5H7XA 4UBIA 2IUEA 3IOCA 3L04A 5C5CA 3N0VA 1FMLA 3AGQA 4QASA 3VUFA 6GPBA 5C52B 2NV6A 3QVSA 2O8EA 2BCEA 1JKJB 4MGZR 4FNOA 1T9HA 1W1IA 5E8JA 1WWKA 5C35A 1TXGA 2W93A 4AMYA 3ZE6A 1Z7BA 1NLFA 2I6GA 1VLHA 2B5WA 1YJBA 1HDZA 4LSMA 4YBZA 2ACEA 3KXIA 2WKQA 1QNFA 5CEFA 2CXRA 2SKEA 3D6HA 4XYMA 3NAGA 4LHEA 1Q2UA 3IUBA 4LDQA 1DEKA 4NV1A 1SK9A 4DUGD 4W9MC 2H4XA 2W11A 3OCUA 4RJKA 2OP0A 3TJZA 1IMOA 3KXPA 1GKKA 4OSPA 3C8DA 2OXTA 3P52A 4PSUA 1EKXA 1DUIA 1L4GA 1LBSA 4GPBA 4NOLA 2BFFA 1KF0A 3JQBC 1J24A 3MRTA 5I9TA 5BN5B 1DL5A 3MWEA 3W9YA 1YCHA 2V59A 1TVCA 3NTXA 1U4SA 1XGKA 4HDRB 4DYHA 5E1BA 3NHMA 2VPXA 2CYBA 2ZQZA 3GDHA 3I6IA 4BLRA 1G9SA 2D3TA 4FBMA 5BNWA 5CCEA 5LQNA 2C2OA 1HORA 3FFBA 1GDTA 1M7GA 1VE6A 4Q4HB 4OSEA 5GWXA 2RJOA 1Y1SA 3ASZA 3VYTB 3DXZA 1JG6A 3L41A 1E2GA 3OE1A 3GFRA 4EELA 4JCCA 5CXQA 4JAVC 4IIGA 4ZPJA 2VT7A 2B5VA 3W3AA 6ADHA 1CUCA 1YZUA 1Z15A 2EP8A 1BU8A 4KLRA 4YC7A 3WNBA 4EEKA 3NRJA 1DGQA 2GYUA 1Z17A 1Q83A 2QG4A 2W6QA 2YOFA 1DEAA 1RJ9A 1R00A 2WJZB 3I1FA 1KH3A 2ATEA 3H8JA 4M1QA 3NIFB 5JO9A 1Z4PX 3EXG2 5D7NA 1SVMA 5HK8A 3WE7A 3JASB 4HAXA 3QVWA 1Q0HA 3OEED 5TMDA 5DGDA 4CG3A 2RJ3A 4CTKA 2O8CA 3JRWA 1AZSC 4JLJA 2VP6A 2YHIA 1E1QD 4ZO8A 3E2PA 1D6SA 1I0ZA 2QMEA 2MINA 3STVA 3TRHA 1HFWA 1C0IA 3AP2A 1UT5A 2EGGA 3L84A 4GRAA 4P7GA 4U00A 1L7NA 2AE1A 2BFDA 3OY7A 3NORA 1RHMA 5K8LA 1BG6A 7MDHA 1ES9A 4X1IA 1ZR2A 3OKPA 1M9NA 1PR1A 2PA3A 4L08A 2P1ZA 1KL7A 3G0BA 2P27A 8ATCA 2C9ZA 3C7AA 1AV6A 3A2MA 2FZWA 4UM9B 3BMCB 2Z5GA 4R2HA 3LT5A 3OE7A 1KDOA 1JLLA 5FWXB 4TKZA 4Y7DA 5EUCA 4NJEB 3TO5A 2QAGB 3N0WA 1EFVB 1M2OB 3MXOA 4PS1A 4D26A 1IY0A 4GIBA 2HPZA 1P72A 4KAFA 4DG8A 3CGWA 3CH7A 3G2NA 3I9MA 3OX3A 5FBWB 3RR2A 4ZI3A 2AX3A 2A0YA 1QMPA 2DHEA 2QP4A 2WYOA 5EY5B 3RSQA 1VJTA 3HHPA 1D1TA 5HRAA 4QGSA 2H65A 1YRLA 4OOEA 3S2GA 2Y1KA 1A5TA 1H5QA 3K15A 5DYYA 4NEGA 1WXEA 2JH8A 2P3QA 2YJ3A 4AQYB 1YIDA 1EWVA 3AHFA 3F78A 2WY2D 3O74A 4BGUA 1XTQA 4BNIA 1GOTA 1IBSA 2E4AA 3ESZA 3MGKA 3ANLA 4UDYX 2W6JD 3RH0A 3QPAA 1V5FA 2FJPA 2BCGY 3BK2A 4Q01A 3HN7A 5CGQB 3UB4A 4E33A 1AVTA 5HRUA 1OU0A 1UPAA 5K03A 4EGSA 3RHFA 3AJ9A 4OHZA 3NIDB 3WYAA 3W5AA 1S2LA 1Y42X 2ZM5A 5SZKB 1J97A 1PWHA 2VWHA 3TK1A 4MAFA 3K53A 1G8AA 2ODNA 4TLEA 5FTNA 3VUEA 4JHLA 2X40A 3AUTA 1KSFX 2WU1A 4LJSA 5IHXA 3KM0A 2FE1A 2IXFA 4QUHA 2VLIA 1ULUA 1DIBA 1MUUA 4CLDA 5EGNA 1UZLA 4BFCA 1SA0B 3WGKA 1UZUA 1K5PA 3CUUA 4OP3A 3BN3A 3UOAB 1G5HA 5E6SA 4IKOA 5DGCA 2X5KO 1UQUA 3FOAA 3FVWA 4BKUA 4DMGA 4XASA 4V1CB 4C06A 3DEKA 3LK7A 2PL3A 4LJ9A 3IB6A 3S55A 1EGQA 4DLKA 4EJMA 5CBPB 2Z30A 4NMLA 2WE8A 3S7ZA 2OCBA 3H8SA 1POXA 4YFVA 3WGNA 4TX1A 5LJLA 2GRUA 1MIOA 5ALGA 2JBAB 2VZLA 1WCWA 4GDMA 1EVYA 5DHPA 3WWZA 1VZ3A 1BRTA 1NF9A 2MSDB 3FMPB 5JXHA 3E82A 2TMGA 4H0CA 2C3MA 3Q88A 1TX4B 1UFQA 4FJ2A 4M1ZA 1SUIA 4ZN6A 3EA4A 3IB3A 3QTLA 3ZX4A 2A92A 1YA8A 2VHYA 4PCUA 1S8FA 4FXOA 4Z1MA 5MFZA 5EOVA 1Y9AA 2JIPA 5AR1A 5FBHA 3ENNA 3BOSA 1OXTA 3KQSA 1GNTA 3K3PA 3Q98A 2YJZA 3HCWA 2Y67A 3ISTA 4ALMA 3I5UA 1BD3A 2J85A 3KLPX 4BX8A 3B1KA 5CCDA 1ST3A 1BMFD 1GXSA 4P53A 2H4YA 5EE5B 2BM1A 1Q1NA 2O23A 5KHOC 2OM6A 1HL7A 3Q9LA 1U63A 1TZJA 4KLZA 5IEJA 2J0QA 4I1YA 5HIIA 3I04M 3LG2A 1TK3A 3BMQB 4HPWA 1MJGA 4JLUA 2WFMA 1FJ2A 2XSZD 1PJSA 2GHTA 2Z95A 3ZHCA 3T0FA 4F1JA 2ZCUA 2FZGA 2AQKA 1W2GA 3CT6A 4NEHB 4I19A 5L51A 3TD9A 1UXHA 4KAJA 5DKFA 3OTHA 1CRPA 1HSZA 2P40A 3OZBA 3ZK9A 2MYTA 1KP9A 5CDYA 2B99A 5T6BA 1TYEB 4OGGA 3O8QB 4B6PA 1Z8DA 4KMOA 1WCIB 1P77A 3F49S 3FF4A 3PK0A 4S35A 3WRXA 2IPAB 4I1SA 3KV1A 3PPYA 1OYVA 4E5SA 2I2FA 1MRSA 2O0JA 4I4TA 4TTQA 2JFFA 5H4GA 3U09A 1C0LA 3EZ6A 4JMPA 5JNRA 1UJBA 2PQ2A 3O92A 1NT4A 4BIMA 4Q03A 2R8ZA 3FPKA 4GP6A 1Y3AA 2WINI 2XBUA 3BVPA 2JD0A 1PZNA 3BSFA 4CIVA 2BGGA 2D2VA 4F4IA 4F4CA 3LY8A 1PFKA 1Q0LA 3UPUA 4EUKA 2ZWOA 2XUKA 4IH9A 5FL7D 4R01A 2QMQA 3WL5A 1LLCA 2WWXA 4IZ6A 1OZGA 4R1UA 1C9JA 1CDEA 4QRHA 1MDFA 4XDHA 4P4TA 3VTFA 4ESEA 1V8OA 1Z0ZA 2P2CA 2VWPA 3R5HA 2H3EA 3NIWA 4HDNA 1YCGA 3TQFA 4ZI7A 2W0MA 4CCSA 1GGJA 1AQUA 4H59A 3IR5A 4ZYVA 1YB6A 2X58A 4IKEA 1SHZA 4DMUB 2BFEB 1UANA 1ZUD1 5K0ZA 3K09A 4ZTZB 1M76A 4HH0A 1Y1QA 2Y2VA 3R3UA 4WZ6A 3JQEA 4IIJF 4M3NA 2W70A 3VJMA 2QVXX 2X1VA 2PPLA 1HYBA 2VYFA 4HGRA 4R4JA 4UUOA 4E5VA 1XJ5A 3D0KA 4UM9D 5T3UA 3WGZA 4CWAA 4S2EA 3QBDA 3RTBA 3HCOA 4TV9A 2P4SA 3PDUA 3I4LA 1I6LA 1P19A 4G9EA 4MJ7A 2PWYA 1QCCA 4J03A 3NV7A 5JQWA 1U5BB 1J90A 3I9OA 3SZRA 3I64A 2ONKA 1COZA 2JFUA 4GQBA 3LXXA 4TL6A 1YQEA 5K3FB 2FUG1 2NP6A 2ROQA 1CZRA 1HH4A 4YJDA 4DBVO 2GO1A 4H16A 1PG2A 4DNXA 3ELDA 1JEAA 1E0SA 1QFJA 1ZJ5A 2C2YA 4I6GA 4QDZA 3R24A 2NO4A 2OV8A 2WYWA 5CW1A 2LW7A 2OHIA 3AHIA 4Y0AA 3KXDA 4C7VA 1PGNA 1T5SA 4CL8A 5J47A 1QZZA 1ENPA 3DHEA 2ATCA 3F46A 2E37A 5E1DA 5JZBA 4XLTA 4EY3A 2FQQA 4C5CA 1CNEA 2JGAA 2GA8A 2IHJA 2YS7A 3GW8A 3L8FA 3TZQA 1O03A 1IDN1 3EEBA 3VTAA 3R7BA 3X1ZA 3ED5A 3NANA 3I01A 3OO0A 4OGFA 2FV8A 3QV1A 5EUMA 3SDZA 10MHA 4BN0A 3K4QA 1GM5A 5HK9A 1UUFA 1Y98A 1XMIA 2BFOA 3ACDA 3WGGA 2E6UX 1KE1A 2BGUA 1JWLA 2J46A 1Z08A 1MXFA 1WPXA 3P45A 1TLLA 1KMNA 2PMDA 2XLBA 3AXSA 1XQXA 2B3DA 5DVZA 4QELA 4KUHA 3L79A 3X2EA 2R1VB 1MEJA 2SECE 4DJ5X 2ONCA 4QPNA 4RIIA 1YUNA 3LP6A 2OCIA 5C4GB 1KRHA 2H1LA 4MR7B 1X7ZA 2ZPAA 3UGQA 2X1MA 2JIZA 3CM0A 4RX1A 2C8KA 1XRPA 5F7OA 4OBBA 2JF0A 2B9EA 2NUTA 2JFXA 4MB6A 2FN9A 2D1YA 2VP3A 3OKFA 2IODA 3ZY6A 2X14A 3N75A 3F7TA 4KPUB 4YJGB 3VPBA 2HPAA 3TIVA 4R6XA 3STTA 4EB0A 3BGWA 4P08A 1VJ0A 1UBMS 3LC2O 4C08A 3UANA 2O05A 2OGZA 3M49A 4RLQA 1FFHA 5CXUA 3WYDA 1PUIA 1AK2A 5D8DA 1C1YA 4HEHA 2BHTA 3M6AA 5JDCC 3EGDB 1RAEA 2PMCA 1RPTA 4R2JA 3TUZC 4ZT6A 1VCHA 3UA3A 1GZUA 1H2EA 3A3KA 5IJ0B 2YCBA 2HA5A 5EWJB 5HTKA 2Z6QA 5IPFA 2CZQA 1M3SA 2WAOA 3T5TA 3GA5A 3HACA 4IIHA 1M34E 3L8MA 3SXJA 1YJAA 2BM0A 1FTWA 3JQFC 3KVNA 1G60A 4IQ4A 3L7LA 4BQPA 3LYAA 1DARA 2JKVA 4DV5B 4LY6A 1OZHA 3CH4B 4IHJF 3DMNA 1PW5A 3MWEB 4V0NA 4G2NA 4XOIA 1RYDA 2AHRA 4U9UA 4WXPA 1I7SB 3BWDD 3X44A 5HKBA 3R2JA 3EBPA 3VU3A 3UGKA 3WL7A 3QOWA 2FWIA 2BGJA 4IZHA 5EJ6A 1CEYA 3ABZA 2HDWA 4Q4HA 3C1OA 4PNZA 3DBOB 3V8EA 2ETVA 1ZD1A 2F2TA 2YMMA 2ZJ1A 2A67A 1N7JA 5DBOA 3X1XA 4C2TA 2VPTA 5G0WA 3PC8A 2FX3A 5CW2A 4AY6A 1X8LA 1T8UA 3LUHA 3ZTYA 1Y7PA 5E9WA 2C4UA 5G1OA 4KOAA 1ZEMA 1U8UA 3EDRA 3LGAA 3PFWO 1NE2A 4I6JA 4MVCA 3PGLA 4D96A 1YZTA 2EKPA 1Y5IA 5ADVA 4I8IA 3SBOA 4Y2GA 1LS1A 5JC8A 1HLPA 1JDBB 1RJ9B 1DRKA 2IP4A 2W2TA 5HM8A 1GT6A 2YTZA 4MR8A 2R6FA 4QQNA 1UP7A 2GFHA 3QNUA 2QRZA 4WXHA 1UWLA 2BLLA 3KK0A 4X44A 9LDTA 1ZH4A 1KOGA 1SKYE 2FSIA 2UV8A 3DMRA 5CYOA 2HYIC 1I36A 4Z4QA 4JXZA 1SCQA 3GFGA 3EY4A 3OKAA 3N6VA 1K6EA 3B5EA 5J43A 3MT9A 1HKHA 2AZ4A 1UDWA 4RFVA 2YQ5A 3G8BA 1U8AA 5B5SA 2PUTA 3ADKA 5ED0A 4CF5A 1F38A 2O1SA 3A05A 3GY0A 2OZVA 3TR6A 4TGLA 1YQWA 4BP9A 1YS7A 4ITRC 4DDTA 4BFSA 1W85B 2C0PA 1RU3A 2PBLA 5AI0A 1Q0ZA 3KT8A 3QUQA 4FDLA 1CR0A 2WUEA 3UCFA 2Q1XA 3HYTA 1N6KA 4GT1A 1FTNA 2QWXA 2BCJQ 4H18A 5DB4A 3ZJ4A 2I7CA 4BXOA 5ALLA 2XBMA 3FFWA 4GE3A 3L8CA 1U6KA 1QS0B 3SCZA 1GA1A 1OE0A 2BPOA 1JG3A 3CWCA 2AN9A 1WEHA 2C5AA 2EP7A 3HBLA 2YOGA 5E7MA 2L42A 4YREA 4AKEA 2CNDA 3VKHA 3KPJA 2QZZA 3NX4A 3OZDA 2B1IA 4XZ3A 2JFYA 1F3LA 4FZ3A 2FDCA 4DJEC 3BMNB 1D9XA 1GPWB 4U9HS 3W1VA 4D4KA 3KZKA 1K89A 3BQ9A 4ZT4A 4CQMA 1WCXA 3EVTA 2B35A 1OJLA 5BNFA 1OLXB 3E81A 4HSEA 4GZLA 1ZM3A 2VN8A 2ZP1A 1F4VA 2HADA 3T1NA 2PQ6A 3AEZA 4M88A 4NYJR 2XUZA 1AV7A 3OD5A 3NP7A 4ILKA 3W9UA 2LP4Y 4S1OA 3E23A 3UH1A 1L1QA 5ICFA 2NYUA 3NHBA 1O96A 3RKRA 5EESA 1M67A 2GWRA 4Z3KA 4KPEC 4D57A 2ZCJA 1ODKA 1MAAA 4WH0A 1XF9A 2QE7D 2DQ4A 4LYHA 4BAGA 4BZPA 2VK2A 1O9BA 3WDLA 4KR0A 3QWHA 3VR6D 1W34A 2I71A 4ES6A 3ZYCA 3E6AA 4P5EA 4YMUA 4MUXA 3L8ZA 3YASA 4NU8X 1CR1A 2H1CA 1W46A 2BR3A 5LOVA 1ZRMA 3WDKA 2YJNA 2PVSA 4UTRA 1KXZA 5INTA 1RWMA 1OPRA 1PL6A 2E5LB 2H5LA 4I81A 3P9IA 3N3AC 3WGYA 4DCUA 1KA9H 2O8BA 3VKFA 3A1WA