4CIBA

Crystal structure of cathepsin a, complexed with compound 2
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
454
structure length
413
Chain Sequence
RAPDQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LYSOSOMAL PROTECTIVE PROTEIN
publication title Crystal structure of cathepsin A, a novel target for the treatment of cardiovascular diseases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 150
structure length 413
sequence length 454
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 2013-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cibA00
2WM2A 1ZIXA 5CTAA 1H2WA 1VZ2A 4QE3A 5T4EA 2PSDA 2XUFA 4K6GA 1MN6A 1R3DA 5AM4A 2OGZA 3FYUB 1Y7HA 1U8EA 4FLFA 2QR5A 5D7BA 1UOQA 1XQVA 2CKMA 4BTVA 5ESRA 3IIIA 4J7AA 5AKIA 4BC1A 4C4XA 4H0CA 2ZVDA 5ALOA 4P9NA 5A7HA 4DLNA 1AX9A 1QIGA 3D5EA 4QA9A 1U2EA 5K3DA 2IIVA 3ZLUA 2WHQA 5AKXA 2HFKA 4L9AA 5CBKA 1GT6A 2QUAA 4Y7DA 3FLAA 2QKYA 1CUAA 4OSEA 3BDVA 4KAJA 1CUBA 3EBLA 5ALKA 4Y2VA 1EI9A 4UBLA 5JAPA 3FNBA 4PNZA 3G02A 3I6ZA 2EDCA 2OCKA 3R3YA 1UK6A 1WOMA 2B4KA 3I2JA 1XZEA 3W05A 4FNGA 3LS2A 3A2NA 3DJYA 3QPCA 4UBJA 5D6OA 2AJBA 1ZI8A 2X76A 2K2QB 4OD0A 1CVLA 5LKAA 5JD5A 5ALJA 1TCBA 3R3VA 4W9RA 4QDOA 3C5WP 1ORWA 4I19A 3ZWQA 1MX5A 5ISMA 3B12A 2W22A 4X94A 2OAEA 3WYNA 5FKJA 1BEEA 3MUNA 1XRPA 4WY8A 5IVDA 2XMRA 4X85A 4UPDA 2V96A 2VEOA 2WG2A 2RAUA 4Y2UA 5AKHA 3CCCA 5EHXA 4FBLA 3RLIA 2BGRA 2ACEA 2JGIA 1XZKA 1CV2A 3STWA 1XKLA 5DYYA 2WUFA 4HS9A 5ALVA 4EUSA 4G4GA 4ZXFA 2PSFA 4DYHA 3L1HA 4FWBA 2QZPA 1CIJA 2XLBA 5CT4A 1JFRA 2DQYA 5I9IA 1AURA 4FDMA 4JEIA 2V98A 3F97A 1CPYA 3FYTA 3D59A 1W6RA 2IITA 3HXKA 2ZSIA 2C0QA 4BZZA 3IVMA 5ALXA 3H2GA 4DNOA 1Q84A 1BCRA 3B3QA 4CG2A 4Z49A 3YASA 2UZ0A 4XX1A 1HKHA 4RE6A 3KWFA 4HXGA 4UBIA 1XZDA 5AKLA 1EB9A 4DNPA 3G0BA 5D3ZA 3PF9A 5LIPA 4OB6A 5HKAA 3K6KA 1UK9A 4JYPA 4BAUA 3I6YA 4HAIA 3ZV7A 1MX9A 4MQLA 4HXEB 4W1PA 1LPMA 1H2ZA 2RIPA 4DMCA 1GPLA 5DWDA 4M0FA 3HYSA 2XQIA 2H7YA 5C81A 5KWIA 4HVTA 2ZJ6A 3BE8A 5EIHA 1P0QA 3KDAA 4LIPD 2OLEA 3JYHA 2CUTA 3ANTA 1CRLA 4B83A 1DQZA 4KRYA 1DT5A 3T52A 3IBTA 3DS8A 2O2IA 4LXGA 5JASA 5JZ9A 4GECA 4B7ZA 3MGAA 1VXRA 3QPDA 1P0MA 1B6GA 1W76A 3Q8WA 4QZVA 4MQMA 3M82A 4GXNA 3DL7A 5ALMA 1C7JA 5HK8A 3EQ8A 2AJLI 3F67A 4ZREA 1UFOA 5HF8A 3HABA 1MAHA 1QGED 2XLCA 3GZJA 2H9YA 5CT9A 3DDUA 3V1LA 3A70A 3BIXA 1K6EA 4CG3A 4W63A 3WK9A 1BROA 1JJIA 5CT6A 3FLBA 1CR6A 2QM0A 2HRQA 5AICA 1VE6A 1QTRA 5JALA 4TPKA 5DNUA 4BBZA 4DNFA 5HFAA 3N2ZB 1MX1A 4AZ0A 3V1KA 5AIBA 2GYVA 3D2BA 4KYVA 1YSCA 1XZCA 1AGYA 4I4CA 3NUZA 2XT0A 3AZOA 1I6WA 1YS1X 3R3WA 2XUIA 1J2EA 4KE6A 3IUJA 1A8QA 1USWA 3C8DA 5AP9A 3S2ZA 3FOBA 4JNCA 2RGUA 1W75A 1AUOA 4ITVA 2XUHA 5FXMA 4DGQA 1IUOA 3E4DA 3AINA 1XRRA 1YASA 5CT8A 4HZGA 5BV7A 4W1SA 4ZGBA 3PFCA 3FCXA 4H35A 1THGA 1FFAA 3WYDA 3BXPA 1JJFA 1ZJ4A 3G0DA 4CIAA 1QZ3A 2PSJA 3I2HA 5AKJA 1AQLA 2JF0A 5D3KA 5JANA 3H1AA 5T4FA 2HA5A 2Q0XA 1MU0A 3OOSA 3O4GA 4RNCA 4B84A 2O2HA 1U4NA 3O4IA 1XQYA 2PBLA 2PVSA 3D7RA 1LNSA 4BCCA 1VA4A 5SYNA 4I3FA 2VSQA 3W06A 1CFJA 4B80A 4U2CA 4FKBA 3V9AA 2W6CX 1O6GA 3S8YA 3G9TA 3O4JA 2WG0A 4X71A 4MWTA 2FJPA 2PUHA 3G0IA 1BN6A 1LPNA 2WLSA 4FOLA 2QUBA 2HU8A 3IDAA 4YPVA 2VTVA 3D2AA 1XQWA 4EBBA 2BUBA 2CBGA 3GROA 2WIDA 3F8SA 5AM5A 4H7HA 3QYJA 1EDBA 4J0KA 2H7XA 4DSAA 1JU3A 1DWQA 1E66A 3R3XA 2LIPA 1UT6A 4J03A 3D2CA 1GQRA 3R41A 1GGVA 4A5SA 4U2EA 1XFDA 3PI6A 4V2IA 2C5FA 3WK4A 2G63A 1FFCA 3VKFA 1T4MA 5JAHA 2ECFA 5CH3A 5A7GA 5E4TA 4OYYA 2XQGA 3IUQA 3I2KA 1CUVA 4E15A 4Q82A 5EIAA 3DL4A 4RGYA 1TRHA 4BATA 1P0IA 1XZJA 2GZSA 3RARA 3WKAA 2RONA 1H2YA 3DD5A 3HC7A 4UBMA 4PSCA 1ZI9A 1L7RA 3QZUA 5JZBA 3P2MA 1QIFA 5AK5A 5JD4A 4B6GA 4FBMA 1LBTA 5YASA 4ZWNA 4BE9A 4ZV7A 1IZ8A 2OQIA 1FSSA 1TKRA 3JWEA 5CMLA 4UFPA 5JD6A 4X7BA 4GHWA 4H7IA 3I6MA 1JT2A 3IULA 2BCEA 2Y2VA 3BF8A 3DYIA 4DSZA 3WQHA 1EK2A 1E8MA 1RYYA 1UKAA 1E5TA 5I7UA 2B9VA 3WWEA 1UKBA 1SCQA 4ZI5A 1CUEA 3WI7A 4HXFB 5FOQA 3ZLTA 4U2DA 4CCYA 3FWHA 3QBJA 5FV4A 2RHTA 5FPQA 2Z3WA 1IUPA 3SX4A 1NU6A 3A2MA 3W04A 5HQ3B 1X70A 4O08A 1CUYA 4HTAA 1H22A 4AXBA 3WA6A 2BAGA 3W9BA 1ZD2P 2Z5GA 5AO9A 2FUKA 3WZLA 2WTNA 5AM1A 2Y1KA 1PV1A 1GQSA 3FAKA 3WK8A 4F60A 2YXPX 4EY8A 3IURA 4IH4A 1MNQA 2AJDA 1L7QA 3QH4A 4ETWA 1ZOIA 1A88A 2PU5A 2WJ6A 5T4HA 1CUSA 2C58A 4IO0A 1YA4A 1AZWA 3G8YA 5CW2A 1W52X 1ZGBA 2XI4A 4BDSA 3DEAA 2ZJ7A 4PQEA 4Y9SA 3WWOA 5C7YA 4LXIA 5ALEA 3LCRA 4U2BA 3M3DA 4EA6A 1TAHA 2E3JA 1QIIA 5ALZA 3O9MA 1FFEA 4U2FA 2GBFA 5EIEA 1CUFA 5AM0A 1XRLA 1ETHA 1TQHA 5HQ3A 4ZRDA 3DOIA 4NZZA 5K3FB 4EB0A 4BP8A 2ROQA 2VAXA 5LZ5A 1DQYA 5AKZA 5C8XA 1K5PA 1MNAA 1ZGCA 1HLGA 3NOXA 4K6HA 1IZ7A 2I3ZA 3R0VA 5JAOA 3U0VA 2PM8A 2DQZA 3QM1A 3FYUA 1R4ZA 2QTBA 1XZMA 3ZLVA 3FSGD 3H17A 1QO9A 1LPOA 4N8SA 4U2GA 2WJ3A 4J0JA 3CN7A 5DYWA 2BJHA 1BE0A 2R8BA 1CUXA 4J0IA 1Z68A 5AK3A 5ALDA 3BIWA 2O7VA 3AIKA 3B5EA 4F5ZA 4FNMA 1GXSA 3AFIA 4X91A 1EK1A 3WLAA 1CUCA 4GW3A 4BCDA 5IVIA 1WB5A 1P0PA 3ANSA 3W9UA 2XQJA 4Q3KA 4CCWA 3E3AA 3AZQA 1PJAA 1QIJA 1JU4A 4NS4A 3WK6A 2XQFA 1THTA 2BGNA 1RWQA 1SC9A 2HL6A 5H3HA 5K3FA 4BB0A 4ROTA 1K8QA 1ZD3A 4B85A 2QJRA 2WQZA 1X2BA 3L1IA 4XWGA 1EDDA 2AJCA 3MVEA 4D9JA 1QJ4A 4G8BA 4EY6A 3OC0A 2B61A 1VE7A 5CT5A 2PSHA 4G8CA 5DNVA 3O0DA 1G5FA 4BZWA 2WILA 1BCSA 5AI5A 1MPXA 1HBJA 5LZ4A 5HF9A 4MXDA 3BF7A 2DCMA 1O6FA 5EHQA 5JIBA 5SYMA 3PE6A 2FX5A 4W1RA 5LP1A 4DTCA 4B0OA 1CLEA 3K9BA 4BTLA 3ESAA 3WIOA 2WG1A 5ALHA 4LYDA 1X2EA 1TCCA 1YAHA 5E4JA 3IB3A 4AQDA 2Z3ZA 3I2FA 3VJLA 4CIBA 2PSEA 2NW6A 4AMZA 2ZSHA 2HA6A 5K3EA 5AKGA 5HKBA 2WU3A 4L72A 4FHZA 1EXWA 1VJ5A 4WFKA 1CUHA 1LZKA 1N5MA 3HJUA 1E8NA 3H2HA 3WJ2A 3QITA 2HRRA 5AKYA 5BOVA 3G9UA 3E0XA 1KU6A 2XUJA 2QS9A 1FFBA 1R9MA 4FLEA 4BE4A 4DMKA 1CQWA 2HA0A 2YH2A 5CURA 4KEAA 2QXTA 4KR0A 2EEPA 2ORYA 1OXMA 1ORVA 3HEAA 1N8SA 4PW0A 3WA7A 4FFVA 4UHEA 1XZHA 4GEGA 2C5GA 3HRHA 2AXEA 1BRTA 3D3NA 1A8UA 1ZD5A 4IHAA 1QIHA 5AOAA 4KE8A 1GPNA 2DHCA 2OGTA 4F21A 2ES4A 4DMFA 5AOBA 1RP1A 5FDFA 3EQ9A 4UFOA 3DNMA 3C6ZA 2VAVA 3H18A 2HM7A 1LGYA 2HHAA 3D4LA 5C8ZA 4H7FA 2YASA 2QJWA 5HF5A 1U65A 1UXOA 3C70A 5T4BA 4QWWA 2Z8ZA 1T2NA 2OAGA 2Z8XA 3G9ZA 4K5QA 1XLVA 4N5IX 5AKEA 4X6XA 4X6YA 1MO2A 1A7UA 1QIKA 3C43A 3DKKA 4AO6A 4K2AA 4P08A 1E8DA 2GBGA 2XMZA 1BU8A 2WIKA 4EY7A 1LBSA 2VJCA 1IUNA 4LKOA 4OUKX 4G9GA 3VVMA 2WHRA 1C4XA 1OCEA 5FP0A 1QFMA 4P93A 1DWPA 2XMBA 1FFDA 2WUDA 2ZYHA 4H77A 4Q3OA 3NGMA 2WJ4A 1XZIA 3VVLA 2VQ6A 2P8SA 4KJXA 5AOCA 4QEKA 3E1GA 4WDRA 1WB6A 2QVBA 1R88A 5AHXA 3ILSA 3V48A 2DR0A 3PDCA 2HU5A 1XKTA 1KU0A 3R3UA 2VJDA 5DLPA 4OU5A 3KWJA 4K6KA 2WU4A 3WIBA 4RE5A 1QIEA 4PSDA 4X6UA 4GBGA 5LZ2A 2X8BA 6YASA 1BN7A 3ESBA 1F8UA 4FFWA 4KACA 4NVRA 4G5XA 1VA5A 1F6WA 1W4LA 3VDXA 5ALNA 1H2XA 2WFMA 2FJ0A 1D07A 2WFLB 3CCBA 4UBOA 3HZOA 3RKSA 2XMCA 4CI9A 5K5EA 3H0CA 5EI5A 4BRSA 3FVRA 3R40A 3HACA 4OB8A 3H04A 1QFSA 4UHDA 3FBWA 4BC0A 5EGNA 2XE4A 5LZ8A 3H2JA 2AJ8A 1UZAA 3VJMA 2Y2UA 2XQKA 1KEZA 4QLOA 1IVYA 4AX4A 2CZQA 1EX9A 4UBKA 3NWOA 1LPSA 1MTZA 3ED1A 3QMMA 1LPBB 4L0CA 5DTJA 2JGMA 1CEXA 1FJ2A 3T4UA 2HA7A 1UK7A 5IKXA 2JIDA 1XRMA 1EB8A 1JI3A 5JYCA 4MYSA 2WUGA 3H19A 3STYA 3I2IA 3ZI7A 2JEZA 3BJRA 3I28A 3GUUA 4LYEA 3CXUA 5AI4A 3OM8A 3STXA 4JYMA 4UHFA 1QOZA 3AUKA 4LXHA 1SFRA 2RI6A 2HA2A 5LLSA 5DNWA 3WWDA 4G4JA 4WFJA 2QXUA 4IH1A 5BWCA 2OXEA 2BKLA 3STVA 5ALTA 1XQXA 3K2IA 3KD2A 1WCYA 5ALWA 2XUOA 1CUZA 1QE3A 1A8SA 3STUA 1QTIA 4Y2YA 1JMYA 4X90A 4CFSA 2HFJA 3GA7A 1AC5A 4WY5A 1XLUA 1Q83A 1VOTA 5A2GA 1YCDA 3D0KA 1HL7A 2JGKA 2ONCA 4KE7A 1UOOA 7YASA 3FCYA 4Q1VA 2PX6A 1TK3A 1H23A 5LKRA 4Q05A 3F96A 2WHPB 4E14A 4G4IA 2R11A 4QNNA 3PFBA 4FMPA 4UHCA 3G0CA 2GBCA 4PF1A 2ZYSA 1TIBA 1NX9A 4A23A 1YA8A 3X3HA 4DIUA 5A71A 2J3QA 2PU7A 1EVEA 2JBWA 5FPPA 4G1FA 2X5XA 3OG9A 4UUQA 5AIAA 2C7BA 5AI0A 4IQ4A 1VLQA 4W1QA 5EHNA 4BYMA 1VZ3A 3PF8A 1DX6A 2EDAA 2RHWA 5F4ZA 5FLKA 1XZFA 3AIMA 1QIMA 4KAFA 2G5TA 4PV7A 1YS2X 2HA3A 5ALQA 5AK6A 2JGEA 2HDWA 4BDTA 1BS9A 4DM7A 4TVKA 2J4FA 1VXOA 2O2GA 1ISPA 5HK9A 3V1NA 1B41A 3F98A 3UUFA 3HI4A 2QT9A 2DHDA 3QMWA 3C6XA 4YK7A 4UHBA 3QMVA 4BP9A 2XMGA 3ICVA 3PICA 2WHPA 1XZBA 3QVMA 5E2IA 3MUOA 2B20A 1YB6A 1ZICA 1M33A 3WL7A 2IX9A 1E3QA 2JGFA 2OCIA 5KWJA 2CEKA 3WMRA 4GDMA 2BUAA 1K4YA 4Y2RA 3WL6A 4MEAA 1DWOA 3O4HA 1NU8A 1HDEA 2J4CA 5FRDA 4X3CA 3V1MA 4J0GA 4QDXA 2ZYIA 1HQDA 3TJMA 1LLFA 3O95A 3I1YA 1XLWA 1XZGA 5DJ5A 1G42A 3EQ7A 3UMJA 4QDZA 5DTIA 4Q3LA 2XUQA 2WKWA 4JH0A 5LZ7A 4MWSA 3LP5A 1ZD4A 4OCZA 1AMNA 3GFFA 3C6BA 1WB4A 3BL8A 2OQVA 3C6YA 4EY4A 5AI8A 3A2LA 3RM3A 4MEBA 1E89A 2XB6A 2HA4A 4ZV9A 3A6ZA 3OPMA 4GLBA 3G0GA 3WZMA 1UKCA 3N0TA 4J0CA 4BVJA 2VT7A 2XDWA 5I8PA 5IVKA 5HF6A 4PO3X 1GZ7A 3R3ZA 4QDUA 4PSUA 1YR2A 1QONA 1R50A 3IA2A 1WHTA 3WWCA 4BAZA 3HLKA 3BDIA 2D0DA 1WPRA 3DOHA 1WM1A 2CMFA 1XROA 4YASA 4C4YA 2PPLA 4Q34A 4BCBA 1QLWA 4RPCA 1JMKC 4H7EA 5KBYA 4QDTA 1EHYA 4AB1A 1C7IA 4JUIA 3PUIA 1G4HA 3FLEA 4OPMA 4QWMA 5EHZA 1QIDA 1OILA 2XMQA 5JARA 4C87A 2H7CA 2GYUA 4HRXA 4FLMA 4NMWA 3Q0TA 3H2IA 5ALRA 4F0JA 2JGJA 4UHHA 2HADA 2DSNA 4INZA 1N1MA 1J07A 3M81A 5LYYA 2WIJA 1QO7A 4KE9A 2JGLA 5CH8A 4B9AA 1CUDA 4KRXA 1Y37A 2O7RA 4QLAA 3EIOA 4WFIA 1DINA 4AN0A 4DMHA 3H2KA 5AM2A 3OTQA 4AO8A 3I2GA 3TEJA 1CUJA 4IH9A 4J0DA 3M83A 4OYLA 1ODTC 3FYUC 2CJPA 1LPAB 2WTMA 2I78A 1WHSA 3ESDA 1ZIYA 5IVHA 3GBSA 1GKLA 1EH5A 2DFPA 5ALFA 2HU7A 2CB9A 4B9EA 1Y7IA 2PL5A 5IH7A 1GPKA 1XRNA 5CH5A 3VXKA 4G8DA 2BUCA 2H1IA 4S0XA 3VISA 3DQZA 3DKRA 3IUNA 4H18A 5DYTA 5EFZA 2GZRA 4EHBA 1ODCA 1N5RA 4C6HA 1XZAA 4WCVA 2C0PA 4J0HA 2Y6VA 4E46A 4EY5A 5J3JA 2WIFA 4UBNA 2OGSA 4LHEA 2HIHA 2PUJA 4C89A 5HCUA 2XMDA 4BAGA 3G7NA 4X97A 3VJKA 4UFNA 2GBIA 1Q0ZA 4H7JA 4J3JA 3UUEA 3WKDA 5AH0A 1DU4A 5ALLA 4BVKA 2XMSA 3TGLA 5HZGA 3SK0A 1S8OA 5JATA 4HRYA 3C87A 4AMYA 1EDEA 2XUPA 2OCGA 2XUAA 4X93A 3G9XA 3WWPA 5CXUA 5CRIA 4ARBA 5K3AA 3JW8A 3AJAA 1L7AA 2XUDA 4AN1A 5JZSA 2OCLA 3ZPXA 1CQZA 1DX4A 3STTA 3WJ1A 5ALSA 3DYVA 4Y2QA 1UWCA 3TRDA 4A16A 4Y2SA 4N5HX 3AZPA 4CG1A 1GKKA 1WPXA 1MAAA 3C8HA 4G9EA 4N8EA 4OU4A 3LIIA 3BWXA 4BRZA 1ACLA 1W1IA 1XZLA 1VKHA 3OURA 3WKCA 1JKMA 5K3BA 1TCAA 2VJBA 2I3DA 1MJ5A 1F0PA 4L3WA 1CUUA 3U1TA 3QPAA 2ZYRA 2ACKA 5AM3A 3DLTA 3LIPA 4YX9A 3GELA 2D5LA 1EVQA 5C8VA 5A6VA 4GI1A 5AI9A 4MJ3A 1JJBA 1J06A 5E4YA 2C4HA 3WL5A 5ALUA 1PFQA 3WKBA 2GYWA 5ALIA 5AK4A 3KOOA 4ARAA 4B0PA 1DT3A 3LLCA 2OPHA 4B82A 1J1IA 1K63A 1R1DA 4DNQA 3C5VA 1SOMA 3DCNA 4FTWA 3L1JA 3IUMA 3I1IA 2VT6A 3SWWA 5AKKA 2VJAA 4Y2TA 4C01A 4Y2XA 4AZ3A 2I03A 4X00A 5A62A 1XRQA 1SCKA 5ALPA 5AI6A 2ZJFA 3HSSA 4H7KA 2PKYX 4X95A 2XUKA 2G5PA 1LPPA 4C4ZA 2WFZA 3RK4A 2V97A 5HFNA 1CUGA 3SC2A 2WFLA 4KAAA 3ICWA 4H7DA 4E11A 2WIGA 2OG1A 1UOPA 2Y6UA 4B81A 5ALGA 4CCYB 5JAUA 4N8DA 4BVLA 1IMJA 3H1BA 5A7FA 2G4LA 2JEYA 3O9VA 3WK7A 4GWLA 5K3CA 1ODSA 4M0EA 2WUEA 1ZI6A 3WKEA 2QRUA 2VATA 3WL8A 1SCIA 1BEZA 5CXXA 2J3DA 1HPLA 1LZLA 1YAJA 1Q0RA 1AKNA 3AILA 3C45A 1ZJ5A 5BWBA 1R9NA 2XUGA 3AIOA 3KSRA 3CN9A 2QMQA 2VA9A 4C88A 3EF3A 5ALYA 2DHEA 2V9ZA 4Y2JA 5KREA 4XJVA 3PUHA 4EZIA 2QOEA 1F0NA 3F9CA 4WJLA 3WK5A 3BJMA 1EINA 4AO7A 1G66A 3W2TA 4OB7A 1CUIA 2WSLA 4P92A 4X92A 4XIIA 3KXPA 4XVCA 4Y2PA 1DTEA 4WDQA 5LZ9A 3ESCA 1MT3A 4M0MA 1EA5A 1CUWA 1YB7A 3FSGA 2YYSA 2BFNA 2VF2A 1ACJA 4MYDA 5FUMA 5AJHA 1UK8A 5JADA 4TGLA 3FVTA
chains in the Genus database with same CATH superfamily
3HN2A 3S27A 4BU0A 2GF9A 1RYBA 2CF5A 2YDXA 2YW9A 3N7TA 2HEIA 3HNPA 1N7GA 1PCXA 4IDCA 5CP8A 2KX7A 2B30A 1W49A 2EKBA 1ECFA 3AUJB 4OBBA 1G6KA 3SEFA 4MPJA 3V8RA 4PS0A 5F52A 2I7CA 3K0SA 5MHTA 2H1CA 1H5UA 4IZIA 1H8EA 2PSDA 5T4EA 4EA9A 2VSOA 5SV2A 1OFUX 1XYGA 1MABA 4K6GA 1QR6A 3P9PA 1SCDA 3VR0A 4RQAA 5AM4A 3KZ1E 2OGZA 1QTQA 4E94A 3FYUB 3GFVA 1DEAA 4JOCA 1ISHA 4QGSA 2VTBA 3TEMA 4US2R 4QBIA 3IAS6 4ZOLB 2GH1A 3MAGA 1UOQA 1XQVA 5KNLA 2V7UA 4PQYA 4XA8A 2CKMA 2EKLA 4ZAXA 1GPYA 2RH4A 2PT7A 3K0CA 4OSOA 1B2LA 1H4QA 3EGCA 4I08A 2ZRQA 3N2YA 4L74A 4EAAA 2WVAA 1C7FA 2HPVA 3PQFA 4J7AA 2IU4A 4WLUA 5TQJA 4C4XA 3AB7A 5IC5A 2ZVDA 4ZT2A 3WJAA 1W581 5ALOA 1GU7A 1FP4B 5NLLA 4DXHA 1D6JA 3V42A 2TSYB 4O3FA 2ID8A 1Z6GA 1GFZA 3OF3A 5C3UA 3OUUA 2XOKD 5IS2A 2P91A 1Y3HA 2J6IA 4RVDA 3Q12A 2QRVB 1OR8A 3IR5A 5DI3B 1I7NA 1CF4A 4MLDA 1OBVA 5BRNA 2X7HA 3LCCA 1GNLA 1GT6A 1MEJA 2OZLB 4Y7DA 4DVGA 3FLAA 2F8LA 3RIXA 2UV8A 4Y8VA 3VNUA 4W8OA 3PI7A 1KE2A 3DCJA 3M9XA 4DIDA 1S3SA 4DRYA 3HYTA 2CUNA 1UIRA 5J47A 4X1YA 1N8NA 2C2MA 3VHLB 1QZTA 3NJ4A 5TMPA 2PJRA 5HYVA 1IDN1 2EARA 1A9RA 4QECA 4URVR 2X2FA 4Q19A 4XIGS 3R7FA 5KJ6A 5E4FA 2Q45A 4L8GA 121PA 1NVFA 2IEYA 1W34A 2Q3HA 4DWVA 1USVA 3AUTA 4FNOA 1D8TA 4RETA 2YWDA 1P2VA 1TQ2A 2I7VA 2ORIA 2P3LA 3EY9A 3OEWA 5DNDA 2H5IA 1KDZA 5AQ1A 4NXNB 4Y6SA 3ZE9A 5KO2A 5GZ3A 2XX3A 5M34A 1R9GA 4WZAB 1P33A 3C3WA 3Q3JB 1DAHA 1UMDB 4Z54A 2YJ3A 2JVJA 4TQ9A 3H3XA 1WSDA 3L7YA 1SCJA 1Z0IA 1ZBDA 2B4KA 2XJ9A 3HBNA 4X1IB 3W05A 5J2UF 4V1CA 5KDDA 1XA4A 3OMXA 3I8OA 4WHMA 3UANA 4A3SA 3MF4A 1HNZB 3I4LA 2HRZA 4JJGA 3FSEA 3PBKA 1I7DA 3MINA 3OUZA 2WM8A 2X76A 4BEBA 2DLNA 3G88A 3WGMA 4I99A 1PSWA 3BTUA 4PG5A 4TT3A 4C2BA 5AUOB 5L7WA 1G21A 2VUUA 4UTOA 5EJEA 2GHRA 2R8EA 4BNLA 2XGGA 1LV7A 1XAIA 5BVHB 2VNAA 1E7YA 2BZ0A 2VSXA 1T4GA 1ORWA 1LJLA 3E9QA 3M9WA 3ZH9B 3J80A 5ECYA 2QLMA 3K94A 2VZ0A 3BXFA 3MZ0A 3D43A 4PC1A 4CKEA 4ETNA 4YT2A 5D7NA 3KYDA 3UH1A 1ZO8A 3P0EA 3RREA 4CEIA 3OOJA 3MUNA 2JFBA 4XR9A 4WY8A 1SKYB 1TK2A 1SUAA 521PA 5IVDA 1B6SA 1ENPA 2J1LA 4M7OA 1AVTA 3QTLA 1UC5B 2I22A 2V96A 1KVTA 2QZZA 2VEOA 1K1EA 1U2SA 1WABA 2YJ4A 1SH7A 1UMBB 1CKEA 1VECA 1M0TA 2A88A 1Q57A 2W0SA 1T29A 2YY5A 4JJEA 4RIIA 4Q9AA 4Y2UA 3R8XA 5AKHA 3V8EA 4B6FA 4D3ZA 1C30A 1HTTA 3MJSA 4I7EA 4XD7D 4FBLA 4FXOA 5K6TA 2QLJA 1S8AA 4BNTA 1DJMA 3GCDA 5JMPA 1NT4A 3QYFA 1VJ1A 4W82A 3V7WA 9MHTA 4RHUA 1W0KA 1B00A 4HS9A 4V02A 1CDDA 4B4WA 1D1PA 3HBJA 1RJGA 3H13A 3KL4A 5J1SB 1B6RA 1Z83A 1MC5A 3KEOA 3FCAA 1HE8B 1DO2A 4DYHA 3NW9A 3IEMA 3L1HA 1QPGA 4BVFA 4EJSB 1WSAA 5DI9A 2ZB3A 2R7LA 1QQ5A 5BV0A 2DPGA 5J2UB 3KS9A 4DYDA 3WDLA 1KOJA 2Q6VA 3KJQA 3OOHA 3UOWA 4W5TA 2V9PA 3D6JA 3ZVKA 1JFRA 3GDOA 3S70A 1YZLA 2C9OA 4DBLE 5J4VA 4DTIA 3LQQA 4RXUA 4EGQA 2OFOA 1RC0A 1V47A 1SIUA 4UUPA 2BFOA 1VG1A 4ABTA 4H3KB 1V8ZA 1U0BB 3CX4A 3LUBA 4Q9IA 4CCSA 3NBXX 5BNTA 3QYAA 5HILA 3U17A 2W8BA 3T7JA 3GJ8A 3LYAA 4JEHA 1ZH8A 2ZSIA 1OF1A 1ZOOA 4PPNA 3I04A 3NP9A 1FTSA 1NKVA 3RSOA 1NBME 3IVMA 3JVDA 5FBZA 3HYCA 3LLVA 5DYIA 1DAGA 4M8SA 3DF7A 2YRXA 1Z6PA 1IU9A 3U49A 4D25A 3L46A 1TM7E 3PWZA 1G20E 3UGTA 3GA5A 1JSZA 2Z09A 1VE1A 4CG2A 4YJHB 4Z49A 4AG3A 2OBBA 5ENVA 3VR2D 4XX1A 4B7XA 4KR3A 1ABBA 1I6MA 3DZBA 3E58A 4TLLB 3IQFA 3VM6A 3N2KA 1GZ4A 1LK0A 4ZVSA 3VU9A 2LE0A 1Z0AA 3K2EA 2R6R1 4HXGA 5KVCA 1XZDA 4D3SA 1K98A 4JYAB 1XAGA 1O96B 3OJWA 2JFHA 1L1EA 4NBUA 4L4YA 4WN9A 5BVGA 3FB4A 3IR6A 4BJ6A 3BSSA 3N3AC 2GVDC 2H1VA 5CW1A 2XJ4A 3EODA 3A05A 2W71A 1Q1ZA 2AX4A 2RSLA 3ANXA 4OB6A 5GONB 5LIPA 2I3BA 5JZMA 3IP7A 4MW6A 5A06A 1QGZA 3ADPA 3K0CC 3MJCA 4GLOA 4MV7A 1VCHA 3I6YA 2BDTA 3MJHA 3PIRA 4QNMA 1V37A 1XZPA 3HCRA 2B2XA 1KC1A 1H0SA 4JLNA 3PHHA 4KO1S 1M72A 3D7SA 4CM9D 4MQLA 5JDIC 1CY7A 2XNDA 8OHMA 3BXOA 2B21A 2RHLA 2NXJA 3R7BA 4D9IA 1PD1A 1V5GA 1D2GA 2H1FA 2QGFA 2D2IA 2AFHB 1FDIA 5F33A 2A5LA 5JG7A 5K2MA 1Z63A 1GPLA 1WY7A 4ZCRA 2ZR0A 4PPQA 1T6XA 5KWVA 3HYSA 1T2VA 4QRDA 4LJYA 3V1UA 1N77A 4PSAA 2QRHA 1O58A 2H7YA 1MHTA 1L4LA 5DM60 2XDQA 4HVTA 4CL8A 4PBTA 2VPZA 4G9BA 1T1EA 2BLLA 2FLWA 2GPNA 4FX2A 3T1QA 3UXMA 4Q3DA 1ZJWA 3DULA 4B8WA 3KT6A 4Z2YA 2NUAA 2J9GA 3KDAA 4A6PA 4ZDJA 2OBLA 4PWZA 5A4DA 4LIPD 1L3BA 3LTNC 3ZTYA 4O2AA 3BD9A 3SZUA 5L6MB 1LX7A 4GVLA 4R3NA 3ANTA 4NP6A 4GYKA 4B83A 4LNAA 2QTTA 3FJ1A 1SHKA 1WDTA 3GLSA 4HRAA 1ZFNA 2H2GA 2NWQA 4LV5B 4O4JA 4R2JA 4J3FA 5EJGA 4DANA 3EZ9A 5B3JC 1ID1A 3HBFA 2GCOB 3EXFB 4PE5B 4EFMA 3R76A 3IBTA 3DS8A 3EARA 4Q93A 4Y1FA 1RLOA 2QE7A 3AT1A 4D7AA 3QF7A 1HMYA 4FJ1A 3T94A 4KQKA 4ZK6A 5LQCA 1Y6RA 3GDGA 3SE7A 4KDRA 2O5RA 4R9SA 2PV0A 3NTLA 4MGYR 4JJ8A 1VRVA 2O2XA 2QJFA 3OY7A 4QPJC 4KGVA 5JZOA 4YRTA 2GMWA 4GPTA 4ALMA 4CKZA 3RAEC 1B6GA 1W76A 3RUEA 2B7CA 4BNWA 3U7GA 3O31A 3UKDA 1ZIOA 2FLVA 3PYMA 1E94E 1NPTO 4OUDA 2Y1WA 3HRKA 4QHTA 2GLTA 2A1UB 2IXGA 3PEUA 1AOXA 4XM0A 1LBIA 1UAGA 5IYZA 1N5IA 1J8QA 1NJSA 4RLQA 2RHOA 4WZBE 5M7EA 4AKHA 3F67A 3G2JA 2OYRA 4X1OA 5HF8A 2VPTA 4UTVA 1RWKA 5BYAA 1CY6A 4YRLA 3QFHA 5U9CA 4MR9B 1QK5A 2XKAA 3SYTA 1R8QA 3F2VA 3LFUA 4YO8A 1MAHA 5BSWA 2Z4TA 3OJFA 2WY2D 1ZGJA 4TWBA 3MPUA 1QGED 3P26A 5F9FA 4DV4B 1ZPDA 5DXAA 1E4EB 2IYTA 2PUEA 1XDGA 1OIVA 2DFNA 2EYQA 2O3RA 2R6DA 2MSWA 1G98A 4WV3A 4NYIQ 4XASA 3KU4A 3ZCUA 2NTEA 3ZHZA 3A70A 5DHRA 2VWGA 3EIWA 2Y99A 4FC7A 1X39A 4HDQB 4WZ6A 3QUBA 3DHWC 4CG3A 2QZ4A 2X5NA 2HI0A 1TA9A 1N2EA 3I5MA 4I9HA 1JQBA 2VRWA 3NGXA 4HWSA 4H1WA 3VC7A 1XAJA 4E7PA 1AQ6A 2Z57A 3WK9A 1JBKA 1JJ7A 4BO5A 5C4MA 1JJIA 1XPJA 1MQSA 1WV0A 3IT3A 2Q3DA 1HO3A 2RGGA 2X8JB 3FKSD 3QFFA 3UYLA 4QGBA 4UDNA 3VOTA 3IDSA 4BTEA 2H51A 1I2DA 4MVYA 1P2DA 1RZUA 1XWIA 1BXKA 3VDRA 4BGVA 4LFBB 3TFWA 3ZZNA 1S6YA 3EDCA 4OAQA 1GGEA 2QZSA 4O0LA 4Q4JA 1P4HA 2AOUA 4I1VA 2ODEA 5B3AA 3RSCA 3U3RA 5A5GA 5DNUA 3F74A 3KXIA 4RA6A 4LF9B 3IP8A 2EGGA 3N28A 2YZGA 5A4JA 1MX1A 3GLKA 4G3XA 1CD5A 1ULUA 2DBVO 4P7FA 1T8PA 3C4VA 4AZ0A 2A0UA 3N1UA 4EO7A 3LT2A 2CMGA 2OCPA 4YP9A 3RC9A 5TNXA 1FMJA 5SY9A 4ZEMA 5I4IA 1AGYA 4J16C 2O3UA 2V5VA 2VK8A 1IBRA 4I4CA 4C1NA 1Z2DA 3BDAA 2Q8NA 3RHZA 5I7HA 5BWLA 3U6KA 2C04A 1RC1A 1XRSB 1YWGO 1P62B 2VP6A 2W4IA 3R3WA 3NC4A 2GBLA 1UFQA 4RF5A 4DJTA 4W9NA 1VGQA 1TPYA 3GJ4A 1DIAA 3DMTC 3B5IA 2XTAA 1GPBA 4FN5A 4HH0A 2E6KA 4ERXA 1YB5A 2KYRA 4ALLA 1USWA 4H1HA 1YMUA 4D5GA 3T7IA 1Z5GA 1UOEA 2VLIA 1ZMRA 4BKQA 3WY9A 1HYGA 2GR9A 2LIVA 5AHKA 2VP0A 4CN8A 3OICA 1ZJJA 2ID7A 5BSUA 2XUHA 3DBOB 4QTXA 2C9BA 3DL0A 4EHIA 5AVRA 2XBMA 1P80A 1P2UA 3AINA 1XTVA 1IBMB 2PLFA 1XRRA 4EF6A 3LRPA 3DEIA 3KPJA 4NESA 3PCRB 2VJOA 1KIAA 2XXBA 4W1SA 5JFOA 3KQUA 3U19A 2HX1A 4LOJA 5BSHA 5F21A 1THGA 3MRSA 1UJCA 2NSDA 2QNRA 2UVDA 4AJPA 3N0VA 4K9LA 1QHFA 2PVPA 3BB4A 1JDSA 3DBHB 1JNYA 2ZANA 1W5EA 1JJFA 2VJKA 3G0DA 1TW2A 3LT1A 4ER7A 2Z6AA 5A0VA 1KZ4A 1RXYA 1X1AA 2K2WA 4NEQA 1S3FA 3I2HA 1D4FA 2C7VA 2FXIA 4HWRA 2O7NA 1CETA 1D0IA 4IIDA 4R7GA 2UU9B 2IY8A 2PFSA 4NFYA 3NHZA 1WCXA 5JO9A 3WP1B 3RFXA 4N0EA 5EJ5A 2VKTA 3JVIA 4I4LA 4QTUB 2QAIA 5E38A 1E5QA 2C4NA 2V59A 2Q5EA 3LW8A 4HDNA 1U3CA 4HH1A 4IWYA 1E1QA 4TSFD 1FP1D 4HQKA 4B84A 1FZQA 1XDZA 5JRDS 4B32A 4I55A 2GK3A 1ZSVA 2A4MA 3OCYA 2DWOA 8ATCA 2VBGA 1JL3A 1WSBA 3IMFA 2QL7A 1XQYA 2PBLA 1EK6A 5JTTA 1JKFA 3JRXA 1OWPA 3HU1A 5K03A 3SJBA 3BK7A 4N7JA 4MQ5A 2NAFA 4J1SA 2JLXA 4OHVA 5SYNA 2PZFA 4O2LA 3WSVA 4F72A 1GTVA 3GCWA 4N48A 1X19A 1E9DA 1LV8A 3D4NA 3R44A 3OFJA 4MV8A 3W06A 5AW1A 1IQUA 4MPDA 2JFYA 2VR1A 4CGYA 1SBHA 1CFJA 3IL2A 1KSJA 5JQGB 4MS4B 3V9AA 3L6OO 1KTIA 4MUNA 5U4QA 4TMVA 1Z18A 2QBYA 2W6CX 2CWWA 1B6TA 3UATA 4CL2A 4CEJB 3T1VA 4J4TA 2VDWB 3X1KA 2P6PA 1LS6A 4A82A 4ZYXA 2IZ7A 1DC4A 1BFKA 1JDPA 2FJPA 3HB9A 1HRDA 1ZRNA 3ZU5A 4EQZA 3K4QA 5E7JA 3Q98A 1M10A 2O5VA 1UEIA 3C39A 5BW8A 3ET4A 4EBBA 5EKUA 1AQJA 3JQGB 2EFDB 3F3MA 5DM4A 5LQUA 1KZ6A 4J0KA 1GPDG 1KZGB 5CDSA 2CY0A 4FJ0A 5I7VA 1DWQA 1GN9A 3DBRB 4LJRA 4TV8A 1UT6A 3M2TA 1FDUA 1E2DA 1BGXT 1L7OA 3OEEA 1P81A 4ID3A 4KFRA 3FA2A 1GGVA 4IFBA 4R8VA 4AW9A 1GVNB 2TYSB 4U2EA 3AFGA 1A1VA 1XFDA 3HKEB 3PI6A 1T8WA 4MW9A 4V2IA 1YR6A 3UK6A 1DP4A 5AD1A 3V80A 4JB0A 1Q0SA 4KV9A 3WK4A 2G63A 2ZYUX 1Y9JA 3B3GA 1NYLA 4EW2A 4XPIA 1EG2A 2D1TA 2D0OB 1EXMA 1UEXC 4J9UE 5DTRA 3T3HA 3E9RA 1E2FA 3WSTA 1D5CA 5KU7A 4BFXA 5CH3A 4N3NA 3AV0B 2O1WA 3PQ6A 2Z6QA 5A7GA 1M2GA 3QX7A 5EE5B 4PWYA 1DWUA 4OGGA 1FQOA 2NOAA 1ZYUA 1OXTA 2XQGA 1IG3A 4MPTA 3I2KA 4NZ9A 3LDFA 1VPEA 2Q99A 2PD4A 2FNAA 2DKNA 1MC4A 1I0IA 3A6HA 3ISVA 4J0EA 5EIAA 4E15A 1TTPB 2XA1A 2Z0MA 3CUEF 2MDTA 2H29A 3KELA 4GPEA 1PTJA 1S3GA 4JI2B 3JQBC 2OHGA 3JQCA 3C6KA 1MB9A 1XQ9A 2CYBA 1HE4A 2X2EA 3OE1A 3WLKX 1NTRA 3RROA 4B76A 1P2GA 1T0HB 2D1FA 2MYPA 3FPLA 3L0OA 4MAMA 2QRJA 4QU8A 3UMSA 5FORA 3VHXA 3OPYA 3LX5A 2J4DA 2I2FA 3A4TA 3HN6A 2IT1A 2GZSA 3WKAA 1YS7A 2OLJA 5JHHB 3TXYA 5CB4A 1XVAA 4G0ZA 1FYDA 3TDMA 2HMYB 1ZI9A 2Q50A 3BFVA 1YU9A 4YS6A 4BZPA 1L7RA 3TVTA 4YUZA 3QX3A 5FUVA 5IAGA 3L1KA 3TRHA 3HY6A 4B6GA 1WLYA 4FFBA 1ADJA 3VUFA 2BGWA 4BLQA 3PEEA 1BQEA 1W0JD 4JT4A 1SEVA 3LT4A 1Z36A 1C50A 3ENKA 4ZHQB 4L8LA 4B46A 4JI7B 4FBMA 1KJ9A 1TEHA 1R27A 2P6UA 2VHQA 4PNPA 5BUQA 5AVQA 4KLAA 3NQ41 4XCQA 4PXSA 4UMDA 5JCJD 5H82A 1WXQA 3EIEA 3LDHA 1FNMA 2BFWA 2PTGA 3IE2A 1K3UB 1LUAA 3W4IA 4ZO6A 1PI3A 3HJTA 3ZNPA 3CRQA 4LEIA 3CZCA 4GHWA 4TMWA 4LOLA 4BKUA 1JT2A 3GRVA 3QKWA 1UZUA 1YXMA 1DLIA 3ILVA 1KY4A 1L7NA 2WD8A 3NTOA 5FADA 2ZUTA 5EAIA 1WUTA 1XELA 4MSUA 1RYYA 3NTRA 3GLGE 4WNYA 4R8SA 4R8RA 5TMDA 3N5KA 3SEAA 2LVBA 4RQBA 2FP3A 1OU0A 5SYAA 1Y81A 2OA0A 3ZKWB 3CQ9A 3L07A 3R6LA 4ZQBA 5I7UA 1LEHA 2GWHA 1U90A 4NOJA 4ARZA 4EH1A 4POAA 5LQMA 3LUPA 3Q72A 3FNFA 4YCMA 2A7XA 2Y0EA 4AKEA 3BSWA 3PU6A 5AVVA 4YR7A 3O2SB 4MICA 1Y1RA 1W4BA 4II2A 4ZI5A 3TPCA 3LWBA 4QXOA 4MRSA 4CGZA 2BFMA 4PG7A 5JJLA 3ZZ1A 1BWQA 4IRXA 4OM7A 4X64B 1KP9A 2AUNA 4U2DA 5REQA 1PHPA 1U7PA 2NUTB 4P82A 2R8ZA 2FDRA 2O8CA 1P0CA 3E5HA 1W85A 3H8WA 3SX4A 3GLFA 1NOJA 4YDQA 1BAPA 3QUAA 2R6HA 1TZ2A 1NVWQ 1S2MA 2P9EA 3A2MA 3I58A 4IM7A 2O8VA 5G3ZA 5DHFA 3TVDA 3VR4A 4DA8A 1M1YA 2ZBEA 3ZEIA 2YWXA 3SEZA 3MWKA 2H4YA 4LG1A 4BQPA 1JEJA 1KZ1A 3D5QA 3QBTA 4OO3A 5BQPA 5BORA 4LRYA 4XEUA 2HH9A 3MWDA 2DWUA 4NR0A 4D3XA 1P1KA 1RQ7A 3DQQA 1OGJA 3SM3A 1E3TA 1SO8A 1ZD2P 4CMEC 3BIJA 2FUKA 4I3HA 4MVJD 2V1XA 2WTNA 1CW2B 3OQIA 1UDRA 3QE4A 2P9FA 3R24A 5G0WA 4OQZA 1K6JA 5E0KB 1SULA 5DCUA 3F5FA 4A0RA 4PCUA 5FTNA 3GFRA 5BR7A 2HCRA 3AJ8A 1ICEA 4ZI3A 3O82A 3LOUA 2KSQA 4RESA 3P8ZA 3ZGNA 3FTQA 5HE9A 3IURA 4JKOA 4NATA 4MB6A 1KKUA 3JZDA 4O1IA 5EJIA 3UAOA 3F4LA 4RMJA 3U2QA 4BL5A 3VI3B 4CMIA 4CTKA 3SXUA 3I9JA 1VKZA 3Q7IA 3FUXA 2AKAB 1BXRB 5T4HA 2C58A 2PGAA 3CISA 3MJRA 2LNDA 3G8YA 4PZLA 4UE2A 4YP6A 4O4LF 1KF0A 4X65B 1K7CA 1YI0A 1GXSB 1RWMA 4M1QA 3N86A 4ALNA 1U0TA 1ZGBA 2LW7A 3OZUA 4OMFG 5J23A 3OQOA 1HSZA 4XD7A 5T8KC 5IABA 4ZCTA 4MJLA 2M1ZA 4FHEA 3OCJA 2Q5OA 4PQEA 4ER5A 2Z8YM 3ETGA 1Z73A 1OY1A 1KEKA 1QCYA 4Z4FA 1MBZA 1P9RA 4OQDA 2YIJA 1RE0A 3EJ6A 3KQSA 1NBMD 1QGAA 4PZAA 1EFPB 4C5BA 2PNFA 4RF2A 4TKZA 4QJBA 5DPMA 3WNBA 4BQRA 4QO8A 1J70A 2E3JA 3REQB 1QIIA 3RT1A 1J8MF 5ALZA 1FFEA 4U2FA 4QDJA 1XNQB 4KQ9A 4QYIB 3R23A 1DRKA 3QLUA 3O3MB 1CR0A 4HN9A 4BIIA 1JEEA 1JWLA 1SG0A 2P5UA 2YV3A 3DVLA 1FVXA 4CLRB 5G4LA 3V3TA 1P6QA 4Q1BA 4W5JA 4ZZ0A 5BN5A 2O19A 2H4WA 4Q1FA 1AKUA 3GEHA 3ER9A 1K66A 3DOIA 4NZZA 4A6EA 5IM4F 5GADl 1EUYA 1SC4A 1TO1E 3UMGA 2FQWA 1V7CA 2YX1A 5LZ5A 3HV2A 1DQYA 3GAZA 1RFGE 2BY4A 2GD6A 3CZAA 3E23A 1I2CA 3GEGA 3IMGA 3V00A 1DAIA 3HP7A 2AMVA 3IKVA 3UOGA 3QMPA 4CL0A 1MNAA 2R2GA 3EXEB 4N65A 3RANA 3EYWA 2I3ZA 3A1UA 3R0VA 3Q15C 1I51A 4AECA 5DX0A 5JAOA 4PLFA 1KPGA 2DR3A 1GPJA 2ZIEA 3Q8KA 3JR7A 4X61A 4CTNA 2NTNA 3AEKA 2JG3A 3K9GA 1MIHA 4NHOA 5AJUA 2FFJA 3CZRA 5AW5A 4IG9A 1A8IA 4WLFA 3EG5A 4WACA 2EX0A 5F76A 3THRA 4NKRA 2J0EA 1FYEA 4JP2A 3WO1A 3ZLVA 3DQPA 3PA6A 3D3KA 4B17A 4LI3X 4CTOA 4NFSA 5CJPA 1ZN7A 4LVCA 4PGFA 2B8NA 5AK0A 1LPOA 2G0TA 1ZK3A 4C4OA 4J0JA 1PK7A 1FNBA 2B36A 2LKCA 2Z56A 1MO5A 3SF8A 2QVGA 1F20A 2CD9A 1JA9A 3CLHA 2W6NA 3IX7A 3MS4A 4IGKA 1GUDA 3KXKA 2IYLD 3OZSA 5GOTA 3CVUA 1PEKE 3A6FA 2KS6A 4GIBA 5ALDA 2OKGA 2ZYTX 3TLXA 1W0CA 3QKTA 4P6VF 4FNMA 5DHSA 4JBNA 1CE8A 3CTPA 3NONA 2OM6A 1EK1A 4J49A 1QG6A 4PHCA 3A1DA 2B99A 3PJRA 4BCDA 3A7EA 5C8YB 1X94A 2IK8A 3T5CA 1GRQA 1CS4C 3KUCA 1GTL1 3B89A 2RGWA 1PQ4A 5EJMA 4CM1A 5H3LA 1G9SA 1ADFA 1SIOA 2BHSA 4TYYA 2G0NA 2B0JA 4EB6A 1T25A 1NY5A 1R5BA 3E3AA 4MP6A 4J3NA 3VDNB 1RI4A 4FKMA 3ZYCA 1CU1A 1DFIA 2XZPA 3FVWA 1BX0A 2WAYA 2WWYA 1PJAA 4A10A 3BKWA 3QA9A 2BN4A 1VKRA 3KXLA 5IJAA 3EXIA 3CF6R 9ABPA 5IANA 2ZM5A 3LDUA 3OP4A 3CS3A 2I6UA 1IZ0A 4CV2A 3X1JA 4IUBS 4RSHA 3W6OA 1L5GB 1PGJA 1QGUA 2V7VA 3BMXA 5E1MA 1CP3A 1E79D 1T5DX 2BFBB 3EOBI 3FGNA 4IG4A 5K3FA 5BN4A 5JYEA 3T1YB 4ROTA 2H5JA 1NR1A 2O0HA 2QUHA 2FKNA 2PNJA 1ZK0A 2QJRA 1U0LA 1PV4A 1GDTA 1I7PA 2GN6A 4HGRA 4BNNA 2QB5A 1X2BA 1FUIA 1EM8A 3ESRA 3I12A 4JI4B 2WWIA 1T2DA 3VKGA 2YHSA 1TZJA 5JXGA 2KE5A 2Q41A 4OJMX 5KX5F 2BGLA 4HDOB 3FPJA 3MBOA 1NBAA 1NIJA 2ZS8A 1VLZA 2AR7A 2JFQA 2F3UA 3KX2A 3MTBA 3NAMA 5E9JA 1NVEA 2P2YA 5BUSA 1PTKA 1TPZA 4W6QA 1NE7A 2BFFA 2D1SA 3COVA 2NU8A 1H3EA 1XEXB 4F5DA 2RHRA 4CG0A 1VE7A 1W5AA 4G8CA 3TWOA 5CFPA 3EA0A 4AP6A 3N8HA 4QTYA 5FPHA 5EQJB 1VP3A 4PY2A 5CDYA 1A7JA 5HJ7A 1BCSA 1TRKA 4GH5A 1M0WA 4EYGA 3Q85A 3MAAC 2XAUA 1IM2A 3IIEA 4KYUA 1M1XB 1HBJA 2Z95A 3BFJA 1J2YA 4Q4HB 2H4JA 5CDUA 3VR3A 3DE0X 4MXDA 3DFMA 1M6WA 3BF7A 1EJ2A 4DJAA 4LF4B 4QD3A 1T0IA 3R7WB 4DV0B 3GBVA 3IDZA 4JGBA 4MROA 1SQ0A 4URWR 5SYMA 1IQRA 2A35A 3CLKA 3WNDA 4F2DA 4YJDA 1Z6QA 3PHCA 4Q9DA 2WD9A 1WXIA 5COBA 1Q0LA 4PYLA 4XUCA 4CLEA 5LP1A 4FUTA 4F2HA 4RXMA 3CYFA 4HMQA 3NHKA 3SDSA 3BQMB 5JEEA 2NZJA 3E5NA 1ILWA 1VHWA 3IS3A 4MHSA 4ZT5A 5IFLA 2DH5A 3LNCA 4GNKA 4DLXA 4HAWA 2WTAA 3O83A 5E4JA 1G7TA 2W00A 3EPPA 1VI6A 3PNPA 4EKYA 1C9YA 4JBLA 5EMHA 1LLQA 1S89A 1E63A 4JI8B 3ECCA 4HF7A 3TKLA 2D2EA 5HRCA 2R48A 1NXQA 4AMZA 2WAXA 1VE5A 2EHJA 1UPBA 1XDSA 4GAEA 2AYYA 2EIHA 4EEKA 5LB4A 1J0CA 4JFRA 5AKGA 3PHJA 1G291 1P9OA 5EFOA 4DCUA 5HKBA 1G9TA 1NATA 4X8OA 2JJ1D 1Y5NA 3T4EA 3RFUA 4COKA 1JHQA 3PXCX 5L3SA 4LJAA 1CR4A 1VPTA 2CXOA 1M67A 1UJ2A 3ZU6A 5KQRA 1UBLS 1P74A 4WFKA 3T5GA 4QASA 1FMCA 3WHPA 5F2NA 3CRVA 4ARCA 1E8NA 1BVRA 3QITA 2CJWB 1RQNA 3G9QA 5LCXA 1NXSA 2R6JA 3P7MA 2GUWA 2OQRA 3G9UA 5BOVA 5WRFA 4DAEA 5JSZA 5KKCA 5FYDA 2W6ZA 5ICCA 3LX8A 4A6XA 2C31A 1SD1A 1UKEA 4FSDA 2D06A 1HWYA 4V0ME 1ZR4A 4JXJA 4HDSB 2OHFA 2CLIB 4DMKA 4H16A 2E4WA 4G23A 2PCLA 4LSZA 4KVFA 4XZ3A 1H2BA 4M55A 5CYPA 3ZW8A 1D03A 3NTUA 4R81A 2PL1A 5CG2A 5CM8B 1KK3A 2BEWB 4TMZA 2WE8A 3FDZA 3ZWWA 5EE9A 4BLTA 2O54A 3NXKA 2YZMA 3PX7A 2HDNB 2W5UA 3HEAA 3KQMA 1Q20A 5E6RB 1N2OA 3KQKA 2HJVA 1PZNA 1ZDMA 1CS0A 3KJZA 3NTXA 1Q0QA 5I45A 4XYBA 3GZNA 1KYZA 3DZCA 4RHXA 1KAQA 1AZLA 2ODPA 1USUA 2L17A 2PEZA 4RK6A 4IVNA 5DE3A 4NY1A 3VPDA 4PONA 3T1TA 2QXYA 2WA2A 1T36B 3NR2A 1DADA 2JD2A 5JNLA 2WWVD 1UBRS 3A25A 3AG5A 3GX1A 2AXEA 4B4UA 1JBQA 1I7LA 1DMRA 2FZVA 2QGNA 1N78A 3HU3A 4AWXA 2FMFA 2RFLA 4MMZB 1BHSA 1Z07A 3QYPA 2A9KA 4OQEA 4C9BA 1TQDA 2LTAA 4G1VA 4BMPB 4QUDA 1FDWA 3IMEA 4GSYA 2PTHA 3TJRA 4IO1A 1E77A 2LDBA 3S81A 2FPPB 3UYKA 3HQ4O 3MOGA 4K8OA 4F21A 2A33A 1G0OA 1DHRA 3PXBA 1KSGA 4ZJUA 4IDBA 1GFSA 4D4KA 3I5XA 4MWDA 2TMYA 1GDHA 4YT5A 3ZCTA 3H2ZA 2O1EA 1R8JA 4EMBA 2DGDA 1VLVA 4XB2A 3TKYA 4RHYA 4YJ3F 2XOXA 4EKDA 1PDOA 3KJEA 3NKLA 5HOEA 5IT5A 1LWNA 5T5QA 1NLYA 1G41A 3S1AA 3WBFA 3A1CA 4H7FA 1Y4UA 5CVUA 3PQDA 2QJWA 4K9SA 1UC8A 2W2QA 3K31A 1KP3A 1DBQA 1RBYA 1USIA 1V11B 2AXPA 2P9JA 3CZPA 5JLAA 2V0GA 1YNSA 1Z0KA 3CR3C 1YS9A 2JIPA 3LUCA 3OPNA 2WI8A 2AOWA 1ECBA 2EC5A 1WU7A 1GTG1 1YHYA 3G9ZA 1XLVA 2BMWA 3L82B 4DA6A 1Z26A 5CM2Z 1D2EA 1MRSA 3N8KA 4X6YA 1MO2A 3GP3A 1U0HC 1ONNA 1QIKA 3ASUA 2FK7A 2W6MA 3MMNA 2ZRFA 3AFHA 1FMTA 3LXRA 4CCAA 4GWGA 1O3YA 3DW3X 4YAIA 5CDHA 5KNBH 1J22A 2Y9MB 4KDEA 4AO6A 4YH1A 4I9FA 4DJEC 4ENSA 4K6CA 2OHXA 3AL2A 2Q3EA 2BBWA 1Q0TA 2YVLA 1SOWA 1AGXA 1SKAA 3CFYA 2QYSA 3MK31 5FNZA 3GLIA 3UK7A 1IUNA 4KDFA 4KMMA 3OLXA 4FFPA 3HO6A 4N9QA 4U7PB 4OUKX 5FX2A 4RADA 2CCJA 4Q3EA 1KJYA 2WWHA 4WNIA 1UBCA 4RTMA 4LY9A 1FS6A 3BWCA 1UM9B 1JVNA 1OCEA 4K28A 1F2TB 1AMUA 4V0OA 4NJEA 2XMBA 1JB9A 1OFGA 1P5RA 3WMXA 3HVKA 3E15A 4HNAB 5C18A 1FE8A 1MVNA 1FFDA 4TKLA 2CNWA 3S2FA 1Q6ZA 4H77A 3OIDA 2IZ1A 4Q3OA 2ZBVA 4JHLA 4RSGA 3OWOA 3ABZA 4JLBA 1XZIA 1XDDA 5MDHA 1N2SA 3ZJ4A 4QEKA 3UY4A 2OV4A 2D0PB 3E1GA 4ZALA 1C7ZA 2OK7A 2Z1NA 4MUXA 4WDRA 1SUEA 1WB6A 2GN0A 4JSTA 4RANA 2W4MA 5AHXA 5I9BA 1QP0A 4DJDC 3V48A 1RRKA 4FGJA 1KMHB 1NUSA 2DR0A 3ZWXA 3ZZTA 4JWKA 2FW8A 4D4HA 1K5GA 2FN8A 3PC6A 4YEDA 4PX2A 4KTVE 2XVZA 1B8OA 1JFLA 4QXQA 3CT4A 4N18A 3FMOB 3CO5A 3DFFA 3ICOA 3P71T 4MVWA 3JWJA 3WGJA 1E7MA 1G2QA 3IXMA 2DY0A 5H80A 3RCBA 1CNEA 1DO0A 1TYBE 5JVDB 4ZTBA 3T5MA 5CA1A 4MS3A 2ON6A 2DPMA 2QGZA 3KK0A 1UBNA 3QU4A 1XHFA 1PDVA 2FCAA 3C3YA 4D1YA 1QIEA 4PSDA 4X6UA 3CVXA 3OJ0A 2ZIXA 5LP6F 1ADGA 3ZD7A 4LECA 2ZOSA 4LBZA 3PCTA 1ZUNB 2D74A 1CY1A 3DC2A 1KAEA 5LZ2A 4QUGA 5FTJA 3SHTA 1JEOA 4PGGA 3UEOA 6YASA 2WNSA 3E70C 2WWXA 3PHIA 3PQCA 3EUFA 3QI7A 1F8UA 1ZMOA 2BTQB 2C9MA 4H2DA 3KR2A 2O0JA 4CF6A 1XTIA 4F4DA 1T5BA 1K6XA 1P45A 4X7MA 4I4TB 1VJTA 2ZLBA 2JBAA 1SCNE 1GVHA 3EIUA 4MYUA 1IHDA 3DR3A 4KXNA 3IO3A 4JP8A 4QOIA 1H2XA 4QYMA 4EKNB 5DKFA 3UJPA 3L8EA 1NI4A 2E4ZA 2PZAA 3J81A 4PLHA 5KTRA 3GUCA 3CCBA 3RKSA 5EIWA 2UVPA 1OT5A 2XMCA 5AFSA 3CG0A 2FMTA 1I9GA 3S40A 4L7QA 3ZZ0A 4GZMA 5GY7A 2ZBFA 4BB6A 3LQ1A 3FVRA 2QTVA 1B76A 3RYTC 4OB8A 4DE5A 3H5AA 3CNHA 4M0KA 3OP1A 2XE4A 3QVWA 4U7FA 2AJ8A 4RZSA 2ZU0C 4RZQA 4L0DA 4ZOLF 1BW9A 1UZAA 4LMAA 1GAQA 5DULA 3TSOA 5TR9A 2CL6X 1XXLA 2JGAA 1Y89A 1J00A 4HAXA 2I29A 4L76A 4MUYA 4QLOA 3W34A 2J9XB 3TK1A 4Z0HO 2XODA 3ROFA 1D2CA 1U2DC 4KPFC 1U80A 1W59A 1EX9A 5EPOA 4CIVA 3NWOA 4BV3A 3KYCA 1NP3A 2GPWA 1BDMA 1QDEA 2DOKA 5B6JA 1WCWA 2B2NA 1LPBB 2E5WA 1WX1A 3A28A 3OFSA 4YRCA 4ICIA 2EJCA 3FFBA 1GDDA 4DDKA 3OCXA 1I2BA 2G77B 4WMLA 2PH7A 4PYNA 2FSVC 4L0CA 3TOCA 1OBHA 4Q48A 3VAAA 1M2WA 3OWXA 3TLAA 2BHNA 2H6EA 2JGMA 5DTJA 4B2IA 4XLLA 4LQLA 1CEXA 4GYYA 1FJ2A 2HDHA 3CBGA 3UWOA 3IEVA 1RI1A 2ZREA 2MCFA 5IFKA 1Q7GA 1CSEE 1HF3A 2JD1A 2WVHA 1XD8A 2RAPA 1V4BA 3LBFA 4IHKA 1M8GA 2H2AA 5FI1B 4LVUA 3SXJA 2JIDA 4EDHA 4HLNA 1D7AA 5KYXA 1FFYA 4A8JC 2O7QA 4KPUB 2PKXA 4N9WA 1W4RA 5JYCA 4TM7A 4TL6A 3MT7A 3CVVA 2RGYA 5DTMA 1RXEA 2Y05A 5EHGA 1IL0A 2PS3A 4TMXA 1X1BA 4X84A 3ZI7A 4KOEC 3DLIA 2HBRA 4NCJA 1DXYA 3QUQA 4PAOA 1SXJE 4M8KA 3IKJA 4PC7A 3GUUA 2OOKA 1KQGA 3QJ5A 2G71A 4IIGA 5CCEA 1M2EA 1D2HA 4NYJQ 4DR2B 1JHVA 3GQBA 4XWYA 3STXA 2QORA 3QPUA 4OQQA 3AUKA 4DCNA 2IPAB 2VIIA 2XA2A 1QK3A 1SBYA 4BLOA 5TPWB 4P3PA 4Y6OA 4G63A 1OX4B 5CFRA 4NWIA 1G18A 5IK2A 4NC9A 3N70A 1ZOPA 1O6BA 4YUVA 2HA2A 2JASA 2YY6A 1I24A 4D98A 1NZDA 4FDVA 1M75A 1EGQA 3WWDA 4L8YA 5L3QB 1NVDA 2BJWA 1PLJA 3GNTA 4TL9A 2UZ1B 5K09A 3S2IA 4MKRA 5BWCA 5KKNB 2OXEA 3OCUA 3K8OE 4DL9A 1XQXA 2PO5A 3NAZA 2PQ2A 2YNMC 3DZ8A 4XKJA 5CPFA 1PVVA 1S8NA 1YC2A 3U62A 3GR6A 5BMOA 2B3DA 1J20A 2BFDA 2Z83A 3FCEA 3ZGOA 4AS1A 1W93A 2N46A 3NT2A 3WMWA 5IBRA 1YB1A 4RNDB 3PR1A 1UBTS 1A8SA 1L4BA 2IU3A 4IDFA 4C0XA 2NO9A 3UCXA 4YCBA 3KJHA 5KIAA 4PSKA 2BFEB 3L0ZA 4Y2YA 1Z33A 1JMYA 2IYZA 3CMCO 3EC1A 3L4BA 3NNSA 4TMYA 4Y0AA 1RXSA 4IEEA 4MYTA 1MO6A 2MT9A 2J32A 3KQTA 1OWOA 3ACBA 2WSMA 1C3OA 3NANA 4FMDB 4HAYA 4L1KA 5DBIA 3T0FA 4B7UA 3JWGA 1GG8A 1Q83A 1VOTA 2F3SA 2I34A 1AY0A 1JTEA 2NZYA 3JD1A 3X2SA 5HJ5A 2I4OA 1HA3A 2CD7A 1YCDA 3D0KA 3EQZA 3KSMA 2JGKA 2ONCA 3BCSA 3G2IA 4KE7A 2LKDA 2VPXA 3FCYA 3ORRA 2HSWA 4PX9A 3EA4A 4Y1GA 3TZ6A 2J0VA 2PX6A 1RPAA 3UJ7A 5BN3B 1H23A 2BMDA 1Z16A 4WVLA 1QMPA 1G20A 3ZOZA 3FHTA 2Q3LA 3CIFA 3E4CA 1GQQA 4TRJA 3ZE7A 3K4HA 5IUJC 5LKRA 4HDMA 4X45A 5DBGA 3DE7X 5EKSA 1GQFA 2ATCA 2ECPA 2IXFA 4GLJA 4BZQA 1IZZA 3BK2A 5FWYB 5B7GA 1RXIA 1JG3A 2HXGA 5FCDA 5K1ZA 2QRGA 1XCLA 1V26A 5MN5A 3FR7A 4EEZA 1YJAA 2OORC 1DQSA 3ELWA 1WDMA 3OQJA 4LPSA 3COSA 1JTVA 4ZEOA 4FMCB 1M6YA 1XC7A 3D3WA 3QG1A 3MHPA 1IXYA 2ZVJA 1YA8A 4H27A 2NTJA 4KLZA 4DCTA 1PWEA 5P8WA 2IVFA 2V8BA 2Z1DA 4N03A 4OHCA 4CM4A 3ODPA 4IGIA 4ROSA 2H92A 4R2LA 3R1IA 4JASB 3B1FA 3K6SA 2NVUA 2JBWA 2WC1A 3BAZA 4Y6LA 1VTKA 1QAMA 4G1FA 1ZL2A 4RSRA 5FPPA 3VR6D 1OI3A 4ZDKA 1MVLA 2C7BA 2JFWA 4D79A 4WBNB 1NOKA 4KN5A 3HBAA 1PJCA 1Y1TA 1YDGA 4A4DA 2IYOA 4M0CA 3M6VA 4GKBA 1ITZA 5FFMA 1DX6A 4FI3C 4FMBB 5FNVB 5FULA 3BRWD 1PHRA 2RHWA 1WNFA 3M2PA 2PZ8A 3HE3A 3PVSA 4KGZA 3BK1A 1DKNA 8ADHA 4KAFA 4KBYA 7GPBA 2XCRB 3HU5A 2G5TA 4R8LA 2JJQA 4PV7A 2VDJA 3U3XA 1E20A 4NI5A 3L9WA 3W5BA 3ROMA 2Z2IA 2HA3A 3BREA 4AJKA 5A4AA 2LV8A 2W2LD 4NH0A 5HUJA 5AK6A 2DAPA 4J7XA 3O84A 3TLKA 3R5SA 3G49A 3OIUA 1DKRA 2ORWA 2HBQA 2ZRAA 3H11A 4GRAA 6Q21A 2WSSD 2JGEA 3L18A 1N5LA 4JQSA 3LBHA 4DB2A 4HLDA 1L4UA 3PK0A 3L7MA 5DGDA 1BS9A 1PFVA 3KUXA 4HAZA 3TQHA 4DM7A 3FR8A 1BMDA 1XCPA 1AN9A 4KH1A 5IARA 1NFFA 3VYTB 5DOZA 5EYPA 3KZOA 3C5CA 4QRHA 1ISPA 1DIRA 2EGUA 1M8FA 3EAGA 1R10A 1YDMA 2RKOA 2NQ2C 3HFRA 3UUFA 5ICFA 2QT9A 3A1WA 2UKDA 1U0FA 3P52A 5GONF 2OYCA 3SMVA 3C6XA 4GF5A 3FDIA 1Z0ZA 2JIMA 2VDPB 2J3EA 2W83A 3PICA 3GOHA 2WHPA 3R75A 2XCQA 1N2CB 2EW2A 4UUBA 3QVMA 4WCFA 5E2IA 1RMTA 1SUIA 4B4KA 4ENTA 3ZXIA 3T3OA 4JLAA 2B20A 1YB6A 3VO9A 5IKEA 1CXZA 2VP2A 4YMUA 1ZICA 1XXHA 4LCJA 3CONA 4DF3A 3DV9A 3ODGA 4DR5B 1A8PA 2ZXEA 4LKRA 3ZE0B 1G2IA 1E79A 1JDZA 1C2TA 2GPSA 2YS7A 2H1RA 3ISTA 4WVFA 4C7BA 2XD4A 2IX9A 2XPCA 4FOSA 3JZIA 3SE0A 2OCIA 4HNUA 1B4DA 4S24A 3LRTA 3F1KA 3R9WA 4DCCA 3I01M 3HPRA 2PR7A 4EFLA 2RGAA 3AI1A 3HSKA 4YJ2F 1PS0A 4PC3A 1GV0A 3VNBA 3UH0A 5K0JA 1OLSB 5B4VA 5JCOA 3K73O 3JQAD 1M2NA 4F4FA 1DWOA 4TQAA 1C0LA 3BM5A 4NDNE 3AJRA 3FB1A 3I0MA 1AHIA 1V5IA 4TLAA 2CEAA 1PK9A 5GJBA 1GUYA 5ESWA 2IGBA 5FLYA 5G4KB 3OCZA 4TXMA 1FRQA 1GR1A 4WESA 2FW9A 2XVXA 3L8YA 1NN3A 1FS4A 4J0GA 3BCRA 2WJJA 5GZ6A 4G85A 2W6ID 4JOQA 3HCCA 1CZLA 1A95A 1WUYA 2ZYIA 2C2HA 1QQTA 1WHTB 1GCAA 2BKAA 4RIGA 1Y8CA 3TTTA 1EFTA 2OP1A 3RC2A 4MQ6A 3UTDA 2FPGA 4NLLA 1FL9A 3KR0A 2ZAYA 3I1YA 3RBXA 3U26A 1EP1B 1HG0A 2ZUCA 3ZWPA 4Q6BA 4F6LA 1G42A 1HFKA 4IQ0A 1E6KA 2PZJA 5TJHA 4NU0A 3ZDZB 1GG5A 1OFUA 2ZSEA 3F5DA 2IPLA 1P4SA 4MVCA 3CPSA 4QDZA 3SYNA 2AR0A 3EIXA 1Z8HA 4M9UA 5JXHA 3AUUA 1NV9A 2WDZA 3DOUA 4QBGB 1P44A 3AGPA 4QOEA 3WAKA 5CFOA 1SVWA 3ESQA 4J29A 3OCCA 1NRWA 4RD1A 4UZEA 1O94D 1TFUA 3L3BA 5LZ7A 1F3LA 5CA0A 4EX7A 2XKJE 1E2IA 2R65A 4BWGA 2P9HA 3CUSA 4LNUA 3VR5H 1J9ZA 1PZFA 3UICA 3LP5A 4OCZA 1R0SA 4OGLA 4DA0A 3X2FA 1SD5A 3GJRA 2C7OA 2ZI4A 4A2CA 2EFYA 4HUQA 5D00A 5CU7A 3RABA 4P53A 4E12A 9ATCA 2YQ5A 5LA6B 1V71A 3CNNA 5C1PA 3DLBA 3LM8A 4WXHA 1U2GC 4KIUA 4YBRA 2WB4A 2W2KA 5AI8A 2BP7B 3RV4A 2GNPA 3LVRE 4NABA 1KYIA 5FJJA 3RK0A 1E2GA 1E62A 2HKIA 3C7DB 3W2HA 3ZCQA 2F7SA 1PP4A 1F14A 3FJYA 3EDMA 4L3VA 4LHVA 4LXUA 4MEBA 3AOEA 3KYJB 1KMQA 3QFTA 5CNKA 1XPUA 2JJ1A 4DJ5X 2PUGA 3HNOA 2VVTA 2JLRA 3KKZA 4BX2A 4E08A 5DNCA 4O1MA 4XARA 3F8TA 2HSDA 2QTRA 3ICCA 1ADBA 2EJBA 1K06A 4EX6A 1FA9A 4OHXA 1KOFA 1EWKA 4DHEA 4R01A 3WZMA 1CC1S 1UKCA 4J0CA 4BVJA 3TZBA 5I8WA 5H8WA 2GWRA 3AI2A 2BI4A 2VT7A 4HN2A 3OZTA 4Z0NA 1FLVA 1NSTA 4REOA 3EGWA 3QV1A 5DV9A 4YDHB 1RU3A 3E27A 1DBSA 5HF6A 3II6X 4US0R 3WDKA 3VX4A 1JIQA 3MQFA 3DMNA 4TLCA 2AN4A 1PF7E 5C31A 2NPFA 4MUMA 3TTXA 1YR2A 3PJDA 3FPEA 1QONA 3IA2A 1J21A 5IJZA 1N9GB 4JKIA 5KS2A 2JARA 5CTAA 3GA0A 1N9ZA 2I2AA 2PKCA 1WPRA 1H6BA 4BEWA 3RJ9A 3U4MA 5BP7A 3ZIAA 1LDEA 1H5NA 3NOOA 4UDYX 5BO5A 3F9IA 4YASA 4QFMA 3RO7A 4GP6A 4ZAGA 1NW7A 3DVSX 3T1NA 4CQMD 4RGBA 2VP4A 5A3VA 3SIXA 1QLWA 5CBPB 3TPFA 2L69A 1W35A 1WZUA 2ORVA 4UJ5A 3W3AH 1H8HA 1YFJA 3M4XA 4F7WA 2Z9CA 5EN4A 1LRKA 3J81k 5IZCC 3TVYA 2R6ZA 1E3SA 1GCOA 2WUVA 5AXDA 4C03A 4QYWA 4AMUA 5KCZA 3H9JA 1J0DA 1CYDA 1BDHA 1NTOA 3PUIA 4U9HS 2V5AA 2BW0A 2C4TA 2HLNA 1NW8A 2AG1A 1N8KA 2ZATA 3GCGA 3UCEA 2ZBPA 1I14A 2YMPA 4QWMA 2JFUA 1E0SA 5DSZA 5EHZA 5JZVA 1SPBS 3JSAA 4HVCA 2M6KA 5JARA 2QLLA 2RJNA 3ZS8A 3E9DA 4YMWA 2VYFA 1GZSA 4M1OA 2GFIA 3TSAA 3KIPA 4TLEA 2JLBA 4X66B 3QLJA 1WEKA 2FUEA 4ZVLA 2G9NA 4HNHA 2IQIA 3K9NA 4A91A 4UHHA 5K0NA 4RFSA 3U9LA 4CM3A 2PRYA 3HL4A 4RGVA 2QVCA 1DCMA 1PJ2A 2AE2A 4YGYA 3VPCA 3W9YA 4Z4EA 2R96A 3QBEA 5LQNA 1NDQA 2AIRA 1N1MA 2PJZA 2PWAA 3GDFA 4JBGA 4NBNA 4AS3A 1X7XB 4FZ5A 1UXHA 4WCFC 3G5LA 2BKVA 3M81A 4JQZA 1BMFD 2VUHB 3ONNA 4NF2A 4ES6A 2R4TA 2NZ8A 2JIBA 3LC1O 5K8JB 1ID8A 3TQSA 1HEYA 2H7VA 3F47A 3K70D 1TM3E 1QO7A 1FX0B 2I3AA 3BVPA 3C4JA 4WKBA 1DBRA 4EWLA 1QQBA 2E82A 4D44A 1CUDA 3Q2OA 4KRXA 1ZK1A 5CXQA 5ESXA 1FUEA 1QHHB 1Q0PA 2DPHA 4UAVA 3UJHA 4B71A 1P1BA 2GK6A 2H57A 4W5HA 3HJRA 1C9EA 1BKYA 3TOZA 3I1FA 5B5SA 3CNBA 4ZZIA 1GQOA 3CX3A 1XTPA 3A0UA 2EZUA 3QE2A 4S12A 3WQBA 5AM2A 2WK1A 2VCEA 2B37A 5AOVA 2YKGA 2XTMA 1SOAA 4UASA 1CUJA 2KQUA 3G82C 4WJZA 1PJQA 2WD7B 5DZSA 1MIOB 4CM8A 3P45A 2NP7A 2FV8A 2VSFA 2JJ8A 4NENA 3T7DA 2WNHA 1QYRA 4BMDA 5ARDA 3MWFA 4LVNA 3SIRA 3RS3A 5CB8A 5JT1A 2FMHA 3SHOA 4JUBA 1I4EB 4TXNA 1X1TA 4BNXA 2HREA 3Q7EA 1B8VA 2A92A 1PS9A 2XYHA 1LJUA 1E1CA 1LPAB 1P75A 2WTMA 4GPD1 2PXAA 5A0FA 1XKXA 1GRVA 1Y4SA 2ZS7A 2BCGY 2I78A 3ONVA 3OZRA 3PT5A 4PO1A 4W7SA 3EWNA 3ESDA 1Z6ZA 2IPMA 5FBVB 4GPAA 4D46A 3ZJVA 3EZ2A 4OOFA 2YIMA 1WKCA 2B34A 3EULA 4KODA 2MMCA 1GKLA 3S3TA 4E21A 4LTNA 3THSA 3RGGA 4ARSA 3GIWA 2XWSA 3QTBA 2O57A 4CETA 2CB9A 1EVIA 4L27A 3C1AA 4YMLA 3CINA 4B8ZA 2AYXA 5JY6A 3ZVMA 2P62A 1EK0A 4G67A 1OC2A 2CXNA 3VU3A 3HKCB 3IQWA 1D4AA 2BM1A 1J8FA 1NQOA 1VHLA 4PICA 3S2GA 1IXSB 2XB2A 3BPSA 1JH8A 3RAGA 4MVJG 3THYB 3MXTA 3MBKA 3MRVA 1JBEA 1OE0A 2W7TA 3OFNA 4ZARA 3RVBA 1QKJA 4FFOA 3AESA 5HFJA 4A5OA 4HGYA 1HMPA 4G8DA 3IHWA 1P9LA 3HB0A 4U9IS 4LDPA 5HTOA 4EYQA 4O33A 3DQZA 2P9QA 4EYKA 2X8LA 4MRPA 1N3IA 5C5DA 1OLXA 1CZUA 2CNNA 1FX1A 5EFZA 4R1OA 4EHBA 3LT5A 3JD2A 4GO1A 1N5RA 3JQQA 2F1HA 3K5IA 1C4KA 3LGSA 4IIBA 5H0IA 3WGLA 1N2HA 1XZAA 3DGFC 1ULBA 3R5HA 4EPXA 4N76A 3F3SA 1ULAA 2I8LA 2R87A 2R7KA 2FEXA 2GM5A 2V45A 4U63A 3WE7A 2XCUA 3K1AB 2JLYA 3AOGA 1BXGB 4PQFA 1MO4A 4N47A 2LBPA 4ATNA 1WW8A 4M9SA 4MQFA 2VJPA 4FWTA 4LHEA 5I48A 4MWOA 4HGZA 3SYMA 2VTKA 3OSZA 5HCUA 4URXR 3TQIA 3RV3A 1NVGA 3BX1A 4OQFA 3BWBA 3PXEA 4UFNA 4PFQA 2GBIA 2JAHA 1G3IA 1KERA 5F1OA 2P2LA 2PLAA 4H7JA 2CXTA 4RDCA 2GN8A 3MN1A 1BWSA 3B1WA 1IY8A 3TLBA 4G24A 2XYPA 1UPAA 4KB5A 1E1DA 1MH1A 1RE1A 2FSIA 2HSZA 5DLQC 3B2QA 3H4TA 3EUAA 4J7CA 3WKDA 2FZEA 4RW0A 2IXEA 2IXDA 4KQEA 4CN9A 1CZOA 3SN6A 2QW1A 5AH0A 1DU4A 1F4LA 2J5QA 5ALLA 3NS7A 1SXJD 1HFEL 4CFZA 3TGLA 3EXHC 3RYHB 3A26A 1DDIA 5K51A 1VYVA 2V9CA 4ZHQF 2XUZA 1Y4ZA 3W8FA 2H5EA 3T7AA 1SRRA 1S8OA 4K1LA 1O77A 4HRYA 3PDIB 3O2JA 4AMYA 2C92A 4BKOA 5FBQB 1JG6A 2J9FB 4DDHA 2BOVA 5B7PA 3KBBA 3SJUA 5K0CA 1ZUWA 2W2PA 2XUPA 5KNDH 1LSUA 1AXRA 2QTHA 5FBWB 5H83A 3WIDA 4A8HA 2G80A 2O8FA 2BHTA 1PLKA 5K7SA 4A27A 2ZJ5A 1OGYA 3F73A 4CUJA 2ZBQA 2IZ0A 5CRIA 4JP1A 3FYSA 4X44A 4AY6A 1WJGA 2Y77A 3EC7A 3WTBA 1DDGA 3DOOA 4RY0A 3IJ5A 2C5LA 2OCLA 4RD0A 3GHYA 3TE7A 4F4CA 1A9XA 1NAHA 1WXWA 3QU2A 4R69A 4JYCA 2IUUA 4DOMA 1ZLXA 1PZGA 3TLCA 3IGFA 4Z7OB 2OZVA 3L1UA 1NBWB 3LBAA 4IMPA 2ZI7A 4ZC1A 3I04M 1C9MA 2DT5A 3U7QB 1R4NB 1ADYA 4TYQA 3F6RA 4MA0A 1EZ1A 1KEPA 1NQWA 4HHEA 3MRXA 4U6SA 5DISB 3VTAA 4CG1A 2WMYA 4MH0R 3IKLA 1CX9B 3TQCA 4V3CA 1NF3A 1WPXA 3K1ZA 1VLJA 2G6BA 3MIIA 4NDAA 3ZG6A 3S7ZA 2HMSA 4NMLA 2IHYA 4R1MA 2D1QA 1TA4A 2IXBA 5LLDA 3Q3HA 3BWXA 3ZLJA 2VHXA 4X41A 4IL5A 5CK4A 1WBBA 3RVMA 1NGSA 1XZLA 1QO0A 3P9SA 3ZE6A 5KYYA 1E9BA 2R1UA 3C98A 1SB9A 2I71A 5F23A 5KSZA 1JKMA 5IPFA 1DKUA 4U9UA 2ERCA 1TCAA 2A9QA 4RTQA 4NZMA 3G7UA 1DRJA 4FSXA 4CODB 1A27A 2WT4A 1EHCA 1UKYA 4UVIA 2RGBA 2GSDA 1BHO1 1A98A 1EFRD 4FR2A 2VJBA 4M99A 3G2OA 1KI9A 3L1VA 4D82A 1TVKB 2F8TA 1EDOA 5EZ6B 3L77A 1G8JA 4JI0B 4C78A 2JLSA 3RS9A 3MB5A 3TAHA 5KCMA 4BMSA 2MIIA 3OJCA 4WFQA 1SVSA 4GPZA 1ZSYA 3GBPA 1TJNA 2DLCX 4P4UA 1IEQA 3CUVA 3TEFA 2NSYA 4BN0A 1MF7A 2DQKA 1EVQA 1SC3A 1R9JA 2HY7A 4XQ0A 3WLFA 5IULC 5A6VA 3WRXA 2Y0DA 3T15A 2YFHA 1QHNA 1SU8A 3MWEA 3TBFA 1GTRA 3GVIA 4C4AA 3MOIA 1KNQA 3HM2A 5KTTA 3DZFA 2ZZNA 4YI5A 3QBVA 1K88A 3CR7A 5F1YA 4EUEA 1J06A 1FTYA 3AERB 5AESA 4KC0A 2O1XA 5AUPB 5JBNA 2C4HA 2O8BB 3VBEA 3ZR4B 5C80A 2TRSB 3NV9A 1PFQA 3WKBA 1L4KA 5CCXA 2C99A 3LKDA 5AK4A 5FOSA 2AUMA 4ILKA 1Z0DA 3CCFA 3KOOA 5HIKA 4ARAA 5A2QA 1E3IA 1DT3A 3NP7A 2VP3A 3QF4A 4RENA 4B82A 4B3TB 2FOXA 4TTTS 1CF2O 3UG7A 1R1DA 1RTKA 2PMDA 1NUAA 2V7EA 5G40A 2G72A 2JH8A 2HRCA 2WOJA 2FH5B 4RHCA 4UQPA 5U4XA 2OUIA 3SOZA 4FTWA 1X7WB 3F8WA 3W3ZB 2VT6A 3VH2A 3SWWA 2ODTX 2YCLA 2N47A 3TZEA 1PN3A 5P21A 4AZ3A 3UJDA 2IHBA 3INRA 4JC5A 1SVKA 5DNEA 4X00A 2QL9A 4BFVA 4BWVA 4AIRA 1XRQA 1M5TA 3RBVA 5DLEA 1EBBA 4U0JA 3PFNA 4ZICA 1L7BA 4KO3S 2VDRB 1LXCA 2EIXA 2PKYX 3HSSA 4M0LA 4NECA 4Q4LA 1MPTA 4E2WA 4LDQA 1RQPA 3N2NA 5KINB 3AR4A 3WQQA 3R5JA 4MOWA 4ZC8A 2XUKA 2JW5A 3GOQA 3M0EA 4KQGA 2G5PA 4OK6A 4WADA 4MMXB 4P84A 1P61B 1ZESA 1JQDA 5I5GA 3P4XA 2FFQA 2JI8A 3NPMA 3A1NA 3CB4A 3GRYA 3P9KA 3GYGA 3ASZA 3M6MD 4MKXA 2ZRLA 5LMNB 1QFZA 1H69A 3LI2A 5LFAA 1YZNA 2XCIA 3V6LA 3ICWA 3A9RA 1I4TD 2C84A 3GD5A 2NU6B 3O74A 1L2TA 3DF9A 3EZGA 1U4OA 4M9ZA 1R0YA 1D2AA 4DIOA 1JSXA 2Y6UA 1UOPA 2XHEA 3DOEA 3Q3GE 4X8MA 5DRTA 3SDBA 2FHPA 2ZIUB 3CKMA 3MSCA 1JPUA 2YHUA 4RLFA 1X77A 4CFYA 1XTSA 5CDFA 4E3ZA 3G5MA 5J4YA 1ZIDA 2JEYA 2OK8A 2WZCA 1O95C 1A77A 3DDZX 3K7EA 1U04A 3O9VA 3R5XA 1Z4KA 4GWLA 4CQLA 4F1KA 4M0EA 2WUEA 2N9UA 3SYKA 5ICGA 1M6VB 1QX4A 3PRKE 1M1ZA 4Z2AA 4NYMQ 1IJFA 1JHXA 2WSSA 1JLSA 1ODFA 2VI5A 1N32B 3P5BA 2VATA 2I99A 3GJ3A 4WXRA 4UAGA 3WB0A 3QEJA 3FZEA 3WRVA 1XSEA 4DFDA 4ZOBA 3BA1A 6GPBA 3BYZA 3DLPX 4UNIA 1G4UR 4S1OA 4Y1RA 1MABB 2NZ2A 4WTOA 3ZYZA 5I7OA 1C1YA 4OHMA 1VPWA 1AO3A 2AD1A 1EP2B 4GICA 2XUGA 3ZK8A 5C8YF 1ZISA 1TGVA 3SQDA 1T43A 2VTBB 3CN9A 1DXQA 1TYEB 2QMQA 1R6AA 2VA9A 2ZP1A 5COQA 1E61A 1Z4IA 2QD3A 2VNSA 1EEXB 4PZ9A 4X8HA 4C88A 3JQ7B 1M34A 2VJYA 4QJ3A 4DILA 3KC2A 1WW3A 3G0OA 4HNQA 1WCIA 2O3TA 2X3YA 2DETA 3W5CA 3EG9A 4DLYA 3OFKA 3PUHA 4C0QC 3C7TA 4IXWA 4EZIA 5EE0A 1EUZA 2HQSA 4E5DA 4G5HA 2OGUA 3F9CA 3MB8A 5KAMA 3NHJA 2C3PA 4FYHA 4V3BA 3T3MB 4BRWA 4BGUA 3CH4B 5T57A 1NJ6A