4CIBA

Crystal structure of cathepsin a, complexed with compound 2
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
454
structure length
413
Chain Sequence
b'RAPDQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LYSOSOMAL PROTECTIVE PROTEIN
publication title Crystal structure of cathepsin A, a novel target for the treatment of cardiovascular diseases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 150
structure length 413
sequence length 454
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 2013-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cibA00
1UOOA 1VZ3A 1EB8A 2BFNA 3O4GA 4H7FA 4ZRDA 4J0JA 2FJ0A 4DNOA 3O4JA 3DLTA 2ZYSA 4QLAA 4OYLA 4WFKA 3GZJA 4N8DA 4BAZA 2WHPB 1SCQA 2ZJ7A 2XMZA 2BGRA 2WTMA 3HYSA 4BRSA 4G4GA 2O2GA 4LXHA 1B6GA 3E1GA 3ICWA 4IH1A 2GZSA 3LCRA 4FFWA 4ZGBA 2HU7A 1UFOA 3F67A 4GW3A 1LNSA 3I6ZA 4NMWA 2WLSA 4WDQA 4HRXA 4PSUA 3A70A 5LZ8A 5AM1A 4KEAA 1J06A 3RLIA 4QDZA 1LZLA 5AM0A 1YS2X 1VKHA 4X6UA 4DIUA 5ISMA 3PFCA 4OU5A 4J0IA 5DNWA 2O7RA 1LBSA 1A8UA 4X93A 4EY7A 3H2IA 3IUMA 1QIEA 4J0CA 1ORVA 2PVSA 1IUNA 5CH8A 5ALJA 1BEZA 2XUJA 1E8DA 4A23A 4W9RA 2BJHA 5T4FA 3D59A 2R8BA 2GBCA 5JALA 4EY4A 1T4MA 2XLCA 1XZAA 4M0MA 4RNCA 1MAHA 5C81A 2V9ZA 4FLFA 1EVEA 3IVMA 4L0CA 1XKTA 5BV7A 1XZMA 5FV4A 3VVLA 2WSLA 3K6KA 1QONA 1CUJA 3PI6A 3QVMA 4UHCA 3EQ9A 5CXXA 4B9EA 1GT6A 2HADA 1ORWA 3DJYA 4BZWA 4CG3A 1DWOA 2DR0A 1JJBA 3DS8A 1LPBB 5ALPA 1QJ4A 4QNNA 2C5GA 5DYYA 3WWDA 3R3XA 4HRYA 4I4CA 3DKRA 2I3DA 2OG1A 3NGMA 4UHDA 1CUWA 4D9JA 3ZLTA 5D3ZA 5A7HA 2XMDA 4HS9A 2FUKA 4LKOA 4F0JA 1BROA 1CUVA 2EDAA 4GECA 2QKYA 4OB8A 4ZREA 1QZ3A 5EHNA 3VKFA 1UWCA 3DD5A 3OC0A 3B3QA 1C4XA 4EZIA 5HF5A 1XQVA 1NX9A 4W1SA 5DYWA 3QZUA 1W6RA 5K3FA 4F21A 4FMPA 5C8XA 2RHTA 3E0XA 3C6ZA 3STVA 3QPCA 1CUDA 3B5EA 1LLFA 2OCIA 1QIGA 4AO8A 1CUEA 5ALHA 4MYSA 2OCGA 2QZPA 2JGIA 5AK5A 3WLAA 4UBOA 4X6XA 2HHAA 1QOZA 2RONA 1S8OA 5AICA 5JADA 1GZ7A 5JAUA 4OU4A 2WUFA 5EI5A 3TGLA 2E3JA 3EF3A 2HDWA 1JU3A 3WQHA 3L1JA 5JANA 1K63A 3QMWA 3WL6A 2XB6A 3DEAA 4KRXA 1QIIA 1H2YA 3AIOA 3WKCA 3OPMA 3ZWQA 1GPNA 1FFBA 1CUIA 3HZOA 1B41A 5I8PA 5CT4A 2WIKA 4Y2QA 1YB6A 3M3DA 5ALNA 3DOHA 1MX1A 4ETWA 3D3NA 2VQ6A 1YA8A 4X95A 4UBNA 3R3YA 2XI4A 2XDWA 1DWPA 3V1MA 4AO6A 4HTAA 3V1LA 2J3DA 5D6OA 1XRMA 5K3AA 2JEZA 4Y2JA 2HRRA 1GKLA 2XMBA 3GUUA 4KYVA 3FLBA 3B12A 1QE3A 2Y2UA 1VJ5A 3ESCA 3PE6A 5JD4A 5SYMA 2X8BA 2WJ4A 1I6WA 3TEJA 2WIFA 1ISPA 3WK5A 5HKAA 3X3HA 4IH9A 3WL7A 5LIPA 1XFDA 4BP9A 1U8EA 3OG9A 2QUBA 1K4YA 2JF0A 5JASA 2YH2A 3I1YA 4CFSA 1L7RA 3A2MA 4J3JA 1ZD5A 3JW8A 2C5FA 3RKSA 3FVTA 5AH0A 3K9BA 2GYVA 4C4YA 5AM4A 2PM8A 5CTAA 3VJLA 1ODSA 1H23A 3H19A 2BUBA 3OOSA 2OAGA 1QFSA 1KU6A 1XZFA 2HL6A 3D4LA 4K5QA 2EDCA 2OXEA 1YAJA 4B0OA 5LZ4A 1C7JA 3GROA 3C6XA 4GI1A 5EHXA 5YASA 3R40A 4H7EA 1YAHA 4Y2RA 3F8SA 3OURA 2PBLA 5JATA 3WJ1A 3O4IA 4BVLA 1CUBA 5A6VA 4FNMA 4N5HX 3IB3A 4FDMA 2I3ZA 3LP5A 3STWA 1R3DA 4J0DA 1XZKA 2PUHA 1JT2A 2VTVA 5EHQA 2AJLI 2IIVA 4B85A 4WFIA 4YK7A 4QDOA 5ALGA 2JGEA 1RYYA 3KWJA 2VT6A 5ALQA 1WCYA 1L7AA 2C7BA 3FLAA 2Y2VA 4BC1A 4W63A 2XE4A 4DMKA 2BAGA 1DT5A 2H9YA 1ZIYA 1YSCA 3NOXA 2XUGA 4DNPA 3S8YA 2V96A 4N8SA 4EY5A 2V97A 1K8QA 4CCWA 4WJLA 5C7YA 1MU0A 4E15A 4M0FA 1EXWA 4INZA 2LIPA 4P93A 4HXGA 1R50A 1UOQA 4IHAA 4PO3X 3L1HA 3DL4A 2JIDA 2K2QB 4GXNA 1CFJA 3EQ7A 5ALMA 2DFPA 4GEGA 2VSQA 2H7CA 5ALDA 4G8DA 1TRHA 3OTQA 4FBMA 1MPXA 5ALIA 2XUKA 1IMJA 2YASA 1HLGA 2I78A 1HBJA 3IBTA 3C8DA 1CQZA 1N5MA 3HACA 1KU0A 2ZYRA 4IH4A 2HA6A 1BS9A 4PSCA 3I2IA 1UZAA 1O6GA 3ANTA 3BIWA 1EDBA 2RAUA 3H04A 3C8HA 7YASA 1QIHA 4AQDA 1XZLA 3G02A 3UUFA 3WWCA 1Y37A 5LLSA 5I7UA 2P8SA 1EI9A 4U2GA 5KWIA 1DX6A 4AMYA 4Y2PA 2VT7A 3MVEA 1DINA 2GBIA 4C4XA 3ESBA 1FFCA 1VA4A 1CQWA 2PU7A 5AI6A 1EHYA 4F60A 2WIGA 1MX9A 3C45A 1ZIXA 4BTVA 3WL5A 3STTA 1AMNA 3P2MA 1ZJ5A 4P92A 4AX4A 4UBKA 3IIIA 4BVKA 4LYEA 4EY6A 4WDRA 4QWWA 5AOCA 2H7YA 5D3KA 4MXDA 1CUXA 4KAFA 4UFNA 1TK3A 2AJCA 3SC2A 4BAGA 3LS2A 5AHXA 1ZJ4A 4QDTA 5DNVA 1UT6A 3S2ZA 4BB0A 4MQLA 4O08A 1AURA 1C7IA 2Z8ZA 4PSDA 1THGA 2HA0A 5HKBA 2ZJ6A 1W1IA 1VXOA 1XROA 1XZGA 4L9AA 4GDMA 4JUIA 5AOAA 1OILA 1XLVA 2ZJFA 1NU8A 2WIDA 2HA3A 3HC7A 2QXTA 1R88A 3HABA 1KEZA 3ED1A 1H2WA 3GELA 1QO7A 3RK4A 2EEPA 2ZYIA 5JAOA 4CCYA 5HK9A 3QITA 3T52A 2CB9A 5A71A 3C87A 5LZ7A 5HFAA 3MUNA 4EY8A 1TAHA 2HA5A 4W1QA 4OD0A 1RP1A 2ONCA 3I2GA 2WHRA 2PX6A 4FTWA 4WCVA 4AMZA 1AZWA 3FYUB 2WTNA 3KOOA 1EX9A 2B61A 3IUNA 3C43A 5AK6A 1QIFA 4YASA 4LXGA 4FLMA 5AM5A 4OCZA 1PJAA 1QGED 2ES4A 3IDAA 1LBTA 1EDEA 2ZSIA 2B9VA 1HQDA 2RIPA 3LIIA 3V9AA 4G9EA 2Y6UA 3SK0A 2JGFA 4U2FA 3W9BA 2HU5A 3PFBA 1XZEA 2I03A 1BCRA 3FCXA 4MJ3A 3W05A 3V1NA 4UFOA 5T4HA 3CCCA 2ZSHA 1BRTA 2XMSA 4U2DA 2PU5A 4RGYA 3U1TA 2PL5A 5CH3A 1AKNA 2WQZA 5HF9A 4MWSA 4W1PA 1DT3A 1EB9A 3I6YA 2VAXA 4DNQA 1XQWA 2PSFA 2UZ0A 4KACA 4KAJA 4B80A 4XVCA 2ZVDA 4FBLA 3ANSA 2WU3A 4G4IA 4UUQA 4QDUA 3EIOA 2XQKA 1H2XA 1YCDA 4U2BA 2CZQA 3IUQA 4X91A 5JARA 3RM3A 1UK6A 3G9XA 5HQ3A 1E8MA 4H7JA 3VVMA 5KREA 1ZI8A 3JYHA 3D5EA 4KE9A 1P0IA 4H7HA 4W1RA 2GBFA 3D0KA 4GHWA 1R1DA 1WPRA 2DHCA 2QJWA 2OGTA 3WA7A 1CUGA 3BDVA 4B9AA 2HIHA 1FFEA 3W04A 5FUMA 4BDSA 1OXMA 2QR5A 2VEOA 4H18A 3M81A 2XT0A 3F97A 3KWFA 4S0XA 4UBIA 1MO2A 3DQZA 4QWMA 4J0HA 3GFFA 5ALOA 2B4KA 3GBSA 3CN9A 4CIBA 3W9UA 5ALEA 2QOEA 1JMYA 1TCCA 1WHTA 1JJFA 4Q82A 5DYTA 5DJ5A 1DQZA 4IQ4A 5AI5A 1CUSA 1LPAB 5DWDA 2YYSA 3HEAA 2WG0A 4LXIA 4UHFA 5BWBA 4P08A 4CIAA 4Q3OA 4X6YA 4YX9A 1WPXA 5AI8A 2ORYA 3I2JA 4JH0A 3HXKA 4MEBA 1JMKC 1RWQA 4OUKX 4JYPA 2DQYA 4G9GA 3WWPA 4FWBA 3PF8A 2ACEA 4EHBA 5JZBA 4DSZA 4FKBA 3D2BA 3KXPA 1UK9A 5AKEA 4DMHA 1VA5A 1ACJA 2DQZA 2HFKA 5I9IA 1XRLA 5AKXA 3AINA 4AO7A 3L1IA 5F4ZA 5HK8A 4B7ZA 2Z3ZA 3F96A 1QIDA 3DL7A 2HRQA 4BRZA 1WHSA 5CT5A 2XUHA 2GZRA 2RGUA 2XUOA 4Y2SA 4BZZA 5CH5A 1J2EA 1MAAA 3H1BA 1CLEA 5ALRA 3G8YA 4NS4A 3E3AA 1ETHA 1U4NA 3BIXA 4EA6A 1QIMA 4UBJA 4B82A 5DNUA 2C58A 1IVYA 1AUOA 4LYDA 5AP9A 3BWXA 5A7FA 1PV1A 2DCMA 3WMRA 1EINA 1TCAA 5AKHA 4KJXA 4U2EA 3BF7A 3C5WP 5E2IA 2WHPA 5CRIA 3WK7A 3PUHA 2GBGA 4A16A 1UK7A 2HA2A 1MX5A 2QXUA 4RE6A 5E4TA 3D7RA 4X94A 2AJ8A 3DCNA 4JEIA 2HM7A 3FYUA 4N5IX 1SCKA 5FRDA 1R9MA 2XLBA 1XLUA 1BCSA 4OB7A 3DYIA 1J07A 3H2KA 5EGNA 1QLWA 2WM2A 4HXEB 4C89A 4HVTA 5HF6A 5K3EA 5AI4A 4BCDA 1VE6A 4RE5A 1CV2A 4G5XA 1QTRA 3HI4A 3ILSA 3R3UA 5D7BA 2XQFA 1W52X 2PSDA 5KWJA 2NW6A 4ZV9A 1XRNA 5AOBA 5EIHA 2G5PA 1L7QA 3C5VA 3WYNA 2GYWA 3STXA 5HZGA 3UUEA 4BVJA 3AIMA 4H0CA 3HJUA 4DLNA 1NU6A 4DGQA 2CMFA 4FNGA 1H2ZA 3G0DA 3H2GA 3F98A 3QMVA 3N2ZB 1A7UA 2O7VA 1FJ2A 5A7GA 2XMRA 1HL7A 4FFVA 1SFRA 3QPDA 1X2BA 1DQYA 1PFQA 3MUOA 1IUPA 2CKMA 4FLEA 4KE8A 3C70A 1VZ2A 3G0BA 1FFDA 3R41A 2XMGA 3K2IA 3EQ8A 5ESRA 5IVHA 5JAPA 4GWLA 4UHHA 3I2HA 1FFAA 4BBZA 1TCBA 3H17A 4J0GA 3STYA 4WY5A 3WYDA 4AZ0A 5FKJA 4NVRA 5K3BA 1T2NA 4H7KA 4UHEA 5JD6A 3D2CA 5FXMA 1VLQA 1VXRA 2WFZA 1LGYA 5CW2A 1BE0A 3TJMA 5K5EA 1IUOA 1ZOIA 2IX9A 3IUJA 5AKKA 2Y6VA 4KRYA 1AX9A 4K6HA 3VISA 3FSGD 3O0DA 2OAEA 4OYYA 1JKMA 2VJBA 3FCYA 3QYJA 5JYCA 3O4HA 3DNMA 3G9TA 3F9CA 1U2EA 1XRRA 2QTBA 1N8SA 4XJVA 4F5ZA 4ITVA 4ZV7A 3BF8A 3BJRA 1H22A 2CUTA 3W2TA 3QM1A 2D0DA 3AILA 2O2IA 4K6GA 1MJ5A 4DMCA 2RI6A 4ARAA 4RPCA 3DOIA 5ALKA 4MQMA 4Q34A 3HSSA 3AZPA 1CUAA 5IVDA 3LLCA 5AI0A 2QRUA 4K2AA 2VAVA 4M0EA 5IVIA 5LZ2A 3O9MA 4QDXA 1E5TA 4J03A 5AIBA 1JFRA 3M83A 1U65A 3QH4A 5ALWA 3G0CA 3FAKA 4P9NA 4GLBA 3AJAA 3BL8A 3IURA 2WG2A 4Y2XA 3G9UA 3Q8WA 2QVBA 5K3DA 4FHZA 3I28A 3WK6A 3KSRA 2OCKA 2DHDA 3KDAA 2OCLA 1YR2A 5CMLA 5DTJA 1ZGCA 3ZPXA 4BCCA 4UFPA 4BE4A 1ZICA 1ZD2P 1EA5A 1XRQA 5EFZA 1XZCA 3W06A 3WZLA 3DKKA 4Y2TA 3H2HA 3IULA 2QT9A 1CUYA 3BXPA 1ZD4A 1LZKA 2J4FA 4CG1A 1OCEA 2JGJA 1O6FA 1UKCA 4YPVA 1WM1A 2X76A 1ZI9A 2WG1A 4EUSA 4Y2VA 4AZ3A 3G0GA 2XUIA 4B0PA 4FOLA 5CT9A 1YS1X 2JBWA 2PSEA 2OLEA 3R0VA 1EDDA 2FX5A 5C8ZA 2WHQA 5ALUA 5JD5A 3ICVA 4QE3A 4B84A 3D2AA 4X71A 1Y7IA 4JYMA 2XUFA 5ALVA 5C8VA 5AK4A 2VA9A 2CJPA 4OB6A 2JEYA 1Q0RA 2D5LA 2VATA 5LZ9A 1D07A 1G5FA 4DSAA 2WJ3A 2WFLB 3UMJA 3WIBA 1ODCA 4I19A 1IZ8A 4Q05A 3N0TA 1K5PA 5AO9A 3JWEA 4I3FA 5FP0A 3Q0TA 3A6ZA 2XUDA 4BAUA 3WKAA 3LIPA 3PUIA 1AQLA 4C4ZA 3BJMA 4GBGA 1P0PA 1LPOA 1E89A 4L72A 4B6GA 4XWGA 4BC0A 4X85A 2ECFA 1CR6A 1XZBA 3HLKA 5JIBA 1CUZA 4BATA 1ODTC 5ALSA 5EHZA 2C0PA 2DSNA 2O2HA 4ZWNA 1MNQA 3CN7A 3RARA 3I6MA 1Q83A 1CUUA 3WZMA 1DX4A 2G5TA 2OPHA 4Z49A 4KE7A 2PUJA 1JU4A 3VDXA 5H3HA 2OQVA 1MTZA 1WB5A 5T4BA 1K6EA 1VOTA 1CEXA 4E11A 4PNZA 3O95A 4PF1A 4N8EA 4B83A 1GKKA 4X3CA 5AKLA 4X00A 1Q84A 1E8NA 4HAIA 4CI9A 5CT8A 2G63A 2OQIA 2OGZA 6YASA 5AKIA 3BE8A 3CXUA 1YA4A 3I2FA 4X7BA 3I1IA 2ACKA 3ZV7A 3U0VA 1SCIA 3AFIA 1HKHA 4HZGA 1LPSA 4MWTA 2XQGA 1CVLA 4BTLA 1E3QA 4UHBA 1THTA 3IA2A 2BKLA 5J3JA 3WWOA 1CUCA 2XUQA 4NZZA 1TKRA 4G8CA 2QM0A 2WIJA 2G4LA 3WK9A 1A88A 5ALFA 2B20A 5AKYA 3AUKA 2HFJA 3A2NA 3VJKA 4DNFA 3DYVA 5E4YA 4ZXFA 1M33A 1BN6A 4HXFB 5ALXA 5AKGA 4TGLA 3DDUA 1G4HA 2JGLA 1IZ7A 5AKJA 4PQEA 4Q1VA 1EVQA 4DTCA 3WKDA 4L3WA 2WJ6A 5HCUA 5LYYA 4Y9SA 5ALLA 1XLWA 1WB6A 1GPKA 4BCBA 4TPKA 1N5RA 4J0KA 4KE6A 4UBMA 3SWWA 3H2JA 3SX4A 5K3CA 2PSHA 3G0IA 5AIAA 4G4JA 5EIEA 4IO0A 1TQHA 4J7AA 4E46A 4JNCA 3O9VA 2XQJA 4Y2UA 2VF2A 3WL8A 5HFNA 2GYUA 5IKXA 3EBLA 3QPAA 3STUA 5FPQA 4H7DA 1JI3A 4K6KA 1WB4A 3WKBA 3WWEA 3FYUC 4ZI5A 5FPPA 1Q0ZA 1QIKA 1N1MA 1USWA 3AIKA 1ZD3A 1Y7HA 4G8BA 4XX1A 1R4ZA 2Z5GA 4MEAA 5AM2A 2OGSA 4CCYB 5CURA 1XZIA 1XZJA 1BN7A 4DYHA 1EK1A 1SC9A 1BU8A 4WFJA 4C87A 4U2CA 2C4HA 2J4CA 3I2KA 2BUAA 5LKRA 1DWQA 1W75A 3QBJA 1XRPA 4OSEA 1GPLA 3OM8A 3ESDA 2WKWA 4PV7A 3WKEA 4BE9A 4AB1A 4UPDA 5JZ9A 3FLEA 3R3ZA 2C0QA 1JJIA 5FOQA 2XUAA 2HU8A 2H1IA 2CEKA 5A62A 1ZGBA 5IH7A 2YXPX 1J1IA 1G42A 5AM3A 4PW0A 4QA9A 1CPYA 1CIJA 2V98A 1MNAA 1QO9A 1EK2A 2RHWA 3C6YA 1ZI6A 5CT6A 1XQYA 4BP8A 3VJMA 1W4LA 1UOPA 3H0CA 3WI7A 2Q0XA 4ARBA 4BDTA 3G7NA 1YB7A 1GGVA 5FLKA 3T4UA 3CCBA 1GQRA 1YASA 3PDCA 2VJDA 2HA4A 1UK8A 1XZHA 3G9ZA 3R3WA 3C6BA 1GQSA 2X5XA 2WFLA 1A8SA 4V2IA 2WUEA 2Z8XA 3AZOA 3QMMA 2JGKA 4H7IA 2WFMA 1AC5A 1MN6A 1F0NA 1QTIA 1WOMA 3AZQA 4QLOA 5LKAA 3A2LA 3WK8A 4OPMA 4LHEA 1UKAA 3WJ2A 4X92A 1ACLA 3E4DA 5AKZA 4KAAA 2XMCA 5JAHA 5AK3A 5BWCA 4C01A 1QIJA 3HRHA 3YASA 5HQ3B 2XMQA 2W22A 1AGYA 4ROTA 4BYMA 2QJRA 1X70A 3FWHA 1XKLA 1DU4A 4Y7DA 2FJPA 2QUAA 4CG2A 4G1FA 5LZ5A 3TRDA 1P0QA 3KD2A 5ALYA 4EBBA 5BOVA 1FSSA 2R11A 2W6CX 5K3FB 5T4EA 5E4JA 3H1AA 3NWOA 4AN0A 2QMQA 3ESAA 3FNBA 4Y2YA 4E14A 5ALTA 3WK4A 1E66A 1QFMA 4XIIA 1CUFA 1F0PA 2VJCA 1W76A 1CUHA 2PPLA 2WU4A 1XQXA 5JZSA 2WUGA 4Q3LA 5HF8A 1A8QA 1EH5A 3GA7A 4QZVA 1GXSA 2ZYHA 2J3QA 4X90A 1HPLA 4C88A 1VE7A 2HA7A 4DMFA 2WUDA 2PKYX 5SYNA 2AJDA 1MT3A 2BGNA 2BUCA 4A5SA 1LPNA 1LPMA 3M82A 5KBYA 4UBLA 2Y1KA 3FOBA 2XUPA 3ZLUA 5DLPA 4TVKA 4WY8A 5EIAA 1UKBA 4C6HA 3R3VA 5LP1A 1UXOA 5IVKA 2VJAA 2Z3WA 1X2EA 1SOMA 2ROQA 5ALZA 2IITA 2BCEA 1G66A 3BDIA 4X97A 4LIPD 5AJHA 3V1KA 5A2GA 3NUZA 1TIBA 4DM7A 3WIOA 5CBKA 1F8UA 1XZDA 4B81A 1DTEA 3WA6A 5AI9A 2WILA 3FVRA 3V48A 3ZLVA 4H77A 2AXEA 4QEKA 2XQIA 5CXUA 5FDFA 3ZI7A 2PSJA 4EB0A 3VXKA 3PICA 2CBGA 1CRLA 2DHEA 4MYDA 5DTIA 4KR0A 3FYTA 1LPPA 3FSGA 4H35A 2AJBA 3PF9A 4AN1A 1R9NA 2H7XA 2JGMA 1F6WA 1P0MA 3H18A 1BEEA 1Z68A 2QS9A 3MGAA 3FBWA 4AXBA 4Q3KA 1HDEA
chains in the Genus database with same CATH superfamily
2J9XB 1UOOA 1IBLB 4EVSA 1KERA 3GLIB 4F9EA 2YJ3A 3WTBA 4COKA 3ZVMA 5IC5A 3TLYA 3CW9A 2ALJA 3II6X 1RBYA 1GL3A 2VDUE 3O4GA 1B42A 4H7FA 4JI1B 3WQSB 4BKQA 4FNAA 5ICCA 5KHOC 3NASA 3PDIA 2PD3A 1GDDA 3O4JA 3S5JA 3S27A 4BPBA 1YIOA 1JDBB 2DVMA 1IY0A 1OZFA 3B52X 1N34B 2HDNB 1VLMA 4DEXA 4IIUA 4V0LA 4N6OA 3RS4A 2GI4A 4BAZA 2WHPB 4C20A 2PMFA 3TIVA 3MJ4A 3ONWA 4UU8A 2BGRA 2PK3A 6Q21A 2D0OB 1TNDA 4X54A 3RW9A 1H6CA 5AVWA 3U9SA 3GR6A 1SIOA 2EFEB 2J6HA 3ICWA 3AVPA 2VG8A 2MMCA 2O7SA 4LXHA 4RO0A 4RVNA 4UNNA 2A1IA 1E5LA 3LCRA 4HB0A 3MINA 1B26A 3RRBA 1L7VC 2FPKA 3GJ4A 3I6ZA 4JLUA 3M70A 4WDQA 3W78A 3HKBB 1V47A 1KEUA 1M1NA 4HRXA 3RFFA 4PSUA 1XPUA 2G7MC 3A70A 4ZP1A 1ABEA 1QJCA 1OC2A 4B7CA 4K40A 2HK8A 1NQWA 1HORA 1LFAA 3UAXA 1W1UA 1PR3A 3DPSA 1T35A 2J0EA 3JPYA 4K86A 1Z4OA 4G5OA 5FORA 3WWYA 4C7VA 4CKCB 3ZJTA 2ZJ1A 3FB4A 4IAOA 3TR6A 1Q44A 5IFLA 1NVTA 4NHOA 1TF2A 4X6UA 4CODB 1AN0A 5C53B 1F38A 3PXAA 1Y1LA 4F3NA 3K70D 2ACWA 3GXBA 2I8AA 4B09A 3GY0A 3LT4A 5B3JA 2GNOA 3ESZA 4M83A 4Y18A 4HNVA 2QNBA 3ADKA 3B6JA 3RYHB 5I4CA 5E2BA 1G9TA 1W85A 3TM5A 1Z7WA 2V59A 5KYVA 3AQIA 4ZU3A 1U2GC 3CVWA 3AEQA 3IUMA 5FADA 3SNKA 2AR0A 1GR0A 2P68A 2NLOA 2FETA 3RSCA 1DJOA 4QNMA 3PLAE 5KYUB 5C5IA 3AHGA 1DBRA 1VJ0A 2BGUA 3KQMA 4RPIA 4F4JA 4N48A 3JV7A 4MW7A 4OGFA 5CH8A 2XCSB 2V9PA 2C9DA 3L77A 3MFYA 4HDSA 1XTPA 3EUAA 3U3DA 3GLVA 3W4IA 1I3CA 2XNDA 1E8DA 1GNPA 1TXGA 1ZGZA 3TRKA 2JJ1D 4HSGA 2HW8A 1YHNA 4NJEB 1NP7A 3D59A 3GJ3A 2R8BA 3GVXA 4RZ2A 1XK7A 3QEJA 1XNGA 3NX4A 3F1LA 5DBOA 5IDVA 4E5UA 5JALA 5ES3A 3VPXA 2IOHA 1VL8A 2XLCA 1S6YA 2VF7A 4GQBA 1IK4A 1G3UA 5IWCA 4MVYA 3LX8A 4D3DA 2Q4DA 1PJLA 1ML3A 3RG8A 3DHYA 5C80A 2B5VA 4NONA 1VMKA 3AF5A 4ZMBA 1UP7A 5FBKA 4R5MA 2VF4X 1TX4B 3RVOA 4RA9A 1XE3A 4L75A 1V9SA 4MVJG 5D3MA 2QQ0A 1P6QA 4RHTA 1NXOA 4L0CA 1I01A 4YV0A 2IZOA 4AYTA 3T7KA 1HTWA 1VG8A 1FDSA 1XKTA 4NATA 1E69A 1ORRA 2C2HA 3GJXC 1A4XA 3IRUA 4I1SA 1O5IA 3BCSA 4CKZA 3SGLA 1XD8A 3MUFA 2WSLA 4H08A 3TCNA 3PI6A 4UHCA 3B9PA 2W2LA 3F9RA 4QULA 3R8CA 2YNMD 4FC6A 5TQ2B 2OEPA 4B9EA 4DTIA 1JH9A 2O19A 2AG0A 5T3YA 3UAOA 3VNSA 3BKWA 4ZVQA 5F2EA 2VJMB 1HOTA 4FT4A 4G89A 1GT6A 3IVGA 1Q7RA 3TKAA 1Y1SA 2WVAA 1RKXA 3IT0A 1N3BA 2DR0A 2QJFA 5BSHA 2SKCA 4M9CA 1E2MA 3LA8A 1EUQA 1OBVA 1E1CA 1YGYA 1M34E 2EP7A 5KQPA 1SKQA 1QJ4A 1B14A 2W5UA 2AZTA 3EGWA 4PIMA 1CNEA 1MW9X 3BJEA 1W88B 1OH7A 1FP7A 3A6DA 4TLMB 1W7AA 3RJTA 4TMZA 3ZHCA 1JEEA 5JSFA 3NHZA 1QKJA 4PHGA 4Y6QA 3FDZB 2CF6A 4QOJA 3ZK7A 2Q5QA 4L74A 4UHDA 3OZBA 2OT3B 1Q0UA 5LYJA 3TQOA 1Y8AA 2Q8PA 4D9JA 5DNCA 3DFMA 5JQGB 1J0DA 1HF3A 4D4JA 1Z8NA 4YRTA 2JFZA 3A4VA 5IU6A 4AMUA 2W98A 2XMDA 4HS9A 4B7XA 2YQ5A 1PP4A 1L3CA 1SVSA 2FUKA 1KPHA 1V3VA 2FSVC 2VO1A 2EDAA 2GCOA 4K8RB 3RJZA 3S2EA 1AO0A 3FPJA 4LHXA 3VZRA 4DR6B 4HGQA 3VH2A 1QZ3A 2ZIVB 1JI0A 5EHNA 3VKFA 4DWWA 1UWCA 2NU9A 4IZOA 4MYUA 4BEBA 1C4XA 2JEOA 4YJKA 2UV8A 3E05A 4EZIA 4ESEA 1CP3A 2D54A 3RS3A 4YJ3A 2LV8A 1CS0A 2VSXA 2Z2IA 2D8AA 1UZMA 2IU6A 3GNLA 4CQNA 1H3EA 2O7QA 1M3SA 3K92A 1NKSA 2V7VA 3EK2A 4NI5A 4MK4A 5LXTA 1XU7A 3QZUA 4ZZ2A 1W6RA 5K3FA 3KJHA 2GTPA 1TEXA 1RI5A 5MN5A 3QXSA 3A6LA 2EWVA 4I5DA 3IT3A 4BNGA 3V7NA 1M6WA 3P0HA 1P2VA 3X1DA 4PYIA 2AG6A 3OKAA 3OQBA 1U7ZA 4NU0A 5B2EA 5I7RA 1Z0SA 1CUDA 1E2JA 3B5EA 1H8EA 4R40A 3MJEA 3PR3A 3BCRA 3FSJX 1DZ3A 1K1EA 1LLFA 3NR2A 4MO2A 3KS9A 1GNTA 1NQXA 4MP3A 4PTLA 1A9XA 4IUCS 1FTWA 2V4MA 3KOXA 3P97A 7REQA 1PEYA 3UMBA 4DV2B 4HWOA 1D3AA 1TIKA 1P7CA 1BS2A 1KR5A 1RKBA 2YHIB 5B7PA 2RB5A 1YZGA 3PD1A 1TL7C 3NAZA 2JGDB 4LQCA 5DHTA 4TM8A 1L7NA 3AOEC 2AE2A 2AXPA 3T3DA 3WLAA 1CQIB 4G1UC 2R7AA 1SEPA 4YAEA 3WGIA 3A2KA 4GP6A 5F1OA 2HHAA 3KOZA 3Q8LA 1QOZA 1I7NA 1UP4A 1Y9AA 1UEJA 1ULBA 2FRVA 2QJTA 2MSWA 2VWPA 5EXSA 2C61A 1H3FA 1PG2A 2WZBA 3S5UA 3KL4A 3TO5A 3W6OA 5IDQA 1FY2A 1JFFB 2PDAA 4EA8A 5JAUA 5JAIA 1KOGA 3DKPA 5EJEA 3RIEA 3E15A 1JALA 1O0SA 4ZVSA 4CDGA 3R5TA 2FP4A 3AUTA 3N86A 3T9DA 2E3JA 4HC4A 4R16A 3QVXA 4BKUA 1Y9DA 5LBUA 1UDRA 1WCIA 5DULA 2CD9A 4RDHA 4XM0A 1JU3A 3FKJA 3TXXA 4DUPA 3DTTA 3F5MA 2O5RA 1K63A 3N8IA 3QLVA 4Q16A 3I23A 5DGHA 3REQA 4GPAA 1ZA1A 3DZGA 2R1UA 3H4TA 1RAFA 1OAAA 3JX9A 1GAJA 1QIIA 1R37A 2CLDX 4PXSA 3ZWQA 2GEDA 1RPTA 4LV6A 5CTJA 3CM0A 5BRNA 3HZOA 1DEHA 2HGZA 3UCEA 5I8PA 3MT8A 3NTXA 1SHZA 4A1FA 2ZUDA 1YB6A 1DCTA 2VXYA 2FPPB 3H5LA 4QUHA 5ALNA 3O74A 3WISA 2IIBA 1IJKA 1RKUA 1EAMA 1S2LA 4YAGA 3BTVA 1LF5A 2ATCA 1RBQA 2RAVA 3ZCPA 4A1OA 4X95A 5KYWB 1UANA 4FOSA 2GK7A 1GY8A 4RF5A 1JE0A 4HT3B 2XDWA 2Y68A 3ZJYA 3PYLA 3ESRA 1YB1A 1KWGA 4HTAA 4YH1A 4QXMA 2P77A 2WYIA 3V1LA 2J3DA 2VTEA 4AT1A 1I10A 2Z2XA 2H52A 2JEZA 4O02B 2OENG 4Y2JA 4ZOLA 4BMYA 1DAKA 1QH1B 2HRRA 2XMBA 4BN5A 4KYVA 4UTNA 3FLBA 1VBFA 2JNWA 3ZHYA 3K1TA 4BMZA 5JPCA 4K6FA 2I6QA 3HB4X 4E08A 5JXWA 3PXBA 1RHQA 2NU6A 3KP1A 1WW8A 3QJ5A 4GWKA 4DYDA 1F8GA 1VJ5A 4F85A 5K8CA 2HJ9A 4UZEA 1L4GA 3NBUA 4TVSA 4WLUA 4N65A 1ZY2A 4Q12A 1ISPA 4Y6RA 1EXDA 1RYBA 4YV7A 4PC6A 121PA 2D06A 4B6PA 4B8ZA 5LYJF 2HCFA 4D9HA 5A4IS 2VTBB 4IH9A 2H4FA 4RHCA 3NWBA 2XA2A 4GG1A 2GJSA 4KXFB 2FRXA 1QZUA 4BOYA 1XSEA 2WWWA 3LUFA 1AQYA 2Z57A 3T41A 5JI3E 2ZDQA 1TMOA 2DBZA 2XYVA 4B33A 5JASA 3N70A 2A58A 2G6TA 3UANA 2W2MA 4A92A 1ZUD1 1M1YA 5TJHA 3ABIA 2FPGB 5E1DA 2B4RO 2KW5A 2DETA 3RC7A 4PBSA 1SU4A 1ZD5A 3BXGA 3ZNPA 1FIUA 3JW8A 2E0IA 2C5FA 1H65A 1F5NA 4WKPA 3IL2A 2XOEA 5E1BA 2WMYA 1N3LA 4I9UA 4G4SP 3OA0A 4O4JA 3DV2A 4EUFA 2IEZA 3HYNA 3WB1A 4IF4A 2EGGA 2QB5A 2ZRDA 1DJLA 3OLVA 3UEOA 4DV0B 2DM6A 3QU2A 5CD9A 4CN8A 2AH5A 4IWXA 3OKFA 4YMIA 1GG5A 4ZPJA 3SR3A 1DAMA 3PC3A 1A9OA 2BSQA 1A9SA 3QEMA 1P2TA 3M2TA 2BUBA 3PIIA 4LRXA 5F5LA 4GF5A 3K94A 4AMVA 1QFSA 4XVRA 3V5NA 5ILOA 4BN4A 5CB6A 4TMTA 3U4IA 1XO1A 2NADA 4JUAA 1ECLA 4R2LA 5DU2A 1TCUA 2OXEA 5IXSA 1G1MA 1XEXB 5E8JA 2PAAA 3BQNB 5CNJA 3V7YA 3WGVA 3I12A 4X5OA 3RJ5A 5A4KA 2IYQA 3TW4A 5JJLA 3QE4A 5LZ4A 2CXPA 3O31A 4XW2A 3IALA 4CLOA 2V8OA 4OQNA 1QAOA 4WLEA 3C6XA 1N92A 5BW6B 2NSLA 5IDXA 4GI1A 5JJIA 4WAUA 2VA8A 5YASA 1E62A 1X15A 3KXDA 4DXHA 3R40A 1RJ9B 5DVZA 1USUA 4CM8A 3F8SA 2RH9B 3ORHA 3VR1A 3EYAA 4KXNA 4DQDA 1NDHA 2XDQA 5F1PA 2J7PA 5JYDA 3I3OA 1BCRB 1TYZA 4ZT5A 4XASA 2EQ5A 3E7XA 3R8XA 1JV2B 5J43A 4XWOA 3JQ8A 3EIWA 4XUDA 5F64A 5EP4A 2OOSA 2HSDA 1LI4A 1W4CA 2RI1A 3BXHA 2DFLA 3FYDA 4L73A 4D46A 3U1VA 3DLHA 2IL1A 2AOVA 3M89A 4ZTBA 1JLKA 3DE2X 1RWNA 2FLVA 4JQSA 1P4JA 3LI2A 4N5HX 3H5TA 1J7KA 3P4XA 4FKMA 2C07A 2WRZA 1EWTA 3GRCA 4XD7A 1VE5A 5IEJA 1AQJA 4IYRA 2FUEA 4EA9A 1ZVQA 4A5OA 4RTJA 2MINB 2OC9A 2Q99A 4EARA 1XZKA 2EERA 3FHOA 4AIRA 2WP0A 4RD0A 2G1PA 2JLZA 3AM3A 1RS0A 3O8LA 4PN3A 2AJLI 1D09A 3E9CA 4UMDA 1G8AA 5EMHA 4B85A 3D8RA 4F8JA 5JVDF 3E5NA 4BQQA 3RWOA 2CYCA 2X0KA 5KINB 1ID8A 3HZHA 2P6OA 4KXQA 5ALGA 5F73A 5FOSA 4ZCIA 3LC2O 1ETUA 3ZQKA 1BQ3A 1ADBA 2OP1A 4MRMA 2VT6A 4L7QA 5TGDA 2A9OA 4E5MA 3V8BA 2MYUA 2IH2A 4RIEA 2M1XA 4JBYA 4MGHA 3TDKA 3FNEA 3BHJA 2VHEA 2C7BA 2CFRA 2Y2VA 4DC9A 4NBLA 4ZU6X 1Z2NX 4W63A 3UGQA 3LZDA 1PLJA 4C0HA 1EJ2A 2ZB4A 5FNVB 4ZOLF 2H9YA 1BH6A 4YAUA 2XUGA 1WX1A 5IULC 2E89A 1M2VB 1CB7A 1HYBA 3OF3A 2V96A 3OZWA 3DKIA 1RJGA 2UVDA 1LH0A 3GLHE 2V97A 2EW1A 2Y8EA 2GVDC 4NKRA 3TAUA 4EUKA 2PBZA 4CCWA 5F9MA 1AKRA 3AUUA 1NSYA 2ILVA 2PX8A 4GIBA 4M0FA 1A82A 3IAUA 2CKDA 3HJCA 4M1TA 2C2GA 3VPCA 2W2KA 4W8OA 4HXGA 1ATIA 1TTQB 2O3SA 2A5LA 2W9XA 4Q37A 5K09A 4OYHA 4OFZA 3LL4A 2IH5A 1IBRA 3Q8XB 4M8IA 3RTDA 2P1ZA 1ZR4A 3KQYA 1KO4A 3MN1A 4IIFA 4YT5A 4LE2A 5KX5B 5LJIA 2NG1A 3DH0A 4HDMB 3NVMB 4YQYA 3OE5A 4CR7A 4PTYA 1CRZA 4HMQA 4HCJA 4TYPA 5HBGA 4PG7A 1TJPB 5BN4A 3WP1B 4TXJA 1YVPA 2ICAA 2EKLA 4JU9A 2YHAA 3IX7A 1BYIA 4MB0A 8ABPA 2H7VA 3ACCA 1C8VB 1R15A 2GM9A 3OECA 3PVZA 4O4JF 4MUBA 3OCYA 4ZYWA 4XXHA 3RAPR 3UQZA 1E6MA 1EFUA 5DHFA 4CEHB 1JPJA 4MPJA 2Q41A 5FHQA 3ZE8A 2GCEA 3DGEC 4JP2A 1X94A 1MPXA 1WPGA 4OKIA 4CKWB 2XUKA 4Q5IA 3WGNA 2J0UB 4ZEMA 1XEWY 2FHSA 2BBTA 3IPLA 1U2DA 2VT2A 1YE5A 3IAEA 1NNI1 3IBTA 1OWOA 1G63A 2AIRA 2WT8A 2OBLA 2QL7A 3SC3A 1EFHA 3HP1A 1UEIA 2ONZA 1ZNZA 1I2CA 3TXYA 4LJ5A 1Q0TA 4A03A 2IF2A 3KSAC 1H85A 1FDUA 3BILA 2ZT7A 3ANTA 1QRDA 4L8YA 1USGA 5B4UA 1EDBA 1ENZA 3GA0A 3MT7A 4BP1A 1WTAA 1N6PA 2XXAB 4PNHA 2JK1A 2D59A 4RIIA 3GU3A 5E3JA 1FQOA 5TRTA 5L7WA 1FRVA 3AUFA 4L6CA 1E9BA 1SD1A 1XZLA 5DP1A 2OMKA 1LBEA 1KSFX 1V3UA 3TSWA 5ABPA 3KT8A 4ZI7B 4UTPA 1YS4A 1IQPA 1GR1A 5I7UA 1DG3A 2CLEB 1KE1A 1DX6A 5KVQA 1II9A 1JUDA 4MV0A 2O8DA 4KFTA 4FZ3A 5DN9A 3MZ0A 5COQA 5J4HA 3SU8A 3WNVA 3H1GA 1FFCA 1JIXA 1KZ4A 1MXHA 1PVVA 3VZSA 1ZHFA 4BQPA 2VSNA 4RU1A 5B3LA 4AJOA 5AI6A 4YPOA 2JGAA 1BGVA 4M53A 5LA6F 1T4CA 4ZRMA 2JLWA 1FUKA 1SXJB 1C1DA 1IULA 3T7RA 2GM4A 4RABA 3FWNA 3QVOA 4BTVA 2HQ1A 5D6NA 4GE0A 3UT0A 1AJEA 3SMVA 4QYXA 2JHFA 3PHLA 5GGXA 3IBFA 1KI3A 3OT4A 4M0PA 1AMNA 2FPSA 3P2MA 5FO0A 5K1ZA 3NEPX 4CUJA 1AKTA 2PV7A 3LT0A 5DIZA 4J2TA 4D4LA 1QO0D 1TU4A 3TQIA 2ZCJA 3TOXA 5EKDA 4H6WA 4ASUD 4LGVA 4EP1A 2QPOA 5AOCA 3U39A 2VQDA 3TE7A 1QHHA 1XIVA 2GTIA 1PS0A 4EW3A 4NBWA 2FH5B 2NQ2C 4I36A 4Q1EA 1SA0B 3MA0A 4QOIA 1GZSA 1WULS 1KA9H 3ZCQA 4TTQA 3QU9A 3HXMA 2WAOA 2EX1A 2RHDA 3HP4A 4NABA 1TYAE 4HV4A 5HCIA 3DOFA 2RAPA 4LECA 4RESA 3FE2A 3HHPA 2R7MA 2B9EA 5F2OA 1GNSA 3HN7A 4MV5A 4YMVA 4CEIA 1RQNA 4YROA 5FD8A 5G1NA 4S2EA 4YUZA 4DMMA 5IX8A 2FSHA 2P8JA 2XRZA 1E1MA 1E64A 3SFTA 1KJNA 2I67A 2VSOA 1XVUA 2FFQA 4QDTA 1PLLA 3PGJA 1E20A 4HH1A 3O21A 4IJ6A 4QGBA 5B6IA 2FCAA 4N82A 2ZI7A 3GNSA 5DBEX 3QOWA 3THOA 3ZDYB 4UARA 3WAGA 1RHRA 4PGHA 5E7MA 4JLDA 4MDEA 1E2LA 4TL7A 1L6IA 1J00A 5EPEA 3QUCA 1LCIA 1JA1A 4FR0A 4BNIA 4MQLA 1W94A 1NUTA 1Y5NA 4LG1A 3L1KA 1QG0A 1C7IA 3PNKA 3PQ8A 4YRGA 1NHWA 1Z28A 4PSDA 5HJEA 5CA1B 2C7OA 2FMXA 5KC8A 4XOIA 1W1IA 3JAWB 1XROA 3QTLA 5EWLA 2BR3A 4UC0A 2VHXA 1QHNA 1XZGA 4L9AA 4UE3S 1NULA 3UM9A 1A8IA 4GDMA 3TZQA 3JD3A 1IK6A 1NR1A 5C35A 3RU9A 5BSWA 1IQ0A 3MJRA 1WMBA 5IBPA 2ZJFA 2WIDA 1GPYA 1LBIA 3MTQA 2QXTA 1V95A 3ZUGA 2H2WA 5JNRA 4HUTA 1BJKA 1DPGA 1SR8A 1KEZA 5J63A 4IFEA 3W8NA 4ND8A 4WLNA 4XCXA 2UVPB 1QO7A 3V8RA 5JYCA 4PXYA 3RK4A 1QHIA 2EEPA 4CMEA 5C1IA 3PUVA 4B3JA 3Q87B 821PA 1C9KA 4RTKA 3RV3A 1Z63A 3DM5A 2FSFA 3T52A 1HT3A 4B2IA 1VLHA 3OUTA 2FUG6 1X8LA 5G53C 4XI9A 5DI9A 2CE2X 3I5MA 4RZSA 4DR3B 4HPXB 5BSRA 2V7QA 2HIGA 3N53A 4P7GA 5LZ7A 2EJWA 2F9MA 3DZCA 5JSZB 1RQXA 1WA5A 4EY8A 3AM1A 2HA5A 1YS6A 3BREA 2NZUG 4WK2B 2WHRA 1UBFA 2IEGA 3RSQA 3WE7A 3WLKX 4JQCA 1B76A 1K0FA 1M67A 4P84A 1I24A 1TCVA 1ESCA 3BX1A 4XYBA 1X7YA 4UD6A 2RGNA 3L6EA 5IZCC 2EQAA 3TTWA 1C9JA 3GC6A 5TS2A 4JJFA 2WU0A 4FTWA 5I45A 2DMRA 1J56A 1NVEA 4QQFA 5EXEA 1HYHA 5FL7A 1WU8A 4XM1A 5A4AA 1JHQA 5G2OA 3WGKA 1TGVA 2PZFA 3LTEA 1CRPA 2B61A 3NONA 4H17A 5LNK6 4ER5A 2X0NA 1H4QA 1PW5A 3RYFA 2XE6A 4Q3NA 1XX6A 4IDEA 1BW9A 2QVLA 4WXYB 3U9TA 2NO4A 4JMPA 4OGLA 2O8BB 1KXJA 4JN6B 5GJCA 3L6OO 2JD1A 4BO3A 5K0FA 2AXNA 3AW9A 4JY7A 1PWHA 1PJAA 3V6LA 2IYVA 2JI6A 4YCNA 2Q29A 4MQEA 3J81k 1JEOA 4AUKA 1VMAA 4OFWA 3N8NA 3QENA 1KS9A 4JKYA 3TPCA 1C8BA 1GPUA 4F2HA 2JHGA 1VGRA 1I32A 1OPXA 1AVTA 2X1HA 3IAS6 4HWGA 3TCKA 3UHOA 5CDFE 4C1BA 3GFGA 3LW8A 3HKDB 3U7JA 3KOYA 2PXCA 2IEIA 3TZ6A 3VJRA 1PGPA 2B8JA 1QTNA 4BU0A 1E94E 2FZCA 3CUYA 3BWBA 1ZJZA 1E1NA 1ODFA 1TM5E 3CWQA 4N9WA 1BD4A 2CVFA 1HQDA 1UFKA 2F1IA 2NXEA 2P4EA 2RIPA 3UHPA 1HLDA 2XEXA 4TTPA 4EFLA 4ZJYA 5JO0A 4HLUA 3V9AA 3LCUA 1L5GB 4G9EA 2Y6UA 3KVOA 3KZNA 1MRZA 4IQ0A 1QMGA 2YYYA 4U2FA 4Z9AA 1UZNA 3N87A 3PFBA 4NC9A 7GPBA 4AKEA 3RCBA 5H8WA 3N59A 2QMZA 3RVNA 4YAFA 3WZ2A 3ELBA 2JAOA 2IGTA 2JKVA 4K9KA 4L57A 3HCWA 4MJ3A 1F8YA 2RDMA 4UUMA 5B53A 3RANA 4UFOA 2ZRJA 5EY5B 3TQSA 3MPOA 5HUQA 3EYWA 1VBKA 1GDHA 2ZSHA 3PIRA 1Z4QA 4X1KA 1R3UA 4Q6WA 2LCQA 4U2DA 5A4FS 1KJJA 5FUVA 3U1TA 1YBFA 1TKAA 1NI3A 2Q9UA 3UFBA 4KPGA 2IOYA 3AKCA 4JCCA 5FOUA 5FEUA 4I5EA 2QW8A 3QJGA 1SQ6A 1U3TA 2FEPA 3LKVA 1YO6A 1MO5A 2Z4SA 4LK2A 3TIGA 5DMHA 3ZWDA 5CM2Z 2YN0A 3RUDA 3TB4A 3WX0A 1EEXB 2QUHA 4F8EA 2ON6A 5EINA 1VMIA 3HKCB 3F7TA 3I6YA 4EJFA 1RWOA 1KJIA 1RQRA 1B8NA 2UZ0A 1QWSA 4QBFA 3MAAC 4NK4A 4U7JA 3U49A 4KAJA 3LY7A 2ZBVA 3HUFA 4IMJB 5A3VA 2GMWA 2ZI6A 2EWMA 3WGLA 1YFZA 4FBLA 5LOVA 3SPXA 1VGVA 2WU3A 3OCWA 3X1KA 1G8KA 2D1TA 4RF2A 4LJKA 4EPTA 3PGKA 3EIOA 5EWMB 1QLHA 3VYSB 2GT1A 2YXNA 1YCDA 3S99A 4F71A 3WGYA 4IRMA 5CNMA 2GVNA 2PL3A 3G9XA 2VBGA 3PFGA 5HQ3A 4G0UA 3B2NA 5HKKA 4ARZB 4NV0A 1XNQB 1D8AA 3UOAB 2X5NA 4GKAA 3EC2A 4H7JA 1DE0A 2C92A 1T43A 1ZGHA 2C98A 4L5CA 3URMA 3UW1A 1N6LA 1QPBA 2HEGA 4PBTA 5KKAA 4DDMA 3JYHA 3W8FA 5JFOA 2P9EA 4GPIB 5KREA 2ZM5A 3D5EA 4MZDA 2IS1A 4JR1A 1HQYE 2OZLB 4EJSB 2GBFA 4CF7A 1PL0A 1YE3A 2RHRA 2CHGA 3LRXA 3FMPB 4HLCA 1YQXA 3EMVA 3W5IA 3FGPA 3BD7A 3EDQA 3DBLA 1DQRA 5MFPA 2QJWA 3DE7X 2DTDA 3NKFA 4LYAA 3TVDA 3UGKA 1PT8A 4E3ZA 2BFWA 3SZOA 3LA6A 4N54A 5K01A 1CUGA 2HPVA 3ZYCA 4ZHSA 4EW2A 3W6NA 1BJRE 4ZYYA 2BTOA 5AT1A 1AKUA 2F1JA 3V2HA 1GL9B 4UW9A 2SICE 2BKEA 1FFEA 3PD7A 2WYWA 3LUBA 1ADYA 4KU4A 3QA9A 2EX4A 1AOXA 1BEUB 1QG4A 3DMTC 2QR5A 5LQRA 2RE8A 3GT3A 3JQAA 1S8NA 2ZJ2A 1JSRA 3F97A 1KIMA 3KWFA 4ID3A 1FFWA 4S0XA 5ADUS 4HFNA 2DB3A 2MMGA 1E4VA 3C5HA 4KHZA 4AICA 5G3ZA 4A15A 1D2MA 1E61A 3V4SA 5IBCA 5EHIA 5KSOA 3GEPA 5ERXA 5B58T 3DQZA 4D80A 4R71A 3P9CA 5WRFA 5ALOA 2XYPA 5F3DA 3GBSA 2VHWA 2YICA 1E9EA 2D1FA 3G85A 4MJXA 1OB5A 4GWGA 2DXIA 1GPDG 3DHNA 3IH5A 5ALEA 3Q6NA 1JMYA 1L5MA 4IKPA 3X1ZA 4B8YA 4Z7NB 2I22A 5KTMA 2BFAA 2ZYAA 2ET6A 1ILWA 3HJHA 1NV9A 4NH4A 1JJFA 4Q01A 5C4MA 4KOEC 2FLWA 1DFIA 1G7RA 1X86B 3ROTA 4M9UA 5DJ5A 1ZK2A 1BU5A 1OI7A 3C3CA 3JVIA 4B3BA 4E88A 4GMXA 3BMOA 1CUSA 4DIBA 4MUJA 5BUQA 5CFPA 5DWDA 3RRZA 1EBFA 1K0UA 2YYSA 1PWZA 5CD1A 1Z06A 3HEAA 4KXLA 2RGYA 3PQ4A 1PZFA 5IJ0A 4KC0A 1Z22A 4INJA 2M9MA 3AEKB 1QH8A 5BPFA 1HI9A 8MHTA 1D5WA 4DLAA 1WTCA 1QRRA 2CVPA 4P08A 4TSFD 2IRWA 4YJHA 2ZDGA 1EHCA 1ECFA 4X6YA 4AJJA 5K0BA 3PL1A 1EUZA 3V2UA 1TT5B 2R5NA 1RBZA 2V6BA 5KTOA 1EJ0A 2FZWA 2GF2A 3AFOA 3BMQA 3BORA 3QVTA 1IH8A 3OIDA 1BGWA 4N5NA 3ZDEA 4URHA 4V1CB 5AI8A 1KVTA 3MYYA 1RWPA 3GMTA 4IEFB 4WBSA 5EQJB 5A05A 4AKTA 1KZ7B 4CL8A 1NRJB 4JH0A 3HXKA 4CMBA 2WPDA 4NYMQ 3AR8A 5H9WA 4U02A 3QELB 4C04A 5EC8A 3BIOA 2F6RA 4EGFA 3HKEA 3H9QA 4K6OA 2PGNA 2I99A 2RGEA 1UDXA 4BFYA 1U94A 2JS7A 1MABA 3NOQA 4MVWA 1ECBA 4RJ2A 3LZCA 3WWPA 3N7AA 3AF0A 3T8YA 1X9HA 1NAHA 4EAQA 1OH8A 4C2TA 1TLFA 1M2NA 1X8KA 3WNBA 3EWNA 1IN4A 2EBWA 2PYDA 5KOIA 1A5TA 2R6HA 1G8MA 4KMOA 2G09A 3K8OE 3DOOA 4K6MA 3LO5A 2E21A 3CLRD 3VVCA 3ZV4A 4K1XA 4ER7A 4EGAA 1IWOA 3KTAA 3K9GA 4FE7A 4DMHA 2DLNA 1Y3DE 3VAZA 4FYPA 1XRLA 4KQIA 1RE0A 1UJ2A 5DYGA 4R68A 2VWGA 2DFDA 3DUFB 1ZJYA 2XCOA 1GTVA 1QIDA 2YXBA 2ZROA 4HSEA 4L6IA 1UBNA 3KPVA 4PEVA 1RPNA 2R6JA 4KR9A 2XCUA 4XKJA 4YJGA 2M6LA 4MV9A 3GGGA 3VV2A 2AI2A 4JT9A 3K9FC 4B87A 4ZK6A 2FWMX 4D0NA 5MHTA 4EVIA 4KQHA 3EIUA 4ENQA 2F59A 4OATA 2IW3A 4D8TA 1Z5NA 2PMWB 4AVYA 3UBTA 4C4SA 4AQYB 3E35A 3ST7A 4DV7B 4KQFA 4HNGA 1KZ6A 4PONA 3KFLA 1Q50A 4P0TA 3MWDA 1UJMA 2D8MA 4L8FA 3DCYA 4QT0A 5D1HA 5DRYA 4WD3A 5JH7B 1U9YA 3VPSA 2PWZA 2FZLA 3K8ZA 3NGXA 3RVQA 2GH1A 5EP2A 5FUWA 3BBPA 3FMFA 3O03A 4UOEA 4F4DA 5BWNA 1VJ1A 3NXKA 1KBOA 1WP9A 1LFDB 1Z2DA 4UDNA 2WA1A 1MJNA 5HKLA 4B82A 5FTNA 3FUTA 4ENTA 5DNUA 5NLLA 5LNK1 4MV7A 5BWMA 4J1SA 5FA6A 1KI8A 4P82A 5KNCH 3PEWA 5FWXB 3R3JA 1TOAA 4N7BA 1AUOA 2H2AA 4LYDA 4BN0A 1FXWF 4Y98A 5LQSA 2ONJA 4AAYA 3GLIA 5A7FA 3O8OB 5JS1A 2VQSA 1AA9A 1UPCA 1LQTA 2YXEA 2ZPTX 3H1EA 4Y1EA 3ZE9A 5L4LA 5B55A 3D9QX 3O93A 5TF4A 5BQFA 1C0PA 3L9WA 3WMRA 1EINA 1U9JA 5I3ZA 4A8TA 4GGMX 1RRCA 4WADA 2C8VA 1JHZA 1ZBDA 2N3ZA 4YGYA 2IYXA 3PC2A 4GOND 4J0EA 1ZUIA 3CJRA 4OBBA 5L53A 3C5WP 5E2IA 2WHPA 2VXBA 4EX6A 5HZHA 2ERYA 1GZUA 3QWFA 1Y82A 5T5QA 4JLPA 1WU7A 3EA0A 3MWLA 1A2BA 4YRQA 2OCBA 1YQUA 2GBGA 3HO6A 3IUBA 2COUA 4ISCA 1M6EX 4QRHA 4RZQA 4IX1A 5CB4B 3OTOB 1YRWA 4DABA 5ARBA 5IYZA 4H4EA 1YC2A 1QF7A 4L07A 1CX9B 1N5JA 4HNTA 1RC8A 2HA2A 4K2HA 1J97A 1MB2A 3CZMA 4KIJA 4N5DA 1R0ZA 2QXUA 1BXRB 3LGAA 1PQWA 2CLHB 3WSVA 2AJ8A 5ULLA 4OGKA 1JPVA 2IY9A 3NH9A 5TIIA 2ZYTX 1G98A 2AG8A 4GPTA 3P9YA 5EE5B 4N5IX 2DWUA 4IWYA 5J5CA 3PPWA 5CFLA 3TXAA 1QF6A 2EFJA 4NBKA 4CKCA 1WL8A 1R9MA 4ZT7A 1EFLA 3HBFA 4LRWA 5EMNA 1T1EA 5A5VA 5L4SA 1V9CA 2R2GA 3NWEA 1Z8DA 3KJXA 2DSTA 2C99A 3JQRA 3ZD7A 1ONBA 4TYYA 2ESRA 3KUXA 3LFHA 3DYIA 4IHQA 3C3MA 1B8UA 2Q3HA 3RQIA 3AL0C 2ZYGA 3PA6A 1U7UA 1IEWA 1ZQ9A 2WM2A 1YRAA 4R4JA 1RZUA 2X2FA 2PUWA 3SQWA 1OC4A 2XB8A 4X45A 3RYHA 2NTNA 2VDLB 1QZTA 1NBOA 2R84A 1FX0A 1ENYA 1TA0A 4P3PA 1J22A 1YZHA 5B7NA 1QMPA 4QJ3A 1X7HA 1VE6A 3OIGA 2CE7A 4C7OB 3EFHA 3QHQA 1ODJA 4IGIA 4B6QA 2VH2A 1CV2A 2XF2A 3KYDA 5FTJA 2JH8A 1B6RA 3M6AA 3AO0B 4PC2A 4DCPA 3ISVA 5D7BA 1P1KA 2LNDA 2OG2A 2Y4OA 3P2KA 2H8KA 3OJ0A 1KEPA 4PY2A 5DT9A 2PJUA 3HWRA 5KSZA 1DUIA 4Q7MB 4ZV9A 1JJ7A 1XDDA 5DHSA 1A4UA 1R7RA 4U0JA 1PUJA 1V8PA 5EIHA 1WETA 2E2WA 2ZSEA 4MWEA 2OO7A 3ZKWB 1DV1A 3WYNA 2GYWA 4PANA 1I9CA 2HK6A 3LXMA 2Q4OA 4GI2A 4YRRA 4ZT4A 2B5OA 1VYVA 4BVJA 3TF5A 4OX9Y 3ZN2A 3AIMA 3HJUA 1GIAA 4EHJA 1M7GA 2J59A 1SQGA 2CUNA 2DBVO 4UJ3A 2YVLA 5EXXA 5FO1A 4LWZA 2CMFA 4FNGA 2PL1A 3M1YA 2A86A 2ZATA 3RRYA 3TOCA 3IPXA 1N2ZA 2TSYB 3IOMA 2Q28A 2AF3C 4S1PA 4YRFA 1KFKB 4DCOA 1JAZA 3PUXA 4QUKA 4EG1A 1A7UA 2OM2A 1OA1A 1Z0DA 3O1HB 2VNAA 4EDFA 2X19A 5DBGA 2C96A 2FPXA 2AWNA 3MRSA 2XMRA 5DYNA 3L0ZA 3N0XA 1FXSA 1PJ8A 3MWFA 3NC1C 2BFPA 5TQ2A 1MC8A 3G7SA 1N75A 4US1R 3IOYA 2VJMA 4FLEA 4LK3A 2C2OA 2QN9A 3BGWA 3ZYZA 3G0BA 2IF0A 1PFKA 3IO5A 4X8MA 4EMTA 1DAHA 4GWLA 1R6BX 2QRLA 4YRIA 1T1SA 3T5BA 2E49A 1L4YA 2RK4A 1TCBA 4H60A 4BBZA 4BKOA 2HJRA 3K4PA 4JLKA 1JDVA 1BDHA 3DLCA 4KO3S 4PPFA 1NNSA 1ORIA 3VSCA 3ZD9A 2FMKA 3NBKA 3HDGA 4LQDA 3CS3A 2R87A 2AZMA 2IV3A 5L3VA 3NWPA 4XGQA 4YCMA 3FDZA 1QNFA 1PZEA 3LH5A 4G07A 3EGDB 4I4NA 2VYVD 5HM8A 4FQ5A 5JQGA 4KXXA 5HA5A 3LDAA 4C1NA 4D5EA 5AUOB 5LDDC 3D2CA 5FXMA 2WF9A 2IHYA 2AW5A 1VXRA 2WFZA 2X0DA 3GYBA 1WKCA 2NWQA 2D1QA 2QLJA 4EI9A 2YRFA 2XNJA 4FEAA 2RKOA 4I1PA 4IM7A 4OHKA 1HE1C 4NOMA 1NBME 3Q9LA 4TV8B 4O4LF 5K0CA 1ZUNB 2IX9A 3CLSC 4HYYA 3USCS 2Z04A 2SKEA 5HIIA 1W0JD 1W29A 2H1HA 5IYZF 1JLHA 3BXOA 1R5NA 1JDNA 3GAFA 5IM4F 1TZMA 2DBYA 2RHJA 1B6TA 4EO7A 1Q6ZA 3NIDB 2XNKA 1WZNA 3DXYA 4BO1A 1DHTA 5LD2B 2VJBA 3QYJA 4DA7A 2VRCD 3LDHA 5BUZA 5HIKA 4EGJA 3VAAA 5JCPA 4MS4A 3G9TA 3F9CA 4JR2A 1IRIA 5DTEA 4RANA 5DX0A 2ZE6A 1E9AA 2H5EA 5FTMA 1U2EA 2QTBA 2YWEA 2PZLA 5IKOA 1NKVA 3SI7A 3UK6A 3VTAA 3W6PA 3A6PC 2BHNA 4F5ZA 1JIUA 3OBBA 4GR5A 2Q3DA 3BJRA 3VSDA 3O2QB 4IV5A 4B6EA 5L3ZA 1IOVA 4JEUA 2CMGA 2D0DA 3ACDA 1B8VA 1W4ZA 2JANA 3AILA 3H05A 3M6FA 5KVSA 2CBZA 5EUCA 1WABA 2WE8A 1LRJA 3UCFA 1MJ5A 3P0IA 2Q4TA 2P27A 3GLFE 1G6OA 3K5WA 5EG5A 3O8QB 1QOQB 4DMCA 1CZUA 4ARAA 2VTDA 2X0RA 1ZD9A 2YHIA 2Y1LA 3DF7A 4HGOA 2FGKA 3MMSA 1TAQA 4UAJA 4PSKA 4AS1A 4YIKA 3SQOA 2YOGA 1CUAA 4C22A 3UG7A 2WQ6A 1EWYA 3NJ8A 3HRKA 3MWGA 1XELA 3AHJA 2PBRA 3CT6A 5AI0A 3FTDA 1ESZA 4K2AA 3OO1A 1QUFA 3DZBA 3NT2A 4KFSA 4RKRA 5IHXA 5LZ2A 1YU9A 1JTVA 5LSAA 1Y5IA 3O9MA 5KCZA 2W6QA 3ZWCA 1JFFA 1WSDA 4O4IF 1XMJA 1M2WA 2AYXA 2X2EA 4BBPA 3U5TA 3GFBA 1MRSA 1PD1A 1NOKA 5TPWB 3U6BA 3DWIA 3INTA 4TS4A 3LUGA 2XVMA 3DC2A 4DHWA 1E0KA 2VI5A 3K3PA 3VNUA 1Z6YA 3BCHA 2QJOA 5KDLA 1JFRA 3CZPA 3ORRA 3EF0A 4TTIA 2HREA 3DTNA 4IXMA 4EECA 1LDMA 4A91A 3G8BA 3A1NA 3NVDA 4WV3A 5EP1A 2EATA 3CUEF 3I5AA 3MPUA 1R74A 4ZEOA 3K0FB 2O8CB 4ENWA 2F2TA 1D7OA 1NZJA 3CLTC 4PAWA 2IU3A 2B99A 2ZTUA 1PWYE 2OE2A 1QTQA 1N3YA 1J20A 3VR6H 3K9WA 1P45A 5FA5A 4C0LA 4B3RB 1M8GA 3BL8A 2G8NA 1SOUA 2O7NA 3KB8A 3WC4A 1O97C 4CLDA 3CVVA 1Z35A 1D6NA 4Y2XA 5JSYA 3HE3A 1ECJA 3I62A 4MCIA 3G9UA 1IDOA 1THMA 3Q8WA 1DJNA 2VPPA 2QVBA 1D2AA 1M74A 2XTAA 4FOPA 4X60A 3I28A 5EE9A 1JIIA 1CF4A 1YRHA 3GIWA 4XGKA 3VR4A 5KYWA 4R1LA 1U9IA 1GVHA 4P3OA 4U4AA 4EG3A 2CMDA 1E5DA 3S40A 4ARSA 1YA6A 4JWTA 1CZRA 4N3GA 2JJYA 2OFOA 5CMLA 3IIEA 1G8SA 4YCDA 1KYZA 2D2EA 2FW1A 2XNSA 5HUJA 1CZHA 1M2OB 4IG9A 3ZPXA 3ASVA 4CMCA 4UFPA 4HFRA 3D2LA 1U1EA 3EEQA 1BHO1 4DEYA 1T2AA 1XRQA 3IAFA 5EFZA 1XZCA 3QNWA 2MWMA 1BD3A 1XYVA 2GAOA 3IP9A 6GPBA 4W5NA 3B53X 1E9RA 5BYKA 3DDHA 1WSWA 4R3NA 5CK5A 1SVUA 2VUTA 3O5AA 5GGYA 4FFPA 5CA0B 2QMHA 4RKFA 5DGDA 3GQBB 1FUEA 3ROZA 4RA6B 1U0RA 2B83A 2ZQYA 4IILA 3FMOB 3ZTYA 3N74A 2X4DA 4NFLA 3H2HA 3JATA 5BR4A 3KEFA 4QRDA 1P3Y1 1YR3A 5J58A 3CRZA 1ZD4A 4P0PB 5JQGF 1IN8A 2VTBA 4CG1A 3SJZA 1R5OA 421PA 3BXZA 2M6SA 4IDQA 1UKCA 3RHSA 3NV9A 2FWPA 2JCGA 1WM1A 3W6ZA 4KFCA 4R01A 3CE6A 4CFZA 4OQYA 4DLPA 1PX2A 3N8DA 5T8KA 2FFJA 2FPGA 4AZ3A 5IUNC 4L50A 3GP8A 4GOJA 2J6IA 4ML3A 3G0GA 3TTYA 3D7MA 2I2WA 3FN4A 5J40A 1RZVA 1C14A 3NHLA 2H0QA 4GSLA 2IJGX 5CT9A 4B0PA 1PNRA 2P9HA 2D74A 1HH4A 3C3YA 1JQKA 1RTKA 2YRXA 1JG1A 1L5FA 2G0TA 1QHXA 2RJ3A 5AW9A 3R0VA 1SD5A 1X74A 4BEVA 3ZBTA 1CY7A 3UJCA 1EZ4A 4KV9A 4S1OA 2IUSA 2Q0HA 1ZC3A 4DDKA 2ZVPX 4GM0A 4WVLA 3CPHA 3EASA 3EB9A 3TNYA 3UFXA 2CMKA 2WHQA 2EFCB 2CXXA 4OMFG 1M8JA 2GCPA 2JVIA 2ZJ5A 4JZKA 1TT7A 4KP7A 2R2AA 1RI3A 4QE3A 4MYCA 5D8DA 3OLZA 1J24A 4BDTA 4UCXA 2C54A 3B5IA 3D2AA 4WNCA 2GXQA 4I6EA 1YF3A 1MB3A 2ASVA 1G55A 1Y3AA 3BQ9A 4QYIA 2YJ6A 1FS5A 3BGSA 1GFWA 1U3GA 3KZKA 4RFVA 4MV4A 4D4HA 3OFKA 3PE4A 2ZRHA 5K51A 1VI5A 5AK4A 2J5KA 3PJDA 2GFIA 1RKVA 4GICA 2KBFA 4TOIA 3VV3A 5CVEA 3WIVA 3VVBA 2ZPUA 3B89A 2GEKA 3COPA 3AKDA 3U2QA 3A04A 3C3XA 1E79A 4ZYVA 4FFNA 2X77A 1NMZA 1N2SA 1ODCA 4I19A 1IZ8A 3PT5A 2XV1A 3R7DA 3K5PA 5K4HA 3NVKI 3HA5A 4MEJA 1KHHA 4M9XA 1NVVQ 3LLSA 2VDNB 1XWWA 3Q0TA 3FXAA 2QTHA 3H84A 4EB6B 5CW1A 4BAUA 2V74B 3PXEA 1JU9A 3LWBA 1J0CA 1VIAA 2DJIA 2GPBA 3OZAA 3NHUA 3PUIA 4I9NA 4BVGA 4FT2A 4TWIA 1JR2A 2ZR9A 4RD3A 5IT4A 1RM4A 4BFSA 4N3BA 2C57A 2M6RA 3LLVA 3EVFA 4KK3A 4AG5A 5BQPA 1JLRA 4TLBA 4QXRA 2AMLA 2E5WA 3KPYA 1ZMTA 2IEBA 2MINA 2C5BA 4IIGA 2OXIA 4B6GA 5A9SB 1ODKA 4JI4B 1K8YB 3LOQA 5EKTA 3TMYA 1WY5A 1E3DA 4K8OA 3BE6A 3GGJA 3X1WA 3BWEA 4YACA 2RIRA 4CMGA 1PSDA 3ER6A 4MX8A 2P2CA 1BHQ1 2FMTA 4BATA 4BUZA 1QDUA 5IPFA 4JR0A 4BKRA 4P58A 1I4EB 5JMTA 1DC7A 1QAMA 2Q2WA 1W8DA 5JNUA 1KE2A 3BFVA 2X1LA 1MOPA 3OY7A 5UKDA 1LDEA 5KI6A 4RVHA 4A26A 4H0FA 5I8ZA 4O63O 4Y9DA 4ME6A 3UAWA 2PUAA 1JAIA 2HXSA 4Q4LA 2V6FA 5TT1A 4R8SA 2CLLB 4UEQA 4RWZA 5BPHA 3ZWMA 2DPXA 1CUUA 3H86A 2Y1EA 1DX4A 4Q7EA 4QJIA 4WNYA 4ZT2A 1AKVA 1EXNA 1T4BA 1PL7A 3DNFA 3ILXA 4JJ7A 4QOHA 4F6CA 5JDIA 3R5JA 1BDIA 4D0LB 4WINA 4Z49A 5BMVA 3D1JA 3UT6A 3PYMA 1HG0A 2OHOA 2V3VA 5CCDA 5JMOA 1JU4A 2Q5IA 2HHJA 2I1LA 1DRWA 4TTRA 4DADA 4CU5A 5BNIA 3PJRA 1P81A 4ZARA 4AURA 3WFZA 1PDVA 5AVYA 3U1BA 4F3RA 1YZVA 2FP3A 1CEXA 4NNOA 3AL2A 5C31A 4E11A 1U2GA 2ST1A 4NF2A 4MKGA 1MPTA 3LKBA 1EQUA 1RRFA 3H6KA 4CF3A 2ZFUA 5AXDA 3BDAA 4N8EA 4B83A 3UK1A 4ZALA 5I9LA 3IVRA 3B9BA 3UWKA 1U8UA 5HTKA 3PRHA 1EP3B 1T3HA 4ZCMA 4GMKA 3SLGA 3EXFB 3H5WA 5I9NA 1Q84A 1FVHA 4G1EB 4D02A 5E2AA 1OA0A 1ZUHA 4ND4A 3GN2A 3GN1A 4YP7A 2O20A 1NQAO 2MT9A 4RZHA 1UXIA 4JGIA 4DL9A 4KQCA 3W2FA 5HYVA 3RBZA 4V3BA 4HNQA 2M98A 4RK5A 4EI7A 1D2NA 1YS7A 3SYTA 3F2VA 5KX5A 4HDMA 2OGZA 2X4LA 2DKFA 2VEDA 5SY6A 3OVMA 3L4BA 5JS2A 3X2SA 3CXUA 2XZDA 1DLIA 1YA4A 3I2FA 1BWQA 3V6MA 3JD4A 4LNUA 1ENPA 4O2AB 4UQPA 5EIFA 3ZV7A 3LY9A 3R7WB 3PC6A 1T9CA 1SCIA 1USVA 3AFIA 3HNRA 5C46F 3K35A 4EENA 2JLXA 4CEHA 2BFEB 2FSIA 3LUPA 4F5EA 4AK9A 4DIFA 4CKWA 2QW0X 4MVJM 5IJWA 2XNCA 3IA2A 2EFDB 4MGEA 4QGSA 2VC2B 3AI2A 3FPAA 1NSFA 3WWOA 3F78A 4EVQA 2ZW9A 2NGRA 4C05A 5BW8A 1N5DA 3S2IA 1PYOA 2A57A 1XHLA 4MQBA 4F9FA 4BZPA 3W5CA 2WIJA 3ZLJA 2G4LA 5F4BA 1EU1A 4OMUA 1ONOA 2XRYA 5ALFA 5DO9A 4FFSA 4ESHA 1HDYA 4OJNA 4D41A 2ZUBA 3R3HA 4TS3A 4DR2B 1E0AA 4F56A 4A8JC 2YV5A 2HAEA 3DYVA 3TNLA 4RY2A 1BVHA 2LUOA 1YCFA 2MU1A 4DSTA 2EW2A 2ISQA 1BN6A 2QIPA 2VSYA 1VHDA 4GNRA 4HXFB 4RSMA 4Y6LA 4DHEA 2XXAA 1DKQA 4XB1A 3UENA 1MJHA 4XIJA 1IHUA 2P91A 1MH9A 1OXSC 2GRAA 3B20A 3LNCA 4PYNA 2JD2A 4NPAA 1X14A 1NYRA 2Z9CA 1NPTO 4KH0A 1SHTX 2A3RA 4ZI7A 4TGLA 1BTOA 1A5SB 3DDUA 3L2OB 3AETA 4G9BA 2ZZKA 4RS4A 3ZJUA 3TZLA 2C95A 4LSWA 1X7DA 2H1FA 3DMPA 4RSHA 1EVQA 5CEFA 3EG5A 1GG9A 4JLJA 2OAQ1 3H1FA 4L3WA 5HCUA 3GG9A 4P4TA 3OJCA 4XJTA 1GCUA 4WGGA 4KNVA 4EM6A 4M4SA 2ZWVA 4Z4IA 4CMIB 5AVUA 1UMBB 4QUEA 5JC8A 4BCBA 2FPIB 2H5LA 4TPKA 3ORSA 4O2LA 4US2R 5BSTA 3EXHC 3CBGA 3KDSE 1AS2A 1SXJA 5DI3B 5JHGB 5EMJA 3THWB 2OD7A 4O2RA 1Y48E 1S7CA 4WXRA 5F2NA 1LNZA 3BTSA 1FLDA 2BISA 1Q7EA 3DTYA 2R25B 3VOBA 3RAEC 1XK6A 1AQNA 4RZXA 3O0TA 1H93A 1ULAA 2PSHA 1C2YA 2HI0A 1LW6E 1J1UA 2FFRA 4FC7A 3NEYA 1LS6A 4WK4B 5AIAA 3SS7X 4NENB 4XWKA 4G4JA 1RPZA 3I53A 1U04A 2A5JA 3WRXC 5EIEA 3OOHA 2RH5A 3ZIDA 2HY7A 4IO0A 3CVOA 4J7AA 2O6LA 3HSKA 4JNCA 4QTUB 1JF8A 3SC2B 4E46A 4M49A 3CVYA 4CU2A 2QP4A 4BL5A 4TWAA 1F14A 2QD2A 3BB1A 3KWLA 1XU4A 4MLDA 4Y2UA 4Z9YA 2GYUA 2HBQA 3OZIA 4KLAA 4TLDA 3JQ7B 4EKYA 5AW7A 3KFXA 5DX8A 5EIXA 2WJJA 3Q3VA 1OI4A 2YY5A 2J7PD 4WXMA 5JAZA 1Y4SA 3O1IC 5BMVF 3WDSA 2NAFA 4K6KA 3OX2A 3H4IA 1SIUA 2L19A 4ICIA 4L5BA 1UBMS 4OAQA 5I4BA 5JBNA 3M33A 1UKYA 3AVXA 3KV1A 2PYZA 3NI2A 3DOUA 5GJWC 1ZR2A 3WKBA 3EUWA 1CDDA 3WWEA 3X1JA 3N07A 3L5KA 4JQZA 1OX4A 3RRJA 3U62A 3M4ZA 5A9TA 3TW8B 3V4PB 3VMFA 5GTDA 1H0HA 4PLFA 4UZSA 1E0SA 4LI0A 2XIJA 1QIKA 3BWCA 4XD7D 1LTQA 1N1MA 3AOEA 3QMPA 1TW3A 3BGDA 1JVSA 2GF9A 2QTFA 1I1NA 4Q9KA 1U0TA 3H6GA 3LAWA 4P5EA 5TT0A 4XJSA 3EMDA 3I8SA 3I9MA 4GLJA 4HADA 4JX9A 4DJAA 5K4GA 5ITVA 4CMHA 2RHCA 1EQ2A 1R4ZA 1KOFA 1VIVA 3JZFA 3K15A 4RAQA 4XPZA 4C0KA 3G1WA 2Z5GA 2HMUA 1S3IA 5L51A 5IAKA 1AH2A 3EMBA 4CETA 2AFIB 1XZJA 3NBFA 5C37A 1BN7A 2C59A 3CTPA 4M9ZA 1XZQA 4UDYX 4DYHA 2PHZA 1SC9A 2IPAB 2XKJE 2IBSA 5KX5F 2IEDA 4DMRA 3B8EA 5K99A 4ERNA 3HG7A 1NMQA 1B00A 1Z25A 4DA8A 3RD5A 1UJCA 2I7TA 4Y1FA 1PNOA 2UVPA 1ZEJA 4D3XA 1RXEA 1R6AA 3M1AA 4M89A 2KWIA 1A8HA 2ZRIA 4M2LA 1W36B 4ZTUB 1X1EA 2QMYA 1GPLA 3I4LA 3IAXA 5FOTA 5IKEA 4P98A 5E7JA 2PD4A 3JD1A 2QRGA 3NM4A 1U8YA 4KFUA 1H3NA 1NOJA 3NHKA 4R2WA 1K7YA 4Q0MA 4R6XA 3PQCA 4BE9A 4CBVA 3AF4A 2W2OA 3GCDA 3FLEA 4HZUB 4J7XA 4LTMA 4UNIA 3WMXA 1FU8A 2H4XA 4KHPB 3QLUC 4LY6A 1SQ0A 5JSZA 4JLNA 1N36B 1E0DA 5DCWA 3KOUA 5FOQA 3I73A 4MICA 2AK3A 2XUAA 1J9ZA 4LGMA 1XP5A 3E9DA 3QVGB 4ZDIA 1QU2A 2ID4A 4K9SA 1VPDA 1J1IA 1W4BA 3ETJA 1O0CA 1QRAA 5HDBB 2OGWA 1DARA 1NW3A 4DPMA 5F9FA 2BFDB 2DFVA 2OHIA 4Z0TA 3VSEA 1CPYA 4PAQA 1SCJA 1PL6A 5DN6A 1ULSA 2FGJA 5TSDA 2O3QA 1YQWA 4W5RA 4Z1MA 1EK2A 1AS0A 2TMYA 1RDFA 4L3VA 4LOJA 4CM9A 4CM6A 3EZ7A 2ZE5A 4L4RA 2JI9A 4IFTA 1T8UA 3OIWA 5GAJA 3TI9A 1XQYA 1Z13A 2OWEA 4HK4A 4BO2A 4N5LA 4NV3A 1UPAA 5EIWA 5CA1F 1YULA 4CKEB 1KF0A 5FPTA 3ZNNA 1W4LA 2BTEA 3H0CA 5EIOA 3RIGA 2REQB 1G291 3K32A 2O54A 3U09A 4YS6A 2OLKA 4C3ZA 2YOFA 2OQRA 3WOHA 4BQOA 3LHDA 2I2BA 4ARBA 2C3PA 4H2DA 2H0RA 4POOA 5JR3A 2PQMA 1AHPA 3DKVA 2C3UA 2ZTSA 4FWTA 3HKDA 1YB7A 3VKWA 3FJOA 1GGVA 5FLKA 2WJGA 2A33A 4OSPA 3OZDA 3L1VA 1R6TA 4E22A 1K8XB 1E6UA 3BGVA 4K03A 4B6FA 1CXZA 5I3CA 2FNAA 2Q6OA 4TKUB 2OVBA 1YWGO 1G20B 1P75A 3NAQA 4HGYA 3VU0A 2ZI3A 1A72A 1PX0A 1QK5A 2YZKA 2YUIA 3C6BA 3PNQA 2PD6A 2QMOA 3PNYA 4FUTA 4MUXA 4RM3A 4X61A 3DMRA 1G8GA 4REOA 5E0KB 1QWOA 1U9ZA 1L8LA 2VK2A 4EUEA 2EW8A 2DF8A 4TL8A 2FW7A 2Z8XA 5IG2A 2PWAA 1O57A 3WGQA 1PZGA 3DUWA 4WJZA 4R7TA 5EQFA 3KHKA 2H1VA 2P7IA 1CQPA 3BL6A 1Z5WA 5KKNB 4RIHA 1ZN7A 3L49A 4RCZA 2ACVA 1AC5A 3ITEA 4PCUA 4JP1A 5C32A 1GEGA 3TAXA 2J85A 1F0NA 3WS7A 5BUCA 1RCTE 1W44A 1SPBS 5JBIA 1A96A 3KYCB 4O8ZA 4Q7KA 1CJSA 2D2IA 3A3KA 4D9CA 1WZEA 1QFYA 2HWWA 1I3MA 1YBHA 1LV7A 2X6RA 3L6BA 3MYRA 3NATA 4LOIA 1OXKB 1WOMA 4QLOA 5DGIA 2UYOA 5LKAA 1F51E 1YBVA 3PJEA 4U3JB 2ORIA 3A2LA 3AUSA 4HN2A 4O2BA 2B30A 3KVYA 1DXOA 4ZHQB 5G0TA 1JLLB 3RS5A 3EVEA 3WJ2A 3WIEA 1FNMA 3EFBA 3ZY5A 3E4DA 1M73E 3NUGA 1EGVB 4JOBA 5KNBH 1XJ0A 1ZINA 2QIOA 4FFBB 2PRKA 4NOLA 3TBKA 3GJ8A 4BJ3A 3HKCA 3RGGA 5KHLB 5FCDA 1DO0A 2IOFA 1OLSB 1R4NB 1V39A 3EZNA 5CUQA 4C01A 3RHTA 1C50A 4MS3B 2YFYA 5JTTA 3EZ2A 1ZPDA 2J87A 2W22A 1Z82A 3WB0A 2WWYA 3IMKA 1EXMA 2UDPA 2EIHA 2XOXA 3KLOA 2HHLA 2PR2A 1VLVA 1VIDA 1DELA 1JLMA 4HAUA 4M3NA 4GP9A 5AJTA 5IDWA 2M32A 4X44A 3WSWA 2PRIA 5K05A 1AGNA 1Q0QA 2Z6VA 3T9CA 3QBVA 3M3PA 4HQ6A 4P81A 1CFZA 2FJPA 3ZDBA 4GZ5A 1E2DA 2XHZA 4X3OA 1VJRA 1IPHA 4U7WA 3S6JA 5ENDA 3W1WA 1WEKA 5IKPA 4M8NE 4L1KA 3DPUA 2IE8A 1LKZA 2B2XA 5ESXA 3G7UA 3I09A 3T5TA 2HF2A 3QKUA 1EA7A 1P0QA 1T3LA 2KS6A 2HBZA 2WAMA 5HMMA 5AVQA 5ALYA 3TSAA 4IUDS 2XVXA 1PV2A 1RWMA 2F62A 2QYHA 4RLSA 4EJSA 3IHWA 2A4MA 4PHHA 2V58A 4DQ0A 4OVKA 5BSVA 3T3NA 3WGZA 3I1JA 2D7CA 1ZH8A 5EGSA 4Q93A 2QRJA 3ZBUA 4C07A 2AHOA 3GJ0A 3RO7A 5T4EA 2VP6A 2C9MA 2HWUA 4ZVVA 2OLJA 5BV1A 3H1AA 4AN0A 5CVDA 4DXAA 3PQ5A 2F1OA 2FY8A 5SICE 1GNLA 2ZVJA 1H0SA 2A14A 2WICA 3EC7A 4LMPA 3VA7A 3ZDQA 1UPTA 3ESAA 3A9VA 4OFBA 5EVJA 2G4CA 2QE6A 2WF8A 3P26A 4H0NA 4AF7A 1T10A 1YR7A 2QVCA 5DHQA 2D1RA 2X7HA 3W2GA 1USKA 1YZTA 4M54A 3T4EA 1L7PA 1E6KA 2AN3A 1GCOA 1MKYA 4JOCA 5KNCA 1W76A 2LDXA 2GSWA 4OA5A 2RG1A 2XGSA 2JIQA 3K20A 1VPLA 5JFGA 1BHJA 4LYGA 5AW4A 2QN7A 1G6HA 4PU0A 2Y66A 4FGSA 4OEHA 4ZQBA 2R7LA 4HD8A 4I4IA 3SHVA 5JZSA 3CX4A 3L6CA 3L84A 4PAMA 3GA7A 4DS3A 4QZVA 3SIWA 3VNVA 1CJKC 3Q7EA 1JDPA 1LB1B 2N9UA 1FB5A 2NAPA 3VH3A 4M1SA 1ONNA 3PSHA 2X9QA 3Q7PA 1VE7A 3OZVA 3S7ZA 3CW8X 1RYHA 5B6JA 2V5UA 3NYQA 4RX1A 3GVPA 2FQQA 1EJBA 3G2QA 1I1HA 5AVVA 4HUQB 4UUAA 2H07A 3KQQA 2OGUA 1XB2A 3AWDA 4FOOA 3SS8A 1FOEB 3KUDA 5JSKA 4A5SA 2XB2A 4H3HB 4PX2A 4HAVA 2HQRA 4RV4A 4F2WA 3RC8A 1BX3A 3A8TA 4MCHA 1ESDA 1ZXLA 4UBLA 4C21A 1BQEA 2V7QD 3DCJA 3NNSA 5ITSA 1DAPA 1KSHA 2Y1KA 3CPEA 3DEJA 3R9IA 4AECA 4ED9A 1MJGM 4TVKA 4WY8A 2D7JA 1BYUA 1FNDA 1RPJA 2GKGA 3B60A 3ZGYA 2BFBB 2X8JA 1UXOA 4AS3A 3V4ZA 3NJ4A 1S7GA 1R4MA 1RWKA 4LDNA 4A0SA 4RWEA 5D86A 1YJ8A 5FL7D 4XDZA 1P44A 3BDIA 4IIJB 1BC5A 1PSWA 1PZNA 2FFBA 3AT1A 1OXUA 3CLUC 2C1XA 3AL3A 2B4QA 1ADFA 4YP0A 3ZW8A 1PR0A 5AJHA 3GAMA 1YDHA 3E9ZA 3EGIA 1RU3A 4R51A 3CF4A 2P4UA 3QELA 5HRAA 1M6YA 1JXAA 1IQRA 1NN5A 5AK0A 5DF1A 5CBKA 1KVRA 1F8UA 4B81A 4NX2A 1I4WA 3CT4A 3ZKAA 4DG9A 3WA6A 1TU3A 2PKCA 4KTVE 2KBEA 5LJLA 3FVRA 4BBJA 4GM4A 4O2BF 2NUTB 4AKSA 4M1KA 5H4HA 2A0XA 2IHTA 4Q4HB 1XI2A 4YA6A 4OLJA 4H77A 4L76A 5HP4A 2WZCA 1WBDA 2AXEA 1YJBA 3GFSA 2BV3A 5E3HA 1NDUA