4CIBA

Crystal structure of cathepsin a, complexed with compound 2
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
454
structure length
413
Chain Sequence
RAPDQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords LYSOSOMAL PROTECTIVE PROTEIN
publication title Crystal structure of cathepsin A, a novel target for the treatment of cardiovascular diseases.
pubmed doi rcsb
source organism Homo sapiens
total genus 150
structure length 413
sequence length 454
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 2013-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cibA00
3DOIA 4AMYA 1MT3A 4GWLA 1FFEA 4MQMA 5E4TA 2WG2A 5CRIA 5HF9A 2XQJA 3HI4A 3DQZA 5ALKA 4B80A 5AOBA 1KU0A 4UBLA 2WUGA 1P0MA 4FLMA 4W63A 1GKLA 1ZIXA 2BUCA 1J06A 1SCKA 4N5HX 4G4IA 1C7JA 3ZI7A 1JJIA 2XUOA 1P0IA 4JUIA 2JBWA 3FSGA 3ESDA 4KRXA 1XQWA 3HLKA 5SYNA 4BZZA 4Q3LA 1H23A 1C7IA 3O4JA 4UHDA 1Q0RA 1A8QA 4OB7A 4EY6A 4CG2A 3IIIA 2AJ8A 4C4YA 5FUMA 4JH0A 5FOQA 4U2GA 4Y2QA 4WFJA 4UBOA 3LLCA 4CIBA 3GFFA 1H2YA 3WQHA 2QUBA 4BB0A 2HRRA 1JMYA 1XLUA 4I4CA 1LPOA 1LPMA 1MU0A 4DNFA 1MAAA 3WKAA 1BCRA 5LZ5A 2PSEA 1RYYA 1H2ZA 3HYSA 2XUQA 3SC2A 1GGVA 2QMQA 2WFMA 1HPLA 5JD6A 4G9GA 3BDIA 5LYYA 2C0PA 2DHCA 2G63A 5EHQA 4DMCA 3BF8A 2FX5A 1GZ7A 4GECA 4UFOA 2HU7A 1JU4A 1WOMA 4HXGA 2J3QA 3EQ8A 3BIWA 1EVEA 5ALXA 2HFKA 1XROA 4Q3OA 4C4ZA 3R3WA 5BV7A 2XB6A 3R3ZA 2H7XA 5T4HA 4G4GA 3G0DA 1VE6A 5LKRA 2ZYRA 5AHXA 1X2EA 3M82A 3R3XA 1R9NA 4QLAA 2QJRA 4X95A 2R8BA 2XMDA 4GDMA 5C7YA 4ARAA 1ZD4A 3FCYA 4BE9A 3GZJA 5E4JA 3STWA 1H2WA 2DHEA 4GXNA 4Y2PA 5CW2A 1BS9A 4DMKA 3PDCA 4X6YA 2NW6A 1UKCA 5EGNA 4MQLA 4QWWA 1ZD2P 3ILSA 4UHBA 2X8BA 2Y2UA 5CH3A 1IUPA 3EF3A 1QO9A 5AI8A 2HRQA 3WA6A 4Q05A 5CTAA 1TAHA 4X00A 4G8BA 2BFNA 2WTNA 1EINA 4H18A 2OPHA 4X97A 1LNSA 5HF5A 2OGTA 1JI3A 1QIKA 4O08A 5LZ4A 4BCCA 2OAEA 5CMLA 1Y7HA 2Y6VA 4I3FA 3S8YA 3TEJA 2ZJFA 1THTA 4YX9A 2D5LA 3IULA 3CCBA 1LZKA 2BAGA 4AN0A 3C6BA 5LIPA 2PU7A 5A6VA 3PF8A 4K6HA 2QRUA 1VXOA 2RGUA 5JYCA 4F0JA 2DSNA 3H18A 4W1PA 4Y2SA 4OB6A 1N5MA 4X3CA 4LXIA 3AZOA 3I2IA 4CCYA 3WZLA 4W1QA 5K3BA 3GBSA 4UFPA 2IITA 1EB9A 1TQHA 4HTAA 1TCAA 4GBGA 3KWFA 4XX1A 1G66A 1EX9A 2WU4A 1YAJA 1QTIA 3R41A 3OOSA 4XVCA 5JIBA 1YS1X 3IDAA 2H9YA 5DNVA 5CH5A 2DR0A 5HFNA 1XRRA 3O4GA 3BJMA 3SX4A 1GKKA 1LGYA 1MX5A 5HK8A 2XQGA 2HA2A 4F60A 5AICA 2XUAA 1JMKC 1BU8A 3I6ZA 1F0PA 1UKAA 4YK7A 3FVRA 4FNGA 2O2IA 1AGYA 1UOPA 1UKBA 4CIAA 4JYPA 1R1DA 3D4LA 1VZ3A 2WJ3A 3I2HA 3PUIA 2WHRA 3FNBA 5ALWA 4G5XA 1XRMA 2GBCA 1CPYA 4E14A 5ALQA 1JJBA 4BDSA 4BTLA 1XKTA 4FLFA 4Z49A 3QH4A 5I8PA 1XLVA 1TK3A 2CEKA 4NZZA 3PUHA 1WHTA 3BE8A 3H17A 1ODCA 1DINA 5IVIA 5JASA 2HIHA 3K6KA 2E3JA 3W9UA 3RK4A 2G5TA 5D3ZA 1XZDA 3KWJA 4ZREA 4HVTA 2JGKA 5FLKA 2BCEA 3D2BA 1WB4A 4NMWA 5LKAA 1VA4A 3I2FA 4H7JA 4FBLA 2HADA 1MX1A 4H7DA 4ZRDA 5ALTA 2Z8ZA 3F9CA 2I78A 1VKHA 1F0NA 1OILA 2WHPA 3QZUA 1R3DA 1XRQA 4X91A 1A8SA 3CXUA 5AOCA 3C6XA 1ACJA 3H19A 4S0XA 1QIFA 5JZSA 3FYTA 4QEKA 2W22A 4UHEA 3WK5A 5AI0A 4J0CA 4DIUA 3HC7A 3V9AA 5EFZA 1IZ7A 5D7BA 5EHXA 2XI4A 5CXUA 4KJXA 5IH7A 3I1IA 3IA2A 1G4HA 3D3NA 5CT8A 5JARA 3QM1A 1VOTA 3WKBA 1QIGA 1THGA 5CBKA 1VE7A 5DYTA 5FV4A 1CUCA 4QDTA 2Y6UA 5AM3A 4PW0A 4H35A 2C4HA 4KE9A 5AH0A 5CT4A 2ROQA 4IHAA 3C45A 1AMNA 2JGFA 3WWCA 3ZLTA 4B0OA 4V2IA 3WJ1A 1CUUA 3DJYA 1H22A 3X3HA 2WFLB 4C89A 4X85A 5AKLA 1XZGA 1AURA 2GBGA 4AO6A 3QPCA 1YASA 3W2TA 4PQEA 4G4JA 1LBSA 2WUDA 4L0CA 1L7AA 2JGIA 5LLSA 4IH1A 4IQ4A 5D3KA 4WDRA 3DNMA 4INZA 1XRLA 1LPNA 4B81A 3TRDA 4OCZA 1FFBA 2VT6A 1ZGBA 2VAVA 5JD4A 4XIIA 5EHZA 5ALHA 4LKOA 2RHWA 2GZRA 3C5WP 4GHWA 1ETHA 4C88A 4B84A 3G02A 3G9TA 1CEXA 2XQKA 1IUNA 4EY7A 2WILA 5JANA 4BYMA 5JD5A 2WSLA 1QFMA 4QA9A 4BRSA 2QM0A 5EI5A 5AM4A 2OGSA 4FNMA 4Q1VA 3VVLA 3WWDA 1MAHA 4AMZA 2VSQA 3E1GA 4LYDA 3G9UA 4Q3KA 2AJLI 1ZI9A 3L1IA 1CFJA 5EIHA 5H3HA 3NWOA 4AN1A 3ZLUA 3WK7A 4PSUA 3MVEA 3H1AA 3WL8A 2HA7A 1YS2X 2I03A 4B82A 5LZ9A 2PSFA 1BEZA 1P0PA 4J0JA 3STUA 1WCYA 4Q34A 3WL7A 1KU6A 2PPLA 4DYHA 2JEYA 2XT0A 4QDXA 4K6GA 5FPQA 4BP8A 5ALIA 1E8DA 2C0QA 4IH9A 3ZLVA 5ALNA 5FRDA 1SFRA 2Z8XA 2XUKA 2RAUA 3HABA 3LIIA 2XUFA 4X71A 4ETWA 5ALYA 1YB6A 2XQIA 4FDMA 1YB7A 2CZQA 1CUEA 5JADA 2VT7A 2O2GA 2X5XA 1CLEA 3WIBA 3LCRA 3I6MA 2QZPA 4KACA 4U2EA 4G8DA 2DQYA 1GXSA 1Q0ZA 4EB0A 1AC5A 2FUKA 5A7GA 4PSCA 4DNPA 3BWXA 3G0CA 1AUOA 3WZMA 5CURA 3AIOA 3K9BA 2Y1KA 1UT6A 4P93A 4E15A 2ZJ6A 3UMJA 1Z68A 1CUJA 3RLIA 1CUYA 4EBBA 2OGZA 1IMJA 4OPMA 1DQZA 3MUOA 3IBTA 5ALVA 5K3EA 2C5GA 4QZVA 3HEAA 1SC9A 1UOQA 3DL4A 3HACA 1W1IA 3AUKA 5FKJA 4A5SA 4E11A 2PSJA 1CIJA 3WWOA 3I28A 5AOAA 3Q0TA 4BAGA 4ZXFA 1XRPA 4J7AA 1XQXA 1WPXA 1GPLA 2QKYA 1MX9A 1NU6A 2WG1A 1CR6A 1E89A 2H7YA 1I6WA 3VJKA 3KOOA 4QDZA 3F96A 4Y2UA 1CRLA 4G9EA 2O7RA 2GYWA 5FDFA 1EVQA 1WM1A 1XZJA 4N8DA 1T2NA 1HBJA 2YYSA 3DYIA 2QS9A 2W6CX 2ACEA 2XLCA 5AIBA 4P9NA 4BVKA 1N8SA 5AI6A 1Y37A 4WFIA 1QIHA 2ZVDA 5AIAA 4DSZA 3ZV7A 2XQFA 4HRXA 1B6GA 3QYJA 4UBKA 4W9RA 5BOVA 3DL7A 3D7RA 5AK5A 2OLEA 2BGNA 3D0KA 3ZPXA 4EZIA 3C70A 1JJFA 1IUOA 2AJCA 3V1LA 2JGMA 1LPBB 4PNZA 4ZGBA 2EDCA 4BBZA 4G1FA 2QXUA 1O6FA 4KAJA 5ISMA 2PU5A 1N1MA 4KE6A 1W76A 1W52X 1Q84A 5ALJA 3VJLA 2GBIA 1R50A 2XMGA 1LZLA 1YA8A 3QPDA 4H0CA 4J03A 4MYDA 2C7BA 1UK9A 4C01A 4CCWA 5HQ3B 2QUAA 1AQLA 4CG3A 4BCBA 4DM7A 2QOEA 2OG1A 1XQYA 3I1YA 2VJCA 1QTRA 3O4IA 1K6EA 4RGYA 4BCDA 2V9ZA 5CT9A 2PSDA 1ISPA 5A7HA 2PUJA 3FLAA 3NOXA 5AKIA 2O7VA 3AINA 2HA5A 1EA5A 4H7IA 3UUFA 3C8HA 4G8CA 2YASA 3DOHA 4J0GA 4P08A 2C58A 3DCNA 5DTJA 2Z3ZA 1BN7A 3WWEA 1F6WA 3LP5A 1LPPA 3O9MA 3FYUB 5A71A 4H7HA 3TJMA 1E5TA 2OCLA 5C81A 3R3VA 4Q82A 4B9EA 3GELA 3LS2A 2BJHA 4U2BA 5AP9A 5HZGA 3A2MA 2BUBA 2GYVA 3FBWA 5ALMA 3FWHA 2WM2A 3ANSA 2QT9A 1F8UA 1PFQA 3C5VA 1UK7A 4J0DA 4BC1A 1CQWA 5DLPA 4I19A 5AKZA 1XZIA 1QE3A 4UBIA 1O6GA 3OTQA 4BRZA 1UZAA 4KRYA 4IO0A 5LZ2A 5DJ5A 2WUFA 3AZPA 1XFDA 3H2HA 1DWQA 2PBLA 4X94A 5HF6A 4UBNA 3ZWQA 1DTEA 3GUUA 2G5PA 2EEPA 2H1IA 3B12A 2PM8A 4DSAA 3V48A 1DWPA 4F5ZA 3KXPA 4A16A 4BZWA 1L7RA 5ESRA 4BC0A 4BVLA 1LPSA 4QE3A 5T4BA 1CUIA 2OQVA 4DTCA 5FXMA 3GA7A 3WYDA 2HHAA 2V96A 3C87A 3R3UA 5JAUA 4AXBA 1TCBA 2ACKA 1QIEA 1CUBA 1UFOA 3STTA 1NU8A 4PO3X 4UHFA 1XZBA 5AK3A 2XMZA 4AO7A 5CT5A 3EBLA 2CB9A 5AKHA 1DT3A 2HL6A 4EY5A 1QIDA 3G7NA 5ALOA 5DTIA 3MGAA 1ZOIA 3H1BA 2QR5A 4H7FA 4KYVA 5ALUA 1UK8A 1TRHA 4F21A 5JALA 1QGED 3O9VA 1XZEA 2BGRA 3E0XA 3HRHA 3DKRA 3WK4A 3PFBA 3A2LA 3AJAA 1UK6A 4HAIA 2QJWA 3NGMA 2HA0A 5ALDA 4Y2YA 3VISA 1XZMA 4UUQA 3OM8A 2VJDA 1CUDA 1J07A 1J1IA 3O0DA 3W9BA 5K3DA 2IIVA 2GBFA 2JIDA 4RE6A 3O95A 4MWTA 2HA4A 2HFJA 1MPXA 4X93A 4FOLA 1XZLA 1T4MA 2OXEA 3ESBA 4FKBA 4U2FA 3R0VA 5AKKA 4QDOA 3R40A 2WJ6A 3I2KA 4HZGA 1QFSA 5CT6A 3U0VA 2ES4A 4UHHA 3W04A 1MNQA 3ICVA 3QITA 2V97A 4KE7A 3PFCA 2XUGA 2ECFA 5FP0A 5LZ7A 4K6KA 2XMSA 4BATA 3WL5A 5A62A 1TKRA 2PUHA 3WL6A 2WG0A 2WQZA 1YCDA 2PVSA 3IUNA 4J0IA 3YASA 4D9JA 4A23A 1VA5A 4E46A 1R9MA 5ALGA 3HSSA 4YASA 3N2ZB 6YASA 1JFRA 4RNCA 3GROA 4JYMA 2QTBA 1J2EA 5DNUA 1ZIYA 2OQIA 1L7QA 1CUSA 2XLBA 5K3FB 1ZD5A 5EHNA 2WIFA 3EQ9A 2RIPA 4Y2JA 2CKMA 3ESAA 1EI9A 4WY5A 1A88A 3VJMA 1DQYA 1DX4A 1W6RA 4P92A 2Z3WA 4OYYA 5C8XA 1SOMA 3DDUA 4GW3A 5A7FA 4FMPA 3WIOA 3VKFA 4DMHA 4CI9A 1YA4A 3I2JA 4AZ0A 4HXEB 4PV7A 3SK0A 2OCGA 5C8VA 2YXPX 5AK6A 4TVKA 2OCIA 3FAKA 2ZYSA 1BE0A 2J3DA 1EXWA 3B5EA 4H77A 3G8YA 4HXFB 4DLNA 1K63A 5AI5A 5AO9A 3F8SA 3WKCA 1AKNA 7YASA 1CUFA 3AIMA 3DEAA 1PV1A 5DYWA 1CUVA 1U65A 4GLBA 2WFLA 3WK9A 4HRYA 1ORWA 3AZQA 4M0EA 5AKEA 5AK4A 1EB8A 3H0CA 1WB5A 2WTMA 1RP1A 3V1MA 4MXDA 1A7UA 2UZ0A 5K5EA 1MTZA 3CN7A 4B0PA 5D6OA 5ALZA 1ORVA 4OB8A 3I6YA 4FHZA 1R4ZA 2VATA 3IVMA 4ARBA 1A8UA 4LXHA 3FLBA 4TGLA 1E8NA 1ZI6A 2BKLA 4BAZA 2HU8A 3CCCA 1MN6A 3WK8A 2EDAA 1FJ2A 3I2GA 1RWQA 1UOOA 4X92A 4KAFA 5KWIA 1ODSA 4B6GA 1PJAA 4FFWA 4U2CA 3C8DA 4LIPD 3ANTA 1EDDA 3IUJA 4QLOA 1BEEA 2XMCA 3BJRA 2BUAA 2PX6A 2HA6A 5J3JA 5HFAA 4AQDA 1EDEA 1XRNA 2WHQA 4ZI5A 5KREA 1U2EA 3PI6A 1QIIA 2HM7A 2JGJA 4EHBA 4AX4A 3DD5A 3FYUC 4UBJA 3VVMA 1TIBA 5I7UA 2AXEA 4FFVA 3JW8A 1VLQA 2WJ4A 3P2MA 2Q0XA 2VEOA 3M81A 2WIJA 3F97A 4WFKA 3M83A 1LBTA 2ZSHA 1K4YA 4AZ3A 3LIPA 2XUJA 1GPKA 2IX9A 3V1NA 4OYLA 1CUZA 3IURA 1W4LA 4OU4A 4GI1A 1YSCA 4X6UA 4EA6A 1XZCA 3L1JA 1SCQA 2P8SA 2OCKA 1XQVA 4EY4A 1D07A 4ZV7A 4B83A 2K2QB 3OG9A 3ESCA 4FWBA 4C6HA 5HF8A 3D5EA 5LP1A 1UXOA 5BWCA 3S2ZA 2JF0A 3E3AA 4DNOA 3R3YA 3BF7A 4M0FA 5LZ8A 5K3CA 3BIXA 4J3JA 5HKBA 2G4LA 3FCXA 4BTVA 3A70A 3PE6A 4Y2TA 5ALEA 3CN9A 3STXA 1ODTC 2ZYHA 5JATA 5JAHA 2FJ0A 3FOBA 1XKLA 4K5QA 4Y2VA 1ACLA 3F67A 1CV2A 2OAGA 1QJ4A 4L72A 1E3QA 4ZV9A 5E4YA 3RKSA 3OC0A 1SCIA 5DYYA 5AM2A 3QMVA 3D2CA 3EIOA 3WWPA 5I9IA 1OCEA 1QIJA 1USWA 3H04A 3C6ZA 3E4DA 3T4UA 3DS8A 1W75A 3HZOA 2VF2A 1CUGA 4Y7DA 4CCYB 2PL5A 4CFSA 1M33A 4N5IX 3OPMA 1P0QA 4BVJA 5T4EA 3MUNA 2VTVA 1WB6A 3U1TA 3D2AA 4WDQA 4PSDA 1CUXA 4KAAA 1ZICA 4FBMA 5KBYA 5IVDA 3BDVA 3JWEA 4J0KA 2LIPA 4WY8A 1WPRA 1UWCA 4BAUA 3G0BA 3KD2A 4LHEA 4MYSA 1G42A 3WKDA 2QXTA 4BE4A 1E8MA 4C4XA 4B9AA 3QMWA 5K3AA 3F98A 2XUDA 2HA3A 5JZ9A 4W1SA 5AKJA 4DGQA 5JAPA 2DHDA 1LLFA 5E2IA 1MO2A 5DNWA 3B3QA 4UBMA 3ED1A 1DWOA 4RPCA 1NX9A 2ZYIA 2B20A 2XMQA 3JYHA 5AM1A 4OU5A 2CMFA 1K8QA 5DWDA 1HQDA 3W05A 3NUZA 1C4XA 3QVMA 3L1HA 1BRTA 2WIKA 3WA7A 2D0DA 1ZI8A 2HU5A 2VQ6A 5SYMA 1WHSA 2Y2VA 5IKXA 2RONA 5JAOA 2RI6A 5ALPA 5HQ3A 4EUSA 4LYEA 2ORYA 3OURA 2PSHA 4XJVA 4MWSA 1HLGA 1QLWA 2Z5GA 3HJUA 4CG1A 2WLSA 3N0TA 4KEAA 4X90A 3WKEA 3WLAA 3FLEA 4UFNA 1GT6A 1HDEA 2R11A 1CUHA 2X76A 3AIKA 1QONA 3ICWA 5FPPA 1GQRA 3H2JA 4MEAA 5JZBA 1VJ5A 3STYA 3K2IA 1BCSA 3WYNA 4JNCA 1IZ8A 4N8SA 1GQSA 2WHPB 4YPVA 5T4FA 5IVHA 3FYUA 2HDWA 3HXKA 4OD0A 2DCMA 1DT5A 3IUMA 5ALLA 3RM3A 5AI9A 3FSGD 1YAHA 3QPAA 4C87A 2B4KA 2J4CA 3Q8WA 1K5PA 1QZ3A 4X6XA 1MJ5A 3D59A 4QNNA 1N5RA 4HS9A 1HL7A 4L3WA 1FFCA 2V98A 2XUIA 2C5FA 4BDTA 1IVYA 2XMBA 3T52A 2WFZA 2XUPA 2JEZA 4OSEA 5AM5A 2RHTA 5AM0A 4NVRA 2QVBA 3QMMA 4Y9SA 2VAXA 2XUHA 1EHYA 4B7ZA 3DYVA 1LPAB 2CUTA 2VJAA 1BROA 3G9ZA 1B41A 1U8EA 1Y7IA 5EIAA 3H2IA 1EDBA 5CXXA 4MJ3A 3O4HA 1XZAA 2XDWA 1H2XA 2JGLA 3QBJA 3C43A 4N8EA 1ZGCA 5EIEA 4M0MA 4QWMA 1DX6A 3IUQA 1EH5A 2B61A 1CUWA 1QOZA 4H7KA 4OUKX 4WCVA 5HKAA 4FLEA 3UUEA 4FTWA 2DQZA 2I3ZA 3IB3A 5AKGA 1AZWA 4JEIA 4W1RA 5YASA 3G9XA 4XWGA 2JGEA 3AFIA 3SWWA 3STVA 2J4FA 1JKMA 4Y2XA 1KEZA 4B85A 4UHCA 5HK9A 4L9AA 1ZD3A 4EY8A 2VA9A 1Q83A 4KE8A 3C6YA 4J0HA 3VDXA 4MEBA 4Y2RA 3A6ZA 2WKWA 5A2GA 1X2BA 2CJPA 3RARA 1XLWA 1HKHA 1FFDA 5BWBA 3V1KA 4LXGA 1DU4A 1EK1A 4NS4A 5ALSA 3VXKA 1XZFA 3M3DA 2CBGA 3G0GA 4AB1A 3PICA 1E66A 2AJDA 4ZWNA 4KR0A 2YH2A 3PF9A 3WK6A 2PKYX 4BP9A 5ALFA 4RE5A 4GEGA 3G0IA 3WI7A 5HCUA 3WMRA 1OXMA 4IH4A 1JU3A 5ALRA 3WJ2A 4UPDA 3KDAA 1EK2A 4PF1A 3TGLA 4H7EA 1QIMA 4WJLA 5AKXA 2ZSIA 2I3DA 1X70A 4AO8A 2GZSA 1U4NA 5F4ZA 1FSSA 2DFPA 4DNQA 3H2GA 1XZHA 4ITVA 1VXRA 1GPNA 2AJBA 2FJPA 1ZJ4A 1AX9A 5AKYA 2GYUA 4ROTA 1CQZA 3BXPA 3BL8A 2ZJ7A 5CH8A 3DLTA 2WUEA 3FVTA 2B9VA 4TPKA 1YR2A 2WIDA 3H2KA 5C8ZA 5K3FA 3W06A 3AILA 3A2NA 3DKKA 2O2HA 1JT2A 1MNAA 3KSRA 2VJBA 4K2AA 2ONCA 5IVKA 1CUAA 5AJHA 1G5FA 1TCCA 1FFAA 1R88A 2H7CA 4U2DA 1VZ2A 1BN6A 2XE4A 5KWJA 3EQ7A 2WU3A 1QO7A 4DMFA 4X7BA 5AI4A 1S8OA 4QDUA 1XZKA 1CVLA 2WIGA 2XMRA 1ZJ5A
chains in the Genus database with same CATH superfamily
1I3NA 1ZMBA 2JZCA 4AMYA 1P74A 4CM8A 4UZEA 3NH9A 4EK9A 1V8DA 1DJQA 4FUTA 1DJMA 2HBQA 5EINA 4AKIA 2ZBDA 2TMKA 4WQMA 4AD8A 2GQ0A 3TLEA 2ZB4A 1KYYA 5JI3E 3U44B 1PFGA 4P34A 1PFUA 3FDXA 3K0SA 4LMPA 1TLFA 4QOFA 2WG2A 5CRIA 2KSQA 2GCOB 5LP6B 4DIOA 3WB9A 3B3FA 1M6NA 5FBQB 2B2XA 1GFWA 2DFNA 2PN1A 2YICA 3H16A 4IWYA 4WBXC 3OTOB 4CV2A 3I04A 2BFFA 2Y9PB 4MX8A 1WPGA 4IIJA 3RDPA 1NFRA 4ZANA 4EG4A 5HJEA 1QTQA 2PKQO 2V0NA 1MO5A 3IP1A 1PR2A 3M6UA 1TF2A 4JCOA 4B80A 4HVCA 1ZCBA 2Z9BA 2HXYA 3OX2A 5F1KA 3SYRA 4EKEA 4CETA 4CGZA 3D8HA 2QQGA 3B60A 2HAEA 5IHXA 5KHLB 4RKWA 1NXOA 1DELA 2C07A 3D3JA 4O2BA 5GJVC 3THSA 3H1EA 1EFPA 1EP3B 1SKYE 1BDHA 4HYQA 5G0UA 3VPAA 5K4HA 3K73O 1GT91 1H9CA 1NYLA 5EZ6B 4URYR 3SQLA 1JF8A 3FTQA 2X14A 2ZXFA 1WDLA 2ZRGA 3ZCTA 1JR4A 4BU1A 3NTXA 4RH0A 2QD2A 2PX4A 2DKFA 1ADYA 1LSSA 4FHDA 1FSFA 3ABZA 2ZRFA 4Q7QA 1P0IA 2L0XA 5LMUB 2XW6A 3JTMA 4ZO7A 3HYNA 4V0SA 4JC4A 2HF9A 1YZNA 2F7SA 2VK2A 4PANA 2K6GA 4TSFD 5IUNC 1TYDE 1RJDA 3DMDA 1E6CA 3LOQA 5KCMA 5ES4B 4KRXA 5HM6A 5JROA 3EAGA 4FOSA 1FJHA 1QGOA 1TOAA 5SYNA 1JPNA 3P2OA 2HIAA 1RD4A 4TWIA 4CT0A 2JJ1D 1KO1A 4PC3A 4UHDA 1WU8A 2ZUUA 3Q85A 1U0SY 3QVGB 2FEKA 5H0IA 4YT2A 1XNGA 3ELWA 4J49A 5AUQA 1KP3A 4OB7A 1EUYA 4YRGA 1VPLA 2MSNA 1ZSVA 1A9XB 3O8QB 2ZFUA 3PCTA 4BQFA 4DJAA 4NH0A 3B6IA 2QD3A 4JH0A 3WV5A 4U2GA 2FV8A 5ER6A 3ETDA 5F7OA 3ZHOA 1B6TA 2QG6A 4WKGA 4PHCA 1PFVA 1N75A 1QO0A 4UBOA 3N0XA 1C9EA 1E4VA 4RF3A 4WFJA 5LLDA 3FFAA 3L7BA 4AZVA 1TC2A 3NUGA 4Z4EA 2QNRA 1TAUA 4C0SA 3OPQA 3DDHA 4M83A 1LXCA 4MSUA 3GH1A 3S6JA 1E2PA 2R4QA 3IJRA 5EYPB 1TQ4A 2MSEB 3KQSA 2OGWA 1LBQA 1S9HA 4I4CA 3IP6A 5JZOA 5KSOA 1W36C 3NOVA 1LPOA 3W3AH 1ZOOA 2Z5VA 5DI3B 4AIIA 3IAS6 4R54A 2EKDA 3N53A 4A6PA 4F96A 4DNFA 4IF6A 3IP5A 4X8HA 1AZSC 1KH3A 1MAAA 1S3FA 4D0LB 2HRDA 3MT0A 1FXWF 3WKAA 4TS1A 4KXYA 3GLHA 3TTXA 2FPRA 3ELDA 4ITRC 1Z45A 5AQEA 3W9YA 1H2ZA 1JT9A 5F7JA 3HYSA 2C61A 1XRJA 1WV0A 4LXUA 4BFVA 1J2TA 3KOYA 4CPDA 3ZHUA 1FS4A 2WFMA 3L46A 4FFRA 1LNZA 1P8JA 2A6PA 2AIRA 3EW9A 3ESXA 4MA4A 1INLA 4G9GA 4FZ3A 1GSIA 3BDIA 4KGZA 2IEAA 2C0PA 2G63A 2PRYA 4U0JA 4UMFA 5CB4B 4ZIRA 3T3GA 4MO9A 5D3MB 2DLDA 1RFLA 1GZ7A 4GECA 2W71A 2ZE5A 5EJIA 4ARSA 1C3XA 1ONSA 2FQWA 3P9KA 2G0TA 4HLNA 4KQ2A 3DTVA 3WC4A 3V1YA 3RUEA 2ACWA 3EQ8A 3BIWA 1SUSA 4C2UA 1WQ4A 3PDJA 1NLUA 1EVEA 1JWAB 2Q0HA 2WVAA 3DHYA 1XMPA 1A4XA 2IDJA 4C4ZA 2IYQA 4WRRA 1CG6A 2XB6A 2Y71A 2HQRA 4X20A 2EP5A 4L0QA 3STHA 3ZEIA 3ANYB 4JXKA 5DXFA 1R4NB 3AM4A 1V43A 5LXTB 4PO8A 3FMFA 1XNHA 3MW8A 3PB3A 3SF8B 5I5GA 4G4GA 5LC1A 3RK0A 4LS3A 1A4RA 4RHFA 5TRTA 4POOA 3I92A 1KQOA 2PFGA 4EH1A 7REQB 3N2NA 1U3TA 4EG8A 4BNKA 1KPIA 3R23A 1JV2B 2R5NA 3K3PA 1Q1BA 5KNCA 1BDIA 1M8GA 4LV6A 3A3NA 4W7SA 2DTXA 4EYEA 1HDCA 1WVMA 4BGUA 2R8BA 3CPSA 1Y4UA 4HDOB 4HAXA 2CCJA 4ES6A 1AS2A 2FSHA 1ODFA 3FCYA 3IVXA 4CR6A 2NU7B 5EN4A 4DREA 3IEMA 3P9PA 3Q7RA 4R98A 1YIOA 4BX3A 1HDYA 1Y8QB 3H5RA 1YR8A 2O54A 2B25A 3GNTA 2W2XA 1YKFA 1E2IA 4A0SA 3CVWA 1WRBA 2AXNA 13PKA 3OU2A 4RXMA 3KPJA 3SF0A 1FF9A 3BRQA 1GG8A 2JFHA 4QBKA 1P17A 4IX9A 2E4WA 5LQRA 1DJNA 3GLFA 3TTSA 1SKAA 3E23A 3U39A 2IDKA 4MQLA 4LTDA 1I1NA 3DBRB 4OA5A 4QWWA 1ZWKA 2YFYA 1ENPA 3BH7A 3NJ4A 5M5BA 4EKGA 4HLUC 3LCMA 3ZGZA 3GZ4A 2ADMA 1TFUA 4UREA 5CITA 1NNSA 4D1YA 4IKPA 1U0TA 2VYQA 2X8BA 2Y2UA 4XCQA 5JY1A 2QJFA 3MS2A 2BMFA 4DCTA 3V33A 1ESEA 2PXCA 1EX1A 1TAHA 4M1KA 2RJOA 2GCGA 6REQB 3UWDA 5I9LA 4ZJZA 3CVXA 2VZ8A 2IHYA 3KVYA 1NOJA 4OJYA 1KJ8A 3EY9A 2RKBA 4Q3NA 5JHHB 1TPZA 4H18A 3OIDA 1E2DA 3N8HA 2CXNA 2HMAA 3AR2A 2MMCA 3O6VA 1ZUNA 4ABTA 3ZDCA 1JI3A 1V41E 3PD0A 2QWXA 3EG9A 3LHSA 1NW3A 3BMOB 2AYXA 2PT5A 3VKUA 3CVOA 4O08A 3X1JA 1TLLA 2VHEA 5REQA 2JD0A 4HFNA 4LJ4A 5IDVA 3BSWA 3B9RA 4I3FA 3S8YA 2ZJFA 1BHQ1 3GFGA 1OXSC 3QXJA 5FNVA 5CFOA 1PDVA 1XN4A 1TTHA 1R2QA 2ZAOA 3T1VA 1QCZA 1OGJA 1SWVA 3C3DA 5DGTA 4Z4QA 3LC1O 4NK5A 1CJTC 3B36A 1O4VA 3AHIA 3DAHA 3E7PA 3O31A 4L75A 4MP8A 4JQSA 1HDGO 1ISGA 1JAHA 2GO7A 2AFHB 1PD1A 3RIYA 1HRKA 2E6KA 2PU7A 4PGGA 4CM9A 3FDZB 2ONZA 5A6VA 3B1XA 3LOUA 2BFCB 1RWMA 2P3SA 5JYCA 1PFYA 1IEQA 3PQ2A 3M89A 3KQWA 4OQYA 4WNAA 1Z16A 4I8DA 3D0OA 1EVKA 2F64A 1JLMA 2AUMA 4L6AA 4U3JB 4X3CA 5ER9A 4CVNA 1X1TA 2VTBB 4AUKA 2FHSA 1WZNA 1MEJA 1T3SA 3O91A 4ZK2A 1LWNA 2Y0PA 5K3BA 3KSMA 4H9GA 2WI8A 3ONDA 2NQTA 1H2AS 1TD9A 2AMFA 4HTAA 6CHYA 5FWYA 1JAIA 2E1PA 2PQ0A 3QVWA 2K5UA 3R7LA 4EJSA 4B8YA 4B87A 5KHOC 2NT3A 3NBUA 1G66A 2M6KA 1EE2A 1EVZA 1YAJA 6ABPA 1Z8NA 3LXMA 3R41A 1ZM7A 4Q48A 1AMOA 1EG7A 3AI1A 4GMGA 3OOSA 3TI9A 4NG4A 2JJ2A 1S3GA 1EFDN 2HK7A 5FFFA 3ZY3A 3OPXA 1GQ2A 2FE4A 3PVCA 1FDVA 1YS1X 3JQFA 3KBBA 5DHRA 3IMFA 4I7EA 2H9YA 2BHNA 2K2WA 2ZB2A 4QREA 5DNVA 4XPZA 1L5VA 3M6LA 1NG9A 4DSUA 5G1PA 3BSSA 1XMJA 3SX4A 1BQ4A 1ZYUA 1RACA 3SM3A 1GKKA 2D2XA 2EXXA 4I2VA 2ZREA 3O47A 4CMIB 4D9EA 3FSJX 1E3SA 1VECA 3F46A 4CLDA 2XZPA 5HK8A 1XDWA 3S1LA 1ZN9A 2UYOA 4JKIA 1BQ3A 1L7VC 3COVA 5DM4A 3G2QA 3HR7A 4PHHA 1Y5RA 3IQHX 4LMBA 5FOTA 1Y1SA 4WESA 1E9DA 1ZGZA 3GT0A 4YB8A 4Y6PA 2JVJA 3DAGA 3PLRA 2I34A 1SEPA 5L53A 3EMBA 1WLYA 3WRXC 3CR8A 3EUFA 5IWCA 2X9LA 4CEHB 2P2SA 1WLSA 3K8QA 3N0WA 2C2HA 5IF3A 5ICFA 4I14A 1NAIA 1U3VA 2C96A 2WA2A 1UKAA 2PRSA 3AUAA 3AHFA 3LNTA 4IXMA 4PO1A 4TTRA 4YK7A 4A4DA 1L7DA 3N2GB 2OGUA 2P5YA 1TA0A 5DPMA 5ILGA 2HBYA 2PKCA 1PJBA 2VH5R 4HRAA 1AGYA 2PKRA 5FR1A 5JXHA 4MPRA 3IS3A 4JNKA 3SMQA 4E6EA 1PW7A 4KKVA 4N3AA 1PUXA 4GPEA 4CIAA 2WD7B 2KM1A 4W82A 4IAOA 4KKXB 3GAAA 2VH1A 1E64A 2IT1A 2J7PA 4H3HB 3B6MA 2VL7A 5CLIA 4MR9B 3M1LA 4EMTA 5EQDA 2HEIA 5IF9A 4IILA 4XQ0A 3ZUPA 1SQGA 3K15A 3PUIA 3VPDA 1T9HA 1XAIA 3BWVA 4FBGA 4ARVA 5TEVA 1KZ9A 1HFEL 2AC7A 4JJ7A 5ALWA 1KOGA 3CT4A 4JXXA 3P0JA 1S1MA 4ZI3A 3QMPA 4LF6B 1E0KA 3G79A 3GV0A 3G13A 3CEAA 4OHWA 1XRMA 3AG6A 5EL0A 4HQ6A 4JLVA 4LBYA 5D2CA 4E14A 3TGWA 2Q4OA 1DEOA 3FDJA 4CV0A 4F2WA 4PFKA 4BDSA 1VLZA 2XUZA 1NLYA 3B85A 3EDCA 5D7NA 4Z49A 3QH4A 4BBAA 1MG0A 1QRUA 4ZQGA 1AOXA 5WRFA 1XR3A 3EXIB 2AE1A 3PUHA 3U3MA 1WHTA 2Q2VA 3GOHA 4P4UA 4BMNA 2FLWA 1F38A 1P8AA 2NZ2A 2VPWA 3A31A 2O0KA 4DT1A 5K99A 1KJQA 3CJQA 1NBMD 4JYCA 4RH1A 4CLXA 1GDDA 3UICA 3EZXA 1JXQA 3E8MA 4AUEA 1TIKA 4IDHA 2YC4C 4MHOA 2HIHA 5JASA 1OC4A 2XTAA 4ZHQF 2ZZNA 3O8BA 3N0VA 4YJ3B 3I01A 1XBTA 3W9UA 1VPTA 4TSFA 2J45A 5IASA 2OHIA 1DZ3A 1WF3A 1UZLA 1T2UA 1OFUX 2ODBA 5BN4B 3KWJA 2IHUA 4Z51A 2XGOA 1QORA 3H9CA 4KWTA 4QU9A 1UDBA 1M2KA 1T6ZA 2JGKA 2JJ1A 4HVTA 4NCKA 1H85A 3WYFA 1BKSB 2CJWB 1JFLA 2H2AA 3D2BA 2FKAA 2OFXA 1R0ZA 4TKZA 1AF7A 2I8CA 1YDEA 2VQFB 3U62A 3HDJA 2QVLA 4D9NA 2Z6QA 2B1JA 3AEUB 1MX1A 1NZDA 2Q41A 3F4BA 3NZEA 1L7BA 1QFYA 2VHTA 2II6A 4OHOA 5ALTA 5B55A 3EPHA 4XQ9A 2R00C 5CDYA 4YJDA 2QAIA 5BN5A 4ZVKA 3T1QA 3CO5A 4L5IA 2WJHA 1BHJA 3LY8A 1VKHA 2FWJA 1X6VA 4DG9A 2YV2A 4V38A 3QZUA 3TQSA 2VSNA 2WF7A 2MYNA 3DR5A 1V4VA 4OQFA 3ZNQA 1XRQA 2PUBA 4C76A 4X91A 4QUGA 3LXXA 1LLQA 1NQOA 1O6CA 4B5KA 5HG0A 3OLVA 5C9ZA 4BNHA 2C2YA 4QPNA 1GPWB 4NKRA 1J5XA 4S0XA 5FPYA 3TXXA 2RG1A 1KA9H 4Z99A 1R0RE 1A71A 2VRBA 1G5PA 4MZXA 1QIFA 3Q7QA 4W4TA 3FOEC 3OMLA 3FSEA 4ZCPA 3FYTA 3DZBA 2QP4A 4N18A 2Z4TA 3EMDA 3ETCA 3LPDA 2W22A 4GXTA 4OM8A 1RRGA 3DKVA 3WK5A 1YHNA 3ZHTA 1NVXQ 3TL3A 3I9V1 4J0CA 1GAEO 3HC7A 4I2NA 3SHWA 3FXAA 5JW6A 5AUOB 3N9IA 4I5DA 1EJ6A 2NZVG 3OZVA 2OKCA 4QXOA 3WGQA 5CVVA 1EAYA 2D0OB 3D7MA 1JSRA 1QHSA 3GP3A 3ZW9A 2XI4A 3WFIA 3C3AA 4BFUA 4P2GA 3TR0A 4D9FA 2VEDA 5JPIA 5IH7A 2VCEA 4IV5A 3KYIB 3RHFA 3IA2A 1KJIA 4H15A 4U7WA 2GZ3A 5JQGF 2ZUEA 5CA0B 1O9BA 5TT1A 1TYEB 3E8SA 2PGOA 2R8OA 1DC7A 2PYZA 1QP4A 4CWAA 2C97A 3QF7A 2FXVA 4JBYA 3A6LA 5D87A 2O2CA 3PUJA 1AGNA 3SI7A 3UTCA 1Q44A 4AZ0B 4C05A 5HPYB 1L0BA 1AF4A 1THGA 1RQGA 2PK3A 3KAPA 3OCZA 4UM8B 3B70A 2FOLA 5HMMA 5IC6A 5JVDB 4ZK6A 2YVKA 5B4VA 5DYTA 1QG6A 5KYWA 3QXGA 1UMBB 1LFAA 3GLGE 1WXWA 3VU9B 3H9GA 4JLMA 2C4NA 4GUDA 4EL0A 2CGEA 4UAVA 2FDRA 5FOVA 5DW3A 4WK4B 3RRFA 1A9OA 3KKPA 5HX7A 3JQAB 1G8PA 2DYKA 2YC2C 1B43A 3LHKA 2C4HA 2IHKA 3OZSA 5FTWA 2A7XA 1L1RA 5CK4A 3OCWA 3C45A 3LT2A 4IHAA 4O2AF 4B17A 1CY7A 2C4UA 1AMNA 4RTJA 3WWCA 2O5EA 4X63A 1TEXA 5D1NA 3UT5B 1N2GA 5CJJA 3OZEA 4V2IA 4DQVA 2Z8YA 4F1KA 3DJYA 2GA8A 1H22A 4MDHA 1RRPA 4C89A 1OFUA 3RJMA 2XHZA 1VG8A 3EEIA 1W5AA 2A0WA 3FG9A 3HI6A 3MK31 3N8GA 3H3FA 2JCBA 4RTOA 4FE3A 5JZMA 2I4NA 1HOXA 1VC2A 3JD4A 4A1OA 4BWFB 1PWXA 1TZBA 5LUAA 2HLPA 1AURA 4DV3B 2P4HX 3F6PA 3X1XA 1OTXA 1OXTA 4ONEA 4Y6OA 4E51A 1YASA 3IPLA 3NM6B 3SYKA 1GZ6A 2BP7B 4I6JA 1N9KA 3W2TA 2FWIA 2XB9A 3MLEA 5J2UB 4BNYA 4G4JA 5ICCA 1ZOLA 4HNAB 2QLJA 5HIMA 4HFJA 4N3BA 5LLSA 2GMWA 2IOFK 4IH1A 3NRJA 4IQ4A 2DEUA 1BIFA 1NL3A 4KQJA 5D3KA 3VBCA 3ESYA 4NDAA 4EKIA 4INZA 1PL0A 2OB2A 5BWOA 1LPNA 4N3GA 5DHFA 5BPFA 4OCZA 1OX4B 1FFBA 3DMRA 1GLGA 1DAMA 4WACA 2WYIA 1XTSA 4LOLA 1O57A 3SFZA 3E35A 3CJRA 1IXKA 3GJXC 4Y1RA 1HEYA 1Z5UA 5IKMA 3QVOA 2XH8A 2F48A 2GXAA 1Z6ZA 2BZSA 1JZQA 3OZWA 2CJFA 3I64A 4LK2A 5LB2A 4E88A 1LTKA 2RHWA 1YVPA 4WJKB 5KU7A 3RIHA 4R9RA 2L17A 1RE1A 4PBSA 2CHEA 3UMGA 3C48A 2VDNB 3I12A 2W2MA 1CCWA 2B21A 2I65A 2A1TS 3CF0A 2YW2A 1EIZA 1SWWA 3N7UA 1TT5B 3FUWA 3LL7A 3WHIA 4EPTA 3P4XA 2HH9A 5EPUA 2Z83A 4MRRA 2OZLB 4MW5A 5GJWC 3BWCA 1JR3E 1Q3TA 3GT7A 2XQKA 4RM3A 5FV7A 1SG9A 5DZSA 4LC9A 5CM8B 1IUNA 1MH9A 3I9V6 2PJDA 3ECCA 1Z13A 4LQDA 4UNSA 1BX0A 4LJYA 4Y0NA 2IODA 5J5VA 1A9TA 3RWMB 2J0SA 3S0JA 1SUPA 4BRSA 3N5KA 5AM4A 5KYUB 1GFSA 2P9TA 3VVLA 5FI5A 3RSSA 1F48A 2JAUA 3VKGA 1FYFA 5AK0A 4MV6A 3C3PA 3PX3A 5E2AA 4PX9A 5H3LA 1TO2E 1NF2A 4AJ2A 3IR7A 4EKDA 2FZ5A 1NI3A 5IXYA 4N0PA 4PPGA 4LOJA 1XTUA 1JA0A 3K96A 2VSOA 4AAYA 4KN9S 3E2PA 1L5LA 2XPCA 3IAEA 4KN6A 1CFJA 4U7PB 4V0NA 3U3ZA 4YDQA 1U3FA 1IXZA 1ZR2A 1RBQA 1E1NA 1H4SA 4YMWA 3ZLUA 1SIUA 2LW7A 4YCBA 2NU6A 1DXOA 1ULUA 4EGCB 4CMKA 1YCGA 1A2KC 3SJ7A 1XCOA 1UXIA 4HF7A 4C7JA 3MVEA 4EDFA 1W581 1Z6QA 3F6SA 3IUJA 3NWJA 1BRMA 1Z12A 3WL8A 4XUCA 2HA7A 3JAWB 1YS2X 3QHAA 1QX4A 3UMRA 2JASA 2I03A 1NXVA 4B82A 2POQX 4WK0B 4BN5A 1CQXA 1BEZA 2AFIB 3A3KA 3DLHA 1TKCA 1W48A 1R6AA 3HADA 3HXPA 1I14A 3CNEA 4I4NA 1II9A 4J0JA 3STUA 1L5NA 3B8HA 3OUUA 2J5BA 4OI2A 2JK1A 2FPXA 3RD5A 3AX6A 3LD9A 5FUQA 3QXCA 3LQRA 3ZVLA 3G89A 4OFZA 4AWBA 3ENKA 1ZUIA 1IEVA 1KJNA 1Q0LA 1W4ZA 2FY8A 2Z9CA 3ST7A 8OHMA 5FPQA 4BP8A 1QGDA 3RFCA 3E27A 4TZ0A 2R2AA 1UJ6A 2HK6A 5KTMA 3K0EA 3ZLVA 1E18A 2EF0A 2PTGA 3JVEA 2ZS7A 5DBGA 5ALNA 2Z8XA 2H1OA 2XUKA 2RAUA 3HABA 4WCFC 4EPXA 1GU1A 2IYZA 3LIIA 1W0CA 5JMTA 2E0IA 2BFDB 1K7SN 4F5EA 1TZCA 1UJMA 3GFVA 2Q7DA 4WMLA 5ALYA 2PLRA 2WSYB 1QH1A 1Z33A 2QN3A 1E58A 2XQIA 2UZAA 1XEWX 1SQSA 2FI1A 4I3GA 3TQCA 4DANA 1ADBA 3DXYA 2TECE 3NTQA 4MMXB 4KX3A 1U3UA 3RQIA 1REQB 1CUEA 1VP9A 5TQ2A 4F71A 2VT7A 5FWXA 5AW3A 3THYB 4UAJA 1DC4A 3JV7A 4IEFB 3ZQKA 1CLEA 3WIBA 2TRSB 4P38A 1M6HA 3WQSB 3TE7A 4OBBA 4YUYA 2VQSA 1LF0A 1Z7WA 4KBFA 3HFGA 1Z6AA 4P0TA 4ZU1X 1MZPA 4ZRNA 1BGXT 1NR1A 3PUXA 4YHBA 1HQYE 2M9MA 2D00A 3IPAA 1AC5A 3JRWA 4FP9A 5EE0A 5A7GA 4C06A 4E12A 1FL9A 2AFRA 1KVQA 1VBFA 3NTRA 3TL2A 1YBVA 1ONPA 1ODIA 1DDOA 1LQ2A 5IBPA 2X0NA 4AMUA 5CW1A 2BFBB 4KXNA 3HJHA 2FW0A 2C29D 5TPWB 3RJZA 4BFLA 4RPKA 1R4MB 3RTGA 4TZKA 4LJSA 2PJUA 4E15A 4H1HA 3GU3A 4IIDA 1R9JA 2JJQA 3A14A 3WBJA 3S3TA 1KIAA 1MW9X 1S5PA 3H3XA 5KOHA 1T2FA 1ELOA 2AYYA 4B71A 2ZPAA 3HXQA 1CUJA 2Q1WA 1OAKA 1SK9A 4NESA 4EECA 2CDRA 3JQGA 3RLIA 1FSPA 1QVVA 1UBGA 1EJBA 4KB5A 4ZCIA 3NX4A 1W35A 5KQMA 1CUYA 1SVKA 2B0CA 1TVKB 3WKBA 1F8FA 4EBBA 5KX5A 1N2XA 3ZWMA 1HZJA 1S2MA 5TJHA 5C3UA 4FS8A 2EZ4A 3SGLA 3BRSA 3KAJA 4C7BA 2R2GA 4CKEA 1SOUA 4RIHA 5KSZA 5EJ2A 4G5HA 5CG1A 1KFBB 3Q8XB 3ZIUA 3L4EA 1BW9A 3IBTA 5B3JA 4D57A 4TKLA 1AH2A 1JHOA 5ECDA 3E9ZA 2IEBA 1JLLB 1G41A 1GR0A 5ALVA 1QF6A 3DCIA 4QZVA 1SC9A 1KY2A 1J20A 1LLDA 1Y6ZA 1W1IA 1Z4LA 3DL4A 3FFXA 4L4ZA 4PG6A 3ZYCA 2YZKA 4HSGA 1LB1B 1ITZA 3DV9A 4E11A 1U1FA 4CXMA 4FXOA 4HMPA 5F98A 2Y1OA 2FUG1 1N2CB 4U7GA 1YDGA 2CFCA 2R87A 2AGVA 2VDVE 3ZWOA 4GPD1 5AOAA 1E6WA 1VCHA 3SX2A 1H3NA 4XM2A 2FLVA 2HJRA 1SD2A 3ZCXA 1JA1A 3K92A 3T5AA 4B3SB 1GA6A 1XQXA 5C18A 1WPXA 1QPZA 3K0CA 4GVLA 3MJHA 3HKBA 3OZ7A 2ZRPA 2WG1A 5IANA 5CNMA 5ICGA 5IAEA 1AXGA 1I6WA 4GOKA 4NE2A 4OJQA 3JSAA 2LKCA 3CZ4A 4U0KA 3SC6A 3TIIA 4OAPA 2H3HA 1CRLA 2JA2A 4G9EA 2GYWA 5FDFA 1Z2NX 3U2QA 3TB6A 1EFAA 3V9PA 1XG5A 2GEVA 4HUJA 3A1TA 4IZHA 4QXAA 3B13B 4GBMA 4GSKA 4E09A 2QBYA 1XZJA 2JLWA 1T2NA 5I7VA 2PA0A 4QTUB 2RGNC 2W9XA 5AVKA 1VL8A 5J1TB 1NQVA 2BI7A 3FMOB 1KQPA 2C99A 2ZSJA 2P67A 2W6CX 4G0YA 4YEDA 1E2QA 2CXQA 2XLCA 3MT9A 3HFJA 3WVNA 4BEJA 1J70A 1M34B 4WZBA 3IALA 3GFTA 2BDEA 3DEKA 1XU7A 3JAMA 4I1YA 1ZVKA 4P6VF 4R81A 1EZ1A 4LHYA 1I13A 4WFIA 2GHIA 2GZMA 3QLEA 5AIAA 5E1MA 3ZV7A 4KRFA 1RKBA 3FNQA 4TMFA 2P30A 2P8JA 2QQFA 4H1VA 1CC1S 4NJMA 3KE9A 3RYFB 1WBBA 4UTNA 2EJTA 2ZIVB 2ZUWA 1STOA 4LJ5A 1L5ZA 2XKJE 5BOVA 2CHQA 3P52A 1YF3A 1N7HA 2J9YB 1GA4A 4L4XA 1U8AA 4KR3A 1FPQA 1K27A 1O5TA 3CRZA 3H84A 4R31A 4IGIA 4ZYZA 3NAZA 3QVXA 3IXLA 2VBCA 2Q4BA 1B93A 3WLRA 4QRHA 4XJSA 2JIPA 3WBKA 4DQUA 2E49A 2BGNA 5LOVB 1R64A 2VPZA 2DPYA 1NQWA 3IAHA 3CA8A 3QGMA 4HYTA 4YWJA 1SURA 4EUHA 5K2OA 1L5MA 3AVQA 1FY2A 3LPMA 3N6RA 3SU8A 4EZIA 1V7CA 3REFA 1OB2A 2Q5IA 4F7WA 4CM4B 3J81A 1U81A 2Q8PA 2IYSA 3UB2A 1GTL1 1P7WA 1QG0A 4R3NA 4XPIA 3RBVA 4PNZA 2Q2NA 2OHGA 2ZZKA 3INGA 3X1ZA 2VVTA 3GZNB 5AHKA 2PE5A 1TZMA 3QKRB 3ZGYA 3ILVA 1GPMA 1Q5PA 4ZOEA 5B1DA 1LVHA 3BICA 4OAOA 5GAJA 4UU1A 3D6UA 2NO9A 2IYYA 5SY4A 1KF0A 3B2QA 1S9DA 3MT7A 3L93A 1L5KA 5ISMA 5LMNB 2BW0A 2R6R1 3A7DA 4OAQA 5GOTA 3JQPA 4HADA 2A8YA 1X7XA 5KMGA 2OB1A 2IXDA 5KQRA 1RWOA 4G0UA 2PMFA 1MRSA 2KW5A 4KE6A 4DL9A 2ZRLA 4CT5A 3CISA 2OD9A 2CL0X 4J3FA 4JCCA 2Q9AA 4KYUA 5ALJA 3O90A 3BQMB 1JALA 1VDMA 2XMGA 5E3IA 3K53A 1N3IA 3QW4B 3RANA 3WSVA 3QPDA 4H0CA 2OCDA 4R8LA 1WSBA 3G5AA 3RS3A 5C4MA 1Z7BA 4GUAA 2NZUG 4C01A 5KTYA 5B36A 1R8SA 1QAMA 4GEKA 3B48A 1TU4A 3F1LA 4RA6B 3OQIB 4UNPA 5HQ3B 2QUAA 1GGMA 3ABIA 8MHTA 2WJAA 5KPDA 4E2WA 1NJGA 3W5BA 2DX7A 3HZRA 3EIXA 4JBNA 2QOEA 3OFND 1BFKA 4YRPA 5BRAA 1KHTA 5C8YA 2FUG6 3OP1A 1VPVA 2A94A 3BXGA 3HYTA 3F4KA 4MR8A 4CL0A 3I1YA 3AL0C 4F8YA 4CCAA 2X22A 3VHRA 4NZYA 2C7VA 1SUCA 4PS1A 4PAGA 1M1ZA 3ZE6A 1B8NA 2J1LA 1HMYA 1PGJA 1Y1KE 3VVCA 1U2DC 5BWLA 2HSEA 2PKXA 2VRCD 1PWHA 4PLVA 3WOHA 4QOJA 1OU4A 4HH1A 4C6TA 2QLNA 4RGYA 4I9UA 1OD6A 2B1IA 1EJ2A 3IP9A 2PSDA 1C1DB 1T6NA 1JU9A 3DZHA 4WLVA 1J42A 2E4YA 2J33A 3IQEA 3OSUA 1OLUB 2AR0A 5DFAA 1ISPA 2WR8A 2FRDC 2COUA 4QU0A 4L50A 4NEQA 1A4IA 4MI6A 2PZ8A 3TRHA 3ZXSA 2J5KA 2YJNA 3EEFA 3P9IA 4JASB 5CIQA 3JASB 2Z04A 2YASA 4R3UC 3V1TC 1QRTA 3DOHA 4AJEA 3KC2A 1V5GA 2ZRHA 1UANA 4KR7A 3I5MA 1WBDA 1BCSB 1ZINA 2E4VA 5DTJA 1DEAA 1SXIA 4E22A 4EJFA 3H8SA 1E2NA 1VKOA 4MQ4A 3MJFA 3AP1A 2NP6A 1MEEA 2PQ2A 3TW0A 4M9UA 4KK3A 3O9MA 2OWDA 3DZKA 1PGQA 1Q1QA 4CUJA 4IZ6A 5A71A 2WJZB 5ERGB 4DADA 5AVUA 2AZTA 5C81A 3AEQA 3GCGA 3SS8A 3D0RA 3RTDA 3S2UA 4F8JA 1IBLB 4XVHA 4UCFA 1V11A 3GEMA 3TS1A 3R3VA 5DHPA 3QOFA 3GELA 5J2TA 3CGGA 3CIOA 3SZLA 4FMCF 5G53C 3LTNC 2BJHA 3NPMA 1IXRC 2C2BA 5FADA 2AN3A 3TW6A 2W6ZA 1JHZA 3PIDA 3L0ZA 4LRSB 3NASA 5JH7F 4HNVA 4A91A 1G21A 3THWA 4D9MA 2PYDA 4Z8YA 2ZQYA 2DP4E 2BY4A 4OIMA 2BUBA 4LE1A 2GYVA 1M1NB 2PAFA 4CMGA 4NC9A 2FF7A 3FWHA 2WM2A 2H1FA 3ANSA 5HGXA 5ESXA 2QT9A 2QG9A 1MIOA 2IYNA 3CZPA 4MRVA 3K70C 1I32A 2Q5JA 1XTQA 4BC1A 2V3CC 5T3YA 5E6SA 4EW2A 4RD3A 5AKZA 5EVCA 1DI0A 3ROZA 5LU8A 1FDSA 5LA6A 5IHPA 1QP0A 4BX0A 4P7FA 2JB9A 1N5DA 3EXG1 1RKUA 2J0QA 1UDRA 1O89A 3PC2A 4CRWB 5BSEA 4BQQA 4ARZB 2ERCA 2FW1A 3RI3A 1YA6A 3AC0A 3B6ZA 3EJ6A 3EVGA 3S44A 3AZPA 3VO8A 2BGWA 1KMIY 2WD8A 3PGA1 1DWQA 3PSAA 2JZOA 4HAVA 4X94A 1FLDA 4JYZA 5BSUA 1RLMA 2V6IA 3MWEB 3WRVA 1QU2A 4DB4A 4PG7A 4LDQA 1S2OA 4UBNA 3TNJA 1E59A 3T5MA 4YP5A 3GUUA 1UP7A 2G5PA 2I0FA 2EEPA 3B12A 3UNXA 5J43A 3VAAA 1GOTA 1Z0DA 4LXYA 3ZWVA 4ZYLA 1VDZA 2FA9A 1VRCA 2AVDA 1YOBA 2PZLA 1PDOA 2H4YA 3HY6A 3KXPA 4RD4A 4A16A 2E4XA 4BZWA 4CUZA 3ICEA 1NXQA 1XRSB 3W5CA 3A1WA 1IE3A 1Z83A 2I6UA 2V4ZA 3IOYA 4IFEA 3S81A 2QTWB 2CXOA 1CK4A 5EFOA 1PV2A 3KXLA 3S1AB 4E7OA 2PQMA 1VL0A 4BNZA 1DHTA 1TZJA 1U5BB 3GY0A 1Z5OA 2IU6A 3B20A 3QUSA 1VJ0A 4RCYA 4BMPB 1Z6GA 1Y6GA 2JARA 1WDWB 2FOIA 1GAQA 3KFLA 4WZAB 3ZWBA 5BV8A 1KSFX 2G82A 3M34A 1KI8A 2PMEA 3M7IA 3C87A 3Q2KA 4K28A 3HKCA 4GZLA 4QQRA 2OHFA 4HZUA 1YK1A 2WKSA 1VG9B 4S3MA 3E2MA 2IW1A 2X3UA 4AXBA 5IKEA 1LLUA 2GOYA 2A9OA 4H4DA 2ACKA 1ISRA 1DQPA 5JSHA 4Y6LA 4HN4B 2IU4A 4QVIA 4IQ0A 3G5TA 2XIQA 3TPZA 1JHMA 2HCTA 3RC7A 4BXOB 1D1TA 3DBHA 2HX1A 5F5NA 4WKBA 1ZXXA 2GKOA 2EQBA 3GJ8A 3JVUA 4LVNA 3E22A 4MR7B 4ER7A 4G5QA 2R6DA 2ATXA 2OYCA 5AKHA 1U3WA 1ENYA 1DT3A 4M1WA 2ECPA 1GGHA 1RHJA 2V4UA 1OFGA 4LVOA 3EW7A 3G7NA 4QU8A 1J24A 4IQFA 1RYFA 4R0NA 2AKEA 3CC8A 4RF5A 3BEOA 2O2SA 1UK8A 2V6GA 3VOTA 5B58T 1TRHA 1G8YA 5JZVA 2IXFA 2XD4A 3DDOA 4M55A 1QGED 4E5PA 4UOZA 3NHPA 3CNLA 4CDMA 4YMLA 2ZWMA 2FMXA 3E9MA 2UZ1B 3E0XA 3OVMA 4TV9B 4M49A 4AZTA 3ZHSA 2XXAB 2PNJA 3ETEA 1ODKA 3PFFA 2NSLA 1DBVO 2HW8A 4BWYA 2IKQA 1H3FA 4EUKA 3ZIDA 1VYUA 1ZEMA 3BH6A 1PIWA 2NN3C 4B3DA 4JBXA 4CKWA 1PJ4A 2Q5OA 1F5SA 1Z7YA 4ZMBA 3FFWA 2NYVA 1TFRA 3A2LA 4ML3A 5CUQA 5H4HA 4ENWA 1B8OA 3GBPA 3G2KA 3B2NA 3R8CA 3ICQB 1NSYA 1BVHA 1U99A 5K8VA 1U80A 521PA 5K0ZA 1N77A 4WADA 2P9ZA 5IT4A 2I1QA 4HVLA 4RY9A 1FMFA 1G20A 2NADA 2NVUB 1W5TA 1UBRS 1YS4A 5LQNA 3C3KA 3KUKA 2WTEA 2JFBA 4KSCA 2GTIA 3MCWA 3C4QA 2PANA 3T9FA 1LDNA 2IIVA 3JD1A 3R3SA 3RAPR 2GBFA 1USGA 2JIDA 4RE6A 1D1QA 4C2TA 3DMFA 3RTAA 2HA4A 4O4JF 2ASEA 4E3ZA 2NUAA 4UVGA 1S8NA 5F7ZA 4FOLA 1XZLA 1YONA 5KTKA 2H00A 3UHPA 2C95A 2Q29A 4QRDA 4RKQA 5AKKA 2VPXA 3BERA 1Q0QA 5KYGA 3IKTA 4QDOA 2G28A 3R40A 2NG1A 3H1PA 1VGVA 2WJ6A 4HZGA 4DV1B 4KQCA 3F1KA 1J33A 3KVVA 3U0VA 1Y1LA 4L27A 4TKVB 1POXA 4YREA 3ICVA 1UJNA 3UHAA 1HDIA 2ZE7A 5AVYA 1E2BA 3PFCA 2XUGA 4MKFA 2NYAA 4H6PA 4KIFA 3V8MA 4ZMRA 4Z2AA 3HJFA 2YV1A 2AFHE 4K6KA 5JSYA 4RPGA 5EWMA 2VFAA 4EPYA 1I5RA 2JCXA 3QY0A 2PUHA 5A62A 4KIGA 4OA8A 3G82C 4KQ9A 5F76A 1DRUA 1M2HA 1CY1A 2BOVA 1JNXX 2ZJ4A 2I3BA 3DO6A 4MQFA 1YCDA 4BLUA 5LQDA 1KR2A 2EATA 1GLVA 1M0SA 1P1KA 4MQEA 4JT9A 1M2OB 2N46A 4HJRA 2CHFA 1BXGB 2VCHA 5ENZA 1C81A 4OHFA 1OVMA 2QX9A 1TPYA 4XCVA 1ZSYA 1U6JA 1EHCA 2C2MA 5FBLB 4NWIA 4YASA 3A4NA 3SC4A 3W8RA 1XVIA 1ICIA 1Q16A 3N2ZB 1JFRA 4FEEA 4OLAA 1I0IA 5CFRA 3QG1A 3OPYI 5BQPA 4MVWA 4W8HA 4LYJA 1DLJA 2V7EA 1E1QA 3ZGXA 3JQEA 1ZIYA 1MJFA 2Z57A 3V2GA 5DNUA 2GPJA 3FUUA 2B1QA 4M9ZA 2H5EA 4D3FA 3SYLA 1JZSA 1N2HA 1L7QA 3FHCB 1ZJYA 2XLBA 1F2UB 4KAXA 4OM7A 4TL8A 1ZJJA 3SR4A 3BMXA 5EHNA 3DD1A 2XD9A 2NQ2C 4MGEA 2WIFA 3UC9A 3AIIA 1US8A 5BOSA 2CKMA 2O8EA 1EI9A 3UPDA 4QUJA 2ZTUA 3GAMA 3O1HB 4TVSA 3FDFA 4BFWA 3DNPA 5DIFA 5DGHA 1NFFA 4NLLA 2CNBA 3JALB 2O0MA 4TYPA 5CEFA 3GBVA 4NRDA 4QU5A 2Z3WA 4OYYA 2NYRA 4RVNA 2Z2YA 2VDKB 4F86A 1FW6A 4W5JA 3S2YA 3RFTA 1IHDA 5C8XA 3DDUA 1WSAA 3ZWCA 4N3NA 4QM6A 1SCUA 5D01A 1WX1A 2QI9F 3ZTYA 1A9PA 1VE1A 4E5YA 3OPVA 2O20A 5EMHA 1W19A 2FJUA 4UW9A 2YJZA 3VKFA 3H1TA 2F1JA 4NZOA 1UEJA 3OHSX 1NATA 1KDRA 5FAXA 4B3RB 4AMBA 1NDHA 1CY6A 4HXEB 1VFPA 2WAYA 2FRDA 1LJUA 2XNJA 4Z6KA 3LA8A 3SK0A 3PDIB 2OCGA 3ZK7A 5JCZA 2CFRA 2BM1A 2IU0A 5J4KA 3UJBA 4H1UA 1RHQA 4TTSA 2OCIA 4L7QA 4ZAVA 5KS2A 5CNKA 1BE0A 1HI9A 3OFNA 1BH2A 2X7HA 4K9NA 1HT3A 4HXFB 4Q9NA 2C20A 2ZIAA 3DLIA 3LHIA 4A8JA 1QWOA 2HQBA 3TUIC 1VI5A 2ZQZA 3G88A 2QTAA 3D4PA 1G5RA 3V7FA 2Q9UA 3F8SA 3GJRA 4XOIA 5DULA 2HI0A 3RODA 1Z63A 2FP4A 4CM8B 4MWEA 4D5EA 1OWNA 3DB1A 1ZO8A 1CD5A 2BGGA 5ERYA 2I1LA 3SYTA 3WNQA 5FPKA 4MB0A 1YBHA 4PNHA 1PV1A 2AN9A 2L2QA 2VJQA 3E58A 3HJRA 5DYWA 4MJLA 4GLBA 1A76A 2WWXA 2A2ZA 4OV6B 1YB5A 1YT5A 1YRWA 2IHTA 2OVFA 4C0AC 4NBUA 5CYPA 2DECA 3LUHA 1LC3A 2YMQA 3D64A 4M0EA 4R5MA 4RZQA 4R7GA 5IRCD 3N70A 3A05A 2VN8A 2BFFB 1C9JA 1HO3A 2AR9A 3H0CA 4IIJB 4DCNA 4DXDA 5JCPA 2V59A 4RHUA 1I4DD 2GDZA 3PC8C 4IMJB 2Y1XA 2JFUA 2WTMA 4FEYA 1RP1A 1H8HD 1JG4A 4WLUA 4YDSA 1ULTA 2ZS9A 3V1MA 3M6FA 1JKFA 4MRNA 2VKTA 5E95A 2UZ0A 5TGZA 3VZCA 5LL6P 1HR0B 3ULKA 5K5EA 4G5YA 4O2BB 2Q3DA 1EFPB 4HWKA 4LXQA 4Z0TA 3K32A 2O19A 1HE4A 1Z4QA 4LZLA 4LFCB 1UPBA 2GK3A 5IDWA 4S04A 4E1BA 4D4GA 3P2EA 3SSNA 4QQFA 3ZG6A 4TTQA 4A2WA 2QUZA 3ASUA 1JSLA 1LK5A 1TMOA 1UQTA 1X1EA 2O2JA 1VIYA 2ECOA 2WQ6A 3I6YA 1IBMB 3W5DA 1R4ZA 2YWBA 2FE1A 1QQ7A 1KETA 1HT2E 3OE5A 1HFJA 3IRUA 4LJRA 3TG2A 2NTVA 1JTVA 2F3UA 1PHRA 3QV1A 4NYJR 4JYAB 2IYXA 1GA1A 2Y1LA 4JR0A 2NXJA 4O8CA 2SNIE 2A4MA 3EE6A 3HCOA 1V71A 4IUYA 4ZEOA 2QNIA 2RH4A 3RBZA 3ZGVA 2R65A 3ZD7A 3WGYA 1A8UA 5TGDA 4TGLA 3UH1A 4B3BA 1A2QA 1UFQA 5DYGA 5FJJA 4D4IA 1TJNA 4DIMA 2UYHA 1RHRA 4PZLA 3TTYA 3HDQA 1FVHA 4S35A 3NBZC 5FR2A 2BKLA 3PFIA 3HNPA 4MINA 3TZ6A 1M5TA 4MTCA 2HZ7A 1A95A 2EKPA 3LKBA 1B26A 3K0AA 4MRMA 5CEEA 4RZ2A 5BP7A 4FHCA 1OFHA 2AC2A 1VCIA 1I4EB 4J16C 4FM9A 2AX4A 1RWQA 3DEIA 4LUCA 3DONA 1UOOA 1P1FA 2X7XA 3K0HA 4MA0A 5JWOA 4LNHA 4D02A 4D96A 1ODSA 1EA7A 2GASA 3KZ1E 4B6GA 1PJAA 2TYSB 3PNLA 4MKHA 4LIPD 1YJAA 5EJAA 1C30A 3ANTA 3WBFA 3NKLA 3O7WA 4OIFA 4TUYA 3MGGA 1LK0A 3ZE9A 1JBEA 1FFYA 4EBFA 1Z74A 3RSLA 3J7TA 1KFJB 2IZ7A 4BNWA 4LG1A 4S0ZA 2WOOA 1FTQA 4DLYA 2H65A 1BDBA 2QGZA 3PITA 4NZPA 2FRXA 2YVLA 1ZCZA 3DFUA 3HXMA 4IJVA 4MJ7A 2HO4A 3PNOA 4JLSA 4JWKA 4JI8B 3OF2A 4EGAA 1MUUA 4EB3A 3DE2X 2JFOA 3RUAA 4M1YA 4M8KA 1VGRA 4NPHA 3PFHA 3GLHB 2WAMA 1Y8RA 5P8WA 4YCDA 3C6KA 3KOXA 1VKRA 1EDEA 1O95D 3IKVA 4AC9A 4ZI5A 5KREA 1PR3A 2B4YA 1JLKA 3H05A 1SULA 3QHQA 5GQSA 4K9DA 3DWIA 1HT0A 2VYVD 3UJ6A 1E3MA 4EHBA 2JGJA 3QG5A 5JO0A 4NEHB 3K35A 4PSKA 1VBMA 5FF9A 4ZIRB 4UASA 5B4UA 2ICAA 3DD5A 2ZUVA 2C77A 2PXAA 1I4OA 4UBJA 5G41A 2PX0A 1S4QA 1JBQA 3I76A 4FFVA 121PA 2J6CA 3DVLA 3DTVB 4G6ZA 4A6XA 1VLQA 1QYDA 4DV6B 2JCSA 2PWYA 3NAGA 5DNCA 2EKZA 1JHPA 3OTIA 2ISSD 1UBTS 2EBWA 2RGBA 1EWQA 3U9LA 2A30A 4DSTA 4X20B 3MPOA 4EPRA 1LBTA 3SXJA 1X0VA 3PQCA 3V4SA 4Y6RA 1K4YA 4AZ3A 2YWDA 4B6SA 3D43A 2YHIB 1O95C 2XUJA 2J4DA 3ZHCA 2QL6A 5BMOA 1JXOA 2IX9A 4IG4A 1CUZA 2J31A 1JKIA 1JQLB 2CHVA 1W4LA 3IMEA 1U31A 4P4SA 1EK5A 3E81A 1LDMA 2NP7A 3EARA 5FL3A 2CNDA 3AI3A 1YSCA 3FYCA 4XVQA 3I0MA 2XSZD 2B78A 2X77A 4WLEA 5F3DA 1P9LA 1J8MF 3IT0A 4L8FA 3QFSA 3JARA 2P8SA 3F74A 1FXWA 3I9MA 1QRSA 3KT6A 1VLVA 1SG0A 1U1EA 2HCFA 3EISA 1NNLA 2ALJA 2OC4A 1JX6A 1K66A 4HTFA 2ZS8A 4QO7A 1D07A 4Z86A 2K2QB 5J4VA 3OG9A 3S2SA 2UYGA 1UMCA 4C6HA 3BFXA 4F45A 3FGPA 3QFRA 1T9ZA 4I46A 1V37A 3D5EA 3DG9A 1V7QA 4KWHA 3HCAA 3KOWA 4HH3C 5LP1A 1PZMA 2R8ZA 4D56A 2OV8A 5FBKA 1GUFA 2JF0A 2NZJA 3FDIA 4QQNA 3GLFB 1NN0A 4CMCA 1J97A 4ZALA 1E2GA 4Q39A 2WZQA 1DXYA 1R9GA 5CBPA 2YY5A 3V4RA 4QG3A 1KKLA 3HU3A 3FCXA 3A2KA 3AQIA 3KQLA 1KO4A 1Y8AA 1RSZA 4BO9A 4B44A 4F1JA 2JLYA 5A0VA 2B4QA 1NP6A 1W46A 4KODA 1IJBA 3GUCA 4XDHA 3W79A 3NTOA 3F5MA 3FTCA 2PKQP 3FGNA 3U4QA 4QXPA 3JQDA 3T15A 3ZDYB 4CT4B 5DWVA 1MC4A 2VDPB 4EO9A 4PYIA 4HY3A 4RJIA 1UBCA 4QOEA 1ZUNB 3TRFA 2JHAA 3DFKA 2IVFA 3EG9B 4MV3A 4EYQA 4K5QA 3O8LA 4JC8A 4QOSA 3D3EA 4RMGA 2JS7A 3SDSA 5BSGA 5DU2A 5IYZF 5REQB 4BP1A 5MHTA 1RRVA 1ACLA 4R8SA 5DSTA 2OAGA 1D6NA 2NXNA 4WT7A 1OWPA 2DFLA 5GM1A 1QJ4A 2QTCA 5FPHA 1R5NA 1ZQ1A 1TCVA 1E3QA 2D13A 2I33A 3PPIA 5FNVB 1RI2A 3GEGA 1SCIA 3P94A 3K4HA 1D1PA 1KMNA 1ECJA 1C1YA 1SBNE 1RM4A 2O1SA 3AP3A 3EIOA 3PKJA 1A72A 3C7TA 3LMKA 2Y1EA 1Q1AA 3DCJA 4N6OA 4DWJA 2P9JA 4MUBA 2HXGA 3LQFA 1USWA 3AFHA 2P65A 3KL4A 1IG0A 2HQSA 4HPXB 4EMUA 1C41A 1SBYA 3E3OA 4D81A 3GJ7A 2KX7A 4LSGA 1L4UA 1W75A 3EG5A 3WLTA 4X84A 4AP5A 4WNAB 3LGXA 5AHWA 1IQPA 3R5TA 2OFOA 4X8OA 2VF2A 3WHLA 1CUGA 3ES9A 1NI5A 3DE5X 3R24A 3RO7A 3WNVA 1M74A 4BJ6A 1JAXA 4DLRA 1GZDA 4CN9A 1X7GA 4DCMA 1HETA 5EG5A 2A5GA 1T1IA 1M6EX 1YE8A 3TKLA 1I7NA 2LE0A 4CFSA 1M0TA 2PWAA 3GMTA 2D1SA 4RVUA 3JATA 4MKIA 4EJSB 2RAPA 3RJ5A 3QNUA 4N5IX 5DGDA 3KJQA 3OPMA 3QLVA 4IM7A 1ABBA 5HS6A 4CTMA 3E1SA 3ZDZB 4MUXA 1OQAA 2G9VA 1EG2A 3QKWA 2DKNA 1C14A 5HRUA 1ENZA 5G0SA 4YAOA 2G8NA 4KLRA 2YZNA 4FNAA 2Z08A 3OE4A 1IQRA 2HF7A 4RV9A 3VOBA 1MJHA 5KBYA 4WOBA 2ABWA 4JMPA 2FZGA 4DHEA 2LCFA 1KEWA 4B3IA 4UM9B 2AFIE 2J0UA 1RLIA 5K6AC 1UM9A 1WPRA 5LQUA 1FRNA 2QX6A 3S7TA 3OO1A 4JDPA 4JQOA 2EFYA 3F7OA 3G0BA 2JI7A 4EMBA 2VHJA 2WDPA 4WESB 1VIVA 3RVOA 2I87A 1E8MA 3MWYW 2CDAA 4B9AA 1D5CA 1HZZA 2NVWA 2VLIA 1F4VA 4JZYA 4ADSG 1ZVVA 2JD1A 1TUGA 4W1SA 1L9KA 2ZE8A 3QU9A 1KE2A 4RC9A 2GF0A 1F1JA 3ZGLA 3HR4A 4AF8A 2ZRMA 1P29A 3FWPA 3PIRA 3U3JA 5JAPA 4JSYA 1F2VA 16PKA 1JDUA 4FCWA 2C2OA 2EHDA 4MIKA 2VNAA 1LLFA 4LWZA 5EUMA 3WGTA 3PA8A 2XOKD 1T5SA 3TZHA 1MO2A 2MWMA 4LWPA 1ESDA 5DNWA 5IBRA 1U9CA 1RAAA 4TWRA 1I3OA 2PWZA 4RPCA 1MB3A 4E2YA 3U4AA 4WV3A 3KLMX 2DFVA 1L7XA 3NGXA 1NFQA 2B20A 2XMQA 4QYIB 4V02A 3CKLA 1XF1A 3LUFA 4FFOA 4I1IA 1L5RA 1ZP6A 4LZOA 1V16A 4RBNA 2IZZA 3VSAA 1GQFA 1H5UA 2CLOB 5JG7A 3K72B 1JLSA 1K8QA 4HPWA 1HQDA 5DWDA 5MDHA 3OA0A 3NUZA 2UYQA 1HLFA 2QMOA 3WL3A 3LYLA 3REGA 4EX6A 2C84A 1OI3A 1TJ4A 2WIKA 1KAQA 4O2LA 2VUIB 5A3QA 2D0DA 3WA7A 2BMEA 3BB4A 4NEGA 3UT6A 5EWJA 4PN7A 2EKQA 2ZVJA 3E3MA 2O7QA 4BIMA 3E82A 1KI1A 5CJPA 2W6MA 5BT8A 4NU6A 2B34A 1V1MA 2O1EA 3A3YA 4KWCA 4CR8A 4LYYA 3GDOA 1R18A 2VH2A 1NC3A 2I2AA 4GOJA 4Z9XA 1C7EA 1D2MA 1O58A 1R6DA 1ZL0A 1GEEA 2OORC 3NKFA 2AOTA 1J4AA 4EMSA 4Z5XA 4INAA 1U8XX 3CW9A 5CGZA 4ASUD 1WHTB 4J1QA 4R84A 4YDHB 4JITA 4P7KA 4J16A 1ST3A 4DT1B 3EFEA 3OURA 1GPBA 3QFHA 1E4EA 1YE3A 4FX2A 1Q7TA 1QLWA 1BFUA 2PJZA 1N9GA 3GN2A 2ZBRA 3FPGA 4UM7A 5TC4A 3HJUA 3RU9A 3NTUA 1J1ZA 1V7PC 1VPDA 3O3CA 1A04A 4MLDA 4AP6A 4WK6A 2J9FA 1VE3A 3PA6A 4FU0A 1DCTA 3B9PA 3PEVA 2AMVA 4UFNA 5K8UA 4OMFG 3R44A 4KXVA 4PZDA 3FOZA 1QQAA 4KR2A 5A0TA 4O0LA 1N4DA 3EZLA 1CUHA 1C29B 1D8AA 5L6MB 4KPYA 3ETHA 3SR3A 1QXSA 5GV8A 5CPFA 5GJBA 3GCZA 1SELA 4XVRA 3ZHRA 1TADA 3GLTA 1N2CE 4I8XA 4RPIA 2Y27A 2X8AA 3LP6A 3H2JA 1QG4A 2FMHA 3T4EA 4MEAA 3PUWA 3V32A 4PTZA 5JZBA 2OMEA 3TAHA 4IGFA 2NUPB 3AUXA 4BLPA 1P61B 3STYA 1S2IA 5BN5B 4S1PA 4OJMX 1JIUA 2BBWA 1ONOA 4QGHA 3WYNA 3C1TA 2TMDA 4ZO4A 1Y1RA 1U9JA 1V3UA 3GPIA 4I1VA 3RROA 3A7EA 1ZH4A 5K3OA 1JW9B 2HDWA 3W78A 1AHHA 2F1HA 5KJCA 4KDCA 4LHXA 4M54A 5TMEA 3PKIA 5DNDA 3BRWD 4RVOA 3TFWA 1YBMA 2EX1A 4ZGGA 1SHZA 5HA5A 2ARKA 2FN3A 2J30A 3RM3A 3E5MA 1PG0A 2CLIB 2NUBA 2EJCA 1Y6JA 4M0DA 4RESA 4ZHQA 4PIVA 3QPAA 1M34E 2IW3A 1RS0A 1L8AA 2V0CA 3TFQA 2QTTA 5DRYA 3K6SA 1MOQA 4O1IA 1K5PA 3S99A 4MW0A 1QJCA 3KQPA 3NBXX 1O95A 4X6XA 2XAUA 3MTAA 1S2DA 2Y9MB 3PL5A 3OX3A 4HS9A 5DNYB 1HL7A 3IP3A 1FFCA 3AF1A 1Q91A 2VYVA 2WIAA 1DMSA 1OXXK 2XUIA 3L0YA 1ZU4A 4O8ZA 1ZX1A 4UM5A 2XMBA 1E69A 1UFRA 4TXJA 4LZJA 5B7QA 2WFZA 2JEZA 2C4VA 3AO0B 5ADHA 2VUHB 2YL2A 4MVYA 1H4QA 4V0ME 4KLAA 4YACA 2P90A 3W4IA 3FHJA 5KYTA 4L9RA 5JY6A 4NVRA 2QVBA 1KAMA 5H1YA 2MSDB 4WLFA 3A6PC 2VAXA 1RXVA 3IO3A 1M75A 4EPVA 3DHNA 4BQPA 4F5DA 3T7RA 4ZGWA 5HRAA 4Q4AA 1BROA 2JIBA 4R2KA 2ZKIA 2Z0MA 3Q7EA 3VUEA 2N1MA 3LRPA 4ZPXA 1B41A 4BLWA 1U8EA 3KOZA 3Q0EA 1CZUA 3DMTA 4ZAZA 1F3OA 5KYWB 3GLIA 2V7PA 4W5OA 4MJ3A 3O4HA 4UVEA 5DXAA 3UWKA 5A02A 1SU4A 4J7UA 4MARA 4WXPA 1TF7A 1XUOA 4MLZA 4ZU3A 1U9IC 3CE9A 1GRVA 4HHEA 2J6IA 4NATA 2FPIA 1WNTA 2OENG 4M7OA 2R47A 4O29A 1JHQA 2XSZA 4Q1CA 4KXFB 4N8EA 4ESVA 4M7RA 4K86A 4M7WA 4MYCA 4GH5A 3EOAI 5KTOA 4PRLA 2OFPA 4ATNA 1GN9A 3N75A 3GGPA 2I66A 1OBOA 2ZUBA 4F4UA 2YXBA 1J39A 2F67A 4AY5A 3GOQA 5EIFA 2FZVA 2JLBA 3S5UA 5I7EA 1CEQA 3EPRA 4I1UA 3P1JA 2P79A 1CUWA 1UEIA 1QOZA 2BL4A 2ATCA 1ZA2A 3IH5A 3UANA 5GJCA 1GDTA 2NTEA 4YCNA 3E2IA 4WCVA 2WAXA 3R0QA 1VL2A 1Z8FA 4XB6B 2FPOA 1Q77A 4FLEA 1W2HA 2IXTA 3HCPA 2AZ4A 5IUKC 1XTVA 5HHTA 5HBRA 3PR2B 2GFIA 2I3ZA 3D6HA 3IB3A 4GYKA 2VTEA 4JHXA 1AZWA 5JQGA 2K87A 2P9GA 4RLHA 2MCFA 4JP3A 4ZQHA 4BNTA 1UZMA 1KSGA 4R6WA 1D2CA 4S1OA 2C9YA 4ESEA 4YQFA 2VJMA 1AKUA 1RR6A 4IQGA 4RANA 2IXAA 3LVBA 4BKMA 1EFVA 2UXBB 1K9VF 3I9OA 3JWJA 4NI5A 4U7HA 3ECSA 2HC9A 1XLTC 3STVA 4UDXX 4OGWA 1BOOA 2JFPA 1TJ5A 4R01A 3TNLA 4DRXA 1IZ0A 1MMFB 1WP9A 4GKAA 2QQ5A 3VPGA 3VR6D 1QUEA 2V8BA 1DQRA 3HXOA 1BKYA 3F2VA 5ES3A 5A6SA 1ZD3A 3QTTA 5B2FA 1ND5A 4JR2A 5JS2A 3R0JA 2WA1A 1SB8A 4Y1RB 3L0DA 3NWEA 2CT8A 4DQXA 3U09A 2ZKLA 1G1AA 4TQ9A 3C15C 3PSHA 4C22A 1PNRA 1SXJD 4AL4A 2JAHA 3VDXA 4BEVA 4MEBA 3LZCA 1W0KD 2I4OA 3FA2A 4O2AA 1DC8A 3WGKA 4BDTA 2VO1A 2NO1A 5A2GA 5AFSA 2CJPA 1UFVA 1UUFA 3HP1A 2VJYA 5BN3A 4YP1A 5B5SA 1RYMA 2NU9A 1FNMA 3FH0A 4TWJA 2DPHA 4BQSA 2IH5A 4LDRA 5JDIC 5HMLA 4ECEA 1Z0FA 3DOCA 3HMQA 3K0BA 3SE7A 2C5EA 5DHTA 3FNRA 5J1SB 2NO5A 4QSHA 1DBRA 5LB4A 4L8VA 5ALSA 5KYVA 2H2GA 3VXKA 1KWKA 4UVHA 3AK4A 2AB0A 2C5BA 1MAVA 4OQZA 3CR7A 1DRVA 1JIIA 1TK9A 2D5IA 2WIBA 4RXUA 3EGDA 3R20A 3SOZA 3QEBZ 4HDAA 1OFVA 1RYBA 1MQAA 1SXJC 3MAGA 4EW3A 2R3SA 3GAFA 1IOLA 3T7DA 4WBSA 2ZCUA 1TXGA 2FAXA 1DO2A 2VUUA 3Q3CA 3R6TA 1L5SA 4I81A 4JSRA 4D3SA 1CRPA 1Q2XA 2YH2A 4EKNB 4YCMA 1E3EA 3BMQA 2QYSA 3WK6A 2W00A 1E3IA 3SBEA 2IA5A 4GP6A 3HA5A 1R0XA 1SQ6A 1VMEA 3EX7C 3IUYA 2Y05A 1UBNA 1LDYA 2I6SA 2VOJA 3RS0A 4YPOA 3EMKA 1PVDA 3PI7A 4GEGA 4GFDA 4TLAA 3RRMA 3LQ4A 3RSQA 4DOMA 2NU6B 5HM8A 2LVBA 1ND6A 1OXMA 1JU3A 2WJIA 1ZCFA 1DUVG 3D02A 3AONB 4URXR 1F14A 5FTMA 5DO9A 3EC7A 4UPDA 4CKBA 4EGJA 3CXRA 1PSWA 4RCVA 1I3LA 4LYFA 1EK2A 1UINA 1HT1E 3ZNNA 5MFZA 2UVQA 4BV8A 4J8PA 1NW5A 1KBZA 1QIMA 2WUWE 4Z1MD 3ND9A 2XDAA 4OQNA 2GN8A 2ZRIA 4ZI7B 5I4CA 3R9XA 3TBKA 3O82A 1XMSA 5FLYA 2G1PA 4JENA 1E6LA 1YC2A 3RABA 2QIPA 1FSSA 2DFPA 2LDXA 4DNQA 3H2GA 2W0MA 4Q3CA 5BRJA 3CLUD 3NFRA 1NVVQ 1D4AA 2FJPA 2HJHA 3LF1A 3C3XA 3KXIA 4H0FA 4HK4A 4HD8A 1T4CA 2XMPA 2GYUA 4ROTA 1CQZA 4R1MA 2IUTA 1J0XO 3A06A 3LT0A 2XRYA 4C0WA 1XCLA 1KMHA 1N25A 3L4BA 3V8BA 3DLTA 2WNHA 2WUEA 2ZUTA 2XOKA 1PX2A 2N3ZA 4LZZA 4TXHA 2WIDA 2ZULA 3K4PA 5K51A 1J1UA 3PNPA 2GUGA 3IQFA 4Q4HB 3GGCA 1AXEA 3FNGA 4FQ7A 2P27A 2HCJB 4TSKA 1QH1B 2P5SA 3SJZA 2ZYDA 2GTPA 4Q01A 3W06A 1CR0A 4B43A 1YJ8A 3A2NA 5TQ2B 4AY4A 4GOOD 3BGSA 4HN2A 5FWXB 2YXLA 1OX5A 2AE2A 3GP5A 4M9CA 1BD4A 1JT2A 1ST2A 2IEGA 3E4CA 2VRWA 5EUCA 4WZAE 1PT7A 1YI8A 3V8VA 4ZFNA 4K2AA 5JJ5A 3D0QA 2OHOA 3I8XA 4AZWA 1EESA 5JQWA 1V9SA 4XSHA 2A9RA 3MGCA 1CUAA 2EARA 5AJHA 1E1DA 2FWPA 1TCCA 4WXRA 2UVDA 2GERA 5DLQC 5JPCA 5B3AA 1AQYA 2OE2A 3Q88A 4IS2A 2NPFA 1P2UA 4WUTA 2XYGA