2BFFB

Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
341
structure length
332
Chain Sequence
AHFEYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
publication title A Versatile Conformational Switch Regulates Reactivity in Human Branched-Chain Alpha-Ketoacid Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
total genus 127
structure length 332
sequence length 341
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bffB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bffB01
2WVAA 3UK1A 5ERXA 1OLSB 2E6KA 2JI7A 2J9FA 1UMDA 2JI9A 3EXIA 4KXXA 3LQ1A 2W93A 1X7XB 3LQ2A 3AHHA 2G67A 1T9DA 2G25A 1OVMA 2VK8A 2XTAA 2C3YA 4JUDX 2PDAA 3DVAA 5EJAA 2BFBB 1JSCA 1YHYA 4JUAA 2BEVB 4MQ5A 4JUCA 2C3OA 1PI3A 1KEKA 1UMBA 4GM1A 2R5NA 2V3WA 2BFCB 1X7WB 3EXHB 2JI8A 2XT6A 3AHFA 1X7YA 1TKAA 2Q29A 1QGDA 1OLSA 2BFEB 3EA4A 1V1MA 1AY0A 4JUBA 1L8AA 3AHEA 2JGDB 2AG1A 4RJJA 1T9CA 1DTWB 2Q5QA 1W85A 2EZUA 5EJ5A 2UZ1A 3EXG2 4QELA 5HJEA 1N0HA 2J9FB 4K9KA 3EXIB 5EXDA 3ZHUA 1V16A 3LQ4A 3MOSA 2EZ8A 4D5GA 2XT9A 3EXHA 2JLCA 3EXG1 4ZP1A 5I51A 1QPBA 4MZXA 3DVAB 1NI4A 1W88A 3M7IA 2OZLB 2JGDA 5ESDA 2IHUA 4JUFA 2QTCA 2C31A 1X7YB 4KXYA 1POWA 1MCZA 1V11A 2QTAA 4GG1A 5HYVA 1V1MB 2G28A 2R8OA 4GM0A 1UPCA 2BEUA 1W85B 5EJ4A 2O1SA 4QPZA 2YICA 2Q5OA 2UZ1B 3AHDA 1PVDA 3RIMA 5I4IA 1V1RA 3DUFA 2OZLA 3F6EX 4MPRA 4GP9A 1OLUA 1YI0A 4K9OA 1V16B 2FWNA 5HHTA 5ERYA 5EJ6A 3IAEA 3HWWA 2C3PA 5EJ7A 5I5EA 1NI4B 3UPTA 2IHTA 1W88B 3FLMA 1YBHA 1UMCA 2VJYA 2VBFA 3HYLA 4JD5A 1ZPDA 1Q6ZA 4FEGA 2WVGA 2EZ9A 2DJIA 3AI7A 3EXEA 1WCIA 2BP7A 3D7KA 1V11B 3EXFA 2O1XA 3FZNA 4XEUA 1YI1A 5HGXA 1X80A 4K9NA 2BFFA 1TRKA 2BEUB 4KXWA 5DGTA 1RP7A 4KGDA 2R8PA 1OZGA 2BEWA 4D5EA 1B0PA 4JU9A 4Q9DA 5EJ8A 3DV0B 5EJ9A 3IAFA 1V1RB 1UPBA 3OOYA 2VK1A 3L84A 3DUFB 2EZ4A 1OLUB 3AHJA 1UPAA 1UM9A 2VBIA 1U5BA 3ZHRA 2Q5JA 3E9YA 4GM4A 1OZHA 1YNOA 1NGSA 2BFDA 1IK6A 3EXHC 1OLXB 1UMCB 4KXVA 4KXUA 1PO7A 5I5GA 4K9MA 3EYAA 3ZHVA 5K6RA 1TKBA 2JIBA 3M49A 4RJKA 3M34A 3EXEB 1WCIB 3DV0A 2BP7B 3EXFB 1OZFA 4K9QA 5EJMA 2VBGA 1V5EA 1X7ZA 1X80B 4JU8A 2BFFB 1T9BA 1GPUA 4WBXC 2Q28A 4C7XA 3JU3A 2WVHA 4FEEA 5AHKA 2BEWB 1POXA 1QS0A 1R9JA 5FEMA 2UZAA 1OLXA 2PGOA 2AG0A 1YHZA 1UM9B 1U5BB 3ZHTA 1T9AA 2EZTA 3AHIA 1V5GA 2YIDA 4QQ8A 5EXEA 1TKCA 2VK4A 2FN3A 2JLAA 2BFDB 5C4IA 4C7VA 2IEAA 1X7XA 5K6TA 2Q27A 3LPLA 2IHVA 3M6LA 2Y0PA 4MPJA 3ZHQA 4GPEA 2NXWA 2BFBA 3F6BX 1PYDA 5DEIA 1UMDB 4MPPA 2BEVA 4RJIA 2BFCA 4K9LA 1X7ZB 1X7WA 1YD7A 4K9PA 5DGDA 3FSJX 1BFDA 2PANA 5K2OA 1Z8NA 2Q5LA 2BFEA 1V5FA 1Y9DA 3OE1A 2C3MA 3EY9A 2C42A 2JI6A 2C3UA 1QS0B 3HWX1 5K3SA 3ZHSA 3KOMA 1UMBB 1ITZA 5IMSA 3AHCA 1DTWA 2PGNA 2X7JA 4COKA 3AHGA
chains in the Genus database with same CATH superfamily
4N0DA 3D4NA 5KNBA 3D8TA 5JAUA 1U8CB 1XDDA 3R41A 1O97C 4XWAA 2MU1A 3B3AA 2IL1A 4DIKA 2ZRDA 4E7OA 2B8TA 2IZ7A 4G4SP 3BZUA 4J1SA 1S7GA 2P35A 1ZH0A 3FNFA 3I23A 1AOXA 4LHYA 2PAFA 1L3CA 3CLUD 5K8LA 1L4HA 1W76A 3GJ4A 3PRYA 4AZ0A 3PJFA 4EECA 1VLZA 2JKVA 5MFPA 1QGUA 2IYEA 2R6GA 4QRHA 5BT8A 4BUCA 2VP9A 4U9UA 2I6FA 2WJ4A 1T1JA 5BXQC 2G25A 3A4VA 1U7XA 1CG6A 1EZZA 4O1HA 4UM9D 3FMVA 1HZZA 4BEJA 1DE0A 1F7VA 3II6X 1JDVA 2JIPA 5E1MA 3IGFA 3AVOA 2B25A 5E9WA 3AT1A 3AF4A 2PUGA 5DYYA 2ARKA 4HEQA 2OP0A 4I81A 1HLPA 3U81A 2I8CA 3VJMA 3F7TA 3B1XA 3QMMA 3DNFA 4C4OA 5EUBA 5D3KA 2CF5A 4J8PA 4WESB 3L77A 2C3OA 1OUMA 3Q41A 5CVJA 3RU9A 5HG0A 4GM1A 3PXAA 1V48A 5LXTF 3O8RA 3T7CA 2NZXA 4R2MA 1P17A 1YUBA 5DYGA 3TIXB 3GDHA 3PGVA 2ZPAA 4ALLA 1R4NB 1WRBA 5BV2P 3K1AB 4BLPA 3LVBA 3ZN2A 4ZQIA 4RH0A 4QLBA 3A9VA 2XMSA 1V8FA 4M86A 1E1QA 3GT7A 1U0NA 3SS7X 5T57A 4OX9Y 2N47A 1UDAA 1CUBA 4ZRNA 4UTZA 2OQRA 4WBNA 2F1OA 5JZVA 1G21E 1M2WA 1LPSA 5ALQA 3QKRB 1XR3A 1E60A 4AY5A 4IHAA 4OD0A 1Z7EA 3DE2X 5JD4A 5JTTA 3TD2A 1L8AA 1HEYA 3AHEA 2V96A 3PQDA 1S4MA 1O95D 4MS1B 4YJFB 4E2WA 2WF5A 2G4CA 2I6GA 3ANTA 1QORA 1HFWA 3DDUA 3LX8A 1DCFA 1FFWA 3TLZA 3WQQA 5KYTA 1W85A 4PYNA 2BN4A 4DA4A 1N5KA 3L41A 1C9EA 4TUYA 5AW6A 2KWIA 2AYYA 2BDEA 4XJVA 2NV0A 1NNSA 1BAPA 2DUJA 2UZ1A 4BKQA 3I8SA 4DE5A 1G7RA 5E7QA 3OFNA 2JLBA 1H2EA 1OXUA 3FROA 3OZFA 1QTIA 1JZTA 5HUHA 3BGDA 2DETA 2VH2A 1J8FA 1PDWA 4ZYYA 3FWYA 2XX3A 1YBFA 1IIBA 3N86A 4RMIA 2UXDB 1BIFA 1NQ5A 3GLKA 1F0KA 2EBWA 2MYTA 3P0FA 4XWOA 2HHAA 4ZO7A 5MN4A 1SA0B 1YCFA 1E3JA 2FE1A 1W0KD 3TXYA 4AJIA 4C9BA 2OHGA 4PG4A 2BTQA 1PGJA 3NMUF 3L6DA 2JHPA 3VYUB 3JVEA 4G4SO 1BOFA 1ZDMA 3U9SA 2P79A 3H5TA 3DA8A 1IJFA 3OLYA 3GAMA 4LNUB 1U2EA 2R1TA 4Q47A 2IPMA 1FDUA 1QBGA 4MV3A 4Q1FA 4BVHA 5BV8A 1FSFA 2H1WA 1IOLA 2DWPA 4WCVA 4L16A 4ZP1A 4BKOA 4LBYA 2ZIZA 4DWVA 5FPSA 1HYHA 1U0FA 4OU5A 5TS2A 2AQKA 2CXTA 4PC2A 1ZJ6A 5EPOA 4MP8A 4MUBA 1FCJA 1TT7A 1I4EB 3MNFA 1TT5A 3GEGA 3IUNA 4PG6A 3V8BA 3W1WA 2V7QA 3ACCA 5HZHA 3ZLTA 1S01A 2K5UA 5K9ZA 1XN4A 1K08A 3MD0A 5EPUA 1ELOA 2RIRA 2Z98A 5AVQA 2A1UA 4I3FA 5C1PA 4XPIB 4QU5A 3GP3A 3JYLA 2YWHA 1DWUA 4JELA 1KC3A 4HVTA 4Q05A 1A9ZA 4ZTBA 1JPUA 5EJ9A 4K8RB 1OFUX 2EQ5A 2ZDGA 4H31A 2A30A 2Y66A 3NEPX 5DYIA 4Q21A 4U39A 3ZIAD 3CJRA 4FYPA 4M9SA 1TJ4A 2ZTUA 4MUEA 4RTSA 3DXXA 2Q0SA 2EGGA 1E1MA 4QTZA 1TQ4A 5A5VA 3T5AA 4RDHA 5B6PA 3GO4A 3HCWA 5AJXA 2JAOA 3JPWA 3LL7A 5CDYA 2ZE7A 4PC7A 3G0BA 1OX6A 4IIVA 1HQKA 3TWOA 2YMMA 3NAGA 5MDHA 3OUUA 1DC7A 1MHPA 1IUNA 1ZD2P 2DKNA 3IUSA 4RUKA 2ZYDA 4TPKA 5TGTA 3TO5A 3ML1A 4NZOA 2P68A 4X1KA 1OX4B 5T4BA 1FFHA 1BEUB 1Z0UA 1PL8A 3PHHA 1ZMTA 4B34A 5BY2A 1RRCA 2CJXA 1WEHA 3KSRA 1M54A 2J5BA 3B2QA 4EO7A 3KQLA 3IBFA 5COBA 2BI7A 5TLSA 1F06A 4JB3A 5TQJA 4UHKA 5ECWA 4OHVA 3ZG6A 3S8YA 4EI9A 2NZUG 1UXOA 2PS0A 3AERA 4NV3A 5AKHA 3KHTA 1SBNE 3JX9A 5JFOA 3KU1A 4Z1MD 1K2WA 3B5EA 4KXNA 4P0PB 4GKVA 1CU1A 3AR2A 2P69A 3O2NA 1U04A 1W5BA 3A9WA 3TLYA 2FRXA 4NDZA 1OLUA 3AUUA 3CWZA 3BMCA 3JD4A 4W6ZA 4E15A 5K8JB 1GD1O 4J0QA 4BZXA 5M7EA 2JFUA 4MB6A 2XYPA 1O54A 3F97A 3AWDA 4M1WA 1E3QA 2YCBA 1IHDA 3BFVA 4TL9A 5I7AA 1ZCBA 3TNDA 4AO6A 4LYHA 4D1YA 4EA6A 3ZWMA 1ISIA 2EP7A 2Q3LA 4C4PA 4HRAA 1QRUA 3GNQA 3FWZA 4DILA 1KO8A 1RQPA 4CM5A 3P32A 4R1UA 2INGX 3M9LA 4GX5A 1NF9A 3FMGA 3WQSB 2BSQA 1FMFA 4P4UA 4B3XA 1W0CA 4BUZA 3H1GA 3JVUA 1EVYA 4LMPA 1VMEA 4YJHB 5FBKA 5C3UA 2EF1A 4UMVA 1W88B 2CMGA 4WN9A 3WLNA 3FLMA 2FWIA 1Q1QA 1EZ1A 4G97A 4F3YA 4FIDA 3V8RA 5A1TA 2XUJA 4W5JA 5JJBA 4FB5A 2CFOA 1DCKA 5FO1A 2FN8A 1I7PA 2EKLA 2GGSA 2NG1A 5JAOA 3PXBA 3EEYA 5FAXA 4MUHA 3NTLA 2A35A 1UT6A 2VCYA 4B6FA 5EOVA 1P8AA 2GAAA 3CKLA 2Y0EA 4WK0B 5LLSA 2X40A 1U65A 4L9SA 5J63A 1HT3A 1JSXA 3LWBA 1Q11A 4IIFA 4YRPA 2M9MA 3OEEA 3IPCA 2OQVA 1F8FA 1YZTA 2CW5A 1D9XA 4OMUA 2I7CA 2ZBEA 4NBVA 3T3OA 1JKMA 1M76A 3ABIA 3S2EA 4YCCA 1JB9A 1LZKA 4M4SA 4ZQGA 1K98A 2OFWA 3JXEA 1T6ZA 1Z29A 1NU8A 4J4HA 5HF8A 2CFCA 3M1AA 5JAQA 4DLUA 2AQHA 4G25A 2OCIA 3FF1A 3UBMA 1BKSB 1YR2A 2XUHA 3GPBA 2O8EA 1NC1A 2IXBA 2Y8EA 1SCKA 2JIQA 4WY2A 3EB9A 2A33A 3LYUA 4R8RA 1DEKA 4Y9RA 1ZD9A 3JTMA 4EZIA 4KFTA 4OVKA 4Y1RB 3URMA 1O0CA 3BMNB 2WJVA 2XTZA 3BE6A 3ABSB 4LF7B 4YEDA 1WMBA 4I8DA 3KJZA 2O8CA 1PZXA 3IDOA 3IBYA 2QL7A 4INPA 2BEWA 2VZ9A 4H9GA 4DUYB 5SYMA 1B0PA 4J90A 2Z2KA 1SUAA 3RVSA 3TZKA 6REQB 1RI3A 4AN1A 1IUPA 4HDCA 2E2WA 3WB1A 4W9NC 3REOA 3C3DA 2HHCA 4QVGA 1D2HA 1JIJA 3V8VA 5B7QA 1QM5A 4P84A 2IT1A 1USVA 5ALUA 4RA9A 4CTNA 4LRSB 1YQWA 2C0QA 4ZT3A 4EF4A 5FUQA 1TAUA 2VUIB 1IM8A 1DCMA 5IJAA 3G88A 3KL4A 3AUXA 1ODTC 3GHYA 2EG5A 2SKEA 4KE9A 1JFSA 4AU1A 3ERCA 2Y76A 1EP2B 1WMAA 4XB2A 2Q3BA 3LY7A 1U63A 1TUBB 1R6UA 2NXJA 1E4YA 1OZHA 2D1SA 2ZWAA 1XZPA 1YC2A 4TS3A 1QU3A 1G8YA 3OCXA 4YK7A 4MTLA 5LOVF 1RZRA 4QU8A 3F73A 2HPZA 4L8LA 3MT9A 1KEPA 1R0ZA 3GWGA 3EXHC 4PIVA 4RELA 1L8QA 2WNHA 2YTZA 3IRUA 4WHMA 1SXJE 3BHNA 3LCVB 5SZIA 2ZRCA 1TZMA 3T5CA 2BGNA 4UAVA 5FOVA 5C2JB 3O8QB 4TWJA 2ZAOA 3RHZA 4R0VA 4E94A 4NI5A 1KPIA 1I01A 4J0HA 3PEYA 3LK6A 3AC0A 3HUDA 2Q4EA 3A4TA 3NOXA 4X93A 2VHCA 3SEQA 3B89A 2P6PA 3E8XA 3TCKA 5EIXA 1SULA 1ZXLA 4RKEA 5JNWA 4ATNA 3DQPA 4OQXA 5B1HA 5SYAA 4DA6A 3C5EA 5J2TB 3GRFA 1NVXQ 3RVJA 1U8ZA 2MSCB 2C4KA 3SHVA 2NO0A 4QODA 1Z6ZA 3PNKA 4TT3D 1ZIDA 3F9RA 1I32A 5TSDA 1HURA 4QPCA 3IMKA 1SKMA 5ITWA 2VJAA 3O82A 4TMFA 2H7XA 1W2WB 2L0XA 2ZOSA 4R16A 4WH0A 4UTOA 4DQ0A 2GDJA 4XXHA 1J49A 2A5GA 2N46A 3OMWA 4ETIA 2GTHA 1AZSC 1HZJA 1Z5VA 3OOJA 3RKSA 3URKA 5H4GA 1WHSB 4GL2A 2M32A 3V48A 1T9BA 4EB3A 1CEXA 5KQLA 3NB0A 3PNYA 2AT1A 2X4IA 4TMTA 5DBOA 4E08A 5KTKA 5EZQA 3E9MA 3JQ8B 3MN1A 3NHZA 2Q28A 1SG0A 3QLUC 2Q1SA 4QEKA 4AXBA 1ZOPA 3MJHA 4OYRA 3GLHE 3KPYA 1Z26A 2VS1A 4YJ3F 1XU9A 3VH4A 3H2SA 5COAA 3JTEA 1IEXA 1O0BA 3R4CA 1ECFA 3RSSA 5E1DA 4F5DA 4ZGGA 5EINA 1DQPA 3C7DB 2C7OA 4OK5A 4EFLA 2OKCA 1ZXXA 3CF2A 3FE2A 3HJAA 5A03A 3ZK8A 1AMNA 1FFYA 1KY5A 1GEGA 1BVRA 1ZJYA 4B6QA 3AUTA 1EK5A 5K3BA 3SBEA 4JYMA 5E1BA 4R8VA 5SICE 2MYUA 3WLTA 4B81A 4Y6GB 3UXMA 2CCKA 2LPMA 2VRNA 2YVLA 3OTHA 4G1MB 1NZFA 3L7DA 1JFFA 1OD6A 2CHUA 3X43A 2IEGA 2P6MA 3QTBA 4BNGA 5AW4A 1W94A 3KPVA 1UT8A 1X70A 3FB4A 4O2AF 1VE1A 1Z8HA 4Q16A 3O4IA 1MO6A 3K9FC 3IUMA 3WMRA 2I6QA 1E64A 3GT0A 4N40A 3TZBA 2XB6A 2IU4A 3EWIA 2VCHA 1RAGA 3RT1A 3JS5A 1PJAA 2OXEA 4OQQA 3ZLBA 1E6KA 1TCUA 1ZC3A 4G67A 2B21A 2LCFA 2PMFA 4IDOA 2ZT5A 3FPSA 3QWHA 3NORA 2ID7A 2IFTA 5BN4A 1O5OA 5A05A 1KIMA 5AUNB 2AMJA 1E62A 2QN3A 4ZDWA 3H42B 2NXWA 4KCGA 521PA 3RNLA 1QLWA 5AXCA 4KXFB 3COJA 1W96A 3H3XA 2BFBA 2VPZA 1EDDA 4B4WA 2IH5A 2V5AA 5F23A 3FR8A 4G2NA 3BRWA 4GZMA 1TU0A 4Y30A 3JWIA 4XLZA 4QBGB 1J9ZA 2WKWA 5LOVA 2Z6VA 3HUTA 3O73A 1QFXA 1L9XA 2HCFA 3K3PA 3PYMA 1TW2A 2EDAA 1DFHA 3B20A 4YAWA 1Z7WA 5BR8B 4FD3A 1GFSA 4JC4A 2HSDA 3EZXA 4FYHA 4B46A 3DO6A 2MSWA 3LRPA 3IJRA 3QE3A 5ADHA 1OI4A 1Y9JA 3UPDA 1ZOLA 1QV7A 3PXUA 2ODNA 1L7QA 4DB2A 2PCLA 3TW4A 4NFYA 1AZTA 5GMOA 3RWBA 3TTXA 3ZNQA 5ENVA 4DCOA 3OTIA 2IWRA 5AW0A 1UAAA 1RKQA 4N41A 4YUXA 1YA4A 3KQPA 1G8GA 3CEAA 2EJWA 1IM2A 1YR1A 5FJIA 2GN0A 1KTIA 2XB9A 4H7DA 4MQ6A 4EFKA 1JVBA 3OE1A 3HRHA 3C5CA 1Q92A 3OE7D 2Z6AA 2J3KA 4B7UA 2GVZC 1B43A 3FZEA 3K15A 2CK3D 4KQGA 2JCSA 1SCBA 2WHQA 1JP7A 3QJ5A 3FJYA 3TZ6A 2DOKA 1KKMA 5DLDA 4V24A 1U9IA 3HWX1 1SKYE 4TQ9A 1JKJB 3OY2A 3C3BA 3KQSA 2L18A 3LK7A 4NMMA 1AX9A 2GKSA 2O2DA 1OH6A 3AHCA 1AHPA 3DE6X 3WX0A 3KPJA 3DZIA 2NTYC 3DP9A 2GFHA 3N0VA 4EGAA 1G21A 3BTOA 3NHFA 1XDUA 3WKEA 4IG9A 1NF2A 2HCBA 3KQNA 4F9EA 1MA0A 1BDMA 2FAXA 5B3KA 1EAMA 1PW7A 4LZJA 4M0UA 3WGOA 1W4RA 5LBIA 3UCEA 4AP9A 3TW8A 4BP9A 4BZQA 3A1UA 3RDPA 5BNWA 2PGDA 4L6AA 4YJ3A 1L6RA 5IG2A 1CVRA 2F9LA 1OFGA 5KQMA 4U2KA 3LQ1A 4E6PA 2P4UA 5AW2A 1U0EA 4BO1A 4F86A 3QX7A 4WACA 1VSUA 1X8JA 3DTNA 1QO0A 1P4GA 1OYWA 3ZJ5A 4FONA 3MUEA 4TUYB 2V7TA 3WDKA 1I5RA 4G1VA 1G9TA 4IQ8A 2XXAA 1TF2A 1W46A 2V7GA 3F78A 1UKCA 1DOZA 3U5ZB 2RGCA 4TSKA 1P5ZB 1XAIA 4I08A 5IC4A 5EIWA 3ZZ0A 3EEQA 4TX1A 2ECOA 4EW6A 4FBGA 1AM4D 2YINC 1TU3A 4LJ9A 1IWBB 1V6CA 2OY0A 3FPCA 4MROA 2IV2X 1BU8A 4O29A 4XGRA 4UDYX 2MSKA 3P26A 1NKSA 2YVQA 5JV5A 5G0WA 1U02A 3TLCA 3KOZA 2QQEA 2X0KA 4M0PA 3VTZA 3UBTA 5K0TA 3G9UA 1EJ0A 1UMBA 3QMVA 1VFPA 2BTQB 4JL6A 4KRXA 2XGOA 2HR1A 4NYIR 1E1KA 3FAZA 4LECA 3AFIA 3RS0A 1F2VA 3MEQA 2ATVA 4LJ6A 3CIFA 3QK7A 4IZ6A 4GDFA 3FLEA 4HQ0A 2ZTSA 3B1FA 3GU3A 4CN9A 4PQYA 1E9BA 2Z5GA 1KZ7B 2BMVA 2BGJA 3L2OB 2ZUCA 4JL8A 4MKZA 4PSUA 5E4YA 1APBA 4NYIQ 2XA9A 1NNI1 2JBAB 2QM3A 3HPQA 2OV1A 2ERYA 1TT5B 4GVPA 4UHCA 1C30B 4UW9A 1IOWA 1V1MA 2AIRA 2YV4A 3OZBA 1WV1A 1D2AA 5HQJA 3X3HA 4F3NA 5AM0A 4HV4A 5ITVA 4OF4A 5EGSA 3ZZ1A 4C3UA 1G7TA 1NDQA 4GECA 4JKYA 3LX4A 3TQQA 4EB6B 1YFJA 4D3SA 4O2BF 4AQ7A 2WWRA 3RRXA 2IPXA 4F04A 4EUFA 1FB5A 1G7CA 1M2KA 4J7UA 5JPCA 2Q5QA 4BNDA 2EZUA 3I42A 3H11A 1CUEA 4Y6SA 2EIHA 3DYBA 4PXAA 1H5QA 3SF8B 1T4MA 1L5VA 3LQYA 3WHPA 4CKZA 3CVYA 3L79A 1DQZA 5FBWB 1FYDA 2GTIA 3AKCA 4RY2A 1WXDA 4PTZA 2W48A 1UFOA 1W7AA 1YHNA 2X22A 2A57A 3OWHA 1DG1G 4PSKA 5HQTA 2VPYA 1Y6QA 4GBMA 4K9KA 5LDDC 2PVSA 2CYCA 4DM7A 2D5IA 3M6WA 2KLBA 1YA6A 1EJ2A 4H7HA 4MI3A 5C31A 3HA3A 3HBNA 3BN3A 1FOEB 2F17A 1XAGA 1ISHA 1RJ9A 3F90A 3KBBA 1P7VA 3FPBA 4B3HA 4CNBA 2OHXA 6ABPA 1LSJA 1QVRA 1NL3A 1BCSA 2VHUA 2X9NA 4X1KB 5FWXA 3DBLA 3R5HA 4BMVA 3D0RA 5ALMA 1ODFA 3RAGA 4D56A 4TL7A 5CAEA 2QT0A 3FCOA 5TVKA 3R7LA 3E5RA 4JSTA 1GAEO 4MEJA 1QRTA 3SSMA 3I6BA 2IZOA 2A5LA 1XP5A 2PX0A 2MSDB 3A9TA 3LV8A 4RJLA 5D3ZA 4ASUD 2OVBA 1ADYA 1RXSA 3DLBA 1TE2A 5AVZA 3GPIA 4DR6B 1QH1B 4PG5A 4QUIA 1EE1A 2ZYRA 1A4UA 3CMMA 2BCJQ 3GCDA 3PTLA 5IYZF 1VLQA 1X94A 4UAUA 4YT4A 2D6FA 3I5UA 4ENRA 1PHPA 4TSFA 4ARBA 3MCTA 2CVOA 1A4XA 2VQDA 2YJTD 3QFSA 3UQZA 1KZ4A 3CXRA 1JLHA 1N2EA 5IM4F 2QG4A 4IUDS 2QTCA 1TM7E 3LI2A 1D2CA 1RQRA 1UDXA 2H08A 5F1YA 1QO9A 1PGPA 4O02B 1KI4A 3NC4A 1Z28A 2I1VB 3D6FA 4U7JA 1E7YA 2EFYA 3HEAA 4MR8B 5JPIA 4QEZA 1NXPA 2VF7A 3LG2A 4U7WA 4RK1A 3ZXYA 3FYHA 5HILA 3H2YA 1DT5A 4PSAA 5C9ZA 3SI7A 1XA0A 3M83A 1L8OA 1EE9A 1W4CA 4YPOA 1V11A 3DL7A 1Y8QB 4WK2B 3KKQA 3MLBA 1QG2A 2I76A 3GOHA 1UIRA 4OLJA 1Z4JA 3JZFA 4BAUA 4LRYA 1LNZA 2GXQA 3JQQA 3MHTA 1VI2A 4MJ7A 3BXHA 1A2QA 2WP0A 3EZFA 4N0PA 2HO4A 2EX4A 4CDNA 4ZHSA 1FFSA 3JQAD 1R6TA 3IOCA 3N7AA 2JRCA 1S2DA 1SD2A 3CZPA 3O7WA 4WPGA 3OOSA 3UWDA 3TOXA 5LL6P 1N3IA 4L6IA 3S2GA 4PAGA 4DLVA 2FSFA 3L0YA 1IN8A 1T2CA 2ZCUA 3O2JA 3QKIA 2C2ZA 4B5LA 4MYDA 2RK6A 1GRCA 1VP9A 2FPMA 4IFIA 2Z1MA 4XLTA 2XGJA 1JU3A 5A5FA 1SXGA 4YAFA 4KN8A 4MVJE 1UC4B 3KP1A 1UP7A 4KE8A 1XFAA 1KRHA 4A1OA 3Q3IA 3TNLA 2QE7A 2F67A 2BHRA 1SVIA 3DB2A 5ALIA 3AL0C 1MJFA 1SH7A 3BTUA 4RFSA 4HG2A 5F76A 1KMMA 3IP9A 4G8CA 1DP4A 1Q1GA 2RJ3A 3DEYX 3HGMA 4RGQA 4OHYA 1ESCA 3B38A 3GRZA 2WPDA 4DY4A 1AE1A 3U9TA 1Y6JA 4B8ZA 1Q7CA 2GZRA 4O2BA 5I01A 1GG9A 2A9FA 3GQBA 4H18A 2DWUA 3AL3A 1D2EA 3RYIA 2QZZA 4MR9B 5AM1A 5CFRA 1JI0A 3MT0A 4CV3A 3PWKA 4EABA 1NBAA 1IDN1 4GLJA 4WKCA 4XUDA 2KM1A 3DMTC 3GNSA 2RE8A 1NQWA 1P2FA 2PMKA 4BDTA 2OOSA 1T8PA 1YDFA 1UBRS 4Q1EA 4ND8A 5B5SA 2OO5A 3TR0A 4KGZA 2GB4A 2FWRA 2XJ9A 4Y2TA 1QR2A 1UKZA 5EWMB 4CL3A 2CC2A 3NQ41 3UPTA 5CVCA 2NYRA 3C6QA 4LDPA 3U56A 3I9V1 4FTWA 5CVEA 4XIFA 2VJBA 3ZV6A 3PUKA 3NNSA 2XOKA 4ZV7A 1RVV1 4AY6A 1YQ9A 4N5IX 3SR0A 5ARBA 4RA9B 4CMBA 1KGDA 2PSDA 3C1AA 1XEWX 3E8MA 3IVCA 3KSUA 4MS4B 5E2IA 3T8YA 2ZVPX 3IA2A 1OASA 3MINB 3N58A 2C8VA 3ZDFA 1N2CB 1MENA 1L5NA 4AXXA 4DSOA 2G17A 2J8ZA 4PQFA 2QD5A 4LBZA 2SKCA 4BNVA 2UXBB 3BERA 4D44A 2H8KA 5A3SA 2WC1A 5J4YA 1Q19A 1Q91A 1UCFA 1ZIPA 4Q3LA 4WZBB 1O94A 2EHDA 2XCIA 2FSGA 5K6AA 1SXJA 2F3PA 2WWXA 2ZKLA 4IHJF 4WOPA 1R5NA 2A9OA 2LIPA 4RVUA 3DMDA 4TS1A 4J03A 2XODA 4JB0A 1SC4A 5IYZA 2TS1A 4H3KB 1T0UA 3UHJA 2VHTA 4TSRA 4RGVA 1NBWB 4W1PA 4KAJA 1GADO 1TM1E 4JHLA 3VBCA 4WKBA 3ROGA 3TLAA 2GYUA 1Z2AA 4K9NA 1USKA 1GNLA 1PVVA 4ZEMA 2BGWA 5IM4A 3NDPA 1YIDA 2P8JA 5IDQA 4ARCA 4BMSA 1QC5B 4MW9A 2FWBA 4EPWA 4PYRA 4A0RA 2V3VA 3KZKA 3NWOA 4Q34A 3NT4A 3HJUA 3ASZA 3WDMA 1NQVA 5T64A 2Z5VA 4JU9A 1JV2B 4N0MA 2RMKA 4NWIA 3F6PA 2QGZA 3QY9A 4PNHA 4P53A 4YFVA 2ECKA 1MO3A 3VYRB 1QVAA 3D8NA 5AK3A 3OA2A 2PMCA 4DRXB 1YJXA 1M8PA 2FA9A 1YASA 1UM9A 4BXOA 3UFXA 1YR3A 4ZRMA 4EMUA 5I45A 3WAGA 5F7XA 2ZIXA 2YXNA 1BA3A 3LSTA 4BNKA 3K0SA 2YIVX 4I4IA 4D8TA 3QFRA 3KR9A 4I5EA 5C8ZA 3GLHA 1S8FA 2XD9A 3RADC 3RC7A 2VH5R 3A6LA 1T5TA 4X97A 3RIXA 4UBNA 5I7SA 3SE0A 1P7PA 2SBTA 5JS7A 2YVUA 1ND6A 4H3HB 2DUWA 2P4HX 2WT4A 4J43A 4I9GA 4PX3A 3I1IA 4FXPA 3I5YA 3D31A 2ZRNA 3GGPA 2XAUA 2QG6A 5JD3A 2OHHA 1VKJA 4DJAA 2XMQA 3HDJA 5CT8A 1LX7A 2BEKA 2QXYA 5TPWA 4KXUA 3OMLA 4Y6OA 2IEBA 5CJ2A 5I5GA 5J2UF 2H1CA 1J7JA 5H8WA 2WIJA 1VFNA 4A82A 4D4HA 6GPBA 1KAOA 2NO9A 4MQUA 1UKEA 4FNMA 3WMXA 4YRTA 2VJDA 4JWTA 4CI9A 3IE1A 1J20A 1H22A 3T3MB 2BTEA 3E2IA 3TQFA 1Y6ZA 2HK9A 4IM7A 3RRNA 3T5MA 4ALMA 1FX0A 1TZCA 1NJ6A 1YZUA 1KEEB 1W19A 2QJWA 3HB7A 3LIPA 5HK8A 4LSMA 4P3NA 2CJFA 3O4GA 3CB4A 1IWOA 3BWEA 4MDEA 3BMXA 1LPNA 2OMKA 3HC7A 4UAJA 1OWPA 5KSZA 1L4KA 3AJRA 1VRWA 3CMCO 3OCJA 1YCGA 4HQOA 4U8GA 4CQJA 4DA0A 2DH5A 1Z5PA 3L1IA 4RVGA 2WYHA 5AJZA 3ZWXA 1U8AA 4UZEA 1QP7A 3HBMA 3EVAA 3PJEA 1KQOA 1ID8A 1UK7A 3IT0A 3DO5A 3NGLA 2BZ1A 1FZQA 1R9NA 5AHXA 3AUKA 3ESYA 3ORFA 5AICA 1FPMA 4F4FA 3ESRA 2R4TA 2XUDA 5CURA 2Q9BA 2ESRA 5HF9A 2Q1YA 4GOOD 3PQ2A 1IMJA 1FMCA 1L8LA 3A36A 4GZ6A 4WBXC 5E38A 3ZZUA 3R0VA 1ETUA 4ENUA 2VT6A 3UK0A 4IWNA 3GAFA 1DG9A 4FGUA 3VAAA 5IWAB 5KJFA 4YCJA 2ZYWX 4Z54A 3ZD9A 1E77A 4OBWA 5AWFC 3X44A 1EGAA 3A9CA 1Z75A 1ZK4A 1A76A 3LVRE 2WOOA 1QPZA 2V59A 4FN4A 5DTMA 3ANSA 3HM2A 4BV8A 5K5EA 4TRJA 4DNFA 3GNLA 3QVLA 2FJPA 4PQRA 4BAZA 4YWHA 4J6FA 2GA8A 5BN5B 4TLDA 3RT9A 4E32A 1IL0A 3O47A 1X7GA 2EGUA 2MSEB 1U2PA 1N5OX 3WL5A 3UQYS 1JDZA 3Q9NA 3GD7A 3KUDA 5EWJA 4OB7A 4X6YA 1NJ5A 2WABA 3QPDA 2ZUBA 4NR0A 3OLQA 5B55A 3NWPA 3S81A 1K8YB 4EGSA 4XGNA 4M9UA 1NASA 3T0IA 3Q12A 3OY7A 4AVYA 4EI7A 1OREA 3DKVA 5KKCA 1Y8ZA 3E03A 4F4IA 2K4MA 2PZBA 3HO1A 3ULKA 4MQLA 1XLTA 2GXSA 3THRA 4TQGA 4EAQA 2WKSA 2IXTA 3DPUA 1GSHA 2IEAA 4PZLA 5FULA 3RD5A 4B84A 1DHTA 1XVVA 3GGJA 2PSEA 1TF7A 1C4XA 1U3DA 1XRNA 3N0WA 4M6WA 4KQFA 4R9NA 3WE7A 3WGUA 4RMJA 1GNVA 1OXMA 3OKPA 5I7EA 1EFVA 1NHWA 5JXJA 1WUKS 3IJEB 4EP1A 1QYRA 1YL6A 1D4FA 2ODEA 3C6MA 2LIVA 1N5RA 1Y1QA 3GZNA 2EV9A 3MWYW 2JHFA 3FGPA 3WIVA 1YRAA 3NKFA 1JHOA 1FW8A 2JIMA 2CE7A 2XWJI 4IXDA 1JEQA 2HRZA 4KMSA 4FQ7A 1QG0A 4DSNA 3MZ0A 4PPFA 2PXAA 3KFVA 1XYGA 1WCYA 2YXBA 1WDTA 1W93A 4NOJA 1OU4A 4IOMA 1Z13A 1OGJA 1H2AS 1N7JA 3C3AA 2CL7X 1JDBC 2HMVA 4FGJA 3V2GA 4EPVA 3ZJUA 1ODJA 5KVCA 1MG5A 2QRMA 2DCMA 3KHSA 3CLTC 5E6SA 3NC0C 3WBBA 5JQWA 1P6XA 1XCLA 3QG1A 1H0SA 5J2UA 3G79A 2JS7A 3IALA 3LIIA 4K8OA 4JOCA 1IH8A 3C3KA 3JYQA 5CLFA 2GLTA 3V4SA 3AB3A 1A97A 3DR3A 3OWOA 4MS3A 4MHOA 2WFLA 4O4LF 1XGKA 1VDMA 4IJQA 4CEJA 3AVXA 3PG5A 5IK2D 5I6DA 3LZCA 1SG9A 2OLJA 4QGGA 4KDFA 1KVRA 2HH9A 4KVZA 4O2AB 1KXZA 2WLSA 3CH6A 2OBLA 1NRIA 4IJKA 2LXNA 5DK6A 5H9WA 2R6HA 1H9AA 2Q07A 5KYWA 4X7PA 1BSVA 2IEZA 1H5UA 3CO0S 4O4HB 4CR6A 2OCLA 5BYAA 1UMBB 4HZGA 2ZYAA 4NJMA 3NALA 1DTSA 1YJBA 2NU9B 1PJBA 3SG0A 1ISFA 2WG2A 4ALNA 3LDFA 2X7JA 1SU7A 2IUEA 3ELBA 3RBZA 4CT0A 4FSXA 1JRLA 3L0IB 1R3UA 3O8BA 3ZVKA 5I9SA 3DUWA 2JH3A 1A27A 1QVVA 1Z4KA 3LA8A 4MYHA 1JLKA 3F6YA 5CLLA 5DT2A 2CVHA 1U3WA 5EWLA 3VISA 3RKUA 1CUDA 4K88A 5DO9A 2E6KA 3DE5X 4R2IA 5BP7A 3QELB 3SKVA 2XEDA 2VF4X 4I9HA 2NAFA 1RWOA 3RTEA 3NI2A 3NJRA 2XYRA 5E3HA 3CT6A 1XZNA 4M22A 3EW7A 4QX6A 3UMBA 3RGGA 5CVTA 2NU7A 5ALOA 2PUFA 3WK9A 2JBHA 3FZYA 4MAMA 3OZCA 5CR9A 2AZXA 1VHQA 4JNKA 4ZPJA 5TQVA 1P2SA 1GARA 3PZBA 2GLUA 3ND8A 1N5JA 1IUOA 4PPNA 3E3MA 4I1SA 4TYMA 5EKSA 3WWEA 3DYVA 2AC4A 3OEHA 4IYJA 4DMMA 4XTCS 3BX1A 1ZVJA 5D00A 3DVAA 2Z57A 1S9HA 2J85A 3QVUA 1JA0A 1AXEA 1MU0A 5AK4A 3U3RA 2FXIA 3GRCA 2VXOA 4N3CA 1JLLA 2DT8A 1NF3A 4PC6A 4DUGA 3H8VA 3SYTA 1SN7A 3BSYA 3LT2A 3IOBA 5TQ0B 2Q6OA 2PU7A 3BXZA 4HZUA 4IY1A 4OKIA 3BXGA 4DPLA 4F5WA 5LB2A 4PXYA 1OFVA 4MQ5A 2WIFA 3RREA 1SHZA 3LT4A 1E4EA 3U0VA 1A88A 2IUYA 3E22A 2NW6A 3IDFA 3X2SA 4BVAA 1SAYA 3S5JA 3DBLB 5EI5A 3DBIA 4HB4A 2PGLA 2PJUA 2BHNA 1JSLA 1Q74A 3CUSA 1FQKA 2ZIVB 4L4SA 5ALXA 2VJNA 2W2KA 3U49A 2CDAA 4M8IA 1JQ3A 4UQLA 1PCXA 1BHSA 2HNBA 2F59A 4HLDA 3WTCA 1PV4A 3DW1X 4HAWA 1Q7BA 3JQGA 4WADA 5HFNA 4FFDA 4TV8A 1GGHA 1NUSA 3D4LA 3FCEA 5EHIA 5JNTA 3WMWA 2AH5A 2PZLA 1Z9BA 4RANA 3ZQKA 4GXNA 4B6PA 1IK4A 2OYSA 3B82A 5A3VA 3TAXA 3ZY3A 1LK0A 1B0ZA 3VU9B 4BQIA 4EYEA 1TK2A 4R3UC 4X1YA 3ZWQA 2RKWA 1LQTA 1NVBA 1JVSA 1WOYA 4D4JA 2O0KA 2W6ID 4CEIB 1LX6A 1F2UB 2QI9C 2FSHA 4MV0A 4MWTA 4EQZA 1J8DA 2PD6A 5LQRA 4PFSA 5DX8A 3WWPA 2OGSA 4OJYA 4B3JA 4PLWA 4Z4QA 2E4YA 4B9AA 1IN7A 4J29A 5T3UA 3WMEA 3NBMA 3ZY2A 4F9FA 3WLKX 3EXG2 4MVJI 4NNPA 1CS4C 4TS4A 4O4LA 2Q1UA 3KQTA 2ZYHA 3U4IA 3WYEA 4OMFG 5EIOA 4I0WB 3RLFA 3P9IA 2B7BA 2Y1LA 3WMGA 1DKLA 4WUTA 4N47A 2ZRBA 4WE3A 2V58A 1KMIY 4NP6A 2F3SA 2YYAA 2VLIA 3IKTA 1DNPA 4LJRA 1GA1A 2G9QA 4BB9A 4IR7A 1YZFA 3JALB 3QFCA 4JCCA 2C29D 4K86A 4UTVA 3LQ4A 1O08A 1YDWA 4DQKA 3Q7PA 4JJ8A 3W8EA 1YH3A 1U0HC 4NBWA 4TYYA 1QGAA 5B3LA 4FFOA 1V3TA 4MVJA 3CZ4A 3KNZA 2O2XA 3ZE0B 3IJ5A 4Z5XA 3A6DA 4LHSA 1TTPB 3VR3A 2ZEJA 1G6OA 3TLGB 1I2MA 3WK4A 3FCCA 3G8YA 1C9NA 1Q0PA 3L0SA 4JVNA 4TMZA 4CU2A 1THTA 4BEBA 5HXAA 1Y37A 2POQX 1MPXA 4BO0A 5H59A 1YJ5A 3RS8A 5BSEA 5KNDD 1CIVA 1JHQA 4KQCA 4G01B 1GG8A 4OM8A 3CS3A 3UYLA 5D8DA 4EYKA 4P98A 3B6MA 2NUPB 2VAPA 4AJ1A 1JALA 1U9ZA 5FDFA 1C3JA 1TVKB 5A0TA 2FPLA 3NUGA 5T6MA 4BN4A 2PFKA 5LWQA 4MQMA 3G8BA 1D2MA 3TRKA 5CNKA 3KU4A 3RWMB 4TVSA 4HMOA 3VHXB 4IIXA 1NRXA 4RHYA 1JF8A 1KDVA 1A82A 3GFFA 4RTLA 5ADVA 4OHZA 2X0FA 2GPJA 1RAFA 4B7AA 1A8HA 1F1BA 1P18A 1X7YB 2YNMD 1S8NA 1MCZA 1VPTA 3LBIA 3MAJA 4OKSA 2X3UA 4DNPA 5HK9A 4H7JA 3TX6A 1ZNYA 1DKUA 5AHOA 2B35A 4LSWA 4EG8A 1NVVR 4TMKA 4ARUA 4UE6A 5L6LB 1XZEA 2A1TR 1E1RA 4Y6PA 4ERNA 1WCXA 3BJMA 5A3RA 3KWFA 2BV3A 1M2VB 3QX3A 1E66A 2A5YB 2EQAA 4Q1DA 4XB6B 2WSYB 4P3OA 2HIMA 4NH4A 1Z35A 4IV5A 3TLEA 4UDOA 1WLYA 2X23A 1K4KA 1UPCA 2K2WA 2BM0A 3KUXA 4RENA 5KNDH 3CVXA 3IMEA 2ZWOA 2XQFA 4ZDIA 1I36A 1OFIA 2DTDA 4LJKA 3ETDA 2FZWA 1E2JA 4TQAA 4DMLA 2J0SA 4J1TC 1GCIA 1XQ9A 2QAGB 1XTBA 3I5AA 4Q3BA 1FDIA 1R50A 2Q45A 4J75A 4JP8A 4PQEA 4C2UA 1SXJB 1M5RA 2EFJA 5BUCA 1UJNA 2I55A 2C4NA 2QSYA 3KSZO 4YI3A 1WPGA 5DNDA 2Q8PA 3A6KA 3QYAA 1RZUA 1U2SA 1B41A 2GM5A 1E2DA 2EHJA 1T0PA 2GI4A 4K9OA 1PG2A 2ZG6A 2NZVG 4XRGA 1L7PA 1QAQA 1E7QA 3UXYA 1N36B 3COZA 4GXTA 1X19A 3S2YA 3LFUA 3R3YA 3ISVA 4FR2A 1E9EA 3QBEA 4QGSA 1EQ2A 1EEHA 3BXXA 3NHLA 1JXAA 2QN8A 5HGJA 2FRDC 2GO1A 3JQDA 5IKMA 4HN9A 1XCJA 2J33A 3L4BA 4UZFA 4DM4A 5JDIC 3PE3A 2HREA 1MT3A 3CNQS 3FYUA 2F8LA 4X00A 3OX4A 3WR5A 3D2CA 3CPEA 4FMCF 1VLHA 5BW6B 3BMOA 1JT9A 1E4OA 1NW3A 1QIJA 4F3RA 4YRBA 2OV8A 1BXGA 5IUJC 4MB2A 2YWDA 3ONVA 4J2HA 2ZS8A 1O6BA 2MINA 2XAAA 1TUIA 3B70A 3P0EA 4V03A 3UFXB 3ILYA 2ZIXB 1ZPDA 4YHBA 2EG9A 3C70A 5LD2C 2Q4RA 5FL7A 2BUAA 4IF4A 3ZGVA 3RLIA 2GBIA 3K8QA 4OFWA 4CL2A 2X58A 5FV7A 2PRIA 1OPXA 3OESA 4EELA 3M33A 1KK3A 1M1UA 1VPEA 1XMXA 5HKOA 5JJ5A 1UFQA 5KNBD 2C5AA 3TW6A 4GFDA 1I51A 1ST3A 3NHMA 4MQFA 1SIWA 4AKSA 5AKYA 3OC6A 1HQDA 3CRMA 3Q7SA 4L5YA 4QXOA 1K7XB 5DN9A 4D8XA 2I2BA 2BGTA 4L0MA 1ZN7A 4NECA 2PJRA 5DLQC 1G2PA 4RD3A 3ZKWB 1SKBA 4I6GA 3HEMA 4OQ4A 4UARA 3T9DA 1JAZA 4Y2YA 4FCVA 4YNBA 3QE4A 2I5PO 4FNGA 4MW5A 3T3GA 1CTQA 3JAWB 2AOTB 3AVTA 5FLYA 3I6QA 4UVGA 3T1TA 2R96A 4KZPA 1OWOA 1FP2A 2G09A 1NJ8A 4K5QA 2HJHA 4ESOA 5B3JC 3SN6A 3NNDA 1ECLA 2WPNA 4KXWA 5GVRA 1QCCA 1L7VC 2JA2A 2PL1A 1GZUA 3W4JA 1HC7A 2EBUA 3G9TA 3BKXA 3VHRA 1L0BA 4F2PA 2GN6A 3SSAA 4CCYB 2GMWA 3ANXA 3KJHA 4ABYA 1ZGZA 3AEUA 4W4TA 3TZQA 2YMLA 4IINA 4L2IA 3OCZA 4MAAA 1GP2A 1H2ZA 3G5LA 5BSMA 5I4BA 5LQSA 2WJ3A 3GLIE 3I6YA 4M76B 5CDUA 1AO0A 2OL4A 2VK1A 3MCWA 3OTQA 4JXKA 2RB5A 4C2AA 1KQGA 3SFVA 4IL5A 1F14A 3AHJA 3JVDA 5KNBH 3NGXA 1QNLA 2WTEA 3NAQA 3B9RA 4MNTA 5ALNA 4AS1A 4CG2A 1NULA 4K05A 2RCYA 4Y6RA 4RPLA 2HI0A 3ZE9A 4LG1A 1GVHA 4A0FA 1MC4A 3DC7A 2R6ZA 2D7JA 2D62A 1YBMA 4PLCA 3VVLA 4DIFA 4OU4A 4PYIA 4AUNA 3FHLA 3E70C 2NYAA 3M3PA 1YKFA 3QUAA 1C7JA 1WQ3A 1WSWA 1S2IA 3CO5A 4W6QA 4YGXB 3FTNA 1UT5A 1LY1A 3UW1A 1QX3A 5FWDA 1CR0A 1IK6A 5ICGA 2I03A 4FZJA 3OIUA 4QEDA 4B43A 4IHJB 4W8GA 1D0IA 4X1IA 4KQXA 1U4OA 2Q49A 2ZTMA 1UMCB 3CEMA 2VXYA 2H06A 1EK2A 4YRQA 3WRXC 2WJWA 1IB0A 4OV6B 1PX2A 3C16C 2QMYA 3RFCA 2QORA 3HLYA 2X15A 2VT2A 4UKDA 4XSVA 1XWWA 2JLSA 5AVRA 2DF8A 5LUAA 4A0QA 4E0BA 5HFJA 2AEMA 3IHWA 1Q0HA 2OORC 2H2IA 1SKYB 1MD9A 1H9CA 3TH5A 1XK6A 2QPLA 1EI9A 1ZI6A 3PGKA 4XYBA 2G08A 2PSJA 3OOHA 3REGA 3JSXA 3G2QA 3OFND 2YFKA 5H70A 3HABA 3IMGA 4KRGA 3WLLA 3Q0IA 1E6WA 1WUJS 4GKBA 1WPRA 4JIMA 4P9NA 4NH0A 1N34B 1U8XX 1P7YA 4PZ9A 3UJNA 1ORRA 5HEKA 5K09A 4GWLA 5KWJA 3PNSA 3V1UA 3CF6R 1K63A 1HE1C 4B48A 1QE0A 4OHCA 3A6GA 1FF9A 1GL7A 5ECYA 1YO6A 4M6WB 4GO1A 4JLDA 4XWTA 1U7WA 4GQIA 2WM3A 3PX3A 3PFGA 2ETXA 4LYYA 5FNVF 1ZA1A 2VIIA 2JIZA 1BEEA 1GPUA 4IMIB 1PGNA 3CT4A 5DGHA 5TB5A 2FZ5A 4F45A 4ZMRA 4TTTS 2D0OB 3UGJA 4YONB 4WA8A 4HN4B 1D07A 4C7XA 5AHKA 3CVWA 3K1ZA 3H2JA 4XYMA 1KZGB 1ODKA 4M0MA 2Y4NA 3B12A 3O31A 4JJKA 5DISB 4BE9A 3AYZB 2R1VA 4KQJA 2OCDA 1WMDA 2C2MA 2V7QD 1SRQA 4BTVA 4C0LA 2HSGA 1UMKA 1BXZA 1UAYA 2NT4A 2ZAGA 3Q9LA 5CGZA 1E89A 2GASA 5E6UA 1T4CA 2Q8QA 1TCVA 1TDJA 3LLSA 3LO5A 4FFBA 5JZBA 3F6RA 4WDQA 4Z9BA 1JQEA 1T9AA 1NN1A 4KQMA 2QTFA 4NESA 4EMSA 1WDKA 4E5PA 3DWGA 3ORQA 3ZI7A 3UOAB 2N42A 1ZVVA 5DGCA 3DZ8A 2W2OA 1GNTA 2F6RA 3O03A 4ECEA 5E0OA 3T99A 2OCAA 2OAEA 2P62A 4HH3C 1E2FA 1XZGA 2X76A 5C34B 3RHFA 3N0TA 4D98A 2Z08A 3UCFA 3FPFA 4MWZA 4P1ZA 3QP9A 1E7SA 3AVPA 3L7KA 4EATA 3OPMA 1TZJA 3HDQA 5G1PA 3ANYB 3V9PA 3O92A 4KI0A 3VKVA 2VDLB 3B1YA 5F4ZA 1FLNA 4F8YA 5KYNA 5JCXA 2ODPA 2Z58A 4FN5A 5A4KA 1IY0A 4BNIA 2EP8A 4R01A 4GPEA 5J1SB 1RRVA 2LDXA 4QUAA 1GDTA 2XF8A 3DMRA 4HWSA 4PW0A 5TNXA 2HOQA 4C0AC 3GZTB 3ZK9A 3I58A 2CKMA 4WECA 4XPZA 1D9ZA 1P61B 5DEIA 1A5TA 3L8CA 4MW2A 2Y05A 1RC1A 2C97A 2O0HA 1LLQA 2AR0A 2YY6A 3CNNA 2GAFA 4HMQA 4N7JA 1HE4A 4K81B 3QVOA 2BR4A 1RCTE 1FTNA 3H1AA 4P5DA 4EG3A 5IX8A 1RWWA 2YQ5A 4HDRB 3LDGA 2NU7B 5E6RA 5HQ3A 2QYOA 1E5LA 4MKFA 4JC8A 4B47A 3WL7A 1VC2A 3CNEA 1Y6FA 4EJ0A 1EVIA 1F17A 1L7RA 3NVAA 4MINA 1NU6A 3RSOA 4LF9B 3OF2A 2CZQA 1ADBA 1CZOA 1RXYA 2WUEA 2QRGA 3PA8A 4DLXA 1WX1A 3TIGA 3IELA 4A92A 1JLLB 4FILA 2ZJ7A 1EFRA 1K06A 4ZQBA 1XDBA 4EHHA 3DWFA 4QUEA 1GAQA 1E3TA 1YOVA 2ANBA 3THWB 2HSJA 1U1IA 4X66B 4E2ZA 3KAQA 4TQUS 1E4EB 1JIUA 2DQZA 2ZRPA 3TAUA 4OYYA 2CGEA 2CVPA 2FHSA 3LOPA 4ND1A 2QWXA 4PO1A 1HMPA 2GYYA 2O7RA 2AKYA 3HNOA 1RJDA 3RFUA 3RVQA 1Y3AA 2AEJA 4TKVB 2OHVA 1OTHA 2J5XA 1G5HA 1SQSA 5JR3A 5KWEA 2O0MA 1TCCA 3AF3A 4R7GA 5FNVA 4PTYA 3INYA 4YMLA 3L0ZA 1ZMOA 4J0EA 4Q3KA 2BHSA 3QUBA 3BZWA 2QZJA 1YS1X 2FW1A 3IP1A 3OEED 4FMPA 4ZMSA 3PVZA 1I5EA 1B4DA 4H1UA 2AE1A 3L8ZA 1H3NA 2YW2A 4G9GA 3T4UA 4XVUA 4V38A 2V3CC 4K2HA 4G24A 3R3ZA 1VM6A 1DC3A 4JBWA 1OV6A 4GC9A 1JQBA 1EX9A 2W93A 3NONA 4ENWA 3D3QA 4X1OA 3AILA 1J5XA 3H5IA 3MTGA 1T9DA 4MKGA 1VYTA 1W73A 2HRDA 3BD6A 4PR3A 4WD3A 3V6LA 1GSIA 2ONCA 4W9RA 4C4AA 4HMPA 5F2KA 3ZJ4A 1OVMA 3AZOA 1NN5A 1XCBA 2BUCA 2NACA 2XKJE 4NJEB 3VR5A 4LJAA 1JH9A 3AFHA 3KHKA 4PGGA 3S2IA 3KZVA 1MTZA 1NVMB 1EGQA 4M1MA 1F3LA 4PFKA 4LY0A 5KTRA 1VMKA 2C61A 2PH5A 4TZKA 3ER9A 4D97A 4BO4A 1XTRA 4NPAA 4IDFA 1M1NA 2WQ6A 1SQ5A 2QM0A 2GXAA 1E3WA 1YIAA 1MAHA 2UVPB 1J00A 2WFZA 5JS1A 3IRVA 1FSZA 1JG3A 4WK4B 4BJ1A 5DDIP 4CKEA 3D7LA 1UWVA 1UZLA 2EKPA 3R9WA 5IDVA 4I50F 2MJLA 4EA7A 1XQWA 2BFCB 1DADA 1R4ZA 4A3SA 2JFGA 1CVIA 1FIUA 1EX7A 2VDQB 5EAIA 3EIXA 3U17A 3HVHA 1E9CA 4L1KA 1J0BA 1M0TA 3ZXSA 1H23A 4ZI7B 1EXVA 4LRUA 3BWDD 2YHIA 5AVWA 2CSUA 2X0NA 3COVA 4D42A 4ZVUA 4EQ6B 1QGDA 5CT6A 5T4FA 1IN5A 4N01A 3P9YA 2AKEA 5D7NA 5DHSA 1NLZA 1QE5A 1NMXA 4EA9A 1F2DA 4F21A 1RZRD 2FZCA 4RMNA 2PYIA 3BHMA 4DIUA 5B2FA 4GBJA 1F0PA 1QFMA 2YOHA 5FI3A 2OA0A 3CH5A 1CUZA 3T9BA 1VTKA 1UH5A 5CXUA 1IN4A 3EAFA 3SLKA 2BGKA 3R3XA 4HDNA 4FOPA 1H66A 2H00A 2FSSA 4FOTA 2BW0A 5IKOA 4C43A 4P3KA 2QN1A 2H1SA 5G0TA 1R0LA 3IPYA 3QKTA 1JMKC 4JN6B 4P3XA 3PQ4A 3HKEA 4QVIA 1DO8A 1ULBA 4QELA 1V2GA 4LWZA 1N0HA 3JYHA 1LSSA 2LKCA 2RFLA 5EIEA 2OESA 2C5GA 3B1KA 3GGDA 1RXUA 3TSZA 2NOAA 4U7GA 2WE8A 1YK0A 5IJ0B 3DZHA 1XLUA 4L85A 4PGMA 1QBKC 1J0XO 1WB6A 1WLSA 4QLOA 5K3FB 3W79A 3W7AA 1US8A 1E3IA 3DV9A 1UJ6A 2HRBA 1EB8A 3LXUX 2VOJA 2OQIA 3E81A 1AV7A 2CYAA 2B3TA 5K3CA 2CF6A 1BGXT 1CQWA 3EXHA 4HJXA 4YAIA 4MICA 2AN9A 3CEPB 5G2OA 2E5WA 1WUYA 3D6JA 2HADA 3ZOKA 4C7KA 1CQJA 1L7BA 4Y7CA 3T5BA 1CJMA 2IIQA 3ADCA 2P4SA 2BZGA 4DCUA 1I9GA 1NI4A 1MFZA 2LUOA 2VDMB 3BOSA 3B9BA 3JQ9C 4HGOA 4NK4A 3W77A 3NIWA 5IH3A 1N32B 4CIVA 1EE2A 3DHYA 4EVRA 2GEFA 1LW7A 4PF1A 4JI3B 1NQOA 5TARA 4BNMA 1RI2A 4ZVLA 3R7DA 2IYOA 1QIFA 3GMSA 4X7BA 2C9ZA 5H80A 3PNOA 3ZZMA 5P21A 2R65A 3GFQA 3KS9A 4QJIA 2WYUA 1JQDA 2XW6A 3PPVA 5LKAA 2PUEA 4W7SA 4YJGB 1PR6A 1ADCA 4JFAA 2AZDA 2RDMA 1NPYA 3TLXA 4FLEA 1MC1A 1JFLA 1QFYA 2X3FA 4HATA 4PSCA 3ZTYA 2HHJA 2YCLA 2YHBA 3ELUA 4KXYA 4M0DA 4NE7A 4XYGA 3HKBB 5DVZA 3U7RA 1FVOA 2VOEA 3KETA 3BXFA 1R5BA 2I4NA 3VZDA 2AX3A 3PPYA 4HQRA 4IW3B 1N2BA 1SXIA 5JSZA 4R05A 2BCGY 3R1IA 5EP3A 1WTCA 1NC3A 4R71A 2X5JO 1C0IA 1SCIA 1Y8RB 1UXKA 3QLUA 4BFWA 2VQFB 3CF4G 1YRWA 3PB3A 4NPCA 3T15A 1SOUA 1ZY2A 4FM9A 3EF1A 3UWKA 1A9PA 4JOQA 3C8HA 4XR4A 2XE7A 4QXAA 2W2VA 2Q3JA 1Y5RA 2A9QA 1RQNA 2REQA 2V7XA 2Y1XA 1W52X 3M2PA 3MJVA 3QVMA 4GWGA 4I50A 4M53A 4A73A 2W71A 4BV2A 4LY6A 1C9KA 1FQOA 1NOJA 2IXEA 3PUVA 2V9PA 5A5DA 1PJ3A 3NEJA 3FTPA 3VKUA 2VUHB 3ZWVA 3QNWA 4IOLA 3UH1A 1Z2OX 4DYVA 5C8YA 1ORTA 4U63A 4OSPA 1Q95A 1XBTA 3ELYA 1TEVA 3NT2A 4DSTA 2IYPA 2P9CA 3AHDA 1HMYA 3MTBA 1LZLA 4YWJA 3T1HB 5FEUA 5JRDS 1OXBB 3PI6A 4X8LA 1CR6A 4HBZA 1IPEA 1Q12A 3EUFA 2QN9A 3PHBE 4R7TA 4RD2A 4DV4B 1U2DC 3BRWD 3R6LA 4MKHA 3DUFA 1B76A 1II8B 2YL2A 3K20A 2O3QA 3PL5A 1E6UA 3MERA 4QUBA 4F46A 4D9JA 1S8OA 3EUAA 1R6DA 2RGRA 1WF6A 1E5VA 3T0GA 2DR3A 2Q9CA 3L7AA 4LJ5A 2C00A 3I12A 3EQ8A 1R3DA 3Q2IA 5EJGA 1CC1S 4JP3A 2AEFA 5HHTA 1RFGE 4OPMA 3RC8A 3FLAA 2EL7A 2B5OA 3GLIA 1BMTA 2Z9DA 4JT4A 1D03A 4MUYA 4N9WA 2A9PA 4EKIA 3QX8A 1I14A 2Q4DA 4BC0A 1GZSA 1SVMA 1DKOA 1HR0B 4BPRA 4LYAA 2OM2A 2EFCB 3TSYA 5T41A 5KBYA 3FJOA 2PFGA 4BQFA 1SHKA 1GTL1 5FHRA 1X1RA 1N5LA 4RZ2A 1SUFA 1CUUA 1LA2A 3QE2A 1Q20A 1T0IA 1II0A 1F9AA 5HWSA 1KEZA 5KQSA 3UK6A 5FYQA 1OZAA 2UAGA 3RUIA 3V55A 2ORIA 1KDOA 3NAMA 2X6TA 1G19A 1QIKA 3NHYA 3JPYA 3A1FA 4BCBA 4DOMA 1WL8A 2BT4A 3D6UA 2W58A 4KPEC 4A2QA 5F51A 1FXUA 9ABPA 2YZNA 2XZDA 3C5WP 4D8YA 1V35A 5CFZA 2V74B 3ASYA 3M9XA 3GBVA 4M1EA 2QRNA 3RAPR 1GQFA 4DC0A 3E18A 3RABA 3B6EA 5BV1A 1RHMA 2NTNA 3CNBA 3WFIA 5FHQA 1XA3A 4R2WA 5TQ2A 2O06A 5HZMA 4CF5A 2P0AA 2DBVO 4Z4GA 3ZJYA 4OHKA 4JNCA 2BEJA 5JVDB 1PQYA 3SYRA 2VP6A 2H9IA 3OM0A 4G9EA 1IONA 3TVYA 4F7WA 2AUMA 3ES9A 2C4VA 5IKXA 2ZCJA 5FIUA 3I9V6 3BA6A 5AKKA 5IXYA 2WF8A 5IC6A 2ZIGA 4A6EA 3X2FA 5FF9A 2VP5A 4PCVA 1T6NA 5KUTA 4UUBA 2XCTB 3AKYA 1QO0D 4ZHQA 1T2EA 3A06A 3HXPA 4JQOA 1PFQA 3H97A 2HRCA 4L4ZA 3JWPA 4KG7A 4LJYA 4W63A 1SR8A 2NO1A 4I4CA 2OCBA 2VATA 1K7EB 3PQ6A 4OP3A 4RSRA 1KSGA 4U7HA 3ZE1B 3MSXA 1PN3A 2HU2A 3PC8C 2WVJA 5KS2A 1ZL2A 1SEVA 1H8EA 1RI5A 4HQNA 1KI2A 3V8PA 3VZSA 1Z6YA 4CQLB 3IVGA 3BGIA 3FAKA 4UCQA 5GOZA 1M6VB 4FMCB 2I9KA 4DR4B 3V8QA 2IS2A 2C9CA 2H9YA 3GT3A 3VKWA 4CM7A 3KOOA 1H2WA 4UUOA 3TEFA 3UOGA 1U5BA 3A6FA 3HEBA 3ZCXA 3ZE2B 5JWHA 2YJNA 4HUQB 3SIRA 4IKPA 4PAWA 3HO8A 3GEDA 4O8CA 1YVDA 3V4OA 2VXBA 3DOIA 2NVWA 4CV0A 5IDXA 3GFGA 3FN4A 4HDMA 5B37A 1C1DA 1SRRA 1TUEA 1TECE 1RYDA 1ZQ9A 2AZMA 3H3JA 3PRKE 4XZ3A 1A8UA 1G9SA 1LGYA 2RH4A 1MQAA 3M3HA 4J91A 4ZZ3A 5I4CA 3IO5A 4JOBA 4Q3EA 1TTTA 5ILGA 5J43A 2HJ9A 3ENZA 2GZHA 1D6JA 5JQGB 1UDBA 2J59A 3EDCA 3AUJB 1TJ3A 2YS6A 3K6JA 3TEJA 4KTVE 4QM6A 4NCBA 1V25A 2PZJA 1VA4A 5F5NA 1YB4A 4KBGA 1T4CB 3SX2A 1XQ6A 2P9EA 2ZAIA 3H6GA 4WT7A 1ZHFA 7GPBA 2OC9A 2ATXA 2B4QA 2O20A 3GBPA 5DBFA 1MXHA 3ZHVA 4D79A 4EVSA 5KJCA 2G76A 3OOEA 4ML3A 5FOUA 2I66A 2FWMX 1VHJA 1NV9A 4HLNA 4PZ0A 5JCPA 1A71A 1GFZA 1YZQA 2FR0A 3KVOA 1I6MA 3DT6A 3TOSA 4B71A 2ZRJA 4OLFA 5D5HA 1MO4A 1I2AA 1V3QE 2KBFA 1JYEA 4XUEA 4ZQFA 4B4VA 4DM3A 3QMWA 2AV6A 1NE7A 3NBFA 3ENWA 5LJLA 3TSCA 4BMZA 4BBJA 4YV7A 1PG0A 4PEVA 5AJTA 1EHCA 3MTQA 1FNBA 1WXGA 1E1CA 3E1SA 4HEJA 1YQDA 1V5EA 3EFBA 4RD0A 1DIGA 4D9GA 3HJRA 2IZ5A 2PGXA 5EE5B 5HR5A 1F1JA 1CKEA 3LXRA 5K3EA 2VWPA 2BFFB 4IDAA 2EAUA 1PJCA 5EXPA 1Y33E 3OQJA 5LQJA 1LVGA 5LFAA 4X62B 3KQKA 3V1NA 3CW2A 3LUGA 3VR4A 2XDWA 3CZ5A 3D54D 5AYVA 1KZYC 2PZKA 1FFCA 1LCIA 1I9CA 2PYZA 2WE7A 4ZCPA 4BU0A 4ANFA 3F3MA 2PUWA 1RXVA 1AUPA 2J0EA 2PKRA 1EPUA 3KEFA 4WFIA 5L3VA 3OZXA 4JA0A 4PLZA 4ZT6A 3PC6A 4PVDA 3K0KA 1JSRA 2WWVD 1T0HB 4ZCMA 3UATA 3BRSA 2D2FA 3H1FA 5EIBC 4I4NA 3BFPA 3L8GA 1AUVA 5KMGB 2C59A 4P4TA 2VNIA 2XKAA 3JZIA 2ZJ4A 5H81A 4TTIA 3RYCB 1FNSA 4BLTA 3PWZA 4A7PA 4WTOA 1L4GA 2C78A 3I6IA 4TL8A 2CKDA 1WPXA 3OF3A 3ROQA 3K0AA 3PYXA 4NX2A 1E5XA 2G70A 1NXWA 3VMFA 1V4BA 2G63A 4AUMA 2XWBF 1RPTA 1GUZA 4HBGA 3CGWA 5CFPA 4KWTA 3FUUA 5DASA 2H2DA 1PNRA 3H4MA 1LQUA 4LXXA 2W2TA 4BN0A 4FCWA 4IJ6A 1JT2A 2L19A 4R6WA 5G0SA 2ZSKA 2OXTA 3VKFA 2YJ5A 1VGRA 2DTEA 2E4UA 1LPMA 2I2FA 3SLRA 2BBOA 2W4MA 4KQHA 4E7PA 1CRPA 4N5DA 5B58T 2Q3MA 3NPAA 4CLRA 4IWYA 1NMSA 2FWAA 3QSGA 1U6KA 5C4GB 3S44A 1CJCA 2C2YA 2C2WA 5F3DA 1GPBA 1NLYA 1SURA 5AIAA 3VPFA 3IYLW 2AFIB 2IHVA 1ECBA 4CIAA 1TM4E 1G0NA 3P9NA 5HA5A 3S99A 3T41A 4ARZB 5KYUA 4ZEVA 1YBVA 1RZ3A 1TD9A 1SUPA 2NV2B 2WFMA 4WNCA 1EM8B 1IXZA 2GCIA 2QHXA 3GUUA 2W5UA 4RAQA 4W8HA 4BP1A 4RYDA 5FNVB 2ZZMA 2DLDA 2PLAA 1GR0A 2X5NA 4QJ5A 1U2QA 1Z5GA 3OX1A 3WFZA 3PENA 4X63A 5AVYA 2GUWA 4LRXA 3RTGA 4B3CA 3UH0A 1P74A 4P38A 3SE7A 3U62A 5FBHA 1W581 2V9ZA 3L5OA 4JHXA 3S8EA 2RI6A 2YHSA 1ML3A 1C1HA 3LM8A 4KLRA 4RE6A 13PKA 5JMPA 2WUDA 2QE7D 3A6ZA 2WIDA 3A05A 1L7XA 1DWOA 4JLSA 3TNYA 4F6LA 1SB8A 3INTA 2XVZA 3L6UA 2F1RA 4WKGA 2BHLA 2V54A 2X2PA 1NQXA 3BK7A 1E8NA 2WPDD 3G2MA 1D5CA 3OPXA 4RFVA 4ZCSA 5BVGB 1BDHA 3PPWA 1TL7C 4R5MA 3TKYA 3UMRA 1W25A 1SOWA 1XZCA 2W2LA 3LYLA 4C5AA 3AY7A 1MH9A 5BNFA 2EWMA 2WF7A 1Q3HA 3I05A 3AB7A 1VQ1A 2C3MA 2YC4C 1W8IA 5TVGA 3STHA 2VP2A 4KGXA 5I3CA 2A9VA 2OV2A 2XKKA 1WMFA 2BKLA 2YVKA 3T1NA 1P7WA 2GN8A 1P1RA 4D9NA 1JDTA 4CF7A 4WVFA 4BO8A 3UGQA 3OO1A 2VEOA 4W1QA 8MHTA 1A1VA 4Y2JA 2HYIC 1DX6A 2CL6X 2JFNA 3PI7A 1BHO1 1GILA 2G36A 3AW9A 3V7WA 5A9SA 3BB4A 3UYKA 4PO3X 3L93A 1P62B 2IYNA 1DCTA 3IESA 4A91A 1QRRA 3C3CA 2HSZA 3GJSA 4I1RA 5FR2A 3RJZA 5AUQA 4O1IA 1PT9A 3RSZA 1NW6A 3SZGA 2QMHA 2F43B 1X9GA 4EZEA 4KYIB 4MUJA 3R3VA 4G8BA 3GDOA 1J25A 5C1OA 1O94D 3DMTA 1CUAA 3KJXA 1SXJD 2QD2A 1N7HA 2XMDA 2Q6TA 4XDGA 3O4VA 1SVOA 3SP1A 4OXXA 4Z0HO 1MPTA 2WKRA 1CUFA 3CF0A 3L82B 5EA2A 4MRMA 3R7BA 3KFXA 4KWEA 3LQ2A 5C7LO 3GLGE 3IEUA 2G67A 3QUQA 4K1LA 4Z9AA 3CVUA 3S7ZA 1XLWA 2PKCA 1J2EA 4KQ9A 3JR3A 4BQRA 2ZBPA 3MMPA 2B8NA 1P0CA 3AH8A 3ICCA 2GZSA 3U48A 2WIAA 4Q5IA 5DBEX 4I46A 1MOPA 5LMCA 4ALJA 2PDAA 4IOKA 3KXKA 3UANA 1GZ3A 1KOFA 5DP1A 1N1EA 1OWMA 1T2FA 5G53C 1NDUA 4ZPXA 5K0LA 4IKEA 5LPNA 3M9WA 2RGBA 3ZDBA 3WYGA 1QHSA 3T5PA 3VC3A 1VE6A 2PBFA 5BN1A 1C80A 3PKJA 4JUCA 2R7MA 4ROSA 1L4UA 1ML4A 4PG7A 5A7FA 2H1VA 2FFHA 4E2XA 1JE1A 3GP8A 2WP8J 5I7RA 2HPAA 1G3UA 4QYWA 1N6HA 3OZVA 4NU8X 2ACKA 2FPSA 1G3RA 4FE3A 1KVQA 4LXYA 4C6HA 3EXHB 4CLDA 2PQMA 1KZ1A 5SY4A 4KO1S 4G1FA 4AJJA 4URVR 4R9RA 1PNQA 3NIBA 1PTKA 2QLBA 3CC8A 4HR7A 1VBNA 4P33A 4Q93A 2E9SA 2RIPA 4DXHA 2W6NA 2X8JA 3HU1A 3D6AA 4I19A 3QUCA 4QYIA 2G9NA 3MYRA 3VZPA 2FXVA 4RHUA 5DFAA 5U4QA 3EZ7A 3AR8A 3S8MA 3SXPA 4RTRA 4FYJA 1H5NA 2ZUDA 5KTYA 3TFOA 4LZWA 2XMBA 4Y2PA 4TTJA 3F3YA 1FFEA 1LBEA 4QRIA 2JRLA 1VLMA 3PCRB 2HQOA 1RI1A 3DWIA 2VSOA 1WBBA 1JJFA 3NBYC 4RJJA 2IVZA 1HYBA 1PJZA 2FLVA 2P91A 3BCRA 4PZCA 4KE6A 3H83A 3PC2A 4H35A 2DQYA 4I55F 3VO2A 4EL5A 1H4QA 1QIHA 2HA3A 2RGGA 4DDMA 2FPRA 2HSWA 1BDJA 1CJVC 3ITDA 2ICAA 1KFBB 5EHNA 1BRTA 4Q1BA 4ER3A 3G1WA 4ZYUA 3IPLA 4EPTA 2O8BB 5HVNA 4NK5A 2CFIA 5L8VA 1JIQA 1WS6A 3OP4A 1GCAA 1IN1A 5G41A 2QTWB 1ZFNA 4CM8B 4PBTA 5KSOA 4DCCA 2W0SA 4LDZA 1VJRA 3Q7EA 2PWZA 2IGTA 4ND4A 4AB1A 2ECPA 3PC7A 2J3IA 2AG5A 1XE3A 1KYVA 3GD5A 1XK7A 1LJ8A 1SD5A 4XWKA 2PY6A 3MAAC 5H3LA 3KVNA 4FYXA 1Q22A 5AVVA 5BYKA 1KS9A 2M6SA 2VYVA 3GVHA 3RE1A 2GDZA 1UQUA 3PHCA 2KQUA 3IXMA 1Y8CA 2CNBA 1KNQA 3ZLVA 5KJ6A 2JF0A 2O14A 5CVVA 4IGFA 2NQTA 4MITA 3EGXB 2BMAA 2JLCA 2QU8A 1R1DA 4GE3A 3WB2A 3M5DA 2Q5IA 3U3OA 4GICA 3CRVA 3PNBA 4QRDA 4ABTA 1EUZA 1LD3A 2L42A 2W2QA 3FPHA 2NUAB 3MA0A 5LNK1 1XV5A 1JFRA 1NG9A 3C2QA 2J9RA 1X0VA 3KR0A 3KLMX 1Q14A 4WNYA 3U7IA 1P8JA 4F3CA 5DGXA 1KSJA 4AJHA 2A0WA 5FOWA 5KOJA 4B2LA 1ZGCA 2BFOA 2PIDA 3B3GA 1PZMA 1U8UA 6CHYA 3TRHA 2HAEA 2V0GA 3KVVA 3ONNA 4BMOB 2EGHA 3HA7A 3L7OA 1A8SA 4KO4S 4Y2UA 4D9IA 4UDNA 2O7QA 3HLTA 1I3LA 1XNJA 3CKYA 3FOWA 4JAVC 4TXHA 4RIGA 3T9CA 3HUUA 3VC1A 3NOQA 3OCYA 3WI7A 5CA0F 1WXWA 2JFXA 2ZI4A 4WGGA 4JYPA 5DSZA 2MCFA 1L1RA 4LW8A 3P2EA 3FDFA 4JJGA 1CE8A 5HPYB 1YKSA 3LHIA 4AF7A 3R9XA 5DCWA 1FXSA 1L5WA 2JNWA 3ZWKA 4EPXA 1RLUA 4JXXA 4WOJA 3GUCA 3PFWO 1PJTA 4MKIA 4OBBA 3SEAA 5LR6A 3BXOA 4MX8A 2QR5A 1J09A 2QDKA 1NM5C 3FIJA 4JWKA 1PT6A 5IAAA 1IZZA 1KQPA 2F3QA 1PF7E 2R6R1 3G9XA 3R20A 3LRXA 5IAJA 1K3UB 2GAJA 3M6IA 3OZRA 5L53A 4RTOA 4Q3DA 3DDWA 1YCHA 1GTSA 3HNRA 4HRYA 3NHAA 2WT8A 4P3PA 1GUFA 4ZO9A 1KEWA 3GT4A 4U1RA 3ZC3A 4F5YA 2NU6B 4ND3A 1S1MA 1HT0A 3KB1A 1IHXA 2BEUA 1V8OA 4HVCA 1AQYA 1LKZA 5EJ4A 3U61B 2MR6A 1N7GA 2ODQA 1VKOA 3PUJA 4CHGA 4E1VA 1J8YF 1H3FA 3EASA 2DHEA 1KOJA 3N8IA 3H4VA 2EF0A 3CG4A 1X15A 1YMVA 4KNWA 3F4LA 4QUGA 4B3DA 5DB4A 5FUBA 3EQ9A 1O95C 1JAXA 4O2LA 1Z6TA 1DUVG 4MI6A 1ZN2A 1E8MA 3NCTA 3V7FA 2P40A 1V1RA 4LQCA 3ZWAA 3GPCA 2VP0A 2ZRFA 4J9UE 3KYCA 3M5CA 4HCJA 5DF1A 4GP9A 1JR4A 2P77A 3CKKA 4JITA 1Z5ZA 3DG9A 4G8DA 3AI3A 2ZB2A 2PU5A 3R3UA 4KIFA 4KNVA 4MHSA 3VJRA 3UWSA 3GK3A 3H9UA 1XHLA 2QQFA 3OKFA 8ADHA 1U7DA 2I4LA 3OT1A 4BVEA 2O8DB 2EU8A 1E59A 2CBXA 2G9UA 4YROA 4I55A 4YO7A 5ERYA 3V9AA 3KFLA 5L4SA 3PE6A 2Z6UA 2BFWA 1JAYA 3U3DA 2P67A 2WM8A 1MAVA 1E6EA 3N8DA 4UULA 1UBHS 1P4RA 4XWYA 1NHGA 4S05A 1DWPA 3VZCA 8LDHA 1Y6GA 3HADA 1QHYA 2DGDA 4QUHA 4ZOEA 4BKUA 1MRZA 1I1NA 1KYQA 1NYRA 2WKPA 4CLOA 3KWMA 1B00A 3JYNA 2O2IA 2SCUA 4RVNA 5JH7B 1GPJA 3G2IA 3KQMA 1W5SA 2QW8A 2G0NA 1X74A 4ID3A 2BELA 4KRFA 4MUAA 3GJXC 3STYA 1TFRA 1ODCA 1SU4A 1R6AA 3SHTA 4BNNA 4E4YA 2O2CA 4QIHA 1B6RA 2G3YA 1OAAA 2RGNC 1GGMA 3QLVC 4G5RA 3G2LA 2ZITA 4CGZA 1OXXK 2QI9F 3ESAA 5CK5A 1F7UA 4BNFA 2CLFB 5FTLA 1JB1A 4KLAA 2V0NA 1RWPA 3AXTA 3GFPA 4K6HA 1IATA 3O74A 4QU9A 2GS9A 4FHZA 4HDMB 3FI9A 2DQSA 3H5RA 4YR9A 1GV0A 4RVFA 3FNHA 5IH7A 2HK7A 1LC3A 3L8FA 3EISA 4WNAB 4Y2HA 4Q9JA 1BGWA 7ADHA 5F52A 1OJ7A 3FZNA 3O3MB 1ZYUA 2IJGX 4BTLA 1C7EA 1TA9A 5JHGB 4YV1A 5IU6A 1UJBA 5AH0A 3P0HA 5A4FS 1J42A 1B8OA 3KKZA 3LCCA 5PNTA 4AJNA 2VXCA 3SQNA 1XKTA 3F4BA 1A9RA 2FN7A 3LCRA 1I4LD 1I1QB 2ZDQA 2ZYUX 4FOLA 2HJWA 4HWKA 4N0EA 4YRAA 2RD2A 1USUA 5ELXA 1N33B 1P5FA 4HH4A 2H4FA 5CA0A 2PZGA 4KQ1A 3WYBA 3FKQA 4X8HA 3EGWA 4YAGA 3OEHD 1QNFA 2G82A 2XCLA 2G1AA 2WHEA 4HS9A 5DM70 1N2GA 2X2EA 2QU7A 1MAAA 2IDKA 3QOXA 4G5GA 4RV4A 5FLKA 4Q3NA 1OW3B 4DUGD 1ISGA 4R3WA 4A10A 1EGHA 3PUYA 1TFUA 5GJCA 2A0YA 1Q7GA 3WJ7A 3Q8KA 2VJKA 2WD8A 3AESB 1GCOA 4OXNA 1IVNA 2EZ4A 3UT6A 4OA5A 3V7NA 2PXHA 4FQ5A 2HBZA 1T8WA 4L57A 3NRCA 1YS9A 2XZLA 1R5OA 1MX9A 4P32A 3LUPA 1H1LB 3CA8A 3T7DA 4PGHA 4OJKA 4UM7A 2Q5JA 3H3FA 2YHAA 3C8ZA 3G02A 4Z0PA 2FEMA 1MP0A 1P29A 2X0EA 4C04A 3QWAA 2X0DA 1I2CA 5BQ3A 3OCUA 4UMFA 1Z12A 1L1QA 1ZUNA 2VYQA 2ZBUA 4YP9A 3NUQA 4JFRA 4KTTE 2TRSB 3FVVA 3AI1A 4NLLA 5COQA 2P30A 2HK8A 3EVZA 3GG9A 4IGIA 4TKUA 4TXLA 4U2DA 3PBKA 1HDIA 2QLLA 4GKKB 4UOQA 4Z8XA 3EMBA 2AN1A 1Z34A 1IY8A 1L5YA 5L3QA 3QVKA 3VI4B 3LNTA 4CNQA 1KTVA 3O1LA 3QW4B 2I3AA 4OQLA 2PPVA 2RGXA 4LGVA 3ZHYA 4QG3A 1XEFA 3QKSA 3N2KA 3U09A 1FK8A 3BDAA 5K1ZA 3R09A 3HXQA 3IV7A 3DDOA 3IQWA 3QQ5A 4ZANA 2NLOA 4RJKA 3QTLA 4MXDA 1B6GA 4RMHA 4D0RA 2XLCA 2YMPA 1WAMA 3DCNA 2X6QA 4MARA 3HCFA 2A2ZA 4AZWA 2Q62A 3WIOA 1QHGA 1K3FA 2BKAA 2Z2YA 3INGA 1RQLA 3OE5A 1KZHA 8OHMA 1Z38A 1ZESA 1SO8A 1Z6PA 3QF4A 3H2HA 4BAGA 1HYQA 2H0AA 2JH9A 1A5ZA 1S02A 3PGJA 4WZAB 3UAWA 5NLLA 3LVFO 4BNTA 4DRXA 1E7MA 1W75A 4IV8A 2H0QA 3VMMA 3RYHA 3P9CA 2DY1A 3OEYA 3BE4A 3HDGA 3NKLA 1JHZA 3ZWPA 1Q0TA 4G0WA 1A9XB 4MVJD 1ZICA 1B8PA 4NBTA 2GZAA 2QTRA 2R8BA 2ZYVX 5K0FA 1A50B 5G4LA 3ZXUB 2AN5A 1CIJA 1OBHA 2ZIAA 1Z68A 5BQFA 1TQ2A 3VVMA 4WOBA 2PV0A 4C6SA 3FI0A 1SVLA 1WVIA 2V7UA 2OPBA 4FHCA 1T1EA 4JJ6A 2AXQA 4P4LA 3GJTA 4KV7A 4TVBA 3QEMA 5B57C 1Q77A 3JY6A 1VZ2A 3DONA 4R31A 3L7YA 2EW2A 1RCUA 2QPAA 4IEIA 2Q0HA 4G1BA 3D6HA 3WA7A 4CV2A 4TWIA 3CW9A 5BSVA 1X8KA 1DEHA 4H7EA 4N3NA 1QP4A 1JWLA 1ZUWA 2AFHE 3L43A 4MSUA 4UBKA 3ZDQA 5JRZA 2H1LA 3KTAB 4NRDA 2PZEA 3PXGA 2JLRA 3KB6A 2WILA 1RLOA 3ESBA 4ZJPA 4GX1A 4KPUA 4C7MA 1HTTA 3QVGA 1VMDA 3I9KA 4IH1A 1NVWQ 1TGVA 2E4AA 5CIYA 4KIUA 3QITA 4H1VA 5EXEA 4PZEA 1WXXA 1PR4A 4FZ5A 4KYTA 2ZTHA 5HIAA 4XRRA 4OB6A 3P9ZA 3DR5A 3WHKA 4MVJH 1L5HA 3C3JA 3WBJA 3F3KA 2V6MA 4F97A 3MWFA 4IIDA 1W5EA 3C5HA 4XQ9A 1AXGA 1VJ0A 4NMXB 5K6TA 5KPDA 4A2WA 4R2HA 3E9ZA 2QR3A 2PLFA 2WU0A 3OSUA 4B82A 3ZY6A 4AF8A 5AVUA 4GRAA 1HDCA 1CLUA 1T43A 1ZCAA 1B8UA 2AVDA 3BIXA 2XZOA 1QDLB 4YUZA 4QZVA 3JQRA 3Q7QA 1NA5A 5IDWA 2P1ZA 3F4KA 3L1KA 5DWDA 4ZV4A 3E3LA 4QAJA 5U4XA 4AYWA 1ISRA 1JG6A 1D7AA 3AETB 3F6BX 3OO0A 5JYCA 4ZO4A 3I4CA 5ED4A 2AUTA 3GJ8A 1DOAA 3WYFA 1VXOA 4BV3A 2GNAA 1LV7A 2IDMA 3F67A 2IDJA 1AQLA 3B9QA 4ZJUA 1DQRA 2MIIA 1T3HA 2FDRA 1FP1D 2BONA 3R8CA 1DARA 4MRMB 1P44A 5HOEA 4K9LA 5IZ4A 1D0VA 3CKMA 1XVUA 3H6HA 1BXRB 1A8IA 4LF4B 3E4DA 3FBWA 3D0KA 1X38A 3FDZA 4ZVMA 4ISCA 4YCLA 1BFDA 5BV0A 3VR1A 1E6CA 3AOGA 2WU1A 3BMQB 4DAOA 3JQBC 3RVPA 5CP8A 2R2AA 3GJ6A 4IBOA 5DRYA 3QEBZ 4IWXA 1T0BA 4AY4A 1T2UA 4H1TA 4GKJB 3KTDA 5MFZA 1BCRB 4K87A 1AK9A 2IPAB 3NUZA 3V3TA 1ZONA 3F5SA 1X14A 7REQA 1KR2A 1SJ9A 4LE2A 4U7PB 3CNHA 5EZYB 3CX3A 3DTVA 4DV6B 3C4QA 1VJ5A 5FPKA 1P2UA 5FUYA 5EMMA 1G42A 3PIRA 3K1YA 2FEOA 3O95A 1DIHA 2JAPA 4MIOA 1U7OA 3HY4A 2QUZA 3IS3A 3PXEA 5LB4A 3RC9A 3TMAA 3WLOA 5JASA 2Z9CA 1UXJA 2VYFA 4YQEA 2GRUA 3QPBA 4JENA 1WB9A 1UFRA 1BQEA 2W90A 5BSWA 1KDYA 4WRRA 1I6KA 3HBJA 4N54A 3MWDA 3B60A 3I9OA 1GTMA 1EUDB 1KH2A 1O89A 2IYLD 3Q7TA 4PX2A 5FL7D 4RK5A 2F55A 4O4JB 4MJLA 1YTUA 2X8JB 2HMTA 3BD7A 5K7SA 4G36A 1TJNA 2UUCB 4YIHA 1CDDA