2BFFB

Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
341
structure length
332
Chain Sequence
AHFEYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Versatile Conformational Switch Regulates Reactivity in Human Branched-Chain Alpha-Ketoacid Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
total genus 127
structure length 332
sequence length 341
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bffB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bffB01
3AI7A 1V1RA 4GM4A 1X7YB 3DUFA 2V3WA 4MPJA 3EA4A 2PGOA 4JUCA 5I4IA 5EJAA 1W85B 4D5GA 5I5GA 3FZNA 3EXHA 3EXIB 4JUDX 2VK1A 2R5NA 1V11B 2BFDB 2QTCA 3AHHA 3M49A 1POWA 1UMDA 2Q27A 4K9OA 1V16B 1W88A 1N0HA 2JGDB 5K2OA 2AG0A 2J9FA 1T9CA 2EZTA 3EYAA 3M6LA 5I5EA 3LPLA 4GG1A 3DUFB 1X7WB 1X7YA 2Y0PA 4QPZA 4FEEA 1U5BA 1OVMA 5HGXA 2PGNA 2BEWB 2DJIA 3EXG2 3EXIA 4KGDA 3AHJA 3EXHB 1UMBB 1QGDA 3RIMA 1IK6A 2EZ4A 1RP7A 1QS0A 2BEVA 2W93A 4K9NA 5EJ5A 1UMDB 1DTWB 2BFCB 2O1XA 3ZHVA 3IAFA 2J9FB 1MCZA 4QQ8A 3EXEB 3OE1A 4QELA 2BFBA 5EJ8A 1TRKA 5DEIA 3AHEA 2C3OA 4GPEA 1ZPDA 3EXFA 1U5BB 2G28A 1V1RB 2BEWA 4C7XA 4MPPA 5EXDA 3EXHC 4GP9A 4JD5A 5ESDA 2EZ8A 3ZHSA 1QS0B 2BEVB 3AHDA 1PVDA 4GM1A 5K3SA 3UK1A 1OLUA 3ZHRA 1V5EA 1UPCA 2WVAA 3M34A 2BEUB 1V1MB 1PI3A 1TKCA 1TKBA 2BFBB 5HJEA 1V5GA 1YD7A 1YHZA 2JI8A 1WCIA 4Q9DA 5K6TA 3EXFB 1QPBA 3LQ1A 4RJKA 4KXWA 2FN3A 2JLAA 1X7ZA 1PYDA 4GM0A 1X7WA 1JSCA 4ZP1A 1NI4B 3AHCA 4KXVA 1TKAA 1YNOA 1X7XA 2QTAA 1V1MA 1UMBA 1YBHA 1YI1A 2VBFA 2VBGA 2O1SA 2XT9A 2BP7B 2BFFB 1DTWA 1NGSA 5I51A 1PO7A 2C3MA 2PANA 2X7JA 5DGDA 1Y9DA 1X7ZB 5DGTA 2BFEB 2JLCA 1NI4A 3DVAA 4JUFA 3LQ4A 1T9DA 1W85A 5EJMA 3ZHUA 2G67A 2Q29A 4C7VA 2NXWA 2Q5LA 4K9LA 4K9MA 5K6RA 4JU9A 3L84A 1OLUB 2EZ9A 2WVGA 1W88B 1V16A 2JGDA 1L8AA 2R8PA 2BEUA 2EZUA 3KOMA 2XTAA 5EJ7A 1Q6ZA 3UPTA 2R8OA 2BFEA 2JI7A 4D5EA 1R9JA 2IHUA 4KXYA 3F6EX 4XEUA 3DV0B 1OZHA 1YHYA 2JIBA 2OZLA 2UZ1A 1T9BA 3LQ2A 2VJYA 1AY0A 3FSJX 5EJ9A 5IMSA 4RJIA 1V5FA 4JUBA 4WBXC 2Q5OA 1B0PA 2C3PA 2UZAA 3AHGA 1X7XB 3MOSA 5EXEA 2VK8A 4MPRA 3AHFA 3OOYA 2G25A 2XT6A 1UMCB 4JUAA 1ITZA 4K9QA 5AHKA 2C31A 4MQ5A 2FWNA 3F6BX 5ERXA 1UPBA 2Q5QA 3HYLA 4COKA 2OZLB 3M7IA 2UZ1B 2VK4A 3JU3A 2E6KA 1OZFA 3ZHQA 3DVAB 2IHTA 3EY9A 1OLXB 1V11A 2BFDA 5EJ4A 3D7KA 2PDAA 1BFDA 5HHTA 1Z8NA 1OLSB 1OZGA 1T9AA 1X80A 2C3YA 5C4IA 2YICA 5ERYA 2AG1A 2WVHA 1WCIB 3FLMA 3IAEA 2JI6A 2IHVA 3HWX1 4JU8A 1UM9B 4KXXA 3E9YA 2VBIA 4FEGA 1OLXA 3DV0A 1POXA 2C3UA 5EJ6A 1KEKA 1GPUA 3AHIA 2BFCA 2JI9A 1X80B 2Q5JA 3EXG1 1OLSA 3HWWA 4MZXA 2Q28A 2BP7A 2YIDA 3EXEA 4K9PA 1UPAA 5FEMA 2BFFA 5HYVA 4K9KA 4RJJA 3ZHTA 1YI0A 2C42A 2IEAA 4KXUA 1UM9A 1UMCA
chains in the Genus database with same CATH superfamily
4NE9A 1DRVA 1PK9A 4PFQA 4PX2A 1QIIA 4O6VA 3RE1A 3T7JA 1V7QA 1KIMA 5CCEA 3BJIC 4JASB 5CT9A 5C4MA 4DVJA 4CI9A 3L0CA 1OCEA 4C76A 3HY6A 5TQ0A 3R0VA 2DQSA 3IIJA 3NAZA 2XI4A 4M89A 4QUHA 3NO4A 1TF2A 2HSDA 3IILA 4HLCA 2Q9UA 2ODQA 4Q7MB 4F0JA 5HBGA 4XDHA 3BQMB 3EHDA 4MYCA 1YRBA 4X61A 4YCMA 1LX7A 3GMIA 5JLAA 2Z57A 5KVSA 3C39A 3BG5A 2RGUA 3B7GA 3KDSE 4EATA 4QBGB 2POCA 3SHWA 1DTWB 5GADl 3H0EA 3O9ZA 4RO0A 1TJNA 5AOAA 2YZ2A 5CDUA 1U3VA 1QTRA 3HCPA 3WICA 4CLRA 2EDAA 1SCBA 5K01A 2BEWA 2G28A 3NM4A 4WESB 5IJZA 2R6GA 1J21A 2CLSA 1BFKA 4CKCB 3G13A 2QN7A 5JPIA 3B8HA 3LUFA 1AMOA 2DAPA 4MLZA 5E7JA 5DX1A 3G88A 3T1NA 2B7LA 1DHRA 4DA7A 4ZI7B 3RTAA 4G5HA 4UTNA 2VZ8A 2K6GA 2XT0A 1HORA 4TWAA 5I7WA 4NVRA 5L3VA 4TUYA 2YWFA 4O2RA 3O1IC 3TOZA 1VBFA 2X19A 1WZNA 3T7DA 4H6XA 2NZYA 3CVXA 3OQIA 1A3CA 4MJLA 2PGXA 3JQAB 3WTBA 2AKAB 1XTTA 4RK1A 3OY7A 5EMHA 4EUHA 4H08A 1QOQB 1UPFA 3IEIA 2ZAYA 4IEEA 4O59O 2OQVA 4CE6A 4ZYTA 2RI1A 3TNJA 1H94A 3WLOA 2X15A 1FUYB 1UXOA 4FKMA 4G0ZA 4AJHA 2XCQA 3OLCX 3KB1A 2I54A 1CR6A 1C3LA 3DG9A 1KZ9A 5BVGB 1DBVO 1KBQA 4XWYA 2O7SA 4RFSA 2PWYA 4W6ZA 3V8RA 3WGZA 1ZNQO 4NE2A 4MX8A 2QMUA 2GZAA 4U2CA 3VNQA 3BA6A 1RYHA 2P9CA 4YRDA 1I80A 2AFIA 2G8LA 1AY0A 2G82A 3ONFA 2ZIXB 1LPSA 4JUBA 4V39A 4POAA 3KC2A 3MXTA 3OEEA 1F2UB 2BT4A 2QD5A 3GDWA 2F8SA 4ZHQA 1VOTA 3ENWA 3L5OA 4V3CA 3CZPA 3WFIA 1ZR4A 1UL1X 4C7OB 3DSRA 3KXLA 3QFTA 4YQFA 4ZI3A 2P9YA 2X1HA 3VSDA 3KALA 2IFTA 4MUXA 5ERXA 3WIVA 2E1RA 1T3TA 5FJIA 1BAPA 4OGGA 4U8GA 4MVJI 1BW9A 4LOLA 1WBDA 7REQB 3HN7A 1I7NA 3CE9A 2QN9A 4P35A 4XB6B 4K0RA 4ZGWA 5F2NA 5JS1A 1QYDA 3SCZA 1YVUA 4KSCA 3RIHA 1A98A 4YRBA 1ZHOA 3Q11A 1IQPA 2ST1A 2VF2A 3F5QA 4TS9A 4ZKEA 2CZQA 3GLKA 1QO0A 2ZTUA 3KQMA 4B2PA 3MINA 4TLCA 4TQ9A 4BKQA 1JNXX 3NJ8A 3QUBA 4U3JB 3SZGA 2ZIFA 1SKQA 1N57A 4JC4A 3ZGVA 2EV9A 2R62A 5ABPA 3C3KA 3ROMA 1IN5A 1DEHA 1WUYA 1Y6JA 1YR6A 1NXQA 4TX1A 1Z6ZA 2HLDD 5IK2A 5J9FA 4N0EA 1B0AA 2QZZA 5DNCA 5EE0A 4ZDIA 4ZYYA 1XTBA 4ZQCB 5K3EA 1ODFA 1CZHA 4KAXA 4ZVOA 4BQIA 5HFJA 4CI0B 1Z0SA 1Q3KA 1ZNWA 2AK2A 2FN9A 3WLNA 4E51A 3CVYA 1ILWA 4P4UA 4RTSA 2Q27A 5TDHA 4DMMA 4W9NA 3PYLA 3RT9A 4IRXA 3CZRA 1H9CA 4IMJB 2PUFA 3UANA 2FPGA 3DBHA 2GA8A 2M1ZA 1ZD8A 5KNCA 3D9QX 4NBUA 4EBBA 1KY5A 2TMYA 1RZVA 1GGVA 2GGSA 4PO8A 4UDOA 2BDUA 1ONSA 1P81A 3CLTC 4IHJF 5AVJA 4JHLA 1SIBE 5KVCA 5LKRA 2C0CA 1NVVR 5TS3A 5JNVA 1YI8A 5AM2A 1QG2A 1NN0A 4DE5A 1DMSA 2QEQA 3QLUA 1R88A 1PF7E 3PFNA 3PSAA 2OPBA 3LO5A 4N03A 5KKNB 3IV7A 5D84A 3H65A 5J2TB 4B3BA 3RH0A 1XO1A 3F6YA 1TC2A 1RFLA 3JWPA 1SCAA 4FQ5A 5CEEA 2OO5A 5IC6A 4R6XA 2FGKA 4AO6A 4JBGA 5I9NA 2WPDA 3PJFA 4B3XA 2O5CA 4EWLA 3I2FA 5AK3A 1JSRA 2XCSB 1UBUS 4RHUA 3ETCA 2Z9CA 2ORED 3CRNA 3GPDG 1TMGE 4OXNA 3LC0A 4NBNA 4P4LA 4AF7A 3SE0A 4US2R 5IM4A 3CFYA 1WIWA 3LC7O 3QPWA 4WCVA 4XA8A 2H1WA 2HPZA 2QSUA 2WPNA 3R3YA 1YUNA 2B98A 2ZXFA 4BIMA 2DLDA 1ZNXA 4N6OA 3D43A 4WACA 5JRJA 3D2LA 3M1YA 1I33A 1W85A 4XD7A 4C0KA 4HS9A 1FFEA 1YVRA 1D6NA 4WXYB 1R64A 4OHZA 3CONA 1PWXA 2G08A 3HEAA 3E05A 1RXEA 2V7VA 4MTCA 1BKSB 2JGRA 3AILA 1Q6ZA 2HO4A 4DAOA 3PZBA 1OAOA 4NAUA 4K2AA 1AUQA 4HI0E 1M0EA 1JA1A 1F0YA 5CH5A 2Z1DA 1GFZA 1SIWA 3KZVA 1P8AA 3KD2A 4CU2A 2PGJA 3PPVA 5MF6A 3ET4A 3GJXC 3VU9B 1US8A 5ADWA 3V55A 3W6ZA 2ZCJA 1ISPA 1JFSA 2CXHA 5GINE 4RPCA 2CT8A 2Q4RA 1H1DA 4HNGA 4YNBA 2IVZA 2Q3FA 4NTZA 5KYXA 1ZITA 4YBZA 3D1JA 1NV9A 1ZISA 4HNVA 4LWPA 3U1VA 4MV1A 3NHYA 3UNXA 2GX6A 1R0LA 5IT4A 5KYYA 1GIAA 3QV2A 2ZR0A 5I3CA 5DYWA 4KRFA 2KQUA 1YBFA 1GCUA 1Z5UA 1EFPB 1N25A 3FYUC 3C6XA 1NN5A 3B6EA 2ETVA 1ZK3A 4JKIA 3CEPB 2OGTA 3HACA 1K5PA 4C7BA 2O23A 2QAGC 2V0CA 4K5QA 1KH3A 3AONB 2OFFA 2JGJA 1GLGA 4IEFB 5DE3A 3RK4A 1K63A 1UXJA 1ZNYA 4V0SA 3WXMA 4ZJUA 3OT1B 4JT8A 1KERA 5FRDA 3OLVA 4ZV7A 5DGIA 2QNBA 3FVWA 2Q28A 1R6DA 2B9EA 3H5RA 3PA6A 4G1BA 2RHGB 3T1QA 4HNUA 4WE3A 4ALIA 10MHA 1SQGA 3SDZA 3CRRA 2M1XA 4PSVA 2JFZA 2VKQA 2P4UA 4UAUA 3TDNA 4WCFB 2XA9A 2PGOA 3QMPA 3PR2B 2CNOA 5G1OA 3WP0A 4E5SA 3SVLA 3FUVA 1XP8A 4W7SA 1PZHA 3GN1A 3W34A 1CY2A 4R83A 3C8HA 3QVXA 2QTCA 1P5HA 2JIZA 3M49A 3ZS9A 1TD1A 3A3YA 3BWCA 4IQ0A 4BTVA 3FUWA 2QTTA 4QJ3A 2A94A 4MTLA 3ZKAA 3CRMA 4X65B 3MJHA 2PRZA 1CNEA 4AY3A 5BWOA 4YJ3A 1U3DA 2AWNA 1ID1A 4ECEA 1Z33A 3GLHA 4DANA 4PIVA 1YJBA 2F9FA 2V7EA 3RTBA 5HQJA 3TEJA 2E6UX 3Q41A 4YXWA 4CIDA 3LSTA 1TMOA 3R7NA 2R65A 2JJQA 2X0RA 3O93A 1EX1A 2PEZA 1B43A 4QELA 4ANFA 4AYTA 1TK2A 2YRFA 1ZPDA 3EVFA 3ISVA 4UM8B 5FNVA 3TPCA 4DF3A 3QEJA 1A72A 1CFZA 1QIMA 3KYBA 4WMLA 2AS0A 2BTQA 3LP6A 3NBQA 1QRUA 2PH1A 4AM8A 1LLDA 2OWDA 1M33A 2WJYA 4ZOBA 2O0LA 3ZE0B 2QR2A 1AT1A 3OQOA 1NUSA 1A5AB 2RKOA 4U7TB 4TZKA 1BGWA 2PFSA 3MFYA 6YASA 4PGFA 4EARA 1W5SA 2D7DA 3K1JA 3NIDB 1BYIA 2CLIB 3GHYA 2W2XA 5E7IA 1HRDA 3DWGA 3AKZA 2P2LA 3I64A 4DV6B 2Y1GA 3ORHA 1UCFA 4L02A 4FHEA 1QGAA 2JEZA 2YHAA 2YZNA 3GELA 5ICFA 3PQ2A 4TMKA 4C7OA 2WJAA 3QY0A 1BXRA 2E0IA 2R60A 1C3OA 1JLLA 3ZCPA 3DWEX 4Q3AA 1ZOPA 3G6KA 1JB1A 2OOSA 1CQWA 2I2FA 1YFKA 3HHPA 3RYHB 3RYFB 2AN5A 3OKAA 2W2PA 4OHPA 1ZGZA 4YRFA 3AY3A 1PQUA 3ZWVA 5BQXA 5IKMA 5JDCC 3EVZA 5BW6B 5TF0A 4RH0A 3H8JA 1E9EA 4QUEA 5TV2A 1XPJA 3MS4A 1TCUA 4NFSA 4R5HA 4JXXA 3VU1A 1Q50A 2AFVA 3IOCA 5GIPE 3IEMA 5J1SB 1JBQA 2XTAA 4PF1A 4EZBA 4BNNA 1I1HA 5GVRA 3FCYA 4LHWA 2Q1WA 5DM2A 3CLRD 2VP9A 3K8ZA 5H82A 3JSXA 1FDIA 2WW8A 1C0EA 1BW9B 4DQVA 5T4BA 5DCWA 1FQJA 3PUKA 1PWYE 3RTEA 4QVIA 2UU9B 1RPNA 3JQAA 3O26A 1SKYB 3KYDB 4IDGA 4QT0A 3AJ8A 4U0KA 2PGLA 5JCXA 2G9QA 5JAQA 1AS0A 2C83A 4FS8A 1NOIA 1UIRA 3EZYA 3A25A 2OXRA 1QZXA 2XYHA 3BE5A 3GAFA 3GEMA 4HDNA 4INOA 2J45A 2ZIXA 2FUKA 2FZEA 4I19A 5EKTA 5L3ZA 3WYFA 1DBRA 2W6CX 2Z5VA 1F4LA 4OYLA 1YMUA 3GQBA 2FUNB 4IQGA 1JHZA 1HO3A 5FADA 3DEJA 1KZGB 1T5IA 2ESRA 3H1FA 1G98A 3IPYA 4KQ6A 3UCXA 2HWUA 1VBMA 4R1PA 4M76B 4NMMA 3ZDFA 1KI6B 5EWMA 2RIPA 1E89A 5F5LA 3GLVA 3F9CA 1YCHA 1R6TA 2LPMA 5F4BA 4WCDA 3EMKA 4FX2A 1KO1A 3EC2A 1UT5A 4CMJA 5J4KA 2PR7A 1AK1A 1HGXA 3D3WB 1KMNA 3Q8LA 4QU9A 1ENOA 3CNOA 4GM4A 4HRXA 1R66A 4D56A 1QQTA 2I71A 3P20A 4TT3A 4H0NA 4ZVTA 4AMBA 2YJTD 4M6WB 1RJDA 1XYYA 2HCFA 1A1SA 1WRBA 1IHOA 1OKKA 2BUAA 2Q46A 1LY1A 1W1WA 3L04A 2C2WA 2IF0A 3QUCA 4C3UA 2IDMA 1WNTA 1K7CA 3EIFA 1U7ZA 4M0CA 3GRCA 3N2IA 5DXJA 4BNGA 5AJYA 2J3QA 5JNTA 4X1OA 5J2UA 5FWAA 3VR5D 1Y33E 4ND6A 1QH0A 1CU1A 2GR9A 1NXXA 4ZAGA 1GVNB 4AS2A 2LCIA 2G1KA 3PWTA 4P4NA 3F1LA 3TI9A 1DUIA 1VCNA 2VUIB 4C01A 1ZK1A 5B2ZA 3RCBA 1EVQA 1UKEA 1ULHA 3AY6A 3GJQA 4RKYA 1G63A 1JQ3A 1M5TA 2HWYA 2XE4A 3RAPR 5FLYA 2A88A 1A71A 3PLNA 5FPKA 2I67A 3I8XA 1NRJB 1UQUA 3G2JA 3RG2A 1NHWA 3ZX4A 4C22A 5GJCA 1FOEB 3NTUA 5C8YA 4R1SA 4CV3A 3UWDA 1Z82A 4M87A 1CF2O 5C5CA 1KMQA 1OBCA 2X5XA 5FQNA 1V1MB 2CNBA 2OHOA 4FDUA 2XGSA 4WDQA 1RHMA 1NW3A 2ERXA 2JNWA 2RKWA 4OHWA 1TIKA 3H3FA 4CPDA 1M2OA 1RFGE 1YOVB 1JQDA 4UHDA 3HBJA 1KGDA 2ZWPA 1EG2A 3Q0IA 4CTOA 3BERA 3UY4A 1YAJA 1Z0JA 4PLYA 1BN6A 1IN7A 4M9CA 2FWJA 1N1EA 1CY8A 1O3YA 3H17A 3L4EA 3MN1A 2H7CA 1AH2A 4EP1A 3TH5A 5I7FA 1RXIA 1V9SA 4J94A 4KIFA 3CRZA 2FX3A 1N36B 3MJCA 4C7KA 5HS4A 1QNFA 3FLEA 4N0QA 1D7AA 1OXKB 4MS1A 4N3BA 1P60A 4C7VA 1R8JA 2BEJA 2YZMA 2W58A 4L0QA 4ZCLA 1SU4A 2NPFA 1NXTA 1YGPA 5DP2A 3UMRA 5L45A 1LI7A 3NATA 4C0LA 1TE2A 3NHFA 2R8XA 5KCMA 1VJRA 2PY6A 3LVBA 4DV2B 1SQ0A 2QMEA 1SY7A 3RC9A 3SM3A 4LEIA 1H2ZA 3COVA 3GCZA 3MYYA 2GN9A 5K99A 3PNVA 1IG0A 1ABBA 3IO5A 1XJ5A 3KKEA 3N28A 5L7TA 3BICA 5CLIA 4G6ZA 4C0WA 5TSDA 2ZSBA 1KZYC 1Q15A 2VT3A 3DAGA 3L0BA 4FGKA 2JD1A 2PH5A 3KLPX 4HTAA 4QYMA 3DQZA 4N54A 1P4HA 1QWSA 3F7NA 1USKA 1PT6A 1WP9A 2YNMD 3EIEA 3T5DA 5J2TA 3NKLA 4OKSA 1UXHA 5CT6A 1VC2A 2OD7A 3R74A 4DY4A 3A2NA 3MF4A 3PXAA 3BXZA 3EFOA 2JJ8A 3EK2A 2BD0A 1U9IA 3NEYA 5CM2Z 1R0XA 4RD4A 5J23A 2LGJA 2BR5A 4FBLA 1XDDA 5FX2A 3MQ4A 5FBWB 4BGEA 5DM60 3H3XA 2WKSA 3RABA 1MJ5A 2P5YA 3QJYA 1QVRA 5BQOA 5BV7A 2HQRA 3H1BA 1N3LA 4B79A 4GL2A 2C1EA 1XJWA 1Y7HA 4FOSA 5FR2A 1M1YE 1HQCA 2H2IA 3FMPB 2W6OA 2WTNA 1Q0UA 1QMPA 1UBGA 3GAMA 4IAOA 4PC6A 4RNCA 4TL7A 4IIJB 3ENKA 4XLLA 1YBVA 3N0WA 3PG5A 1UJ6A 1ODIA 3OIUA 3OIVA 3V8MA 4HDOB 3NKFA 4C88A 2W2TA 2EQ5A 1TO1E 3V33A 3JYLA 3FWKA 2Q62A 2KJQA 1VZ2A 3D6NB 3WO0A 2VJMA 3TRJA 4AECA 4LRUA 4U8HA 3D8TA 2QRLA 3R3JA 5ALGA 4ALMA 1OAKA 1MQAA 2WZQA 3R4VA 3S55A 1S8OA 2J9RA 2F64A 2WHQA 2R7NA 5CA0B 1CJCA 3WAJA 5GY7A 2ZJBA 2SICE 3V8PA 5LCXA 2WF8A 3U2QA 1JMKC 1XRRA 5L40A 3W3AD 2IBMA 3KEMA 3OPVA 4Q1AA 3R0XA 4DCTA 5C7YA 2YDYA 1NKVA 2DHEA 4BKRA 3PX7A 5EIFA 3HB5X 4PU0A 3CW9A 1KA9H 2C82A 2GHTA 2GJSA 4RIIA 3V2HA 4G0VA 1U1IA 2HU7A 4JLOA 4QBTA 3WMEA 5D00A 4YLEA 4LJ8A 2I6UA 5F4ZA 1P1CA 1VLMA 3SR3A 4RJKA 1USWA 1XPOA 3NDJA 2PX6A 1OWPA 3HY3A 4CFSA 3DFUA 1HQYE 3Q2KA 4YJFB 2E7ZA 3OQ1A 1QP7A 1K6JA 3KG2A 1MLDA 4IX9A 1A9ZA 2MYUA 2WD7A 3VBCA 5IXSA 1Z7WA 1XNJA 4QULA 1FDTA 1DAPA 4PGHA 3IC5A 5AM0A 4TL6A 4YAGA 3C4JA 3L02A 1ZJ6A 4J4TA 4ZVKA 4HG2A 3I05A 3GBSA 4G0NA 2HWWA 3HU5A 4QYXA 3WSWA 3LS2A 1P45A 3WLKX 3EULA 1NTOA 3MGGA 4TMYA 4EUKA 4FFRA 5G2OA 5I4KA 3BILA 5TGZA 3EQ6A 1MB2A 1UFVA 2FW9A 2XQIA 4G5OA 5F21A 4HQNA 3NBZC 4PLGA 5FORA 2N0SA 4U00A 1OTYA 1O87A 4IOKA 5KU1A 3CF4A 3FMFA 1YB2A 4WVFA 5AJUA 2VJYA 4JP2A 3UHPA 3FA2A 4TUYB 3UV3A 4C43A 5CLJA 4CKBB 3RAFC 3AVYA 2BGKA 2JJMA 3STTA 2JAOA 3BJEA 3O5AA 3QNMA 1Y8ZA 5GJWC 1GTRA 5H0IA 4ZK6A 2C2GA 2MSLA 2BBTA 5M5BA 4UXIA 2P4EA 2C31A 5KINB 4YDHB 5LMNB 1K08A 1U0SY 4UUMA 3DFIA 5ILQA 2I3ZA 3UHOA 4DIKA 4YCSA 5KPDA 1E62A 4UREA 1WZCA 4WOBA 4GI3A 4Y0VA 3W79A 1XJQA 1BQ4A 3AJEA 5C1IA 2ZIEA 5A7FA 1DIRA 1OZ0A 1E1KA 2DTEA 3QI2A 5B53A 1T8WA 5FDFA 1UF9A 1WBJB 4BO9A 2QLNA 3F74A 4AROA 2XDYA 1Z5OA 3E84A 1H23A 3K8YA 2FPWA 2VH5R 3FE2A 5E9WA 2AE1A 3NH6A 3EUAA 1U2SA 2W6JA 2ZJ7A 3D0OA 4NV1A 5IYZF 3QEKA 4A8TA 4CU5A 1CQXA 3ZD6A 3OCXA 2VUTA 3T34A 2HQ1A 2Q6LA 3DHYA 2EU8A 3VHXB 5K0CA 2M6LA 1Y3CE 5K8CA 1BA3A 4X00A 1LPMA 3Q85A 5AKXA 1KJ8A 2OMEA 3NBUA 5G3ZA 3IULA 1FMFA 2DUUA 2HLNA 4EHFA 1PX2A 2QAGB 1MAVA 1WDWB 3KKNA 2PEYA 4IHKA 4GICA 5F3RA 1G9TA 5TPZD 3AI3A 4CYMA 2AQ8A 2IKSA 4MHTA 2WSMA 3RS0A 2FPXA 4M7OA 3V1MA 1LWNA 1PZGA 5HUJA 4AJNA 4JNCA 1OI4A 4PWYA 4TQUS 3GI1A 2NM0A 4CNQA 1F2TA 1S9HA 2J6CA 3BJZA 3LHKA 4EW3A 5BN3A 5KYTA 3T35A 4IEIA 3L05A 2OESA 3GRFA 4HDQB 3PJGA 4FJ0A 3PR3A 4O8ZA 1BWPA 4X6XA 5DHFA 3FDXA 5BW4A 3ELDA 3WKAA 2GD2A 1IEXA 3S68A 3O38A 3U7RA 1F7VA 1Y7IA 3IEKA 4YRAA 3E82A 2WNIA 4PRZA 1HNNA 4LPKA 4OI2A 2PMEA 1T9GS 2ASEA 4P4GA 4AG3A 1MVLA 2DH6A 2NYRA 3GLFB 3EIQA 1DT3A 2UXCB 1Z6TA 4FYVA 3KOZA 2H1VA 3UT5B 3X1WA 5D5PA 4EYOA 1R27A 4QWWA 5C37A 4KRGA 5LWHA 1F6BA 5D1NA 4JD5A 3FYHA 4A4DA 5U9CA 5K6AC 2PH7A 3VTAA 3W5JA 1TF7A 2A59A 3W8RA 4HATA 2GZSA 3OCJA 1G7CA 3C41J 3I9NA 4M88A 3AKCA 2WIAA 4I4TA 4J1TC 4LJYA 1SXGA 4WERA 4XIJA 1T43A 4CWAA 2C2MA 3PEEA 3GLIE 2X3UA 4OYYA 2P6NA 1XAHA 1HYEA 4X9XA 3BGIA 2VNAA 3KSAC 5K0SA 1A77A 4I5IA 5T8KA 3O3NB 2GWHA 1UMBA 4ECAA 5CGQB 5LZ5A 3UW1A 2WLTA 4NCHA 2JIPA 4Z3OA 1V37A 3S81A 2X77A 3K9QO 4RMHA 3P52A 4H35A 4IXDA 3W2FA 4MB6A 4DC1A 3F6PA 4LX8A 3MTIA 4Y98A 1GQRA 2FUG1 5HIJA 4QOJA 1M34B 2RHRA 1PIWA 4NU6A 4RWZA 5DBIA 5ECGC 4B0OA 3U61B 3PHLA 4GOOD 4EJSC 5K20A 3GB9A 1RRMA 1VMIA 2ONJA 2WKRA 4KOEC 3IQDB 1RYMA 4Q1CA 4EF5A 4BY9E 5GGXA 1H4SA 4EENA 3K0SA 5EZQA 1BOOA 1RW4A 2FEXA 2JH3A 2W2KB 3B52X 3H87A 2I8AA 5FUMA 3L4BC 5JJKA 1T26A 4RAQA 1ID8A 3DEAA 3OHPA 2WVJA 3L9XA 3BFVA 3H84A 4YWJA 2FP3A 4H60A 4M7PA 4O4JF 1OBVA 4EG8A 2FOIA 1JDPA 2QDKA 4PRYA 3TL6A 3ZIDA 1Y6ZA 3UJ8A 4DRYA 1GGEA 2GPYA 2Z98A 3UBTA 3VPCA 1JEYB 1V8PA 5DLEA 4XYMA 3ZU2A 5CFQA 1DADA 4DADA 4DUGD 2DFNA 1ISRA 5DPMA 2OGSA 4RCZA 2HT1A 4XD2A 1UZNA 4H15A 2GPBA 1D4AA 5JDCA 4IHAA 2I1VB 3KPUA 4G36A 1FNNA 4ND2A 1PK8A 3QIVA 1CRWG 1A8QA 4LJ6A 5GONB 3PUIA 4NLLA 2NTJA 2WAAA 3O4JA 4ZYLA 2OAQ1 4MZXA 4G67A 1I7QB 4D26A 2DG2A 5DNYB 3TR0A 2OV3A 1Z8FA 4EABA 3O8RA 2WJHA 3S2UA 4FHGA 3ROGA 5CVTA 1AZTA 1T8SA 1UC8A 2IDKA 2P1ZA 1AOXA 2D5IA 2VYND 4FT2A 3UMBA 1FU8A 3KAKA 3ZWNA 3IQHX 2DHRA 5HRCA 5I47A 3JQ8A 3NTXA 4PZ9A 5HMLA 3FTDA 4A91A 1Y5MA 3U60B 3OQVA 4FHZA 2C7GA 2DLCX 3I9LA 1DLIA 5A9TA 5ESXA 5FAXA 4BASA 1TLTA 4HNAB 3HUEA 3ML1A 3AUYA 3ND8A 4WIAA 5EEGA 4WBSA 3FFXA 3GVHA 2XCTB 4OPMA 4EGFA 3ECAA 4FJ1A 1ADGA 2GAJA 2ZAGA 3FZGA 3CSUA 4OSOA 5DCLA 4OI0A 1ZLYA 2GH1A 4XX0A 3SDBA 1BVRA 3I39X 4JODA 3UWSA 4OLFA 5GV7A 3ZW8A 3TBHA 4REQA 1K8ZB 2C2YA 2J0UB 5CDSA 4FDLA 3F6RA 3VTKA 2XWJI 4BRUA 4CQLB 2AB0A 5CNJA 1DZIA 3PUWA 4KJXA 4YAIA 3A0UA 5JXHA 2EGUA 1XE3A 2IQ5A 2XUGA 1LPPA 3CRVA 3KYIB 5COBA 2X0EA 3ZQ6A 4YR7A 2OV4A 1ECFA 4WZBE 4C6RA 4D0SA 4GX5A 4PLWA 3M6MD 4R81A 3S8EA 3PFCA 2QW0X 1GZUA 1C1DA 1L3IA 4R9VA 1WETA 5LJLA 2VJDA 5F3DA 1FJXA 1RYZA 4BAZA 3HZZA 5CPBA 2DHCA 2XAAA 2ADMA 1TRHA 1JKXA 3GZTB 3I2HA 1R0ZA 2OZKA 3JAWB 4Y0AA 3O8BA 1SCDA 3AR5A 2CMKA 2WY2D 3ST7A 2DR2A 4QPNA 2HPHA 2WINI 1MB9A 3EASA 3EZGA 4FTWA 2R8EA 5B1DA 5IFLA 3GFBA 3F3KA 4JJEA 3U7EB 4OMCA 3ZK8A 4AKEA 4DLRA 3C0KA 3RQIA 1NX9A 2ZJZA 4B4DA 4ER5A 3MLAA 3NFYA 3EPJA 2DUWA 1G4UR 4YT8A 3IJ5A 2KLHA 5JECA 1BIFA 3AX6A 1FLNA 1RCTE 4X20A 3KETA 1WY5A 3MWJA 4EMSA 4EUNA 3U7GA 1Z12A 1V95A 2IRWA 2PSHA 3DHEA 1C8BA 2A5GA 3L92A 4ZZIA 4LJKA 3WYAA 2PYZA 2VP5A 4IH9A 2O4CA 1QQ5A 5I6DA 5CNMA 3P9SA 4D5EA 5LLTA 3N9IA 4ESOA 2FW7A 3LL4A 1R3DA 5COAA 2HY7A 1Z5ZA 5EJ9A 2W6JD 1H8HD 3L4KA 1ZHFA 2JCVA 2JIMA 2D1YA 1YKSA 2L19A 4MCHA 4OI1A 2IZ5A 5IAGA 1PLJA 3FM9A 3MWDB 1N4AA 2AC2A 4J0CA 3WBFA 4CF5A 2WNSA 3NYIA 1RZRD 1DQRA 1M8KA 2H2AA 5FNVB 1EK6A 4BV9A 1FVFA 2ZCUA 5C1PA 1VE9A 4M37A 2OHVA 4YMGA 1KC3A 2ZJ2A 2JVIA 2FJUA 3HCCA 5L3SA 1TI7A 3C8MA 1LVGA 4XASA 1Z39A 3D2AA 4JL5A 1SQFA 5TB5A 5HDQA 2C94A 3BH0A 4GH5A 3TKLA 4BMDA 3K6SB 1MZVA 2IYXA 4LZAA 2JCYA 3K6JA 1J0XO 2EQBA 4G2TA 4C2BA 4ZJZA 1A5BB 5SZHB 3H6GA 4LTMA 1XF9A 1KS2A 4RKEA 1USVA 2I2AA 2OHGA 4W5TA 1QUFA 1G18A 1UAYA 2B5OA 2J09A 3ZOZA 1KWGA 1U0GA 2I6XA 2Z5LA 2YXDA 4R9RA 5FTLA 1CUZA 3I0MA 5TE9A 4BNJA 2CNDA 1MJFA 4G41A 3N76A 4AYXA 2Y77A 3DB2A 3S2ZA 1EFKA 4EGAA 5CBPB 1G2PA 4KPUB 3PQ7A 4H4DA 3K53A 3AJDA 2JLWA 3FZNA 3HDVA 1AXEA 3ZCVA 3HFJA 4A73A 1CEQA 3SAJA 1JECA 2NAPA 1ADJA 2BCJQ 2XIQA 1CZLA 1T36B 3LNCA 2R6ZA 2IEBA 2ZRPA 3LKVA 4IIXA 5ALDA 1GZSA 3E7DA 4EA9A 1PJBA 2HA6A 2E4ZA 4PZDA 1TEVA 3UJPA 4ZDJA 2DVMA 1RC0A 1TVKB 2XOXA 4CDMA 5KNBD 2QJOA 2RD2A 3W3AA 2G8NA 1P2TA 1LDGA 4H6VA 4MRVA 4CG1A 4DLLA 1G5PA 2CKMA 4NE7A 2R1UA 5DISB 4NYIR 3X1JA 2BH9A 3O82A 4MDYA 4V0OA 4P34A 5EXDA 1EWVA 1PZXA 2JCBA 1DG1G 3M5CA 3T9BA 4EKGA 3M5WA 1EZ1A 4RANA 3T61A 3ZC3A 5A2QA 4PTZA 2JI8A 4ZOLF 3RD5A 3AJRA 3K7EA 4EPYA 2YR0A 3P5SA 3FNGA 3VR4H 4UEWA 4C29A 3AIKA 4W5JA 1IUNA 2EFEB 2J3EA 5DHTA 4KRYA 1N9KA 1BS9A 3E53A 3K16A 2HIGA 3RSLA 1JI3A 3V4FA 2PX2A 2O8DB 3WISA 3LY9A 1YK1A 4TUYF 1PG0A 3OTIA 1LJLA 5F9FA 3WWEA 2W4IA 1RNLA 1Z6PA 3A10A 1N9ZA 4FQ8A 4YJGA 2WAOA 2I78A 4DLPA 3FMVA 4EHAA 2C9CA 1SCIA 4UBJA 3B36A 2C4TA 2ZUDA 5JAUA 4BO8A 4BKPA 2V9ZA 2JK1A 2OBBA 3CH4B 2KBFA 3CKKA 2EFCB 4W5RA 3DE7X 4RYLA 3L6DA 3WZ2A 4NI5A 1BXGA 2H85A 1NVXQ 5BN5B 4AD8A 2C07A 5M34A 1YQQA 2JC3A 3QBTA 4N5HX 1PGJA 1L7PA 4XYBA 2OHJA 1OW3B 4L28A 4EPWA 1VA5A 2PZ8A 5B58T 1BVYF 2W71A 2H51A 1S1MA 2FE1A 1TFUA 4HWGA 3LC2O 2XV1A 1E3DA 2C96A 4PC2A 2D1QA 4RNDB 4JQYA 3CEHA 1T5SA 1WL8A 1Z0FA 4UFOA 1LV8A 1TXGA 3N7AA 3ZWDA 3BTOA 4TKVA 5AKHA 1OBOA 1GTG1 3G0HA 3GPBA 3HABA 4B4OA 4CM9D 3WL6A 3DV2A 4EDHA 3ZGZA 3DKIA 2WT9A 3O4FA 1FX0B 1V1JA 1X1SA 1YTLA 3BA1A 3HDYA 3LIPA 4K3VA 2VO1A 3KCNA 1P0CA 3TXAA 3S2GA 3ODPA 4TV8B 2UDPA 3R5TA 3SWWA 2FDCA 2XWQA 3QPVA 2MSCB 4ZT5A 3SBXA 3BK7A 2ZBRA 3I01M 2HEGA 3U4IA 2YW9A 2O8DA 1WZIA 1POXA 2XDAA 2B0CA 3M4XA 5EJ6A 1GPUA 2E89A 1E5XA 4A2QA 5A3JA 2PR2A 3GAZA 1CX9B 2H5LA 1QFYA 4WADA 2WP8J 3ORYA 1JU3A 4BV3A 1QQBA 4ZT7A 4YIKA 5DI3B 3N59A 2IELA 3EWIA 4NZZA 4DTIA 5C9ZA 2AQKA 3COYA 1XLWA 4MPJA 1EXDA 1N5DA 1QRRA 1KI6A 5EWMB 1VIYA 2D7CA 3PEWA 3AIMA 3PI6A 3VHXA 5ITSA 3Q0TA 5EQJB 5J5CA 2AZMA 5KTSA 1JG1A 3UVEA 5JIBA 2OCIA 2QUZA 5F1PA 4MKIA 5L4LA 4GP6A 2P9QA 4WK2B 1PAUA 2JGDB 2QG4A 4XIGS 1NMSA 1GRQA 1NJ6A 5GM1A 1IJKA 1JH9A 3IX7A 1YFLA 5L7WA 3HN2A 4BFVA 5J4HA 5H8WA 2DM6A 1CUWA 3L01A 3MGCA 1YZHA 1UJCA 4QUJA 5KHOC 6AT1A 5HQ3A 5LP6C 4ZHQF 4YALA 4QT4A 3DOHA 4Y7DA 3LXRA 1EEHA 4XGKA 2VKTA 1IWOA 2Q5CA 3PD7A 4R2HA 5LU9A 1E7YA 3I42A 3WWOA 4N7MA 1VPTA 1XDWA 4F6RA 1XB2A 4POOA 4YWHA 1ZDMA 2ZSDA 2QN1A 3DNPA 4RJ2A 3P9YA 5LVAA 1E9CA 1QH8B 2GPTA 3VHLB 3L7CA 3KTDA 3LF1A 5DM4A 3V2UA 3QW2A 3LGXA 2VEDA 1QF9A 1ENPA 2H07A 2JJ1A 3FWNA 3KWLA 4OGFA 4E11A 1RJ9B 1OX4B 2V6FA 1WCIA 1O95C 1HV8A 1QPBA 1RQGA 4DC0A 3RYCB 2JW5A 1YIDA 2AFIB 8ABPA 1JFFA 3ANSA 3GLGA 1SVIA 1OTHA 4LY3A 4NH0A 1YL5A 2C9OA 1XQVA 1UBLS 1RLIA 2VJAA 2WU0A 3T3PB 1WBBA 3CUWA 1VFNA 3HDGA 5M2QA 4MCAA 3RVQA 4U5QA 3DZCA 5L4SA 3OE4A 4XUDA 5F35A 3LUJA 4YRRA 3SC2A 1XTVA 1YR7A 4I9NA 2GVZC 5BOSB 1IZYA 2VPWA 4QOSA 3S70A 4WJKB 2O6HA 1ZCFA 4TSFD 1E1QA 3KT0A 1T9DA 2BONA 2HWKA 5EIOA 3RJZA 1IQ0A 1UBMS 2RB5A 3DE3X 3OI7A 3HXLA 1K5GA 2EW1A 1ZIDA 1E6EA 4L95C 4NCNA 4QUDA 4B7ZA 1CEXA 4ROTA 4LCBA 4YP0A 4ZYVA 3NMUF 4G0MA 1N6KA 1Q14A 2PT9A 1DBPA 2QX7A 3ZDCA 1YUBA 1FEZA 1WXFA 3LC1O 3E35A 4FI3C 4YCNA 2VH2A 4DJDC 4JBNA 5D3QA 3AUUA 5TIIA 4NG4A 1HEIA 5ALMA 3THRA 3M1LA 2IYLD 3B2NA 4KL8S 3UPDA 2IE8A 1Q0HA 4XCVA 3U4QB 2A7XA 2P4HX 4FNAA 4H1HA 1HYHA 1I9CA 2E3JA 1E4VA 3QTLA 3ADBA 3URMA 2JHCA 1R5BA 1W5AA 3GCDA 5BW5A 1X77A 1C9DB 2C4UA 3QOFA 2BFDA 3I0ZA 2QWXA 2AWOA 4BJ6A 3IO3A 5AW1A 1OLSB 2JPDA 1W6UA 1AQLA 5EE3A 5BPFA 1G21E 3Q3HA 1PUJA 2GN8A 3ZY4A 2J4FA 1OB2A 3D4LA 2BMJA 4YRQA 2BMWA 1PE0A 3CQ9A 2WD9A 1F60A 1IDOA 5JSZB 1WW8A 1W87A 1K8QA 2FHPA 3LCRA 1ORVA 5TQ0B 2BP7A 3B7WA 1MIHA 1E9DA 4R0VA 3AIOA 1F4VA 5HYVA 3ZD7A 4Q21A 1QFJA 2NQTA 3G5MA 2IOFA 4D9FA 1Y3IA 1NW9B 3TJMA 1UEJA 1QCYA 2FR8A 2RGEA 4BMZA 1UZLA 3A27A 3ME5A 4BVLA 3G2MA 4XUEA 2WMYA 2E2WA 2G09A 4GLBA 2WWGA 2Z2JA 2IPAB 4PZEA 2UXDB 3BE8A 2ECKA 3CW8X 1VB5A 2ZEJA 4OXXA 3ZXIA 4PICA 2EIHA 1XRJA 1YJ5A 1JR3A 1KQOA 1R0SA 5KAPA 2PV0A 4C3VA 5BWMA 4EG1A 1OHHD 3EXIA 3KOXA 3BL5A 3M1AA 3NC4A 5CH8A 2W11A 3OBBA 5BWNA 3BXHA 3MB5A 5JWRA 4EHKA 3L8ZA 1FJHA 4HYTA 3TMAA 3W5IA 2CMFA 2OV1A 2JFQA 4Y2VA 1PNQA 3K70D 2LCFA 2P9JA 3CNLA 1X1RA 1ESEA 2RH9B 3JQPA 1GRVA 1T0HB 4KHZA 2CHVA 2BE7A 3S2FA 4ERNA 2WVAA 2NU9A 1EVJA 1Q1GA 4LXTA 4XWGA 3AB7A 4Y1EA 1C3EA 4TV8A 2PE5A 4PGAA 1INLA 2J3JA 2Q0XA 1YE3A 3LFHA 4KR3A 3NHLA 1J8FA 1PUIA 3ZQUA 1C2TA 1E3SA 4HWPA 2YMPA 1EBBA 2YXPX 4J7UA 3ZDEA 3BE4A 3P9CA 3CPEA 3JALB 2IL1A 3CLVA 5JBQA 1E1LA 3IOEA 4NEGA 5HXAA 3JWHA 4YASA 3E2IA 3NDIA 4P2GA 1X7ZB 4XDYA 3MWYW 4HDSB 2PIDA 5E4YA 1JFRA 2YASA 2X8AA 4YRJA 1BXZA 3EFHA 5K6RA 4X94A 1X2BA 3QX7A 3KJNA 3NVMB 4LHSA 4PAOA 3RR2A 5CP8A 3G17A 3UMCA 3SKVA 1JEJA 2JCXA 2BFEA 4A23A 4KXYA 1Y98A 3FUXA 1IEVA 5CK5A 2R47A 3LQ2A 1I2BA 2JCGA 3D6VA 4RS4A 4ATNA 3RTCA 2IS1A 5ALNA 2R0QC 4CNBA 1ZUHA 3TTSA 2BJWA 4D98A 5HF5A 4OQMA 3ZQJA 4PSKA 1UK9A 3CTPA 4HWOA 1QV7A 3HUDA 2CF5A 1OI2A 2QGNA 5IKEA 3PHJA 3K2QA 4LYDA 1V39A 4X7PA 2ZFUA 3I0NA 4QSMA 1C0LA 1N2BA 1W9HA 1XMPA 1UWVA 4FFNA 4G25A 4GYJA 5DHQA 3WJ2A 4EUSA 5C53B 5FJJA 4M9XA 3KZ1E 2QHXA 4DSAA 5FP0A 2NO0A 3X2SA 1TVEA 2H2HA 1E1DA 2ZIAA 3O2SB 3QNWA 3P9PA 4UM9D 2CFTA 1W36C 3T3DA 4Z6KA 5IVKA 2XMSA 1GQFA 2VSYA 3EEFA 1QZ3A 4QOEA 4Y9RA 3R5KA 1TTTA 3CX8A 4FZVA 3VVBA 3LQRA 3HJTA 1F14A 1OWOA 1VSVA 1V7ZA 4TKUA 1V9CA 1P5ZB 1ZJ5A 2EKQA 2ZJYA 3JZIA 3KJQA 3QKSA 4X95A 2I6GA 1J7KA 1AGRA 2HN9A 4IOLA 4M0FA 3T0FA 7GPBA 1A9YA 3DDHA 4J29A 1XU9A 3GPCA 4WK6A 1Q44A 4EY4A 1DCKA 4FZ3A 2ZS9A 1H5QA 4E7OA 2PRSA 1QU2A 4KGVA 4TVSA 3S2IA 4GOLD 5E1BA 1E3EA 1CUCA 3HQ4O 2F2TA 1UR5A 1H0KA 3H8VA 3MYRA 5CK4A 1PD0A 5BQ5A 4BLWA 3T1OA 3TZEA 5J2UF 3ROEA 2KHZA 1IH8A 1SVKA 4M49A 5TS2A 4I2NA 4LJ4A 3ISTA 4UE2A 3ZY2A 5ULLA 1SM4A 1EP3B 1YC2A 2RBEA 3TSOA 3DLIA 4NR0A 4FS3A 3HUFA 2OBXA 2DTXA 3EXEB 1UFQA 3QHAA 1J25A 2ZYWX 4TTIA 3OX3A 4N5MA 4I4CA 3LOPA 2FPIB 3GU3A 3ADDA 4MPPA 3X2FA 3MCVA 3OMLA 1B6GA 1CJBA 3KFXA 2HADA 4PX9A 5HIMA 5JCJA 5LP1A 3ZN2A 4E4YA 4P58A 1T4DA 2JLRA 4BVHA 1FTNA 1SHLA 3N2YA 1T8RA 3B1KA 3LJKA 3GXBA 3CR3C 2XUZA 2ZM6B 3AQ4A 3LBYA 4N82A 5AOVA 1JIJA 4KJZA 5BR7A 4TV8F 2ET6A 1O6BA 5LP6A 3OQHA 5C8YB 1XDBA 4HAIA 4LGYA 3HU1A 3TGPA 2W9XA 4ODIA 5REQB 4DNXA 4AT1A 5H83A 1FUEA 3DR5A 4IQ4A 5E9QA 2MU1A 1O4VA 4Z9AA 3CR7A 4HDNB 4MARA 3V1YA 1P0MA 1OXSC 1W44A 2BGMA 5CB6A 2IHBA 2VA9A 2XYRA 4LNAA 1NR5A 4M0MA 3IHLA 5FI0B 5ITWA 2QE6A 3EZ7A 3MUEA 4ILKA 1KDTA 1MD9A 4JU9A 5IEBA 3K2IA 1NYTA 1XTUA 1VKRA 1RHKA 5KS2A 2PSFA 3AZOA 3JWJA 2H0QA 2EEPA 3ZEIA 5I7EA 2HMAA 2DQYA 1N7JA 2AMVA 2R8OA 4PYOA 2HFJA 3B20A 4NZ9A 1IBRA 5JSZA 3IIMA 4AK9A 3T7KA 4F7WA 3AK4A 1YU9A 13PKA 3M3HA 4RJIA 3N6XA 3NONA 2AX3A 2DUJA 1IM5A 2K4MA 2VHWA 3H2ZA 4RORA 5ELMA 3S99A 2XTMA 1MUUA 5AKZA 1U31A 1QO7A 3SHVA 2Z6QA 2E87A 1IPFA 2FFQA 2ZIVB 1C0PA 3KU4A 5FPYA 1JSLA 2CDCA 3MOIA 3TFOA 1OZAA 1O6GA 2JGKA 5C8YF 2H06A 3W5VA 1HETA 4ESEA 2Q3BA 3L06A 3C5WP 2RHHA 3E5RA 2FETA 3LM8A 4IO0A 5J2TF 4DREA 7YASA 1NVUQ 2MSDB 5EJ4A 2JIRA 3ACBA 4MO9A 4YGXB 2ORWA 5ERYA 3SVZA 1BS2A 2X1LA 1RQRA 1P1KA 3FOWA 4S3MA 3ZGYA 4EJ0A 4B8YA 1JDBC 4I8IA 4GKAA 4HLDA 4JS0A 4MWDA 1G7RA 3I5XA 2CK3A 4JP5A 2ZB4A 5JCPA 4JDPA 4YJFA 4R1MA 3G5UA 3B85A 2OHHA 2C3UA 2YHSA 3NJRA 1X8LA 1SG0A 3LU1A 4AMVA 4CMGA 4DUZB 2HCJB 1JL3A 1I4TD 5CW1A 4ZK2A 2YV2A 3STHA 3OWXA 3P2OA 2Z2ZA 4OHKA 4UVHA 4JEHA 2CDNA 2CHQA 2G9RA 3KYDA 2QTWB 1IM8A 2IXAA 1B14A 3QE4A 1QSGA 3AETA 3GZNB 5IYZB 1YFJA 2BBWA 3R0IA 2JHFA 2O1WA 1RWNA 2HBRA 2OKCA 1AV6A 3SXUA 4XX0B 2EJBA 1MC5A 3RIYA 3R1IA 2FX5A 5IKPA 4JLSA 3JVIA 4Y2RA 3E58A 1DP4A 1M8FA 1Q11A 4G63A 5CFRA 2WHPB 1JA0A 1X0XA 3CLSD 3S1LA 5AXDA 1VJTA 2GXUA 3AZQA 3BOSA 3OKPA 3UJ7A 4QHYA 3QBJA 1A97A 5CCBA 1N5OX 5P21A 1B1CA 5B64A 4PC3A 2I99A 2XPCA 4HJXA 1IK6A 1H8ED 5JNWA 1TM5E 1Y1QA 3QI7A 4Q9NA 1R50A 4UZEA 2Q3HA 1I3NA 1M6NA 1PNVA 2A5FA 3L1KA 4KQ2A 3ZXUB 3ETEA 1PJTA 3PK0A 1XZFA 4EQ6A 3WJ7A 2HF7A 3JAWA 2YWJA 1J2YA 3COPA 4EMTA 1I1NA 1PVDA 1XCJA 1XMJA 1DJQA 2PMFA 4ND1A 3ZWYA 1E6WA 3I8SA 1O0BA 1HNZB 2BKEA 3B1FA 3SNHA 1H93A 1Y3HA 2C5LA 3D7SA 3LCUA 1P31A 1U0TA 2IYVA 2CEAA 3A4VA 1GL6A 4IGEA 4URVR 2WNHA 1KVQA 3DHVA 2WQ7A 3ECSA 1Z5NA 3S5UA 2QL5A 2Q4OA 5FI1B 4GDMA 2BKUA 4CV0A 2WJVA 1SRRA 4LWZA 5JY6A 3SBEA 1AGPA 5EP1A 2ZRLA 1DKQA 3ZE7A 3NB0A 4HEQA 3WV4A 4RUKA 3A9WA 4PM4A 4PPGA 4X0EA 4X97A 3LWNA 3NVAA 4Q4JB 1PZEA 4DV5B 1YOVA 4Z2AA 2LP4Y 2JLCA 4JGIA 1GHTA 1X9HA 4DOMA 4G9BA 4BS9A 1FU7A 4ENVA 2OILA 3AP2A 1TYBE 1EE2A 1NQ5A 2NU8A 3RVMA 1YE5A 3ZZ0A 1V16A 2W2NA 1QCDA 4GMKA 3MG9A 5BV0A 4Q1BA 4C08A 1A7UA 1J6UA 3O75A 3W9SA 4QEDA 1QHHA 4JXJA 5AK0A 1ZCJA 4PX5A 4XWAA 3TLBA 3QK7A 4I8DA 2WMNB 2ZDQA 5A5VA 3KQLA 1NYRA 1P6XA 1ZO8A 2NOAA 1EB9A 3N75A 5FR1A 5H1YA 1QP8A 3EVGA 3ADCA 5IBCA 1G8JA 2BIFA 2V7WA 4QUAA 1YB4A 3DAHA 1Z17A 4XJVA 4F3KA 5DH9A 2PM8A 3RROA 2FWNA 1F5SA 4MQ6A 1KI3A 1TEHA 3A6LA 5F7JA 3BK2A 3U7JA 4MWTA 4KITB 3U4AA 5J4VA 3ZHQA 1VL2A 2GJ9A 2WSSD 4K2HA 4UBIA 4W7IA 1HZZA 3BWXA 4FFLA 1XA3A 2CFIA 3BWEA 4MSUA 4NY1A 3ACCA 4LNUA 2HA0A 4LHEA 4Y1RB 1K27A 3I6ZA 3L8FA 1FMCA 1M2VB 3ZQ4A 4PAQA 1COWD 1V4BA 1QHHB 3QBVA 1L6IA 4A16A 1G8FA 3FNEA 1CDDA 1IXZA 1MFPA 1J2JA 3BCHA 3UYLA 3VKWA 5CTAA 3AHIA 3ZBUA 4E3ZA 3HRHA 3MT8A 3RRZA 1KFJB 4K9PA 4CMCA 3GUYA 2CMHA 4AKIA 4OFXA 2XNDA 2ZRDA 3ZJUA 3OIDA 5EE1A 3NHRA 2Q6TA 1N3IA 4WZZA 2N42A 1GUZA 2RGBA 2TMDA 3AYZB 1V6SA 1T6NA 3X1ZA 3G8AA 2ID4A 4M0PA 2HGSA 5IULC 3DJYA 3GJ5A 3MVEA 1X1QA 4ZD6A 4UJ3A 1SPXA 3E2PA 3H3JA 2A1TS 2Z09A 1N0HA 5IAJA 1QKIA 2IIVA 4CJXA 5LQMA 3QFHA 4YUYA 1ZN7A 2NO1A 4IJQA 2Y0PA 4LBYA 2VAMA 4QPZA 4ESVA 4MPTA 1RAFA 4OJQA 3K1AA 2DJIA 1YQ9A 2D0PB 1WOYA 3KVVA 1ZA2A 1R74A 5BR8B 3KZNA 3TLMA 1N6LA 2B5WA 4ALKA 2B1IA 1J07A 2G0NA 2J9FB 1W4ZA 2P2GA 1WUHS 2EKZA 3ADOA 3F96A 1IHXA 2C57A 2ZTLA 1NF2A 3INYA 2DBVO 4UOEA 1NG9A 4RHYA 3EVNA 3LX8A 1EEXB 2XUPA 2VHCA 3IMFA 3LVFO 2OBNA 2NVWA 4GP9A 2BEVB 1BWSA 1WXDA 1D9ZA 3T1HB 1WMFA 4O33A 1UXKA 3I4CA 4ZOLA 3R7AA 4R71A 2LXNA 2WJPA 2O0HA 3ZLUA 2IXGA 4Y6OA 4JLMA 2FTKE 2WM9B 4V0MA 5DSZA 5A1TA 5JANA 1KU6A 2X76A 2QM8A 4L15A 4XQ9A 1QAMA 4F3CA 1DE0A 3FVRA 5AI9A 3QE9Y 3EQ7A 1P0FA 1V0JA 4M0UA 3TSZA 3ZGLA 3T52A 3GD5A 4D79A 3FPSA 1JHAA 4FP9A 2J5XA 3LZ6A 5IAEA 4AXBA 5F98A 4BV2A 1XQ1A 2P6UA 3W7VA 1MG5A 2HCBA 1JQLB 2F3QA 3I09A 4DCGA 3BBLA 4B32A 2QP3A 3R0JA 3VPDA 5IDWA 1GSHA 1QX3A 2XDWA 3ILSA 1XA4A 2B4RO 1QRAA 3T1YB 3ZI7A 1ZL2A 3L2OB 3PIDA 2LKDA 3UQZA 1EFCA 3NVKI 5A0VA 5DW0A 4MQ4A 1JIQA 2YHIA 3A9UA 3QXCA 2PFKA 2QRKA 4IJ5A 3WYDA 5CVUA 1JW9B 1ODKA 2BKAA 2FPSA 2FFRA 5AP9A 1U9YA 3HJHA 3QMMA 4TS1A 5KWEA 4B6FA 2KBEA 4J07A 4RFSB 5CM8B 3B51X 2GPJA 2REQB 2ICAA 3OOYA 1KQNA 3A6FA 5AK4A 5ER9A 2GCNA 3FZEA 4V1CI 4ZVRA 4K9QA 1WZ2A 1SZCA 2QIPA 1BE6A 3CWZA 1NBME 1RHUA 1L8LA 4YB8A 3AXSA 5FFFA 1PP4A 3CZAA 4QVKA 3LP5A 3MBIA 3MS2A 3ZKWB 3LYHA 5KU7A 4W8GA 1M66A 5EUQB 3DD5A 3F9IA 1B6RA 4GR9A 3HSKA 4ZOLB 1BZYA 4DLSA 2G1PA 3I04M 2NU7B 3HKEA 4DPKA 4AJ1A 3FNHA 3W8EA 4EYQA 4GS5A 3E8XA 4CKZA 3SFTA 4AW9A 3U39A 1GZ5A 4Z1OA 1X1CA 5CNIA 4RVHA 1JKIA 4EB3A 2DP4E 3D5TA 2LWIA 3OWOA 3DXZA 4B40A 2ZRNA 1ULBA 3KSMA 3EPRA 3R20A 4UASA 3E3MA 1CY7A 3TSCA 1UBKS 4NICA 4GIBA 5EUMA 2J9ZB 2PX4A 2EVWX 5A0TA 2EWVA 3KKOA 1PT5A 3L1IA 4YN3A 3BXEA 2Q7OE 2VTVA 2OBYA 2J8ZA 2GZ1A 1DI0A 1NU6A 3B3JA 2FR1A 4JJKA 3SYNA 4YCCA 3DHNA 4I6EA 3BWYA 3L0SA 4D8VA 1OV6A 1XJCA 4B7AA 3KM0A 1WMSA 2VUUA 3Q7RA 1FXWA 1UC4B 4UZSA 2B69A 3K4HA 3KUXA 4BRZA 4JZYA 5LDGA 4AN1A 4AS1A 4M1OA 4J16A 1N1GA 1O57A 3FKJA 2XKAA 4QD3A 3L4JA 4RPKA 3I01A 2H4FA 4PPYA 5CM9C 4EW6A 3HJCA 2QMZA 4KIWA 5IANA 1L4HA 1QONA 3HYRA 4LW8A 5ESDA 4MJ3A 4OAOA 1JJAA 3WNBA 1PWZA 2IV2X 4DM7A 2YS6A 3QHPA 3KAJA 3O2NA 2VHTA 2VHJA 2GK6A 1C50A 3B6ZA 2R79A 1SGWA 5FNVF 3ZCXA 2ATVA 3R3XA 3MSCA 1TMYA 2DWOA 4GC5A 4MRSA 1OAAA 4CV1A 4B3RB 3UAWA 1Z0KA 2EGGA 1XNQB 2QYSA 3QJ5A 4HLUC 1HURA 5A3QA 3UK1A 2WFLB 3T7IA 5KJEA 3UUGA 3H2JA 4YJ2A 2G4LA 4K40A 1SUDA 3R6WA 1YD7A 1E98A 1U2GA 1IDN1 1R18A 3G89A 2FSFA 2A35A 3HBLA 3OTQA 3GLIA 2G77B 2Y0EA 1Y6GA 1D1TA 4F6RB 2FI1A 3ZV4A 3G0IA 3A4LA 2Q21A 2YWRA 3G23A 1NUUA 2BMEA 2OWEA 2ONYA 4XGQA 4C04A 3H2IA 3USES 3V4ZA 3W4KA 9ATCA 3GEGA 1H4TA 4LHXA 1KC1A 4OA5A 4ZVMA 4DL9A 4IIEA 2GTHA 1CVIA 3TCKA 4P6VF 1UAGA 2BM0A 4MITA 4XIFA 1DO2A 2PH3A 3HDHA 3LD9A 4U2KA 1J4AA 2GKOA 2QRNA 2W83A 3EA5A 4LOAA 1U7UA 1U8XX 1BHJA 1UK8A 3QVVA 3A58B 1T25A 3VR6H 4M54A 5IVIA 4GX2A 4UHCA 3N2NA 5A05A 5D7BA 4UCFA 4HP8A 1OLOA 2ECPA 1YIAA 2M32A 4GMGA 1H2YA 4HQRA 2F9LA 4JHXA 4JQCA 4QBFA 2R8PA 1HX7A 4KO1S 3QF4A 4M36A 4ID3A 1CCWA 1HDOA 2VEOA 3G5AA 1R9JA 1UXGA 4YROA 1Z0UA 2IYZA 1DXHA 2O5VA 3HR8A 5D86A 1AXGA 4P82A 3L9WA 5IDVA 5LXTB 2HTEA 2SCUA 1BXKA 3Q2IA 821PA 3ROTA 1FTSA 1KORA 1M3SA 1TVCA 2BOVA 2NT4A 2RCYA 2RH4A 2X5JO 3IBTA 3G2LA 3EYWA 4YA6A 2C1XA 4RENA 4M60A 4GLFA 5IJ0A 5AVSA 2P0EA 1QGUA 4E5DA 4OXQA 2QTFA 4F3NA 5ICCA 3GW8A 4F2PA 1PU2A 5ICSA 4BGIA 1NXVA 2XH8A 3I83A 3PJDA 2OHIA 5JYEA 4DMUB 3GZJA 4UAVA 4XX1A 4BTLA 2YICA 3VDXA 1KR5A 1NIJA 1L7BA 1OILA 4EVRA 1HE4A 2DFVA 4KLNA 3HWX1 1SC4A 1I9GA 4MA5A 3F7MA 4YP7A 2KE5A 3RSSA 2MJLA 4ZVQA 4ZEMA 3OQPA 4HV4A 5IAAA 1IY9A 3S0JA 2D2VA 1U80A 1PFWA 4L4ZA 3TEMA 3DCIA 2EFJA 2QQ5A 2ZRBA 3EGEA 2X41A 4RABA 2RI6A 4UQPA 4A7PA 2AZXA 3PE4A 3TSYA 1CUYA 1ADYA 2Y8EA 4TSFA 3IPXA 3E9RA 4FSDA 3C3XA 1TCVA 2R44A 4L5BA 4Q00A 1C41A 1GU1A 1NNI1 3ND5A 4RZSA 2VH1A 1JX6A 1VE5A 3HLKA 3RVKA 2AHOA 2LUOA 2UZ3A 3EAFA 1P2SA 3K5HA 2WKQA 1AQ6A 3ID6C 4AJEA 4AYWA 4WXEA 1KXZA 2DKFA 3DW3X 3O4RA 4CT5A 4W82A 4UDYX 4YAJA 1ULTA 1MX5A 2JKVA 1KDOA 2FW8A 5FO0A 2WDZA 2IH5A 2I87A 2H4YA 1OA1A 1UK6A 3HVRA 4GRIA 1IY2A 3LCVB 5HF6A 3N8IA 3MWEB 4IDAA 4P3NA 1HA3A 5J58A 4C0BA 1AJEA 1F2UA 1V6CA 3A70A 1MRNA 2HSEA 2J3LA 2QI9F 3BVPA 4KK4A 4GBGA 3Q12A 1O95D 1XZAA 1MTZA 1LKZA 4X5OA 5B5SA 5ETJA 2JJ2A 2Y92A 4EGSA 5AJVB 1I1QB 1PQ4A 3GXOA 3RIGA 5KWJA 4G4SO 5JVDB 3UMYA 4Q16A 1SZPA 4P9NA 1L7MA 1RPAA 2EZ8A 4XQCA 2GNPA 5JISA 1RLUA 1KY4A 2EYQA 1Z83A 3FPKA 3OJLA 9ABPA 3QP9A 4ZOCA 3O1JC 1GNRA 4JFAA 3W5SA 4H1VA 3FKQA 3NHWA 4XWKA 2WJGA 3EWSA 3PV0A 3ZK9A 4DMGA 3TSAA 2CGEA 1YRWA 3IMGA 5FO1A 1JKMA 2G9VA 3AUAA 3I1YA 2GTPA 3CA8A 4KFTA 2VWHA 2XOKD 1P4GA 1SIOA 3NASA 4P84A 4RAOA 3DZGA 4N0PA 4W8OA 4UARA 4G86A 2JA1A 4IQ8A 2BDTA 5H3LA 6NULA 5BOVA 4JYMA 3ICEA 5IWCA 5AM5A 2QDXA 3E1GA 4MR8A 2YVKA 4MVJA 5DNWA 3INTA 3EIXA 1AV7A 2JGFA 2NO4A 1AGYA 2OCBA 1FVOA 3D8NA 4NMHA 3WLPA 4ZAVA 3E18A 1Z4LA 1OYOA 3EHEA 3TD2A 1DX9A 3VKGA 4X84A 3WWYA 2R4UA 2WAXA 1T6XA 5DYYA 1PJSA 2XGGA 1GOTA 1NONA 3KK0A 3P32A 4PCLA 3BMOB 3HA7A 2A9RA 4KBGA 1G0NA 3MUFA 1C9KA 2PLNA 3NIBA 4TKLA 2G1UA 4RSRA 4EMUA 1QLWA 4RKWA 4GU5A 4TZTA 2LCQA 5FLXA 1ODSA 2YYAA 1L5OA 2IHZA 3N6VA 4DA8A 3U44B 1AA9A 2CFCA 3GFFA 2PZEA 3QITA 3T0GA 5BUSA 1FSSA 1C7QA 3A1FA 1FDOA 3V2IA 2FZVA 1ZXBA 2XGJA 5I7UA 1GQOA 4K6MA 4YJHB 1D2AA 5IDQA 4BNHA 2ORYA 3L5KA 4HLNA 4OSPA 2QW8A 3A7DA 4LFCB 1GCAA 4BMNA 1QRTA 3JQEA 3DO8A 3MSXA 5FEUA 4UQLA 3C3PA 1LI4A 3KV3O 3TE7A 3KQVA 1VHJA 1NVTA 2VJOA 1EWRA 1JJVA 2WVHA 3CEMA 1BMFD 3FYTA 3DZ8A 3ICPA 4X60A 1NF8A 1C4OA 1RVV1 2DPLA 1ZC4A 1EGAA 2I33A 4YEDA 1KZ1A 3AM4A 3H5WA 1JT2A 3QG5A 3W2TA 4EKDA 3BZBA 3CH5A 1RYBA 1EVLA 3T3IA 2X8JB 4HRYA 2OFXA 2H92A 2DR0A 4IVRA 4JI7B 5AIAA 1TCAA 5AHWA 4NYJR 1HDZA 2EG9A 4BVAA 1JIKA 2PWPA 2GXSA 3EBLA 1IOLA 3DV9A 3PDHA 2F3PA 4PXSA 1N5LA 3Q7SA 1TQ4A 4X8HA 1X87A 1ULAA 4Y9TA 2XMPA 4JMPA 4EG4A 1D4OA 1P5RA 5K0LA 3TUZC 3IGFA 4OQXA 1ZVKA 4LDRA 1EQAA 3LK7A 5A4FS 4CDRA 1JAIA 1T4MA 3R76A 5LQNA 5IM4F 4Z4EA 2D74A 2XUFA 3GG2A 3M6XA 3OLXA 4HZUB 4Y2YA 4B48A 3T7SA 3T9EA 3AVPA 1V96A 4R2MA 5I9LA 3ZDQA 4FNOA 1P61B 2ATEA 2XMRA 1Q5PA 4YI5A 5LZ7A 1JAYA 4UTOA 2X3YA 4LDNA 5DP1A 1SVMA 4C0QC 4DDKA 1LV7A 1NF9A 1CS0A 3UJNA 1KO8A 4D9KA 3HKBB 1E3IA 1PBTA 2PVSA 2XW6A 4YCLA 1AX9A 1H0SA 3GFSA 1COWA 3AFNA 2DUNA 2FMXA 3OE1A 2QROA 4RY9A 4CMEA 2WFZA 4OJTA 3A0RB 1XXHA 4YMUA 4U7FA 4YP9A 1R4AA 4TVKA 4MRMA 3HVKA 3O21A 1HOTA 4BQQA 1Z0DA 3F3MA 2HBYA 1B41A 4QAJA 5FL7A 4PZYA 4EFLA 4R8LA 4C0AC 3GD7A 4LYHA 1T15A 2OSBA 1U8YA 2QVGA 4JB0A 4CQLA 3T7RA 1K4KA 4RY2A 3V9AA 2O2HA 4DHEA 4RV9A 4X6LA 4OGKA 2PUAA 1BWQA 1XVUA 3PEYA 5AW9A 2DPHA 3KLOA 2FQXA 1ZW6A 4W9MC 4PVDA 3MJRA 3G02A 3PNSA 4RJLA 3ZD9A 4DXHA 3DAOA 1PCXA 3BS4A 1W5EA 5PGMA 1ZWLA 3FHLA 4M0EA 4GMFA 5CFNA 1AQUA 4L85A 4DNFA 3FMGA 4K6KA 2Y9PB 2CBZA 2G0TA 3QMWA 4QNRA 4B47A 1WPRA 1FMJA 1R0YA 2ADFA 4TROA 1VRWA 5HUHA 3GL9A 1Z4PX 2PKQO 4QDTA 3L49A 3N39C 2BFMA 4X91A 4HUQA 5AUOB 3Q6IA 2P41A 5LM3A 2L69A 4IFIA 1OFUX 1NM5C 2I6FA 3O8QA 3OP1A 1GP2A 1OYYA 5AVXA 2FQYA 2FFBA 2I66A 2YJ4A 3OOHA 4I9FA 2WG1A 4AZVA 1YMQA 1WEKA 5K8UA 4BB0A 5BT8A 5ALVA 3OT4A 2PZAA 4REQB 3F73A 3PPXA 5EGNA 1EUDB 4YAWA 3EX7C 4LNHA 4E2FA 1P72A 1GTL1 4AJOA 3IDOA 4PTYA 2XQKA 1JTVA 1QYIA 3Q3JB 1SUFA 1IAQA 4H7EA 4J16C 1U5AA 3QRWA 1LSJA 3HCEA 5JYCA 4D45A 4WZAE 5I9SA 3RDPA 4A0RA 1ZUNB 2HDNB 3L7DA 1Q1AA 1AHHA 2LZ0A 2P7IA 2F4NA 3G0BA 1XDZA 3IBGA 4UTXA 1L5GB 4LGCA 2ZE6A 3OG9A 5G53C 6CHYA 4R4JA 2VBIA 3GOQA 1W0KA 4Z8XA 3RKUA 3D6UA 3M6WA 4OI4A 4W99A 2AL7A 1RZ3A 2R8ZA 4HNSA 4NV3A 4QYWA 2GHRA 1RACA 3MHTA 2C5SA 5FWYB 1HFEL 1JRLA 3VU9A 1UP4A 3WGTA 2X2PA 1QG6A 5K6AA 5BSMA 1S2NA 1M7BA 4MRAA 2R2AA 1QM5A 3E9QA 4TTSA 4EG6A 1I51A 4RMJA 1FQWA 3AV3A 5ICMA 3U3KA 4RC9A 1ZJZA 1GPMA 2VDNB 1GLVA 3BMNA 3K1AB 1ZIXA 2ZAMA 3OFVA 5EJGA 2EBWA 4BKOA 2A8YA 2Z4RA 1P4SA 3A1DA 3FPGA 3AHHA 3DVQX 3N07A 1TT5B 121PA 4J2OA 4D0RA 2ZPTX 1MV8A 3G2NA 3O31A 4A0GA 4IOJA 2PUJA 4REMA 2QR3A 1TJ5A 1Z7EA 4D4HA 4YCJA 3AF0A 3VDQA 4INAA 2WG2A 4MRMB 1KDVA 1IONA 3W78A 2XTZA 2XJ4A 5DTQA 3VI3B 4BAUA 1EDOA 2YC2C 5K09A 2HF8A 1DTSA 2Z1NA 3RUPA 3WRXA 3IAFA 3P2KA 2RBGA 3KB2A 3TW0A 2ZYSA 5HKAA 2JIZD 7MHTA 1N6HA 4MQFB 3KSBC 2ENWA 3KYCB 1IZ7A 3NWPA 3WGIA 2QE7A 5LNK1 8ADHA 5EMKA 4JJ6A 3CWCA 4ZAFA 3KOOA 4C4AA 1W4CA 3JAKB 4MKGA 4ZARA 4E6EA 1Q7RA 4YR9A 5GZ3A 2G5GX 3PNMA 4JVLA 4L75A 2REBA 4TN1A 1ENZA 3LPNA 2B92A 5A9SB 3VR3A 1R0RE 2FUG6 2H0AA 5FA8A 1SXJE 1JBKA 1S2MA 5GZ1A 5ED4A 1YR2A 2VXCA 3AR9A 4PGMA 4YUXA 1WXEA 1SXHA 2NIPA 1Y1PA 3KLMX 1NYLA 3NHJA 3WLMA 4QXMA 3UAZA 3HBMA 3JASA 4AY2A 3ILVA 2IYOA 5JG7A 3C8ZA 4AI6A 4H7HA 1XDSA 1BHQ1 3IH5A 3PDJA 4LHVA 4TRJA 4Y2QA 4QOGA 1EP9A 3SIPA 2J5KA 3TRIA 4OM8A 1XROA 2VDOB 4UBKA 3VDNB 4IO1A 3RADC 5KQGA 3SQDA 4GQIA 3LQ4A 3OOJA 1FYWA 1DDIA 3V7NA 3OIGA 4OFBA 3ICOA 2V58A 3HJAA 1SNYA 1G60A 2JLZA 4NZYA 1ZKMA 2Y99A 1F1BA 2A9JA 3P2YA 1P5FA 2LIPA 1CDZA 4G9GA 4M9QA 4Q9LA 3GH1A 4RPGA 5EFOA 5C8ZA 1E59A 3VFDA 3VC7A 3VZQA 2PS0A 5J5VA 1CPYA 1P17A 1T0JB 1AKYA 1LDBA 1Z74A 3LIIA 3ONVA 5DNUA 4MR9B 4UNSA 3QKTA 1EMDA 3ZZUA 3PCXA 2V6JA 4YC7A 4YUAA 1XYVA 5A4IS 2F3UA 3NRJA 1ISIA 1PDOA 3F97A 4FMCB 3OCVA 4XWTA 5E0OA 3UTCA 5KQRA 4RKFA 2VHXA 3KKMA 4YPFA 4JUAA 1LVHA 2EX1A 5DF1A 3VAAA 3WZMA 5KOHB 1YB7A 2WYOA 4B17A 4C78A 2O0MA 1LZKA 5FYDA 3DMTC 3EIHA 3D3KA 2IC5A 5FAKA 2OFOA 1T6ZA 1U9ZA 2UUAB 1RRPA 5HIAA 3AP3A 3GRAA 5KYKA 1NP3A 2AG1A 4EM6A 4G5FA 1I7SB 2FZLA 2YV4A 4EA8A 1EDBA 2Q41A 3I4FA 3EG9A 4JB8A 3SS9X 4N01A 2DBQA 5JZSA 1CY6A 1S2OA 4OLJA 2EC5A 2VC2B 4MVCA 3E22A 4EY3A 1ZOLA 2FZWA 2Z1MA 3FWHA 3WMXA 4CDNA 2W4QA 3DEHA 5T57A 2GZMA 4GGPA 2BZSA 3P0HA 2OXIA 3FMIA 2WJZB 4KSYA 3L4BA 1XU4A 1U3CA 1VHTA 3G9ZA 2HL6A 3PJEA 5BSKA 2C03A 1AA6A 4N76A 1YDEA 1LSSA 2B1QA 4HQ6A 3FWPA 4WEOA 1L2TA 4FSXA 1DS6A 3ADKA 1DPGA 2AI1A 2C1ZA 1S2GA 4TMWA 1OJ7A 4OF4A 1LJ8A 1A88A 4G1EB 3W6PA 4NZNA 5G0UA 4ER6A 2K2QB 5JVDA 2WJIA 3CW2A 3D8SA 3ASVA 3GLRA 3I92A 3SXUB 4BUJA 5HGXA 4Q3DA 2HMWA 3OKFA 5TPWB 4D9NA 1E69A 2H59A 2GZRA 3TS1A 4D97A 1M8GA 4D02A 2VXBA 3U09A 2OKGA 3CM0A 3PUVA 1G3IA 4GE0A 1KI7A 3MWDA 3KXIA 4Y6PA 1IY8A 1I4LD 3GG9A 3MTQA 3WB2A 2YN2A 3AUTA 5TMPA 1R0BA 2YY6A 2ZWVA 3B53X 1H22A 5KTNA 1W73A 2PPLA 4RH3A 4HVTA 3G68A 5EINA 3UOAB 5IW8A 1JHRA 4HD8A 2Q3EA 5C7OO 2ODEA 2POQX 3OZFA 1O9BA 1PYDA 3T95A 3TF5A 3MD0A 1U3TA 3DXFA 3V4VB 1HQKA 3W6NA 4RF3A 2Y0DA 5CFPA 2VRBA 3A3PA 3GFPA 4O29A 2XNDD 2GN6A 1KJIA 3KT3A 3JQQA 3EEOA 1UT6A 2HSGA 1QAQA 2PUEA 3E7PA 2XB8A 3BC1A 4LXIA 4BB6A 2R4TA 4IDCA 3IURA 2AN4A 1X19A 1RI2A 2JI4A 2QSZA 3A11A 2LIVA 4Y1GA 2YV3A 4YXWD 1KP3A 4K03A 1EDDA 3L43A 2IX9A 1NAHA 2I1WA 1A96A 1JR3E 3IP7A 1EM6A 2HAEA 5LL6P 4WZBB 4P3PA 3ZVKA 2AF3C 2C9YA 2OVBA 5G4KA 4ARCA 4DLBA 2D5CA 4JVMA 2HRZA 3EVCA 3A36A 4C6HA 5LBIA 3SSAA 1CB0A 3AUFA 2JH8A 3RLIA 2A9PA 3PFBA 3ABQB 1XF1A 2O2JA 5U1PA 3UHFA 4JX9A 1ESMA 5AVRA 1NJFA 2ZDGA 1ZGGA 1H2AS 4D3YA 4BUZA 3FBTA 1WDMA 4O4IA 5CJPA 3SXJA 3B70A 4KAFA 1NZDA 4YMWA 2W22A 1G5TA 1HNWB 3W2EA 3N70A 1N6IA 3BZUA 3R6LA 4I55F 2I0FA 5CCDA 4KR2A 1T3HA 2PDAA 3F98A 1JG3A 3L8EA 3NWBA 1AU9A 3R3SA 4QBIA 4J7CA 4CM4B 2IY7A 4NMXB 4KCGA 1JQKA 4E5NA 4DEVA 4JBXA 2YCBA 4A15A 4ZYZA 2NVOA 5CXQA 1JQ5A 2V5VA 4YMSA 3K9CA 3ZV6A 3TTXA 1Z0ZA 1DBQA 2WTAA 4OFWA 1WHSA 1T1JA 3E0QA 2CL6X 1C4KA 3F5DA 3AOEC 1E6MA 4K88A 3PWZA 4AG6A 1QORA 3ZV3A 1EP2B 1E1NA 4ZEXA 4R41A 3PA8A 1URPA 3E15A 3H9JA 3QMVA 4E5PA 4ZZ2A 3U19A 4K6HA 1CY0A 2NWQA 4H2DA 4ZRDA 3K0FB 3IR5A 1W8DA 4PZCA 2ORIA 2P68A 3ZXYA 3ANNA 3LBNA 1W85B 1E9RA 3L46A 4BFSA 1FXWF 4ZQEA 4GW3A 5E2BA 2OXEA 1ULSA 1Q21A 2R5NA 2SHKA 1R4NA 2WKPA 1WVGA 1MAUA 1MJHA 2JDID 3MCWA 1MOQA 1RJWA 3AB3A 3D59A 4GZ5A 3GWZA 2P2NA 3HV0A 5GMOA 4EY5A 2INGX 2D4HA 3V1UA 3BN3A 5B6IA 1UMKA 3WB0A 3OZSA 4KR7A 5DB4A 1XMQB 2MDTA 3VPXA 3RO7A 3DP7A 4WY5A 5GJBA 2P75A 2ABWA 4QPDA 1VCHA 2FEMA 1MNAA 5JLJA 1SU7A 3GLGE 4MUHA 3GLFE 2GNOA 4C07A 4F4IA 3WB9A 2HPVA 1YDFA 2IYFA 4EEZA 4OA8A 2AH5A 1SVLA 1VLJA 2VZEA 1IAVA 1RHJA 3FBWA 3MCTA 3R6GA 2OUIA 4UUPA 2G63A 1DAEA 4K9DA 1WTAA 2YX1A 4O02B 3AI1A 4WD3A 3V8QA 2WWWA 2PV7A 1CR1A 2PU7A 3OUTA 1D0SA 2YWCA 4UNIA 5DN6D 2PSDA 4K8RB 1MEEA 1SQ6A 3IL2A 3OZWA 3T3OA 4UAGA 4Y2HA 4RK7A 1BTOA 1E2GA 3GNLA 3PGJA 3EISA 5CFZA 3PHIA 2WABA 3UEOA 3AIIA 3GLQA 5CEFA 2YMLA 1B93A 2VP0A 3DONA 3WJAA 4YP1A 3ETGA 1HLGA 3WWDA 3ZXXA 4EG3A 4R8SA 3VR5A 3E8MA 1PEAA 1DJOA 5EXPA 4EAAA 4ES6A 4BX2A 1CE8A 5E6SA 2R6CA 2WB4A 4FFMA 3PQDA 4TPKA 3VSEA 4BE9A 2Z8XA 3ASUA 4ZCIA 5BWCA 3L7LA 5KMGA 1LD3A 2R00C 2IS2A 1OGIA 4HDAA 4IUDS 1JWLA 1JR3D 2WIGA 3MWKA 2X0IA 2A84A 4PIMA 3IDAA 1XRPA 5CB8A 3R6DA 4DLTA 2C78A 5JXGA 4Z2YA 4ZIRA 3SD7A 3D6FA 4JJAA 5CD9A 4KAJA 1RRCA 2R6AA 3LPDA 4YMIA 5TNXA 2WU8A 5AK5A 3I9KA 3LL7A 3CT4A 3C1UA 4JBHA 3GGCA 2AJCA 4J7XA 5EJIA 2OXTA 1BEZA 4IY1A 4FFPA 1VIDA 4NJOA 3D6AA 3LY8A 4N9WA 1QJ4A 1H5UA 3O4GA 3ZDYB 1UJMA 4MXDA 3X1KA 4NHEA 4D0LB 4O4IF 3FBGA 2OECA 3H04A 2OYRA 1Y4SA 2OZLB 1BMFA 3FETA 4RM3A 4B9AA 1ECLA 2E6KA 4MGIR 1I3CA 4CMIB 1PZFA 3JYOA 2FXVA 1Y6FA 1EWQA 1MX9A 2Y66A 5J59A 1E2EA 1JZSA 4MW4A 3VR1A 3ZUGA 4B74A 4YY3B 3TPFA 3ELUA 2D3WA 3W6OA 2R1VA 4D8WA 3KR9A 3MJSA 1BCSA 1PV1A 4MAMA 1PBNA 3WK8A 3NS7A 3H2SA 3PGA1 5G0WA 4EHBA 4URYR 4GFDA 3EGVA 1FVXA 4G0PA 3H0KA 4KQIA 4DR1B 1XQWA 3NOXA 4WWHA 2YIDA 3DGEC 2ZJ5A 5K9ZA 1CF4A 1PNTA 5AVUA 5JAZA 4KVAA 1Z4NA 1SUEA 4KO4S 4NFLA 4KMSA 3QVSA 1HE5A 1M8PA 4D9BA 1QPZA 4ZJYA 3NM6B 2BZ1A 2Q6KA 1FRFS 5JW6A 5LIPA 2RHMA 1L8OA 1KAMA 4R2KA 1JV2B 3RASA 5L3SB 3RS8A 4FGSA 4H4EA 1PJ3A 5I7RA 4RLFA 1U7XA 1BRTA 5B1IA 3SJBA 5AKYA 2QJRA 4IDNA 2C2BA 3MJEA 2JFBA 2YHIB 2JLUA 2IH4A 1FPMA 5G1PA 3CO0S 4NENA 2WE8A 4N65A 1TZMA 4E2WA 5LBUA 1KMIY 3AQIA 3BB1A 4HNHA 3RRNA 2X2OA 5ENDA 4ID9A 3KFLA 3I2JA 4KSBA 2RARA 2QTMA 2YWGA 1T8PA 1AHIA 2IP1A 2PRIA 4LDQA 3ZV7A 4AUMA 4QBKA 5IN4A 2WK1A 3EN0A 2WZCA 3C7DB 4ZXPA 4NDAA 4R1UA 1RQ7A 5TQVA 5CMLA 5A62A 4GM1A 4EPRA 2XQVA 1QFXA 4HDRB 1XEFA 1N2CA 3V1TC 4MDEA 1NT2A 4OQQA 1S2DA 3LLMA 1VIMA 4M8IA 4EJSA 1WY7A 4XOIA 1I2MA 3T5GA 2GCPA 1SCUB 2HJ9A 5EP2A 4E08A 1GZ4A 2YJZA 2C61A 3ZU5A 2EHDA 4YMTA 5KPJA 4UUAA 5KYGA 4XJSA 3OFKA 2YOFA 3SQOA 1JHVA 2CUZA 2NT3A 5C4GB 4QEZA 1B8VA 2XBLA 1QU3A 4FKBA 3DD1A 3GEIA 4GAEA 4NCAA 2LTAA 4H3VA 4LF6B 1P77A 2CVPA 4M1MA 2CXXA 3PQ4A 3TFWA 4OHVA 4EVSA 1ZK4A 2JGEA 3VSBA 1C9EA 1P2UA 2BEKA 3D3NA 1YS9A 1I6KA 3HI4A 5KSPA 4E2YA 1KYWA 3P0FA 4RZUA 2X42A 3L6UA 2H1RA 1EM8B 1P3Y1 3RVOA 1D09A 2DWQA 2ILVA 1TT5A 1W94A 1FSFA 4NG5A 1MT3A 1W46A 2FZ4A 3FYDA 4KWEA 1GG2A 5B1SA 1ISSA 4RVUA 5B37A 3KEGA 5E3HA 4UDNA 2DBYA 2EWWA 5JSHA 2UXBB 4BEBA 1S5PA 1YZLA 3EMVA 1GPWB 4KBYA 4RW0A 1CBUA 4RM2A 1O95A 2GD1O 4RA6A 4P0QB 4I50A 1JT9A 1F7UA 4LKOA 3AHFA 2IWRA 3COWA 1YJ8A 1ZZEA 4YAEA 4Z9FA 1U7PA 3AERB 5TY0A 5B2FA 5B7QA 4Z9YA 3BM5A 4RDXA 1XEAA 1E2IA 2H1HA 2Y1KA 4WZAB 1K1EA 4UU0A 3UG7A 1ZX1A 1JHOA 1KPIA 1YCFA 4D4IA 2FY8A 3HCDA 4G3XA 1ACLA 3TCXB 8LDHA 1WWKA 3AEYA 4LOHA 5A3SA 3UT6A 2C7BA 1QRDA 3HJGA 3KWFA 1T5DX 4TKUB 3NFRA 3UXHA 2ZJ0A 2GRJA 3RV4A 5BN5A 2O2GA 1U0RA 2WSLA 2YJ5A 4H7JA 3W3AH 1RWXA