4XGNA

Crystal structure of 3-hydroxyacyl-coa dehydrogenase in complex with nad from burkholderia thailandensis
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
255
structure length
255
Chain Sequence
HHHMEIRDNVFLITGGASGLGAGTARLLTEAGGKVVLADLNQDAGEALARELGGVFVRCDVAREEDAQAAVAAATKLGTLRGLVNCAGIAPAAKTVGKDGPHPLELFAKTITVNLIGTFNMIRVAAAAMAANEPAPTGERGVIVSTASVAAFDGQIGQAAYAASKAGVAGMTLPIARDLSRNAIRVMTIAPGIFETPMLLGMPQEVQDALGAMVPFPPRLGKPAEYAMLVRQIFENPMLNGEVIRLDGAIRMQPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 3-hydroxyacyl-CoA dehydrogenase in complex with NAD from Burkholderia thailandensis
rcsb
source organism Burkholderia thailandensis
molecule tags Oxidoreductase
molecule keywords 3-hydroxyacyl-CoA dehydrogenase
total genus 90
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xgnA00
4II3A 3Q2KA 1IB6A 2YW9A 1D1SA 1IE3A 2O2YA 3RUDA 1UAGA 4NPCA 2DVMA 3DOJA 5JDCA 3H2SA 1I8TA 3K92A 5JAMA 4GPD1 3JD3A 1NFFA 5FF9A 4NFHA 5JXWA 4BGVA 1EUCA 1GZ6A 3FHLA 1WW8A 4EBFA 3M6IA 2HQ1A 2PH3A 2Y1CA 2WYWA 5L4NA 4YVFA 4XDZA 2DC1A 4DQXA 1UR5A 3GAFA 4RCVA 1QLHA 4IDBA 3I9LA 4XX0A 2NM0A 1MFPA 1P44A 2PLAA 4IDAA 4IQ0A 5DBGA 1UDBA 1U5CA 1WMBA 1X1EA 4PG4A 4CQMD 3VPSA 3VPFA 1YL5A 2WSBA 2B36A 4NU5A 4Z6KA 1VPDA 3G49A 1HLPA 2I3AA 1ZSVA 2HK9A 3PXXA 5IN4A 1J6UA 1WWKA 2DKNA 1Q0LA 1PQWA 1UUFA 3NDJA 2VTDA 3H65A 2V6BA 1H5QA 3FBTA 3NTRA 5L40A 2A35A 1PGPA 4W99A 4KUEA 4LISA 2PA3A 3PDUA 3GHYA 4YJDA 3ZCXA 3OM9A 4AJJA 3IJRA 2QG4A 1A7AA 2I9PA 2RBEA 4RZIA 2DUWA 3OJLA 4O59O 1LU9A 3ZZNA 2Q46A 4RORA 1K2WA 3AUAA 2FY8A 3PYMA 4WCFA 3V1UA 4HP8A 2P91A 5KVQA 1OMOA 4PLPA 4U6SA 4CQMA 4KUGA 3N7UA 1TT5B 3E8XA 2YFQA 3CSDA 3A28A 1JN0A 2QRKA 2YHIB 3AW9A 1V3VA 3JV7A 3INTA 3E9NA 1P1RA 4S3MA 4FDAA 3TF5A 3IAHA 3U4IA 2AE1A 4ID9A 2EXXA 3ST7A 1IL0A 4CR8A 1B3BA 3RAJA 5C5IA 3RFVA 4O5OA 5CG1A 4EJ0A 5L53A 1P0CA 5L3ZA 3KEQA 4P38A 4PLCA 3DEYX 3RD5A 3TJRA 4C4OA 3VKVA 3PQEA 2HRZA 1WZEA 1NVMB 2ZB3A 4FR5A 3QVWA 4IQGA 3K9QO 1R4MA 3WSVA 2Y1DA 3R3SA 1ZO8A 2EGGA 3KYBA 3IIEA 3COSA 5DCUA 2QX7A 2EG9A 1ZXLA 3D4PA 1U8XX 6LDHA 1KBZA 5G4KA 3PQDA 4C7JA 5C7IO 3ICCA 3W8DA 1V3UA 4NHEA 3SLKA 4YT5A 5EPOA 4PLTA 5F1OA 5T5QA 4E12A 3BHMA 1VKOA 3GUCA 1N9GB 1DIBA 2OMEA 4AJNA 3G79A 4CR7A 1E6UA 1K6XA 3QP9A 1XQ1A 3K6JA 3ZWPA 5L9AA 4NBWA 2DTDA 4B79A 2PD3A 4YA6A 3LT0A 4FGSA 5F1KA 4EW6A 5MGBA 1E6EA 2W4QA 3BMOB 3PRJA 2BKAA 3WYBA 1UZNA 3V1YA 4NH4A 4GMGA 2ZQYA 3WICA 4BMNA 4CR6A 2I66A 1Q7GA 1ZEJA 2RIRA 4BNGA 3I1JA 1XIVA 4D79A 3OSUA 2O4CA 1KC3A 4CLRA 2C5EA 4CMIA 1KERA 1PZHA 4I5FA 4OGWA 4R68A 4CM4B 2CVOA 3ZWOA 1VL8A 5DNAA 1CF2O 4DWVA 1P1JA 4J2OA 4BKPA 4WLFA 4FFMA 1ISIA 5AQ1A 4WOKA 3RUFA 3K5PA 1T1RA 3KV3O 4NBUA 3Q9NA 1JA9A 1SOWA 5G4LA 2J3IA 2NV6A 2OBYA 4ZQEA 1K0UA 1E3WA 2NVWA 4J1QA 3CIFA 4YT2A 1ONPA 1YQDA 1E3JA 3ONEA 3GH3A 1SPXA 3DONA 3RIHA 2RH8A 1BMDA 1JQBA 1HKUA 2FR1A 1WNTA 4XJSA 2DBRA 2OO5A 3RU9A 1B0AA 2OUIA 2X7HA 4ND3A 4QX6A 3I4CA 4IPTA 1EVJA 3EAGA 1LRJA 1C1XB 1QMGA 3ABIA 1W73A 5U9CA 2YHUA 3F47A 1T25A 4AJLA 2ZCUA 3AUSA 4NI5A 4JBIA 1EFKA 1E3EA 2FN7A 1C0KA 2G1UA 3EVTA 1YJQA 3FTPA 4OSOA 2J5RA 3PDJA 1SBYA 3RWBA 3L07A 5HWSA 4XWYA 2QRLA 4BKRA 1M75A 1ZK1A 2O3QA 5HA5A 4RPGA 1BTOA 1E7RA 1ONNA 2HSDA 3OP4A 1I2ZA 5JAIA 1NM5A 2JKVA 2OFPA 3DZKA 4DBZA 3ZWXA 1YBVA 5I8WA 3AOEC 3GN1A 3QQPA 3KYCA 3PJFA 4BO6A 2NVBA 3PEFA 2PNFA 4FQ8A 1NX6A 4XYEA 4LSWA 2G5CA 3VKUA 2ZQZA 4PG8A 5K6AC 3JD4A 3GVPA 4BKQA 1GYPA 3TZHA 5JS6A 5KCZA 1I30A 4JROA 2J5QA 2BFAA 5BNIA 1OI7A 2GPTA 3KBOA 4ITUA 4OL9A 3F4LA 4D3SA 4EEZA 4L74A 4YRBA 1KC1A 3H9GA 2W2LA 4J4TA 3QV1A 1E7MA 3OQ6A 4PRLA 1PS0A 1YDWA 1LDYA 3IKVA 4WNCA 1EE2A 2VN8A 3EUWA 3C7DB 3E48A 2CMDA 3VVCA 1HDYA 3OFSA 1U7HA 3PIDA 4DPLA 1ML3A 3RFXA 1VL0A 1CETA 3NT5A 4MVJG 1U3TA 2HK7A 4GWGA 4IXWA 4IS3A 3TOZA 1C1DB 3WGZA 4QXMA 3OIGA 5B4TA 5BR7A 5L7YA 4YJHA 3I52A 4FFPA 4DUPA 2HU2A 2YFHA 3WGGA 1DXYA 2FR8A 2P68A 3PWZA 1DLJA 3PHLA 4RLHA 3FWZA 3L77A 2PGLA 1GDHA 3BAZA 4S1VA 5GZ6A 2EEZA 4RVFA 3GDFA 1XG5A 5BSHA 3FNHA 3JQEA 1P77A 3AU8A 1F06A 3FPLA 3I9MA 3G1UA 3K2BA 1HE5A 1ONOA 2WYVA 4J1TA 3ZWAA 2CF6A 2WMDA 1U2GA 4RF4A 4EZBA 1DRVA 2AQ8A 3ZGYA 2VZ0A 2FPIA 5I9NA 3BTSA 3DMYA 3GC6A 4EUFA 2HK8A 3C7AA 1EBFA 4MPDA 4E5YA 4MINA 3M1AA 4R4JA 3JYLA 4N18A 1F14A 3PLRA 2Y67A 1CIVA 2C5AA 5JY1A 1TB4A 4ILKA 5JDIC 2ZATA 3QIVA 3JQGA 4Y67A 3JQFC 3ONDA 4OXYA 1B8PA 2VNAA 3DR3A 3TL3A 1B3RA 2FPPA 3D3WA 1GQQA 4HWKA 1MG0A 3DZIA 5IXYA 1LLUA 4YAEA 3QWHA 4CMJA 2IEDA 3AOGA 5TT1A 4ND4A 3SX2A 3PZBA 2TMGA 4DLLA 1KVRA 3PHGA 2DTEA 5A9SB 1YRLA 1LNQA 1E1LA 4NQZA 3ZU2A 4DREA 1Z82A 4GGPA 4YACA 3DBLB 3C1AA 3LDHA 3MZ0A 1N92A 2GYYA 2UVDA 4NFYA 4BNKA 3A14A 1SZJG 1U3WA 2VYVD 1BSVA 3QWAA 4P22A 2J3KA 1RKXA 1ENOA 1E77A 2DPHA 3U4HA 1YJ8A 3C24A 1ADGA 2EW2A 1KVUA 1CDOA 1D3AA 2FWMX 1ENPA 1MUUA 3OICA 1XCBA 1NTOA 1O0SA 1TI7A 2X0NA 4UVIA 4TQGA 1E6WA 2YUTA 1E3LA 3NAQA 4N54A 3S55A 1M2WA 3I6QA 1M76A 2V65A 5IN5A 3KM0A 2X9NA 1GYRA 1UH5A 4QO8A 3LC7O 4Y6PA 3I9OA 1DB3A 2PGJA 1O6ZA 2PGDA 4CLOB 5B4UA 3DHNA 1P1HA 1E3IA 3PQFA 4Z3KA 5IFLA 3W4IA 1EZ4A 2J8ZA 2SCUA 1YB1A 2ZB7A 3GY0A 3KXDA 3L6DA 4J1NA 4RDHA 3VDRA 2IODA 4BNYA 3OA2A 2X86A 3C1TA 3PFFA 2QRJA 4XIJA 4Q3NA 1TXGA 3OECA 2CF5A 4MJLA 3W8FA 3R3JA 3BXXA 3VTZA 4DC1A 1LSUA 2OL4A 2Q50A 1ZW1A 2IZ0A 4ZICA 2ZIZA 3O03A 4R51A 5BNFA 2NACA 4OQYA 1NASA 2DLDA 5C37A 1ZVMA 3LYLA 4NU6A 4E6PA 4UEOA 3HNPA 1MLDA 2VWGA 1LUAA 1VI2A 4LRSB 4YRAA 2CDCA 2G0TA 5GMOA 4TROA 5G0UA 3UFXA 1GYQA 3DB2A 3IP3A 1WDMA 4PFJA 2WD7B 4J16A 4RGBA 1O8CA 2UV8A 3LT4A 4W4TA 5CEJA 4CLRB 2D5AA 5AXAA 1YOVB 4YAKA 1GTMA 1YS4A 3WIDA 1DEHA 4ZU3A 1TEHA 1QG6A 1MX3A 3IQDB 4GI2A 4BL5A 7ADHA 2VHVA 4UAGA 3CTMA 4E3ZA 3FR7A 4M49A 4XQEA 1PSDA 3K96A 4C7KA 1LQUA 4R9SA 4W9NA 1Q7BA 2DT5A 4ALJA 3VZQA 4YB8A 5HTOA 1JU9A 4CMEC 5IZCA 3KZVA 5EERA 1H6BA 3BIOA 2C82A 3RUEA 4E2WA 1NWHA 4RO0A 3D1LA 3I4FA 1BXGB 4D42A 4IBOA 4LMPA 4CMIB 3D3WB 5TJHA 2VYND 3LF2A 1LSJA 1S7CA 3FSRA 2BFPA 3ROMA 1YH3A 2NQ8A 3WMWA 2CY0A 4IMRA 1DBVO 1XU7A 2VZ9A 4B3JA 3WLFA 2BI8A 2P4HX 5AVOA 1EDZA 2UYYA 3JQAA 2R00A 4RLSA 2X5JO 4DLBA 1FK8A 2OORA 2Y0CA 3P2YA 4N7RA 4QQRA 4JP2A 1T2CA 5MDHA 3RUCA 3TRIA 3PJEA 4JX8A 3JQBA 2VRBA 3C1OA 3T7EA 1GZ3A 4BNLA 4O0LA 1I2CA 3AY3A 3OMLA 4Q9NA 1PGOA 1QYVA 4G5HA 4B4UA 4FJ2A 3SLGA 4UUOA 1QR6A 4IM7A 4J4HA 4BNVA 2NTJA 4NBTA 4R41A 1MG5A 4FIZA 1Z6ZA 1X7DA 1LBEA 3NJ8A 5LCXA 5KKCA 3PWKA 1BW9A 2I67A 3NV9A 1GQYA 3GLQA 1Y8QB 3TPCA 1AE1A 4FC7A 3WMXA 4AL4A 4PN3A 4ZJUA 1LLQA 2X23A 2FZWA 5KVCA 3VAZA 1KIFA 4JQCA 3FI9A 3A06A 3RASA 5U4QA 3DC2A 3TFOA 2DM6A 1R66A 3RUHA 3MEQA 4CM6A 3H9JA 4BKUA 1ZCJA 5JMPA 1M66A 4BV9A 1PJCA 2OOSA 4J91A 2WE7A 1U3VA 3Q0EA 2B4TO 4PG5A 5TLSA 4ESOA 3WFJA 4B7UA 4XYLA 4TVBA 1AGNA 2EV9A 1VSVA 4FCCA 4WLNA 2Y99A 4GL4A 4EGFA 1I32A 3GQVA 4RVUA 1A5ZA 1ZK4A 3ZHZA 2IE0A 5HM8A 3AI1A 4UVDA 5L4SA 3DQPA 4XD2A 3JD2A 2WTBA 1PQUA 1KYQA 4IDCA 4MKRA 3CUKA 4XRRA 5BQFA 1T4DA 5DCWA 2AQIA 3MJVA 1PQPA 3NEPX 4IZIA 3H9UA 5G2OA 1HEUA 4WJZA 4RPLA 4XA8A 1U7TA 4LCJA 1SMKA 1PIWA 3DTYA 5KJFA 4G2NA 3F1KA 5KJ6A 3ZV6A 4CMHA 2FR0A 1FDVA 4CL3A 5BSFA 2NNLD 3VTFA 3IS3A 1ADFA 1W6UA 3NKLA 1S6YA 1Y5RA 1U4OA 2GZ3A 2X6TA 1AUPA 1Y8QA 1YOVA 4IUYA 5A9TA 3TN7A 3LZ6A 5BSGA 5ER9A 2AXQA 1AN9A 2VT3A 2WEKA 3I3OA 4CLEA 3KLMX 3HB4X 2RHRA 4IIUA 5A9SA 1LC3A 1BDMA 1WMAA 2NU7A 4TSKA 1ISFA 4PZCA 3S2GA 4CM8B 3JQ8A 3KYCB 1C3VA 4CV1A 5A4DA 5A04A 1BDBA 4DA9A 1A27A 2X0IA 5HS6A 4JJIA 1M6HA 3RI3A 4QTZA 2IYPA 3EC7A 3QWBA 3IJPA 2A4KA 4NR0A 4OIMA 5K6AA 4MVJD 4MIYA 3NDRA 1QP8A 4FFOA 3AI3A 1LC0A 2YHIA 3ZWBA 4D41A 2VRCD 1PWXA 1EVYA 1HZJA 2WE8A 3WGOA 1UAYA 2C2YA 3WB9A 4FB5A 2B69A 2VZ8A 1A9ZA 3AOEA 4CM7A 3IOYA 5EN4A 1CQJA 3VC7A 3H6KA 4OXKA 3HDHA 2DTXA 5JFOA 2AHRA 5ENDA 1LRLA 1GFSA 1VSUA 2UUPA 3MJTA 2BFOA 4AJPA 5AXCA 3C3XA 1NQOA 1GQ2A 1H6CA 3R1IA 1PZFA 2GDZA 3HADA 4BUCA 1EBUA 1I24A 1K3TA 4J43A 2BELA 3BHJA 4E21A 3ZWMA 1D4FA 4BNIA 4CV0A 1LTHR 1ZNQO 1NQTA 4DMMA 2C7VA 5CDUA 5IZ4A 1BG6A 3HN7A 2Q4EA 4MDHA 1HXHA 2NVUB 5A3JA 4DMLA 2VQ3A 3S8MA 2P9EA 2Q49A 1QORA 2AMFA 4EUEA 1YBAA 1K6JA 2PH5A 3JTMA 2YDXA 1PZEA 4A2CA 2HJSA 1YB5A 4E4YA 1X7GA 1DDOA 2GSDA 4ZQGA 4I5GA 4CM9A 4GKVA 1J5PA 4XB2A 3D3EA 5T8KA 3UOGA 2LDXA 3A9WA 1ZH8A 4U0JA 3WYCA 2W98A 4ND5A 4W7HA 2VYNA 4BGUA 5JBIA 2R00C 1AXGA 4BNHA 2BH9A 1PJSA 4R3NA 3LU1A 4IGEA 4YT8A 1C0IA 3QY9A 4A03A 4PGFA 4OOFA 3TZ6A 1PGQA 2V6GA 3O8QA 1ZMOA 4J9UE 4KDEA 4CPDA 3PP8A 3QHAA 2W8ZA 1R6DA 2BGKA 1C14A 3JYNA 1U5AA 2NADA 3Q3CA 1ADBA 1X0XA 1Q2XA 3H2ZA 4ND2A 3B1FA 4Z0HO 1E3WB 1CERA 1Y7TA 3EHEA 4BNZA 5IZCC 4PLWA 1I0ZA 1EVZA 3ZNOA 4OOEA 4FGWA 4J0FA 3NTOA 3ZHXA 1B2LA 5C7OO 3FNFA 4MVJI 4M86A 4BNMA 3AI2A 4DQUA 1FMCA 1PWZA 5KJCA 1EK6A 4J1SA 2VHWA 2YV1A 3SXPA 4QSMA 1P1FA 1VRWA 3KHUA 3O38A 4WUVA 5J23A 3HSKA 5CEFA 4E32A 3WFIA 5G0VA 4II2A 4YBZA 2X0JA 3DZBA 2AQHA 1BHSA 1DFGA 1GUZA 4F45A 1XELA 2JFHA 1R4NA 4X54A 5AOVA 2I3GA 2PY6A 4OO3A 4FPXA 3RFTA 2JFGA 1YQGA 3UAGA 4HXYA 4QFDA 2Z1NA 3NJ4A 2BF7A 4UULA 5IXSA 3GRKA 5T8KC 1GZ4A 5C7LO 5ADHA 4GX5A 5ER6A 3E9MA 4G81A 4DC0A 3A4VA 4MVJP 1XYGA 4J49A 4R69A 3IMFA 5KOIA 1HL3A 2BGMA 4WCFC 4XR4A 3Q2IA 4CQLB 4FC6A 1X14A 3D0OA 3ZWWA 3KVOA 4A7PA 3MJCA 3UCFA 4I9NA 4H16A 2EJWA 3DHEA 1R0LA 2W2LD 1U4SA 1ZK3A 4FFLA 4GKBA 4J3FA 4IY1A 4E30A 3RBZA 1X1TA 4CLDA 4D46A 3FWNA 1K6IA 3MTGA 4GQAA 4ZD6A 2AG8A 5CDGA 3HJAA 3JQ7A 4DVJA 3ZNPA 5B4VA 2Y0EA 1TLTA 3WBBA 2DAPA 3NUGA 3WQSB 2VHYA 3L4SO 1AXEA 2YV2A 4INAA 1Q0QA 3ADOA 2RCYA 4FS3A 1BVRA 1IOLA 1DHTA 2GN6A 4MVJA 3OH8A 3OJEA 2HUNA 3QRWA 4XQCA 1HDRA 2OP0A 2Q3EA 3GA0A 3E03A 4TRNA 5GZ3A 4ZRNA 3KYDB 4LK3A 4ZVVA 1W8DA 1R0SA 2E82A 3ITDA 4D7AA 2Q1UA 3PWSA 3N58A 5ES3A 3GUYA 3PVZA 1V9LA 5THQA 1JVSA 4RL6A 4BO2A 1Y9EA 3EDMA 1DIGA 5DP2A 3DOCA 2C0CA 2NSDA 4RV9A 1Q0HA 1JLLA 3CH6A 2O7SA 4DL9A 1DIAA 4K28A 2JCVA 3U62A 3W8EA 4PLYA 5HBRA 4E5PA 4WGGA 5B37A 2Y93A 3QVSA 3WNVA 4BO3A 3KO8A 3NYWA 4FOOA 4W7IA 1NQAO 5I8ZA 1GD1O 4OYRA 4MKXA 4ZQBA 4HY3A 4WPGA 2VUSA 1QYXA 3VH2A 4BNUA 3DBHA 5IDQA 4I9UA 5DN9A 2NQTA 3HDJA 2Q2WA 3SBOA 4MP6A 4EYEA 1HWYA 1J49A 1ZJZA 4R1SA 2GUGA 4E2YA 3RSHA 4M55A 1RYEA 2DUUA 3GRPA 1PL7A 4KUHA 3VPHA 2VUUA 1SB9A 2Z1MA 4PZDA 1N9GA 1NXQA 3GMSA 2ET6A 4E13A 2ZYDA 1CYDA 1SEVA 2XXBA 4HX5A 3QVXA 4GLLA 4RDIA 3ENKA 4R16A 4ALIA 5JYEA 2CDAA 5C3MA 1K89A 1U3UA 1DLIA 3LQFA 3ROPA 3V8BA 1NR1A 4MVJM 4M1QA 3S2EA 3VZRA 1LDMA 5A9RA 1IY8A 5ICMA 3VH4A 3DHYA 3RROA 2ILTA 6ADHA 2BD0A 3H3JA 1F8FA 5F3RA 1ZEMA 1ZKMA 3AFMA 3MTJA 3O9ZA 1W4ZA 4LN1A 2UAGA 4ND1A 1QXSA 3WYEA 2ZB8A 2X22A 3AK4A 1B7GO 3HWRA 4YJFA 1GR0A 1JKJA 1MFZA 3GNTA 1HDGO 4YJGA 5I7VA 4EITA 3AM3A 2A92A 2J3JA 4M89A 1UP4A 5B12A 1DSSG 4I08A 4TZKA 1NAIA 2GD1O 1IPFA 4W82A 2GERA 3JSAA 1RWBA 4KP7A 4J6FA 3ZNQA 3RC9A 2GZ1A 1JW9B 1E92A 2BI7A 3GNSA 4PVCA 2D3TA 2POQX 2B83A 4H7PA 3NRCA 2Q45A 5HS4A 4H3VA 1WDLA 5T57A 1N7GA 3ON5A 4HADA 3BMQB 4GMFA 3WJ7A 3H7AA 4ZQFA 4BNFA 4BOYA 1RM4A 3D64A 3DZJA 5CHEA 2AA3A 5FYDA 3PHHA 5ILGA 3WWYA 4WLEA 1Z74A 3D7LA 2P9GA 3M2TA 2GZ2A 1SNYA 4CJXA 3L9XA 2QHXA 2TMDA 2ZTLA 2VUTA 4FJ0A 2O3UA 3DWFA 1UXJA 1WXDA 2D5CA 3GVHA 2JHFA 3DMTC 3LT2A 4K1LA 3MOIA 4UUPA 4E2ZA 2CD9A 2J5KA 1Y8RB 3ADPA 1LJ8A 2QYTA 1TT5A 3W1VA 4LMRA 4WLUA 4MVJH 3DBLA 1I3LA 4OMUA 5TQVA 4L73A 1SAYA 3K8ZA 2Q1SA 2WYUA 2F00A 2J6IA 3ZV5A 4EJ6A 3VH3A 4ZA2A 4E2XA 4CMCA 1NNUA 2G17A 2V7PA 3UXYA 1XHLA 2YZ7A 4AJ4A 1P1IA 3ITKA 2QW8A 3OIFA 3C8MA 4WK6A 1A72A 1IUKA 2X5OA 4OSPA 2JD1A 4A10A 1OC4A 5A5EA 4DRYA 5HRUA 4E5KA 4NFSA 1LSSA 1KVQA 4PLHA 2O2SA 4RVHA 2C20A 4BO9A 2YDYA 1MV8A 3K73O 4NBRA 4P8RA 3W4JA 1KY4A 1I2BA 1QYCA 5JSFA 1I01A 1W0CA 3AJRA 4BGIA 4CMEA 5DT9A 1T2AA 3PHJA 3U3XA 3ZW9A 4YT4A 3TOXA 1R16A 3OIDA 4Q3AA 2JJYA 2E49A 5TSDA 1BWSA 4I5DA 2BMAA 3UUWA 1ENYA 2EW8A 1YDEA 4WCDA 4L4RA 1XGKA 4QUKA 3CZMA 2E4AA 2GGSA 3QA9A 4DIFA 1UXGA 2AEFA 5CFZA 4XEHA 2C2XA 1PJ4A 1O5IA 3PYLA 1UZLA 3M2PA 1H94A 2B5VA 2GASA 4PLVA 3ZV4A 3AWDA 3KUXA 5JY6A 4NMHA 1KEVA 1MC4A 1YKFA 4CQLA 2PFGA 3O8QB 3RUIA 3PIIA 4NJOA 2D4AA 2XOXA 4YCAA 4YPOA 5JW6A 3P7MA 4TKLA 3B1JA 3BA1A 3GK3A 4LW8A 4MO2A 2O3SA 3OJ0A 4XZ3A 1SOVA 3WDSA 3MJEA 3V2GA 2D2IA 5G0TA 4YJHB 4KOAA 3UHAA 3DAGA 4OM8A 9LDBA 1F17A 1P33A 5F1PA 1CJCA 3R0IA 1P1KA 3H9QA 4HFNA 1JKIA 2X4GA 1MGOA 3S2FA 3HHPA 2ZK7A 1O95A 3GG9A 3BMQA 4XGIA 5BNTA 3RUAA 1V8BA 4FJ1A 2NTVA 4L9RA 4Z9YA 1SEPA 4L75A 1HYEA 3JCZA 4KMSA 4CV3A 2HO5A 4KDFA 2VOJA 3GPDG 3EVNA 1HE4A 4J0EA 1KVTA 2PKQP 3NGXA 3PK0A 2V6MA 8LDHA 4O1MA 4WNIA 4IJVA 1LA2A 1NP3A 2JD2A 1LX6A 1PGJA 4QEDA 4U5QA 2CZCA 1M67A 3IUPA 4R1UA 4YYZA 4RF2A 3INRA 2B37A 2EF1A 2LDBA 2ZJ0A 3TZKA 1KY5A 3NTQA 3K30A 5KJEA 4KWIA 3QWIA 3PLNA 3DZFA 1Y81A 3IUSA 2C29D 1PJ2A 3JD0A 4URFA 1YQXA 4H15A 1G6KA 1HDZA 1CRWG 5LC1A 3DAFA 4NK5A 1GU7A 3RJ5A 2Y68A 5TS3A 4Q3DA 4RPKA 3W4KA 3RKRA 2I99A 4GX2A 4JXKA 4KWHA 4O6VA 5DOVA 2VYVA 3EMKA 1DJNA 4GX0A 3L4BA 5JMWA 1R0KA 4PIVA 2EIHA 4PLZA 2D1YA 2Q2QA 2Q4BA 4IJWA 3IL2A 3ZV3A 5DDIP 3L9WA 2JFFA 3JQ7B 4UVHA 2AE2A 4P4GA 5I7EA 1VL6A 3HFGA 3JQ8B 3WSWA 3SJ7A 1MXHA 2DBVO 3PYXA 1HDXA 1H9BA 1R15A 3KSDO 3MWEB 1PZGA 4U0KA 1GUFA 3H5RA 3CMMA 4HUJA 4TRRA 1NVTA 3OF2A 2IZZA 4RZHA 3ZDFA 3FF4A 5B1YA 5JDIA 1PR3A 1VKNA 1VJ0A 5FI3A 4HFMA 1YE3A 2RAFA 4U6QA 5COBA 3WBFA 2GN4A 3H8VA 1OFGA 5L7WA 2NUAA 1IZ9A 2IYOA 3F6YA 4Y98A 5L51A 1DFIA 2NU8A 3FCOA 3H9EO 3GF4A 4HKTA 2B35A 3GOHA 3OETA 4JLWA 3PFWO 5JDCC 4B4WA 2UDPA 1C1DA 2AQKA 4JIGA 3OJFA 4TRMA 4RF5A 1GEEA 4CM1A 1MC5A 1IULA 3I9NA 1U9JA 4FD3A 1I5RA 5I7SA 2CVQA 5ICSA 4YAGA 1A7KA 3WIEA 1NFRA 2EKQA 4GBJA 3E18A 4GWKA 5DZSA 3QLJA 5IAAA 4GSKA 1HETA 3F5SA 3JYPA 3GR6A 1QLJA 3MOGA 3GFGA 2P5UA 3T4XA 1ZZEA 3INGA 5I9LA 3CEAA 4NJMB 4AJKA 3DBRA 3I5MA 2HRBA 4TKMA 5G4KB 4FBGA 4R1NA 9LDTA 1D8AA 5JNLA 3QW2A 2Q99A 5DOZA 4BMSA 2PR2A 4I5EA 4RF3A 1KETA 3WLEA 3R6DA 3RBVA 1IPEA 5JE8A 2C07A 4NG5A 3TFQA 1WAMA 2OBNA 4YXFA 3GAZA 2QQ5A 3F5QA 1A4IA 1Y9AA 3NT4A 1PJ3A 5JLAA 1JDJA 4J7CA 2Y1EA 5A03A 2G76A 5CAEA 1XR3A 2OZPA 2HJRA 4CM9D 3WWZA 4KTTE 4HFRA 4EI2A 5IG2A 1DC4A 5F21A 1XWFA 1BVUA 4Q3BA 4IDFA 5EL0A 5TNXA 3L4BC 4BV8A 1JVBA 4PRKA 5KVVA 1F8GA 4JK3A 4OXNA 4JJFA 4DLAA 2DQ4A 1ISHA 3ETEA 2VHZA 4WCFB 2EHDA 4Q3EA 1HT0A 1N1EA 3LLVA 3DBHB 2E37A 2EJVA 1L1FA 3WOHA 1EE9A 3T7CA 4MVJE 3UW3A 4B8ZA 2I65A 5CDTA 3FNGA 5FFFA 4YR9A 4J90A 3FTNA 1E7YA 1FDSA 2H5LA 4LGVA 5T6BA 4BB6A 3V2HA 3DXFA 4NBVA 1KVSA 1QSGA 2WD8A 3ANLA 2NWQA 1HTBA 3HE3A 2OP1A 1D1TA 4XRGA 4JBHA 4EUHA 4UUNA 4BO8A 1JKFA 5LDHA 1B8VA 5CEEA 5DF1A 1RJWA 1WDKA 1BXGA 4NZ9A 1HZZA 2JCXA 2O3RA 4B4VA 3SVTA 4IIVA 4BO0A 3D4NA 1HDOA 1U28A 1DRWA 1PEDA 2ZCVA 2GF2A 3DDNA 3PTZA 2O50A 1R4MB 3HN2A 3QE3A 3WX0A 3CKYA 1RM3A 3UCXA 4B3IA 2HMTA 2GO1A 3OEWA 1ENZA 1GPJA 1VJ1A 3LVFO 2FZEA 3ZWVA 3VOSA 1P0FA 4CUKA 1UDCA 4UVEA 3RU7A 3DMTA 5AXBA 4CLXA 2QZZA 3GVIA 5JCJA 2PZJA 4Q3CA 2B5WA 1I33A 4XGKA 1FF9A 3GN2A 3Q11A 1LLDA 4BNJA 1Y6JA 4OJNA 5L95A 1E5LA 1XDWA 2EERA 2XAAA 2EWMA 3GZNB 4DPMA 2XPCA 1FXSA 3GPIA 3TWOA 1D7OA 2NU9A 3T4EA 3UVEA 2PWZA 1OZAA 3H3FA 2W2KB 1Z73A 4KZPA 5ENVA 2B4RO 2V6FA 4CMAA 3ZU5A 2X5KO 2PK3A 1EEHA 2H6EA 4LCEA 4CMKA 1I3NA 5EJ2A 3HG7A 3RC2A 1UXHA 1UP6A 1LSOA 5KWEA 1XSEA 3L6EA 4HNGA 3PHIA 4A73A 2O23A 3QWFA 3ZW8A 1HDCA 1J0XO 3U4CA 2O7QA 1TVEA 4JBGA 3WNQA 4B8WA 2ZTUA 3G3EA 2VWPA 2WM3A 1XA0A 1EUZA 4GGOA 1DC6A 1PL8A 1RM0A 2OGUA 4WEOA 1NWCA 1TT7A 3UCEA 4B7XA 3WQRA 1H6AA 3SC6A 3KETA 2Y1FA 4AJOA 3BTVA 1I10A 3GVCA 4FFRA 3LC2O 5LDGA 4QT0A 5BT9A 4Z9XA 3PJDA 4XQGA 3PGXA 3B6ZA 3BHIA 1MA0A 1GL3A 1ADCA 4LSMA 3WQQA 4I1IA 4ALLA 5JO0A 4ZHSA 3WGHA 3PZRA 3U9LA 1GCOA 3NGLA 3U0BA 5TJ9A 5KVSA 1T1SA 4PG7A 1MP0A 3GZ4A 4UVGA 3P19A 1KS9A 1QYWA 2FHSA 4A0SA 4XKJA 3BMCA 4LRTB 3SC4A 5COAA 3VZSA 3VPXA 1OC2A 1ZUD1 5G0WA 3WGQA 2NLOA 4YTEA 4NJMA 1YGYA 1E7WA 3BMCB 1F0YA 4OKIA 2NTNA 2ZB4A 4BB5A 4PZEA 4WOJA 1ZFNA 2HLPA 1KEWA 2PKRA 2AG5A 4BNXA 4D0SA 1UP7A 2H63A 1H0KA 4P4NA 1KEUA 2GCGA 3BMOA 3LF1A 2YQ4A 2JAHA 3NDIA 4GSLA 1X0VA 1E7SA 1HSZA 1AHHA 1O89A 2BGLA 4CM8A 3CZRA 5K0ZA 3KLPX 3DL2A 3CPSA 4N5LA 1YL7A 4NK4A 3AUTA 1ULUA 4ALNA 3F4BA 4R5MA 2DBQA 3GVXA 4DYDA 1BW9B 2VWHA 2ZKLA 4DIOA 1P74A 3CXRA 4WEQA 2HMVA 1WPQA 2PV7A 3DZHA 4E33A 3GMDA 4CM4A 1WLYA 2XF8A 4ROSA 4ZRMA 2Y0DA 3FBGA 4PG6A 2BHLA 4AG3A 2CVZA 4EJMA 4L8VA 4WKGA 1BXZA 1DPGA 1U1IA 3JQFA 5I9MA 5AYVA 1SC6A 1YWGO 1TA4A 4M54A 4DIBA 1BRMA 2P4QA 3BTOA 5EESA 3FR8A 4KQXA 4A27A 2EP5A 3IDSA 3E6AA 4DBVO 3GEDA 1NPYA 4WASA 1N1GA 2O48X 2O3JA 3RJ9A 3UF0A 1T24A 1N5DA 5CPBA 3JQAB 3PGJA 2GRAA 3OA0A 1Y5MA 1PU2A 4EDFA 2RH4A 1NHWA 4WE3A 2IEBA 3ONFA 2WWRA 3JQ9A 3O26A 3DAPA 4Y6RA 2W90A 4AVYA 1PTJA 1ZK2A 4GVXA 4IDDA 4GX1A 4XB1A 3TNLA 1T26A 1R12A 1XLTA 3JQAD 3ZU4A 4CQMB 1B14A 2RHCA 4BO5A 1DJQA 3ZWYA 3M1LA 3D4OA 4GLOA 3KTDA 3E5RA 3RQSA 2FOIA 5IDYA 3S1LA 3E82A 1ZMTA 1YXMA 3HB5X 1QRRA 3L0DA 3NT2A 5EQDA 4P4LA 1LRKA 5GZ1A 4YQZA 5L7TA 4GVLA 1EK5A 3ZHYA 3AFNA 1VC2A 4ALKA 4MP3A 5KIAA 4YEDA 2Y1GA 4IXTA 2JAPA 2IRWA 2UUOA 1NQ5A 4Y6SA 4BO4A 1MXFA 5A1TA 4M8SA 3MCVA 1LI4A 4XYMA 2X1HA 4RQTA 1YL6A 5DBFA 4HNHA 1HRDA 3GGOA 4RVSA 4ZGWA 3ORFA 2AW5A 2VOEA 4NDNE 1NVGA 3STHA 3KSUA 1F12A 4J2HA 3VVBA 1OAAA 1T2FA 4BIIA 4GAEA 2Y66A 2I76A 3HUDA 3H5AA 3ZNNA 2EKLA 1T2EA 2JD0A 2C7GA 1BXKA 1PX0A 1NHGA 3ULKA 5A5FA 1IHXA 4YRDA 4B3HA 2HMSA 1UJMA 4U8GA 4AICA 1DOHA 4FN4A 1GEGA 3GDGA 1ZSYA 3EY4A 4BNWA 3BZUA 5COQA 1NPTO 4XGNA 4CLHA 3F1LA 3QSGA 3IKTA 5ITVA 3HQ4O 4IMPA 5FWNA 2E6UX 3VHRA 4XCVA 4J7UA 1HYHA 3WGTA 1H9AA 4M87A 4BGEA 1UZMA 3EK2A 3U5TA 1Z75A 1GY8A 3GGPA 1ID1A 3E9QA 4D0RA 1IZ0A 3QVTA 3MJ4A 1GADO 1GAEO 4BMVA 1EVIA 3ZWCA 4JCOA 2YQ5A 4NNJA 1C0PA 1C0LA 1UDAA 3DFZA 1SB8A 4BHTA 1LQTA 3CE6A 3G17A 3LK7A 1H2HA 1UXIA 3JQ6A 4WECA 4D45A 2GNAA 2QYSA 3TL2A 7MDHA 4FSHA 5IDWA 4XDYA 4PLGA 2VT2A 5G0SA 4CMBA 2P2SA 4JGBA 3JQDA 1GV0A 5DBIA 4RQUA 3ZH2A 4D44A 4YQYA 1QV6A 3OJOA 2NU6A 5U1PA 2A9FA 1OBFO 3JQGB 5JCXA 3GGGA 5TC4A 4Y8VA 4IINA 4U7WA 4BKOA 1JAXA 4WLVA 1X7HA 1CQIA 4UUMA 1E1KA 3DO5A 3EZYA 2PD4A 4XR9A 3HZZA 1ISMA 4HFJA 3JD1A 4IZHA 2HCTA 3GEGA 2D8AA 2DFVA 5GY7A 1XQ6A 4Z9FA 4R54A 1E1MA 3I9KA 1QYDA 2H1SA 3WGIA 3NX4A 3JYOA 2J3HA 4E31A 5EINA 3TZQA 3KYDA 1Q7CA 2Z95A 5TGDA 4Y9DA 3OHSX 1Z45A 4OKNA 5IDXA 3ANMA 2I5PO 3BMNA 4J4BA 1QV7A 3DBVO 3LC1O 2GN8A 3QVOA 4AJEA 1RPNA 5DULA 1E5QA 4MIEA 4F6CA 1DC5A 4MIOA 4CLOA 1ZIDA 3SJUA 4IGFA 4YJFB 5IJZA 3WJAA 8ADHA 4K26A 1V3TA 1PGNA 4E5MA 1KEPA 4R9RA 3ASUA 1U8FO 2Q1TA 1DHRA 3GNQA 1QKIA 1LDEA 1G1AA 2B4QA 1JTVA 3UICA 4BVAA 2Q2VA 2HKIA 3O4RA 4MVJF 1HE2A 1YVEI 1YO6A 4XQ9A 1ISGA 1ISJA 3LSYA 4B7CA 3B1KA 4CM3A 5CDSA 4JNKA 4Q39A 2EGHA 5KNLA 2O3TA 3AM4A 3AUUA 2YJZA 1OOEA 2HAEA 4CV2A 4F6LA 1IYZA 1LLCA 4Z0TA 1PJLA 2X8LA 4J7XA 1Y1PA 1UXKA 3GEMA 3HFSA 2PTGA 1YBMA 4CODB 1PJTA 1K5HA 1V0JA 2FMUA 3V1TC 1ULSA 2A94A 2WJPA 4JJGA 1N2SA 2P9CA 4L76A 3D5TA 3ZN2A 1ZSNA 1PS9A 3X2FA 3Q6IA 1IHYA 5H81A 1U2DA 3IC5A 3KEOA 4D3FA 2IXBA 3EW7A 4XJTA 2W2KA 4MKZA 1JAYA 1Q1NA 1PR9A 1H6DA 4BQRA 1P3DA 2GLXA 4L4SA 2FP4A 2YV3A 3B70A 4OAQA 3B20A 3UN1A 3OEYA 5JAZA 1VE9A 4QO7A 2G82A 4F3YA 3P5SA 3GT0A 3F9IA 3GZNA 2CNBA 3VH1A 4XYBA 3I83A 5TRTA 3Q9UA 2C59A 4IJUA 4TVOA 1JWBB 3WTBA 1WVGA 3U4DA 1LEHA 2R6JA 2BRUA 3DTTA 1NR7A 4I9HA 4L4XA 2PZMA 3GHHA 3JQ9C 5DP1A 4A5OA 2ZTVA 2ZTMA 2P5YA 2ZYAA 3ICPA 3K31A 3FD8A 1WZIA 2CUKA 1CWUA 1SO8A 3DZGA 5THKA 3WR5A 3ZI0A 4BS9A 5JCJD 1E1NA 3GG2A 3KSZO 2OXIA 2CFCA 1HE3A 5KKAA 2DBZA 2YY7A 3UH1A 1YONA 2X58A 4F46A 1AHIA 1ARZA 1C1XA 3S2IA 4B4OA 5FEUA 1NPDA 2AEJA 3PJGA 5F5LA 4CL8A 4OHUA 4K9DA 4L0QA 4PCVA 1NYTA 1YB4A 3H5NA 4ZN6A 3OBBA 2CDBA 3L6OO 2EKPA 4FFNA 1FJHA 3MJSA 1RYDA 3C7CB 3F46A 3WGYA 1E7QA 3IP1A 4JN6B 2QIOA 1VJTA 4RPHA 3U49A 4HV4A 1CEQA 4W6ZA 1LDBA 4TWRA 4Z3DA 1ZK0A 2GN9A 4BNNA 3Q1LA 3RKUA 3FPCA 3RCBA 3QJ5A 3OQ1A 4WLOA 3ROKA 1I36A 5H83A 2DU8A 3V5NA 1N7HA 5KJ1A 4G65A 3N74A 1GPDG 3VZPA 2JHGA 5I7FA 1B16A 1FDWA 4QECA 1A4UA 3MWDB 1J4AA 4E5NA 5TX7A 1MB4A 4ZQHA 4BO1A 3C85A 4D3DA 1NFQA 4R1TA 2WD7A 3BYZA 3TZCA 3RVDA 3W6UA 4R01A 5K9ZA 1EDOA 1H2BA 5JAQA 3ZHBA 2BLLA 2X0RA 1EFLA 1T2DA 2HMUA 2VRCA 5DCYA 1EUDA 1GCUA 1ORRA 3EYWA 4FOSA 3WS7A 1JWAB 3TDKA 3CINA 3JYQA 3RBXA 2X9GA 2BFMA 2FPGA 5JYDA 3G1TA 4TZTA 1XKQA 5ITWA 3PI7A 2F1KA 4ALMA 1R37A 1B26A 1NAHA 4R3WA 4RPJA 4R5HA 1GUYA 2D0IA 5A06A 1G0NA 1DC3A 3JQCA 4YAJA 4TMFA 2QZ9A 3EZLA 3ANNA 1BGVA 4EEXA 2YYYA 4GH5A 4IS2A 3ASVA 4CUZA 4MOWA 1GV1A 1ZBQA 4QFCA 5EQFA 5L45A 2X9VA 2PD6A 2HMWA 2IDZA 4DPKA 1E0DA 4IDEA 4N5NA 5CDYA 3WTCA 3I6IA 5BSEA 3EGOA 1DFHA 4K6CA 1DRUA 3RC1A 3V2UA 4DYVA 1EQUA 2CSUA 2Y1OA 5A02A 1I3MA 3FN4A 5JC1A 1A9YA 4CM5A 2FSVA 1L7EA 1I3KA 4CUJA 2PZKA 2VCYA 4Z0PA 3AY7A 3AY6A 4IJKA 1H93A 2NVUA 4E0BA 3DBRB 2IZ1A 4UREA 1DO8A 4JP3A 1E3SA 4I8XA 1HF3A 4A26A 4AJ2A 3AM5A 3FNEA 1Z7BA 3CMCO 3ZWNA 4ONEA 1DAPA 1R4NB 4AJ1A 1V35A 3KOUA 4AFNA 2FRDA 1PL6A 3OQBA 2HDHA 1T4BA 4UEKA 5JO9A 3F3SA 1PJQA 5CP8A 3TSCA 3LT1A 4XIYA 2JL1A 4PLFA 3GDOA 3JQBC 4YWJA 1B15A 3KRTA 1FDTA 3K2EA 4AJHA 3U09A 3G0OA 2VWQA 4NIMA 5T64A 4OQZA 3ENNA 5AXDA 4K6FA 1P45A 1ZXBA 2DPGA 3D5QA 1NBOA 2H9IA 1O9BA 4XYGA 5EMHA 1HLDA 3KB6A 4YAIA 2WDZA 2O4UX 2EP7A 4CMGA 1DAOA 3BMNB 4J9VA 5F5NA 4IDGA 3PPIA 3I9JA 1P9LA 4YJGB 3WG9A 1LXCA 3DFUA 1VLLA 3VPGA 5CG2A 1ZJYA 4MP8A 3A1NA 3FRJA 1B8UA 1LDNA 1VM6A 4RVGA 5TF4A 5FI5A 2Q1WA 2R2GA 1XEAA 5KTKA 2FSSA 1A71A 3I23A 4DQVA 1XU9A 4LVUA 3UKOA 3ETGA 4DGSA 1O94A 1Z7EA 3VDQA 4RVDA 5TIIA 4W9NC 4AJIA 1HYGA 2VTEA 2PZLA 2AEMA 4O63O 2GR9A 2D59A 1EQ2A 3SEFA 4LVCA 2JCYA 1P31A 4BNTA 3W6ZA 4PVDA 1RM5A 3HDQA 5JPIA 4BO7A 1EMDA 3HDYA 4FW8A 3X2EA 2C54A 5A3VA 5EIOA 3E1KA 3ROQA 2DFDA 3ZU3A 1L7DA 2B0JA 2OHXA 4IQ8A 3WXBA 2E48A 4N5MA 4RJTA 5L4LA 1X15A 4BQPA 3BTUA 4KQWA 4UEJA 4DXHA 1WP4A 2PKQO 4KTVE 1Y8RA 5H82A 1PS8A 2ZJ1A 5IF3A 3TQHA 5ILOA 4D43A 3H4VA 4OH1A 3UGKA 3AU9A 2IXAA 3DOOA 5T67A 4YDRA 1LDGA 4DTIA 1DIHA 1FDUA 1G0OA 4HBGA 3ETDA 5JC8A 3RC7A 1SCUA 5CPFA 1HSOA 2XXJA 1KOLA 1M6WA 1DIRA 1X13A 1PJBA 1V6AA 3E5MA 2VNSA 3P2OA 3GFBA 2Z5LA 2VHXA 5A05A 3LLSA 2ZYGA 4TRJA 2I6TA 2Y05A 5TT0A 1N8KA
chains in the Genus database with same CATH superfamily
5FTKA 3EQ8A 5EJ5A 2P1RA 4RLQA 1QF6A 2XR1A 3TCXB 3RUDA 3MG9A 4NPCA 1ICIA 4IIFA 3KJGA 5DBEX 2AMYA 3OZGA 2XZLA 1IXRC 2F1OA 3DOJA 3EPRA 3F71A 3FYUB 1E32A 1QCCA 2KPOA 3K92A 4IJ5A 3JD3A 2DSNA 1XZKA 2QM7A 5FF9A 3SX4A 5JSZA 5JXWA 5KMGB 4CEIB 1GZ6A 4LYAA 1B6TA 4PC1A 4UMDA 1ZRNA 1UJ6A 2PSDA 3FHLA 3RG8A 5HSGA 3E2PA 4F8EA 3CXUA 4EBFA 2Q3FA 1QVAA 1X7ZB 5DJ5A 2YNMA 3MWLA 3OTHA 1HDEA 3JPWA 3ECSA 4YVFA 4DQXA 1E64A 3ZXUB 1QGED 2V7XA 1WRBA 1PJZA 3HA5A 4DWWA 1GDDA 1UBTS 3I2YX 4OFBA 5DBGA 2OAQ1 2E5LB 3H6GA 5CT8A 1NN3A 5SY4A 2W6IA 4WZBA 4L08A 5AVQA 5LD2B 5LWHA 2ZIAA 3GMTA 3VPFA 1L4UA 1NRJB 1RRPA 2WTMA 2HZBA 3OI7A 1Z5OA 4Z6KA 3K6SB 2OM2A 1BHJA 1HLPA 3C8HA 5BSWA 5KYGA 2CXTA 2J4DA 3UEOA 1TU3A 2HK9A 2ZAGA 1DELA 5AMXA 3VVMA 3QKIA 4W5WA 1J06A 4H9GA 5A4IS 3UG6A 1UUFA 4P6VF 3ZDQA 3FOEC 2V6BA 1H5QA 2VCEA 4D57A 5CJJA 2HQRA 4LISA 4NECA 2L0XA 1ZOLA 1OFHA 2CZQA 2QSZA 2ZIXB 1ACMA 2FXVA 3AONB 4YJDA 4ZPJA 2WFMA 4MMYB 5B6PA 1UMCB 2IYAA 2Q07A 2QLTA 3IJRA 2QG4A 1W8IA 1A7AA 2I9PA 4LZJA 5EZQA 2RBEA 2QPOA 2VDNB 1Z9BA 2FVYA 2J4CA 3IR6A 3O4JA 2FV8A 3OJLA 4M0EA 4LHZA 1DV1A 2Q46A 2JBAA 4HJRA 4QD3A 1JMKC 1GRNA 4N9QA 4BVHA 2RGBA 1Z88A 2DPLA 4JR2A 5LQNA 1RQGA 4HP8A 1CD5A 2E55A 5BYJA 2A0UA 4ITRC 4D9JA 1XVUA 2J3QA 3CYFA 4PRZA 4U6SA 3FMVA 4GC5A 4F5EA 3E8XA 3KWJA 2YFQA 1A8IA 2VPIA 3OF5A 3A28A 1K88A 2QU8A 3ENWA 1GGFA 2W00A 3IALA 3W77A 2AX4A 1XNRB 3NC0C 5E3HA 1T0JB 4KXVA 4G9BA 5CT6A 3ILXA 4RANA 2GFIA 5G0SA 4G9EA 5FDFA 3E9NA 1Q7TA 1SC3A 3FPGA 4PHTA 4S3MA 1H1LB 1OU4A 3A3KA 4TVSA 1FMFA 2G0NA 3LA8A 4ID9A 4ER5A 3QLUA 2W6OA 2OV8A 3NHPA 4NBLA 1G41A 1B3BA 1T5LA 2O2EA 4Y2SA 2OBMA 5ICGA 2J30A 1N2CA 3E7PA 3C14C 3UGJA 1OXMA 4ZAGA 4D99A 3QVKA 5L3ZA 3VOBA 3RD5A 3K4HA 4D9KA 4C4OA 1TJ4A 3VKVA 2HRZA 1WZEA 4IHJA 3CLTC 3QVWA 2D1SA 3K9QO 4R2HA 3VNBA 1FPQA 1BH2A 2PH7A 2XEXA 4G23A 1JV2B 2GM5A 3HRIA 4ZTUB 2QQFA 4MV4A 1H1TA 4C2TA 3A4MA 3KYBA 5EXXA 3IIEA 2BL4A 4X71A 3W5AA 1ZXLA 4L8FA 1U8XX 2NO7A 2ZYTX 4RBNA 2J9YB 1KBZA 2QT1A 3KHSA 3UOAB 5G4KA 4CKXA 3WLMA 4C7JA 1VSBA 3MSXA 1V3UA 3T1HB 5EPOA 5DLDA 2NU6B 2RGYA 5F1OA 4YMWA 4HQFA 5T5QA 2JH3A 3AB3A 3BHMA 3E3AA 3LBIA 3TQTA 1RJDA 4AJNA 2OMEA 5ITZA 3G79A 4QPCA 1E6UA 4D1YA 1KOGA 3ZHQA 3QP9A 1XQ1A 1N2ZA 1KAOA 2UYOA 5FBRB 2OA0A 3ZWPA 5CX1A 2PD3A 3F6BX 3DJFA 2BGIA 2QNBA 4FDMA 4R7TA 2J0UB 2RH9B 3A58B 5F1KA 3KQKA 4IO0A 2XCSB 3EZXA 1P9NA 3EWIA 2JASA 1ZCZA 5K3FB 4CF4A 4RWEA 5BN1A 5JOQA 3SXJA 2Q0HA 1CRQA 4CGZA 2VLIA 4MYCA 3WYBA 4J94A 4NCBA 2PZAA 2OC9A 1RRKA 5DIFA 2ZAMA 3SP1A 4NH4A 1KJ9A 3RAPR 1PSZA 3QELB 4G4GA 4LHEA 2F17A 4GMGA 5TMEA 4CR6A 3PTLA 2RIRA 3M49A 4RZUA 3LOUA 4BEVA 4D4MA 3VR5H 2O0LA 1FXUA 1VHQA 2FPUA 4I5FA 5J2TF 1BHO1 4Q9KA 2CVOA 2BV3A 1VBMA 2QG9A 2JH8A 1V4BA 4FT2A 5DYIA 5HK8A 4DSAA 2FMFA 3GGDA 4O4IA 4B7ZA 3D6VA 4BKPA 3A32A 3RAFC 1U0LA 4MQEB 4PRYA 3R6TA 4KX5A 4FE3A 3RUFA 2GAAA 3CONA 4W5JA 3K5PA 1T1RA 4KO3S 2EATA 2G36A 3KR1A 5FNVF 4PQFA 1SOWA 3NHLA 4NV1A 3FYDA 4JJAA 2NO9A 5KSOA 2PVPA 2YVQA 1E3WA 1TL7C 5F7JA 2NVWA 4FMDB 2MYPA 4DCMA 2JIMA 3WLNA 5JECA 4FCVA 3CF2A 2RH8A 1FJ2A 3IOMA 1MD9A 3KL2A 1IQRA 1HKUA 3MM4A 2ZRBA 4K9SA 4W7SA 3W78A 4X5OA 1GTG1 1WNTA 1V45E 2OO5A 3PXBA 3GFFA 4LY9A 4I14A 3TFWA 4K87A 5CCDA 1F5NA 3HSSA 3R7AA 2EAUA 4ZOAA 3QUSA 1LRJA 2BF4A 1YUMA 2H16A 3ABIA 4HEQA 3RJMA 5U9CA 2EFEB 4F1JA 1T25A 1E4VA 1VP3A 1SG6A 2NOAA 1F6BA 2ZCUA 3H1FA 4RMHA 2YZNA 4BBJA 1YF3A 5CX4A 2OD2A 1SU7A 4LC1A 1R4ZA 1N3BA 2IU6A 3RWBA 4AYTA 4TKVB 4DNPA 1CF4A 5IKOA 1FSGA 2QN9A 2QRLA 1ZK1A 5HA5A 4HEJA 4RPGA 1E7RA 1ONNA 2VQ6A 3NIFB 4BVKA 1LB1B 4BZZA 1KO7A 1BYUA 1NM5A 2JKVA 2VHUA 2ZRFA 1YBVA 3FPAA 3PS9A 3IP7A 3S1AA 5KDOA 5JQGF 2OLJA 3PEFA 2NZYA 3DMGA 1QO7A 3K1YA 3AV3A 4H7KA 4RIHA 4CHTA 2UZ3A 3DCNA 3VR4H 1O0CA 1OFUX 2P0YA 4PG8A 2Y77A 4G1CA 2ZAOA 4C3UA 1R5JA 2ANCA 4PZ9A 5AM0A 4BKQA 5KCZA 4UPVA 2J5QA 3H9BA 1C1HA 2BFAA 4MITA 3ZEIA 5BNIA 1Z0FA 1KZ7B 4OL9A 2I4LA 2BEUA 4RL4A 3S4YA 1JU3A 3T5BA 2OXTA 3EUAA 4PRLA 3OQ6A 2RB4A 1PS0A 2AWNA 4REQA 4HUTA 2RAUA 1N2OA 2P3OA 5BVHA 1NUSA 4WNCA 1QQAA 1EE2A 2VN8A 2QUAA 3COVA 4P36A 4OMFG 1HYBA 2ZRJA 3TUIC 2Q5JA 4TOIA 1ML3A 1Q2UA 5FUQA 5AVTA 2XCOA 1MOQA 5GIOE 1GVNB 2YC4C 3KE9A 4AM8A 4EZIA 4IS3A 2NSYA 1Z2PX 4M36A 1OIWA 2VZLA 4DMGA 5B4TA 1QP4A 2OHGA 3QKSA 4B1FA 1Z2DA 4YJHA 4C43A 4IP0A 2CEKA 5KTTA 1OF1A 1M8FA 3D6TB 5T6MA 2P65A 3H2BA 3Q0TA 2BC9A 1XLVA 2C61A 4JJ4A 3WGGA 4BLQA 2IS6A 3LUCA 2FR8A 4DSZA 1NW4A 1NC3A 1PFUA 1FRNA 1V7CA 3ZDRA 3PHLA 2W2TA 4RPCA 4OKSA 1KGSA 1YZFA 3L77A 2OO7A 2V3WA 2WUGA 2Q1XA 3BAZA 3F3KA 4S1VA 4B47A 1PZNA 1ST3A 1YHYA 5HJ2A 1RPTA 3R8FA 1QOZA 4HEA6 1T43A 2O6LA 1T9AA 1XO1A 1P7ZA 1P77A 4OPMA 4R8LA 1GFZA 2IYUA 3BBPA 3I9MA 1Z35A 1P91A 1HE5A 1ONOA 1QHSA 1RIFA 2WYVA 3H1AA 4GIBA 1X6VA 4J75A 5ALFA 5ADUS 4C4ZA 3PICA 1GG2A 2WMDA 5KC8A 4EZBA 2YFYA 3VR0A 4F3RA 1T3SA 2A9KA 4M0CA 1TO6A 3BDAA 1KOJA 3DUWA 2HK8A 2YXNA 3C7AA 4Q4DA 1EBFA 2FFHA 2FFAA 2FSIA 2QUIA 2CVHA 2Z98A 3NCHA 4C4AA 1MX9A 5LOVA 1AO0A 2Y6VA 4GZ6A 4K2AA 1ORWA 1XDGA 2FFRA 3KYIB 3ZBPA 4B0OA 2DE0X 3P9IA 2GJ8A 2IYFA 2VJQA 1CB0A 3DDUA 2C5AA 4FYJA 4BTEA 2Y1LA 3LX6A 1TB4A 4XGQA 4IVQA 2ZATA 1M8KA 4JU8A 2P90A 3W5CA 1SU8A 4Y67A 3BIWA 3JQFC 1E1DA 4EECA 4TX1A 3T7DA 3TL3A 4OU5A 1X87A 4CIAA 2FPPA 3RT1A 1G20E 1RYFA 3DZIA 4DHEA 5K3EA 2GX6A 2ZRDA 1TKCA 3C6MA 1L5GB 2LPMA 1AQNA 2O54A 4QJ4A 1F4PA 4ZO4A 3X1XA 1A04A 1F2TB 2IEDA 2WIBA 2XWBF 5TV2A 4CMJA 1YVUA 4C04A 1XF1A 3SX2A 4LYDA 2TMGA 4GICA 4DLLA 2FW7A 1T1EA 5G3YA 5ALGA 5KWJA 2O0HA 2RB5A 1Q0PA 3HBLA 1KZGB 1U2PA 1LK7A 1YRLA 1T3TA 1A8UA 1E1LA 2AOTA 3LG2A 4TMVA 2YCBA 3V1NA 4B76A 1ZXXA 5E2IA 5G1OA 3RV4A 4AQDA 3IEMA 2WAXA 2A8YA 5CFQA 3AHCA 1XFAA 1SZJG 3LPAA 1LWOA 2VYVD 5JD3A 1E4YA 2DPHA 1RKXA 2J3KA 1L5KA 4B3CA 1YJ8A 5D84A 5DXFA 2V0GA 3EPHA 3Q41A 1I7NA 3WJ2A 2C9YA 2AMJA 3SSOA 4REOA 4Q1DA 4DG5A 3MPOA 5FR1A 2C99A 3GLUA 3PUXA 1MUUA 3OICA 3OZUA 2QAGA 1XCBA 1WPXA 1LBQA 4HPXB 4N49A 4P7FA 1ZIXA 1NF2A 4DG8A 5FFMA 4AS2A 2PX5A 4HLUC 1GT91 4RJKA 4TQGA 1ZGHA 3HGTA 4M1MA 4E31A 3D6AA 3C5WP 1SQ5A 3T41A 2ZWPA 3P27A 3SDZA 2XQKA 4D26A 1G3RA 1M2WA 1NZFA 1V5GA 1COZA 2H54A 2QTAA 2NZXA 5AKJA 5IN5A 4XQ0A 1MNQA 2X9NA 1MC8A 4N3BA 2WYOA 3UT0A 3RK1A 4U8HA 1WUJS 2Z8XA 5FPQA 4G97A 1AMOA 3EVGA 4JUFA 1H2AS 3P0FA 2PGDA 1PLLA 3RSZA 4HF7A 2C7PA 1FCJA 3W4IA 1QDUA 4OHMA 5HIMA 2EOAA 4WT7A 1YDGA 2H3EA 1T9KA 3MN1A 5JARA 3CF4A 3KSMA 2DY1A 1L5FA 3AB7A 3C1TA 4OLHA 3D1VA 2QRJA 2VK8A 4MW6A 1YZLA 1TZKA 1Z6GA 4Q3NA 1BKSB 2PXXA 3R3JA 3SS9X 3VTZA 1LSUA 1KYIA 4B5LA 2GHTA 2IZ0A 3TRDA 1PVDA 5JNTA 2LTAA 3ONWA 2IWRA 4S04A 2QP9X 4UJ5A 4R51A 2A86A 4Q48A 1Y9JA 4G5YA 4YIKA 4WI1A 3FTEA 4FYVA 2DKOA 2WNHA 1UKCA 2HDOA 1NASA 4GR4A 4P2BA 4NU6A 1GFIA 3I53A 4UEOA 4AN1A 2MMGA 2HXGA 4IOJA 3VNUA 1C8BA 2FN9A 3B3QA 1VI2A 4LRSB 5DTEA 3V7WA 1UBOS 4KFSA 5AK4A 4LJAA 5K0JA 3IBTA 4TROA 1GLVA 3M1IA 3SFZA 2PLWA 1CUSA 1QRDA 1WDMA 2ZT7A 2FF5A 5D2CA 4W1SA 3E22A 4KRYA 4W4TA 4BKMA 5ALTA 1FUKA 2FE4A 5CEJA 4QPZA 1I6WA 3WIDA 4CKBB 4ZU3A 4JAVC 3C3WA 3TOVA 1MX3A 1SUWA 1QPBA 1VIMA 2WC1A 3AP2A 4GI2A 2WR8A 1QV9A 4HWRA 2YOGA 3CTMA 2ZRGA 3UAYA 3Q7RA 1MPTA 2MSDB 4B48A 3K96A 1VI5A 1Q7BA 5AO9A 2FW1A 4UCXA 5HTOA 5EAIA 5ICCA 4JUIA 2W6MA 2GJ9A 3KTOA 5FO1A 3HU5A 5IZCA 1E63A 4WQMA 2XITA 5ES4B 1DWOA 1QBKC 4MRAA 4QQ8A 4Z1OA 3AUKA 2HA2A 1G60A 3C39A 1L5HB 2CB9A 3I4FA 2VSFA 3D6HA 3ZCRA 4AW9A 1R6BX 2B0CA 2OGZA 4FONA 1T5IA 2H1VA 3D6MA 2ZBEA 4XPIA 4CMIB 2O7NA 4QYXA 3GELA 1N8TA 5TJHA 1K1EA 1T8SA 2CLLB 1KJYA 2YWRA 3LF2A 1S7CA 2FCAA 3FGOA 2BFPA 4GG1A 4X84A 5H4HA 1DAMA 1FVHA 3I5XA 4IMRA 1FQJA 4RSGA 2VZ9A 1XU7A 4RE5A 4B3JA 2Q3JA 1WQ1R 2XODA 5LA6F 4Q7EA 5EZ6B 2JHPA 2OK7A 1E5XA 2KHZA 3GRYA 2UYYA 5DMHA 4MV8A 4B45A 3JQAA 5JVDB 4RLSA 3W04A 3H13A 3U4MA 2IPXA 3IDQA 3P2YA 4N7RA 4QQRA 4FKBA 4U2EA 2RSLA 1KEKA 4M8IA 5TS2A 1T2CA 1T0PA 2FU5C 2PL5A 3ED5A 3QPCA 3TRIA 3U7HB 4C06A 4S1TA 2VRBA 1KS2A 2A9OA 3TQQA 4BNLA 1GTSA 2ZJ3A 4YHBA 3OMLA 2VNHA 5FOVA 2X4DA 3AQ4A 4ZOLA 5LIPA 2V74B 4G5HA 1EIZA 3SLGA 4UUOA 4Y2JA 4B4UA 2GJ4A 2R1TB 2WIFA 4NBTA 4WWHA 4UQLA 5K9ZA 2OVFA 1Z0IA 4GXNA 5FOWA 4JBNA 5LCXA 3W7VA 2NZ2A 2EEPA 3PWKA 4LCBA 1CUIA 2WG1A 5FUXA 3GLQA 2BZ0A 1FSFA 4WESB 5B55A 3GLHE 2C7OA 3WMXA 3MD0A 4JC5A 4PN3A 1B0PA 4PC3A 5DBHX 3OLCX 4ZJUA 5MN6A 5J1SB 3A1SA 4KN9S 1WS6A 2WINI 2IHTA 1GZDA 3FFTA 3MSCA 2X3FA 4KQ6A 1KIFA 3BHNA 1JNYA 2NO4A 5DXJA 1Z5VA 1GQRA 2BGTA 2NAPA 5D8DA 2EFHB 1G3QA 4HGZA 3RUHA 2HLHA 2FSVC 4GYKA 2G6BA 3U7EB 1M1UA 4RACA 2PWYA 2DOKA 2JDIA 1J56A 4KQGA 2Z4RA 1MV5A 5JMPA 1ZOIA 4BV9A 3K1AA 3DFFA 4BWYA 5TLSA 1XMVA 2AKEA 1G6Q1 2F59A 4C2BA 3TDNA 3CM0A 1R0RE 2G1JA 3L1UA 3LL7A 3ROZA 4A6XA 4XYLA 5I01A 1AGNA 1VSVA 2YZ2A 4Y3UA 4Q7JB 2B8NA 2P11A 2PT5A 1AS2A 1SPBS 2Z57A 3CH5A 3KZ1E 1T0IA 5FIUA 2IE0A 1HMPA 3AI1A 3QVLA 4JKIA 3DQPA 3NYQA 4MB6A 4XD2A 2RBGA 4ZQIA 1Y4UA 3BCUA 1PQUA 1AY0A 1LVUA 3U60B 3LWBA 1YGPA 2ORWA 1L5SA 5EZYA 4KB5A 1YB7A 5ALPA 4DA8A 2REOA 1NXWA 2BMWA 1EVQA 1QS0A 3D43A 1TK3A 3GRUA 3IEIA 3NEPX 2YASA 4GM1A 2FWAA 4TXNA 2M6KA 3TR5A 3ZE0B 1XTUA 1J21A 1J2YA 4NU8X 3DYIA 1GTJ1 4M4SA 4H4EA 4V0KA 1R00A 5G2OA 1WXIA 1XMOB 1WBBA 1MABB 2XIJA 5EIHA 1G7TA 1MAUA 1PT5A 2A1TS 3DSRA 3KE8A 1BD3A 3R3WA 1QVRA 4DM4A 3EZ2A 4QU5A 2UXCB 1RXEA 2FR0A 1FDVA 4DV2B 4BX0A 4YMHA 4JYPA 2IPOA 5BSFA 3HSYA 3TLJA 1HT2E 2OYRA 2RHTA 2EX0A 1ADFA 1ACJA 4O08A 4E03A 3QJGA 4Q15A 1U4OA 1RWPA 2AKYA 3OJCA 4G0QA 5I5GA 1L3BA 1BVYF 4NYIQ 4EG3A 3CLKA 2C1EA 4G56A 4IUYA 1IY1A 4A8JA 1GTVA 5AI5A 2R8ZA 3LZ6A 3WQHA 4D0GA 5IEJA 1RVV1 5ER9A 2AXQA 2VT3A 5EVCA 4OIFA 2QL5A 1QHEA 2ZG6A 3LYAA 3KZKA 5D3MB 2RJNA 4EFLA 2ZBFA 3OE7D 4IXMA 4TV8B 2RHRA 2FUNB 3AR4A 5A9SA 4KLRA 4UMEA 4PHFA 1Y1LA 1BDMA 2NU7A 3WA7A 3ZH9B 4PZCA 4XX0B 2WOJA 3S2GA 4BN0A 4XM1A 3MT8A 3JQ8A 2PHZA 1KA9H 4CNBA 4DKXA 5JWRA 4BBPA 4R2LA 4C7VA 1I7SB 5DEIA 3GJ7A 1J39A 4RTSA 3RC8A 1A27A 4H35A 2H85A 4Q02A 3U44B 3SC3A 421PA 2X0IA 1W87A 2WJHA 3FFBA 5ENZA 5HS6A 2BSQA 3G8BA 1CY6A 3S27A 1SHJA 4MUMA 1N32B 3MUNA 4QTZA 3UQZA 2PL3A 1JSZA 2X76A 4NR0A 2WY2D 4MVJD 4D96A 4G37A 1GILA 1A95A 4TTAA 3LLUA 1B0UA 1LC0A 2YHIA 2AIRA 4J3JA 4C20A 4FB5A 1CK4A 1IM2A 1UAYA 2C2YA 3UWPA 1D8TA 4CM7A 3FKQA 4NHOA 3IOYA 4FDTA 3F8TA 2C2BA 3G59A 5FLEX 3SNKA 3I61A 4B74A 3AVTA 2ATXA 5JNUA 3LPCA 5DHRA 1SIWA 2C31A 2VJCA 3E0QA 3HH8A 3NGMA 3X1YA 2DH5A 3EOZA 2QVLA 1XJWA 1U1DA 4YCJA 4MS1B 3RS8A 2QYOA 1GXSB 2MSNA 5IH3A 3OCJA 1MAWA 1NQOA 1GQ2A 1H6CA 1T0UA 3PNQA 1WOYA 2ZDHA 1Z29A 4MTCA 4QYIA 2PS0A 4H77A 3H1PA 3SZUA 2VDOB 1X19A 4LF4B 3HBNA 1I24A 2IELA 4CF6A 3DJYA 3FCSB 2BELA 4E21A 2ACVA 3ZWMA 5B3JA 4ZGGA 1OBOA 3O2NA 1GSHA 3KXPA 3WAKA 2I87A 3MTEA 2ZBPA 1A4XA 2NVUB 1A69A 4PONA 1E2MA 4V0MA 5ALZA 2C4NA 3C6ZA 2H11A 3N87A 4OA8A 4RKQA 3S8MA 2NVOA 3GU3A 4JZKA 3VBCA 1PG0A 1YBAA 4QNNA 3ZYZA 5DN6D 1UFVA 4K40A 2YDXA 1PZEA 3HBJA 3FJYA 5LB4A 1IUNA 2VHCA 3ANXA 3ORRA 1E2QA 2VEDA 1RWNA 2VNJA 1YRWA 4OLJA 1NOIA 1Q3TA 1BMQA 3SF8B 1E2PA 4CM9A 4GKVA 2R1ZA 3B9PA 3A9WA 4W7HA 2AHOA 4BGUA 5A7FA 2FLKA 2N1MA 1VA4A 2OESA 2AN3A 4B87A 3JYHA 4BNHA 2NO0A 1T9BA 2W7TA 4YY3B 2HA5A 3MERA 3R3XA 4IV5A 4OOFA 3CEPB 4PGFA 1PQ4A 2V6GA 5PNTA 2CYCA 3TZ6A 1V8OA 4J9UE 2CHVA 3WNCA 4R1QA 2KS6A 6REQB 1WB5A 3EIFA 1KJ8A 5J4VA 3TPFA 1KP9A 1ECGA 2C5SA 4YJ3F 4EMBA 2NADA 4X45A 1ADBA 2AK2A 2FX2A 3AEUA 3UW1A 1JS1X 2ECPA 1RR6A 2OPHA 4INPA 1JTEA 2PT7A 3ILYA 1OHHA 6CHYA 1W46A 1JE0A 2IHBA 4L3WA 1SD5A 1DDGA 1W44A 4LXUA 1GNPA 4O2AB 4MWZA 2ZRLA 4BNZA 4EW2A 2DWQA 2Y0BA 3KDSE 1I0ZA 1EVZA 4MWEA 3GGCA 3NOQA 4TTVA 1RQNA 3MINB 4DRXB 3OFKA 1B73A 2F4NA 4FGWA 3MRVA 3O1LA 1JDNA 1MJFA 3NTOA 4J0FA 3TCKA 1F38A 1PR5A 4TLDA 4H4CA 3ZHXA 4OQLA 3B6MA 5JBNA 4WXEA 4E5UA 3FNFA 4MVJI 1OKKA 3PC6A 1EFUA 4HWPA 4L5YA 3AI2A 4DQUA 5KYKA 1PWZA 1QH8B 3B7PA 1MB2A 1EJ2A 2EJBA 3O0DA 1YS7A 3SXPA 1C3XA 4QSMA 3TIXB 5F7OA 4OU4A 4DDWA 3VR2D 3O38A 3FNQA 2ZWMA 3IPLA 4G5QA 4E32A 4JB0A 1G5QA 2DFLA 4RHCA 1CNMA 5G0VA 2QZJA 1A88A 3C2QA 3TIVA 1JHXA 4II2A 1PJAA 3PUIA 4YBZA 1DTWA 3I1FA 2AQHA 2BDTA 4GLBA 4BP3A 2I3BA 3JWHA 1DFGA 5ALDA 4G0XA 5E3JA 3W3AH 1A7UA 3OZTA 2HADA 4X54A 5AOVA 4YUYA 5C8DA 4WH0A 4XJVA 2HGSA 1HH4A 4CEJB 4GP9A 3GLHB 2Z1NA 3AEQB 3VJKA 5LXTF 2PGIA 3WNZA 4Z2AA 4B0PA 4KIJA 4WX2B 1F0NA 4YRRA 4FX5A 1WZUA 1CIPA 2Z8YA 2OGSA 1Q1EA 3E9MA 1SZCA 5HJ5A 1XYGA 5L6LB 2XADA 4XR4A 1A8SA 3GJ4A 3Q2IA 4CQLB 4JZYA 1AUVA 2Q6OA 2HYIC 3E2MA 4A7PA 4M9SA 2SKDA 2EWWA 2A5LA 4J0GA 3UCFA 3OZ7A 4MLZA 1P2BA 2ACEA 1KPIA 1R0LA 3DHEA 4EGAA 4F4CA 1U4SA 2LIVA 3R9XB 3CX7A 1SVMA 5D87A 2CLFB 3RBZA 3VI3B 4DLWA 3LUHA 1U0GA 1LW7A 3FWNA 1H4TA 1UWCA 3N8HA 1E3DA 4GQAA 2C4MA 2AG8A 4MMXB 4OA5A 3JQ7A 5I51A 4KR9A 5IYZB 3V8QA 1P5RA 3CBQA 3DF7A 4EIWA 5J43A 3WQSB 3DQZA 5SY9A 2VHYA 4CKEB 5C80A 2VP2A 4E11A 3DC7A 3T7AA 4QOHA 4INAA 3IQFA 3TLKA 3MHPA 3OUZA 3ADOA 4FS3A 3P2KA 3R7SA 1IOLA 1F3OA 2GN6A 4MVJA 1TJNA 4JI6B 1HRKA 3OJEA 4NENA 2X0DA 2ZM5A 4MAMA 3UT6A 4DCNA 5FULA 3GA0A 3E03A 4LK3A 4ZU6X 1J24A 2BFWA 2YVKA 3DP9A 4HNTA 3UV3A 2PUAA 3ITDA 4UARA 5G02A 1IEQA 4DSTA 2PL9A 2MR5A 4KGDA 3M33A 1KYZA 1V9LA 2YNMC 4GYYA 3VZCA 1JVSA 2GAOA 5JI2E 4XIIA 1Y9EA 4R2JA 4B17A 1V39A 3MT7A 1I2AA 4FP9A 2OSVA 2C0CA 4HLNA 4L5CA 1F2UA 1JLLA 1DAEA 2O7SA 4DL9A 4LGYA 1ZX1A 1ICEA 1Z36A 3EXEA 5EMLA 3W8EA 3WWCA 4CT0A 4WGGA 4Q4AB 5B37A 3Q10A 2R7KA 4KGXA 3GRZA 4BEJA 3WNVA 1OH7A 1G5FA 3VKGA 2RONA 3Q72A 1TEVA 3HR4A 4FGJA 2NQ2C 3PTAA 4FOOA 3GNLA 2EF0A 1NQAO 4PBRA 5GJCA 1TJ3A 3TKLA 1GD1O 4H6VA 4KO2S 3K35A 4DWOA 3BCRA 1WETA 2XA9A 1P6XA 1VYHA 1WX1A 4YCCA 4I1UA 5BSMA 2BEWB 4L6IA 5FJIA 2ADMA 1ESMA 2VUSA 4WPGA 4UCWA 4C1BA 4EY8A 3FRHA 1NMXA 5JTTA 1M2NA 1P4HA 4Q05A 4DLSA 2H1CA 1JG4A 2PCJA 1XVTA 2CB0A 3DUFA 4KFUA 1JP7A 4IXDA 4MRSA 3VH2A 3FGZA 2ISSD 3DBHA 5KSZA 4RLFA 1ZCAA 4PCAA 3CB2A 3HDJA 4QRHA 3R74A 1IRXA 1IAQA 1E9AA 4EHAA 1DVRA 4R1SA 3HFJA 4F4HA 1NBAA 3MXTA 4FNMA 3RSHA 1RYEA 2DUUA 1ISRA 3GRPA 1SU6A 3VPHA 3N8NA 1OE0A 1QTQA 3I32A 4YLYA 1SB9A 1UMKA 2Z1MA 4U2FA 4PZDA 5TQ2B 3WGLA 4DEXA 5IM4A 1N9GA 3OPVA 1QH8A 1I0LA 2RJ3A 3PXAA 3PWTA 4E13A 4EQ6B 2HU7A 2XXBA 2ID7A 3FFXA 1QLWA 4MGYR 4AN0A 4EJ2A 4GLLA 2PR7A 5CM2Z 3ENKA 1Q7EA 4R16A 3WGJA 4ALIA 5JYEA 3HZRA 4M0MA 3H0CA 1TM3E 1T3HA 3ROPA 3KZNA 4DCVA 3H75A 5J4LA 2IJGX 1UQTA 1PTJC 1LDMA 1GQFA 3E7WA 4EPYA 4M9XA 2V5UA 5CXXA 3C4QA 4MS1A 4TKZA 3VH4A 4KQHA 4CTOA 2Z58A 3DHYA 3RROA 5I48A 3ZX4A 2WF5A 5CFMA 2F1HA 2XCQA 1E4EB 3KZCA 1X80A 1KKLA 3OEHA 2ODAA 4G0NA 5F3RA 1KAQA 4OHCA 2GLUA 3MTJA 3QMPA 5DX0A 3N7TA 1MJHA 1OHHD 1OBHA 4HGRA 3EQZA 1RNLA 1VMIA 4ENQA 4M7RA 1L5RA 1RC0A 1FE8A 1OT3A 2VP0A 1TD1A 4M21A 4BLRA 3OX2A 1FFBA 1S02A 4I6EA 5KUTA 1HDGO 1BEUB 4YJGA 1ZLYA 3DOUA 3P0HA 3W9BA 1JHAA 3A3YA 3ZD9A 5JJ5A 4XWKA 2VDVE 1DSSG 1JFFB 1H22A 3PPWA 1RBMA 4V0LA 1IPFA 3M5CA 4KR0A 4K03A 1OPRA 3CLHA 3OWOA 3ZIAA 1RWBA 5DNCA 2I80A 3MTAA 3RC9A 4B85A 1JW9B 2BI7A 2ZANA 1PR0A 4PVCA 3ND9A 5KPDA 4UU0A 4P3NA 3WHKA 2PGAA 2Q9AA 4TMTA 2Q45A 4TT8A 2WHYA 1S3SA 2WWYA 1N7GA 5TE9A 4DA6A 3UTDA 2XUOA 3PNMA 4ZJZA 3L8ZA 1TUBB 3D64A 3DZJA 4OYLA 5CHEA 2AA3A 1D1QA 5FYDA 4BVJA 3WWYA 4C01A 1FOEB 4DJAA 1D2MA 1Z74A 4MUGA 1UMCA 2P9GA 3FKSD 2RGUA 4WLOA 4X6XA 3WLIA 2TMDA 1QFYA 2R6CA 2VUTA 3F7OA 3ADCA 1OB5A 1C3JA 4I81A 4DDTA 2H4JA 2O3UA 4WBNB 3CNHA 2DWOA 3DWFA 3GFRA 4B3SB 1P6QA 4YREA 3A9CA 3FDJA 2D5CA 2QLBA 3LT2A 2Q9BA 3MOIA 3ZI4A 3ADPA 4HPWA 2BGNA 5LBIA 4P80A 5JPDA 2C3OA 3R40A 1U7XA 5IVPA 1XZAA 4KWEA 4NC9A 1CULC 1OLUA 3PUVA 4RZ2A 5TQVA 4L73A 3H1BA 5SY6A 3W9SA 4JI7B 4LZPA 3VU0A 3LO5A 4JYCA 2L69A 2M1XA 2C84A 3VU8A 2R3SA 1D7AA 1E2GA 1L9KA 2Q1SA 2WYUA 3QMMA 2I22A 5M04A 4RVOA 2QJOA 2RK4A 2GM9A 2OO5C 5EQJB 4R0NA 3OU6A 1HZZC 4UHEA 4P54A 1L8XA 2YZ7A 1TRKA 3N53A 3N6XA 3QEMA 4WY2A 4AJ4A 1IUKA 3AVQA 5B2EA 1N3IA 2JD1A 4C7OB 3D3NA 5HRUA 4E5KA 4HMOA 4GZLA 1L4FA 3WB2A 2VXOA 2YDYA 2HA0A 1M1YB 4WZAA 4P8RA 2X9LA 1KY4A 4V1CB 2A1UA 1GKIA 2CLSA 4DEVA 3B1XA 1I4DD 2QQEA 1Y80A 3PHJA 4YT4A 3L5KA 1F0KA 2W2MA 1TCAA 3VC1A 3IOBA 4OREX 4Q3AA 4AU1A 1JFTA 1VHLA 2B98A 4LE2A 1BWSA 3V1KA 5BUSA 1FFXA 1XRSB 4I5DA 1U99A 2RC6A 1EPUA 3AUFA 5CLHA 5HPYB 2VR1A 3K20A 1YDEA 1YACA 1EINA 4WCDA 4L4RA 3TD9A 1E5VA 4NABA 4QUKA 3CZMA 2J9ZB 2HV8A 1CJSA 4MWCA 3QA9A 3O8DA 1UXGA 1ZWKA 4ENSA 3F97A 2GEDA 2D74A 2C2XA 3IE1A 1N33B 5D01A 1O5IA 3PYLA 3WB1A 4PLVA 1JLSA 4JS0A 4ZDWA 1MEEA 5MF6A 1HA3A 4CQLA 4J6EA 5EA2A 3FY4A 1JAZA 1N2IA 1V2HE 1KZ1A 5I7HA 2WUWE 1KZ6A 1ZKDA 3H83A 3Q9SA 1ZGGA 5JW6A 1VBKA 3P7MA 3B1JA 2O05A 2O3SA 2BJHA 1M83A 5TMDA 1EGVB 1OI4A 3P97A 3SAJA 4AZSA 3OZWA 2BGUA 3ZDZB 3MJEA 3V2GA 3Q7EA 1N2CE 2XB6A 4YJHB 2ODWA 4CDRA 1IWOA 1F17A 3AF1A 3OZCA 2HK6A 1CJCA 1P2GA 1P1KA 3SZRA 2YXDA 3GJSA 1S96A 4F8YA 4DSOA 1DEOA 3EIEA 1N6KA 2XT6A 4X9XA 1VFNA 3AJ9A 5LD2C 3FOBA 3GG9A 3BMQA 1ECFA 4PSAA 1JE1A 5JWOA 1V8BA 4RXTA 4V2IA 3ZU6A 2FN8A 3K0FB 2GRJA 1YTUA 2G63A 2ZDQA 4L9RA 1X38A 5C9ZA 4M37A 3T7TA 1SEPA 2PNJA 4L4YA 3N59A 3JCZA 4HAWA 2XBMA 4ZQCB 4WERA 4F3KA 2WU4A 1ZLXA 5E1OA 2O1WA 4G4JA 1JA0A 5F76A 2PMEA 2HO5A 4GOJA 1N57A 1A1VA 2VOJA 1BE0A 3NWPA 2Q9CA 4GOND 2F3PA 2IV3A 2MINB 1E6MA 1RZVA 5KNBH 2V6MA 1Y82A 3J7TA 4O25A 4IIJB 1XZDA 1UC4B 2W0SA 2ZSJA 1JH8A 4DRXA 3B3JA 4JQOA 3EXEB 3EH2A 1Z0KA 4LJKA 1LX6A 2I6FA 4QEDA 4U5QA 1ZI6A 2B6NA 4HTFA 4JVSB 5TVKA 2B37A 2EF1A 2FWNA 2ZJ0A 1CFJA 2XEDA 3TZKA 3FLMA 4KO1S 2E6KA 1N2CB 1E5DA 2GEVA 5KJEA 3DZFA 2BFDB 3R0XA 1PJ2A 4URFA 5ALMA 4YBRA 4K8RB 4Z1MD 2EDAA 4ZTZB 4UHBA 3FUUA 3B1VA 3CRVA 3ENQA 4HDMA 4LRUA 3DAFA 5I5EA 3QE2A 4GP7A 2XVZA 1KDZA 2Y68A 1G8FA 3BL5A 3UBTA 3AINA 3OHPA 3W4KA 4GKKB 4G24A 4DJDC 1ISPA 2QW0X 4KWHA 3VR4D 2BAGA 2C9ZA 4MLCA 5DOVA 5H70A 3Q98A 4F4IA 5B6JA 3UJ3X 4EAAA 5JMWA 3UENA 3T1QA 4F0JA 3UOWA 4I0WB 4Y30A 1VLMA 3PSHA 3TQRA 2VDKB 2Y92A 1YRQA 4LPSA 1A2OA 3IL2A 5D86A 5DDIP 3L9WA 1Y3IA 3C4JA 4M7WA 5CLQA 4TLCA 5TDHA 2LV8A 4UVHA 3ZLVA 3B78A 1NQWA 3AESB 3PUWA 2G1PA 3V8NA 5I7EA 1NBEA 1EB8A 2BP7B 2IH2A 4KH0A 4JV5B 5FPKA 1OZ0A 2C5GA 2JA1A 4C0KA 1AMNA 1UINA 2J45A 2J31A 1XZCA 3CLSC 3DEFA 4U0KA 3A1CA 4DDKA 4IOLA 9GPBA 5JSKA 3STUA 1CRPA 3D1JA 3CMMA 3EZ9A 2QTZA 2QAGB 1NJ5A 2IZZA 2ZUDA 3FKSA 4QPDA 4RZHA 1UFQA 2G4VA 3CRNA 1VKNA 4UNIA 4GGMX 3ZDFA 4EVRA 5B1YA 1UDRA 1QE3A 2WMYA 3W0LB 1W5TA 1BS9A 1GZVA 3FPJA 4NATA 3VR4A 1XNGA 4U6QA 4A8TA 5IT9A 5FV4A 1Q91A 1FDOA 4O8ZA 5E4YA 5L51A 1DFIA 2G72A 1UBEA 4G1FA 4C30A 3GF4A 4HKTA 2HN9A 3HJRA 3OETA 4JLWA 2CDNA 1NX9A 2A0YA 2HWUA 5JDCC 4UQOA 5KHLB 1KMNA 3CW9A 1NQUA 5BP7A 4IEFB 1I7LA 2W2NA 4RK1A 4TRMA 1GEEA 2WPDA 4GZMA 4YECA 2I2BA 2P7IA 2CFOA 1U9JA 3HNOA 4GRAA 2RBKA 3G8YA 4FQ7A 5EEGA 2B1IA 5EWJA 4YAGA 5I7SA 3C5EA 3S29A 1E4EA 1A50B 2YUIA 2C7RA 2GBIA 1LPMA 3QX9A 3LUGA 1CXZA 1WUIS 3OC0A 3SY8A 2GK6A 2BE7A 1VI6A 3QLJA 4LDZA 4L22A 3EXG1 1HETA 3HBMA 3F5SA 2BCGY 3JYPA 2EBUA 3MOGA 3FMFA 4BASA 3G2LA 4Y9TA 3A6ZA 4H0NA 2XF2A 3TOSA 5BNWA 5I9LA 4W5OA 2WJ6A 4AKEA 3A6EA 3I5MA 4DUZB 1E4OA 2GILA 3TM4A 3GRVA 1QIMA 3ZJYA 5KWVA 4R1NA 9LDTA 3D8TA 5B3JC 5DOZA 4Q4AA 2CXSA 3KAJA 4NEQA 2FUKA 3RBVA 3RNOA 1T1GA 4FEGA 5JUWA 5JE8A 4NV3A 2IBTA 1RKQA 2GPSA 4NG5A 2OCLA 1WF6A 2OBNA 4YXFA 1XRQA 3F5QA 3PV0A 1A4IA 1J7KA 3DDZX 5FTLA 2HF9A 1R6AA 3VUEA 3MYYA 2WKSA 4TTQA 1JDJA 2GWRA 2XNDD 2HSWA 2Y1EA 3DKPA 3FCUB 3IHKA 4RMGA 3UY4A 3G2JA 5A03A 5CAEA 3HB0A 2HJRA 3FSEA 2D54A 3RBAA 1GPUA 4TTPA 1KIMA 3CKMA 3HFRA 2AJTA 1LJLA 3M5WA 3N0XA 5JZSA 3K0SA 2I34A 4KTTE 2DULA 1FX0B 2FFBA 4RY0A 4YO8A 1DC4A 2OHVA 1R74A 1XWFA 2V4MA 3GFQA 1XTQA 4KACA 3EGXA 1RD4A 3G2HA 2A3NA 3G0BA 4FEEA 4IDFA 4Q3BA 3X3HA 3S99A 4ZKDA 5IXJA 2PN1A 3P9KA 4BV8A 5AVZA 4M0UA 1NXVA 1L8OA 2OAGA 1RQPA 3JZMA 3ZOZA 1S2NA 3SCZA 3FAZA