4XGNA

Crystal structure of 3-hydroxyacyl-coa dehydrogenase in complex with nad from burkholderia thailandensis
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
255
structure length
255
Chain Sequence
HHHMEIRDNVFLITGGASGLGAGTARLLTEAGGKVVLADLNQDAGEALARELGGVFVRCDVAREEDAQAAVAAATKLGTLRGLVNCAGIAPAAKTVGKDGPHPLELFAKTITVNLIGTFNMIRVAAAAMAANEPAPTGERGVIVSTASVAAFDGQIGQAAYAASKAGVAGMTLPIARDLSRNAIRVMTIAPGIFETPMLLGMPQEVQDALGAMVPFPPRLGKPAEYAMLVRQIFENPMLNGEVIRLDGAIRMQPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-hydroxyacyl-CoA dehydrogenase
publication title Crystal structure of 3-hydroxyacyl-CoA dehydrogenase in complex with NAD from Burkholderia thailandensis
rcsb
source organism Burkholderia thailandensis
total genus 90
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xgnA00
2TMGA 4ZHSA 1Z75A 1LRJA 4MVJE 3MJSA 4KWIA 4ZD6A 1T2FA 2P4QA 4Z9YA 2V6BA 3DMYA 3LYLA 3KZVA 3N58A 3NV9A 4F6CA 2EG9A 5ICMA 1XYGA 3LT1A 2VHXA 1T4DA 3KEQA 1X13A 2PKQO 4P4LA 4HUJA 2EKPA 4EJ6A 1E1KA 1XQ6A 1YONA 3K31A 4CMEA 1H6CA 3L6DA 2PKQP 2Q1UA 2WSBA 4A0SA 1VI2A 1LDMA 1UZLA 2AXQA 2EXXA 1U5AA 2EEZA 1MC4A 1EK6A 1LDYA 3ZI0A 1HDGO 1CYDA 2WJPA 5B4UA 4CMGA 4CR7A 5T5QA 2CDBA 4OO3A 4LGVA 1UP6A 1LLUA 5JMPA 4D44A 3W8FA 1CERA 2PNFA 3QQPA 1EBUA 3GMDA 4WJZA 4CMHA 2O48X 1H5QA 3WR5A 2E37A 3IAHA 5U4QA 3MTGA 3M2PA 4MIYA 3L4SO 3UXYA 4JK3A 3UCEA 1F14A 3E1KA 3CZMA 4IDFA 1A7AA 1TEHA 3QVWA 5TC4A 1Y8RA 1WP4A 4N5MA 1AGNA 4U8GA 2J5RA 3PIIA 1U5CA 3FPCA 2EKLA 2VTDA 3HDQA 3HE3A 1LBEA 3W4KA 1SO8A 4CM3A 1JVBA 4CMIA 2PY6A 3KBOA 1OFGA 2J6IA 5ER9A 4YEDA 3JQ7A 4MKXA 2O4CA 1DRWA 4EEZA 1IPFA 5IN5A 3C1OA 3IKVA 4BNWA 4WUVA 1Y1PA 3VDRA 3WG9A 2OO5A 2CY0A 3BMCB 4LCJA 3W8DA 2CF6A 4GI2A 1KS9A 1N7HA 4NMHA 1WW8A 4PLWA 4FFMA 1ZK2A 4WLOA 1LRLA 2VYVD 1Y81A 1H2HA 4XYGA 4BNGA 1E6EA 4EYEA 3PLRA 1E7QA 3GFGA 4LK3A 1RM3A 4NHEA 4YAIA 3QA9A 2PR2A 3HUDA 4J3FA 3L9XA 5C37A 3K92A 1P1IA 4O0LA 2X23A 4JJGA 2SCUA 3VDQA 1UUFA 2X4GA 1QV6A 1P0CA 4IIVA 2CVZA 4MOWA 4RCVA 5K9ZA 1SNYA 4KUHA 3PWSA 2VRCD 2EW2A 3BZUA 4R51A 1HDXA 2OMEA 3U3XA 3DO5A 1XCBA 3V1UA 4CUKA 4E32A 4F6LA 4DRYA 4BHTA 4CMCA 4FJ1A 3EDMA 1ADCA 1BG6A 4M54A 1EDZA 4PLHA 3PI7A 1YKFA 1PJBA 3D0OA 4IZIA 5EIOA 5L51A 2HKIA 4YJHB 2YYYA 1NVTA 1Q7GA 4PLZA 5JDCA 4TRMA 1J5PA 2Y1DA 1VJ1A 2FMUA 3CINA 4Q39A 2Q50A 5EL0A 2HJRA 4IY1A 5JCJD 1MLDA 4JCOA 3E9NA 1SC6A 5BSHA 1UXKA 2CDCA 2D4AA 1Y8RB 5EN4A 3IJRA 5I7FA 2RAFA 3INRA 2X6TA 3HADA 3RC2A 3QVSA 4XIJA 3M6IA 1ZK1A 4YAGA 5FWNA 5JW6A 1B7GO 1K6JA 1FDUA 1YB4A 1HLPA 3C24A 1R66A 2VRBA 1W6UA 4Y9DA 4XGNA 2J3IA 3WTBA 3JD0A 2RCYA 1CEQA 4XB1A 3KTDA 4NFHA 1R4MA 4BGUA 4YCAA 3TL2A 5A3VA 1LQUA 1IL0A 2BHLA 4Q3AA 4B3HA 4DYVA 2EHDA 3P2YA 2X5KO 3KM0A 3MOGA 2EP7A 2FRDA 4S3MA 2GYYA 1Z73A 2TMDA 3Q6IA 4CM1A 4E2XA 1T24A 4NJOA 3QWBA 3ADOA 4PGFA 4J2OA 1HSZA 2PD6A 1AN9A 2Q1TA 3G0OA 3KLMX 4J49A 1IOLA 4JJIA 5B4VA 1GZ6A 3FWNA 2CSUA 5KNLA 3L6EA 1LDEA 4RVDA 3RASA 4DA9A 4J1SA 1C1DA 3QE3A 3RKUA 4J4BA 5FYDA 3Q2KA 3ZGYA 3I5MA 3AY7A 4IBOA 3TZKA 2VOEA 4GPD1 3RUAA 4Z0HO 1JWBB 2VN8A 4N54A 3AY3A 3ONFA 4IIUA 3FNGA 4XR4A 1NX6A 4IS3A 3AM4A 4IJVA 1DXYA 2HMVA 2DTEA 2ZIZA 3RUHA 3AK4A 1PWXA 1UH5A 2Q2VA 1I2CA 4R9RA 4OXNA 1JA9A 4A03A 1NNUA 1BXZA 3S2GA 1SOWA 2IODA 4BNVA 3VZRA 3BMQB 4TSKA 5EERA 1ZH8A 5U9CA 4RJTA 3L4BC 2JFFA 3LSYA 3UICA 3TF5A 3GZNA 1P77A 3Q0EA 4XJTA 3ZWMA 2IZZA 3H9UA 1O8CA 3QP9A 3RC9A 4BVAA 3GN2A 3R3SA 1QYDA 1AUPA 1YB1A 4M49A 5LC1A 2DTXA 4Y67A 4DPKA 4FQ8A 4RLHA 4DPMA 1R15A 1X15A 4W9NC 2X8LA 4HV4A 1C14A 2W98A 1OBFO 1WZEA 5T8KC 2QRJA 3ADPA 1NQAO 2C20A 4ZRNA 1MXFA 1ZSNA 1DIGA 1I3NA 1JWAB 2BF7A 5HA5A 5JDIC 3OIDA 4CQMA 3H6KA 3ROMA 1M75A 5A06A 1PGJA 3V1TC 5L3ZA 4QFDA 1PZHA 1NAHA 3DAPA 3UAGA 1NWCA 1UDCA 4B3JA 2O3QA 3IP3A 3IOYA 2JCVA 4RPJA 3WJAA 3HJAA 5F3RA 1J49A 1HEUA 1WPQA 2WM3A 4I9NA 5EQFA 4JGBA 4ZQFA 1MXHA 1B8PA 3STHA 3G17A 1PQUA 4CJXA 3MEQA 3DZBA 4C7KA 1ZVMA 2ZK7A 2Y1OA 3H9GA 4LSWA 1CF2O 3OECA 5KVVA 3MJCA 3AUTA 3OIFA 1HDRA 1Y5MA 4RLSA 5A03A 4TZTA 1C0IA 1U8FO 1UP7A 1UXHA 3VPSA 1C1DB 1GD1O 4YWJA 1YL6A 1LUAA 3KYCB 1N2SA 1WDLA 3ST7A 2P4HX 5A5EA 3BTVA 1NP3A 2D3TA 4NIMA 3I6QA 4TQGA 1MG5A 2FPGA 1E7RA 1VKNA 1P9LA 5CP8A 4HNHA 3VH4A 1KEWA 1LXCA 4R3WA 4FBGA 1M6WA 1R0LA 4DIBA 1OMOA 3CMMA 1R12A 1Q1NA 4DREA 5L7TA 2BFMA 3QLJA 3WSWA 1EDOA 1HT0A 4S1VA 2NM0A 5DCYA 3PGXA 2DKNA 3GUYA 5KIAA 3DOOA 2NNLD 1P1HA 3JYOA 1JKJA 4D7AA 2C7GA 4UUNA 2AQ8A 1KYQA 4LVUA 1Q0QA 5AVOA 4EITA 2WMDA 1HKUA 1O9BA 1GUZA 1WVGA 3ULKA 2X1HA 5G4KA 5THQA 4CL3A 2C2YA 1ZMOA 2GN9A 3EZLA 3C7DB 3TQHA 3RUFA 4CR8A 4LN1A 1M6HA 3ANNA 2VHYA 3GVXA 3K5PA 1D1SA 1P1JA 3WQSB 2X9GA 5L4NA 3E8XA 1U4OA 2EV9A 1DO8A 1FDVA 3B1JA 2J5KA 3JQAB 5L4SA 2YV3A 4CL8A 2EF1A 3ANLA 5ITVA 1BMDA 3EK2A 3WGTA 4PLFA 3F3SA 2HO5A 3BMNB 3WB9A 1BWSA 3AUAA 4IDBA 1PJ4A 3AI3A 3EUWA 3WTCA 4K26A 2HMTA 4NBRA 2W2KB 4RO0A 4TRNA 4XGKA 2BI8A 4Q3EA 1PL7A 3AFNA 3VZPA 3ORFA 3RU7A 1GEEA 4A73A 2BLLA 3S2EA 3GEGA 2DUWA 4XD2A 1PIWA 4BO9A 4N5NA 2EW8A 4II3A 3KB6A 3O4RA 4P4GA 2DAPA 4QT0A 3WMWA 1C1XA 3JQDA 2NTJA 4GX1A 2XXJA 4CM9D 1TA4A 1H6DA 4MO2A 4UVEA 3NTOA 3ZV6A 3Q2IA 3V5NA 1UAYA 2EJVA 4YB8A 3EW7A 5KOIA 2C29D 3TOXA 2IEBA 4EI2A 3ZW8A 3VAZA 5JC8A 1NWHA 4MP3A 1LEHA 2WWRA 5DOVA 3DL2A 4XDYA 1HYGA 2IZ0A 2VHZA 1DLJA 3VVBA 1DIHA 1IZ9A 4TROA 3PP8A 1QV7A 3HB4X 5I9NA 3PRJA 1Q7CA 3OF2A 3QVXA 4ZVVA 1ADGA 1OC2A 4L4RA 5C7OO 4A7PA 2YV2A 4U0KA 2XOXA 3AJRA 4IMPA 4WASA 4E13A 1YQDA 5F21A 1O6ZA 4GMFA 1GYQA 1A9YA 3OQ6A 3HHPA 3DOJA 2FHSA 3ZWXA 2FSVA 2Y66A 1Y9EA 1IYZA 2B0JA 5G4KB 1BW9A 2B36A 2IDZA 4BO6A 2VT2A 4NZ9A 1QMGA 3G49A 1FMCA 3KO8A 5AXDA 4AJNA 3ZH2A 1ONOA 4PVCA 1E3LA 4MVJM 1P0FA 4KQXA 4YT4A 5JC1A 2HK9A 2A92A 1GV0A 3ZHYA 3F47A 3PLNA 2OP0A 2D8AA 5G0SA 1NFFA 4BV9A 1I36A 1XGKA 3FCOA 2VYNA 2P68A 5A4DA 5TSDA 4BO0A 2FZWA 1B3BA 3OH8A 3NDIA 4HNGA 3GH3A 1KEPA 1B15A 4E5NA 5ICSA 1QLHA 1D3AA 3RVDA 4IJWA 3HQ4O 1I0ZA 1LJ8A 3DHEA 4HY3A 4NBTA 3CZRA 4PLGA 1AXEA 1E5LA 4XRGA 3UHAA 3QVTA 1MG0A 3FD8A 4IDCA 3KETA 1DEHA 1ADFA 4IXWA 1Z82A 1V3UA 1MA0A 3JQFC 4E6PA 4OM8A 4CLRB 4OSPA 4W9NA 1DHRA 2WD7A 1CQJA 2UAGA 2Q45A 3OEWA 1NQTA 5T8KA 2NVWA 3ZU4A 2DTDA 2OOSA 1IZ0A 1LTHR 3JQ6A 3K2EA 1DC6A 4QO7A 5JDIA 3IC5A 2YFQA 3PHIA 4KDFA 4KMSA 2VZ0A 4FD3A 4M86A 4WLEA 4BNFA 1BDMA 1D1TA 5JNLA 1UXIA 4YT2A 1X1EA 3ONDA 4CV2A 3ETGA 4YA6A 3DAFA 2YHIA 2YJZA 4L8VA 1B14A 1ISGA 4XQGA 1NPYA 1QP8A 3WNQA 1LLCA 1G0OA 1LDBA 3DBLB 3F5QA 3IL2A 2VZ8A 1I33A 1I8TA 1T4BA 4YACA 3UKOA 4MVJA 4Z3KA 2V7PA 3WYEA 1HETA 3GEDA 4OYRA 3OBBA 1I01A 3I23A 4KTTE 3GC6A 3UW3A 1Z6ZA 4R3NA 1H94A 1O5IA 3ABIA 3GVHA 2VQ3A 1BW9B 3WFJA 2OL4A 3FWZA 4ZGWA 2HAEA 2X5OA 2BFAA 2B35A 4ZRMA 2FSSA 3NX4A 4BNUA 3T7EA 5EJ2A 4RDHA 2FZEA 4Q3NA 4Z0TA 3RU9A 1ONNA 3TFOA 4BB5A 3GVCA 3DZIA 2DPGA 3I9OA 4RF2A 5T57A 5L95A 4FOSA 2Q46A 4CMBA 3K6JA 4EUFA 1PJQA 1YOVB 3ZV5A 1DFGA 3D3WB 1PWZA 4E5MA 3GDFA 4E31A 4O5OA 3GN1A 2OGUA 3RJ9A 3U4HA 3PYXA 5KJ1A 3H5NA 4MJLA 4QECA 1K6IA 1DC3A 1EVJA 4G65A 3VKVA 1JTVA 3DBHB 1A72A 3IIEA 4YRBA 1KIFA 3P2OA 4I5DA 1X7GA 5L7YA 3WBFA 1P33A 3KV3O 3F4LA 1M67A 5IZCA 2PGDA 1N5DA 3VPHA 2PH5A 4YTEA 1N92A 1EUCA 1OOEA 3JV7A 3GA0A 5B37A 2ZTLA 1EFLA 2IXAA 2FPIA 4OKNA 3GK3A 5IDWA 1DC5A 1GU7A 2WD7B 3AWDA 1HDOA 2AG5A 2QRKA 3LLVA 2ZJ1A 4F3YA 3TZ6A 3RC7A 3C1TA 3TNLA 4D46A 2OBYA 3VOSA 4WNCA 1K2WA 1GUFA 1TVEA 4RQTA 3GG9A 4UVDA 2AQKA 3GAZA 2YZ7A 5KTKA 4TKLA 3E5MA 2PLAA 4IUYA 3PHLA 3LVFO 5CEEA 2VYVA 3OMLA 4IJKA 3PVZA 2YHIB 3FF4A 2C54A 2UVDA 4K6CA 2AMFA 4EJ0A 3BMCA 1E3JA 2PV7A 1ISHA 1NPDA 3KSUA 4KOAA 5F5LA 5AYVA 1GZ3A 4QSMA 2NACA 3WWYA 3WFIA 1R4NB 4XQ9A 4K1LA 2X7HA 2WYWA 1T2EA 1JU9A 3TPCA 1WDKA 4YQZA 3MZ0A 1IE3A 1SB9A 5I9LA 1IPEA 2VRCA 2GUGA 3TJRA 1DIRA 1X0VA 4ZJUA 3D5QA 3H8VA 4N7RA 1T1SA 5TX7A 4E2WA 3NJ8A 1A4UA 4ND5A 3LLSA 1ZXBA 4DLLA 4CR6A 4DMLA 1JDJA 3L0DA 4PZEA 1XWFA 2Y0CA 1XLTA 1ZFNA 4JBHA 4WCFB 2X0RA 3ASUA 2I3AA 4O6VA 2PZJA 4ALIA 2Y68A 4J2HA 4PLTA 1OZAA 3GNTA 4J9UE 4YT8A 4CM5A 2YW9A 1F0YA 1ZEMA 4FN4A 1V9LA 5F1KA 2GLXA 4FFRA 3PHGA 4L9RA 1YQXA 5EQDA 4DBVO 4DWVA 4KP7A 3HFSA 1ZMTA 3PXXA 4FFLA 5JCJA 1YL7A 2O3SA 3SXPA 1SEVA 4BNKA 2VWPA 3NT5A 5JYEA 3I83A 1D7OA 7MDHA 2HK7A 4K9DA 2G82A 2HUNA 4FFPA 1GPJA 3TFQA 5FEUA 2NU6A 3NDJA 1N9GB 1DJQA 3H3FA 1ZCJA 4BGIA 1H9AA 2JD1A 1YBMA 4YJHA 4RZIA 2CVQA 4FSHA 5BT9A 4ND1A 2YDXA 1XQ1A 4I9HA 1T25A 2FR8A 2EGGA 3GR6A 1W73A 2NQTA 4FS3A 2NLOA 3AY6A 2O50A 1YE3A 4TMFA 4B3IA 1H6BA 3OETA 4HXYA 1C0PA 2LDXA 3HDHA 2ZTVA 3QWFA 5ENVA 4ALMA 1WMAA 1PJ3A 1ISMA 3HZZA 4JX8A 4QO8A 2P5YA 5KKCA 4KUGA 3DZHA 1DFIA 1BRMA 2HK8A 4Z6KA 1BVRA 1SEPA 5DBFA 1I3LA 2AE2A 5MDHA 3DBRB 4R41A 4OQYA 3GGOA 2NVBA 3Q11A 4E33A 4OQZA 4DGSA 3ANMA 2IYOA 3LU1A 3JD4A 5JS6A 4PG6A 4A26A 1GTMA 5BSFA 2CUKA 2F1KA 2WYUA 4GMGA 1K0UA 3T4XA 2I67A 5A9SB 2BD0A 5B1YA 4N18A 4IQ8A 1QKIA 3I52A 2QG4A 1LLDA 5CDUA 3H65A 3GHYA 5HS6A 5JXWA 4NPCA 3U9LA 3ICPA 4K6FA 3BMOB 1PJSA 4I5GA 2Y1GA 5L7WA 1Z7BA 3NYWA 3KLPX 4CV0A 1HDYA 1T2CA 3F1LA 4FFNA 1GZ4A 4JJFA 2ET6A 1N8KA 1NVGA 4LVCA 1Y5RA 4BKUA 1MFZA 5ILGA 1R37A 5JO0A 5A02A 5FI3A 4M87A 3PGJA 2QRLA 3QW2A 4YJFA 1KVTA 1SPXA 2V6GA 3EYWA 3DB2A 2W8ZA 4WEOA 4ZA2A 4PZDA 5CEJA 4BMVA 1EVYA 3WOHA 1PX0A 3PEFA 2B5VA 4ND3A 3F46A 3GDOA 4CM4A 5COAA 3H5AA 2R2GA 4XB2A 2JCYA 3GMSA 4RPHA 4GX0A 5TJHA 2OXIA 4FPXA 4AG3A 2H5LA 3GNSA 1A5ZA 4YRAA 2NU7A 6ADHA 1MV8A 1Y6JA 3MJ4A 3R6DA 1P74A 4XGIA 4BKPA 4J1NA 2DC1A 3BMQA 5JSFA 3H9EO 4MP8A 2B5WA 1LI4A 1SBYA 2I3GA 5IN4A 5IXSA 3PIDA 3JYNA 3M2TA 4BNHA 1GQYA 6LDHA 1XHLA 1PTJA 1UP4A 1DLIA 3OIGA 4RVHA 2NUAA 4OH1A 2BMAA 3PWZA 5DULA 3TZQA 4D45A 4WOJA 4D0RA 5L40A 2VUTA 2Z95A 2C2XA 1AHHA 1C3VA 4W4TA 5COQA 4CLEA 1KC1A 4IZHA 1ULUA 3ZN2A 2ZQYA 4IJUA 2P9CA 4J4HA 4NBVA 2ZB4A 1GEGA 1UDAA 1KEVA 3B1FA 1HZZA 4E4YA 1UDBA 4OHUA 3V8BA 4CQLB 3EVNA 3OA2A 1DB3A 5JMWA 2HJSA 2J3HA 4GKVA 3ASVA 1D8AA 2CZCA 2NU9A 1ML3A 1F12A 4YBZA 2QYTA 3ZWAA 4XYBA 3O8QA 1RKXA 4FOOA 4YDRA 3JQBC 4D43A 1BDBA 3HSKA 1B8VA 2WYVA 4GWGA 1ZIDA 3WGIA 3WIDA 1FK8A 5JE8A 3ZNPA 1F06A 4PIVA 3SLKA 5IDYA 5DP2A 1O95A 2GR9A 4B4VA 2BFPA 4RQUA 1HLDA 1EQUA 2UV8A 1UZMA 5ES3A 4E3ZA 3LF2A 4YR9A 1YB5A 2EIHA 5IXYA 3FN4A 3KYCA 1PGNA 3EAGA 4W7HA 3AUUA 3PPIA 1B0AA 2POQX 4U5QA 5U1PA 4YJFB 5FFFA 4MIEA 2NU8A 5HTOA 5G4LA 1XEAA 4BOYA 2PZKA 3WGGA 4YAJA 4YPOA 3IKTA 3C1AA 2PWZA 3C3XA 3G3EA 1PZEA 5TLSA 2A35A 4CM4B 3OA0A 2G76A 4ZQBA 4D3DA 2DFVA 3LC2O 1Z7EA 3HFGA 4MP6A 5G0UA 2DBVO 3V2GA 4IMRA 3WLFA 1ZXLA 1E5QA 3O26A 5THKA 2Y99A 2P5UA 3AI2A 4YJDA 1QYWA 2BKAA 1FF9A 3EZYA 1FDSA 4CV3A 2XPCA 2H1SA 4MKZA 2PKRA 1QR6A 1H6AA 2GPTA 1NM5A 1L7DA 1GR0A 3RCBA 3DMTC 2DLDA 1JVSA 1C0KA 1IB6A 1PSDA 4PG8A 5K0ZA 5BNFA 5CG1A 1YJQA 3JQAA 2JAHA 1BTOA 2ZYDA 3GG2A 5AXCA 4HADA 4TKMA 1Q2XA 4OIMA 4L75A 5LCXA 2Q1SA 2YFHA 1EE9A 2PZMA 4ALJA 3BMNA 5K6AC 1YO6A 1FJHA 3GNQA 5DBIA 4WLUA 3SLGA 1QLJA 2BRUA 2W2KA 4FR5A 4CLOB 3AOGA 4BNMA 1M2WA 1IULA 5ENDA 4CM9A 1T1RA 1W4ZA 2HDHA 4RF5A 5IDQA 3NGXA 1PQWA 1DOHA 2YQ4A 4MVJH 4RDIA 3I9LA 1DRVA 2YUTA 2O3UA 2G5CA 3G1UA 4LRSB 3O8QB 3U09A 1XIVA 2UUPA 2GZ3A 1KVUA 3GEMA 4IQGA 3V2UA 1ZK3A 3IMFA 3GLQA 3CTMA 2NVUA 5GY7A 4Z0PA 1WZIA 1YXMA 4HX5A 1LRKA 3C7CB 2CNBA 2LDBA 1GL3A 3T4EA 1YL5A 2FWMX 4B4OA 4PRKA 4XCVA 1GDHA 4ILKA 2VNSA 5TIIA 1NVMB 1U4SA 5L45A 4DXHA 1QSGA 1NXQA 5TQVA 1HXHA 3BTUA 4QX6A 4R4JA 1R16A 1MFPA 2FR1A 3H9QA 4KWHA 4W82A 2IXBA 3KYDB 1O89A 4WK6A 4RVSA 2DQ4A 5JAIA 1E77A 2AQIA 4OKIA 4WCFC 4DQXA 1ID1A 2OFPA 3QWHA 2H6EA 3ZNQA 1ZO8A 4OOEA 1EBFA 3Q1LA 4GGPA 2UUOA 4BO2A 4LRTB 4I08A 1U3VA 3H5RA 1GFSA 4Y6RA 2W90A 4GL4A 2NV6A 4FC7A 4AJJA 1UXJA 2GASA 4ITUA 1T2DA 5ILOA 1E7YA 3DZGA 4E5YA 3PQFA 2Y93A 4U6QA 1PJLA 2RBEA 3WS7A 4EUHA 4KTVE 1OAAA 2GRAA 3DHYA 3UGKA 4RVGA 1TI7A 5BNTA 2GN6A 5JAQA 5C3MA 2VUSA 2VWHA 3D4NA 5COBA 3BAZA 4DYDA 4KZPA 1RJWA 1VPDA 4QXMA 1XA0A 1FXSA 1EUDA 3WGOA 3QRWA 4KDEA 3COSA 4Y6SA 3FBTA 2BI7A 1N1GA 1F8GA 1P31A 1HDCA 2ZQZA 3DDNA 2CF5A 1ENOA 3AUSA 3H4VA 4R9SA 4B7UA 4GVLA 4XX0A 4ALNA 4G81A 2HMWA 2OUIA 4WOKA 4R1TA 1I24A 2PFGA 1V35A 4DIFA 3I3OA 1E0DA 2QHXA 2PTGA 1VL8A 3A1NA 3HDJA 3O9ZA 2O4UX 5EMHA 4AJHA 3OFSA 3QV1A 2O3JA 8LDHA 4H7PA 3NT4A 3VH2A 2XXBA 1X14A 3INTA 2W2LD 3IUSA 3NT2A 4P8RA 3GPIA 4CLRA 1I3KA 4K28A 3NTRA 2NVUB 3RUDA 4A2CA 1LQTA 2Y0EA 4EUEA 2B4QA 5B4TA 2AEMA 1Y7TA 5JYDA 4F46A 1XU9A 1RWBA 2BFOA 3ENNA 3QWAA 4HFRA 3ZWWA 1HDZA 3NDRA 3UVEA 5KWEA 4D41A 3WQQA 1AXGA 4LSMA 4BO5A 2J5QA 4R68A 3WSVA 3AU8A 4CPDA 3ZU5A 1LSJA 3S55A 1RM0A 4D0SA 3E18A 2WE8A 4GLOA 4Z9XA 2GO1A 3UUWA 4RVFA 3VTFA 4W6ZA 5KJ6A 4R54A 3W4IA 3BHMA 3JQBA 3RJ5A 3DBLA 3NJ4A 2VOJA 4G2NA 3PFFA 1ZNQO 1A7KA 4UREA 4D3FA 1ONPA 1ISFA 3SJUA 1L7EA 4PFJA 2P2SA 3B70A 1SCUA 5KVCA 3KXDA 3PYMA 1ORRA 2HRBA 1BGVA 3W1VA 3ITKA 2ZTUA 4ROSA 2WEKA 3S1LA 1E3EA 4MVJI 4II2A 3D4PA 4HFMA 1YDWA 2Q2WA 1KBZA 2O2SA 4DIOA 2HU2A 3S2FA 2VTEA 1PS0A 3AOEC 2IYPA 3G79A 1A4IA 3VVCA 3RQSA 4JIGA 4RGBA 4CMEC 5CAEA 4GX5A 2G17A 3PDUA 4H3VA 4WLFA 1YOVA 4CM8B 5L53A 3GQVA 1VKOA 3D3WA 3WWZA 5AXBA 3A4VA 3DFUA 4BV8A 3R0IA 5BSGA 4NU6A 1MB4A 2HMUA 1R6DA 1I10A 4L73A 4MIOA 4WLNA 4Z9FA 4HWKA 1JKIA 1WWKA 1PJ2A 2IZ1A 3DBHA 1U1IA 4B7CA 3UH1A 4CMJA 2JAPA 3L4BA 1Q0HA 5JPIA 2JJYA 2YV1A 5L4LA 1CRWG 4HFJA 1AHIA 3ON5A 3PYLA 1NHGA 4DTIA 1A9ZA 2EERA 3F5SA 3OJOA 1YWGO 4NK5A 3DWFA 1TT5B 3NTQA 3V1YA 3VH1A 4BNTA 3GGPA 2DBQA 3DHNA 3E03A 3KVOA 1V0JA 2BH9A 4YXFA 3KHUA 5K6AA 4DQUA 1RYDA 1U2DA 1PGPA 2ZTMA 1E3WB 5A05A 4RV9A 2HQ1A 3DBVO 2QX7A 3JYQA 2J8ZA 4D79A 1EEHA 4IGEA 2E4AA 4DLBA 1JLLA 3JD1A 3NUGA 4TZKA 3OQBA 2AG8A 1YS4A 4CV1A 3C85A 4C7JA 4B79A 4LMPA 1A71A 2BGLA 2C0CA 3E9QA 3Q9UA 3IUPA 3RIHA 1J0XO 1DIAA 1R4NA 3NGLA 3OP4A 5GMOA 3AI1A 4M55A 1KVSA 4INAA 1E1NA 3QY9A 1H9BA 3DTTA 4XQEA 3H2SA 3D64A 5HWSA 2D5CA 3BIOA 1GV1A 2C5EA 1HTBA 4CUJA 3WDSA 5LDGA 4P4NA 2RHRA 3RFXA 3E82A 4GH5A 4WCFA 3I6IA 3N7UA 4QQRA 3ZV3A 3JQ9C 4MVJF 3MWEB 4G5HA 1EVIA 2XAAA 3AFMA 3JD2A 2O7QA 5KJCA 4X54A 3ETDA 5G0TA 2OZPA 3PFWO 1MGOA 5TNXA 2A94A 2DVMA 1DPGA 4URFA 1LNQA 3D5TA 4FDAA 4BO1A 3FPLA 4ALLA 3LT0A 2WE7A 3DTYA 3JQCA 4CMKA 1I2ZA 1U3TA 2ZYAA 4RPLA 4BKQA 9LDBA 1EE2A 3E9MA 1N9GA 2X0JA 4PZCA 4WNIA 4PLCA 5AOVA 5EESA 5I8ZA 3IP1A 3ROKA 1E7MA 4BNIA 1PZFA 3WGQA 3L77A 3K9QO 3ETEA 2GDZA 4EEXA 3FRJA 1GADO 4D42A 2ZJ0A 4JROA 5F1OA 3GF4A 1YBAA 2YHUA 4GSKA 3ROPA 2GERA 2X0IA 4JBIA 2EKQA 1MX3A 3GZ4A 3ZNNA 1I2BA 1ENZA 1ZJYA 4M89A 2VHVA 1PS8A 3FNFA 4NDNE 4EW6A 1RYEA 4R16A 2Y1EA 4L0QA 3FSRA 1F8FA 1OC4A 3DBRA 3UFXA 2D5AA 4OOFA 4Y8VA 5FI5A 5J23A 4B4UA 1Y8QA 1PL6A 1JN0A 2JKVA 3LT4A 4MDHA 2FY8A 5KCZA 1OI7A 3FTPA 2JFGA 4B7XA 4FIZA 3I4CA 4DLAA 3GGGA 1E92A 4CLHA 1UJMA 1ZSVA 3WQRA 4E5PA 3VPXA 5A9SA 4DL9A 4J1TA 1VRWA 4RORA 4E12A 1GAEO 5AQ1A 1ISIA 4JN6B 1XR3A 3MJTA 4AL4A 3BMOA 4DBZA 1K5HA 2J3KA 3SC4A 3W6UA 2G0TA 4UVHA 1QG6A 1J4AA 4OSOA 5GZ6A 3IQDB 3K2BA 3O03A 2OBNA 4P22A 3SX2A 5IF3A 4GSLA 3PWKA 1E7WA 3NAQA 1ZK0A 3TL3A 1DAPA 5TF4A 4WEQA 1RM4A 1UR5A 3RD5A 1Y9AA 4XA8A 1U28A 3GOHA 1Z45A 3FR8A 2YQ5A 3I1JA 2JHGA 3ZCXA 1WDMA 4IS2A 3EVTA 5DP1A 4XJSA 1P1RA 3WYCA 1X0XA 3VTZA 5BSEA 3FHLA 4J0FA 2NADA 4MVJD 2HSDA 2NTNA 4NFYA 4QFCA 4TRJA 1TXGA 4NJMA 1KVQA 1PJCA 1SOVA 1Q7BA 2VWGA 5HRUA 1M66A 3BTOA 4IINA 3CEAA 3KEOA 3AOEA 4ESOA 3TRIA 4IDAA 3ZWYA 1U7TA 5HM8A 5JFOA 2QZZA 2O2YA 5IG2A 3D7LA 1LLQA 4A10A 3Q9NA 2ZYGA 3TWOA 1KC3A 5IJZA 1LC3A 1EVZA 2CD9A 3ZWOA 2JL1A 4NQZA 2O3TA 3WICA 1DRUA 3ZNOA 2BGMA 1E7SA 5KKAA 5T67A 1M76A 5KVSA 4AJOA 4NFSA 1NAIA 5GZ3A 4JQCA 4R5MA 5I7VA 1T26A 1YGYA 2I5PO 3WGZA 3ZZNA 3JTMA 4AICA 4OL9A 2QIOA 3JQFA 4BO4A 1Y8QB 3I9MA 1GYRA 4GGOA 4HP8A 4J1QA 2AEFA 4MKRA 4CQLA 1D4FA 2J3JA 4XRRA 5A1TA 1IHXA 3A9WA 2Q1WA 1S7CA 4J0EA 1LSUA 1PGOA 2IEDA 3B6ZA 3ITDA 2ZB8A 2CFCA 1V3VA 1CWUA 4DMMA 4H16A 2PH3A 3GUCA 4R69A 3K96A 4TWRA 1HF3A 1BHSA 2BELA 3ZWVA 1GQ2A 3P7MA 4B4WA 3I4FA 3U49A 4DQVA 1R0SA 2FP4A 4GQAA 1L1FA 4RZHA 1NR7A 4ONEA 5CPBA 4MPDA 1XSEA 5CEFA 5DZSA 5BQFA 1DAOA 1EK5A 3JYPA 3RBXA 4DVJA 3WBBA 1NFQA 3EMKA 3OJ0A 3BTSA 1P45A 2Y0DA 4MINA 3F9IA 2WDZA 1HYHA 3JQGA 4R1UA 1R0KA 3TZCA 2AHRA 2E49A 3OICA 4UEKA 5CPFA 4ID9A 3GT0A 2NQ8A 4BL5A 3OHSX 1A27A 4FJ0A 4I9UA 3ZDFA 2ILTA 4WKGA 5A3JA 4XDZA 2QQ5A 1QYVA 4GKBA 5A9TA 5JCXA 4LISA 4BO7A 3A28A 4NI5A 4NJMB 4IPTA 4Y98A 4EBFA 4O1MA 2R00C 1KY5A 4XR9A 4AJKA 4AJLA 4UUMA 1CDOA 3JQ9A 1VJ0A 3P5SA 3VHRA 1YJ8A 4WLVA 1NTOA 4AJ2A 5H82A 3ZWCA 4QUKA 2C5AA 5IZ4A 1I30A 2Q2QA 3PZBA 5ADHA 1HZJA 1TB4A 1LU9A 4XEHA 1QYXA 4PCVA 1RM5A 4JBGA 3ZU3A 2A4KA 2A9FA 3OSUA 3RBVA 4XKJA 2H9IA 3HWRA 5ITWA 4J7CA 3CUKA 3WYBA 3TN7A 5CHEA 3VH3A 4LCEA 5LDHA 3D4OA 4QTZA 3U0BA 3F1KA 4Q3DA 5CDGA 2ZB7A 4PRLA 1P1FA 4XIYA 4U0JA 1EFKA 4CLOA 3KSZO 3TSCA 4PVDA 4FB5A 4BS9A 4D3SA 2B37A 1KERA 5JY6A 4EDFA 3QIVA 4U7WA 4CMIB 3CPSA 2WTBA 1QRRA 1H93A 2E48A 3HG7A 4I5FA 3JQ7B 4WPGA 4L4XA 2Y05A 4F45A 3PDJA 2HRZA 1MP0A 1LC0A 3WLEA 5T64A 4BO8A 2Y67A 4CM7A 5DBGA 5CDSA 4JLWA 3RFTA 1ENYA 3L9WA 3WX0A 1PJTA 3AW9A 1W8DA 3O38A 2DU8A 1WMBA 2PD3A 5CFZA 1JW9B 2B83A 5EPOA 3CKYA 2QZ9A 3JQGB 5TRTA 1I32A 1NQOA 3R3JA 3ZV4A 2HMSA 3KYDA 4AVYA 4GAEA 4J91A 4KUEA 4XYMA 4CM6A 2JHFA 4B8ZA 1ARZA 4IDGA 2DBZA 2W4QA 1P1KA 3GHHA 4NG5A 1ULSA 3PQEA 3VPGA 1WNTA 1E6UA 3SVTA 2WD8A 1NBOA 4B8WA 4ZQHA 2B4RO 2CDAA 1B16A 2C82A 2O23A 1DFHA 2PGLA 1KVRA 4RPGA 1O94A 2JD0A 4JP3A 4A27A 2PK3A 4P38A 3NKLA 1QORA 1LDNA 4PN3A 2NWQA 3VC7A 1PEDA 4BUCA 4EJMA 5KJFA 2E6UX 2GD1O 1LSOA 2V6MA 5F1PA 4NBWA 3DOCA 3GVPA 2UDPA 3DFZA 3KUXA 1WLYA 4J7XA 4LMRA 4L76A 4ZN6A 3W4JA 2QW8A 5BR7A 1ZEJA 1Q0LA 4N5LA 3WNVA 1KETA 1LA2A 4FC6A 4J7UA 2HCTA 3ONEA 4BIIA 1EQ2A 5MGBA 2AQHA 2P9GA 4BNXA 4UEOA 3DZFA 3RUEA 1B8UA 1ZBQA 4R1NA 3CIFA 3HB5X 3RROA 2W2LA 2PGJA 3UCFA 4M8SA 3RAJA 1I5RA 4L74A 3HDYA 4WE3A 3RC1A 5G0VA 4GX2A 2AA3A 3OJLA 3KRTA 4J90A 4I5EA 3L6OO 4PLVA 1UZNA 4RF3A 3TZHA 2ZCVA 3TDKA 1PGQA 2GNAA 1XDWA 2D2IA 4YAEA 4UVGA 1ZZEA 2IE0A 4Q3CA 1VL0A 2DUUA 4GBJA 1ZKMA 4XZ3A 2JD2A 1B2LA 3HN2A 4J43A 3PJDA 3MOIA 1EZ4A 1SAYA 3DONA 3IS3A 2RIRA 2NTVA 1U9JA 3EGOA 1T2AA 2GF2A 4RVUA 1DJNA 1R4MB 3CE6A 3CXRA 3HN7A 3EHEA 4J4TA 3V2HA 4IDDA 4BO3A 1PS9A 3X2EA 4AJPA 4BKOA 4NR0A 2OP1A 2GCGA 2DM6A 3ZWNA 4DC1A 1AE1A 3U4CA 4TVBA 1FDTA 3H9JA 2O7SA 3JQ8A 1VC2A 2GSDA 2Q3EA 4IXTA 1KOLA 2ZB3A 3JYLA 4I1IA 5DN9A 3SC6A 1VL6A 5IDXA 3AU9A 1U7HA 4W99A 3DAGA 3C7AA 3GDGA 1B3RA 4YT5A 3SJ7A 3WIEA 3OEYA 2HLPA 3D3EA 5I7SA 2OHXA 1NFRA 4BNJA 3VKUA 2G1UA 3QVOA 1WAMA 1ISJA 5ER6A 1K3TA 1UAGA 1YQGA 3DEYX 3FNEA 1PR3A 4CUZA 2RH4A 4ZICA 1H0KA 2DPHA 5HS4A 3AM5A 4TVOA 2ZATA 1ENPA 1X7HA 2VHWA 2EP5A 3I9JA 4PG4A 1HL3A 3CH6A 1CJCA 5DOZA 5I7EA 4BKRA 1SZJG 1QYCA 2GN4A 3KYBA 3MCVA 3DC2A 5A9RA 4I8XA 4MVJP 4Q3BA 5G0WA 4OAQA 1LDGA 3RI3A 2X0NA 2AE1A 4BGEA 4CM8A 1DC4A 9LDTA 1HRDA 3PHJA 3H7AA 1DSSG 2R00A 1RPNA 4ND4A 1MC5A 1NR1A 4Q9NA 1GUYA 4J16A 1CQIA 5I9MA 3U4DA 3VZSA 3BA1A 3MWDB 1X1TA 3GZNB 1LSSA 2O3RA 2QYSA 4BMSA 3QJ5A 5IZCC 2VWQA 2JFHA 1EMDA 3G1TA 4UUPA 3WXBA 2UYYA 4DUPA 2Q4BA 3C8MA 5B12A 1U8XX 4OMUA 3LC1O 4YJGA 3FR7A 4A5OA 1ZK4A 1TT5A 2VZ9A 3MJVA 1U2GA 4OXYA 4WCDA 2XF8A 1JAXA 3ROQA 1I3MA 3MTJA 4BNNA 1HE2A 2D1YA 2B4TO 4W7IA 4Z3DA 1CETA 4E21A 1PR9A 1HE4A 4CQMB 4XYLA 1H2BA 3RFVA 5CG2A 3IDSA 1YVEI 3EY4A 2P91A 1DIBA 4UUOA 1P3DA 5JAZA 3GRPA 1E3WA 5C7LO 3UCXA 4M1QA 4L4SA 4IGFA 1UXGA 2AW5A 4GVXA 5F5NA 4IM7A 4DC0A 3QWIA 3JQAD 1HWYA 2E82A 1BXKA 2Q49A 4NH4A 5H81A 3JQ8B 4CLDA 1ZUD1 2DFDA 1DDOA 2C07A 3U62A 1DBVO 3PJEA 5JO9A 3SBOA 4FJ2A 4CLXA 4IQ0A 2Q4EA 4OXKA 4CQMD 1BXGA 4FFOA 4ZQGA 3FBGA 4HKTA 1DHTA 4EZBA 2Z1NA 1HE5A 1YH3A 1VJTA 1G0NA 4YAKA 4AJ1A 4E0BA 2ZKLA 1E1MA 4JNKA 5JBIA 3OM9A 1ADBA 2X5JO 2Y1FA 3K8ZA 3T7CA 3EC7A 5C5IA 1VM6A 4XQCA 4FGWA 3GAFA 4AJIA 1EUZA 1TLTA 4BB6A 5DNAA 5TT1A 3WGHA 1JKFA 1E3SA 3WMXA 3Q3CA 4CMAA 3CSDA 4C4OA 1PU2A 4KQWA 3BYZA 4CODB 1HYEA 1W0CA 3PQDA 2RH8A 2NSDA 3VPFA 2F00A 3KSDO 4UULA 2DBRA 4FW8A 1YDEA 1JQBA 1ZW1A 1V8BA 4JXKA 4YYZA 1G6KA 2I65A 4BMNA 3OJEA 7ADHA 2V6FA 3PJGA 4BNYA 1O0SA 5KJEA 3LQFA 3ZU2A 4BNZA 2X9NA 1HSOA 3ZHBA 3JSAA 4YQYA 4BQPA 4NNJA 5DCWA 1S6YA 4YJGB 4UEJA 4DPLA 2FN7A 5FF9A 2C7VA 3D1LA 3DMTA 3RWBA 1TT7A 3MJEA 4XWYA 3ENKA 3PZRA 3HNPA 3IJPA 4AJEA 2Z5LA 4H15A 1GYPA 1YBVA 4NBUA 3DQPA 1QXSA 2CMDA 3K73O 2X9VA 1VLLA 5JAMA 1JAYA 1ZSYA 3LDHA 2VUUA 1U3UA 2PD4A 2R6JA 3WGYA 3PK0A 2ZCUA 2C59A 3JCZA 5KVQA 2YDYA 5EINA 5JY1A 3OQ1A 4O59O 3U4IA 2I66A 3QSGA 3GY0A 3LZ6A 4Y6PA 3TOZA 3ZWBA 3U5TA 3JQEA 5IAAA 2H63A 4WECA 3I9NA 3PJFA 3NEPX 2EJWA 3KOUA 3W8EA 5CDYA 1BXGB 1XKQA 3RBZA 1C1XB 1Z74A 5L9AA 1IUKA 4PLYA 3B20A 2GGSA 2DT5A 3F4BA 4JP2A 2AEJA 1IY8A 3K30A 1PL8A 4FCCA 5G2OA 2V65A 1FDWA 3GVIA 1E6WA 3RSHA 4GWKA 3W6ZA 5A04A 5CDTA 2P9EA 4AFNA 4YVFA 4ZQEA 3PTZA 2I76A 4TRRA 8ADHA 3L07A 5AXAA 5TT0A 2FOIA 4ND2A 5A5FA 2YY7A 3DXFA 1NQ5A 3ICCA 4EGFA 2Q99A 3ZWPA 5IFLA 3N74A 4R5HA 3ZHZA 4E30A 3LC7O 4RF4A 3QHAA 5DDIP 1SB8A 3INGA 4GLLA 2IRWA 1U3WA 3NRCA 4OJNA 2Y1CA 3VZQA 3BXXA 4HBGA 4IDEA 3UN1A 2X58A 5DF1A 3GFBA 1K6XA 3H3JA 3ZW9A 1LX6A 5BNIA 1PZGA 1P44A 1GQQA 2D59A 2FR0A 3FNHA 1NYTA 2GZ2A 5GZ1A 1VE9A 5I8WA 1V3TA 4XYEA 1CIVA 3ZHXA 4BGVA 4WGGA 3PHHA 5JDCC 1ZJZA 4J6FA 2FPPA 3M1LA 2CVOA 1VSVA 1XU7A 4YRDA 2EWMA 4U6SA 3B1KA 3GRKA 4LW8A 4OGWA 2B69A 4O63O 1IHYA 2PA3A 3DR3A 2X86A 5TGDA 3FTNA 1BVUA 3M1AA 4UAGA 4E2ZA 1K89A 4NU5A 3FI9A 1E3IA 1NHWA 2EGHA 5TJ9A 4UVIA 5T6BA 5DT9A 3GPDG 3H2ZA 3R1IA 5C7IO 1NPTO 4NK4A 4QEDA 4E5KA 3S8MA 3JD3A 2D0IA 2I6TA 2OORA 2BGKA 1E1LA 3UF0A 1G1AA 1J6UA 2VCYA 3DZJA 4PG7A 2VYND 1F17A 1NASA 3OJFA 4MVJG 5TS3A 2VNAA 4HFNA 2VT3A 1XELA 3DZKA 1N7GA 3X2FA 4FGSA 3UOGA 1PQPA 3SEFA 4RL6A 2RHCA 5HBRA 2GZ1A 2Z1MA 3A14A 1GCOA 4PLPA 3E6AA 3RUCA 2JCXA 3CMCO 1B26A 3AM3A 2GN8A 2PZLA 1X7DA 3I9KA 5H83A 1SMKA 4ALKA 1MUUA 3P19A 4E2YA 1V6AA 3BHJA 3LK7A 3WJ7A 2X22A 3LF1A 2I99A 1WXDA 3BHIA 4RPKA 4BNLA 3LT2A 3RUIA 1GPDG 4J9VA 1VSUA 4R01A 4PG5A 1BSVA 3F6YA 4ZU3A 1GCUA 1C0LA 3E48A 1KEUA 4BQRA 3A06A 4R1SA 3S2IA 1KY4A 3E5RA 5JLAA 1YRLA 1HE3A 2I9PA 5DCUA 4AJ4A 1N1EA 3RKRA 1GY8A 1XG5A
chains in the Genus database with same CATH superfamily
3H87A 3BE8A 2R8YA 3EUFA 5I7AA 1R6TA 2ZJ4A 4ZHSA 4ZYUA 3LW8A 1Z75A 4S2EA 5K3BA 2ZRFA 2Y71A 4KWIA 3Q3IA 2FWAA 1T2FA 2N1BA 2J9FB 3NV9A 4ZAYA 3LYLA 3KZVA 5K3FB 3T9DA 4BJ5A 3DLHA 5GOZA 1RFGE 5EPUA 1T91A 4KKVA 4YFVA 4MITA 1X13A 2WM2A 3M6AA 5J2TF 2EKPA 4P82A 3UJPA 2ANCA 3PEYA 1AUXA 3SF8A 3EGEA 1E1KA 2G5TA 4PO1A 3IRUA 3N07A 4CKWB 2BM8A 2IOQA 2K87A 3PC8A 3TXYA 4M76B 4ZI7F 2YJ5A 5IT4A 5C8YB 4Q03A 1CX9B 1B93A 1D2AA 2Q1UA 2VYQA 2WSBA 4HMQA 3S1AA 4A0SA 5GWXA 1R8SA 1LDMA 2JANA 2EXXA 1OF1A 2CYBA 4O2AB 5CHYA 2C97A 4PYOA 2H2FA 4QELA 3RVJA 4Q9HA 1JALA 1HDGO 4HX2A 5B4UA 5AW4A 4X0EA 2Y1KA 2GBIA 4TV9B 4BQIA 1G3RA 1EFHA 3N59A 4ACAA 1LLUA 2VPIA 3C74A 3MCTA 3ZEAA 3S8YA 4WJZA 5KKNB 1EBUA 3EMBA 3TJZA 1Q20A 2GEVA 2O48X 1JG1A 2YJTD 1JEQA 4XJXA 3WO0A 5F21A 3BDAA 5JYBA 1G9XA 2FPIB 1Y63A 3G0CA 4HH1A 3MTGA 5U4QA 4CXMA 4P4SA 1DZIA 2QD3A 3M2PA 4M1YA 2CFTA 1X7WA 2QPAA 3KE9A 3O5AA 2QVGA 1DBQA 2IEIA 4JK3A 3BVPA 3E1KA 4FYHA 4TTIA 2X0EA 5DNVA 1A7AA 1TEHA 2A1UB 2P2DA 4HAVA 4XE5A 3AF0A 4N5MA 3EDYA 3M33A 4U8GA 4WA7A 3W4KA 3N8GA 3HE3A 4KDRA 1QQ5A 3JVIA 4MQEA 4QOGA 4G0PA 4EBBA 2ZBGA 3N8IA 1ZJ4A 4HJRA 1L7QA 1M8PA 4UASA 3ZHSA 5ER9A 2PM8A 5FR1A 5T3UA 3NH9A 2W2PA 2QRNA 3OEHD 2O4CA 4FOTA 2VQDA 4YDQA 4EHDA 4HYQA 4GDMA 4TUYA 4Q4CA 1C9YA 4DCGA 1NR5A 2V7UA 3AZPA 3CBGA 4AP9A 4WUVA 3CW9A 1EP9A 3VDRA 4LCJA 3BMCB 5IUNC 3W8DA 4FYPA 4G6ZA 3E9CA 3VKGA 1QOZA 2B8NA 3LOPA 4R1MA 4KPGA 4G63A 1AO0A 2IHUA 4TM7A 1WW8A 4PLWA 5EGSA 4C7VA 4CVNA 2EKDA 4LECA 4S1TA 1SQ0A 4RGVA 1F4PA 3DPSA 2A0WA 4FSXA 3IIIA 3R9KA 4DV1B 1VL2A 2ZI6A 2ZJ5A 4LXYA 1GXSA 2BR3A 1E6EA 1XI2A 1P1BA 2C4VA 2ZT6A 4OQNA 1W2GA 1E7QA 4PC6A 4Q12A 3UPTA 3DE3X 1RM3A 3P2EA 4YAIA 3MWJA 3QEAZ 1UEIA 3HUDA 5B57C 1ZJ5A 1QKKA 2YNMC 2YW2A 1F2UA 3L9XA 5TGTA 4NX2A 4XPIB 1P1IA 1DV2A 3TD9A 3YASA 1QHHB 3SIRA 1RMQA 2G36A 4FDUA 2XTMA 5JJKA 1ZNWA 1UUFA 3IR7A 4WAUA 1NNEA 3GB9A 1DKUA 4ND8A 4JB2A 2OPHA 1S3IA 4G4JA 1P4SA 3ILSA 3OWXA 1JIVA 3U3DA 4XWGA 1A1SA 4IHJF 4XAQA 3GO4A 3O94A 4P34A 3NMUF 1LB1B 1NN5A 1LW7A 4KIJA 2OBMA 3IVXA 1XCBA 4HWOA 4MGIR 1GNQA 4MMZB 5AJZA 2V55B 2ZUVA 1E9DA 4PQEA 4UMEA 2QD2A 4E32A 1Y98A 3HKDA 4NYIQ 4FJ1A 3BFXA 2E5WA 4KE6A 2AFVA 4P0TA 4RAOA 5EFZA 2XWJI 4M54A 2XCLA 3PI7A 1YKFA 3MSXA 1RAIA 4V0KA 4X7RA 1PJBA 3D0OA 3M8KA 4JR0A 1ZITA 3H05A 1Y8ZA 5L51A 2BKXA 2YYYA 3B9RA 2BZGA 1E6LA 1UMCA 3O8BA 4PLZA 1BQEA 4UXIA 5DX8A 2Z6UA 1FJGB 5C81A 2YASA 1TU4A 3CINA 2V9ZA 1D2NA 4Q39A 2IYUA 3NDBB 2FZLA 5EL0A 2OZEA 5A71A 4I1VA 3FIUA 1RKUA 1MLDA 3I28A 5KSZA 2FWPA 2ZBVA 5JYCA 1TYBE 3CT4A 2UZ1A 5EN4A 3TRJA 2JGLA 5LZ4A 3K6SA 3J81k 3RC2A 2VYCA 1JR3A 4XIJA 2RI1A 4BVLA 3RSLA 1MC1A 3CLKA 1TUEA 1MOQA 4L7QA 3Q40A 2G40A 4UUQA 4ZJZA 4LF6B 4DKJA 1RJDA 2VRBA 5JVDB 2GH1A 1AKUA 4MA0A 3WTBA 2RCYA 3NP9A 1CEQA 1GGJA 3AF4A 4UBJA 2RDMA 4R6WA 5AVZA 1YAHA 2QTAA 4XB1A 1T4MA 3X44A 3OLQA 2CHQA 1OXTA 4UZFA 4EG4A 4IFBA 5A3VA 4P3NA 1Q1QA 4A2PA 5CURA 2EHDA 1IIRA 2QGNA 4NENB 3KHTA 2JGJA 3HEMA 2TRSB 3HSYA 3BFPA 2IHYA 2WDPA 4TLLB 5FPPA 3NBFA 4GPIB 2ORED 2YZ2A 3RRJA 3Q6IA 1K3FA 2FEOA 1Q15A 4J07A 1R8JA 2ZBDA 3OZFA 1CC1S 1S2MA 4JWTA 3EGXB 3EVEA 5CFLA 3RQIA 3VOTA 4PGFA 1KEEA 4J2OA 3PNBA 2PD6A 1OT3A 2DUNA 2Q1TA 2QU7A 2I55A 3G0OA 1IBLB 1GZ6A 1PDOA 1AKVA 4GYYA 2CSUA 2JLQA 1T9GS 1W94A 1DS6A 3USZA 3HCWA 4HN2A 4F71A 5B3JC 4OQPA 3IXQA 4S35A 1EGQA 1C1DA 1T8PA 4CFYA 3M9XA 2XIJA 4JU9A 1U8YA 4IIFA 4KXVA 5CYFA 3RGWS 3AY7A 1TVKA 1QDUA 2R1VB 4AQDA 1ZBDA 4BP8A 3CJQA 3P4XA 4GPD1 3ZDAA 2VN8A 621PA 4TMWA 2OKCA 2CE7A 5D6NA 4FGZA 4DCUA 2QMQA 2RGGA 2H4JA 1XZHA 2QZJA 4P92A 4EFDA 3HL0A 4G4SO 1WEKA 3AM4A 4JA2A 4Q4JA 4OP3A 3SS7X 2O7NA 2V7WA 4LI3X 1VGRA 3RUHA 2Q2VA 5KNDD 1XZAA 4OXNA 4YJ3B 3KHKA 3LQ1A 1NNUA 1BXZA 1PYGA 3FLAA 4HUTA 1P62B 3CRRA 4H18A 2GXUA 1E69A 3T3DA 4BNVA 3VZRA 3BMQB 2JVIA 1YFZA 3FOWA 3A25A 4IVPA 3SICE 1SVWA 2EFGA 3LSYA 4JI1B 3ZWMA 2IZZA 1RRPA 1YCFA 3H9UA 4BVAA 3BSYA 1G291 3GN2A 1VJRA 3UJHA 3R3SA 3V8QA 1R0CA 3L7IA 3TQRA 5LC1A 2H4YA 1WXFA 3RSQA 3RVBA 3M6VA 3RSZA 3D0KA 5DK4A 1H2RS 2OC9A 4IIHA 4FQ8A 3AF1A 5KTRA 3SWWA 1KI1A 1BN6A 2FEWB 2QAGA 1E2LA 2C5GA 1QPBA 1COWD 4H7FA 1C14A 3FBWA 4HV4A 4RTNA 3SQXA 2ZUBA 5T8KC 3CKKA 4DG9A 1TUBA 5JU6A 4QFMA 2C20A 3PGVA 1FA9A 4P3YA 4J0JA 1DGQA 5H9VA 1ZSNA 3W8RA 1NYLA 3W90A 1DIGA 1JWAB 2ZLBA 2FMKA 4C9BA 1Y3IA 1YQWA 4BLQA 4L5AA 4RH0A 3UMCA 4IQFA 4GE3A 5AM2A 1GUDA 3UMRA 3IP3A 2JCVA 2P9FA 1Z25A 2FE1A 2WOOA 3HJAA 5C4IA 1X9IA 3HYRA 5HQTA 3SNHA 5JXIA 4I9NA 2AUTA 1MXHA 1B8PA 1SRQA 2V0NA 2W37A 5AK0A 4NTZA 3JWEA 2NP7A 4DHWA 3Q15C 4C7KA 3NRJA 2ZK7A 4I5IA 2Y1OA 3H9GA 4LHSA 4QODA 1XMJA 1P81A 4G0OA 4B87A 4XIFA 1CLEA 3HY6A 3ENZA 3EGCA 3OIFA 2OC4A 3IIKA 5BPHA 1NBEA 4R7GA 1GUAA 1PNRA 1H4SA 1Y48E 3WGUA 4TZTA 4GI7A 1UP7A 2WAOA 1UXHA 5HQ3A 4DRZA 3COPA 3GUVA 3AIMA 3ZDXB 3VUEA 1DBRA 3KYCB 1XVVA 4FE7A 4QIHA 1NF2A 5CT8A 4N6OA 3AKZA 2W8BB 3Q6MA 1UPFA 4AKGA 3I34X 1CUXA 2B2NA 5B7PA 1WUJS 1Z2NX 1G9TA 2AG1A 2FPGA 4Y9TA 4EATA 4EO7A 3VH4A 1LXCA 2WG1A 4FBGA 2YXEA 1R0LA 4IFTA 3ZDQA 3LYUA 3RF7A 2BN4A 3T9BA 4UMVA 2Z43A 3CMMA 1AKEA 3L1HA 5L7TA 1Y4SA 3WSWA 2DYKA 4DN6A 1CUUA 4ES6A 4WZBE 3UKJA 3THYB 3A1FA 2PXHA 4L9AA 4N82A 2R25B 1BHO1 3A0UA 1QVRA 1XJQA 2C9BA 4QDJA 3RSOA 5K0LA 4EITA 5BMVB 1L5RA 2CLLB 3U7HB 3D6FA 4B2YA 1O9BA 1WXEA 3ULKA 5BWCA 2IOFA 3GGDA 2KI5A 3I64A 4R2WA 5THQA 4L5YA 4P81A 3C7DB 4RK0A 3TQHA 4ZCMA 5AOAA 3IUMA 2J6BA 3CX8A 5IABA 4A0RA 3AF6A 1PJRA 3GVXA 5ULLA 1HTWA 3IAEA 4EARA 1LK0A 2XNSA 2PUGA 1GG9A 2OVBA 4TMZA 4RY9A 2EV9A 2ZW9A 3L40A 3JQAB 3JAWB 1G3QA 3SEQA 4CL8A 2H17A 2JA1A 3ANLA 5E7QA 2HIHA 4O2BF 2HNAA 3KVYA 4QXRA 2B21A 2WJHA 3NCHA 3ZXUB 4L0MA 5F9MA 3TUZC 2WWYA 1A04A 2PN1A 3K09C 4BFSA 3JATB 1PJ4A 2CGEA 2XVMA 5DTIA 5EY5B 4U39A 3QITA 4XGKA 2H4FA 2HQOA 5D6OA 3MLBA 1IEWA 2RG1A 2YWFA 1PL7A 3T1OA 4BJ3A 1XD2B 3ESQA 3QEKA 4MGYR 2ANBA 3H6HA 3VYRB 3E7XA 3EXIB 1FSSA 2IZ7A 4ARBA 3ZD8A 2XT0A 1BDJA 3OTGA 1PIWA 1ZGJA 1YBHA 3A6LA 4II3A 1DXQA 5G53C 1II8B 3DLPX 1NE7A 2QRHA 3BXHA 4PX2A 1TIPA 1ZOSA 4G0ZA 1QE3A 2EX0A 2F17A 4HGQA 4OG2A 3ZZ1A 4QVIA 3ADCA 3T61A 4QT0A 4I2NA 4HGYA 2RGWA 2A7QA 3SDZA 1VIMA 3CONA 3JQDA 3PE6A 4GX1A 2GCPA 3WIBA 4KFRA 1JSZA 1QHIA 1H6DA 4G56A 2FAXA 4JAVC 3QNWA 2ZYRA 3C5WP 5HBGA 3D3NA 4YB8A 5CM8B 2ISSD 3H5VA 1FX0A 3N87A 5JC8A 1GA1A 1QYIA 2HLDA 1MJGA 4TWAA 2WWRA 3DL2A 4BYGA 3BAFA 2IZ0A 2VEDA 4MV7A 2WIKA 3HI4A 5I9NA 2JIZA 1ADJA 3PRJA 5SICE 1NG9A 3KZMA 2GPSA 4PHTA 5I7HA 2G1KA 1FY2A 1U8AA 1A8UA 4JXZA 1E79A 1OC2A 4L4RA 1ODCA 2P1RA 4TQ9A 4UHEA 4B32A 2V7EA 1R6AA 4NJEA 3AYXB 4WASA 4W5NA 3IAUA 2QRPA 2D5LA 5G1PA 4HAWA 1IEVA 4IGAA 1GYQA 5DYWA 1YZ3A 3OQ6A 2FHSA 1BFUA 2GMWA 1T9DA 5FKJA 3SJAA 1WUHS 2Y66A 1IY1A 1L4NA 1Y9EA 1NBIA 4PAMA 3VXKA 2MHCA 4NZ9A 2E4VA 2NSJA 5HZMA 2A58A 1YJXA 2MOKA 3G49A 3R2JA 3LA6A 4C4XA 3N0WA 5KWSA 1T36B 4PVCA 1ETUA 4D92A 2Z2YA 3E61A 1KYXA 1RQXA 4QPJC 2A92A 5SZKB 8AT1A 5JC1A 3GCGA 1SKQA 2CXRA 1KYZA 4EY7A 1LCIA 3N76A 2OP0A 2WU0A 2D8AA 1O08A 1BH2A 2YJ3A 4YGYA 1B4DA 2P68A 1E5TA 5TSDA 4B3MB 3D3KA 5A5DA 4PSAA 1JBKA 1QZXA 1P2GA 3NDIA 3OH8A 4HNGA 4J94A 5ARDA 3A1TA 1GG2A 1QFJA 1KOJA 3MUFA 4V0RA 3HQ4O 5CK5A 4YPVA 4CEHA 1G8JA 3DHEA 2R7AA 1YVRA 2ZRMA 521PA 2FVXA 3CZRA 1TQ6A 4QTUB 2YOHA 1E5LA 3PPYA 4UDXX 1Q3KA 4TZ6A 5CFRA 1EFAA 1MG0A 3FD8A 3MXOA 3KJFA 4IDCA 2H1WA 3PUVA 1E63A 2WHQA 3EB9A 5C0OE 2ZUUA 1O58A 2Z5FA 4IXWA 2XB8A 5DBHX 3JQFC 4KX3A 2ZSJA 3BDIA 1SHTX 2AR7A 2XUKA 1U7OA 3NEJA 2H7VA 4KDCA 3T3OA 1H42A 3C3DA 2Q45A 3G5AA 1NQTA 1YQUA 3GGJA 4DR7B 4WFIA 3WK4A 5B1DA 1I4OA 2J0QA 3JQ6A 3K2EA 3TW8B 4R81A 3MQ4A 3DV0B 1DC6A 3WI7A 3IC5A 4KMSA 6REQB 2ODQA 5JNLA 2PU7A 1RWXA 2D7JA 2CWDA 1F5SA 1X1EA 3ONDA 2YJGA 3OX3A 4Q01A 1WA5A 2XA1A 4CE6A 4MLPA 3ETGA 4WN9B 5JBQA 4YA6A 2W4MA 4QD3A 2IP2A 3RRFA 2F90A 4BWVA 3DAFA 1R6UA 1B14A 1ISGA 3T1QA 4KMOA 2BHNA 4L1KA 1O5TA 3EVDA 3Q1KA 1QRDA 1LDBA 4FMDB 1XAIA 1IXZA 3FDJA 1AK2A 3IL2A 1QX3A 4GOLD 3WP0A 721PA 1I33A 1F0PA 4D9MA 1I14A 3AL3A 2H29A 2J87A 4MVJA 1GPKA 5E6RA 2VBGA 3I12A 4Z3KA 3GEDA 1TADA 1EI9A 4MV1A 4KTTE 1R5OA 1XMXA 4QHTA 5KWVA 4UE3S 2FE4A 1Z6ZA 4L22A 4R3NA 5FADA 1O5IA 2JF0A 1M54A 2V4MA 1OBVA 5DSTA 4HJXA 4R0NA 3GVHA 2VQ3A 4BFVA 1FRFS 2XMQA 3FWZA 4PGMA 5DKFA 1X7YA 1Z4KA 3URKA 4GBMA 1JPVA 1KAQA 2ZSEA 4ZV4A 4DS3A 4DQLA 2BFBB 1AGXA 2W4IA 2WIJA 4BNUA 3T7EA 1Y6ZA 1PT8A 2FZEA 2J9FA 5K3FA 1RXUA 4MYCA 2A84A 1UIMA 3D8SA 3K3PA 2HUPA 3GVCA 2J41A 4N7MA 2C1ZA 4RLQA 4FOSA 5ALZA 1MHTA 1AUQA 3ZV5A 4DV0B 3D3WB 4E5MA 2PVSA 4D4HA 4E31A 3NHMA 5DIFA 2BHSA 2CLHB 3M1IA 3RJ9A 1QYRA 2Q9UA 3QLTA 4S05A 2NO1A 2ZR8A 3BE5A 3CR7A 5KDDA 5KQMA 1DC3A 1F3OA 1DEAA 1J8FA 4Z2AA 5AVRA 2ODBA 1A72A 1VLJA 1T5HX 3LCUA 4UM7A 2JHAA 1JPUA 4C0BA 4CIVA 3WBFA 1NLZA 1QCCA 3KV3O 1HK7A 3F4LA 1N5DA 3TBFA 3VPHA 3LVRE 2PH5A 5E7IA 1T5DX 3LCCA 5GAJA 4UHCA 4BFXA 3VX4A 2GAAA 1OZFA 3L8CA 3NC4A 1I2DA 2Y4OA 3WRVA 3WLMA 1EFLA 1HZZC 2FPIA 1JE0A 2FP3A 2OHHA 1CE8B 5CYGA 2BKVA 1HBJA 1QGDA 1G8KA 2WD7B 1CR6A 2QM0A 4PYIA 2ZJ1A 4JUBA 4F3YA 2VDJA 1EKXA 2J7PA 3TZ6A 2A1UA 3C1TA 4NYJR 3PQ6A 3TNLA 2OBYA 3VOSA 5EHZA 1KJYA 4Y1RB 1TVEA 3CZ9A 4K03A 4TOIA 2GXAA 4IOJA 1W4RA 4UVDA 5D87A 4YV7A 2YZ7A 4YMLA 1YB6A 4MNTA 3PHLA 3ZTTA 2YWDA 4W5RA 1Y6QA 1Y3HA 2VQFB 1GNTA 3H5TA 3Q7SA 2JJ2D 4N0PA 3ZGOA 2YHIB 5KSOA 1UPTA 2G8NA 4LOAA 2XQKA 3L4JA 1THGA 1VSBA 3DVQX 3Q41A 2UVDA 5LLSA 3C70A 1PF7E 4F9EA 3BMCA 1EVKA 5FV7A 2IU4A 2GM5A 3ZY2A 3L0IB 2NACA 4N5DA 5HUQA 2CNNA 4OYYA 4JQOA 1L7NA 2X7HA 5CK4A 1BZYA 1T2EA 1JU9A 1KJJA 1ZS9A 3I2YX 3ZKWB 1OHHA 5CJ2A 1NNSA 3JWIA 3KOZA 4XWWA 4JLBA 3F5DA 5D7NA 5CLJA 3QBVA 1JYEA 1ES9A 2VRCA 4MHSA 1GZHB 3BL8A 1NBHA 4IDOA 4AJ9A 1GRQA 3SJCA 3C6ZA 1DQNA 5IYZB 5DMXA 3O4FA 1T43A 2G5PA 2B25A 3DT9A 1XLTA 4XPIA 1R4ZA 2WI8A 3E4DA 2X0RA 4JBHA 4DEVA 4O6VA 2PZJA 1PDVA 1QHHA 1YHYA 2Y68A 3P9QA 3QEMA 4JI5B 5HZGA 3I61A 5K4GA 4JUFA 3RH0A 4WSOA 3GBVA 2YBEA 2ECOA 1IK4A 1JSLA 5F1KA 3FSEA 4FN4A 1ZMBA 2GLXA 2KWIA 1YFKA 3O84A 3TGWA 1CY6A 1YQXA 2G3YA 5EQDA 2XUPA 4WOPA 2FLKA 5KX5B 2PS3A 3IQWA 3LLUA 1U0GA 3DHWC 1LY1A 2JK0A 4KP7A 1ZJJA 1ZMTA 5ALGA 5JCJA 4EKGA 4RZ2A 3KAKA 3UMVA 4KRGA 3QEOA 1BQ4A 1OZ0A 3QMMA 4RK4A 2R7NA 2VWPA 3ZTYA 4H7HA 4BNKA 4ZEVA 2C3PA 5C2JB 1D7OA 1NATA 3HV0A 1O6GA 1PT7A 2H1CA 3H1TA 5J59A 5FEUA 1DJQA 1LBHA 2ONKA 3E2IA 3H3FA 4KI0A 4CF5A 1F3LA 1H9AA 4TTSA 3V7FA 1VE3A 1Z8FA 1EUCB 3DE4X 2CVQA 2IHTA 4FSHA 1X80B 2OAGA 2XECA 4R7TA 4X95A 3RSCA 4W5QA 2BRUC 3PNSA 2ZRNA 5EXEA 1OI4A 1K92A 1Z6GA 1GG5A 2FR8A 4PXYA 4PZ9A 5AW0A 4ZCIA 3IOBA 2CEKA 1W73A 2CW5A 1WZCA 4PC7A 4PO3X 3P9SA 4MAAA 5IM5A 4PC2A 4B3IA 1H23A 2RC6A 2ZUWA 4KQGA 1EP1B 4HXYA 3KYJB 2FQXA 2BTQB 3A1UA 3QWFA 4CW7A 3X0DA 4O4HF 1T29A 3PPVA 3PPXA 1Y34E 4E09A 2QX9A 1VG0B 4QO8A 2HK8A 5B30A 4OFXA 1BVRA 2WT8A 1FFAA 3ETJA 3HB1A 3GUZA 3I0ZA 3QGMA 4XEUA 5JVDA 1SVNA 1W36D 1G5IA 4ZVUA 2ZUEA 3U80A 1XVLA 3UFXB 4OB6A 5FLKA 1WTAA 1TF5A 2NAFA 1HNXB 4EGSA 3Q11A 4DY6A 5DE3A 4E33A 3S5JA 2ZIXA 4HGNA 2D0OB 1KDVA 3ANMA 3HBNA 3LU1A 4NAUA 3TXXA 5JS6A 2WICA 3G2KA 4A3SA 1QH0A 2QP4A 1KORA 3ER6A 3OOHA 2QG9A 4NENA 4PG6A 3U44A 2H2AA 1XRLA 4OV6B 1EDDA 5KDOA 3KJZA 3RBAA 1FJXA 1KH1A 4GMGA 4DMHA 2I67A 3T3PB 5B1YA 3OHMA 4RU1A 1XD9A 2QG4A 4H7IA 1KU0A 3A6HA 2P4SA 5HS6A 1IWPB 3SZ3A 2CB0A 2WG2A 3GUUA 3EGXA 3ZXIA 2XYHA 4Q4HB 3TRKA 3D6NB 1G63A 4MYTA 4BECA 5JD3A 4A5SA 3UV7A 1HDYA 1L1RA 3LQQA 1VMDA 3QW4B 4N40A 4RKQA 1NVGA 1X9GA 5C3UA 3HK2A 1Y5RA 1OY1A 3D59A 4EHJA 1OAOA 4LJ9A 2MSNA 4MGZR 4DLNA 5A02A 1SXJA 3LL7A 2VTVA 5FI3A 1IXKA 2R1VA 3PGJA 4BX9A 4JYZA 1V4BA 2EFEB 3V00A 2XX3A 4MRMB 2QZ4A 2W8ZA 4RY8A 4JYBA 1XZFA 1H2XA 1GRVA 4UFPA 2I8CA 4BMVA 1EVYA 2A88A 2F1OA 3F2VA 1PHRA 1PX0A 4V0NA 3WOHA 4X1KB 2B5VA 4R84A 5CYOA 5D1NA 3GLGB 3GMSA 2WF8A 4TSFD 2ACEA 3T5BA 5KYXB 3LL4A 4GX0A 4JYMA 1PVDA 4BQQA 1AVTA 1XKLA 3CO0S 4AG3A 3TBHA 3F78A 1LPOA 1Z26A 5IK2A 6ADHA 1VE6A 1PLKA 4XGIA 4BKPA 4J1NA 1GTJ1 4TLAA 3BMQA 4TL7A 2D6FA 4UUAA 1ATIA 3H9EO 1HG0A 3R7WA 1I13A 2H1FA 1SBYA 2ZAMA 4X45A 2EG5A 3PUWA 3NRBA 4O29A 5JANA 3H86A 4ZHQF 1IJBA 1KAOA 3RV3A 4EG0A 4EJ2A 1NVKA 1PTJA 3L02A 3T1TA 3I5YA 1LZKA 4RVHA 3KR2A 3ESRA 2BMAA 2P1ZA 3PWZA 5DULA 4CI9A 1GPAA 4BMPB 4HQ0A 1Y1SA 5L40A 1U6JA 1USIA 3GYBA 5CLHA 3CISA 4G5OA 1G7RA 2DFPA 5CDFA 1YMUA 4C43A 1F0KA 3NAGA 5JS7A 1KC1A 1JDBB 1YS9A 4IZHA 5EHGA 4ZT3A 2ZQYA 3B82A 1DUVG 3HXQA 2GX6A 2ZB4A 3JALB 1XK7A 4ZANA 1EGHA 1KEVA 3ZWDA 1UDBA 4IFEA 4PAOA 1A3CA 1Q7TA 2ZREA 3P9KA 2PNJA 1T3LA 3V8BA 2H2WA 4O33A 2IBTA 1U0TA 2DX7A 3L0SA 3PXAA 5JMWA 1OGIA 1YU9A 4LKOA 3VMMA 3WGKA 5IJWA 4GKVA 1Z6TA 2NOAA 3HCOA 4NCXA 3WE7A 2CZCA 2NU9A 4HEQA 4D6XA 1ML3A 3LIIA 4ECEA 1IY2A 2QUJA 3OZBA 5EJAA 1XCPA 2GB4A 4OAPA 5T4EA 1Z15A 5LP6B 1TMOA 3IPLA 3FVVA 3JQBC 2EFYA 3U13A 2G5GX 1N0IA 1VZ2A 2JK1A 2B34A 3USES 2WYVA 2C4WA 1ZIXA 2IZOA 3R7BA 1WABA 2FFHA 3OLZA 1F06A 3GRZA 4PIVA 5CX4A 4YUXA 2F48A 2XQJA 1XP5A 1I0IA 3ILYA 4GZMA 5H3HA 3T3NA 1P0PA 2UV8A 4MUIA 4YAOA 3VI3B 4DADA 1BFDA 3MTAA 3P9XA 3LF2A 121PA 3SZUA 4YR9A 1NT2A 2I78A 1PGNA 3KYCA 3EAGA 1YD7A 4MA5A 4MYHA 4WVFA 1IC6A 2VXBA 3PPIA 3LPMA 1CU1A 5B53A 3OCXA 1ANKA 1GRNA 4P3PA 5FBRB 3WDMA 3K2IA 4X9XA 2SBTA 3KD3A 3RFFA 1BS9A 1ZYUA 3E3MA 3NM6B 5J1TB 2CMKA 4M1SA 4I8DA 3C1AA 3VO9A 3C3XA 5IF9A 3OO1A 4OJTA 5TLSA 4TZ0A 4C03A 1J25A 2B3DA 4MIKA 5JEEA 2G6BA 4WXPA 3TI9A 4ZYLA 2G76A 4D3DA 3AB3A 1XTVA 4RIHA 2K4MA 2Y1LA 4EFMA 2IU3A 1EX9A 2J67A 3D31A 1EJ6A 4IMRA 2NU7B 1R50A 1YS2X 3FTDA 1JV2B 1UBNA 1ZXLA 4U00A 3WLFA 3O26A 4ZYTA 2B7BA 5THKA 3ZZTA 5BMVA 4HRXA 1QGED 4B35A 3AI2A 1NUPA 3HVRA 3E58A 4V3BA 2QTBA 3FW1A 1OSNA 2QYHA 4ZK2A 5IC4A 2O1EA 2QN8A 1KXZA 3R4VA 1N2XA 2H1SA 3AJ9A 2OCDA 4ZEWA 5IJ0A 5EXSA 3W2GA 1PNTA 1NW4A 5JUWA 5LQSA 4C2UA 1NM5A 2I1QA 3ED5A 2AN4A 3M4JA 4LZOA 3R77A 3UAYA 5E7MA 3I30X 3X1MA 3ISTA 2ZETA 1DAIA 3LXXA 1JVSA 2H0RA 1C0KA 3RGGA 5K0ZA 2CN1A 1OT5A 3CXUA 5BNFA 3JQAA 5CG1A 2F43B 5G3ZA 3PT9A 5EYPB 3NNNA 2Z9DA 2H2DA 5ISMA 4TT8A 5AXCA 4EJFA 1JJ7A 1YRAA 3EODA 4HADA 2OG2A 4E07A 4OIMA 2JBAB 5IFLA 2Q1SA 1C7ZA 4ALJA 5K6AC 2CFIA 5D2CA 1YO6A 1FJHA 1W19A 1YJ5A 2WVHA 3FRHA 3T7KA 3K0BA 2AKEA 5EZYF 3SLGA 1P6XA 4IHQA 2POCA 1RHJA 3IP9A 4YH1A 4BNMA 1FS4A 4CM9A 2HDHA 4OA5A 3WNBA 2O0JA 5C5EA 2J3EA 3EVGA 3EXIA 2YQ4A 3ICVA 4RDIA 5KU1A 3RVLA 3TVTA 2YUTA 4NBSA 1FU4A 1AN0A 2ZTSA 3ELDA 2YYSA 1U80A 4HL6A 2FDCA 4FT4A 2Q3HA 3GLQA 2NVUA 4DMFA 1II8A 2R65A 2HF2A 4G3XA 5DNCA 5EQTA 5M3BA 4WKNA 1J20A 1LRKA 3C7CB 1QGUB 2LDBA 2BFDA 1Z5VA 2YRFA 1L5HB 2CD7A 3OQHA 4TQUS 2IHNA 3E9EA 3B9PA 4LF9B 1R7RA 4JYAB 1JRLA 4L16A 4UAJA 1U4SA 1QSGA 4BMYA 3ZH9B 3U7JA 1HXHA 2Q4OA 1Y5NA 3NHWA 2FCRA 4K5QA 4PNHA 5NLLA 3AJ8A 3W5JA 5C4MA 5JZSA 1GVHA 2DT8A 3O9VA 4KO8A 4W82A 1UF9A 4WK6A 2DQ4A 1C9DB 3FLEA 1E77A 3B36A 2AQIA 4DQXA 1DX9A 5AKXA 1WOYA 3UK0A 4Y2XA 2H6EA 2CLSA 1NN3A 4RJ2A 2PH1A 1AKQA 1EBFA 1M8FA 3HB0A 3Q1LA 2VXOA 4NPHA 1EESA 4L5CA 4BO2A 2QRVA 2XUGA 3A7DA 3LQ2A 3UB2A 1TF7A 3V4PB 4EB8A 1O6CA 3GCZA 3IIMA 5IXJA 2DWPA 1XXHA 3AL2A 1IG0A 1U3VA 4AK9A 2WU1A 2WJ4A 5E9JA 3FOAA 4NOLA 2UYGA 1M2VB 1EEXB 3IT1A 4Y6RA 4ZYYA 3E2PA 4FHGA 3K0AB 2GASA 4PZZA 4B4KA 3WWDA 4X94A 4G0WA 4TMVA 2WHXA 3LM8A 2REOA 4E5YA 3DYBA 4UOQA 1OUMA 3ND5A 1QCDA 1PJLA 1ZD1A 3H11B 4R2KA 1Q0RA 2YJNA 1SOAA 4H0CA 3QHQA 5FA6A 2P9JA 3CNOA 2O6LA 4EPWA 2EZ4A 1ZVQA 2G70A 2GRAA 4JT4A 3UUEA 2BH2A 5EWMA 1KEZA 5CCEA 2JGNA 1TI7A 4LRQA 4EI9A 2J3LA 4EY4A 5C3MA 5ITZB 1W7AA 3KFVA 1W36C 4DYDA 1EG2A 4DLRA 2CCGA 3JQPA 4LNUB 3VYWA 3NHRA 3QRWA 3BZBA 4KQIA 4Y6SA 4YRCA 1F8GA 1E9FA 4YP5A 3DDNA 4ZZ2A 3HU2A 4R31A 3FKSA 1U7ZA 3MM4A 1GITA 2W6PA 4WK4B 1UC4B 2ZIWB 4R9SA 2YUIA 3SD7A 3AHGA 4ALNA 3DGEC 5F7ZA 2FEXA 2XKKA 5T4HA 2FUKA 2BPOA 4XIIA 4W5TA 4R1TA 3H5OA 1EJ2A 4EA9A 1XPUA 4I9GA 1EJBA 2OLJA 2PTGA 2WSMA 1VIVA 2V7BA 2WWWA 4H7PA 4DBLE 4Q05A 3VH2A 1N5RA 3BRWD 4QRDA 2XCQA 3U26A 1HQDA 3IUSA 1C2TA 3TRHA 1ECJA 1ZH0A 3WGVA 3GPIA 3A9VA 2RHGB 1I3KA 1XTUA 2DKOA 3NTRA 4ZDJA 1Z63A 5FOVA 3U2QA 3KFLA 4TT3A 1K7XB 4M8NE 3DCNA 2WAAA 2Y0EA 2LIPA 4RYDA 4PY2A 4CTNA 1R0WA 1H8HA 3D4IA 3IMCA 3T0FA 2OCXA 3DV0A 3IXLA 5A0FA 1EWYA 3EIXA 1I7LA 1QIMA 1JLSA 4ZAWA 3WXMA 3S44A 3A6ZA 1UOQA 3E3OA 2ETVA 3SKXA 1C4WA 1CZNA 3UWKA 1ZOIA 3D8RA 1CEXA 3AM1A 3UGQA 2XMRA 3LBFA 3MJRA 4LSMA 4MWDA 1X8XA 1XN1A 3AU8A 4WN9A 5B1EA 1TA0A 1G2OA 2L82A 2WIDA 2IY7A 2JDIA 1T2UA 2XRYA 4F5ZA 1GN9A 4D0SA 2WE8A 3F7NA 5DIZA 3V8VA 3TGLA 3FMFA 5LZ9A 4NEHB 1W75A 1XJ0A 4R54A 1WZNA 1UFVA 3HJCA 1K0FA 3NKFA 3NJ4A 3MD0A 1CS0B 1P3JA 2I8AA 1K6EA 2ABWA 5K0FA 3LPLA 5KWIA 2R6AA 3QHPA 4QYTA 4Y3UA 3ZTWA 2QVYX 1TW3A 3R0ZA 3VNQA 3JAKB 1SUWA 3P0JA 3HU1A 4PFJA 3UMSA 2P2SA 1U28C 1HYBA 3UHJA 3HFRA 3FDFA 1EUYA 1Z88A 1PHPA 4UD2A 2C8VA 4O0MA 4BY9E 3CWZA 3C0KA 2I6FA 2DH5A 3MAAC 1KJWA 1VHTA 1VPEA 3CGGA 5IVDA 5HFNA 1M72A 3AIOA 2WUVA 4US2R 3DO6A 4DLTA 2G63A 1GTG1 2BBSA 1SCQA 1D6NA 2FPOA 1N7JA 2WLSA 2ZRCA 3D2AA 3H8SA 1PS0A 3KB8A 1TLLA 4R1OA 3AEXA 1Y1LA 3QKTA 3QEJA 3NORA 1XHEA 1UKEA 4RGYA 4ANFA 5JCPA 4CMEC 2G17A 4H3VA 4WLFA 1SC3A 2PRZA 2Z04A 1V48A 2ZITA 3D3WA 4HK4A 2A14A 3HXTA 4RA6B 1EUDB 3O3CA 2F1RA 4M7RA 3H1PA 4HAIA 4OJKA 3SBXA 2HTEA 3TTSA 4AZ3B 2AYXA 1U63A 4H9GA 1I10A 1W5BA 1G7CA 4UQOA 4X3CA 1TQ4A 1FUUA 1U2TA 2HPHA 4HDCA 1U6IA 4X8HA 2XD9A 4GFDA 4Z9FA 4WBNB 1GAWA 4B7CA 3AO0B 1DADA 4YREA 3RYIA 4CMJA 3L4BA 1Z3CA 5JPIA 1ZHFA 2QP3A 2YV1A 2SHKA 1ECGA 1M3SA 1CRWG 4P7JA 1BDIA 5JSYA 1P5RA 1NHGA 2CNWA 4HQNA 1ZU5A 3EZXA 4PS1A 4RTKA 3OJOA 4NK5A 1WV0A 4ENRA 3LQRA 1GCAA 1SZDA 1TT5B 4LJ7A 1ECPA 2IP1A 2Q6LA 3OT1B 5I3ZA 3VH1A 4NRDA 1CE8A 1S2GA 2I34A 3L1UA 3NAZA 4HSEA 1TU3A 1QBGA 1F60A 3DHNA 3ZIDA 3ZVRA 3SZLA 4NZMA 4AB1A 5GPBA 3CN7A 2ES4A 3ZD9A 4YXFA 1R2QA 4DQUA 4Y1RA 1V8DA 1OREA 2ZTMA 4BLVA 5A05A 3VU9B 4LWPA 2AXNA 4UOZA 3FTEA 1I7QB 4JV5B 1Z56C 1KP3A 1KK0A 1AXRA 4AULA 4WOCA 1G21E 3IAS1 1SWWA 2QX7A 1P2VA 3T3MB 3T3GA 4QJ3A 2DZDA 3MINB 5CCXA 3H3XA 4TZKA 4XFDA 3WMGA 1FSFA 2XMDA 1SBQA 2VKQA 1PV1A 1TYDE 1YS4A 3HPQA 3C85A 4JVNA 4PFQA 4KE8A 1K7YA 4B79A 4LMPA 1K8XB 5DNWA 1D1PA 1HPLA 1E9BA 3E9QA 5CIYA 1T1IA 3IUPA 1QP0A 4F11A 3PKZA 2O2GA 3KUKA 3NGLA 1GSAA 3DT6A 4Q19A 1GFZA 2NVOA 4IAOA 1PV2A 5FPSA 4KFUA 2WMNB 2BDTA 2P9YA 2AV6A 1C41A 4L15A 5EXTA 4J75A 3QY9A 1XDGA 2YXDA 5IBCA 2VLBA 4WXMA 2C5EA 1IK6A 1G5QA 1HTBA 1U2ZA 4OK3A 4U9IS 5LDGA 1BXRA 3F96A 5IYZA 3T9FA 3DEFA 2F67A 1PFGA 1PQ4A 1ZOPA 2C77A 4JQZA 3UUGA 1QHGA 3HY3A 4GR5A 3JQ9C 4ZI3A 5TQ2B 1FUKA 4KEAA 1E1CB 2R6R1 2ZSIA 4KXUA 4D9NA 1MENA 3UFBA 2XAAA 2H85A 1GZ7A 3NG1A 5KJCA 4HS4A 1D2EA 4X54A 3ETDA 1VIYA 1SXPA 5JD4A 1GGVA 2Q5HA 3DCJA 1FQOA 3G2MA 4N0MA 4RENA 3X1ZA 2DVMA 2IU0A 5AUOB 4DSZA 2QVBA 5KX5A 2PJRA 2WA1A 1U5BB 2YN2A 5AKIA 4KO1S 3JQCA 4D8UA 1I2ZA 5MFZA 2P2NA 2IH4A 3BIWA 3C3AA 1RRCA 1GQOA 1SHJA 3KR1A 3ZZ0A 4CKEB 2VKTA 3AV0B 3E5HA 4BGDA 2X0JA 3VO1A 1YDFA 4V0OA 3U16A 1ELOA 3IP1A 4GP6A 4DFDA 2B9VA 16PKA 2VH1A 4GNKA 1H0HA 4NCBA 1PZFA 1E1RD 2I33A 3SPXA 2PWAA 1CVRA 3KKQA 4RIGA 3WKBA 1ZRNA 3DULA 2GDZA 1D5WA 4G4IA 3OQNA 1YDHA 5DHPA 1GDDA 5FQOA 1I1HA 3RIYA 3PR2B 3DGFC 4F97A 4XIGS 3AXSA 3DTVB 1U0OC 4PZUA 4BQEA 1RWPA 2EQAA 3FLBA 1DEOA 1YBAA 4OFWA 3ROPA 2BTQA 4OQ4A 4H6VA 4DMKA 3A1DA 4R8KA 4RE5A 2O8EB 3K94A 1CUHA 4F72A 4M89A 2J0VA 1XQ9A 3FCUB 4R16A 2Y1EA 3H1EA 4MLDA 3NP7A 5NULA 3R8CA 4WCVA 4DZZA 1OC4A 4EO4A 5I4CA 3IEKA 3UFXA 4HD8A 2D5AA 3BIJA 4OOFA 3O4HA 4MI3A 4B4UA 4Y1GA 3PITA 2JKVA 3LT4A 4LF8B 5KCZA 4LHZA 3RWOA 2FRDC 3ZBTA 2HV9A 4BMCA 1FZQA 1JFSA 4CCWA 1AOXA 4JOCA 4LE0A 4B7XA 4KXXA 1DPFA 3O6VA 3P0HA 2PMKA 3I4CA 4DLAA 4F96A 1MMFB 5A0TA 4NYMR 5LP1A 4QYXA 3L7CA 2J9XB 4B85A 2ZYWX 4J1TA 1VRWA 4RORA 5H80A 5B3LA