4XGNA

Crystal structure of 3-hydroxyacyl-coa dehydrogenase in complex with nad from burkholderia thailandensis
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
255
structure length
255
Chain Sequence
HHHMEIRDNVFLITGGASGLGAGTARLLTEAGGKVVLADLNQDAGEALARELGGVFVRCDVAREEDAQAAVAAATKLGTLRGLVNCAGIAPAAKTVGKDGPHPLELFAKTITVNLIGTFNMIRVAAAAMAANEPAPTGERGVIVSTASVAAFDGQIGQAAYAASKAGVAGMTLPIARDLSRNAIRVMTIAPGIFETPMLLGMPQEVQDALGAMVPFPPRLGKPAEYAMLVRQIFENPMLNGEVIRLDGAIRMQPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 3-hydroxyacyl-CoA dehydrogenase in complex with NAD from Burkholderia thailandensis
rcsb
source organism Burkholderia thailandensis
molecule tags Oxidoreductase
molecule keywords 3-hydroxyacyl-CoA dehydrogenase
total genus 90
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xgnA00
1UZLA 1VM6A 4OO3A 1DOHA 1N9GA 3JD4A 2WJPA 3DMTA 1MGOA 2A4KA 4R16A 1C0PA 2I67A 4IGEA 2GZ3A 1YONA 2GN9A 4B8WA 4JX8A 1PL6A 4J2HA 2C2XA 2UYYA 2VUUA 4E0BA 3TOXA 2P5UA 5KWEA 4QO8A 5A1TA 4I08A 4IY1A 2B4TO 1E3SA 1YOVA 1EBUA 2EV9A 4JROA 5KCZA 1MC4A 3QWFA 1MA0A 3FBTA 4JXKA 1ZK4A 3PGXA 5G0UA 1ZSVA 2AW5A 4IDAA 4EW6A 3HJAA 1WVGA 3AWDA 4Y9DA 3RQSA 3E8XA 1CRWG 1QSGA 4UREA 4W6ZA 3PXXA 3SLKA 3DQPA 3BMCB 4B7UA 5AQ1A 2DUWA 4OMUA 5TF4A 5KVVA 2D1YA 1ISHA 1ZMTA 2JCVA 4PVCA 2B4QA 1HE2A 1I3NA 1T24A 2Y1OA 2FZEA 2VWPA 1JA9A 3IC5A 4KUEA 4EUHA 3LLSA 4XIYA 1PZHA 4NR0A 4Q3CA 4CUJA 2QZZA 2CD9A 4TRRA 3HUDA 3T4XA 1WZIA 4PLHA 1AUPA 2WTBA 3MWEB 1ZO8A 3WNQA 3DC2A 3QW2A 4CLRA 4OL9A 4L9RA 1HF3A 4RPHA 4G2NA 1PGJA 3NGXA 3PTZA 4FOOA 4RZHA 1C1DB 3KEQA 1YBAA 2P4HX 2YDYA 3IDSA 2J6IA 5KJEA 1Y81A 1I2ZA 2O23A 4Z9XA 3I6IA 1U5AA 2VTEA 5COBA 3E03A 3UF0A 1UAYA 2B35A 2XF8A 2IXBA 3ZHYA 4DLLA 5I7FA 2DAPA 4IMPA 1DHRA 1E7MA 1P0CA 2Q2WA 3DAGA 1B16A 5CDYA 4U0JA 3QP9A 4NBTA 1CDOA 5L7WA 4B4OA 2Z1NA 1KEPA 3L0DA 3KETA 1DEHA 1L7DA 3MOIA 4W9NC 5HS4A 5DCWA 1E3JA 1V3UA 1KEWA 1UP7A 1Y7TA 4FJ1A 5FEUA 4YXFA 3GGOA 2P91A 1RPNA 4GKBA 4XYBA 4CV3A 4ALNA 4MVJH 2PH3A 1I3MA 1B15A 1WAMA 2HDHA 3GHYA 3S55A 4DIBA 2FR1A 3PGJA 4BNWA 4BNLA 1NFQA 1ULUA 4BNNA 1FDSA 3PP8A 3MJEA 4GVXA 3RU9A 3BHIA 4RVFA 3VPHA 1PX0A 2R6JA 4XDYA 2FRDA 1YWGO 4TKMA 3HN2A 4DMMA 3OJ0A 5BR7A 4BVAA 1LLCA 1GADO 4AJ2A 2JFHA 4KDFA 3EZYA 3H2ZA 1WDMA 2OGUA 4MVJF 4Z9YA 2W8ZA 3WGYA 4J0FA 1NPTO 4TKLA 1GCUA 5L4LA 5G0VA 3QE3A 5L4SA 5T6BA 3ZWOA 2AXQA 1YVEI 1KEVA 1C14A 3QVSA 1ZSNA 1I3KA 3GGPA 2WMDA 1ZJZA 1M2WA 1BXKA 1P9LA 3CZMA 3LC1O 4J2OA 4A5OA 2NU6A 3W1VA 1NQTA 9LDTA 1VKOA 3EY4A 4LSWA 4BIIA 2WSBA 3LSYA 4QXMA 1MX3A 5JE8A 2DUUA 4YQYA 1YL6A 4XIJA 5BSFA 4UUMA 1LEHA 1H93A 1TLTA 1H6CA 2Y66A 3INRA 3KLMX 4JIGA 1BGVA 5I9MA 4M49A 3ETGA 4BO9A 3QVTA 2NVWA 3I9JA 4B8ZA 1BWSA 1V0JA 2IXAA 2NTJA 4YJDA 4UVEA 2QIOA 1CETA 4DC1A 2EKPA 5DBFA 1T4BA 2VYND 3RBZA 5GMOA 1E3WB 3GN2A 1XLTA 5L7TA 3ROQA 4I5GA 3TFQA 5JXWA 2PK3A 1ZK3A 1PQUA 3GVIA 3WFIA 3WXBA 2QZ9A 4XR9A 4DIOA 1HDOA 2HUNA 4LCEA 2E37A 3IP3A 3KYBA 4NPCA 4CQMA 5JW6A 1KY5A 2IDZA 1L1FA 5FFFA 3PZBA 2VUSA 2NNLD 4R9SA 3OA2A 2W2KA 1LC3A 3ZV5A 4XQGA 4IDDA 1U8FO 2FMUA 2XXJA 5JS6A 5JAZA 3H3FA 4BNZA 4NK4A 4PVDA 4CM8A 2EXXA 3MJSA 4BO5A 1M75A 3I23A 1VI2A 2PTGA 1P1HA 2GN6A 2VNAA 1P1IA 1HYGA 1GZ4A 3QSGA 4CL3A 5JY1A 4BKOA 4K1LA 1SB8A 1A4IA 2B4RO 3GFBA 2PV7A 1A7AA 1N7HA 4GKVA 4XYLA 2IRWA 2I66A 5A5EA 3GGGA 1KVSA 5G4KA 1EVIA 1OC2A 1Q0LA 5I8ZA 2WYUA 2O3RA 4CQMD 4MIOA 2PWZA 3AM3A 5H82A 1IPFA 3JQDA 1MV8A 4ESOA 1JKFA 5IG2A 1PJBA 2QQ5A 1B26A 3PJDA 1X7DA 4D0SA 4AJHA 5BSHA 1QLJA 4CLHA 2EJWA 2DC1A 3JQBC 4ONEA 1LDBA 5GY7A 2VUTA 1Y9AA 2NACA 2OL4A 4J1SA 1C0IA 4X54A 2NU7A 4RJTA 4LISA 2YFHA 4CJXA 1XG5A 2ZCUA 4IS2A 3OFSA 4O0LA 2WWRA 2NV6A 2CZCA 5ITVA 1B8PA 2ET6A 4NK5A 2VHVA 1DIHA 1NPDA 2AE2A 3WGHA 4MKZA 3H65A 1OC4A 1P1KA 2PZJA 3H8VA 3K30A 1FDUA 1PJTA 2Q50A 4FC7A 3Q3CA 2Q1WA 3GOHA 4BV9A 1UP6A 4R1NA 5G4LA 2HK9A 4I1IA 4FR5A 3BMQB 2DU8A 1YDWA 3JQ8B 3H5AA 4OSPA 3TFOA 3OSUA 5J23A 2XOXA 1Q7BA 3ZWMA 1K6XA 3ZZNA 3RAJA 4WGGA 4Q3DA 3ABIA 1F17A 2NWQA 4CM9A 3FR7A 1HDCA 1NWCA 2BMAA 4YAJA 4XDZA 4YAEA 1PJ2A 3GEDA 4ZHSA 1DAPA 3GN1A 3C1OA 3CEAA 5ENDA 4HKTA 2IZ0A 2UVDA 1XYGA 4OJNA 2JD1A 4ND1A 3ZNOA 3OM9A 3BYZA 4RORA 4J3FA 4D3FA 3DBHA 4IZHA 4I9UA 3OQBA 1QRRA 4S3MA 4XGKA 3JYQA 1HT0A 3BAZA 1EQ2A 4AL4A 2OHXA 3E5MA 4DL9A 2WE8A 5JSFA 3WG9A 3U5TA 2E48A 1I0ZA 2ZYGA 3R0IA 4P4LA 1JWBB 1NVMB 3I9KA 3WR5A 2YV1A 2VWQA 1Y8QB 2P5YA 3DAFA 4WECA 3A06A 1PR9A 3AUAA 4BGEA 4WCFA 4ALJA 3E9QA 1DAOA 2Y1CA 5AXDA 3RC9A 3GQVA 2OBNA 2E6UX 1EK5A 2WE7A 1IPEA 2YZ7A 2V6FA 2C2YA 1EUDA 4IJKA 3EYWA 1ZZEA 1DFIA 1NWHA 1SB9A 4U6QA 1UXGA 3GMSA 3L77A 3TDKA 3VVCA 4EITA 4PLPA 2GZ2A 3JD2A 3NX4A 3PRJA 3F47A 1N1EA 3EZLA 3JQ8A 4FS3A 2JL1A 3BHMA 1NAIA 3K2EA 2DBRA 4MKXA 2ZTUA 2E4AA 1NHGA 3FWNA 2POQX 1DJQA 4IUYA 4TZTA 5EJ2A 3ONEA 3PFFA 1HLDA 4BNTA 5ENVA 5LDGA 2HO5A 2CFCA 3OF2A 2W4QA 3EGOA 1SOVA 2DVMA 3HWRA 3RKUA 2BD0A 4XWYA 1TB4A 4CQMB 5BSEA 2AMFA 1N5DA 4CQLB 5F1PA 2JFGA 3V5NA 3F4BA 3IOYA 3G3EA 4PFJA 2YHIA 4XJSA 3QV1A 1NFRA 1XGKA 1VKNA 1PIWA 4CLXA 4WEQA 1I30A 4HFNA 3PVZA 2V7PA 7MDHA 3CIFA 1RYDA 4N5LA 3RI3A 2PGJA 4J7UA 4UVHA 2ZJ1A 3ZH2A 1ID1A 4EBFA 2ZB4A 4WLOA 4FC6A 2XAAA 4ZGWA 5B1YA 3ZWAA 3ANLA 4DXHA 4FDAA 3SLGA 2VT2A 4P22A 5CG2A 4CODB 3GPIA 3COSA 2BI7A 4CM5A 2YYYA 3ZDFA 2EJVA 1Z6ZA 5DOVA 4HY3A 3K6JA 5K6AC 2JHGA 3ZU2A 3QIVA 4ZA2A 4F45A 5IZCC 3H9JA 4L73A 4G65A 4E3ZA 1DC4A 3PWZA 4XJTA 2VNSA 1PZEA 1ZIDA 1F0YA 4BHTA 1BXGA 2YW9A 3BMOA 4M55A 3UFXA 2IEBA 1P1JA 1ZXBA 3I3OA 1S6YA 1U8XX 2HRBA 1DC6A 1PL8A 3GVCA 4AJ1A 4YRDA 1W0CA 2G76A 1D4FA 3QJ5A 2Y67A 3SBOA 1B14A 5TS3A 2HMUA 1MLDA 4WPGA 3JD3A 4AJJA 1T2EA 1NNUA 3MTGA 1ZEMA 1NR7A 5H81A 3IAHA 2BGMA 1JAYA 1GV1A 3Q2KA 2Y05A 2OXIA 4CLEA 1I2BA 2BGLA 2DFDA 3U09A 2O50A 1YB5A 3KBOA 4WJZA 2C07A 1UXHA 3GR6A 1M66A 3P2YA 4YTEA 5BNTA 3G17A 3U4IA 5EQDA 1ZCJA 3ZW9A 3WIDA 4FPXA 5DT9A 4NJMA 4BNKA 1AHIA 3W8EA 6LDHA 1ZK0A 4RF5A 2OBYA 4R51A 5K6AA 5IXSA 3CMMA 3MJ4A 3S2GA 1AXGA 2PA3A 3TPCA 3DB2A 4MVJG 4WCFB 3WTBA 2CDBA 4YT8A 4LN1A 2Y1DA 1YBMA 1YRLA 2GD1O 2PD4A 3RC7A 4BB6A 4E13A 1VRWA 2P68A 1CWUA 4II3A 3L9WA 4ZQEA 4HV4A 1I33A 2RCYA 4LK3A 3AI1A 3EVNA 3KYCB 1LSUA 1U3WA 3JQ7B 1H6AA 1IZ0A 2V6BA 3DZKA 4FGSA 2VQ3A 3D7LA 3FRJA 4J1TA 4MVJM 3U4HA 4CMCA 3SXPA 3ZWWA 2CMDA 2ZB7A 3GH3A 1EDZA 5JDIA 4JP3A 5EINA 1NPYA 4E4YA 4BMNA 1R66A 3HDYA 3JV7A 1R0LA 4G81A 4L4RA 4AJIA 2F1KA 3GVPA 3D3WB 1FDTA 5A4DA 1YQGA 2CDAA 3AUUA 4GVLA 4B4WA 4BO0A 2V65A 1B8UA 1X0XA 4U0KA 2ZIZA 5C3MA 1MP0A 2ZTLA 4IIUA 2BFAA 5JAIA 3GZNB 3I9NA 2Y1GA 3LT1A 4WE3A 1ENOA 1SC6A 2X4GA 3JQEA 4MP6A 2G0TA 1LTHR 3LYLA 1W4ZA 1IHXA 2PKQO 1HL3A 2EIHA 3DXFA 3O03A 3OH8A 4CM8B 3AM4A 5T8KA 3IMFA 1DFHA 2OP1A 5ILGA 3CINA 3C7DB 1W8DA 2J8ZA 1PGQA 2BFPA 3GDGA 3AU8A 5HA5A 3HQ4O 3OMLA 3A1NA 1IHYA 1Z7EA 2WM3A 3IQDB 1XR3A 3E18A 5LCXA 2A92A 1X15A 3B20A 2D2IA 1A27A 2YV2A 4KMSA 1M6WA 1P1FA 2C20A 4MINA 1NQOA 3V2GA 4BO7A 1U3VA 4XR4A 1BHSA 1ORRA 5T8KC 3ZWPA 3FI9A 3BMNB 4CMGA 4B3JA 3BZUA 1EE9A 2GR9A 4I8XA 1A72A 4TQGA 3JQFA 2EW8A 3ZV3A 1E7WA 1Z7BA 2UDPA 3MZ0A 3K2BA 1U7HA 5JO0A 4D42A 5B12A 3FNFA 4ROSA 4BB5A 1KETA 2EERA 1HRDA 4S1VA 3TN7A 2Q99A 4IQ0A 1CIVA 2O4UX 5GZ1A 4TRNA 3HG7A 4OQZA 4BO6A 1IOLA 3AFNA 4WEOA 3VTFA 1E7RA 1XWFA 1LJ8A 2NU9A 4EJ6A 1LRJA 2C5AA 4RV9A 1UZNA 3BTOA 4ND4A 2BHLA 1DRUA 4TWRA 1BG6A 1D8AA 1GR0A 4M8SA 1LRLA 4O1MA 2AQ8A 2EG9A 4WLFA 1CQIA 5JDIC 4QECA 4BKQA 4YRAA 1WZEA 4XQ9A 5KJ6A 4UAGA 1BXZA 4H7PA 4IQGA 2X0RA 1XKQA 4YWJA 1U4SA 4XRRA 3RUAA 1X0VA 3WWYA 1KVRA 1R0KA 4CMEC 1NP3A 1X1TA 1K89A 3RUIA 4L0QA 1R4NB 4DLBA 2X0IA 1B2LA 2B83A 3QWBA 4N7RA 3LC7O 4A2CA 1K2WA 4YRBA 2X0JA 5TQVA 5BQFA 2JAPA 1A7KA 4Q3EA 4EGFA 1DC5A 4WOKA 4G5HA 1PU2A 2HRZA 5F5LA 3AOEA 3WBFA 4OKNA 5CFZA 2RBEA 3OQ1A 4IDGA 5AYVA 1K5HA 1BSVA 5AVOA 1TEHA 1E92A 3EK2A 3OEWA 3HZZA 3JQBA 4CUZA 4GLOA 2YQ5A 3CE6A 4RL6A 4D3DA 2EP5A 4ILKA 3DBRA 4E2YA 3FWZA 1WDLA 3PHLA 1KEUA 4FQ8A 2H63A 2B5VA 2X86A 3HFSA 3T7CA 3H2SA 4JJFA 4RDIA 5HS6A 1ENPA 3JQAA 4N18A 4CM4A 3M1LA 3OBBA 1ISMA 3QVWA 4LVUA 3LT0A 1PQPA 1ZJYA 1VJ0A 3FBGA 2ZKLA 4KTTE 5JMPA 1AGNA 2YHUA 4PIVA 3ZGYA 3UHAA 1E1NA 4BMSA 1O8CA 1ULSA 3BTVA 3LDHA 5JLAA 4TSKA 1DXYA 4ND5A 4E2XA 4GL4A 1GZ6A 2E49A 1WNTA 2NQTA 4PN3A 2QYTA 3GA0A 4YEDA 3DBVO 2VN8A 4D7AA 1NM5A 2X23A 1ISJA 1Y8RA 4H3VA 5CHEA 3JYNA 1N92A 2O2SA 3G79A 4GX5A 4Y98A 1R4NA 3UW3A 2BRUA 3EHEA 4P4NA 1FDVA 3RWBA 1PJ4A 2NLOA 5TJ9A 2GPTA 3MJTA 3NV9A 1P44A 1XU7A 1V3VA 4BQRA 4PLCA 5I9LA 4XQCA 3DWFA 5A04A 5ICMA 5ITWA 4MVJA 4DQXA 4ND2A 2WYVA 4ALMA 4LW8A 3V1TC 1EVZA 1TT7A 5FYDA 3FPLA 2EP7A 2I76A 1FDWA 1H0KA 3WDSA 1KC3A 1WPQA 2VOEA 4J91A 3O9ZA 2PR2A 4PLYA 4DPMA 4B3IA 3LT2A 1OZAA 4IM7A 1EDOA 4FFPA 4JLWA 2V6MA 3PHJA 4BO2A 4M89A 4FJ2A 2AQKA 4BO4A 2HCTA 3DZHA 3GK3A 4R5MA 2IZ1A 3K31A 4RLHA 4U8GA 4CLOA 3KRTA 1Q0QA 1RYEA 4GAEA 3C24A 3TRIA 3LF1A 4KQWA 4FW8A 5ES3A 4MKRA 4D46A 3G1UA 2Y0CA 3NJ4A 4AJPA 4NHEA 2X22A 4JJGA 1JN0A 2FY8A 5FI5A 4BL5A 5C7OO 5F21A 3BA1A 4W99A 4ZD6A 3QRWA 1FXSA 2UUOA 3PIIA 2X9GA 3ONFA 3MJVA 1PGOA 1CF2O 4I9NA 4NJOA 1SCUA 1HE4A 2ZCVA 2DFVA 3PJFA 2VTDA 2J3KA 1D1TA 4Z9FA 1XEAA 5EESA 2FZWA 3QY9A 3OA0A 3NAQA 4IDBA 2VRCA 3FN4A 2CVQA 5IDWA 5JO9A 3SVTA 1BW9B 3B6ZA 4A26A 4R1SA 2NU8A 2JD0A 1Y8RB 2C54A 4QFCA 1HEUA 4AJNA 5I7SA 4TMFA 1YDEA 2EF1A 3RVDA 4ZRNA 5I9NA 1KBZA 3DZBA 4XGNA 4PZEA 4OM8A 2VZ9A 3AOGA 4NH4A 1A4UA 3AM5A 2X9NA 3IJRA 3DZFA 3K73O 1OAAA 3HADA 5JBIA 8LDHA 3P2OA 4NG5A 2O3UA 4L8VA 1UXIA 1ZEJA 2VWGA 3VZQA 3E6AA 2HK8A 1IY8A 4YVFA 1GEEA 2VHZA 2A35A 3JYOA 1I5RA 2NUAA 3QA9A 3I4FA 3I4CA 3H5NA 2I99A 1GCOA 3JQGA 4R9RA 5GZ6A 1H2HA 4IQ8A 4CR8A 1UP4A 3OEYA 2RIRA 4XRGA 1ARZA 1QYCA 3CPSA 3F6YA 2P9EA 3FF4A 2EW2A 4F46A 5JY6A 3WGIA 1LSJA 3H4VA 4L4SA 3RUCA 1EFLA 1L7EA 2SCUA 5CPFA 5JC1A 5KIAA 2I6TA 3E9MA 2BGKA 4RF4A 3OJEA 4DPKA 1I8TA 3U0BA 2GRAA 1I32A 2H6EA 1DJNA 3HN7A 4DVJA 4UVDA 1EVYA 4HX5A 3EUWA 3RD5A 3PWKA 3T7EA 4YDRA 1KYQA 1LSOA 1GQYA 3I83A 3KSUA 4NNJA 1KC1A 4ZVVA 5A9SA 3IKTA 1K3TA 3B1FA 3K92A 3V1UA 4UVGA 4A27A 4WCFC 1GEGA 2EGHA 1QMGA 4QO7A 2GN8A 5KVSA 3EAGA 5L45A 1LA2A 1XU9A 4I5DA 3JSAA 5F3RA 2W90A 1BMDA 5A5FA 3CH6A 3QWHA 3HDJA 2AE1A 5T57A 3NTQA 4PCVA 5CDSA 4E31A 5ADHA 2NM0A 4BNGA 2YJZA 1HSOA 1MUUA 1PJLA 1E6WA 1GQQA 4PLWA 4E2WA 2AHRA 1HE3A 4OXNA 3FNEA 5CEJA 4DYDA 1E5QA 5EIOA 1LUAA 2CY0A 4DPLA 1EEHA 3GVXA 2LDBA 4NDNE 3VZPA 1XELA 4CPDA 3TL3A 3DBLA 2FN7A 2AG5A 2CF5A 1LLUA 1HKUA 1DSSG 1VSVA 1ZSYA 4BNXA 3JQCA 4GX1A 4H16A 2GASA 3DEYX 4K26A 3JQ9C 1R4MA 4MVJE 3A4VA 3RFXA 4AJLA 1XQ1A 3MTJA 4EUFA 3DZGA 1NQ5A 2AEFA 2CDCA 3QVOA 1C0KA 4BO1A 3JCZA 4E12A 4RVHA 2Y0EA 1OBFO 3IP1A 1C0LA 4E5NA 4GWKA 2VWHA 4M86A 3TWOA 3PLRA 1F12A 3FCOA 4BNYA 1YB1A 2DT5A 2X5JO 4KP7A 2P2SA 4L74A 4ZQFA 4BGUA 5K9ZA 4QX6A 1U2DA 2DTXA 5JYDA 3GG9A 1HTBA 1BXGB 1U28A 1YQXA 4BNHA 4UUPA 3IS3A 3ULKA 3LLVA 5HRUA 2H5LA 3WX0A 3TJRA 4TROA 3OHSX 4RZIA 1XIVA 5CPBA 4YJFB 3ZHXA 5EN4A 2RHCA 2G1UA 1GYPA 4CV1A 2HK7A 1ZBQA 3ZWBA 2NVUA 1V9LA 3E5RA 3VZRA 4D44A 3K5PA 1T4DA 1EVJA 5IJZA 4D3SA 3FTNA 3F46A 1UZMA 4RCVA 2EHDA 1V3TA 3TF5A 4HFMA 2VRBA 4IZIA 1DRVA 3ANMA 4IPTA 2FOIA 4WLVA 3ITDA 4D41A 4YT2A 5DULA 4WLNA 5CDUA 1A9ZA 2X1HA 5G0SA 1O95A 4B3HA 1P3DA 3JQ7A 4IDFA 2ZQYA 4LRSB 3VPXA 4ZU3A 1M67A 3W4JA 4OIMA 2TMDA 3PJGA 5IAAA 1PJQA 1F8GA 4C4OA 5GZ3A 4PLFA 1EE2A 1DC3A 2VYNA 1TI7A 2O3QA 2Y93A 5BNFA 1PJ3A 3C1AA 2QRJA 1KERA 3AK4A 5U1PA 3ITKA 5LDHA 3KHUA 4HBGA 3ZU5A 4OGWA 3HFGA 2YFQA 4PLVA 1MG5A 4YJGA 3KSZO 3R1IA 2Z95A 4QQRA 4AG3A 1RKXA 4BNMA 1NHWA 3ETEA 3P19A 3ENNA 2J5KA 2IE0A 3C1TA 3GUYA 4N54A 1GAEO 5AXAA 4D79A 5HBRA 2HJRA 3OIGA 2IODA 1EUZA 2Y0DA 3HNPA 3WTCA 1PQWA 3GNTA 1VJTA 3H7AA 1ZNQO 2Q1SA 4IGFA 1NXQA 4OYRA 3MWDB 3NKLA 4TRMA 3WBBA 5TT1A 3WYBA 2W2KB 3ZU3A 5JYEA 4LVCA 4EUEA 3N7UA 2C5EA 3F1LA 2GF2A 1Q2XA 1XSEA 4K28A 1UDAA 3L4SO 3S2EA 2QW8A 1V6AA 3D1LA 2JCXA 3FD8A 4PLGA 3FNGA 4PZCA 4UEJA 4NZ9A 2BKAA 3RSHA 1ADGA 1PGPA 1VPDA 1QP8A 1GUFA 1YE3A 2UAGA 3D0OA 3DMTC 4JN6B 3LQFA 3ORFA 4FFRA 1SNYA 4OOEA 1KVTA 4KOAA 4U7WA 1DIBA 5I7VA 1H2BA 1TT5A 3EVTA 2I5PO 4L76A 4CV2A 3AY6A 1LDYA 1E3EA 1GQ2A 3TL2A 1HDXA 1DIRA 1P0FA 3NGLA 5THQA 1Y5MA 2EWMA 4B4UA 3NYWA 3VH2A 1NX6A 5DCYA 3K96A 3HDQA 3WQSB 1P45A 3LZ6A 2AQIA 3DFZA 1E0DA 2JCYA 4DQUA 5JCJA 4YJGB 4LCJA 3M2TA 1R15A 3GNSA 4NFSA 5G4KB 3PFWO 4IJUA 3HB5X 4NBUA 3GEGA 4AJ4A 4CM1A 4NQZA 4BOYA 1WWKA 4ZICA 1OOEA 1U1IA 3DOOA 4R3WA 1TXGA 3Q9UA 3NT5A 1IE3A 4CMAA 2RHRA 5U9CA 3ZNPA 1R37A 5JCJD 3Q0EA 1NVTA 2XXBA 4BMVA 5L53A 2Q45A 3KUXA 3KB6A 4GX0A 1T2CA 3AUSA 4Y8VA 2Q3EA 5HTOA 1SEVA 3RUHA 3U9LA 3RUEA 1PWZA 5TT0A 2X8LA 2NVBA 4W9NA 1VL8A 4P4GA 3L9XA 2NVUB 3WMWA 3O26A 2D0IA 3Q9NA 4PGFA 1J5PA 2B0JA 3PYLA 1T1SA 2BLLA 1E3WA 3KXDA 4B79A 1HE5A 2JHFA 4FFOA 1QYVA 3HDHA 1NAHA 1QR6A 3C3XA 5K0ZA 1MFZA 4KUHA 4E6PA 4OH1A 2FWMX 4KQXA 4DLAA 3L6DA 4E5PA 2FSVA 5IF3A 4NJMB 1ENZA 4WLUA 1RM0A 5C7IO 4K6CA 4W7IA 4JQCA 2EGGA 1EK6A 4MVJP 1PWXA 5FWNA 4INAA 4WK6A 4NBVA 3ZWCA 5KOIA 3PPIA 1GY8A 2OO5A 3F9IA 5A9RA 3DMYA 3A14A 5L9AA 1SPXA 4EEXA 3ROKA 3OIDA 4ALLA 1H5QA 4HUJA 1C1XB 3I9OA 1NBOA 2WEKA 1UAGA 3R3JA 2WD7A 3QHAA 1DDOA 4RDHA 3TOZA 1MB4A 1R4MB 5AXBA 3D5QA 1HWYA 2X5OA 2P9GA 5IZ4A 4GGOA 4O63O 1F8FA 3S1LA 1Q0HA 2DTEA 3KYCA 3ETDA 1HLPA 1RJWA 2EKLA 2HKIA 4B7XA 4YAKA 3WICA 3OJLA 1NTOA 5FF9A 2XPCA 3RU7A 4NMHA 1LDEA 1PZFA 3KV3O 1E5LA 1UJMA 3O4RA 3BXXA 3W4IA 3D3EA 2GERA 1ZW1A 5C7LO 4BNVA 4FFNA 3KOUA 4DBVO 4J0EA 3D4PA 5H83A 4F6CA 3H9EO 4J90A 5IDYA 1A9YA 1CQJA 5CG1A 2X9VA 3F5SA 3HHPA 3ENKA 1FJHA 2VZ0A 2HAEA 2B37A 3UCFA 2PFGA 3V1YA 5JMWA 3GHHA 1U9JA 4FBGA 1XHLA 1VL0A 3ZW8A 3B1JA 3ZWXA 3IJPA 4A10A 4R54A 5TC4A 5IN5A 1RM4A 4CL8A 3AUTA 5B4VA 4DUPA 5IZCA 3TZKA 1G6KA 1GDHA 1Z45A 1ML3A 2OUIA 1JKIA 1HXHA 4RVDA 3PDUA 5IN4A 4J49A 3PQDA 5JPIA 4XA8A 3RIHA 2NTVA 2G5CA 1QYXA 1LDNA 4J16A 3UXYA 3GUCA 2EKQA 1ZK1A 4BQPA 3GG2A 1Q7GA 2DBQA 1LXCA 2JAHA 3FSRA 4I5FA 3KSDO 1GPDG 2A9FA 3SC6A 2BI8A 5JDCC 3W8FA 4IJVA 1J6UA 2PZMA 2O7SA 1EBFA 4EJMA 1YJ8A 1O94A 4RPGA 1YKFA 4DGSA 1JVSA 1HSZA 1UR5A 4JGBA 1PS0A 3LT4A 3H3JA 2H1SA 4N5MA 2Y1FA 4J7CA 4TVOA 3PQFA 1VSUA 1WDKA 4URFA 4AJKA 3VDRA 3OP4A 1X1EA 2X58A 3H9GA 3CKYA 2OZPA 2IYOA 3DTYA 2C0CA 4MVJD 1R16A 3WJ7A 2D5AA 1ONOA 3PI7A 1N1GA 2RAFA 3PHGA 4NBRA 3ZHZA 3GZNA 3MOGA 3ZU4A 1UDCA 1VE9A 3FTPA 2CVZA 5A3JA 1W73A 1JW9B 4RQUA 3OJOA 1N8KA 1LSSA 1MXFA 1QKIA 3HB4X 1U7TA 4MO2A 5BSGA 5TSDA 3VVBA 5TLSA 3IIEA 4Q39A 3PYXA 3UICA 3WLFA 4ZQHA 3QQPA 1P33A 4OXKA 3WJAA 4CMIB 4CUKA 1YBVA 2HMVA 1O9BA 3DTTA 3BMCA 4RF2A 1PGNA 4E5MA 3R3SA 1KVQA 1Z82A 3MJCA 3GNQA 1GYQA 4TZKA 2AA3A 2E82A 3AFMA 4JP2A 2BF7A 2F00A 4J43A 4WKGA 1ZVMA 1BDMA 1OI7A 3OECA 4EJ0A 3WIEA 4YQZA 2DM6A 1AXEA 1V35A 1YL7A 3FNHA 3I9MA 3WB9A 2Z1MA 3FHLA 2NQ8A 3QWAA 4OKIA 1C1XA 2X6TA 2B36A 1ZXLA 4J4HA 3DFUA 3GVHA 1WW8A 1T2FA 1Z73A 2TMGA 4ZQBA 1ADCA 3KM0A 5CP8A 1W6UA 2G17A 2QHXA 5L7YA 4CMJA 5ER9A 4YPOA 1E7QA 4JCOA 5CAEA 2J3IA 1BW9A 3Q1LA 3RKRA 1I3LA 5TIIA 2VRCD 1UXKA 4WNCA 3ZWVA 3GAFA 1NFFA 4N5NA 4Y67A 3V2HA 3JQAB 4PRKA 3VPFA 4CM4B 1XA0A 3GRPA 1DB3A 2CVOA 1ZFNA 4RVSA 4P8RA 2HQ1A 4R3NA 4HNGA 1X14A 1RM5A 4A7PA 4EDFA 3DONA 1EZ4A 1U4OA 4WUVA 3ICCA 2VZ8A 1GL3A 1NR1A 3UAGA 1ONPA 3D5TA 3BMNA 4ZQGA 3V8BA 4GSLA 4F6LA 4XCVA 1LX6A 3I9LA 2C7GA 3VPGA 4PG8A 2WDZA 3TSCA 2VCYA 3PEFA 3HSKA 5THKA 1BRMA 3W4KA 2PGDA 1LLDA 3B70A 3ROMA 2O3SA 3O38A 3ZNQA 4PRLA 2JD2A 1IUKA 3JQ9A 3JTMA 5KJFA 3BMOB 3LK7A 4Z3KA 4LMPA 2X5KO 4YB8A 3TZHA 3GAZA 1SAYA 3L07A 4KDEA 5ICSA 3PIDA 3E48A 2HJSA 3GLQA 4EYEA 1KIFA 4XEHA 3KVOA 3NJ8A 5EERA 4XB2A 4ZN6A 1EQUA 2Y99A 2ZK7A 1EMDA 1FF9A 1ZK2A 2O4CA 2ZQZA 5I7EA 1R12A 3GY0A 3Q6IA 3WGQA 1HETA 1B3RA 4OOFA 4AJEA 1GYRA 3KTDA 3DOJA 1MC5A 4R69A 2W98A 3ZCXA 2VHXA 1DRWA 3QWIA 4YR9A 1LQUA 4PG7A 1TT5B 5DBIA 1G0NA 4RGBA 5G0TA 3S2FA 3OETA 4DYVA 1T26A 1Y8QA 3GPDG 4J9VA 4J1QA 1U3UA 1MG0A 1Z75A 1E6EA 4I9HA 1VC2A 2Q46A 5I8WA 3GFGA 4Q3NA 4YAIA 3PQEA 1KS9A 4C7JA 1B0AA 1C1DA 4UUNA 2FHSA 4FJ0A 2HMTA 3JYPA 2VHWA 4ID9A 1F06A 2ZTMA 2FR8A 3ZWYA 5L95A 4WOJA 2CUKA 3P5SA 4EZBA 1DPGA 4J4BA 4Z0TA 3VKUA 1YOVB 3FR8A 3LU1A 3RCBA 5ER6A 1PJCA 2HSDA 3VAZA 3A9WA 1RWBA 5KVQA 4GI2A 1PEDA 1P74A 3NTOA 3CXRA 1JWAB 1PSDA 4MVJI 4OSOA 4MIEA 4LGVA 2IZZA 4GPD1 2GNAA 4OAQA 3GEMA 4ND3A 4W82A 1E77A 4J6FA 2QRLA 4D43A 3DBRB 4E2ZA 1YXMA 3RC2A 1XQ6A 1E3LA 1J49A 4OHUA 4FCCA 1GPJA 4Y6SA 4IDEA 4OXYA 4U6SA 3VH3A 4YT4A 3OQ6A 3DHEA 3U4DA 3RROA 3JQAD 5TGDA 1ADFA 4RF3A 1Y6JA 1QG6A 3UOGA 3BTSA 2FP4A 1VLLA 1KY4A 1OMOA 5B4TA 3RUFA 1BTOA 5JAMA 1GTMA 4YAGA 2GN4A 1DO8A 2GUGA 3WNVA 4LRTB 3W6ZA 4J4TA 4XB1A 4KUGA 3I52A 5CDGA 1O89A 1GUZA 1K6IA 1CEQA 2Q1TA 2VOJA 5IDQA 1IYZA 2YHIB 1HDYA 3NDIA 1H94A 4FD3A 1CERA 4CQLA 2CF6A 5DNAA 1X7HA 3ST7A 5MDHA 2Q49A 4Q3BA 5FI3A 5KJ1A 3D4NA 2HMWA 5A3VA 4LMRA 2DBZA 1CJCA 4QTZA 3SEFA 3U62A 4DRYA 3E1KA 4DWVA 2RH8A 3UH1A 2X7HA 4DBZA 2IYPA 9LDBA 4II2A 2FR0A 1LLQA 4GGPA 3JD1A 2C29D 3DBLB 4Z3DA 4CM7A 3NT4A 4KWHA 8ADHA 4GSKA 1LDMA 1Y9EA 3UUWA 1KVUA 4UVIA 4J9UE 4J1NA 2P9CA 4BV8A 3H9QA 4XX0A 4BNFA 3T4EA 3VH4A 1R6DA 1T25A 1GFSA 1YGYA 3PZRA 3AY3A 1HZZA 3FPCA 1IZ9A 4E21A 2W2LD 4KTVE 2JJYA 2Q4BA 1XCBA 4H15A 3TNLA 4RVGA 2QRKA 4QUKA 4RVUA 4CR7A 5TRTA 3ASUA 4I5EA 1NASA 3CUKA 1B8VA 1DLJA 2PZLA 2OOSA 3LC2O 1P31A 3ICPA 2BH9A 4UUOA 3TZCA 1LDGA 1PTJA 1WXDA 3U49A 1VL6A 1YS4A 4R1TA 5T64A 4BNUA 1E1KA 4TVBA 3DBHB 4ZRMA 1VJ1A 3A28A 2OMEA 3HE3A 4XGIA 2C82A 4XYMA 4GQAA 2QX7A 5DOZA 4GMGA 2PNFA 2D8AA 1LU9A 3EDMA 4JBIA 1LQTA 3O8QA 2DBVO 3KLPX 4MP8A 3ZV6A 4Z0HO 4IJWA 2ZTVA 1U2GA 2C7VA 2PY6A 1UDBA 1Z74A 4W4TA 5DP1A 1HDZA 2YUTA 4YCAA 1WMAA 4R41A 4E32A 1MXHA 4MJLA 5JCXA 1H9BA 1ZUD1 3L6OO 1IULA 4A03A 4HXYA 3PLNA 4K9DA 1ADBA 4IMRA 5C5IA 4JK3A 4NIMA 3AJRA 3WGZA 4F3YA 3KEOA 2PD3A 3BTUA 3SJ7A 3WSWA 2UUPA 1Q1NA 2CNBA 4XYEA 4C7KA 2GLXA 4QSMA 4NI5A 1O0SA 1P77A 3VHRA 1N7GA 3RFVA 3ZI0A 5G0WA 2NADA 4IXTA 4YT5A 3GC6A 2Z5LA 1V8BA 5T5QA 2Q4EA 4WNIA 5TX7A 3ROPA 4R1UA 1M76A 1XDWA 1ISIA 1AHHA 5A05A 4DQVA 3JQGB 1PL7A 3K8ZA 1SEPA 3VOSA 5KKAA 5EPOA 4DA9A 1E3IA 4BKRA 6ADHA 3PHIA 3VKVA 4Z0PA 3Q2IA 1B3BA 3RBVA 2PH5A 3QVXA 4RLSA 1HYEA 1EUCA 3ZV4A 4A73A 5KVCA 2VYVD 4YYZA 3F1KA 3CTMA 1JAXA 2PLAA 2O7QA 4KWIA 4DC0A 5A9TA 4XYGA 4Z6KA 2O48X 3AU9A 4ALIA 4GWGA 4CLOB 2FSSA 3UN1A 3IL2A 5B37A 3G1TA 4FGWA 4MPDA 3VTZA 3ZN2A 1T2AA 1DHTA 1SO8A 4CV0A 1YL5A 4OQYA 2PGLA 3RASA 3GT0A 3JYLA 3VPSA 3RJ9A 3RUDA 3WGOA 1MFPA 3DO5A 1A5ZA 1JLLA 5HM8A 5F1OA 1K6JA 3DZJA 4MIYA 5CEFA 2FPIA 2G82A 1SZJG 3GMDA 1HDRA 1LC0A 2D5CA 3NDJA 2WD7B 5G2OA 3VH1A 1QYDA 2NSDA 4L4XA 4D0RA 5B4UA 4NU5A 5ILOA 2I65A 4MOWA 3VC7A 3H5RA 5JDCA 1J4AA 4CMIA 4CMBA 2I3AA 3NUGA 2WYWA 4HWKA 2J3HA 1KOLA 3LVFO 2Q1UA 4FFLA 4XQEA 3CZRA 3NTRA 2YDXA 1J0XO 1PS9A 3IUSA 1RM3A 3DR3A 3WMXA 3F4LA 3PYMA 1PR3A 1G1AA 5A06A 5IXYA 2AG8A 1I2CA 2GSDA 4JJIA 1ENYA 5LC1A 5JNLA 4RQTA 7ADHA 5DP2A 3W6UA 1M6HA 2ZJ0A 2ZYDA 5AOVA 2HLPA 3D3WA 1JTVA 3WQQA 4HNHA 3NRCA 5F5NA 5L4NA 5TNXA 4ALKA 4J7XA 3RFTA 1S7CA 3WS7A 1H6DA 2OFPA 4HFJA 2PD6A 3EW7A 3KO8A 1PZGA 4NFYA 3I1JA 2GCGA 1T1RA 4W7HA 1DIGA 2DTDA 5BT9A 4E30A 3R6DA 3TQHA 3NEPX 3KYDA 4RPLA 4UULA 4Y6PA 2C59A 3PDJA 5JAQA 4CM6A 4YJFA 4PZDA 3QLJA 2DQ4A 1DBVO 1WLYA 2BFOA 4XKJA 4AJOA 1QV7A 4TRJA 4ITUA 4BNJA 5EMHA 5KTKA 4PG6A 5BNIA 3E9NA 2QYSA 5L40A 4YJHB 1HDGO 1I01A 3N58A 5C37A 4RO0A 3MCVA 1H9AA 1ISFA 2WD8A 3WYCA 3AI3A 3EMKA 4XZ3A 2Y1EA 2YV3A 3ONDA 1ONNA 5DF1A 1WP4A 4GBJA 2DPGA 3SJUA 3PHHA 2B69A 4IIVA 3ADOA 4ZJUA 3RC1A 2FPPA 3DDNA 1QXSA 5DCUA 4YACA 1Y1PA 4WCDA 1GV0A 5A9SB 3GZ4A 4CMEA 3SX2A 1D1SA 2GO1A 3DHNA 4K6FA 1D3AA 4IBOA 1QLHA 2NTNA 2I3GA 4HADA 4PG5A 4Q9NA 3UCEA 3CMCO 1HYHA 1YQDA 5IFLA 1QORA 2Q2VA 3WWZA 3JQ6A 1OFGA 3L4BC 4BO8A 1PS8A 3ADPA 1N9GB 5L51A 3UVEA 1LRKA 1F14A 2PKQP 3EC7A 1YJQA 2YY7A 4FN4A 1DIAA 2ZB3A 1BVUA 3DHYA 4CMHA 1NVGA 2B5WA 2QG4A 5DZSA 1PJSA 2D4AA 1JQBA 1CYDA 1U5CA 5CEEA 4PLTA 5COQA 4DIFA 2IEDA 2O2YA 1Y5RA 3M6IA 1O6ZA 3JQFC 1R0SA 1JU9A 1E1LA 3U4CA 4E5YA 5HWSA 3ON5A 2PKRA 3NDRA 1GZ3A 4Y6RA 1SBYA 4JBHA 3ZNNA 3F3SA 4DREA 3CSDA 3AW9A 3BMQA 1IB6A 1C3VA 3IKVA 3RBXA 4CM3A 1N2SA 4JNKA 2GDZA 4IS3A 3INGA 3U3XA 2H9IA 3ASVA 3DL2A 4GMFA 3WYEA 1YH3A 1G0OA 4FSHA 2J5RA 5EQFA 5KKCA 2R00C 1JDJA 1YB4A 4BUCA 4M54A 2PZKA 5F1KA 4IINA 4Q3AA 1ZKMA 1ZMOA 2Y68A 4BKUA 2GYYA 4BKPA 4YJHA 3E82A 1A71A 1ISGA 2HMSA 5L3ZA 3I5MA 3UCXA 2JKVA 4D45A 3ANNA 1BVRA 3VZSA 4R01A 3I6QA 4HFRA 1JKJA 2FPGA 3TZQA 3WLEA 4NFHA 4B4VA 3TZ6A 3BHJA 2R00A 3UGKA 4E33A 1LNQA 3X2EA 3OIFA 3PJEA 2VYVA 2AEJA 2R2GA 1FMCA 2VT3A 4QT0A 1AE1A 2J3JA 4M1QA 5T67A 3C7AA 3SC4A 4YBZA 3L6EA 1X13A 1I36A 4AVYA 3C8MA 1AN9A 4B7CA 4E5KA 4UEOA 3M2PA 1HZJA 1U3TA 4O6VA 5TJHA 4CM9D 1NYTA 3DZIA 1YO6A 2W2LA 2O3JA 4QEDA 2X0NA 5U4QA 2DKNA 1E1MA 2D3TA 2Q2QA 2BELA 4IDCA 3MEQA 5DBGA 5A02A 1LI4A 2GGSA 2J5QA 4HP8A 3B1KA 4FOSA 2ZB8A 5DDIP 3WGTA 3H9UA 4FIZA 4IXWA 5IDXA 4CMKA 4WLEA 1T2DA 3OICA 3V2UA 3RJ5A 4DTIA 4EI2A 1DLIA 3H6KA 5KNLA 3JD0A 1WMBA 3STHA 3IUPA 3DAPA 1I10A 1FK8A 5MGBA 2ZATA 2D59A 4MDHA 4O59O 2YQ4A 4PLZA 2BFMA 1QYWA 3GDFA 3AOEC 3PWSA 3W8DA 1E6UA 1I24A 2OORA 4CLRB 1E7SA 3L4BA 4CR6A 2ZYAA 3LF2A 2V6GA 4XD2A 3UKOA 5EL0A 3G49A 1K0UA 3INTA 1EFKA 4QFDA 1X7GA 1SOWA 1D7OA 2GZ1A 3C7CB 3N74A 4RPKA 3WGGA 4AFNA 5CDTA 3WQRA 3KYDB 4BGVA 3NT2A 4O5OA 4CLDA 3ZWNA 3DOCA 5JFOA 5AXCA 5A03A 4R5HA 4GX2A 3F5QA 3KZVA 4R68A 4RPJA 1UXJA 4JBGA 4PG4A 2CSUA 1O5IA 2EEZA 2AEMA 2AQHA 3ZHBA 5JC8A 2RH4A 3D64A 3GDOA 3OJFA 1NQAO 5COAA 2P4QA 1UUFA 4NBWA 4BO3A 1Q7CA 4P38A 3O8QB 2JFFA 4DMLA 4FB5A 3PK0A 3WFJA 4BNIA 1TA4A 2ILTA 1LBEA 3C85A 3M1AA 4L75A 2HU2A 4KZPA 3S8MA 3P7MA 4EEZA 1H6BA 3WSVA 4M87A 4MP3A 1ZH8A 3Q11A 2I9PA 4R4JA 3VDQA 2A94A 3WOHA 4A0SA 4AICA 1DFGA 4LSMA 1GD1O 3BIOA 4GLLA 2LDXA 1BDBA 1TVEA 4FFMA 4BGIA 5DN9A 1UH5A 2DPHA 3K9QO 1GU7A 1IL0A 2OP0A 5KJCA 1JVBA 4BS9A 4WASA 4YA6A 3AY7A 3D4OA 1P1RA 3S2IA 1E7YA 4GH5A 4NU6A 4UEKA 4U5QA 1QV6A 3X2FA 3GRKA 2DLDA 3AI2A 2O3TA 1SMKA 2UV8A 3G0OA 2VHYA 1B7GO 1GUYA 3GF4A
chains in the Genus database with same CATH superfamily
1UZLA 4U7HA 2WMYA 4R9VA 4OO3A 1AD2A 4ZCSA 4RV5A 1DOHA 5H68A 2WJPA 3DMTA 2C1XA 4PYNA 3AF5A 2A4KA 4BB9A 1Q95A 1CXZA 2ZIXB 2GZ3A 4MPTA 4NZNA 3DKVA 2PKCA 1W75A 1RRVA 1BZYA 2Q9UA 4J2HA 1NIJA 4WY2A 4DEVA 1PV4A 3C3CA 4BPRA 2EAUA 5JECA 2P5UA 5LBUA 1LPOA 2C5FA 4XOIA 2BMJA 2E89A 1EWRA 3G5MA 4F1JA 4EVQA 4YCNA 1Y5LA 4QO8A 5EPUA 5A1TA 3KUUA 3QVKA 4IY1A 2ENUA 4DM4A 3SSNA 1ZJ4A 1YOVA 5CU7A 2UYOA 5KCZA 1MC4A 4EUNA 3M33A 1XPUA 3I9FA 5LXTF 3WVNA 3PTAA 3R74A 1ZSVA 3BWDD 2IH4A 5GTDA 4EW6A 3KFVA 3AWDA 4G4IA 3E8XA 3STVA 1XZCA 1QSGA 2FG7C 4W6ZA 3N76A 3KALA 4JHXA 2WM8A 5E9AA 3DQPA 2QUKA 3FSGA 3IX7A 1JJIA 4TN5A 4B7UA 2YJ3A 3PBKA 1E2QA 1T5DX 3P9CA 1ILWA 2D1YA 5KVVA 1ISHA 2JCVA 2VP5A 3V8VA 5KCMA 1M2HA 1GU0A 1T24A 2O1XA 2FZEA 4G26A 1QHHA 4EUHA 4XIYA 4X71A 5EJMA 3NBQA 2CD9A 3MTAA 5D8DA 4EGCB 2Q62A 4Y2UA 1UM9B 1XTIA 3VC3A 3SM3A 4MA5A 4DHWA 3MHTA 1AUPA 2OAQ1 3A4YA 4BZQA 4CFZA 4D4JA 1RC0A 2YMLA 3PFIA 3LTEA 5IEBA 3N2KB 3ZE7A 4DNPA 1ADJA 1JF8A 2H1HA 2MR6A 1BE1A 1FU8A 1QUFA 2WWXA 3D6JA 3DC2A 3HO6A 4ODIA 2ACVA 3GEIA 2VF4X 1PGJA 3A9RA 3M82A 3LPAA 3Q85A 2XIQA 4GLBA 4OQQA 1A2BA 1C1DB 1S1CA 1JU4A 2MIIA 2Z5FA 2J41A 1A97A 3EYAA 1YBAA 3K5WA 4XJVA 3M89A 2P5TB 4W1QA 4C4ZA 5ICEA 3KTAB 2WI8A 5KJEA 2Q9BA 5F51A 3WV5A 1KZ1A 1LI5A 2OPHA 2O23A 3B2NA 4Z9XA 2Q3JA 3I6IA 3RWBA 4KQ1A 1UAYA 2B35A 1WULS 5LD2C 3R3UA 1MB0A 3DAGA 5CTAA 4HAXA 3OFJA 1FFXA 4GM4A 5EP3A 3BXZA 3GA5A 4JLKA 1II8A 1K3FA 4QASA 4UEWA 5JBQA 4LF9B 4P7GA 2OCLA 1MVOA 3HRIA 4DJEC 1M1NB 1NUAA 1K8XB 4PRZA 5KOJB 3QFSA 1L5MA 2NSLA 1KEPA 2FX3A 3RRZA 4W9NC 2P0AA 4MYSA 4E5VA 4DA6A 4YMGA 1E3JA 2X4LA 2WV9A 3LOQA 4YXFA 1ZVKA 2AXNA 2P91A 2OD9A 2R1TB 2BDUA 3RYHB 1RXVA 1FBNA 4JUFA 3HVUA 4DIBA 5EWMB 4KVFA 2FR1A 5A5GA 4BNWA 3TW8A 4BNLA 1G2IA 2H29A 3ADCA 5FBVB 1YMUA 1FDSA 4L57A 4GVXA 4MQ4A 3VSDA 4ZCTA 3U3JA 4YRQA 4Z86A 2BM0A 2ZI4A 2CZGA 1AHNA 3HN2A 1NURA 1GL9B 3OJ0A 3UWDA 3SQWA 1J2JA 1TVKB 2IW1A 2WF7A 3TRFA 5BR7A 3ENWA 1G3UA 1NOKA 4UHEA 2FPOA 1GADO 2AWNA 4JB3A 1DZIA 1IOWA 1O94D 1QHIA 2JFHA 5H1YA 5LNK1 1WDMA 3VJKA 1OV4A 3M5WA 3WMEA 3I2GA 2XT0A 3NVDA 1GCUA 4MWGA 3CG0A 5T6BA 4A8JB 3MUNA 1YVEI 1JMYA 1KEVA 2ABWA 4B81A 3QVSA 4NESA 4C0LA 2O54A 4R8LA 4Z4GA 1O1YA 2VPWA 3CLTC 3NWBA 4PPGA 3FLBA 1BXKA 1VLMA 1W9MA 2RGDA 3ASYA 5TQ0B 1TZBA 1O57A 4F9TA 3LUFA 5HSGA 2GA9A 3I09A 4O2BA 3W1VA 3HMQA 3QXHA 4R31A 4FT4A 1F8XA 2PSHA 1DKNA 1CUGA 2Q27A 5DV9A 4BIIA 5CYPA 3IAM6 2XMBA 5JE8A 1SN7A 4XM0A 1EXMA 1NVVR 2R1UA 4YQYA 5FUQA 3BEOA 3EASA 1JYEA 4QUBA 4EK9A 1COWA 3EF0A 1MEOA 1H6CA 4AY5A 4JIGA 2WM9B 4EECA 3RTGA 3UOWA 1KYVA 4BO9A 1L4KA 2HLNA 4REOA 2QTWB 3HBAA 3KQVA 1JTFA 1CZUA 4MXDA 1BWSA 4YLYA 1YHYA 2F1RA 1OFHA 4Q1EA 3HKCA 4YJDA 5GOTA 1EUYA 4DR7B 1CETA 3ML1A 2HDOA 4M0KA 2IKSA 1SWWA 2ZU6A 2FDCA 4GGMX 2VYND 1MRZA 2XNSA 1CVIA 1ETHA 5DX1A 4OXXA 3KPWA 4EJSC 5L7TA 3DPIA 4M46A 2WTUA 1NXWA 5CFRA 2WT9A 4I55F 3LKVA 3NS7A 1E0AA 3EUEA 5IYZA 5BRAA 1T5BA 2QZ9A 1ZGBA 2HTEA 4N49A 2QTVB 4O2AB 3UC5A 3BCHA 1L4HA 1V7ZA 2PYZA 2FKNA 3MS4A 2IPXA 2C8LA 3MRSA 1UK9A 1AC5A 3PZBA 4UQPA 4GOMD 5G1NA 4RESA 3MRXA 1T1EA 5J4KA 3U5ZB 4LFBB 2QBYA 1KRHA 5ALNA 2WJ3A 1ECGA 3SHFA 5IJ9A 3SF8B 5K0CA 1QVVA 1K27A 2HREA 2EXXA 5KWSA 2IS4A 1M75A 3I23A 2GN6A 4DMHA 2J32A 1NTRA 4CL3A 1KQPA 1G2OA 4BKOA 3K8QA 2B4RO 3EWIA 3DJFA 1DEAA 2AFVA 3RVBA 1JPVA 1ZVQA 2IGBA 2P2ZA 2R8OA 5CVJA 3R7LA 3UMVA 4B74A 5TE9A 4B4KA 3R5XA 4JKOA 5JAHA 3U26A 1RYFA 2IUFA 1FPQA 1KKMA 1Y63A 2PWZA 3CWCA 3AM3A 5K20A 1N34B 2RGXA 4NULA 2FMIA 2FSIA 3D8NA 1XA4A 2JGAA 1PJBA 2QQ5A 2VDJA 4IRXA 3O82A 1FUKA 3KXLA 3WHPA 2X3UA 4X64B 3SF0A 3ADDA 2X3FA 1F6DA 1XF1A 3IQZA 4AJHA 5AUOB 3EB9A 4TWBA 3AVTA 1QLJA 5BRJA 3UK6A 4WY5A 2JLZA 2FK8A 1XEXA 4NH0A 4ONEA 4AYTA 5ALJA 1ECJA 2HU5A 3RYHA 4JCCA 2VT6A 2NU7A 4HQ6A 4X54A 4OATA 4RJTA 2OM6A 4LDZA 4NZOA 1CW2B 1M2OB 4II7A 4ECEA 4LF8B 3BIFA 2F4VB 1FSGA 2ET6A 3I58A 4RTQA 4JVNA 1DIHA 1II8B 1CUDA 1NPDA 1BS2A 1SCQA 3DE0X 1P1KA 2ZBRA 4FYYA 2G3YA 2JBAA 4EH1A 4ZYVA 2FWBA 3FPGA 3AKZA 1KJJA 2Q50A 2WTXA 4R1PA 3SFTA 4IGKA 2J9GA 3ZBTA 1MENA 1AKWA 3OD5A 1F4LA 1UKYA 2BFNA 3BRCA 4FR5A 2RH9B 2DU8A 2GK4A 3RNOA 4MYHA 4OSPA 2XRMA 4J0QA 4UHBA 3SGLA 1KWGA 4NOKA 5D1HA 1UC5B 2J3EA 5AJXA 1E9RA 1X7ZA 1E2FA 2JGEA 3RAJA 3PKIA 3EZXA 3I6ZA 4RA9A 2ORIA 3ABIA 2MYTA 1SVKA 3OWOA 2NWQA 4LFCB 4CM9A 4DV6B 5D3KA 5T3UA 4LKRA 2G36A 3V8NA 4ZOLF 3W77A 4XDZA 1FYEA 3DMGA 5B3AA 1B6GA 1PZXA 3I04M 5BT8A 3C1OA 3K5HA 4MUGA 4HKTA 1YIOA 2IZ0A 1XCJA 3DKRA 1FMLA 2B92A 2V4MA 4P86A 8MHTA 2WUEA 3OM9A 3BYZA 4RORA 4J3FA 4V1CI 2JFYA 2F3RA 2GYUA 1HC7A 1QAOA 1RYZA 2ST1A 4P0TA 4YCLA 3R9XB 2BJVA 2IIQA 5AKEA 1CUZA 2EQBA 2B1GA 1SKAA 4EA6A 2WR8A 1R9GA 2ZS9A 3CEMA 5F1YA 5GJCA 1HT0A 3K9FC 3OT4A 3BAZA 2IEYA 2OHXA 5LXTB 4JLSA 2FYTA 3WG9A 3U5TA 1I0ZA 4NMMA 4L9AA 2ZYGA 4D92A 4OEHA 4OI4A 4FYXA 1U7PA 1JWBB 2PBZA 4P4LA 4UCQA 3WR5A 4ENUA 3I9V1 3NBYC 3FIJA 3DAFA 1AKEA 1OPXA 1Y42X 1Y8QB 3A4MA 3AR9A 3C3PA 1WV0A 2BV3A 1PR9A 4HYEA 4JLVA 4MVWA 4WCFA 3DAOA 3RC9A 3L79A 2Y1CA 1IM8A 5AXDA 3VDMA 1EK5A 4HEJA 3HV0A 2IWRA 2B1QA 2YZ7A 5B3JC 2V6FA 5HZMA 2BCGY 4Q9AA 4IJKA 1OWMA 3RVPA 3VGJA 5K8LA 1JHAA 4D57A 1NWHA 4TMYA 2AWOA 1E3TA 3BB3A 5KNBA 1Q77A 4OI0A 2ZUUA 3LX5A 3QUCA 3TDKA 1ATZA 1ODLA 4TMWA 5CR9A 5IVDA 2C2GA 3NX4A 4DLAA 4YRZA 3F47A 3G6KA 2BSQA 3B6JA 1H22A 1B73A 4A8HA 3L4EA 2CFSA 2JL1A 3BHMA 2R8BA 1Q22A 2JLAA 4YRCA 3TLEA 3T6KA 2ZTUA 4BQSA 4TS9A 2P2GA 5E1MA 1NHGA 2GDJA 2QMUA 3CSSA 3FWNA 1CQJB 1J0CA 1Q7EA 4TZTA 4YECA 4D9JA 2F8TA 5ERGB 1Z2OX 4IJ5A 3L84A 5IC6A 4B71A 2FFJA 3CX8A 4XM1A 1NQVA 4D6PA 4MHTA 3EH2A 3NLLA 4B3RB 2GPBA 1IVYA 2FSFA 4Y2YA 2BD0A 3O1LA 1DBRA 2PMFA 2AMFA 1QO7A 1T0UA 5AJVB 4QU8A 5F1PA 2BDEA 1W9HA 2JFGA 5LLDA 2INGX 2LTAA 1NVVQ 3IOYA 1VHTA 1JJAA 1ZOSA 3E7FA 3I12A 4O4HB 4XJSA 3VKWA 4LNUA 3VR3D 4RFLA 1VKNA 4FONA 3TX2A 4F60A 3K70B 1BIFA 4CLXA 4PYIA 1I30A 3C41J 1M0TA 4HFNA 3KFXA 2NV0A 1GU1A 4UEQA 5ADVA 2V7PA 2F3PA 1CY8A 3OJXA 4N5LA 4LGMA 3RS4A 5A6SA 5BSKA 4DNXA 4AZ0B 4QGGA 2WMOB 3KSAC 1MQ8B 4KSYA 2PLFA 4OHRA 1GTL1 1VB5A 2ZB4A 1ZH6A 2I7CA 2FPWA 4LWOA 2JJ2A 4AIRA 1DKMA 4UNNA 3TNYA 1N8NA 2ZTSA 1R8YA 1BDJA 5C8VA 2ZI9A 2ID9A 4DXHA 3CRW1 3DXZA 2NZUG 3WMRA 4P22A 4EATA 2WIGA 4IDHA 2W8BB 2H08A 4X1YA 3ZLBA 3A9TA 1D7AA 1NZFA 1CQXA 2GJ9A 1N9ZA 2YYYA 3GPCA 2Q1YA 5KMGB 2H5IA 3ZDFA 4ZYUA 5KO2A 1E0SA 3W9YA 1HFEL 4GO1A 4V0RA 4YP5A 3UMFA 3QOFA 2C3UA 1XRMA 4Q7LA 3ZU2A 3JQQA 3Q7TA 4YJ2B 5IZCC 5FT9A 2GPSA 5BWNA 3TQSA 4KK4A 3TD9A 1DC4A 2ZWVA 3SNHA 1U65A 3WGKA 2O20A 4BECA 1FX1A 1PEKE 3GBSA 1F0YA 1QH0A 4M9ZA 2FRVA 4EPXA 2YW9A 3BMOA 4JQSA 2LCFA 4JGIA 4LYJA 2DE0X 1SVIA 1EFRA 1P1JA 1UBLS 2VXBA 4QD3A 5KHOC 3I3OA 4IZ6A 4LWQA 1ZUNA 1OUMA 2YRXA 3GJ3A 4TLAA 4YMHA 3MMPA 4Z7OB 2IUEA 3N2YA 5IJAA 3AUFA 3FYCA 1WXGA 2Q21A 3S99A 3O4IA 3QJ5A 3FH0A 1B14A 3RNLA 1K75A 2O14A 2HMUA 1ZOLA 1NNUA 3Q72A 2PZBA 5FPPA 2OO7A 3I1YA 2Y05A 2OXIA 1Y7PA 2Y9PB 2ZUFA 1PF7E 4OA8A 2DFDA 3UV3A 3T5PA 1GGMA 3LHIA 4QDJA 3K3PA 2PL5A 3ZOKA 3HV2A 2B30A 2QSJA 3KBOA 1RPAA 2H59A 3CW2A 3CPEA 2OCYC 4L7VA 5JHHB 7AT1A 1CUFA 4YTEA 2BFEB 3DT6A 1ZCJA 1AJEA 1KE2A 2HD4A 4HO1X 4GEGA 2XVZA 5LMUB 1KO8A 1AHIA 1JLHA 2H7YA 3A6GA 5AW1A 5HK9A 5HZGA 1D0SA 2BMWA 3CCCA 3INNA 2IFTA 5J5CA 3NANA 2HM7A 3OX1A 4RF5A 3ELYA 3QA3E 1TF2A 4GICA 2GH1A 3VR0A 4RK1A 4OMFG 5FDFA 3B48A 2PA3A 1ZR2A 2CYCA 1OWPA 3HVHA 3HNOA 4WCFB 2CDBA 4HBZA 3OUZA 5D51S 3MYRA 1RRFA 1YBMA 1YRLA 2H1WA 4GECA 2PD4A 3EC2A 4BB6A 3QLTA 4E13A 4S04A 3GIWA 1VRWA 3VV3A 1Y9ZA 1LPNA 2PVCA 3AWIA 3G9TA 4TTAA 1TFRA 2XKBA 4NMWA 3VDNB 1EVKA 2OT3B 1D6NA 2VPQA 1NU6A 4ZDKA 4B6JA 1HQCA 3ZHOA 1VPWA 3A6FA 1L7VC 4G1EB 2WHPA 1F51E 2ZE5A 2A3RA 3RYCA 5JXJA 4RTOA 3F7MA 2YASA 4HLQB 4I8IA 3KKEA 4F3RA 1OHHD 2JGRA 2VQ3A 3QUQA 3FRJA 5EOVA 1G5QA 4Q21A 3M9LA 2QP9X 3LOUA 2F1IA 2ZDHA 4N6NA 3ZWWA 5JZSA 1G19A 2CMDA 2WAXA 1Z5UA 3E9EA 2VSFA 1EDZA 4NEHB 1P2GA 2QN3A 4DJDC 1XX6A 5JDIA 1MEJA 1NPYA 3PVSA 5THXA 4E4YA 1CVLA 3DMPA 2AMYA 5EZ5A 1NOJA 4G81A 4AJIA 1O9GA 3D3JA 2BFDA 3D3WB 2IC5A 3GVPA 4W8GA 3X43A 2CDAA 4RE6A 3AUUA 1X7ZB 5KAMA 2W4IA 1QIDA 4FEYA 4DB4A 2FHPA 2OZEA 3MTEA 4I99A 5I48A 3R6TA 2BFAA 5JAIA 4CGZA 4D9KA 1HX7A 2Z2JA 1U9CA 1ENOA 3M6WA 3KWMA 3AHHA 3DZ8A 3H75A 2GPNA 3O5AA 3TOSA 3FVQA 5LP1A 2NSYA 3LYLA 1UM9A 1P7CA 1E66A 1RI3A 1UBMS 2CLHB 5DW3A 3U40A 3COPA 1F20A 3NNSA 3OH8A 4IIEA 3SC2A 5T8KA 1LWNA 5ILGA 5CNIA 1L5FA 2KX7A 5E1DA 4JQZA 2DB3A 4L0CA 3BE5A 4YDSA 3UYKA 3GDGA 3ZDAA 1Y5IA 2IYTA 1FEZA 3BFPA 5HA5A 4JSTA 3UWKA 3S1SA 3A1NA 1RWXA 1W52X 4CVNA 2GCEA 4ZZIA 3IQDB 3UIEA 2Q3LA 2ZE6A 1C41A 4Z8XA 2AOUA 2D2IA 2W5UA 2PUAA 4FZRA 2C7OA 1BGWA 3F7OA 1R5JA 1M6WA 3D0KA 4GHWA 4GI3A 1O87A 2R60A 4MINA 4RPCA 5LQSA 5SZJA 3UHOA 4BMZA 1QPBA 4BO7A 4ZCLA 3NASA 1WSDA 1T43A 1U9IA 3IR6A 4I5IA 1BYIA 3UB2A 1KGSA 1ORVA 3AP1A 3FI9A 3HWWA 1GTJ1 3NJRA 2VS1A 4OQDA 2WWVD 1A76A 1VPLA 1XZJA 2WPDA 3DLAA 3EGWA 3NV7A 4B3JA 2XVMA 4I8XA 3L7NA 3V1KA 1Q7RA 1A72A 3JQFA 2EW8A 1JKJB 2G9VA 4LVNA 5MFPA 1JDTA 1BEZA 1Y5NA 2N3ZA 3A1CA 4BXOB 4I4TA 3CF6R 3NPAA 4MGHA 3M83A 3ESZA 1V4NA 1M3SA 5C2JB 3GLKA 2BKVA 3GZTB 2YY6A 4IQ0A 2C4HA 4OB7A 3OF5A 5ALIA 1A9RA 4TM7A 4TRNA 4OQZA 1IOLA 3OTHA 3U31A 3K0SA 5A3SA 1E7RA 2MINB 4YRJA 3UMSA 3DYIA 2C5AA 3BD8A 4RV9A 3ZKWA 4BASA 5IM5A 4ND4A 1OPRA 2BHLA 2ZSHA 2IBTA 1MNAA 2OFOA 3FGOA 4H08A 2EG9A 4PYMA 1Z63A 3IXQA 3O21A 3GGDA 3AG5A 4BKQA 1KA9H 5KJ6A 2P4EA 3VYTB 2IK8A 4H7PA 2P6UA 1XKQA 4HYYA 3DOUA 4X6YA 2CKMA 2JFUA 1YJ5A 4B35A 3MCTA 1X0VA 3H7IA 3K15A 2XE7A 4YQEA 4Q4JB 1XZQA 2WQ7A 2ZBVA 4OA5A 4P82A 1F2VA 3MXTA 3RUIA 4W5QA 4LF5B 1SKMA 3PF9A 1B2LA 4NNOA 3LC7O 2ZLBA 3AR7A 3KTOA 4GRIA 4GPBA 5JSYA 3CO5A 4EGFA 2UXDB 2OAGA 1JAIA 4W8OA 1T0PA 4G5HA 2O0MA 2XCLA 2HRZA 3K9GA 3TUIC 3L8ZA 3C5VA 3FZQA 3V8RA 1GNQA 4GLJA 3UTDA 1Y4SA 5AYVA 3IAUA 3DLCA 4UUAA 5GONA 1K5HA 3OHPA 1BSVA 5AVOA 4MRSA 1PX2A 4CUZA 4GLOA 5IRCD 1L0BA 5EQJB 3U2QA 4D3DA 1Z4KA 1GPLA 3VYWA 4ARZB 1WUJS 2WTMA 4LHVA 5HCNA 4E2YA 3PFBA 2UZ3A 1FC0A 3SEAA 1J2TA 1KEUA 1J33A 1OAOC 1XF9A 3ER9A 1SA0B 3KQMA 1P9NA 4JJFA 4RDIA 2C58A 2MT9A 2FWIA 1U8YA 4QYSA 4CM4A 2CNKA 4JEIA 2JIZD 3D7KA 1T8YA 2VP2A 2ERYA 3FMPB 4QGFA 3LL4A 4O2BB 4R0NA 4WD3A 1GZUA 1DGQA 4KAFA 3R7SA 4NE2A 3FF1A 4MLZA 2WHQA 5JMPA 2H1FA 1AGNA 1UMBB 3C6MA 2OSBA 3BJMA 4PV7A 2YHUA 3R9KA 7GPBA 3PNVA 1E60A 1Z2AA 3W5HA 1QQBA 4INOA 4IHQA 3IR7A 4TSKA 4DIDA 1DXYA 3IOCA 4ND5A 2FEXA 1GZ6A 3TIVA 3WGVA 4DZTA 2G1AA 2EJUA 1NULA 1WNTA 1Z83A 1UKVY 3OOSA 4GZ5A 1Z6QA 4MUNA 3ZTTA 4NZYA 3D81A 4D7AA 5CT8A 5IAOA 4DE5A 2NVOA 4CKBB 2XMQA 5F3DA 4F86A 1RHRA 1W35A 4DLWA 1O08A 2CNLA 4EGAA 1YAHA 4TWIA 4H2DA 5CHEA 5I7OA 2XTJA 3QENA 4GX5A 2DY0A 3CWZA 1XZAA 2BRUA 3JVDA 3EHEA 4IIGA 4PSVA 4ACAA 4Z2AA 1ABBA 1RXSA 1T4CA 2YJ4A 1U3FA 3GEEA 4TX1A 4EBBA 3JALA 3E2MA 4DWWA 1QF7A 2W0MA 1MAWA 1XU7A 1ODFA 1V3VA 4BCCA 3ZZTA 1M10A 4AG5A 5I9LA 4F2DA 3DWFA 1ZC3A 2EC5A 3AHDA 2FEWB 3QNMA 4DQXA 4ND2A 2RJ3A 4YCSA 5F33A 1E2KA 1WSAA 3FMIA 4TKVB 2ZSFA 4JYCA 2I1QA 2MSEB 3OLCX 3HXTA 4ISCA 5FYDA 3T3GA 3UHPA 2YMPA 1KFJB 3FMOB 3TQCA 1P17A 2B82A 1FDWA 2GYWA 3G6WA 4PC6A 3A1DA 4KO4S 3TVTA 1H0KA 3WIOA 2OCKA 1DXOA 5AM4A 5BN4A 1D2AA 3MHPA 3MSCA 1Y1TA 5FI0B 3MS7A 1E6LA 4JASB 2IHVA 3I64A 4Y7CA 1C4XA 3UUEA 3PFHA 1BOOA 4PLYA 4XFDA 1OZAA 2Q4OA 4C2AA 1EDOA 4K3VA 1MTOA 4WY8A 4FFPA 1R00A 4BO2A 1PJRA 4M89A 4FJ2A 4RETA 1RBQA 4BO4A 1RVDA 4X00A 1EG2A 3IUBA 4R5MA 1QU3A 1VG0B 3K31A 4BC0A 1XT6A 2CNNA 5E6RA 5ULLA 4QBTA 1QS0A 3L05A 4L27A 3KL4A 3CUSA 1RTTA 3OZCA 4BVKA 1L5HB 4MKRA 3G1UA 3VC1A 3S3TA 2R6GA 3A0RB 2HH9A 2IYZA 4NHEA 4XLZA 5JI3E 1I1QB 4FLFA 4K9SA 4KU4A 5GGYA 3R3WA 1UBRS 3SHWA 3W3AA 3BA1A 4ZD6A 1VMAA 3B3QA 3QRWA 4H17A 4TV8F 3K05A 1TMGE 2PUGA 1VMKA 3PIIA 4V3CA 4L72A 3DE6X 1L4GA 1OXMA 3K0CC 1Z3CA 2N9UA 3JASA 4FCVA 1HYQA 4F71A 2IUUA 5BWMA 1LJUA 3EIXA 1UBTS 1TZJA 1VZ3A 2ZCVA 2J3KA 3UXMA 1VIYA 3M34A 1TKRA 3QOYA 2HNAA 1F4VA 2FZWA 2Q5EA 3E05A 1GDTA 2J7PD 2R11A 1M0SA 1TVMA 2PVSA 1EUCB 3BD9A 3KVRA 3TIFA 3FNIA 2JJ1D 2CVQA 5IDWA 3GJZA 2ZUTA 4JWTA 4UJ3A 2Z9DA 1V26A 4H1TA 4C6TB 1Y8RB 4LSZA 5B7NA 5TVKA 3S2YA 4AJNA 3P5BA 4BMOB 2QRUA 3NIFB 3OAAA 1DTEA 1YDEA 4EW3A 1TYDE 3O3NB 3GI1A 3N28A 1L9KA 3DZBA 3KTAA 4Y6QA 1EM8B 3N6XA 4EAAA 3CRNA 4PZEA 4OM8A 2R85A 2FW7A 3NATA 4XUDA 4N0EA 3GLGB 2VHUA 4K6HA 2G0NA 3NBXX 1Z0DA 3AX6A 3KVVA 3GMIA 2OCBA 2E18A 3K73O 3ZHQA 5LLTA 1GGEA 3D6AA 2AR9A 2RGCA 2ADFA 2JI4A 1PKXA 3OJWA 3UJ6A 4UD2A 1HQYE 3IHLA 2OWDA 2VWGA 1Y1RA 1OX6A 1PR2A 1XZEA 2FZ5A 2HK8A 2UKDA 2QKYA 3FPFA 4YVFA 3WLAA 3R9XA 2X6RA 5EEHA 3JYOA 1JEOA 4YQFA 1I5RA 1QOZA 2NUAA 1QWSA 5EZSA 1L5OA 4DMRA 2EWWA 4V0LA 4ARZA 1F5NA 3FJYA 3JQGA 3NWPA 4R9RA 4DLPA 1UP4A 2RIRA 5EWMA 1QHHB 1ARZA 4WINA 3Q8MA 1IRIA 3FF4A 4DLRA 4QNNA 5CB4B 1WUHS 2EW2A 4F46A 4F2GA 1TC2A 3BSYA 3WGIA 2ZRKA 2QLFA 3VYVA 1ZYUA 3OQIB 1CFJA 1UOPA 5CVVA 1OFUX 2C5LA 4CNQA 1DO2A 1PEYA 2HPZA 1P6UA 2SCUA 2A0YA 3S44A 3TRHA 3VPBA 3W9SA 1EB9A 4E7PA 1M0WA 1DWUA 2G8LA 3HI6A 4KQGA 2AFRA 2ZJFA 4RF4A 4E94A 4DPKA 1A2KC 2PL1A 4JELA 1FP6A 1G98A 2ISQA 4OGGA 4BDSA 2H6EA 3AR2A 1GOTA 3HN7A 4H7FA 4HB2A 2ICAA 3BUSA 1E2NA 4F12A 2ZB2A 3LUHA 3PPXA 2ATVA 3CZ4A 1TW3A 2BTQB 1Z28A 2WJAA 3EUWA 3KKQA 3ZZ1A 1ZCAA 3JXEA 4G01B 4F91B 4YDRA 2AMVA 2KLHA 3P94A 1BHQ1 1MCZA 2NSJA 4ZVVA 3C98A 3VHXB 4ETMA 3IKTA 2QTLA 2RHOA 1ZQ1A 4PNZA 3B1FA 1AZSC 2P0EA 3H3XA 4QDUA 3O0DA 1QHNA 4ZC1A 2ZJ6A 4MR7A 3UKDA 2QSYA 1AQNA 1FMJA 4QG3A 3ORSA 2CV0A 5L45A 1AIPA 1SC1A 4PBTA 2XB6A 2JGLA 1TQHA 3JWPA 1XU9A 2PYDA 3PPVA 4I5DA 1FZQA 5F3RA 4FBMA 4RACA 3KC2A 4J3NA 4F4IA 5A5FA 5M2QA 4TLCA 3LQ4A 4RSRA 5DNCA 5KU7A 4CEIB 1K68A 2EFEB 3G7UA 1XTPA 4U00A 2H1VA 4BVHA 5CDSA 3AF0A 5AKGA 4TWZA 3M49A 2Y6UA 1PRYA 3TKLA 1PJLA 2Q5FA 1PNQA 5FTJA 4WJLA 4PLWA 2VXCA 1HE3A 2XMZA 3C45A 4OXNA 3V4FA 1SG9A 2AZMA 3HYTA 1E5QA 2V5VA 3KUCA 3ZJ5A 1RXUA 2HHHB 3FPHA 1FSFA 4DPLA 3QU9A 2WJ6A 5F52A 2FUNB 3VOAA 1JU3A 3ORYA 3DMDA 2IHYA 3DBLA 2DFPA 5PNTA 1ZSYA 1DX6A 2W0SA 4GX1A 1XEXB 4GUAA 4P2BA 4R2KA 1HG1A 1ZH4A 1VIMA 3L1VA 1PVVA 3K53A 3TBKA 3DEYX 4C7XA 2XMRA 3JQ9C 1B76A 1R4MA 1XZDA 3RFXA 1T6XA 2FW9A 1XQ1A 3LX6A 4HGQA 2XA2A 2IHBA 1PT8A 3A1FA 3ANXA 5P8WA 4US0R 4MV7A 2CL5A 2RGNA 3JCZA 4BC1A 3TB4A 3L7KA 4M0CA 3MC1A 3MINA 4JLMA 1RPTA 4MWSA 2FRDC 1ULTA 2Z4SA 1W88B 1M34B 2ZVJA 4MUXA 5C8YB 2VNKA 3VSCA 3PFNA 1EFUA 1YZQA 2VWHA 1BWPA 3FJOA 1GN9A 3QUTA 4DUGD 4KP7A 2B1IA 4Y1GA 1E99A 4EHDA 2C31A 2W6MA 5DPMA 3RWOA 4H6WA 1FTGA 5IP5A 3DDSA 5IVPA 4MULA 3GG9A 1HTBA 4DIEA 1BD3A 2WYHA 4N5IX 4E07A 2KE5A 4MQLA 3LLVA 2A86A 5AI0A 3RIEA 1COZA 3PDIB 1Q83A 4TROA 2C4KA 3I32A 1O4VA 4RC9A 4IGAA 5EN4A 3UWSA 2G1UA 5FRDA 1KHTA 3AF6A 2SECE 3H1GA 3KFLA 5IWCA 3GXOA 3TYXA 3GLHB 1AGPA 1YIAA 1NN5A 3AUXA 4LOKA 4G4JA 3TF5A 5C9ZA 4CEIA 2NZ8A 2ZEJA 4QPCA 1K8QA 3ITDA 1ZH2A 1BC5A 4K87A 3EISA 2PANA 5DNEA 1GXSA 3FHJA 5DULA 5LBIA 3DUFB 3GX1A 3FOEC 2R5FA 3D2AA 1WDTA 1A9ZA 1WXQA 3HVRA 4DA0A 5AI8A 4B3HA 1PNTA 3RIMA 2Z6QA 1EK1A 2NZYA 2H1CA 4QLAA 4MKGA 1RZ3A 4ZU3A 3A3PA 5IEJA 4LFAB 5AJWA 3PJGA 4EF6A 3LPLA 2B3TA 4DG5A 4PLFA 5BYBA 2UYHA 3CVJA 2GFHA 2H0RA 4W6QA 3VHQA 3DH0A 5BNFA 3C1AA 4S35A 3GAAA 5U1PA 2VTBB 1WUYA 2CNOA 3ZU5A 1XTTA 2H31A 4HBGA 3VQTA 4PLVA 2CHEA 4C14A 3R1IA 4DCMA 2ZWPA 3NDBB 2OD7A 3GXBA 1JXQA 1QYIA 1ZGGA 2W2TA 5DB4A 1JG6A 4Z53A 5AK3A 2IE0A 4H0FA 4D79A 1GAEO 1N75A 2HJRA 1CJKC 2Q7DA 3GGSA 1PQWA 1G291 3GNTA 1POWA 1ZNQO 2HN9A 2QU7A 4N01A 4QG7A 5TPWA 3T3HA 2O7VA 2C1ZA 3WV4A 1T3ZA 1NXQA 4NARA 3NKLA 4K6MA 2JANA 3O8RA 3WBBA 1UK8A 2W2KB 2JJ2D 4PPYA 3VM6A 4HVLA 1XN1A 3DDHA 5EE0A 4NCBA 4ZAZA 4O29A 2WVAA 5HFJA 3SIWA 2C5EA 3V4LA 3WZLA 1P9RA 4A6EA 5IKMA 5F9HA 2J7PA 3JPWA 2FPMA 1RBMA 1XTSA 3M5PA 1XSEA 2Q0SA 4ZAFA 2QVXX 5KDDA 1UFQA 3S2EA 3TXXA 4CT4B 4CIWA 1DEXA 3RVQA 3I1FA 4Y2VA 3RM3A 3B6IA 2AUNA 3D1LA 2JCXA 1H5NA 3FD8A 1H4SA 4PLGA 5LQRA 3FNGA 4PZCA 3GLIE 3RFCA 3WRWA 3WRVA 3EWNA 2I9KA 1ADGA 5D00A 2R66A 4MS4B 1EA5A 4X0EA 3LQFA 3VMMA 2WVGA 4R2HA 4OOEA 1I9GA 2HHLA 3ESXA 4BB0A 4ZYWA 1XTJA 1GILA 1E2BA 4U7WA 3KSMA 1A5BB 2HQRA 3PA8A 2CCKA 5I7VA 1H2BA 5AVZA 1HH4A 4OBWA 4FDMA 2HBYA 4CV2A 1X6VA 3JARB 3GJYA 1AKYA 1KI3A 4LZAA 1QH8A 2GKSA 1VCIA 3AY6A 3OQOA 2FN3A 2NG1A 4L16A 2PH7A 2PX8A 4JI5B 1GQ2A 3UF0A 5THQA 4BFYA 4B7AA 3SYMA 4LE1A 3M4YA 2XOEA 2QE7A 4JUBA 3NHWA 3IIKA 1NX6A 4G85A 4P3NA 3RLFA 1P45A 4NAUA 2K2WA 5DLDA 3ZHVA 1E0DA 3PFKA 4WVFA 5BWCA 4HZIA 5JCJA 1KO7A 2I1WA 4PBRA 1HT3A 4YJGB 3Q8KA 3QVLA 1BXRA 1X3SA 3GO4A 3JPYA 3QF7A 5G4KB 3OZAA 4IJUA 2FWJA 1S2GA 1IBCA 1IH8A 3H1PA 3B12A 3GEGA 3O0TA 4CM1A 2PRKA 5DW0A 3AB3A 2NX2A 2E5WA 2FWRA 2ID8A 2RHJA 2ZJ3A 1QIMA 4D99A 1TXGA 4DCGA 4F3KA 1IE3A 2PQ2A 3LAWA 1M5TA 1DI0A 1KYTA 5JCJD 1CNEA 2HSZA 1V47A 4BZWA 2VQEB 1GAQA 4IO1A 4JUAA 1IXKA 2Q45A 2D62A 1SHKA 1T2CA 1CZNA 5LQJA 4Y8VA 1J22A 5HTOA 5KI6A 3QKUA 4BWYA 1FNMA 3ETHA 1GA1A 2QSZA 1MPXA 3ZGZA 3NFYA 4BMDA 3L9XA 4MRAA 4NDZA 4RM3A 4H3KB 3O26A 2D0IA 3HCCA 3UWPA 1J5PA 5LVAA 4RY9A 3I42A 3NOOA 3KXDA 4B79A 4S12A 5AHKA 4FFOA 5B6JA 5BSVA 5JJBA 3R6LA 3HDHA 1CULC 2Z0MA 1KPHA 1WKCA 4QL3A 3VNRA 3WLSA 1I6LA 1WA5A 3IODA 1R9MA 2Y4NA 3GT7A 2P40A 3BJZA 5FO1A 5AVRA 1NBEA 2DPMA 2WHEA 2H9AA 4P54A 3A6EA 4EKYA 4DLNA 2FWMX 4HF7A 3OMWA 5CW2A 2FSVA 4Z7QB 4DM7A 1Y7HA 3CKMA 1G2QA 2GEVA 1J97A 3AIOA 4K6CA 1EJBA 4NNPA 3PQ4A 5CH5A 1A8HA 1EK6A 1MJNA 1O77A 1SVNA 4CN9A 2ZSJA 1Z2NX 3AQIA 5FADA 1X7XA 1XMVA 3S6JA 5HF5A 3PPIA 1GY8A 1LW6E 3HJGA 3DMYA 3A14A 4GOLD 4JI0B 4IUCS 1KI8A 2HXSA 1DQRA 4QUAA 3OIDA 5L8VA 1XXHA 3I9OA 3ZDZB 4GG1A 2WEKA 1F6BA 2WD7A 2XWQA 1R4MB 4RTRA 3DV0A 1H1DA 1ZLYA 2H7VA 1HR0B 4BV3A 1SWVA 2DERA 4KSCA 3VDXA 2X77A 2HMAA 4LPSA 4YRTA 1OLSB 3B5EA 3KYCA 5F7XA 2JFWA 3AFGA 2D1FA 2HKIA 4ENTA 1XQVA 3SHVA 1V5WA 2ZBFA 3UMYA 4B9EA 3P96A 4M22A 4NBSA 1F8UA 1WVIA 1Q3HA 5B30A 2G1KA 2NXWA 1PZFA 3NONA 1Z68A 3L8FA 1JDVA 4GT1A 5EJ9A 2PN1A 2VF2A 4LGYA 3D3EA 4FD2A 3CN7A 3CH4B 4KO3S 1PR1A 4OLFA 3RRYA 4W8HA 4Z51A 1U98A 3D4PA 3IPXA 1XRJA 5HILA 1QHXA 3U6KA 1A9YA 3HXKA 3L8YA 1I9CA 2X9VA 3DLTA 3F5SA 4LHEA 3SK0A 3RK0A 2VJBA 3PEVA 4LBZA 4PWYA 1KEKA 1VPEA 5ISMA 2VZ0A 3AF2A 4DB2A 2AJCA 2RHGB 221PA 3B3GA 5ICGA 4E5UA 1KOJA 3HU3A 2A2ZA 5JMWA 2J1LA 4UPEA 1VL0A 4DFDA 3WA7A 3B13B 3ZWXA 3IJPA 2Q29A 4MUHA 6REQA 2QTNA 1RIFA 3DMFA 3P4XA 3AUTA 4H1VA 1SA0A 1KJ9A 1SUPA 1G6KA 5AK5A 3DGFC 3VI4B 4M9RA 4ZT5A 3FYDA 5D6OA 1JKIA 1EP2B 3DFMA 5F2KA 3EDOA 3B6MA 4RKYA 5IN4A 1DBWA 1PJ8A 2PBLA 3E84A 1W581 1PYDA 1ZOOA 5D5HA 1ZD4A 5JPIA 3F5FA 2XD9A 1GUBA 4UBLA 4MGEA 4MR9A 1BE6A 5HX7A 1V11A 1Z18A 4J16A 2PRYA 3PUJA 2E55A 2ZSUA 1ZK1A 3UXYA 5JATA 1DCTA 3T15A 1T0BA 1KMCA 4GP7A 4LQCA 5B7GA 1LXCA 3R5FA 2JAHA 3VBCA 3CUWA 2HA3A 4XLLA 1TUIA 3TSWA 4DNOA 5AW9A 5PGMA 1A9TA 5JDCC 1DAFA 4RU1A 3S5UA 4ENPA 2OV1A 4G9EA 5HBGA 1KJIA 3DEZA 2WSMA 1WIWA 2CLMB 2O7SA 3P2EA 4MRMA 4DDUA 3HCFA 3OFND 5GIOE 4N7BA 1L5VA 1YJ8A 2WKRA 3KPVA 1WB5A 4CF6A 1NDHA 1P3JA 1TGYA 4YUYA 1MMFB 3OD1A 1BMTA 2A1TS 1XTZA 2TRSB 4TVOA 3IVAA 5KX5A 2ZZNA 1CY6A 2RHWA 4PSCA 2FPPB 4AJKA 3OCYA 1HMYA 3R5KA 2YCBA 1FP2A 2X58A 4ZHQA 3CKYA 3D6HA 1JEQA 2IYAA 3SKXA 2XR1A 4ROTA 1ORDA 3JQRA 3FG9A 3Q12A 3TLXA 3EIQA 1NXOA 3PDHA 1ONOA 2HJHA 5B58T 5AHXA 2WSLA 5FTMA 2NXJA 2H1LA 2YTZA 1PP4A 1JG2A 3AF4A 3P0EA 5CHYA 1UDCA 2C97A 3FTPA 1LQ2A 4OUDB 4ZT3A 4ZVKA 5A3JA 9GPBA 1W2GA 2WJVA 4P58A 1YQ9A 2VFAA 1JR2A 3OJOA 5E7JA 3R9IA 3QLVA 1LSSA 1MXFA 3HB4X 3KHTA 1XKXA 4PZUA 3SNKA 1KJWA 2DF8A 3IIEA 4MX8A 3S7ZA 3UJCA 3NWEA 1PNRA 3EOZA 1TOAA 1JIVA 2OBLA 3WJAA 4CUKA 1IHPA 3P26A 3ZQJA 4JEUA 1DBQA 1JEEA 3EPJA 4RF2A 5LNK6 3BL5A 4E5MA 4QGBA 1OIXA 3OI7A 3PQCA 4RS4A 1H8EA