4XGNA

Crystal structure of 3-hydroxyacyl-coa dehydrogenase in complex with nad from burkholderia thailandensis
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
255
structure length
255
Chain Sequence
HHHMEIRDNVFLITGGASGLGAGTARLLTEAGGKVVLADLNQDAGEALARELGGVFVRCDVAREEDAQAAVAAATKLGTLRGLVNCAGIAPAAKTVGKDGPHPLELFAKTITVNLIGTFNMIRVAAAAMAANEPAPTGERGVIVSTASVAAFDGQIGQAAYAASKAGVAGMTLPIARDLSRNAIRVMTIAPGIFETPMLLGMPQEVQDALGAMVPFPPRLGKPAEYAMLVRQIFENPMLNGEVIRLDGAIRMQPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-hydroxyacyl-CoA dehydrogenase
publication title Crystal structure of 3-hydroxyacyl-CoA dehydrogenase in complex with NAD from Burkholderia thailandensis
rcsb
source organism Burkholderia thailandensis
molecule tags Oxidoreductase
total genus 90
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xgnA00
4PLWA 4PIVA 2SCUA 5CEJA 4JIGA 1PS8A 4XZ3A 4YACA 1HRDA 4JJFA 4KZPA 2PZKA 2NTVA 4RCVA 5EESA 4OGWA 3P2OA 2DUWA 3TDKA 1GL3A 1GZ4A 1E7SA 3CE6A 3UF0A 3ZI0A 1O94A 2X7HA 3I52A 4YRBA 3BMQB 3DDNA 3FCOA 3AUSA 2EIHA 3DC2A 5TJ9A 3GOHA 1Y6JA 1U3TA 4YXFA 3GHHA 2EJWA 3GN2A 4EITA 4XGKA 1PJSA 2OZPA 2XOXA 3C7CB 3C8MA 3E03A 5DDIP 3A9WA 5IF3A 1I3KA 4IXTA 1WDLA 3TRIA 2HDHA 1R12A 3U4DA 1MGOA 1N7HA 3ANMA 4FOOA 1O9BA 4BKUA 1H6CA 2A9FA 5JNLA 2ZQZA 3I9JA 2O2YA 4BNYA 3OH8A 4K1LA 3Q2KA 1C1XA 1YDWA 4L0QA 4RPGA 3U3XA 2R00C 2O3UA 4FDAA 1NVGA 5A4DA 1NX6A 3Q11A 4JK3A 1H6BA 3PHHA 4BGVA 4AFNA 5B37A 4MVJA 1HDGO 5L95A 4DLLA 2DM6A 5F1OA 1A5ZA 3R3JA 3AFMA 4BO1A 1MP0A 2G1UA 3VKVA 2PK3A 4K6CA 1P1IA 3W6UA 3SC4A 2Y93A 1D3AA 4HNHA 1B3RA 1SZJG 3K2BA 4NI5A 3L4BA 4WLUA 1P1HA 1Z75A 3H5AA 3SJUA 1K6XA 4E32A 5FI3A 2VNAA 4CLRA 4H15A 2AQKA 3BMOB 1M2WA 1I0ZA 2RIRA 2GGSA 3F46A 3PJEA 4OMUA 4BL5A 4A0SA 2EGHA 1NP3A 1UDAA 4ALJA 3I23A 3OJFA 4U6QA 4WECA 4B7CA 3DFZA 4GQAA 3BAZA 4IJKA 1GV1A 4LMRA 3NTRA 3FNGA 4EI2A 4AL4A 1ZO8A 1E7QA 3H5RA 4NDNE 1ZMOA 1K2WA 4BNIA 3PHIA 1GU7A 5ER6A 4NHEA 5ENVA 5KKAA 4Z9XA 2FR8A 5MGBA 3BZUA 1F06A 4J4TA 4BV9A 4ALMA 4ONEA 1QV7A 1NBOA 2QRJA 3BA1A 1DXYA 4YT8A 4R16A 5JAIA 4QO8A 3E6AA 1VJ0A 3ZU3A 3DAPA 3GUCA 2C5AA 4NJOA 2IRWA 2Q2QA 1N5DA 3Q0EA 4KTVE 3TSCA 1T24A 4TRNA 1B7GO 3IUSA 3VPFA 4FJ2A 5L4NA 3I6QA 1JAYA 2Y0EA 1DAPA 1GPJA 1CETA 2EW2A 4IDGA 1P74A 2QRKA 2VUUA 5ICMA 2O7QA 1GEEA 5AYVA 1BG6A 4TWRA 3JCZA 2VWQA 3I83A 2XXBA 2FWMX 3FR7A 4RVSA 2NTNA 5L45A 4GLLA 4L4RA 1PL7A 1MXHA 1AHHA 4XB1A 4XEHA 2YV2A 4RVUA 1U5CA 4JGBA 4LISA 4BNNA 1FDSA 5EL0A 1DRUA 3GH3A 3EYWA 5B4UA 3AOEC 2XF8A 4JNKA 3GEMA 4KDEA 4RF2A 3UCEA 5I9LA 2NQTA 4UVIA 4PLYA 1Y9EA 1RM3A 4RZHA 1B26A 3TZQA 4CM4B 2EW8A 1WZEA 1H93A 1T2DA 4IUYA 5LC1A 5I7VA 4DREA 2O2SA 3DEYX 3JV7A 3OEYA 1CRWG 4LK3A 4CL8A 1W4ZA 1Z74A 4L74A 3RUAA 1P33A 3U0BA 4RLHA 4GBJA 3D5TA 3M1LA 4GWGA 1JW9B 5BT9A 3OP4A 3OBBA 3PGXA 4E13A 1U4SA 1I8TA 1T2CA 5DULA 4GSLA 4Y6PA 1HDYA 3DTTA 4TVBA 1T4BA 1D8AA 1Q0HA 1DRWA 1LC3A 2CFCA 3GQVA 3PQFA 4BNHA 3N7UA 3EHEA 4IMRA 4OL9A 1PGNA 1GYPA 3PLRA 3WNVA 4BNJA 1SB8A 1HLPA 1NVMB 2O48X 1B8VA 1IHXA 3IJPA 3Q6IA 2QQ5A 2NVWA 2B4RO 3I1JA 1LLCA 3PFFA 4H7PA 1I2ZA 3ZHYA 5B4VA 5G2OA 4RVGA 1UAYA 1NASA 4CV3A 1O89A 3MTGA 3IMFA 4RGBA 4MKZA 3GFGA 4GAEA 4W9NC 1H5QA 1E7WA 4CM8A 4BNLA 2HKIA 3WQSB 4CLOB 3HB5X 2F00A 3CZMA 3ONFA 4TROA 3TFQA 4A73A 3EY4A 4Z9YA 1C1DA 3IDSA 4ID9A 2IE0A 4PG4A 3LC7O 1ZK1A 3ZWOA 2PZMA 1HE2A 2BI7A 3D3WB 1PGOA 4B4UA 1NAIA 3FRJA 3RFTA 5U4QA 2J5QA 4E2ZA 2V7PA 3S55A 3D3EA 1UXHA 2QW8A 1DB3A 4NBRA 2EHDA 2WE8A 1LRLA 2IYPA 1E1NA 3HN7A 4OKNA 4TRRA 5BSGA 1E0DA 4Y6RA 2I3AA 2B4QA 3EGOA 4XCVA 1HDOA 3KUXA 2BFOA 1P45A 2Y0DA 2CMDA 4YAJA 3O03A 2HMWA 1X7GA 2BRUA 5A02A 3DR3A 1AUPA 3E48A 4I1IA 3F1LA 3W4JA 2PZJA 4LGVA 5CPFA 4OXYA 2ZB7A 4ZQEA 4XRGA 4BO7A 1DC3A 4R9SA 2OUIA 5JO9A 1N92A 3PXXA 3W4IA 2P9CA 4RF5A 3ZNPA 2FR1A 3OQ6A 3QWBA 3VH4A 1PGQA 4Y67A 2ZIZA 4ZGWA 1ZW1A 2VYNA 5G4KA 2NSDA 2OBYA 2Q1WA 2WD7B 4CMIA 2VHXA 1P1KA 4R5MA 4DL9A 4IXWA 3KOUA 1R4NB 3DO5A 2O4UX 3Q9NA 1N2SA 1O8CA 2VRCD 2W90A 4I5DA 4J7CA 2CY0A 3A06A 1LUAA 5G0UA 1NWCA 3P5SA 3WIDA 1LBEA 3AUTA 1XA0A 1ADGA 3ITDA 1SEVA 3D1LA 5A9TA 5IN4A 1QLJA 4NJMB 1PR3A 3BMNB 1DJNA 4J16A 1MXFA 3COSA 5G0VA 4P4LA 5JDCA 3STHA 1XDWA 3JQBC 2HK8A 3F5SA 3FSRA 3DMTA 3ZZNA 3PGJA 1E3EA 3FD8A 3QQPA 4L73A 1AXGA 5F21A 3DAGA 3H3FA 5HS6A 2X6TA 3E9MA 3BTSA 3Q1LA 4J4BA 3GK3A 3LK7A 1SNYA 1YBVA 3BMQA 3KLMX 4BO9A 4FFNA 3WOHA 1DRVA 3VZPA 1IYZA 5KVCA 4J9UE 2OFPA 5TX7A 4CV2A 3DL2A 3JQGA 1TT5B 4O0LA 4R68A 2HJRA 2YW9A 5JY6A 5L4SA 4KUGA 5ES3A 4URFA 2VOJA 3ZW9A 4E12A 1XGKA 4CL3A 4FPXA 4YT5A 1QKIA 1PL8A 3C24A 3WSWA 4DUPA 2WYUA 5EQFA 3SC6A 4QSMA 4D3DA 1SC6A 3VZQA 3NT2A 4I9UA 4NNJA 1ZNQO 2Q49A 1LC0A 1P31A 1U1IA 1KEPA 1N9GA 1W6UA 3IKVA 2I76A 3QIVA 4MVJD 4GKVA 4OYRA 1JKFA 2ZK7A 3VPGA 2CUKA 2QZZA 1LNQA 5A5FA 1IPFA 1P0FA 2V6MA 2O3JA 4CR8A 4CMJA 2X1HA 4XYEA 1KYQA 5LDGA 4GLOA 2DFDA 4ILKA 1A4IA 3MWEB 2B35A 1NFFA 5C7LO 4RPLA 3BMOA 3HSKA 5TC4A 4N18A 1CIVA 3VTFA 4BV8A 3BTUA 3A4VA 3DBVO 2B4TO 5AXAA 1KETA 2YQ5A 5CPBA 3AI1A 4W7IA 3ZU4A 5LCXA 2O3SA 3EAGA 4DIOA 3VH3A 4WLOA 4IDEA 4UVGA 1ZSYA 2WSBA 1JKJA 1VE9A 1S7CA 4TKLA 1LDYA 4UAGA 3JQ9A 3ON5A 2VYVD 3FPLA 1U28A 2WDZA 3ZWVA 5KWEA 3ANNA 3UH1A 4KOAA 2BD0A 3TWOA 2LDXA 2I67A 2ZJ0A 4FOSA 4A7PA 4D43A 3U4HA 1JWBB 3ETDA 3E5RA 3G17A 5COAA 4DQXA 5F3RA 2XPCA 5KTKA 3LT1A 3FBGA 3JQ7B 3C85A 4E31A 5CG1A 5TT1A 4EUFA 3WLEA 3VKUA 2ILTA 3HUDA 4EJ0A 4AJ2A 4XGIA 1PGPA 3LLSA 1GY8A 3IIEA 1UDBA 2RH4A 4HFNA 4CQMD 1UR5A 1LI4A 3H3JA 4XQCA 5DCWA 4Z3DA 4PGFA 3IKTA 1WDKA 4IBOA 4MDHA 1PR9A 4BNWA 1F17A 2P9GA 4IIVA 2Y67A 1W8DA 2JAPA 1UP4A 2FZWA 2I65A 4EJMA 3IC5A 1I30A 1I10A 4WOJA 4XYGA 3V1UA 3U4IA 2Y0CA 2Q46A 3QVWA 1A71A 3QWFA 3OM9A 2P9EA 1PGJA 5L51A 1JLLA 3QY9A 1DC6A 1DHTA 3M1AA 1YOVB 4FBGA 5T64A 4XYMA 4TQGA 2C2XA 3PVZA 3U5TA 3NRCA 1BXGB 1YBAA 4CM4A 3ZWWA 1ISHA 5JSFA 2PGLA 3KXDA 1CF2O 3AU8A 4M86A 4J7UA 4IMPA 2G5CA 5TF4A 4CQMB 1LDBA 2Z5LA 2RCYA 1MFPA 1BMDA 4YAEA 3WICA 1E5LA 3FNFA 5H81A 5TJHA 3WLFA 3GG2A 1Z7BA 1HDXA 2E82A 4CM6A 4OXKA 4J9VA 3W4KA 3AY7A 1JVBA 1YQDA 3RAJA 3K73O 2GO1A 1KS9A 4YQYA 4XDYA 3INRA 4BNZA 2QYTA 5JO0A 1R4MB 3K92A 2OO5A 1B8PA 3F9IA 4XB2A 1T1RA 3FPCA 2CF5A 1GPDG 3GA0A 4DRYA 2X9VA 4BKRA 2YJZA 2B5VA 2C54A 3RUEA 2F1KA 1PJTA 3UAGA 3AJRA 3S2FA 2C82A 2GR9A 2VT3A 4FS3A 1OOEA 1CDOA 3AM4A 3CEAA 2I6TA 4J0FA 2AA3A 2GN6A 4NFSA 4R4JA 3GVXA 3HN2A 3BIOA 4NQZA 5CDYA 1UH5A 5HM8A 4XYLA 1F14A 1T26A 4ESOA 4XIJA 4BMSA 5JXWA 1Y8RB 1PJ2A 4C7KA 3SLKA 3D64A 2ZTMA 3ZV6A 4WLFA 4CLOA 3V5NA 4NBVA 3R1IA 2HRZA 3OEWA 5L3ZA 2X0NA 3MJVA 4M89A 1QG6A 4M1QA 5THKA 3ROQA 5JAMA 3NX4A 1E1MA 3QVXA 4LRSB 4OXNA 2R6JA 4RF4A 2PV7A 2V6GA 3D3WA 1TLTA 5ILOA 2H63A 2J5RA 5DOZA 4PLPA 5IDWA 3L6OO 2ZCUA 5JMWA 5KVSA 1U7TA 1T25A 3L07A 4R5HA 5AQ1A 4U6SA 3D4PA 4CUJA 4BNTA 3RD5A 3TN7A 4NIMA 2CDCA 3RFXA 1QYDA 2X5JO 1Q7GA 4YAGA 1M6WA 4KP7A 2O50A 1DFGA 1G0NA 4B3HA 2AG5A 1Q1NA 1HETA 1UUFA 4NZ9A 2JKVA 4R1TA 3OIDA 4TZTA 3UCFA 4DLAA 1NNUA 3UKOA 3CXRA 2DTEA 5GZ6A 2GZ1A 4J7XA 2C0CA 2VHYA 2VRBA 3HDYA 4WJZA 1E7RA 3RBZA 3SX2A 4CM5A 1E3IA 5CFZA 3AK4A 4BNMA 1JDJA 1GADO 1L7EA 2AHRA 4NMHA 1UXKA 4B4WA 1PZGA 3O8QA 3ITKA 5L53A 3FR8A 1Z73A 4JBHA 3PZRA 4GVLA 3QWIA 4ND3A 2Y1DA 1HYEA 2HRBA 3TJRA 2NACA 3ONEA 2WD7A 2NV6A 3ZNOA 3L6DA 5TGDA 4TRMA 5JDIA 4L76A 2X23A 5AXDA 5T57A 4EW6A 3ORFA 2UDPA 4N54A 4EZBA 1DSSG 2JCYA 1NR1A 5HA5A 1U7HA 3PLNA 3LT4A 3L4BC 4QEDA 1JAXA 4GX1A 4B7UA 5DBFA 3A14A 3JSAA 5DBIA 4R01A 1SBYA 2JCXA 3BMNA 4IZHA 4Z9FA 4D3FA 3DBHB 4CLDA 3PDJA 3QW2A 1WP4A 1HXHA 3P2YA 2C7VA 1YS4A 2J3KA 1I3MA 3FNEA 4BKOA 1NWHA 4BQPA 1WVGA 4R54A 5COBA 3I9LA 1Y81A 1R37A 4OQYA 4KWIA 4FJ1A 1DC5A 1OAAA 5G4KB 2Y99A 1H9AA 3GRPA 3V8BA 2GPTA 4BGUA 2ZQYA 1XU7A 5EIOA 4WEOA 1GYQA 5THQA 1FJHA 3VH1A 3KVOA 1ZEMA 5JC1A 1SPXA 2VRCA 2BGLA 1E92A 1GV0A 3I9MA 3OF2A 4W99A 1WNTA 4CLEA 1UP7A 2GN9A 4E6PA 3KETA 5G0WA 4CV0A 4XIYA 1P1RA 4BO6A 1QLHA 3ADOA 3UGKA 3Q9UA 1QMGA 5JW6A 4ZHSA 1J0XO 2DBRA 1X0XA 4I5EA 1P1JA 2VHWA 4TVOA 4RVHA 3TL3A 1ZMTA 3E9NA 2DFVA 4IQ0A 1B16A 1IY8A 4PG5A 1X15A 2OL4A 3L9XA 1TB4A 3EVTA 4JX8A 3CMMA 3EZLA 2OBNA 3CUKA 1NPYA 3HB4X 1G0OA 3U09A 4ZU3A 1LJ8A 2NTJA 3H9UA 2Q99A 4IDDA 5K9ZA 1C14A 1ZH8A 2BGKA 2VQ3A 3KSDO 3JQGB 2PD6A 4EEZA 5EPOA 1BHSA 1ZBQA 1H0KA 4PG8A 4G81A 2QX7A 2AQ8A 1NFQA 1YJQA 5AXBA 3F6YA 1BWSA 1PIWA 3JQDA 9LDTA 2OHXA 3G3EA 4BGIA 2FZEA 3PK0A 3I9KA 4YCAA 4GPD1 4YR9A 4UUMA 1E3LA 4PCVA 3TL2A 1NQTA 3GDFA 1C0KA 1H9BA 4QO7A 4WNIA 5C3MA 2PLAA 3HG7A 1N9GB 1PQUA 2HMSA 5H82A 1XG5A 2Q45A 4YJDA 3NUGA 5KJEA 2YHIB 1YE3A 4P22A 4ZN6A 2YDXA 2Y05A 3WMWA 3INGA 2Q3EA 4ZJUA 3LT0A 3UHAA 5BQFA 4RQTA 4FC6A 3JQ8B 4D41A 1YXMA 3RJ9A 6LDHA 4WCFA 1PWZA 3DHEA 3JQ7A 4S1VA 4WCDA 1ORRA 2Q1SA 4I08A 3GZNA 4DQVA 2HK9A 2ZCVA 1NYTA 1N8KA 4RVDA 4MVJH 1DIAA 1EZ4A 1GR0A 1MA0A 2VHZA 4IZIA 3NTOA 1EVIA 1LLQA 3DBRB 5I9MA 3RC1A 3OJEA 3K6JA 2W2LD 2EP5A 1KVRA 1JWAB 2XAAA 2NU7A 2YFHA 3I5MA 4OSPA 4ZRMA 5ADHA 1RKXA 1IHYA 2WD8A 1CYDA 4DGSA 3CPSA 5CG2A 1NFRA 1NQOA 4TZKA 3DFUA 2IYOA 5DP2A 1X1TA 3KYCB 1PTJA 2P5UA 1V3VA 2VYVA 3DOCA 4E30A 1U3VA 1Z82A 3WWYA 1RPNA 2B37A 4GH5A 1A7KA 3X2FA 4CM3A 2TMGA 1V0JA 3ASVA 4ZQBA 3RBXA 7MDHA 1YOVA 4QFCA 4J1SA 5JMPA 3PYLA 3VVCA 2OMEA 2G0TA 1LLUA 3NJ4A 1BXGA 3GGGA 3JQ6A 3DZFA 4GX5A 1VLLA 4R9RA 3HWRA 4CQMA 4E5MA 1ID1A 1JQBA 1MG5A 4FD3A 2PNFA 3DB2A 2A94A 4RF3A 4MINA 4PLZA 5JE8A 4G2NA 2H6EA 3NGXA 3T7EA 3GT0A 2NUAA 1LU9A 3CINA 2VCYA 3KYDB 1ZK4A 4MIYA 4AJHA 4CMCA 3WS7A 1R4MA 2X58A 5BSHA 3N74A 4BNGA 3RUHA 2BMAA 5A9SB 1GCUA 3ICPA 4BMVA 4BO4A 5KKCA 4R3WA 4ZICA 2HU2A 2HSDA 5C7OO 3DBLB 3UW3A 4RVFA 4QXMA 3AUUA 4YJHB 4IS3A 4UUPA 3VZRA 5CEEA 4NFHA 4IJVA 3VTZA 5JY1A 1NHWA 1QXSA 4J1TA 3WGQA 2AE2A 3OFSA 3K5PA 4TMFA 3QP9A 1RM4A 1JTVA 5I8WA 1HDZA 1EE9A 2IZ1A 3L4SO 3S1LA 3GEDA 1ZUD1 2CZCA 2ZB3A 3DZKA 5FF9A 4DLBA 3GVPA 1Y8RA 1KC1A 3MOGA 3NEPX 3WJAA 4FJ0A 1I5RA 2GNAA 1HDCA 3E82A 3WNQA 2QZ9A 3WMXA 2AEMA 1E3WB 4QUKA 5I7SA 2EF1A 5G0TA 1UP6A 3JQEA 2BFMA 4XR9A 2EWMA 1H94A 5DCUA 1BVUA 1FDVA 4DA9A 4CMEA 1DO8A 1U4OA 1Z6ZA 3H6KA 4IINA 3ZW8A 2CVQA 5JDCC 3JYNA 2AW5A 4E5KA 4BO8A 4CUKA 3M6IA 1TEHA 1PZEA 3DMTC 3UVEA 4U5QA 4ND5A 2AEFA 3GAZA 1ENPA 3R0IA 1YB1A 3K8ZA 3I6IA 4E2WA 5I7EA 2X8LA 2V6BA 3O4RA 3C3XA 2NU8A 2VNSA 3WFJA 1PQPA 2GF2A 3RCBA 1PZFA 4M8SA 2JHFA 3DZJA 1EQ2A 2J6IA 5GMOA 5IFLA 3H9GA 1XCBA 2D0IA 4FIZA 1ISJA 2I99A 1G1AA 4RDIA 5DN9A 1H2BA 4HBGA 4HFMA 2JFGA 4YTEA 1WPQA 1YONA 3ONDA 4O63O 4ALKA 2IZZA 5FYDA 5K6AA 1O6ZA 4L4SA 1DOHA 3VAZA 1Z7EA 3PEFA 3MZ0A 1A4UA 1ADFA 1D4FA 4JQCA 3P19A 3GVCA 1JU9A 3LC2O 4BNKA 1FK8A 1ZJZA 3ZV4A 1GQ2A 4E2YA 3SEFA 5DOVA 4E0BA 4WE3A 3OJOA 5KJ1A 1TI7A 1Q2XA 3DXFA 4OOFA 2VHVA 1JN0A 2AQIA 1AXEA 2Z95A 3JD0A 3P7MA 3AWDA 2A92A 4LCEA 5EINA 1VM6A 3OJLA 1VJ1A 2FPGA 4KWHA 3OIFA 3ZWYA 4B3JA 4NK5A 2ZJ1A 2J3JA 4IQGA 4BB6A 1KVSA 2Q4BA 5FEUA 3T7CA 8LDHA 4B7XA 2VTEA 4IDBA 1IULA 4CMKA 3IAHA 2WYWA 1D1TA 1HYGA 1MX3A 1QYXA 3DBHA 3PDUA 1C0IA 3WGZA 1G6KA 1UZLA 4HX5A 3ZWAA 4CODB 1EQUA 4X54A 4K9DA 3LC1O 3B1JA 2JFHA 3QVSA 3RU9A 3O8QB 2CNBA 3LZ6A 4YPOA 4B8WA 2WEKA 2D2IA 2EV9A 3JQ9C 3S2EA 2OGUA 2WJPA 4OQZA 1GQQA 1X14A 1E3SA 1LSUA 3JD2A 4BHTA 4RPHA 4HNGA 4AICA 3QA9A 1SOWA 5HWSA 3CSDA 5TSDA 3WG9A 1ONNA 1K3TA 4DBZA 1DIGA 3LDHA 5A05A 4CM9D 1DLJA 1FF9A 1NQAO 3D4NA 2GERA 1F8GA 2DVMA 3CH6A 1JVSA 2YQ4A 5FFFA 2AEJA 2PWZA 2UUPA 1YDEA 1ZXBA 4ZRNA 3V1YA 4KDFA 3LT2A 3ZNNA 1U2GA 3OJ0A 3GNQA 3W1VA 2JFFA 1MLDA 2EXXA 4LCJA 4K6FA 1X0VA 1DHRA 1HDRA 1N1EA 3NT4A 1KEWA 4II3A 3S2GA 2WYVA 2TMDA 4YA6A 1LQTA 4GKBA 4NR0A 4NBWA 4UVEA 3WWZA 3HFGA 5BNFA 3OECA 3PIDA 1HF3A 4RPKA 3U4CA 4J0EA 2D3TA 1CJCA 1LDEA 4BO0A 1HLDA 1XR3A 4ZVVA 2NQ8A 4OH1A 3H9EO 4JBGA 3FN4A 3F3SA 3INTA 1KEVA 4Z3KA 2EKQA 5FWNA 1PL6A 3N58A 1J4AA 1E7MA 4QX6A 4FQ8A 1PEDA 4L8VA 1WXDA 1WMBA 2YHIA 4DWVA 4EGFA 3NYWA 2Q1TA 3RI3A 1IZ9A 4KUEA 4JJIA 1SOVA 3JQ8A 4YWJA 4YAKA 3IP3A 3QWHA 3PJDA 4FB5A 3QLJA 4II2A 4RJTA 2DC1A 3GN1A 4J3FA 2B69A 2JD0A 4E33A 1BW9B 1QR6A 1QV6A 3QSGA 3WTCA 4L4XA 4PZDA 3DBRA 3MOIA 2B5WA 1ML3A 1MC4A 1I01A 2E4AA 3W8DA 1GUFA 4YYZA 1ZEJA 2X0RA 3UCXA 1IPEA 1ZFNA 2VT2A 1VC2A 3VHRA 3SVTA 1PZHA 3M2TA 4BNVA 4XWYA 4AJOA 3KYCA 2BFAA 1BXKA 4BO3A 1JA9A 4FR5A 3GGOA 3WYEA 1EBFA 2O3QA 3QWAA 5HS4A 3EZYA 3KHUA 3S2IA 3PYXA 2I5PO 1PX0A 4UREA 3RUDA 4AJNA 4M55A 2RBEA 4WCFB 1ZVMA 3JTMA 4Q3NA 3T4XA 1E1LA 3GZNB 4H16A 3HZZA 4D0SA 3K9QO 1RYDA 4XQGA 4AJLA 3WX0A 2Z1NA 5CP8A 4YQZA 1ISFA 5JFOA 3BHJA 4CQLA 1D1SA 2H9IA 1GDHA 4TRJA 4PRKA 2W2LA 4Y98A 1GUZA 2DPHA 1EK5A 2FR0A 2UVDA 1M6HA 3PHGA 1ENZA 1RWBA 4E3ZA 5C7IO 2ZATA 1PJLA 4IPTA 4IDAA 5L9AA 1HYHA 2D8AA 1VKNA 2FMUA 1UZNA 3KYDA 1VPDA 3H9JA 4NH4A 4RZIA 1ULUA 2BI8A 1DPGA 1PJCA 4TSKA 1U8XX 5A9SA 3SXPA 3AI3A 2HLPA 3ST7A 3BMCA 3GPIA 1WAMA 3TZ6A 3E1KA 2PR2A 1Y1PA 2ZYGA 2HQ1A 3DBLA 3NDIA 1DIRA 4W7HA 4YJHA 3OIGA 4WLVA 1BVRA 2EKLA 1E3JA 2NVUA 2P2SA 4NU5A 4UEKA 1XIVA 4WUVA 4GX2A 4N5LA 1YH3A 1T2EA 1XLTA 1WZIA 1YGYA 1BDBA 5GZ3A 3LF2A 3HFSA 2GN4A 1U5AA 5IDQA 3WGIA 1E1KA 4MVJF 1EK6A 5KNLA 3JQAD 1LTHR 1ZSNA 3LQFA 5T67A 1PU2A 2EG9A 2I9PA 5JCJD 2RH8A 3ZV5A 5TQVA 5JDIC 4I9NA 1E3WA 4LW8A 2VUTA 3G1UA 3ZN2A 1GYRA 2RHCA 3QHAA 4EYEA 1DLIA 4HKTA 5EERA 4BB5A 3BTOA 4ITUA 2IEDA 2CF6A 2QRLA 1LQUA 3B6ZA 4UUNA 3UN1A 3W6ZA 4I8XA 4J4HA 1LXCA 2O3TA 1W73A 3R3SA 4AG3A 4INAA 1OI7A 1R0LA 4J43A 2C7GA 1EFLA 1UJMA 3B1KA 2PA3A 3LSYA 3ZH2A 1J6UA 2A35A 3F4LA 5ILGA 3SJ7A 3VPXA 3ZWCA 3UOGA 1OFGA 4MKXA 4DPMA 2VWHA 1R6DA 2NM0A 1UAGA 3PWSA 2IXBA 3FI9A 3MWDB 3KYBA 2DAPA 1YL6A 4C7JA 3KEQA 4WK6A 5JPIA 3WQQA 5AXCA 4MP6A 2OOSA 4MIOA 4YDRA 5BR7A 3JQAB 4EDFA 3AW9A 1B3BA 2W2KB 3MJEA 4IJWA 1V3UA 1ZK3A 3H5NA 5G0SA 3GF4A 1H2HA 1LX6A 2QG4A 3PHLA 2PTGA 3B1FA 3D0OA 4GMFA 1AN9A 4E4YA 1YWGO 1SAYA 2QIOA 4ZA2A 5KOIA 1HZJA 2QYSA 1S6YA 3LU1A 3GLQA 4HWKA 5H83A 1T1SA 2GYYA 1XQ1A 4ND2A 3LYLA 4W4TA 4YRAA 7ADHA 4R1UA 1B15A 2HUNA 5TNXA 4Z0HO 2YDYA 1IOLA 2C29D 1XELA 2YUTA 3K96A 3ROPA 3WDSA 3X2EA 3GNTA 4Y9DA 3U9LA 3AUAA 4YJGA 3GRKA 4CLXA 3SBOA 4P38A 4E5PA 1VSVA 3GC6A 4L9RA 4CMGA 4J2OA 1PS0A 3E8XA 2FN7A 4ND4A 4NFYA 5BNTA 2FRDA 1V6AA 2Y1CA 4FC7A 1F0YA 2FOIA 1MG0A 3FF4A 1P44A 3UUWA 3ZDFA 3FHLA 3PI7A 4DIBA 3ROMA 4J6FA 2WWRA 4FSHA 3K2EA 3DONA 4AJEA 1ISMA 2GZ2A 2BLLA 2FY8A 2PH3A 1X7DA 4GL4A 5U1PA 1KVQA 4R3NA 4NBUA 1XSEA 1BGVA 2ZB4A 4IGFA 5ER9A 3UICA 4K28A 3AOGA 3QRWA 4GX0A 5EJ2A 4CR7A 3RWBA 3TZCA 3VPHA 4IM7A 1P3DA 3IJRA 2D59A 4YBZA 1YKFA 4P4NA 3WR5A 2POQX 3ZWNA 1GCOA 4ALIA 4AJKA 3TF5A 1YL5A 4YJFB 2RHRA 4XD2A 3GY0A 4N5NA 2JD1A 5JLAA 4AJPA 3RU7A 4N7RA 4KQWA 4B3IA 4WCFC 5COQA 1P9LA 2X0IA 4RV9A 4LMPA 3EK2A 4KQXA 2C20A 1C3VA 3HQ4O 1PQWA 4BOYA 3OETA 2EJVA 3NV9A 2R2GA 3HHPA 3G0OA 1J49A 1NPDA 3GHYA 5A3VA 2YYYA 1TT7A 3AM3A 4MVJM 1BXZA 4W82A 3DOJA 4XQ9A 5TS3A 4HP8A 1P77A 1LRJA 2Z1MA 3JYOA 4FFMA 4BO2A 4PG7A 1DDOA 3H4VA 9LDBA 1ZSVA 4MP3A 4RPJA 3IL2A 5A9RA 2B0JA 5L7YA 1EVZA 4BVAA 2I3GA 1YO6A 1Z45A 3GDOA 1PS9A 4JP2A 5I7FA 5C5IA 1DFIA 5G4LA 3NTQA 4OO3A 3VDRA 4PVDA 5KJ6A 3QVOA 1H6DA 4NK4A 4CM9A 2OP1A 4BKPA 2UV8A 1EDZA 3ADPA 3HDJA 2W98A 2DKNA 3NDJA 1QSGA 3B20A 3KSUA 2DTDA 4PZCA 2O23A 1EFKA 2AQHA 2XXJA 1HSOA 4O1MA 4OIMA 1ZJYA 3GMDA 2EERA 4YT4A 5IXYA 3NJ8A 1KVTA 1MC5A 2Y1EA 3ZWPA 3AI2A 1VL0A 3W8FA 4Q3EA 4Q3DA 1HEUA 2VZ0A 2DQ4A 4UULA 1ARZA 3FTPA 2GASA 2Q4EA 4P4GA 3CZRA 2GD1O 4AJ4A 1BW9A 1NAHA 3HE3A 2IEBA 4MVJG 4YAIA 1I3NA 3F47A 5ITWA 3DHYA 3FWNA 3ZWBA 1R0SA 3OQ1A 2Q2WA 2ZTLA 2FHSA 3U49A 5IG2A 3JQCA 1IZ0A 3VVBA 5I8ZA 4WGGA 3CTMA 3IUPA 5F1PA 4JBIA 4PRLA 3FTNA 1NHGA 4GI2A 3A1NA 1LSJA 1XYGA 4O6VA 4JCOA 5DT9A 3TOZA 3DQPA 1HWYA 1YVEI 4ZQHA 3H9QA 1EEHA 5BSEA 3I4FA 3TPCA 4RO0A 1KOLA 3GPDG 5TRTA 4O59O 1O0SA 5GZ1A 4D7AA 4Z6KA 3ABIA 3BYZA 4PVCA 3DHNA 5T8KA 1WMAA 2H5LA 3H2ZA 4CMEC 4YB8A 3JD4A 1F8FA 3KV3O 1R15A 4A5OA 5IN5A 3TQHA 2Y66A 1CQIA 1E6UA 4R41A 1SMKA 1H6AA 2DLDA 2D1YA 1DIHA 1XQ6A 3ZU5A 4GGOA 1E6WA 2AG8A 3GGPA 2GLXA 5T6BA 4XYBA 8ADHA 4I9HA 1A7AA 1ZXLA 1UXIA 5B4TA 4R1SA 3ENNA 2Y1FA 1E7YA 3OQBA 1N7GA 1F12A 4MPDA 2O3RA 4FFPA 3KTDA 4U0KA 5FI5A 1M76A 5IAAA 5JYDA 1SB9A 2O7SA 3VDQA 3KSZO 1Y5RA 3RQSA 5EN4A 3WSVA 1PJ4A 4K26A 3ZU2A 4Q9NA 1NQ5A 3W8EA 4G65A 2LDBA 3Q2IA 2OORA 3NKLA 4XJSA 1FDWA 1IUKA 1ONOA 3WGOA 3VPSA 5K6AC 2P5YA 4TKMA 3RBVA 4YRDA 3PQEA 5KIAA 2DT5A 2IDZA 2DBZA 4PZEA 4MO2A 1VSUA 4QT0A 2HMVA 1DJQA 3ZWMA 1V35A 4CQLB 3NDRA 4QQRA 3GVIA 3AY6A 1GZ6A 1SEPA 4IY1A 1HZZA 3H65A 1L1FA 1VKOA 5ENDA 3R6DA 1B14A 1YRLA 2AMFA 3ANLA 5IZCA 4I5FA 3HADA 3IOYA 4E5YA 3ROKA 4DC0A 4F3YA 3KEOA 5J23A 3JQFA 4J2HA 4A26A 1I33A 2E37A 3I3OA 3BMCB 3HDQA 4IDCA 4Q3BA 1LLDA 3F4BA 2EGGA 2IXAA 2PKRA 4MVJP 4OJNA 3VOSA 4C4OA 4CM7A 4DBVO 5HRUA 1ZKMA 1HE3A 4G5HA 4FFLA 2NVUB 3B70A 2ZKLA 4J90A 2JHGA 3DTYA 2W8ZA 3GUYA 5L7WA 3MEQA 4BKQA 3L77A 4CUZA 4HY3A 5GY7A 2FPPA 1P0CA 1CEQA 3WB9A 4HFJA 5ICSA 1DEHA 3U62A 1T2FA 1OBFO 1DBVO 1ZIDA 4XGNA 5A04A 2CD9A 2VWPA 1I36A 3TFOA 3H2SA 3EMKA 2CSUA 4A2CA 1U3UA 4DYVA 3JQAA 3MJCA 2CVZA 2UYYA 1YQXA 4JN6B 1ULSA 2HJSA 5JCJA 2W2KA 4CR6A 5EMHA 2VZ9A 3OHSX 4PLTA 3D4OA 2B83A 4UEOA 1LRKA 3SLGA 2JL1A 2A4KA 3OICA 5L4LA 2JD2A 3D7LA 1GEGA 4ALLA 3KZVA 3MJSA 2E48A 1LEHA 3FWZA 3PP8A 2BKAA 2R00A 2J5KA 2EP7A 3GR6A 4J1NA 5F5NA 4GVXA 1NVTA 4Q39A 1DIBA 3AM5A 3V2UA 3GEGA 4CJXA 2AE1A 4FGSA 2NADA 2BH9A 5IXSA 4PN3A 2OXIA 2VWGA 1Y8QB 2X22A 3A28A 4ALNA 3GDGA 1Q0QA 3JYLA 1ISGA 5CDUA 1K89A 3C1OA 5KJCA 3K30A 5IDYA 4OKIA 2J8ZA 2NVBA 4U8GA 5JYEA 2GN8A 1PWXA 4MP8A 1HKUA 2P91A 4CMAA 1FDTA 3ICCA 2DPGA 5DP1A 2WM3A 3GFBA 3ZCXA 3RROA 3DWFA 2HMUA 2Y1OA 2IZ0A 3EDMA 5CAEA 1CQJA 4MVJI 2EKPA 3WGYA 1BTOA 3WYCA 1KY5A 1OC2A 3PWKA 1ADCA 3K31A 4YJGB 3VH2A 1B0AA 3GNSA 1ONPA 4YJFA 1VI2A 1I2CA 4BNFA 1ZCJA 3V2GA 1RM5A 2WTBA 1HT0A 3PRJA 3KBOA 2DBQA 4AJ1A 3BXXA 5EQDA 5HTOA 4BNUA 1X13A 4NG5A 3WBFA 4CMBA 5F5LA 4JP3A 4WLNA 1XEAA 2W4QA 3RUIA 1TXGA 3JD3A 1UXJA 1XU9A 5CDTA 3HJAA 5JAQA 4F45A 5DCYA 3V1TC 3ENKA 3GZ4A 4BGEA 5B1YA 1LDGA 3RJ5A 2OP0A 4WKGA 1I24A 1Q0LA 4ROSA 1R66A 3NT5A 1P1FA 3EUWA 4ZQGA 4PG6A 1LSSA 2C5EA 1NR7A 4D0RA 4DXHA 2FSVA 2BFPA 3ZHZA 5JAZA 3AOEA 2X9NA 2PY6A 2QHXA 1YQGA 4KUHA 5DNAA 2CVOA 1HTBA 5AOVA 4D79A 4PLFA 4AJJA 4LN1A 5IZ4A 5CDSA 3ZHBA 2VUSA 2JAHA 3ASUA 3G49A 2FP4A 5CHEA 4B8ZA 2DU8A 4LRTB 4QECA 2ZYAA 4DVJA 5CEFA 1GQYA 3F1KA 2ZTUA 1M75A 4Z0PA 4EEXA 5JS6A 4M87A 4OSOA 4BS9A 4CLHA 4XRRA 2I66A 3ZHXA 1EBUA 1XWFA 3H7AA 4RDHA 4H3VA 3AY3A 2NU9A 4R1NA 4YT2A 2YFQA 3IQDB 4IGEA 2PH5A 4PFJA 3KRTA 1BRMA 2AXQA 3UFXA 4FFRA 4Z0TA 1U3WA 3RC7A 3IP1A 1E6EA 5KVQA 4R69A 2Q2VA 2WMDA 2NWQA 2X86A 3V2HA 4BQRA 2O4CA 3O38A 1U2DA 4Q3CA 3WXBA 1Y7TA 1WW8A 1A27A 4BIIA 3KLPX 2HCTA 3QVTA 4W6ZA 1E5QA 3G79A 1L7DA 3O9ZA 2C59A 3ZWXA 3PJGA 4W9NA 3RVDA 1WWKA 3HNPA 3LF1A 4NBTA 4DMLA 1EVYA 1CWUA 3ETEA 4UVHA 1NTOA 5BNIA 1K6JA 3I9OA 1T2AA 2FSSA 4WOKA 1OMOA 4IJUA 3WGTA 4U7WA 1LSOA 4CMHA 2GRAA 1C0LA 1ZK0A 4B79A 1YBMA 3RFVA 2EEZA 2C07A 3L6EA 5DF1A 5TT0A 4BUCA 1RJWA 3PPIA 3PIIA 3FNHA 3OSUA 3BHMA 1R0KA 2P68A 1DFHA 1EVJA 4M54A 5I9NA 4A10A 2X4GA 3WGGA 2NU6A 3CMCO 3RSHA 4ZQFA 5JBIA 1FDUA 1UZMA 3I9NA 6ADHA 4L75A 1LDMA 4EJ6A 1QYVA 1V3TA 1Y9AA 4O5OA 1EUDA 4J91A 3EC7A 4KTTE 4QFDA 3RKUA 2PD3A 3WQRA 1GAEO 4DC1A 3CIFA 3WIEA 3RC9A 1TVEA 1HSZA 4N5MA 1WLYA 2DTXA 2HMTA 1NM5A 2J3HA 5B12A 4JROA 2DUUA 4EUEA 3RC2A 4IDFA 3KB6A 5IDXA 4FFOA 2JJYA 1C1XB 1HL3A 1VL6A 3H8VA 2VZ8A 1XKQA 4U0JA 4IIUA 5DBGA 4GMGA 1LA2A 1V8BA 5A5EA 1X7HA 1K6IA 1M66A 5BSFA 3BHIA 2Q1UA 1R16A 4FCCA 1T4DA 2VN8A 5JCXA 1PJQA 4J49A 1PSDA 3JYPA 4EBFA 1YL7A 2PGDA 2G17A 2YV1A 1QYCA 5U9CA 4AJIA 3S8MA 1KIFA 1ZZEA 2J3IA 1CERA 2BGMA 4D3SA 1I3LA 4A03A 4XKJA 4CLRB 1ISIA 4XJTA 1QYWA 1VL8A 3WFIA 4DTIA 1RM0A 4F6LA 1QORA 3BTVA 3JQBA 5TIIA 5T5QA 3T4EA 2PKQP 3OMLA 4HV4A 3C1AA 2G76A 1KBZA 1K5HA 4LSMA 2HAEA 4XR4A 1NXQA 4E21A 2FPIA 2ZYDA 2PKQO 1B8UA 3DZIA 4MJLA 3GMSA 3RUCA 3IS3A 1KC3A 3NGLA 4WNCA 1X1EA 4CM1A 2D5CA 5HBRA 1A9ZA 2D4AA 3PHJA 4DMMA 1I32A 4RQUA 2PFGA 2HK7A 2YY7A 3I4CA 3TOXA 1EUCA 3C7AA 2Q50A 5MDHA 1OC4A 5A3JA 1HE4A 4P8RA 1TA4A 2NLOA 4QTZA 4XQEA 5A03A 4GSKA 3WBBA 1I2BA 1WDMA 2YZ7A 3L9WA 3NAQA 1MUUA 2YV3A 3VZSA 1D7OA 4AVYA 1ZK2A 3CKYA 2X5KO 1Q7BA 4KMSA 4I5GA 4HFRA 3GG9A 4D44A 1N1GA 3E9QA 3MTJA 3ETGA 1VJTA 4GGPA 3RASA 2V65A 1Y8QA 1YB4A 2Y1GA 3DZGA 4HUJA 2GUGA 1QRRA 1KERA 3DOOA 5AVOA 2GZ3A 1EMDA 3OA2A 4D45A 1ENYA 1IB6A 2P4QA 4PLVA 1LDNA 5IJZA 1NPTO 3D5QA 4Q3AA 5F1KA 2X5OA 2IODA 4Y8VA 4PLCA 4DPKA 5TLSA 4E2XA 4JXKA 3G1TA 4WLEA 1DAOA 3RIHA 3JYQA 3KO8A 4XDZA 5KJFA 2B36A 2X9GA 3QV1A 1UDCA 2V6FA 2VOEA 2YHUA 4FGWA 4F6CA 4FN4A 4PLGA 3FBTA 2DBVO 3DMYA 3GAFA 3PWZA 4M49A 5L7TA 2Y68A 2HO5A 4HADA 4DQUA 1E77A 1Y5MA 4JJGA 3PTZA 3LVFO 4PLHA 1U8FO 4WEQA 4LSWA 3ZNQA 5LDHA 1EDOA 4CPDA 3EW7A 4E5NA 1PJ3A 1Q7CA 1KVUA 2VTDA 2JCVA 3M2PA 2CDAA 3L0DA 3EVNA 1M67A 5K0ZA 1EE2A 1A9YA 4UEJA 1YB5A 1U9JA 1AHIA 4BO5A 1QP8A 2CDBA 3AU9A 3RUFA 4D46A 4NU6A 1YJ8A 5A06A 5DZSA 1C0PA 1PJBA 3C1TA 2ZB8A 4RL6A 4OM8A 3DZHA 2H1SA 3O26A 4JLWA 2PZLA 3PQDA 4YEDA 3MJTA 1A72A 2PGJA 4MKRA 4XA8A 3ULKA 4CM8B 4F46A 1BDMA 4FW8A 3WTBA 5C37A 1GD1O 1C1DB 1AE1A 3PJFA 4DYDA 3HDHA 2E49A 3RKRA 3TZHA 5KCZA 4UVDA 3AFNA 1J5PA 2G82A 2BF7A 3PYMA 1KY4A 1OZAA 2E6UX 3DZBA 1ENOA 4XX0A 5T8KC 4MVJE 1JKIA 3WYBA 1MB4A 4RLSA 1V9LA 4DPLA 3UXYA 3OA0A 2GCGA 4B4OA 3KM0A 2UUOA 1DC4A 2VYND 2GDZA 1GUYA 4NPCA 4UUOA 4MIEA 3QE3A 2D5AA 4BNXA 1SCUA 2BHLA 3LLVA 1R4NA 3QJ5A 3TZKA 3VC7A 1W0CA 4B4VA 4R51A 4Y6SA 2GSDA 1IE3A 3WJ7A 1K0UA 1SO8A 4OHUA 3GVHA 2RAFA 2ET6A 3E5MA 5ITVA 3JD1A 1EUZA 4EUHA 3DAFA 4LVUA 4S3MA 4BMNA 1MV8A 4NJMA 1O5IA 1FXSA 4ND1A 3MCVA 3TNLA 4D42A 1AGNA 2UAGA 1XHLA 5CDGA 1HE5A 4ZD6A 5A1TA 5JC8A 4LVCA 2P4HX 1IL0A 1MFZA 4OAQA 3C7DB 1UXGA 4RORA 4CV1A 3MJ4A 5L40A 4WPGA 2C2YA 4GWKA 2PD4A 2X0JA 4IS2A 4CMIB 3F5QA 1GFSA 1O95A 1GTMA 1TT5A 1VRWA 2ZTVA 3E18A 1B2LA 3PZBA 4DIFA 1FMCA 2BELA 4OOEA 2NNLD 3Q3CA 4HXYA 5KVVA 5IZCC 4YVFA 3WGHA 3ZV3A 3JQFC 1ADBA 1BSVA 2WE7A 4IQ8A 4WASA 1GZ3A 4A27A 1KEUA 4J1QA 3PFWO 4MOWA 1RYEA 3ZGYA
chains in the Genus database with same CATH superfamily
1BFDA 1HI9A 1Z3IX 2IBMA 3AW8A 4M1WA 4HGQA 4PLWA 1NNI1 4PIVA 3TLKA 2CNLA 4KDRA 1SCAA 3TR5A 5CEJA 5LU8A 1K4KA 1VI5A 5FT9A 3MELA 4XZ3A 4YACA 5CJJA 1C9EA 3DTVA 3K0KA 1WXFA 2RHOA 3B1ZA 4V0SA 4TTIA 5D51S 4J3NA 5E2IA 4JLOA 3TDKA 2A14A 3V1NA 2J41A 2QX6A 3IVGA 1LD3A 2X7HA 5T41A 3DO6A 5AP9A 1OXUA 3BMQB 1ZWLA 3AUSA 2P3LA 1PHPA 3MAAC 3FHTA 4URHA 1GGJA 2QLMA 1Y6JA 4HLCA 4QASA 1VCMA 3FCYA 4AY4A 3MCZA 4EITA 3R5JA 3C97A 3QU2A 4JT9A 4F4JA 2AYYA 1PJSA 1RXSA 2CDRA 5DDIP 2XUOA 3Q85A 2GM5A 1I3KA 4DADA 2O19A 1ZZGA 3E7WA 1R0RE 5SZHB 1R12A 3U4DA 3HA3A 1DX6A 3KPUA 1O9BA 4XIIA 4BKUA 3WLRA 2P6UA 2O0MA 2CFRA 1H6CA 5H68A 5KMGB 4W5NA 3LS2A 3UWMA 1FFXA 4L0QA 5EHGA 1G8HA 1PSZA 1O6CA 3IEIA 1KMQA 3DZ8A 2O3UA 3Q11A 1H6BA 3PHHA 2OHFA 4MVJA 1YBFA 3AEZA 3WL3A 1V43A 3K15A 3C4QA 3CJQA 2ZJAA 5F1OA 4C7VA 3A9UA 1OFVA 5TVKA 3RKSA 2AIRA 2HI0A 3VV2A 3PQ3A 4FXOA 4I3HA 1GNLA 3VKVA 3R5XA 1FA9A 4K6CA 1D03A 2AG6A 1P1IA 2Y93A 4KR6A 1G42A 1TZ2A 3PC7A 3OLYA 3M6MD 5HR5A 1OFUA 1DEAA 4BEWA 2AFHE 4RSRA 4E32A 1P1HA 1OFTA 5FI3A 4CLRA 1GP2A 2WAYA 2AQKA 2YYSA 3BMOB 1M2WA 4A23A 1Q7TA 1COWD 2RIRA 1R4ZA 2F4VB 1QPGA 5JD6A 4RVOA 3QF4A 1J8VA 2YXLA 4GW3A 3BMXA 3T99A 5FUMA 3ZDCA 1UDAA 3A25A 3NNSA 5FNVB 4M9QA 2RD2A 2Z4RA 1KDYA 1PQYA 3DE5X 5LMZA 4OI0A 2RGUA 3CBGA 1T5OA 3GYGA 3JPYA 4U6QA 4C4YA 4D8UA 2AZMA 2GM9A 3DFZA 3KHKA 3LLMA 1SXJC 2KMLA 4IJKA 3RT1A 1KDTA 1XT6A 4LMRA 4NPAA 4EL5A 4BE9A 2Q5QA 4X00A 4AL4A 2Z9BA 3KB8A 4ZT5A 2W2XA 3PQ2A 1XDBA 1N3IA 1XTSA 4WZBE 4BNIA 4AUKA 2GHQA 2NN3C 5BWMA 3DH0A 3V1LA 1OQAA 5ENVA 3AVTA 1XMSA 2XBLA 4Z9XA 1NU8A 2UYGA 4HGPA 4AUEA 3WWDA 4EA7A 4WBNF 5MGBA 4IGIA 4L6AA 3CSSA 2RMKA 3W5BA 3OY2A 1DXYA 2P6PA 4WINA 1LBTA 1CY1A 1FRVA 2NUTA 5J2TA 4AY3A 4QO8A 3SR4A 1JQ3A 4EGAA 2H0QA 5EHIA 1BH2A 3PXEA 2QTNA 1OTHA 5I7RA 2C78A 3GLGE 2ABWA 4RDCA 4TRNA 2ZUEA 4KXFB 5I7OA 4EKEA 3UXHA 4FJ2A 1GU1A 5L4NA 2H07A 1JAYA 4BEJA 1FSSA 1DAPA 1Z0FA 2ZTHA 4KE9A 3WHLA 1IOZA 1HEYA 2IA5A 5KNCD 2EW2A 2QRKA 4N6OA 2VUUA 4HVTA 3W5UA 4TSRA 1GEEA 2P27A 2VYQA 1BG6A 2X19A 4F2WA 2O8DA 2H2HA 2YR0A 2XXBA 2FWMX 3FR7A 1YIOA 5EP3A 2ZRHA 2NTNA 5L45A 2P2YA 3O9VA 3UQZA 1E0AA 1PL7A 2HQRA 1MXHA 3E05A 3NHRA 4XB1A 5JATA 4RTNA 2YV2A 1A77A 1U8UA 2C1EA 1U63A 1K6MA 1JEOA 4AMBA 2ZSUA 4JGBA 2FSVC 4LISA 4RWEA 1OLSA 1W581 2C3PA 4DA0A 2XF8A 4JNKA 4KDEA 4MS3B 5LA6B 4D9NA 1DELA 2NQTA 5SICE 1Y9EA 3LPNA 1AUXA 1I7SB 1H5UA 1W5EA 3CS3A 1JP7A 2ZSHA 4NS4A 1H93A 4BQIA 4N0EA 1RI1A 4IUYA 2F48A 4BBZA 2MHCA 1UDRA 1I4OA 3DEYX 3TMKA 4HSEA 3VSCA 1CXZA 1CY8A 1SOAA 3USZA 1SIOA 1DMRA 1RRGA 1W4ZA 3NU1A 5E8JA 4L74A 5LBUA 4C0LA 5B55A 1MAVA 3U0BA 3OPQA 1RYBA 3M1LA 3OTHA 4PFKA 4EY4A 2A1TS 3OP4A 3PGXA 2QI9F 2H1RA 2ZJZA 4HB2A 4YO7A 1I8TA 5DO9A 5FWDA 3K20A 3BSWA 3UHFA 3CRMA 1M1YE 1HDYA 2HIAA 3D3NA 5TGZA 3AZQA 4F1WA 5LYJA 5FL7D 4DEVA 1ABEA 1NX9A 5FOXA 2BKLA 3GQVA 1ZCAA 3P9XA 3K6SA 3B7GA 3U6KA 1PGNA 2XCTB 1L1EA 3R20A 3PLRA 3WNVA 5BVGB 1LV8A 1NVMB 2BEUB 1VDZA 4HDAA 4JT2A 3ZY2A 1B8VA 1IWOA 1ZU5A 3Q6IA 2QQ5A 1O54A 2B4RO 2NVWA 3I1JA 4R1QA 4BU1A 4IMJB 1LLCA 1THMA 2XUGA 3LUPA 3PFFA 5FLEX 4CF6A 1PWYE 3CE9A 5B4VA 2JFXA 4EPYA 1UJCA 4X66B 1NASA 1PI3A 2RBGA 5D7NA 4Q1AA 1UBKS 3VVMA 4AURA 3MUNA 2P9QA 1OT3A 1YJAA 1A8UA 1ZGGA 3IVAA 1DZIA 5CNMA 4N6GA 1NG9A 2BR3A 4L8FA 5C1PA 5ALNA 3OZTA 3MYRA 3WQSB 2NZXA 3L7KA 1M5UA 2F00A 3ONFA 3TFQA 1NN0A 1CKEA 1JHZA 4O2AB 1A7JA 3EY4A 1C1DA 1H65A 3IDSA 1RC1A 4HJXA 4ID9A 5JMPA 3U16A 4KPYA 2UXCB 4PG4A 3NBMA 1FUIA 3O8OA 1TZJA 4O02B 2AD1A 3LC7O 4PXYA 3COJA 5TPWA 4YHHB 3VC1A 3ZWOA 2PZMA 3WJ2A 1HE2A 1POWA 2BI7A 1QDLB 1PGOA 2V8BA 4OREX 2BDTA 2QRPA 1QS0A 1NAIA 1J9ZA 1CC1S 4C07A 1ORVA 3GZJA 2V7PA 4YC7A 3S55A 2FUKA 4AF8A 4DEXA 4F4HA 3SFZA 3D3EA 5BWNA 5HQ3A 4L9AA 4BQOA 3T35A 3WK8A 1QVVA 4NBSA 1DB3A 4DDVA 1U3DA 4IUBS 4L95C 5BSGA 1E1NA 2WLSA 4ZCMA 4KH0A 5KTOA 1MKYA 2Z58A 4JVSB 1P5HA 4HHEA 2YWDA 3EGOA 2XUFA 3TEFA 4XCVA 3TLAA 4HVCA 1GVHA 1W0JD 1SQ6A 2BFOA 1FRQA 1VHWA 4KN9S 4KOEC 4A9AA 4D0NA 5AESA 5JI3E 3O03A 2HMWA 2J0UA 1OT5A 2IY8A 2PKWA 3F1LA 1RBYA 1V25A 1SVLA 2Y1XA 5JG7A 4P83A 3X43A 3DOIA 1MO2A 4LGVA 4ENSA 1KQGA 4PHFA 1W5TA 3CX7A 1ACMA 4GOXA 4F9TA 1U31A 4XRGA 5JSZA 1NDQA 2V9ZA 1ZM2A 3H19A 2Z83A 3AF2A 1H3FA 3HCBA 1N92A 3W4IA 1M54A 4V39A 4Q21A 4KE8A 3NBZC 5AVUA 4NTZA 1N32B 2WICA 2Q1WA 4CMIA 4ARSA 2GCOA 4DL9A 4BV8A 2OXTA 1R4NB 3AB7A 3TQOA 1PCXA 2VXYA 2XUHA 3D4IA 4MWGA 3BDAA 1RBQA 5AI5A 2UUBB 1N2SA 3W3AA 2QE7A 1MC8A 2CY0A 4Z2YA 3A06A 2V6JA 3UV3A 4XJVA 4EJSB 5HP4A 1U0RA 3AUTA 3NNNA 1SVOA 2A86A 1H2ZA 1RWNA 3ITDA 3HWWA 5TQ0A 2PS0A 3RVQA 4F2GA 5IN4A 1RZRA 1HE1C 3BMNB 4N3NA 5AJWA 1MXFA 1MW8X 4P4LA 3KIPA 2RK4A 2R8RA 4UMFA 4UJ5A 4C6HA 1XDWA 5BMVF 3QQPA 4MEBA 5HKAA 5IW8A 5BSVA 1ZCFA 4N8EA 4JC8A 4JI7B 4O4IB 2H06A 1DTWB 2AFIA 3H3FA 4DDHA 4HUTA 5KQGA 4CIXA 1BEEA 3G7SA 4FLEA 4I66A 4KQ1A 4A8JB 2XV1A 3MSXA 2VDLB 4MW6A 4CCWA 3GK3A 4Y0VA 4RTPA 1YBVA 2Y4OA 3KJIA 3BK7A 2CHQA 1UBTS 3KDSE 1TMOA 3VZPA 4REQB 2Q21A 3WLNA 1JS1X 5TX7A 3ZGOA 4RABA 5L4SA 4TLAA 1TT5B 3AT1A 4R68A 2HJRA 5FBLB 2HLDA 1Z4MA 3JWIA 4HT3B 2WF8A 4AO6A 1JDSA 5A4KA 2VOJA 3FMGA 3LFUA 1KO8A 3G88A 1CQPA 4I1RA 2H7YA 1VGVA 1VYUA 1XGKA 4CR7A 1XAIA 1L4HA 1ZKDA 2JK1A 4XM1A 7GPBA 1XEFA 1WXXA 1RYYA 4D9FA 1SN7A 3ETNA 2EFGA 4PTLA 4MIKA 1KMHA 1WDTA 3H8WA 4UHHA 3L7NA 4D3DA 4NNJA 2ZANA 4RA9A 5BYAA 3KUKA 1JI0A 4UU7A 5D3QA 4EW3A 4TXHA 3NMUF 1JHQA 5KDLA 5LSAA 1KEPA 3SF8A 4EYQA 3QTLA 1I2MA 1N9GA 1W6UA 3IKVA 4LRQA 4OQNA 4PYOA 3TLZA 4DCOA 1A0OA 3KTOA 1WLSA 4GKVA 2CLIB 1ZRSA 5ETJA 1JKFA 3UMCA 2XI4A 3V8RA 3VPGA 3ZXUB 1GCIA 2LR0A 4C3ZA 1T8SA 4AKSA 4I55F 3HEBA 1NN1A 1P0FA 4HPXB 1UAAA 4DJDC 3N2GA 5FORA 1HC7A 3DAOA 2VK8A 4GI7A 4CR8A 1N3YA 1XZDA 2ZUTA 1JFFB 2X1HA 1KJQA 2G1KA 1KK0A 2HU5A 4XYEA 3AXSA 1NKVA 1D4ZA 1FP6A 4CKXA 2IIVA 4GPTA 1A4IA 2B35A 3LBHA 4QQNA 1ESNA 3H13A 2YJ6A 3E1SA 5LD2B 1A2QA 2F64A 2BFCB 2AFRA 5TC4A 2Z6UA 2NO0A 1CIVA 1Y5NA 1HQCA 2WU8A 1J1IA 4DAOA 1SUEA 2JAQA 1EX1A 2LRHA 2OZVA 4RIHA 3A6EA 3FOWA 3PENA 5AXAA 3RHSA 2F8LA 1YFKA 2ZREA 3BE8A 5JHHB 1KETA 2YQ5A 3IQFA 1MB9A 4M37A 4Y6LA 3ZU4A 4FMBB 3T3IA 3EAGA 3EFHA 2JC3A 1G5RA 3OEHD 5K0EA 1XF9A 5CW1A 2J1LA 4AW9A 1ZSYA 1FYWA 3O8CA 2IXEA 1DX9A 1S7CA 1XZMA 1HOXA 2A0FA 2H1IA 4IH1A 4O2BF 3QITA 2QZPA 2ZRFA 3JQ9A 1EEXB 1U0GA 4BIMA 3REGA 5JADA 4GOOD 1YQWA 3ZWVA 5A4IS 3EGVA 5K7SA 2RGGA 2BD0A 3TWOA 1JR6A 4W9MC 4C78A 2ZJ0A 4QVGA 4WW0A 4A7PA 4D43A 2ZJ7A 1N0UA 1OAOC 2CNDA 3JTEA 1JQEA 4IILA 3AWIA 5KTKA 1WXGA 2NZWA 1MEOA 3JQ7B 3ZDEA 3C85A 1U2TA 1T9GR 2ZJ4A 2NYVA 3IESA 4FIDA 4FKZA 3H84A 3VKUA 4E31A 1GN9A 4JB0A 2QTLA 4XGIA 3CX6A 2OCLA 3LLSA 1GY8A 1EI9A 3IIEA 1COWA 1UDBA 4CKBA 1U1FA 2PANA 4YGXB 4NKRA 4ZO8A 2FZKA 2QSZA 3HCDA 3F8WA 5M2QA 1UR5A 2JH8A 2RKWA 5DYTA 1VMAA 2MYNA 1CDZA 1K3FA 4LTMA 3ICQB 1K5GA 4F92B 1IM2A 4PGFA 2NU7B 2XNHA 1HUQA 3G0IA 5GIPE 4IIVA 4TXLA 1GSIA 1DNPA 4L9WA 4OX9B 3AVWA 1XZIA 2JAPA 4P31A 4W63A 1G1MA 1MO3A 1PKEA 1ZNYA 1U99A 3KKOA 1QIFA 5IT5A 1P73A 2A3NA 4DG9A 1EVLA 3B5IA 3NC0C 2Q46A 3QVWA 1UKVY 2ZM5A 3KJEA 4EEKA 5K20A 4O4JF 3M4JA 1SK9A 4EDHA 1VIMA 4MW7A 1RVDA 1JLLA 3CVJA 2IHTA 5FAXA 1YOVB 4PM4A 1TAQA 4PHTA 1JDTA 3IAS6 3MYYA 3CKMA 3PVZA 3QFFA 4QOJA 4XPIB 3OX2A 4V0NA 5ALTA 2WJIA 3SPXA 5J4VA 5JRDS 3RAPR 1DARA 3HPQA 5JSFA 3RSGA 1ETHA 1CIPA 3CTPA 5DYYA 2GESA 3AJ9A 4M86A 3LL4A 3KWJA 3VU3A 1Q1BA 2O0JA 4DANA 2Z4TA 4YPVA 1OJ7A 3TS1A 3UMFA 4DHWA 2B8TA 3HPRA 1J7JA 2OCKA 4P7JA 3WK5A 5KNCA 3S68A 4OXKA 4RMIA 4CQJA 4J9VA 3T7JA 4F2PA 5CITA 3EXHB 3C4VA 5BW6B 2BMJA 4UFPA 2GO1A 4YQYA 4H4DA 3RHZA 5A62A 2DF8A 2HLNA 1R4MB 3KKQA 3MD0A 4LV6A 5JECA 1J09A 1J06A 2JAUA 4LBWA 4M38A 1L7PA 1NATA 3F9IA 5IVPA 2ZR9A 1KXJA 1H4VB 2X9VA 1JYFA 3I34X 2C54A 2H7XA 3RUEA 4MA4A 1OLSB 5E4YA 3VJRA 1W88A 2BEVB 2K2QB 1I3OA 1ZJ6A 3AUYA 3BK1A 3TNYA 1AMOA 4EFNA 3LVQE 2CLSA 5DKFA 5NULA 1CUWA 1E8NA 4JA2A 1IN8A 2P90A 1E2BA 2H08A 2I6TA 3DW1X 4CI0B 3JYHA 2GN6A 2IDMA 4A8JC 3W4JA 3GXBA 1NXXA 4V0QA 2AX3A 5CDYA 5HM8A 4F04A 1F14A 4XIJA 1G98A 5DXAA 4EVQA 3KZCA 1Y8RB 3KQKA 2OK7A 2GBPA 2WR8A 2VAWA 4FT4A 2XOKD 4CLOA 2QRQA 1PK8A 3V5NA 3I32A 1Z25A 2AZDA 3G8CA 4Q66C 2X0NA 1AURA 2D74A 3MJVA 4WZAA 2XQGA 2HGSA 1IJBA 3IUYA 2A5DA 1LS1A 1TF7A 2AT1A 1G2PA 5FL7A 4RHUA 4F7DA 4ZU1X 4PLPA 1EFUA 2QM7A 5CD9A 1E2MA 5IDWA 2ZCUA 2EYQA 1WD5A 3ZY6A 5HK9A 5JMWA 2QN7A 1FMFA 4HS4A 5KVSA 1QGED 2ZS8A 1U7TA 4GQIA 4YCLA 4XFJA 1JFLA 3CG0A 4BNTA 4G0QA 1DKNA 2CDCA 2X5JO 1Q7GA 4I3GA 4JYMA 3TGWA 3VHXB 5FTMA 3B2NA 4M9RA 4RANA 1RRPA 3FZYA 4NBKA 3TRHA 3W7VA 1SH7A 3GRYA 4XASA 4MR9B 2PWPA 1G0NA 2WHEA 5KQRA 3G5AA 4DLRA 1TM2A 4XWGA 1HETA 1EGVB 2W6JD 4FNGA 2JKVA 4LJ6A 2ONKA 2X3UA 3OIDA 4FR0A 2K4MA 2ZSKA 4R1TA 1G4UR 4RVCA 4TZTA 2WUGA 3UCFA 2GWRA 2Q4DA 1PYDA 1SRQA 2OAP1 5GZ6A 2GZ1A 1ZL0A 3EZGA 1P19A 3O8OB 5D5QA 621PA 2PUDA 1G6OA 4LBVA 5FL3A 1PUIA 4WXYB 2WSYB 4N0DA 3P5BA 3PNQA 4KWEA 3H86A 1UT6A 3JQQA 4HTAA 4CM5A 3QEMA 2XSZD 4UNRA 3G0CA 1JDJA 4HL6A 4QNNA 4ADSG 4PC3A 3BC1A 3ED5A 3K0FA 1DUIA 3TIFA 4LJYA 2PBFA 3FR8A 1Z73A 4C76A 2QG9A 3QWIA 2R66A 5D8DA 1OYYA 521PA 3CR8A 5DBOA 4TUYB 4C4XA 5JYBA 4QPCA 1PHRA 1W44A 1F6BA 2QUJA 3L6DA 5DNEA 1G8PA 3DMHA 3F9RA 3QFTA 3DO8A 1ZH4A 2GKGA 3OLZA 1EDBA 4DTCA 4DR3B 2C4NA 4F7WA 2AWNA 3CUEF 4L76A 2HADA 2X23A 4LC0A 5T57A 2UDPA 5F76A 5LFAA 1DSSG 2JCYA 1DKUA 2XCOA 3E7XA 3PFHA 1NR1A 3FPBA 4LMAA 2O5CA 3FWPA 5GJCA 1DKLA 1WO8A 4S24A 4QEDA 1SCIA 5JQGF 3A14A 3JSAA 3TW8A 1PW7A 3ZE0B 1SBYA 3PTLA 2Z2KA 2JCXA 4IZHA 3CQ9A 1YZKA 1JSZA 2OBBA 3HA2A 2MINA 3ICVA 3T6KA 3FUXA 2J30A 2M6LA 3TUIC 5A6VA 5I51A 4LXQA 2H4JA 1PKXA 1WP4A 3P2YA 4PHHA 4HDSB 1JWLA 5B1EA 5LP6F 1ZHFA 2J3KA 4NZPA 4BKOA 5BR4A 4DCVA 2C58A 2OENG 2G5GX 4HVLA 1SKUA 4Q6WA 1Y81A 4HDQB 4N41A 3HZHA 1R37A 2NO4A 1ZM4A 2JGRA 3UOWA 2XQFA 3LHSA 2R47A 1DC5A 1H22A 4KQ6A 1M8JA 3TOVA 3GRPA 1QNLA 2OB1A 3LQQA 3ZCQA 1OU4A 2GCOB 2ZSAA 3SM9A 4B47A 4WEOA 2Q0HA 3NUQA 4MJXA 5THQA 3VX4A 2XDAA 4OQDA 3SHVA 1T0HB 4DMCA 1WQ4A 3CNLA 2OHOA 1FYFA 4W99A 1GTVA 1O57A 2GN9A 4A6EA 4E6PA 4P0QB 4QPDA 1GPLA 3IBGA 4P7BA 2JCSA 1Z0UA 2H17A 1AVTA 2KPOA 4G5OA 1P1RA 1I4EB 3JATA 3OCZA 3G8BA 3FGNA 2HMYB 1EDDA 3K35A 2ICAA 1PF7E 3TZEA 3H1PA 4YAWA 1G20E 1X0XA 4ZANA 3VNQA 2HPVA 2OGSA 3DBIA 1JALA 4DBLC 1RLOA 4AT1A 3ZZ1A 4FSXA 4C4TA 2NO5A 4KYUA 4MQ6A 4JX8A 2KE5A 4D4LA 3EVTA 1PLLA 3RSLA 1AHNA 4MWDA 4LI0A 4FZVA 3U09A 2Z5GA 2P2CA 4IDDA 2Q99A 4GEGA 2VXCA 3IDFA 4I7EA 2BGKA 3GUZA 1W4CA 2D0DA 2Z6VA 3CWZA 1J8YF 4KAFA 1QCZA 1RQRA 2GLUA 4NMLA 4ZOAA 1ULZA 2QD4A 4FZ5A 4D92A 5EPOA 5JZBA 6ABPA 4XARA 3UBMA 3MWEA 1N9ZA 3KBBA 3KQYA 3B51X 4ZI2A 3U7FB 3RG2A 3NHFA 5AXBA 1YE5A 1BWSA 1PIWA 1VXOA 3DL4A 1JR3E 2A67A 1VLMA 4G5RA 1O6FA 2OHXA 3G3EA 4LYEA 3PK0A 3BAFA 2QJTA 4YCAA 4YR9A 2QTAA 3GUHA 4UUMA 1E3LA 1EWQA 1NQTA 3KQVA 1BH6A 3GDFA 4W5JA 1H9BA 5AM1A 3W5SA 4ERNA 1U3CA 4WNIA 4DCPA 1P0IA 5C3MA 5AVSA 1N33B 3HG7A 1XJ5A 1BA2A 1JIQA 1AUQA 1N9GB 1PQUA 2C61A 2JVJA 1DQZA 3T3HA 3NUGA 4RK4A 1CFJA 3SIPA 2G7ZA 3IXQA 4ZN6A 1I1QB 4RTOA 4OEHA 1EFAA 1IBCA 2P11A 2PCLA 4YRPA 1KZ9A 3A4TA 1GITA 2C3YA 3AEQA 1R8JA 3UHAA 3N6XA 4FC6A 5CJ2A 5I7WA 1JEQA 3N86A 4HQFA 4M9ZA 3G0GA 5B57C 1K4MA 3P9CA 5FUBA 1PWZA 5GAJA 1RWXA 4Z54A 2ANBA 1MDBA 1STOA 1GGVA 3AP2A 1LBSA 4FDLA 4JBYA 4C5CA 1N8KA 1G41A 3I9V1 1CJSA 4GWLA 3HUFA 1KOJA 1JEDA 3I1FA 4DLYA 4EGSA 1ZH2A 3JSXA 4GNRA 1GR0A 3ABZA 1EVIA 1Q84A 1WG8A 3SC2A 5G3YA 5F23A 4QXPA 3DDCA 1YACA 2Q2OA 3K6JA 2FUG6 4DDKA 2EP5A 1JWAB 5J4KA 3I5MA 3OEHA 3MG9A 4B9EA 3RH0A 5ADHA 1PSWA 1IHYA 2ZVQX 1Q22A 1CYDA 2V4UA 4MQ5A 3CPSA 4OXQA 5GOTA 5CG2A 2IUTA 1NFRA 1NQOA 2A2ZA 4JC4A 1X1TA 1PTJA 1DU4A 1NV8A 1GNSA 3ZI4A 4UU8A 2XRMA 4YRGA 3Q9LA 5KWVA 1U3VA 1Z82A 4GH5A 1KTVA 1JNXX 2AOVA 3QLEA 4CM3A 4Z1MD 1V0JA 1VCIA 3PFKA 2GAAA 3OURA 3ASVA 1NVBA 4MCAA 1A1VA 4LHVA 3FYSA 2WAXA 3WZ2A 2Y92A 1BWPA 4QFCA 3PYLA 1M8GA 2EGUA 4LDQA 1X92A 1G2OA 2R8ZA 3PUHA 3IODA 4TS4A 4URUR 3GGGA 1NIPA 1RFLA 3AYXB 3DZFA 3H2KA 4U00A 3SQXA 1XA4A 1Q17A 1KAQA 2IVFA 1W0KD 4EJFA 1M7GA 1SCDA 3VISA 1EVQA 1W36C 2IYVA 1ZMRA 2Z5VA 1PJZA 2QL7A 1RQNA 3K1JA 3PNPA 4XDHA 5EGNA 4PLZA 3NPAA 4ZI3A 1FYXA 2IX3A 3W5IA 1QBGA 3NGXA 2P3SA 4H0NA 1CW2B 1LU9A 2IYRA 2ZS9A 3NWBA 4Q7QA 5C2JB 2XY4A 1UPUA 4G0XA 2PS3A 4BGDA 1A69A 2F3RA 5KTRA 1FB5A 2CLFB 3N74A 2E7ZA 3RUHA 4MMYB 4C0QC 3ICPA 2HMAA 4BO4A 2YXNA 3QMPA 2ZPAA 2P41A 4QARA 4F6RB 4I1PA 2HSDA 2R3SA 1XZJA 2HTFA 4NQRA 5JD4A 1QE5A 1A97A 3UW3A 4QXMA 3B8EA 4NL4H 1ZS9A 4IS3A 1UBNA 4MRVA 1PT7A 5JD3A 4DCMA 3VTZA 3DDOA 1OH6A 4Q1DA 2NXJA 1NHWA 2WU4A 5K3FA 4XUDA 2AE2A 3OFSA 3I5AA 2C7PA 2QU7A 3D3QA 3QP9A 5I8WA 1M34B 1T9AA 3THRA 1EE9A 5C1BA 2BR4A 5FF9A 3PE4A 4KXVA 1X7XA 2PRKA 1CQZA 3MOGA 3I6BA 3ADBA 4FJ0A 5HJEA 1I5RA 2ID4A 4EX7A 1Q7EA 1ZINA 3E82A 3FZEA 1CZHA 2AEMA 3ZYCA 4R40A 3SOPA 5I7SA 1IJKA 2BTQA 1G63A 4HNRA 2PCJA 3IAEA 2XZOA 3PKJA 3A1VA 2EWMA 2XNKA 3L7IA 2FWAA 1NUTA 3HKEA 4A6PA 1CRLA 3HVUA 1JLRA 1CLUA 2R25B 4JHLA 1QONA 5DASA 1YR3A 4CMEA 3HB0A 1W1IA 3HA5A 2BC9A 4XWAA 2OBXA 3A1FA 1GSAA 5IAKA 3SMVA 3B82A 5DGIA 3ZW8A 3JYNA 4TLMB 4YJ2A 3RTEA 1NDUA 3WGUA 2JBHA 1YQEA 4G4GA 2JRCA 5E4FA 1TEHA 4DY6A 1V48A 1YVRA 3ZTWA 1U80A 3UVEA 4QWMA 4JWTA 4PICA 1IQRA 3HUTA 5CFRA 3UATA 1A9XA 4BN0A 1Q11A 4JT8A 1T1IA 2B5OA 3O1IC 3R0IA 1R0XA 1S2IA 2HA5A 5FX2A 1UWKA 5AUNB 4XFKA 2WOJA 2C4TA 3ND5A 2YZMA 5K0BA 1FQJA 4E2WA 3CUTA 2X8LA 4IZOA 2QMEA 3AFIA 3C3XA 3V4SA 2ZRAA 3WMFA 4NAHA 3RCBA 1A5AB 2XOKA 1U8EA 2NUBA 5AH0A 2JHFA 1JLMA 1KYZA 4R1LA 3WKDA 5HKKD 4UXJA 3SEAA 3HKDB 2X4LA 1ISJA 1LTQA 4RFLA 3FZQA 4QYIA 2IEAA 2Y71A 4NCXA 4WY8A 4HFMA 2JFGA 2WMYA 1WPQA 1YONA 2I3DA 3ONDA 4OTZA 2WU1A 4D6XA 4DQUA 2OFXA 2G88A 4D25A 2PL3A 1O6ZA 2ZGVA 4PY2A 2YZ2A 3LPCA 5KSPA 4G9BA 2HTEA 3H0CA 3KWMA 2EKDA 4LDPA 1AZSC 4JQCA 2PJZA 3GVCA 5JT1A 1S3FA 2FFQA 1L7VC 3JXEA 1ZJZA 4AY5A 4V02A 5H5JA 1VLHA 2FW9A 3S27A 4E2YA 3SEFA 4RZXA 2C7RA 1ZC4A 1T9HA 2VK4A 3OLWA 4WE3A 1QIKA 3DBOB 5SYNA 4G8BA 1FXWF 4OOFA 1WY7A 3JD0A 2XCSB 5JFGA 3GRAA 1ODCA 3ZPXA 3R0JA 1AKYA 3VPAA 2C88A 1NI4A 2A92A 2P78A 2W6JA 4IHJB 1CY4A 4A0HA 3ETLA 3V2IA 1VJ1A 2FPGA 2VHEA 2CE7A 3OIFA 1SG0A 2P79A 2PX0A 2WG1A 1U5BB 4FWBA 4NK5A 4N0QA 3IHTA 4AN1A 2J3JA 9GPBA 5DNDA 1P81A 1SOUA 4HC4A 4IDBA 4CMKA 5BR1A 2IIQA 3RSQA 3Q5EA 2YL2A 5L6LB 2WYWA 1D1TA 1L8OA 4PYRA 3W78A 3PDUA 3WGZA 2AGVA 2O2IA 3SN6A 2MSCB 5CGQB 1REQA 3Q88A 4AUNA 3W04A 4YRNA 1QHNA 4QJIA 3N2EA 4A15A 3LC1O 1O96B 2X76A 4RZ2A 2HRCA 3M9XA 4GMDA 4JJ8A 2AYXA 1IY9A 2G67A 3B1JA 3H4MA 3K0FB 1QTRA 3QVSA 3RU9A 2NZJA 2PO5A 4DVGA 4C05A 3QPDA 1IHPA 5D3MA 4OQQA 5ALJA 3QU5A 2DSNA 3JQ9C 3M83A 5IC6A 5BYBA 1L5OA 3S2EA 2WJPA 3S3TA 4OQZA 3UXEA 5JNUA 1E3SA 5CVTA 2IHKA 4U7JA 2QMUA 3EQZA 1ZOPA 3JD2A 3MB8A 1N3BA 4RPHA 4U2GA 1E9CA 2RHHA 1LF5A 3LY5A 4I3FA 1FUKA 4O25A 3KZMA 3D8HA 3CF0A 3INYA 1MHTA 5ALZA 1S3GA 4HX9A 5HWSA 3CSDA 3AERB 1YT5A 3Q41A 4D9GA 2A0WA 2V0CA 1NRIA 2AEEA 2Q4TA 1NQAO 3HKCA 5J40A 3VX3A 2C5FA 4DKJA 4OHZA 1C3EA 1EG2A 3AKZA 1P72A 2NO9A 1RHQA 3H6GA 4IEIA 2YQ4A 5DE3A 4V3BA 5ECGC 4FNAA 3T1HB 2G6BA 4NXNB 1R74A 4AKTA 1ZXBA 5KNBD 3KXPA 4KDFA 1UBEA 2JBAA 2IUSA 2AJLI 2VEOA 4J75A 4CW7A 3GNQA 1AB5A 1RJ9A 5CX1A 4LXUA 3AIOA 3NWOA 3CZ4A 1P0MA 3EVGA 1X0VA 3HH8A 2PUVA 3EJ6A 1N1EA 3IQXA 2VEDA 1J0CA 2Z9CA 3NT4A 2WYVA 4X3CA 2XT9A 2BEWB 2G8NA 2TMDA 3RVRA 4GKBA 5EE0A 1H42A 3DEKA 3Q12A 3U48A 1SQGA 4NBWA 3TEMA 2FGJA 3U4MA 3QJYA 4L8WB 5PGMA 4EATA 2XXAA 1J8FA 4DEYA 2Q62A 3PIDA 1Y8CA 1HF3A 1Z36A 3M81A 5ITSA 2BH2A 1NMSA 3O4VA 4KREA 3M8KA 1LDEA 3NKFA 4PYKA 3WDKA 1FLAA 1XR3A 5KZMB 3I45A 1RE0A 3OFND 5ESRA 4PQFA 2CSXA 3CF4A 4G0YA 3LI2A 4JBGA 4KQMA 1JAHA 1RWQA 2W48A 4Z3KA 4KIJA 2HSZA 2YZKA 3K1YA 4D0RA 1MZPA 3GCXA 1YIDA 4U39A 5J2UF 3N58A 4I50B 4EZIA 1AH2A 4WBNA 1PEDA 1XVTA 1VLQA 1WMBA 2PH7A 2QJWA 5AIBA 3HRKA 5JR3A 1FEZA 1I0LA 2Q1TA 4L4YA 4L5BA 3TTVA 1UEXC 1XKLA 5C31A 4DM7A 4KBYA 4MRPA 5JPDA 3KQHA 5IHPA 4RD0A 1BU5A 1EA5A 2AFVA 1ZUWA 1KJ8A 2GF9A 3DL7A 4QGHA 5CVUA 3HACA 4I6EA 4KFTA 4C6SA 3TLYA 4QT4A 4N8SA 1RAGA 2BFFA 2O2JA 3E7DA 2CHVA 4EX6A 4F72A 2FE4A 4KBFA 1JDBB 3I09A 5E7IA 1BW9B 4JS0A 4IJ5A 4ZGBA 3B1WA 5C8DA 1J1UA 3U7RA 3BSSA 3FPSA 3VR6D 1Z29A 1TYAE 2FEXA 5JDIC 1UOOA 1MC4A 3CLVA 1BAPA 3FLAA 5AT1A 3UK2A 2FFRA 1KFBB 1KPHA 4OGKA 3LSTA 5IBRA 3E3NA 4GHWA 4B6SA 5LP1A 3SVTA 3M2TA 2ZWIA 3GLHE 2KHZA 3LP8A 3LT5A 4AJOA 4HEJA 1D8TA 3NCTA 1YB2A 2OT3B 4RSMA 4M6WB 1RKVA 1RJDA 2OQIA 2IP2A 2GUWA 2B25A 2PQ0A 1X94A 3QU4A 1EBFA 4FR5A 4N7BA 3UHPA 3EZYA 1GPKA 3KHUA 1KP3A 2DOKA 1NUUA 4L1KA 4O4LB 1U94A 3NHBA 1YVUA 4KGVA 5DVZA 3RUDA 421PA 2FUCA 1KZ6A 4DV6B 3BD7A 1T1EA 3FE2A 3JTMA 2IOFK 1EJ2A 2GPAA 3FIJA 1WW3A 1DWUA 4YV1A 4D02A 1V47A 1RYDA 1BMQA 5HJ2A 4K6MA 2G83A 2CXHA 5LLTA 1MF7A 3BHJA 4CQLA 2REBA 3R8FA 2M1ZA 4DIDA 2OM6A 3AETA 1S2MA 3IAUA 1MX9A 3ETCA 3FPFA 3IP8A 1UMBA 5E6SB 3OZRA 3PA8A 3VHLB 4A0FA 4JD5A 2OA0A 4C4ZA 1CS4C 2FR0A 4YONB 1ENZA 4DLAA 4Q47A 4E3ZA 1UBCA 5C7IO 1PJLA 1ZJ4A 3AFHA 4DWOA 4JJKA 1H85A 5KOJA 2FK7A 2BI8A 1DPGA 2HR1A 2UYQA 5EP4A 1F1JA 4P3KA 4Z1MA 1P2TA 3SXPA 4C14A 1SA0A 3AI3A 5ELXA 2X2OA 1R6AA 4U02A 1WULS 4BCDA 2QBYA 3EOZA 2GN0A 3G9XA 1WAMA 2XR1A 3X44A 2H8GA 4ZV7A 1Z15A 3NDIA 3PF9A 4Q3KA 2ZR0A 2WWWA 1YTLA 1PK9A 1EX6A 3FI0A 2Q0SA 4RA6B 3ELBA 2EKLA 2IYUA 3TQRA 4N0MA 1YDHA 4D8VA 2JDID 5H3HA 3ZCTA 2P2SA 4G8JA 1G2QA 4HQ0A 3V8PA 1TU3A 1W0KA 1BS1A 1T2EA 1XLTA 2QLJA 4QHYA 2HDNB 4M9UA 5ICFA 3RREA 13PKA 2ZBRA 3GFPA 4ENUA 5ALGA 5KNLA 4NOJA 1LTHR 2Y9MB 1T0IA 3SVZA 1JZTA 1SXPA 4AO8A 3KSBC 1PT8A 3G1UA 3OZUA 3J81A 2FI1A 4LSGA 1KZ4A 3AZPA 5CCXA 3GAMA 4RDXA 4FI3F 1DV2A 4UUNA 5DWQA 3C3BA 3IAFA 4OD0A 3R3SA 2FUEA 4AG3A 1IXYA 1JJIA 4OUKX 2C7GA 1NE2A 1G55A 3LOUA 5BN1A 5JS1A 1E2PA 2A35A 2I6GA 3VPXA 4ER3A 3CVYA 3HY3A 1OFGA 3QYAA 1XMJA 2E87A 2VWHA 3Q7EA 4DPMA 4DJEC 3KQLA 3FMOB 1OLXA 1YOBA 1J0EA 2ODTX 5FLYA 3BG5A 2FPPB 1BJKA 2ZYRA 3LH5A 4MRMA 3ZCSA 2CVPA 1R27A 3SY8A 5JPIA 1T2NA 3EXEA 2XWSA 2YWBA 3DULA 2GBGA 2OOSA 5AXCA 3SSOA 2XGJA 3DE1X 3JQAB 1QUFA 1XLWA 3AW9A 2QTMA 3DLCA 3FYTA 1A9QA 1XWIA 3HNRA 4TVKA 1B3BA 2W2KB 1RXYA 3H5NA 1AUVA 2L42A 2O8FB 1N2ZA 2PR7A 1WD7A 2AW3A 4CKCA 3B1FA 3E1GA 3D0OA 3AR4A 2ZM6B 3R7FA 2QRVB 3QPAA 2XA1A 1L8AA 2A9VA 4OB6A 1LTKA 1M1ZA 3HO6A 4TMWA 1L7BA 1ISRA 2GYUA 1AV7A 3HCAA 4ARZA 4YUWA 2EATA 3ZS9A 1XQ1A 3I6YA 3LYLA 2HBZA 4YRAA 4BRZA 4XEUA 2DB3A 1J20A 4ETWA 2RJNA 4YBRA 4Z0HO 1B6SA 3DXXA 4TX1A 2C29D 5DK6A 5DM0A 4GR5A 3RFUA 3X2EA 1YS6A 4Y9DA 1QCCA 4NE9A 3U9LA 4RV4A 4P38A 3NOQA 4E5PA 3BSYA 1VSVA 3EQ8A 1NG1A 4ETMA 1UC5B 5FR2A 4YP5A 2G08A 5BSRA 4B76A 1CFZA 3E8XA 2VAPA 2HFKA 1Y80A 1SHJA 5BMVA 5HKKA 2A0XA 2R65A 1HQYE 1MG0A 4EI7A 3QMWA 4YLYA 3NBAA 4CDMA 5JAMA 1TW3A 4FSHA 2OTCA 3MXTA 3ZK9A 4HWOA 4IH4A 4K9RA 5L8VA 1X8JA 5U1PA 1KVQA 4R3NA 4QAJA 2ZB4A 4H7EA 1QH8A 4K28A 3I2GA 4MWSA 5MFPA 3PFIA 1WUTA 1N7JA 1HNWB 4PZ9A 2J9YB 4PBRA 3RWBA 3VPHA 5LL6P 2E0IA 4IM7A 1EXMA 2A7XA 4G4IA 5A1JA 2CYAA 1G3IA 1YK1A 3GRRA 1GIAA 4NCHA 5B53A 2R8BA 4FUTA 3F98A 4BEBA 4GZ3A 3KWLA 5AW4A 4G0OA 1QKKA 1GQRA 4NEGA 1NURA 2IGTA 4OJKA 4RYDA 4U3JB 4XD2A 3O8LA 4N5NA 4MI3A 1ILWA 1NI4B 1UKZA 2G28A 1VLJA 1YRQA 5AW7A 3RU7A 4N7RA 3D8BA 3TL6A 2ATVA 3LY8A 3L3BA 1QYIA 4JB8A 3SLRA 4CDGA 1QPZA 2GPBA 1CZUA 4IHQA 3RQIA 4ZCPA 2GPNA 3PNSA 5FP0A 1P91A 2O57A 5EWMB 1OB5A 1J2EA 2VDUE 1T6YA 2HT6A 3OETA 2EJVA 4RY0A 3IDOA 4I55A 1J49A 3GHYA 4YMWA 3ZKAA 4RH0A 1TT7A 4GYYA 3AM3A 1T91A 1NSYA 4L6CA 4MVJM 5TEWA 2XUQA 1ZD2P 2FMXA 2HJHA 3F96A 1P2DA 2KBFA 3LZCA 1VCOA 1J21A 4HP8A 4L5AA 1HBJA 3LCRA 5D3MB 3TW6A 3RIYA 3NHZA 2V5UA 4RTMA 1PTJC 1CUCA 2FFHA 5HCIA 9LDBA 2H1OA 2A5FA 1ZSVA 3C6YA