4Y6QA

Human sirt2 in complex with 2-o-myristoyl-adp-ribose
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
288
structure length
287
Chain Sequence
ERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-2
publication title Kinetic and Structural Basis for Acyl-Group Selectivity and NAD(+) Dependence in Sirtuin-Catalyzed Deacylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 92
structure length 287
sequence length 288
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.-:
pdb deposition date 2015-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4y6qA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4y6qA01
4C78A 4V1CA 5IMSA 4RMIA 2C31A 2H2IA 2H2FA 4UU7A 1T9DA 4FVTA 2Q5LA 2EZ8A 2Q27A 1Q17A 1POWA 1ZPDA 3U3DA 2X7JA 2A1UA 2VJYA 4GG1A 1YNOA 4UU8A 2AG1A 2JI7A 1M2JA 2EZUA 3ZGOA 4L2IA 1BFDA 1OZHA 5MFZA 1S7GA 1JSCA 1YI1A 1PI3A 5EJMA 2PANA 1V5EA 5K6RA 1O96B 4Y6LA 2UZ1A 4JU9A 4MQ5A 3GLUA 3JR3A 5K3SA 1YC5A 4BVEA 4F4UA 4RJIA 4MZXA 5BWOA 4MPPA 3D81A 2OD9A 4BN5A 1PTJC 3D4BA 3EY9A 4BV3A 3CLUD 1Z8NA 4FEEA 4RJJA 4K9NA 1SZDA 5BWNA 2JIBA 1V5FA 3FSJX 1Q14A 1SZCA 5MGNA 2FWNA 1N0HA 3JWPA 4UTNA 4X3OA 4JSRA 4ZZIA 4BUZA 2IHTA 4MPRA 1Y9DA 3CF4G 1POXA 4GM0A 2NYRA 5K6TA 4RMGA 2EZ4A 2Q5OA 2JI8A 1O97D 1YBHA 1PYDA 1OVMA 1U28C 2NXWA 3K35A 1MCZA 2H4JA 4RMHA 2EZTA 2OORC 4JUDX 4BVFA 2VBFA 4BV2A 1U31A 3IAFA 4BVBA 2B4YA 1M2KA 4O8ZA 5MFPA 2H2GA 4Y6OA 3HWX1 4V1CB 1PVDA 2IHUA 5EJ8A 3U31A 1U2DC 3OE1A 4JD5A 2H4HA 3LQ1A 4D5GA 2OD2A 1YI0A 4GP9A 4IF6A 5EJ6A 5DGTA 1J8FA 3CLTD 3F6EX 2Q28A 2VK1A 2WVHA 4J1TC 5D7NA 2FRDC 3PDHA 4COKA 4BN4A 4GPEA 4BVHA 2V3WA 2VBIA 1YHYA 2A1TR 1T9CA 2VBGA 4L3OA 2UZ1B 1HZZC 1V5GA 4IAOA 5EJAA 1PO7A 4QPZA 4K9LA 1U2GC 4D5EA 4UUBA 4JUAA 5EJ7A 4Y6QA 4HD8A 4UUAA 2VK4A 4FZ3A 3F6BX 3FZNA 5EJ4A 1YTLA 2JI9A 4RJKA 2QQGA 4X3PA 4IG9A 1UPCA 4C7BA 4KGDA 2PGNA 4BVGA 4RMJA 3CLSD 2JLAA 5DEIA 4JT9A 1XLTC 2Q5QA 5K2OA 5FYQA 5BWLA 1S5PA 1T9BA 2WVAA 4ZP1A 4UTRA 5MF6A 4GM4A 4JUCA 3E9YA 1ICIA 3IAEA 1NM5C 2QQFA 5FEMA 4GM1A 4I5IA 2H2DA 1EFVA 4MPJA 3RIGA 4V1CI 3CLRD 1Q6ZA 1T9AA 1M2NA 1MA3A 5EJ9A 1UPBA 1OZGA 5DGDA 5AHKA 4Q9DA 1OZFA 3ZG6A 3EA4A 1QPBA 4G1CA 3D7KA 1EFPA 3ZGVA 5EJ5A 4TWJA 3GLTA 2JI6A 2DJIA 3GLSA 1DJLA 4K9MA 3EYAA 1Q1AA 4K9OA 3GLRA 2FSVC 2W93A 2PGOA 2FR8C 1PNOA 2VK8A 2JLCA 2H59A 4JUBA 3PKIA 2OD7A 1YHZA 4K9KA 3FLMA 3PKJA 4KXQA 4F56A 1PT9A 4FEGA 3RIYA 2H2HA 4KPUA 4JT8A 1UPAA 1D4OA 2Q5JA 4QELA 1E3TA 2AG0A 2Q29A 4HDAA 1YC2A 1PNQA 4UTXA 4JUFA 1M2GA 4K9PA 2HJHA 4K9QA 4TWIA 2FN3A 4UTZA 4UTVA 4QQ8A 4JU8A 2OO5C 4R8MA 2IHVA 1M2HA 2H4FA 2EZ9A 2WVGA 4J16C 2BRUC 3HWWA
chains in the Genus database with same CATH superfamily
4WXEA 4I8IA 3QW2A 3EBPA 4UUNA 4L74A 3L0OA 4OXRA 1OE0A 2DGDA 4KO4S 4XW2A 5IMSA 5JU6A 2ZSDA 2O06A 4R51A 2ZB7A 4LXUA 2I6XA 3B36A 4JI0B 1YL6A 3HXOA 1RE1A 5J40A 2O3RA 1T43A 2X77A 3OTWA 1EVJA 1YZYA 4YRIA 4LVOA 1C0KA 5TEVA 1E1DA 2QP4A 4B46A 4BJHB 4CKYA 1U28A 1JHUA 3RADC 5BN5A 2NUTB 3C5EA 1GRQA 2OZLA 3CH6A 1UT8A 4NQZA 4GYYA 4A82A 4RD3A 4E13A 3UGTA 3MLBA 2FQ1A 4KLNA 1EX6A 3HKDA 4S05A 2A9JA 4DMCA 5E3IA 4LHYA 4YJGA 3TQSA 3PFWO 2X5JO 4MV5A 4NCIA 4RVFA 3WXBA 3ONEA 3COPA 3OTHA 3Q3VA 4UZFA 4MGIR 2ZU0C 4YRJA 1L7VC 2QRLA 3KALA 3OZVA 3D2BA 3H5WA 5F52A 1TTPB 1ZJ6A 3T95A 4JZYA 2I1WA 1UBFA 4L4ZA 4WK0B 2GFQA 3KT0A 3QPBA 1UAAA 3DAPA 3VO9A 3X0DA 2PLNA 1FLNA 4CODB 4GOKA 4S1NA 4KDRA 1JSCA 4ZO6A 2XNDD 1L4EA 3LDGA 2FKAA 1RBQA 3LXRA 3BGWA 2HADA 4NHEA 1GYQA 5EJMA 1QRTA 3QNWA 4DRZA 2VUSA 3OLXA 4X20B 1CV2A 2PD3A 4MV6A 3UTCA 1M9NA 1SELA 3P4XA 1TC2A 3UOGA 2EERA 4GICA 2JLUA 2DLDA 3IPRA 2GAIA 3N2KB 4X8OA 3LHSA 3G5AA 3T3DA 3UHOA 2Q1TA 1YKFA 2H0AA 2J3QA 1BX3A 3WYNA 2HHCA 1S8AA 3AKYA 1YVUA 3I58A 2OVBA 3NDRA 1T3HA 5IVDA 3V7WA 4CFYA 7MHTA 5DCYA 4U7GA 3H16A 3JD0A 4MRMA 1IBCA 1W36B 2GCNA 2HSZA 3OIVA 4HDKB 3ER6A 3REGA 3UJBA 4BNZA 1GUZA 3V4RA 4EJSC 1KDPA 1BKDR 4JBIA 1JIVA 2P30A 4F93B 1XRJA 1FP2A 1LC0A 1V39A 1NY5A 1U0LA 2GBFA 3D4BA 3AFGA 5CK5A 1P2GA 4DM4A 3NOQA 4DR1B 5JR3A 2VSYA 4L08A 4ZCMA 4IR7A 4EB0A 1YZTA 4LV6A 4ZQEA 5EZYF 3C1OA 2I6TA 4XAQA 1H0SA 1OXMA 2HPZA 3NJ4A 2YVLA 3TQCA 2EP5A 5KBYA 1IVNA 1JHRA 1FRFS 2ONKA 3R3JA 4KC0A 4JXKA 2BP7B 2V6IA 4JB2A 3IFSA 2KM1A 3KT6A 2FRDA 5FL3A 5SZKB 5ENDA 3AZOA 4BAGA 1V5FA 5HIKA 2IYVA 5K6AA 2OGZA 4WL0A 5DHTA 1Y8ZA 1T0HB 2ODWA 3DZBA 3GW8A 1BRTA 2AN5A 2OGUA 1JS1X 1TF5A 2VNJA 4UHEA 5SICE 1JEOA 1H22A 3IEVA 3H9GA 1OI7A 2JGEA 1P0FA 3RS9A 3GJ3A 1LVUA 1TK3A 4BKUA 3BTVA 4MHOA 2HU5A 1J0BA 4Z4IA 4JXZA 1RLTA 1NUAA 2X13A 3PV0A 4O4HF 1GZ7A 1GPKA 1VP9A 3GDHA 3GJ8A 3HP4A 4NEQA 2A86A 3ULKA 1JE1A 2ZVJA 4AZ0B 2XWJI 4HP8A 1DAOA 3HBAA 1OREA 3CNBA 1EG2A 2XYGA 1BJKA 3KXPA 4MVJG 1RE0A 1R6VA 6GPBA 1OHHD 1P81A 2F64A 3IP7A 1ZICA 2VP9A 3GA0A 4ZVTA 1U7ZA 5KREA 1AQLA 2Q1XA 4HUTA 4MARA 3SD7A 1CUXA 4ANFA 4W5TA 1GSIA 5A4AA 4ZVSA 1Q0HA 3QLEA 4RPCA 1X38A 1EUDB 2ZI4A 3COZA 5JCJA 3CVVA 4C22A 2RE8A 2B36A 4NCJA 1H23A 2HQBA 4QUJA 3VZRA 4RMGA 2AZDA 2H0QA 3Q11A 3AFNA 4HB3A 4FSHA 4INOA 5L6LB 4YXFA 2EJVA 3MGAA 2G6TA 4ZO9A 1YFKA 2ZIAA 4ZO4A 1PYDA 4EUKA 1RT9A 4IHJA 2P7IA 2HA6A 2ZJAA 3I05A 1J42A 5AM4A 4ZDWA 4QRIA 1VG0B 4CQMB 4DZRA 1AMNA 1M33A 3PJDA 2IYYA 3STYA 4HNUA 3SE0A 3QE3A 4ZVRA 2XADA 1SBNE 1XQVA 3J7TA 1MCZA 2CLLB 2GAOA 5CVVA 4WN9A 5K01A 1F0NA 3JASA 2YNMC 2QX7A 2ZRAA 4P7FA 1IY0A 3QX7A 3AT1A 1GL6A 3HK2A 2CK3D 1GA4A 2Q6IA 4RPGA 3AEYA 1ZR4A 3P9ZA 3O26A 2YFQA 4N03A 5IAOA 5K8CA 1E2HA 2ZSJA 3AESA 4Q7KA 5C5IA 4N8DA 4OSPA 4TZ0A 5A0FA 2Q5IA 5I7UA 3QVGA 5BVHA 4U6SA 3WGIA 4LE2A 4IFEA 4RFSB 4YNBA 3U6KA 1SXQA 4PG8A 3SLGA 1GQYA 3GZNB 1Z06A 3CSUA 1E9CA 3L9XA 5IZCC 2D5LA 1ECCA 1C1DA 3HWX1 5L6MB 3URMA 1PVDA 1EX7A 1JFFA 2IXFA 4MQMA 1XPOA 1D1PA 3IP8A 4DYDA 2HJRA 2OYRA 3UW3A 3I8OA 3H4VA 1JDZA 1O95C 2FPWA 1R4MA 1VIAA 1TGVA 4I4NA 4BRWA 2G36A 4CLEA 4CIBA 5AHOA 1U3DA 3BGIA 5DYNA 1COWD 1T9KA 1LPNA 5BN5B 1TUEA 4BNIA 1NG9A 2OZLB 4JQCA 1SY7A 5LZ7A 2HA0A 4BHTA 3P4UA 3NBUA 2H1LA 4LGCA 4UW9A 3A7DA 3I1YA 4MCIA 4O2LA 3HKDB 2Q62A 1CVLA 3PT9A 4P9NA 2O59A 4YJGB 1H9BA 3IP9A 3D7SA 3PR1A 1FDIA 5JZOA 5ANRB 1NYRA 2B2XA 3FD8A 4M21A 4GSYA 3VTFA 5JCZA 1BNCA 4NG5A 3ENQA 1MHPA 5CX4A 4ADSG 1XA3A 2HV9A 5LYJA 1XROA 1Y3IA 3USCS 2V7GA 2AR0A 2OAEA 3SI7A 3X1JA 1QU2A 5E0KB 4EY5A 4IUCS 2G5TA 4WBNF 1P4SA 3D0RA 3GC6A 3KZOA 3TLXA 2BZ0A 1QBGA 2QR5A 4UTPA 2CT8A 4ND6A 1TKCA 3HHPA 4J91A 1U2PA 3DW3X 4YJHA 1DKUA 4IQ4A 1SU6A 3R7FA 5D1NA 3I42A 4NNPA 3FWPA 1GM5A 5H80A 2H17A 3O8RA 5I5GA 1E18A 4A27A 4LRTB 1VGVA 3KLNA 2Z09A 4D92A 1S2OA 3B38A 1V8ZA 4FE7A 1SOVA 2BONA 1A5ZA 1PQ4A 1XDWA 5C3UA 4RENA 3COJA 1JJBA 3D8SA 2WT8A 1NAIA 1OGYA 2WWGA 3T5BA 1CYDA 3MT7A 4Y2YA 3P9CA 2ZBPA 4TV9A 2QMOA 1NJ6A 2GZ2A 4PQGA 5B1IA 2BM1A 3GHHA 4MRMB 3TZBA 3K6SA 2ZYDA 4UCXA 1M34A 4K9LA 5DX1A 4UULA 3GH3A 4CG0A 5D5PA 2ONCA 1T0BA 4GO1A 1SXGA 3KDPA 2PRJA 2O2IA 3WYBA 1AF7A 3B1FA 3C8HA 3Q72A 3G2KA 2OE2A 1NRXA 3R44A 5CR9A 5JS6A 3FF1A 4L5BA 3VTZA 1XYVA 2NZXA 1BO6A 3KO8A 4M1YA 5ARBA 2IEYA 5ALOA 3KQVA 3DMPA 2ZSUA 3N87A 4UHJA 4WEQA 4U7DA 5LQJA 3WB2A 2C8KA 3DFIA 3T52A 2W4QA 2ZGVA 4V2IA 3K70D 1Q0UA 3S2IA 3IA7A 3WWYA 4P7KA 5IPFA 5TPWA 4DR5B 3AIOA 3M6IA 2B8TA 1MJGM 4BNGA 1GGVA 1V3QE 2NSDA 4ZVPA 2JFQA 5CFPA 1NURA 2A0UA 2Y0BA 1E5LA 5CJJA 4KH0A 3ZNQA 4GECA 1HFJA 3RVBA 4ZAWA 1I5OA 4PZUA 2ZT5A 3G6WA 2C9OA 4B3XA 1K8ZB 4URVR 5FLXA 1Y5MA 1KEVA 3NQ41 4F5ZA 1W0JA 5F73A 1R6UA 2VH1A 2NU6A 5IAEA 2YWJA 1MAWA 4FYMA 3NBKA 3W8EA 3FNGA 2GO7A 4KVFA 4R0MA 1KQGA 2OV4A 2AX4A 5J4VA 1TF7A 1U0RA 621PA 3AI2A 1L1QA 3L8ZA 2W48A 3V4LA 4AYWA 1UZAA 4ARZA 3OPYA 3A2MA 1I1NA 4OMUA 3AIKA 4IOLA 4QQFA 1L5GB 4EWLA 1ZVJA 4EG1A 1ZFNA 1KETA 1R18A 2XLBA 4RSGA 3PT5A 1FNNA 4DIUA 2X0EA 4Z4CA 1NW5A 3GT4A 2IVZA 1DIRA 3PD1A 1R4AA 2ENUA 4YUAA 4G5SA 3IOEA 1W0KA 3M4JA 4IHJB 5ALNA 3G7NA 2C1ZA 3CZRA 3CRW1 2QU7A 1E92A 3HXPA 1OI3A 4GPTA 3QSYA 1DBWA 3IQDB 5MDHA 3OX2A 3PU6A 4MNTA 3TBHA 3LI2A 3IQIX 3EIFA 1DB3A 4KWCA 1XA0A 1XE3A 3BXHA 1T6NA 3FBGA 4LDNA 2HWYA 2JLQA 2YV5A 3MAAC 1YWGO 3A32A 2YX1A 5FI0B 1YJBA 2CJPA 3JASB 4QECA 3OE7A 3Q7EA 5JISA 1MKYA 3RIGA 1MF7A 1CD5A 2NUAA 1UPXA 3BMOA 1ZVVA 1PZXA 3WGZA 3MTBA 4EPVA 1YMUA 3HU1A 3RC3A 4TXNA 3RWOA 2F55A 1GPDG 1ZS9A 3TLMA 4D80A 3VV3A 2W2NA 5AJYA 5HUQA 3K0SA 1FYDA 1JIIA 1AE1A 1OROA 1GAQA 3S40A 3OTOB 1J0DA 1PR4A 2D2EA 4HQ0A 1AKWA 4EFLA 4LJ7A 5FOQA 4LBYA 3EARA 3HBLA 2JLYA 2FWAA 3P4YA 3QVGB 4Q9DA 1U7UA 4UM9D 5BVHB 1C29B 5HKBA 4R41A 2JGNA 2YXBA 1FX1A 4ISBA 4JB0A 2ERYA 1W47A 3K4PA 3B1YA 5BXQC 4WNIA 1SG9A 3OVMA 1M6HA 1C1DB 3GFTA 4KLZA 3UUGA 4I6EA 5DFAA 3KSAC 1U0OC 5JLJA 2FXVA 1JFFB 4Z3DA 4JNCA 3NMUF 1G2OA 3GPIA 1QSGA 5FA8A 4OA8A 4TWJA 4KUHA 4I1PA 1JGTA 3GLTA 1R4MB 5JROA 1BGVA 3HS3A 4IDCA 3MAJA 2PSHA 2JH9A 3HVUA 4IFIA 4M1ZA 1WUKS 4LGVA 5FF9A 3IUQA 2C4HA 5DTMA 3DKKA 4Q9HA 2R62A 3NIFB 3BA1A 1A97A 1AQNA 1HQCA 3MWLA 3O2QB 3T6KA 1FIUA 3CX8A 2QZ9A 3HN6A 1ODIA 3KSDO 3L6UA 3I9FA 5AKYA 3SEQA 4XWGA 2BHRA 4H77A 1RP7A 4FB4A 2C77A 2AMJA 4LOLA 3UBTA 3F5DA 1CHDA 1D3AA 1MT0A 5TB5A 2SCUA 4I1UA 4D4MA 5DXJA 4FGUA 2O1SA 1MPTA 3IVCA 3N8HA 3WJ2A 2IYPA 4XWOA 3GLRA 4QT4A 2HDNB 3B8EA 2A94A 3OFVA 1E4VA 5P8WA 5JS1A 3N5KA 2GZ3A 1Y3HA 2D5BA 2NTYC 5LYJB 3EEIA 3KJNA 2QVYX 3UJPA 2NYVA 4RH1A 4JJ8A 3TAHA 2XMPA 1PV2A 2I0FA 4HF7A 1XXHE 4NESA 3QPVA 4YA6A 1XRPA 3BOSA 5FWXA 1G64A 4HDNA 2PX0A 4LJKA 4MA5A 4YJHB 3UUWA 1RAFA 1TUIA 4HYQA 3IHTA 2FPKA 1XX6A 4DMHA 3RUEA 2RGGA 1JP7A 1MN6A 4QWMA 2NIPA 5GONA 1IIRA 2X8LA 2G25A 2HUNA 3A8TA 3HPRA 3LFUA 4EB8A 2EDCA 5DN6D 2EFGA 3CVWA 1L5HA 1T36A 1Y3CE 1QOQB 1O77A 4JN6B 1E20A 1P2UA 1KPHA 4FFBA 2NVUA 4FGSA 2Y4NA 3HBJA 1GNVA 4KSBA 3NBYC 5FNZA 3VNAA 1XF1A 4EHKA 1THTA 2YY6A 4EJSA 3IAS6 4TV9B 1RPAA 2DMRA 3WGGA 1EAMA 3RIYA 1MNQA 4TS4A 3VZQA 1RQ7A 3L7IA 5EESA 1UC4B 1WEKA 3K6SB 3N28A 3D6VA 1G59A 1L3IA 2ADOA 5HX7A 3GP3A 5HQJA 1E32A 4URZR 3CZPA 4B71A 1UBEA 5C9ZA 1QGAA 1QKIA 1FP1D 1XSEA 3SR3A 5DX0A 4ZCTA 3LX8A 2AMVA 1Z0JA 3DOJA 5LPNA 1JEYA 4AY6A 1WXIA 3EZGA 5J4KA 1ESMA 5ELLA 2C5LA 5G41A 3UKOA 1W8IA 5A71A 2MT9A 4M0DA 1WR8A 3T9BA 2KPOA 3U17A 3I2HA 3SCZA 3VR2D 4PZAA 1HX7A 1FQKA 3SWWA 3DMFA 3HVKA 3TD2A 1KMCA 1OLUB 2OSVA 2WTNA 3EF1A 1I7LA 5TPWB 1ZUIA 1IYZA 1Y37A 1ZGJA 2FY8A 5TQ2A 2PKYX 3DSRA 4IP0A 4DIOA 5J5VA 2V3CC 1W2GA 4PSUA 1J0XO 4X7PA 2I76A 2VAWA 3IT3A 3HXTA 4DQLA 1SC3A 3JZFA 2GRUA 1EFRD 2PX3A 4HFRA 4JHXA 4XB1A 4EVQA 4EG6A 4F5DA 1IEWA 2VFAA 3QXSA 1Q7GA 1WU8A 2J0SA 2NU6B 1I9CA 3SBEA 4LSZA 3G13A 4NL4H 1CR1A 3LVRE 3HKBA 1BROA 3LS2A 4L27A 4LV8B 4GX1A 1ECLA 2ZBDA 4HAXA 1N6KA 2GHTA 2CLSA 1YBFA 3CBGA 4P5DA 1DKLA 1PJQA 4AECA 3RNLA 1IUOA 4ARZB 1QRRA 3OF2A 4TS9A 2HK6A 2H08A 3OPYB 2I3AA 2ZWOA 1FC0A 3IV7A 4IFBA 1O2DA 4IUYA 3RHTA 2PKWA 3T7JA 4ZK2A 3I5YA 2XSZA 3KKMA 4NRDA 1EXWA 5BQPA 3TAXA 4AM8A 5CD9A 4TRMA 4G24A 1YS6A 4UATA 4J0FA 1GADO 2I2WA 4MPDA 3WMFA 3DDNA 1T24A 1UBLS 3KJZA 3F3KA 3FX2A 5AVZA 3LVBA 3WGLA 3DNFA 4FGKA 1N5LA 3NHMA 2O57A 2QZPA 2X4IA 2QLFA 2YNMA 3RASA 4Q5IA 3VZCA 2ZZMA 1NVKA 3WGKA 2PD4A 2X7XA 3DDHA 4R2MA 1KZ1A 2GM3A 1CJBA 1U02A 4ZHQF 1Z36A 4J2HA 1VCHA 2QJOA 4N7JA 4C3OB 2GR9A 3FSRA 3NGMA 1X94A 1TJNA 4RVHA 2XNJA 3MS2A 1LDMA 2NUAB 1DAHA 2I3GA 5IYZF 2WUWE 4N7BA 1LJUA 2I2AA 4L6IA 3UXMA 2TSYB 4BMPB 1AHHA 5B2FA 2WM9B 2PLRA 2YZ2A 5KPJA 1QTQA 3TRJA 3C8ZA 2VP0A 2QZZA 3ITEA 5ES4B 1DAEA 3LOPA 4KRXA 4YDRA 1UF9A 1DBPA 2I1QA 3ND5A 4DLAA 4YS6A 3WP1B 1E3QA 2EHJA 1LF5A 1R4ZA 2XMGA 1K5GA 3O8OA 1BD3A 3SQLA 2ARKA 3HUEA 1CY8A 1INLA 1O95A 2NQ8A 2XDAA 3E7XA 4IYRA 4MAMA 4TT8A 4NY1A 3PTAA 3ZCVA 4WA8A 2P6RA 3VKHA 1JLSA 1J9EA 2VF8A 3GLUA 3NUQA 4PF1A 4LYEA 3C41J 4S1TA 4AX4A 2ODBA 3JQEA 1HEIA 5DM60 1EMDA 3BSSA 4ZVVA 3KDSE 4YN3A 4JBYA 1P7CA 3TZCA 3WK4A 5BN1A 1S9DA 3KU1A 2DBRA 2PT5A 4PZ9A 4UUPA 4W8HA 4A0QA 1PSZA 2AG8A 1W5BA 2VJCA 3UXYA 2KE5A 3Q41A 3NNNA 5KWSA 3HXLA 1V11A 1CT9A 2QW8A 1GVHA 3LTNC 3OQVA 4RZQA 3O3NB 1RRMA 3HDGA 1WY7A 4NZYA 4WLEA 3VMFA 4KK3A 3ZYCA 4O1MA 3R0VA 2D5CA 3NHRA 1J33A 1KK2A 3CLUD 3EIXA 3U1TA 1ZOSA 2PXAA 2SKDA 4FEEA 4MVJD 1QJ4A 2IUTA 2SCUB 5ALQA 4IGKA 3S0JA 3AL0C 1M1YA 3W77A 1FE8A 4OIMA 3F5SA 5JAIA 3WBJA 4JLMA 1HTTA 4YP7A 3YASA 4W7HA 4PR0A 3T7AA 1Z18A 2BR4A 3B5EA 3AHIA 3Q9LA 5DULA 1NYTA 4NFSA 5EIOA 3GARA 3H9QA 3NFRA 3VX3A 1DRUA 3BE5A 4HDNB 2MDTA 1LLQA 3P2IA 1F0PA 3V4SA 5IJWA 3LWNA 1U80A 3IMEA 3L01A 4PSAA 2DCMA 5COBA 5GONB 1M1NA 3FN4A 2WOJA 4MVJH 4YJ3F 4ZEOA 4ZOLF 1L5HB 3HGQA 1T36B 5BT9A 3WB0A 3ZE0B 1VECA 6ABPA 3IBTA 1DC5A 3NASA 4PN3A 4FFBB 5JPCA 1F5SA 5E38A 2NVUB 3BIOA 4RGVA 2WE7A 3I4FA 4JROA 3QWHA 1IBRA 3HYSA 3DWEX 3LUCA 3NATA 1T34A 4R2IA 2DHCA 4EJSB 5JWHA 1YRQA 1C7FA 4DSUA 4BNFA 4L4SA 1VSUA 2HEIA 2WYOA 4WCFC 1LDBA 3UT6A 4Z4QA 2C5AA 4C7OA 1M8PA 5CFZA 2QP3A 1FRQA 4EW3A 1U4NA 3PJFA 1PQPA 4WV3A 1SIWA 4R9NA 1PJSA 4X5OA 1Z39A 5FRDA 1HRKA 1XMJA 1XZBA 5WRFA 2QAGC 4FUTA 1DPGA 4OQFA 3VOTA 5L3VA 2EC5A 1T29A 4YTEA 5HP4A 1OKKA 5C7LO 1JEYB 4HXFB 5AXCA 4KVAA 3IRVA 1WD5A 4M9CA 4HGRA 3RAJA 4MW1A 2C20A 1L7XA 2D4AA 3BTOA 2DUWA 3VR3A 1DKNA 4GXNA 4MRPA 4FS8A 1AKUA 3L6DA 1W1IA 4Z2YA 3SQXA 1NDQA 1WXEA 4OB7A 1SA0A 3FSGA 5BW5A 2IDZA 5TQ2B 1P1IA 4BRZA 4CKEA 1KKUA 4ER5A 5A3QA 2ZROA 3BJRA 1CQWA 1JWAB 2VUHB 3U3ZA 1XEWY 2H9AA 4EF6A 1JLHA 2D1RA 3BCSA 1QP4A 1Z5VA 2VCYA 3PRJA 1GTRA 1LTQA 2G67A 2YBEA 3WRXC 1B93A 3PDJA 2CFRA 2B4YA 1EA7A 2BKAA 4PAMA 5KHLB 3IIKA 2X3YA 2Y3IA 3R2JA 1IHOA 3TZHA 1LPBB 3HKBB 2OFXA 4WI1A 2LKCA 1P4AA 2PLWA 2ZS9A 3ZZMA 4I4TF 4N0PA 4D74A 1GR1A 3GRAA 1PKEA 1SHZA 2TMDA 3GN2A 3PUYA 3U3RA 4YAIA 2H1IA 4FKBA 3OFNA 3GDFA 3L8EA 1C9NA 4BGEA 5I9LA 4D9NA 4G23A 2VHQA 1ULHA 4DMMA 3OCUA 1K3FA 1MGPA 4DV1B 4TYYA 1NJ1A 1FZQA 2CF6A 3H2ZA 1LQ2A 4HQRA 1GXSA 4FR2A 1E7YA 4G09A 3I9LA 3KQWA 4LW8A 5JTUA 2PTHA 4UFPA 1JTVA 5G4LA 1T9GR 3ZZNA 2YZ7A 4ZQFA 5BR4A 3OQMA 1YIDA 4P31A 4UPVA 3K72B 3DFUA 3N7AA 2FEAA 5C1DA 1XTUA 3DONA 2ZYSA 4CYMA 5K7SA 2OCYC 4FI3C 4C0SA 3G0GA 3NX4A 1QH0A 3LWZA 4H08A 1AQIA 4LZPA 5BV7A 4B82A 5C1OA 3DR3A 1H2YA 2IYWA 3ND9A 3Q1KA 5BWCA 3W5BA 3HTXA 4QOSA 1KVSA 4ZRDA 2ZQYA 2XCQA 1RM0A 5NLLA 5JXGA 3DE7X 3EC2A 4PIMA 4X1YA 5JXHA 1WXQA 5LKAA 3QUQA 1PW7A 3CEJA 1A8UA 5AJXA 3K53A 1LQUA 2B1GA 3PDHA 4FINA 4OH1A 4Z9AA 1YASA 4BN4A 3EOBI 3Q0TA 4UBKA 3P2EA 4L5CA 4QOIA 3V8RA 4Q1AA 4KP7A 5MHTA 1SOUA 3CWQA 3ELBA 9GPBA 1CUDA 2ADFA 2GBCA 2I4LA 1ADJA 3KXDA 2YIMA 4Q39A 3ZE6A 2XTNA 1UJCA 3O8OB 1TZCA 3GR6A 1T9CA 2ETXA 4YALA 4JI3B 4HWKA 2X23A 3AM1A 1HLDA 3CZMA 2C3MA 3DYIA 4BQIA 2FEMA 4HVCA 3TD6A 2CYBA 3KKPA 2H9IA 4XYBA 1P45A 5FJJA 3Q10A 3ZIAA 3RS4A 1GZ6A 3PCRB 1ZH0A 2Z3WA 3LCJA 1NYQA 3QYPA 2AXPA 3FLEA 3JVVA 1Z16A 3Q8XB 4BMYA 1ESEA 4HZUA 3GROA 2ZWVA 1QH1B 3BTUA 2EX4A 2RK6A 2XUQA 3HL0A 3ONVA 3H2GA 1ECJA 4DDMA 1GGKA 1D2GA 1U3CA 3CT6A 1AKYA 3UV3A 3TZLA 5LNK6 4AI6A 5BNWA 5DBGA 2ZKLA 3IS3A 4L7VA 5I48A 1V11B 1A7UA 4HGNA 1OH7A 3ZGXA 2Y1XA 1DQYA 3UWMA 1FUYB 1A1VA 1SC9A 3NBXX 4JL5A 3BAZA 1IZ7A 4AICA 5BW8A 1XKLA 5K3FA 5BQ3A 3C48A 6CHYA 2V0GA 2AF4C 4FSXA 1NXVA 2ZR0A 3C2QA 3IAAA 3T9AA 1TECE 1M1YB 3C5WP 4P0QB 1HE8B 3VA7A 3WQBA 2N75A 5JD3A 4QRHA 2DPHA 4ZZ3A 3RFXA 1T5OA 1NUTA 1ZOIA 3CC8A 4AROA 3UY4A 1G42A 4WESA 4LEIA 4D8VA 4FE3A 3NCTA 3TWOA 3GMIA 4DLYA 2BFAA 5BRAA 4GZLA 3GEIA 4GOLD 5ERGB 4JJ7A 3L7CA 1Z34A 3UB2A 1B74A 1HYHA 2CD9A 4FHZA 4O08A 1FJXA 4PZCA 2QNBA 2COUA 4G5QA 1NN3A 1JZQA 2ZPTX 1DL5A 3LOUA 4U2BA 5EA2A 4B3MB 1OBVA 4OHYA 5DGIA 4RMJA 1SQ6A 1C9YA 1M1NB 2XE8A 3BJIC 5K8LA 5J2TA 4KTTE 1CS0A 2J31A 4DEXA 1AQYA 2RHOA 1YZLA 3GUUA 3ROQA 3ZE9A 3U13A 5DLEA 2F1OA 5K2OA 4OI0A 1O54A 2L18A 3QVJA 2HT1A 3I62A 1R5JA 2CLKB 2YXEA 3I2JA 3K4QA 5A6SA 3ES9A 3QY0A 5GM2A 3UJ7A 3ZCPA 1DO2A 1RJEA 4IHAA 1JLMA 2W2MA 3IUYA 4F3YA 3F1KA 4Q7MB 3SQMA 5JY1A 2JHPA 5IBPA 4C7OB 4J3NA 1XTJA 1Z6ZA 3B20A 4A1FA 3JV7A 2HLDA 4ZYYA 4LN1A 3E22A 1K86A 1YMVA 1SPXA 1O5IA 2OCKA 4P92A 1JVBA 2ODAA 5CG2A 4OSEA 3EIOA 4JC8A 3IE1A 4JEHA 3T1OA 1E69A 2CEAA 2CXXA 2PBLA 1KTVA 2IW3A 2ZJ6A 3DF9A 3EC1A 4H7KA 1D09A 1TCVA 1R37A 1SUCA 4L4XA 4QDXA 3VFDA 4XGRA 4DB2A 4YCJA 2WP0A 5FWDA 3W8FA 3AUAA 1YGYA 3A1DA 4R1LA 3MJTA 4HH4A 1EFVA 4EG5A 1VLLA 4FLMA 2JH8A 5B6JA 2XB2A 2H4XA 5FWYA 2OQ2A 4EO9A 1SVLA 1XFAA 3CNHA 5F9HA 1Q6ZA 4P54A 5IN5A 4CKEB 5A7FA 2AQKA 5IBRA 2UVPA 4E2ZA 3OAAA 4ZJYA 3NHAA 1MA3A 1KMQA 2UDPA 2YWEA 2J7PA 2O07A 2CJWA 3ZDFA 2WMDA 4PHCA 4JENA 1KI6A 4BCCA 3QKIA 1Y1RA 3CUEF 1XZNA 2Z3ZA 2ZE7A 1ZESA 2NZWA 1IB0A 2BI8A 2R44A 5JXIA 3HFSA 2RK3A 3VKUA 1WHTA 1X74A 3LPCA 2PUVA 4B6QA 3CF4A 4G1CA 3RS2A 5DNDA 2Y0DA 5BSHA 3K6KA 4YK7A 1L5WA 3WV5A 1T35A 3IBSA 1ABEA 3NKLA 4PXYA 3UGKA 1I6LA 5BT8A 1GXSB 5FFMA 5I7AA 3ZKWA 5HJEA 2QT9A 5AK6A 2Q4TA 2I78A 5ALEA 3S4YA 4IIEA 1KE1A 4BMCA 4ZKDA 1W6UA 3HCCA 1J1ZA 3FFBA 2BFPA 2GPWA 1Y6QA 4ZMSA 1KEUA 3K2QA 4QDTA 2YC4C 5CHYA 4KYUA 5AUNB 5JD4A 3KQKA 3AF5A 2GHQA 2FOIA 4L9SA 1SUBA 2TMYA 1LPSA 4F5YA 1MABA 1U0GA 1ORIA 4D3DA 1WOMA 2L69A 3GAMA 4L02A 4A6PA 4C1NA 3RC9A 2R8BA 3F4LA 1Q1AA 1WMDA 1I3LA 4L4UA 5K3BA 5KAPA 4DR3B 2YN0A 3X1ZA 1Y1KE 4X1YB 3NORA 2I4TA 3X2EA 4KMOA 4N4AA 5FD8A 2OHXA 1XZDA 4ETIA 3ACCA 4NV3A 1LRKA 5JAOA 4PNEA 1IPEA 1Y4SA 3DKRA 4PC3A 3N6RA 4I81A 5KSPA 4K46A 3SSMA 3SSOA 3RVMA 4YRDA 3DYBA 4BRUA 2BUBA 3CZQA 3NETA 2HU2A 3VU9A 4MI6A 1O9HA 4AUMA 4R0NA 3RVQA 4BGVA 3S8EA 1YHZA 4L8VA 4B33A 3C3CA 1B8UA 1BHSA 3FTFA 3O0TA 2C54A 3DTVD 4RPHA 1DJPA 2WT9A 4FONA 3V1TC 4ZJPA 2GLUA 4WH0A 2XNSA 3BQNB 4RV9A 5IEBA 4AP6A 4BASA 4HEHA 4KQJA 5DI9A 2VF2A 5F9FA 5TX7A 2ZYHA 3M5PA 4BB6A 5HFNA 3UATA 3KKLA 4DARA 4J2OA 4JT2A 4GBGA 1JEEA 1N6OA 1SC4A 2EIHA 4HZUB 4F9FA 5JQGF 1YQXA 1A9OA 3IKMB 1A5BB 3FOWA 1JECA 4XTRA 3SIWA 1EBFA 3TUJC 4E1AA 3WTCA 3QBVA 4QDOA 1I24A 2P75A 1Q83A 1NNI1 1DEOA 1JDTA 1TW3A 3GAZA 2VTKA 3HB0A 4HX5A 4RXMA 3M6LA 1TRHA 3ZD8A 3K2IA 4Q1EA 3DZIA 4BB9A 4OHMA 5K3FB 4CG3A 1A5TA 2AG0A 3VVCA 4OQYA 1U1IA 1VFNA 4A0GA 2JEYA 1KOGA 2CEKA 1M2FA 3IOCA 3KBOA 5FWAA 1Y1QA 2P1ZA 4U2EA 5JSHA 1SPBS 4R84A 3BRWA 3PYXA 4KO3S 3S55A 4AJ9A 1KWKA 3A4NA 2I91A 1L5LA 2JGIA 1XVTA 2JGMA 2E1PA 2WHEA 3HU3A 3ZWYA 1M2GA 1NKVA 2JGLA 5ESXA 1E1KA 4OP2A 3WISA 2C9BA 3U61B 1QANA 2NU7A 1C7IA 3KYIB 2DWQA 2O52A 2Q0SA 2WU1A 2Z5LA 4WESB 3GJZA 4EO4A 1PR3A 3CLVA 4OOFA 4QQ8A 1USKA 3OPQA 5BQFA 1HT0A 3ICQB 4F85A 1NQXA 5L9AA 3GAAA 1UQRA 5EHZA 2WG0A 2PT6A 4ABYA 3JQGA 1KZHA 2WYIA 1QGOA 1KO4A 5KOIA 4AWXA 3FA2A 2ZYVX 2Z9CA 4J7CA 4Q7EA 2PNFA 3Q9SA 5TMDA 1R8XA 1YK1A 2EBHX 1NW7A 5J2TB 1ULSA 3L7YA 5BO5A 3RRZA 1G8SA 4RJLA 5IG2A 4WCFA 4UOZA 1OV4A 5ALGA 2H2IA 1L7EA 2WPNA 3DPIA 4IV8A 3BH7A 4E5MA 1UK8A 3PFHA 1YUNA 3GO4A 2QPTA 3WLNA 5A6SB 2OP0A 1VOTA 2QKYA 4UU7A 1XVAA 1M54A 1BG6A 1EM8A 3GRPA 4O4HA 2C9ZA 1SBHA 2GHRA 3PHGA 1QCDA 2QAGA 1BMTA 3RUAA 3TW0A 4EA6A 1I7DA 1E9AA 3MUEA 5EE3A 4L22A 1KAMA 1OMOA 1LLFA 2ACKA 4GRAA 4YCAA 3OIWA 1GNPA 2CDBA 3E22B 3U39A 1C3EA 1SOMA 4BNWA 5COQA 4BZXA 1VSBA 3D6HA 2ACEA 2VLBA 1OWNA 2WFAA 4R1PA 3DTTA 3G68A 5JARA 1AV6A 2BL4A 1OLOA 4FFDA 4Q37A 4CQLA 4XGNA 5EXTA 1XNJA 2IODA 3F97A 3A4MA 4XUDA 5CH5A 5KINB 1F7VA 3RYFA 1Y9EA 3P45A 2V1XA 4WXRA 1FX0B 2A4KA 4HYYA 4R16A 4HLUC 4Y6SA 4L6AA 1EFVB 1P2FA 3BEOA 3RFTA 4F4HA 1VJTA 4HZGA 2VHJA 5FWYB 2H2AA 3BWEA 3JWIA 2EG9A 3LBIA 3O1HB 2CLFB 4TVKA 1FPQA 3RC2A 3WRXA 4EA9A 3OJEA 2IGTA 2F1KA 2B78A 2LNDA 2UVPB 3CRQA 2HF8A 3IBYA 4OYLA 5IKOA 5AESA 3JQ6A 1O97C 5GMOA 3OM0A 2CJWB 2O3TA 3PHBE 1QIKA 2XNHA 1URPA 4H1UA 4HH3C 4RVCA 1KI6B 1J07A 1HLFA 2AG5A 1BDBA 1RYDA 2JIRA 1SCBA 3PSAA 2WJZB 4WBSA 4HGZA 4DUYB 5K6RA 4BAZA 4JLKA 4BX2A 1L7PA 2EW2A 3E48A 2IZ1A 5K9ZA 3GVHA 3EGDA 2Q6VA 3HKEA 4B4KA 3KEMA 3E03A 1E4OA 1FTYA 2XJ4A 2CLHB 1LH0A 3IQXA 1LI5A 3U4IA 2JGRA 4MVJE 1Z7YA 2HLPA 3KAJA 2HMUA 4IF4A 4JYAB 3FRIA 3ZKWB 3F46A 1RBMA 2VP5A 4GX2A 2FHSA 3IOYA 3NBQA 3GEDA 3LUBA 3I3SR 3NI2A 4LDAA 1L5KA 4MCHA 4TKUA 4NYMR 2XE6A 4QUGA 4QARA 4BN5A 2AOWA 2H48A 3AUYA 4MB2A 2DUUA 4R69A 5EKUA 2VKQA 1OAKA 4TSKA 5H82A 2F43B 2HA7A 1MABB 1R8SA 1C8LA 2E4AA 4Q3NA 4C20A 2G9NA 1MORA 2QTZA 3QA3E 2X9QA 3ZY6A 4TTSA 2W2QA 2WTBA 3E27A 4U6QA 3ZDEA 4DILA 4ERNA 3GLGA 3OLQA 4OHUA 3WMXA 1SZDA 1FUIA 3A26A 4ZT6A 2AEMA 4IKOA 2QTFA 2DHRA 3WQHA 4O4JF 1RXCA 3BS4A 3I1IA 3Q2OA 4ALIA 4F96A 1ICEA 1BIFA 1CLEA 3SG0A 5JNRA 4OQPA 4R40A 5KNLA 4O5OA 4J0EA 5IT0A 3EUEA 3PWZA 2VTBA 2IPOA 1N0HA 3MRVA 1RCUA 4QC2A 5JS8A 3JWPA 2D3TA 4HDOB 4X3OA 4Z0TA 2E18A 2AFHE 1UQTA 1I5RA 2GEDA 2PKEA 2YQZA 1PG2A 3ESCA 3AHGA 4KDCA 4RKWA 3VYUB 5K8IA 3F2VA 2ZUFA 3I8SA 4DR6B 1DEHA 2PYIA 2ZI5A 2AOTA 3LKVA 4N3BA 5CUQA 3BBLA 4FQ5A 1O6GA 5DXFA 1GEGA 2H29A 3H9EO 3JZIA 1CQJA 4YBZA 2R8PA 4WGFA 4YI5A 5FORA 4RNDB 5EIHA 2A92A 3IAM6 4WBNA 1EB9A 1U6JA 3C8UA 4FJ2A 4JYMA 1UT6A 4IVRA 4W63A 4CPDA 4F46A 2IS4A 4OXKA 5KJCA 3H0EA 2QR3A 5BYAA 1JJAA 1LA2A 1R00A 4FN4A 4EYSA 4DANA 3DO6A 3RQSA 1AUPA 4IQGA 4JVNA 4BB0A 4IJWA 5AKHA 1VRVA 1AVTA 3WNBA 4NV0A 3FNEA 3EPKA 5FAXA 3K0BA 4TTRA 1QF6A 1YBHA 1E1LA 3BXOA 3D0OA 5EZSA 1H5NA 3O8LA 2Y2UA 3R4VA 2Q45A 3IULA 3F1LA 1M5UA 3AZPA 2GPYA 1P0IA 1ESZA 2KSQA 1GTVA 2Q4BA 1TA4A 2DVMA 1ABBA 4ND2A 4KLRA 2XYRA 1QG6A 2ZWIA 5ECDA 3HKCA 4DA9A 4YMIA 2Y93A 2I8AA 5F3WB 1SU8A 3L93A 3KSUA 3BRQA 3LHKA 3VZBA 3SXJA 4Q1CA 3EX7C 2Q0QA 4RMHA 3ND8A 2E82A 1ENPA 4Q03A 4PFKA 3MT0A 3SJAA 3KCQA 1AMUA 2HNKA 2NU7B 3W1WA 1ID1A 2Q21A 4F91B 4LNUA 4M89A 2CBZA 2EJUA 3EQ9A 4NG4A 1H3FA 2VF7A 4RAOA 3WNZA 1Q1NA 3ZCSA 2OOSA 3LHFA 3AEQA 1XNQB 2ZRPA 3JQGB 3KELA 4MULA 1U63A 3STVA 5AI9A 2D74A 4RELA 5BNTA 4B3HA 4IL5A 2PJDA 4LX0A 1XMPA 3KYDA 1FVXA 4FXOA 4GUAA 3AM3A 4WCFB 3FPEA 2OHVA 1G20A 1HYGA 2EX1A 4LBWA 2YICA 3PX3A 4EMBA 5EUBA 3VAZA 3ZHQA 3W7VA 3TG2A 2C3OA 2NUPA 1SUWA 5CH3A 2GLXA 4ZDIA 1LW6E 1EM8B 3FNFA 1PQUA 2O2DA 2GUWA 3Q6NA 4KX5A 4O4HB 4PIPA 4RNCA 3QLUC 2QAGB 5M2QA 3G5MA 4FGJA 5GIPE 3IMGA 1LPOA 1M2EA 2ZJFA 1RC0A 2QN8A 2GA9A 3LQ1A 2D1FA 2O05A 2HGZA 1FSSA 1PG0A 3DEJA 3NV7A 4RLHA 5JATA 2ICAA 2OD2A 1V7CA 1RXIA 5DYGA 5LLSA 3GGOA 3QY9A 3VNSA 4CR8A 3GLKA 3MA0A 4G85A 4M8NE 5FHQA 1OT3A 3N0XA 4KIUA 2QG6A 4CQLB 4JXXA 1YB6A 1AKRA 2VO1A 4C4OA 3RYFB 1WLSA 1W0KD 2PO7A 2AT1A 3U1VA 1K0UA 4GKBA 2CHEA 1G8YA 2ZRJA 1IDN1 3F6EX 1A4IA 1ZWKA 4JIGA 2P6OA 4JOSA 4R8VA 1JF8A 3FWZA 3EC7A 2JD2A 3NT2A 4OB6A 4MDEA 3E7WA 4G5RA 3L0PA 1WZNA 2ZVDA 1V35A 2DUJA 3RS5A 3MJEA 4JZKA 5KYKA 1VI5A 1E1RD 1SKYE 1X14A 4UU0A 2VYVD 3FDXA 2PEYA 3FAKA 3K7EA 1NMYA 4QGHA 1JQKA 3IUNA 2F7SA 4W1RA 4WKGA 5D8DA 3WKAA 4EG0A 1S9HA 2G4CA 5AO9A 3KC2A 2NSYA 2Z0MA 1PRYA 4D8WA 2RH9B 3VYVA 4B2IA 5AQEA 4EMSA 2EW8A 1ODFA 521PA 3FBWA 4LOHA 1ZW6A 2O4CA 1BS9A 3PICA 3WJ7A 2C7QA 1RD4A 5SZHB 4US1R 5TGTA 3EGDB 3HKEB 1W73A 4ENRA 1EVEA 3E18A 3GP5A 3ZQJA 1ZNYA 4EYOA 5A5VA 1L8QA 1BCRA 1PK7A 1XDBA 2QD3A 2I4OA 5HUHA 4FW8A 2Q5FA 1M6VA 1RTKA 5JBNA 2ZFUA 4HQKA 3F7TA 3QU5A 1KRXA 2C97A 2ZJ4A 4E51A 1G5HA 4G63A 1AGNA 1SK9A 1EGQA 1DG3A 4X41A 1I3CA 2GSWA 3L8GA 4KKVA 2B2NA 3KVYA 4TKUB 4ZTUB 1Q19A 3KEQA 4QPJC 4ER6A 2H11A 3QJ5A 2OXFA 4WVLA 3EFHA 1OZ0A 1TQDA 2Q4RA 4GOND 5AIAA 4GE3A 2VNKA 1CZOA 1JSRA 1VJRA 2ANCA 2QRMA 4C0QC 4RY9A 1PZNA 2UYGA 7YASA 5I9NA 3GLGB 3BL5A 4PVDA 4ZI7F 4GUDA 5DWDA 3WBFA 5KNDA 2B5OA 3EDCA 2BZ1A 2C7VA 4GOJA 4QJ5A 4B3TB 3CX7A 5I9SA 4Y2XA 2PQ2A 2JAOA 3N8DA 3R3SA 2C0QA 1MC8A 4UAGA 3ONNA 2VTBB 2FG7C 2VJBA 3PSHA 4DLKA 3VTAA 3HDQA 4C0JA 1R27A 4BFLA 3GL9A 2MYTA 4MYDA 4HNAA 2W9XA 2EKQA 1MLDA 1ZM7A 4KX3A 2AOTB 2ZYTX 3FW1A 2FEOA 4P4SA 4JJAA 4BMVA 5JRZA 2PCJA 3BD9A 4B3IA 1CQJB 4OP3A 4XFDA 5ETJA 3SZOA 3RVPA 4WBNB 3F7NA 1B15A 1ZC3A 4E94A 5JSQA 5INTA 3C4VA 1ECGA 3T5DA 3FWKA 3MINA 4N0EA 1TAHA 2DPLA 2QTBA 4HWGA 4XJTA 3LHDA 4CL3A 4DM3A 3U4QB 5ALFA 1OX4A 1KS2A 2X3UA 2NYAA 2CMFA 3O38A 4IGEA 3TQRA 5CW2A 8MHTA 4E6EA 1CEYA 4IJKA 1NFRA 3OEHA 1SQFA 2WVAA 4XIFA 3BM5A 4ZP1A 3A3OA 4AO6A 1OV6A 1BVYF 4ASUA 4E3ZA 2VHUA 3GRRA 4GM4A 1JDPA 5DRTA 2I67A 3E9YA 4ZOBA 1FFGA 4DV7B 4H6WA 4KHPB 4KQFA 1QZTA 1VB5A 1K63A 2X8AA 5LP6A 3C8MA 4HR7A 3QJGA 1Q1GA 3HKCB 3PWSA 4BKQA 3PBKA 4Y0AA 1M0TA 1E2GA 2V58A 1I1HA 1U9YA 3NOVA 1RXUA 5C18A 1DV2A 1WS6A 5B1YA 4CDMA 4C6TA 4I8DA 2JAQA 4QFDA 1P61B 1NXTA 2FFRA 4D4IA 2OCDA 3S7ZA 1F6DA 4LNUB 1OTXA 1XP8A 1P7WA 4Q15A 5EJ9A 2JCGA 1X0XA 4I1VA 2WM3A 4GNRA 3F7MA 1T2FA 3AEQB 1U2TA 3DMYA 4Q4DA 2IBSA 2XWSA 5T6MA 2ZYWX 1R5BA 3DW1X 2OGSA 1M6NA 4G56A 1RRGA 2YZMA 5E4FA 1VIYA 3BGVA 3QTBA 1U90A 5EP2A 3RT7A 4Z1OA 4RTJA 4NK5A 3HVIA 2IHKA 4QYWA 3D7KA 2H65A 1G20B 1IHXA 1B4DA 1QE5A 1RJGA 2JCXA 4Q4LA 3LGXA 3ZGVA 1OASA 2YOFA 5ARDA 2QRHA 2NUPB 1C8BA 1FZTA 1TYZA 4PCAA 3S70A 2NO0A 1KAQA 1YCGA 4LY0A 4UEKA 1NXWA 3OZAA 4BKPA 2WUEA 4FCWA 3BL8A 2H54A 2DJIA 1E0KA 1BWSA 1J0AA 2VP2A 1SOAA 3ZHRA 2XSZD 2AFVA 1ENYA 2Y1EA 3PUHA 4OSOA 2ONZA 4WLNA 2NVBA 4X64B 3T1TA 5BQ5A 1CFZA 4AKSA 4YP0A 4URFA 2MSDB 3E9ZA 3C1UA 4HLUA 1E2BA 5TJHA 3ZXXA 3RWMB 2OCAA 4JL8A 3II6X 1MJNA 2HA3A 4K9OA 3ZWAA 4N5HX 5J4YA 1NFFA 3ZJVA 3GJ7A 1LSUA 1V3VA 1XN4A 3DHVA 2FR8C 3TO5A 2XZDA 3W3AA 4BO2A 1N36B 1A8IA 2JFYA 4FFWA 3IMFA 4B80A 2D6FA 1VYUA 2WDPA 1KH3A 3QFCA 2JLCA 2B4QA 3A28A 4PYOA 4TKVA 4LJSA 2B5VA 2H59A 3W4IA 5DLQC 4AQ7A 3A11A 2YXLA 4Q3OA 3OTIA 1QKKA 1CR6A 2VDKB 2PWBA 3WAKA 5LDGA 3UNXA 4EEZA 3ZGLA 5FP0A 1P4HA 1O03A 1KY3A 3ONFA 4R6XA 2GBGA 2H4YA 3Q3HA 2F1JA 2G5PA 5LN1A 4ZHQA 2UUOA 4OMCA 1IHYA 1TTHA 1V2HE 4KXQA 2PLFA 3CJRA 3DV2A 4NBNA 4N65A 3SDZA 3WY9A 5IYZA 3D7RA 1NW4A 4HNRA 3THSA 1Z37A 1SM4A 1XBTA 2ZI3A 4R1SA 5E8JA 5ALJA 4CJXA 4XVUA 3T15A 1BCRB 2IT1A 5FNVA 2I6GA 1M6VB 1RM4A 3D4NA 2PJUA 8ATCA 2PLAA 4WDRA 2X6TA 2M32A 4CL2A 3ADBA 4NFYA 5H02A 1B3BA 1H65A 4RK4A 4ZT4A 3ZY5A 3ECSA 5HBRA 4DW8A 1E7QA 3IBGA 4TXHA 3NUGA 3RNOA 3FHOA 5BR1A 4RTKA 2POCA 1B76A 1TZMA 3LHIA 4YGYA 4EHLA 1E3TA 3KQYA 5ICCA 4YRFA 2Q3FA 3PPVA 1P1CA 1XRLA 1TDJA 3E2MA 5KX5B 1MAHA 1FNMA 1OILA 3BXPA 4OQ4A 3C3KA 4IXWA 4WJZA 2O1XA 1VPEA 3RBAA 2ZTUA 4HEA1 3FPSA 4K8OA 3DPUA 3KLPX 4LKOA 1BXRA 2G7MC 5A1JA 5IK2D 2EG5A 2ZEJA 1HYQA 3ICCA 3QUCA 4S2UA 1Z2DA 4DZZA 2OBYA 3DZGA 4HKTA 4EG4A 1K6XA 4OJYA 1W5TA 5EQTA 5F3DA 3WWDA 2PH1A 4N9QA 4AW9A 2VJNA 3BXXA 3A25A 4P7JA 3KJEA 1QE3A 1FJHA 5HCUA 2RI0A 4DY4A 1U0BB 2IS1A 2A9OA 1VKZA 4HNAB 3SX0A 4DA4A 3NIDB 3OKPA 1NV8A 2CXQA 4FYHA 2Y9MB 4P4SB 4CU5A 2HLNA 1ZCJA 2HM7A 2OV6A 4Q02A 3W06A 1JUDA 3UK1A 4X65B 3PFCA 3N86A 1P1HA 3L8DA 4LJ9A 3THOA 3QWIA 2ZBVA 2H2FA 2PX2A 1H93A 3T4PA 3D6UA 4ONEA 1FMCA 2Q1WA 4E07A 3PYLA 4C4TA 2ISQA 2PKXA 2HJSA 2ZRMA 3IPYA 1YA8A 3ITKA 3MINB 1ORTA 4N6OA 4X61A 3V8EA 5CFMA 5KYGA 5ALHA 3L7OA 3DLCA 4HVTA 1OX4B 1UWLA 3E5RA 1GO2A 1E79A 3L7MA 4PW0A 4XQCA 3PDUA 4F1KA 4YJ3A 2G0AA 4ZOLA 2QM7A 1B8VA 4PINA 2WZQA 4QZVA 5A62A 3E5NA 2XUGA 5HTOA 1ZGHA 2I7TA 3D3NA 3WX0A 1CUJA 1ZH4A 2NP6A 3FTQA 3DT8A 4EFMA 1VJCA 1VKOA 4E09A 3DOOA 2QM3A 4WZBE 2WWIA 4DXHA 2WMYA 1PK9A 2FFJA 2OM6A 4F72A 2W22A 2JI7A 1IY2A 3R3WA 1OKKD 4HLNA 1BGWA 1XQ6A 2JIMA 4FTWA 4C6TB 1BFDA 1CRLA 1VJ5A 4Q9AA 2NSJA 2V74B 1NG1A 2I6UA 1Z2NX 1VRCA 1THMA 1IULA 2BGKA 1DJQA 2MOKA 2QUIA 3ASYA 5HKKA 1SKMA 2V1UA 1K4KA 2WJYA 4XQEA 4BUJA 4BMOB 3B13B 1Q0QA 3FSGD 4JLJA 1U8EA 5HKAA 3MWDA 3AJ9A 4OAQA 3BKWA 1G8FA 3EXG1 4B34A 4PM4A 4UDNA 2CCGA 3DWIA 4Q3BA 2FE4A 1MPXA 3CEPB 1ISMA 2XAUA 5EIFA 2XVYA 4RJTA 3PG5A 4NMWA 2AQ8A 3QLUA 5CFNA 1DKPA 5BSTA 1O87A 1FS4A 2B6HA 3EFEA 3H5AA 4E7PA 5J47A 2PFSA 1RQPA 1U6IA 3NUZA 4RHXA 5B53A 4JR0A 5T3UA 2VQ6A 3ZXSA 5CTAA 3U44A 3KL2A 3QZUA 4G81A 4MGZR 1PJCA 1QIIA 1BH2A 1TYBE 3C3EA 3NTLA 3Q3GE 3T3HA 2IITA 1CUVA 4I4TA 1I36A 4Q16A 5LMUB 2PZMA 2W6ZA 4V24A 4HV4A 1GNQA 5IEJA 3O3CA 2P3SA 1YE5A 5IXYA 3T0GA 1UQUA 3P9NA 4MWTA 1AUQA 4AF6A 1D1SA 5BNFA 1N5KA 3FPLA 3QEJA 3H2KA 1DFIA 1N7HA 3O1JC 4QDKA 1WZUA 2GZ1A 1BFKA 1UXKA 2QENA 4RIIA 3ZWMA 3E6AA 3ROMA 3ZWXA 3FZYA 1Q14A 4DV0B 4E1VA 1RWKA 2UYCA 4GLBA 4TKVB 2VXCA 1M2OA 2C4MA 3VSEA 1BYUA 1OXSC 3ZE2B 1Y4ZA 3E7DA 3TQHA 4S04A 4DWOA 4HVLA 1D4ZA 1T2UA 2MMGA 3HI4A 3JQAA 4QYTA 1N5RA 1C1YA 3ZDYB 2EKBA 3LQQA 4BB5A 4BZPA 3BUSA 4ARCA 2COEA 5F5XA 4B5LA 4ZHQB 2Y2VA 3KJGA 3Q5EA 4C2TA 3KHSA 4ZJZA 5H81A 4PGHA 1DADA 2WZDA 4IQ8A 1S8FA 2HCFA 2OESA 3UHFA 4RF3A 1NULA 2RGCA 2XD9A 1YAHA 1PFGA 1AS2A 2CNWA 3JYQA 3OTGA 1QFJA 3AWIA 1Z74A 2O7SA 4KSYA 4PX9A 5FNVB 1IUPA 3PL1A 3WLTA 5FUYA 4R7ZA 1Z6XA 4YMHA 1HTWA 4J0IA 3BE6A 4M98A 4ZYWA 3QVVA 3ORSA 3FTNA 3E53A 5TV2A 1CERA 4M54A 3KLOA 1BMDA 1BWPA 2N46A 3UHAA 3WGVA 4KNYA 1V1MA 4KITB 3OJFA 1HQYE 4K9RA 4AUEA 4BKOA 3FYHA 4E5DA 5BNIA 5DHUA 4KB5A 5JCOC 2PWPA 1ZIXA 2PGJA 3CUVA 3GFSA 1XPJA 3HDTA 5TPZD 3RYTC 3ANXA 3WQRA 5LQMA 1WDMA 1W85A 2BFOA 3GWZA 4P4NA 2O5RA 4KAFA 1VDMA 4RZ2A 5LSAA 1DQRA 1VHJA 1PJRA 3PEWA 2DUMA 5SYMA 3JWEA 4ETMA 1MB4A 2DTEA 3T3NA 1J99A 1IE3A 1MX1A 3UHPA 2VPZA 4X63A 2VR1A 3BE4A 4ZT5A 5TLSA 3WGHA 4KN8A 4UJ3A 1BXRB 5T57A 2Q6LA 4GOMD 1BX0A 1RI3A 5EMNA 4YDQA 3H1GA 1ZU5A 5JNUA 1KFBB 4DB4A 3UV7A 2WG1A 3JQBC 1PDOA 3VH2A 2H51A 5CW1A 3WLEA 4BO5A 3AJEA 5AOBA 3NFYA 4LF9B 1EDOA 2BM8A 3IAS1 1PHRA 2ZQ5A 3PA8A 2A58A 4X1KB 3BCRA 5SZJA 3ADOA 2VP6A 3LKDA 3ZR4B 3DCNA 4C4XA 1CZKA 4E5KA 3IUBA 1AKVA 3UHJA 3V48A 4EUHA 1TRKA 3AJRA 3BCUA 3E58A 2B25A 3EVGA 1FS5A 4XPZA 1R3UA 2JASA 2A5JA 3LSYA 3F6RA 3V1UA 2QG4A 2IYSA 1PFUA 4WUVA 1OWPA 2JDID 2O3JA 3MTEA 4ABTA 4MLZA 4M0MA 1TF2A 3LP6A 4MAAA 1T3GA 3R5FA 4OKIA 3VGJA 3WFIA 3ZX4A 3VMMA 1E1MA 2FZWA 2HD4A 1IDOA 2IEAA 3K0KA 4AWBA 5AVQA 2GA8A 3CNQS 5DT2A 4KQ9A 5IU6A 1OWLA 2OV1A 2GJAA 5KKCA 1QG4A 2HF9A 2NZYA 4BNHA 5CCEA 4YJ3B 4ZOLB 1WKCA 5IZ4A 5C80A 3LYHA 4M9RA 4Y67A 2AJCA 2WPDA 4B1FA 1UEJA 1UMCA 5JW6A 5AHRA 3WADA 4AN4A 4FFMA 1P80A 2RARA 4UFNA 5EJGA 1JWBB 1G98A 2QV7A 3AU8A 4IIDA 3UJAA 1ECFA 5GWXA 1QQ6A 2VQSA 3H2YA 2NNLD 4D26A 3N8IA 2EKPA 5DGTA 2I9PA 2XB9A 2JC3A 4Z9FA 4WPGA 3W6OA 2RJ3A 1N9GA 2DSNA 3A6GA 5IH7A 1SXJC 1UBKS 1JDJA 4K03A 3CMCO 1XEFA 3E70C 3OLYA 1H85A 1YO6A 2P5UA 5ECYA 4MOWA 3MAGA 4A4DA 3P9KA 1JMKC 2DETA 2YXPX 2LD4A 3MWDB 3RI3A 4QUEA 3GCGA 4TTQA 1XLUA 1OJ7A 1YHNA 2O5EA 4BNTA 3OU7A 5LA6F 1XZQA 3OAAD 3BWMA 3COWA 5EKXA 4ZGBA 3EXIA 1HTBA 1K7CA 3GXBA 3IMCA 3NTQA 4ZPXA 1T2CA 4BFVA 4NOKA 3PFIA 3TKYA 3R0JA 3N05A 2GKOA 2XTZA 1VIVA 1V45E 4H1TA 4BQNA 1TU4A 2QMZA 1E4YA 1ARZA 2ZVPX 3DAOA 3M4ZA 5DYWA 4ESEA 2D59A 3ET4A 1DX4A 1NT4A 2X41A 4Q47A 3RSGA 1L1FA 4TYNA 2CZQA 3FRHA 4S12A 2XKKA 5MN5A 3U44B 1XCMA 1O5TA 5B1DA 2F2TA 1JMVA 2Y76A 5D3ZA 3FKSD 1WB6A 4DR4B 4NBSA 2QPAA 3PVSA 4I4TB 4DNPA 4YY3B 4MWOA 1WPQA 1KMNA 3F9RA 1XAIA 3D8NA 3I32A 1SCKA 2XE7A 4G5HA 5GY7A 2QX6A 3W5VA 2CY0A 5LZ5A 2FR8A 2ZZNA 5GJBA 5EJEA 3N2NA 3OF5A 2GNAA 2NTVA 3WLHA 3DKPA 2OWDA 3OCJA 2R5WA 2XA9A 2ZI6A 3DC2A 1G2PA 2I99A 1N8SA 3R6TA 4GZ6A 3R7SA 4XD7A 2B8NA 1PR2A 2V59A 5G1NA 4DCUA 4E2WA 1IN4A 2XUIA 1L1RA 1KP9A 1OFIA 4CM6A 5EMKA 3HZZA 1MB9A 3IIMA 1M2OB 3WYFA 4Y7CA 3S7TA 1GDHA 3OO1A 2YW9A 5DDIP 1B2LA 3I3OA 4KGZA 4QOGA 1FUEA 3ILXA 3V1LA 4NPCA 4P4GA 1GCUA 1IPHA 1NDUA 2E9SA 3A10A 3QFFA 3Q7TA 1JIQA 4C7BA 1L7DA 1DXOA 2AV6A 2FF7A 2GEVA 3D5EA 2WFZA 4FFNA 4K6OA 1I94B 1C81A 3O75A 2ZWAA 4A23A 3WV4A 1ZJ4A 1I01A 5IBCA 4UE3S 5GM1A 5ARCA 4K8RB 2DBQA 5EYPA 3E9DA 2PRIA 1A95A 4NBTA 3EIQA 1S3SA 2XTAA 1Y6RA 1ADCA 2NPOA 4QXOA 4ZD6A 3NDBB 1FYWA 3QEKA 4NAHA 2AE1A 3LA8A 5IBQA 4M1SA 3TR0A 4G84A 3LWDA 3AIMA 4G0NA 1RQRA 4I19A 2WJ6A 3HZOA 2QTWB 5JD6A 1JHAA 4UM5A 3RUPA 3JZMA 3DFKA 4GI7A 1E8NA 5EXDA 3FMGA 2HO4A 1V1MB 2WWRA 3U3MA 1UWKA 4PG7A 3Q3JB 2C9DA 3DV0A 1ZH8A 3IUMA 4QO7A 4BO0A 3X1YA 1EVIA 4OBXA 2I2BA 4TLBA 5MF6A 3KFLA 3KX2A 4HWSA 1GTL1 4N82A 5FX2A 4TTAA 5BSMA 1W85B 3KYCA 4ZYZA 4WK4B 2OPHA 1UPUA 1R15A 3QOWA 4M7OA 2HEGA 4WUTA 2ATIA 5JQGA 4HNQA 1WSDA 4LBVA 4QNNA 4KAAA 5KJ1A 1LW7A 1XQ1A 2J9YB 3GLIA 1GZDA 1XI2A 4F8JA 1HH4A 3A3PA 3AM4A 3AUKA 1S2GA 1J39A 1FQWA 1OPXA 1ZO8A 3V33A 2FW0A 4M36A 4PZYA 1LNZA 2P9QA 4B4UA 4R5HA 2ZG6A 1N0WA 1QO9A 1ZMTA 3B85A 4HK4A 3OHPA 4X91A 3UKDA 3D7MA 2Z6VA 4MUXA 1JKXA 2J32A 4N6NA 1VJ0A 4WOJA 4X6UA 1RCFA 3VQTA 4TUYF 2FI1A 2Y71A 4GYWA 3HR4A 4JY7A 3S2SA 4LQ4A 5CVDA 1NV9A 3T3PB 4F12A 3DLHA 3HUUA 1SC6A 2II6A 2HUPA 4DQDA 1C7ZA 3EQ2A 4PC1A 3R3VA 2NADA 5JZBA 1TM2A 1REQA 4XCQA 1W35A 5EJ5A 2IUSA 1C0PA 3TCKA 2EQAA 3T94A 1IPFA 4ZVUA 2AEJA 1WF6A 1KNXA 5EPEA 2JCBA 3KJFA 3KWJA 1KJZA 4EUNA 5JAUA 3FCXA 4YRQA 1H3NA 4A2QA 3GLQA 4BFYA 2EFEB 2IUEA 1G3RA 4MW2A 3SP1A 3VVMA 1AN0A 5KJFA 2GCOA 1F2VA 1UMCB 4QUBA 4J7UA 3RHFA 5HHTA 3G82C 3GDWA 3P27A 4JODA 4ARSA 4CKCA 3EYWA 1PBTA 1Z4MA 3KVVA 2M6LA 3SF8A 1D7OA 4R3NA 4ZCQA 2EU8A 2C07A 2PGOA 2R85A 3NHSA 3O73A 3FMFA 3AB7A 3AP3A 4D3SA 4B79A 5KYYB 2FQYA 2VK8A 1CR4A 1J0CA 5EAIA 3PQFA 5B1HA 4M1KA 4EJ0A 1QRAA 4JSTA 1N9GB 3IESA 3IV9A 3S5UA 4L5IA 3OO0A 1W2WB 1XYYA 1M72A 2C2KA 2X6RA 2YMPA 2WWTA 3HQ4O 3JVDA 3A9SA 1AKQA 4RVNA 5LB2A 3PKIA 2ZVQX 4ZEXA 3UA3A 4DSAA 5C32A 3DMHA 5K2MA 2VIIA 1J0EA 5DK6A 5B3JC 3CNNA 3B1VA 3H04A 1JDUA 1FTQA 2JFUA 4ZICA 2YWGA 1T4CA 3FCUB 2GBLA 5I7EA 1RYEA 2GJ4A 4UZSA 5FQNA 4WKPA 1DBRA 3MJVA 3SEAA 3EXIB 4ZOEA 4QU0A 5FLEX 5HIAA 1TAUA 1U1CA 3KIPA 5FPHA 8ADHA 4MDYA 1WZ2A 3BSWA 1C50A 1UOQA 1ES9A 3V4FA 4Y2PA 4CHGA 1FP4A 2J5QA 3CQ9A 1Y4DE 1T3ZA 2DQ4A 4FHCA 2YV3A 4NZMA 4LK3A 1NOIA 3N2YA 4H7DA 1U81A 1WPGA 1C4WA 2BM0A 4KQMA 4L78A 1FP6A 2GX6A 4OLJA 3ZU3A 3HY3A 1OWMA 2WKPA 2O2ZA 2HTEA 2X1HA 4OHFA 2FMXA 3ITDA 1JFRA 2JHGA 3K2EA 4NH4A 1D4OA 1OIVA 2ZM5A 1BDHA 1QR2A 2HHHB 1LZLA 2CGEA 2G80A 4R68A 3FHCB 2EFHB 2VZ8A 4I66A 3EA0A 1F6WA 4PYIA 2GN8A 1L5FA 2I2CA 2VNAA 1JI3A 4DLVA 1H2RS 2Q29A 5EWJA 6REQA 1P6XA 4CR7A 2Q1UA 2DLCX 5C1IA 1E7MA 3CLTC 1GZUA 3A6LA 5FBWB 1T5DX 1XXLA 1BWQA 1V8BA 1JFLA 2C5SA 2QLLA 2YDYA 3IC5A 4AVYA 1JR4A 3D3EA 3M6XA 1WUYA 3DM5A 2FNAA 5HSGA 4UQLA 1Q1ZA 1EU1A 2Z6AA 3CXUA 1NF9A 1I0LA 2VZ0A 3KZVA 3R3XA 4JP1A 4B6RA 2H4FA 1G55A 2AI1A 3QE2A 3C3PA 4RVGA 5CNKA 1SVIA 3VH1A 2Y6VA 1G8MA 4LBZA 3FFAA 3OC0A 1PZGA 5LNK1 2ZXFA 3V3TA 4HOYA 1XU7A 3LCCA 4RWZA 4A8PA 4UXIA 2BGIA 1R7RA 3CVJA 4JJGA 1VMAA 1Q92A 3U81A 3LCMA 2VT2A 4O4JA 2BWJA 3D3JA 3UOWA 5EYPB 2GPBA 1CWUA 1NONA 3BX1A 3N59A 3DYVA 5B7NA 2XPCA 3GFQA 1N4DA 5AUQA 1E3WA 4RA9A 1KWGA 2MSEB 4QLAA 4OFZA 4TRJA 1PEYA 4FNGA 2ZTVA 4TSFA 4UCFA 1D2HA 1G18A 1BS1A 2TS1A 5JCOA 1E3JA 3B3GA 4YRPA 3LG2A 3ZU5A 3RSHA 4BGUA 3R7BA 3DG9A 3M2PA 1FDOA 4CL8A 5IS2A 1MIOA 3DV0B 4E70A 3AF1A 3K32A 3AUUA 2CFIA 4QLBA 2VPTA 3TFQA 3EJ6A 3VYSB 3RGWS 1SHTX 1DIBA 4FDAA 4IGFA 2OBLA 3L7AA 2AJTA 1PF7E 1XOIA 2O48X 3A31A 3KYCB 1VYHA 5DCUA 5EIEA 4AP5A 2OY0A 2I71A 3BXGA 5F7ZA 5FEUA 3F49S 5JQGB 4E2XA 3O4FA 3HCOA 1QIGA 3EXEA 3JQBA 5HZMA 2PRYA 4V0QA 1MB0A 1M2JA 3F8TA 1RXSA 3OZ7A 2ZE6A 4K28A 4L2IA 4LJ6A 4RK6A 4A8HA 2JKZA 3A9CA 3H9UA 2CXUA 2VRCA 3Q40A 3TMKA 5JCXA 5LJIA 1DOZA 3BH6A 3AUTA 5C8YA 6Q21A 5G40A 2QTRA 1E5XA 1S7GA 4HTFA 1SD1A 5CU7A 3WMWA 1D4AA 2XQIA 3GRVA 4EDHA 4KIFA 3LUFA 1J06A 1L8OA 1YZ3A 4B2YA 1Z17A 2G9QA 4ZVNA 3KFXA 3VX4A 1PLKA 2EF1A 5ENVA 4RCVA 3WI7A 1AK2A 1X80A 3IYLW 5FOVA 3RG2A 3UV6A 4FZVA 4P1ZA 1FU4A 5GZ6A 1SIOA 1YTUA 4DN6A 1A76A 1AKEA 1REQB 2A35A 2OHGA 4GVXA 4IX1A 1XWFA 2J5BA 1ZA1A 4KGVA 5DNUA 3TMYA 4CNBA 2JJYA 2I7VA 1C5KA 2REBA 1N2CA 4IICA 4XPIA 3TL2A 2HK8A 4DTCA 2OGWA 4B40A 4MWBA 3UF0A 3P2OA 4U2GA 4LDPA 1YZVA 4MQLA 2ZDHA 1CJVC 2YV4A 5F1OA 3OLVA 2E49A 2XHEA 4PSVA 1CYEA 5IKXA 2RGYA 1ZD1A 3R5XA 4ZYLA 1J2EA 3L0BA 1Z2PX 2GCOB 4RDCA 1G6KA 3W9UA 1RWXA 2PWAA 1X2BA 2GFHA 3DNMA 4G0ZA 4K2AA 1NR5A 3WXMA 2OXCA 1ZIOA 3PDWA 3AF3A 4IRXA 1ZGBA 3HFJA 1EZ4A 2GDZA 1YQUA 2G70A 2PS0A 3AR7A 3PQDA 3KJQA 4OUDA 1SXJA 1X1RA 1D2AA 3SF8B 3SZ3A 4AIIA 1NU8A 1EE2A 4B47A 2GETA 3LC1O 3FSJX 4Y7DA 3UM9A 2R65A 3TZKA 1NP3A 2FWNA 1SBYA 2P3LA 4UMVA 3M5CA 2AOUA 5LZ4A 4XIJA 2OGTA 3JWJA 1JG2A 1JLKA 3QUTA 4KDFA 5G2OA 5ES3A 2HMSA 3V1NA 3WLMA 2B61A 1XDGA 3DXFA 1B14A 4HAYA 3OPNA 5LD2C 3G79A 1VGRA 4IJ6A 3F0TA 1T5IA 2EL7A 3TAUA 4JQZA 4Z7QB 1QYWA 1T4CB 4ZZIA 5D7BA 5E3JA 3RUCA 2DQYA 1M67A 4QLOA 4Q9KA 1D1QA 1RQLA 5IC4A 1KR2A 1DXQA 3LAWA 3IKJA 4JP3A 4KBYA 4QBHA 3AUXA 3GVXA 2PIDA 4ZA2A 3QYAA 4MR8A 1Q12A 1FRZA 4X84A 2IPMA 5JLAA 4YREA 2IX3A 2BYTA 5IDVA 4H35A 2G40A 1XTIA 3PVCA 4OLAA 2G9RA 1A8SA 4I6GA 2ZB8A 4TXJA 1Y9DA 1ZX1A 3R0IA 1RLOA 4U7FA 4FBLA 5AW9A 2WD8A 2X3FA 1QRUA 2IWRA 2V03A 4HAOA 2WSIA 5HF9A 3RIHA 4EVIA 3AVVA 1GT6A 4LY9A 4V0RA 2FUG6 1CU1A 3RSZA 4QE3A 3OZFA 1WQ1R 3QEMA 4ID9A 3ZX5A 5KNBH 1RMQA 3BD8A 2WF9A 1U0EA 5JNTA 1KO8A 4G86A 4R2XA 5IAGA 3BFXA 2WAMA 3DBLA 2IYEA 5EWJB 2VCEA 2AJLI 3QVKA 3E0XA 3NGLA 2HBQA 6REQB 4W8OA 3RH0A 721PA 3BULA 4RVDA 5DM70 4H59A 1QIDA 3DMTC 3QVTA 3A1VA 2J87A 5H16A 2NTJA 5HS6A 4TKMA 3ZHOA 1A3CA 1JA0A 3IBFA 3VKVA 1Y7LA 3ZCRA 3IQHX 3FPCA 5A4MS 3PGVA 1E6WA 2QWXA 1SU7A 3MCUA 5BNZA 1W7AA 1ZXLA 2D00A 5KNDD 4G4IA 1MTOA 2GNOA 4KLAA 4QOHA 3RSLA 1J22A 3QKRA 1R8QA 4BVBA 3AI3A 4AF8A 1X8XA 5KOHB 5KYXA 2IEZA 4N40A 3JAMA 4UKDA 1RACA 3WIEA 2C2GA 4HX2A 4EYEA 1FL9A 1H4TA 2J5KA 1TCBA 3EWAA 3QJYA 3F73A 4KMSA 1SCAA 1GTMA 3M9WA 2FEXA 5JSYA 7ADHA 2VEOA 2MMCA 4CT4B 1F9EA 4O4JB 4C4PA 4C4YA 5FQOA 3QELA 1MD9A 4Z0HO 4S1VA 4L72A 1TM4E 1ZCFA 3SS9X 3NW9A 2W6NA 2RMKA 3D6TB 4C3UA 1E3WB 1F3LA 1U2DC 4PWYA 4RA9B 3SBXA 3HDVA 2B1RA 3GA7A 4K6GA 1Z25A 3TNJA 4WJLA 3GNQA 1CQIA 1DT5A 2V3VA 5IXSA 3P32A 2ZBGA 2C9YA 2V6BA 4N6GA 3EEYA 1NQUA 3NIGB 2B21A 1MIOB 4Q21A 3AR4A 1YE8A 1KE2A 2PT7A 2DBVO 3QMPA 3RSCA 1AY0A 2BD0A 3CTPA 4JI5B 3I2KA 4DXAA 2H52A 1SQGA 4MUKA 2H57A 3M6WA 4RV4A 4HGQA 3U7IA 3WLFA 1V96A 1KDZA 2J0EA 6ADHA 4PTLA 2QK4A 3BAFA 4AJ1A 5KPDA 4P3XA 3EXEB 3EODA 3WB1A 5TVKA 2PGLA 4ED9A 3KU4A 4L2IB 2ZT6A 4GP6A 1QP0A 3OE4A 1WW2A 1U9JA 1I3MA 2XUZA 4YR9A 3KR9A 4BMDA 4RDHA 4UNRA 3TW6A 5C8YB 4NF2A 2BHNA 3CY6A 1T0IA 3VR6A 3V4VB 4WIAA 4HTFB 4EP1A 1CF9A 3O7MA 1A2KC 1KDRA 1U4OA 1DMSA 1L7QA 2BGJA 1Y5RA 3FIJA 4RIHA 4YRMA 1UBOS 3PR2B 4XM2A 5HWSA 5LXTF 2JHCA 5JPDA 2F3QA 1Z28A 3N8GA 3PJGA 4RFVA 2G8LA 4EPRA 2J3KA 5MN6A 4N0QA 1J25A 1JXQA 3TGWA 2W0MA 1OYOA 2DF8A 2DCUA 5F35A 3SEFA 5KTNA 3OCVA 5ADVA 1E60A 2CYCA 2REXB 4JYCA 1KVRA 4JCOA 3AX6A 1Y5IA 4TMFA 4OKNA 1NXPA 5U4QA 4IV5A 3N8KA 3G0IA 1L4KA 4QODA 1SEVA 4ZVOA 2CZCA 3RAFC 3N2IA 1B42A 5CEFA 2AUTA 4L7QA 3T06B 4XPIB 1LC3A 1R5OA 3T7RA 3TDMA 3UANA 2HHJA 2QLTA 4YYEA 3I6BA 1BSVA 4BU0A 2P9BA 2HU8A 1XTZA 5CVJA 2PKQO 2RH8A 3LUJA 1U0HC 1GGJA 4JBNA 1BA2A 3C6KA 2ANBA 5G1OA 4CTJA 4RE5A 2CV2A 3DE1X 2N1BA 3WSTA 3GLHA 4IDGA 4HBZA 4X0EA 3RC8A 1OLXA 1CK4A 1RZRD 4UASA 4BP1A 3HADA 4OUDB 1LUAA 5KVVA 1GWNA 4GRDA 1SXJB 2EXXA 3RBZA 5I01A 2IXTA 3BSYA 1ZLXA 5BWBA 4RH0A 3TB6A 3TXYA 2FLVA 13PKA 3RJMA 3TGLA 3DH0A 4PLTA 3L82B 3TTWA 2JCYA 2XUFA 4OJMX 2OPBA 4LVUA 5B3JA 4D98A 1G8PA 1I4OA 2AOUB 1KO1A 2WAXA 4JMLA 4ALKA 4O5AA 4DTIA 1QQTA 3E5MA 2EX0A 1VJGA 5AXBA 1SCUA 3QMMA 1CETA 1P74A 1PQWA 1IY9A 3I37X 3QIAA 2CL5A 4FOSA 4G9EA 4M1QA 3RPEA 5DW0A 4UTOA 4Y9UA 4YO8A 4MQ4A 4TT3A 2Y9PB 4LHXA 4PHGA 3FFWA 3HM2A 5C0OE 4BO7A 1GGEA 5HCNA 1RABA 2OZPA 4M0UA 2CKDA 4E3WA 4EGSA 3VI4B 4W5HA 4MR8B 2QTCA 3AY0A 5KCZA 4D9FA 5KC9A 2FMHA 3QTLA 5KYVA 4IJQA 4IXTA 3OURA 3F6CA 4CFSA 1CQPA 1GZSA 4NS4A 1DWUA 4AG3A 3D3WB 4NJEB 4XWWA 3WR5A 1CY0A 1J8VA 5K99A 3HV2A 2FG6C 1ZUD1 4KO8A 5AJZA 2O14A 2CHUA 4PZ0A 3NU1A 4FHFA 1JR3A 2A33A 4EA8A 1H0RA 2WU3A 4HAWA 1Z45A 4Q3DA 4YMUA 4P82A 3QEMB 2A9VA 2XECA 4JLUA 3R75A 3ROFA 4IQ0A 4PHHA 3SYTA 5DYYA 4OL0A 1QAMA 4QXAA 3RFFA 1N2HA 1BH6A 1EP1B 2LW7A 1F3OA 1YBVA 1YQEA 1VG9B 2X8WA 2PRZA 1MFPA 3EQ8A 3VUFA 3DBLB 1TPYA 3HWSA 3FYSA 1HK7A 3VU8A 3H5TA 4OTZA 3EEFA 1DAMA 1V7QA 3ZDQA 1NMSA 3CR7A 3IEMA 2DPXA 1G4HA 1P2VA 3JVIA 1KI9A 4CMIB 1RAAA 4BWVA 3LV8A 3LVFO 5EUCA 1UJ6A 1WUHS 4HPJB 4RS4A 1Q57A 1KKMA 2V7UA 5T3YA 2C59A 1QONA 3ZVMA 1KRWA 2F8MA 4I50F 4ZVMA 2ABWA 4YRBA 2ST1A 1JJIA 3FDJA 2QROA 4OU4A 1U3FA 4JJFA 5EINA 4MINA 3ZOKA 4EPXA 1UP4A 4NZNA 4O2RA 1DRKA 3WFJA 3QKRB 4EITA 4B6PA 5J3JA 5C35A 4IXDA 3V2HA 2HIMA 5KYXB 5REQA 1HDZA 3X44A 4DCJA 1KEWA 3NCHA 5HE9A 1FYXA 2RKOA 3MRXA 1SCNE 1A9YA 2X14A 4BTLA 1II8A 4F84A 1DAKA 5IT5A 1KK3A 2G3YA 2VTEA 3GUYA 4JGGA 3GUZA 4DIEA 1FSGA 3JYPA 3PNQA 1WW3A 1P2BA 4KWHA 3QELB 1OYYA 2KBEA 4JLNA 2QVBA 4CVNA 1F60A 4N76A 4MYUA 3SLRA 2A9RA 3PK0A 2HHLA 1KEPA 1SKUA 3C7KA 1GQSA 2Q2NA 3AI1A 4DJTA 4DC1A 2YQ4A 4UBJA 1F38A 3NKFA 4K87A 5E2AA 1Z2CA 4XWKA 5DM1A 3C3YA 1YFZA 4TKLA 3KD2A 4IDOA 1CQIB 5EY5B 3VKGA 2Q5HA 1W5EA 2RBKA 1NVVQ 2OV2A 4HUJA 3IHLA 3W6NA 2FW7A 2WTEA 1HA3A 4KUEA 3O4VA 1KY4A 3G8BA 4F8YA 4F06A 1K97A 2GOYA 2QB5A 2XW6A 4LHSA 1NX6A 1EDDA 1E79D 1T0JB 1XEAA 1VLZA 4P3KA 4QASA 4Z1MA 1CVRA 4M0KA 4A2CA 2FK7A 5IM4F 4RCZA 2UXBB 5FPKA 1VZ3A 2QL9A 1NJSA 5GPBA 2O0KA 4FT2A 4X7BA 3GRCA 5DBFA 3GD5A 3CPJB 2YASA 4N47A 2QLNA 4Z86A 2MINA 4E7OA 1NW6A 2O2YA 2BKEA 3A58B 4WEOA 4B0PA 2XCOA 4FNOA 4Y1FA 5CYOA 5H8WA 1SB9A 5L4SA 1KL7A 4KIWA 2JI4A 1MIHA 4EIWA 5DE3A 1Z4LA 1N2OA 1VXRA 1RC1A 4FDUA 3V6MA 1KS9A 5A4FS 4JKIA 5IABA 3Q88A 4CFZA 4ISCA 4NAUA 5ESWA 4LE1A 3I64A 3RVSA 2JFFA 3B82A 4XX1A 4L3WA 4EKIA 3MM4A 3GP8A 1VLVA 3RR2A 2B99A 2J08A 2PSEA 1IQRA 4JLWA 4NVRA 4CM9A 1PTKA 5KQSA 4O2BF 1AV7A 1CHNA 1BVRA 1KFJB 2WICA 2WWHA 2ERXA 4DDKA 3SM3A 2VL7A 3DLIA 2DFVA 2YCBA 1HORA 1SNYA 3OFKA 3OT4A 2GILA 5FI1B 1RBYA 1LU9A 3L07A 5JNVA 1PL8A 1GA6A 4P8RA 2XITA 2GTIA 3KZMA 4LZOA 3NYRA 1KZ9A 2P9HA 1E62A 2W6MA 4HGPA 4H6XA 5LIRA 1H2ZA 2XOKD 2JJQA 3BJZA 1SXPA 5A03A 2H1WA 4ND7A 2R1TA 1UPAA 4FYIA 3MTIA 2A9PA 2B7BA 4OIFA 1L5NA 4ZI3A 4GKJB 1U9ZA 4LYYA 4ZAVA 3Q7QA 3LC7O 1JT2A 1MC1A 1PGNA 3WLRA 1RYHA 5A2GA 1UADA 1O57A 4KWIA 5AICA 4DLZA 3GLHB 2DWOA 3JSXA 4AX8A 3I28A 4OG2A 3ZN2A 1WVIA 1OLXB 2EBWA 3FBTA 1PUXA 2XRFA 5CFRA 5COAA 2I9KA 4ZO8A 1PJAA 1N25A 4TZTA 5FLYA 3K8QA 2Y05A 3UGQA 4QT0A 2ROQA 3F8SA 4GQBA 2AG6A 4ND4A 1VKNA 3R5SA 3FLAA 3SDSA 3DB2A 2OZKA 1VPWA