4Y6QA

Human sirt2 in complex with 2-o-myristoyl-adp-ribose
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
288
structure length
287
Chain Sequence
b'ERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-2
publication title Kinetic and Structural Basis for Acyl-Group Selectivity and NAD(+) Dependence in Sirtuin-Catalyzed Deacylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 92
structure length 287
sequence length 288
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.-:
pdb deposition date 2015-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4y6qA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4y6qA01
4GPEA 2IHUA 1MA3A 1ZPDA 2W93A 2H4FA 4UTRA 1S5PA 4V1CA 1YTLA 3JWPA 4TWIA 1PNOA 2X7JA 3F6EX 4K9QA 5K3SA 1T9DA 3GLUA 2PGNA 4IAOA 1OVMA 1PI3A 2Q29A 4FVTA 3D81A 1T9BA 5BWOA 4GG1A 1OZFA 2B4YA 4C7BA 1O97D 4TWJA 4K9LA 4BN4A 2JI7A 1V5FA 1PVDA 4GP9A 1POXA 3RIYA 1UPBA 2DJIA 4JU9A 1PYDA 2H4HA 2JLAA 4BVFA 1XLTC 4K9KA 4QPZA 3EY9A 4UUAA 2EZ9A 3U31A 4JUAA 4BVGA 3GLSA 4RJKA 2H2IA 2A1TR 3E9YA 4UTVA 1PT9A 2WVAA 3EA4A 3D4BA 1JSCA 2FSVC 1M2JA 4BUZA 2IHTA 4BVEA 1M2KA 4I5IA 4BVBA 3CF4G 4BV3A 1Q17A 2AG1A 3JR3A 4MQ5A 4L3OA 4UUBA 5EJ8A 2C31A 5BWLA 4FEEA 2EZUA 4KGDA 2H59A 1Y9DA 3OE1A 2NXWA 1U31A 1E3TA 2H4JA 2VK8A 4X3PA 3HWWA 4JD5A 5K6TA 4IG9A 2JI6A 1YC2A 2NYRA 2OD7A 3PKJA 4JUBA 5D7NA 4V1CB 5EJ6A 4UU7A 2FWNA 3CLUD 4COKA 5FEMA 4UTZA 3LQ1A 1EFPA 1POWA 3ZG6A 1M2GA 1PNQA 2VJYA 1YI0A 2VBIA 2H2HA 1UPAA 4UTNA 2Q27A 5K2OA 3FSJX 4RJJA 3IAFA 5K6RA 1J8FA 4O8ZA 3U3DA 4MPPA 4HD8A 2H2FA 1DJLA 3CLTD 4JSRA 2JIBA 2VBFA 5DEIA 2HJHA 4D5EA 2Q5QA 1YBHA 1EFVA 4C78A 1M2HA 4UU8A 4RJIA 4Y6LA 1MCZA 1Q1AA 5MGNA 2VK4A 3ZGVA 2JI8A 1SZCA 3GLRA 3ZGOA 4JUFA 3GLTA 4ZZIA 4RMJA 1PO7A 1V5GA 4ZP1A 1U2GC 4J1TC 5FYQA 4V1CI 4BV2A 1S7GA 5IMSA 1N0HA 2Q5JA 4F4UA 4GM1A 2A1UA 1ICIA 2BRUC 3FZNA 1YHZA 1NM5C 2VK1A 4K9NA 2QQFA 4Q9DA 3FLMA 2WVHA 2UZ1A 2UZ1B 5DGDA 2PANA 3PDHA 1Q6ZA 4Y6OA 5EJ5A 2PGOA 2Q28A 1YI1A 1YNOA 4KXQA 2IHVA 4K9PA 4KPUA 2H2DA 4D5GA 1YHYA 4JT9A 1D4OA 4K9MA 1OZGA 1BFDA 4JU8A 4QELA 1SZDA 4JUDX 2QQGA 1HZZC 4RMHA 4Y6QA 4GM4A 4K9OA 3RIGA 5MF6A 4F56A 4X3OA 1U28C 2EZ4A 5AHKA 1T9AA 2FN3A 1PTJC 4MPRA 2V3WA 5MFPA 2Q5OA 3CLSD 4MPJA 1QPBA 2VBGA 4HDAA 3CLRD 1V5EA 4JUCA 4UTXA 1O96B 1T9CA 4FEGA 4R8MA 4GM0A 3PKIA 1UPCA 2OD2A 4QQ8A 2AG0A 4J16C 4IF6A 2H2GA 2EZTA 5EJMA 3HWX1 4BN5A 1U2DC 5BWNA 2WVGA 5MFZA 2OORC 3F6BX 2FRDC 1YC5A 4FZ3A 1M2NA 4MZXA 1OZHA 2Q5LA 5EJAA 3IAEA 4L2IA 1Q14A 4JT8A 1Z8NA 2EZ8A 4BVHA 2FR8C 2JI9A 2OO5C 4RMIA 3D7KA 4G1CA 2JLCA 4RMGA 5EJ7A 5DGTA 5EJ9A 3K35A 3EYAA 5EJ4A 2OD9A
chains in the Genus database with same CATH superfamily
4PZ0A 1JBEA 3E4CA 1KI2A 4M89A 1VM6A 4BVJA 1S0UA 2HV8A 4EI2A 3JZMA 5JZVA 2F1OA 3ET5A 1J70A 1FP1D 3FKJA 1I51A 4FFOA 4HHEA 4PX2A 1GZVA 1IATA 4KRGA 1CZUA 2X0KA 4LIPD 4P4SB 3ZHBA 3ZV4A 1OLSB 2PL9A 4AJLA 1TU4A 4BP8A 1O5IA 1K6XA 3FUTA 4LE1A 3GV0A 4XVUA 3RRFA 4Y3UA 5C8ZA 1QDLB 1EA7A 4X1IB 4L9AA 5CYOA 4JP8A 1F8GA 3WSWA 2ODBA 4U9IS 1SG6A 3VYVA 2AUMA 3A1DA 3AQ4A 3I2FA 3AHDA 1Q57A 1DX4A 1N0VC 3I83A 4ZOAA 1OFUX 5J40A 1E98A 5EGSA 1WE2A 1TOAA 4QBTA 1RYMA 4IAOA 3OO1A 2QGFA 3IQGX 4IRUB 4HZIA 1TVCA 3N8IA 3OMLA 4MNTA 3FHCB 2JBAB 2EIXA 2YNMD 3OJCA 4QAQA 2J0UB 4FYYA 2OHGA 4O4IA 1W2GA 3DWIA 4AJEA 3J81k 5JOQA 1CJTC 3OCVA 1ZK3A 2Z5GA 4C7BA 1HT3A 1KQPA 1SCNE 2HSGA 2QHXA 4YJ3B 4ZICA 4LUCA 1ZSYA 3TK1A 2ZJ6A 5LYJA 1IBCA 5AHXA 2YMMA 4TZ0A 1V8OA 3LC7O 5AI9A 4UFNA 1QGUB 4GP9A 2VQFB 1KIFA 4ZV9A 3W6NA 5E0KB 1SHJA 2OFFA 4R8KA 4C3ZA 2NO6A 2Y05A 4G8JA 4DQDA 1FW8A 3WI7A 4C07A 5A1JA 4K40A 3OE4A 5BSUA 2YYAA 4DANA 3FG9A 3N6XA 5IBQA 1KYWA 4CHGA 1H65A 4QT4A 5GP1A 4HEA1 1QR6A 2YVQA 2C3OA 3TRIA 1M76A 5FTWA 2JGDA 3HSKA 4QBGB 3DEJA 3LUCA 4NBLA 3SC2A 4EGQA 4YRKA 3ZDBA 3W77A 1A2OA 1G98A 2XHZA 1FX1A 2M6RA 4WNIA 1VHLA 2O8CB 5CFPA 1HDOA 1OXXK 3K0CC 3ISVA 4HY3A 1P2UA 1ZM3A 5FXMA 4WZBA 2BV3A 1ULZA 3TOCA 3I72A 1ULBA 1IULA 3OF5A 4RTRA 3R3VA 1TB4A 3EOZA 1VBNA 2Z9DA 1JDVA 3DEZA 1H2BA 1T3HA 3BJEA 1YQTA 3LP5A 1G9XA 1ZOIA 1OBOA 3DDCA 2VPTA 4E2XA 1KO7A 3KC2A 4P3YA 1ORVA 5JC8A 2DFVA 4PG8A 2D06A 3SOPA 1KK3A 4UNSA 2PZ8A 4M1WA 2JNWA 3Q7IA 3GJ6A 1UJ6A 2G1AA 5KPDA 4DA6A 3I9LA 1MENA 5FWNA 5T3YA 4D74A 5E6SB 4DN6A 1VJ5A 4HDSB 1G20E 4GLFA 4W8GA 4IQGA 5JNUA 3LL7A 1VB5A 1BDJA 3FHTA 3SK0A 1U1EA 5KZMB 3A31A 3VZQA 5I4KA 3CRVA 4F5EA 4NCIA 2AEJA 3QEMB 3TNLA 1JU3A 5SZHB 2VZ9A 4PFJA 1S96A 3K6SA 1Y8CA 1ZISA 3W5HA 1PLKA 2G04A 1PZNA 1Y7PA 2XNDA 1XTUA 4OXQA 3OTIA 3WL3A 1SKQA 1XL0A 4GQAA 3MG9A 4JENA 5HF6A 4RZQA 4WOKA 2VWHA 1TT5B 2JF0A 4Z7QB 2G1PA 4IEIA 4K46A 3MJFA 4I8IA 1QOPB 3TLBA 2UKDA 1G8GA 3DKVA 3AOEC 3EUFA 1T4GA 5ALZA 4OBWA 2QTVB 2VL7A 2RHDA 4EX6A 2OPBA 3GROA 3DXXA 3HXTA 2EFDB 3DOCA 5BWLA 5GONF 3V1KA 5I7VA 2IHJA 3EZYA 2C7PA 5G4KB 1ZCZA 3WKEA 2EZUA 4QDKA 1ZM2A 5B55A 5FV4A 2QY9A 2IZOA 4TTPA 4CKBA 3TTSA 3L6BA 3DLHA 3RFUA 4GMHA 3LZCA 2RBGA 1HDCA 4DCVA 1Z08A 4F3RA 5I4CA 3JQ7B 2PA3A 1IXKA 1Z68A 3DMTC 4IP0A 1GIAA 4JXKA 2Z2YA 5IK2A 2D5IA 1JLRA 4HSGA 3SJUA 5BUQA 1WDTA 4PGHA 3K2BA 1W7AA 2R1VB 1GYRA 3F9CA 3IP8A 3KYDA 4NZNA 4B4UA 4YYZA 4ZZ1A 1GKUB 1V6CA 3DTVA 4MRMA 1KVRA 2CL7X 3HSSA 1A72A 2EP7A 4I9UA 4MKIA 5CYFA 2QE7D 2FWNA 2DBRA 4UM9B 2CE7A 2A0KA 5KYNA 5B36A 5A1TA 3AJEA 4Z5XA 1U1GA 4Z9YA 1EA5A 3O1LA 3C3XA 4FCCA 4LHXA 4IHJF 1BWQA 1E79D 4KAJA 4CL2A 3ZK9A 1B43A 1JKFA 3O9MA 4OY3A 4LS3A 4NDZA 5HG0A 3WK7A 5JLJA 3QLTA 4CMAA 1HFJA 4EB3A 1XZHA 2VJCA 5C8YA 4PYIA 4UTZA 3N07A 2GHQA 3COZA 3ONVA 2RIRA 2ES4A 1L2TA 2CHUA 4JB3A 3WWZA 1EFPA 1AH2A 2AJBA 1BJRE 4RGYA 1OB5A 4IEFB 3P0FA 4CIYA 2IS4A 2I62A 5THKA 2XW6A 2Z2JA 4NV0A 3R9IA 3WQRA 3VNUA 4B4DA 4DPKA 1LKZA 4UZSA 1U9IA 4S2UA 2P5SA 4W9MC 4TTIA 4RIIA 1DTWB 1XAGA 4IJ5A 2JGJA 3DD1A 2C8LA 2QJOA 1ABFA 3PS9A 2ZUTA 3WGTA 4E14A 3MAJA 4E31A 4R3WA 1IEXA 3I1IA 3ZOKA 1BOOA 5FWXB 3D54D 2P6NA 1GPH1 2CLIB 2RSLA 2XF2A 4Q4LA 1GNSA 3UN1A 3PXEA 2VBIA 2IU3A 1W8IA 3MWJA 1RR6A 3PE3A 4LN1A 3PDUA 3EAGA 1L3CA 1W34A 1FCJA 3NLLA 2PLRA 4M7WA 5J5CA 1MOSA 4OHBA 5HSGA 1LNSA 2R9VA 4FSDA 1NP3A 3J7TA 3N0VA 1WBBA 2ZSEA 4XYLA 5BO5A 5B7PA 3B9PA 1UFRA 2OGWA 4XIGS 3HO8A 1ZJ6A 4LOLA 4HN9A 4KUHA 5AOAA 1RQ2A 4CYMA 4UARA 1JFRA 3A7EA 3ESYA 2APJA 4MPPA 1AQ6A 3CB2A 4J7CA 1MEJA 1ZVMA 1VKRA 1VJCA 4K05A 3WYBA 4TOIA 4IIJA 2WV7A 2G8NA 4DA9A 1X7GA 1C3EA 4C9BA 4OHFA 2BZ0A 4HXGA 3ZLVA 4FEYA 4WKNA 1Y8ZA 4JSRA 1XZEA 3FZYA 3MQ4A 3IO3A 2OC9A 4H7IA 2JIBA 3QLVC 4C4SA 1Z56C 2J85A 3AFGA 1LZKA 3UKOA 4GW3A 4N5HX 4C0QC 1HYBA 5DN6D 3B1XA 3DWGA 2OOKA 3FHJA 3PL5A 4ZARA 1H0HA 2J7PD 4ZK6A 3JQAA 2GK4A 3AW8A 3QMMA 4E5VA 2CFCA 4DKXA 1VLVA 2ZJ1A 2W11A 4ACAA 2Q41A 4RJIA 2QLTA 4MWGA 3GK3A 2QM7A 3VTAA 4PZPA 3LPLA 1MCZA 4OHUA 5K3OA 2ZRIA 3QVWA 4XWAA 2ZJFA 3ADOA 4UUQA 4QD3A 4ZAZA 3KE8A 1JDJA 3IDZA 4OSOA 1ZJWA 2H29A 3H8JA 1SZCA 1MC1A 1VQ1A 4DCJA 1XNGA 3H2KA 4V0SA 4BFUA 5MDHA 4QXPA 1QH1B 4PHGA 1COWD 3NWOA 3IEIA 3VKFA 5JXWA 1Y8AA 4RMJA 1G20B 4MX8A 2QEQA 4OQMA 5A9TA 5TT0A 3KZCA 3PNPA 4IS2A 1XAJA 4F84A 1HUQA 1WUKS 2VJQA 2ZIXA 3X1DA 2V55B 3LUFA 3K4HA 4FYVA 4GM1A 3HCPA 3SBEA 2BMJA 4YH1A 3F9RA 3HKCB 5C4GB 1RC0A 5A7GA 5KPJA 3OJWA 2NLOA 3U4CA 4DNQA 4AWXA 2FRDA 2A94A 1RTKA 3BSSA 5ITWA 1CERA 2I71A 5C9ZA 5IZ4A 1PGQA 2Z56A 1XUOA 1F60A 2DLDA 3HEMA 2WYIA 1QQBA 2LKDA 1B8NA 2P2ZA 1MRSA 5KWVA 4KWIA 1LJ8A 3FYTA 3VO8A 1R0SA 2FSUA 1MT0A 2YJTD 4QWMA 1L5YA 1YK1A 5AK4A 1PEDA 2VDPB 4JBXA 1HE2A 3H83A 1P7WA 1MC8A 4KXWA 4X64B 2JGAA 4FONA 5AHWA 4EATA 1ADYA 1R4MA 1SHLA 1UBKS 1OLXB 1DKQA 3M83A 1V8DA 2FX5A 3D6HA 3MINB 4RVOA 2G63A 1PFGA 4M7PA 3D6AA 1E1RA 3EAQA 2AMLA 4WN9B 2Z6UA 1EZ4A 3GJRA 3QGMA 3ELDA 1WAMA 4NYMR 2JFWA 3OWXA 2FRVA 4ND8A 2HZ7A 4M8SA 2C4HA 2KQUA 2YUIA 1CUHA 2IHVA 2PGDA 2VTDA 2GM3A 3CUYA 5L7YA 2HRDA 2UZIR 3MGBA 5EXTA 1ISMA 1NF3A 4XWYA 4R1SA 1RW4A 4YX9A 3T5AA 3QA3E 3HXOA 1VZ2A 2V1UA 4PNZA 4L50A 2XSZA 1LXCA 2YQZA 3OIFA 4OSEA 1XZFA 3KQHA 2FZVA 2IX3A 4PSDA 5F5XA 4IO0A 2OT3B 2PX4A 2P4SA 2ZI5A 4K6HA 2G88A 3GFSA 4UDOA 2Q2WA 1KL7A 3ABRB 3JQFC 3KUCA 4CU2A 3LQQA 4D3DA 3NM6B 3O91A 2G7ZA 1COZA 1DIGA 3I9KA 5FOXA 1FRZA 3LHSA 3N0WA 2C2ZA 1ID1A 1EH5A 3WLIA 2RKBA 3ZWBA 2E21A 4KRFA 1CP3A 1Y3FE 3GUYA 4HGNA 3KDPA 4QBIA 2QGNA 3DC2A 4H1HA 4LC1A 2FK7A 3FYHA 4OP3A 2D1QA 5CNIA 4W5TA 1ULUA 3PC7A 2HA3A 1T91A 4B3BA 4GI1A 4PX9A 5SZIA 2YWDA 3T7KA 3RIGA 4HPWA 5EGNA 3UAGA 9GPBA 5JNTA 2H65A 2IVFA 5H83A 4MDHA 1E1LA 2ONYA 1MQ8B 2CZQA 4L4UA 2FWRA 2H4YA 1WMSA 4QOFA 1HY3A 2PQ2A 5AI5A 4DIOA 3DZBA 1E5LA 4PYOA 3OBIA 1NRJB 4X8LA 5FTNA 1U4OA 4M1SA 1V5IA 1TMKA 3S8MA 3MTBA 3TVDA 4MR9A 5FCDA 3HJUA 5E6RB 1U8YA 4H27A 4BMXA 1YVDA 1YE3A 2A9JA 1DSSG 3ZGXA 1DHTA 3HABA 2REXB 3V9AA 3ZJ5A 1XZJA 1DCTA 3C6BA 3KLNA 3R9XA 1NONA 2G6TA 4J4BA 3U60B 2B1RA 3AVQA 1RC1A 1ZK0A 3LX8A 3RM3A 3TRKA 3DQPA 1CFZA 3RROA 3TXAA 1AM4D 5BQPA 4BEJA 1Y48E 4C03A 3YASA 4MCJA 3BGDA 3OIGA 1YIAA 3TSOA 3VJKA 5BSEA 5D86A 1Y5MA 2Z57A 1FMFA 3DQZA 1QIFA 5EJEA 4OBXA 2PD3A 2QJFA 1ZYUA 4PANA 3KVVA 3Q6MA 4XGIA 5DM1A 3IDOA 2B7LA 4F2WA 1EFLA 2O7QA 5IJWA 4EUEA 1QQ5A 3M5PA 3G3EA 3S6JA 3U3JA 3A1VA 4JEIA 5ALLA 2JLYA 1JKJA 2PO7A 4UZFA 4J91A 1P5RA 4A10A 1CSEE 2GRAA 2RAVA 3GRZA 1DKOA 4RPGA 1KKLA 1C8KA 1Q0ZA 1WOYA 4ZT5A 2PAAA 2H57A 1G8PA 1J1UA 2I65A 1RKVA 5LQMA 3RK4A 5T5QA 1LH0A 2R65A 3PEYA 1YR3A 3MM4A 3H1PA 5E9AA 4FCVA 4RBNA 4KQ6A 2FRDC 1PGOA 3ZW9A 1DFIA 1KAHA 3M7IA 4ER5A 3ODGA 4LXQA 1FSPA 4V0RA 3ZWDA 3CJQA 1N9GA 1KRXA 1GA4A 1UP4A 3DNMA 3IFSA 3L02A 3RIEA 3TLCA 3WWCA 4DM3A 1AV6A 5H02A 4KR6A 1XCJA 3NYQA 4D0SA 2ZI9A 3SQDA 3IKTA 4KU4A 3HJAA 3EH1A 3PTLA 3KJGA 4RK6A 4XGRA 1XU4A 1QTQA 4B3RB 2L17A 1UWKA 1M7BA 2IIQA 4JJ4A 4YNBA 2ZSDA 3O8QB 3WL8A 5ENVA 3O8DA 4UC0A 5KOJA 2C2WA 2YVUA 4R1OA 2WZCA 3AB7A 3A9TA 1E6LA 4FLEA 3WGNA 4CWAA 4WBNA 4ZCMA 5JSZA 2VOJA 3LDFA 1RXCA 4X6LA 3BJZA 5JAZA 1XFDA 2BHTA 3LHFA 1EIZA 3I1YA 1Q11A 2Y2VA 3D7KA 3TAHA 1ZEJA 2CT8A 3BE6A 1NW8A 2OQVA 3U26A 2BDEA 3G2JA 2BMDA 3NGXA 1O8CA 4RMGA 2DQZA 3WLTA 3HN2A 2X8JB 4I9HA 3L0SA 2W8ZA 3NEJA 1UXKA 5JASA 5A5FA 1MV5A 3OZVA 3W1VA 4PS0A 2CL0X 4HAVA 1WSAA 3R5TA 3ZE8A 3VDNB 3R6WA 4YGXB 2GCOB 3ETDA 3HDGA 2H7YA 3KHKA 5F21A 1UKEA 1GLGA 2O2ZA 2R7KA 3OQJA 4I4NA 3T5PA 3C7KA 2W93A 3G13A 1N2BA 4JJAA 1U0FA 5GMOA 5LU9A 1YTLA 1TADA 1WKVA 4J6FA 2YOGA 2IZ1A 3NOVA 4RZUA 5EKUA 2E5WA 4FYPA 3Q3HA 3VNSA 2OQ2A 3JATA 2J45A 1R4AA 1Z5NA 3MTJA 1HT1E 3M4XA 1D0IA 4P3XA 1GV0A 2J3IA 2QV0A 4BCDA 1JHYA 2WMOB 4QDJA 2C88A 4ZAFA 5G4LA 3MGGA 3Q1KA 1QO9A 5ECYA 1D1QA 1KVUA 3DVAA 4EYQA 1IM2A 1KDOA 4I1IA 2ZVJA 4YCSA 2PDAA 3COVA 3MQFA 5C4MA 5ITSA 4FVTA 2YYSA 4M1QA 5LP6B 4H3KB 5HOQA 4C2BA 3HDTA 4DQ0A 1ZNQO 1QRDA 2GSWA 4Q4HA 1ID8A 3BDAA 1R5BA 1PZXA 1OI3A 4QHTA 1Z5VA 4FQ8A 3HHEA 4QWWA 5T4FA 2C1EA 1RQPA 1YNSA 1J2UA 3RKUA 4EPYA 1DRWA 3PNSA 3HSYA 4GR5A 2IHKA 1POXA 1NUUA 1HFKA 1Z6TA 2O2GA 3CG0A 1JQLB 1J49A 2IOFA 1N2GA 3JASA 4C7XA 5C7LO 2FHPA 3RIYA 5I7OA 3G5TA 5HZKA 3CO5A 3LWZA 3WADA 2X3YA 5AW4A 2QL9A 4M37A 4B6PA 5KYUA 3QPDA 4KNYA 4AB1A 4X84A 3A6GA 3G9UA 1TZJA 4KKXB 3EFEA 1XMOB 1XTJA 2QP4A 3A4IA 5M04A 3OECA 3ICWA 4OTZA 2C4WA 1UADA 4YFVA 1E62A 5DGIA 1X7WA 3ADPA 4TMFA 4UMFA 1XWWA 2D1SA 2XNJA 4PYMA 3BHMA 5LWQA 4C2UA 3TAXA 4Z7JA 4A03A 2WABA 1EJBA 3QX3A 1Q12A 1U8XX 2QZZA 4HMPA 1TT7A 2BE7A 3OQPA 4ZALA 4B1FA 2CNWA 4N12A 3RU9A 3GQVA 4OD0A 2ZWAA 1OX4A 1XCGB 1I1NA 1GU0A 2XKBA 1OE0A 1CY0A 3E27A 3QQ5A 3CR8A 4BQSA 2EZ9A 3BZBA 3MB8A 4X8MA 4OU5A 1C0IA 4J76A 1SULA 2IF0A 2H7CA 2P9FA 5IDQA 5LJIA 2QG9A 4BVGA 3LYAA 4PG7A 4PXYA 3LSTA 2D4HA 2A0FA 3QFHA 5GONA 4BECA 2VHXA 2UZ3A 3HB7A 4RJKA 3OTQA 3L05A 3LL4A 3ADBA 2F9FA 1GU7A 2PVPA 1ZN2A 1ODLA 1Z8FA 2YIDA 3GYBA 3NS7A 4RVNA 1WZNA 4MQFB 4YV7A 1JFLA 2WYHA 1ZUD1 1RHMA 2QDXA 3A4NA 2FWIA 5AW8A 1YZTA 2HSZA 4UE6A 3AG5A 3O0TA 1U1IA 1UH5A 4EHJA 3U5ZB 4AUEA 4HWTA 5DGXA 3FRJA 2G9RA 1ACJA 1CZOA 3KJEA 2NPIA 1BKYA 1U99A 2ZPAA 5AUNB 2IHTA 5KOHB 1Y0BA 3L1JA 1M54A 1R0LA 2Y71A 3GJ0A 4X24A 1KKUA 3K71B 1O5TA 1CR2A 1QHHB 2R6GA 1KI7A 3H9UA 5EE5B 1XEXB 4MUYA 1M8GA 1U8EA 4IIVA 3SIRA 1MIOA 4Q4DA 4BNNA 5JU6A 2AN3A 1H2XA 1PLJA 2ZBGA 2W43A 1TAGA 2XB9A 3K2EA 3HBAA 3M6AA 4MQ5A 2ZJ2A 3K9WA 1MH1A 4J7UA 1G21A 2IUFA 4A6DA 1LI7A 1ZVJA 4IZHA 2WOJA 3PLAE 4ZMRA 3NBXX 1GTMA 4DEYA 1D4AA 2ATIA 2K2WA 2AMVA 2F9LA 4QDXA 4HH3C 2LE0A 4IHJA 5CGZA 3CF0A 4GC5A 4BAZA 3CR7A 4LRSB 1JALA 4BDSA 4A16A 2WM8A 3H4IA 1YASA 3IR7A 3T1YB 5DKFA 4PF1A 4E13A 4DRXB 4AF8A 4QPDA 3VR6H 2FMHA 1EE9A 2AD5A 5BV8A 2RFLA 1R8QA 3IAS6 2WVJA 4X3PA 3I2KA 3RS2A 3V7UA 2QMHA 3FGZA 4BRUA 3OE7A 1Y1QA 2PGJA 2ZPUA 4CF5A 1SC6A 1WPQA 3IEXA 2CHQA 4CG2A 3LWNA 5IM4A 2YHBA 3BULA 4P98A 2M9MA 3V42A 2NYRA 4TV8B 4DLNA 3TLXA 1HL7A 1OBFO 1L8XA 1XX6A 1SKYE 3CF6R 1FUKA 2NQTA 4ND2A 1D07A 4L8LA 5HQJA 7MDHA 1RDFA 1TUEA 2FFAA 4GUDA 4QOGA 1GCOA 3R0VA 3H9BA 2Z8YA 4FX2A 1Q0HA 4JBWA 4CV0A 2O7NA 4MI1A 1ESEA 2H0RA 2YIJA 1W44A 3B1KA 3RFVA 5C51B 1BDHA 1SCUA 4D6YA 3GCDA 1H42A 1RI2A 5FPQA 1XZQA 3V8BA 3WRXA 4CCYB 3W5JA 2QJTA 2VJKA 1MEOA 4RXMA 1NXSA 3NNDA 3OTHA 3I8XA 3OQIB 4RO0A 4DLWA 3IPCA 1JSZA 2PT9A 4FI3C 3AF5A 4M1OA 4B33A 2AFHA 2PBZA 3T3GA 1ZW6A 2I7CA 5I7UA 2IS6A 1XMIA 1REQA 4Z0NA 3ZD8A 4D8XA 2Z6AA 1EP9A 3TSAA 1N33B 5DRYA 2QU8A 3LOQA 4I1PA 4IBOA 4KGXA 1E6WA 5KTOA 3JU3A 2B6NA 1L4FA 1G7CA 5EIAA 1YKFA 1HL3A 3SLKA 4RV4A 3EDOA 1Z13A 4LZNA 5I9SA 3R6LA 4LJ9A 3TW4A 4CRWB 1Q2UA 1KJ9A 1AU9A 1KDRA 1C81A 2VYND 3FI0A 2XZPA 3OT4A 4EB0A 1CETA 1SQFA 4LGCA 2XOKA 1SUDA 1L5LA 4B5KA 3R3JA 4ZO8A 4BVAA 5HFJA 2V6GA 3VJLA 5LIPA 2LR0A 5HQ3A 1KQOA 2CUZA 1U0SY 4P84A 3WK6A 4ESEA 1L7QA 2AJLI 3PX3A 4EJFA 3D6VA 4QYWA 4R16A 4R8LA 2X1HA 4A9AA 4Z4FA 3JYHA 2Z3ZA 4MA5A 4YJKA 1WMAA 5CX1A 3H5OA 1ODCA 4FPXA 3ZZUA 2OV4A 4UVGA 5AH0A 4CI9A 3QELB 5K6AA 3ACCA 3DDNA 1Y8RA 5HGXA 1PGPA 4C08A 5K6RA 2EKLA 2DTEA 2H16A 3L6RA 3GOQA 5F1YA 4Z9AA 4YO7A 5FWAA 3O8NA 4YPFA 2J3DA 2H2FA 2CXXA 2YYZA 2ZW9A 3IP7A 4JWKA 3DV2A 4RAOA 1EWRA 3RYTC 2YXLA 4TLAA 4WKGA 5JC1A 1QRSA 2PH7A 4Q39A 5GGYA 1AC5A 3JVIA 3ZEAA 1TO6A 2Q8PA 4KXYA 2FU5C 2B9EA 4O0LA 4BS9A 3C6KA 3N58A 5K1ZA 3PNYA 3D8RA 5EKXA 4OP2A 1O96A 3ZX5A 3G9TA 4EW3A 3G2NA 4KLRA 5HZMA 3LECA 2Q6TA 3T95A 1TUIA 1P45A 3BWDD 1CTQA 3KKZA 3RVNA 3HVRA 1EFVA 3MUNA 4QYXA 1VSBA 3Q5GA 1M8PA 3UMRA 4I9GA 3ZV6A 3GAMA 1JHRA 1QTNA 3AIOA 4O2BB 2R0QC 3HR8A 1Y4AE 4ZTZB 1FRQA 1LDMA 4RWEA 4XE5A 1TQ6A 3PNMA 1RM4A 4WVFA 4YQYA 3DBVO 3O2JA 1YKSA 1Q1AA 3R3UA 4IWXA 5SY4A 4LCJA 3ZZMA 1T8WA 1T2NA 3REFA 1AN9A 1J24A 3W78A 3PXBA 4CM7A 1XDZA 4J90A 3D1VA 3INTA 4TMZA 2FB9A 3NO4A 1YMUA 1DCFA 2XXAB 4NBTA 2VRCD 2WJYA 2DTXA 3AUKA 5GM1A 4IIDA 1ZKMA 2X8LA 5JT1A 1KO4A 5F3RA 1KIAA 2IYYA 2VNJA 3CEPB 3L6UA 1WTCA 2R6CA 4FWIB 1YD7A 3DE6X 1CLUA 2D0DA 1OIWA 1QF7A 3DT9A 3OZIA 4Z9BA 2Z3WA 4NBVA 2MMCA 5K0SA 1UKYA 3CU5A 4G4SO 1KZ7B 1UMBA 3E9ZA 3FOBA 3MWEB 2QPOA 3OFNA 2AF3C 1G5QA 1Y5LA 4IVNA 4TXNA 1XRJA 3BFXA 3U44A 4HQKA 1W85A 1ZRSA 1NI5A 1CFJA 3I9OA 3IP9A 4N6NA 3N86A 3GG2A 4C3UA 5L3QA 4WOBA 1UMCA 4DJTA 5JQWA 1PR6A 3TOXA 4K9NA 4DLKA 1GQFA 5JYDA 3K53A 4OX9Y 1BC5A 1IJKA 4RSMA 3SD7A 3KPVA 1V1MB 1X38A 4C0BA 4FHEA 2GVNA 5IUNC 3P4YA 1FPQA 4JVSB 4FFSA 4BQOA 1QQAA 1R8YA 4L28A 3MTQA 4M0LA 4TVKA 4R2IA 3SIXA 1LQTA 1ZP6A 4RTLA 1AS0A 5CFQA 3W6OA 5HRUA 3AL2A 3UWKA 1N2HA 1MW9X 4BRSA 1VA5A 2GILA 3LCMA 3NEAA 2Y3IA 5A71A 1YWGO 1QRUA 2C2YA 2PU7A 1CDOA 2NU8B 3T9AA 1OGIA 2FETA 4LOKA 4HB2A 1NNUA 4EKYA 3LTNC 3D0QA 3HP1A 2J3LA 1U0LA 4DMUB 2J33A 4YASA 3IMKA 4W7IA 3W06A 1L8LA 2P2SA 1SKYB 4H1TA 1PQUA 3S68A 1JFSA 2JFXA 1R74A 2HA5A 1R6BX 4HNRA 2ONKA 3PEEA 4CLOB 4JXXA 1T8UA 3NUGA 4RE5A 2XVXA 4L9WA 8OHMA 3T06B 3IPXA 2WKSA 3PNKA 3UG6A 2B2CA 4CIAA 5G0TA 3RS4A 2QXTA 3E7DA 1THTA 1HORA 1T2UA 4IRXA 2DUUA 5ALFA 1RMTA 4LRXA 1XR3A 1AMOA 3OEHD 3AILA 2XT6A 4UVHA 2W6IA 4D3FA 3DAHA 4X97A 1EGMB 2HX1A 4HTFA 5J5VA 1EUQA 1NJSA 4YO8A 3UUEA 5JJKA 1TLLA 1E89A 3CEJA 1NYQA 4LRYA 3CN9A 1AGRA 2YY7A 2VXYA 1YV9A 2ZK7A 3O4JA 4W1SA 4OQFA 3SI7A 1MU0A 3HWRA 4GZ6A 1P2BA 5UKDA 4F8JA 3LW7A 3RGWS 5CMLA 1CPYA 3HVIA 4O4JF 2R1TA 1NX6A 4ZGWA 3LPDA 3RVKA 3L06A 4XX0A 2PT6A 3VVBA 4F56A 2CLHB 1RIFA 3WBKA 1L5WA 5A06A 2PO5A 1P9OA 4J2HA 5JDCC 2P2YA 3T35A 4Q16A 3K7EA 5L3VA 3TTVA 1J09A 1MG0A 1X9IA 3N53A 2OWDA 3GRKA 3TO5A 4LF6B 3C70A 3DW3X 4KE8A 3EHEA 4IDDA 1F5NA 3UMMA 3IUPA 5HM8A 1GG9A 5KNBD 4A0HA 4I4CA 3GR6A 1TYBE 1VP9A 3TE7A 4NCKA 3HFJA 5HMLA 1OYVA 2HMAA 4HDAA 3AVTA 2P3LA 3L0BA 1NMZA 5DI3B 3V4OA 1JEYB 1DFGA 1YS1X 4W7SA 3V4ZA 1T9CA 1T3SA 2P4HX 5EZSA 2FA9A 1N1DA 3MWFA 1GQOA 1UIMA 3UZUA 1RU3A 1MUUA 2G06A 4G5GA 1CIVA 3TL2A 2PKEA 4HL6A 3VYWA 4GLLA 4X44A 3GUVA 3QLJA 3ZHOA 4YJ2B 4D92A 5CCEA 3GNTA 1U3CA 2HO5A 3P2KA 4C0JA 2YJ6A 4QGHA 2PGIA 1G41A 4OOFA 4CQLA 1T9GS 4LY0A 3T1NA 2XUIA 3ENZA 3RAJA 4JNKA 1QCCA 4YAFA 2EZTA 3AERB 1PSWA 1TUGA 3HWX1 3P4XA 2PMEA 4BZPA 1Q7EA 2ZWOA 1BRTA 3IRUA 1XK6A 3HNOA 4LMBA 4X8HA 3KPYA 5CNJA 5KCZA 1AKWA 3KKPA 4QQKA 5ADUS 1J2JA 5CNMA 1UZAA 3VZDA 1UKAA 1HYGA 3PDCA 3GF4A 4LV8B 1Y82A 2YY5A 1TPZA 5DOZA 5HFNA 2PXCA 3W79A 1VHJA 4PHHA 4O5AA 3VO9A 4HAYA 4RCZA 3E1KA 3ZYCA 4ARZB 1I0IA 1R88A 3JPYA 1NP7A 1ULTA 4Z3DA 3F6BX 4BY9E 3O26A 3DL0A 4BEWA 4DA7A 3TE6A 1FRNA 3N2YA 1OLUB 3NNSA 1LS1A 5JVDA 1F2TA 1UK7A 4ZCIA 4I55F 1PK8A 4CXMA 4HZUA 3EQZA 3BRSA 5I9TA 3GVIA 1LSUA 4HS9A 1M2NA 3KD2A 3M6VA 4U6NA 4UDNA 4Z7NB 1I6KA 1G1MA 2QMUA 4TXLA 1UQUA 4KODA 3L07A 1Q3HA 1SPBS 2OZLB 2BFOA 3C5HA 1PFUA 3WFIA 3TFOA 1YR2A 1NAIA 3B78A 3M9LA 1C1XB 3OX4A 5JDIA 3GJSA 3RSOA 5ED0A 5IF9A 4LV6A 3EFBA 4EZBA 2AT1A 1SKAA 4LWZA 4M55A 2FCRA 1ZSVA 5HE8A 4PO8A 3CX6A 2DFPA 5AW9A 4R1LA 3H11B 3S70A 3PPWA 1BRMA 3C8UA 3TW0A 2JI9A 2HXYA 1ZRHA 2FP4A 1X7YB 3E5NA 3EF1A 1Q0UA 2GZ3A 3OO0A 1F3LA 1B0PA 2DULA 4L9SA 3HB9A 4M9RA 3X2SA 1NC1A 3PICA 1CQXA 4AMGA 3ND6A 2YWEA 1EVQA 2DUNA 4GEKA 3NHJA 1G3QA 5DGTA 4M8NE 1AVTA 3TUJC 4TS1A 4HNVA 1XRLA 5TEVA 3HXKA 4HLUC 4RD3A 3DYVA 2J9FA 1JIXA 2NZUG 5T6MA 1YQQA 4QHYA 1FSZA 4WINA 3C3EA 3KXDA 5G0UA 4D8UA 4KQMA 4QUIA 5EXEA 2Y0BA 4N6OA 4Y67A 1HQDA 4QXRA 1RABA 4XQEA 1JLKA 2H2AA 4F97A 3RWBA 2V7WA 3H1GA 3ZQ6A 4M1EA 4HWKA 4ACBA 3NKVA 3JWPA 2PX5A 1KARA 2Q21A 3S3TA 4AKEA 3CVYA 2ISQA 3RVRA 1VE6A 1NR7A 2V4UA 3ZKWB 2HU5A 1VHQA 4LZLA 4WLEA 1A9OA 3OZAA 5FNVB 4BJ1A 2DQ4A 2WZDA 4QM6A 3LLUA 1JQEA 2A9QA 1CNMA 2VYFA 1FTWA 3GLUA 1JSLA 1WVIA 2B99A 5CDSA 1AGXA 1IEQA 1AQUA 1F7UA 5ALMA 3BK1A 4IV8A 1L7NA 4NU6A 4HVCA 2IS2A 2YRWA 3BD8A 1YIDA 5A02A 5JYEA 4MKFA 3MZ0A 5KX5F 1XEFA 3FNBA 1CC1S 3QXGA 3H86A 3EIQA 2B1QA 4QAJA 5KTNA 1PJSA 4UBMA 1IBSA 4FP9A 4AS3A 2WWYA 4IW3B 5H70A 2GXQA 1H8EA 3VNRA 2Y77A 1AKVA 2WZQA 1VHWA 2XKJE 7REQA 1OH7A 1UXJA 1PBNA 1Z2OX 3ICQB 1QOQB 1RTTA 2WAOA 1RJ9B 4OMDA 1AUVA 1KHHA 1M2OA 2NADA 2RHRA 3WDLA 5KC8A 1AQYA 4MRVA 4OU4A 3M3DA 2YNMA 3FPKA 3ILXA 1V9SA 4E12A 1ADBA 3LVBA 4HUQB 4L6IA 2DT8A 5B5SA 4R2MA 1DWPA 4JIMA 3WIUA 2FEWB 1EM8A 4FNOA 4BMYA 5LN1A 3PWTA 4HCJA 1K1EA 4HRAA 3FFXA 3MUOA 4YP9A 2Q8NA 2OGTA 4WCFB 1VDZA 3L0IB 3VH2A 5KYWA 1UBOS 1CUVA 2O0LA 4KJXA 4Y18A 1UWVA 1L4NA 4NZ9A 3ID6C 5DULA 4R41A 1VIAA 1Z0UA 3L1HA 1MHTA 5KYTA 2A3NA 1VDMA 2IOFK 4G1FA 3ND7A 4J0JA 4MUJA 3D3WA 2FMKA 4YUVA 2HYDA 2Z3VA 3JZIA 4AJ1A 5DRTA 4KSBA 3U31A 1C9KA 3JQBC 1BKSB 2RARA 4WL0A 1R50A 3NHLA 3KTAB 4II7A 2PX0A 1VP3A 3OT1A 2QM3A 2MSCB 3JAWB 3LDGA 1R4NA 1BW9A 1YUMA 3V2GA 3ZD9A 1NAHA 2YV3A 1XZ8A 1RWBA 2ZJ7A 5C3MA 4EK9A 4E33A 3P0HA 1I9CA 4YMLA 1FDUA 3U7JA 3WLHA 4B74A 4B80A 1XVLA 1LBQA 4IZIA 5DP1A 4J8PA 2CEAA 2XCTB 2EDCA 2QI9C 1RZRA 2FPRA 2NO5A 1EFKA 3RSSA 3RYCA 2WILA 1LVUA 1MF7A 4ALJA 2GK6A 3AI3A 2AFRA 3HV0A 3U4MA 4ZYUA 2HI0A 4ZEMA 2ZBPA 4BFVA 3JSXA 3JWGA 2XUOA 4J16A 1ABEA 3H5VA 3VAAA 1MAWA 2UVQA 3A1NA 2A4KA 2ZTMA 2DG2A 4TYPA 4DDMA 3DV0A 4M1YA 5GV8A 1X7HA 5JS7A 5CH8A 1KEEB 5DBGA 1DJOA 4FMDF 3C8ZA 3ELWA 5B6PA 3QV2A 5LKRA 3A32A 3GVXA 4ARBA 1Z2PX 5K0LA 5ELLA 1SUIA 3OPYB 2VXCA 4YECA 3DT8A 1W5BA 1G8MA 5FA8A 2P4QA 3AUAA 2I1VB 4JKIA 1W5AA 1KP9A 2XMZA 4WXHA 1KR2A 2YVAA 4X1YB 5BW8A 3OE1A 3ZUGA 4E4YA 1V4NA 2W58A 1EWVA 3BCRA 5AKGA 4EKEA 1QE5A 3BMNB 1ESZA 1TRKA 4E2WA 2LXNA 5FOSA 1KZYC 2XVZA 3BERA 1QFXA 4JXZA 4K03A 4JBIA 5HR5A 4O4LB 1VLHA 3H2GA 4YRFA 4TL9A 1XCPA 2BRUA 2C4KA 2WHRA 4R8RA 1M2WA 3PGVA 4Y2SA 5IAOA 4KEAA 3GPLA 3JQRA 4L74A 4XW2A 4BPRA 1BH2A 5B3JA 4TYMA 1XELA 2GVDC 5LA6F 3DFZA 4DW8A 1JT9A 2F4NA 4XJSA 2WNIA 4TKVA 1Z34A 4UU7A 4B6OA 2YC2C 4I5DA 3H4MA 3AKDA 3ZXXA 5MGBA 4FT4A 3O8RA 2OFXA 3EUEA 3PG5A 4NHEA 4EVSA 3NH6A 1ZAKA 4Y1EA 1JSRA 5KYGA 2CYBA 3EARA 2A0YA 3WNCA 3ZCSA 3N8KA 2WY2D 5I7WA 4KFRA 5CH5A 4G1MB 5JBQA 2NAPA 3NWJA 3JD0A 1NJ1A 2JVIA 2DH5A 1C14A 1QCDA 2JCYA 3GFRA 3KK0A 3N2IA 5FEMA 3TD2A 2Z4RA 5HJEA 4BJ5A 2A86A 2QE7A 1T2AA 1E4EA 4DQXA 5I47A 3UJNA 1AHHA 1UJ4A 1S2IA 1POWA 3IP3A 1VCNA 4MUHA 3G5UA 3VOSA 1ZJYA 4G37A 1OR8A 1NZDA 5CLHA 5GJVC 5TB5A 5LYJB 4UJ5A 1I94B 1PR3A 4FW9A 3W5AA 1OHHD 5F77A 1SK9A 3QUCA 1DEXA 2OCDA 1QGOA 5AOVA 2R6JA 4CCAA 1E2EA 4MW7A 1F7VA 2PKXA 4ZI7B 4HEQA 1OXMA 1ZHOA 2RG7A 3GHHA 4MA0A 2PLAA 2FPGB 1KFCB 3AFNA 5T8KC 4P22A 2NO9A 1WXHA 4DR7B 1QC5B 2OILA 4K9DA 2HCTA 4LCBA 1DBIA 5FLEX 4TS3A 3I64A 3TQIA 1MV8A 5IAKA 2ZBEA 2JGDB 2PLFA 3DBIA 4H0NA 1WDWB 4PPFA 2X1VA 5AKJA 3SC2B 2NP7A 1L7DA 1T8TA 2XCIA 4QA9A 3MT9A 2JK0A 2FK8A 3EQ9A 5HK8A 3U9SA 4P34A 5DDIP 1H8HD 5EIEA 1XDWA 2P2DA 2J0QA 2NGRA 2C5GA 2IX9A 2QLMA 2ZUVA 3C3KA 5ALYA 1KJJA 1DJNA 1EFUA 2XT9A 3SHOA 1O6GA 2I22A 3VAZA 3R77A 4XI9A 3O21A 5C32A 1DUVG 2IXGA 2VATA 1NT4A 2MU1A 2GD6A 3TLJA 3VU1A 1PG0A 5G02A 2YV2A 4AX4A 2DMRA 1UDWA 2XMGA 1VG9B 2KM1A 1RSZA 1FOEB 1NJFA 3RVMA 4YT8A 3BN3A 5CK5A 5I6DA 3OZSA 3A7DA 4NOJA 1ZNZA 1NASA 1UC9A 4LNUB 4WLVA 3GEEA 4NS4A 4MV6A 3W7AA 1PS0A 3Q11A 1JQBA 1RQ7A 4UU1A 4HVLA 1SXIA 1M2HA 1KF0A 1TNDA 2M6SA 2C9BA 4OUKX 1SBZA 3MWLA 2AN1A 3SEQA 2WB4A 3G2OA 1E59A 5HUHA 1DIBA 1UBTS 1L4MA 1L7XA 2QTZA 1OW3B 1NOJA 3IVCA 1K8YB 3V7YA 3DZJA 4O2AF 2VK4A 2G4VA 3VZBA 3MC1A 1E0SA 2BMAA 2NU9A 2ZCUA 1YBMA 5DN6A 5BXYA 3K6SB 1E7RA 2BTEA 2J7PA 1VI6A 3UKJA 4BASA 3GLRA 1U6KA 2REBA 1E1MA 2BWJA 1NNSA 3MN1A 2GTPA 2NVBA 3TNYA 4R31A 1OFIA 3OICA 5AXCA 4PQGA 2FKNA 1ZZEA 2XTAA 3DYBA 3L8GA 1UZLA 2V7PA 2O14A 5EMMA 1XHEA 3A6EA 1UL1X 4BV2A 3KAJA 2BIFA 3UCFA 4M0FA 1MB3A 1N0HA 4R54A 2OCKA 5B1DA 1E9BA 3I5AA 1M8FA 3H0KA 1ZA2A 3PFBA 3PF8A 3DLCA 2FMXA 3E9RA 2V0GA 2PRKA 3LXMA 4M60A 3GFTA 1JWLA 2BRUC 1V26A 4E70A 2HSJA 1AG9A 1IPEA 3KJNA 1N5JA 3L1KA 1S3FA 4GNKA 5BYBA 5AD1A 1Q1ZA 4C29A 5CG1A 3T7EA 3L18A 1GTVA 1QIEA 4DABA 5B3JC 3EF3A 3QPAA 5LNK1 2WTXA 3ETJA 3S2FA 5E2IA 5GINE 2I4MA 2VDQB 2X4DA 1PS9A 3ZCXA 2C8KA 1PT6A 3MMSA 1EMDA 1XTRA 3KYDB 4TX1A 5LYYA 1IH8A 3DTVB 3EPRA 2IXFA 1TMGE 3GRPA 2PVCA 3EGEA 3PU6A 5DYWA 2DPMA 4P4GA 3TMYA 2WC1A 4J4HA 4BE4A 2XH8A 3LC1O 5BN4A 4UHJA 4W5WA 4G5HA 4B6GA 2CDAA 2OESA 4C4AA 2FPXA 1ZNXA 5FI1B 1MP0A 3PI7A 1OVGA 3VU9B 1ENPA 1G16A 3TL3A 3KAKA 4XEHA 2UUAB 2PAFA 1AZTA 2ZSUA 3HRHA 4GRDA 2DWUA 2GJ9A 4LOJA 2HCFA 3ZQ4A 4HDCA 4NNOA 3O0DA 3Q8KA 1TJYA 1L4UA 3GLIA 1FU8A 2DPLA 3AB3A 1E8NA 3TLKA 5C8YB 1I2MA 2G71A 5FI3A 4EY5A 3Q6IA 4OMUA 4B76A 3A3OA 3GN1A 3ZY4A 3ELBA 1PNTA 1Q7BA 1EFPB 1WW3A 2V7EA 2VWPA 3BMCA 4RNDB 4J0CA 1E58A 3RTAA 1H0SA 3QIAA 3BGVA 2XZOA 2B8JA 1JQDA 1W5EA 2EP5A 4TZKA 4BDTA 1ZVQA 3CVXA 1QWOA 3UENA 5DBIA 2FY8A 5D51S 5C7YA 6PFKA 1BE8A 3QTLA 2IIVA 3WWOA 2FSFA 1C4XA 1RE0A 1HZJA 4DR2B 3VR4D 5NULA 3EMBA 4P38A 3RABA 3R5KA 4RPHA 2IYUA 2V5UA 4TVBA 4YLYA 1Z4JA 1XMXA 3AVPA 2QTMA 3RVQA 3V9PA 3KUDA 3RBVA 1GZ5A 1DGQA 5AXAA 4GD3Q 1P91A 4TWAA 1J1IA 4I1OA 3RK1A 5FB3A 5A2GA 3N2KB 1UJ2A 4QVIA 4YHHB 4M9UA 5I9NA 1WXWA 1D1SA 1CQIB 3QVUA 5K8UA 5LMZA 1ZKDA 2R1ZA 4PY2A 2YKGA 3LT2A 1U28C 3FVRA 3OU7A 4JH0A 1L7AA 3EVTA 1DT5A 2NSDA 5HKLA 4TSRA 2G5CA 1YKGA 2ZS8A 4PCAA 4XUEA 3TYXA 4BKQA 2Y99A 2PUGA 3T7AA 1QG0A 3TQQA 3V3KA 2Y9MB 3F67A 1ZIPA 4D45A 1FIUA 4EBBA 3LSYA 2GD1O 4L5CA 1VB3A 3LT5A 3N8NA 4KN9S 5H80A 4ZDWA 2BDUA 2VBGA 4M87A 3X1WA 6REQA 1IRIA 3LE8A 3D02A 5LMCA 1U0OC 3BORA 2ZRPA 4MR8B 4YPOA 5BVHA 3VNVA 3GVCA 4PU0A 3M6IA 4LZWA 1A9SA 3HBFA 2P62A 1HDEA 4Q9JA 1UBSB 4GR9A 5AKXA 3GA5A 3VC7A 4I55A 5KWEA 5LU8A 3CUWA 3GVHA 4V2IA 4JL5A 2IIPA 3T3MB 5FUVA 4YRDA 1EGVB 3JD2A 3VISA 5FIUA 4DE5A 3EB9A 1ADCA 4DWJA 4AY2A 4BZWA 1IOWA 3T9CA 4NRDA 4F3NA 4MLDA 4DYVA 2OC4A 3BPSA 2VPZA 1XLUA 1YFLA 1L5HA 4HAWA 5M29A 2ID7A 2KYRA 1XQVA 2PR2A 4NMLA 4JI1B 4E08A 1NXXA 2CDRA 2R97A 3ONFA 4OH1A 2GYWA 5BURA 3GLFA 2P9QA 4R81A 1DTEA 4AIIA 4C6SA 1JDTA 2UZ0A 3ZHRA 2X13A 2ZRFA 4N3GA 2C8VA 3G8YA 1MQSA 1JT2A 3HM2A 4RDHA 3L4BC 2J4DA 2KX7A 1L5VA 2ZXFA 3ZDFA 5MFZA 2HPHA 4MW0A 3GD5A 2J32A 1USWA 3JQGA 4G1BA 1U6IA 3BSYA 4JP1A 3U1TA 3X43A 3B9RA 3ZX4A 2OAQ1 4LV5B 3OJLA 3FPCA 1W49A 2ODNA 2ZIXB 3DL2A 4GGOA 5TS2A 3SIPA 3IT1A 1AS3A 1KAGA 3PBKA 4GMGA 4RVDA 4LF7B 4FDMA 1P7YA 5K05A 1KA9H 3GIDA 2FSVA 2IYQA 4OJMX 3B12A 4UHHA 1QF9A 5EJAA 3K09C 4RIHA 3QVLA 5BSMA 5T6BA 2QV7A 5B6JA 5LMNB 3JARA 3ML1A 2IYTA 1N3LA 1M6VA 5JS1A 1DOHA 2OK8A 2XRYA 3L4KA 4OKNA 2Q4DA 2XMBA 2O2YA 3V5NA 2QTCA 1IN5A 4QLOA 3ZCVA 1QFSA 1P1BA 1ZL0A 2E1RA 4D9JA 1ATIA 4NY1A 4HYEA 5BT9A 4LRQA 1K8QA 1MD9A 2Q6IA 2G80A 2G0NA 3L8DA 4EP1A 3PQ3A 3Q3EA 3L4SO 5JALA 2FCAA 3A06A 4UQLA 1KYYA 3IRVA 4G1CA 1HE3A 1R4MB 2ISSD 2DU8A 3P2MA 3I62A 3RAPR 5JRDS 5JI2E 5KX5A 2YCLA 1GFWA 1THGA 1Z8HA 1H23A 4WV3A 3UMBA 5EJ4A 521PA 3K16A 4GBED 2Q5CA 1ZL2A 3NOQA 5C53B 1C2YA 1EU1A 4ND8B 4FBLA 4BKRA 5K09A 2YFYA 2FZWA 1E9CA 2VT6A 3OOJA 1JPUA 5ALGA 1L5FA 1SH7A 4ERXA 1DXOA 1DLJA 1QHEA 2DP4E 4R2KA 3MJCA 3LOPA 4W4TA 5EFOA 4EI8A 5KKCA 4OH7A 1GQSA 4XCXA 4TWIA 4TQGA 3HH8A 2XR1A 1FF9A 2XUAA 4AZ3B 2XUJA 3ZE6A 4OBBA 3L49A 1FEZA 1W48A 3V8PA 2I4NA 5CB4F 3NTVA 1IM5A 1QLHA 2GPAA 1XQ1A 3EC1A 2PGLA 1BXKA 2A30A 1U7XA 4WBSA 4EKNB 2A9RA 5BN1A 2V9CA 1KEKA 3W2EA 3COJA 1ISGA 1UWCA 3A1UA 4UTPA 4UD6A 3S8EA 1BGXT 2F8SA 2Q29A 4CKEA 5AVSA 2A5DA 1B4DA 3DP7A 2A88A 3EE6A 4WNAA 2XNKA 5IT4A 4EO4A 5ALSA 1N6RA 4ER7A 2J9YB 5A3QA 3U5TA 3IA2A 1JIKA 4J9UE 4MR7A 1P7PA 3GLGA 2UZ4A 4HRXA 1FB5A 3KSBC 1QIKA 3IVXA 1CB7A 3HB0A 4N03A 3G85A 2CXTA 3PJFA 1Y3BE 5CJPA 2NUPA 2D0PB 4UDXX 1BXRA 1EM6A 4N0EA 2WJ4A 4FDAA 4MR9B 1FNCA 4PYRA 1UJMA 4ONEA 1TTHA 2YHIA 4OFWA 5AW7A 3LFHA 3ZW7A 2P77A 5HJ2A 1I7DA 4EF5A 1EXMA 1SHKA 1YS2X 3IQZA 2PUJA 3G2LA 2QRLA 5TJHA 2CF5A 2NSLA 3E61A 2RI0A 2IUUA 1SB9A 3FDFA 1WUJS 3OBBA 4KQEA 1ZOSA 4EARA 2F6RA 1UP7A 3H16A 2FVYA 3EGXA 1HZZA 3R9XB 5FPKA 2H4HA 1RPAA 4U7PB 2X41A 5ABPA 3AV0B 1RI5A 4OAQA 3SSOA 3HC7A 1XRRA 4LZOA 2FPSA 1ML3A 3IESA 4G41A 4HTAA 3BQ9A 3QUBA 4ND3A 4XVRA 5JNWA 1TEXA 4HS4A 2DAPA 3KLPX 5A3VA 4EBFA 3EIUA 1L4LA 3P5BA 1MABA 2B4AA 3EY9A 4PCVA 2DHCA 1K4YA 2BY4A 2I8AA 4YJGA 1TIBA 4LYHA 4MO9A 4BLRA 1HG1A 4V3CA 3DCYA 3W34A 3VU3A 4D0GA 1NNEA 3VC1A 3K5WA 4E2YA 1GN9A 5F2KA 4K0RA 1DWQA 2X5JO 2UZAA 1RQGA 4FYKA 1SXJE 3QK7A 2VBCA 4JI7B 2VWGA 1Y7HA 2BR3A 3CT4A 3L92A 4RDIA 2JANA 3H9JA 1I7NA 1XTQA 3FCUB 3RC8A 1OI7A 3N2GB 3CURA 3WGYA 3AKYA 2Y4OA 3QXJA 2EX0A 1E9RA 1PWEA 3F3KA 4X7RA 4Y2GA 3HDYA 1PT9A 3ME5A 4DIKA 1TAUA 5EPOA 4RFSB 3LG2A 2XA1A 2FSVC 5E8RA 2VZLA 5ARCA 1M2JA 4BUZA 5TPWA 2GN8A 2QL5A 3AU8A 3UGTA 3PUYA 1QGYA 3AJ9A 4TLBA 4I5IA 1N9GB 1VG0B 2A84A 4GZLA 4K3VA 4UUPA 1FY2A 2JGRA 1T0UA 3TZEA 3WS7A 1A9QA 5J4KA 4P0QB 3H2JA 3ZPXA 5J43A 2XXAA 1XD9A 5J2TF 2XNHA 3HCWA 2FWMX 1LJLA 3EUWA 4IG4A 4NK5A 5LA6A 1K3TA 2AK2A 3PUWA 4RVCA 3TLAA 2FW1A 1Q83A 3WIEA 4PV7A 3MSXA 3SSNA 1N6OA 1RIIA 4NE7A 4OIMA 5HFAA 1FDWA 1MNQA 2EJCA 3PJRA 2TMDA 4IGIA 1DEAA 2C9MA 2XAUA 4PFSA 3SPXA 5C8XA 2ZB8A 1YUBA 5JSZB 4YRIA 3DOEA 1L8AA 1W4BA 3FPAA 4UKDA 5CA0F 4KXNA 4P32A 5FADA 1J00A 4GO1A 3WLKX 4BO8A 1Y4DE 2DFNA 2ZSBA 3DO8A 1PV4A 2BTOA 3GJ5A 2V7VA 3PNQA 1B2RA 2VPPA 1CUUA 1OGYA 1V5WA 1DKPA 4BLOA 4QRIA 1JR3D 5GQSA 3UNXA 1LSSA 4QQNA 3VPBA 2R8YA 3LZDA 4YXFA 1KPHA 3F4LA 4B83A 3VPXA 4EHBA 2YWJA 5JAHA 1PAUA 2I76A 2ZS7A 5FFFA 1EK1A 2FPOA 4WGFA 5F4ZA 3AF2A 5KBYA 3OZDA 2HU2A 3P94A 1HGXA 3EEQA 4L72A 1K2VN 2HQOA 1TKCA 3REQA 2OD7A 2NZYA 4NEGA 4ZVTA 4CDMA 2CLOB 4QFMA 3PKJA 3II6X 4JUBA 2A9FA 3IUNA 3K4QA 5D7NA 3HEBA 3L9WA 2HLDD 2PXAA 3B2QA 4P4TA 4JLDA 4YCBA 2AFHE 3F0TA 4NJMA 6AT1A 3MMPA 1ULAA 4Q7EA 4PLPA 3QMPA 4CM3A 2Z6QA 2A5YB 3KOXA 4AZSA 3WJ7A 2QL7A 4MKHA 4X6UA 4LXYA 2NPFA 4R7TA 2PYZA 4CKYA 4RSGA 3BHNA 1M9NA 4FCTA 4G89A 4KQXA 2LIVA 3BFKA 4GBGA 4M7RA 1Z38A 2OWEA 4YCDA 2ZANA 3HNPA 3WJ1A 4ENVA 3Q5DA 1TQHA 3SCZA 1U2RA 1IZYA 2BONA 3OP1A 4BLSA 1RYYA 3EA5A 1RXEA 1K2WA 4LNAA 2WM3A 2DTDA 4H1VA 3LHIA 1C3VA 1G64A 4HMQA 4XWGA 1UODA 3U19A 1IZZA 3TX2A 2UXCB 3GXBA 5JTTA 1L5QA 3MPUA 3QPVA 4QE3A 4BAGA 3O1IC 4JWTA 4Q4CA 1UM9B 1H5UA 1X39A 2Y1KA 3AR8A 4ZOEA 1PN3A 5M3BA 2XGJA 2GYYA 4MZDA 3P97A 3PQ2A 4QPCA 4M6WB 4X5OA 2I3DA 2ZJAA 5AKHA 5FOWA 3TPCA 3OIWA 1WBDA 1XD2A 1XYGA 2FJ0A 1AIPA 1GO2A 4WXRA 1S9DA 3EMVA 4G24A 4RGVA 1MX9A 3JASB 3FROA 2BL4A 3JW8A 4LXHA 3U48A 4D3XA 2QBYA 2ZSKA 3SF8A 3VMMA 1F2DA 3KKNA 3KOZA 1QLJA 1E5DA 3G2QA 1E3SA 3EG9A 3PTAA 3QTTA 5A62A 3S4YA 1YZHA 2WF7A 4N8EA 2XMCA 3G2KA 1M7HA 4MMZB 3IMFA 4HYQA 1JTFA 1J33A 3HCNA 3IAXA 1YR6A 1E1QA 4AK9A 4OHVA 4RHCA 5EHZA 3STWA 1W4ZA 3B3JA 4MV7A 2O06A 1XD8A 2L2QA 4PZAA 3QJYA 4YP1A 5KC9A 2VYNA 1BHO1 3D5QA 3CMMA 4YLEA 2CFSA 2AG6A 5AR1A 4E5PA 3H4VA 4A2WA 4MITA 2PL1A 1NJGA 3RIHA 4EM6A 4H4EA 4PLYA 2OP1A 1IWOA 1JMYA 1OX4B 3A6HA 4CL0A 4MJLA 2AR0A 3KVYA 4ITUA 3X1ZA 4KLCA 3C4QA 3H42B 1UEJA 5I5GA 9LDTA 1YA8A 4TKUA 2JVJA 2ZUBA 3OIYA 3HN6A 5K3BA 2EATA 3HBJA 4P4UA 3H5NA 3HLYA 3LRXA 5GONB 3ULKA 3LRPA 4D9KA 4F6RA 2E1PA 4BYGA 3EZNA 3N74A 4D5EA 2PKQO 4LCEA 2H1SA 4WJZA 1QPGA 1CUYA 3JWHA 1VGRA 4FJ1A 3MRVA 4M0UA 1VL0A 5HW0A 2I6QA 1DOAA 4CMJA 1E3WA 2V6JA 4QTUB 2W98A 1FTNA 2NIPA 5DNWA 3ROZA 4ZKDA 4GH5A 1SEPA 2D13A 3M5WA 5DZSA 1EKXA 4UE2A 5AVUA 1AO3A 2HXGA 5DM4A 1GT6A 4ZV4A 1WBJB 3TD9A 5KTSA 1SXJB 4AJPA 4ZO9A 1ISIA 3H8WA 4GSLA 2VQEB 2R66A 3SJAA 1ZXLA 4IIXA 4II2A 1G42A 4N39A 4B34A 4WJLA 4TSFD 1XNQB 4XJXA 1ORHA 1XKQA 4F60A 1MIOB 4Y7CA 1ZI6A 2IYSA 2X5KO 3KBOA 4TRNA 3B6JA 4AJJA 2GZAA 2P6PA 3NHBA 1FSFA 4PGFA 4BQPA 2R1UA 3K9LA 1S8AA 3UMGA 2ZBVA 4RDXA 2Q5EA 4KYTA 1FJGB 3Q15C 1TK3A 2GBIA 5F33A 4YI3A 2X1MA 4JR0A 2JCSA 4P86A 4I1YA 3EBPA 1ZLYA 4Y2XA 4TYWA 1QYXA 2EHJA 4IHJB 3RIMA 4RD6A 1BCRA 1H6CA 3S27A 4EJ6A 3SVZA 2YHAA 1F4PA 1TO1E 2DX7A 5EY5B 2JVKA 3V6LA 1Z6XA 2BFNA 5K45A 3P96A 2RBKA 3S0JA 1A9PA 1H0KA 2I78A 5E1BA 4OHYA 2XVAA 1DMSA 2BEVA 1YZFA 4XCQA 4HFRA 2BC9A 3LC0A 3MBKA 4B3XA 1JIQA 1AOXA 2GZSA 1C8VB 3HJGA 2ABWA 1SVLA 1YJCA 1Z0ZA 2Z95A 4MWOA 4Y8VA 3KVRA 4KDEA 1ZXBA 3DFUA 4IDBA 1AUOA 5AOBA 3P26A 4EIWA 1URPA 3ADDA 4FSHA 1A7JA 4XD7D 1MB2A 3HKDA 2FEXA 1CUDA 1RLMA 1U4SA 2VUHB 4C7OA 2XAAA 5EIBD 1VL5A 1MOQA 2C7RA 2QSUA 4OCZA 4AAYA 3S81A 1SU4A 3WB2A 3AEQA 3JQ6A 4JDPA 4MAFA 5DLPA 4DR4B 3ZY2A 4OOEA 4QC2A 4ZAGA 3PHBE 2QJRA 2ZB2A 4Z4CA 2KLHA 5K0FA 3UFXA 3FSGD 1V2HE 3A14A 4QYIB 4TZ6A 1OH6A 2ZE6A 1B14A 1ZQ9A 2EAUA 2HYIC 4M86A 3V8RA 2AFHB 1IXRC 2WIDA 3FTNA 1REQB 1N57A 2GCPA 3IXLA 4E5SA 4JLVA 1ZM9A 1E1CA 1HPLA 4UHBA 5CYGA 1BN6A 2J9GA 4GECA 4AF6A 5CVEA 2JD0A 4HEHA 5FYDA 1E3MA 3DXYA 2VHCA 3PNOA 4NMWA 1JIVA 2BEUA 3NIFB 3ZHXA 4LY3A 1PJBA 1ZGGA 2ECFA 4XUGB 3M5DA 3K1ZA 4O2RA 1RKXA 1XQWA 2HRBA 2VAXA 3KM0A 4RS3A 4TLEA 4B7AA 5L4NA 4RE6A 5HIJA 2J67A 1J1ZA 2C4TA 4OATA 4YRBA 4ZHSA 4WESB 2OMKA 5KJ6A 3F90A 3TM5A 4Q3EA 4ZQCB 2ADMA 4BB9A 1UAGA 1BHQ1 2BKVA 3ER6A 2NWQA 1X7XA 3EQ7A 1PCXA 5M34A 4NMXB 2XGMA 5JBIA 4Y6QA 1JTEA 2V4ZA 4JA2A 1GRRA 3NHAA 4YMWA 1GQRA 1K75A 1SUEA 5CX1B 4Q7QA 2I34A 4YUWA 1U90A 5HQTA 4H18A 2X0NA 1OQAA 5G41A 2OXEA 4AZTA 1T1JA 3S29A 2LGJA 2EZ4A 1Y8RB 4M3NA 3I0NA 3RSLA 3I45A 3SS7X 4BEBA 3AUUA 2WJHA 1SVNA 2OFOA 1J07A 5FBKA 5JEDA 2Q5OA 2C4MA 4X7BA 2WZBA 1KYTA 4RK0A 1Z4IA 5U4XA 4G4JA 1N7GA 3O3NB 1KC1A 3R3HA 4DSNA 3BTUA 3EG5A 1XKXA 3BRCA 1SUCA 1BG6A 1M75A 2YJNA 3G0BA 4PLZA 3ROPA 1YZQA 4R9SA 4JI8B 3CVOA 4JSYA 3W2HA 5CPBA 1CQZA 3GEBA 1I4DD 1R64A 4YMVA 1GRVA 1O96B 2CFIA 3ABQB 2O2EA 1ONPA 1QSGA 2RK3A 3GJ4A 3KDSE 3MRTA 3H75A 1W2WB 4BNUA 2JPDA 2GNPA 5FBHA 2AZMA 2UYHA 1YB7A 1UC8A 2FZLA 5H3HA 3OX3A 4GP7A 5KNBA 1MLDA 4YAKA 2QTFA 3CEMA 3MTAA 1MC4A 2J0VA 3H9EO 4IY1A 4D26A 1NTOA 4HGPA 1MJGM 1J4AA 3H99A 3QRWA 4B6SA 5ALEA 2GN6A 1KMHA 4NESA 2H2GA 5JCJD 2ZRKA 3T6KA 3OOWA 1E4OA 5DK4A 3IUSA 4BNFA 4ZVKA 3IHKA 3L0PA 3IL2A 1AKMA 4K3UA 1JFTA 1F38A 1RCTE 3CZQA 3ORYA 2JKYA 5K8JB 2X6QA 2CHFA 4UAJA 4BMDA 3D2LA 4FDVA 1UXIA 1NQXA 3WYCA 3ZC3A 4HGRA 1WSDA 4I5EA 3PEVA 1FYDA 1XXHA 2W8BB 3T0FA 4P6VF 3OD1A 1N0WA 3JQEA 1OFUA 3SQNA 3RSQA 4RVUA 5HP4A 3QWHA 1N78A 1D0VA 2JGFA 4MYCA 3M6XA 4C4PA 3TNFA 4GPTA 3ZVMA 4TTTS 1SC4A 4IUCS 3LBIA 5TT1A 1RM0A 1SPXA 1UMBB 2GK7A 1V4BA 4BC0A 5E4TA 3MOSA 3WMFA 3QUSA 4EGAA 3IAEA 1LLFA 1W85B 3LDAA 1DC7A 5L3QB 3GLHA 1K86A 4CEHA 1UMCB 1K6JA 4BKPA 5FF9A 4D8WA 3OC6A 1VKJA 5BT8A 3KE9A 3B1JA 3AZOA 1BS9A 3PFWO 4EMSA 3ZE9A 4FINA 2AXEA 2QE6A 5B4TA 2VJOA 4HNSA 1PJTA 5CB4A 1J5EB 1A9RA 2BBTA 3PR1A 3ZLBA 5G0WA 4CMGA 5K3FA 2B3TA 3FKQA 2ZXUA 3OOEA 3ZJTA 3IQHX 2OO5C 1JP7A 1OCEA 4E03A 4F85A 1Q84A 1WKBA 5J2UA 2NUBA 1V8FA 2HWKA 2FXVA 4J1TA 2IRWA 4AJNA 3WOHA 4I6EA 2P3SA 2QF7A 4AVYA 1IUOA 2IFTA 2BFBA 4H7HA 4HLCA 1Y8QA 1GADO 5FWYB 1KSGA 5REQB 1KDVA 3RSHA 5JHGB 2WIKA 5TGDA 3SJ7A 3SQMA 5FX2A 2B1JA 3P8ZA 5C1DA 1CR1A 2WSSD 4PNPA 1A1SA 1H9BA 1ZH8A 3WMRA 4GPEA 4NLLA 1NM5A 4HLQB 3JYQA 4EQ6A 2E85A 2XVYA 3MWGA 4F91B 4RHFA 3CJRA 2ODEA 4P93A 1TIKA 2ZETA 5JZOA 5JAMA 2XF8A 2I7DA 5LB2A 4ECAA 4HDQB 1ZJ4A 3VOAA 4OXIA 3IAS1 5IEBA 3EXEA 1ESDA 5BVGA 4YIHA 1BEZA 2D1YA 5JH7F 4IKPA 4JLSA 3GFQA 2JHGA 3LY8A 4KPYA 7AT1A 2KI5A 3V97A 1JR2A 1EGAA 2PQ6A 1I7LA 4BRWA 2PGNA 3CCBA 4HTFB 2Q0HA 5CD1A 4HQFA 4QFDA 1J2EA 1DAGA 1YGPA 2CLEB 5JSQA 4XQCA 1Z18A 3VDMA 2CV0A 1N6PA 3OLQA 3ORRA 3WB1A 2HU8A 4CM9D 2VDLB 4ZZ3A 1KBOA 5B6IA 5KQRA 4ZYTA 1G4UR 2G28A 4Q3CA 2J5BA 5H16A 3VU8A 5BSVA 1O97D 4D9CA 2HTFA 4XARA 4XX0B 4KX5A 3WLEA 4HX2A 1EBBA 2QAIA 4LA4A 4XDYA 3SLGA 4F9TA 1E2PA 5AI4A 5DMXA 5ESRA 2A5JA 1M83A 3U6BA 2AK3A 1EX7A 4Q7LA 1BE1A 1ONOA 2FN7A 2P9JA 3OAAD 5I8WA 3S2UA 3ZTYA 4FJ0A 5EP4A 5BOVA 1Q7TA 7MHTA 4RTMA 1NUTA 1W581 3QW4B 3AINA 4W9NA 4YP6A 4Y6PA 2J5QA 2JLRA 1ZBDA 4CNBA 4U4AA 1AXGA 3PHGA 3BK7A 4B73A 3AESA 1QQ7A 1G0OA 4XR4A 4LF9B 4C2AA 2OR3A 3MT7A 5B30A 4K81B 4L27A 4H0FA 2E49A 1NBHA 3NGMA 4KH0A 4OGFA 4B4KA 2ZAYA 1ST2A 4CM5A 1M6HA 3F9IA 4L78A 1DIRA 2R5FA 1TF2A 3A3KA 2YY6A 1E1YA 1P0FA 4QULA 5EUQB 3UAYA 4GPD1 1ARZA 3AT1A 3GYGA 3FUCA 4P35A 5J2TA 4OGWA 3EULA 1CEQA 2WIGA 3BCSA 5DASA 4BNZA 4F7DA 1IE3A 2VQ3A 4HK4A 4TTSA 5F73A 3L7OA 3I28A 2ZYWX 4K28A 3H1TA 1DADA 3I9NA 3QOYA 2OLJA 4LECA 5IVDA 3UJDA 1P3DA 1XWFA 3UJ8A 4CQLB 4ENWA 1XQXA 2XB6A 2FOXA 3NI2A 4GT1A 3RUEA 2CB9A 4MO2A 2V1XA 2EJTA 3ENVA 3GMTA 4HF7A 4ZC8A 3UB2A 1V16A 4YUZA 1QNFA 5CBKA 1YCFA 3I32A 5CA0A 3P45A 4N7JA 1GPYA 5BW5A 1ORTA 2Q6OA 3NX4A 5K8VA 3QYJA 1L7RA 2X2FA 1AGPA 1ONBA 1C7FA 1YB5A 2EW8A 5BN5A 5D3KA 4R5HA 3TZBA 3V48A 4JSTA 3WA6A 1M2KA 1F2TB 1KJNA 5F2OA 4HZUB 1RWKA 3GL9A 2Y76A 2ZTLA 2XRZA 1E0KA 1PWHA 4MA4A 1HSOA 5A4AA 2OV3A 4Z8XA 4POAA 1FLVA 2BTQA 3HZZA 4QNNA 2GN0A 1TF7A 3HBMA 2ZYSA 4JUIA 4UHFA 1JNYA 3BJMA 1UDRA 2XODA 5IBPA 3KX2A 4ZDKA 5IEJA 3ZJVA 2K4MA 3QXHA 1R6TA 2XNCA 1XKTA 4UUBA 4YMUA 5HKAA 2ORIA 2RHOA 2V7QD 3HP4A 1BD4A 4OB8A 1HTTA 3VH3A 2PWBA 3GDOA 3RV4A 3P9SA 5IDXA 2YFHA 4FEEA 2LCQA 1SY7A 2R4QA 2NTEA 2QD5A 1YZYA 5U1PA 1RBQA 3JY6A 1Y9DA 1NURA 2GCEA 4UZEA 3DL7A 2FV8A 3AHIA 2VP4A 5AT1A 1AKQA 1EWKA 2SCUA 1YACA 2WJIA 3RK0A 2HM7A 1I7PA 1WSBA 4L85A 3WLPA 4I2VA 4KIWA 3W5UA 3AUSA 2J9FB 4QBHA 4AC9A 1P4SA 4DC1A 3KALA 1QG6A 3BICA 2I9KA 2NXCA 5AVYA 3OQNA 2TS1A 2AYYA 2ZYDA 2X0DA 4MVJI 2VPXA 4EOGA 4LE2A 1Y1LA 5I7AA 1JB1A 3LKZA 5IJ9A 4CE6A 4Q9AA 4RZHA 4C6RA 5ICFA 3WLRA 1GUZA 4RTOA 2R6R1 1DIOB 1A69A 4FMCB 5I7SA 1G5PA 4KV9A 2VXBA 5EXDA 2EERA 3NMUF 3SKXA 1L3BA 1M10A 4UEWA 4X6YA 1N2OA 1P8AA 3CLUD 3F1KA 4QASA 1OOEA 3RVJA 4UPVA 3PRYA 4F3KA 2WQ7A 1CZHA 2P75A 1Z35A 5G0SA 4D96A 1P6UA 4COKA 1H6DA 1GARA 1Y5RA 3STTA 3ESRA 1ZSNA 4PSCA 1CXZA 4I08A 2FI1A 1G5FA 1AMNA 3OHMA 5AICA 4GS5A 2UXBB 1UDXA 1KU0A 2OCXA 4RPKA 4KE6A 5IU6A 4F12A 1U65A 3R40A 5K01A 1W4RA 3GN2A 3QHPA 4JN6B 1QB8A 1XZGA 2XITA 4DVGA 2IUEA 2DSNA 2OHHA 3LVRE 3W5SA 4FYIA 4S3MA 3H4TA 3S7ZA 5GZ1A 4YRJA 4DEVA 2WIAA 1ACMA 3GO4A 3OU6A 4LBYA 4QYTA 4R8SA 2IHNA 3K0FA 3FPSA 4QRHA 1YAHA 1EE2A 1I2BA 1I5EA 1DO2A 2Q07A 3NR2A 5CLFA 1DZ3A 4LDRA 1X3SA 5DWVA 5FFNA 2VF8A 3OKPA 3RNOA 3V1UA 3W6UA 2BUAA 5P8WA 3LVFO 1FYXA 2B69A 5JSHA 3KELA 3C8HA 1G4AE 1GQ2A 2QA5A 1JIUA 1R0CA 4ZAWA 621PA 3AR2A 4O3MA 1EM8B 1LSJA 3AM3A 3H3JA 3LCRA 2POQX 3EJWA 2EIHA 4G0ZA 3GAFA 4WK2B 5DBFA 5DIFA 4UTNA 2O23A 1SO8A 3OFJA 3DAGA 1DMRA 2EXXA 2GAIA 5B4UA 1OHHA 1CZNA 4NI5A 4WK4B 1SM4A 4N0MA 3D0RA 5AUQA 3PUKA 5HS6A 3ZQJA 5KYWB 4FR5A 4PIVA 1M2VA 1KKMA 3NCHA 4LQ4A 5F7JA 3PGA1 5E7MA 2YJ5A 1NW9B 3K94A 1HDYA 3O4RA 1WZCA 5J58A 2FSPA 3IODA 1VFPA 2FSIA 2QQEA 4QNMA 3RUHA 5AK3A 3SHQA 2DWPA 3DP9A 5GY7A 4H2DA 4H3HB 3UC9A 3GDWA 3MBOA 4XYMA 3D3WB 4XEUA 3VHLB 5K0EA 1R0BA 4G8BA 3FPHA 1GTRA 2G9VA 4KXLA 5AJXA 4D0LB 1GCAA 1Y4ZA 4FS8A 1IK6A 3LD9A 3WGUA 2R4UA 1CX9B 3LY9A 4F6LA 1PHRA 3A9SA 5LZ7A 4ID9A 3M89A 3RVDA 1NXTA 3H97A 1H94A 1YB2A 2WG1A 1MQAA 1F9EA 1O4VA 1SD5A 1WNTA 5FOUA 1X8KA 4L1KA 2Q3EA 2YINC 2R7MA 1PJ4A 1E2UA 2W00A 4DUZB 5F7ZA 2PNFA 4PFKA 1BMTA 1TCUA 4FFPA 2M32A 4GOKA 4NAHA 3ZS8A 3SLRA 5CX4A 1A8PA 5DHSA 3B3AA 2G1KA 4JLUA 1RPNA 4JOSA 3KU4A 5IKMA 4OLJA 5KSPA 1OI2A 2IXBA 3AWDA 4NARA 5BSRA 4QG3A 3FYUC 1XLTA 5G1NA 3L3BA 4W5HA 1PNRA 3RYCB 2VZ0A 4ZMBA 2ZJ3A 2OZVA 2ATXA 1CF2O 2BDTA 5E1OA 3RH0A 4ZXPA 4IGFA 1UR5A 2JI8A 1TL7C 1C7ZA 2AVNA 1Y1TA 4MW6A 1JAHA 3EZLA 4UE3S 3SZUA 1FXWF 4JUFA 3DKPA 5LZ8A 4E2ZA 1EX6A 3SS9X 4Q7KA 4ABYA 4AIRA 4DCUA 4JELA 4C4TA 1EJ0A 3QNMA 3PC8A 2OP0A 4G0WA 4LVCA 5DU2A 2XECA 1YR7A 1EESA 4DSUA 3MPOA 4NFLA 2Q5JA 2XEXA 3FCXA 4NCXA 1Z82A 3ECSA 1PR1A 5DH9A 2Y1FA 2B4KA 4MCHA 3STVA 4URFA 3U16A 1NBWB 1HMYA 4PHTA 4CCWA 3B60A 2ZAOA 3R8CA 2Y1CA 3L6CA 3BHIA 3U17A 5B58C 1E1DA 4K2AA 1RHJA 3WKBA 2D00A 1DXHA 2JGIA 4FX5A 4KXXA 4V0KA 3HYSA 1RWWA 2HHAA 4RL6A 4XAQA 4IR7A 3TFQA 4EELA 1U9ZA 2VAVA 4U3JA 2XT0A 2W9XA 4OHWA 3W05A 4XWKA 1Q3KA 1OBCA 3THOA 2DY0A 5IT5A 5IZCC 4TT8A 2CWWA 3B53X 2WKQA 1M5UA 3W90A 3H5IA 4QLBA 4JQSA 1RRPA 3SBOA 2ZTSA 5ALVA 3GLIE 2FN8A 2XRMA 3EVCA 3LX4A 2VJMA 2VUSA 4QOJA 1Q1QA 3SEZA 3R23A 3MJDA 4ZU3A 2IOQA 5K3DA 3L4JA 2R6AA 3CH4B 1P60A 4FYHA 4JX9A 3VOTA 4AP9A 3BMXA 5KWSA 4Z53A 1U9YA 4J0EA 1CQJA 1KY4A 1OWOA 1VGQA 1ZY2A 2PGOA 2I9PA 4YI5A 1OV6A 3KZNA 2RHMA 3GPDG 3PFHA 3RVBA 4B40A 3EGVA 3KLOA 4E0BA 4EHIA 3F7OA 1Z2EA 4LQCA 3T52A 3CSSA 1DQZA 1FNSA 3K3PA 3OUTA 4L5BA 2IYOA 3O6VA 4GMKA 4HWRA 4U7FA 1ZD4A 3MEQA 1A4IA 5KJEA 2BFAA 2C42A 3B9QA 4HQOA 4EHFA 1G6Q1 1GTL1 2X7XA 5FR1A 4YR7A 1EXVA 2XCLA 4DQUA 4UAUA 2EDAA 4D5GA 3U7EB 1W0CA 3RBXA 4A2PA 1YCGA 4MK4A 4OP1A 3SN6A 5TV2A 5CFOA 5F9HA 5M7EA 1SBIA 1CHNA 3L4EA 3PQ6A 4PICA 1J8MF 3TECE 3VNAA 5B2FA 2ZI4A 1CQWA 2GF0A 5BRJA 2BMFA 1BQ3A 1BN7A 1QE3A 2I2WA 3I4CA 3KJIA 4YJDA 3VHXA 3GEGA 4HT3B 1KR5A 4PCUA 2PMDA 2PSFA 3WNVA 4E1AA 1KBZA 4RTNA 1VE1A 1H2YA 3AJRA 4RKEA 3WO0A 4BVKA 3A28A 3NCTA 3DXFA 4ZYYA 3PK0A 4XSVA 1AV7A 4CDNA 3FJOA 4GXRA 2ZRLA 1NKSA 2AQHA 5A4KA 1ZD3A 1LY1A 4Q1VA 1KTVA 5ETJA 2OTCA 4D9HA 4EF4A 4LC9A 3AVVA 2AXPA 3OZUA 4ZJPA 5TX7A 2Y8EA 2RAPA 3C8MA 3H2YA 3WHKA 1PTJC 5C52B 3AB8A 1B8OA 2NZVG 4D4GA 2QNIA 3ECCA 4MPJA 1WOMA 1Y4SA 1XPRA 1RADA 1R3DA 2G0AA 2JI4A 3B2NA 1UEXC 3ETCA 4FT2A 4MV0A 2P6RA 2O8DA 3AY3A 4WECA 4JR1A 3WGHA 4PO3X 3K2IA 4UJ3A 3ANYB 1NY6A 4ISCA 1NBEA 3BQNB 1YDEA 1Z6QA 3U1VA 2K5UA 3UMCA 3T0IA 4D4KA 3L01A 1XEWY 1P9NA 1PL8A 1TZMA 2FPLA 4OYRA 1ZD9A 4FEGA 4Z2YA 4OHMA 4KWCA 1D7AA 1A7KA 2JD2A 1JLSA 3INYA 1E3DA 1XHFA 2I3GA 4YRNA 5CYPA 5IXJA 1KRHA 5KNCA 1Z37A 3N9IA 1TTQB 4EY4A 4QQ8A 1DJQA 4CBVA 5FD8A 5CR9A 5AYVA 1O6CA 2IH4A 1YRLA 3TQRA 2A8YA 1JLMA 1JDPA 1N3BA 2R8BA 3LF2A 4DTIA 1QVRA 2I67A 3K9HA 2X6RA 3MF4A 2JFGA 4Y1GA 4OHXA 3UH0A 5EJMA 1OYYA 3BCHA 5F1KA 3VBEA 4OAOA 3Q6NA 2BGGA 4D6XA 1OROA 4P7GA 4XYGA 5JYBA 5K9ZA 1AY0A 1P7ZA 3G89A 1DQYA 3QW2A 5BWNA 4LXGA 3GRUA 3E2MA 4GRAA 5IAJA 4DBVO 1Z9BA 3ZIAD 3MA0A 1U7UA 3EX7C 1VHDA 4XFDA 3FB4A 3AGQA 2GK3A 4II3A 3ETLA 3GU3A 2J9ZB 4F04A 3STXA 1H85A 1D2CA 3TPZA 1Z22A 3UMFA 2FXIA 2XA2A 2WYWA 3FFWA 3NWEA 4MZXA 4BO5A 4RCYA 3B9BA 1SCJA 4UULA 5NLLA 3QHAA 4L3WA 2IYLD 4M76B 4L16A 1U2PA 5D3QA 1GOTA 4PN7A 2PUEA 4JT8A 5ENDA 3GH1A 3AI1A 3NW9A 2E7ZA 4RK5A 3A10A 4HNQA 3PD7A 3LCJA 3AVWA 5JH7A 3ZEIA 1WX1A 3D2BA 2XCQA 2Z1MA 1CUAA 1WW8A 1YOVB 2OHIA 4BO2A 4PZCA 5FI5A 1CRWG 5BW6B 1XDSA 3E6AA 1SOWA 3JR7A 1XEAA 1IMJA 4DTCA 2XKAA 2HA7A 3TEJA 4UVEA 1VECA 3F3MA 1BGWA 5BN4B 1OC2A 1H9CA 2YZKA 3P9NA 4HQ6A 4JBNA 2ZIUB 3URKA 5JO9A 4GDFA 2ZZMA 1CULC 3LM8A 3M1AA 1JE0A 2RD2A 1I24A 1TW2A 1FYVA 4WERA 3TCNA 4C5BA 5EWLA 3QP9A 3GCXA 3P7MA 5A9SB 4RTPA 3ED1A 4O4JB 5B2EA 3KSZO 5JS8A 2PRZA 3HACA 2XOXA 1GP2A 4RKQA 1Z5ZA 2ZE8A 3B7WA 10MHA 1KJWA 2GJ8A 1KIMA 2WWWA 3GLIB 3HVUA 4OF4A 2ZI7A 2WW8A 3UH1A 2B35A 3REGA 2C0QA 2YWGA 4X92A 1LU9A 1Z4OA 1B6TA 2CVFA 3KFVA 3T1QA 2ID9A 3MWKA 4MVJM 3VC3A 1YE5A 4G0NA 4DVJA 1KEVA 1T1SA 2AH5A 2QYTA 3BMCB 3DW1X 4DSAA 4QUEA 2GEFA 1RFLA 3ET4A 1UINA 2XQIA 2ZUCA 4L02A 4L73A 5FTMA 3K70C 2X9QA 3RFXA 2RC5A 1C8LA 3EVEA 1ZOPA 3AFHA 1IUPA 3RB8A 2MJLA 2OV2A 4WKOA 1GLVA 4G5FA 3T1VA 1E9FA 1EDBA 2YBDA 4UXIA 5LP1A 4KBYA 1YJAA 3GLGE 4HWPA 2HLHA 5IN4A 2J87A 3DKRA 4TTJA 1GV1A 2WJJA 4LF8B 2HMTA 2HNKA