4Y6QA

Human sirt2 in complex with 2-o-myristoyl-adp-ribose
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
288
structure length
287
Chain Sequence
ERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-2
publication title Kinetic and Structural Basis for Acyl-Group Selectivity and NAD(+) Dependence in Sirtuin-Catalyzed Deacylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 92
structure length 287
sequence length 288
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.-:
pdb deposition date 2015-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4y6qA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4y6qA01
4JUBA 1YHZA 5MFPA 1NM5C 5EJ4A 2JIBA 4KXQA 4JUDX 2VK1A 1OZHA 2FR8C 4ZP1A 4JD5A 2VK4A 5EJ5A 2PANA 4D5EA 1Q1AA 4JUAA 1T9DA 1U31A 4RJIA 3ZGVA 4K9KA 5K2OA 4UTVA 5FEMA 5EJ6A 5EJ8A 4FEGA 4IAOA 5EJAA 4BVHA 4JT9A 4C78A 4MPJA 1XLTC 1V5EA 2B4YA 1PVDA 2UZ1B 2H4JA 4Y6LA 2DJIA 1U2DC 4UU8A 3RIGA 2WVHA 5BWNA 2JI6A 2W93A 4BVGA 1U2GC 5DGDA 4BUZA 2H2DA 4Y6OA 2OORC 4K9QA 1T9BA 2JLAA 4I5IA 2Q5LA 4UUAA 3D7KA 1M2JA 1MCZA 4J16C 4K9LA 1T9AA 4V1CB 2OD7A 1O96B 2PGOA 1ICIA 1M2GA 2PGNA 1YHYA 4RJJA 3EA4A 2H2IA 3U3DA 4ZZIA 3ZG6A 4FEEA 3FSJX 2JLCA 2UZ1A 4K9NA 1PNOA 1OZGA 1V5GA 4BV2A 4BVBA 3IAEA 2JI8A 1PNQA 1U28C 3D81A 4K9OA 4D5GA 2VJYA 4KGDA 3ZGOA 3F6EX 2JI7A 2NYRA 1OZFA 1EFVA 1OVMA 5K6TA 3IAFA 3JWPA 4BVFA 2A1TR 2H2FA 4RJKA 2AG1A 4JUCA 1MA3A 4BN4A 4GP9A 2Q28A 4G1CA 1M2KA 3D4BA 2HJHA 3CLRD 2EZUA 1HZZC 2VBIA 2EZ8A 1V5FA 4GM4A 5MGNA 4FZ3A 1QPBA 4JSRA 4MQ5A 4RMJA 1S5PA 4GM0A 2Q27A 4IF6A 5BWLA 2IHVA 3CF4G 4UTRA 2EZ9A 2FRDC 2X7JA 4QELA 2H59A 1Q17A 1YI0A 4IG9A 4BVEA 3CLTD 4TWJA 3GLUA 3K35A 2FN3A 4JT8A 4JU9A 3PDHA 5DEIA 5MF6A 4GPEA 4HDAA 3RIYA 5EJMA 3PKJA 3FLMA 3HWWA 4MPRA 1YC5A 2AG0A 3HWX1 4UTNA 2OD9A 4O8ZA 2H4FA 4X3OA 2EZTA 4RMGA 1UPCA 1YI1A 1SZDA 4BV3A 5K3SA 1BFDA 4GM1A 4FVTA 1PTJC 1PO7A 4UTXA 4X3PA 1YBHA 1Y9DA 1D4OA 1PI3A 4TWIA 2QQFA 4V1CA 3EYAA 2OO5C 4UU7A 2A1UA 1YNOA 1YC2A 4MPPA 4HD8A 1JSCA 3PKIA 5D7NA 2WVGA 5EJ7A 4K9MA 1J8FA 3OE1A 1Q6ZA 1Q14A 5MFZA 2V3WA 4R8MA 4L3OA 2Q5QA 4QQ8A 2QQGA 4K9PA 3F6BX 2BRUC 3CLUD 2EZ4A 3GLSA 4L2IA 4JUFA 2H2HA 4BN5A 5IMSA 5DGTA 2Q5OA 4J1TC 3EY9A 2Q29A 2NXWA 2C31A 1M2NA 5BWOA 2VK8A 1POXA 1UPAA 4UUBA 4GG1A 2JI9A 1T9CA 3GLRA 3CLSD 2VBFA 2VBGA 1UPBA 4RMHA 2H4HA 2FSVC 4Y6QA 4RMIA 1POWA 1PYDA 1E3TA 1PT9A 1EFPA 4C7BA 1DJLA 4Q9DA 3FZNA 3U31A 5FYQA 4MZXA 4COKA 4F4UA 3LQ1A 1YTLA 4F56A 1Z8NA 2IHUA 4UTZA 3E9YA 4V1CI 2H2GA 5AHKA 2WVAA 5K6RA 2IHTA 1M2HA 1S7GA 4JU8A 3GLTA 1N0HA 2OD2A 2Q5JA 1O97D 4QPZA 1SZCA 5EJ9A 2FWNA 3JR3A 4KPUA 1ZPDA
chains in the Genus database with same CATH superfamily
10MHA 5AXCA 2ENUA 4MUMA 3QF4B 4R01A 1TLLA 5K3CA 1JSLA 5CX4A 3K2QA 4KXQA 4Q3EA 1RC8A 2GBPA 2QENA 3MTQA 1GG2A 3IQEA 5C8VA 5HOEA 2J4CA 1XCJA 1PBNA 4JC5A 4E5SA 1KFEB 2HF9A 1ZLYA 1IATA 2GXUA 2HT6A 2F00A 2M6LA 3NWPA 5BOSB 5LQAA 3D8BA 4GPAA 2ZE8A 4YQFA 2DYKA 3IOEA 1FSFA 3KLPX 4EYQA 1DIBA 2R60A 1JUDA 1MGOA 3QY0A 4EQZA 4XVCA 5C46F 1WMFA 5BURA 5GIPE 4RQBA 1NW6A 4YP0A 5F9FA 4EI2A 4YROA 1AV7A 3DOEA 3AL0C 1S3SA 1U8AA 3F7OA 2LW7A 2FXIA 4CKEB 2OESA 4W1SA 5GMOA 2C8KA 2Z1DA 5DE3A 2Y6VA 3TDNA 4PFKA 4YJ3F 1PG5A 3TQTA 2XWQA 5FEMA 3NH9A 3SEZA 4WOJA 2ZCJA 1ETHA 2V9ZA 1D2HA 3JD3A 2QTFA 3QKSB 1GDHA 2XNCA 4G9BA 5FFFA 5ARDA 4CKXA 1JHRA 3R2JA 5K51A 1BEEA 2IHYA 2JRLA 3ZI0A 1G8FA 2VJKA 4RZIA 5C53B 3ITDA 4RXUA 4YO7A 1K63A 4KC0A 2FXVA 1BX0A 1GUYA 1PSDA 1JQAA 1A82A 1ZXLA 2Q0XA 2VJQA 3A3KA 3CEMA 4QHYA 3CGGA 5D3KA 3K0SA 1G17A 4U6SA 2IBMA 4MP6A 2JVJA 3RS4A 1CWUA 2XTJA 5NULA 4HQ6A 2EKQA 5CH3A 1XU7A 3O1IC 1S02A 4CG1A 1RM0A 3O3MB 2RBGA 3I6BA 2H1VA 4OAPA 2RHOA 1I6KA 2DJIA 3F4BA 1QX3A 3LPNA 3RC9A 5FWXB 3MQ4A 1PEKE 2QAGB 4P58A 5DK6A 4FJ2A 1QO9A 4H17A 4A5OA 3G0IA 4LYFA 5CVCA 2F8TA 4TTJA 3OZGA 4XRRA 4GBMA 2QHXA 5EYPB 3TTXA 5HIMA 1DRKA 1WUYA 3QBEA 3UUEA 2R79A 5B1YA 1DCMA 2LKCA 4O2BF 4OREX 1B0AA 4O3MA 5DYIA 2HK7A 3QW2A 3CNHA 4D45A 2YWBA 1VYTA 1O57A 4O2AF 4F8YA 2ZE6A 4F9FA 1QPGA 3OP4A 1TCAA 4Z5XA 3CBGA 3TCKA 3GOQA 5AW9A 4YB8A 2VC2B 1BMQA 2HLNA 1TVEA 1PG2A 1IEWA 1ZGBA 2QLNA 3KOWA 5A6SA 3H97A 1VG0B 3GGJA 4KN8A 5ARCA 1VIMA 3PT9A 2G28A 3PJRA 4OA5A 1PS9A 4TL9A 3AEKA 4YJHA 2G77B 1U2DA 5DM0A 5ITZB 4K9LA 2WF7A 2EHDA 4V1CB 3H19A 1TEZA 2F43B 3AWDA 4V3CA 2PN1A 3CEJA 3OIWA 4LXYA 2JJ2D 4EW6A 3HUDA 3OQNA 4DARA 2GEBA 4C4XA 4XJTA 5A4IS 2XHEA 3Q7RA 1U8EA 4BPRA 2R5WA 4WTOA 3WL4A 4D6PA 1OYWA 2RI1A 4QGFA 1TYBE 3AHEA 2C8VA 3RK0A 3ZDZB 4ZU3A 2IZ5A 1M5TA 1SR8A 5JDIA 3QXSA 4TKMA 1IBSA 2BZSA 1SD5A 5JZBA 2H63A 4B9EA 3MWLA 3EGIA 4QRDA 5B1SA 2ZROA 3GMIA 3NETA 4DUPA 4NCIA 7AT1A 3L1KA 4RV9A 4I6JA 1O4VA 1LZKA 2BGRA 3GJRA 5DU2A 3B51X 4XZ3A 3ZHRA 2JFBA 2EW8A 1MIOA 2OQ2A 1DIAA 1GL3A 2Z57A 3FKSD 3O91A 1VTKA 5F35A 4ZWNA 3TOXA 5CFZA 2IDZA 4F3CA 3EGOA 1J09A 1PFGA 1JHAA 1XWFA 3OESA 4AG3A 1PK9A 2REBA 1NFFA 3PLRA 2IIPA 5SZHB 1GZSA 3HYNA 3F6EX 1E3WA 3K0AA 1IL0A 3Q9UA 4JL6A 1PD0A 2JI7A 2VFAA 2OHOA 4QHTA 4TUYB 2XTMA 3PNKA 4EF6A 3W5CA 4N41A 3GG9A 4AO8A 4IJVA 3DV0A 2Y1OA 3OJOA 4R1NA 4MRVA 3MT0A 2B8JA 3BIJA 5ADHA 4DT1B 4M6WB 2GKGA 2FMFA 5AK0A 1BD4A 2FW1A 1AZLA 4G0YA 5LBUA 1CUJA 3A6EA 4ZGGA 3WWEA 2P69A 4PLHA 1YULA 1WSWA 3UA3A 1ULSA 5IPFA 3OLWA 1NZFA 1FDSA 4FCVA 4N1AA 5BORA 4JLJA 3EGWA 5L3ZA 2YWFA 3WDKA 1F9EA 1WW3A 3WB2A 3K94A 4C6TB 1KJ9A 4CMKA 2OAQ1 5JXGA 4IQ0A 3DBLB 4DCUA 3LP5A 4OIFA 3RVSA 5FI0B 4QDUA 4I4CA 4CLXA 2YWHA 3ROGA 5E7QA 4KR2A 1DCFA 3QE2A 2EFJA 4PFJA 3PR2B 3KUCA 1NI5A 1PUXA 3HXMA 1HZZC 5CPFA 2YCBA 4N0QA 4RE6A 5DLYA 3LKVA 3I6YA 2M6RA 4MDHA 2VL7A 4EJ2A 2N0SA 3I12A 1W1UA 1WKCA 1RIIA 3KHTA 5AKYA 3ST7A 3ITKA 2VSQA 5A3QA 3ICVA 4LJ4A 1ZEMA 3UAVA 3F46A 1VMEA 1P61B 4D82A 1H1LA 4X1YB 3L0SA 3QSGA 5HJEA 4CM9D 1WNFA 1M76A 3FB1A 1K3TA 1PT7A 4Z49A 5KHLB 5L8VA 4X8HA 2D3WA 4Q1EA 1D7OA 4O0LA 1JKXA 5J4LA 1PHPA 3EG9B 4MV5A 1I7LA 1KERA 2PHZA 4KPFC 1XQVA 3VPBA 3PE4A 3K9FC 4NAHA 4OYLA 4MQFA 5CRIA 3EZ9A 4F72A 3R6TA 3KJNA 1IIBA 4ZZ2A 4DIBA 5IANA 1OU4A 1GGMA 3M9WA 4BUJA 3Q0IA 4PTLA 3LWDA 1GPDG 2V6FA 2Q0QA 1X7GA 2C42A 5CURA 2B7CA 5BV0A 3VR1A 3GGGA 1Q16A 1QHEA 5JASA 1IYZA 3RVOA 5HR5A 3ESXA 1YDHA 2EP7A 1J39A 1RKUA 1P2BA 2FN9A 2OC4A 1GQ2A 2R47A 1UT8A 2VHZA 1Y3CE 4EW1A 3KQLA 3COSA 4QULA 3FVWA 4JLUA 5B53A 2AYZA 3DMRA 1Y1KE 4AMZA 3EVCA 2Y1CA 3CR3C 3QEMA 3K35A 3TGWA 1ML4A 3HK2A 2V45A 2PKYX 2PRYA 5EJ2A 1WSBA 1WRBA 2QX6A 5SYMA 3C3XA 5AW3A 1MQSA 5CYOA 2IUEA 5HNKA 1ZCFA 2HPZA 3KD2A 4LNUA 2Z4TA 1DDGA 5ALDA 3SQNA 4BKQA 5JXHA 3T3NA 4MR8A 1MAWA 3HYCA 3ZI7A 1P6QA 2NQ2C 1NQUA 4RD2A 3DCJA 2C5LA 3AW9A 3PXDA 4V0LA 4NI5A 4OJMX 5JNLA 4N3AA 3WDMA 4KZKA 2FQWA 3NTOA 4B76A 4EG0A 5JPDA 1H69A 1WQ1R 1B1AA 3OQVA 1ZMRA 2FRDA 5JYEA 4UHCA 5J5VA 5K3EA 1G3UA 4A0RA 4YH1A 3HC7A 3WQRA 4CUZA 1G8AA 3CLSC 3FLMA 1GDTA 1FFAA 4UCQA 2BFEA 3TW0A 2BYTA 1RHRA 2I2FA 2WLTA 2YZKA 5IJ0B 3JCZA 1PEYA 1V8DA 3NNDA 3OMXA 3VDMA 1GKYA 4R2MA 4EA9A 1XNRB 2F64A 1ZIDA 3N2KA 3E4CA 3HP4A 4C03A 4D7AA 4C2AA 2WEKA 4XPIB 5JZSA 1FBNA 1GR0A 3IAAA 1EKXA 4R69A 3QIVA 1PV1A 1A8PA 1E7QA 1Y98A 2BGUA 1V2HE 3A6KA 3FVTA 4FFLA 4I99A 3V55A 1RYFA 4KX3A 2PLAA 4C29A 5C4IA 1KMHB 5TNXA 2IEAA 4EABA 3HKDB 2P4UA 1QB7A 2A5GA 2HFJA 1ZGAA 2X7XA 4KBGA 4QDOA 4QU8A 5L4NA 5LLDA 2HAEA 4PO1A 1JR6A 2VZLA 3DM5A 2LBPA 4H1HA 4IDEA 3RH0A 4QXMA 4GM1A 4LXHA 2R8XA 4FHFA 4DANA 3BE6A 1IMOA 3PA8A 3LYAA 1W6UA 4K9SA 2B2CA 1J0CA 3R77A 1KDRA 3HJHA 3W1EA 1FJXA 2J9YB 3RC7A 1O2DA 1VGQA 2VP9A 3D7LA 2H4ZA 3ET5A 3O03A 3P0FA 1DDOA 1JKJA 4UHFA 1JSXA 1M5RA 4KQ2A 1CDOA 3FJYA 3U5ZB 4X41A 3UOAB 1AUQA 3JQRA 2RGCA 1QOZA 3TPCA 1IN5A 1F48A 2PKQO 3C5EA 3TFOA 2C03A 1DX4A 1LC3A 2BCEA 4S1PA 4TSRA 3WX0A 1J0XO 3D6VA 1P6UA 2B36A 1GUZA 4N9WA 1NVWQ 1RS0A 1WHSA 5EC8A 3EIXA 4BNDB 4QLAA 2RMKA 2PRIA 1FYDA 1JVNA 1BE0A 2SICE 3OQOA 2KM1A 1SU7A 3KE8A 3O90A 3GHHA 3SFZA 3TAXA 2XZDA 4DB2A 2LPMA 2YV4A 3U0VA 5B58T 5JBNA 1T3LA 3I1JA 4LDJA 1C81A 3H86A 4ZCQA 5C4GB 1SB8A 4EG8A 1U28A 4MYDA 3BM5A 2N46A 3MEQA 2FQ1A 4FWTA 2ZJYA 3S7ZA 1EX6A 4XVHA 3VPCA 1K75A 3SZGA 1AKEA 4JI0B 1NC3A 4HFNA 2V0NA 1W2HA 3UANA 1E2LA 1BYIA 1V45E 1YOBA 2KWIA 1TTQB 4EWLA 1VHJA 2GT1A 1NBOA 2AEEA 5DN6A 2D5AA 4EA8A 5JC1A 5KINB 2BISA 1V9LA 4WEQA 4M38A 5J43A 5LD2C 2C9MA 2VBCA 1UXKA 1ZQ1A 1BMTA 2AJCA 3AEQA 1NR1A 3LOQA 3X0DA 4PX2A 2PX5A 3T1YB 4JT4A 2IGBA 3ORYA 1NLMA 1Y4DE 1YNSA 5K01A 3A37A 1NOIA 3AVPA 2ETXA 2QQ0A 3DDOA 3LTEA 4YALA 2WU0A 3MJFA 3V4RA 4ZAGA 5HRAA 4URYR 1ZK1A 4HNTA 2VQ6A 1X42A 1Y7HA 1SG0A 4WA7A 4F1JA 1VMDA 1R74A 1HE8B 1SCIA 2J6CA 2WUEA 5AKEA 4EPTA 2H31A 1B26A 3G6KA 2H1RA 1VLZA 3MSXA 2VSFA 3HJRA 1JEYA 3B3AA 3UK1A 5JNTA 1QG6A 3FUVA 3AY3A 4P83A 2DQZA 1SELA 3UJBA 4LHSA 4NAVA 4YAJA 3ZK9A 3RS5A 3G9ZA 3U4QA 4TSFA 4QOSA 3IP9A 1AHHA 1S89A 2H2HA 1RJ9A 2I2DA 4MUEA 2NXNA 3R09A 4NEGA 4KE6A 1TEVA 3I0NA 5EQFA 4HDNB 3CW9A 3JAKB 2ZULA 2C2OA 2Q5OA 4IFTA 1P60A 5E4JA 4DLYA 5B1HA 5K8LA 3LOUA 3IULA 4PZ9A 2C31A 2AI1A 5FP0A 3NEPX 4G0MA 1XJ0A 4DR1B 1XLWA 3AF3A 3OKCA 4WXEA 2PKEA 1VPVA 3O94A 4YRZA 3UK0A 3VUFA 4KJZA 3Q11A 3SIXA 3PG5A 4TKVB 4YCNA 3ETNA 1QCDA 2YV5A 1QRRA 3N8HA 2GPTA 4G81A 3WQQA 3NBXX 3PEVA 2VHWA 2GCOA 1Y34E 3AHFA 3PU6A 3K15A 2VBFA 3HNRA 3PGXA 1I2AA 4N01A 2UU9B 2PZFA 5K3FB 3DT8A 2W37A 3DE1X 3FYDA 3ZIAD 3CIOA 4R84A 4YVFA 5EZ6B 2AHRA 4JIGA 2WHXA 3NPAA 4QDZA 1MT3A 4GI7A 3VC7A 1PEDA 1UBSB 1PYDA 1Z7EA 2C9YA 4U63A 1KZGB 1N2CE 3PDUA 4EGCB 1EFPA 3D4OA 4ND8A 1DNPA 2ZI4A 5I51A 4LY0A 5ETJA 5KWSA 4D8UA 2Q1TA 4DCTA 4QBTA 5LOVF 2WB2A 4BO4A 1JX6A 1ZNWA 3LPLA 4YI5A 1WULS 1WLSA 3FZNA 4YDRA 4K9DA 4Z8XA 1UWKA 5FYQA 7REQA 1CEEA 3MD0A 2HHAA 4UARA 1OC2A 4GX0A 4P7FA 3VR5A 5CCEA 4Z1MA 2FJPA 2LCFA 4IW3B 1LPOA 1Z45A 3A6FA 3JRNA 2IV3A 2H11A 3GUYA 3E9YA 4E32A 5JQWA 1FMJA 5CYFA 2PWYA 3HA7A 1F4LA 1DCKA 4FD2A 3MFQA 4JP3A 4CFYA 5LQDA 4KYIB 4DA4A 4WLFA 1EG7A 2H9YA 4N4AA 1B8NA 1M73E 4DMMA 2J6HA 3AFHA 3DG9A 4EDFA 3HY3A 3RJTA 1UZUA 1YSCA 4FHZA 2ZBEA 4U0KA 5CHEA 5K6RA 1DQRA 3NAZA 4OA8A 5FOWA 1VBKA 4LOLA 3HCCA 1KJJA 1J9EA 1YBMA 2B2NA 2XKBA 4LWQA 1C0IA 4MR9B 5C8ZA 1UBRS 4PBSA 1J2EA 1VPTA 4K6MA 4A6EA 2QV0A 2IXEA 3ZWYA 1JFSA 3RV3A 4NBRA 1W2WB 4AKTA 3RWMB 5FOVA 3Q8KA 3GYBA 1EWKA 5EGSA 4EQ6B 1GPBA 4WX2B 3M9XA 3OOSA 4F4FA 1BXRA 4YQZA 3ZZ1A 4QWMA 3V8MA 1XCMA 3MAAC 4MEBA 4CL3A 4E1VA 2G5TA 5DI3A 2P2YA 5BW4A 4GRAA 4PGMA 5EFOA 1CZNA 1V48A 2Q62A 4RTMA 4N6GA 3VZCA 2MIIA 1M10A 5CA0A 1E8MA 3L3BA 1EBFA 1UKBA 4V2IA 1U7OA 5F2NA 3T9BA 3CPJB 4QJ3A 4MMZB 3UOGA 1R6TA 1VJRA 4ALKA 1QGYA 3AV3A 1NHGA 1NMZA 4L7VA 4U00A 3CX8A 1ENOA 1FDOA 2RI0A 3QENA 4C7OB 1YU6A 3HS3A 4C0BA 5JECA 2AL7A 2ROQA 1G0NA 3B1XA 3SX2A 1RXVA 3SN6A 1O03A 2I1QA 1C3JA 3PUXA 3HVKA 4CTOA 3L0ZA 1V9SA 2XE4A 3P96A 4BLVA 1SC1A 4ZVRA 3FZQA 3SWWA 4G0UA 2CFIA 4PFSA 5F77A 2V9PA 3L04A 5T67A 2VO1A 1TQ6A 3DE2X 3TSCA 1EXWA 1DV1A 3RIEA 1Z4KA 1U8ZA 2ZEJA 1NXSA 1SUAA 1R4AA 2PSFA 3H6KA 3SGLA 1N8SA 1OXUA 1HDEA 2O1WA 3GJQA 3HR8A 3M5DA 4UQPA 2FW9A 5ES3A 4L5JA 3JWHA 2ZJ6A 4GEGA 3TX2A 4P6VF 4GW3A 5EZYF 4CTNA 4BIMA 4M46A 1QYDA 1B16A 2R6DA 1I5OA 3VZRA 1F38A 2CNWD 4GI2A 5WRFA 5HUQA 4CQLA 2UZ3A 1ABBA 2P75A 3DTVA 2Z4SA 1RWKA 3DPIA 3PUZA 2P11A 2A5YB 4HNVA 3MTAA 4G67A 3GLQA 4NFLA 2P6NA 4R5MA 3K7EA 3KXPA 2PV0A 3IR6A 2NU7A 3P9NA 1YJBA 1YIDA 4R2KA 3RQSA 5JC8A 2XWSA 2HU5A 2UDPA 5EIWA 1Y9AA 3TW4A 1JEQB 3P2OA 5HIAA 1WX1A 2J0VA 8ATCA 4JYBA 2PBRA 1U2DC 4YASA 3DVAB 3LL4A 3MWEB 1OI3A 1W46A 1J5PA 5JZMA 4CEJB 2QZ4A 4MW6A 4B3DA 4BTLA 1UH5A 2AQKA 2HUNA 2XSZA 3DMYA 3IESA 4QYMA 3VPXA 3W8NA 4FMDB 3VOSA 2IKSA 4XR9A 1JA0A 3QXJA 1U2GC 1OX5A 4GNRA 1IZ8A 2FSUA 4FHDA 1N25A 4B3SB 4BUZA 3W8RA 2C77A 1F6WA 3LW7A 2W6MA 3PL5A 4IGFA 4Q4HA 5J2UF 3BMOB 1ZI9A 3R5HA 5C8XA 4CN9A 5JDIC 1N2EA 4LIPD 1XLTA 1A8IA 4K9QA 4LBZA 1USUA 2XZTA 4K7JA 4POAA 4QUDA 3CH6A 4IPTA 1X7YA 6LDHA 4QVGA 3O75A 4RGQA 3DDWA 3LX4A 1W19A 3C1OA 5LU9A 5KKCA 3A0RB 4LJ6A 4I4TB 3CRW1 3TNDA 2AMFA 4HN2A 4ZC1A 5LJLA 1HFWA 2Q9AA 2QT0A 3N0WA 3B1FA 3LX5A 1LNZA 1C1HA 4IVPA 1IMJA 1P19A 2PGOA 5ALZA 3THOA 3WLEA 2O0JA 1YHYA 2C99A 3SZLA 3D64A 2DFNA 1TW2A 1K7XB 2PRJA 1E2EA 4FEEA 3DAHA 3JQDA 4O25A 3KQVA 4ZO9A 2UZ1A 4DSNA 3I5MA 1C7FA 3MCWA 4TTVA 1PNOA 2PCJA 3URMA 1KH3A 1HE5A 1Z2NX 2CXNA 4FINA 3UMVA 1TFRA 1DEOA 2BY4A 2H5JA 3VNUA 1N32B 2GFIA 3ONDA 1E94E 1GKUB 1I6MA 2FU5C 3ZHSA 1UJ4A 4Q9NA 2IH4A 2CT8A 1RYNA 2DQSA 4TWRA 4UXHA 5JNWA 4RHUA 4YFVA 3TTTA 1Q0TA 3NDIA 1UK9A 2Z98A 2C9CA 4YRCA 4IJKA 4B09A 1U5CA 1AXRA 2ICAA 4WBNA 4EYKA 2ZWVA 3GJSA 3KOUA 1CDDA 1GGEA 5FWAA 5IT0A 3KQNA 2VT6A 4JVLA 3T0FA 3V9AA 5C5IA 2HT1A 3GI1A 3K3PA 1VB5A 1F8GA 5K0LA 2F8MA 2PQMA 2C3PA 1OILA 2DHQA 2F3PA 5KNBA 1Z82A 5ESXA 2XYRA 1YVUA 2D74A 3QPCA 1RWXA 5JTUA 4HDRB 4HNHA 4RAQA 1C2YA 2OYCA 1UL1X 4OU4A 3WKAA 3ZZUA 3ZIUA 2Y3IA 4TYPA 3H7AA 4PHFA 5DW0A 1OROA 2W90A 1S3GA 4P31A 1CR2A 4QUGA 2OVBA 4YFYA 1UXGA 1N3BA 2PZ8A 3GMTA 2H2FA 1NUUA 4E09A 1PLLA 2VNJA 2XZPA 4QUKA 3HGMA 3U4CA 2PUWA 2I4TA 2PH1A 5HZGA 5KYUB 4LF4B 5DWQA 3RJ9A 4ZQEA 4LXGA 5BUSA 1GPKA 3EWSA 4DTCA 1DTSA 4LRXA 3QHPA 4RM2A 1O0CA 1G21B 2AK3A 4GMXA 5CXUA 4MICA 5CBPA 5TQVA 2FSPA 2RBEA 4OQYA 3W34A 3WE7A 5ED4A 3ZGYA 1QQBA 2VNSA 2VZ9A 1KIMA 2ZB2A 3D6JA 4KNYA 3C8ZA 4JB8A 4NJOA 1XRMA 4ENWA 4R3UC 4DV1B 5TPWA 4G0WA 1WMBA 4RESA 5HM6A 4K87A 4BE4A 2ODBA 2QTMA 5EMLA 1SG9A 3B3JA 4K6CA 4MVJG 3F4KA 5KYWB 2D06A 4WACA 5AVJA 3LC0A 4DB4A 2Y0DA 1NN5A 1S8OA 3C5CA 3CPHA 4J0IA 3GFOA 2WD7A 3GT7A 3RSLA 3FWZA 1DBVO 1H4TA 1S5PA 2IPOA 3TRKA 2AKYA 3WP0A 4EHKA 5IYZA 3TLEA 4ND7A 1Z8DA 5T4EA 3U40A 2RHWA 1SVOA 1DPFA 4KRXA 4RK7A 3VOTA 1H2WA 2FMUA 3V42A 1D1TA 3Q2IA 4MQ6A 4ZD6A 4F4CA 5IN4A 1MZPA 2WTMA 2BGKA 1XEAA 2WHRA 1XTSA 1ZRHA 3ZH9B 3RLIA 1S8NA 1X0VA 2CDRA 3HZRA 1TNDA 2XT6A 3QJYA 4M1ZA 2XT9A 5LDDC 3IEUA 1U0HC 5LYJF 2FRDC 1CQPA 1L1RA 3LVQE 3ZLVA 2DH5A 3LDGA 3MCVA 3O3CA 3BH7A 1TRKA 3C3BA 4BVEA 2LE0A 1R5NA 4QARA 1STOA 4HSGA 2YIVX 4ESHA 3CLTD 4FB5A 4TWJA 2I6FA 5JAOA 2VH1A 3IODA 2FHPA 4H6PA 1R50A 4Q4JA 3SAJA 4UPVA 3PUYA 4AN4A 5I7AA 4KR7A 1E5VA 1UIRA 4C3ZA 2IS6A 2RARA 3TIFA 3CUSA 2V03A 4R83A 5AI4A 3A3NA 3E0QA 1PKXA 4KV7A 1HDXA 1P5FA 4LFCB 1HH4A 4FSDA 4JT8A 1YQGA 1H93A 1Z6ZA 2Y92A 4NNOA 2C9BA 3VNVA 2IYSA 2JK1A 2PWAA 3NYWA 3H11A 1SU6A 4RDCA 4PSUA 4NATA 4CV3A 1A04A 2YWGA 3B5JA 2ZI5A 1ZJWA 1H6CA 4GPIB 3D0OA 3K6JA 4H7FA 2NUPA 3KETA 1BVRA 2V6MA 2OCKA 5CNKA 5HK8A 3I4CA 4I46A 2DULA 1GM5A 1E6MA 5D8DA 3EEIA 2O8DB 2P2ZA 2CJWA 3FG9A 4DPKA 2VDOB 2FEKA 1JMVA 1FW8A 1M6NA 1YZ3A 3BDVA 4OHZA 3A9CA 1OE0A 4M89A 5AKJA 3KVVA 4YAGA 1LPPA 5K09A 2WJ3A 3FGNA 5AM4A 3COJA 3KX2A 2AQ8A 1XEXA 3LWBA 2Z04A 4TV8F 1W36D 2XCTB 2PUTA 1TCUA 3C1AA 2NZXA 3DZ8A 3A6GA 2EW1A 4UTNA 3A4IA 3N5KA 1P0MA 3HCPA 3JQAD 3DMNA 1BX1A 3KT0A 3P9RA 1ZOSA 3STVA 3UNXA 4CMIA 4O8ZA 4I3GA 3HH8A 3E6AA 4R9NA 2XDAA 4ESEA 3FVRA 4EPXA 3U6KA 3DHVA 1UPCA 1YAHA 1QIGA 2DHDA 2OL4A 1G21E 1GZ4A 2BC9A 4D9MA 4YMHA 1P8JA 3AFIA 1J8VA 4F9GA 1ECLA 4Q00A 3TR5A 3X1KA 2TRSB 2OKGA 3T4UA 8GPBA 3QI2A 5K8UA 1XU4A 1EX9A 2QMZA 3FROA 1JLLB 1NVUQ 2XUJA 4LE2A 4X0EA 4OV6B 5DLPA 5DWVA 3RSOA 1YS1X 1YBHA 4CIDA 2PBZA 3BTVA 4GKVA 3QG1A 2QG4A 4RK1A 4GI5A 2IYTA 4U9UA 4EGSA 4F3KA 1K4YA 5T7BA 1DRVA 3VI4B 1T6XA 3OFJA 4TKLA 1X13A 1CFZA 5JCXA 3MUNA 4BMCA 2HBRA 5HGXA 1LRLA 4DFDA 1XIVA 2C96A 3GHYA 3QOWA 3DKIA 1L5HB 1ODLA 1ZU4A 4TZTA 1HLFA 3OCCA 3SHOA 4F6RA 2CE7A 1GIAA 4FKBA 1TM7E 2ZDHA 5H68A 3VVLA 4B85A 2QQFA 3RYFA 3FLBA 1AS2A 4U5XA 3OIGA 1W93A 4DC1A 2EGGA 4BRWA 3N74A 2EX0A 2HF2A 3FYUA 5B5SA 1L7NA 4FE3A 5IARA 5CDGA 3RUCA 2PUHA 2XMBA 5AKKA 2IS1A 2C1ZA 2OK7A 1YRWA 1WUIS 5DGIA 1T3HA 1EGHA 3I34X 3K9CA 4UDXX 4CDGA 3B2QA 4HYTA 1X2EA 1EFLA 4YRKA 2YJTD 3U1BA 2A9RA 4ZAWA 3V1KA 1Y8CA 5IBQA 2H1SA 3PXUA 3ND5A 4RANA 3EZ2A 4OI2A 3DMTA 4R40A 4EHAA 5BRJA 3W2TA 1H8ED 4EJSA 2XBLA 4D2IA 4FIZA 4YXWD 3SIPA 1I32A 2JKVA 3Q9SA 4N03A 4MCIA 5L51A 1JFLA 5LQCA 2V6BA 4JFAA 2H7CA 1RHKA 1S96A 2RG1A 2ZBVA 3AIOA 2GK4A 3ZCXA 3QNMA 1PL0A 1X9GA 2B3DA 1Q6ZA 1PUIA 4G07A 1XEWX 2OO5A 3N0XA 1HC7A 4RZUA 5LWHA 4DQVA 1WHTA 3ESDA 2ASEA 4AZ0B 1O94D 1FIUA 2QN6A 1HT3A 4JROA 5FWNA 5BNZA 1XXHA 4LI3X 4NHOA 2C20A 2RONA 4NZOA 4WVLA 4ES6A 1CY1A 2PBFA 2V7VA 3TCNA 2V58A 4NYIQ 8MHTA 1XO1A 1D9XA 1T2CA 3MCUA 2FPLA 1D1QA 1U5AA 2JCVA 3O8LA 1YBVA 4JA2A 1JB1A 2ZRMA 3KB8A 4JB0A 5JSZB 3V6LA 3TR6A 3ILYA 4M0FA 4ZI3A 2HWKA 3ET4A 3ONFA 5E9WA 4A73A 1W4BA 2EIHA 4G89A 3LAWA 4Q7LA 4WCDA 2ZXEA 5BSRA 5T4HA 4PN3A 5F5LA 2WIDA 2EWMA 4Q9HA 5IKOA 4Z7OB 4KFCA 3BJMA 4DMRA 4YUYA 4Q3KA 5GONB 3F7TA 2D1RA 4K40A 2IYRA 2OT3B 3GXBA 1E2DA 1QTIA 1VLHA 4Q6BA 4PYRA 3WAGA 2FUCA 2MR6A 3A7EA 4OYRA 4OFZA 4QICA 5BQPA 3EVEA 2P6RA 4X00A 3OFNA 4QTTB 3UTDA 2VYVA 3BE5A 1UPAA 2HRQA 2QJRA 4UUBA 1ODKA 3QE0A 1UEIA 1R0ZA 1KOJA 4MB2A 3ZV4A 5AVUA 5IASA 3O1LA 1FX0B 2GNPA 3O26A 3UW1A 1PWZA 1W5FA 1KAOA 4DM4A 4M1OA 1EZ4A 3RRXA 1G9SA 1QTNA 1WDMA 2JLSA 3DNPA 4FX2A 4HDKA 4O5OA 4PIPA 5CTAA 2ONCA 1Y8RA 3FHJA 3GP5A 2XDYA 3GFQA 2UYCA 4MKXA 5LSAA 4MO2A 3LDAA 4J0KA 5IULC 3KZNA 3L9XA 4Q4LA 1E79A 2OCGA 2WTXA 2AN5A 5TY0A 3EZ7A 4XSVA 2NV2B 5KSWB 4A2WA 4B7XA 1B7GO 4AUNA 4QBIA 4LTDA 2BSQA 4LNAA 3MJVA 4TZ0A 4U02A 4AN0A 1F2UB 3RF7A 4ZCPA 1E3TA 2ZYTX 3G17A 3N53A 4XUGB 2O2GA 2IE0A 1HLGA 3R6DA 3BMXA 4C3OB 4EITA 1T1RA 1XL1A 2D5IA 2ODTX 2G40A 3F2VA 3B1VA 3I6IA 3KR9A 1CETA 2QQ5A 4KAFA 5DM4A 4ATNA 4E7OA 1BCSA 3H1GA 4P3NA 4WZZA 4JITA 3TL6A 5HF5A 3EXIB 1TM1E 2QVBA 1UQRA 3GPDG 4OJTA 2GRAA 2OGSA 4GAEA 4MV7A 1CQIB 2BI4A 5JVDF 3T5GA 4CIWA 3TWOA 4AJEA 5IT4A 1IN4A 4RBNA 1UEJA 3M3PA 4ZQCB 1J22A 1NYRA 3A4YA 4FLEA 2PSDA 4A03A 1CVRA 1D0SA 2P1DA 4I50F 1E1RA 2OUKA 4YMSA 4P4NA 1ND5A 3ZJ4A 4UOEA 5JJLA 4KRGA 4D56A 3QK7A 5FD8A 1JU9A 3UMCA 1BGXT 2FSVA 4HOYA 4I55A 4X20B 2UXBB 4PR3A 1BXGB 1NAHA 4MUYA 1ULUA 4KQKA 2BVNA 2C4UA 2P2CA 3GLTA 3H0KA 4HSEA 1TU3A 1N0HA 3CQ9A 1J0EA 1TOAA 1WXWA 2OD2A 3O8OA 3ZKWA 5IJ9B 1BFKA 2Z2YA 1T1GA 1HQKA 2FUG6 3ANTA 1TF2A 4PQYA 3WYAA 3ICPA 3BXZA 4P3OA 4X64B 2CZQA 4MRSA 2OKCA 4E4YA 2FWRA 4LRWA 4D0SA 3RT9A 2IUYA 3SF8B 4BBJA 5JEDA 1NURA 1T4GA 2J9XB 3COYA 4CQMA 1H0RA 5DGXA 5TE9A 4I1IA 1MHPA 4IH9A 1GAQA 3NM6B 4PQEA 4R8KA 3ZY3A 4B3RB 5C80A 1O5IA 2WDPA 4ZQBA 1IG0A 4WUTA 3M5WA 3B3QA 3EK2A 4MKHA 1ODTC 2ZTSA 3TLKA 2P30A 1L8QA 4LE0A 2AMJA 4X95A 4C5BA 4LF5B 5F98A 3OO0A 3I52A 5BXQC 2D2IA 2DAPA 4LF9B 4JUDX 3ORHA 1OZHA 2FN7A 3UVEA 1SKYB 2JF0A 4BLSA 2AT1A 3J81k 4ERNA 1VJ5A 2Q6LA 3HB5X 2WJJA 3ZZNA 1BW9A 1OWOA 1XF9A 5FNZA 4CDRA 5JHHB 2Z5VA 1P44A 3SX4A 4LDNA 1BH2A 3WLRA 5KU1A 3VPSA 3HJUA 1G5QA 1I5EA 2P6OA 4BS9A 3FBGA 1D2EA 5JPIA 1APBA 2NU9A 1JPVA 3BGDA 3A3OA 4OMUA 4M0LA 5DBFA 4ZTZB 3T3EA 4CMAA 4Q9IA 3LZCA 4OJKA 3PHCA 1CF9A 2VA8A 3HJCA 4ROSA 4YRSA 7ABPA 3OQIB 4K9KA 3CFYA 1C0PA 4FGUA 2W6JD 3IP8A 4GD3Q 4LHEA 4RLHA 5A3JA 1DXQA 1K6IA 1G59A 1M0EA 2HADA 4ZDWA 2Z2XA 4KK4A 2K4MA 5CX1A 3HBFA 4NC9A 1KORA 4BX0A 1E2BA 3ZVRA 4M8NE 3TYXA 4Y2QA 3IQDB 4PC1A 2HSGA 2QDXA 2XPCA 3P0RA 5JFTA 3PHJA 1ZJ4A 3Q72A 1TC2A 2D0IA 2YICA 3GP3A 4JT9A 2VQFB 2EF0A 121PA 1QO0A 3DF9A 5AHRA 2K7ZA 4TS4A 1KEEB 4LISA 1XLTC 1TA4A 3BIFA 1I6WA 3BWVA 4DIUA 3ZS8A 5CLHA 3AVOA 2HZ7A 4ND5A 2QM7A 3C7AA 2AC7A 3WOHA 4L5CA 1Q83A 3ES9A 2ZIEA 1DJOA 2CHVA 1M8FA 2OFOA 2BHTA 1N6RA 2OG1A 2Y0CA 2ISSD 3OJXA 1HV8A 3BVPA 4QA9A 5FFNA 3ZQKA 5IHXA 1WXHA 3E9MA 3M6WA 4C0JA 4E5NA 1KTIA 4X8LA 4Y0AA 1S9HA 4PGFA 4LK2A 4U6NA 3TZKA 3D7NA 3DYBA 3FUCA 3R44A 1UMBB 3BB1A 4M7OA 5JG7A 2CBZA 4RIHA 3UG6A 2PZEA 4FYYA 4OXNA 4YJGB 3ZVMA 1E7SA 3LDHA 4UOQA 5KYYB 3ENNA 4CT5A 2GI4A 3NWBA 2Q3BA 4ZQFA 2DKOA 5H0IA 3H3JA 4ZPXA 3V1UA 1PGJA 2QOEA 4W5QA 5D1HA 3Q3HA 2XUHA 2XUDA 4X6XA 2OCXA 4YT5A 3HP1A 5HKAA 3PNQA 3EIUA 1CD5A 4B2IA 3LVFO 2PYDA 4JEHA 3U3ZA 2ZR0A 2ADMA 3VX4A 1XPJA 2WYUA 3IVCA 1E9SA 1HLDA 1PIWA 1FFBA 1R18A 2XVZA 4KTTE 4UUAA 3IHWA 4KXVA 4MIEA 4HJRA 4X1IB 2XYPA 5L4SA 3DOHA 3IA2A 5CVJA 1EP2B 3OU7A 3H1EA 1KYZA 2FLWA 2OZLA 3WYNA 2LGJA 3IELA 4F9TA 1PQUA 1AMOA 5B4VA 1KFCB 2P35A 4C2TA 1G64A 4PTZA 1FDRA 3B1YA 1RKQA 3IBFA 3H2KA 4HDSB 4OHRA 1R3DA 1IDOA 1N5KA 3E84A 1J5XA 4INJA 3I5YA 3JQAB 4JUIA 5ELXA 3Q7QA 4KO3S 1O6BA 2W2KA 1G3MA 1M1NB 4ZU6X 3AKDA 1NQTA 4KKXB 3WGLA 3VSDA 4CCYB 2CL5A 3TZ6A 2OHFA 2HLDA 3JALA 3EWNA 2QUKA 1LJUA 2ECFA 2JFGA 3H9EO 3KZCA 4PG8A 4IS3A 5HJ5A 4WHMA 3TGLA 3FHTA 1QGZA 4XVRA 5F4BA 2Q3JA 2IY8A 3UC9A 5FQNA 3G68A 4P0PB 4UAUA 1BWQA 4AICA 1J1IA 4I1RA 3LPAA 1HI9A 2BFDA 1ST3A 3PFFA 4K9NA 3RHZA 1SA0A 5I7OA 3CZMA 5EXSA 4KVZA 4GLJA 4IWXA 5LFAA 2YW2A 1WSAA 2BBWA 4GL4A 4EKDA 2HA7A 2HSZA 3AUJB 3M7IA 1IRXA 4NP6A 4ZCRA 3IXLA 2RGNA 1MO3A 3NUQA 4HMPA 4ZOAA 3JPYA 4C14A 1MG5A 1T1JA 2JASA 5HJ2A 1QRUA 1RWQA 2WA1A 4JBWA 2OHHA 2WU1A 4PICA 4I9GA 3R8CA 3UHPA 5CB4F 1QIHA 5IZCA 2F59A 3AGPA 2KMLA 4KODA 3GIWA 4BZPA 5AD1A 4Q82A 3R7WA 2AJLI 5L3SB 4L0MA 2ORED 3WLKX 2XGMA 4NY1A 2EFCB 2A5DA 1HA3A 3TO5A 4GQAA 1JEOA 2I34A 2J5BA 3ENVA 3BWMA 1JIUA 3OI7A 3MMPA 2FEOA 3IAFA 3RRYA 4YPFA 4CM4A 3K8ZA 4FCTA 4KDCA 3WLNA 3CWQA 1EXVA 4R9RA 1UAAA 5BNTA 1AX9A 4JJ4A 3FUXA 1CUIA 3UB3A 5E4FA 2LIVA 5THXA 1UFOA 1KARA 4FJ0A 1KO5A 3FNQA 4ISBA 3L0BA 1FMTA 1O5OA 4ESVA 4E2YA 3ABSB 3LA6A 1AS3A 3V4FA 3D8HA 3FSEA 4EMUA 1Y5IA 3M3HA 2QYTA 3ML1A 2FG5A 1JR3A 1PJCA 3P4XA 3P9CA 4ER0A 4ZK2A 3MJTA 2R9VA 1ECJA 1NRIA 2PJDA 5L3VA 5D6OA 3T1HB 3QWBA 5CCXA 2NSYA 5JBQA 3D2CA 4II3A 1JILA 3RUFA 2P6MA 2IITA 2CHGA 1CVLA 1CUYA 1GTJ1 2QN9A 3GK3A 5KS2A 3K1YA 2EZUA 2W9XA 2VBIA 1F2TA 2K2QB 4HDQB 1OOEA 1V5FA 3OJLA 4P84A 5EMMA 2J3QA 1AGNA 4FZ3A 2V7WA 2VJAA 3LT5A 2XQIA 2R48A 5CT8A 1N2HA 3QVMA 3VYTB 3RU7A 1OAKA 2PT6A 4BCDA 2LDXA 2X0EA 1U7PA 3RM3A 3H1TA 1J1ZA 4IZHA 4EI7A 4HFRA 4UNPA 3Q12A 4GM0A 1XOIA 4OQPA 4TS9A 4AY2A 3B9BA 1KSFX 3VTKA 2QN7A 4WK4B 3AM1A 1XE3A 2NMVA 1XROA 1RM3A 3H05A 4C4PA 2VP4A 5LA6B 2CDCA 3I6MA 1LPBB 4TN5A 1KYIA 3RHSA 4CF4A 4O4JA 5U9CA 3VHLB 3LHIA 3I83A 5E38A 2Q9BA 4J2OA 2H8KA 4UM9D 1P2DA 2FQQA 2BFFB 3BB3A 2NUBA 3HBNA 3KKNA 3C5WP 1SHTX 3OFKA 4BLWA 2YZ2A 2AZDA 2B99A 1G7CA 3LUBA 4H6VA 1PK7A 1R27A 1JLKA 2AUTA 5B6PA 3HYRA 4B9AA 1I3LA 4ZICA 3GLHB 6REQA 3NHZA 1YMQA 4BVAA 4ZPJA 2JH3A 1LF5A 3A3PA 1UBLS 1NX6A 1BMFD 1W8IA 3P9IA 2IXTA 4B3GA 2QJFA 2SECE 3U3RA 2ODNA 2REQB 1HDGO 4NZYA 4MGHA 4XUDA 4G0NA 1B0ZA 5DNVA 5DWDA 3VU9B 5JXWA 3THWA 2JGNA 1OA1A 3EQ6A 2R8BA 3WAJA 2E4WA 2G9UA 2ZJAA 4NONA 2C57A 4WFIA 4EBBA 4EFLA 2O0MA 4MAFA 5K8IA 4U7DA 1RZRA 3AEUB 3EXG2 3DA8A 3ZCTA 1H9CA 2QPTA 4Z4CA 2AC4A 5DX8A 3TVTA 4P4LA 3L1JA 1ZIOA 4ZVOA 1FP1D 1CJMA 3STHA 3VH3A 1A77A 1XGKA 4HRXA 4J1NA 5DV9A 4EB6B 2OLJA 2Q2NA 5EEHA 3W2FA 4KGZA 2ZRNA 1IUKA 1U4SA 1X92A 3ROPA 4ZA2A 4AXBA 4E0BA 2J08A 4YRNA 2QBYA 3M33A 1C4OA 2ZSEA 3PKZA 4R05A 3SOPA 4FYHA 2PJRA 2CCKA 1V37A 3DBRB 1G5FA 1GILA 3OX2A 4XH9B 4PSDA 4G4GA 1YOVB 1MTZA 5BUZA 4JZKA 3PX7A 4QVKA 1QH8B 2WTAA 1C1DB 4OGWA 2EZTA 2QB5A 3AM4A 4PLZA 4XI9A 3Q9NA 2Y76A 1OIVA 3WB1A 2GEDA 1Z0JA 2PX3A 5MN6A 1NPTO 1OSNA 5K3SA 4BKRA 1BFDA 1FEZA 3T9AA 3D6HA 1WO8A 3RUIA 1RAEA 3FYUC 2IUSA 2G8LA 4OGGA 1PO7A 3SYRA 1Q2UA 1E60A 3ZHUA 1Z06A 4HO1X 1XVAA 4MVJD 3SQOA 1KI8A 4D57A 3QE4A 3T34A 3KQWA 1DTWA 3IAXA 3QX8A 3PQCA 4PYOA 1L5KA 2HCRA 3BMNA 4WESA 2FDXA 3DR3A 5GJCA 2PXHA 3ISJA 2WKPA 2JDID 2L82A 2AGVA 3HI6A 1B3BA 2JIPA 1KI6A 1OLSB 2PKRA 3LV8A 3LXXA 4Q3OA 2PK3A 4CCSA 4M0KA 2VQDA 3DMTC 1S7CA 2GHQA 4NFYA 4WGFA 2H3HA 4EJSC 1LUAA 1BDMA 1EM8A 4ZJYA 1W49A 2H08A 5EIFA 3PWZA 1NMEA 1BXKA 3LX6A 3Q5EA 4BFVA 3WWYA 4EY6A 1PI3A 1VG8A 4CDMA 1L5VA 4LF7B 2BKVA 4P53A 3QUAA 1WQ4A 1RE1A 3B9PA 1GFSA 1E3QA 4NS1A 1YQDA 1JAIA 3WSVA 4UMDA 1W88A 4IIYA 3NAGA 2OO5C 4M8SA 1Y48E 4KN6A 5EP4A 3JRXA 2P4SA 4LC0A 3VFDA 1PFUA 3HU5A 4KI7A 4R16A 4DSZA 1D7AA 1NWCA 1NDQA 1DINA 1F14A 1SAYA 3F5SA 4JVNA 4LUCA 3V4LA 4Z1OA 4Z54A 5AWFC 3IXQA 5EIOA 4ZVVA 3EIHA 1YD7A 4H4CA 1Y8AA 1FXSA 2J67A 1CYEA 4JJIA 4I4IA 1KR5A 2FPGA 1YZYA 4TROA 1XRNA 3SJZA 1XEFA 2IYYA 1TU0A 2B6HA 1EE9A 1MU0A 3HA3A 1HDOA 1PGQA 1RAGA 1PR5A 1S9DA 3A9VA 3ND9A 3C5VA 3GLHE 1KBOA 1N8KA 4DRZA 4BP9A 4KLCA 4HEJA 5THKA 2IBSA 3HDVA 3NT4A 4B3HA 3LUCA 3FETA 5JCJD 3FCEA 1SJ9A 3HKCA 2V97A 2GA9A 1XPOA 2Q1UA 2X0KA 2ZJOA 1LI4A 1Y4SA 3ICWA 1FPMA 3X2EA 1NR5A 1NVGA 1FE8A 1T25A 2ZJ4A 3UKDA 2QQGA 2VXBA 4ZEWA 5K0TA 2BGIA 1XD2A 1QVWA 5IMBA 5K45A 3D0KA 1LLFA 3NTRA 3EAQA 2AQIA 4K9PA 4INZA 3EZLA 1E4VA 3SR4A 4OAOA 2ZS9A 1E3JA 1L1FA 2DUNA 4X6LA 4YUAA 2YVLA 4PF1A 4TUYF 1M34A 2JVKA 3OAAA 5FBKA 5BVGA 2BRUC 1FB5A 1JG4A 1H2RS 1Q95A 4NCNA 3GNQA 4P80A 4AP5A 4MHSA 1G8SA 2EZ4A 4IHKA 4C3UA 1HF3A 5J1SB 4OLJA 2NW6A 3LBHA 2VXYA 5IMSA 1CW2B 1SXJB 3UFXB 3A1CA 1P31A 3OE7D 4AX4A 2ZR8A 4OI0A 1E96A 1KI7A 4WFQA 5DRYA 4AYTA 2NTVA 2X7HA 4P5DA 5HF9A 3HEMA 5KX5A 1FU7A 4KXMA 5IW8A 1EAMA 2WE7A 4ZQHA 5IXYA 2HA0A 2Q50A 3ORFA 4BQSA 4YMUA 1UM9A 2GNAA 1I3CA 2ZAIA 3GAAA 2AW5A 1EX1A 5F3RA 1OYOA 3TOVA 4KH0A 5HW0A 2QRVB 3CLSD 1U4NA 1DQPA 3EGDA 3NZEA 2Y4NA 1MT0A 1RYHA 2H1OA 2ST1A 2ZQ5A 2F1KA 5C5CA 4RY0A 2EWVA 1UPBA 3UGKA 3M4XA 1ZMTA 3MXOA 5DXFA 1N36B 4QT4A 4CCWA 1DRJA 2POCA 4JKYA 2FSVC 1OLXA 3HABA 2PX4A 1SQ6A 4JOQA 3GQBB 4HGZA 1SGWA 3R76A 2H54A 2OQVA 4O4IA 2XI4A 3BUSA 3DEHA 3OH8A 4NU6A 2ATXA 5K4AA 2ZBDA 3K0BA 4MWEA 2ZJ1A 4AG6A 1G6HA 4BNXA 1FVHA 3GFGA 3H2GA 2O5EA 1O3YA 2EKZA 2BL4A 2G6TA 3NH6A 1JHDA 4JP8A 4AMBA 4ENPA 5JPCA 2VF2A 5HMMA 1D8TA 3ZDBA 3W77A 4DJEC 3T52A 4LFBB 1KHHA 3TLJA 3BD6A 1FFEA 3C48A 2HZBA 4EFKA 3ZDRA 1GA4A 3KYCB 4LY3A 3HXPA 2H2GA 5FXMA 4FSXA 4N18A 1W44A 2J87A 3GEPA 3OLVA 4G5YA 3O8DA 4R98A 2C5AA 5DHAA 1IM8A 1TGVA 3BKWA 3E3MA 3C74A 2Z2JA 5CEJA 3DGFC 3FN4A 2HEIA 2H5EA 1DPGA 1PWHA 1M33A 1YBAA 1M1YB 1RXYA 3MOSA 4MVJI 3P7MA 2UXDB 2QX4A 4QPZA 1QIEA 4J75A 3RVDA 3K9NA 2XE7A 5DGCA 3CVVA 5AUNB 4BB6A 3DTNA 3E23A 3SXUB 3EVBA 2J9FB 3KYDB 1F7VA 1T5DX 2WD8A 4EG7A 3QX3A 4ZEMA 4FC7A 4UEOA 1WF3A 1N0WA 2O1EA 2Z3ZA 1D4FA 5DYWA 2WD9A 5FFMA 1HR0B 1TK9A 4F97A 1MOSA 2V5VA 4H0CA 1NJ1A 4DHEA 1WVIA 2RIPA 2YS7A 1IQPA 3GC6A 3USZA 3X44A 3JAWA 4C0KA 1N8NA 4P7KA 1PD1A 2IL1A 5JH7B 3E9DA 3C1UA 1KXZA 4NE2A 2JEOA 1HM5A 1QORA 2B4AA 3QLUA 2WUDA 4O29A 3ADBA 1QWOA 3F3YA 4JNCA 1GRQA 3K0KA 4A2QA 4YBRA 1SXJE 1IWOA 1PU2A 4U7FA 4XX0B 4BMVA 2B83A 1Y82A 3WRWA 4OUDA 1R4MA 5CR9A 1Z18A 1X3LA 2CYCA 3AERB 4GECA 4U8HA 4TS3A 4W9NA 3UXHA 4TT3D 1MG0A 4C0QC 2YZGA 4XWYA 2PZAA 3F9CA 4OOEA 2JCYA 5AHXA 3LX8A 1QHXA 3H6GA 3TSYA 3NIFB 2BEWB 2YWJA 3VHXA 1BE6A 4BB0A 2AOVA 4PZUA 2PUDA 4UCWA 4YJ3A 5DLDA 3MRTA 1C1XB 1W0JA 2Z2IA 3EMBA 5E9JA 1WAMA 3KSAC 3P20A 4EW2A 2J0UA 3T4EA 9ATCA 5LKRA 2BF4A 3L8HA 4UTVA 1PVVA 3OF3A 4ARCA 1RRFA 2Q1SA 1ULAA 1IWBB 1SWWA 1XZLA 3PYLA 2F9LA 5EVCA 3IILA 1WWKA 4JVOA 4XM0A 1O9GA 1OU0A 1YQQA 2ONYA 4OP2A 3I37X 1Z4MA 2G5GX 3HN2A 3I0ZA 5KWIA 4RTNA 1JYSA 3KQQA 1A76A 3SBOA 3TEJA 4FT4A 5BR4A 4CIXA 3SEFA 4UM9B 2D62A 3RAJA 3U7GA 3I8OA 3UT6A 3LF1A 4KKVA 2W2LD 2X58A 1FUUA 1UC8A 3KSMA 2FK8A 3TSZA 1T6ZA 1SQ5A 5FAXA 4BJ1A 3B6KA 4IVRA 2AA3A 3ZE6A 5IDXA 4IDQA 1LFDB 2YHIA 3I5AA 1GUDA 3QEBZ 3ERCA 1RR6A 4R8RA 2P4QA 2DUJA 3DMHA 4WLUA 4XFKA 3VU0A 3ICOA 3B9QA 5KO2A 1Z6TA 1HY3A 3IBTA 3O7MA 1S8AA 4L27A 3OC6A 4JY7A 2IQIA 2IHJA 1ND6A 4TYQA 2QN2A 1VPWA 2V6JA 4TQUS 3LT4A 1RRMA 3T9EA 3AONB 1DBQA 1WB5A 2B34A 2B8TA 5J23A 3SSNA 1AY0A 4JI7B 1I4DD 3AF0A 4IYJA 3CH4B 5IAJA 3SBXA 4LDRA 4D8VA 4DL9A 5IWAB 1G42A 2ZYAA 4CG3A 1C0KA 4RADA 3MJ4A 4FYXA 3DOCA 3DV2A 3SSOA 5I01A 1BC5A 4CEIA 3ZEAA 3NHLA 2GDJA 4GNKA 3HUFA 2QRJA 3ZNPA 5B64A 1M1YE 2GJ9A 2ZJ3A 5C18A 5MDHA 4E30A 1BZYA 1G4AE 4FOSA 1UMDB 1KSGA 3UJAA 2N1MA 2CC2A 1WU8A 4FHGA 1XDUA 3GEIA 2ALJA 4E07A 5DBGA 5BSHA 2ZCVA 3P45A 1EG2A 1KQGA 2IRWA 3IX7A 4L4SA 4LQCA 1BMDA 5AT1A 4DF3A 4PV7A 4NH0A 2JJQA 3OZXA 2I4IA 5LB4A 2RGNC 2QPLA 2HSDA 3SJCA 4BASA 4FFBB 5DBOA 4PLGA 1T9AA 4AJLA 4ABTA 3WHPA 3FR7A 2ATVA 1NN3A 1NATA 2GPBA 4ZKEA 4BBAA 4D9IA 4YACA 2Q8QA 4EPVA 2I33A 3RS8A 2DR2A 4IXMA 1P5JA 3AB3A 4K8RB 4D74A 1JU3A 5EINA 3JARB 1B1CA 2H2IA 2GCNA 3SJUA 1ILEA 4RWEA 1EJ2A 1EMDA 2BTQB 2NUTB 3E3LA 3P2EA 4D9HA 2CVHA 4MRNA 4BKOA 3P26A 2ACKA 4N0MA 4RU1A 3FCCA 3IQHX 1T0IA 1VE5A 1A5BB 2JIDA 3A32A 1SY7A 2H1FA 3BRSA 4OU5A 1GFIA 3HM2A 2ZZNA 3SD7A 3SXJA 5GGYA 3BRCA 4AC9A 1RYZA 3IEKA 4UPEA 3EPKA 3K1AA 1F8UA 4IBOA 3ICQB 3ELDA 5DRTA 3FPEA 3L0OA 2D7DA 1Z83A 4C5CA 5CP8A 4JI2B 3MLBA 1L7OA 4X7MA 3H84A 5C8YF 1SBHA 2B0JA 4DM3A 3FTFA 4FFNA 4PC7A 1WZEA 1XZHA 5EWLA 2I99A 3KR1A 1Z07A 1E59A 3LH5A 1Y81A 3RU3A 3CC8A 3PYXA 4BAGA 2ZKLA 5G3YA 1ESZA 3LKDA 4YONB 3Q6NA 3T9CA 1U2EA 5L45A 1HO3A 3DH0A 1CUAA 2BD0A 4K6OA 3GRAA 4ZKDA 1M9NA 1Z47A 2VPYA 4TV9B 4WL0A 3S2GA 3WLJA 5A0TA 1E9CA 1MV8A 1Z68A 2NTNA 2ZQZA 1TVCA 4MKGA 4QGGA 2B92A 1HE2A 3UGJA 4H3KB 4V39A 1DS6A 1NW9B 2JFPA 2LNDA 1N9GB 3SR3A 4DV6B 1KSHA 1N1MA 1Q6YA 3K0FA 3BIOA 4PG5A 2B4KA 2Q21A 4BX2A 1FRZA 2WFAA 2YIDA 3K8OE 2DLNA 2P5SA 3ZHCA 1WOYA 4X5OA 4BN4A 4FHEA 2G7MC 4LZWA 5COBA 2PMEA 1VKZA 2AJDA 3KOZA 4V24A 1TM3E 1W52X 4M8KA 4C20A 2BFCB 3T3OA 2QS9A 1ACMA 1QLJA 1U2SA 1VC2A 2AFIB 1T34A 3P9ZA 4N0DA 2HJHA 2OBYA 1P4HA 5SYNA 3TTSA 4BFSA 2PBLA 3CLRD 3HXOA 1YT5A 4HBGA 4RZ2A 2GEJA 2PFKA 2DTEA 1K5HA 2VHCA 4DEXA 2RC6A 4M2LA 5DNEA 1TVKA 4C7VA 3NHWA 4N7MA 1JHOA 1SIWA 2CNKA 2FPIB 2OBFA 2W6QA 4MZDA 3U7IA 3VVMA 1C41A 2IK8A 3K8QA 1KOGA 3G2MA 3CRVA 2CZCA 3EH1A 3N3BC 3IURA 1XZPA 3Q4GA 1EJ0A 4F7DA 5ALYA 1X7WB 2FGKA 2Q9UA 2O3TA 5BNWA 1Q0RA 5KJFA 4E03A 4OKNA 5DTJA 3H8VA 3RTBA 1RXWA 1NTRA 1Q1ZA 3EE6A 3VR5H 1PGOA 2IHVA 3KVRA 2NTJA 4X9XA 4XW2A 1EU1A 2OZVA 5LQSA 1GSAA 3RFFA 4BLPA 3N75A 4ALMA 4EKEA 3KWFA 4LK3A 1V8FA 1FVXA 1VCMA 1UBNA 2AYXA 4OOFA 4Y9SA 2QL7A 2XKKA 1SK8A 2NYAA 3WICA 4NCXA 3DOFA 2ZTUA 2XVXA 4FBMA 4NICA 3RASA 3AI7A 4DZZA 3OT4A 4IEIA 1CQJB 3IV6A 3AJ9A 1T8YA 4MH0R 4E70A 2NWQA 5BMOA 1Z88A 2PQ0A 4AWXA 4ZN6A 5T6MA 2VIIA 3JSXA 3UWPA 5HTKA 4F93B 4XTCS 3STUA 4E12A 1YS9A 3EPLA 3RAPR 4Z9XA 2IH5A 3R3UA 2VPQA 3W5VA 4F11A 3I28A 3Q8WA 4N6OA 1QONA 4QU9A 1G291 3E3NA 1YA8A 4RIGA 3CWZA 2IPNA 4L74A 4BVLA 5EOVA 4RQUA 3W1WA 3SYTA 4Q1FA 5I8WA 1DWOA 1I3KA 2QF7A 3FFWA 3FOZA 2MSDB 4XWKA 5ICEA 4PAOA 1J0AA 1XA3A 1ZXXA 4MV0A 2CLLB 4Y2JA 1JXMA 3OQJA 5KSOA 2A3NA 5HBRA 1CY7A 2OPHA 2Y1WA 4DA6A 4ADSG 5BSFA 1CS0B 5BWBA 2R8PA 2DSNA 3OSZA 4GYWA 4TS1A 5HEKA 2BLNA 1HFKA 3CVOA 2NPOA 1G18A 2QRMA 3EGVA 4FBLA 3J81A 2VCEA 1K6MA 1P2GA 2C8LA 2WSBA 2INGX 3BXFA 4G8DA 4UUMA 4EG6A 1H9AA 4QG7A 4KXUA 4RH0A 1ZSYA 2IU3A 1ORRA 4RY2A 4FN4A 1XAHA 1ZHOA 4M9RA 3FOEC 2F2TA 3EUEA 3UUWA 2J3JA 3DB2A 2G4VA 4GP7A 3GUCA 2VAVA 1INLA 1D0VA 1UJNA 1NF8A 1XT6A 4I9NA 3AR2A 2O3JA 4NBLA 4E46A 2B1QA 5FX2A 5JI2E 4C3VA 1Y6JA 2P9GA 1UKEA 1TT7A 1VHDA 1XZAA 3LP6A 1U5BA 1Y80A 2V7XA 3BG5A 5K4GA 4G1BA 1CQXA 3GAZA 3BK1A 5HILA 1FFCA 1RMTA 3NOOA 1VGVA 4K9RA 1GU1A 2R6HA 3IE2A 5CJPA 2FVXA 2FZLA 2QLJA 4C2BA 4NZ9A 4DCOA 3MB8A 2ZRDA 3BF8A 3U4IA 2DSTA 3DO8A 4M88A 4OHVA 3EF3A 4MIYA 1CUSA 2JEZA 5EHGA 4BC1A 1Q3KA 1UK7A 1UBHS 5HIJA 2DFKB 1ZSNA 5AXDA 3P0IA 3B85A 3ZD9A 1ZKDA 4BQNA 1I5RA 3VAAA 2HU8A 2VPPA 3H2IA 2C2GA 1H0KA 1P4JA 1R0LA 1L7AA 1P75A 2IPAB 2TYSB 1XJ5A 2XUZA 3EPHA 4BFTA 2PFSA 5BSKA 1DBWA 1RABA 4J1SA 4RM3A 5ALWA 2ZUTA 2HIHA 5ALVA 5I8PA 2VTVA 1MW8X 1P0IA 1N78A 1CY2A 2FE1A 4I4TF 4LPSA 1ENPA 1MLDA 2HJVA 2X8WA 1Z6PA 5E6SB 3PB3A 3BHJA 5D6NA 3V5NA 1JQJC 2QRGA 4MQUA 1PTJA 2R6ZA 2WF5A 4DNXA 2O8BB 5IN5A 1GRVA 2X8JA 3A4MA 3RYIB 2UUAB 4N5DA 2CLSA 1C8BA 4J2TA 5DIFA 4YUVA 1GL7A 2QTGA 5B2ZA 2A58A 3M83A 3V1YA 4YP7A 1KPHA 3GLVA 5BN1A 2AXEA 5ECDA 2BV3A 3WGIA 1XHEA 2NVUA 2QTZA 3MWDB 4GYYA 5DXAA 5J59A 3PFGA 1RBZA 2P7IA 3K9QO 3E1GA 4HRYA 2D1YA 2I78A 2QRPA 1I3NA 3MWKA 2WJGA 1BGWA 2I22A 3OHPA 4QQKA 4LWOA 1NP6A 3R5SA 3T1VA 4AKHA 2V1UA 2DXIA 5JEEA 1DV2A 3ROFA 4Y18A 3RTCA 4MLPA 1NI3A 1NI4B 3KXLA 2ON6A 4S1OA 3RT7A 5BV7A 5JAHA 3TB4A 2P4EA 1YIOA 1RYBA 3CSSA 3L1IA 4PLPA 4Y2PA 3WIEA 1N1GA 3A26A 1FTWA 1NXQA 4U7JA 5DMHA 1KMMA 5LUAA 4CW7A 3BMQB 3FKSA 1XMXA 3LBNA 3CLVA 1RKBA 3OQ6A 4YRFA 1BDHA 1NNLA 5LP6C 1RAFA 3KJEA 3L18A 3X43A 3AVYA 5FA6A 1D6SA 3AFMA 1RPZA 1I8TA 5FL7D 4JXXA 3R20A 4IX1A 2CMKA 3PPXA 2YQ5A 3UTCA 3VISA 1ARZA 2FGJA 4IEEA 3Q7EA 4NABA 3I30X 4CKYA 3OWOA 1DKRA 5FBLB 3UT5A 1SXPA 3ICEA 1N5OX 3BD7A 3PEEA 2O2XA 1YR8A 2P9JA 4L9RA 1AQ6A 2YFYA 1SQFA 2K5UA 1DGQA 3WIDA 3JQEA 5HZMA 4US1R 5FCDA 1FDIA 1B15A 1VHQA 2FI1A 2ZTLA 3AF1A 2PTHA 3FSRA 3KLNA 4LVCA 4MQEA 3TRIA 5A62A 3KYIB 1DRWA 3ZH2A 1QFMA 4KXLA 3FDXA 4P3KA 4QUIA 6ABPA 2FF5A 1F51E 1A72A 2EG5A 4FILA 3V8VA 4B6EA 4OO3A 2OGWA 3TLGA 1TYZA 2IZ6A 3PNLA 4WMLA 5IVKA 2BHRA 1VG9B 1CCWA 1ECPA 1BHO1 1K2WA 1N2XA 1N9ZA 1OREA 3N28A 4XD2A 1S8FA 1HRKA 1Z6QA 1NV9A 3M6AA 4URUR 5DYTA 3T8YA 1OY1A 2BF7A 4LHYA 4N5IX 3TBKA 3NVDA 2VAWA 3L8DA 4G5SA 1QGUA 2VBGA 2X2FA 1BN6A 3LIPA 2HMSA 4I2VA 3SYLA 4OFWA 4DPLA 5KYXB 3L4KA 3G7NA 4LY9A 3HVIA 5KOJA 2JGJA 3IDFA 2H4HA 1YRHA 2Q2VA 3K16A 1EVLA 1PQWA 2CFRA 4CM9A 1BQ4A 1CTQA 3RVBA 3WRXA 1U1FA 1KO8A 5LOVA 3RT1A 2HCFA 3H9QA 4UBOA 1UBUS 3EIWA 4G5QA 1DVRA 1F60A 1IZ0A 1LJ8A 2NNLD 2OHXA 2Q3LA 4PSCA 4HUTA 5A5EA 3LYLA 3A9RA 5EEGA 1M0SA 1OPRA 2IYWA 2HJSA 1AQUA 4G85A 2PKQP 4BP8A 5BR1A 2R1ZA 5DK4A 1EVIA 3I42A 3EFOB 1UUFA 4KRYA 2NACA 3IVMA 3LQ1A 3N2NA 4F56A 3Q6MA 3TVYA 3I9MA 4Q03A 1JG1A 1CJSA 2QL5A 1QKJA 4FFVA 4NDZA 4Z9YA 2JIMA 2QRHA 1RI3A 4KJXA 4KE7A 2PD3A 3FX2A 2ZZKA 3WL5A 4NULA 1CULC 2QNRA 2WYIA 2GRUA 4MV3A 4FYVA 2FZKA 5C81A 4K26A 1E2FA 5DN6D 4U2EA 3CR8A 3QLUC 4IWYA 2IU6A 1FUIA 3NHMA 2JFWA 1I10A 1LK0A 1JDVA 1C7RA 2O7NA 1WXGA 4MHOA 1FYVA 2JFQA 4MEJA 1O97D 4OJNA 1OV6A 1DAGA 4HLNA 4R1TA 3TL2A 2P8JA 2WAMA 5JIBA 4WKGA 1USGA 4JN6B 4BEBA 2XCRB 2WTNA 4Q7QA 1V7CA 2VTKA 3TS1A 1AF7A 3R4CA 2J0SA 1E2NA 4BFWA 3MJEA 3DFZA 1I33A 2J5XA 2YHAA 1O8CA 4TVSA 1BWSA 1EUDA 2JVIA 1CKEA 2RJ3A 1KK2A 3RVKA 4ETIA 4RTOA 5E3IA 1US8A 2R8YA 1GXSB 4DQLA 2GUGA 4E6EA 4H0NA 5CVTA 3UAYA 4DXAA 1J0BA 3V34A 4X63A 2YN2A 3KKLA 3N2ZB 4XWWA 2ZWOA 1C4XA 1BA3A 2RK6A 4LHWA 2L2QA 2ZANA 3QYJA 4WZ6A 4D9JA 4M99A 2Q0HA 3CG4A 3L6DA 1DAKA 3I2JA 1H22A 4P5EA 1E3IA 1UCFA 3IKJA 4TSFD 3EVZA 2XECA 3SLRA 3UN1A 4RJTA 1JQBA 5JWOA 2X4DA 1EDBA 1CC1S 1U0GA 1U2RA 3GUHA 3JW8A 5IK2A 4C08A 1QFJA 2Z95A 4CLDA 2WIKA 1DELA 2EBFX 5HQ3B 5KTKA 3JQGA 3GFVA 2RIRA 2YVAA 3G1UA 1NU8A 5KTNA 2BMEA 1TMKA 1K3UB 2H3EA 1U31A 4Y1FA 2W0SA 5D87A 3AU8A 4PLFA 4KR3A 2J30A 4NNJA 2AJ8A 5ER6A 1TU4A 1D07A 1XCPA 3NDJA 1KVRA 4ZAZA 3O0DA 5I6DA 3I01M 3R7DA 2BDEA 4TOIA 5G0VA 4RX1A 1C9MA 4C7KA 1YXMA 1E5LA 1RKVA 3KSDO 3OF2A 3KFVA 3T0GA 3UO8B 4DLNA 2F67A 4CDNA 3KWMA 1J06A 5A6SB 1HYQA 4C0AC 3ZD7A 1I0LA 2GVNA 2EQ5A 3COPA 1U7DA 2DBRA 4D9FA 1J8DA 4LYAA 5JY6A 1OFUA 1N5RA 2NZYA 2ZB4A 3AEKB 4S1NA 5EJ8A 1VSBA 2NZVG 1SIBE 1UPTA 1RWOA 5C1BA 4P2GA 2XNJA 3Q7TA 2G1PA 1DAIA 4MS3A 1NDUA 1YRYE 1CUCA 2XTAA 3VO1A 4QZVA 1PZHA 5F7ZA 1U3TA 5ALRA 3RSQA 2JGMA 2O06A 2ZRIA 1W4LA 3ZWDA 3ETLA 1CT9A 4DQXA 4P98A 5BSGA 5ITVA 5KOIA 4RYLA 2W8BB 3YASA 3AHHA 1XZNA 3K1TA 3P2KA 3PV0A 4QEDA 1GA1A 1I6LA 2E1RA 3JY6A 1M2WA 5DHTA 3TX6A 1I2CA 3SC4A 2F9FA 4DJAA 4B6RA 3QSYA 1E64A 4JLVA 4PQFA 4AKIA 4PLCA 1A8HA 2NV6A 4MRPA 4PANA 4BNNA 3AVUA 3VR5D 1TJNA 1HFEL 1JIXA 4Z1MD 1DC7A 1PZXA 3QU2A 1GZDA 1UK8A 4A82A 4M1YA 3V4PB 1X77A 3OEWA 3CU5A 1DCTA 3EXHA 2PUAA 1J1UA 2QTNA 4NMHA 1G60A 4CKBA 2O2ZA 1UODA 1FTYA 3RYHA 5EP2A 2JI6A 1F1BA 4LV8B 1O9HA 3H9GA 3IHLA 5FUVA 5FV4A 2R25B 1A9TA 1TECE 1ETUA 4TQ9A 1MIOB 2DPLA 1JSRA 1GCAA 3PDIA 2FSIA 4DLVA 2IHKA 4HB0A 2HTFA 2A33A 4ENQA 4L73A 1KFJB 5TRTA 3KCNA 4MINA 1MDFA 4RJ2A 5FLKA 2XCSB 3CUKA 3DT6A 4Q7JB 4MVJP 4WJKB 1QCZA 5TV2A 5L7TA 2P2SA 4LE1A 4GPZA 1NBIA 3G1TA 4FIDA 2IEIA 3ZNOA 1R6VA 2X77A 4MA5A 3UJ7A 5F9MA 4ZVNA 1EFCA 3DV0B 3HO1A 1T8TA 5ALLA 4MRMB 1QOPB 2YZMA 4BNUA 3VKVA 4O4HB 1KYTA 4M1WA 3S40A 2BEVA 1ZX1A 2QUHA 2ZBPA 4M0PA 2PMCA 3PX2A 4KVGA 2G08A 4RYDA 3IIMA 3LGXA 4NBWA 3OVMA 2GK7A 3G0CA 1KU0A 1QZXA 2F8LA 2W2MA 3W3AH 1XMSA 1U04A 1N6PA 1P2SA 3AFOA 3CLHA 4FFOA 4KYTA 1M2GA 2HWWA 3PC2A 4M37A 4UASA 3VVCA 1W25A 2P6UA 3L8EA 4GVPA 4B3BA 1QKKA 3WZLA 4OSPA 1FQKA 1VMIA 4UQLA 1T5OA 4I2NA 4NENA 3H18A 4P38A 2PSSA 1LX7A 4JOBA 4LHXA 4MI6A 2COEA 4MPTA 1G38A 3PF8A 5H59A 1T8RA 2YHUA 3VGPA 1QGDA 3B6MA 3LY9A 1QMPA 3FRJA 2BLLA 4FX5A 1EWQA 4HDMA 5EE3A 3RSSA 3ETEA 2JHFA 1JQKA 1Q11A 1SWVA 1ZINA 1LQUA 4QNMA 3F6PA 3I9V1 3K09C 1ZH0A 2RAPA 4PIMA 3GEHA 2VQEB 3QWAA 2P41A 3LMKA 4L0QA 5BMVF 2O59A 3F67A 4WZBB 2EKBA 1MO4A 1L8XA 1I7NA 4B84A 1E7MA 1E61A 1M83A 3N6RA 3VZQA 3ZCSA 2PE5A 4REMA 3D0QA 3H1FA 5AJWA 2YIMA 3TIIA 1I2DA 1MNQA 3EZFA 4MQFB 3U19A 3H3XA 1MAUA 1PR2A 1L5GB 5JYBA 3NWEA 1RQXA 2O05A 2NYRA 2IYOA 4GUAA 4M9CA 4ZVSA 4EY3A 2QXUA 2OPBA 4W82A 1JE1A 3MTBA 4MW1A 2YMPA 1FTGA 4KHZA 3KPJA 4BQFA 2Q0SA 4JWTA 2O2DA 2WYVA 8ADHA 3MINA 3WB9A 1EFRD 1U0OC 3DTVD 3LUJA 1ULZA 2I2WA 1PJ2A 4JHLA 5EN4A 4EMTA 5AFSA 3ZGZA 3JVUA 4RJKA 2PPVA 4H6XA 1X1CA 2BKUA 4ID3A 3RC3A 1SUBA 2XQJA 1M8KA 2YDYA 3EXFA 2WHYA 1GZUA 4YHBA 3RGWS 4LDPA 3ZS9A 5DCYA 4LNUB 4NPHA 1NNSA 2QTLA 4MR8B 2NP7A 2EC5A 1JZTA 3CBQA 1AJEA 1TIKA 4HAVA 5DOVA 2H7VA 3AB7A 2XSZD 1LBEA 4Q01A 4COOA 1JDUA 2JKZA 1NBME 3BFKA 3C6QA 3K96A 2B20A 5EE5B 5EWMB 4QE3A 3ZE0B 2BUAA 4MQBA 3CZRA 4GXQA 4OHXA 2Q1WA 4J3NA 2OA0A 1C7IA 3CTPA 3KAQA 3S44A 3O9MA 3WBFA 3ZWWA 3PUHA 4HZUA 3BGOS 4CLRB 1X1AA 3CKYA 1Y63A 3DEJA 3O4HA 4FU0A 4GE3A 4P32A 2VT2A 1Z56C 4UATA 3ZHVA 2C92A 3KV3O 4H4DA 3GNSA 4WXYB 4QQRA 4W9MC 1T35A 1B0PA 4LKRA 4QC2A 5B1DA 2O8CA 3WNQA 1I0ZA 3S29A 4B3CA 1H2XA 1I51A 2CHUA 2C2BA 2V8OA 3GY0A 3N2KB 4ZT3A 1AE1A 3B78A 3F6SA 3KZOA 1G5IA 3V4VB 2QYSA 3S1AA 4JBIA 3NBFA 5DHQA 1A5SB 2WF8A 2CUTA 3A14A 2Z8YA 1VHLA 2ZBFA 3RB8A 1QBGA 4PSAA 2IZZA 3ZQJA 4DCMA 1KC3A 2MSCB 5GQSA 1KYXA 2AD5A 4HB2A 4RIFA 2GZ1A 1AKMA 1YI0A 1M0WA 4IG9A 4WGGA 1QQAA 3RANA 3FPAA 4HNQA 3UKOA 1YMVA 2CV2A 3MT9A 4UE6A 5JAIA 4F21A 1KS2A 4NXMB 4MAMA 1TA9A 4AZTA 3CLUC 2IYEA 1X94A 4YCLA 3LXRA 5HDQA 3M6FA 4JV5B 1P2TA 4P22A 1KP9A 1ADJA 2ZB8A 1JKJB 1M0TA 3D6TB 3IQXA 1QIMA 2C8JA 3JQ9A 3NX4A 3ORQA 5E1MA 1GV0A 1KJWA 2XF2A 3PPIA 1YQ9A 5LCXA 4MQ4A 3W0LB 3U81A 4F1WA 3GG2A 1JHZA 4DY4A 4RHFA 3UJ3X 2H4XA 3JYHA 2FB9A 4KLZA 3T7DA 3VR3A 3QKRA 2QLMA 4LPKA 1W96A 1T2DA 4WZBE 1ZW6A 2XRZA 5FB3A 1SVNA 5AW6A 3N76A 1KMNA 3Q87B 2A0KA 1QAMA 5H83A 4HXYA 5D85A 1E5XA 3P5BA 4DV3B 4RA6A 3HDQA 4WKPA 4TQAA 5HSGA 4HGPA 2W4IA 4H7PA 5KNBD 1KNQA 1F0KA 2IHBA 1WVMA 2WA2A 4NCKA 3PNBA 1JAYA 1F8YA 1ZEJA 1UADA 2CF5A 5JARA 4AMGA 5KC9A 2XA2A 4HN4B 2CNWA 3WGTA 5IM4F 5IRCD 2QX9A 1FXWF 1ZUNA 2GFHA 4PAGA 4TZ6A 5BN4A 3DTTA 1ZD9A 4YAKA 1H5QA 5FIUA 4O1IA 4MS4B 1AUPA 3AHJA 4Q1VA 4J6EA 3EDCA 2R6JA 3CZ9A 4UDYX 4WNIA 1E4EA 1VOTA 4DDHA 2FY8A 4KE8A 5FHQA 5H02A 4RTPA 1ADBA 2IVZA 3L4BA 3TECE 1GAWA 3DEFA 3SHWA 4KIUA 5FOUA 3KPWA 4PHGA 3AEQB 2BEUA 2EJVA 4LYYA 4M0CA 1NSTA 4N8SA 2ZDQA 3PA6A 4CWAA 1V7QA 1TK3A 1B0UA 1BXZA 2HMTA 2OGTA 2PXCA 3IMEA 3OY2A 4N5LA 4DSOA 3GLFA 3KZ1E 4ACAA 1H2EA 1PTJC 1TTPB 4YP1A 2PWBA 3QV2A 1UJ2A 4YRBA 3HR4A 4DCJA 1JG3A 3KTAB 5MHTA 1X1QA 2GA8A 4I8DA 4RABA 3QBJA 4X3PA 1AKWA 2ZIFA 3D4PA 4M60A 1H4QA 2XUGA 1XQWA 2YV2A 3I9V6 1KDZA 2AUNA 3HXLA 4MK4A 1QOQB 1Y9DA 2GN8A 5JOQA 3QBDA 1ZM9A 1AA9A 1JEYB 1ZNQO 1SZPA 4NECA 3WLMA 5CBKA 1XU9A 5KEIA 5CVUA 4WI1A 1X19A 5G1OA 2D13A 2C7VA 2FRXA 2ZIXB 1N5MA 1T9ZA 2BFOA 3IR5A 4JOSA 3VO2A 5A9RA 5GADl 1Z8FA 2ZSJA 4L22A 5CA1F 2WAAA 2GZSA 3HDJA 2V65A 1IOVA 3DLAA 1RLTA 5B7NA 3VTZA 1YV9A 2JKYA 1A4XA 2VQSA 2C98A 3EYAA 3L41A 3E5RA 4MW9A 5F23A 2VI5A 1KH2A 1YCHA 4A6DA 2O2SA 4YWJA 1LXCA 2GJ8A 4NWIA 4Q7KA 1E1KA 2PRKA 3EX7C 4NNPA 4JR2A 3UK7A 4LI0A 2CSXA 1UM8A 3S4YA 4LGVA 4D6XA 3OTIA 3SEQA 5LKAA 3H9JA 4JSTA 1H23A 3VV2A 5AM1A 4FGKA 3IE0A 1BJRE 4BBZA 5M5BA 2GBIA 2GHIA 4ZO4A 1P72A 2P3LA 2PO5A 3RHFA 2VN8A 1CRLA 3BBLA 4TLAA 5FLEX 4C0LA 3WYEA 2Z30A 2QA5A 1T0BA 1M54A 1HQDA 3BXOA 2JCBA 9GPBA 5D7NA 1YUBA 3HQ4O 4HRVA 4UNNA 4B4KA 3FCAA 3KSZO 3AJAA 4TMXA 4OQFA 4N47A 4QJIA 4BFLA 5CDUA 4KQCA 4QOGA 1ATIA 1XDZA 3S5UA 2ZXFA 3OLZA 1PL6A 4ETNA 5A3SA 4S24A 4F0JA 3FF4A 5IUNC 2VG8A 2VP2A 4KVAA 1K6JA 3ECAA 3HU2A 2IHZA 5HS4A 2H4WA 1G20A 1YB1A 2IEDA 3CCCA 3FTDA 3U09A 4L8VA 3DM9B 3DL0A 2CB0A 2ZFUA 2E85A 5REQA 3TLCA 3H1AA 3EDYA 4JFRA 1RWPA 4L4ZA 5F2EA 3KQKA 4LJRA 3H9CA 4G0PA 1MO5A 3TKLA 1G4HA 1VDMA 1XRQA 5J4YA 3TQRA 5CFQA 1CRPA 1KHTA 1VP3A 2JCSA 4A8PA 4DJ5X 2LVBA 3HYLA 2YVKA 1BTOA 4E15A 1Y8QA 3B5IA 4LGCA 4UMEA 3VYWA 3PHGA 2L0XA 2ZM6B 4FMCB 1NW5A 1RVDA 1MFZA 4JJ8A 1E69A 4JLMA 5CYGA 3ZVLA 3DLPX 1X2BA 2OAEA 2LCQA 4B4OA 1NRJB 5CHYA 5DJ5A 1JQDA 1IQ0A 2GPSA 4G5FA 4YLYA 2FMXA 3BSWA 3WRXC 5AM2A 2FJ0A 2C59A 2IZ1A 3EY9A 3SX0A 1MX3A 5JW6A 1BQ3A 2OBMA 3ROZA 1CJVC 3DZIA 1GNVA 3I09A 5AO9A 2I6XA 4P9NA 2D2FA 5JMPA 3I76A 3SJBA 1F9AA 3INNA 2Y9PB 1ML3A 1T4CA 2ZTHA 3NR2A 1RZ3A 3TK1A 4RLSA 4CEHB 4PNEA 1Q1BA 4JI1B 1P4SA 2MHCA 2IVFA 5AKIA 2OFXA 1L4NA 1QF7A 2HJRA 2OV2A 2Q3CA 3HKEB 3ND7A 4L02A 2X6RA 4JC8A 3K5WA 3C6BA 4FUTA 3AVVA 3NUGA 1WNTA 4M1MA 1GG8A 2I9PA 3V7NA 3AXSA 4B0PA 4JQYA 4B83A 5IFLA 2XZOA 5CA0B 3R24A 4RHTA 1ODCA 1KDVA 4AL4A 4ETWA 2BHSA 2DFLA 3QPBA 3L07A 1U0JA 1GPYA 2GCGA 2PCLA 1WDTA 1M3SA 2E4ZA 3JS5A 1TF5A 4NCHA 5D5PA 5BN5B 4PC6A 1C8KA 3UK2A 1YZUA 4Z3KA 3U4DA 5LA6F 1PJSA 3I5UA 1JU4A 1TT5A 4KQIA 5F7JA 4ZYZA 1LK5A 2R7MA 4JJKA 1TO1E 1Z39A 2BFPA 3CO0S 1E0JA 3CISA 1II8A 4HKTA 4WINA 2DG2A 4I50A 3FIJA 1YTLA 3F6YA 2CVQA 2VTBA 1BRMA 1MENA 3P4YA 3W3ZB 1BVUA 2J09A 3PGKA 3L6OO 1TUBA 4QX6A 5KIAA 4XGKA 3BB4A 3W3AD 1S4QA 4CIAA 2W0MA 2UZ0A 2YWCA 3BCSA 5BT8A 2AFHA 4GP6A 2D7CA 3PGMA 5TEVA 2UYHA 3FZGA 3VR6H 5EHZA 1WKVA 1Z37A 4UVIA 5COAA 2OEPA 4N7JA 2HYDA 2ZLBA 3ILXA 4ZCTA 1KOLA 4C89A 2ZYUX 3NM5A 2YWEA 6PFKA 2COUA