5HOQA

Apo structure of cals11, tdp-rhamnose 3'-o-methyltransferase, an enzyme in calicheamicin biosynthesis
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
251
structure length
234
Chain Sequence
b'QDLRAFVHDSPEETETTQRLTKLLTNSPIPTEELVNNLPLFLRRHQMTDLLSMDALYRQVLDVPGVIMEFGVRFGRHLGTFAALRGVYEPYNPLRRIVGFDTFTGRFAVPGGYPAYLKEVLDAHECSDFFGHVTQRSVLVEGDVRETVPRYLAENPQTVIALAYFDLDLYEPTKAVLEAIRPYLTKGSIVAFDELDNPKWPGENIAMRKVLGLDHAPLRLLPGRPAPAYLRWGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TDP-rhamnose 3'-O-methyltransferase (CalS11)
publication title Loop dynamics of thymidine diphosphate-rhamnose 3'-O-methyltransferase (CalS11), an enzyme in calicheamicin biosynthesis.
pubmed doi rcsb
source organism Micromonospora echinospora
molecule tags Transferase
total genus 69
structure length 234
sequence length 251
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05711 TylF Macrocin-O-methyltransferase (TylF)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5hoqA00
4K6MA 1O9GA 4X60A 4JXJA 5FA8A 2AN4A 3R24A 4OQDA 2YUIA 2YQZA 2NXNA 3R0QA 5EPEA 3UZUA 4HRAA 4OA8A 4AUKA 3HVHA 5DXJA 5GWXA 2B78A 1IY9A 3NTVA 4FS8A 2YXEA 3Q7EA 2PKWA 3LCUA 5DRYA 4E70A 4RTMA 1FBNA 4NECA 2PXAA 3SXJA 3GCZA 3RW9A 1ZGAA 3NJRA 2PVCA 2AN5A 3B3JA 3MGGA 3PFHA 5EMMA 5FUBA 3EEOA 1DCTA 3NMUF 2FYTA 3PB3A 2GH1A 3FTFA 4RX1A 2IDJA 4R8SA 5FA5A 2HNKA 4PIMA 5E1BA 3GDHA 3M6WA 5DTRA 4QDJA 4DM3A 5EEHA 2P41A 3SVZA 4C07A 5HIKA 1L3IA 2EJTA 1SKMA 4WXHA 1SUSA 3KQWA 3OFJA 4BP3A 1WY7A 5G02A 4E2YA 1RI4A 3UFBA 1XJ5A 4RTJA 1X1BA 4RTNA 4BLUA 1WG8A 3CVOA 2JJQA 2PWPA 3P9NA 3UBTA 2IP2A 5BP7A 1ZKDA 4BY9E 5EHGA 5EZQA 3QV2A 4RTPA 2H11A 4PCAA 1L9KA 5CIYA 2PXXA 3EVFA 3PX2A 3CCFA 4E2ZA 3HVJA 1L3CA 4YV1A 3DXXA 5HZMA 5KS2A 7MHTA 1G8SA 4PYJA 2ZSUA 2GAFA 4RYLA 1JQ3A 3OZRA 5E8JA 1EJ0A 5EMLA 2OB1A 3R6TA 4QTUB 5FTWA 3H2BA 2PY6A 3G2MA 1BKYA 1QZZA 3PLAE 4GBED 2ZBQA 1RJGA 3HVIA 3NDIA 5ICFA 1R74A 1JSZA 1VPTA 2ZZKA 3R3HA 4GC9A 1RI5A 2O0LA 5DRTA 3EGEA 2PX8A 5C1IA 2BR5A 3A7DA 3OFKA 1WXXA 2F8LA 2G8NA 4X41A 1B42A 2IH5A 2PX4A 1NBIA 3BUSA 3GRUA 2FRXA 4RVHA 2ZBRA 1R8XA 3A26A 2PT9A 1JR4A 1NV9A 3FUXA 1YZHA 3ELDA 2G70A 2AR0A 3FPGA 2BM8A 3FRIA 5DXAA 5E1MA 2O57A 3FYDA 5D1HA 3WSTA 1XDUA 3ME5A 3FYCA 2UYHA 2IPXA 3TFWA 2UZ4A 3FTEA 3GNLA 3KPVA 4FP9A 4AX8A 5HIIA 5K0GA 2G1PA 3HCDA 2AOTB 4YMHA 2PGXA 5LQUA 2C7PA 5DT2A 2OPBA 3E05A 3C6KA 1M6YA 5EHIA 4HTFB 5EIWA 1UIRA 3I64A 5BW4A 5IKMA 1BHJA 2Y1WA 1EIZA 1Q0TA 4GOOD 5E8RA 1NW8A 2LD4A 2EFJA 2ERCA 2P1DA 3BWBA 3I53A 2GLUA 4FSXA 4WVLA 1VIDA 5KVAA 1XVAA 2PV0A 3P97A 4OA5A 2VDUE 3EEYA 4DKJA 4YUVA 3UJCA 2ADMA 4M37A 1DL5A 2YVLA 2CMGA 1RJDA 4M7RA 4XCXA 5EZSA 1I9GA 2IBTA 4KW7A 5DM4A 4FT2A 4F85A 2NP7A 1M6EX 3HA3A 4FT4A 3LL7A 1SUIA 2HMYB 3P9CA 4PYNA 1G6Q1 3A4TA 3CGGA 3EVAA 3HP7A 3KR9A 4MTLA 4A6EA 1X1CA 4EKGA 2PX2A 3KR0A 2XBMA 5K01A 2PJDA 3B3GA 2C7RA 4XUCA 4UOEA 5KQSA 2P3QA 2ZW9A 3SX0A 3G8AA 4E31A 3LDFA 1D2GA 1KXZA 5GOZA 5HILA 4RTSA 1IM8A 2PT6A 3QOWA 3TMAA 5HFJA 3SM3A 5E2BA 4FGZA 2UYOA 3ELWA 4QTTB 2O06A 5F2KA 4RSRA 3C6MA 2R3SA 1NW7A 3JWHA 4CKEA 2I7CA 3EPPA 2IH4A 4HGYA 5LSAA 1H1DA 1WS6A 3ID6C 4P58A 4ER3A 1UWVA 1N2XA 5DM2A 4V0RA 3GWZA 3KR1A 5E9QA 5LR6A 2AOTA 5LQJA 3E23A 3A25A 4EMSA 4LWOA 3FZGA 2B2CA 3FUWA 4HTFA 3M4XA 1XTPA 3KPWA 3KQOA 4DF3A 4ER7A 2C7OA 2VZ9A 2AS0A 2NXCA 3KQQA 4Y2HA 5T6BA 2P35A 1AV6A 2ZLBA 3KHKA 3K0BA 4LWPA 5CCBA 3B7PA 3MTIA 3TQSA 4M36A 4RV9A 2VDVE 3E7PA 4PYIA 2PSSA 4DZRA 5K03A 1MJFA 2FHPA 2I62A 5EOVA 3TPZA 3C0KA 3ORHA 3ERCA 5T64A 3HTXA 5C9ZA 4HH4A 3AXTA 3BWCA 3PFGA 3FUTA 2PLWA 5FQOA 1XCJA 2FK7A 5M5BA 2BH2A 1R8YA 3B3FA 3BWYA 3DOUA 2VDWA 3EVGA 3G2PA 4HG2A 4LG1A 3KQVA 1KHHA 2HV9A 4GQBA 3VYWA 3O4FA 5LQCA 2YX1A 5K0FA 2IDKA 2G71A 2O07A 1QANA 3ANXA 1P1BA 4RTKA 1XXLA 4R6WA 5DM0A 5FWAA 1ORHA 1NE2A 2DPMA 2IIPA 5GIOE 4O29A 3GRZA 3LCVB 2XYVA 3DLIA 3PX3A 2OB2A 4KRGA 4C05A 3G5TA 3MB5A 1JG3A 2UYQA 2JG3A 3P9KA 4QQKA 1M0EA 2P40A 2ONZA 2ZZNA 2NNWB 5K0JA 3DULA 2BR3A 2EJUA 3EVBA 3OZTA 2ZTHA 3BKWA 5EMKA 3REOA 3P71T 4F86A 5KYGA 1N7IA 3P2EA 4FZVA 1TW2A 4P7GA 3UJDA 2ZZMA 3NVKI 1YB2A 3P2KA 4P7JA 3THSA 5LQAA 4EQZA 1R6AA 3RODA 5CUQA 5ERGB 5KQRA 3CBGA 3NDJA 3LBFA 3SGLA 3GO4A 1PRYA 2B25A 2OZVA 3BKXA 4C04A 4RTOA 3OU6A 5DLYA 5DTQA 2P3OA 3NVMB 3BXOA 3GRRA 3P9IA 2YXDA 5DTMA 2OBFA 4KIGA 3UJ8A 5E9JA 5ICGA 1ZHFA 2VS1A 5EQJB 1YFJA 2IH2A 1XCLA 4F84A 3DLCA 3OE4A 5EKXA 3F4KA 4X61A 5HIMA 3VSEA 3HCEA 2BM9A 3O31A 2VP3A 4GF5A 5CVDA 2CL5A 3EVDA 4YUXA 2GB4A 3LECA 1HNNA 2B3TA 1RJFA 3M6UA 2P3LA 4AZSA 1FP1D 1O9HA 4CWAA 1VE3A 2WA1A 2AN3A 1BOOA 3Q87B 3T7SA 4L7VA 5HOQA 2N47A 3QOXA 5EIFA 2AZTA 3DTNA 4OBXA 4X63A 3FPEA 1SQGA 3TLJA 4RTQA 1VQ1A 3GIWA 1YZ3A 2E5WA 5EEGA 3BGDA 4U7PB 4BLVA 1X1DA 3G7UA 1SVUA 5EGSA 3HEMA 4PGHA 4DMGA 2FPOA 3I58A 4BLWA 3M33A 1YFLA 4G56A 3NWEA 2JHPA 2A14A 3DH0A 3DUWA 2FCAA 4EKIA 5K0EA 5K09A 4MWZA 4MHTA 2PX5A 3P2IA 3EVZA 3B5IA 4R05A 1KPIA 2CWWA 1P1CA 3KPUA 1TPYA 2QE6A 4DQ0A 4PYKA 2WA2A 3CKKA 4EK9A 1VP9A 3DXZA 3LKZA 4C4AA 1HMYA 2OO3A 2HWKA 4GOND 3G2OA 3G88A 5LQKA 2QRVB 3TKYA 2ZFUA 5FWDA 4CXMA 4YUYA 4OX9Y 3CJTA 3MHTA 4GEKA 4FSDA 4AZWA 3BZBA 3EVEA 5EC8A 3JWJA 5BXYA 1VBFA 1KR5A 2NXEA 3FPFA 1QYRA 5EKUA 3HM2A 2PXCA 5GP1A 5HEKA 3BGIA 4XUDA 1KP9A 1KYWA 1SG9A 4PCLA 5GM1A 3AJDA 3I9FA 2ZIEA 4YUZA 2AOWA 4MQ4A 1EQAA 4GUAA 4CKBA 3M6VA 5CM2Z 1IXKA 4E2WA 3DXYA 5CVEA 4E30A 1I4WA 1BC5A 2P8JA 1O54A 3UJAA 4YUWA 2I6GA 3TM4A 3HCAA 4RTRA 3G8BA 1JQDA 5FHRA 2R6ZA 1AQIA 4Z2YA 3JWGA 4PWYA 4X1OA 3LHDA 3KQMA 3OCJA 4Y30A 2XVMA 5T67A 2HR1A 2GS9A 2P7IA 3MTEA 2ESRA 2ZWVA 3HVKA 3A27A 3C3PA 2P7HA 2DULA 3V8VA 3C3YA 2AOVA 2GPYA 4A6DA 5K8VA 2CKDA 4YV2A 3UWPA 4POOA 1NBHA 2EG5A 2Q41A 2JH8A 2PBFA 3THRA 4PIPA 4PNEA 4V0QA 3BT7A 2C7QA 5K0LA 3UJ9A 3X0DA 1P39A 1G38A 5CVVA 3EMBA 1KYZA 3TR6A 3HNRA 2HTEA 4ER6A 5FADA 1ZG3A 3GXOA 3UJ7A 5ICCA 1AF7A 3IHTA 2UYCA 3O7WA 2QRVA 3CJQA 2JHAA 3A7EA 4OBWA 3PTAA 5CCXA 3VC1A 1MHTA 4IKPA 1YF3A 1OR8A 2ZCJA 3KQYA 2ONYA 4ATNA 1SQFA 2CMHA 3PVCA 1EAMA 3GRYA 3GGDA 4B17A 5CVJA 4GC5A 3UA4A 1YUBA 3NWBA 3P8ZA 4QDKA 5K0BA 4GOLD 3CJRA 3HA5A 3DP7A 3V97A 2AOUB 4HSGA 2ZIGA 4PYOA 3IV6A 4E33A 1L3BA 3NW9A 4RVGA 3T7RA 1NT2A 4FR0A 5DM1A 3OU2A 5K0CA 5LQNA 5GINE 3MERA 3VC2A 4KVZA 2ZWAA 3B89A 3FTDA 1FPQA 1NW5A 1Y8CA 1X19A 2O05A 2NYUA 3KU1A 4RVFA 4BP1A 2IBSA 1WXWA 2BR4A 3EVCA 4P7FA 5DSTA 3KR2A 1L1EA 3LX6A 1D2HA 5JR3A 4M38A 3CC8A 3M70A 1VLMA 1ZGJA 1EJ6A 5F2NA 1F3LA 3HA7A 4QQNA 5IH3A 1NW6A 1R00A 4PYMA 2Z6QA 4H0NA 3KKZA 5MHTA 1JG2A 1WZNA 3HCCA 5EG5A 3AXSA 1DUSA 3FRHA 3PT9A 4HC4A 4KWCA 3E8SA 4C03A 2YXLA 3MQ2A 2XYRA 2IGTA 1G55A 3T7TA 5K05A 2Y1XA 3ELUA 3G5LA 3GRVA 3HCBA 3MCZA 1JSXA 3TKAA 2AVDA 1R18A 1TW3A 5E1OA 1QAMA 4CTKA 3LBYA 5E1DA 1AQJA 1FP2A 2H00A 5DX1A 3ER9A 3AY0A 1G8AA 3LSTA 3R9XB 4YV0A 3MAGA 3EGVA 10MHA 3FPHA 1JG4A 2Z6AA 2V7EA 2OYRA 1KIAA 3LDUA 1RI2A 2PWYA 2JH9A 2ORED 1F38A 3BWMA 1KPHA 3DMGA 3D2LA 4OQEA 4P7KA 5FQNA 4DA4A 2H1RA 2B9EA 1JTEA 1NW3A 2NXJA 5EVJA 3UJBA 3FUVA 2AOXA 2YR0A 4U7TB 5GM2A 5JUWA 1PJZA 5HIJA 2OXTA 2AOUA 3OPNA 4QVKA 4EVIA 5CD1A 4QPPA 5U4XA 1EG2A 2EX4A 3KPJA 9MHTA 1T43A 4CTJA 5EMJA 3FPJA 3LDGA 2JHCA 5H02A 1RI3A 3FUUA 2GA9A 3KQTA 3EMDA 2ZULA 3OU7A 4ISCA 5DX0A 5FULA 3EGIA 4PYQA 2WK1A 3KPYA 3GJYA 1INLA 2NP6A 4QVGA 3IYLW 3S68A 1VP3A 2ZIFA 4DCGA 2OKCA 3IEIA 5CVUA 3UJ6A 4RWZA 5K0NA 5FHQA 3TM5A 1VL5A 4QPNA 4DCMA 2QY6A 2XVAA 3SSMA 3JWIA 2I9KA 3L8DA 1RI1A 1FJXA 3SR4A 4AZTA 4KDRA 3ELYA 5DX8A 2KW5A 5D1NA 5BW5A 5ICEA 3G89A 3I5UA 3LPMA 4R6XA 3DR5A 4C06A 4ER5A 5DPMA 3FTCA 2BZGA 4IV8A 4PGGA 4IV0A 1V39A 2Z6UA 4KDCA 2ZBPA 1JTFA 5DWQA 1ZQ9A 2IFTA 4LECA 1QAOA 3DMHA 2K4MA 3KQSA 1G60A 8MHTA 3DMFA 1P91A 3MCTA 2V74B 3U81A 4PONA 4PYLA 3T0IA 1X1AA 3AWIA 3RIEA 1U2ZA 5P8WA 3OE5A 4RVDA 5E9WA 1Z3CA 3SSOA 4YMGA 3G2QA 4PINA 5B1SA 4E32A 3M6XA 4IWNA 4CKCA 4RTLA 1N7JA 1NV8A 3LCCA 3K6RA 4ZTBA 1XDSA 5C0OE 2YTZA 5E2AA 3BGVA 4MIKA 1NKVA 4HGZA 4C08A 4AZVA 3SMQA 3LGAA 2OY0A 2ZVJA 1I1NA 2FK8A 2AVNA 3ER8A 3LKDA 2XYQA 1JQEA 5FCDA 4KIFA 1ORIA 4R8RA 1Q0SA 3OZSA 1D2CA 1JG1A 1KPGA 3TOSA 5F2OA 4GOMD 4XUEA 2QM3A 1UFKA 5LQRA 1QAQA 2G72A 3PS9A 1RJEA 5DSXA 3SSNA 3UA3A 4E2XA 3KQPA 4ER0A 5GIPE 2QYOA 1XDZA 3GU3A 3TRKA 3HCFA
chains in the Genus database with same CATH superfamily
3GG2A 3HGTA 2Y6VA 1BGXT 1V47A 1E79A 4J2OA 4LVOA 4R7TA 4X91A 3W2TA 1ZKMA 2V58A 3O84A 1K66A 1PQ4A 1IUKA 3KXKA 3JS5A 4FS8A 1M1YE 3H5LA 2F8TA 1U02A 4QDXA 4FU0A 1U0NA 4HAOA 2XEDA 4WBNF 3MD0A 3FMFA 5KU1A 1FLAA 1L7RA 3A0RB 4I4TA 3TEJA 5BOSB 1NONA 1U8TA 4NE2A 4S35A 3UMMA 3U26A 3SAJA 4Q4DA 1VYUA 3LHFA 1TAUA 4RJKA 2A67A 1UKVY 2ICAA 2JIDA 1EKXA 2OWDA 3H0CA 4IFEA 4QDJA 5EEHA 3N70A 3PITA 5J4LA 2YQ4A 3K70D 5DHQA 5IDVA 4HX2A 3IKVA 2YOFA 2PH1A 4QU8A 1V16B 2WJ6A 3GZNB 3IPCA 2HK8A 4LC9A 1D2EA 3QVLA 3O8LA 3EK2A 1DFHA 1XEWY 3OETA 3P9NA 4G5OA 4RH0A 4C7BA 4W8HA 5T5QA 1JT9A 2J4CA 4D42A 2XGMA 4PG8A 4M88A 2ID9A 3MSCA 5EE3A 2DE0X 5LBIA 3V2UA 3AHHA 2ZJ7A 1SHLA 4FXPA 2O1XA 1NUQA 1R8JA 1OC4A 4MZDA 1ONOA 1NN1A 4P5EA 3TLBA 3PDHA 1E4EA 5TQ2A 3EVFA 3NEPX 3QVMA 4KXWA 4ZOLB 3WX0A 4ZTUB 3M1YA 5AKKA 2XX3A 3GP3A 3IBYA 2VHQA 4LVUA 1EGQA 3CS3A 3H3XA 1QIJA 5HW0A 2UUBB 2RGRA 3A4YA 1GA1A 4D9HA 2Q9UA 2ES4A 1YAHA 4FHEA 4HZUB 4OMFG 4UDNA 1CEYA 2GN1A 2D74A 4GBED 4L2IB 2ZBQA 3IDAA 3OPYB 4TLEA 5EXTA 3RU9A 4C4RA 3U4DA 1MA0A 2FPKA 2Q6KA 3DONA 4TLAA 1R37A 4MUGA 1NUSA 3PHGA 4GC9A 2XUQA 4NK4A 3WMFA 1HGXA 4JLAA 1KMQA 3PRYA 4JUCA 3IH5A 1KJIA 4H6VA 4JJFA 1FFYA 4JT2A 4BP8A 3QM1A 4TT8A 1JQBA 2C4VA 4JVNA 4X41A 5FBKA 1EFLA 2ZUSA 3R6LA 4DW8A 3VR0A 3LTEA 1VJ0A 2EDAA 2WAOA 3LFUA 2VDPB 3NOXA 5LZ7A 2PPLA 5BOSA 3ADCA 2WJVA 4B2LA 3SF8B 2WFMA 1KU6A 4N5LA 1MN6A 3IRUA 4BO2A 3GL9A 4U3JB 3H97A 5IDWA 2CFTA 3FYCA 3P9PA 4CZ2A 1KFJB 3OLYA 4JENA 3V7YA 4DDTA 1G8YA 3T7AA 2ODAA 3AONB 4JZYA 1QCYA 2OCPA 1V16A 2PFSA 3GZNA 1JEOA 3GF4A 1Y6GA 3HCDA 2AOTB 2Q3LA 3R41A 3K32A 1GZ4A 3P9ZA 4MWOA 2WYIA 2H59A 4ZAFA 2GN0A 2QSZA 3IKJA 3M3HA 1CNEA 1E9EA 1WCYA 2NW6A 1KI2A 3M83A 3WV4A 3I28A 1EVLA 3KJHA 3N87A 1EYZA 1Q22A 2WUDA 3R5HA 3UMYA 4F3CA 1N6OA 2AI3A 2CXRA 4ZOLA 5LP6B 4I0WB 3C14C 5BOVA 3STYA 1BXGB 3NB0A 2VF5X 3ZE0B 2WRZA 3ONFA 1K06A 1UOOA 2J7PA 4ZRNA 3T4EA 3A1TA 1AB6A 1JTVA 1ZVQA 1I13A 2HLHA 3L0CA 4HZUA 3TLCA 2P2GA 2P67A 4YRSA 2WQ7A 4L2IA 5KCMA 3OPYA 3AR8A 3L7IA 5EHQA 1J99A 3PEEA 4IIEA 5HSGA 1LK5A 2ZJZA 4DSOA 1U8XX 3D7RA 3IUMA 4G0MA 3QXGA 4QM6A 5ALZA 1SNYA 4F9TA 1U2QA 2UZ1B 4FYIA 2B8NA 3A4TA 4RZ3A 4W9NA 1U8EA 4YI5A 2OCDA 4PGMA 4CMGA 3IESA 4IVPA 2GGSA 2QQ5A 2XBMA 1YR6A 5C35A 4PICA 1MO2A 4EG7A 1KI7A 2QL7A 3R8CA 4I46A 2DF8A 1N25A 4OI4A 3EDQA 4EI2A 2QOEA 3SF8A 1ZJWA 3DEFA 3GGCA 1YKSA 4U3JA 5LZ5A 4QTTB 4DYHA 1QCCA 1GADO 4RF5A 4ZVQA 3TS1A 3ZWXA 1FSSA 5K4HA 1YQXA 1IMOA 4S2EA 5KOYA 2D2FA 4BZXA 3LA6A 3U4HA 2AOTA 3JQGB 1X39A 2CXUA 5CAEB 4J91A 3QVSA 2E4ZA 3QYAA 4LWOA 4B9AA 4A3SA 6NULA 2VH5R 4XX0B 1ZVMA 1K5DA 2ZJ8A 2GZ1A 4CFZA 5F1YA 3NG1A 4JY7A 5LP6A 5JMTA 3RQSA 5BSFA 3IHKA 2V98A 3E7PA 3U44B 5FWYB 1BXGA 4BXOB 3T0GA 1HO3A 1XELA 3GNTA 3TPZA 3QZUA 1CIPA 3ORHA 3G8DA 4EG0A 2QZ9A 4FMDF 4LRTB 5JSUA 3KJNA 1IOWA 1ZL0A 5TLSA 1H8HD 2YICA 4PANA 4EPTA 1XCJA 4UHFA 5AUNB 4L76A 5KX5B 1ISIA 2WKPA 4PSKA 5IVKA 2VBFA 2ZRIA 1ZJ6A 2HV9A 3IXLA 1T9GR 3A1DA 2XMGA 2Q5LA 3HJTA 4LDQA 3ZGVA 4RJTA 2UZ1A 1JJFA 1DWPA 4BKOA 3QKWA 1R3DA 2G77B 3VGJA 4M9XA 3T38A 3WLJA 3DLIA 3UAWA 3REQB 1O97D 3NM4A 4S3MA 1Y3DE 3BFPA 2HBRA 2WUVA 1C9DB 1H05A 3NAQA 3RKSA 2CV1A 4FYHA 5F98A 2UVQA 1S1MA 4MR9B 1LLDA 3QU4A 1Q77A 4EUSA 4CHGA 2G1PA 2O54A 2IS1A 5NULA 2QU7A 5LXTF 2I4OA 4WFQA 5I7RA 1N7IA 3HDVA 4WFJA 1FU7A 2YVUA 5AJUA 3WGMA 1N3LA 1YIAA 3DOJA 1ZP6A 3E35A 1TAGA 1C81A 4PQRA 2WDZA 5I9NA 3NVKI 3CG4A 4ZCIA 1U04A 4YRCA 4PN7A 3JQGA 3E1KA 3KKLA 4OJQA 5CAEA 1XXHE 2GRUA 1NPDA 2HQBA 3FZQA 2JGFA 3ZS8A 4BQNA 3GDWA 4XX0A 3V4PB 3H5VA 3IKMB 5EJ5A 3CONA 5A5FA 2O8DB 1IBRA 4DR2B 2C97A 3AEKB 2QRUA 5DLYA 1GV1A 1VRCA 3QWFA 5HKKD 3FWPA 3IERA 3BXOA 1DE0A 1RLUA 3D6NB 4OJKA 5P21A 4ZD6A 3COZA 4AJLA 3C97A 1CRWG 2WMYA 4EA9A 1WW8A 5FWYA 3U44A 5E9JA 4BXOA 4WT7A 4ZCQA 4Z0PA 4DUGD 4Z5XA 3LX5A 2CHUA 3EE6A 5KOJB 4QUDA 1MIOB 4LZAA 3D6VA 4X61A 1MC5A 1C1HA 1PZXA 2B6NA 3VA7A 1A2OA 2BMAA 2B8EA 2FFHA 2IDZA 2ZIAA 1U7TA 3FAKA 4LYDA 4OKIA 4BV3A 5KX5A 3PTZA 3M6UA 3O9VA 3LYHA 4N40A 3FTPA 3PDWA 1Y34E 2VPYA 3CLRC 3FR8A 3Q87B 4TMYA 4DIUA 2N47A 1ML3A 2PD4A 2F6RA 2VH2A 3UV3A 1W1UA 1YJBA 1YD7A 3R3XA 3LO5A 3HQ4O 4HKTA 4ZI7F 3REQA 1VQ1A 1E7YA 5EEGA 1T9AA 1EGVB 1KA9H 2VTVA 3R0IA 4CRWB 1JX6A 5DI3B 2GX6A 5E7IA 5EGSA 2WICA 4MR9A 2VNKA 3H4TA 1BOFA 3VX3A 2BD0A 4RIEA 5EWJB 1DX4A 3KU4A 3H1EA 4KXUA 3WJ2A 4EX6A 3D54D 3E27A 3KD3A 2IYLD 3N2IA 4UHKA 4Z8XA 4L6AA 1ZC3A 4R05A 2AE2A 5AJZA 1AQLA 3ETLA 3K1ZA 4FR2A 1SB8A 2R8OA 4N0PA 5EP3A 3IOCA 4YRRA 3WOHA 1FY2A 1RPAA 4BKQA 2D59A 3DXZA 4XWWA 2O2XA 4EF4A 3A58B 3QU9A 1MOSA 2GTHA 3UCFA 2ADFA 4OLJA 1LTKA 3F7MA 2VSOA 2O8DA 2LCFA 1ES9A 3AEKA 1SCNE 2PCLA 3OZBA 1L7VC 1SUFA 4LZZA 4I4LA 5IN5A 5LZ9A 1J33A 1OBFO 1T4MA 2GOYA 3F1LA 4MINA 5EWMB 3SD7A 3AVUA 2P4HX 4OK5A 1RQLA 2AMFA 2WJJA 3W6UA 5CEFA 2WQZA 4R40A 1BJTA 1JIXA 2J5BA 4XTCS 1KS2A 1YR7A 3SYRA 3UUWA 5BNIA 4QUGA 5KOJA 4YUZA 1MIOA 5BPFA 1QX4A 4XGRA 4LJYA 4WZZA 2I7TA 3BXFA 2YHUA 3PNVA 1XZNA 3SR3A 1U7UA 3A3PA 3HC7A 2HA5A 4BB0A 4ICIA 4B44A 2HRRA 1GL3A 2EDCA 4POAA 2AR7A 4K2AA 3ZZNA 1R9JA 3B8HA 3NP9A 2QTWB 3AY7A 5B2EA 1G3QA 1R8SA 1PFQA 2CEAA 2RGBA 1UANA 2FUG6 4U6NA 2WB4A 2RHLA 1D0IA 1NU8A 1X7DA 1XMVA 3CEHA 3JR7A 3KJZA 4OSEA 1KQPA 4TMTA 4N3GA 2I2CA 3OA2A 4I50B 1Q3KA 5DI3A 5ALYA 4CM7A 3L07A 2PSDA 5EWJA 1VPWA 2I9PA 1WA5A 4LDNA 2AD5A 1LNSA 3EXG2 3UC5A 1NZFA 3RKUA 3X0DA 5CVVA 4P54A 1H1LB 3LXRA 3Q0IA 2JIMA 1GFSA 1FTWA 3H8VA 1SIBE 2WSMA 1P5RA 3O8BA 4H1VA 1VDMA 1ZPDA 3EGOA 3I04M 3LUFA 4DJEC 2JGLA 1BU5A 3D8RA 3IHTA 1RD4A 3EGCA 1FMLA 5D85A 3FKSA 3W90A 3RCBA 3WG9A 4FCVA 3AQIA 3G7NA 4HS9A 3J81A 2OGWA 2AX4A 2H9IA 2GZSA 2MR5A 3A7EA 2CXOA 4GVXA 4N5DA 4JDUA 4MR7B 3WKBA 4DGQA 1ZUIA 1ZINA 1FQWA 4F5YA 4Z51A 1QH1B 1TGYA 2GCIA 3PTLA 2BGMA 5EWMA 1IK4A 4GGPA 4XRRA 4ZT7A 1IWPB 3KTOA 4GC5A 4QDKA 3EZYA 2W2LA 3DOEA 3IKLA 3V97A 3IUBA 4H0CA 4NARA 1IXRC 4Q9NA 3OLXA 3DVSX 1T4GA 3RS5A 3D7SA 5LJIA 4YDQA 1QQ6A 1XV5A 2QD1A 3HZOA 4XCQA 4EABA 1E18A 2VPPA 1CDZA 3QHQA 2OCLA 4KE9A 2WD8A 3PG5A 4X24A 3L41A 2P5YA 2V59A 3OX4A 3WYAA 4GXNA 1EXNA 4BGDA 3DD5A 4PSCA 1Q16A 3UJ3X 2BR4A 2OFPA 3U3RA 3T7JA 3VO1A 5I01A 4BMOB 5B4VA 1H8ED 3CLVA 1GG8A 2PL5A 4JFRA 5E9AA 1E2BA 2B1RA 3FETA 5U1PA 4QPJC 3V2GA 2E87A 3E8MA 2X41A 3EDCA 3RVOA 5IJXA 2PM8A 3RVNA 1U2DA 3NV7A 2GHIA 3I3OA 3C3CA 3NP7A 4LOJA 2BCJQ 1PNVA 3PR1A 4G0NA 4I50A 4LDAA 2J33A 3T1QA 1UBSB 5EG5A 4JLJA 3UFXB 1M34E 1F0PA 1NJ5A 2FRVA 3DWEX 3WAKA 1POXA 1H1LA 4COKA 4EHBA 3GRVA 1Z4LA 4PQEA 1PW7A 1M2GA 1SU6A 3LH5A 2JD1A 1R18A 1ICEA 1MXHA 4D79A 3LBYA 2IHTA 3Q11A 4FFNA 4H3KB 1RTTA 3R09A 3QQ5A 1RAEA 4ZCPA 1KORA 1M2NA 4NDZA 3NHLA 1TUIA 4LXTA 2JIOA 2B4YA 2VOJA 6GPBA 1OA1A 3R3WA 3R7DA 3MPUA 3LLUA 5B1HA 4MR7A 3GELA 1I2ZA 1X77A 1KPHA 2FGKA 4HAWA 1NBMD 2RSLA 4GMFA 1QH1A 2OC9A 2X2FA 4H1TA 3IOYA 4NU6A 3ZXIA 4BRWA 5BV2P 2XUIA 5TGTA 5BWMA 3KYBA 4RU1A 1IHUA 1GZVA 4J1SA 2GERA 5JAQA 3PJRA 2PZKA 3CV3A 2XB9A 1O4WA 3URKA 3W3AD 4CF3A 4FK8A 1A2QA 1MCZA 2CXHA 3PUYA 3BDIA 4EAAA 2P77A 3WIOA 5JQGB 1NMEA 4JJGA 1AF4A 4G65A 2ODQA 2X1MA 4R8MA 4XQ0A 5J40A 1KZ9A 5JH7F 4I1OA 2VQ6A 4QSHA 3HDTA 3SVTA 1PDWA 2YW2A 4FQ7A 5HRUA 5KTMA 3QMVA 4YCSA 3OPMA 1CS4C 5JYDA 4JBWA 3WO1A 4QPCA 2JD2A 4IQ8A 4EPRA 3K4PA 3ZD7A 1QIMA 1VL0A 1UPXA 4RULA 3ETJA 3U3XA 3VSAA 5BW5A 4PVDA 1FU4A 1ZNWA 1J70A 3M4YA 4OYHA 3F2IA 2RG7A 4WCFC 1OI7A 1U8UA 3FTCA 1KDZA 4PGGA 1TQ6A 3UFXA 1OXSC 3NNSA 3T7EA 3E2IA 2IFTA 1X9IA 2ZREA 2PGIA 4BB6A 1JSLA 1MF7A 2VXYA 4AUEA 3MCTA 2OBMA 5JAPA 4DV5B 5DIFA 4KQJA 1PL0A 2OV2A 3RR2A 3O8OB 4ZAGA 4XFKA 2DLCX 5B1IA 1L7BA 4Y9RA 3OE5A 4YMGA 1XA0A 4TYPA 3S2FA 5BWBA 3GVIA 1N7JA 1V71A 2YC2C 2YTZA 4TLMB 5TMEA 5CEEA 2YKGA 2HYIC 3BRSA 3DZKA 1CZOA 4IXTA 4QGFA 1ZMTA 2O3TA 3QX8A 1FC0A 1NA5A 3HE3A 3QFSA 3LGAA 4UCFA 1X7XB 2GZHA 1WPRA 4LI0A 4EKEA 3NZEA 1H69A 1NVMB 1TM7E 3L6OO 1W0KD 4RUKA 5GY7A 3VR6A 4F3NA 4KIFA 4P2BA 1ORIA 4RL6A 3RANA 4W5TA 4WXPA 2VJAA 3E4CA 3OZSA 5B3JC 4URFA 3A6FA 2BFPA 3U7QB 3PXUA 3VUFA 3WRYA 3ZDRA 4Y2SA 4L57A 3UT0A 5JQGA 3H17A 5TPWB 5EIAA 1H5QA 4DC1A 4LXGA 3TL6A 4PC3A 1NDQA 2SKCA 4JBIA 4OYRA 4UM9D 1AS0A 1NFFA 2O2YA 4OA8A 5TXGA 5JNTA 2XCTB 2C00A 2VHZA 4AN4A 1XU7A 3WICA 5KNCA 4F3RA 2NTVA 1XMSA 3RW9A 1H9AA 5FUBA 2IYFA 4F2WA 2OXEA 4TTRA 4FFVA 4OXXA 2FYTA 4A8JC 2ON6A 3OT4A 1KZ1A 5BSUA 3V8RA 1B0AA 2G09A 3GJTA 4PIMA 3ZU3A 3M6WA 2I99A 3I52A 2PEZA 2P41A 2EJTA 1RBYA 4GAEA 2QW1A 3ENKA 4NESA 3CKMA 2AEMA 1ZIXA 2IPMA 3BRWA 1XJ5A 3KQHA 1UOEA 1JA1A 1H23A 5AI5A 4DPLA 1PNRA 5DEIA 1WG8A 3PT5A 1F8YA 2G25A 3O8OA 5CX1B 5BNFA 2ST1A 4UNPA 2RGEA 4UCXA 1TYBE 5ANRB 5G1NA 4QGAA 3RSHA 2H48A 1TM3E 2PQ6A 3VYSB 3I4FA 3RC3A 4MWDA 4BBZA 4N8EA 2H3EA 4PXYA 4R84A 2VYVA 3WIUA 3FE2A 2YOHA 2D1TA 2C5LA 2PWBA 4S1VA 3Q8MA 4KKXB 1X7XA 5J23A 2M9MA 2OHJA 3ZE1B 4A82A 4B5LA 5WRFA 3AINA 4J0DA 1HWYA 1POWA 2ZAMA 4P32A 2AMVA 1E5LA 5CFNA 1GP2A 1M2VB 5EMLA 3LVBA 2BISA 5T41A 4C7JA 1DP4A 3U9TA 3EA4A 2MJLA 3U7QA 3G7SA 2XJ9A 3ZHSA 3U1BA 5TPWA 1MRNA 1X7YB 2FR0A 4WK6A 1F2UB 1WDTA 2EERA 2ZJFA 2F55A 5J63A 1SVNA 3P4YA 2B4AA 1F8GA 1A0OA 1RI5A 2YYSA 3MC1A 2XYHA 4NJEB 1DAIA 2KE5A 1S1CA 3FKJA 3KRTA 2DUMA 2DR3A 2PRZA 3LUDA 4Q00A 4DC0A 2P9ZA 1K1EA 2OQ2A 2WYWA 5JCXA 3UHPA 1PGJA 1SOAA 3MQ4A 3HHEA 2PT9A 1NV9A 1UBMS 2IIVA 3MMNA 3DB1A 2Y92A 3ELDA 3IQIX 3OC6A 4D02A 5JIBA 3EHDA 3WIBA 4YRMA 1V6SA 2Y1FA 1VMAA 2Q6OA 1DRKA 4KXNA 4XDZA 5EQTA 5FXMA 1VTKA 1NQ5A 1YIDA 4XI9A 1D3AA 1OC2A 1J25A 1ZZEA 5TPZD 4LZLA 4MV3A 1R0KA 1YDEA 1ZK1A 2WFAA 1KJWA 3U4QB 5CX1A 2PGXA 3ND9A 2OLEA 5DT2A 1KBQA 1RM5A 2BMWA 2I8CA 3ZWPA 1ODCA 1H3NA 1RYBA 1UBCA 2Z08A 1RBMA 3B1VA 1TYCA 2P9CA 4RKEA 1YHYA 2IYAA 4OB6A 5CXSA 4FBLA 1TIKA 1E1RA 3A1WA 3AU8A 4BMZA 1X7WB 1YB4A 4DDKA 1NPYA 1NSYA 4R54A 2BFEB 2OCIA 3U9LA 4C0JA 3AILA 3GROA 5CHEA 1W19A 3KUDA 3JQAD 1ZCJA 2HSJA 3SWWA 3HXMA 3BK7A 4NENB 1ZOLA 3LT2A 3QFFA 4RZXA 3EIOA 1M2VA 3NHUA 1ZW1A 4UE6A 2EZUA 3OT5A 3WYFA 1EX1A 2XUGA 2ZTVA 4RK4A 1UINA 2BCGY 3NHYA 1ZH0A 1RJDA 3JV7A 4JVOA 4OU4A 3OZDA 3T5PA 2GF2A 1PD1A 1X7YA 3LKVA 3VZSA 1F2UA 1M6EX 4Q1EA 1N36B 2TRSB 1P5ZB 3UKDA 1JDSA 2VHYA 4NJEA 3SSAA 4A6EA 4IDCA 4B46A 4CDNA 1CUWA 5B7NA 3QHAA 3KR0A 4F21A 4YCLA 1RCFA 4ITUA 2LE0A 2X76A 3B3GA 2IHBA 1K92A 3N75A 1UL1X 1CHNA 1H6DA 5C4MA 3S99A 2DWUA 1Z2NX 2ZSEA 3O4IA 5G0VA 1ZN8A 2UV8A 4Y2UA 4ID9A 1B15A 2JLBA 1LI7A 2W5UA 3AWDA 1OIVA 3I30X 5LA6F 1ZIYA 1B0UA 1PJSA 1TOAA 3K7EA 1RYDA 4HUTA 3D8TA 4HGYA 5IF3A 3W6ZA 1WS6A 4BNLA 3JYOA 3X43A 1UWVA 4DZZA 3IBSA 1PL6A 3GOQA 4ZDKA 3U4QA 4V0KA 1I1OA 1DMRA 3P19A 2J3LA 1MX1A 2ANCA 2B2CA 1IULA 4QBFA 5IF9A 4JLSA 3ZI4A 1MOZA 1X7WA 3QUSA 4CLRB 2RHCA 3LLVA 4EI9A 3AF1A 1OW3B 3L77A 1I80A 1Q0ZA 4CIAA 2KI5A 2BFEA 1X70A 1E7WA 2TECE 3EH1A 2QYSA 1QKJA 4X3PA 3ZLTA 1KEKA 2VPZA 5AXBA 3T5GA 2ZJAA 4NENA 1EDEA 2FOXA 5CK4A 4Q03A 5FUMA 1W25A 4L6CA 2ZCUA 3EAQA 4OFZA 4H6XA 4ZKEA 3C6ZA 3L6BA 1RYYA 1ULBA 1CHDA 3C41J 4OGKA 4MA4A 1W34A 4U2GA 5ER6A 3R7FA 1NJ2A 1DBPA 3ZWQA 5FBZA 3BWYA 1XF1A 2HC9A 2XOXA 2JANA 3I2HA 4W1RA 4ZQFA 3I2YX 1FTSA 2YX1A 5H4HA 1DDGA 4S1WA 1NW9B 3F7NA 3FZEA 3GFBA 1XXLA 2JZNA 1A5SB 3JR3A 3HR4A 4KWEA 4O5AA 5JXJA 1E3MA 8OHMA 4B71A 1IHOA 5LUBA 2BRUC 3EXG1 2Q7DA 4QQ8A 2FZVA 4DJAA 2YC4C 1GTL1 1T2NA 4KWHA 4Y18A 4RCZA 4NCBA 2QRGA 4DAEA 4NYJQ 2I4RA 3L0ZA 3O4HA 3P9KA 4HNQA 4OO3A 4UCQA 4XDHA 5CTJA 3TAXA 4E0BA 1I7DA 4I3GA 4PGAA 3TXXA 2EJUA 2IODA 4XD7A 1IPFA 4ARBA 2ZAOA 4KRYA 4OD0A 2W6IA 1RW4A 3UAXA 3MSXA 5LU8A 1XQ9A 2P65A 1YZLA 3FWHA 5FJJA 3USZA 1AMUA 3FBWA 3JARB 4AXBA 1MV5A 2QQ0A 4BRUA 5HP4A 4P7JA 1NSFA 3IQXA 2ET6A 5CIWA 4ARVA 5LQAA 5KQRA 1HH4A 1S6YA 3RFTA 3ODGA 3LBFA 2OV3A 3OMXA 4D9BA 2YASA 1NAHA 2QPAA 1PRYA 3OKCA 4UAJA 4CLRA 2GPBA 1L5MA 2PZFA 3ROFA 1CFZA 4R5MA 1GGFA 3TBFA 3NNNA 3H9CA 4W82A 3WDMA 1I2CA 3GJXC 2VIIA 1LF0A 4UM5A 3PGLA 1KR2A 1GTG1 4IEEA 3C6BA 1QCZA 3ENNA 3V7FA 3C98A 4K03A 3K0AB 5JASA 2A1IA 4NBVA 3DKPA 1RACA 2HRCA 1Q11A 4Y9UA 4CL2A 2XOKD 1ONPA 3LVRE 3CW9A 1XO1A 4B7ZA 3L7CA 1DWQA 3LFHA 1H66A 3I1IA 3LWDA 4LY3A 3FYTA 2FKAA 3BFKA 3VQTA 1JNXX 3UK7A 3U7JA 4YA6A 5H3LA 2ETVA 3NR2A 1C0PA 5HTOA 4X63A 3ZZ1A 2FW1A 3A1SA 2ZBFA 5AOAA 5F9FA 2ZJ4A 3ZPXA 4FYKA 3AJ9A 2E5WA 2I22A 1HT1E 2WVJA 4YAFA 2IZ1A 1OH5A 3G7UA 1E58A 4HAYA 3KB2A 3BFXA 4XEUA 3RIXA 3G2NA 1QCDA 2QQFA 4FI3C 3ST7A 1Z6AA 3NOQA 4YMUA 4JL5A 2FCAA 4FFDA 3L7BA 1XTQA 1U0HC 2VYNA 4D0RA 3M6MD 4NMMA 3TNYA 2W6MA 1CCWA 1GXSB 2CWWA 1PQPA 2EP8A 5FI1B 1MPTA 1BVHA 3JARA 4J4TA 2YNMC 1GZ7A 1GWNA 1T2AA 4NCIA 1YCGA 2JIRA 2V6JA 1PSDA 3ABRB 3SDZA 4RPKA 1WV1A 4GOND 1H22A 1OV4A 3G1WA 1LBSA 1P8JA 2J3QA 1JSRA 3C8DA 2INGX 3MT7A 1Z5PA 4H7IA 2VDKB 1DCMA 4P82A 5AKXA 2BM0A 2DU8A 1JT2A 1V5IA 2FJ0A 2V45A 1LWNA 1P44A 1SZJG 1BWSA 2EIXA 1QUFA 1YR2A 2B35A 1YRWA 3FPFA 4BVHA 1W75A 1RAHA 1DOHA 2JAUA 4A16A 4HWTA 2N9UA 4GI7A 1KYWA 5MFZA 1R8QA 3GRFA 1OYVA 3K0AA 4FNGA 5F78A 1Q6ZA 2YFQA 1N92A 3G9QA 4NYMR 2RBKA 4RD4A 1EQAA 4E7PA 2O2ZA 5E7QA 4MRAA 3NHSA 3WLPA 1GZ5A 1H2ZA 2NZWA 3JVIA 1VMDA 3R5TA 4PLPA 3CTPA 3ZD9A 2IV3A 3BCUA 3JD2A 4GL2A 3LT1A 4Z2YA 3KFVA 2BJHA 1T2CA 5TIIA 1A8QA 5DYYA 5JEDA 2CNWA 3W3AH 3E22B 5G41A 5G53C 4OQXA 3ECCA 4L16A 3D6TB 4RPJA 4WIAA 5K99A 4LXQA 5HF8A 3DF9A 3LBHA 4TWZA 1JBEA 1XLTC 2R8PA 1UMDB 1VOTA 3CLTD 4LK2A 4YONB 1TD1A 2D8AA 4B3JA 3QNUA 4ZHQF 3CZCA 3V4VB 5MN5A 1BQEA 2CGEA 2QLBA 4D74A 3ZJVA 3VSBA 2W37A 4PEVA 3RUAA 5LIRA 5JCJA 3BQ9A 4MW5A 3CX8A 3H18A 5HF9A 4CIWA 4XIYA 2VHVA 5IJZA 2YZ2A 1GXSA 1PUIA 2H4XA 2HTEA 2WU0A 2R7KA 2Z09A 5FADA 3SBDA 5GTDA 4G0UA 4JJIA 1C50A 2WAAA 4UREA 5G3ZA 4JMPA 5LMNB 1J0CA 1G0NA 2H0AA 1G21E 2EZ9A 1C9JA 4B3IA 2PZEA 4LYYA 1MOPA 2WU8A 1SXHA 5KYWB 1CZKA 4TTJA 2BE7A 1KZ6A 3I5YA 1JWLA 2GVZC 3K16A 2X5NA 4I99A 5CB6A 4G67A 4R3WA 1ESEA 1KZYC 4BEWA 2HXYA 4WDQA 1WE2A 1DC6A 1I5EA 5EZ5A 1RWKA 5EXDA 3ZVNA 1XWFA 1ZOIA 3M4ZA 4BVKA 1YONA 1ZM2A 3W4JA 6AT1A 3HUFA 2PRKA 1FLDA 4NQZA 1WKCA 4NQRA 1NLFA 1S96A 4MEAA 4KQHA 4V24A 4YFVA 1I4DD 1Z2OX 4MYSA 3FTDA 2C9CA 3NKVA 1EA7A 2FEWB 5TT0A 2IZ7A 1GKIA 1ZN2A 3WLIA 3E22A 1YK1A 3LJKA 4JIGA 3IVMA 4OHFA 1FIUA 3VNUA 3G49A 2HSDA 4P84A 4TSFA 3U4GA 1RXEA 2BDEA 5JXWA 4DDMA 2Q46A 7MHTA 4LFAB 4WK4B 1JZSA 4PLVA 2V97A 5F2NA 1TFRA 2FEKA 1UMDA 2BEVB 5IVIA 4C2AA 1RXIA 4NZNA 2WZQA 3RGGA 4BLQA 2Z6QA 1VJDA 1CEQA 1XIVA 4F1WA 4MDEA 3HCNA 1V2HE 3BAFA 4Q9LA 1DS6A 1V8ZA 1NVEA 5LCXA 1SUAA 3AFMA 2DY1A 2EWMA 3MTDA 3TX6A 4LC0A 3L6EA 1EDZA 1P4RA 3PJFA 1X3LA 1ZH2A 2PO5A 3BD7A 3UC9A 5CJ2A 2B9VA 3O3CA 4JLNA 1MO4A 1BXZA 1WY5A 1XLVA 4WLVA 3WL8A 2W9XA 5I8PA 1T2VA 4MIYA 5LLSA 4R9NA 5KYWA 2OYRA 3SK0A 3I76A 4MO9A 3H13A 4Z0TA 4TYQA 1AXEA 3OHMA 5LBUA 2WD9A 3R5KA 4CGYA 4UAGA 2GRAA 3EPRA 2P9YA 1QRRA 4V0NA 5HZGA 3LIIA 4FYMA 4YX9A 1G4AE 3NUZA 4G84A 4ZAYA 1N5MA 5A5DA 1PUJA 1BG6A 2V4ZA 2Y27A 3EUEA 3Q2IA 4J0GA 5K4GA 4XLZA 5ALPA 2BAGA 4QU0A 1YS4A 2A5DA 1GAEO 4P3OA 5AW8A 5C5DA 1B8OA 1G3RA 1SHKA 4FUTA 1BS1A 2EFYA 4FKZA 3W8RA 1NVBA 2C0PA 2JHCA 3FKQA 3FUUA 1IJEA 1XEWX 3I72A 4H16A 4RLFA 3F6EX 3LYAA 4MGIR 4Z9XA 1PR9A 4ECEA 4ES6A 2YWEA 4E03A 4GFDA 4JI8B 5AK4A 1SGWA 3M81A 1OH6A 5A1JA 1EE9A 3SSMA 1E77A 2IC5A 2HKIA 4BNTA 4PHFA 1R0XA 1Y5IA 1P5FA 2F8MA 3I04A 3THOA 2BEVA 2KW5A 4AZTA 4QECA 5BUQA 3G89A 5K6AC 1DI0A 2C95A 2PGAA 3H4IA 5CYFA 4B3CA 2NUTB 4HJXA 5ED4A 5DPMA 1N3IA 4IV8A 2QR2A 2CLOB 2FJUA 4LECA 3DMHA 2YJ4A 2FVYA 4TQGA 2ZXFA 3T99A 1OB2A 1JR3E 3K09A 1Z6XA 2GFQA 1WVIA 3K9GA 1YRLA 3D6AA 4IZHA 2MSDB 2KHZA 4LV6A 4G1MB 1E3JA 1CERA 4GBGA 1X1RA 5ESRA 2CB0A 1Y1PA 3ZVLA 2LP4Y 1GA6A 4JEIA 4O2AB 4U2EA 1TXGA 3AR3A 3FFWA 4C08A 1XCMA 1G2OA 4IDGA 3U16A 2FX5A 1Y5LA 2KLHA 5KVVA 1AM4D 2H65A 5JMPA 1MORA 4IOLA 3VHLB 1O2DA 3IT2A 1C3LA 1CDDA 2HT6A 3D5EA 3JAWB 2W00A 2G63A 3NM6B 3E0XA 1XRJA 3R0XA 4UMVA 1PTKA 3U0VA 3BIJA 1Y1KE 2FDCA 1BHQ1 4LGMA 1YS7A 1OV6A 1PGQA 1MAAA 2C2GA 4YGXB 3RFFA 1W4ZA 3GDOA 4ZGGA 2Q0SA 4GUDA 4K6MA 3WL6A 3ZJ4A 5C8ZA 1WUHS 3EWAA 1CJMA 2AN4A 2EP7A 4OQDA 4PRLA 2A5FA 1XTBA 4AO8A 4X85A 1NHGA 1PG0A 2HA7A 1CR4A 1NBOA 3SOPA 3N28A 2YXEA 4F4IA 3WGIA 1XVLA 3AIIA 3JQEA 3NHRA 3QPCA 4KLRA 4PX5A 1IZ9A 2QSYA 2AZXA 2E4AA 1XD8A 5FPKA 4TSKA 1LK0A 4J43A 4XYBA 3AVYA 3EPHA 1LDEA 2NUTA 2IDJA 1TA4A 2VJKA 4Z2AA 4F46A 1EX7A 4S1OA 1SUSA 3PNPA 1YE8A 1ZQ1A 2QM0A 2BFMA 4GBJA 4L9AA 4LKOA 3FGOA 3KDAA 5JE8A 1UKAA 2LVBA 2WTEA 2I2AA 3GJ6A 4C4XA 2GETA 4CLHA 1M33A 1R1DA 1YU9A 5CB4F 2ZU0C 2ZRGA 1AVTA 3B2EA 1YC2A 5TY0A 1X9HA 2GYVA 1A8PA 1F48A 2OT3B 5DBFA 1A04A 1Y4SA 5EHGA 1KDPA 4OHBA 3KQLA 4PCAA 1NL3A 3PFWO 4OIFA 4Z7JA 1UBHS 2PKQO 4KWIA 4O2AA 2QI9C 3QVTA 1Y3FE 2GQ0A 3OCZA 2QBYB 1W35A 4MA0A 1SZPA 4KHPB 1T0HB 2GAFA 2DB3A 3V48A 3JAWA 3UKJA 5ELLA 3QWIA 1BWRA 2DUWA 2XMSA 4NOKA 1CF9A 1D0SA 4FX5A 4WBNB 3NJ4A 1K7YA 2DAPA 4AY3A 3PGXA 2Q3FA 4MGZR 1JH8A 3RI3A 1L1QA 3VPGA 2IITA 4FCCA 4DQUA 5LNK6 3LC0A 2W2QA 3PPYA 4WASA 5K8UA 1VE7A 1V2GA 2ZEJA 3R3HA 3CRVA 4W5JA 5LD2C 1RBZA 4YR7A 4BVBA 1A3CA 4XFJA 1KOJA 1AKQA 2H52A 2TS1A 2APJA 2VCEA 5IRCD 2LIPA 5EJFA 4UUAA 1JS1X 3KKPA 3SKVA 4N6OA 1UXHA 3KWFA 3VMFA 1XOIA 1N9KA 1XJWA 2CE2X 5E4TA 2B8WA 2QE7A 3FMGA 3WWYA 3UJHA 2HO5A 2X3UA 3O94A 4GZ5A 4A7PA 5CFZA 3LXXA 4MP8A 4NH0A 1ZU4A 4LDZA 3OE7D 3AOGA 5GV7A 4DIBA 1XWIA 3QV1A 4ZV7A 1JQJC 1XDUA 4HVCA 1M2OB 1YS6A 2RK6A 2UYHA 2AW5A 1SXIA 3UG6A 5C53B 1D2MA 1BA3A 2IZZA 3GK3A 1ZR2A 1MB4A 1R3UA 3LOQA 4D0LB 2JIBA 2UZ3A 1QFMA 1AMNA 1NVVQ 1YJXA 1BMDA 2WWGA 5IAGA 4N0MA 4FDTA 3TH5A 2NACA 2ZS8A 2CWDA 5EIWA 2GD2A 1C9KA 3IAM1 2IV7A 4NV0A 3CW2A 2F43B 4NAUA 1UDXA 2ASVA 4NU5A 2J0SA 2QBYA 2VPWA 2GJ9A 1QVWA 1H8HA 1MUUA 1PX2A 1ST2A 2NSYA 4OMDA 1VG0B 1OLUB 4DY4A 2J31A 2WNHA 1FMTA 1S2IA 2ZB2A 3HP1A 5A5GA 4EDFA 4TL7A 1Z0AA 4WBNA 3GV0A 3CWQA 2OZKA 1WPQA 2HGSA 3PRHA 4ONEA 1I7PA 5EZSA 2WV7A 4JQYA 3B6IA 3HDGA 4C6SA 2OPHA 1BDHA 5JMOA 3JQDA 3TEMA 2P9GA 2XTNA 5DLQC 1WSAA 2XIQA 5COAA 4K3UA 1WB9A 1RRMA 2AG6A 3H1FA 1Z2AA 2WR8A 1C3OB 2B1QA 1OZGA 2AYZA 2PX2A 2UZ0A 1LW6E 3CXUA 4YB8A 1N9GB 3UWDA 4GLFA 2EZ4A 5C32A 3QLUA 3KXLA 4RESA 4XUCA 4ON9A 1Z6GA 4MB2A 3VJLA 4KK3A 4OLBA 3LRPA 4P2GA 4RTSA 3TMAA 4DG5A 4I5FA 2OYCA 3OEED 2WZBA 3MYRA 3I6ZA 3KEQA 2O06A 4RSRA 1M2OA 1GCOA 3C6MA 4F3KA 3U56A 3Q98A 4IJ6A 2R3SA 1OX5A 1QZUA 1K8RA 4X6YA 2HBZA 1YA8A 1E9DA 1JQAA 4RDHA 3VTFA 3IVCA 1UZLA 5BSTA 4WZBB 4MKFA 3E23A 1M6WA 1TRHA 3IR5A 3GARA 4B3TB 3U48A 1Q1QA 1LV7A 4L7QA 3U7FB 3UUFA 2AG5A 1JJBA 2ZAGA 1IOVA 4Y98A 3WV5A 4DMKA 5KTNA 1X7HA 2F43A 2G8LA 4XAQA 3T06B 4DUGA 4FZRA 2PUCA 1Q14A 1TC1A 2BWJA 5F1PA 5CVTA 2OUKA 2X86A 2NYRA 3AR7A 3AMVA 4QL3A 2B7LA 4YRTA 2YHAA 4GSLA 3FPLA 1FLVA 3P32A 3VBCA 1YCHA 1OLUA 3H2YA 4L22A 4D4IA 4ZWNA 1JEJA 4MRMB 4OHVA 3VU9B 2XSZD 3CT6A 1RADA 1PSZA 2GWRA 2DH5A 2V6MA 5BQ3A 3RARA 3DLBA 3K31A 2VN8A 5M5BA 1ZD4A 1PV2A 1R8YA 1G2IA 2P79A 2RD2A 1E6CA 2QVYX 3G2PA 1JBKA 2FSPA 2ONKA 3VYWA 4GNRA 4GQBA 3HY3A 1GFWA 3FDIA 5LP1A 3G0OA 2FPIB 5DE3A 4HBZA 3ZCQA 2GHQA 1ODTC 1C3OA 2L2QA 3ORFA 1JLLB 2XE6A 2W83A 2DPMA 3OQJA 1N9GA 2XBLA 4JJEA 3U2QA 4CR6A 1RAGA 1ULSA 4DCCA 2PZLA 4Z1MD 1PDOA 2B98A 2QTAA 1MD9A 3MB5A 1E2FA 3TW0A 4BPRA 4IGEA 1BYUA 1ODIA 1W2HA 1N2EA 1RP1A 2XWJI 2CL7X 3FMPB 3JSAA 4OQQA 5F52A 4U7JA 3T1YB 4ZOCA 4MCAA 5A71A 5DU2A 2BFOA 2QA5A 4C21A 1EUZA 3QPUA 4HQNA 2BZSA 2FFJA 3F5SA 1IYZA 3K6JA 1YBMA 5CFMA 4WZBA 1CEXA 4J4HA 1VI2A 1UMCB 3NDJA 4N5NA 2IYPA 3IDQA 4M0DA 4DMMA 1MRZA 1PI3A 1MT3A 3GO4A 4TM7A 4CMJA 1TU3A 2FPMA 3I92A 2IYYA 4J7AA 2XYPA 2XTAA 3KHUA 4NV3A 4BFWA 5A04A 3NCHA 4UVGA 1E4VA 4KPYA 5KQPA 3GP5A 3W5VA 4I9UA 3WGKA 3KKEA 2AUTA 1JAYA 1M6NA 4N7RA 2ZDGA 2RAFA 3C3BA 4K9MA 2YZ7A 3I6IA 5E7MA 4KQCA 1C0IA 4MRMA 3VU9A 3LIPA 3MVEA 4W8GA 4DYVA 1Z7YA 2QIPA 4P80A 3S5JA 3WXMA 5JC8A 2IOQA 3LK7A 4INAA 2EX0A 5CVDA 2CL5A 3Q3EA 4HQRA 4YUXA 1RJFA 2P3LA 2HUPA 2XQKA 2FPIA 4CIYA 4CVNA 4FJ1A 4UMFA 1JLLA 1ESNA 3QPAA 4Q9DA 4EP1A 5CA1F 1UPBA 2DFLA 4IUCS 1FNBA 2CFOA 3PNLA 2IU4A 1D4ZA 3X1XA 2A0XA 2KBFA 3CEPB 5E6UA 1QLHA 4PGHA 9ABPA 2F48A 3NT5A 4F4HA 1P29A 1JVSA 2BL4A 3KS9A 3AM5A 3GFSA 3VDXA 5AUPB 1G64A 2JFQA 1L5QA 4RDCA 3T5BA 4DNPA 3FVVA 2Q1TA 1CX9B 3BFVA 1II0A 2ZYIA 3AF2A 4C3UA 3SHQA 3LMKA 1GFZA 1VA4A 4BN5A 1PT5A 4U2DA 3ZNOA 2VYCA 1T25A 1UMCA 3G88A 2XXBA 1ZOOA 3I83A 3JX9A 3ORRA 1TK2A 4XYGA 3CJTA 1SCKA 3KHTA 1IRIA 1G9TA 3MHTA 4FQ5A 4O2BB 1EEXB 1LSUA 1TTHA 1TAQA 3WXBA 1Z16A 1L5NA 4IJWA 1E96A 2NZYA 1CKEA 1GKKA 3TB4A 2WPNA 5GGYA 1G9XA 2YY6A 1JFVA 1T5LA 1VBKA 3LP6A 4ZJPA 3NEJA 3BH6A 4DSZA 5CA0F 2E2WA 1XP5A 4DARA 4LXUA 1X7GA 2WHQA 3O1JC 1QDUA 1U1FA 2YJ5A 2YINC 2YV2A 4PQGA 2I7DA 3JAMA 2I7VA 3X1YA 4RPHA 2P30A 4IXDA 4NOMA 4Q21A 1VJTA 4G0VA 1H8EA 1JXQA 1WCXA 3QEJA 4IILA 4GPEA 1I3CA 2YH2A 4LS3A 2O52A 4PWYA 2FTKE 1KEZA 5TX7A 3NVDA 2C4WA 2ZDQA 3OCJA 4TTTS 4FMCF 4UTZA 4DMRA 3MINB 4LCJA 4K1XA 1R2QA 2D3WA 2QK4A 1GDDA 1UXIA 2DT8A 4PPYA 2VDOB 1IFXA 2E89A 2P7HA 2TMYA 3FDJA 2JAHA 3KFLA 3LC2O 5IBPA 5J2UB 3V8VA 3EEQA 2CKDA 3K0SA 2HPZA 3F8WA 2FQYA 4OP3A 1KNXA 1G20B 2G9RA 5AXAA 1KQ3A 1RWQA 2YDXA 3AHCA 4RO0A 1BGVA 1FXWF 2AJBA 3GQVA 4M0EA 1Z56C 3O1IC 3FH0A 1ZG3A 3GXOA 1UZAA 5TRTA 2PX3A 2ZT7A 3U3OA 3F5MA 4C3ZA 5CD9A 1NBMA 2W93A 1HM5A 3BL6A 3RC9A 1PAUA 2GEDA 5AKEA 2IE8A 5AFSA 3MAJA 5FBWB 1E3EA 1SBCA 4OXNA 4Z7NB 4CQMD 4KR3A 4FGKA 1Q1EA 1J8QA 1P9OA 3QKSB 4O2BA 1YF3A 1YDMA 2KYRA 3U80A 3V1TC 1OR8A 2BGUA 2AJDA 1QHIA 1SCIA 1UPAA 1PVDA 1XQ1A 3NYRA 1XU4A 1VKRA 2FJPA 3OLCX 4IMJB 4TXJA 5FTJA 2VG8A 2VRBA 4IZOA 3HO8A 5KWIA 2PUFA 2M6SA 5BSMA 1XJ0A 3FCSB 4K8RB 1OD6A 1L3BA 4L8LA 3AGPA 1T8TA 3P52A 4M1MA 4RVGA 4XA8A 1ZH8A 3B38A 5ALKA 3UO8B 3MERA 3WIDA 1ZM3A 3U7EB 2QZPA 4IHJF 5AI9A 3VZBA 2IBSA 4IJQA 3SZMA 1JDBB 4H17A 4RDXA 3ZLJA 4WUVA 3BG5A 3S81A 1W5TA 3ESRA 3L04A 4QTYA 2GESA 5LZ2A 3MINA 1AV7A 1OFVA 2J85A 2ZXEA 3C3DA 3N2LA 4WHMA 1KKLA 4AICA 5A5EA 4PHGA 3IP3A 1R5OA 2X40A 4MVJI 2YJ6A 4BKUA 5J2UA 1QFJA 2CHEA 1NW6A 3PUHA 5IH3A 2DECA 1Z63A 3ZJTA 4BVAA 3GJ5A 3ASYA 2I6UA 1QIHA 1E94E 4C5AA 1F2DA 2ZSFA 3EN0A 4GDMA 3NFRA 4A0QA 4F60A 4LPSA 1G20A 2B1JA 1XB2A 3FRHA 1T3TA 4NU8X 3D3NA 1JYSA 4KQ9A 4UBJA 4EG8A 5HKOA 3ANNA 1L5FA 4IXNA 2IX9A 3D6HA 4OREX 1TRKA 3JAKB 4RVOA 1Y8QB 3Q2KA 4ZO4A 1GR1A 4MP3A 4Z9FA 4AZ3B 1QU3A 1FP2A 1IHDA 2XYGA 4QJBA 3LSTA 1PQYA 4EL0A 4DFDA 1FDWA 4JKIA 3FPHA 1W0KA 2I6SA 2OMEA 2JGIA 4DSAA 5G0WA 3QKSA 4MUBA 1DINA 2A5GA 4P7KA 1XPOA 4GZMA 1BX3A 2ZTMA 4BOYA 1CEEA 3KEMA 4CHTA 4DCNA 1HV8A 4Z8YA 1VYVA 3UBMA 4Z4GA 1O95C 2YY5A 1OBOA 3Q88A 2GKOA 4U2FA 4B6JA 4EFLA 4EVIA 1GAXA 4ZMSA 2Q3CA 2QTVB 3EZFA 1SUPA 5FR2A 3JQFA 5KKCA 1HL3A 5EMJA 4HPWA 5EIEA 1CF4A 4PCVA 5JDCA 2H7VA 3FUCA 3RKRA 2OO7A 5AHXA 5KYNA 1EINA 1VP3A 2KSQA 2ZIFA 2ZI5A 3AI2A 1UJCA 3PYLA 4ZYLA 3H75A 2ZE7A 2AN1A 4HMOA 4NBWA 5EP4A 1Z2CA 2A9QA 5FHQA 3T4XA 5DCWA 1F3OA 1BXKA 1S8NA 3AW8A 3K2QA 4EY8A 4W9MC 2QXUA 3WYBA 3BVPA 2MU1A 5D1NA 3V4SA 2FR8A 3PQ7A 1ZY2A 1VFPA 3BA1A 4BMCA 4GKJB 3FCYA 1NNUA 4R83A 4WNAB 2H8GA 1RSZA 2OGUA 4R9UC 2Z6UA 4F4CA 1P18A 5JNRA 1N2ZA 4UQOA 4WXMA 5ALRA 1XMQB 2Q50A 4HWSA 3QUCA 4RM3A 5JJ5A 2CLIB 5IUJC 1AQ6A 1NXSA 3QMMA 3UUGA 3FVWA 4B35A 1C4XA 3JAKA 1LPAB 1Y8QA 5BSRA 2REXB 4OQLA 4IMIB 4AZ3A 5IVPA 1YHZA 2V7TA 3DYVA 3H4MA 3N8NA 4LRYA 4PINA 4ESHA 1K08A 3NRCA 3RK4A 4BVFA 3AVVA 4O3MA 3JQAB 4NF2A 4I6GA 1WW2A 2PZGA 4QDOA 4YV7A 3OSZA 3GUYA 4HS4A 2E4YA 1ZW6A 2DBVO 2RJOA 2XMBA 2DBZA 4NMLA 3L7OA 4FEGA 3EODA 2ZYRA 4DWJA 1V48A 2BFNA 3VO9A 5JYBA 3GLTA 3LWZA 4C4ZA 1ZFNA 1GNTA 4YCDA 3HBFA 1ZIOA 4HVLA 4NICA 3G6KA 5B7GA 1B0ZA 1KAOA 1GTSA 4Y2RA 4AP5A 1QKKA 2I1VB 2QTVA 4W8OA 1I01A 2XGJA 2AW3A 3MFQA 4RQUA 4UTPA 1QAQA 3PS9A 3JWEA 1A50B 3W5JA 1Z4KA 5ALLA 3GU3A 4GXRA 1IM2A 5GONB 3H3FA 4IIUA 5BSEA 1PUXA 5A4KA 1AHIA 3MTBA 1I4TD 1WOMA 3T9AA 4AQDA 3HADA 4PC1A 2PT7A 3D64A 5F5NA 1MC4A 3NTVA 3O74A 3OJLA 5DRYA 5HMMA 1FBNA 4D45A 4I3HA 3B3JA 5TPZA 3N8HA 5D5QA 1T2UA 1E2KA 1Z3IX 2H9YA 4NG5A 4WNAA 5K6TA 3CF4A 4YIKA 4DM3A 3BJZA 1IBKB 3F4LA 4P8RA 2Q45A 4WEOA 2ZJBA 3VNRA 1DADA 2A7XA 1XCGB 3CM0A 1TVKB 3T94A 1ECJA 2HWYA 2DQZA 1ECPA 2JCVA 2JCXA 3I8XA 3ZH2A 821PA 5L40A 5K20A 3TECE 1XHEA 2Q29A 3CPJB 4KQ2A 4PQFA 4ZQHA 5AUOB 2YRWA 1J8YF 1L4BA 4QJ4A 5JROA 4YR9A 2YHBA 3JQAA 3K53A 4MAFA 3IJ5A 3AVWA 2QMUA 3WDLA 1NLUA 3FRJA 1PVVA 1A71A 4DOMA 1ULZA 1AUVA 3IVXA 3PX2A 4E2ZA 2HZBA 2JHGA 4EX7A 1I6WA 1U8CB 4V0LA 1G8SA 3BSWA 5FL7D 1A77A 1ZU5A 1SELA 5LBTA 2W70A 3OLQA 4RMNA 3H5RA 1JQ3A 1EJ0A 2G4CA 5FA6A 3RJMA 4I8IA 1ZGCA 4I4CA 2WDPA 3CXRA 5BVGB 8ADHA 1VLJA 2RC6A 2BOVA 4FPXA 2XPCA 4P53A 5I8WA 4WI1A 4P93A 5M3BA 3EAFA 2C29D 3ESDA 3KVYA 1ZN9A 4BNXA 1RQRA 1VPTA 5GONA 4YQZA 4MPPA 3TI7A 3RTGA 5AW9A 1I7LA 3LP5A 5BNWA 2GM9A 3F6SA 2PMEA 5EINA 1N1MA 4C1NA 1IUNA 2GXQA 2IZ5A 1FE8A 1WXXA 4UFOA 5C34B 3TTWA 3KV3O 4O33A 1R8XA 3A26A 3LC7O 2FW6A 5FH9A 1RMTA 1YZHA 2FGJA 3TZCA 3B7WA 3G85A 5CDSA 1X1EA 4JBNA 5JLAA 4DJ5X 1WNTA 5DXAA 5L4LA 3NHFA 5ITVA 3GFFA 3K0KA 2ERXA 4OAOA 3NUGA 2AYXA 4MVJD 1DV2A 2G67A 1TVKA 5EUQB 1SWVA 1JKIA 4OYLA 2BF4A 1IJKA 3I4CA 5DBIA 3TIGA 3W5SA 4A8TA 5HIIA 5JLJA 2QROA 1J1IA 4KJZA 4L4RA 3TLKA 5LQUA 4YJFB 2YWFA 3LPCA 3W7BA 2PL1A 5B2FA 2WP8J 1USUA 3C6KA 2WE7A 3E05A 3I37X 4B6EA 2M6LA 4DMLA 5BW4A 2E0IA 4X8HA 3NM5A 1SXJC 4KMMA 1F17A 4WL0A 4QRIA 1KETA 4JXKA 1NW8A 3UXEA 3HYCA 2ZRJA 5BVHB 1THZA 2YYAA 3K1YA 1EVIA 4XJVA 1ZJ4A 4IJVA 4FSXA 4FSHA 3HVRA 2L0XA 4FLFA 4MB6A 2WFZA 2D1YA 4QHYA 3ZCUA 3R9WA 2CDAA 3ZWWA 1B74A 3ZNQA 1TUEA 3F78A 3DCYA 3A1VA 1K6MA 1TIBA 3PC8A 1A8UA 5BVGA 2X1HA 1Z9BA 2WIJA 4RKYA 2VAWA 5DCYA 3QSYA 1OH7A 5HCUA 1P6QA 1I9GA 2DQSA 2J3HA 4PVCA 4EF6A 2VHJA 3G9UA 4PBTA 1E64A 3RU7A 3VKWA 1RXUA 4UZSA 1IVYA 2JA1A 3MMXA 1XVUA 3M9XA 1IUOA 2QLMA 2YZNA 2ZGVA 4RWEA 4FYJA 1X1CA 4GVLA 1PYGA 2BI4A 1AS2A 3FOBA 2C1ZA 3PUKA 3WBFA 2CCKA 5CT8A 2C7RA 3L1JA 1S8FA 2PYDA 5KQSA 3W5CA 1BDMA 3PXEA 5EERA 4HX5A 4P7BA 4RJJA 3QSGA 5FBQB 2WNSA 3QE3A 1K3UB 4IIYA 4DTIA 4P4TA 2XMQA 4L6IA 5M04A 1NW4A 2H5JA 2H2HA 3ZU5A 1T1JA 2I3BA 3TBHA 3SEFA 1V7ZA 3QEOA 3MT9A 2UYYA 3GWZA 3NOOA 4Q37A 1I0IA 2OECA 3A6LA 3H5OA 4JB8A 4YJFA 4ZVNA 3FOZA 4JOBA 3TNJA 1DBRA 1NVDA 1TUBB 4AYTA 2QUIA 2WJGA 5HQ3A 1U9ZA 2HU8A 2QV0A 3R77A 5AKYA 5EE9A 1HDIA 4TM8A 2R5WA 1ZRMA 3Q9UA 2ZLBA 4EPWA 4F2PA 4CMKA 5BVHA 1WW3A 1I7NA 4F91B 3FHTA 2BGWA 3MTIA 4YRGA 4NHOA 2XOKA 4E11A 3MT0A 4REQB 4JT9A 2G07A 4M7OA 5I9LA 5IBCA 2QEQA 3A3NA 3WLMA 2YQ5A 1AO0A 3MN1A 1F9EA 1M54A 3N3BC 4AROA 3P0IA 4OOEA 4B3BA 4MUFA 5AVYA 3SN6A 4ZN6A 4YDSA 3EZ9A 3KZOA 4Z4HA 4JL8A 4LG1A 1EK6A 4AKTA 1WDKA 2FDRA 1SCDA 2JEZA 3W5BA 1LZLA 2GBLA 2Z2XA 5KKAA 4X7PA 3ROKA 2E18A 2OSVA 1JEAA 2ZQZA 3UMVA 4BX9A 3QXHA 3GRZA 3R44A 4KODA 4PU0A 3D1VA 2PNFA 3M0EA 5LP6C 3VO8A 4C7VA 1FTNA 1PO7A 2I3ZA 3BWEA 1U7OA 2A0KA 3U09A 5MDHA 2NO5A 3DQZA 3R3YA 4ZEMA 3L8ZA 4PC6A 3V7NA 4JSYA 2D0DA 1NUAA 3FYUC 3B9RA 4JSTA 1R0YA 1OXXK 4L9WA 4UXHA 5FFMA 1VDZA 1WD7A 3L7NA 3IIEA 4UTVA 5EMNA 1RU3A 2WU4A 3E9EA 1EA5A 1XKQA 2ZRLA 3CNHA 3FIUA 3HBJA 2VZ8A 3LSYA 2WBLC 3W2IA 1LQ2A 4DIMA 4EVSA 2LIVA 4NZMA 1UXGA 1TUBA 3PNKA 2NADA 2AIRA 4R1MA 1YI8A 2H8KA 1GQ2A 3BKXA 3I9MA 3AZPA 1GRRA 3P9SA 4KIJA 1L6RA 2CDBA 5HRAA 3CFYA 3G9TA 2Y4OA 3HSSA 3NVMB 2HEGA 4K28A 4WK0B 2OK7A 4RY9A 3L40A 5DTMA 4F9EA 1U28A 3IGFA 4HOYA 4L9RA 5I7UA 4KIGA 1KGSA 4L0CA 4MKZA 4REQA 5PGMA 4RK1A 5HR5A 2JFXA 3B6EA 1SD2A 2VFAA 3OE4A 4MGEA 2EKPA 4ZAWA 1U4NA 2BM9A 5IJAA 5AXCA 1LLCA 2GB4A 5BV1A 1K68A 1RHRA 2B5WA 1ABEA 3I8SA 3N74A 4AZSA 5F9HA 3G9XA 3CF4G 2WOJA 4FNMA 3OQBA 4OPMA 4ZT5A 4ZEOA 2PK3A 3DZGA 5IT5A 5SYNA 5EIFA 2JFWA 5B58C 5HQ3B 1SQGA 4R16A 2PR7A 3O03A 3TLJA 4LBZA 1OH8A 3AEYA 2H5IA 1GEGA 5EXEA 5EJMA 3EX7C 4TZ0A 3OM8A 4KBFA 2V6FA 5B58T 4K9OA 4NY1A 1SKBA 2P2SA 3EQ2A 4KE6A 3RTCA 4QXPA 3U31A 4ZVTA 2PX5A 3PVSA 4NBNA 2XLCA 2IUUA 5ISMA 2D00A 3DL2A 3FVRA 3IE2A 2F9MA 3NORA 4RXMA 3TGWA 4IIDA 4O2RA 1OASA 3CKKA 4KREA 3ND8A 4QLAA 1EVKA 4BLOA 3L4EA 2W6PA 3ENZA 4UC0A 2H4HA 5C31A 5CDHA 3ZIUA 1OGJA 3QTTA 1R0SA 3DAOA 4IDHA 1FDUA 2VP6A 2FUEA 1N57A 2FN7A 4YQYA 5IAAA 1O8CA 3CCCA 3EVEA 4OFXA 5EC8A 1RWBA 5F12A 1ATZA 3A32A 5AI6A 2QX9A 1Q2XA 4BWVA 2JFFA 5TS3A 5SY6A 2Q6LA 4ZJUA 3GX1A 3BB4A 1F4PA 2JFGA 3EXHB 1FP4B 3BJRA 3HUUA 4CN9A 3R7NA 1VI6A 4QJ3A 4QUHA 4MDYA 3AKZA 3OTOB 2HPHA 3RM3A 3LRXA 5T7BA 5AI8A 3GNSA 3OMLA 2QQEA 1NOJA 4TXHA 5EIOA 3VR3D 1LXCA 4M4SA 2UKDA 2EKLA 1KY3A 4BCCA 1K98A 1XDDA 3H1BA 4U0KA 2JLSA 1Q44A 3U3DA 1L4LA 1WXIA 2VDNB 1I4LD 2ZWVA 2Q5FA 2C9ZA 3MTEA 3L6UA 1GNVA 5FNVF 4YP1A 4Q1VA 3SDBA 1AZLA 1PWXA 3AH8A 2AWNA 1L4UA 4XWTA 4EHFA 3IEMA 2WKQA 3AR6A 4MI6A 1D6JA 4R1OA 3SZRA 3ZGNA 4EKYA 2JH8A 4DV1B 4WLEA 3D3KA 3T1TA 3MXTA 3V4FA 3HU5A 4HR7A 2FRDC 3IEPA 3O4JA 3QHPA 3RYFB 4FEYA 4P36A 4PO3X 2QL9A 4BNNA 5AVXA 1AXRA 3D3EA 1APBA 3VI4B 4IJMA 1IQ0A 3MTGA 1ZK3A 3JALB 1LVUA 3X44A 3IAAA 3AEXA 1XPUA 1QRUA 5H0IA 1NXQA 3ILSA 3MUOA 4NLLA 4X90A 2SICE 3K9QO 3H87A 3T3HA 3STVA 3CW8X 4BB5A 3NI2A 3CVJA 5KHLB 4Q9KA 1VGVA 3L7LA 5CCXA 4IWXA 3E5NA 2IYZA 2MHCA 3H8JA 1EVQA 2IP4A 4QNRA 2WPDD 1V3VA 1JXOA 3OCYA 4Y2YA 5TARA 4D4GA 4BZZA 1FX1A 5KYTA 1JDUA 1TKAA 4HI0E 1BVUA 1NVUQ 1LQUA 1K8ZB 1U3UA 3F8SA 2C58A 1Y82A 3OHSX 4GR5A 5AHWA 3DEAA 3PNSA 3EXHA 1FP4A 4NZ9A 2JK1A 1OI3A 2CJFA 4ZOBA 2NYUA 1X19A 4EARA 5JNVA 2VYFA 4RY2A 3UTCA 3WWOA 1C9NA 1FNSA 2EZTA 4ARIA 1KBOA 4CF4A 3ILVA 3KAQA 4ZOEA 3GBSA 4EEXA 3DJYA 4LF6B 1OQAA 1VJCA 2J09A 3QVUA 1Y6QA 2CCJA 1C1XB 1Y4AE 4GPTA 3HA7A 1N2SA 1GLGA 2VUSA 3R6GA 4W7HA 5TV2A 1NC1A 1XA4A 1ESZA 3VV3A 3ZVKA 1NJFA 5AKJA 1P1HA 3SC6A 2CCGA 4EFDA 3SC4A 1YE3A 2QD5A 4JT4A 3M49A 2VAMA 5L3SB 3ABZA 4GOXA 1DUSA 3UMBA 3O92A 4OQ4A 3MQ2A 3Q6IA 4L07A 4G0OA 3RYFA 4M0PA 3GLFB 4DLLA 3MCZA 4EW6A 3HY4A 3QXSA 3IP9A 3JALA 1UC4B 5D3QA 2ISQA 4J2TA 1AQJA 4MVJM 4M1WA 3IJPA 4PX3A 1CD5A 4WDRA 3SZUA 1XRNA 4CKCB 1PBTA 1XVIA 3VTZA 2FI1A 4WK2B 3W8NA 3M1IA 1LI5A 1R4NB 3Q12A 4FFBB 3ZV7A 2ZVPX 3DDSA 4U6SA 2JH9A 4MUJA 5CEJA 2H08A 2V6GA 2VPQA 1IWOA 4YI3A 5H4GA 3DOIA 1EBBA 1ZGHA 3VAYA 4EHAA 4ENPA 1U2DC 4IS2A 3JSXA 1GITA 2CL0X 2H4FA 1XI2A 1T1EA 2AOXA 2VRNA 3ICWA 4DABA 2R6R1 4J16A 1ULHA 5JADA 5ARCA 4YJKA 1VZ3A 3ONDA 1IVNA 1EXMA 4NKRA 4H18A 4D9FA 2ONJA 1OCEA 2QW8A 3C70A 4IEFB 4UVIA 3OQHA 3EMDA 1Z0DA 3U40A 4NZPA 4BO5A 4CLEA 1FUYB 5CXXA 1HTTA 3ILYA 5C7IO 3C3KA 1P7CA 2IL1A 2XF8A 5AK3A 3M8KA 2XVZA 1OHHA 1DOZA 4KR7A 3SFZA 1K6EA 3EQ6A 2BFFB 1ND6A 1M1NB 4AAYA 3ZK8A 1C1XA 4MWSA 1FJXA 3RC7A 3N2NA 3O90A 1FUKA 4Q3CA 5L3SA 1YV9A 1NASA 4P08A 3VPDA 3Q5EA 5ERXA 3WLOA 4H7EA 2O2DA 3GLFA 2VWHA 1G60A 1RRFA 3A6KA 3E1SA 1NHWA 2NQ2C 3C39A 4NHEA 4RLSA 2P62A 5FLEX 5FUWA 5FV4A 2VRCD 4Q3EA 2VTDA 1AKRA 2QPOA 3V9AA 2GPNA 1NOKA 1QH0A 4H4EA 4IWNA 3VR4D 3UMFA 4BUCA 2ZYTX 4CKCA 4MVJH 3P0HA 4FFBA 1P5HA 1R4NA 2HLDD 2XGGA 4F92B 3GAFA 4DM7A 1N8TA 2J45A 4YFYA 2G36A 5HVNA 2P69A 1KOGA 4QOSA 4QX6A 4JJKA 2HBYA 2ZVJA 3WK6A 4F9FA 3ETEA 4C0XA 3GLSA 4DA8A 3QI7A 1P73A 4DB2A 2NMVA 1WQ3A 5FCDA 1W47A 3QG5A 1U9IA 4ND1A 4ZQBA 4ALLA 1H2FA 2F3QA 1UKYA 4UEJA 3GLGB 3KX2A 1VCOA 1Y9JA 3N6VA 3IMFA 3ABQB 2SKEA 1OAOC 3H2KA 4JQSA 3IJRA 4HAZA 3ZE2B 3TRKA 1IN5A 2MDTA 4B87A 3H5TA 4PLCA 3H5AA 4O4HB 3TZKA 2VDJA 3T34A 1X87A 4XVCA 5AW4A 1HFEL 1SRRA 1KVTA 1DBIA 5CT4A 4WW0A 1NPTO 1T8UA 2NXNA 4E5KA 4ZEVA 5JSQA 5DBGA 2BEUB 1Q74A 1JU3A 1Z5VA 2XVYA 1QGDA 3C48A 3HVHA 3OE7A 3OZ7A 4TS1A 1WVGA 1QHHB 1Q0UA 2XAUA 2BFFA 3UGJA 4QBKA 4NECA 1M1NA 2XMCA 3DDNA 3GCZA 5FJIA 1WB6A 2ORYA 4CYMA 2HWUA 1V7QA 2AHOA 3PB3A 4HNSA 3SXUB 4GZLA 3W9UA 1HY3A 4Y2VA 1FTGA 4RX1A 5FA5A 1KRXA 3LWBA 5E1BA 3RUIA 1F0NA 3K72B 2EJCA 4QOIA 3CNNA 3FDFA 2XNDD 2QVCA 1NJ8A 3HLYA 3D81A 3DWIA 4EZEA 4CCYB 3IPXA 3ZIAD 2KLBA 5ILGA 1QTIA 1J6UA 5IDYA 3QOFA 2VAPA 5CDGA 1O87A 1IATA 1IBSA 1YGPA 2K2QB 2NTNA 3Q15C 1PNOA 1ODKA 1KJQA 2CF6A 4HWKA 3VZCA 3FBGA 2NZ8A 4JHXA 2H11A 2C98A 4N54A 4ED9A 4QYWA 2PXXA 1MX9A 2IYTA 1W7AA 3G5AA 4WKCA 1LGYA 1FOEB 4QUIA 3QVJA 2R79A 4TWAA 3WZMA 4U9UA 5DCLA 2EFCB 1EB9A 2BZ1A 1WTAA 2AJTA 1NI4B 4H31A 5IYZF 4B73A 3GLGA 3HK2A 4KNWA 4Z4IA 4JLDA 5HJ5A 1BDJA 1RIIA 1QVRA 3ELBA 3Q1KA 3U60B 2O1EA 1OKKD 2Z43A 4RIHA 3WKEA 2GD0A 1JI0A 3ISTA 3JVVA 3QY9A 1BE6A 4H7DA 1QQBA 4O4HA 4A5OA 5FORA 3GJ4A 1KQGA 3EJ6A 1YVEI 1NVXQ 1RZRD 1K3FA 2BEUA 1SBTA 1ZH4A 5EKTA 3OEEA 3BMCA 3N86A 1QHHA 3ILXA 3FDXA 2PX4A 3IELA 1ZMXA 4AP6A 5BR7A 4CUKA 3AUUA 1YGYA 5CJPA 4F8YA 5AESA 1AA9A 1FMCA 3SXUA 3T9EA 2Q1UA 2JIQA 3PUXA 1WO8A 2RI0A 4Y6SA 3FPGA 3DVRX 1K88A 4E14A 2E6UX 4DV6B 1KDRA 2FP4B 1AMOA 2IPXA 3CNQS 3DLAA 3JWPA 4GYYA 4IUDS 2AN9A 1KO1A 2XQVA 2GM4A 4CCYA 1KMCA 3GZ4A 2VPTA 3C7KA 3X2EA 3SJBA 3IQDB 4CM4B 5C37A 1GSOA 2PBZA 1QH8B 3CIFA 3NQ41 2LGJA 2WVGA 2ZS7A 3PEWA 1VJ1A 1RJWA 3MA0A 4N7BA 3N0TA 4W5WA 3W4KA 1AK1A 2GCOB 2JFUA 3D02A 1MEEA 2JGJA 2P9QA 3DS8A 4K6KA 4D41A 1Q0TA 1NBEA 2FPWA 5BORA 4FONA 5LDDC 1GIAA 1JZTA 2XSZA 4H4CA 2J41A 3CR8A 1AGNA 1X0XA 2I3DA 3JQBA 3RRFA 4ZQCB 3TTYA 5A5VA 1C8VB 3TRFA 3ZU4A 3KSAC 4KVGA 3ANYB 3AF4A 3VU1A 1XTJA 2ZUCA 1M8FA 1NI4A 1ZXLA 4UBLA 4RORA 5FYDA 5AIAA 2O3UA 4GYWA 1G1MA 5B3AA 3DW3X 5A6SB 1JR2A 2F90A 4KQ1A 3D7KA 3W0LB 1Q20A 3PQ3A 4IG9A 4DAOA 2VDWB 1R88A 3DFZA 4H59A 3R9KA 1HX7A 3HA3A 4OHCA 4Z1MA 2EIHA 3F8TA 3HRIA 2J3EA 1X13A 3BH0A 4B79A 4RGQA 4MPTA 1JPJA 1PN3A 2POQX 2RHOA 2Q2WA 3NHMA 4J0JA 4UBOA 4V39A 1L5KA 5IM4A 4OHRA 3HB9A 4A03A 2PH3A 5JEEA 4OP2A 3IMEA 5GOZA 3RC1A 3VPAA 5IJ0B 1ZNYA 2AFIE 1BN6A 2AA3A 3TAHA 2K5UA 5E2BA 4UM9B 1JHRA 5KPDA 3ITKA 1VJ5A 1XRSB 1EB8A 2FP4A 3O91A 2LUOA 4EFKA 1NBWB 4QOJA 3KUKA 4NTZA 1YQEA 4BCBA 2QVBA 3L1UA 1E2QA 2W2VA 3ID6C 4CM4A 1H85A 3T9DA 5E9QA 5LR6A 1RC1A 5LLTA 2VUTA 1QH8A 2WAMA 4EW1A 3A25A 2Z1DA 3EASA 4GMGA 4LZJA 3QPVA 3ACBA 3L18A 5B4TA 3PA8A 4J0EA 3GEGA