5HOQA

Apo structure of cals11, tdp-rhamnose 3'-o-methyltransferase, an enzyme in calicheamicin biosynthesis
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
251
structure length
234
Chain Sequence
b'QDLRAFVHDSPEETETTQRLTKLLTNSPIPTEELVNNLPLFLRRHQMTDLLSMDALYRQVLDVPGVIMEFGVRFGRHLGTFAALRGVYEPYNPLRRIVGFDTFTGRFAVPGGYPAYLKEVLDAHECSDFFGHVTQRSVLVEGDVRETVPRYLAENPQTVIALAYFDLDLYEPTKAVLEAIRPYLTKGSIVAFDELDNPKWPGENIAMRKVLGLDHAPLRLLPGRPAPAYLRWGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TDP-rhamnose 3'-O-methyltransferase (CalS11)
molecule tags Transferase
source organism Micromonospora echinospora
publication title Loop dynamics of thymidine diphosphate-rhamnose 3'-O-methyltransferase (CalS11), an enzyme in calicheamicin biosynthesis.
pubmed doi rcsb
total genus 69
structure length 234
sequence length 251
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05711 TylF Macrocin-O-methyltransferase (TylF)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5hoqA00
3C3YA 3HA5A 2YUIA 3UJ7A 5K05A 3KKZA 5K0JA 5DSXA 2P8JA 4PYQA 3U81A 3R9XB 4FS8A 3TFWA 2PLWA 3FUTA 4CTKA 3AWIA 3M70A 4RV9A 1NBIA 3E05A 3LBFA 2ZZKA 3NJRA 4PYJA 2IH4A 4GF5A 1ORIA 2IGTA 1H1DA 3EMBA 3AXSA 3GGDA 5EOVA 3FUUA 5FA5A 3VSEA 3CVOA 3UJBA 3C3PA 5CVUA 3A25A 3EVCA 2EJTA 5BW5A 1QZZA 3M6VA 4HTFA 5LQRA 3KQTA 2GLUA 3KQPA 2VZ9A 5HIIA 3C6MA 3SX0A 3OE5A 5FHRA 4GEKA 3B89A 4OA5A 1O9HA 4C06A 4KW7A 1RI2A 3I53A 4HTFB 5DLYA 1YZ3A 1INLA 3BGIA 4IKPA 4AZSA 5HOQA 1YFJA 3UFBA 5EIFA 2H1RA 3BWCA 4RX1A 2BZGA 5FWAA 5KVAA 3TKYA 1TW3A 3P9NA 4HRAA 5EGSA 1IXKA 1XCJA 4R05A 3THSA 2ZW9A 3AY0A 4WXHA 2PY6A 3T7TA 1U2ZA 5EEGA 3A7DA 3PB3A 4AZWA 2KW5A 3LDFA 1DL5A 2YXDA 1KXZA 2ZWVA 3GRVA 3FYDA 2AN5A 2V74B 5CM2Z 2I62A 2ZVJA 3KQQA 4GOOD 1NT2A 4HGYA 5E1OA 1ZGJA 3HM2A 3MTIA 3EVZA 2Z6UA 2H00A 2BR4A 2QRVA 4HH4A 2XYQA 5K0BA 2P35A 1O54A 1G38A 2Y1XA 4YV1A 3TRKA 2E5WA 5K03A 3BT7A 1NBHA 1R8YA 1P91A 5LQNA 1HMYA 3MCZA 1ZQ9A 3T7RA 4F86A 4KIGA 4R6WA 2B9EA 4X60A 1KYZA 2HNKA 3I64A 1UIRA 2PV0A 1NW3A 5DX1A 5E1MA 1YF3A 4QPPA 1X1AA 1JG2A 1XJ5A 1DUSA 3DR5A 4GQBA 3GRUA 2ZCJA 2PKWA 2QRVB 4OQDA 3OPNA 2FHPA 4YUYA 3G88A 2ESRA 5FWDA 2OZVA 3P9KA 3Q87B 4FZVA 4PYMA 5DXAA 5GIPE 5HFJA 4AZTA 2C7OA 5EMJA 2N47A 5P8WA 1BKYA 4FGZA 2ZBPA 2Z6AA 1B42A 1ORHA 5BXYA 3G8BA 4R8SA 4MTLA 3M4XA 1Q0SA 3SGLA 3WSTA 3M33A 3LHDA 4M38A 2JHCA 1FP1D 2EFJA 4KVZA 2YX1A 3D2LA 4LWOA 4R8RA 3A26A 5DXJA 3RODA 2UZ4A 3DLIA 3DULA 4E2YA 1RI5A 3FTEA 2FK8A 1AQJA 4XUDA 2UYCA 3EGEA 5EPEA 3GRRA 3KPUA 4ER7A 2FYTA 5DX8A 4A6DA 2NP7A 1M6EX 1KR5A 2UYQA 2C7RA 4DM3A 2OKCA 3M6XA 4PWYA 1QANA 2AZTA 3K0BA 3LCVB 4RTSA 4Z2YA 4DQ0A 1FJXA 2FRXA 1XDZA 3SXJA 3MAGA 4DCGA 4E31A 3CBGA 3G7UA 3A4TA 4DMGA 1L1EA 5F2NA 5CCBA 3EEOA 1TPYA 3HNRA 5DTMA 3FPGA 2O06A 3GXOA 1X1CA 4QQNA 9MHTA 3NWEA 5DM1A 1QAQA 2PXCA 4CKCA 3FRIA 3MCTA 2ZFUA 2G72A 1QYRA 4P58A 4YMGA 4RTMA 4GOLD 1SUSA 1JG3A 4C03A 5KQRA 5CD1A 1EJ0A 2AOVA 1VP3A 3C6KA 3R6TA 5E8RA 4RTPA 1M0EA 2IIPA 4QVKA 1TW2A 4E2WA 2CKDA 4RVHA 5IH3A 4Y2HA 3AJDA 2OB1A 3R0QA 4RVFA 3NVMB 1V39A 4IV8A 2C7PA 1JQEA 1AQIA 2ZBQA 3IHTA 3KR0A 3SSOA 1NW7A 3F4KA 5F2KA 3PTAA 2IH5A 1RI3A 3CGGA 2GAFA 4AUKA 2P3LA 5H02A 1F3LA 1SQFA 4EKIA 3B3FA 2FPOA 3G2OA 5M5BA 3UBTA 1EJ6A 5CVEA 3EGIA 1ZG3A 2JHAA 4E32A 5LQJA 4GC9A 2ZIFA 1X1BA 5EZSA 3P2KA 2IH2A 1XTPA 5K09A 5K0EA 3O7WA 1F38A 3E8SA 3R3HA 5E2AA 4C05A 2NXJA 1O9GA 3IEIA 2WA1A 2XVAA 5EHIA 3LL7A 4NECA 5DTQA 1SQGA 1WY7A 1VE3A 3HCEA 3M6WA 1JTFA 3IV6A 4YUXA 4PGGA 4V0RA 1RJEA 3LECA 2VS1A 3EMDA 2UYOA 3SSMA 1T43A 2AVNA 4OX9Y 4IV0A 3FTFA 3OU7A 3NVKI 3CJRA 3PX2A 5DM0A 3LDGA 1XDUA 1N2XA 3OE4A 3UJ9A 4RTLA 4GOND 1XDSA 1OR8A 1X1DA 1L9KA 1RJGA 3JWJA 4LG1A 1R8XA 1Y8CA 3FTCA 3HEMA 4U7PB 3CJQA 4XUEA 4CWAA 2PSSA 3UJ6A 2JH8A 3BKXA 4PCLA 4PONA 4EQZA 5K0FA 5T6BA 3GU3A 4LWPA 4BP1A 3PT9A 4ER3A 3EVBA 2Y1WA 3LCUA 3R24A 2GH1A 3P9IA 2PX2A 2XYVA 1L3CA 5LQKA 5CVDA 5E9WA 3I5UA 3UJAA 3CJTA 1YFLA 3DOUA 2CL5A 2G70A 4UOEA 5E1BA 1N7IA 5EMMA 2IDKA 2AVDA 3LKZA 4FSXA 4H0NA 3HA3A 5EEHA 5LR6A 1JQ3A 2ONYA 3GO4A 5D1HA 4XCXA 4ZTBA 2HV9A 2PT9A 3KHKA 3UJCA 2ZULA 4ISCA 5BW4A 3SMQA 4MWZA 4BLVA 4RWZA 2VDWA 5CVVA 4POOA 2ZZNA 5GWXA 3SR4A 3P2EA 3Q7EA 4XUCA 2ORED 4PCAA 3V97A 3EEYA 4PIMA 3QOXA 3FPJA 3KPVA 4FT2A 4GC5A 2I7CA 2XBMA 1KIAA 3OU2A 3HCBA 1D2GA 5DM2A 5DX0A 4E33A 1BC5A 1JR4A 2G8NA 4B17A 3DMGA 3E23A 1NW8A 2ZIEA 3GRZA 4F84A 2OO3A 8MHTA 2VDVE 2QM3A 5FQOA 3DMFA 2GPYA 3HVJA 4HC4A 3V8VA 2FK7A 2NXEA 3KQSA 3P97A 2F8LA 3FUXA 4PYLA 1WG8A 3MERA 2AR0A 5HEKA 4OBXA 2DPMA 1VBFA 2Z6QA 1M6YA 3EPPA 4PIPA 1QAOA 2R6ZA 3I9FA 5K01A 2AN4A 3JWIA 3I58A 4PYIA 4E2ZA 3KPYA 1EQAA 3A27A 3G2PA 3SVZA 2ZZMA 1SKMA 2O05A 2B78A 5DT2A 5EZQA 2PT6A 5LQAA 3GCZA 4ATNA 4RTNA 1R00A 3G2QA 3DLCA 3UJDA 5GINE 1EIZA 3KQMA 3CCFA 1G8AA 3IYLW 3EVGA 3RIEA 3VC2A 5FCDA 1N7JA 5T64A 2O07A 5GM1A 5DPMA 5KS2A 2ZBRA 1JG4A 4RYLA 5HILA 2BM8A 5GP1A 1R18A 2R3SA 1VP9A 2YTZA 4HGZA 1JQDA 1NV9A 3RW9A 2WK1A 3FUVA 5FULA 10MHA 1DCTA 2P3OA 2B3TA 2EJUA 5EC8A 3P2IA 4QDKA 1JSZA 1KPIA 1ZKDA 3E7PA 3GIWA 3M6UA 3LKDA 4PYNA 4CKEA 2OXTA 4M37A 1VQ1A 1FP2A 2I6GA 3DXXA 4KIFA 2G71A 3ELUA 2ZIGA 2DULA 2QY6A 4X61A 5DM4A 1G60A 4BLWA 3TPZA 1KP9A 3PS9A 2IBSA 2BR3A 1SG9A 4HG2A 2PWPA 3FTDA 2AOUA 4QTTB 1SVUA 3ID6C 1XXLA 2P40A 5E9JA 4V0QA 4YV0A 3C0KA 5K0NA 5KYGA 2ERCA 3PX3A 3VYWA 1YB2A 4DCMA 2NXNA 5GIOE 3EVAA 2PXXA 3OFJA 2H11A 1AF7A 1X19A 2P1DA 3FPFA 4M36A 1AV6A 3UJ8A 1Z3CA 5EMLA 4C08A 3FPEA 5ICGA 1L3IA 2XVMA 3LCCA 4R6XA 3OZRA 5EIWA 1RI1A 2NYUA 2PX8A 5K0LA 2EX4A 3GNLA 3BZBA 3ERCA 4QVGA 1D2CA 4X41A 4RVGA 5GM2A 5E9QA 2PVCA 2WA2A 3MGGA 1FPQA 2BR5A 2HTEA 5EG5A 2QYOA 3KU1A 4P7KA 4RSRA 3K6RA 3NDIA 4CXMA 5CCXA 4CTJA 3EVEA 5K8VA 5EVJA 3HCCA 3KQOA 3UZUA 1IM8A 5IKMA 3G89A 2CWWA 1WS6A 4OA8A 5E1DA 5ICEA 2AOWA 3TQSA 4MQ4A 4CKBA 5DWQA 2G1PA 5MHTA 2CMHA 2B2CA 3B7PA 2AN3A 2AOTB 1RI4A 3S68A 1G55A 2OBFA 3OCJA 2QE6A 1FBNA 3BGDA 5FTWA 1RJDA 4IWNA 5K0CA 3L8DA 3OU6A 2UYHA 4E30A 1MHTA 4FSDA 3MHTA 1VIDA 3FUWA 5EKUA 1P1BA 3HVKA 3MTEA 3BWMA 2AOXA 5LQCA 3G5TA 3PVCA 4HSGA 2YR0A 4P7FA 5CIYA 4EMSA 3UA3A 4BLUA 2ZSUA 5DSTA 3GWZA 2VDUE 5CVJA 1PRYA 1XCLA 2HWKA 3NW9A 3UA4A 3NDJA 4KWCA 3HVIA 4KDCA 3P8ZA 1XVAA 1L3BA 3B3JA 3LSTA 4GBED 5DTRA 3SM3A 2I9KA 3NMUF 3OZSA 3BWBA 2PX5A 3TM5A 3EVDA 3TOSA 4C4AA 4F85A 3ANXA 2PWYA 2IFTA 3GRYA 3KR9A 1NV8A 4ER6A 3ER9A 1UWVA 4YUWA 4JXJA 5C0OE 3GJYA 4PNEA 4ER0A 5T67A 2A14A 1ZGAA 1UFKA 2ZTHA 3FRHA 3OZTA 3P9CA 4PGHA 5FHQA 1MJFA 3OFKA 2OYRA 2YXLA 3ELYA 3BUSA 1I4WA 4MIKA 4U7TB 3UWPA 3G5LA 3THRA 3DTNA 1P1CA 3LDUA 2CMGA 1WZNA 2O57A 3ELWA 5K0GA 2EG5A 3DP7A 2HR1A 3QV2A 2YVLA 5GOZA 1QAMA 5B1SA 4RTRA 2JG3A 2P41A 4YUZA 3G8AA 5ICCA 3QOWA 3HTXA 1R6AA 5JR3A 2IBTA 1SUIA 3GDHA 1ZHFA 1D2HA 3O4FA 4K6MA 4WVLA 5EMKA 4BP3A 5BP7A 1JG1A 1VLMA 4G56A 4BY9E 2HMYB 2FCAA 2K4MA 4LECA 1BOOA 3TKAA 1WXWA 3LBYA 5ERGB 3B5IA 3DMHA 1HNNA 3NTVA 1KHHA 3KR1A 5LSAA 1YZHA 3LX6A 2OB2A 2LD4A 2OY0A 1KYWA 1I1NA 3AXTA 3KPWA 2JJQA 2IPXA 4GUAA 5G02A 3T7SA 4RTJA 3ER8A 2JH9A 2ZLBA 3KR2A 4M7RA 3HCAA 2IP2A 3PFHA 3SSNA 4MHTA 1NW5A 4EVIA 3X0DA 4RTKA 4DKJA 3FPHA 2YXEA 2BM9A 4DF3A 1YUBA 2PX4A 3G2MA 5CUQA 3BXOA 3VC1A 5HIKA 3DXYA 2JHPA 3TLJA 1NE2A 1JSXA 1NKVA 4QQKA 5FA8A 3LGAA 5C1IA 1PJZA 5HIMA 4QPNA 1G6Q1 5EKXA 4FT4A 2PBFA 1P39A 2P7IA 5FQNA 1EG2A 3TMAA 3HA7A 2OPBA 4AZVA 4YMHA 2C7QA 2PJDA 4O29A 2PXAA 5DRYA 3TM4A 5HZMA 4RTOA 2PGXA 3KQYA 2VP3A 1KPGA 4GOMD 2GA9A 5KQSA 1KPHA 3A7EA 3CKKA 2AOUB 2NP6A 2BH2A 3ME5A 2B25A 3DUWA 3FYCA 2AS0A 5DRTA 3P71T 5EQJB 7MHTA 4PYOA 1BHJA 2P3QA 4FP9A 3ORHA 5E2BA 3JWGA 4A6EA 4E2XA 2V7EA 4YV2A 4OBWA 4PINA 5FADA 1RJFA 3MB5A 4QTUB 1NW6A 3HCFA 3KQWA 2O0LA 1G8SA 3B3GA 4E70A 2YQZA 3HVHA 2XYRA 2IDJA 3JWHA 5HIJA 4EK9A 3HP7A 3CC8A 4QDJA 3BGVA 3EVFA 4EKGA 5U4XA 4P7JA 4ER5A 4KRGA 2Q41A 4OQEA 3REOA 4YUVA 3PFGA 4DA4A 5FUBA 3PLAE 3FZGA 2NXCA 3KQVA 2ONZA 1R74A 2GS9A 3DXZA 4X63A 2AOTA 1Q0TA 4PYKA 4C04A 3MQ2A 1IY9A 5D1NA 3ELDA 4L7VA 2P7HA 5F2OA 3KPJA 3O31A 3NWBA 4P7GA 5E8JA 1WXXA 5EHGA 5JUWA 1EAMA 1I9GA 2ADMA 2GB4A 3DH0A 4KDRA 4RVDA 3LPMA 4Y30A 2ZWAA 4C07A 1VL5A 2NNWB 3BWYA 3EGVA 3H2BA 4DZRA 4AX8A 5LQUA 3BKWA 4RTQA 5C9ZA 3T0IA 3TR6A 4X1OA 1JTEA 3HCDA 1VPTA 5ICFA 4FR0A
chains in the Genus database with same CATH superfamily
1WXHA 4RZHA 3RJ9A 1MEOA 2DT8A 1C1DB 4OF4A 2P8JA 5AVWA 1W2WB 5I47A 3H8WA 1YK0A 3JD1A 4EW3A 2R1UA 4XJSA 3UXMA 3T5MA 1DT5A 3L7MA 3QXGA 4R9SA 2O1SA 3U0VA 2ZZKA 5EHXA 1L8QA 2B5OA 3R76A 4DBVO 5ES3A 1H1DA 3FUUA 2GXAA 3DMTA 3H5TA 3I92A 4WKNA 4K0KB 3OTHA 5FR2A 5BW5A 4KU4A 5L7WA 5LQRA 5A5DA 3FZNA 2H2DA 1B74A 1KC3A 2EKPA 3BWVA 4KQ1A 4XAQA 4AYXA 3RU7A 2H9YA 2QB5A 4B8ZA 1XRSB 3A9UA 1NUHA 3TIGA 2OBBA 4E51A 5A6VA 3F6SA 4IDAA 1RI2A 1ESCA 1TVEA 1Y42X 1NUAA 4TSKA 4BMPB 1EG7A 2VJDA 3H86A 1ULHA 3SJ7A 3UJNA 2WZCA 3L7YA 4CF7A 1NMXA 3ZHZA 2GOYA 2HF2A 2QTRA 3WGLA 2WF9A 5LMUB 1U0FA 2RGNA 3VU9B 1CDDA 4BEBA 3SU8A 1IEVA 4FU0A 2FEKA 3GT7A 4Q6WA 2WSMA 2D7CA 3SCZA 3SEQA 2RC6A 3RC8A 1IZ9A 2J31A 4BEVA 4O5OA 1W34A 2E89A 3GUCA 4NBWA 4NQRA 4UVDA 3QY0A 2G06A 3QTTA 2G0TA 3ASVA 2C61A 3EFBA 2C0PA 4MUJA 4RGQA 3OKPA 4M9SA 2C1ZA 1YXMA 2QSYA 3B6EA 2AJ8A 2IOHA 4DYDA 2W2KB 3TIFA 2F1KA 3KQQA 4GH5A 4GOOD 1RM0A 2FR8A 2WF5A 3HM2A 4EHLA 3O2JA 2EFCB 2H07A 2B1IA 4ML3A 2XYQA 3BDIA 3RHSA 5AUPB 1XCPA 4X3OA 4YQFA 1MJNA 1O54A 1T5BA 2PYIA 2W2KA 1PEDA 4E5SA 2PO5A 4Q9HA 3EIXA 4TL6A 4YV1A 5INTA 2I4NA 2NADA 3OZ7A 5DYIA 3ZWNA 2A78A 3KDSE 2AG1A 3VOSA 1L5OA 1QUEA 2HXGA 4NHOA 4ETIA 2VWQA 3IQFA 3PWTA 4JP2A 4ALNA 3BBPA 1CQIB 4HL6A 4QDOA 5FWXA 1F7VA 4AG6A 4XDZA 1GLVA 1R4NA 5IXYA 1CUFA 2FXVA 4CM4B 3DGFC 1FYFA 1YQXA 3IAXA 4XKJA 1Y7TA 4GQBA 5T4BA 3GRUA 3KOOA 3HACA 5CJPA 4Z4QA 3HRIA 1GU1A 4I8IA 4MSUA 4FFVA 3R5FA 1FMTA 2V97A 3DDSA 1TTHA 1ZH0A 2ZJYA 3JU3A 4FGZA 3HR7A 4BJHB 4IIUA 5LBTA 3FHLA 3K1AA 2VNIA 3QJGA 1AMNA 3LPLA 3UJPA 2OEPA 3B8HA 1TYCA 1XC7A 3DBRB 3DHVA 3IQEA 3KEGA 3KT0A 3ONNA 5CXXA 4YPFA 4P86A 1XMJA 1YZYA 2EFJA 4KVZA 1MO2A 2BWJA 1E2UA 2WJVA 1LU9A 1DFIA 2PVPA 3H9GA 4F4CA 1WF6A 4DNQA 2QTFA 4DEXA 4LI0A 1AY0A 1BWPA 1WDWB 4OPMA 3R7WA 3KPUA 2X9NA 3X1JA 4A6DA 5CBPB 2ZCUA 1Q0LA 1M6EX 4H18A 4RTSA 3UOGA 1LW6E 4BWYA 5JU6A 3IQIX 3DJYA 2VJKA 1WRBA 3R74A 1C7RA 1M2OA 5CLQA 2W6NA 1I9CA 1OHHA 3CBGA 1EXWA 3C1UA 3GJSA 4FGLA 4HGRA 4MQLA 2W8BA 5C37A 3G1WA 5F2NA 3O8CA 2RCYA 4CM9D 1X1CA 2W6QA 1NE7A 5A2QA 1GD1O 2H2GA 1KOLA 3ER9A 4CKCA 5A9RA 3BXGA 5HKOA 1V7ZA 4UUBA 4F4UA 1IB6A 2DBYA 2G72A 3AHJA 3ETEA 3IMKA 3F49S 4GOLD 1E5VA 4C43A 5ELMA 5F7XA 4IH1A 5AD1A 2O8DB 4RGYA 3J81k 4FIDA 4BVLA 2C2WA 1D2MA 3EIOA 3EF1A 4YASA 4ZZ1A 4GPTA 3AJDA 4FPXA 3DMPA 5BSWA 2V9ZA 2HJSA 1TGYA 2OO5A 2IRWA 1P62B 5FP0A 1JKFA 1FVFA 3L8HA 2PYDA 1KO7A 4X1KB 4TRNA 1T1IA 5JYEA 3WQRA 4PZUA 3KYBA 1PZMA 4BQSA 2PT7A 3CPSA 1YS1X 2J0UA 3FNBA 4IF4A 4RIFA 3NHAA 4MJLA 4BCBA 1Q21A 1EX7A 1OB2A 3DLTA 4QIHA 2P2SA 1P7PA 4YECA 2A58A 4S1NA 1JG7A 4YAOA 4NLLA 3CH7A 2IOFA 2NVWA 4AJ2A 5CDTA 2WUWE 2RHHA 3M6WA 3UICA 1AH2A 2OXRA 1XZCA 3WLEA 3P20A 2FZ5A 1RJEA 3HN6A 3K0FA 4RUKA 3SDZA 4HAYA 4IV0A 4J0JA 3L46A 3R7FA 3T1HB 3THXB 3DE3X 2DLNA 4XA8A 3R7BA 2VPZA 5JJKA 2D3WA 3FBGA 4KUEA 4XVRA 1Z4IA 3WVNA 3HSYA 4MGZR 4DPLA 3EPKA 1V9CA 1C7FA 1IMOA 3IA7A 2XHEA 1AOXA 3I4LA 2AN9A 3GB9A 1HKHA 2PSSA 2HKIA 2QN8A 3I9JA 2QAJA 3TX2A 3LXMA 5E6SA 2B69A 3IT1A 4L50A 4MIYA 3VTZA 4BP1A 2E85A 4QEZA 2A92A 3PQ2A 3R24A 2BGRA 3OETA 5L4LA 2LVBA 2XYVA 1IG3A 1P45A 2ZRQA 4BMZA 2RBKA 3T5BA 1NJGA 4MYUA 2IPNA 1XP5A 2OYSA 2WM8A 5LZ9A 3SC3A 3O8NA 4A5SA 4C87A 1UK9A 3F5MA 3CPHA 3QITA 4XCXA 3UYKA 3D6VA 2J32A 4P35A 1Q0ZA 3RS9A 2VDJA 1ZNXA 4CF3A 1RQLA 1TIBA 1DO2A 5F76A 4EDFA 1F3OA 3HJUA 1E3IA 4MV5A 4QDUA 2C00A 4D4HA 3EGWA 3TLXA 5JFTA 3SR4A 5IF9A 2ORED 1BWQA 2Q6OA 4HZIA 4BZZA 3S2SA 2R6AA 2AA3A 5A71A 4XGKA 2LCIA 2X5NA 2ZITA 3HYNA 4GGOA 5ALXA 1L5GB 4EOGA 3HFGA 3EOBI 2D8AA 2P4EA 2XMSA 4OFWA 4Y6OA 3RAPR 4UNSA 4AJHA 1XU4A 3QE2A 4QXQA 3M4ZA 5JSHA 3HFJA 2P1RA 1N2SA 2YC2C 5HE9A 5KSWB 2YY6A 3GAZA 1NBMD 3MTGA 1X13A 2EGUA 4MUYA 1MPXA 3KJQA 4FBMA 5T8KA 3SICE 1L5RA 1RABA 1ZIYA 2ZS7A 3UK6A 4N9WA 4XIFA 2Z5FA 1UWKA 4WK6A 1FFAA 4PQYA 1YDHA 2XJ9A 4PIPA 1QU2A 1ZUWA 1DJMA 1PHRA 3DZHA 1ZM2A 1GXSA 1ONNA 4DWOA 1WDLA 2J59A 1V7QA 4BIIA 3LO8A 2P2ZA 4OGFA 2O05A 4O3MA 2B1QA 1EBFA 1R7RA 1XZIA 4JEMA 2YNMC 1R00A 3DAFA 3K9QO 4UUAA 4IJWA 3UJDA 1QX3A 2WUGA 1L5HA 1F2UA 3O3NB 5FI3A 3SF8A 1TC2A 2FSPA 4Y3UA 4ACAA 4BFSA 1ZI9A 3A9SA 4RGBA 4M55A 2BIFA 2PEYA 2ZZMA 1N5JA 3ADCA 3VAZA 1VP9A 2JGLA 3E22B 4LA4A 3SJUA 3LL4A 5L6MB 4BV3A 4R1QA 4TM8A 5F9HA 1KJ9A 1RE0A 2IHBA 1C2TA 1EP1B 2B82A 1PJ4A 2Z08A 3A6EA 3HB4X 3T7EA 3ZW7A 5IYZB 3WP0A 1GL3A 4PF1A 1VSTA 2OXTA 2JS7A 1D6NA 1Z13A 4Y2QA 1WUHS 3HB1A 2YIJA 2B35A 4K8OA 4AQYB 1H3EA 1MPTA 2G9VA 3HDGA 4X6LA 4CG1A 5A62A 4RVNA 3OTQA 2QY6A 3OKFA 4L4SA 4TQ9A 4XYMA 4WH0A 4TV8B 1XWWA 3Q10A 3P4XA 1O77A 4JJZA 3GLHB 3ZXSA 2W2MA 4CEIA 4HG2A 4D9BA 3IB6A 1ZOLA 2PUJA 3EAFA 3GHHA 3GNTA 2P40A 5JQWA 1C7QA 1O5OA 2ZYDA 3ANNA 4X62B 1UDBA 1BE8A 1ESEA 1ES9A 1YHZA 1YBMA 3AU9A 4OXKA 5SYAA 3TPFA 5KU1A 1AS0A 2X5JO 4I1PA 2NPIA 5G3YA 2PGDA 1ZD3A 4Q16A 2PU7A 5CJJA 4EMBA 3GR6A 2HLDD 1PGNA 4MW9A 2EW2A 2FKNA 4I50B 4YDQA 1W6UA 3DMYA 3P7MA 2AQKA 1LZKA 1Z8HA 2VUSA 5BMOA 1ONOA 2L18A 2XQJA 3KWJA 1B7GO 2D5LA 3C3BA 3DBVO 5K9ZA 3G79A 4OLBA 5HRUA 4ZU3A 2WA2A 3G2HA 4JS0A 4N01A 2B3DA 1L4KA 1DKUA 1G5HA 1KIFA 3JQFC 5TX7A 3EODA 3WHLA 1UJ2A 2WYHA 4RK0A 1GSOA 3NDIA 5DHFA 3RQSA 3RV4A 3PHLA 4MR7B 3VR1A 1WVGA 3N8KA 1OI7A 4O4JF 3T1YB 1W0CA 4IO1A 4O33A 4CKBA 1EWKA 3GXBA 4ESHA 4MS4A 2BFBA 4X00A 3T35A 3S8YA 3JASB 2C88A 3W0LB 5CX1B 1VA5A 2ODAA 2J5KA 2VHEA 2PL1A 4YUAA 1YU9A 5K6RA 4MI9A 3W7BA 4Q1FA 3BB3A 5JXGA 3U4MA 1J1UA 3L5KA 2YR0A 1FUUA 1KO5A 1QGUB 1T4MA 3UA3A 5EWJA 4YHHB 3RSOA 3UWOA 1GVHA 1YQDA 3G0HA 5LKRA 4JHLA 2OXFA 1G1MA 1TEHA 1TAQA 3LK7A 3VSAA 4CIDA 4CIWA 4DBLC 5KQLA 1LJUA 5TQ2B 2WUFA 2CY0A 3EBPA 1LC3A 3ANYB 4KMOA 5DBGA 3TZHA 3WRYC 1BGWA 3IMCA 4JJ6A 4J2HA 4Y9RA 3RRXA 1ISGA 1ZCFA 3LSTA 5REQB 1K6IA 1K98A 2ZG6A 3ZIDA 2E0IA 3LUCA 3HGQA 2QAGC 3ANXA 1YZNA 4LHVA 1YRHA 3GRYA 2RIRA 3IQWA 3EGDA 3KOZA 4ITVA 1U0LA 4S12A 5F2EA 3ZDEA 3EW9A 3EUAA 3PC2A 2QXUA 1M8FA 1UFKA 4LQLA 4C5BA 2VT3A 2XMPA 4MPDA 3E18A 2YXLA 3L7IA 1W88B 4U7TB 3WJ2A 3ZC3A 1CS4C 1RRPA 2WABA 3PUWA 3LDUA 1GFSA 1HEUA 1WZNA 3BZUA 4M0DA 5KZMB 3M9XA 4TTTS 3W5DA 4HZUB 1BEUB 1VLVA 3LLSA 4R3UC 4BLSA 2G04A 4F92B 2JG3A 4FMDF 2VBCA 1V47A 3K8OE 5DHRA 4I5EA 3V6LA 4N5HX 3MJRA 1QK4A 3RTDA 3ILHA 2GJSA 1XZPA 5EUBA 1H42A 3RRZA 5BP7A 5A7FA 1GZ5A 4KWHA 5TPWA 2E6UX 1VLMA 1R9MA 2BISA 2JFWA 1CCWA 2VBGA 1K2WA 3ZU2A 4UNQA 5MN4A 3RLIA 4OLFA 1U9CA 3QLEA 3ZY5A 3DMHA 4NYMR 1JF8A 1HNNA 4MUBA 4TQUS 2Q5LA 3WKEA 2WU0A 4FMPA 5FAXA 1I33A 1KK0A 2BMEA 1W59A 5HKLA 5JHGB 4Q21A 4AWAA 4OUDB 3SSNA 3VKFA 1KRWA 3AEKB 1L5QA 1J8DA 3BDAA 5HA5A 1CUUA 3FPHA 3ZJ4A 4MR7A 2H7CA 2PX4A 4R01A 4PFSA 2XMGA 1N3YA 3LP5A 3AUSA 1BW9A 1M6NA 2PZKA 3VR5H 3W05A 1XZHA 4PANA 1PJZA 3RC1A 4AO6A 4XSGA 3RT7A 3QF7A 4LNHA 2RDMA 1RZRD 3TMAA 1NUSA 2OSVA 5FYQA 3CYFA 5CCDA 4IW3B 5L3ZA 4O1MA 3KQYA 2C95A 2VP3A 3MVEA 1FFDA 4QJIA 2ZAOA 2IEZA 3HEBA 4PG4A 1VHQA 1BQ4A 1JJAA 1HE5A 1OX4A 2D2XA 3HZZA 1KJIA 4IAOA 1FS4A 2GZ3A 1G8JA 3SEAA 2PH5A 1YMVA 4A6EA 2GLXA 4WBNF 4JNKA 2VNAA 2NUTA 4K9MA 4ZZIA 3QBVA 1Y1RA 4BOYA 1OSNA 3RLFA 5AM1A 3HCFA 3TLBA 3REFA 4CR8A 1H6DA 1LWNA 2AEJA 4FWBA 1MFZA 4GIBA 4MS1A 1BVYF 3RRMA 5HIJA 2XYRA 3ZHVA 5CXUA 4CKCB 1PFKA 3VZPA 3Q98A 3ZLUA 4TV9A 5DCLA 3JVUA 1IAQA 2IHTA 5BSVA 2FPGA 1MA0A 2A3NA 4W8OA 3PNSA 5I7FA 4DA4A 1LRJA 1HE2A 2NYRA 4CG3A 4I1IA 4KZPA 4MCJA 4C29A 1WLYA 3H11A 1SBYA 5HXAA 3U6BA 1RWVA 4BMYA 2P4HX 2X19A 1UUFA 1C4KA 1LX7A 3A04A 4MQUA 4QELA 1R64A 2IYUA 2P9TA 4ZOLB 3EEBA 2BFCA 4L9SA 3O75A 4MUKA 1OI3A 1K6XA 3OD1A 3QBJA 4YA6A 4K87A 4FONA 5FTJA 1Y7LA 2TS1A 3C98A 1AS3A 1MKYA 5G4LA 1I2CA 4IINA 2Q8NA 2P6UA 3C7CB 2YFQA 2Y0DA 3DDWA 3PD7A 5JALA 3OZDA 1T1JA 2CF5A 2LKDA 1WVMA 2CBZA 2OO5C 3JRWA 4E22A 4RTQA 3TR6A 2D1SA 3AUJB 3I8OA 4BKRA 2YXNA 4BBAA 1OJLA 3COZA 1JR2A 2YUIA 2EJBA 4UUQA 4LC9A 4UE2A 4WPGA 2IYXA 5DJ5A 1DAHA 3AM5A 3G9QA 3K6KA 3MS2A 4E15A 1J99A 5LU9A 1H9AA 4Q48A 4G63A 3NRCA 4F8YA 2PFKA 1E8MA 1C0LA 3WGHA 4ZYZA 1R0CA 5H70A 2BFMA 1GYQA 2VWHA 3GLHA 4IZ6A 4ZGGA 1E1RD 1X2EA 3Q15C 3QVUA 2H6EA 4QEDA 2EJTA 1JBKA 1NMEA 2F8MA 1QIIA 1UZAA 1SBQA 3KZ1E 3OE5A 1FVHA 4QFCA 4CF6A 1Z8DA 1ZN8A 1U2DA 1DB3A 1G8PA 1U9YA 2FLWA 2BMDA 2XY4A 1L4GA 3A58B 1RC1A 5IYZF 5SZHB 4DLWA 1E77A 2EDAA 4TMXA 1M66A 3V1LA 3CO0S 2DKFA 4GI1A 5DE3A 1GWNA 2UZ1A 3GLKA 3C4VA 4ONEA 4IIYA 5DMXA 1WETA 2GHTA 4J0CA 3FMPB 1OH7A 3BWCA 3NIDB 1ZR2A 3NG1A 2XEDA 3G59A 1HE1C 3UG6A 2FW1A 4EF5A 3CSDA 4NE7A 2Q3MA 3KLMX 1SM4A 5F1YA 3BD9A 3T7TA 3PDCA 4RFSA 4NBVA 3W90A 1EP9A 1GPUA 3AONB 4J3NA 4YBRA 2WHYA 3JQAD 1NT2A 4G2TA 2IITA 2IHUA 4HGYA 2OQVA 3MGBA 3I5YA 4NXMB 2V9CA 3HMQA 1WSWA 2VQ3A 4O8CA 2O2SA 3TSWA 4B48A 4DLYA 4MS3B 4I55A 1H9CA 3BE4A 4HH4A 2HA2A 5EWLB 4J0DA 4NPAA 9ATCA 3OF2A 2BBSA 2W0MA 1QRTA 3BT7A 2FGKA 1A7UA 4CIYA 3BG5A 4RD4A 3WRVA 1QFZA 1Q91A 1H2FA 1H93A 5G4KA 4DQUA 3LC1O 2CSXA 1NN5A 2ZYGA 3PR3A 4GI5A 5HTKA 2IZZA 1T91A 4YYZA 1D8TA 2BHRA 2ZSJA 2G4LA 1JQ5A 3LBIA 4JN6B 3ZNPA 4JOBA 3EG5A 3H1PA 4J0QA 1YS2X 5AK6A 3W5BA 1XPUA 2AJCA 2DFVA 2QRVB 4BKPA 2TYSB 4EB0A 4GMDA 2BTOA 1W30A 5T4FA 2I22A 2GVZC 4V0LA 5BUSA 2VYFA 2O20A 3N1UA 4K3VA 1JH8A 2DBZA 5DNCA 3ITNA 1BKYA 3H7IA 1R0ZA 4KZKA 5H9VA 4YT5A 2BMWA 5DNUA 4A6XA 1N9GB 3I62A 1V5EA 4GVLA 2WWXA 4QDXA 4MLPA 2FWRA 5ALLA 4Z9FA 1V1MA 3EIHA 1T4CA 3FSGD 1J1ZA 1MXFA 3DD5A 2XE7A 3QNMA 2JFXA 1YH3A 1ZGHA 2ZSKA 4YJ3A 2DLDA 2X7XA 4GGMX 1VLZA 2WVJA 1M7HA 2C3PA 3QU5A 5H5JA 1G291 4E14A 2VH1A 1ZH4A 4TLAA 1DMRA 4C6SA 2X14A 3DQQA 1DNPA 4V03A 4TZ6A 2GESA 3ENNA 1IK4A 2AC2A 3GRRA 3L02A 3X1WA 4FOOA 4KP7A 2LIPA 1JEQA 1U65A 4R2XA 5KDLA 1EGQA 1T6NA 3RRJA 5LQCA 1TAUA 4IIJA 1MJ5A 1IOWA 3WK7A 1G8KA 4WFJA 5DYNA 1XTVA 1PU2A 3QMVA 2XKBA 1EWTA 5F9MA 3GEDA 2I87A 1ZK4A 2XGGA 4G2NA 3IFSA 4AROA 4EY7A 2IY8A 1WKVA 3A6PC 2Y1OA 1SUPA 3B60A 3EAGA 2JEYA 2OZLB 3JD3A 5KYUA 5DSZA 4P58A 3SHWA 3VHLB 2ACEA 1GPBA 2WJ6A 3QVGA 4QNNA 3QFRA 4B3TB 3FNFA 4IXMA 1TQ2A 3B82A 2H63A 1P4GA 4RWEA 2ZTLA 4BN4A 3R6TA 4DQDA 1OBVA 1MT0A 5BUQA 2A9OA 3I3SR 5EP2A 1E79D 5F3DA 4WLFA 4J3JA 1HMPA 1EE1A 1M6VB 1TO6A 2BBTA 2JCSA 4JU9A 4WDQA 4XW2A 3ENQA 4R9VA 2IWHA 4HD8A 4FZJA 4Z0NA 4URVR 1LPAB 1K63A 2ODBA 3NZEA 5JMTA 1LVGA 1SEVA 3SSOA 4ZC1A 4GSKA 4EHKA 1O6BA 4MVCA 2AL7A 3V2GA 4E4TA 2YZKA 2PZ8A 2HMVA 1EKXA 2D59A 2IYRA 4OI2A 3UAWA 1TCUA 1SA0A 5JNWA 5DBOA 2Y3IA 3CZRA 3OICA 3BFXA 3JZAA 5JXJA 4JC8A 4WVFA 4DV3B 1KEEB 2EBUA 3TI7A 4L4YA 2PH1A 1MO4A 2YWHA 1WO8A 4OL0A 1KAHA 2D4HA 2P75A 1I3OA 1SBHA 1FUYB 2OCYC 3HCEA 2J09A 2F3TA 4GYYA 2OLJA 4V02A 2NU9A 1IXYA 5AT1A 4Y6SA 5E3HA 4Q01A 4TVOA 4ZA2A 4DVGA 1Z07A 4RK5A 5JRDS 2II6A 1FLNA 1JAZA 1MAAA 4R2IA 2PKQP 4XIJA 4H3HB 5GMOA 2VP5A 3WJ1A 3TI9A 4C78A 2GRAA 2DSNA 1MJGM 2W2XA 1MLDA 4OKNA 5JLAA 3FTCA 4RKRA 3ZUPA 2O6LA 5C1DA 2D62A 2GXQA 5PNTA 3WISA 1BN6A 2ZSEA 4KXFB 2JI7A 4FI3C 4FJ0A 5G1OA 3LT4A 1C81A 5ILGA 3OWHA 13PKA 3NHUA 1ETUA 1IB0A 3WAKA 1B23P 1UH5A 4XASA 1MX1A 2RGBA 4UC0A 2VP9A 4QOFA 4TTRA 3NO4A 4IPTA 3CCCA 1IHPA 1OWPA 1XNHA 2C03A 3TOZA 3N07A 1QR2A 2PGJA 4GMGA 4V0NA 2FOIA 1SIWA 1AIPA 1OX6A 3B51X 2IP4A 4I81A 3A3PA 2PMWB 3B13B 5AI6A 1K5PA 4BLVA 4W5JA 4MYCA 2XNSA 3BB4A 3LUKA 3S55A 1AA9A 4CQJA 4IFTA 4J7UA 3Q5GA 4OAQA 5CGQB 4K9PA 3WSWA 2BHSA 3P2YA 1UBRS 2NSLA 2PD3A 4D74A 4ZYUA 4U7WA 3NT5A 5ETJA 1U3TA 4YAGA 3L4BA 1GPAA 4CM9A 2WD7B 4CT4B 4ZT7A 1E9AA 1R9GA 1VLJA 2O3UA 2X76A 4KH1A 1LSSA 1YHYA 4RQUA 4ZPJA 4B4UA 8MHTA 2VDVE 4KLCA 3QXCA 4L22A 1I4DD 4DOMA 2DWQA 2GX6A 1QONA 1K68A 1UDCA 1V6AA 4JLWA 3DAOA 4IG9A 2H0AA 5TPZA 4Q7KA 3SJZA 4D8UA 1PVOA 2ZB2A 5HEKA 4HPXB 2QTWB 4L4ZA 3IO3A 7GPBA 1JDSA 1QG6A 1K92A 4QGBA 1W94A 3NP7A 3RF6A 4F1KA 4MVJM 1QAOA 1ESZA 3CZPA 1IU9A 4E7PA 4Y6GB 2OP1A 1NY6A 4KBGA 4W6ZA 1HSOA 3Q7PA 4U6NA 3UN1A 2BTEA 1O96A 2D2IA 4ZOQI 3IE1A 1H4QA 4EHAA 3NALA 1T9GR 1X1RA 3ONDA 1BFUA 4UU7A 4ATNA 2BFDB 3OE1A 1KQNA 4AMZA 1P1KA 3C45A 3MMPA 5I7EA 2W6IA 1PZHA 3NHYA 4NEGA 4P4SB 3V48A 3IEUA 1ULAA 1CEXA 2DQ4A 4HATA 4EA7A 3K9BA 2CL6X 1GG5A 4HDSB 4IVPA 3PQ4A 3I28A 1BVRA 3VGPA 1NASA 1TA4A 2JJ1D 1L7BA 3FNQA 3FF4A 2JAXA 4IRXA 3N39C 1NYRA 2PZAA 1NV9A 2GJAA 1Z0FA 1BCSA 5L3QB 3R3WA 3FHCB 2GBCA 2O50A 2QD2A 2B3TA 1EDZA 2EJUA 3DFKA 4A8JC 3D7NA 3JWEA 2RH4A 3K16A 3LJKA 4H3VA 4QPJC 4L73A 1QYDA 1P7WA 1PL8A 4TWBA 5G4KB 4MWCA 5KYYA 2ZUVA 1OFVA 4RABA 3OQIB 5D3ZA 3PCXA 2P6NA 2GCIA 1C9KA 1HUQA 2QSZA 4FYKA 2A35A 4G1BA 2IYQA 4LBWA 5D6NA 2E49A 4OSPA 2V7GA 3DV0B 4GX1A 4M9CA 1XHEA 2HMTA 1GCUA 2DTEA 1R16A 1PWYE 1VHWA 2HA6A 1EFDN 3JZMA 2MMGA 4ZRNA 4P1ZA 5IK2D 4IV5A 3GYGA 4EB3A 1Q15A 1ABEA 4JA2A 2XXJA 4KE7A 3ZKAA 2PJRA 1RD4A 1K7FB 1Y0BA 2BOVA 2PXXA 4LI3X 2C9OA 4BNZA 2EKLA 4F06A 4J6EA 4DDKA 2ADFA 1BS1A 1U8AA 2BFBB 2X4IA 2GM4A 1IZ8A 3U3MA 1R0SA 1HLFA 1GN9A 3DZJA 4ZEWA 2YYSA 2BDTA 3V7YA 4ZMSA 4BX2A 3IOBA 4RSRA 4BRWA 1M2NA 2LNDA 3K2EA 4CTJA 3VKHA 3FYUA 4JBYA 2FP3A 1K6MA 3RFXA 1PZGA 5AQEA 3T3PB 4KI7A 1CUAA 4RY2A 3WIUA 1SQ5A 4K6CA 4JIMA 1N0VC 1KXJA 4MQ4A 1L5ZA 4CQMB 4KOAA 5TF4A 1E1QA 1C1XA 1SCUB 3AK4A 3Q7QA 4EEZA 1I7QB 2DLCX 1WSBA 4EATA 4C7VA 1QYWA 2Q4BA 1Q6ZA 1NBMA 4KHPB 1J07A 2HU5A 2D06A 2AOXA 3QMWA 4I9FA 1RAEA 4J0EA 4ZAVA 5KTMA 3AZOA 4MUEA 3WMFA 2FN4A 4M60A 1DE0A 9LDTA 3A14A 4IVNA 3EC2A 1Y34E 1USWA 3QTLA 3GWZA 4TMTA 5JQGA 5EAIA 5JWRA 1PRYA 4JQSA 1PW7A 3D81A 1KU6A 1H9BA 2G5PA 2G9NA 1OH8A 4YP9A 3AEYA 2H4JA 1FUKA 1ACJA 1VMKA 1XN1A 1YKGA 2X1VA 1ECBA 3JW8A 3HFSA 3L0DA 3MELA 4GBED 1L3BA 2QJOA 2HRZA 2WF7A 3FWYA 4LV8B 4LYJA 3WB0A 2C4KA 3NV7A 3OZSA 1QKKA 2NO6A 3G13A 2V54A 3IUPA 1XTTA 4OJMX 3QKRA 2GZDA 4W82A 2X8JB 1FOEB 2O8CA 4XDHA 2FEOA 1ECPA 3U4CA 3V4LA 4PNEA 3ZYCA 3AB7A 3MBOA 4ZU1X 1JJIA 5ECGC 2OD2A 1M2KA 4ZT5A 1P9OA 1A9ZA 3LMKA 4OAPA 3VDRA 3OA0A 3PLNA 4HAIA 4DR1B 2JAWA 2RKWA 3EF0A 3ELWA 4LVNA 2EG5A 1QSGA 4AG5A 2HGZA 2YVLA 4OO3A 4Q3AA 4Z8XA 1U3FA 1FYWA 2IPOA 3JQQA 5ED4A 1R6AA 1I7PA 4OLHA 2IBTA 5ICMA 2AC4A 1GG2A 2GNOA 2GCPA 2O52A 4B7CA 2OTCA 2HMYB 4BY9E 2K4MA 3H3JA 1IONA 1O94A 3KKLA 4MS1B 3U9SA 4W5OA 1YZVA 1NW9B 1YZHA 1UBSB 3AVPA 1J0BA 1JLHA 3HI4A 2Z2XA 3Q6IA 5KI6A 4GHWA 1GL9B 1LK5A 3U7JA 2W6ID 4BJ5A 4N49A 1CY6A 4YJ3F 5JPDA 2FZKA 2OC4A 4G0PA 2OUKA 3AF4A 1H6CA 4HS9A 4OHWA 5SZIA 1XRRA 5BN5B 4E13A 1JHYA 3P9SA 4URHA 4B9AA 3MOSA 3SMVA 1XLUA 2HPHA 1BEEA 1JA0A 1NSYA 1Z5WA 1E94E 2ZIXB 1JSXA 4CM8A 5C1IA 3TIIA 3TVDA 5C46F 1UBEA 3L0CA 4HPWA 1HY3A 2O6HA 4M0CA 5ALWA 5ARDA 1EUZA 3W3AH 4AZVA 5HP4A 3L7DA 4ESEA 2B8NA 3WP1B 3B6MA 2F62A 1IN5A 3ANTA 1KMMA 3CNEA 2I2XB 2FWMX 3GJ5A 4FNAA 4Y2GA 4EYOA 4RTOA 3HKCB 2O2GA 2GCGA 3FLAA 4NJEA 1NIJA 4JHXA 5AICA 1HKUA 1DVRA 1P7CA 2CVPA 2IW3A 3S3TA 2JB9A 2FFJA 5KSZA 1NQUA 4NYMQ 2CFRA 4OMCA 1BHJA 1OYOA 2GD6A 1K1EA 1S8OA 2KBEA 1DOHA 4YCAA 3W7VA 1GPWB 1A95A 2Z2IA 4TMVA 5TE9A 2NTJA 2IV2X 1F7UA 3AVWA 4PTYA 1I3MA 3O94A 2IT1A 3LUAA 2CVOA 2W6JD 3KQWA 3SNHA 5MFZA 3QSYA 4FN5A 3QE9Y 3KJEA 5AXDA 3TTWA 2R1VA 2EOAA 2FPLA 2Y1LA 2YQZA 4NE9A 3I09A 2ODTX 4BVFA 5IFLA 5HK9A 3GMIA 1KMHA 4P0PB 1IY1A 1NI4A 3H87A 1GA6A 3KHTA 4QYTA 1QK3A 4FCCA 4DLLA 1RWWA 2Y2UA 5BV0A 4K7JA 4FYXA 2I6FA 1UOOA 5LIPA 3B9BA 3I8XA 3ZV3A 2ONZA 3H8VA 3V4SA 5TNXA 4QPZA 4OQZA 1PD0A 2R62A 2ZPUA 3FLBA 4W8HA 3SZMA 3UIEA 2PR2A 2C83A 2IYAA 5CA0B 1E20A 4N0QA 3BMXA 1GZHB 4BP8A 2GDJA 4UHEA 4PWZA 3AVOA 4R2KA 5TS2A 2O2ZA 1UJ4A 3OIUA 2SKDA 3LQKA 3ZD6A 1DTWB 2NO5A 4Y30A 4EHJA 1SVIA 5JXWA 3GT0A 2RBGA 2P9FA 5C1PA 2H57A 3RUCA 2BVNA 2JKZA 3BKWA 3KSZO 1NP3A 2GCOB 5IVPA 5K5EA 4HH1A 5TQ0A 4F9TA 5AHWA 4EEKA 1N92A 2JJYA 1YS9A 3QUCA 3Q8KA 1NI5A 1ORRA 1D3AA 1P5FA 2J46A 3HJGA 4LF7B 1N0HA 1XO1A 4QQRA 3ZHOA 1TZJA 2WG1A 4YJHA 3QX3A 2WLSA 3FFTA 4KQ6A 2OG1A 1ZOSA 5K0TA 1KJJA 2C5EA 4C3OB 2IH4A 1JHUA 1GCIA 4G0YA 3GGDA 2C9ZA 4PQEA 3NPMA 3UM9A 5CVUA 1T2UA 1ZFNA 3M6VA 5BW8A 4LSWA 5K20A 5ELXA 4LFCB 5B7QA 2VZ9A 2DWOA 2C58A 3STWA 1Z2PX 2HH9A 1BW9B 1WTAA 3UUWA 1KVSA 1BJRE 3P0FA 3QHQA 3TXXA 2ONKA 2QTLA 2GZ1A 4BYMA 4QVIA 3I53A 1MR3F 1NVTA 1BJTA 1SUFA 3WLNA 1U11A 1GR1A 1MVLA 4EF4A 1ZCAA 2DKOA 3TCKA 4E3ZA 1B16A 3BCHA 3MTQA 2DEUA 3KFVA 1NC3A 2RGAA 1IIBA 3AUXA 2AI2A 2NAFA 3GGGA 3IQHX 3OUTA 2XLBA 4RU1A 4ZRDA 4LSGA 3SFZA 3PA8A 2Q49A 2BEUB 3TR0A 5LOVF 2I1QA 2ZW9A 4WJZA 1W2HA 4WXHA 5EI5A 3TW8A 4CG0A 4WMLA 4HQFA 2X42A 3MD0A 5KPJA 4B71A 5EJ5A 1PV2A 4LXXA 3V8QA 5JEDA 3S70A 1HYQA 1HEYA 1QLHA 1NXQA 2V74B 2I62A 2ZVJA 1G2QA 3CNBA 3OO0A 4QUGA 4TMYA 4D3YA 4DYHA 2O5VA 5LPNA 1WCV1 2AK2A 9LDBA 4JYZA 3TAUA 5H68A 1Z25A 1KQPA 2F64A 2PZLA 4IQGA 4JL5A 4KO8A 4MGIR 5CLGA 2Q99A 1QH0A 4G89A 2Y1XA 4QJ4A 4UTNA 2C5LA 2JIDA 3IGFA 3O8OA 2YDYA 3PVSA 1B0AA 4TMZA 4V1CA 3A70A 2B9EA 2I9PA 2HNKA 1GZ7A 1LI4A 4U7DA 1TO1E 2IYWA 3WNZA 1XG5A 5F21A 4IH9A 1AO0A 3ZKWB 1MW8X 1ZJ4A 1WXEA 1K08A 3EZFA 2O2XA 2G7ZA 1DUSA 4ABYA 1P6XA 3F0TA 4FEYA 5G40A 1UZLA 4GT1A 3VFDA 1J22A 2K2WA 3LUBA 1WMBA 1WHSB 3M5WA 2ZYWX 1NN0A 3KL4A 3NDPA 4BFWA 5CA1F 3A11A 2QW1A 3O73A 4ZYYA 5GIPE 4I8XA 2GEJA 1KDOA 5L8VA 3VU3A 4IQFA 4KXQA 1HBJA 2N47A 3L8MA 2OZEA 1YCDA 4O2BA 2C0CA 4PLHA 4TS9A 2R8XA 1P4HA 4LE2A 3SF8B 4QTZA 4EJ6A 3BCRA 4CTMA 2HA3A 4IMJB 2AFRA 1V6CA 2G6BA 1VG9B 2R5WA 2Y0EA 1ADBA 1OXKB 3OFNA 2DPGA 1PFUA 2XE4A 1EBUA 3RBZA 3RYIA 4B32A 1CRPA 3N2GB 4OQXA 4QOHA 5GJBA 1TD9A 2QZPA 5AUQA 4NC9A 5AVUA 2UZ4A 1GPNA 4RY0A 1DSSG 2JFBA 4AMVA 1AVTA 2DUUA 2ZRPA 4YJHB 3FTEA 1VL6A 2FK8A 4P0TA 3F7OA 3WWZA 4EHHA 4KQWA 5KOHA 5ALDA 4UQLA 5EA2A 4RXMA 3AF5A 1X8XA 3NIFB 4WBXC 5JAPA 3N6XA 4OJTA 1ZIDA 2OKCA 4DM3A 6LDHA 5J43A 3LCVB 1Q5PA 3MT7A 2ZSAA 3QEMA 3Q7TA 3ROMA 3X1KA 1M8GA 5JZVA 3C14C 4JV5B 4WESA 4MMXB 1E89A 3A9CA 1Z5PA 2D54A 3HQ4O 5K2MA 3TNDA 5DM60 4YRRA 1RP7A 5TSDA 1QLJA 2CJYA 2P62A 3EJWA 3FPGA 4OH7A 3D8TA 1PS0A 4I4CA 3JR7A 2QPOA 1UJCA 4INJA 2ZUFA 3ETHA 1Q74A 3ICQB 4IKEA 4D4LA 3VO9A 2JEOA 5B58C 3WLKX 3A6DA 3OTWA 4DKXA 1EJ0A 4UVEA 1QVRA 2ZAMA 4RTPA 1KL7A 2P1ZA 1H23A 1KYIA 2FEMA 3JCZA 1H5NA 4BO0A 3D4IA 3TE7A 3PPWA 3F6EX 3TBHA 1RQ2A 3D6NB 4G65A 3VVBA 2B6HA 5DZSA 4REMA 5C2JB 3E8MA 3BHIA 4CGZA 3DDZX 4C7BA 1HYBA 1IHYA 1ZD8A 2Q5FA 3N7UA 4EPVA 1NQXA 5CDGA 1R6TA 1E0DA 4UU1A 1NXSA 2YJZA 3I01A 3EGIA 4JUAA 4G0QA 4N82A 4UHCA 3AI3A 4JX8A 3P2KA 4WQMA 4CQMA 5TMDA 4GG1A 2QDKA 3E8SA 1U0OC 2RGUA 1EFVA 3E1KA 3E2MA 4UJ5A 1W76A 1MFPA 3GRCA 3PIIA 3PJRA 1SQGA 1T9BA 4MIEA 1LDYA 4LRTB 4QLOA 4IUBS 4OV6B 2VJAA 1SHLA 4ZGBA 4UEWA 3A4NA 3LA8A 1JVSA 2XVXA 4M88A 1P1IA 3MT0A 3DHEA 3BXFA 1K8RA 4BN5A 4HT3B 4PHGA 3QPVA 2PV7A 2ENUA 4IDGA 1N2XA 3MRSA 1U3DA 2P9CA 3H5LA 4ETMA 4ETNA 4GOND 1US8A 4RC9A 5IAOA 5JTTA 2JFQA 3PC8C 3DFUA 2JIPA 3M8KA 3F2IA 3N7TA 4KQFA 3W3AD 2HTFA 5FL7A 3CJQA 5JAZA 4FDLA 2UZAA 5BRNA 1J4AA 2R1ZA 4ZRMA 1E0KA 1XX6A 3NANA 4O0MA 3TSCA 5K99A 3WLIA 4Y9TA 4M76B 4N6OA 5HRAA 4ZO4A 4LMPA 1TK9A 5CVDA 1VG0B 3VGJA 3JQAB 2JNWA 2CDNA 2EWWA 4CLHA 5E1BA 1HDEA 3PQEA 2JGDB 4AD8A 3MWDB 2HQRA 5LNK6 2JVKA 4FSXA 3NM5A 5C4GB 5LJLA 1UMCA 2YIVX 3EVTA 5TB5A 3UXEA 1SUWA 2TMKA 3ND9A 3VHQA 4AY6A 2W90A 3WYNA 1GLGA 2H1VA 4K6GA 4A6PA 1MG0A 4IMPA 5K0SA 5ESDA 1M34E 2B8EA 4YT4A 2HX1A 1S1CA 1T8UA 1TJ4A 2BFPA 3MC1A 5HFNA 3U3JA 4G5QA 1NUUA 5DBEX 1QKJA 1ZC4A 4BB9A 5GVSA 4HKTA 1KO8A 1M2EA 5BQ3A 2Q1TA 4KGVA 1Y1KE 2DP4E 3HCBA 1MF7A 2I66A 1KSJA 3BIXA 5DGCA 1Y3AA 5DM2A 1X1TA 4Z0HO 4CMJA 1EDEA 4M2LA 1J8QA 1R0XA 3RSSA 2JLRA 2V5UA 1XZGA 4NOJA 4OHFA 1ZRSA 1ID1A 3HVJA 4QGFA 4DE5A 3TO5A 2FK7A 5AJTA 1ULSA 4JYBA 1XTSA 3FUXA 5K3CA 3GVPA 2OO7A 2BGJA 3K94A 4IS2A 1P9RA 3OA2A 1QR6A 1U8CB 3AIOA 3C3MA 4JZYA 3IE0A 2VJMA 3NBKA 3I58A 5J5VA 4E2ZA 4XGQA 3RRFA 3KK0A 5JCXA 1SKUA 5A4KA 4IX9A 4PAOA 1BEZA 3SZGA 1PZXA 3ZXIA 1TJYA 4PFQA 3DLCA 4JROA 4LC0A 2PMEA 3VNBA 3IMEA 2FPPA 5FBKA 4AJLA 2RHRA 2CCKA 3I1YA 3BCSA 4NG4A 3RIXA 3RSGA 3V00A 1V11A 1QQ7A 1HDXA 2QRGA 4YRAA 2WB4A 3HXQA 2WYUA 2DBRA 3C1OA 4INPA 4EDHA 4KAJA 1N6OA 2OCDA 4YJKA 4HWOA 4Z7JA 3MBIA 4IIEA 3EFHA 4LYYA 2R3SA 4PAMA 4V0OA 5DLEA 3PC7A 5GP1A 3R7NA 3W4JA 4B2YA 3FN4A 4WKPA 1G3UA 1MB2A 2YJ4A 5BRJA 2P3OA 4M7WA 3B6JA 3P2IA 2YZ2A 3MCWA 5CDFA 1UWLA 2D2FA 3E7PA 3GIWA 5DT9A 2FMFA 4CKEA 3ILYA 4QWWA 1VQ1A 4ZT6A 3UQZA 3CX7A 4DADA 2XKKA 3PR1A 4EGCB 2G71A 3AP3A 4F2WA 3BJIC 2DULA 1GKLA 4KPYA 4IZIA 1Y82A 2VUTA 1VCMA 2E4UA 1JN0A 2R6DA 4OHUA 3PXCX 2Q2VA 5JO9A 3N5KA 3Q3JB 3RK4A 2GWRA 4QTTB 4RD6A 3Q3VA 4FUTA 4XDYA 1E99A 1X0XA 4PLZA 3CE6A 3Q3EA 1XZQA 2IJGX 4O4HA 4ZVRA 3SYTA 4RORA 2HT1A 2ZQYA 2GI4A 4UBOA 3W6UA 1YR7A 1LC0A 3UJ8A 1Z3CA 4C08A 3PWKA 4EUHA 1DJOA 3R3UA 5IWCA 3I0MA 3HEAA 5IVHA 2PQ0A 2XVMA 4M9ZA 3OM1A 2ERYA 4JVOA 4PW0A 4TL7A 4UHBA 1RI1A 1RJ9B 5KTRA 2XODA 4LXUA 5JBQA 3NAZA 1HDZA 1KFJB 3R6DA 1RYBA 4OJKA 3PEUA 2SBTA 2C2HA 3K0AB 2BR5A 4MUXA 3VMFA 4A5OA 2B8WA 1Q0HA 5BWLA 4CXMA 1I10A 4FCTA 3E9DA 4N5IX 4KI0A 2V3VA 4WNAA 4ZV7A 4B3JA 4OA8A 5EKDA 1HQDA 3F6PA 3PWZA 5ICEA 3U4QA 4HRVA 2E3JA 3P9PA 4PPYA 3TJRA 3L4KA 3NYRA 1MH9A 4X44A 2ONJA 1GTG1 2QE6A 4CFZA 5CB4B 3JQ9C 1J1IA 1NPDA 1ZAYA 2ORIA 5LBUA 2QI9F 1X39A 2O2YA 2PAFA 5EWLA 2FMKA 1OY1A 4AK9A 4CV3A 4IDHA 3HV0A 2ACVA 2J87A 2MYNA 4D4KA 2RB5A 4ZGWA 3CVVA 4CNBA 1UBGA 3PQDA 1QF6A 2XWQA 4REQB 1YL7A 1KARA 1OVMA 4NZNA 1Y98A 1DAKA 4IDPA 1BXZA 4KWCA 5JOQA 5JZ9A 4KDCA 3EXHB 1OIXA 4OXXA 1MZPA 1YDWA 2QOEA 4PSDA 4YYEA 1XRLA 4A10A 5U9CA 1JNYA 4ZAYA 2PX5A 3R5SA 1OH5A 3N6RA 3F1KA 4YCDA 3ZCPA 2GZRA 3J80A 1ZUIA 3BILA 1ISSA 4ZQFA 5GV7A 2IXDA 4JLMA 2Q0SA 3IKLA 1DTSA 4R9UC 5U4QA 3H0CA 4XD7D 3ZHYA 2CLSA 4MQEB 1Z18A 3JVIA 1SNYA 2QN2A 1I4WA 3BUSA 3CSUA 3SHOA 3WHIA 5ALTA 2H1CA 4FGWA 5JD5A 3J7AC 3PNYA 1JE0A 1HGXA 4WCFB 3QYAA 4K03A 2VNSA 3USES 1KJWA 1L1RA 1HTBA 3NAMA 3IUBA 1T8PA 5B1SA 1Z5OA 1QHFA 3F46A 3DE1X 3QX7A 4FYMA 4NONA 1P33A 2FA9A 1PSWA 1PG2A 2AX4A 2PIDA 3SYNA 3L84A 2DRIA 3UO8B 4EUFA 3ZDDA 5FOQA 4Q1VA 4C01A 4I66A 3Q5EA 2R65A 1DEXA 3KS9A 4YJ3B 1NLMA 4OBEA 2HIAA 1FFBA 1DAEA 2IOQA 5AVZA 3NYIA 4KQHA 2CHEA 4WLOA 2LD4A 4ESVA 1QE0A 4BLUA 1I1NA 5K3EA 3HU2A 4OH1A 5E0OA 1AJEA 2Y1KA 1X6VA 2B1JA 5E6UB 5B1HA 2D2VA 2TRSB 1CF2O 1LA2A 1WU7A 3KR2A 3QP9A 1WKBA 4FDTA 5IDXA 3JAWB 1XFAA 3K9FC 3AKYA 3TF5A 5A3SA 4NF2A 2HN9A 4MICA 3ONFA 4NHEA 3T0GA 4YJFB 3WADA 1TCCA 2W4IA 2DUMA 5SY6A 5DEOA 5CX4A 2HV8A 2OBMA 2VJPA 1MABB 2IQIA 4ZDWA 4OHVA 3CIOA 4KAFA 4DNFA 5ISMA 1OREA 4MGEA 3GRPA 1N8TA 5EKXA 4XM2A 5HIAA 4JB8A 1QGDA 4YXWD 1P39A 3L01A 2OPBA 1QJ4A 5GZ6A 3S29A 1Z0ZA 1WDTA 4X3PA 4BMDA 4B9EA 1WNFA 3V5NA 4PG8A 1WEHA 1K4MA 1K7YA 3EXFB 4GNRA 4BV8A 1MAUA 3Q72A 5EUMA 5FF9A 4ZK2A 2AS0A 6Q21A 3KZVA 1KSHA 1CUYA 1FZQA 2ODEA 4M0UA 4YDSA 2B8TA 4PINA 1E7MA 3OT1A 4IH4A 2OWDA 2JI9A 3A1DA 1M1YA 1NW6A 5DNAA 4WKBA 3RVNA 4D5EA 2JFNA 1SAYA 3RM3A 2QLNA 4E70A 4L0DA 4Q4JA 1VKHA 2IDJA 1M10A 4JGGA 4F2HA 5EHZA 4QDJA 3BGVA 1CY8A 2EV9A 3TLKA 3A6JA 2OYCA 4LHEA 1U5BB 4JT2A 4LRSB 4NABA 2GTPA 3SHVA 2FUG1 1DTWA 3ZS8A 1DX9A 5CR9A 4NOLA 5AUOB 4DLXA 2Y6UA 3I2FA 3NM6B 1D1QA 1RZUA 1MC5A 3W9BA 4EO9A 5BOSB 3V6MA 4KVAA 4JOQA 3FCUB 2WEKA 4ZD6A 5SY9A 3ZJUA 2PQ6A 3BL8A 1XJCA 1HK7A 3N0WA 4IQ0A 4WE3A 4JSTA 4HNUA 1V43A 1Z5ZA 2XTZA 4XD2A 1E3JA 1JFRA 3P4UA 1EAMA 1I9GA 1VDZA 2GB4A 2B8JA 3BK2A 3DH0A 3H04A 3LPMA 2D5IA 2ZWAA 1Y5IA 2XCSB 1Z0JA 1RXWA 1GPKA 2WKWA 1NM5C 3OOHA 4PEVA 1SCBA 3VR3A 3MILA 1SU8A 3I45A 3OO1A 3H2JA 3ESDA 2DZDA 4GWKA 3VR6A 5FBWB 1CBUA 3O8LA 3GDFA 2O8FB 2QJRA 2IXFA 1Y8QA 3A4VA 3MG9A 2H1LA 4OFXA 5DSXA 5TQVA 2ECKA 4YCNA 4NE2A 1QLWA 5JECA 2P6OA 4F4HA 2XUKA 4B6GA 1ANKA 1Z6TA 1G19A 1RAIA 3A05A 2XE6A 5KVVA 2P2DA 3LPAA 4HUQA 1OC4A 4JJGA 3MRTA 4AF6A 3AR8A 5IAKA 3CVOA 1F0PA 2WU1A 1RC8A 3KAQA 1AHPA 1BDHA 3OEEA 2QRQA 1L7DA 1CG6A 2W5UA 1QZZA 4I46A 4LOHA 4MQFA 1T0UA 1NQAO 1OPRA 2GLUA 3C6MA 3ED5A 5IDQA 2OOKA 5JJLA 1CS0A 1U1EA 3GEPA 1NUQA 2IUYA 4G9EA 2WJYA 3F5FA 3RJ5A 4HXEB 1LUAA 1KO4A 1YI8A 1ZDMA 4TKZA 2A5JA 3LY9A 4R1SA 5DDIP 1E3DA 4K9DA 2HWUA 2J5BA 1K0FA 1T3HA 1Z7WA 2J4DA 3AP2A 3CF4A 1OFIA 2JGAA 1SK9A 1KYQA 2PANA 3PITA 2QJTA 1KWGA 3PQ3A 4LGMA 4AMUA 4QZVA 3MJSA 3NHJA 3ZCRA 3UMGA 4IDOA 4NCNA 2H08A 1VCHA 4RJTA 2GYUA 4G5OA 3AZPA 4CFYA 2B4KA 2QQ0A 1J25A 4NP6A 2ZBUA 2JARA 2YXDA 5B7NA 4OOFA 4X8MA 1G7CA 1A9XA 1CPYA 5CM2Z 1G5FA 4IICA 1D2NA 1JEDA 1O4VA 1CLEA 1V9LA 3ET4A 2AUTA 4HUJA 4HEJA 4L08A 4GLBA 3A4YA 1CU1A 1Q2XA 4DIKA 1V8PA 4YREA 2BEJA 3CSSA 4QU8A 3ZWQA 1FUIA 5LD2B 4LDJA 2KLHA 4XIYA 1GFZA 1A2KC 4YMTA 821PA 5FUMA 1N5OX 4RZQA 5BN4A 2WUDA 5LQNA 1JR3D 3QWBA 4GI3A 3T7CA 1O8CA 3GDGA 1FDUA 2JFYA 4ZT2A 1NW3A 5FLYA 5J59A 3ZQUA 1J2EA 1VMDA 3S7ZA 4YT8A 1RT9A 2JLXA 4TLBA 3OKAA 4JBNA 5TRTA 3IB3A 1TT5B 4TQAA 2HDHA 3D59A 3VTKA 3C8UA 3PVZA 3E27A 2FHSA 1CQWA 1CUSA 3EUWA 1Q16A 4V3BA 5BN1A 3TB4A 4YUYA 2X2OA 1G41A 3ETGA 4PX3A 3ZGLA 5HFJA 4MYDA 1Z6GA 1Y1SA 5G1NA 3ZCXA 3ZQ4A 4UCFA 3O38A 2QM0A 3ENVA 4P54A 4S05A 2QAIA 4IQ8A 1ATZA 3V1YA 5IT9A 1WOYA 2FFRA 3M2TA 2TECE 3U7FB 4F2DA 1T1GA 2WHQA 4AO7A 2ZE5A 2VZEA 3DAGA 5AVSA 4IO0A 3UAVA 1XWFA 1ZJZA 4LCBA 4WGFA 1I2ZA 2M6LA 3U4DA 3LWDA 4A9AA 4EG3A 1EK2A 1SZCA 4QOJA 3W3ZB 3KZKA 1UODA 4ND1A 2D1TA 4RPLA 5EHQA 1NWHA 2BUCA 2UYCA 1FYDA 1KVUA 1U8YA 2WMDA 4M8NE 1XGKA 2O4UX 3PC8A 1OXXK 3TB6A 1KAOA 3ILXA 4DLUA 3TDNA 2WE7A 4H2DA 1E0SA 4F6RB 4Z2YA 4GM0A 4EZIA 3DHYA 1H2AS 3BJZA 3TZCA 1E0AA 1BMDA 4HN4B 1SC4A 2PK3A 2R86A 1AF4A 1KIMA 5JSZA 4AB1A 4RL4A 1BKDR 3L41A 4BX8A 3M1IA 1TKRA 4QL3A 3JSXA 2WINI 5EE1A 1IJBA 3ILVA 2D7DA 1K3TA 2ODQA 4BGEA 4LF5B 1OA1A 4GBMA 2R97A 4C3UA 1E2FA 1W6RA 2J6BA 5HM8A 2POCA 3C6KA 1DAMA 2ID7A 3KUUA 3OQPA 4MGHA 2X0FA 3LYAA 1JQLB 3ZCUA 1MNQA 1NVEA 1WPGA 4IV8A 1JIKA 4ZEXA 1EFCA 1NJ2A 2CLCX 2G0NA 3NH9A 2HPAA 3VYRB 2C7PA 1FQWA 2EQ5A 1YE8A 3H7AA 4WCVA 2FWJA 1W47A 3HHPA 2COKA 4ZFNA 4KPEC 5DI9A 3T5TA 2P3LA 5H02A 1F3LA 1XA4A 5M5BA 3PJEA 1EJ6A 2GN9A 3QPAA 1SELA 3RVKA 1QPZA 3ZZNA 3IURA 3JZIA 5LDHA 1N6HA 5K09A 5DULA 1YRAA 5J2UA 5ITZA 2VP6A 1ZH2A 2CVHA 4QUDA 5A4MS 2I71A 4FZ3A 2CXUA 4PNPA 2YVKA 1YR3A 1ADCA 4M1WA 3GJ0A 3T5GA 3ZWBA 1JQBA 1TM3E 1VE3A 3CU5A 4HYQA 4YUXA 5CXQA 2HLHA 3OIFA 4MPPA 3MF4A 4CMBA 4RPIA 2BF4A 1C3JA 2Y0BA 4RACA 1DAGA 3VO2A 3LHKA 4HP8A 1XHLA 4KK4A 3Q9LA 3OU7A 5T3YA 5L9AA 3FWHA 4LDRA 4R5MA 3R7LA 4F7DA 2F7SA 3SLKA 4KVFA 2J0SA 1X9IA 3AU8A 3HP1A 3IXQA 2CC2A 1M74A 1OR8A 4Q02A 1X1DA 4UDXX 3B38A 1ST3A 2TSYB 4WY8A 4XVCA 1HE3A 2YICA 3QU7A 2FSUA 3OIDA 4IOJA 1ZI6A 4NAUA 1ENPA 1WMDA 1QCZA 2WU8A 2GH1A 4KFUA 4JWKA 5J5AA 1ZL2A 4F71A 1TB4A 3DE2X 3EY4A 2Z2YA 3RKUA 5CD9A 5LQKA 1KQFA 3ZBUA 1WQ4A 1G9XA 4Q37A 1O95C 5TT1A 1PWHA 3C5EA 1BXGB 1LKZA 5IEBA 4UOEA 3I9OA 5BSEA 4BO8A 5E4FA 2G28A 1S4MA 2RKOA 3HA3A 5I7VA 1T8YA 5CLFA 4D4IA 5BW4A 2HV9A 1S3GA 4BMXA 3R0XA 1KH3A 2ZDHA 3L0YA 3PQFA 3QRWA 2YQ4A 4J9UE 5I7OA 5CLJA 1AM4D 4L5CA 5GWXA 3M5CA 1OZGA 1SN7A 2V0CA 3QHAA 3V97A 4Z6KA 4A73A 4D3DA 3QOXA 3RE1A 3VHXA 2XBMA 2KJQA 2CK3A 2FVYA 4RIGA 2GGSA 1ZNYA 2PH3A 4Z4FA 3UCXA 3NFYA 4NH0A 1RLIA 3ZWKA 3TLEA 4B4VA 1N36B 3GA0A 2CLFB 1PEKE 1P3DA 3IJEB 4MWTA 4EF6A 2SECE 2GPYA 3MUFA 5EUQB 5C18A 3DEJA 3R7SA 3T0FA 2HREA 3E15A 1ZGGA 5HUJA 4DCSA 3KVVA 5CAEA 1DO0A 1QRUA 3TINA 5J1TB 5C53B 1U0BB 3JYLA 1ZW6A 5C1BA 3WJ7A 4IM7A 1KDYA 3LBNA 1S3SA 3AEQB 4J4HA 2OCGA 5K01A 2EYUA 1TA9A 3TG8A 3UPUA 3C6QA 2KX7A 5LDDC 2G0AA 2YFKA 3PYXA 5T4EA 4OTZA 3KUDA 3UTCA 2BL4A 4PN3A 4BO6A 2C8JA 3HYTA 1Z2EA 3ECCA 3DLPX 4P80A 2HEGA 3K8QA 4ZYVA 3CLRC 1QQ6A 5KWSA 3AHFA 2BFNA 3FR8A 1IJFA 3D1LA 2W6OA 3E5RA 3Q9UA 1SVMA 2WJJA 2IXBA 3EVGA 5FBQB 5IHPA 2D6FA 2QE7D 2WAYA 3NBMA 3CM0A 4ICIA 3SFTA 3HBFA 1JR6A 4ECEA 2YASA 4I1SA 4YRPA 5CA0A 3RIYA 2BI8A 1Z6YA 3UMYA 3JWPA 3VM6A 3ER6A 5F5LA 2IYOA 4ZAGA 2D8MA 3FDJA 2ORYA 3RAEC 2YTZA 1PYGA 4HGZA 1USGA 2BKLA 3HHEA 4IMIB 1W87A 2EXXA 3JD2A 4B7UA 5A4AA 3LAWA 3UGTA 3OQVA 2FZWA 4K26A 2HHHB 2ECOA 1XEWX 4JLPA 3UEOA 4H1HA 2ILVA 3MAAC 5FJIA 3G82C 2GFIA 2DWPA 3LKDA 3M6UA 4D0RA 4XQ0A 4LJLA 3JATA 4EI7A 1MUUA 4WCFC 1P0MA 1ZLXA 4J75A 4XOUA 5TC4A 1EDBA 4CV1A 3EZXA 4LTDA 1O03A 1RXVA 2Y1CA 2JVIA 2R2GA 3V46A 4JQYA 3WLHA 2C77A 3D2BA 4YALA 2VXCA 4PX5A 2X5XA 3TPZA 3WFZA 1SG9A 2PWPA 5DXFA 1KF0A 2GM3A 3NWPA 1OLXA 3FTPA 1E1YA 3GBVA 4HDQB 3V1TC 5AHRA 1F0KA 4HLNA 1Z4LA 3WMWA 1Z16A 3EVAA 3IXLA 4WNCA 4M36A 5LCXA 2E82A 5AVYA 2FE1A 2IHYA 1J33A 3LWBA 3BWEA 1HT2E 3RS7A 1R0YA 1HLPA 5K3SA 4NXNB 2OC9A 3IOEA 4LK2A 4MAFA 1QH1B 4IXWA 3T4XA 1N57A 2J08A 3VISA 2GAAA 3HVRA 1GRNA 4PPNA 1GV1A 4LK3A 3L7CA 4PAWA 1I51A 3DEHA 2JLCA 4LV6A 1O1YA 2ZIXA 4MRAA 4WXEA 4ZI7B 3B1ZA 1HDGO 4QOSA 1ECJA 4DLVA 3TOVA 2PQMA 3AR7A 3R75A 3HN7A 4KE6A 5FNVA 4RD0A 4ZOLF 5FV4A 1UKYA 5L4NA 1UXJA 2B94A 2YOGA 1UAYA 2AMLA 2VRCA 1MAHA 4G0XA 4KXVA 3KBOA 5IVIA 4C4PA 1IXSB 4GO1A 2IIBA 2VF4X 1JHDA 1ENZA 3G5UA 1YUNA 4F60A 4BFXA 4BC0A 3EFOB 2NV0A 3P0JA 3VYTB 1KY4A 1YMQA 1J49A 1DADA 2O2CA 4NNOA 2V7UA 3UAXA 1QP7A 1UBOS 5IW8A 2CMDA 3ENWA 5CIYA 3DXFA 3U19A 3T7IA 5DSTA 3VU1A 1V3VA 2WDZA 4CDNA 4BATA 2XGMA 2J3LA 3OQJA 3R23A 5FLKA 2WKPA 1JHRA 2ZROA 2WHXA 1RAHA 2LP4Y 4MLZA 1QFYA 3WK6A 4Z4HA 5L53A 1P0CA 4TKMA 3WYBA 3UOWA 4PZEA 4NV0A 5EXEA 4YIHA 2OILA 2D7JA 2XXAA 3MINB 4ZO6A 3I04A 4D81A 4DDUA 1F8UA 3HYRA 1MB9A 1T8TA 2CGEA 2AR9A 2ZI4A 2ODWA 1NV8A 2Z2ZA 1E7WA 1EVYA 3MEQA 1TK2A 2FZEA 2ZIWB 4YUWA 1U7PA 2PQ2A 2DMRA 4JYPA 3P9CA 3CX6A 3WYEA 5IC4A 1AXGA 1G3RA 2D1QA 3G8CA 4KYVA 5F64A 5IUJC 1C3LA 4R8VA 4TYQA 2JANA 3SHTA 4L3VA 1IN6A 1BCRA 4NKRA 5C8YF 2B36A 2VJQA 3ZNOA 4JODA 5JNUA 1VM6A 3RAJA 4RMIA 3O0TA 3B1JA 1TFUA 1RMTA 1NF9A 4IGAA 1P73A 1L4EA 2P41A 2V6MA 4QO8A 3A9VA 2VQ6A 3KC2A 2FN7A 1YZUA 1JAHA 1PT6A 1ZHFA 3RKSA 2N46A 1JEQB 3ES9A 1I5RA 3SLGA 1XDDA 1XSEA 1W85A 1O94C 3TD9A 3WS7A 4F1WA 3SKYA 2JFFA 4H7EA 4HWPA 3RT9A 1EXMA 1G6OA 4BC1A 3THYB 3MPUA 3LS2A 2FPUA 5ERGB 3IEVA 1GNSA 1T8SA 3G2KA 1W8IA 5ALSA 1VA4A 1HX7A 1PFYA 1T6XA 4RTJA 1G8GA 2B92A 2GHQA 1JR3E 1E1RA 4MKIA 4YR7A 1Q20A 3WAGA 2CEKA 2FB9A 2C3YA 3ER8A 3BL5A 4EG6A 4Q3EA 1OA0A 4D5GA 4KTTE 1SUEA 5LU8A 3TW4A 3R7DA 4LXYA 1TM7E 3EIWA 4HNRA 3DT8A 3AOEC 2DPLA 3E22A 3ZV6A 1JPJA 3QKTA 2ANBA 1V96A 1JDUA 3O90A 2HRRA 3HDYA 2SNIE 3DMRA 3GPIA 5L3SA 1CS0B 5HDQA 1Q95A 4QQKA 5K4GA 3GCDA 5ADHA 3SVTA 4XM0A 1CKEA 1F60A 1GGNA 2FUG6 1YC5A 1FS6A 5AKJA 5FLEX 3ZX5A 3GUYA 1Z2DA 1C3XA 3KKKA 3RD5A 1KK1A 1CUIA 1IEWA 1ZOPA 2GK7A 2HO5A 4JENA 1ZAKA 3T3DA 3KXPA 3CEMA 3F73A 2ZDGA 2O4CA 3HXLA 2BCJQ 4TWJA 1ZR4A 4GOMD 1OV4A 1QOQB 4ETWA 1G8YA 1KPHA 3F8TA 1BFDA 1JKJA 3W5CA 2WSSD 4HF7A 4L5AA 2XB9A 4P3NA 2D1FA 4RCYA 4XE5A 5EQJB 6ABPA 4CCWA 1Z6XA 1AA6A 1HQKA 3ORHA 5E2BA 3K35A 4TL8A 3L0BA 3PHGA 1TK3A 3RIMA 3C6XA 3PGXA 1NUTA 2HSZA 2VWPA 1TT7A 3UMCA 4ENSA 1UXGA 1JLSA 1P5ZB 2J67A 3F4LA 3GDWA 1SUAA 5COAA 1LNZA 2WBLC 4ZQEA 1GQRA 1GSHA 2NSYA 3GAMA 3RVDA 3AVQA 2WVHA 4DGSA 1HOXA 3NIBA 2NXWA 4E08A 4PC7A 1D0VA 1OLUA 2R6JA 2XUZA 2O8VA 3AKDA 1DAFA 3PFGA 5DN6A 1P18A 1GTVA 3MGKA 2RI0A 4BNNA 4ZAWA 4HX2A 1CP2A 3BRSA 3PKIA 1W36D 1YQQA 2D13A 2AOTA 2PWBA 5KU7A 3KE9A 1DI0A 1ESMA 1E2NA 3FYUC 1U8ZA 5D1NA 1BE0A 3Q8LA 4Q03A 3MJVA 5A06A 1RBZA 3EEQA 2QNRA 4ARVA 3KPJA 5ARCA 3M89A 1E59A 1U0EA 3AL2A 3IULA 2EFEB 3GPCA 5LWHA 2H65A 4AMBA 3E4DA 1D5WA 3N8DA 4AECA 4B34A 2BRUA 3LIIA 2DHEA 2NYVA 3N2LA 3WE7A 4BO5A 3EIUA 1OXUA 4AX8A 4OP2A 4FW8A 1AE1A 3NT4A 5C9ZA 2RH5A 1QE3A 3HPQA 4AY3A 2DC1A 1F2VA 3DNFA 3HCDA 4HFRA 4WUTA 5K8LA 1IL0A 1I01A 4EBBA 2WIAA 2CL7X 3NC0C 3OSZA 3PIDA 5KNDD 3LUDA 4O4IB 3QH4A 3D8RA 1OKKA 1P1FA 2VHVA 3A4MA 3P9YA 4B3FX 4EL0A 1YA4A 1G21B 2AV6A 4G24A 3R41A 5T4HA 4A8TA 4BFLA 2AZMA 2WMNB 1G3MA 1Y6QA 2WSIA 5H8WA 4PYJA 1C30A 4TXNA 5FA5A 3S6JA 3AF6A 2AX3A 1SRQA 3C3PA 3PDUA 1NHGA 2JZNA 1EX1A 2RHBA 3PC6A 1XE3A 4GKBA 3HLYA 4EABA 4X91A 3RSCA 4JLDA 3DFIA 1N34B 4O2AB 1CZOA 1M54A 3DV9A 3N8GA 4K28A 2VDRB 4EELA 4IZHA 2Q7DA 4IFIA 3TLYA 2WYOA 1U1DA 4W1RA 5LZ4A 4Y6RA 1KAQA 3W8DA 1LLUA 4KFTA 2JI8A 1NT4A 1VXRA 3STYA 1TZ2A 3VYSB 2FMHA 5F7JA 5HOQA 3WYGA 2COUA 2FWPA 5JSFA 2ISCA 3KYCA 1AZSC 3QXSA 4AI6A 3EXEB 5JNRA 3D8HA 1U7OA 3ZY2A 1WXFA 1UXHA 2YN4A 1N2ZA 4IP0A 3K9LA 4M9UA 2C4MA 5F9FA 2BRUC 1RWPA 2K6GA 4H17A 4J7AA 3OT1B 3IP7A 4M0PA 3FFWA 1GAXA 1CRQA 2ZWVA 3DZGA 2W2OA 2NUPB 3FYDA 1HL7A 2OFOA 1OAOC 3K15A 3LA6A 3D3JA 4U3JB 5FFNA 1S2DA 4QREA 1ML3A 4TV9B 1UZNA 3HCOA 2QUKA 3MTIA 4FD3A 4HMQA 1P7VA 3N53A 1CFJA 1MB3A 2FW6A 4UM5A 4EP1A 5SZKB 4LWQA 3CR8A 2BEVB 3LT5A 2GPBA 1OGYA 1ABFA 4YQEA 4L75A 4LRQA 1JWAB 1ZU4A 1LLCA 1YJQA 1U4SA 4KJXA 3LF2A 3T7RA 4F38A 1RRCA 1KJYA 1IMJA 1HYHA 3I76A 3DWIA 2EIHA 4RA9B 4RH3A 4BKOA 4P82A 4C0LA 3R0JA 5JCJD 1DBIA 5HPYB 1XTKA 5PGMA 1RM3A 1RWOA 5HJEA 4KN8A 5AIBA 3PEWA 2E9SA 3AJEA 2WSBA 3VX4A 4EG8A 1CIPA 1E6EA 1ZITA 1XXHE 4GMHA 4EAQA 3Q2IA 1V35A 4I5GA 5FTMA 3AUYA 1O0SA 4MYHA 3WOHA 4ZDKA 5C51B 4MUFA 4QTXA 2YJTD 2GRJA 1OAKA 5F33A 4PYMA 4O3FA 1F2TA 5KKCA 2HOQA 2VRBA 1X3LA 3B9RA 5MGNA 3I01M 1SB8A 4ZTZB 1LSUA 2JFPA 2IS1A 4Y2TA 5BXYA 3G8BA 4AJ4A 5BQXA 2H3EA 2JAPA 3IVXA 2VPXA 5UKDA 3W2IA 1EUYA 4OG2A 2DSTA 5JNVA 3SYLA 1Q7GA 1V8OA 1J5XA 1FP1D 4LWOA 3A26A 5EIBD 2QU8A 5EP3A 4DILA 1H6AA 3HU5A 4E2YA 4LF4B 1WUIS 3KWMA 5ALJA 2AE1A 4HDAA 2IIVA 3Q4GA 3NETA 4HYYA 1IBSA 3LGSA 4XUDA 3STTA 2FX3A 3SR0A 3BD7A 2Y0PA 4RHXA 2VHJA 2C7RA 2AJLI 2IYLD 3FSEA 1X7YA 4CKBB 3CHYA 1FJXA 2QTNA 4FBGA 1UPFA 1M5UA 3B5EA 1XTQA 1J2TA 1ND6A 2C2BA 5CB4F 1GZ4A 3JYHA 2ZIVB 1M7BA 4HGNA 2C2YA 3B6ZA 4PQGA 4QYIB 1TPYA 1SU6A 3GXOA 3EZ6A 4L3OA 3RNOA 5LLDA 2Y77A 3FDXA 4NBKA 2I3ZA 2QP9X 1YWGO 3COSA 1IG0A 2ZVDA 3NR2A 4QUEA 1E2JA 2IU0A 4OI1A 3ZEAA 2ZBDA 3WQSB 4I50A 3HUTA 1L5KA 2Q1SA 3NEPX 2AOVA 2WIGA 3NC4A 4FHFA 3IP5A 3SZUA 4GVPA 3T4UA 4ES6A 5FNVF 4N5MA 3V1UA 4WSOA 1T5TA 2XTAA 4L6AA 1T2EA 3I6YA 2G7MC 1BO6A 1KE2A 4ZEOA 5KNDA 4DA0A 3PICA 1QFXA 2PS0A 3SFVA 1QV7A 3MJCA 4HXGA 1PDOA 2Z2KA 1XPJA 1ISIA 3JD4A 1WXDA 2XR1A 4J91A 4PRZA 4ZI5A 2O8DA