5HOQA

Apo structure of cals11, tdp-rhamnose 3'-o-methyltransferase, an enzyme in calicheamicin biosynthesis
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
251
structure length
234
Chain Sequence
QDLRAFVHDSPEETETTQRLTKLLTNSPIPTEELVNNLPLFLRRHQMTDLLSMDALYRQVLDVPGVIMEFGVRFGRHLGTFAALRGVYEPYNPLRRIVGFDTFTGRFAVPGGYPAYLKEVLDAHECSDFFGHVTQRSVLVEGDVRETVPRYLAENPQTVIALAYFDLDLYEPTKAVLEAIRPYLTKGSIVAFDELDNPKWPGENIAMRKVLGLDHAPLRLLPGRPAPAYLRWGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TDP-rhamnose 3'-O-methyltransferase (CalS11)
publication title Loop dynamics of thymidine diphosphate-rhamnose 3'-O-methyltransferase (CalS11), an enzyme in calicheamicin biosynthesis.
pubmed doi rcsb
source organism Micromonospora echinospora
molecule tags Transferase
total genus 69
structure length 234
sequence length 251
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05711 TylF Macrocin-O-methyltransferase (TylF)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5hoqA00
1QAMA 3KPJA 3RIEA 1X1DA 1ZGJA 2EFJA 3HVHA 4KW7A 5EMLA 3GU3A 4BY9E 3FPFA 4OX9Y 5ICCA 3HCBA 4C07A 4WVLA 3MCTA 5DTRA 1AQJA 5DLYA 3OZSA 2AR0A 1O54A 2PT6A 1SVUA 1KYZA 3G2OA 2P1DA 3NWBA 1NW7A 3G89A 3UWPA 3G2PA 4NECA 4PYIA 4OA8A 3P97A 4CTKA 2AVDA 3KQOA 3GO4A 4GOOD 3EEOA 4P7FA 5E2BA 1AF7A 2G71A 1YB2A 3KQWA 1RJEA 1N7JA 1Z3CA 2I7CA 3R3HA 5EGSA 4X63A 5GP1A 3LCUA 3BWBA 2OZVA 3K0BA 3ELDA 1R74A 4ER0A 5LQRA 2PXXA 3EVAA 3LDUA 2NP6A 2YX1A 2PLWA 1I4WA 5EZSA 2IP2A 1NW3A 4A6DA 4IWNA 2PXCA 3UJ8A 3KPUA 4LECA 5FWDA 2ERCA 4OBXA 1EJ0A 2F8LA 3PS9A 4PGGA 5CCBA 3C6MA 3OZRA 1H1DA 3KPWA 5BW4A 4ER7A 4CTJA 2OO3A 4KIFA 5E1BA 3FTEA 2ONYA 1JTEA 3A26A 4E2WA 4DF3A 3I53A 5FTWA 3HCAA 2GB4A 1I9GA 1EQAA 4R8RA 5DRYA 4E2ZA 2HR1A 3EEYA 3AY0A 2C7PA 3OPNA 5E2AA 2IBTA 4GOMD 1P1CA 2ZWAA 5DTQA 2H1RA 5DSTA 3SSNA 2H00A 2YUIA 5C9ZA 5EC8A 3SSMA 5DM2A 5EG5A 4AZSA 5K03A 2Z6UA 3QOWA 2O06A 3EPPA 4BP1A 3A27A 2HV9A 3BGDA 3DMHA 3EVBA 3GRZA 4RTNA 3EGVA 1NKVA 1O9HA 1L3CA 3LKDA 4RWZA 2YQZA 3I9FA 3ID6C 4PYKA 4ISCA 2UZ4A 5ICFA 3LSTA 5FQOA 3ELUA 4IV8A 4ZTBA 2ESRA 3EMDA 5LQCA 1AV6A 2JH8A 3GNLA 1IXKA 1XCJA 3C3YA 2Y1XA 3FPHA 3TKYA 2NXNA 2VDWA 2UYOA 2P7HA 2WA2A 3KQYA 3UA4A 2EJTA 2ZTHA 5K0GA 3O4FA 5DXAA 2QRVB 3LBFA 4K6MA 1JQDA 1VP3A 1XCLA 5BP7A 2OB2A 1EJ6A 3M6VA 3FYDA 5EHGA 5DM1A 4QTUB 4M37A 2AOTA 2PV0A 3CC8A 3UJ9A 2PX8A 4FSXA 2I62A 2NXEA 3THRA 4PGHA 5KS2A 1I1NA 1KR5A 3TOSA 4RTMA 3CJQA 3BKXA 5CIYA 4P58A 3KQQA 2AN5A 3MTIA 1RI2A 4V0QA 5DM0A 2PKWA 4PYMA 1X1BA 3DH0A 1YUBA 3DMFA 5FADA 4PYNA 3OU7A 3P71T 3UA3A 5K0BA 1RI4A 2IH4A 2XYQA 1JQEA 1R8YA 1F3LA 1SKMA 4XUCA 3CJTA 4GQBA 1VE3A 3GIWA 2GA9A 5LR6A 5EIFA 1NW6A 2PWPA 3TMAA 4AZTA 2B25A 3ER9A 3CGGA 4PYQA 1QAOA 4DQ0A 1YFJA 4P7KA 3HTXA 4YUVA 3GRRA 3DXYA 3JWJA 3JWGA 1SUSA 5CVDA 5EPEA 1VBFA 3PX3A 4RTPA 1YFLA 1BHJA 3CVOA 5EHIA 4RVHA 4YUZA 3A25A 1Y8CA 5LQNA 2ZZMA 4POOA 1RI3A 1X1CA 5T64A 5CUQA 2P7IA 2C7OA 3SMQA 4RSRA 4MHTA 3UJCA 1G8AA 2AVNA 2A14A 4GOND 1YF3A 5EZQA 3CCFA 4RTSA 1Q0TA 2ZCJA 5JR3A 1G60A 4QQNA 3F4KA 1ZHFA 3CJRA 4E70A 2ZLBA 4YUYA 3B3FA 5HFJA 2E5WA 3MGGA 4P7JA 3FTFA 1F38A 4FGZA 3E05A 2DPMA 2GPYA 2P35A 3LDFA 4V0RA 1JSXA 2XVAA 2PX4A 4R6WA 1R6AA 4AUKA 2HMYB 3KKZA 2I9KA 3BT7A 1XJ5A 4UOEA 5EOVA 1KPGA 3EVCA 3VC2A 4RTKA 3FYCA 1ORHA 3ANXA 5HIKA 3WSTA 2ONZA 1BKYA 3B3GA 2PGXA 1EAMA 3FTDA 2IIPA 2AN3A 1ZQ9A 2CL5A 1PJZA 3P2IA 3PFHA 4FP9A 5FUBA 4Z2YA 3I64A 4H0NA 4PCAA 5FA8A 5LQKA 2G8NA 5DX1A 3FUTA 3EVDA 1D2GA 2ZW9A 3OU6A 3T7TA 4PYJA 5LSAA 5EKXA 2FK7A 3AWIA 3DMGA 3DUWA 1G8SA 1ORIA 2B78A 4PCLA 5D1NA 2BM8A 5DWQA 2NP7A 1G38A 5G02A 3BWYA 1AQIA 2YXEA 3B3JA 5CD1A 2PJDA 2WA1A 4LWOA 4YMGA 1L1EA 1NV9A 5K0FA 3KHKA 5HEKA 3B5IA 4C06A 5FA5A 3L8DA 3HP7A 3ERCA 1Q0SA 1R8XA 3KPYA 3MB5A 5HILA 2AOTB 3NW9A 3O7WA 3M6XA 2JHPA 4RVGA 3C3PA 3TPZA 3KU1A 3KR0A 1FPQA 1JQ3A 1O9GA 1ZKDA 2QYOA 3DOUA 3KQPA 2JHCA 3TRKA 5EEHA 3U81A 1WS6A 3DLCA 2PWYA 3VSEA 5M5BA 3EVFA 2ZBQA 4RTLA 5KYGA 1N7IA 3M6WA 3SR4A 5FQNA 4FT2A 4C03A 3E23A 1VPTA 4PINA 5F2KA 3HCEA 5EEGA 3G5TA 3IHTA 1XVAA 2OXTA 2ZIEA 4OA5A 4E30A 4HTFA 3S68A 4F86A 3IV6A 2GLUA 3UJ6A 1VLMA 5K0NA 4EMSA 2IBSA 2LD4A 1U2ZA 3LBYA 4HRAA 4LWPA 2HWKA 2O57A 3ELWA 1VIDA 4PYLA 5LQUA 1QAQA 1KPIA 5IKMA 3K6RA 3HA7A 1X1AA 3FPEA 1DUSA 3KQVA 2B2CA 3FZGA 3KR1A 3NWEA 4HG2A 5EKUA 4DMGA 3KQTA 5E9QA 2IDJA 5ICGA 4MWZA 5U4XA 2C7RA 4OBWA 1RI5A 2AOVA 2AOWA 3KR2A 1HMYA 1NW5A 3HCCA 5E8RA 5CM2Z 3GJYA 3HNRA 2QY6A 1KIAA 1BOOA 4F85A 5K01A 3OCJA 5KQSA 4GBED 4E2YA 1FBNA 1DL5A 2AOUA 5HIMA 3E7PA 5DRTA 2UYHA 5GIOE 2I6GA 3H2BA 1L3IA 2FHPA 4PIMA 3GCZA 5E8JA 1PRYA 5B1SA 2HTEA 1L3BA 4HGYA 4PNEA 4RTJA 4GC9A 4KDRA 4KVZA 5ERGB 2FK8A 1FP2A 10MHA 1SQGA 4EKIA 3B89A 3PB3A 1UWVA 1NT2A 2NNWB 4BP3A 1IM8A 4EVIA 2IGTA 3C6KA 5E9JA 3HA3A 4M7RA 2NXJA 4RVDA 4DCMA 1MHTA 3AJDA 1G6Q1 5GM1A 3HA5A 5DTMA 4CWAA 4YUXA 4DKJA 7MHTA 1NW8A 2ZVJA 3EGEA 1KP9A 4RTOA 1D2HA 4YV1A 1B42A 4GEKA 2YXDA 1P39A 3T7RA 4E2XA 4RV9A 5K0LA 3P2EA 2V74B 4ER3A 4HH4A 3R6TA 3OFKA 1IY9A 1YZHA 2VS1A 2BH2A 3NTVA 5HOQA 3LDGA 1KPHA 1XDZA 1VQ1A 1WG8A 1WZNA 3BWCA 3HVKA 4GF5A 1RJDA 1UFKA 4FS8A 4OQDA 3ME5A 3LPMA 3OFJA 2R3SA 3HCDA 5DSXA 4DM3A 1P91A 2BZGA 3OZTA 4DA4A 2CKDA 3G7UA 4GOLD 3SSOA 5CVJA 5FHQA 3P9IA 3FTCA 5EQJB 2JHAA 2NYUA 1M6YA 3EGIA 1KHHA 3AXTA 3NVMB 5E9WA 3EVZA 4QVGA 2GH1A 3UFBA 4BLWA 4CKBA 4F84A 1V39A 3FUXA 1G55A 4GC5A 3A4TA 4IV0A 3PLAE 3DLIA 3NJRA 1WXWA 2PX2A 2ZZKA 3RW9A 2C7QA 3JWHA 5EVJA 2PT9A 2EX4A 5GM2A 1JTFA 1XDSA 4O29A 3TKAA 5BW5A 5GWXA 5CVVA 1DCTA 2ZULA 1BC5A 2O07A 2PY6A 4C08A 4X61A 5HIJA 3GRVA 2FYTA 3G2MA 2HNKA 4DCGA 3Q7EA 4QTTB 3PVCA 2IFTA 1D2CA 2XYRA 3TLJA 4PONA 1FJXA 3SXJA 2UYCA 3PX2A 2P3LA 3LL7A 3V97A 1QANA 3I58A 1JG4A 2ZBRA 2R6ZA 2P41A 2XYVA 2YR0A 3FUVA 5F2NA 1MJFA 4BLVA 3PTAA 2PVCA 2ZIGA 2IH2A 4R05A 3ELYA 1N2XA 4C04A 2P40A 3R24A 4C4AA 5GINE 5IH3A 3EMBA 1L9KA 5K0EA 3I5UA 3R0QA 1NBIA 4CKEA 3DTNA 3NDJA 5C1IA 3UJBA 2OB1A 1M6EX 3ORHA 3O31A 4HGZA 5KVAA 1KXZA 4FT4A 8MHTA 2ZFUA 5EMKA 2JH9A 3PT9A 4OQEA 3IYLW 4RYLA 2CMHA 5CVEA 2OYRA 3X0DA 4YV0A 4ER6A 2FRXA 2K4MA 3TM5A 4P7GA 3FUUA 2ZWVA 3OE4A 2AN4A 3NMUF 5FHRA 4G56A 5DX0A 1JSZA 3SGLA 3M6UA 3P9KA 2P3OA 4QPNA 4X60A 3Q87B 2VZ9A 2G1PA 3MHTA 1SQFA 2EJUA 2IDKA 4R8SA 3THSA 2XVMA 5HIIA 3MCZA 5FCDA 4RTRA 1M0EA 3KR9A 5EMMA 1TW3A 4HC4A 2PSSA 2QM3A 3G88A 4IKPA 4QVKA 2VP3A 4PYOA 2AZTA 4ATNA 2P3QA 3DXXA 3ER8A 5MHTA 2FPOA 4QDJA 2GAFA 3DULA 2PX5A 3SM3A 5JUWA 2QE6A 1SG9A 3BZBA 1P1BA 1WY7A 3TM4A 2ORED 3GWZA 3G8BA 3KQSA 1KYWA 4MTLA 5EIWA 2ZSUA 4MIKA 4PWYA 2EG5A 2NXCA 1NV8A 1R00A 3G5LA 2CMGA 4KRGA 2Q41A 4LG1A 4XUDA 5T6BA 3TQSA 2PBFA 2XBMA 1INLA 4BLUA 3P8ZA 2CWWA 3HEMA 1XXLA 3TFWA 4JXJA 3T7SA 4AX8A 3UZUA 3DP7A 3LCCA 3GGDA 3KQMA 1T43A 3A7EA 1HNNA 3G2QA 5GIPE 5K0JA 1XTPA 3BWMA 3NVKI 4FSDA 4KIGA 3CKKA 2B9EA 2O0LA 3BXOA 3OU2A 4X41A 4MQ4A 1JR4A 2V7EA 3P2KA 5DXJA 5FULA 1WXXA 4RTQA 2JJQA 3SX0A 4B17A 3UJDA 3FRIA 3BGIA 2YXLA 3UJAA 1X19A 3M4XA 1TW2A 3FPGA 4EKGA 3LGAA 2P8JA 2Z6QA 4E32A 3BKWA 3DXZA 3E8SA 3A7DA 4M36A 2KW5A 5GOZA 4CKCA 4YV2A 4CXMA 3VYWA 2ZZNA 2PXAA 1SUIA 2ZBPA 5CCXA 3R9XB 3LKZA 5BXYA 4C05A 5LQAA 3UJ7A 5K0CA 3BUSA 1NBHA 3AXSA 1VP9A 4DZRA 3CBGA 1EIZA 1FP1D 3PFGA 4U7TB 5LQJA 1OR8A 3IEIA 3LECA 4PIPA 4U7PB 4XUEA 5F2OA 3P9CA 3SVZA 4ER5A 4E31A 3UBTA 4XCXA 2VDVE 3VC1A 1JG2A 3HCFA 1RI1A 5E1DA 5HZMA 3EVGA 3FRHA 5K8VA 2O05A 4Y30A 4RVFA 1RJFA 3GDHA 4QPPA 1JG3A 3T0IA 1QYRA 5T67A 2B3TA 2UYQA 1XDUA 4X1OA 4Y2HA 3DR5A 3EVEA 3HVIA 4R6XA 1RJGA 5H02A 2Z6AA 4YMHA 2IH5A 3GXOA 5FWAA 4E33A 3B7PA 2H11A 2OPBA 2AS0A 1JG1A 3GRYA 5DX8A 5KQRA 3MERA 3FUWA 2WK1A 2YVLA 2G70A 5K05A 3GRUA 5DM4A 3LCVB 5P8WA 3P9NA 4M38A 2G72A 3QV2A 4KDCA 5C0OE 4EQZA 3V8VA 5ICEA 4RX1A 1R18A 3HVJA 4QDKA 2DULA 1YZ3A 3M70A 3FPJA 2VDUE 2BR5A 1UIRA 3G8AA 3JWIA 2BR3A 4EK9A 3MAGA 3M33A 5E1MA 3C0KA 1EG2A 4WXHA 3QOXA 4KWCA 2GS9A 5K09A 4FR0A 2AOXA 4HTFB 4FZVA 3LHDA 4AZWA 5E1OA 4YUWA 1VL5A 1ZGAA 2QRVA 5EMJA 3D2LA 1NE2A 2JG3A 5D1HA 4HSGA 2FCAA 5CVUA 3TR6A 5DT2A 3MTEA 1TPYA 3NDIA 2ADMA 5DPMA 4GUAA 3HM2A 4A6EA 3OE5A 3RODA 2BM9A 2Y1WA 2IPXA 3MQ2A 4QQKA 3KPVA 2BR4A 2OY0A 2OBFA 1ZG3A 2N47A 3REOA 2AOUB 2ZIFA 4L7VA 3BGVA 1QZZA 4AZVA 9MHTA 2OKCA 3LX6A 2YTZA
chains in the Genus database with same CATH superfamily
2D00A 4D25A 1ZGJA 4N0MA 1N6LA 1JHYA 2OFPA 1X80A 3A6JA 3KZMA 4BRSA 5JYBA 1J8FA 1X0VA 1HUQA 3HCBA 2G4CA 4MRAA 3NKVA 1CKEA 1XTZA 2OTCA 3ZYCA 2PNJA 4HRXA 2P9TA 3K5PA 1HGXA 4RE6A 1Z06A 2X5OA 3RV4A 4ZT5A 1ECBA 3FHOA 4K9SA 4D3YA 3LZCA 4OJKA 1DHTA 3AHIA 1KAQA 1S9DA 1IFXA 4H7JA 3QELA 1EAYA 2RAVA 2WWXA 2JHGA 3VX3A 1JHMA 3MK31 1QU2A 4HWGA 1YB5A 3HZRA 1N8NA 1XAHA 2OZVA 3ZCSA 1XDGA 1RRFA 2FZGA 3CLUD 3EWIA 4M86A 3PQ5A 4NABA 2AJBA 1J2UA 4ER0A 1U0BB 2Q2OA 1G9SA 1NMYA 4D3DA 1UZLA 3LY8A 3CWCA 1IMOA 1AO3A 2WSYB 4QXRA 4TV9F 4ZOCA 1KBOA 1RDFA 3OZRA 3RUIA 4PV7A 1TJYA 4KAJA 3OTOB 5H81A 1NZFA 2HADA 4KIFA 5G2OA 3OSZA 3JQAB 1L4KA 2QTVA 3C7TA 1TLLA 3CR3C 5FTWA 2GB4A 2GDJA 1EQAA 2OGTA 2PZFA 2WU4A 2IUSA 2X9GA 4L6CA 4YP5A 3VZBA 5F98A 1FP6A 4GL2A 4IDNA 3TUJC 5A4MS 2NSHA 4ZI7F 2Q7XA 1T26A 4GYYA 4F2PA 3ORSA 2QX6A 5C3UA 3Q0EA 3ZWWA 1AB6A 1DMRA 2F3RA 4LSMA 1NNLA 1QX4A 1UQRA 4GPEA 1FB5A 1IEWA 2JHFA 2R85A 3D8NA 1HDCA 5CTJA 4BKRA 3F67A 1MABB 5IVHA 1EP3B 3AJ9A 5C32A 3K1JA 2DB3A 3I9FA 4CMHA 2VQ6A 1OA0A 2GLTA 1Y8QA 4E1AA 5FQOA 3LYHA 3C3CA 1XZKA 2E5FA 3IIIA 1QH9A 4QHSA 4GNKA 4RIEA 3VDMA 1D2NA 2KBEA 3ZZMA 2O2IA 4EAAA 4Z7OB 2D2FA 4CNBA 1SU6A 2NXNA 4EVSA 2JCXA 3DO6A 4TMWA 4DPMA 1PZNA 3VH2A 4WBSA 3O4FA 1H6BA 1RKUA 1H42A 1JQDA 1SZCA 1KZHA 2CJFA 3Q8KA 1W0KA 1QLWA 3B36A 3IP3A 2QJRA 4N3CA 2Q5CA 3FYDA 5DM1A 4ZYUA 1M1UA 4KXWA 2E4YA 3ORFA 4K81B 4O4HA 3KYDA 2OENG 1KJ8A 1Y0BA 4RM3A 4ASUD 3CW8X 3ORQA 1BX3A 3F98A 5JO0A 2AEEA 2FWBA 1MB0A 4HFRA 3HCWA 3HKDA 2IP4A 3CJQA 4WESB 3FVWA 4R1PA 3PR2B 3V9AA 3WYEA 2FWMX 3KQQA 2BKUA 1CZUA 2R1ZA 2FY8A 5GJWC 4BNJA 1BZYA 4MI6A 2L17A 1VJ5A 4PYNA 3U44B 5EFOA 3KXKA 1LSUA 1GLNA 4KR0A 5F1YA 2JIRA 3K70C 2I87A 3I09A 4V24A 1USGA 3HRHA 1R64A 1GAWA 3R3UA 3DUFB 1XVVA 2FP4A 2HO5A 1T9GS 2AG5A 2ZWMA 2AZMA 1SUSA 4PC1A 2B7CA 3PX3A 4IHJF 1EWKA 4L72A 2HMUA 3AC0A 1V8OA 4DIOA 1JQBA 1N2CA 1NLMA 2EZ4A 3EPLA 3VR1A 1X1CA 3IC5A 1KMCA 1JHDA 3D31A 2WI8A 2NZVG 3TAUA 5T5QA 4C3VA 1QP7A 3W6NA 3OZDA 2IVFA 3ABSB 3R1IA 1ZRSA 4FBMA 2PZLA 4UBNA 4WK6A 2I4NA 1HDZA 1UBRS 4TWBA 4QJBA 4A10A 1U2TA 4RY8A 3HABA 1F8UA 5GZ3A 3UVEA 1QGED 4CEHA 5HFJA 2H2WA 2IF2A 3VPFA 3AJEA 4F71A 2QTFA 1Y1QA 5LXTB 3LDFA 1GU1A 1AS0A 4JDUA 5IW8A 1FX0A 1KJ9A 3ISJA 1K8ZB 1QUFA 5ERXA 5I5GA 4GWKA 1V1MB 5I7SA 4WDQA 1ZJ6A 1D4FA 1OBCA 2VF8A 3JWEA 1FBTA 1SKQA 4OQQA 2P2CA 4AO8A 4AMGA 1E94E 2B2NA 2PGXA 1Y9ZA 2IIPA 2XR1A 4D6YA 1YZVA 2IKSA 3B3AA 4EX7A 1UXOA 1YE5A 1CE8B 2YIDA 4BMVA 4EW6A 1NN0A 1F6DA 3KAJA 4JLSA 1KE1A 3C5CA 3DV0A 3F49S 2FZKA 3B8EA 2I99A 3V9PA 2NAFA 4KRXA 3U31A 1HFEL 2O8VA 2QZJA 3NKFA 2N1MA 4DQKA 3W2TA 1O96B 5JEEA 5L51A 1N6PA 2GTPA 1U2DC 2PMFA 1IYZA 4Y1FA 5E7JA 3C6XA 3DL7A 1Z2PX 1YZQA 3EHEA 4HDNB 1PI3A 4X6UA 5DBEX 1J7KA 1PT8A 3MOGA 1Z2CA 2VN8A 3UT5A 4C06A 3ZXXA 5I7RA 5JTUA 5F35A 3DYIA 3KB8A 3O2SB 2QD1A 5AW8A 1CULC 2J3IA 4MQMA 3IKVA 5DI3A 3GGPA 4WOBA 2I65A 4YJ2A 1QTNA 3A6KA 3OA2A 4FNAA 4Q7QA 3VUFA 4J07A 1QQTA 4WUVA 4JSTA 3GELA 1CFZA 2FSVC 1L4YA 3PQ8A 2VDPB 2JD2A 2CFSA 3PT5A 5EQTA 3U19A 7REQB 3V1YA 3U7GA 5FQNA 3KSDO 1R4NA 2XMQA 1CR6A 3EFOB 4G0OA 5AUOB 4W7SA 4ZOAA 3UAXA 3FH0A 4KLNA 4EI8A 1K9VF 4JEMA 2XW6A 2O2CA 3TEJA 3PUXA 3IJRA 2D06A 1J9GA 4E5KA 4OO3A 4P4TA 3PFWO 4LWPA 5FLYA 1CZRA 2G88A 4IXMA 5AO9A 4PX2A 4CQJA 3FPEA 1YDEA 4EENA 1PR2A 3UICA 4EA7A 4IOMA 1JHVA 4MYSA 5ESXA 5JAMA 3PRKE 3NGLA 4HB4A 4P0QB 4OBWA 1W49A 2AX4A 2EKPA 4QUDA 1FTYA 3WL4A 4Z0TA 4RHXA 3IDZA 3SJCA 4MEAA 5IJ0B 4WAUA 1TAGA 3B2EA 3ZNNA 3VM6A 4OPMA 2BMVA 3CG4A 4KJXA 4ZI7B 8LDHA 2VHZA 4D9CA 3LAWA 3LRXA 2UYHA 2ZJ5A 3U37A 3IMEA 3E9NA 1U28C 1E5LA 1K88A 3H1TA 2P9JA 1OLXA 1Z12A 2QJFA 3NT5A 3AVTA 2FK8A 2DQSA 1QFSA 1NRIA 4JHXA 3IVGA 2Q1TA 1SG6A 1VJGA 1D4AA 1CZKA 2OEPA 1UP7A 1UWVA 1YJAA 3JCZA 1HTTA 3I73A 4LKRA 1P9OA 1ZM9A 4F8EA 2IA5A 1D04A 4KHZA 2VQSA 2YIJA 5E9JA 2QZ9A 3CEPB 5LLTA 2WWRA 3TJMA 1Q3KA 2GJ9A 1EFVA 4CWAA 3NBAA 2VJDA 5BR7A 4B3IA 1FYXA 2FFHA 4R7TA 2PKCA 5JC1A 4JB2A 1V7CA 3UMCA 3BL5A 4WX2B 2CMFA 5T3UA 4E5UA 1P1JA 3GLGB 2OECA 3UATA 1DELA 3H9QA 2XNJA 3L5KA 3TLBA 5KZMB 4U2DA 3DV2A 1IY9A 2W6PA 1K3FA 1UPBA 1Y1LA 2ZRKA 3B9QA 3FWHA 3G49A 3T94A 4TS4A 1E0SA 4Y9SA 1EZZA 4LJ5A 3UJ3X 5G0SA 3LHKA 3QKWA 3R9IA 1ZCAA 4G97A 3T1YB 4CU5A 3ME5A 1V11A 4D9MA 1KIMA 1CY8A 4EEZA 2F43A 2EAUA 4BUJA 3TINA 4C22A 5BOVA 1QLHA 3R3SA 4P86A 2H5JA 3UC9A 3KJEA 4XWGA 4B76A 3QVMA 2HNBA 4G0VA 4RZIA 1FRFS 4AK9A 4DJDC 4FGUA 2BGUA 3SJ7A 3IEKA 3R0IA 1M6YA 2B83A 5GJVC 3WK6A 3AXTA 4DN6A 3EZLA 1SHUX 2AJCA 3U3ZA 4A1FA 2A0UA 4RD0A 4ARVA 4ZFNA 4BP9A 2OBLA 1LTKA 1W4LA 4LGYA 1UMCB 3L41A 4FZRA 5LP1A 3F6YA 1G8FA 3NPMA 5JS7A 1DKUA 1HDYA 4X6YA 3GDOA 1KQGA 3GRCA 4DUPA 1CQIA 3G9UA 4RLSA 1EGMB 2H1WA 5I8ZA 1JG6A 2XYGA 3MBKA 3SWWA 2E4VA 3A1EA 1GDTA 3ROZA 2ODNA 5KNDH 1JILA 2WIAA 2HCRA 1JDJA 4P4SB 1OTXA 3FOWA 4HYQA 4G5RA 4W9NC 1E79D 2XWQA 4NCJA 1U2DA 4KK3A 3PITA 3OZXA 3PQFA 3U1TA 4DYVA 3R3XA 1Y5LA 5HS6A 2R1UA 2MSWA 4F9TA 1KP2A 2XUJA 3KC2A 1NBIA 3I2YX 4LJ7A 4RESA 4CR7A 1CZHA 3ZHOA 1E9CA 1Y33E 4K03A 3SEFA 1VKHA 3WV4A 1B14A 5KVAA 1OSNA 3M5CA 1DQNA 1LSSA 2FSVA 2E82A 2Y67A 3VUEA 5IXSA 1SNYA 1Z26A 1IN6A 1MX1A 4L4ZA 1QDEA 2JA2A 4RW0A 4AIIA 4ER6A 4MVJD 3K0AA 4JP5A 5GTDA 3AB7A 3TI9A 1A0OA 1A4IA 2Z8XA 3LPNA 1RPTA 4I9NA 4ON9A 3SP1A 2ON6A 4P3KA 1ADCA 3HDYA 1CLEA 5KDDA 2DH5A 1N1GA 2GXSA 2NO9A 2RAFA 3FVVA 1KDYA 4C29A 4U39A 5HIIA 4CF6A 3E6AA 5FOQA 5C35A 3TW8B 3UMBA 1OHHA 2B2XA 3PVZA 2G9VA 3EAQA 1SPXA 1NIPA 1XK7A 1ICEA 2IPAB 3IAAA 3M4JA 4YA6A 1DQYA 3SC3A 5BVHA 4Q19A 3GNTA 3UMMA 2VSQA 3H11A 2GF9A 2J85A 3VZCA 1KYWA 2NU8A 4AJ1A 4D8XA 1A8HA 4K9DA 3LPAA 2CCGA 3NYIA 2QW0X 2NXCA 3N5KA 4FGLA 3OEHA 1KTVA 5T6BA 4C6TA 2Q4DA 2Q9UA 1OILA 3SFZA 4BVEA 4IP0A 3VO1A 4OBEA 3DCIA 1UINA 5KUTA 1JJAA 2A4MA 1BRTA 1G66A 4CV1A 4RL4A 1C3XA 1E3WB 2ZRIA 5HJ7A 3QM1A 4F72A 1I4OA 4KR7A 1JDPA 2VJOA 4MJ3A 1QVVA 3H9CA 4L22A 4RTQA 5IFKA 1U63A 1NQWA 3GBPA 1K8YB 3VYSB 3O8CA 4WNCA 2Z58A 2IHZA 5EHQA 1KKLA 3NBQA 4WGGA 3MTDA 3LCMA 1H2AS 3PNSA 1P7ZA 3TQIA 1LH0A 1ADYA 3LLCA 1GV1A 1R2QA 4OXQA 1P8JA 2HUNA 2WU8A 3FKJA 3VVLA 2W2KA 2BYTA 5G4KA 2UU9B 5D7BA 4C1BA 1FYVA 1G2OA 3DBRB 4D96A 3PP8A 3GCDA 4RQTA 4J0EA 1IZ9A 5K0CA 3EXG1 1XNRB 2O8CB 4QVIA 3TZHA 3NT4A 1T2NA 2EBUA 1SVKA 2WYUA 1FFAA 3EAGA 2FR8C 4IIHA 1JHUA 1OWPA 1G8HA 1AXRA 1TPZA 1L7QA 2GSDA 4XCXA 5A2QA 4GH5A 3M5WA 4MPTA 2HDOA 3QVGB 1LPMA 2J0UB 3UXYA 3N0WA 3JQBC 1RJFA 4NMXB 1Y6JA 2W8BA 2YQ4A 2F00A 1QYRA 3BSYA 1GPMA 4M87A 4O3FA 4TGLA 2VH1A 5K3DA 4EUSA 3BCHA 5HOEA 4LS3A 1GL7A 4WEOA 4BS9A 2IS4A 4WGFA 3IV9A 3DEIA 1Y37A 2FW9A 2O7RA 5FORA 5A02A 3H5LA 4QKQA 3ZV5A 4MGZR 1ZHHA 2HHLA 1U1DA 3PEUA 1NVFA 1UDAA 2GARA 3OTQA 5P8WA 3UK2A 1BE6A 1P60A 1A50B 2AEMA 3EN0A 2QLLA 3DEYX 3KBOA 1NYQA 4QDKA 4IIGA 4XPIA 2J08A 3K96A 1Z47A 2QD4A 1EZ4A 1EQUA 3LD9A 3M70A 2I2DA 3Q1KA 3M8KA 1U9CA 3LX4A 1KZ4A 1DXHA 4FHDA 2PJRA 3CNEA 1CB0A 2GZSA 1RS0A 3F3SA 4W9NA 3MAGA 3QV1A 1YR9A 4G09A 1G20E 2X8AA 3A3OA 3D1VA 4GWGA 4NFLA 4W8HA 2B8WA 1KMHB 3KLPX 1JSRA 2I2BA 3AUUA 2R6DA 1U3VA 2GVNA 2I4RA 3OEED 3OPQA 4K86A 4KWCA 3H1GA 1UEXC 2OYCA 4CYMA 4MQ6A 3H2HA 1X86B 1NTOA 3WIUA 3WC4A 3NUQA 1O4VA 3GJQA 4KACA 3TRHA 4C4ZA 2CV0A 1BHQ1 4JX8A 4CQLA 3B9PA 3AI7A 3R4CA 2V3CC 3O6VA 3K9FC 2CDAA 2JBHA 2E21A 4L8FA 1JDNA 5C8YF 2JIMA 3DOEA 2ZUTA 3MOSA 4HSGA 5CVUA 2BFEA 4DG9A 1U8UA 1QH1A 2C9OA 4IGFA 5I9NA 1TU4A 4TXJA 5G4LA 3TRFA 2N0SA 1QC5B 5D86A 1VKNA 5JQGF 1L5QA 3RNLA 5IDYA 4DG8A 4MQEA 1I0ZA 5D5PA 3QMVA 1QGAA 2JAHA 4QQKA 3PCXA 1N9GB 1OE0A 2CF6A 3FGPA 1QG0A 1AK9A 3ENWA 5TT0A 1JQKA 1WCV1 4DLUA 1P72A 1WP4A 3BIOA 5BW6B 1MVLA 1G3UA 4CKCB 3IL2A 1BIFA 1H2YA 2ROQA 1AGPA 1CG6A 2XTZA 5CT8A 4JJ6A 1DGQA 4JN6B 3CF4G 3G9TA 2W9XA 2WAOA 3AEYA 3EBPA 5CFLA 4L85A 3NWBA 5DSZA 3AVPA 1Z5PA 4NECA 1FP7A 3FCCA 3MJ4A 2OCBA 3O95A 1YR3A 2CXOA 2IOQA 3B7WA 3KQOA 3NYWA 5E6SB 4ZGWA 1QKJA 3T5CA 1ZW6A 4R1UA 3CMCO 4CN8A 1GQQA 3X3HA 1CSEE 1NMQA 3OECA 4AFNA 2FLVA 3BWBA 3OZFA 2C5AA 4BX9A 2HC9A 4X20A 3WGGA 3DZGA 2B4YA 4E5SA 4C7OA 4G6ZA 1Y5RA 1CUSA 2HYDA 3Q40A 3AESB 1B3BA 3ZLTA 4OFZA 4UHBA 3BJZA 4LZPA 4JI0B 3PFBA 4X9XA 5ALKA 1C0EA 2ERCA 2YWHA 1T25A 3H13A 5CJ2A 1W7AA 3G8CA 1HE5A 1QPGA 2PZAA 2ONYA 2XOKA 4PBSA 3WWCA 3GJ3A 3AF4A 4IXTA 1YVRA 2VUUA 4NARA 5LQUA 1AM4D 1G1AA 3AY0A 4PHFA 4WV3A 1V8BA 4C7BA 2BI8A 4B0OA 1D7OA 1P1CA 3ILYA 2G7ZA 4WOJA 4EMUA 4Z1OA 3WL5A 4DMHA 2HZBA 2Z5GA 4UPEA 1OASA 2PL5A 1BCRA 1RAAA 4PZUA 4C0JA 4HVCA 1N2OA 3ONDA 3DMHA 4G89A 2ZP1A 1DV2A 2QU7A 4PZ9A 4WFJA 5H59A 4OLBA 2C4KA 2PX6A 3LKDA 4WW0A 1VE7A 5FOSA 2AFIA 1LX7A 1YR8A 2CNKA 1XZLA 3JARB 3DWFA 2COUA 5LQCA 5HUJA 3CSUA 1GKUB 2Q4RA 3MPUA 2CY0A 4V1CA 2YIMA 4AKGA 4YRLA 5FNVA 4JZYA 1EXNA 1GCGA 3AB3A 4YIHA 3O8QA 3TCKA 4JQYA 3PGA1 4NBUA 5AI4A 5JSHA 4GXTA 1NVBA 3VU9B 2R9VA 2EFGA 3WK7A 1AXEA 1TM2A 4JYCA 1DPGA 2VQ3A 1JSLA 2X1VA 4GKAA 2F7SA 4HDKB 2OM2A 2DFPA 2B1QA 4LVNA 1QV6A 3IP6A 1B43A 4MX8A 1X6VA 4RIHA 2AD1A 3U1VA 5JS8A 4GSKA 3M6FA 4BFYA 1K5GA 1RW4A 5TMPA 3QITA 2Q4TA 5HFNA 4I4TF 1KI8A 3ZGYA 5ITVA 4AJOA 1IU9A 4PYMA 1GLGA 2CGEA 5FFNA 4L0QA 5JY6A 1DJPA 2CNBA 4ND6A 5K0BA 3CY6A 4DT1A 5G53C 5HGJA 1Y9DA 1IRIA 1HL7A 3LA8A 4HAWA 1C5KA 4KLCA 1CV2A 4U2KA 4WNAA 4D0LB 4PHHA 4QT4A 2C3PA 2PX3A 2VT6A 4K88A 4B3HA 1EWQA 2C4TA 2XMGA 2ZVQX 5CT9A 5IVKA 2VHWA 4PYQA 2BRUC 4R2XA 1T8SA 3B3QA 2BJHA 4KXXA 1NJ2A 3ETGA 1R4MA 1FFXA 2OFFA 3AR3A 4PC7A 2O5VA 2LPMA 4IEIA 1Z2EA 3RNOA 3FKSA 1ZZGA 2X6QA 4JGIA 1Z2DA 2Y1GA 4MR7B 4RVHA 4IDOA 2VT2A 3UH1A 1YCFA 3COZA 1ND6A 2D3TA 1QHYA 4MP3A 4O2AF 1A76A 5L7YA 3SMQA 3GL9A 4EHIA 5CFOA 5KTPA 1ZS9A 3PC8A 4ZOQI 4G8CA 2WC1A 1XJQA 2AXEA 2Z3WA 1UDBA 4RF2A 5EZQA 2DPGA 2J3MA 3H75A 4HX2A 1T1SA 2QVYX 2R8PA 1T5TA 2J7KA 1XAIA 3MLBA 4TQ9A 3X1KA 2ZLBA 4E70A 1W9MA 2VAXA 4LYEA 4N5NA 5L6LB 5YASA 1EESA 2PWZA 2WIDA 1OI7A 4AJNA 4F3YA 1JALA 3HSYA 5ULLA 4J0CA 3WHPA 4A6XA 3E05A 5CBPA 2QQGA 4OFBA 2VTBA 2XVAA 2PX4A 4DMMA 4GZMA 5KAMA 1UF9A 3SF0A 4UOEA 5AK0A 3RGGA 2XUGA 3V2GA 2QRUA 1Z8FA 4B3MB 1VGQA 2FW6A 3BZUA 5EJ7A 3AKYA 2H7CA 4QL3A 3JYNA 5D00A 3SF8A 4Q6BA 4BDTA 4EUFA 2WABA 3JQ9A 5EJIA 4GX2A 2C2WA 3H86A 1J1IA 1E60A 3JD3A 1J5EB 3NHZA 2WINI 1PV2A 4YP0A 4DGQA 4PM4A 5KPJA 3I62A 4R3WA 1XR3A 1BDJA 1I8TA 4YPOA 1S2IA 4NBTA 3FZQA 3D7RA 1FU8A 1QGUA 3MINB 2Q5HA 3ZDRA 3DT9A 2FFRA 1KGSA 1X1SA 2Y71A 2H85A 1Q1NA 3EXHB 2GNOA 3GLHE 1YVEI 3FMFA 1Z3IX 3HDHA 4PGMA 3JAMA 3PEYA 2J7PA 4J76A 4FHFA 1OU4A 2RHWA 4QFBA 4DCSA 4LWOA 5L3VA 1L1EA 4X3OA 4XD2A 2VXYA 5HEKA 3VPXA 2BZSA 3RDPA 5D2CA 5B30A 5HILA 4AJKA 1W36D 2QLMA 3IO3A 4JL5A 3AEKA 4F1KA 5AK5A 1N6OA 2O3QA 4MWOA 3TPZA 1Z6XA 1Y9AA 3HY4A 1FPQA 3KVNA 2OCGA 1ZU5A 3Q2OA 1F8GA 2WTEA 3M5PA 1ODJA 5DH9A 3LPCA 4AVYA 3GW8A 4H7FA 1P9RA 5J2UA 1UEIA 2ZPTX 3MBOA 3QW4B 2P0EA 1EUCB 4HHEA 5TJHA 3RANA 4B4VA 1AHIA 1XVAA 2CJYA 4HAIA 2EL7A 3U3XA 3BWVA 3U62A 1J0CA 3OJXA 5LD2B 1YIAA 4GDMA 1N5DA 2BMJA 3FPBA 4HRAA 4MJXA 1L8LA 2BISA 4DQUA 1JVBA 2VYFA 3I72A 5A0VA 4B7UA 3HA7A 3K8YA 4CV2A 3PNMA 2I29A 5F77A 4DMGA 4LF9B 1NAIA 1AQYA 4LCBA 2CDRA 1SC6A 1WDTA 1IDN1 2RHLA 1I6LA 4B0PA 1CVRA 3ZYZA 4MROA 4F4HA 1NW5A 2NZ8A 3TZ6A 5I9BA 1TD1A 4B3DA 1FMJA 1Q92A 4JD5A 1CDOA 1KJQA 3IPAA 2C77A 1FC0A 1L3IA 5KKNB 4KDRA 2FJPA 1WVMA 4DLYA 4URXR 1FP2A 4AJIA 3GLGA 1HNZB 1Q7RA 4DV3B 3HPQA 5L6MB 1HE4A 3QVSA 4CM7A 4WKGA 1NG9A 1HFWA 2IGTA 1CF9A 5HPYB 4M7RA 4XVRA 4RVOA 1G6Q1 1WEKA 2BRUA 3KAPA 1P73A 3A1NA 4KPUB 2PGJA 3FMVA 1L5FA 5EMHA 1RP1A 1YS1X 4PICA 1B42A 2WYWA 5GJCA 4BCDA 3LCJA 4TQGA 4BP8A 3IUQA 2RMKA 5KNLA 3RTEA 1NXTA 1M83A 1ADFA 3FNIA 1FTQA 5IAEA 4XSVA 3EYAA 4QBIA 2MR5A 4PO8A 3DA8A 3FCOA 5HR5A 1JFFA 1QMPA 1RXVA 1O58A 2Z2JA 3LS2A 4KE7A 3HXOA 5BR1A 4PSDA 1J1UA 2VUIB 1RJDA 3BXPA 3LQ1A 4OLAA 2HRQA 4FFSA 1IHOA 1QTIA 2C98A 2XECA 3DF7A 4MKZA 3EZ7A 1PGOA 3JQAA 1U0SY 2ZSKA 1VOTA 4ZYLA 2WWVD 3ZR4B 3CRRA 4DMUB 1P0MA 1A9RA 1AUQA 1J33A 1H8HA 3C8MA 1GZ3A 3DLTA 3FTCA 3KUDA 3EB9A 1PUJA 5FTNA 5TPZA 5E9WA 1N0IA 4B44A 4CKBA 4JCCA 3HFJA 4NNOA 3RQSA 4LQCA 4ZZ2A 4MHSA 5AHWA 3DLIA 4PFQA 1UBJS 1WXWA 2ZJ3A 3TTVA 2EJVA 5EXTA 4F3CA 4IAOA 3HZOA 4CL0A 5BN3B 5HSGA 1MABA 5I9SA 4Q1EA 2W0MA 2ZULA 3TQCA 1DEHA 3QENA 4L5AA 3E5RA 2FLKA 3WB2A 4D4MA 5FIUA 4X61A 1CUYA 1ZD4A 4EARA 1I94B 3GRVA 1EFLA 4OP3A 1BW9B 1GGJA 3BF8A 3LP5A 4UBJA 4WZZA 3R7FA 4JI8B 3U7EB 4NNJA 1PZGA 2P3LA 1TIPA 3LL7A 5T3YA 3WISA 1QANA 3PTAA 3LOUA 1U2RA 3INTA 4XYEA 5BNTA 4X45A 2VDQB 3IBSA 1U0NA 4MARA 4YT4A 1WKBA 4ZV9A 3BJEA 1C9YA 3F3YA 4HXGA 3LQ2A 4LQ4A 4ES6A 1FLNA 4Z9BA 2C83A 2ZG6A 3P9SA 1IATA 3V1LA 3LT2A 3MJEA 1D2AA 1R3UA 2PZGA 4WESA 2NUAB 5HKLA 4QOEA 4DDUA 3EZXA 4MQFB 4FT4A 5EMKA 1X92A 4JB8A 3VH1A 4B87A 3CNBA 3VKHA 3U56A 3V2UA 1A9OA 3V80A 3U44A 4ZRMA 4BAZA 3A6DA 4C6SA 4F6RB 2QZSA 3CWQA 1RAHA 1G291 4XOUA 2K6GA 2PUTA 3NMUF 4M60A 2P2LA 3CPJB 5AWFC 5JWHA 2QUAA 3S6JA 4BFCA 1BTOA 3V1MA 4C3UA 4UNRA 4O4JB 3DUFA 1Y80A 2QRJA 4MUGA 3BE5A 3S8EA 2HUPA 3RJ9A 5IDQA 1A77A 1MC4A 3UF0A 2E6UX 3FDZA 4DR6B 2PKRA 2M32A 3JSAA 4NTZA 1KDPA 5E6UA 5KTNA 1OV4A 1A98A 4LXGA 2PKQO 4H6WA 5H1YA 1I5OA 4OJYA 4Y9TA 1GU0A 1CUXA 3EW7A 3QVXA 3GMIA 4FWBA 4M9XA 5AQEA 4BFXA 5JIBA 2ORED 5IEJA 3R41A 1QWOA 2HW8A 2Y27A 4BTEA 2C95A 4CQMA 4LYFA 3DEHA 1H0KA 4PR0A 5KYXA 1BEUB 4CU2A 2VLIA 2LTAA 4GQIA 4A2PA 3TD6A 4F4DA 2WB2A 1MO4A 1QU3A 4RAQA 2QQFA 2JZCA 5LJIA 1E0AA 1I6KA 4PXAA 2GCIA 3OLVA 2IX9A 2IYVA 4RVUA 4J3NA 5GY7A 4FFBB 3OU2A 5FULA 3U6KA 3VNQA 1PG5A 3B70A 1DAKA 3REQB 1V16A 3PGMA 1V1MA 1FYDA 3UJAA 5M2QA 1GGFA 3E9ZA 2OSBA 5FOXA 3L7IA 5SYNA 3A6GA 1MQSA 4YCCA 3PFIA 2IX3A 3DDOA 1ZI9A 1KEPA 2IOFK 3CLKA 1ZD9A 3GGCA 4RMIA 1P3JA 4P35A 3ZV7A 1VPLA 2Y1OA 1TTTA 3U16A 1PW5A 1UJ4A 3W4JA 1CE8A 1JKFA 3EPRA 1WXEA 3HBJA 4M9QA 3U7IA 3V2HA 4F93B 3L8CA 2H0AA 2HMAA 4MXDA 5DIZA 1Y3CE 2BF4A 2YV1A 1O97D 2JFXA 1T24A 2BD0A 1DAOA 1QHNA 2YZ2A 1GDDA 1PNQA 2BM1A 3C48A 4MLCA 3P2JA 5F2OA 4DLWA 2GZAA 1O96A 2CL7X 4BC0A 3QUQA 2V96A 3HCFA 1QIMA 4OI1A 2RARA 1RRVA 3EW9A 4K6OA 5FP0A 3X44A 5K8VA 2ZGVA 2NV2B 2FRDC 1JTVA 3LQKA 4HGOA 2VJMB 3AQ4A 2VG8A 2D5LA 4XIJA 1T9DA 3ZI0A 2DWOA 2OV4A 4JMLA 1C41A 1Q3TA 4GKBA 2DLCX 1IEVA 2IYRA 3AJ8A 3KLBA 4CFYA 2Q5LA 4GXNA 3MT9A 3EK2A 3PUWA 2OPBA 2WIJA 3TSCA 2HSJA 1ONSA 3G2IA 1TRHA 3W04A 1L8XA 3PCTA 1Z6PA 4WJLA 2QG9A 1XLWA 4EOGA 7REQA 4ENRA 4CLRA 4LC9A 5GQSA 4MUIA 3JV7A 4LRYA 1D7AA 4MEBA 2C92A 3Q72A 2E6KA 1YNSA 3AW9A 4MTCA 3V6MA 2GD2A 2W8ZA 4ZQIA 4KQ6A 4D4IA 3UFXA 4F1WA 3G8YA 4FNGA 2ZU6A 1SXJD 4DOMA 1QLJA 1UJCA 3AR4A 3H87A 3UOAB 1UIRA 1DAGA 4HAVA 2IVZA 3JWIA 5C4IA 4LNUA 3U7FB 3TL6A 4MUHA 1E7QA 3H5OA 3RTDA 3SKYA 4QYXA 1JZQA 5BQXA 1IZ0A 3HKBA 4INAA 2QHXA 5TXGA 3ROFA 2OAP1 2X8BA 1CUDA 1VIAA 2V0CA 3OHSX 2OV2A 2YZ7A 4NU8X 4WE3A 3RWMB 2QT1A 4FDVA 3EUWA 1L5SA 1ZI8A 1WTCA 1W29A 1DXYA 4KXUA 1RPJA 5A7GA 4JLBA 1E9DA 2HQ1A 2PSHA 5I7EA 5IJ0A 1ES9A 4ZI7A 1NZJA 1Q83A 1NM5C 1NW9B 1XYVA 4H2DA 3NEYA 5FBQB 3T1VA 4DCOA 2R8YA 3M3PA 4F5ZA 4QULA 2AHRA 4NXMB 3W5VA 4IWXA 2AXNA 2Z56A 4ZJZA 2HOQA 1M3SA 2DT8A 3HUDA 1LD3A 4M98A 2OXFA 5DPMA 1ZIYA 4RK6A 1YI1A 1RYHA 4ZHQA 2ACEA 3DFUA 4ZARA 4YY3B 3PEVA 2NLOA 4PXYA 2ZJ1A 3Q3GE 2CXTA 2VSOA 4KUHA 3EIUA 2OV1A 1I2ZA 5F64A 3SDSA 1OKKD 2YJGA 5KU7A 1P74A 2XIJA 2FB9A 3DKIA 3CH7A 1Q50A 2XRYA 3KEMA 3PE4A 3ND6A 2QLFA 2Y77A 1G4UR 2HO4A 3FPFA 3P4UA 4H6XA 5DN9A 4OX9Y 4C07A 4CI0B 1BX1A 1ST2A 1AQJA 2V5AA 3WLOA 1AHNA 3Q0IA 4I9FA 1ITZA 4UZSA 2IS2A 3W8RA 3W4IA 4KPGA 2J1LA 3C3XA 2V6BA 1VIMA 1FUIA 2JGMA 2CSUA 2Y8EA 5JAOA 5EN4A 2P9QA 4OP2A 5DNCA 2YXNA 1D5WA 3QEMB 1Z08A 3FDJA 3C98A 3GCGA 3NWJA 4B6EA 1HLFA 2NVWA 1H9CA 5T4FA 1SCIA 3SR3A 3TIFA 3JY6A 4R7GA 2PSJA 4AECA 3UAGA 3WK9A 3LDUA 1NXSA 3QVLA 3T7EA 5CXSA 4NCXA 3MCWA 3WGLA 4KGDA 2A9RA 3EDQA 2W6QA 5IK2A 1UMCA 2FWIA 3PS9A 4XDGA 5AVSA 3TX6A 4ONEA 3EUEA 4CTJA 3QKUA 3CR7A 1X38A 2PT5A 3JQFA 3NI2A 5HHTA 2I0FA 1L8OA 2GXUA 4Q0MA 4AUEA 2AN1A 4G5YA 4GKKB 1IAVA 1NVTA 1VIYA 4B34A 4IH1A 1SCBA 4UDOA 5DSTA 5C5IA 2H1RA 4E5PA 3NIBA 3PHBE 4FN5A 5FBVB 4NPAA 4BNFA 1RZRD 1E77A 2H63A 3TTSA 2C9YA 1OY1A 2GN1A 2DKFA 2GBLC 2QTMA 2DPLA 3I1YA 1PUXA 3JSXA 2EZ9A 5AKEA 5CX1B 4G8DA 1E2MA 2FRDA 1QM5A 3HYSA 4ISCA 1T6XA 3RRZA 4U0KA 3KZNA 1WMAA 4D8WA 2JFHA 4C0SA 3DZ8A 4QPJC 4AQ7A 3IMKA 3B5JA 4E1BA 5C8DA 4Z4GA 4G0MA 1HMPA 5BNZA 2Z2ZA 2HF9A 3SVLA 2XQGA 4R31A 1YDGA 2YWXA 4AB1A 2QTAA 3UA4A 3IIEA 5LB2A 1ZMBA 5K0GA 5FI0B 4DR7B 4K6MA 1YOBA 4Q21A 4FOOA 5BT8A 1C50A 1RYFA 1CFJA 4LIPD 1PFUA 1RIIA 4D43A 5AVYA 1NVEA 4BJ3A 4QTUB 2AOTA 2QUJA 4NICA 4OYRA 2OXIA 3VYTB 3X1WA 2VDMB 2CMDA 4TXMA 1KMIY 3F5SA 1AUOA 1KVRA 3MWYW 4M22A 3H04A 4FEGA 3E3LA 3PNQA 2HMSA 1JFTA 5AH0A 1ZN7A 2Y68A 3L0YA 5D3QA 2WKQA 4UXIA 1RI2A 4FD2A 3KJIA 4MS1B 3IVAA 4C5CA 2IEAA 4H3VA 2JFYA 1X1BA 4N0PA 5LYJA 1XRNA 3ZE2B 2BHLA 1U0FA 1M5UA 4ZICA 4D0RA 1S3IA 3KB6A 4BMXA 4W5TA 2BMDA 4ZV4A 1OXVA 4DNQA 2I7XA 1SXJB 2Q1WA 1N5IA 4IR7A 4GQBA 4YQEA 4MV8A 5CFMA 2HF8A 1HBJA 3QEBZ 2BTOA 2WD8A 1WABA 2HU5A 3FUCA 4NYIR 2VHQA 2RIPA 4DQ0A 1QIIA 2WNIA 4RABA 4YJGB 1NM5A 4J0HA 5JCJD 2FI1A 5CVDA 2D1SA 1KOGA 1AU9A 3IIJA 1ZJJA 3I9NA 4TQAA 3IPXA 4F7WA 3TN7A 1SXIA 1XP5A 3M83A 1GZ5A 1D9ZA 1USVA 1E3WA 2J0QA 1AO0A 3JQGB 4KNYA 5T64A 1J2TA 1ZJWA 1YDFA 2JFPA 1M0WA 4YMLA 4PAMA 1IBCA 1XU7A 3D4NA 4I14A 1ILWA 4F4FA 3UIEA 2WF9A 5EJ6A 5T7BA 1JDTA 3C3DA 4YCNA 3OPYI 2IDZA 3EG5A 4MWBA 2CUKA 5H82A 3VHXA 1E4OA 2Q1XA 2VYND 3IX7A 3OJFA 3MJFA 2WKRA 4YC7A 4MYHA 4DZTA 1KEKA 1MEEA 2DUUA 4TTPA 3C1TA 3CRMA 4L4XA 3KTAB 3DBRA 1M54A 2O8CA 1R6AA 2FN9A 3SJZA 3C3MA 1NNUA 5HCUA 1ZRMA 3I9V6 3HB1A 3UO8B 1VJCA 3C97A 4G1FA 4UE6A 1HNXB 1ZWKA 1XI2A 3ADPA 1KORA 4MYCA 3QVGA 4MW9A 5LN1A 1J42A 2FUG1 3CZ5A 2R8ZA 2GFQA 4RIFA 3GQBB 4BTVA 3NAMA 3ES9A 1TEVA 3A1WA 5FDFA 3IIKA 2G8NA 3KL4A 1W34A 3CINA 1DBRA 4A82A 1IQPA 1J23A 1MTZA 2IZ0A 1RTTA 1ZW1A 3AV3A 1F2TA 1WPXA 4I5IA 4MICA 4RZUA 1XA4A 4TQUS 4E12A 3S81A 1OD6A 1E62A 1SKBA 3VR5D 1L4UA 4QRDA 3DONA 1UC8A 2OMEA 3IAS6 3QF4B 5CD1A 1LEHA 3I3SR 3ILXA 4BQOA 1R5JA 3BIXA 1JWLA 3STTA 4LY0A 2WHXA 5GAJA 3IT1A 1RXCA 1OV6A 5LZ5A 5TNXA 4MDEA 2B37A 1UMDB 3EPJA 1R6TA 2HK9A 3N5CA 4IILA 3MUEA 1JQ3A 1O9GA 1QS0B 1ZKDA 3C39A 4I9UA 4AG5A 5AI9A 3K9WA 4X85A 2IYSA 3UMVA 2GBLA 4BNWA 4DLBA 1HX7A 3OIFA 3QUCA 1C1XA 5AJVB 4BUZA 4RGYA 1SZDA 3QXCA 4NYMQ 4PLTA 4QEKA 2VH5R 2LDXA 3UK0A 1E2PA 1VI2A 2GTHA 2IYWA 2RCNA 4E30A 4BEBA 5CFPA 1OU0A 1TA0A 1U3CA 2F9MA 3PE3A 4IL5A 4UZEA 3TTYA 4EMSA 3DJYA 4GXQA 1U2ZA 3RVBA 4BLRA 2XXAA 3USCS 2E3JA 3PZRA 4BMCA 3K6RA 2CE7A 3KEFA 4KK4A 2IXTA 1XZHA 1IHUA 1NOKA 1M6HA 2IUYA 3DHEA 1ZA1A 3KQTA 3OZGA 4V0ME 3EXFA 4OYHA 4ZT7A 3KYJB 1QC5A 3N2LA 1V7PC 2DHDA 1PTJA 2ZYHA 4NOKA 1WB6A 2FRVA 2IXEA 2Z1MA 3GJYA 2M1ZA 5CB8A 1MBZA 2QR2A 2PD3A 3GJSA 1D3AA 2JGEA 2GWRA 1FFWA 1V9CA 4Y3UA 5ALQA 2BHNA 3NBZC 4XDHA 2FWRA 2I6GA 2VOEA 2ZCUA 4PIMA 4EJSB 3GCZA 1UDCA 4EGJA 2QMQA 4EPYA 1O95D 3EYWA 4CMCA 3ZWVA 2F64A 4C7OB 3B89A 2W70A 3WYFA 3ZU4A 4C30A 2RCYA 2W2MA 7ADHA 3FLEA 1L7AA 1E2QA 1FW8A 2Z3VA 2GVZC 3CH4B 4QAQA 5JMTA 2X5NA 1E3EA 1DJLA 4L3VA 4DLPA 1KO1A 1SRRA 4IVQA 2X7HA 3VPCA 5E6SA 5DWDA 2QEQA 2A33A 1PZHA 1WM1A 1IPEA 2FH5B 2YJ5A 3Q6MA 3FIUA 3OC6A 2XNKA 4ZT2A 4YFVA 1EP1B 1DRWA 1M6VB 4TRJA 4Q1AA 1VPVA 1ZGGA 3LUDA 3FSJX 3O90A 4RGQA 4XWWA 1T5IA 5CB6A 4D99A 2SKCA 3AFOA 1DAIA 4RMJA 2J3EA 3DZKA 2FE4A 1G5RA 1Q1BA 3KKOA 1UOEA 3EEIA 5KTTA 1K86A 2CE2X 3D7SA 1WZNA 3HVKA 3R5JA 1BDIA 5A3RA 4FHEA 4UEQA 9ATCA 4GBMA 1XTTA 4FFWA 5AI8A 3DOCA 1Z0IA 1NQUA 3G79A 3LQ4A 4LXYA 4QTYA 3KSZO 4LDPA 4Z54A 4UVIA 1QHGA 2ZVPX 3EZ6A 3L7MA 1D2EA 1P2BA 3NVMB 4Y6RA 3WLKX 2G7MC 4W1RA 3JQ7B 3OAAA 3FUXA 1G55A 2EEZA 2WYHA 2OGWA 5AP9A 3TLEA 4TS9A 4DC9A 5G1NA 3R44A 1X77A 2XQJA 2DQYA 5BV2P 2CF5A 5KSPA 1C1DA 2X22A 5ESRA 3Q8WA 3OHPA 4IDAA 4ENVA 3AY3A 3WLRA 3JARA 5G0UA 1Z34A 3ZJYA 4OHPA 2XNSA 4BBAA 2V5UA 3MUFA 2NT4A 4WMLA 5A3VA 2PZBA 4YRTA 2NT3A 2KJQA 4QTTB 2IFTA 3BS4A 4AZ0A 4JLUA 3H1BA 5DB4A 4AWXA 2XYVA 3LDAA 1T3HA 4J03A 5IJXA 5B7PA 1MJFA 1SVMA 2WW8A 5CLFA 4DR2B 1ORVA 2WU3A 5CA0A 3IJEB 3RO7A 3PFCA 2EDCA 3DOIA 3SXPA 5HMMA 1DIBA 4YBRA 5I8WA 1JXMA 5B4VA 2QL6A 1O3YA 1QIEA 4WY5A 1BVHA 3THWA 1U0RA 4BGIA 4LA4A 4AYWA 2RBKA 5B7QA 1V4VA 3KBBA 1E1QD 1KXZA 3VPSA 4G5SA 1URPA 4U6QA 3HCNA 4R69A 3LO5A 3SY8A 4A0GA 1XZQA 2XQFA 4NK4A 5CVEA 1IY0A 2AD5A 5WRFA 2YJ3A 4UXJA 3J7TA 1NONA 1KEVA 4DYHA 4M1MA 1POXA 3EOAI 4IIUA 1MVOA 5AM5A 1GHTA 1P7WA 5FUWA 5TX7A 5J58A 3PYMA 1QE3A 2EJUA 1YI0A 2OK8A 3EDYA 2EWVA 4JP2A 1QR6A 4H35A 3UCFA 1B93A 4LMPA 1AIPA 1JU4A 2QTTA 3H5VA 3UT6A 1K6MA 1YA8A 4ATNA 2C1XA 4QU8A 1T8PA 1AUVA 5AM2A 3ZK9A 1M2VA 2GHQA 2WICA 3QEJA 3VC3A 3AF3A 1ESMA 1G20A 4KKXB 3LC7O 4MGYR 3WQBA 2O48X 2TYSB 4NVRA 4RJKA 5EJEA 1XAJA 1JFVA 1Y4DE 1Y6ZA 4NBNA 4YI5A 5SZHB 2ZSUA 3KLNA 3CX7A 3ANYB 1YL7A 1S2LA 4XUDA 2BGMA 4I50A 4OYYA 3IE2A 2PMKA 4IDCA 4QGGA 3GLUA 1VBKA 4BWVA 1AVTA 1SWWA 2C0PA 2CWWA 3L1KA 1OXTA 4LBWA 3BH6A 3EF3A 4QG7A 3T54A 1Y81A 2P9YA 3OF3A 1L5KA 2ZYVX 1L1QA 5GIPE 2ES4A 2O3SA 5AK6A 1VM6A 3BWMA 4R5HA 2JK1A 1P4SA 2DUJA 3NEJA 5DU2A 4J6EA 3P2KA 4N48A 2MSDB 1WXXA 2GM5A 3DFMA 4KUGA 4EJ2A 3BWEA 2AI1A 4D82A 5GGYA 1FLDA 5ADVA 2YMPA 1RXWA 1Q0QA 3K8OE 4BJHB 1KZGB 4D9EA 4O1HA 3SLKA 4GW3A 5FX2A 2Q3EA 5B4TA 2J3KA 3GGJA 4AL4A 3VH3A 2OCIA 2PXAA 1NPYA 4R1OA 5IMBA 3CLTD 4QT0A 4HB2A 4XR9A 4RA9B 3A4NA 5IH7A 1NBHA 4NBLA 4EYQA 3C8DA 3FYTA 2PXHA 1QONA 2A4KA 4R2MA 4XUEA 1PQPA 6ADHA 5EWJB 1W87A 4ND1A 1DS6A 2NUPB 4HGRA 5IU6A 1C0KA 1F0KA 2QDXA 2X76A 1ZAYA 4L28A 5CPBA 3UK7A 4DNPA 1OLSB 4FMDF 2O05A 2XB9A 3FETA 4LOJA 1Q7TA 2A9KA 2QM0A 4U1RA 4JVOA 2PM8A 1JG3A 3DZHA 3KAQA 4MIYA 4QDOA 3RLFA 5ITSA 4NXNB 3EUFA 3E2PA 4RD4A 3RU7A 1T36B 4P31A 1RLIA 1LS1A 2XTAA 2Y6UA 4N6GA 4F5EA 2ZT6A 2GBCA 3A8TA 2Q5QA 4K7JA 2FMHA 3GZJA 5EIHA 3D6AA 1S2GA 4HEA6 5DO9A 3T7AA 3USZA 3W8DA 1OX6A 1F48A 1SBTA 3AERB 3C85A 1A9SA 5K8CA 1LDBA 1A8QA 4D6PA 1R8JA 3B13B 1L7BA 2C8LA 2M6LA 5ADWA 1DINA 3WIBA 1U0JA 2R84A 4NMLA 4A8JB 5H7XA 5CH8A 4TX1A 3W1VA 4P38A 2JF0A 4G8BA 2DFDA 4XLLA 3OQHA 2C07A 1GNVA 2J5QA 1UZMA 2CXHA 2WHEA 3L7KA 4JUDX 1ORTA 4LRWA 5THKA 1BMQA 4AUNA 4LF8B 1T3SA 1XRRA 2DBVO 2VUSA 4PAGA 4NS4A 3GFPA 5ALTA 2FX3A 4PX9A 4AYXA 4XTCS 1EGAA 4A5OA 4N47A 1II0A 3DDNA 4FFLA 1QWSA 1GILA 1SVWA 4D9KA 4E88A 2QN6A 3L9XA 4RF4A 5ISMA 3SSAA 1ECCA 1ULTA 3TXAA 3O8NA 4MP8A 4O02B 4MDHA 2L42A 5E1OA 2EWWA 2VLBA 3D2LA 4JLKA 1SVLA 4P8RA 1A2KC 3FI9A 3KU4A 3BRCA 2WFZA 4MUEA 4OFXA 4RC9A 2UZ1B 2PUAA 2VT7A 2OLKA 3G2NA 3LXMA 4HEHA 5IJAA 1TQDA 1OZ0A 1F9EA 3HM2A 3CURA 1QQ6A 2A9FA 3MCAA 4LJ9A 5F73A 2UUBB 4EW2A 4PHGA 3L7LA 4ZVVA 4FIZA 4WSOA 3FDXA 1PZFA 3GFOA 2ETXA 2VATA 1VSVA 4DLLA 2DC1A 3KVVA 4WZBE 1PFWA 2P9HA 2D59A 1QZZA 4QGBA 3H6HA 2G08A 2EXXA 4QO8A 4GPZA 4BX8A 5KTYA 1XV5A 1S3SA 1AGRA 1XFDA 1M8GA 1JXAA 2QG4A 2FW8A 3A9RA 3AV0B 2DHRA 3RAFC 2PT6A 4TMYA 3UOWA 4WADA 3WRXC 1NW7A 3N6VA 1I6WA 4LDRA 1CP3A 3P97A 5LCXA 3ZGLA 2EBFX 4OB7A 2FFJA 3EGXA 4K6FA 3V34A 4FMCF 2LXNA 2QGZA 3L8EA 4FTWA 3WSVA 3WWYA 5A2GA 1MV8A 1DG1G 2AXPA 3KE9A 2QZZA 1VCNA 1AURA 2JLSA 2GRUA 2C61A 5LQRA 1N92A 1UKEA 1N0VC 2FXIA 4M8IA 4DRYA 5IPFA 3SJAA 1JJIA 2OLEA 3BRQA 5BRNA 1GU7A 4ZO7A 2HEIA 3MGAA 4Q12A 3DWEX 3KDAA 1WCIA 2ILVA 1WPRA 4JJ4A 4ZAYA 5J63A 3RVPA 4E4YA 5BMVF 4DUGD 4ANFA 2IY7A 2YINC 2X7JA 1ZXBA 3R6WA 5K3EA 3RVNA 3WMRA 2IZ7A 4GU5A 5KYUB 5AICA 2XUZA 2HQSA 1TA4A 3ZE0B 2L0XA 4R8RA 5DRYA 3F4BA 4G4SP 3KEQA 1DEAA 4GO1A 4PC6A 1KSFX 1L4EA 3AWDA 4Z3KA 2QRKA 4N3AA 1YULA 4P4NA 4H7EA 2BFDB 2YUIA 5BVGB 5DM2A 5HKKD 1NUPA 1TKRA 3QU7A 1TUEA 1JLRA 2ANBA 3STVA 2XTJA 1ULBA 2OQIA 1CDDA 1XRMA 4GLBA 5CITA 4R41A 2EU8A 5LKAA 4KVGA 1ZUHA 2JJYA 1Z7EA 3MTBA 5KVVA 3BFPA 4XJXA 4RDIA 1FU7A 5CAEB 4PRLA 4A92A 3AUTA 3COWA 1RJWA 4TWZA 5IUJC 1DIHA 3UAZA 1S3FA 4RA6A 5F4ZA 2DTXA 3TR0A 1U90A 5ALPA 3WYDA 1NKSA 3HV2A 1DBWA 1NTRA 4RMGA 1XCLA 5JD5A 2OCYC 1YCGA 4MGHA 4AZ3A 3IBFA 3M6VA 3RPEA 5KNCA 1G5FA 1R0KA 2B5WA 5JCPA 5LP6B 4F6RA 4ZI5A 4ZYVA 3ZEIA 1HDRA 1UJNA 2HU2A 1Y7TA 3WO1A 2OM6A 3DS8A 4KVAA 1SUBA 4O2RA 4MYRA 4KPEC 4P32A 1KR5A 3VZPA 3O0DA 4PSVA 4DLVA 3VTZA 2FQYA 2ZT5A 3QXJA 4GLJA 2RBGA 1QGOA 3CYFA 3JX9A 2O2HA 2XX3A 3U2QA 2ZUWA 3VO9A 3JASA 4B1FA 2XYQA 1XLTC 3OOYA 4OKSA 2IIVA 1NI3A 5H3LA 4CGYA 2RHHA 3AVUA 3T4PA 1KIFA 3C6BA 3QTTA 3VV2A 3GIWA 4Z99A 3CCCA 4RE5A 4X97A 5CJPA 5EIFA 3Q3EA 4J1QA 1Y3BE 2BKVA 4S05A 2QRMA 5JDIC 3M89A 1XRJA 5GONB 4BUCA 3QFFA 2D4AA 5K6TA 2C7GA 4NJEA 4K3UA 1PBNA 4OV6B 3VU8A 1B4DA 1UBKS 3FRJA 3L18A 1LQTA 2WP0A 1F06A 1ATIA 3NC1C 2V7QA 4DIBA 2GKOA 1AGXA 1PX0A 4DA6A 4POOA 3E5HA 1FW6A 4INPA 4RSRA 1NN3A 2ZUCA 1VG0B 1F20A 2QWXA 1NURA 3BL6A 1R5BA 1X1QA 3HR8A 3QY0A 4FJ1A 1NWCA 2QQEA 2VWPA 3FJYA 3NRBA 4KWHA 4N5DA 4Y2UA 5JFOA 1YF3A 5KVQA 2XA2A 1V37A 4DCNA 1U8YA 2PS9A 3HG7A 5LVAA 2YXPX 3CKYA 3QX9A 5CB4A 1ZM3A 2ZYAA 4MVJM 1O03A 4NDAA 1QIKA 4DLZA 1NP3A 2RGBA 5ALHA 2WYIA 1GXSB 2SICE 5T4BA 2O8DB 2C4UA 4MVJE 4MK4A 3WRYC 3GZ4A 4DKXA 1D07A 3CRW1 4Q3AA 3WRXA 3EVCA 5ILQA 4RTKA 4B31A 1MUUA 3L4JA 1CUUA 1NRXA 1S0UA 3D6FA 5IEBA 1K4YA 1WY5A 2UVPA 1OLOA 1U8TA 3E3AA 4TTRA 3U80A 4CG0A 1NVMB 3PXBA 1LU9A 4AP9A 4JXXA 4GM4A 3N05A 5JSZA 2AN3A 1GUFA 2Q9AA 1ICIA 4NE9A 4D7AA 4FP9A 1JJ7A 2VJMA 5KNBD 5G0VA 3QA9A 1GKLA 1TM7E 1U04A 1I0LA 1WUHS 3RRBA 3EVDA 3RAJA 1EVJA 3DMGA 5BR8B 4CNQA 4FE4A 3KT3A 3ZIAA 3M3DA 5L4LA 4WZ6A 5IHXA 3GVIA 1KY3A 3IOEA 4B7XA 1LBIA 5GVSA 1XTKA 2A0XA 3BJIC 4WK0B 2I8CA 2L2QA 3CRVA 1CQXA 3MWJA 3B5IA 2D1QA 1IY1A 1I0IA 1TTQB 2BKXA 4IQGA 3BICA 3L8DA 3HP7A 4NONA 1Z4IA 1D9XA 1PTKA 4ZK2A 2KMLA 4D74A 3FWZA 3WYGA 4ND5A 5J4LA 5AKIA 3L8GA 1TUBA 3N70A 4IJWA 1Q2UA 3WIVA 3CS3A 5IWCA 2JHCA 3VSEA 1WS6A 1WXQA 2R97A 3K7EA 3TW0A 1PLKA 3ZTTA 5PGMA 4O2BF 1UBTS 3D4OA 3HO8A 3AFMA 2PU5A 3SEZA 4EUNA 1D1TA 1FFBA 3G02A 4R8VA 2AZXA 1XQVA 3RT9A 4DJTA 4UAUA 4IGKA 1XMJA 3UJ6A 4D9GA 2BI7A 3W9UA 5JWOA 4BLTA 5I47A 2RGWA 3D2BA 4EKDA 2W98A 5LWQA 2QTHA 4PG6A 1EM6A 1VIDA 3N0VA 5C51B 5BUZA 2X8WA 2C59A 4PO3X 4EI9A 4EY5A 1C7JA 2EOAA 3ECAA 4JOSA 3ICQB 4I19A 1EIWA 4IYRA 2ZITA 4G2TA 3Q5GA 3KFLA 3WLIA 3K09C 5JBQA 3KKLA 4Y6PA 1WBDA 4N41A 1L7DA 3IUJA 3VU3A 2ATIA 2FZCA 2JGLA 1DL5A 1TGYA 5DXFA 3E7PA 4A1OA 2ID7A 1G6HA 1ULZA 3LWBA 4Q7EA 2HTEA 2P2ZA 1X7YB 2H31A 3CZQA 3MBIA 4RK7A 3WGYA 1GPH1 2OZEA 2ZJYA 1I3MA 1XLTA 2AYZA 2P62A 4OK3A 1GG9A 2XUIA 3OX3A 4BP3A 1M72A 1E6CA 1XN4A 3K8ZA 2D7JA 1Q15A 1X7WA 2NZ2A 4YACA 1Q5PA 4F06A 5JDIA 3ICEA 3ZDEA 4HD8A 4J0FA 4D42A 3PG5A 2Q5IA 1X1TA 3E9QA 4BV9A 4CMKA 3B6IA 3BIWA 1G4HA 3S44A 4D4KA 3N8HA 3GA5A 3DPUA 4RANA 3Q2KA 2QX9A 3TLKA 3MMZA 2XKKA 1E7YA 2ZI5A 4G84A 3T34A 5CCDA 1X2EA 3T41A 4X1KB 4A73A 1GGVA 2TMYA 4YMSA 5AT1A 2QNBA 1Z17A 1GRNA 4L74A 2RAPA 5GZ6A 1QQ7A 2RKWA 5D85A 3S70A 5NULA 3PRYA 3A1SA 3U4DA 3I1JA 2QTBA 2BHRA 3FOAA 1UBOS 3EGDA 1PWEA 5EIOA 3IAXA 1OJ7A 5IKXA 4U7JA 4TZ6A 4CM8B 3L0DA 2KE5A 2J46A 4DJJA 2QAJA 1CEXA 2JHAA 3LTEA 2FW0A 3ZW9A 5IG2A 3WRYA 5IT4A 4OXRA 1TZMA 2GYYA 2I1VB 3E0QA 4JBGA 4CIBA 3NIDB 4A8HA 5E9AA 3OTHA 3LVRE 4BNMA 5F7XA 2LUOA 2QSUA 3WGHA 4DIKA 2JI6A 4RZSA 1M66A 5T8KC 2V1UA 2GPTA 5DHSA 2PCLA 2N75A 3V8RA 2YXBA 3AFGA 2QRNA 3NIWA 5DCUA 3R7BA 3WK4A 1XDSA 4TMFA 3IOMA 1P1KA 2V5VA 5CVVA 3P9ZA 1BKSB 1HC7A 1UBNA 2ZS8A 3QPAA 3ZUPA 5FRDA 1VSQA 5L7WA 4TKUA 3HSSA 2WILA 4FYWA 4YGXB 4D45A 3FLBA 2PMEA 4OAOA 4P3OA 2X42A 3KDSE 4PONA 4LXIA 4TV8B 2ZSAA 3PX2A 1XG5A 2HPAA 4ZPXA 5FUVA 1L7EA 1JG4A 1F17A 1SBYA 3GNSA 4GOXA 1TKCA 1UAYA 2ICAA 5TRTA 4YRIA 3GZNB 2PR7A 3ZDYB 2VXBA 3BH7A 4ZGBA 4Q3CA 3VDNB 5LMNB 2PUCA 3E82A 3WLQA 1XZJA 4GR9A 3GP3A 4Q7JB 4MRMB 4BX3A 3V1NA 4KSCA 3NDJA 3H8SA 4JBXA 3UJBA 4ZN6A 4BO9A 3BFKA 2DR2A 4OREX 4Q34A 1TJNA 2Q99A 3O31A 1T4CA 3W5UA 1AN9A 1XZPA 3DDCA 3PT9A 1PV4A 4BZQA 1E63A 4RYLA 4KQIA 5IYZF 2NGRA 4MR8B 4GZ5A 3G68A 3PC3A 4L9SA 1WXHA 3LYLA 4CEJB 3DQPA 5IDWA 5J5CA 1WOMA 4KKVA 1TUIA 2YS6A 5EZYA 1N33B 3FFBA 1ZJYA 4DR4B 3F6CA 1FUEA 1PNTA 4JROA 3IVXA 2D0PB 2CNDA 2ZUVA 3W1WA 4CM3A 4HPJB 4EI2A 2TRSB 4JR2A 1YTUA 2AMFA 3GG9A 2H2GA 4LRTB 2QRGA 1GUDA 1WIWA 3DTVD 4FGJA 4URFA 3S2IA 4A23A 3U5TA 3DYBA 3WBBA 1PGNA 3JWPA 3UV3A 5ADUS 3D2CA 2EZTA 4JBLA 1NI4A 2P65A 1RIFA 5EMNA 4B46A 3JQGA 3TVTA 4BQQA 1OPXA 1GCUA 3MT8A 4Z1MA 1MO5A 2FPPB 1P1BA 1ML4A 4HUJA 4JYAB 3K09A 3KQSA 4QUIA 1UBMS 4UREA 2HQRA 1MV5A 3AUFA 5DWQA 1HE8B 4EJMA 5ABPA 1FNBA 2A2ZA 1H8ED 2HB6A 5KI6A 3DCYA 1Y98A 3RU3A 5CNIA 2YRWA 5DN6D 1GTG1 1XXLA 5JS2A 2JIQA 1T1IA 4MW2A 1KTIA 1VRVA 2OXEA 1DCKA 1X74A 4PNHA 1G8PA 1Y1SA 2PQ0A 3KTAA 4FHCA 4JKYA 4O4IF 4IEFB 4FSDA 4XQEA 3I9V1 4YEDA 2HV8A 4ZVTA 5FOUA 3TPFA 3THXB 1JR4A 3S2SA 1NP7A 3HJUA 1NBWB 4JX9A 1NF2A 2R86A 2VPIA 3OM0A 4KSBA 2ET6A 5E95A 2AJTA 1ZD1A 2YYSA 4K46A 5CLHA 3TJRA 3M4XA 4YPFA 3GPLA 4XYLA 2O6HA 3GOQA 1COZA 2W43A 1Z68A 3BMOB 1C4OA 3PX7A 2HCTA 2Z5LA 3I5MA 3BUSA 3NHKA 4DDTA 1D6NA 3L46A 4C4RA 1FP1D 4RK0A 3MMXA 1OR8A 4IS3A 4G1VA 4XZ3A 3F97A 3ZDQA 1IZ8A 3IAS1 4Z4QA 1UC9A 3QF7A 1GAEO 1Q57A 1LNQA 2OMKA 4NCKA 5CX4A 3RTGA 3K0EA 3VC1A 1E3JA 2D0DA 2BEWB 2BTQA 2XE6A 3FRHA 3RTAA 4UUBA 2PH7A 4P54A 4QOGA 4ZAZA 3KM0A 3K2EA 3FYUB 3MSCA 1RWQA 1ZONA 3HUEA 2VHTA 3EARA 3GLFE 1N2JA 1NSFA 3GUUA 2F1HA 1HOXA 4HX5A 1FYEA 2RDMA 3D6VA 4LHWA 1CJUC 1ABEA 3L1IA 4PQEA 3ULKA 4YJ3B 4OQYA 5T8KA 1NQAO 2O14A 3QWFA 4D02A 5KNCH 2EG9A 2A1UB 1M7BA 4JEHA 1YQEA 3S5JA 1JA0A 2ZR7A 3SDZA 1JJFA 1QBGA 2DH6A 4K3VA 5H68A 4N5HX 5BUSA 2BGGA 1K89A 1W88B 2IW1A 1HT2E 3SKXA 1EGHA 5KYYA 3DF9A 3FPAA 3R5XA 4PX3A 1PEDA 2Q3JA 2HJGA 2UDPA 1UK7A 4L95C 3ESZA 2ZDHA 4U2FA 5EE0A 2GM9A 3N0TA 3J80A 4D3SA 3NRJA 1E2DA 4FSHA 2JKVA 3L4BC 1JMKC 2BKAA 3A37A 3BD9A 3OO1A 4NYJR 4Y2TA 2JATA 1TMGE 3G0IA 4HQ6A 4QODA 5DGIA 1U1IA 3RFTA 3K2BA 2M6KA 4P5EA 3HWSA 5KKCA 1K1EA 2AE1A 2VKQA 4RS4A 2A5YB 2NTEA 3BGOS 3S8YA 1IHYA 2G25A 4ZVSA 3JRWA 2P77A 3QBDA 3E1KA 2K2WA 1YJ5A 2WWGA 1R5OA 1Z0AA 2IOFA 4TUYF 3ICOA 1E1MA 2XZPA 4FOTA 1Z15A 5JAUA 1CUAA 4ZJUA 3H5IA 2H7YA 2VWGA 5ED4A 3BVPA 1MDBA 3ABQB 5BNFA 4KMSA 3BRWD 4NJMB 3MJRA 1UKAA 4ZA2A 2DRIA 3F47A 2VUTA 3T52A 4XYGA 2IYUA 3DKPA 4BZPA 1CY7A 1WXDA 4IDEA 2Y1KA 5DYTA 1BAPA 4R01A 1BDMA 2GYVA 4EQ6A 1T4GA 1Z0UA 2P6RA 2YMQA 4X3PA 2FE1A 2CB0A 2C5GA 1M6VA 4ZOLB 1SBCA 1X1DA 1O94C 2BN4A 2UKDA 3I04M 4IZ6A 1Z88A 1NQOA 3NAGA 2NOAA 1SUWA 3KZCA 4OAQA 5KC9A 1VG9B 1CRQA 2R65A 3H3JA 3OZSA 2GOYA 2AR0A 3NTXA 1SBZA 1SVUA 1TZJA 1JKMA 2IY8A 4IZOA 1HK7A 2JJMA 4ZWNA 3ROEA 4FX2A 4KYTA 4EMTA 4MPRA 2W6JD 2WT9A 3DTVB 4IMJB 3HC7A 2ZB3A 2OZLA 4F91B 3F6SA 3KE8A 1QSGA 2QGFA 2JFNA 4A4DA 4C76A 2NQ2C 3V42A 3QLVC 1EB9A 3RYIB 3AEUA 3EULA 2ZRHA 4M1OA 1NMSA 2PRIA 1ZNYA 1CY0A 3FNGA 4UDYX 3E4CA 5JW6A 4KGXA 3B9BA 3HMKA 3OCYA 4ND7A 4YQZA 3FLAA 5IM4F 2JGIA 3SPXA 3SQWA 4JHLA 4RM2A 4YCMA 3AT1A 3TVYA 3ADDA 2NXWA 2H2IA 3FJ1A 3KPUA 3NP9A 3Q11A 5CCBA 2YY5A 1OI3A 2C97A 2FOIA 1ESCA 4I46A 2XQVA 2Y92A 4FIDA 1P1HA 4A0HA 5CYPA 2V7XA 3O8BA 4FDMA 4G0NA 5CFNA 1BJTA 1P0IA 1Y9EA 6REQB 2HR1A 3EH2A 2IC5A 4J94A 1K8RA 1BMDA 3TR5A 4YWJA 5A4KA 2H00A 1SC9A 1SMKA 5A5EA 4UUQA 3I2FA 1O5TA 1C29B 4JKOA 4CLEA 5CDGA 1JR2A 2AJ8A 4EIWA 1E3TA 4RTNA 1NKVA 4KOAA 1U3DA 3HYNA 3NOVA 3WZLA 3EWSA 3V3KA 2R7LA 3DKVA 1DIAA 3WWDA 4BMDA 2GJKA 3AF0A 3LSTA 5KU1A 5B36A 2W6ID 1AZTA 3RUCA 1ENOA 2XDWA 4B3BA 4Z8XA 1MR3F 1UQTA 2JZNA 1JR3A 1QP8A 1VLZA 1XTBA 2G1UA 2VDWA 3KQYA 2EJTA 2ERYA 2O2YA 4KVFA 4MW1A 2Q1UA 4R2LA 5IVDA 4C14A 1RQ2A 1VP3A 5UKDA 2IHVA 3TXYA 4ZVRA 4BNHA 3MXTA 4MRSA 3MTGA 1SCKA 4RWEA 2LKDA 2E18A 2P3SA 1RWNA 4BX2A 4KCGA 1F1JA 1NF3A 1Z38A 4HTAA 4UPDA 5AW9A 3T5GA 2CV1A 1ORDA 2C3OA 1V5EA 2C5LA 3LZDA 4AF8A 4BRWA 2C2YA 1V5GA 3H9JA 2VK4A 1M1NB 4YDRA 3KELA 3Q3JB 1J8VA 1RWPA 1U8XX 1V26A 3IVMA 2SCUB 3THOA 5J59A 4V0QA 1Z2OX 2EC5A 3CLUC 1PR1A 3LZ6A 4LJ6A 4D79A 1HY3A 2FZVA 1ZC3A 4PHTA 2G5PA 4F2HA 2Y4OA 3IHLA 1N6RA 4LHVA 3RUEA 4L8LA 4PAQA 1JQEA 2HU7A 2O4CA 1UDXA 3O4HA 4X8MA 3DHWC 4BHTA 4OAPA 1MO6A 1Y8RB 1VRCA 3AR6A 4REMA 3BM5A 1WUIS 1YRAA 1V5WA 3KRTA 4HWRA 1OXKB 1L5RA 2ZT8A 4A2WA 4WBNB 4AY2A 4B4KA 5AUNB 3W8FA 1QHEA 4R2KA 3ISVA 5EXEA 1EJBA 3LXUX 1M2NA 5JVDB 3IPLA 1M1YB 3DW3X 1OJLA 4O6VA 3U48A 5J1SB 3CVOA 1LC0A 3CR8A 4X5OA 1OC4A 2GPSA 4BN0A 2FTKE 3R5KA 1GPKA 4IICA 4JNKA 3KSUA 2UXBB 1W52X 1PYGA 3QVKA 3FPLA 4V0MA 5ALFA 1JEYA 2PUDA 1R9JA 5A1JA 4LZOA 4D3XA 1TZBA 5KHLB 4F4CA 1LI7A 1XZMA 1B26A 1FZQA 3D8HA 4X6LA 1SG0A 1TEXA 1ZIXA 4TL7A 2RK4A 1VB3A 2XITA 3PQ6A 1NUAA 1PX2A 5FPKA 2H3HA 1XTQA 2VCEA 1SOAA 2VAWA 4ND3A 4R6WA 2HAEA 1REQB 4RA9A 5KX5A 2I9KA 2OL4A 3K0FB 5EWJA 3WGTA 2X3FA 3OOEA 3U13A 2IYYA 2BSAA 4WCVA 3ZU5A 1OLSA 3PXGA 4NNPA 5JMPA 2XKAA 4OH1A 5LA6B 3ZWQA 4PZ0A 3D0RA 1M34B 5FUBA 1PJZA 2B69A 1RLTA 2QV0A 3OZ7A 3BF7A 3RSLA 1OA1A 1PQYA 2J32A 4KG7A 4LE2A 1XVUA 4NR0A 2WG1A 4QELA 5HF6A 1PR6A 1K7FB 4HEA1 3V2IA 5DT9A 2X5XA 2ZW9A 3PWTA 1ZMTA 1CR2A 3ABRB 1WDKA 3KX2A 2QVGA 4K9OA 4MKFA 4RELA 3QKRB 4DCCA 3DE2X 1U0GA 2Z95A 3TTWA 5JXGA 2ZJOA 3A06A 1S89A 3AERA 1JBEA 4X92A 4BNUA 2A5DA 1AQIA 2P4SA 4KRFA 2W2PA 2YXEA 2J30A 4LY9A 3UWDA 5DKFA 1GZSA 1SPBS 4YMGA 2VHVA 5FPSA 5LQDA 3TEMA 3AI2A 2XUOA 2ZI9A 3LVBA 4P93A 1X8JA 5DEOA 3ZQUA 4Q24A 2XVXA 4M0LA 5EJ5A 1ZA2A 2HXSA 1XK6A 4GZ6A 2XEDA 2QM7A 1TLTA 5F7JA 5TGDA 1DE0A 1PG2A 3DXFA 2H7XA 3W6OA 2Y9PB 4UDXX 1ZVJA 1G0OA 4AM8A 3TRKA 2VDLB 3TK1A 4LBYA 3TRJA 3RHSA 1AKQA 3UAOA 4CFSA 3K5WA 1G7RA 4WXRA 3SQOA 4AWAA 1DDIA 1VI6A 3SYNA 2G8LA 1L5HA 4Y9RA 4BJ1A 1N3IA 2ZIEA 5T6MA 3RSQA 4EYGA 3S68A 1EXWA 3IV6A 3UY4A 1EINA 1MPTA 2IYOA 3WDSA 2ZUEA 4J4BA 1YJXA 3UG6A 5CA1A 3GFBA 4DNFA 3RRYA 1DX6A 4V3BA 2M2IA 3ELWA 1NN5A 2ZR0A 1NVAA 3L7BA 3IO5A 1QHFA 1X1AA 1ADGA 3L0PA 4IJUA 1AT1A 4BNKA 3G5AA 5A9TA