5HOQA

Apo structure of cals11, tdp-rhamnose 3'-o-methyltransferase, an enzyme in calicheamicin biosynthesis
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
251
structure length
234
Chain Sequence
QDLRAFVHDSPEETETTQRLTKLLTNSPIPTEELVNNLPLFLRRHQMTDLLSMDALYRQVLDVPGVIMEFGVRFGRHLGTFAALRGVYEPYNPLRRIVGFDTFTGRFAVPGGYPAYLKEVLDAHECSDFFGHVTQRSVLVEGDVRETVPRYLAENPQTVIALAYFDLDLYEPTKAVLEAIRPYLTKGSIVAFDELDNPKWPGENIAMRKVLGLDHAPLRLLPGRPAPAYLRWGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords TDP-rhamnose 3'-O-methyltransferase (CalS11)
publication title Loop dynamics of thymidine diphosphate-rhamnose 3'-O-methyltransferase (CalS11), an enzyme in calicheamicin biosynthesis.
pubmed doi rcsb
source organism Micromonospora echinospora
total genus 69
structure length 234
sequence length 251
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05711 TylF Macrocin-O-methyltransferase (TylF)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5hoqA00
3NWBA 4KIFA 3EGVA 3S68A 5KQRA 1NW5A 4DCMA 5FQNA 3A27A 4YV1A 2O0LA 3ORHA 2ZZNA 4POOA 1SUIA 3KPUA 3E7PA 1VQ1A 2ZSUA 4Y2HA 5K0EA 2UZ4A 4FZVA 2XYQA 4CTKA 2R6ZA 4AZTA 3PVCA 3T7TA 3JWIA 3KR0A 2H11A 4IV8A 3NJRA 3E23A 5HIJA 4QQKA 1IM8A 3CGGA 5EC8A 2ZLBA 5FULA 3SXJA 1QAQA 4OQDA 2AOTA 4PYNA 2GA9A 2VP3A 1KP9A 1YZ3A 3ELYA 1SVUA 2P1DA 4KW7A 3KQMA 2AN3A 4XCXA 4YUXA 2ZWVA 3M6VA 3OZRA 2IBSA 4A6EA 1BHJA 1YFLA 3PB3A 1G60A 3LKDA 2FRXA 2Y1WA 3FTDA 1MJFA 2P3QA 1Y8CA 3BGIA 5E9JA 1KPGA 3FUXA 4GOND 4PCLA 1M6YA 2FCAA 4R6WA 3C3PA 5DM2A 4LG1A 5EEGA 4F86A 1VP9A 5E1MA 3FPHA 4E32A 2JH8A 3MTEA 3B5IA 3R0QA 1G8SA 5KQSA 1KPIA 3QV2A 4X60A 1I4WA 5DXAA 2PBFA 1SUSA 2P3OA 3NWEA 3OU7A 3UJDA 1UFKA 5KS2A 1RJFA 4KDRA 1FP1D 3UWPA 3GNLA 4E31A 3GGDA 4V0RA 5EHIA 3DTNA 3MCTA 2OB2A 1RI5A 3MQ2A 3ELWA 1NKVA 4YMGA 4MWZA 4C04A 3TM4A 3TR6A 1YZHA 2JH9A 3UBTA 4RYLA 3MTIA 2EJTA 3LCUA 4PCAA 2IDJA 3H2BA 2B25A 4P58A 1X1BA 4RX1A 4YUYA 3HVIA 3CBGA 4GC9A 2NP7A 3LKZA 5EQJB 1RI1A 3LBYA 3LPMA 4KVZA 1QYRA 3VYWA 3TKAA 3GU3A 5LQCA 2FHPA 2ZIGA 3KPWA 3O4FA 2C7PA 1SQGA 1ZQ9A 1VBFA 5E1BA 3M33A 5HOQA 5LQKA 2ZWAA 3FZGA 3NVMB 4BY9E 5ICGA 3AXTA 2GB4A 5G02A 1Z3CA 5K0LA 2IH4A 5DM1A 3MHTA 5B1SA 1VP3A 3REOA 2AS0A 4WVLA 2EFJA 2ZFUA 5EMJA 4C07A 1R18A 3DMFA 1VIDA 5DPMA 3EMBA 3TKYA 1X19A 4OA5A 3UJ7A 5D1NA 4E30A 2OZVA 3V97A 4PYJA 5E8JA 1EQAA 3AWIA 2AOVA 3HCEA 1V39A 3QOXA 4PYKA 3TRKA 4EKGA 4YUZA 2UYCA 5CM2Z 1O9GA 2VS1A 2VDWA 4GOOD 1TW3A 1AV6A 2DULA 2PLWA 1Q0TA 3LBFA 4AZVA 5DTMA 2PX2A 1DCTA 1QANA 5GM1A 4U7TB 5HEKA 1JSXA 2QM3A 2G72A 3HNRA 1KIAA 2ORED 3HA7A 2EJUA 4C03A 4RTMA 2YXEA 3GO4A 2UYOA 4HGYA 4QTUB 3LDGA 4QVGA 4HTFA 1NE2A 5GWXA 5C0OE 2G8NA 4ISCA 4MHTA 2Q41A 3MCZA 3LSTA 3G2OA 4RWZA 3JWHA 1BC5A 5GIPE 3LL7A 3SSOA 3I58A 4M37A 4C05A 3EGEA 3AY0A 3TOSA 4M38A 3F4KA 2ZBQA 3TQSA 1IXKA 1RI4A 5DSXA 5T64A 3VSEA 4AZSA 3KQTA 3I5UA 3HA3A 3ME5A 3DH0A 3FPGA 2ZULA 3KKZA 4RTQA 3BT7A 7MHTA 2PXCA 4XUDA 2PXAA 3B7PA 3P2IA 1G55A 1IY9A 4P7KA 2DPMA 1XDSA 3EMDA 5K0BA 3ELUA 4WXHA 3JWJA 3SSNA 4OBWA 4HG2A 3A7EA 4RTRA 3NTVA 4BLVA 4GOMD 4XUCA 4AZWA 5BW5A 3ID6C 1KPHA 3KPVA 4OQEA 3NW9A 5EGSA 2AZTA 3R6TA 3M6XA 3SSMA 4P7FA 1KYZA 2O57A 5DX8A 4RTJA 4CXMA 2ZIEA 3KPYA 3CVOA 1ZGJA 4DQ0A 2PX8A 3BKXA 2XVMA 4QQNA 2I6GA 3DXZA 1X1AA 2ZTHA 3SX0A 4RTPA 4CWAA 3KQSA 2ONYA 2JJQA 1NV8A 2AOWA 1FPQA 1XDZA 2EG5A 2NXNA 1NV9A 2Y1XA 3P2EA 4RVGA 1G8AA 1RJEA 2IPXA 2AR0A 4BP3A 5K05A 2E5WA 3CJRA 3G5TA 3PT9A 3G2MA 5K8VA 2PVCA 1NW3A 4B17A 3UJ9A 2OXTA 3AXSA 5LQJA 2PX4A 1PJZA 1EG2A 3KQVA 4IWNA 3SVZA 3ERCA 4PINA 3CCFA 4KDCA 4LWOA 1R74A 2R3SA 3OE5A 5LR6A 1H1DA 1NW6A 1DL5A 3A25A 3UJCA 5T67A 4LWPA 1FP2A 1TPYA 3HCBA 2IH5A 2N47A 3HM2A 2IH2A 1JQDA 2PSSA 1XCLA 10MHA 3EGIA 4DCGA 4JXJA 3ER8A 1G6Q1 4X1OA 4RSRA 3A7DA 3FRIA 3X0DA 2ADMA 2QYOA 1FJXA 4RVDA 2BR4A 3TM5A 1HNNA 2PT9A 5EMMA 2PWYA 1FBNA 2PXXA 3HEMA 5E9QA 5F2KA 1D2CA 5JR3A 3LCVB 4QTTB 4OX9Y 3HVKA 5EMLA 2AOTB 4XUEA 5HILA 3FTFA 3HCAA 1XVAA 4GC5A 1L1EA 3EPPA 3BUSA 4EMSA 4QDJA 4RTLA 3DP7A 4MTLA 4DA4A 4KIGA 1JG3A 3FYDA 3BWMA 5HIKA 2OKCA 2G71A 4EKIA 1JR4A 3DR5A 2PY6A 2CKDA 3M4XA 3TFWA 4AX8A 1SG9A 3I53A 3T7SA 5IH3A 2PGXA 3IHTA 3GRUA 2HNKA 3M70A 5M5BA 1YUBA 3OZTA 4E33A 1JTEA 2NXJA 4M7RA 5LQAA 4F85A 2G70A 2C7OA 2P8JA 1RI3A 2YXDA 2HR1A 4FSDA 2VDVE 2XBMA 2AN5A 1XCJA 1EIZA 5FCDA 2JHCA 5LQRA 3KR1A 2AOXA 4MQ4A 1ZHFA 2AOUA 3OFJA 4R8RA 1KHHA 4F84A 2I9KA 2QY6A 2CMGA 5CCXA 3LX6A 3GRYA 3KU1A 2YXLA 4HC4A 2BM8A 2BR3A 2H1RA 3LDFA 1JQ3A 5HIMA 5C1IA 4ER6A 4DM3A 4RTOA 3MGGA 2NXEA 1XDUA 5DTQA 1YB2A 2F8LA 3P71T 4Y30A 5DTRA 4X61A 1R6AA 2ZBRA 2XYRA 3P8ZA 5DSTA 3UJ6A 4CKBA 4FR0A 4R6XA 3OU6A 3PTAA 5ICFA 1N7IA 5HIIA 5LQUA 2O06A 2G1PA 3IV6A 5FUBA 1WZNA 2O07A 5E2BA 4EQZA 5E9WA 1RJGA 2IGTA 1AF7A 4ATNA 2PWPA 5CIYA 5HFJA 5CD1A 2BH2A 3BWCA 3OPNA 2QRVA 2HMYB 3BKWA 3C0KA 4ZTBA 1L3CA 4RVHA 5DX0A 3QOWA 1I9GA 5IKMA 4HSGA 3THRA 2B2CA 3KR9A 5K0JA 3O7WA 2O05A 3SGLA 1JG2A 1VL5A 3B89A 1KYWA 4P7GA 5ICCA 2JG3A 3UA4A 4C06A 1ORHA 4PIPA 3C6KA 3I64A 3FYCA 2ZIFA 2OB1A 3FUVA 3LCCA 1WS6A 3HCCA 2YVLA 2BR5A 3KHKA 3KR2A 5DXJA 4HGZA 4RV9A 2XYVA 4M36A 2FK7A 3UJBA 4DF3A 3HCDA 3P9NA 1M6EX 5EHGA 3P9IA 3V8VA 2ERCA 5JUWA 2OBFA 4PYMA 3MB5A 3T7RA 3Q87B 2ZVJA 4KRGA 5EG5A 3TMAA 5K01A 2GAFA 1P1CA 2AVNA 3DOUA 5EEHA 2Z6QA 3DXYA 4KWCA 3G88A 4K6MA 3U81A 4E2WA 2YX1A 4HTFB 1VLMA 5CVDA 3RIEA 2GLUA 5K0GA 1XXLA 2ESRA 1RJDA 2WA2A 3GRVA 1BOOA 3OZSA 4UOEA 4QVKA 3CJTA 3IYLW 3P2KA 5K0FA 1QAOA 3PLAE 2V74B 2FPOA 4FT4A 3P9CA 2HWKA 4L7VA 5LSAA 1D2HA 1SKMA 2P7HA 3TLJA 3UFBA 1JSZA 4PYIA 5K0NA 2KW5A 4FSXA 2JHAA 3HVHA 3DMHA 2PX5A 4PONA 3UJ8A 4ER7A 2P40A 3R3HA 3O31A 4H0NA 3B3JA 1D2GA 2GPYA 3RW9A 5FADA 4E70A 1Q0SA 1JG4A 4IV0A 3DXXA 3GDHA 2XVAA 1EJ6A 3AJDA 3EVAA 4HH4A 5DRYA 4PNEA 1KXZA 5FHQA 2YTZA 1ZGAA 2UYHA 3L8DA 2ZZKA 4FP9A 4R8SA 3FTCA 3DULA 2CL5A 3M6WA 5DX1A 5ERGB 5CVUA 5EZSA 5K03A 1N7JA 5BW4A 2P3LA 1VPTA 3OCJA 1P39A 5FWAA 3HA5A 1U2ZA 4YV2A 3PX2A 2PT6A 1P1BA 3ELDA 1L3BA 3VC2A 4E2YA 3P9KA 4CTJA 2C7RA 2ZZMA 3B3GA 4OBXA 5EIWA 3EVFA 3R24A 5C9ZA 2ZCJA 3HVJA 2YQZA 2LD4A 1INLA 1EJ0A 3FRHA 1XTPA 5DT2A 3G2PA 3KPJA 3KQYA 4FT2A 2JHPA 1VE3A 5HZMA 1JQEA 1QAMA 3FUWA 4EK9A 4E2XA 3B3FA 4QPPA 4ER0A 3EVGA 1WXXA 1M0EA 4GF5A 3UA3A 1OR8A 3LGAA 5FQOA 3TPZA 3GIWA 5D1HA 5K09A 5FA5A 1XJ5A 2P35A 2QE6A 3FPEA 3G5LA 2B9EA 8MHTA 2BZGA 3G7UA 1R8YA 1R8XA 1BKYA 5GM2A 1G38A 3RODA 4HRAA 4QPNA 3BXOA 4X63A 5F2OA 1JTFA 3EEOA 3BGDA 3NVKI 3UJAA 1NBIA 4IKPA 4OA8A 3P97A 3OE4A 3SMQA 5BP7A 2IBTA 2IFTA 3GRZA 3WSTA 2ONZA 5KYGA 2Z6AA 1KR5A 2BM9A 3GCZA 3K6RA 4FS8A 2OPBA 3LDUA 5GOZA 3HP7A 2YUIA 4GQBA 4GEKA 1YFJA 5U4XA 4PYLA 3G2QA 2OYRA 4ER5A 1L3IA 3E05A 4PIMA 1YF3A 5EMKA 1NW7A 2B78A 3OU2A 2IP2A 3FUUA 3IEIA 3KQQA 5BXYA 3DLCA 2B3TA 2GS9A 3CJQA 3SR4A 5KVAA 5CVEA 5DM4A 3I9FA 5T6BA 3KQWA 1WY7A 5DRTA 4CKCA 1AQIA 3EEYA 4Z2YA 4C08A 2AN4A 3GXOA 3NDJA 2AVDA 4YV0A 5F2NA 5DWQA 5CUQA 5E1OA 4YMHA 1ZKDA 2ZBPA 2NNWB 3MERA 4GOLD 2FYTA 1HMYA 3G8AA 4R05A 5EKXA 5LQNA 1TW2A 4BP1A 1UWVA 2PJDA 5MHTA 2WA1A 3UZUA 2PKWA 3PFGA 5EPEA 3FUTA 4DZRA 3CKKA 2EX4A 3Q7EA 5DLYA 3PX3A 3C3YA 1WG8A 2VZ9A 5EVJA 3BZBA 2IIPA 3D2LA 3GJYA 3THSA 1X1CA 4RVFA 3GRRA 3BGVA 4PGGA 2WK1A 3HCFA 5GINE 2CMHA 2P41A 3C6MA 2NYUA 3EVEA 3ER9A 4YUVA 3R9XB 3A26A 5EZQA 1QZZA 4YUWA 1EAMA 3GWZA 2I62A 2PV0A 4U7PB 2Z6UA 5FWDA 5GIOE 3BWYA 2AOUB 4P7JA 3A4TA 5FHRA 4QDKA 3KQOA 3EVDA 1PRYA 4PYOA 5E2AA 1L9KA 3ANXA 5EIFA 5H02A 2NXCA 3CC8A 3LHDA 3OFKA 2H00A 2OY0A 2VDUE 3SM3A 1T43A 4DMGA 4ER3A 5E1DA 1NBHA 3DMGA 5EOVA 4FGZA 4G56A 5FTWA 3VC1A 5K0CA 5P8WA 1MHTA 1DUSA 3FPJA 4BLWA 2YR0A 4O29A 4NECA 1RI2A 1ZG3A 3EVBA 4MIKA 5GP1A 4BLUA 1O9HA 1I1NA 2K4MA 2FK8A 1F38A 2V7EA 3LECA 4GBED 4CKEA 4X41A 5ICEA 1F3LA 4V0QA 9MHTA 4EVIA 3K0BA 2ZW9A 2GH1A 4E2ZA 5CVVA 5CCBA 1ORIA 1X1DA 5DM0A 4C4AA 4PWYA 3T0IA 3JWGA 3BWBA 3PS9A 5E8RA 1WXWA 4PYQA 2CWWA 3E8SA 1UIRA 2QRVB 1SQFA 1NW8A 2HTEA 4GUAA 5EKUA 4A6DA 5CVJA 1P91A 5FA8A 1N2XA 4LECA 3DLIA 3NMUF 4AUKA 3DUWA 4RTSA 2P7IA 2HV9A 3HTXA 3M6UA 2IDKA 3G8BA 4RTNA 2A14A 3FPFA 1B42A 3EVZA 4RTKA 1O54A 3EVCA 3G89A 3NDIA 4PGHA 4DKJA 2C7QA 2NP6A 1NT2A 1R00A 2UYQA 3KQPA 2OO3A 3MAGA 3FTEA 2I7CA 1AQJA 1JG1A 3PFHA
chains in the Genus database with same CATH superfamily
3N2EA 4KIFA 3WMXA 3I9MA 3S68A 3QFFA 1HYBA 2FW0A 4YI3A 2P6NA 4DCMA 2O2ZA 1RQ7A 4XTCS 1YDEA 3BJEA 5BQOA 2IQ5A 4UUOA 4LRUA 5EIAA 4TZTA 2C54A 4BLQA 4IHQA 2RAUA 2ZAOA 3LKVA 2GKOA 3DNPA 3DOIA 4ZTZB 3O6VA 4XD7D 1K27A 4FYXA 4Q0MA 2ZUEA 4C1BA 4UCWA 3VDMA 5CAEA 5CX1B 3STXA 3VSAA 1IOWA 1WBDA 1FSFA 4D8WA 4NENA 4X5OA 3WBBA 1CUWA 4PO1A 3LCRA 1NXWA 4KQKA 4OQDA 2JFXA 4M4SA 4MS3B 5B1IA 2H0QA 5KNDH 3K05A 4OP2A 2TMKA 1NYRA 2ZI9A 4E07A 4CIBA 4I4LA 1ECCA 1QFJA 2K7ZA 2CVPA 2QENA 5I9MA 1XL1A 3KIPA 2VRNA 2O2EA 2XRYA 5IJAA 4U6QA 1VL1A 1NQVA 4MKHA 1R0LA 5DCLA 5TQVA 3BGIA 1NI4B 2XV1A 3R0JA 4YCDA 3AI3A 2IUEA 2XMCA 1J8VA 2GBCA 1DIGA 1X14A 2C0CA 4XJSA 4ZCRA 4Q4DA 4F5YA 2ZI4A 5DOZA 4LPKA 4XYBA 1KVSA 3VNQA 4DIFA 3TBHA 1T5HX 3NWEA 4HQ6A 1SCQA 1WZ2A 2VDQB 4IUDS 7ADHA 4I4TA 4RJ2A 3PC3A 1GSOA 3OO0A 2B92A 1G8PA 1SK9A 2H07A 3MCTA 2J9FB 2R6R1 4AL4A 2UZIR 1OAOC 1T0BA 2GTIA 1SCUA 2IYEA 2HIAA 2R7KA 1I10A 1RLTA 3AEYA 1VG9B 4B44A 5I3CA 3HXLA 4UBIA 2V6MA 1YZHA 4W9NA 3PQCA 5DYIA 3ZI0A 1I33A 2AI2A 4HDNB 1K92A 1J5XA 1CQIB 2NGRA 2PBZA 1UJMA 4UPEA 3HKEB 1ONNA 2DHDA 4JKOA 1PEAA 1GQFA 4H4EA 2NO4A 3WLMA 4G67A 1Z6QA 3W5UA 3FOBA 1RI1A 4HDKB 2FU5C 4KPGA 3RBVA 3JQPA 2OGWA 2ATXA 2VDKB 3O4FA 4PO9A 5TGTA 1A2KC 2X14A 4IH1A 4CG1A 2D0IA 2EYUA 4MR9A 3RS9A 3SPXA 4C5CA 2HWUA 3FPKA 4I6JA 3LC1O 4QNMA 4US0R 4WSOA 4CU5A 5JSZB 1IN1A 2YINC 1GCUA 5HOEA 1E6LA 3UHFA 2YRFA 1OBOA 3MLBA 2Q2WA 2X1LA 4PW0A 4S35A 2MSKA 5LP6C 3RE1A 3PFNA 4CF6A 2O1WA 4C07A 2HZBA 5BURA 3UJ7A 5L51A 4YRMA 2Q4RA 2XUOA 4YR7A 1R5NA 3C4JA 3OPMA 2B2NA 821PA 5KINB 1K86A 2I78A 5KQPA 2PYIA 3T1OA 1P2SA 4R7ZA 2FN8A 1YL7A 1M73E 4YUZA 5JFOA 2R47A 3A3OA 5BRAA 3TSCA 5B6JA 3CRRA 3T5BA 1J97A 4B71A 1R6XA 1T36A 2BGRA 1LVGA 3SOZA 2NQTA 2CN1A 3C3AA 5C5DA 1I7SB 1MPXA 3OT1B 5T4FA 3RG2A 2QM3A 2G72A 3HNRA 4LW8A 2ZB3A 3WIDA 2EJUA 4NBRA 3LT1A 1PR3A 4UEOA 4B6EA 2Z2KA 4ZAWA 2RSLA 2OZEA 4FN4A 4ZT5A 4RGQA 2GGSA 2DPLA 3ECAA 3DAHA 2I0FA 5JCOC 4RF5A 1BC5A 3EBLA 4LHWA 1J70A 2IHZA 1T6YA 3KBBA 4JDUA 4MQEA 4GWLA 4JLNA 3MTJA 4OHVA 4M89A 5ICMA 2ZBQA 3GLRA 1TJPB 3KHUA 2B1QA 3QX8A 2QAGC 1W1UA 4IRUB 1DO0A 5AJUA 4UQLA 1EHYA 1N1GA 1OFGA 5SZIA 3O8NA 3ORYA 3PL1A 3SS7X 2H1VA 4Z1MD 2V1XA 4PPQA 3W5IA 1JG6A 2ID7A 5DK6A 2EERA 3L8HA 4AY3A 4F2WA 5IBCA 3PGMA 1ZD4A 3WGZA 2ZRBA 5HVNA 1JZSA 2YIVX 3EFBA 5KVCA 3HB0A 2IYXA 1BYIA 4MR8B 4N12A 5TDHA 1O94D 3G5MA 4HG2A 4D9MA 3NCHA 5D51S 1X70A 4C29A 2FOLA 3F98A 4WOKA 1O77A 3I52A 2O7RA 2KE5A 3RI3A 1IDN1 3QXXA 1DKUA 4DOMA 4JI7B 3ZXSA 2G7MC 2ZS8A 1Q6ZA 4HFRA 1YHZA 2BMVA 2JBHA 3K9CA 1YQTA 4BE4A 3C1AA 5A7GA 1ZGJA 3AB8A 4UEQA 3CT4A 4L85A 3HWWA 3DXZA 4XDGA 4JQSA 3AVTA 4GMFA 2O7QA 3SX0A 1NURA 1N92A 2Z5GA 1AM4D 1U0JA 2AOWA 3FI9A 3GGCA 4GGMX 4GGPA 1JQJC 4L5IA 5IBQA 3RSOA 1GZ5A 3D6HA 2PRKA 5CLFA 3LAWA 1R5BA 2IPXA 4KFTA 3UAVA 1D9XA 1ZM7A 3I0NA 4IO0A 1XK6A 3W1EA 4GL4A 1NYQA 3E5MA 4JP8A 2Q5JA 4YROA 1EG2A 4PINA 2W2QA 3WGHA 4KDCA 1NQXA 4KNVA 1YV9A 3UCFA 4JYZA 4IQ0A 1PK8A 1S7GA 4DJJA 1W48A 1FP2A 4LWPA 4DPLA 5T8KC 1E0JA 3VBCA 1WZEA 2GUWA 2N47A 5KTSA 2GCEA 4WL0A 3G0DA 2NXWA 1HE8B 3E7DA 3RVJA 2W4MA 4JJIA 3WTCA 1C3VA 4OYYA 1CLEA 1EZZA 3NIDB 2QR3A 3D3WA 4RPJA 2IPAB 1QV7A 4HGQA 1OILA 4BMDA 4ZYYA 5CDTA 3SHFA 5M04A 2JI4A 2J3DA 3QENA 2UVQA 1DHRA 4TWZA 2WUWE 4ZAGA 5KNBD 1HE5A 5K8LA 5LP1A 4Y6GB 5K6AC 2R1TB 3SKXA 1QIGA 1ISSA 4HLCA 4RW0A 1LY1A 3LE8A 1ZXLA 3DEZA 1LC3A 1BDHA 1UBHS 3WFZA 3ADBA 4GC5A 1YS9A 4MDHA 4HWGA 2J3QA 1M2OA 2CDCA 1QVWA 2O2CA 2QEQA 2ZSAA 3RYIB 1OW3B 1RP1A 4CL3A 4IEEA 2PT7A 3DJFA 3ZQKA 5B4UA 1VL6A 3DL0A 3L0YA 1PZNA 3FSRA 2X5JO 2N3ZA 1ONSA 5DNYB 3CKYA 3DZBA 1FXUA 3K92A 4BU0A 4G0NA 3Q1KA 2V8OA 3GJ0A 1NVVR 1E3TA 5BWNA 1RS0A 5U1PA 4AKSA 1E98A 4AMBA 3WOHA 2GAIA 5AUPB 3T5PA 2NACA 3W6NA 3HFSA 1DAOA 2VDVE 3OQHA 3OOJA 3TZKA 4OH7A 3O74A 1BXRA 4FUQA 4KQGA 2RKBA 2XCRB 2JCBA 2AB0A 2B4TO 1O7JA 2Y77A 5HIMA 1HL7A 2GZ3A 521PA 3FTQA 4JLMA 5ENZA 1IZZA 4D3XA 3ANSA 3U60B 2V54A 1P4HA 1Z7EA 5KZMB 3H97A 3KKOA 1YFZA 4OQNA 3TOZA 4CDGA 1G66A 1HZZA 1RKVA 1ZWKA 4I1IA 4ENRA 3IQZA 4KPUB 1O5TA 1N7IA 1BQ3A 1XNHA 1YB1A 1V37A 2OD7A 2XNDA 3G9XA 3OI7A 4C7MA 4E7OA 2OO5C 4G9EA 1HE3A 4FNGA 4X7PA 2QAIA 4JCOA 3KLOA 4ENPA 4YCSA 3AW9A 4YAKA 5SZJA 1VE9A 2J4CA 2VWHA 4DDKA 2C77A 3KVVA 2YMPA 4KLNA 1M5UA 4LV8B 5EI5A 1M6NA 4HV4A 2CB0A 1GKUB 2IPMA 4UXJA 4YS6A 3X1KA 5HZHA 4ZTBA 1RHRA 4XVHA 4L3OA 3EXFA 2HLNA 2BRUC 3KR9A 4ZWNA 2E87A 3O7WA 1EXDA 4UNPA 1LPAB 1P9WA 2HC9A 1KYWA 2IYQA 2E5LB 3FTFA 4UBLA 4ASUD 1OX4B 1V9LA 2PGNA 5AJWA 2PQ6A 4IDAA 2XKKA 2VJOA 2ISQA 4YJHB 5JRJA 1KAEA 1FFWA 2LBPA 5F1YA 1D2EA 1XZIA 3R7NA 3FNRA 4ZQCB 4BBAA 1K7YA 1OTYA 5JSYA 3WGMA 1BH2A 2AUNA 1US8A 3FJ1A 3G2KA 1Y1RA 5EEHA 3DFIA 1UKBA 1QDUA 1REQA 2JB9A 2Z9CA 4FHFA 4WKPA 4BZZA 1IVSA 3DUFB 1G3QA 1YNSA 2XVXA 3OPYI 2VK2A 5IVDA 1CC1S 3GN1A 4LFCB 1COWA 3JQ7A 1P29A 1XXLA 1F12A 2WA2A 4OXNA 4LF9B 3ICOA 2YWFA 1QQ5A 3MXOA 2XA2A 4DV2B 3LY5A 3E5NA 5ADHA 3COJA 4CM3A 2BGMA 4XM2A 4L75A 1P4GA 5KVSA 4PX5A 4DCOA 1KNXA 2OWDA 4FC6A 3DMHA 4IMPA 5A4FS 2RGYA 3ITKA 4ZCSA 3RU2A 4A26A 2NX2A 5BNTA 4G0UA 2JLSA 4X3PA 4JYCA 4HXYA 5K51A 2NM0A 3EZNA 1H2EA 2DKNA 4OXKA 4IIEA 1UXOA 2FPXA 4S1WA 4BWFB 3UO8B 3M6WA 4Q34A 3EXG1 4NJEB 4QYWA 4X90A 4BQNA 1NG9A 4MITA 4CR7A 1VPTA 1Y42X 3F3MA 4NNPA 2Q62A 1L7MA 4DCNA 1GDHA 1IXSB 3ELDA 1RRGA 4B80A 3N7AA 1R4AA 1RWOA 1G5RA 1I3CA 5LQSA 1FIUA 1SC6A 4JOCA 4YGXB 3KU4A 3VKGA 5KEIA 2AMJA 1V1JA 4XQGA 2PKQP 1CYEA 4H6WA 3TXAA 2QLNA 4YYZA 1LSOA 3JVEA 3WLLA 3CNQS 3G2PA 2FWMX 4Z4CA 4CM4B 4KQ1A 3I45A 3DZDA 2HF8A 2ETVA 1F8YA 1PYDA 4UHDA 4KXNA 4UCFA 3UUGA 3TG8A 3D4BA 5I9IA 2AZDA 4B3GA 3H1BA 5BOSB 1BJRE 1N2HA 1X8JA 4PAMA 3FSEA 1XJ5A 2QRLA 2AGVA 2F3RA 3HB5X 2NQ8A 5CLLA 5E4YA 1B0PA 3Q10A 3DZKA 1FFSA 3IP8A 3H5TA 4TN1A 1U3VA 4PFQA 3RODA 1D4OA 2OXCA 5JALA 4XX0A 5K3OA 1XHLA 3RC1A 2BHRA 2ZAMA 4TUYF 1UKVY 5IJ9A 3NVKI 5CEEA 1NBIA 1K9SA 1QCYA 5AW0A 3T95A 4DLBA 4IGEA 2PD6A 2A9KA 4P3XA 5D84A 1T1JA 3I6QA 3IJ5A 3S7TA 2CZCA 2J31A 4L5CA 3T3DA 1PQUA 1WZUA 3AESA 2NNLD 3BXHA 4MUKA 5HKAA 1K4MA 1NR7A 2JLRA 2VK8A 3IMKA 5JYDA 5C4IA 3HJFA 5EIOA 2IY7A 2OGZA 1KNQA 1U3FA 1CY7A 1TQ4A 2YZMA 4QJ5A 3ZQ4A 3OQNA 3NDJA 3QI7A 4D3FA 4K9MA 3V55A 3HKCB 3I39X 5BT9A 3PX7A 1JTVA 1WUIS 2NAPA 3CLSC 2XMQA 3M89A 4D6PA 1G5TA 2HGZA 3MBKA 5KSYA 1CS0A 4G4GA 5CJJA 3OFVA 4A8HA 1GAXA 4HNAA 4NDAA 4JB0A 2P75A 3EF0A 4WPGA 1KY5A 4UEJA 1IRXA 5F77A 3W6PA 3WOVA 3Q7EA 3K71B 3FH0A 1AKUA 2V97A 5ER9A 3O4GA 2O7SA 3W3AA 2AFIE 1J0CA 2H7CA 3HG7A 4DXHA 1QQBA 3MJHA 3UWMA 5EAIA 3UMRA 3H2GA 1I14A 3H2IA 1DJNA 2P41A 3A8TA 3HKDB 3O75A 1TKCA 4MLPA 4W1QA 4H3KB 1DFIA 1O96A 1J49A 2RJOA 3PKJA 3R41A 2A9OA 4C0WA 2R6DA 3GJZA 2IPOA 2FUG6 2B1GA 1SB8A 1DINA 1ZL2A 3WLEA 3AEXA 4F9FA 1X8LA 1T15A 2HRZA 1WBBA 3PXDA 1RM5A 5CRIA 3IMFA 1DBSA 3D2BA 1BVHA 3G1WA 4ZOEA 4UAUA 5A7FA 2DCUA 4U1RA 2GASA 1RBZA 1XHEA 4DQDA 3HJTA 1DUSA 2E82A 1L7RA 5DHTA 3QG1A 4DDVA 1AA6A 5JAQA 4I6EA 3VPSA 1J56A 4CKBB 3EC7A 2OHOA 4MKRA 1I1NA 3N0XA 3BX1A 3F8TA 2Q3MA 2G36A 3B70A 5JATA 4FILA 4GMGA 2A9PA 4OMUA 5CPFA 1GTMA 2ZW9A 4JQOA 3F9CA 3ILVA 1KVRA 5P21A 2VO1A 1YR1A 3MSXA 4UMVA 2A84A 2GN1A 3N2NA 4RXUA 2INGX 3RQIA 3B8HA 1HTWA 1U6KA 2W0MA 1DBIA 3PS9A 3IT3A 2E48A 4L0DA 3R7SA 5SV2A 4YCCA 1CYDA 1R1DA 1KDZA 4BLPA 1DRWA 4FHDA 4KJZA 1GDDA 1T2VA 4MRSA 4TXHA 1Q92A 1WXEA 3NOQA 1E1CB 2HHJA 4HXEB 4EY4A 1QC5B 2OESA 4V0OA 4MS1A 4E6PA 3PWZA 4DTIA 1WMBA 2FW8A 1U0TA 2NO9A 5AI6A 1RZ3A 3DBVO 2VT2A 1V16A 2UDPA 4H6VA 1MAWA 4G5GA 3ZUGA 3ZZNA 4PLVA 1A7UA 3MUFA 3EXG2 3SS9X 4BMZA 3PG5A 1N57A 1XU7A 2EZTA 1M8JA 3NHKA 4ZVVA 3UGJA 5F23A 2EWVA 3EZGA 3LDAA 3PFHA 3CF4G 1NAHA 1JEOA 1NW5A 3KKKA 4GL2A 3O73A 4MYUA 5FDFA 1B3RA 4FD3A 3O2QB 2C2ZA 2I03A 2G04A 1QHYA 1YA8A 1VQ1A 1QHIA 4Y2HA 1PJ3A 4ND3A 2DWCA 2JRLA 1RWQA 2X9NA 1NX9A 4RWEA 2PS1A 3Q5DA 5EIBC 5EUQB 1U80A 1JE0A 4AXXA 3ZY6A 2C0PA 3K0AB 3HSKA 4BQRA 2EJWA 2G82A 1QONA 4DLVA 1XA0A 1XWWA 3SJBA 3DG9A 2ZBGA 1ZQ1A 1NLMA 3C97A 1QXSA 5CYOA 5JEEA 2IBSA 1IQPA 3P2MA 2I8CA 5B58T 4X91A 1P74A 2JC3A 4YRPA 4XGIA 1QPGA 1X15A 3EAGA 5FPTA 4JI1B 4FDMA 10MHA 1QFMA 4C0BA 1ZJYA 2WI8A 3LNCA 2EBHX 3LL4A 4DRXA 1ZGHA 5DW0A 4LXGA 1U28C 3HMKA 4E32A 2AUMA 1OZFA 2Q1TA 3BK7A 3R0QA 2E4VA 1ODCA 1Z13A 2JCSA 3KD2A 3PWKA 2EARA 4TUYA 4EY3A 3N7TA 3ETDA 4I0WB 2WINI 3ASVA 4NG4A 4PNZA 4B4WA 5BUQA 1Z5WA 5BWMA 5AOVA 5I7SA 1FP1D 2EGHA 3GGDA 1PWZA 1K5DA 2LCFA 1MTZA 3UQZA 3BMNA 3LQRA 3EFOB 3A4IA 1W36D 2ABWA 2G6TA 3VKHA 3U09A 4H6PA 4JSTA 1EA7A 1KK1A 2ZYRA 4ZHSA 4JZKA 1XYYA 3TXYA 2L42A 3E1SA 1DU4A 4LJSA 4O2BF 5L8VA 3LCUA 2G77B 2PYDA 3WO0A 3HC7A 2FPSA 3QF4A 4P58A 2JLXA 5H1YA 5G1PA 5IKOA 5E6RA 2XNJA 3CX4A 4IIYA 4J94A 3B13B 1QF7A 2W2KA 3EAFA 4R9UC 4AC9A 3OWHA 5IZCC 4HX5A 3ZIDA 4DADA 4DCPA 5DN6D 1BQEA 1GV1A 3R6DA 2JLQA 4YMTA 3FZGA 1TYBE 3H99A 5TEVA 3RAGA 4M53A 3D64A 4OREX 4B3BA 2D7JA 4PBRA 4ARCA 1SPBS 2YNMD 4TKUA 4W63A 4X7BA 1W5FA 2QTZA 4GBJA 4GKAA 1WX1A 4IDDA 3DMFA 4RK6A 5A4AA 3A1SA 4DVJA 5C7OO 1PAUA 3GEMA 1JQBA 5FTNA 3GOHA 4TS9A 5JQGF 5KQLA 1OOEA 1IU9A 2AL7A 5IJXA 4XDYA 1UFOA 4NXMB 1N0VC 2V96A 1G4AE 1G16A 4U00A 4F3KA 1RXWA 1C3OB 3ZHOA 3HNOA 4HJRA 2GA8A 2R60A 3BFXA 1UP7A 4XX1A 2VFAA 3PHCA 2CEKA 4CF3A 1C3XA 1GGNA 4KQCA 5F1KA 3N8KA 4EYQA 5B58C 5LNK6 1JYSA 2VPTA 3TB4A 2QMQA 4PQEA 2A4KA 4Y7DA 3L82B 4MQFB 5LP6F 4RJLA 4FFOA 5JQWA 1RPJA 3DOFA 3S99A 3PNOA 3DBRB 2PSFA 3UGKA 1EM6A 1CQXA 4EG8A 4F6CA 1GUDA 3AY0A 3K8OE 1NC3A 4OQMA 2O1XA 3WYEA 2YV1A 4QJBA 5AKXA 1H8ED 4V02A 1R0RE 4XR4A 1GQ2A 4FMDF 3UG7A 3VO9A 4DLXA 3JWEA 1JEYA 5IKXA 5JEDA 1E3SA 1J0XO 3CUYA 5IUNC 4FS3A 4IIBA 5C7LO 1KE1A 3WBFA 1R2QA 4RTQA 1B0ZA 4QDUA 1ZIXA 4BEBA 1P1IA 3B7PA 1A8QA 3N3AC 4Q48A 1TZ2A 1QYWA 2CCGA 1EEHA 1MD9A 3IUEA 4FYHA 3W2TA 1NMYA 3VPAA 4PVCA 3OTQA 3V1LA 4OBWA 5LOVB 2I66A 1TDJA 1FFXA 2GXUA 1K7CA 3FRJA 1Q0QA 5JPDA 2DEUA 2D4AA 1S96A 2GBLA 4ARAA 1L4UA 3MELA 2CNKA 1OPXA 5DX8A 3TTSA 2JGRA 4B35A 1GA1A 4F5DA 1TZCA 3U56A 4S1TA 3OLVA 1HZJA 3CVOA 4DEYA 2PQ2A 2JFYA 1F4PA 2VJMA 2XKBA 2FFRA 2ZTHA 2QRGA 4LI3X 4ML3A 4WOBA 1DBQA 4BO4A 3D2AA 3TE7A 1X7ZA 3IAHA 1U7DA 3N53A 4D9NA 4ZC8A 1SKAA 2OV1A 2Y3IA 3DV0A 4EJ2A 1EFPB 3VU1A 3W7VA 4C7XA 2AK3A 2BTOA 1M8GA 5EE1A 1JKJA 1E89A 2C2XA 2NZJA 4XLTA 4RKQA 3ESBA 3PWTA 2N9UA 3T3PB 2DE0X 5AWFC 4LSWA 4AAYA 1QGOA 5HPYB 2RG1A 4LF6B 1W7AA 1E2UA 4V0KA 4WTOA 1WR8A 3PC4A 3AEKA 2JI7A 8ATCA 2DWPA 3TCNA 3I5XA 1NW6A 1K5HA 4OLHA 4ZI7A 5C51B 4BO7A 1YRHA 1TLLA 1ZD8A 3IDOA 4UTOA 1L5HA 4I2NA 3WGJA 1T5BA 3OX3A 3FMOB 1Z5NA 4BV3A 1AURA 1U9YA 3WSVA 3ZN2A 2A9RA 3L04A 1TYCA 2JCGA 5LBTA 4JI5B 4DRYA 4EB6A 5BSWA 3ABQB 5CNIA 1A5BB 5HFNA 4PY2A 3W2FA 1MZVA 2AC2A 1G6Q1 4O5OA 2WTAA 2HSWA 2BGNA 1C1XB 1UR5A 3UMSA 4LBVA 1HR0B 2WTBA 4JJEA 5T3YA 3ZY5A 1Z4OA 4TQUS 1QRRA 4BIIA 1N78A 4GMHA 4R71A 2XA1A 3QI2A 1CCWA 4TMXA 1KMMA 4DB2A 3ONWA 2BDUA 2Q1YA 4RGYA 3RFFA 1DEAA 2C8LA 2QL7A 2ET6A 1Z83A 3KEGA 1MEEA 4RTLA 3KAQA 1MDFA 4M49A 4BNDA 4ISBA 1CUUA 1MNAA 2OFWA 2AN9A 3L0PA 2PLFA 1SUAA 4GM0A 1RYMA 4LQLA 3DAPA 4O2BA 1AKMA 3A3YA 5FBQB 5HJEA 3ZE2B 1B6GA 4L72A 3X1XA 1JHQA 4W5TA 4ITRC 1KI2A 1J5PA 1DRVA 2MMGA 3QF7A 4CUJA 2ZAIA 2W7TA 3N2LA 1PKEA 4Y2JA 5B3JC 3GA7A 4G0PA 2H29A 3A10A 4D0RA 2P27A 2XDYA 2ZB7A 3W7AA 3CX3A 4E12A 1KY4A 4QU8A 4K03A 1V6AA 1JR3E 1BDMA 1UJ5A 4ZODA 3IV9A 3LXUX 3NM6B 3EIFA 2O2IA 4UHKA 1NONA 1OAOA 1QDLB 2DRIA 4TV8F 4LFBB 3D6UA 2QN2A 3ESZA 3AF3A 2GYUA 4IOJA 3LX6A 1TB4A 1L5MA 2DWUA 4IG9A 1M2WA 4XAQA 5IWAB 4ZI2A 1NNSA 1H93A 1V4VA 1YDFA 1U0RA 2NXEA 5J2TB 1Y4SA 1NFFA 3MBOA 2O7VA 1XQVA 5GZ3A 4CMBA 1SXJB 2QN1A 1X7DA 2PZEA 4PICA 3SZ3A 3EIEA 1VJ5A 1Z2CA 3C5HA 4FBGA 4IH9A 4YCBA 5JQGA 1U7PA 1V7CA 1T4MA 2ZDQA 3K35A 1L4HA 2CFRA 3K0CC 3NT4A 3UJHA 1TEVA 4BQOA 4GWKA 1KJQA 4NAVA 2FQYA 3S1AA 5BV7A 3TFOA 1EP1B 1TUBA 3D7RA 3E22B 2GYWA 5B1DA 3WAGA 2G1PA 4CQNA 3FFWA 1NVBA 3LHKA 4H35A 4B9EA 3PJGA 5IULC 4KKXB 2IGTA 4QKQA 4ATNA 4BJ5A 4B3MB 3DE4X 4XDZA 1Q16A 1OV4A 4I9NA 5KYXA 2BUCA 2FZGA 1D0IA 3BRWA 5LP6A 4O4JF 2IZ6A 3MCWA 1OXUA 2A57A 2QUJA 2E37A 3QOFA 3MA0A 4OI2A 5ICCA 4G65A 1NDUA 4A0SA 5KQGA 3IJRA 4ARBA 5EP3A 1D2MA 4YGYA 3UAGA 4TMTA 1JJIA 3WI7A 4YVFA 1CE8B 1A8UA 3VJLA 3IMGA 1J22A 4TLCA 3NBFA 2YZGA 1KZ1A 4E11A 2JIQA 3E6AA 3LNTA 5A1TA 1KP2A 1U65A 3P0RA 3WLSA 3ZDBA 5JUWA 4OL0A 4BMSA 5K01A 3KKLA 2ZBVA 2GAFA 4FGSA 2X8WA 2VT7A 3DM9B 2YL2A 1V4BA 2GZRA 3D3QA 3R5XA 4B2PA 4M9CA 1RXIA 4ETWA 4KR2A 1P60A 1MW9X 2KS6A 4L7QA 1VLMA 3RIEA 1PS9A 1OWLA 5A3RA 1P61B 1Z33A 3KZNA 5TT1A 5JCOA 3A3PA 3IYLW 3OPQA 3KRTA 1EVIA 4F2HA 2WIAA 3GGOA 1FTSA 2M9MA 2ID4A 1D2HA 1E5QA 2B36A 3CV3A 1RMTA 2X13A 2RARA 1JB9A 5AVWA 4YLYA 3RVOA 2JHAA 1RAEA 2QAGA 2X15A 4QGHA 1IMOA 1O5IA 2QROA 3FETA 4MV4A 3W0LB 3WLFA 4E3ZA 3QM1A 4E70A 5BYAA 3RFVA 3V1MA 3NOOA 5GGXA 1YGYA 3DE7X 3AK4A 3ESDA 2A5FA 3LFTA 4I08A 4WZBE 2VTKA 4Y9SA 2HQBA 4R8SA 5EWJB 2PS0A 3C43A 3FOWA 3TVTA 5BW4A 3H9CA 3HLTA 4NY1A 1QIKA 4TX1A 5LKAA 3W2IA 2PL5A 4HEQA 4M1KA 4Q21A 5D85A 4B7UA 4BNIA 6ABPA 4WNYA 5KOIA 4G24A 3DKKA 2Z6VA 3HHEA 3L6UA 2W2VA 3TR5A 3OIGA 1UMBB 2SECE 2IYAA 3B3GA 5ITSA 3DHWC 4NSNA 2XGOA 3G7SA 2ZCJA 3GFOA 3PBKA 3R0XA 1FCJA 1INLA 5C81A 3ZGLA 1EJ0A 1URPA 3H4TA 4N7MA 5MFPA 1KZ4A 2I5PO 2E55A 4FFRA 1Z3IX 4QXAA 4UVDA 1N36B 4Q1CA 2D8AA 1V5IA 1YCDA 1FLNA 1BE6A 1GU1A 3RAEC 4H0FA 4DA6A 4EFNA 4FD2A 4RL6A 3FFTA 4B4DA 3KT6A 1XDDA 3H9QA 1QR2A 4XARA 3LTEA 3OJLA 3T35A 1WB6A 1RQGA 1A9XB 2C8JA 1VRWA 2NV2B 1EGMB 1LPPA 3QYFA 2QF7A 1PZEA 2CYCA 1OFHA 1DSSG 1UDXA 3ROZA 5LIPA 4FFBB 4F56A 1OV6A 5T8KA 1VHJA 2G63A 1PJRA 4KZKA 5FPKA 1FX0B 4OYLA 2BM1A 3AVPA 1EXMA 3K6RA 2QZZA 3LDUA 3QEAZ 3IESA 4OP3A 4IGKA 1YFJA 2IY9A 4NESA 2IUSA 1Z8HA 2P90A 2CLKB 1MJ5A 4JT4A 3TTVA 4DDUA 1A9PA 4KVFA 1TGYA 3SR4A 3OKCA 4K9RA 4PLTA 4TWBA 5DRTA 4IDGA 2AXNA 4XWWA 2AVDA 4QUDA 2IOHA 2FEMA 4FDVA 1ISGA 2BKEA 3GCDA 3OEHA 3H5LA 4TV8A 3PGXA 4DMCA 2H16A 4ZU1X 2BGWA 3EDMA 2LDBA 1DARA 3LBHA 2FMHA 2HJ9A 1VMKA 2H4XA 3AVQA 4V0SA 4BP1A 3D43A 2RH4A 3G0CA 3NAQA 4I4CA 4NOMA 4JBIA 1GUFA 1I9CA 2YCBA 4BEVA 2FB9A 1VIYA 1EFKA 3ZLTA 2YJZA 4GYKA 1V1MA 2E4YA 5HRCA 4HNRA 1TRKA 2XUPA 2VZ9A 4U6SA 5FLKA 1IJKA 1V5WA 2X0NA 2OCAA 3MT7A 2PG3A 4RHTA 5K4AA 3UT5B 3ZE1B 4AKEA 1ZH8A 4KGDA 4KYIB 2FKAA 1UINA 3GUVA 3AHIA 4FBMA 1KFJB 1D5CA 1WPGA 1JLSA 1XJ0A 3A26A 3EG5A 3WK4A 3V34A 2YCLA 2VAWA 1DKLA 2WVAA 1GV0A 5FNVB 1QH8A 2IDZA 2ZB4A 2WD8A 3OFND 1NNUA 4WN3A 1K3TA 5EIFA 3NB0A 4DLAA 4O4JA 2OY0A 5HKLA 3UHAA 4CM8B 1ACLA 1UJCA 1C0LA 3DMGA 4FGZA 4G56A 3COZA 5EJGA 3MPOA 4EAQA 4KREA 3PNKA 4RK5A 2OK8A 3ROGA 4YXWD 1LDBA 3IXQA 4B79A 1R8SA 2HU8A 3BTVA 3THYA 2CHQA 1NUHA 2OHIA 4PCVA 4C0KA 4DR7B 3U0BA 1CUYA 1QO9A 4PO3X 4F92B 1ZUHA 1LBEA 2FPIB 2OO5A 5TS2A 1WNFA 2CNLA 4CKYA 1VSVA 3T15A 5BMVF 4QEZA 2YRXA 3ONDA 3QVJA 1Y9DA 1FSSA 2FHSA 2ZT8A 3P9RA 1YKSA 2FN3A 4ZRNA 2WTUA 3DM5A 1X13A 3RT9A 2QRVB 3FWHA 2LW7A 1VYUA 2XR1A 2V1UA 2BRUA 3A6JA 3NHMA 2X8JA 4HP8A 1JL3A 4RTSA 2CUNA 2PWAA 3LLCA 1JDTA 1KDPA 2P7IA 2WPDA 3BWXA 4G1FA 3VMMA 5AVXA 3SD7A 2CYAA 3LQ1A 1PBNA 1CQWA 4DHEA 1JXMA 4DJTA 4B2YA 3NDIA 4ESEA 4R81A 4YAGA 2IEIA 5C3UA 1P0QA 3V1YA 4KPEC 3H87A 5AKKA 1X7XB 4LOJA 4YJ3F 2AIRA 1EWYA 1HYGA 1SQSA 2H4YA 2BKUA 1BA2A 1EWRA 1FFBA 2W6QA 4V2IA 3HUTA 3GT4A 3QVMA 1E4VA 5SY6A 2ZSDA 4GMDA 4BX9A 2J09A 3M2TA 1JWBB 2HLDD 3L0OA 1PX2A 4HNGA 1TAUA 4BP9A 1DKPA 3T9DA 3K5PA 3L8FA 3NPMA 4KFRA 3W8RA 1ZY2A 4KXMA 2A1UB 1B43A 2BD0A 4PC7A 1NRXA 3G0BA 1J6UA 5A6SB 3R7LA 4F3YA 2WKRA 1G20B 1MZPA 4JT2A 2WFLB 3O4RA 4UNNA 4P38A 5CDUA 5BNZA 3EVNA 3KHTA 3ZZMA 1Y1QA 3B48A 1ZJWA 3IUNA 3CPHA 4RIFA 4ARVA 1BE0A 4ZYZA 5E9AA 3CUUA 3UMMA 4JBNA 2XRFA 5HGJA 3EIHA 2VYCA 3HB9A 4AYTA 5CB6A 2NPIA 2P65A 2PMCA 2PLAA 3HSSA 4NAHA 5HTOA 5I45A 1Z2NX 1Z4IA 3BJMA 4CLRB 4NCBA 3L7OA 2R8EA 4JLWA 4Q1BA 4E2ZA 1Z0JA 1KI3A 1Y8CA 2EL9A 2X0JA 4LZAA 4ZVMA 4AS3A 4JITA 9LDTA 5AVQA 1U98A 3GYBA 1AB5A 4HS4A 3R3XA 3VM6A 4Z54A 2A0WA 4IDCA 5LXTB 2JH8A 2GK3A 2QSUA 1G8SA 3B60A 3DWIA 4MPPA 5SYNA 3CS3A 3OZFA 3QUAA 4HB3A 5FO0A 4NZNA 2DH6A 3BGOS 5B3KA 4Z8XA 4KR3A 2FMFA 1RJFA 4KDRA 4M7PA 3DO8A 1S3FA 4OUDA 3WB2A 2CXHA 3GNLA 1ZI6A 4ES6A 1TKBA 3WMEA 1T4BA 2XCIA 4DAEA 4YT4A 1RRFA 1V4NA 1DJPA 3U7QB 3T3GA 3L9WA 5KPJA 3O1IC 3RRXA 1KGDA 4CKZA 3RSFA 3ONEA 4ZT2A 2NO6A 1DE0A 3DEFA 3I76A 1LH0A 1PJQA 1ZNXA 4LXIA 4NZYA 2P2NA 2IDJA 3IE2A 2I4IA 3ZK9A 4B3XA 4EY6A 3FG9A 1ISRA 5EQTA 1FPMA 3RUEA 5HUJA 3U61B 2HJWA 2VP2A 3BK1A 1YB4A 3PHBE 4MZXA 3MJRA 3PICA 3DYIA 3AR6A 5FH9A 3ONVA 4LMPA 2HA0A 3GUCA 1ZC4A 3TIFA 3OE7D 4P5EA 3I4CA 4MV3A 1L4YA 2ZRMA 2C2OA 3OEEA 3NVMB 4B3CA 2X2EA 3WKAA 5FEUA 5K3EA 3D7LA 5AD1A 1Y6FA 2GEDA 4WZAB 2QMUA 4KFUA 4NABA 3WYGA 1G41A 1OLOA 2AS0A 2G0TA 1P45A 4MRPA 5AK3A 2CVQA 1MC8A 1R66A 1UDBA 2QMEA 4K8RB 1W75A 2GILA 3DBLB 1VIDA 3CR7A 3LYHA 4H1VA 4N7JA 1U7XA 3E7XA 1H2BA 3V8EA 2KPOA 2XXAB 1LQUA 3KKMA 3C3XA 1J7JA 4AJEA 4IYJA 2AOVA 3HCEA 2ZYHA 3OUTA 5CTAA 5CM2Z 1ES9A 3G2NA 3KJIA 4C4RA 5TMPA 3QMVA 3H84A 1W9MA 1P7ZA 2Y1EA 1ZUNB 3Q98A 4KIJA 1GLGA 4LV5B 2XMGA 3CF0A 2WILA 2ZRKA 4KJXA 4RD6A 2HSJA 2PX2A 5PGMA 1GYQA 4IS3A 1QANA 3F78A 1KJ8A 1IZYA 1QPBA 4ABYA 2HJHA 1JSXA 3H5IA 2BPOA 3LUKA 3KSZO 1YJCA 2H8KA 3E48A 1QTIA 3R3WA 3DT9A 3JQDA 2HDNB 5KQMA 3FMVA 5BYBA 2WF9A 2V5AA 2H17A 2W48A 2AJLI 1K68A 1K5PA 3EZ6A 3KUXA 1MA3A 2QMZA 3LSTA 3P9PA 3RTGA 1E0KA 3UC9A 5BMVA 3QKWA 1JDJA 1PW5A 1ZCJA 2C04A 2ON6A 3UANA 5JH7F 3NHRA 5G2OA 3QFRA 3RU3A 1I80A 2COKA 1F2UA 5FUMA 1TJYA 2QTRA 5ALYA 4CCAA 3PQ7A 3L40A 4L8FA 5KMGB 4X44A 3F7NA 3FPGA 2ZULA 3GHHA 4M22A 4RMGA 1JR6A 3NRJA 1N2CB 3IIIA 4XOUA 2QBYA 1H2ZA 1FUUA 1AQUA 3DF7A 4X20A 5LLDA 5C31A 1G55A 1R37A 1LF5A 2D1RA 5LMZA 3H3FA 2D2FA 1SJ9A 2ZIAA 2E9SA 3ELUA 1R3UA 1YZNA 3BQ9A 2CHVA 1FNDA 2JL1A 4P33A 3VYSB 4XGRA 2GZAA 1CQPA 4RHYA 1HLFA 2W2LA 4YJ3A 4D79A 5G53C 3UAOA 1QS0B 4TL8A 5I01A 2ZR9A 2XD9A 4UNIA 1JA1A 3ITEA 3K3PA 2O50A 1SVMA 1O95C 3LJKA 3QKTA 4QQNA 5A02A 4WGGA 4BZQA 2HFJA 4FQ7A 3AGQA 5D7NA 3UT0A 2AF3C 3IEKA 3LF1A 1X86B 4GOJA 3I01M 2IOFA 3CCBA 3P2EA 4KQ6A 4L8GA 1NV9A 4S1VA 4W6QA 3S7ZA 4BB9A 4V1CA 3L1KA 3C7AA 1KIFA 3WV4A 3MWEA 4EJ0A 4NMHA 2E5WA 3HCPA 5K8VA 4AQ7A 3R9XB 2P2SA 3G2JA 1C9JA 3HL4A 3WMRA 3X43A 2MSDB 3ASZA 4TRJA 3CGWA 4B9AA 3VNRA 1Z6YA 4UREA 1M1XB 2X4LA 3RK1A 1CZHA 1E3JA 2DPXA 3EPRA 2IH5A 2GTHA 3WFIA 2FVYA 3PFIA 1JALA 1O5OA 2BT4A 2IEDA 1XHFA 4J8PA 5CHEA 3B2EA 1LTQA 2DUNA 3KV3O 4JJ7A 2P2CA 1S6YA 2JASA 1U2RA 2GJKA 3K1YA 2O8CA 3ZVLA 3NBYC 4QOEA 1Z7YA 2PGDA 3F6BX 1JAIA 2IY8A 3HPQA 2E85A 4M0EA 3USCS 2CXPA 4OLFA 3ZE0B 3NR2A 3AO0B 4EZEA 3WMWA 3S27A 3ZDDA 2VHQA 4BDSA 2P79A 2WHQA 4OOFA 2GO1A 1MRSA 2QVZX 3DYVA 3IUBA 2C20A 3RVQA 5J9FA 3ZGOA 3DMTC 4IFIA 2OUIA 5E9QA 5C4GB 1Y9AA 4YLEA 4EFDA 3OJCA 2BN4A 3BUSA 1QIHA 1E3WA 2GJAA 3ZUPA 1AGRA 1XZEA 5DOVA 4BGUA 2C42A 4XGQA 2WHYA 3O4IA 4FDTA 1UBOS 4QEDA 4LF4B 1SBIA 1GILA 5A3JA 2PGXA 3IHTA 2Z04A 1U28A 4W1SA 4URXR 1G21E 5EE0A 3IEPA 1ZN8A 5I4KA 2GCIA 1DELA 2RC6A 4RF2A 4NVRA 4XVUA 1TRHA 3FHLA 2C7OA 4OK5A 3R7AA 4U2EA 1EFVB 3AR9A 3D6AA 1W5AA 2IA5A 2IV3A 2BLLA 4DXDA 4D4HA 4FFNA 4EO4A 1U3DA 3BBLA 3CEMA 4YFVA 1ZHFA 3T4UA 1Q2XA 1T2AA 1Y6JA 3N8GA 1N6NA 1YQQA 2Q1SA 5FBWB 3U4CA 5BRJA 1TA0A 3MJDA 3UMJA 1TPZA 4H7HA 3AVXA 2DLCX 2HUNA 1SCAA 3WAJA 4RTOA 4N6NA 1KEEA 1X38A 3P71T 3MIIA 1QZUA 4ZK2A 1EGVB 3PU6A 3O47A 4PQRA 3BD8A 1GUYA 2X5KO 4KE9A 3MZ0A 3UEOA 4A8JB 4A9AA 3DE6X 4NJOA 3BMQB 2X6TA 3HFJA 4NATA 1T3SA 2MSLA 4L4SA 3U7JA 3PTAA 5KBYA 1MEJA 2RIPA 4PGFA 5IZCA 1OC4A 2EKQA 3B2QA 3VR2D 4XASA 2J45A 3N5CA 1SBNE 2P77A 3JD2A 4W5NA 2QS9A 4PFJA 1LBQA 3IAS1 3ZGYA 4EHKA 2Q8QA 4WFQA 3GLVA 3NHUA 4TXLA 4GPD1 3E70C 3BEOA 1JLLA 2P3SA 4P0PB 1BROA 1NXQA 3QOWA 2EL7A 4M9XA 3B89A 4BTVA 2YWCA 5JH7A 1TZBA 3BSSA 3W77A 4GX1A 3FUVA 4LBZA 2BWJA 5HCIA 3OLZA 3HCCA 4RFLA 3ZW7A 5DXJA 4L1KA 1RLOA 3RF6A 2ZJ2A 5K8UA 5M29A 4OI4A 4BDTA 1YDHA 3RK0A 2BW0A 3QEJA 3VAAA 1GRRA 1FFYA 3IDFA 1P8JA 1BHO1 4FCCA 3DAGA 5KX5B 2C98A 2G40A 3GZNA 2QJTA 4RIGA 3R5KA 3RSCA 5DMHA 1XCMA 3SQOA 4K6MA 3DTVA 3ER6A 4LRSB 5SYMA 4B6RA 2GM3A 4Z51A 4KODA 3QK7A 5K0GA 4WK0B 1SXJD 1Y80A 2G76A 3D0KA 4KMOA 5JS7A 5KOJB 3Q7PA 1KI6B 2V74B 2XUIA 3IEVA 2NT4A 4WZ6A 2WMYA 1I24A 5CX1A 5FLXA 4EGFA 1JAYA 1B00A 3AEUB 5B12A 1N2GA 3UJ8A 4PONA 5E6SB 3TLEA 1EFAA 1PNRA 2PHZA 3OX1A 4MS3A 4DQKA 1UC5B 3HSYA 3OZWA 5FADA 1Q0PA 4UAVA 4JHLA 5F33A 3SHVA 1NLZA 3FZQA 4PNEA 1GGHA 3LCMA 2I80A 2FI1A 4FGWA 2WZDA 3MRXA 3RRJA 4HVLA 3E03A 1Z29A 4L8VA 3LQ4A 5EZSA 1NI4A 1XLWA 3PQ6A 2PU5A 3Q7IA 1FS6A 5H83A 1W5SA 3BE5A 1L7NA 2AX3A 4E2YA 2GM9A 3C87A 1YZLA 1V6SA 2VBCA 1Z6GA 4OHOA 4AKTA 1JWAB 1NR5A 1ZJ5A 2JEZA 3F9IA 4QUBA 1Z88A 2GAOA 2IUYA 3E4DA 4RESA 2I2BA 4YAJA 1GSIA 3ZVKA 1YMVA 3ODGA 2J9FA 4HTAA 3WTBA 3GD7A 1QYXA 4M8IA 3ZWPA 5K6TA 1K98A 2WWTA 1GN9A 4JY7A 5J43A 2ZRQA 4EK9A 4E2XA 3ZI4A 3ZQ6A 4IHJB 5KSZA 3EVGA 2HB6A 4FZ3A 4HDNA 2B37A 3TPZA 4EUNA 1TO2E 3DFUA 3VXKA 3CN9A 1T8RA 5AW7A 4N76A 1JDBB 1PNVA 2RJ3A 2BZGA 1ZD2P 2QMOA 5CM8B 3SKVA 1GPMA 2XAAA 3ACCA 1TM5E 3ET5A 4O4IB 4HPWA 5AKEA 5E2IA 5M3BA 1XVVA 2GI4A 3BGDA 3BG5A 1N6LA 4HNHA 3VU8A 2ECKA 1FDOA 4HVCA 1J2EA 4EG7A 2ZWOA 1X94A 1YVRA 2OHXA 3GRZA 4B6OA 2ONZA 3H86A 3U62A 1BDIA 5KC9A 4YI5A 1PR1A 5GOZA 4EVSA 4NBUA 4OLJA 4NU5A 5CYPA 2NYRA 5EUBA 2AG6A 2Z1MA 3BIJA 4C6RA 5JSZA 1N6KA 4JC0A 4BNUA 1EWVA 2ZRAA 5DBEX 3I62A 5LB4A 3DQZA 2WSSD 4UTRA 2WAXA 2I65A 2C2MA 1WW3A 4PLGA 4PG6A 4OATA 4HQLA 1N0IA 2CMKA 4DC9A 3J81A 5ALPA 1T35A 4F72A 4AF8A 2NUTB 3SC6A 3EWAA 1TA9A 3VKFA 5JYEA 2YQ5A 3BIWA 3FR7A 4YPVA 1F4LA 2I1LA 4MW6A 3W8DA 1D8AA 2EWMA 4M55A 3VR6A 4BEWA 5JCZA 3E3NA 4GOLD 1VLJA 1EFHA 5EKXA 4FXPA 2OQRA 3I6BA 2VEOA 5TQJA 4L78A 1OFVA 2PJDA 3D5QA 4EA7A 3GP8A 3E18A 2ZJ6A 3RBZA 5L4SA 3X2FA 3GLFA 2UZ0A 2NV0A 4RS4A 4XE5A 1N32B 3GEIA 1D8TA 4MROA 1HSOA 4EITA 5J2UF 4DR3B 2B4YA 4GZ5A 3K9FC 5B3JA 3LXMA 3VMFA 4CMIB 1N34B 1CETA 3OTHA 2B1IA 1J1IA 4K3VA 4MYDA 5KU1A 1UEXC 5EWMB 5GONB 5AM2A 3QOYA 4GPAA 1C7FA 4QXPA 4E14A 4FEAA 3ICVA 4AF6A 4REQB 4Q00A 2PWZA 1RM0A 3EVDA 5ALIA 3QMMA 4PPNA 4O5AA 2Q3EA 2FFQA 1FNCA 1M2HA 2JIDA 3QU4A 5FTWA 3ENQA 3RTCA 2GXSA 2X5NA 1NXXA 1ORRA 2A0XA 3NJ4A 2HFKA 4JL5A 2IV2X 3V5NA 4AX4A 5ECDA 4MVJH 4MR8A 2WDZA 1OA1A 1RI2A 1RM4A 1VL0A 4CMKA 2OV3A 5TGZA 3K0CA 3ZQJA 3P19A 5D6NA 3UIEA 1UDAA 1FBTA 2HXSA 2AFHB 4MV6A 1YR7A 2EBFX 3F97A 4C4AA 3A2MA 1P1FA 3CTMA 3K20A 3JWGA 3L1IA 2RAFA 4IKEA 3HJUA 2WFMA 1IBCA 1G2QA 3I9LA 5FPQA 1NSFA 5BWOA 3CLHA 4YV7A 3DLIA 2NVOA 2RI0A 4ECAA 4JYMA 1U0LA 2YBEA 4KR7A 4HK4A 1C8KA 3QJGA 1XNQB 4KRFA 3OY7A 2W6JA 1Y3FE 1NY5A 1VGQA 1BG6A 3ZZTA 1C1HA 1K89A 1QLHA 3BM5A 3F5FA 5FTKA 3PPXA 1O54A 4UCXA 5L3RA 3JZMA 2DECA 4DBLE 4F4IA 1P2TA 1O6ZA 5D3ZA 5A5GA 3HLYA 3V4OA 1EVLA 2UYQA 1QKJA 1U3TA 2OO3A 3MAGA 4ZO9A 3KQNA 2X2PA 3HI6A 2B21A 2COEA 1BO6A 2QP3A 3LP5A 3NGXA 1AX9A 4QHYA 1VZ2A 1JE1A 3K9LA 1YL5A 2R8ZA 4IIUA 1E1RA 4QDZA 4ENWA 3WWZA 5BR4A 2Y68A 4I9GA 3ESCA 1CB7A 4BC0A 3EGXB 1EMDA 1ANKA 3PVCA 4NCKA 4P32A 3ZYZA 2F90A 3O8OB 2PFKA 4ZYWA 1DBPA 2R1TA 3NJRA 1F14A 4AJIA 4AJLA 5L7WA 5DW3A 4DV7B 1XTTA 2IC5A 1D1PA 3AU8A 4TMWA 3TMKA 2P1ZA 3CEAA 3SXJA 1GTRA 3ZJUA 4RA6B 5GJVC 1MJGA 1CIJA 3W2HA 5D3KA 3GP5A 1CUVA 3ELYA 1SEPA 2HEGA 1DXHA 1V41E 2VXCA 4K7JA 3LBAA 4OMFG 3RYIA 3UGQA 1E4EB 1D2NA 1VE6A 5AM5A 2JFNA 3D8TA 5CB8A 2XCOA 2BFBB 2FCAA 3KELA 1FTWA 4OI0A 3MSCA 4X60A 3N39C 1I4WA 3SLKA 4LZWA 3TIVA 5B2EA 3P2OA 1B14A 2GESA 5TPZD 1DMSA 5EIHA 5KS2A 1U3UA 3L6BA 2QUZA 3NBZC 4F38A 3N07A 5BYJA 1KH1A 1GY8A 2F3QA 3DTNA 5ALSA 3SFVA 1E79A 1UQUA 4LYGA 4MGZR 3PKZA 1KJZA 3W90A 4YMGA 1NKVA 1N6PA 1YS1X 2FW9A 3NBUA 5BV2P 1AUPA 3HWSA 3NKLA 3RJZA 4C6SA 5DHAA 3PDIA 3A1TA 4I99A 2ISSD 3KFVA 4AIIA 4EYGA 4L5AA 3EB9A 1O3YA 1KDVA 4JT9A 2NU6B 4QPJC 3JQ6A 3L92A 2I4TA 5AUOB 2FPLA 3TTTA 2XQKA 1JBEA 2WU8A 2ZI5A 3C24A 4P3PA 5ECGC 2A58A 4YNBA 4EECA 4NZOA 1M1ZA 3F5DA 1PGOA 5C1BA 4I4NA 3ROQA 4S0ZA 2QTWB 1AUVA 5BYKA 2YWGA 3KPWA 4XPZA 1YI1A 4ZZ2A 2JIZD 4I5FA 3TTWA 4AYWA 1UEJA 3EOAI 2IIVA 4RY8A 1ISIA 1QP0A 4R9SA 2JATA 5J2UA 1H1TA 3QMPA 4TQGA 3DLPX 3B78A 3REOA 2BLNA 2EATA 1V8PA 3H9GA 4MJ3A 4EF5A 4GYWA 2QX4A 2JVKA 2ZSHA 1Y6RA 3TQOA 2IVFA 3ZWNA 4ID9A 4RAQA 1R18A 2QVXX 2P68A 4TTIA 4Z9BA 1SBCA 1YQGA 4OA5A 4EHNA 4E30A 1A9TA 3OKPA 1YA4A 1ACMA 1I4DD 4V3CA 2WZBA 2YHAA 4RMHA 1F60A 1OX4A 5ILGA 4KQWA 1FDIA 1PJSA 3X1MA 4BNGA 2C92A 1F7UA 3CLRD 2VS1A 2W22A 2D1FA 2BTQB 4PG8A 3N2GB 1X7HA 1BN7A 2XUDA 4YJHA 2G0NA 1WUKS 1X2EA 2PLWA 1MFPA 2Y0DA 2ICAA 3U5ZB 3HEBA 1W52X 1IY1A 1L4FA 1T8UA 3NGMA 4JBHA 3VPXA 5A4KA 1X9HA 3QEKA 4KCGA 1PFKA 4YLGA 4KQHA 2QD4A 3FBTA 5TB5A 1EBFA 1NN5A 2F48A 1LS6A 1PR6A 3MFQA 2R8BA 4QTUB 4UM9D 3COYA 1UKEA 4BECA 4F9EA 3GFRA 5BN3B 4MHTA 4RMJA 1TQ6A 2VKTA 5FBVB 1T25A 2VTBB 1J07A 2WWVD 3UCXA 2UVDA 3P5SA 2IWRA 5H9WA 1JLKA 4KUEA 5LBUA 4AJOA 3EGEA 4OD0A 5HF9A 5KHOC 1SHJA 4G1BA 4LY9A 2QM0A 1WXIA 3WADA 1QG0A 5LKRA 1UJBA 1CULC 2CHGA 1A5AB 2H1WA 3WLIA 3QPWA 1PL0A 3HA3A 3HXOA 1EIWA 1HQDA 1P4AA 3FWNA 4AICA 1J99A 4F1WA 4A36A 4KL8S 4NS4A 1Y48E 1EQ2A 3P2IA 2I71A 3KXLA 5LCXA 2JK0A 3EMDA 3PJFA 2PLNA 3T5TA 1W94A 2Q28A 5HS6A 1QGDA 4FK8A 4NJEA 3T54A 3SSNA 1AZLA 3N75A 4MAMA 4NX2A 1BW9B 3FVQA 3FCCA 2HL6A 1T91A 1OZGA 3I12A 3M5DA 3QXCA 5HMMA 2R62A 1U0NA 2XD4A 1OAKA 4GM4A 5K8JB 2PMBA 1JNYA 4LHYA 1C4KA 1XTRA 4AURA 4C0JA 4MUMA 4DXAA 3GLKA 3EFHA 1ADGA 4QBHA 4O4HB 4N9QA 3TO5A 2CJWB 1MX5A 1E2JA 4RSGA 5L6LB 5MN5A 5FL7D 2RG7A 4I1RA 4GNKA 2PQMA 4M21A 2JJQA 1QDEA 1SH7A 3NNDA 2GWRA 1UOQA 3PC8C 3S2ZA 1X0XA 2B7CA 1DEHA 2XT6A 4FCWA 4YP9A 3ZV3A 3G0OA 2V6IA 3VC7A 4DA9A 3HBNA 2Y8EA 4PC6A 4BP3A 3OTWA 5J4LA 3GMTA 4JC5A 5BOSA 2OXTA 6Q21A 3AXSA 2I2FA 4O8CA 3EBPA 3UXEA 3ERCA 5MN6A 2ZQZA 1YA6A 1JBQA 4TVOA 3D6FA 1LBSA 3M5WA 1R74A 1T0PA 4R9VA 5EJAA 1DL5A 3CVXA 4TVKA 4PNHA 2BFOA 1MC5A 3LPCA 4YP0A 2W71A 2XUZA 1N5RA 2D2VA 3NLLA 4XM0A 4AULA 3KX2A 1JQDA 3KK0A 4IHAA 1L5QA 3C4VA 4HAOA 1L4NA 4YCLA 4DCGA 3E3OA 4FEYA 1PDWA 3ER8A 1T2UA 1RJ9B 5K2MA 3PHJA 2C1EA 3A7DA 2ZE7A 4L9WA 4MGEA 4ZEWA 3CE6A 3FOEC 1S2OA 1ZMBA 1RZRD 2DVMA 1SRQA 3R75A 1KBQA 2A86A 2P4SA 3TM5A 4FB5A 4HQOA 5KDDA 3QIVA 1Q1EA 3ESQA 1FP4A 4YCMA 4PV7A 2UUOA 1XDGA 4M46A 5HCUA 1W1WA 2XGSA 3HKCA 4QBIA 1MGPA 1P5RA 3LYAA 3NHBA 3SYNA 1V8BA 4DC1A 4JVNA 1Y82A 1ZOIA 5EJEA 5HUHA 3D4NA 5HIKA 4AKHA 1ZH6A 2OKCA 1UKCA 1BRMA 2C9DA 3DR5A 3D2CA 2W4QA 4QGFA 1TYEB 2OBNA 4AIRA 3AFGA 5C80A 5IH3A 5J58A 3ZU3A 3A9UA 3S3TA 1BJKA 3GRUA 4XR9A 3QFTA 3PHLA 1M7GA 5J4YA 5LQAA 3G3EA 3KYCB 3CNOA 4DMKA 4MWSA 3HKDA 4LEIA 5AW3A 1H3FA 2ZUCA 1FRFS 3P1JA 3K8QA 1XZDA 3VR5A 4WHMA 2AN5A 1NX6A 2FPPB 1XQ1A 1ENOA 4PZ0A 4CTOA 5F7OA 1U63A 3QPDA 1JFVA 3R3UA 5DIZA 4F84A 1KHHA 3LTNC 4JIMA 4Q12A 1ZD3A 2HPHA 4MKFA 4FKMA 4WGFA 3WNCA 1K0UA 5C1IA 1MB3A 5G4KB 3TL3A 5KNBH 3H1FA 4KMMA 1R64A 1WMAA 5A0VA 2HYIC 1U3WA 1U2PA 1E7RA 3CYFA 4GGOA 3QKRB 3BDIA 1GL3A 3SIRA 1RR6A 4CKBA 2PUWA 3OBIA 3QEMB 2UVPB 5T41A 1UODA 3ROTA 4CFSA 2FUKA 3R77A 3IV6A 4G2NA 1GKIA 3EPKA 3N8DA 1HYHA 5KSWB 4WMLA 2H2IA 2PIDA 3N8HA 4JZYA 3CR3C 4G0OA 1VB5A 3SMVA 1DI0A 1U6JA 2HMYB 3BDAA 3CLUC 2BEVA 1XZHA 1WQ3A 1LI5A 4LK2A 3HBFA 5AQEA 3BMXA 5AW2A 5ERYA 1ZA1A 2FFHA 3LY7A 2F1HA 3QUCA 1M66A 3D1JA 3DE0X 1SKBA 3HXMA 2I6XA 5K3CA 1I7QB 3PT5A 3HJGA 4LTNA 4WN9B 4BC1A 5LOVF 3EW7A 1JUDA 4HBZA 4IJ5A 3RFXA 1VIMA 2VQFB 3KALA 4M36A 4RENA 1ZKMA 2FK7A 1P0IA 2ZDHA 1M6EX 4KOAA 1E9VA 4C2BA 8LDHA 5KTMA 3QJ5A 4NDZA 4ALLA 2FSFA 1Z74A 2D1YA 3GLTA 3PQ5A 1C9NA 1RC0A 4EZBA 1SC3A 1YS7A 2PAFA 3B3QA 3PUXA 4HMQA 4R1NA 4FNOA 3TTUA 3PNYA 3V3TA 3PUZA 3AF1A 1DEOA 3KQHA 1JJBA 4MUEA 2QL5A 3ZX5A 2XMBA 3C6QA 1RJDA 2PSHA 5EJ2A 3ZTYA 4BO8A 1YBVA 4MYSA 3K0AA 1V45E 1UC8A 2C82A 4F8JA 4FWTA 1B15A 2P9FA 2P40A 4ER7A 4YY3B 3BHIA 4ZAZA 4EM6A 1N5JA 1SZJG 2D3WA 3AHFA 1ZR2A 2KJQA 3EVAA 3NIFB 4UCQA 1UXGA 1KXZA 2FUEA 3ISJA 1S1CA 3NUQA 4ZQHA 1XRPA 5CLGA 4JS0A 2UYHA 4OHPA 2IT1A 1KJJA 2C4VA 4BQFA 1GAJA 5ERGB 2E21A 5A6VA 3Q8KA 1RM3A 4G1CA 2OORC 4IFBA 1VJDA 5DYWA 2WRZA 1FYFA 1H5NA 3BA6A 3CR8A 1JEQA 1R6VA 1ADYA 2ATCA 2HSEA 1K0FA 4G4JA 4HAIA 1WW2A 2WSBA 3P9QA 4ZARA 4K9DA 4YDQA 5I48A 3VC2A 3ZCQA 2C84A 4C4ZA 1Z18A 2I91A 4M0DA 3TQIA 4G23A 4G8CA 1NSTA 2HQRA 2LPMA 5C52B 1LLCA 2IRWA 4R2LA 4H3VA 1OI2A 5LWQA 1O95A 2QRHA 4LQCA 4G01B 4B1FA 4F45A 1QH1B 4HKTA 5JJBA 4UNSA 4ADSG 3TKLA 2MR5A 2P9JA 5DP1A 4M1TA 1U5CA 3ZX4A 2QTLA 5B4TA 1QHHA 4OPMA 4XSVA 3BD9A 1WXXA 4AG5A 1M0EA 4WX2B 3IKJA 2D6FA 1EKXA 2A2ZA 1LF0A 4U7FA 4B3HA 3ZGNA 2P35A 2BGTA 3HZRA 3PCXA 2QA5A 5LLSA 4A8JC 5F2EA 4QVIA 1G38A 2FSVC 2W0SA 3MJ4A 2V03A 3GLHB 1XI2A 1E9DA 4LRWA 2Q27A 3VU9B 1E9EA 3EEOA 3PRJA 5A1JA 3CVUA 3AILA 4KB5A 4EUEA 1ECLA 1IXYA 1Q7GA 4EZIA 3ZCPA 5J4KA 1KR5A 4D7AA 4J9VA 3UPUA 3K6KA 5FL3A 3TLKA 3EYAA 3H5NA 4M83A 5IXJA 4P7BA 5A9TA 5ITZB 3CXRA 3OETA 1Z5OA 4Q7EA 2XQJA 3HMQA 3IQWA 1ZL0A 4FKBA 4P35A 5AVZA 1YO6A 2FZ5A 3I9FA 5F98A 1AKTA 1OGYA 2CJFA 3BWVA 3DMTA 3L8ZA 2NU8B 3WIUA 2JGNA 3GAZA 6ADHA 3WGVA 5EL0A 4BB5A 5DWQA 4YMHA 1DJLA 1LU9A 4A0QA 3A1DA 1UC4B 1VI5A 4A0FA 3NHLA 3R2JA 4K9SA 4CF5A 1B0AA 1OPRA 1MOSA 2AN1A 1C3OA 2G28A 2JK1A 2NADA 2V7QD 3P4XA 3DBHA 4R31A 4Y1EA 1IN8A 2Y1GA 3QY9A 4U2DA 3OOYA 2HCJB 4CR6A 1XEAA 4F11A 2FGKA 4CT4B 4EHDA 4G0WA 3PGLA 1NJ8A 1C7IA 4MUBA 3RIMA 1VSUA 2WWYA 3BZBA 2CBZA 2PPVA 3D2LA 1RQLA 3FF4A 4RGBA 4MQFA 5CLIA 4C7BA 4DLKA 2ZXUA 4LF5B 1IQ0A 2ZTMA 4ZIRB 2VRCD 4ZHQB 1T4DA 3DBRA 3EVEA 3KEOA 2BBTA 2YHIB 5DGDA 2XTJA 2AQ8A 1M6HA 2Z8XA 1NN0A 2R8YA 1PEDA 3K6JA 5JWHA 1NTRA 3R4CA 2DLDA 4GH5A 3KXIA 2TSYB 4ID3A 5DLQC 4CQMB 2A5GA 3A4TA 3PV0A 1X87A 5FA6A 4OQYA 2CF5A 4LDRA 3CC8A 4MP8A 4QQRA 4WOPA 3RVLA 3ZYCA 4U8GA 3QVVA 1E0DA 5FOVA 2GBGA 1EVKA 3CWZA 5E1DA 3ND7A 3ETGA 4BVAA 4DLRA 4DMGA 3L4KA 3K32A 5IVHA 3CN7A 1ZWLA 4OTZA 2PUEA 1ZW1A 2VQ3A 4MW7A 1TFRA 1Z47A 1FZQA 2NW6A 5LOVA 1YTLA 5ENVA 1GXSB 1K9VF 4K28A 1NXPA 2WU0A 3C6BA 4GBED 1Y3AA 2W2MA 3I04M 1B76A 4JYBA 3M6MD 5IUKC 3L0BA 3PIDA 4D4KA 5B7GA 3GCXA 2VDPB 5DM0A 2IOYA 1PSDA 2FZEA 3IBCA 3P94A 1NM5C 1JMKC 3DE5X 4G4SP 2VRWA 2FA9A 3B1WA 3BWBA 1ZH4A 3FTNA 1YZUA 3P96A 4FE7A 1FP6A 1W85A 1UIRA 3CHYA 5EE9A 1H8HA 1QFXA 4HQRA 3UJPA 3F3SA 5KYYB 3IELA 3EIUA 2BGJA 4N5LA 2EP5A 1BEZA 1N25A 1EFPA 5I7WA 1FQWA 1J8DA 4TV9F 5LZ7A 3EUEA 3G8BA 2E3JA 3EVZA 3HY6A 4ZZIA 2KX7A 2GRAA 1JDBC 1W35A 5H9VA 1JHMA 4IZOA 1G4HA 3THOA 2ZPUA 2ZRIA 1Y7IA 2YV3A 2IXDA 3HY3A 4G81A 3UYKA 3T9BA 2B7BA 3ZHZA 5CX4A 2JFWA 4LRQA 1PV1A 2O20A 4MXDA 1S02A 2GERA 3LUPA 3ZK8A 1NWHA 3L9XA 4AQYB 1RYZA 3JAWB 4NYMR 2POCA 2JLWA 3E7PA 3U31A 1LPBB 5D8DA 1ZJJA 3T0FA 1ESEA 2QG9A 4C4PA 1U9ZA 4YASA 5AH0A 4L5BA 3QPAA 4MGYR 2V7PA 1RKXA 4Q7JB 4YALA 1C1XA 1YRBA 2W37A 2WQ6A 4QX6A 3OIUA 2AMVA 2I4NA 4FR2A 1Z73A 4LYFA 3RJTA 3WSWA 4MV8A 1ML4A 5EC8A 2OCPA 3AYXB 4GXRA 2AEEA 2I4MA 3GEPA 1WCIB 2CNWA 1MXHA 3FB1A 3DQQA 1BS1A 2JFOA 3OZXA 2ZYIA 4BO2A 1L5YA 1XQXA 4JLVA 3KXPA 4L8LA 1Q3KA 4ZPXA 4GU5A 1YZ3A 3ANLA 4EI9A 1KSGA 4BJ1A 2QSYA 3KKPA 5BSMA 4TTJA 3DD5A 4UOZA 4UJ3A 1G60A 1CSEE 1G7TA 1Z6TA 2P4UA 4JBYA 3WP1B 1P6UA 3SC2B 1ZZEA 3P9YA 1YC5A 2F43B 3AI7A 4ND5A 4F86A 1G8GA 3F5MA 2A4MA 2FZ4A 2BFMA 3GVPA 3AF5A 1GPWB 5JY1A 3I9OA 4II7A 3T9AA 1L4BA 1XR3A 5AO9A 4GUDA 5MN4A 2F55A 4O08A 2ZJFA 4D4IA 2WJZB 5HS4A 3DEIA 3IVMA 1MV5A 1P62B 1AKWA 3L4SO 4OCZA 1NZDA 1FQOA 1ORTA 3GA5A 3IO5A 4FYMA 1MG0A 4NU8X 3H0EA 4URFA 4GVLA 4V2UA 5F76A 3I72A 1HO3A 1VYHA 4YXFA 4EH1A 4LJLA 1E58A 4KQIA 4D8YA 3IGFA 1Q1ZA 3A4VA 1TCBA 4EHFA 3KAPA 3I61A 1PGNA 3DC2A 2WOOA 2X77A 5JNTA 4UM8B 3OOWA 4XIFA 4DZZA 1E1RD 4EKEA 4RMIA 3NRBA 1VPEA 1SA0B 1ISFA 3GFTA 3CEHA 1ZITA 1QYRA 1V8ZA 1FRNA 1IEQA 3C39A 2P9BA 3E22A 3H6GA 2QP4A 4CR8A 5I7VA 5J4VA 4F3TA 1GZSA 1SRRA 4F91B 2Z2JA 1TK9A 3W4KA 1UAYA 3WHIA 2EKLA 2F9FA 2QV0A 4KSCA 1MX9A 5FNVF 5TV2A 3A2KA 3ROMA 5C8DA 2WWHA 4WK6A 2QVGA 1F20A 5JS6A 4D56A 1HRDA 2PBLA 3U39A 3EPHA 1A7JA 2WAOA 1MT0A 1VHLA 2JZOA 3NVDA 1FDWA 2IYZA 4XIIA 3SYKA 5G41A 3AUUA 4DEVA 4CETA 4HL6A 5B55A 2IW1A 4YBRA 1F1BA 4UZSA 1CE8A 4PLHA 1WULS 3KSDO 3REQA 4GAEA 1BU8A 3T5AA 3CE9A 4MWBA 5T5QA 3B38A 2HRRA 2RD2A 5AJHA 2NTEA 1TK3A 3HR7A 3OJXA 1PZFA 3VVBA 3RSSA 1E9BA 3JQCA 3LZDA 3HACA 2FDXA 2CNNA 3HA7A 3UTDA 1WVIA 2XUQA 3GO4A 5AW5A 5IXSA 2I3GA 2IS1A 4FNAA 3FA2A 1K6EA 1OFIA 3FM9A 4LNUB 1GKLA 2Q41A 4LKOA 1Z8NA 2WF6A 3DHEA 5AVSA 1Z5VA 3BXXA 3JWHA 2X0FA 2HDHA 1YK1A 2VOEA 3LL7A 3M6AA 1RABA 4XCQA 3UWDA 3AF4A 2GNOA 3F4KA 4B6JA 1VJCA 1W4LA 2G07A 2JGKA 2OM2A 4FCVA 1FDTA 4TXJA 4E21A 5ADVA 1L7BA 3JVIA 1J8YF 3PUVA 4DSTA 2OCKA 3A4YA 3DDCA 2OLKA 3QUSA 4EQ6B 3A37A 2Z43A 3DTYA 3E53A 1CZOA 1QOQB 3EZXA 3KOMA 1VGRA 4GR4A 2XWBF 3VO1A 3IE1A 2EGUA 4P7KA 3WP0A 3V2GA 3HM9A 1JQLB 1M1NA 2O2SA 4ALIA 5C8YB 2GKGA 2R1VB 5HFAA 3ANNA 4M0PA 3OEYA 3T7JA 4DNFA 1ADJA 3RPEA 5BW5A 3CF6R 2A6PA 4QGGA 5JFGA 3RGWS 1MXFA 1TX4B 1C0IA 2VNJA 1UMBA 2C4MA 3FFBA 1PJBA 3I42A 3OJEA 1G0OA 1CNMA 2RH8A 3LUFA 3O3OB 2HCBA 3AF6A 1L7QA 4R1LA 3W34A 2OHVA 2EWWA 2F9LA 2ZJ4A 4PG7A 3UTCA 2OC9A 4EUFA 5KVVA 1KOGA 4YEDA 2OOSA 2B1JA 1BD3A 3H42B 3IALA 3LYUA 3OH8A 1KYQA 4F96A 2ONCA 1ADFA 3O4JA 4EGSA 3V2HA 3ADCA 2Z2YA 4RA9B 5AM0A 1G8AA 1RJEA 2H85A 2QN3A 3GPCA 1XLTC 2IP1A 4AJJA 1Q83A 3ZE8A 3MMZA 5CGZA 1BZYA 3AWDA 4BFYA 5IJZA 5FT9A 4UNQA 3FIJA 4YIKA 5C46F 1B2LA 2R3SA 3H5WA 4BGEA 1W73A 1H1DA 4DILA 4XB2A 3GGPA 4N3BA 4RCZA 4FFBA 4FOLA 2GARA 2IKQA 3DZJA 4P93A 3LOUA 3E82A 4XRRA 3RF7A 1FX0A 4BMCA 1H1LB 4L76A 1BCRB 4F04A 4N0QA 4F5WA 3W5BA 4ARUA 1VE5A 3I8SA 5AOAA 1XCLA 4KTVE 4AP6A 2MSEB 3FWKA 3K94A 3U6BA 1ADCA 3IERA 2REBA 1E9SA 3UFXB 1VHQA 1KFCB 1VRVA 1GL7A 4RVDA 5CMLA 1UZMA 4JN6B