1ORHA

Structure of the predominant protein arginine methyltransferase prmt1
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
318
structure length
318
Chain Sequence
b'FDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYQSMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein arginine N-methyltransferase 1
molecule tags Transferase
source organism Rattus norvegicus
publication title Structure of the Predominant Protein Arginine Methyltransferase PRMT1 and Analysis of Its Binding to Substrate Peptides
pubmed doi rcsb
total genus 91
structure length 318
sequence length 318
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2003-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 1orhA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1orhA01
5K8VA 3BWCA 5FWAA 2YXDA 4OQDA 3E23A 1SUIA 3HA5A 1AQJA 1WS6A 5E9JA 1WXWA 5DTRA 4POOA 4BY9E 2XBMA 2C7PA 2GPYA 1NV9A 4RTNA 2V7EA 3KQYA 4HSGA 4QPPA 1B42A 2O06A 5DX1A 2BR4A 4C04A 3ER9A 3C0KA 2P8JA 3G5TA 2ESRA 4K6MA 3AY0A 1WG8A 4AZSA 2AOUB 3ELWA 4GOOD 3MQ2A 3LCVB 1KR5A 3G5LA 4R8SA 10MHA 1X1CA 2IGTA 4YUWA 2DULA 4FSDA 3OCJA 1XDUA 4RVFA 5CM2Z 2G8NA 3GRUA 1O9GA 1R8XA 3OE5A 4F86A 3PLAE 2AOUA 2YR0A 4R6XA 4AZTA 2OPBA 4HTFB 1OR8A 1JR4A 3KQTA 5DRTA 3HNRA 2H1RA 3OPNA 5HIJA 1SG9A 3MCTA 2B2CA 4EVIA 1YB2A 3LCCA 4P7JA 2PSSA 5LQRA 1N7IA 4QDJA 2ONZA 3OZTA 5HEKA 5DTMA 4B17A 4FSXA 2PWPA 3HCBA 1FBNA 1G8SA 3P2EA 3P9IA 3HVJA 4DZRA 3B3FA 2O0LA 5DM1A 5LQAA 1ZGAA 2ERCA 2OKCA 5LSAA 5DM2A 2CKDA 2OB1A 2OY0A 4FT4A 5HOQA 3PTAA 2NP6A 1EQAA 4DF3A 3GRZA 5C9ZA 2O07A 4DMGA 2CMGA 3M70A 5KQSA 2CL5A 2OZVA 1VLMA 4DCMA 1JG3A 3B7PA 5HIKA 4RV9A 4CKEA 3UBTA 3EEOA 5K09A 4PYJA 3MB5A 3NMUF 2BR5A 2ZBPA 5K0JA 3O31A 5GWXA 3UJ7A 3MAGA 5EEGA 4CTJA 2JG3A 4RTSA 4OA8A 5KVAA 4ER0A 5CVDA 5DRYA 1T43A 5ICGA 2B25A 1ZKDA 3FTDA 4GOND 2VDUE 3FZGA 2UZ4A 4ER6A 2AOTB 4HRAA 2G72A 3H2BA 2I9KA 3P9NA 3JWGA 2HTEA 1KIAA 2OB2A 3HVIA 4PYIA 5EOVA 2BH2A 2AVNA 2WA2A 4M38A 4BP1A 1Z3CA 1WZNA 3UZUA 4E32A 2QE6A 4A6EA 2Y1WA 1HMYA 2AOTA 1XCJA 4KIGA 4X60A 2P3OA 4GUAA 5DLYA 5EZQA 3FYDA 1QAOA 3SVZA 3KHKA 3U81A 4YMGA 4RTMA 5CUQA 3IHTA 5DXJA 4Y2HA 4E33A 2H11A 3A7EA 3DR5A 4CTKA 4ER3A 5HILA 3OE4A 4KRGA 3LHDA 5EZSA 2IH5A 3M33A 3ELUA 3TM5A 2NXCA 3R0QA 7MHTA 3THSA 2AS0A 2P40A 3OU6A 4CWAA 1P39A 2N47A 4F84A 3SXJA 1JSXA 4IKPA 5DSXA 4AUKA 3NTVA 5CVVA 1MHTA 3P9CA 4PNEA 3NWBA 1IXKA 5EKUA 5FQNA 1HNNA 1UIRA 4IV0A 3HVHA 3P2IA 4HC4A 3KR9A 3P9KA 5EVJA 5C1IA 3GXOA 3B89A 4E2XA 5CIYA 4GF5A 4Y30A 2AOVA 1NW5A 2CMHA 1PRYA 5DTQA 1Q0SA 3BGIA 3CCFA 4FZVA 5T64A 3T7RA 2OBFA 5EQJB 5BW4A 2PT9A 3HCEA 3EVEA 5G02A 1KP9A 4PIPA 3FUWA 1XCLA 3DOUA 5FHQA 3HCDA 5H02A 5EGSA 3TRKA 4CKCA 1SUSA 3BXOA 1M0EA 5DM0A 2B3TA 4YV0A 4RTQA 5GINE 2AVDA 3G2PA 3FPJA 3I58A 3LKZA 2ADMA 1BC5A 4DM3A 4EKIA 2NXNA 3LGAA 3SSNA 1QAMA 3TQSA 5LQNA 3DXXA 1WXXA 3MCZA 4ATNA 1AQIA 4M37A 4QVGA 1EIZA 2HMYB 3C6KA 2HR1A 3D2LA 1P91A 3R3HA 2JH8A 5CD1A 4X1OA 5FA8A 5HFJA 4U7PB 2R3SA 3P2KA 3LDUA 2XVMA 3NDIA 3QOXA 3HM2A 2GAFA 2FPOA 4RSRA 3JWHA 4U7TB 3B3JA 3EVZA 5DT2A 3SSOA 3E7PA 2B78A 3ORHA 2VDWA 2Q41A 3A26A 3G88A 3TKYA 4C07A 3AXTA 3ELYA 3UA3A 4QTTB 1YFJA 5M5BA 2IFTA 2NYUA 5EMJA 1IM8A 1BHJA 5CVUA 1UFKA 4YV2A 2P7HA 5EKXA 2ZZMA 3L8DA 3OFJA 2UYQA 1G60A 4R05A 4RVHA 4E2WA 3KQPA 2ZVJA 1N7JA 1TPYA 3UWPA 1RI5A 4A6DA 2JH9A 4YUXA 3GRRA 3NWEA 1XDZA 1XVAA 5ICFA 3ID6C 5F2KA 1EJ6A 2YXLA 2EFJA 2B9EA 2IDJA 2XYQA 4F85A 1NE2A 3OZRA 1ZHFA 3CJTA 1R6AA 2BM9A 5C0OE 1NKVA 3HCFA 1XDSA 3CVOA 4MQ4A 5BP7A 5BXYA 4X63A 3GWZA 3TMAA 3GRYA 3LKDA 1NW3A 3CJRA 5FCDA 3HP7A 3M6UA 5P8WA 3O4FA 2DPMA 4FP9A 1M6YA 3MTEA 3KQMA 1NW7A 1JQDA 3P97A 1YF3A 4MHTA 3KPYA 3DH0A 1VBFA 4C4AA 5FQOA 2FRXA 2JHCA 2PWYA 2ZFUA 1RI2A 5FA5A 1SQFA 1VL5A 2QRVA 1TW2A 4KDCA 4PGGA 2ZSUA 3KQQA 5E2AA 2H00A 4R6WA 3SGLA 5CVJA 2PV0A 3LDFA 3LCUA 4KVZA 4E31A 2YXEA 3BWBA 3EVFA 5CCXA 5T6BA 2Z6AA 2Z6UA 2ZZNA 1JG1A 4IV8A 3DMFA 3BGDA 4ZTBA 3C3PA 3ME5A 5EIFA 1N2XA 1P1CA 4G56A 4QTUB 3ANXA 2AOWA 3EEYA 5B1SA 2IH2A 1PJZA 3FUXA 1FPQA 3QV2A 2PY6A 3KR2A 3FUTA 5K0LA 3BWYA 3PFHA 5K05A 4MTLA 4RTPA 2FHPA 5IH3A 2KW5A 3GU3A 3SX0A 2AN5A 2YQZA 2VS1A 4OA5A 4DKJA 3EGEA 3KQVA 4OX9Y 1NT2A 3FRIA 3UJBA 2GH1A 4NECA 5KYGA 1L3IA 4BLWA 4P7KA 4AZWA 3PT9A 5EEHA 1JG4A 4HTFA 4RX1A 2PXCA 2PT6A 3UA4A 5EHIA 2NP7A 1G6Q1 1G55A 2UYCA 5E1OA 4YUZA 2IIPA 1R74A 5FULA 5LQUA 4KW7A 3EMDA 4PGHA 1JG2A 1X1AA 1XXLA 2O05A 2ONYA 3LBYA 3AXSA 3VYWA 3G2QA 1RJGA 2IDKA 3M6XA 4WXHA 1AF7A 2AN4A 5EG5A 4BLVA 5DX8A 1ZQ9A 3C3YA 3IV6A 3HEMA 3HA3A 3HA7A 1UWVA 4RYLA 3P71T 5EMKA 2ZWAA 4RTOA 3GNLA 4E2ZA 1FP2A 5U4XA 2BR3A 4M36A 3M6WA 3ELDA 3VC1A 2HNKA 5IKMA 5K01A 1BOOA 5LQCA 3UJ9A 2JJQA 3TM4A 3EVCA 4KIFA 2IPXA 3IYLW 3UJAA 1NW6A 3DULA 1KXZA 2NXEA 4OBXA 4LWOA 1RI4A 1NBHA 2BM8A 5T67A 3LDGA 3GDHA 3C6MA 1D2HA 1RJDA 4C05A 5CVEA 3GO4A 1SQGA 4FGZA 1ORIA 1ZGJA 5GP1A 1WY7A 2YVLA 2PXAA 2YTZA 3A27A 3FUUA 4RVDA 2P35A 3JWIA 5E1DA 4X41A 3DMGA 3F4KA 5E8JA 4DQ0A 2QYOA 1NW8A 2AN3A 3T7TA 2GA9A 1NBIA 2WA1A 3B5IA 5JR3A 2OXTA 3DLCA 1DCTA 3IEIA 3LPMA 4V0RA 1P1BA 2ZBQA 3PX2A 4OQEA 4P7FA 2PKWA 3I53A 4GOLD 4LG1A 3A7DA 3BKWA 2FCAA 4PCLA 1FP1D 1TW3A 2PX8A 5K0BA 1Q0TA 3OFKA 3KQWA 1ZG3A 3EVGA 5GM2A 3EGVA 3K0BA 2GLUA 3EMBA 5E1BA 1Y8CA 3FRHA 3MERA 5D1HA 5F2NA 1QYRA 5FADA 3SSMA 4QQNA 1U2ZA 1VPTA 4MIKA 4AX8A 4P58A 4QQKA 4PONA 2Z6QA 3BUSA 4C08A 4HGZA 5EMMA 3TFWA 2P1DA 4GBED 1IY9A 4EKGA 1YZHA 3FYCA 1SKMA 5DM4A 5D1NA 3G8AA 4RVGA 3NW9A 2ORED 1KPHA 2PXXA 3BWMA 5DXAA 4YMHA 4QPNA 2QRVB 2I6GA 1I4WA 5GIPE 3TKAA 1YUBA 4LECA 3P8ZA 3E05A 3TR6A 2V74B 1NV8A 3GRVA 3VSEA 4HGYA 3VC2A 2VDVE 3HCAA 3DXZA 1DL5A 4WVLA 2WK1A 1O54A 3CJQA 2ZIGA 4ISCA 3ERCA 3NVKI 3G89A 5K0NA 3UJ8A 2ZW9A 3FUVA 2I7CA 1R8YA 2HWKA 2XYVA 2PLWA 3BZBA 2UYHA 4OBWA 4HG2A 3FTFA 5EMLA 3BKXA 3LBFA 3B3GA 1JTEA 3TPZA 3MTIA 4QVKA 4RTLA 2EJTA 1D2GA 1EJ0A 4PYNA 3ER8A 4ER7A 3UJDA 4EK9A 2ZWVA 4PYLA 4YV1A 1KPGA 4BLUA 3LX6A 1FJXA 1QANA 3V8VA 5GM1A 4XCXA 1AV6A 3AJDA 3GCZA 3RODA 4AZVA 2PX5A 2ZULA 3E8SA 3EGIA 5ICEA 1ORHA 2BZGA 3DXYA 1L3BA 1VP3A 3RW9A 4DA4A 3LSTA 4LWPA 3SMQA 4V0QA 3CC8A 4C03A 4XUEA 5BW5A 4HH4A 3SR4A 2EJUA 3FPFA 5E9QA 3LECA 3A4TA 2ZZKA 4M7RA 3GJYA 2AR0A 2ZIFA 1O9HA 3R9XB 3QOWA 3I5UA 3PB3A 1JSZA 5K0EA 3FTEA 2C7QA 2FK8A 3K6RA 1M6EX 1RJFA 2FK7A 2PX2A 1MJFA 4PYQA 3REOA 3TOSA 2I62A 3NVMB 4XUCA 1VIDA 2VZ9A 4CXMA 3M6VA 3Q7EA 4FT2A 5F2OA 1EG2A 1INLA 2CWWA 2C7RA 3G8BA 1KYZA 3KR0A 3KKZA 1D2CA 4DCGA 1VQ1A 3KQSA 3FPEA 3HTXA 3FTCA 3T0IA 2GS9A 2P3LA 3HVKA 3G2OA 4MWZA 4RTKA 5LQKA 2A14A 5E8RA 2AOXA 3I9FA 4GOMD 2ZBRA 1I1NA 2AZTA 3JWJA 1DUSA 2QM3A 2HV9A 1VP9A 5HIMA 5LQJA 3MHTA 2R6ZA 3S68A 3CBGA 4FS8A 3A25A 4H0NA 4PINA 4RWZA 3PX3A 1L1EA 5EC8A 1XJ5A 1F38A 2P3QA 2PJDA 3KPWA 4GQBA 4E30A 1JQ3A 5CCBA 2NNWB 1SVUA 3DLIA 1KPIA 1R00A 3R24A 5FWDA 5K0FA 5GOZA 3WSTA 4R8RA 5K0GA 1XTPA 3I64A 3AWIA 1EAMA 5HIIA 5ICCA 1V39A 1F3LA 3MGGA 1KYWA 4PYMA 1YZ3A 2O57A 1JTFA 3RIEA 4E70A 2E5WA 2FYTA 3KU1A 4PWYA 5K0CA 5FTWA 1X1DA 1RJEA 3G2MA 4RTRA 4YUYA 4E2YA 4EMSA 3T7SA 4CKBA 1YFLA 3LL7A 4EQZA 5K03A 3Q87B 3TLJA 3FPGA 4RTJA 2JHPA 3NDJA 3FPHA 2JHAA 4C06A 2ZLBA 3SM3A 3KR1A 2LD4A 3V97A 2ZCJA 3KPUA 3OU2A 2IP2A 2Y1XA 3NJRA 3X0DA 4PIMA 4Z2YA 3GGDA 2P41A 5KS2A 1KHHA 2UYOA 3GIWA 4JXJA 3OZSA 1G8AA 3PFGA 3PVCA 4UOEA 2IH4A 1QZZA 2NXJA 2IBTA 5JUWA 3BT7A 4BP3A 5EIWA 4FR0A 4PYOA 5DWQA 3OU7A 4IWNA 5DPMA 3EVDA 3G7UA 2PBFA 2EG5A 5DSTA 2OO3A 2ZIEA 1X19A 3KPJA 1I9GA 3KPVA 5EHGA 5FHRA 2ZTHA 3THRA 4XUDA 3UJCA 2XYRA 3DTNA 5E1MA 3CGGA 1X1BA 1JQEA 3EVAA 2P7IA 3UJ6A 3M4XA 2XVAA 2K4MA 4KWCA 5LR6A 3DUWA 1RI1A 1VE3A 9MHTA 1H1DA 5HZMA 3DP7A 1G38A 3CKKA 2GB4A 3DMHA 5GIOE 2YX1A 4L7VA 2YUIA 4QDKA 3O7WA 5EPEA 4KDRA 5KQRA 2G71A 3R6TA 4PCAA 3EVBA 5E9WA 2EX4A 4GC9A 1L9KA 5E2BA 3BGVA 2PVCA 1BKYA 2F8LA 4GC5A 4YUVA 2G1PA 5FUBA 4P7GA 5ERGB 1QAQA 3HCCA 1R18A 2VP3A 3EPPA 5MHTA 5DX0A 2OYRA 4ER5A 4O29A 4PYKA 8MHTA 2C7OA 2PGXA 2G70A 3UFBA 4X61A 1RI3A 4GEKA 1L3CA 3PS9A 2IBSA 2QY6A 2PX4A 3KQOA
chains in the Genus database with same CATH superfamily
4UMDA 4LMBA 1OVGA 1ZGCA 3D8NA 4OQDA 4QICA 4RA9A 4X54A 4ZOLF 2OXIA 3VSDA 4CQLB 5BMVB 3EZYA 1COZA 4GL4A 3RJMA 5B6PA 4TRMA 1Q7TA 1I3MA 2MDTA 1F6WA 4G1UC 4WNCA 5B30A 2C7PA 2JLAA 1LV7A 1YQGA 3G1TA 3ZU2A 2Q27A 3MMXA 1C80A 1FJ2A 1G0NA 5DX1A 3SC3A 1D4AA 1GFWA 3X1DA 5C5EA 2CEKA 4LFBB 3RAEC 4BWYA 4NYIR 1E6EA 3CHYA 4NMWA 1XMIA 4OL0A 3UJHA 3QVGB 4XTCS 3O0TA 10MHA 1Q7EA 4JWKA 2FKAA 4GW3A 1FSFA 3B38A 3TCNA 4I66A 5CBPA 4I1SA 4G0MA 2JGDB 2ACKA 1B93A 4GVPA 2X6TA 4Q9AA 5KTMA 1FSZA 4KGXA 1NULA 1J00A 3SYKA 3FE2A 4PWZA 3HI4A 3OWOA 1HTTA 1U0EA 2B2CA 3IT2A 4AROA 1XPUA 4K9RA 1FS4A 1TC1A 2VNKA 5JVDB 3GZTB 4MGZR 2R6DA 2JI7A 2B98A 3DMDA 2JFOA 2MSWA 1FP4B 4R4JA 4WJZA 4EM6A 3GMSA 5DGXA 4WCFB 1T35A 3IB6A 2I4NA 4DXDA 4OHCA 3PHLA 1LX6A 2PGDA 1ZR2A 2VPYA 1K68A 1CDEA 5FDFA 1KOLA 2HK8A 4YAGA 5KNDH 2J1LA 3OQMA 3RSGA 5H3HA 1GADO 4K46A 6GPBA 1O6CA 1CBUA 5HZGA 2I55A 5IKXA 1UM9A 1VLMA 5CLJA 4UBNA 3B7PA 4WK0B 2INGX 5CX1A 1S9DA 2X8WA 4PGAA 3UBTA 3HZHA 3BF8A 2P5TB 3LQYA 3MB5A 5EY5B 3MJVA 3DAGA 4RVUA 5EHQA 3N6VA 3AIKA 4N5MA 3H5AA 2FMIA 1PL8A 2J9YB 2Y2UA 3JRXA 4ZOBA 4BB0A 5M29A 3DE3X 4RTSA 3C7TA 1GUBA 1YU9A 2Y0BA 4LRUA 4B7CA 2X1MA 2Z83A 3FF4A 4G37A 3K32A 3K5HA 1G9XA 4DSOA 3GJ3A 1C1XB 2EP5A 1I4OA 4ZRMA 1OU0A 4JL5A 4F5DA 4PPFA 4XGKA 1C5KA 3E5MA 3SYLA 4M38A 2BHSA 2XUOA 1C9JA 4AL4A 2IZ6A 3EXAA 4C6SA 2P5SA 4YMGA 2O3SA 3QU5A 3GEPA 2EQ5A 3ZCTA 5MDHA 1F9AA 3K96A 3UPTA 1D4ZA 3URKA 1XA0A 2I4MA 1T15A 2AS0A 2POQX 4HRYA 3THSA 3NIDB 4WKCA 1E5TA 1Y5NA 4GICA 4ZXPA 4HZIA 5I8ZA 1XAJA 2ETXA 3M34A 2TMGA 2ANCA 5TMEA 2GN8A 1TCAA 2YJ5A 2QWXA 2P5YA 3JD0A 3JQPA 4JFRA 1T2VA 4NCXA 5K1ZA 3W5CA 1G8MA 3FFTA 1T5BA 4AP9A 2IXEA 3MSXA 4EW2A 1WOYA 4CM8B 4ZKDA 3OHSX 4MUIA 3FTQA 5T64A 5IXJA 1N6OA 1A5TA 2WJHA 1GUYA 4UC0A 5J59A 4A8HA 3C98A 4X1KB 1JEEA 1SULA 2BFEB 2JJ1A 1G7RA 2WZQA 2DHRA 3HCEA 3OLVA 4RYDA 1KH2A 1SG0A 3VV3A 2VHUA 4CIXA 1TQHA 4RKWA 4UQOA 1KZ4A 4J9VA 4UZEA 4GKAA 4G09A 4MWSA 3G49A 4KMOA 4HDAA 4F11A 2AQHA 1J09A 2BFEA 4QJBA 1SCIA 2I67A 2JFQA 4D41A 5CEEA 2WWHA 2IU6A 2WTUA 1Z13A 2CXXA 5JS7A 4ERNA 3C24A 3DZHA 1HT2E 2A35A 2H52A 3GW8A 4M37A 5A0FA 5JVDA 4GOKA 3ZWMA 5JAPA 3X44A 3S8EA 1KMMA 5DEOA 1KFEB 3V4FA 2G07A 2XUFA 4TWRA 4U7PB 1DQYA 3P2KA 3VPHA 1HLFA 1YBMA 5CH5A 3GPIA 1TGVA 5FOVA 3H1TA 2PCJA 4JGGA 1YV9A 2R6GA 4FR5A 4UXHA 2AC4A 2YH2A 4XIGS 3ZGVA 2XXAB 1CTQA 3P2YA 2JDIA 4X00A 1A9SA 5HFAA 1X7HA 2R68A 5JNWA 3ELYA 3ILVA 2XITA 2CXNA 2GMWA 4GR5A 3GYBA 1LC0A 3FLMA 4HNAA 4K0RA 3E9CA 1E9BA 3QUAA 4HNQA 1MJNA 1V47A 1J0AA 3VH4A 4BNHA 5CXQA 5EJ6A 1GPKA 3CIFA 4A6DA 5ABPA 4QBKA 4HGOA 1AN9A 1JQBA 1RAAA 3OFND 2R9VA 1D8TA 4E5NA 2YMLA 2JJMA 3QX9A 2P6NA 4JFAA 2JLXA 4NFSA 2VC2B 4OQZA 5ICFA 2WD9A 4YP6A 3ZVKA 1IBKB 4RPGA 4X1IA 4YACA 4F85A 4GMDA 4EHBA 2W6CX 3CX8A 1SA0B 3TN7A 2FNAA 1DOHA 2JZOA 2OFOA 1SVSA 3DEFA 3PDWA 1RZ3A 1X1RA 2H07A 2EFDB 4X63A 2ENUA 3WICA 1EFVA 1XZDA 4RVSA 4CDRA 1ZN7A 3IO3A 3NPMA 1YO6A 3AC0A 3JALA 2HI0A 1RJWA 5AK5A 4B7XA 2Y4OA 4KH1A 3I6MA 4UATA 4L27A 1IZ9A 4WZAB 3U3KA 1YK0A 4CETA 1YDEA 3MWFA 4MDEA 3WB9A 2Q7OE 4JLKA 4FM9A 1MDFA 3FKJA 5JD5A 1DEAA 1AKNA 3FMIA 4PX9A 4YPVA 4PHTA 1WETA 2YC4C 1KS2A 1TW2A 2YJGA 4IY1A 4D9EA 5AVZA 2ZSUA 4BPBA 4A27A 4MPPA 2YXBA 4B83A 3H5VA 3RUCA 4DV3B 1SXGA 1V8ZA 1MAAA 3I4CA 4B3BA 3NAZA 3I6IA 2Z6AA 1JG1A 2HREA 2XGMA 4NZOA 4BO8A 1JHZA 2GK6A 4EG7A 2QUKA 1LTHR 4J8PA 1QYXA 1VMEA 4JBNA 3ANXA 4QTUB 3RWMB 3UG7A 1SQ5A 3FR7A 3LNTA 1JHPA 2PY6A 2J3IA 3AB3A 1SBQA 2HXYA 3PYXA 3VPGA 4BEJA 5EHZA 5IH3A 1FU7A 1P2DA 2PU7A 2RAPA 2RBEA 1J23A 3GU3A 4FGUA 4C30A 4CKYA 4DBLC 4DKJA 4XA8A 5C80A 2ALJA 5H1YA 3EA4A 2VK8A 3QHPA 2PS3A 3U31A 3UJBA 4Y9SA 4BLWA 3IALA 2AE1A 2PQMA 2XLBA 4FOTA 1ZCZA 3VDXA 5KIAA 4NCBA 4REQA 1MAUA 3TK1A 2M98A 3ECCA 4DWOA 4RUKA 5DV9A 4D0SA 5BWLA 5CB4F 4PGHA 1F8GA 3WKDA 2CL0X 3ZDRA 5LBUA 4EW3A 1S9HA 3OF3A 5FR1A 1M5TA 1RJGA 1C9DB 2DPYA 2NYRA 3IP9A 5EZYB 3GLIA 3GFOA 4R5HA 2ZRQA 1VLZA 1YACA 2BRUC 4JOBA 1LC3A 1WX1A 3T7IA 3TZLA 4DIFA 2FUKA 2A5LA 2CUNA 2C3YA 4CEIB 1UBCA 4AF7A 3RQIA 5A4AA 4KQXA 5IMSA 3NBYC 3VPFA 3ELDA 3W9SA 1BOOA 4PC2A 3DNMA 4YRZA 4UUMA 2XQKA 1SVIA 4D80A 4HH3C 2RK6A 3CV3A 1DKQA 1NBHA 3A1VA 4IIXA 1A2BA 3NETA 4XKJA 4B4OA 3X2EA 4DARA 1RJDA 4YNBA 1HH4A 1JFSA 1KYTA 2WG0A 3FCUB 3IDOA 4KLAA 1T5HX 2ZRAA 3FVTA 1I01A 4AF6A 4B6EA 1E61A 4A2PA 1KI1A 4K5QA 3EF1A 5IPFA 5GJBA 3Q9LA 4GZ5A 1LH0A 4R0NA 4WKGA 2A88A 1OTXA 2KWIA 2D1QA 1NW8A 4BLTA 1NKSA 2BM1A 1OWLA 4CHTA 1UAYA 1SZDA 4DDHA 3H1FA 1MB4A 2XVXA 3QVLA 3Q10A 4G8DA 3T5BA 2YASA 4PCLA 1ZPDA 4S12A 4IICA 4MW2A 3TE7A 4AQ7A 1KJ8A 5DK4A 3EGVA 5GM2A 2GLUA 3OA2A 5HMLA 1Q3TA 2EU8A 1KL7A 2KQUA 1OYYA 4XOIA 4EFNA 1ODIA 1LF0A 3EC7A 2CK3D 5LD2C 1C9MA 4LVUA 5ADUS 2WMOB 1O2DA 4BNUA 2GK3A 5JDCA 1J49A 5KC9A 4GBED 3KB2A 4RJLA 3FOZA 1ESCA 4OLFA 3WGOA 3DTYA 1IN7A 1I24A 3AQ4A 3H8VA 4KGVA 2ZRPA 4P3NA 4CMBA 5JMWA 3I09A 4NAVA 4C2AA 3PEYA 4HNUA 2W6IA 1Z5VA 1FYEA 5FI3A 3WQQA 2O8BA 1RYYA 2NPIA 4XB6B 3UICA 4ENPA 1P4SA 4IOLA 2AF4C 4QELA 1B4DA 1X8KA 1X80B 4N5LA 2CC2A 4YP1A 3EXFB 2GPBA 1SD2A 5ITVA 1QIMA 3NHMA 4RE6A 2VTBA 2PSFA 3WMGA 2VRCA 2RDMA 4FFBB 5JO0A 1N34B 1BFKA 5I7AA 2IHYA 1NXVA 1W1WA 2G8LA 2WSIA 4ZVKA 4WFKA 1KFBB 1W0KD 2XMCA 4KHZA 4DQXA 4CGYA 1U6KA 3G7NA 3GC6A 4YTEA 4BLRA 3O84A 5K8UA 4IQFA 4E1VA 5HKOA 2EFHB 3AEUA 3GOQA 1FJXA 3L7NA 2NGRA 3MFYA 3V8VA 1TEHA 1PK7A 3QELA 2VTKA 4MRVA 1EXDA 5JDIC 2RONA 2XPCA 4DV4B 3ROZA 4OI0A 1JU9A 1T6BY 2LRHA 4AJEA 2FVYA 2BN4A 3GOHA 4RMGA 4E94A 4G23A 4IOJA 3IS3A 2WT9A 3KQHA 4JASB 4LKRA 1RPAA 4IGFA 1ATIA 1IULA 2WHRA 4M1KA 3S0JA 4UUAA 1M6EX 4PAGA 3JYOA 2J0EA 3VDMA 2C8JA 4A0FA 4AG3A 2IYVA 3BXEA 3NHAA 3A4YA 1VIDA 1PT7A 2E5FA 3DVLA 4Y1RA 2CDAA 3NBQA 3QF4A 5JPIA 1RCTE 3EQ8A 1BMFD 1EG2A 4GECA 1D1SA 4MLDA 1FOEB 2LNDA 2Q62A 2A1IA 3WGJA 4UQLA 3ZJVA 3BTOA 5LOVA 3LFTA 1MTZA 4TRJA 2HRDA 1CT9A 4HDSA 4ZO6A 3ZGNA 2PUGA 4OLJA 5FBLB 4DS3A 3QF4B 1QTRA 4NZPA 4B47A 1APBA 1KO1A 2GDJA 3IULA 4TMVA 3GA5A 4CCYA 4CR6A 1VLHA 2QENA 1I36A 4P4GA 3EGDB 1QO0D 4L95C 2F17A 5I9IA 3C1AA 1RTKA 2BFNA 2VYFA 2HDHA 4WNAA 2R6ZA 3IHWA 3UOGA 5KOJA 3MHTA 1Z56C 5TPWB 5KI6A 1Z2PX 2I6TA 4GFDA 3TIVA 4ZO7A 4TL7A 1FMCA 2O0JA 2H1OA 2ZJ6A 5EXXA 4OM7A 2ZUSA 4L4XA 3VNQA 4BFZA 5DMHA 1TNDA 3CW2A 5CDFA 5ADWA 1K75A 2CZQA 2VUHB 5CJ2A 4QZVA 4YMLA 3ZJ4A 1N8NA 2ZT7A 4AJJA 1PKEA 1P4HA 4D2IA 3DE5X 3RTAA 5GQSA 1COWD 4E2YA 4I46A 1EK6A 4UHEA 4ARVA 1F8YA 1LV8A 2VP5A 1P29A 1M10A 1GCGA 2BEWA 4CKBA 1QQAA 4N8DA 1KJJA 2CLCX 1XTVA 1FFCA 1Z33A 3FVRA 2QIPA 4JR1A 1ZGHA 3Q15C 4IH4A 4JBHA 1SBZA 2XR1A 1RPJA 3H8JA 3L0OA 4MUGA 1UDRA 4Z9YA 1VYHA 5EJEA 3K0CC 5CCDA 5SZHB 3UENA 3WIVA 1GEGA 3DW1X 1NMQA 5ADVA 4MK4A 3B51X 4XH9B 5BPFA 1VRVA 2I34A 4LQLA 1DP4A 3TGLA 3MJCA 3W3ZB 1PJ2A 3JQQA 3D6VA 1RMQA 1T9ZA 4UNQA 1PQYA 4QPZA 4IP0A 4C2TA 1CRQA 3IDSA 4LOLA 4PRKA 3CTMA 3W5UA 3FHTA 1U0GA 3GR6A 2IBTA 1QE5A 1O97C 2ACEA 2CVOA 1LGYA 2ILVA 3ON5A 4TS4A 3GXBA 3F5DA 2X15A 4UM8B 4E2FA 1EUCB 4AN1A 2HRCA 2OO3A 4RZ2A 4TLDA 1Z47A 4AMYA 1MD9A 1J99A 2AK3A 4I50F 4NNJA 4NX2A 3DTNA 4G67A 4TS3A 2HCFA 1JQEA 1SVOA 3DGEC 2WLTA 4JDUA 4P86A 3ZWVA 1NFRA 3PC3A 1OI3A 4FZRA 4LTDA 1KVTA 1II9A 2FJUA 1Z3IX 3MWYW 4DSAA 4FLEA 2EFGA 1A7KA 4JS0A 3WA7A 4ZVVA 4RDCA 5KWIA 1KH3A 2B2XA 2Y99A 3VR5A 3W78A 4ZDIA 1N9GA 4RORA 3HJCA 4MMXB 3I42A 3AGPA 2PK3A 2WVGA 4Q3AA 2G0TA 3O4GA 4B6SA 2DUUA 1HF3A 1LZKA 5A9SA 4EY8A 5I48A 2G1PA 4TS1A 5ERGB 3F1LA 1E0KA 2C7BA 3QYFA 3ROMA 1EP9A 1HKHA 1EDOA 4KQ9A 2MYUA 1CZHA 1IE3A 1EA5A 1MIOA 1NM5C 1W25A 1XI2A 2GJ8A 2H8KA 3EPRA 3PQ5A 1ULAA 4O29A 4PYKA 2A5GA 4PBRA 1SN7A 3GQBA 3N5KA 1YRAA 5CLLA 2A0WA 2I4LA 3K6JA 3PS9A 4M1WA 1DDOA 3FDZA 2V0CA 1ZGZA 1YB4A 1Z0JA 2J9XB 2A9OA 2PMBA 3BWCA 2ZJ3A 1U0LA 4RPCA 4EW6A 1VSUA 2BF7A 2QS9A 3DMRA 3TWOA 3K5IA 2QW8A 1AUOA 3OQVA 3QIVA 5CA1B 5J1SB 1WDTA 4WBSA 3DWEX 3IV9A 1H3NA 3GQBB 5E9JA 5TXGA 2TMKA 3UWMA 4RM3A 4POOA 1J20A 1NV9A 5IWAB 2IHNA 5BN3B 4KV7A 2JATA 3STHA 2QG6A 2IW1A 5IAKA 5EJIA 3RFVA 1ODCA 1XC7A 4C04A 2F43B 4YRBA 4K6MA 4R69A 1T3ZA 5C1BA 2FPKA 3AUKA 3DDNA 3D6HA 4LDQA 5JDCC 1A4RA 3S2IA 2WJZB 1QRUA 3FCAA 4ZU6X 2HU8A 3ETNA 2IGTA 3KXKA 2FFHA 5EGNA 4GX1A 3WK8A 3W4JA 4LIPD 4R3WA 1BE8A 2D2XA 1F14A 3KWFA 3LK7A 4COOA 3GRUA 1O9GA 2PUHA 1JJBA 2VBCA 3JQ7B 4KX5A 2P9GA 5MN6A 4D7AA 1KJQA 3BRWD 3KOYA 2GJ4A 2GOYA 4OMFG 2FY8A 2VG8A 3GJXC 1JEAA 1VKHA 2WINI 1Y8RA 3C8UA 3LPDA 2XWBF 4CM6A 4N5HX 3GFVA 4X71A 3QQPA 4KI7A 3BEOA 5EMHA 2IP1A 1P2FA 2A67A 2D3TA 3GPBA 4EYKA 4WJLA 1C8LA 1EE1A 1AXGA 3G82C 3S29A 3FCSB 4W5OA 1I2MA 2O0LA 1YHZA 1EMDA 3T7KA 1U1EA 2A1UB 1ZGAA 2ERCA 3VYVA 2O5EA 5EFOA 2Q07A 3H5NA 5ITZB 3UTDA 1ORDA 1SUDA 1W4CA 1R6VA 1BSVA 4M1YA 3RYIA 2OZLA 3D2AA 4NVRA 1AURA 4NJEA 3ZWPA 2JBHA 4DCMA 4AXXA 1PR3A 2WMYA 1EYZA 5T4FA 1FVXA 5K09A 1DINA 1N5KA 1U4OA 4LGVA 3OIFA 3W6ZA 1F8XA 1AZTA 1PLJA 2C4TA 2VWQA 3MWDA 4GLFA 1VRCA 5FYDA 1T43A 2GEBA 5LMCA 2IXBA 1JLLA 4GOND 3U6BA 4GP9A 4DR4B 3H2BA 3DS8A 1A9OA 4ALLA 5FWNA 1N6PA 2AG1A 4OV6B 3IUYA 3AHEA 4U39A 5EOVA 5LC1A 1TIBA 1ELOA 3UF0A 4CLXA 4F6RB 2EXXA 3GZNA 1G42A 4F7DA 2PKQO 3NS7A 4Q4LA 4XARA 2JLZA 3D43A 5C46F 1XCJA 1ESNA 2NNLD 2VF5X 2Y71A 3DWIA 3FY4A 3ITNA 1DDIA 5AI0A 2DYKA 2GQ0A 2Z58A 4Y2HA 3PJEA 3JQ9C 5AVXA 3R4CA 3USCS 1QHIA 1P6UA 1VCNA 1Z7BA 2CF5A 2PUJA 3KLOA 3M33A 3GJ4A 4ZJYA 5CVTA 1LDNA 1Y6FA 2FW9A 3DOOA 1MV5A 2VNAA 3O8RA 2ZR0A 4J75A 1AGYA 4OOEA 4HAWA 3SP1A 1YTLA 4BV9A 1W73A 1XMPA 1P4GA 4LYGA 2RHMA 5FQNA 5JNSA 2YDYA 3AG6A 4AMVA 3TZKA 2UYHA 2OBNA 2C5SA 3EWIA 2B0JA 3NBMA 4TMXA 4EPYA 2W2NA 4B7UA 5JAUA 4PHGA 1F7UA 4Y30A 3HJRA 3GEBA 1HEIA 2R8EA 1ZY2A 3C4QA 3HCRA 5DTQA 1PTKA 1P9OA 2R4QA 3RVPA 5K6AC 3AI3A 2EX1A 3IL2A 1NVAA 1V1RA 4B76A 4RJ2A 3RV4A 3FMPB 2VRWA 4ITVA 1TD1A 3FZNA 1U5AA 2HO4A 1MHPA 3DBRB 3GWGA 1R16A 4O3MA 3E3AA 5TMDA 5C35A 1KWGA 2WQ6A 3ZQ4A 1QHGA 1JDVA 4QJ5A 1HDOA 1AQYA 4KBFA 5F78A 5GONB 2D1TA 1XTJA 3HS3A 1KKUA 3EH1A 3BXOA 2QX7A 3HXQA 1Z08A 3M81A 4U63A 2OSVA 3JQAA 2AVDA 1UJCA 3ANNA 1A77A 4K9OA 1EWYA 2IKQA 3LT1A 3LZDA 5I9BA 1QGOA 4QLBA 5B7NA 4UVHA 3T5AA 4B3TB 4L6IA 1GG2A 3CW8X 2OHGA 2V0GA 1TLLA 1BJRE 4C3UA 1FQKA 1M1YA 4Z1MA 5LQNA 1ZLYA 3Q3CA 3KUDA 2G83A 2F3SA 3ETGA 3KYIB 4KTVE 4LI0A 1XHLA 2CW5A 3HKBB 4LVCA 4QYIA 3TVDA 4EHLA 5CD1A 3BJIC 3KQKA 1PTJA 3GVIA 3HBJA 4PSUA 4FLMA 1R2QA 4R9SA 4EUEA 1BX3A 1GQRA 1M8FA 2P3SA 1RRVA 2XNDA 2XUJA 3CT6A 4Y2UA 4RV5A 5DT2A 5A5FA 2APJA 2W8BA 4X8MA 2QE7D 4QTTB 1FB5A 3EEQA 4FIZA 4IEEA 2UXDB 3MJ4A 4FLFA 1Y3IA 1P33A 1M5RA 1NI3A 1K3FA 2BVNA 3L4SO 5EE1A 3X2FA 2PGIA 3ZXXA 4TT3A 4E2WA 1YTUA 3UMRA 3CE6A 16PKA 2EQAA 4PBTA 2GPWA 2C5AA 3QW4B 4FINA 4RY0A 4BUZA 4ZHSA 3GGSA 2F2TA 4RDXA 2J3MA 1WULS 3FTNA 4ZT2A 1UXJA 2WM3A 2W2PA 1GKIA 2YIDA 4H16A 2O7RA 2X8BA 5JYCA 3FKSA 5AI5A 4D4MA 2XZOA 1F0PA 1O1YA 3NB0A 4AO8A 2HIMA 1RXYA 1YA8A 4JT2A 3S5JA 3WY9A 2R48A 4KNWA 5JXHA 2OV2A 5EUQB 2RI0A 2JBAB 4H7FA 1RQRA 3THOA 1ECBA 5L51A 1SKBA 2O7QA 1XRQA 2PJRA 1RADA 1O03A 3HZZA 2OD9A 4A2QA 3BHMA 1R3UA 1YD7A 4PC1A 1U8CB 3H2KA 4QOGA 4RZSA 4WESB 4GP6A 3S28A 3EDMA 1G5PA 4CKZA 3V4OA 5JWOA 1K0UA 4V3BA 3V33A 4OG2A 3DD1A 2FRXA 3V55A 2BFDB 3ZHVA 3IJPA 1XLTC 1T36A 5T5QA 5COQA 4OB6A 1EXNA 4W5RA 4J0FA 3CR8A 5K3OA 1C0IA 1SCJA 2L82A 3QVMA 3NXKA 5E2AA 3VU3A 3LJKA 4KPYA 4J03A 4JELA 1S8NA 3OZGA 4AJ1A 2V0NA 3H8SA 1U2DA 2F1IA 1PSZA 3V6MA 4B84A 1TVKA 3WDSA 2P9YA 1N2XA 3JARB 3SLKA 4KQFA 3ZHUA 1KJIA 2YV5A 4J7AA 1QYVA 1WF3A 2P2ZA 3I2FA 5JZBA 5EJ8A 3C2QA 4NI5A 2JFYA 4JWTA 1I33A 1LRLA 1K3TA 2QUZA 3EZ2A 3L7MA 2FSGA 4I1UA 5EUMA 3RS5A 1G8FA 3TR0A 3W8DA 4BX9A 2YJ4A 3C14C 1CC1S 3HYRA 5GVSA 2VLIA 4P7KA 2FN9A 2CY0A 1T4MA 2WT8A 3BJRA 2I2BA 1G6Q1 4S1OA 3CH5A 1PV4A 1HMPA 3MJFA 4FFVA 3D4IA 4O63O 2J5BA 4KW7A 4MP6A 4RK4A 1XRLA 3HG7A 1NGSA 1NBWB 5ALOA 4IM7A 4ALMA 4DT1B 2FN7A 2AX4A 3FH0A 2P9BA 3GLUA 3I8OA 3G68A 2ZAOA 3K9CA 3U56A 3NTLA 4QUJA 3CLKA 1OX4A 3COPA 3EG9A 4LC9A 1T0IA 3H4MA 3HA3A 2C04A 3TINA 4QBTA 1I1QB 5I9SA 3H11A 5I4CA 5HF8A 2H1LA 4D8VA 3GNLA 2WTXA 1NC3A 3A6JA 3PQ6A 3J81k 9LDTA 3D02A 3TM4A 2ZVDA 2W8BB 4PZEA 4O4LF 4NOKA 1LNQA 3ZWWA 1JPJA 2G5CA 2GJSA 2H65A 1KARA 4LEIA 2IUTA 3JD3A 5JPCA 5LOVB 3ES9A 3CVUA 5IXYA 1FW6A 4WY2A 2XT6A 2AEFA 4FR2A 4KXXA 2ON6A 3KVYA 1P18A 3AKCA 3AUTA 3LH5A 4YIHA 1BS9A 1OA1A 1ZX1A 3MWKA 1KJZA 3REQB 1DTSA 4RY2A 1EEXB 1NR7A 2JFGA 4TSKA 2AZMA 3GVXA 3EW7A 2FOIA 2GA9A 2RAUA 4OQLA 5BR8B 4IW3B 4N18A 4Q7QA 3VSBA 2VSXA 3VO8A 2QM7A 3G3EA 1LSJA 3I45A 1EVEA 5HCUA 2FCAA 5K0BA 4FDTA 2YZGA 3OFKA 3AY7A 2CE7A 1K6EA 1U8TA 1V4VA 3G79A 1VSBA 2X14A 3WG9A 5E1BA 1P6XA 1XTBA 3GCXA 5DB4A 3W2HA 3A4VA 2JGJA 2FUEA 3MPOA 1V8BA 5G3YA 3NUGA 2AW3A 4IINA 5JCPA 2I8LA 3BUSA 1NMXA 1GXSA 2IYOA 4QXQA 2PZEA 3HLTA 1IY9A 1NWHA 1CNFA 4IV5A 1KJWA 1AZLA 2O2XA 4PSCA 4RVGA 4XX0B 4LCJA 2FEKA 4JBLA 3IA2A 4LRQA 2I78A 1QCZA 3PV0A 3FSRA 3RYHA 2VQSA 1CUEA 2JJYA 3LPAA 1KDYA 1GTSA 2OHJA 2F55A 1HOTA 2WV9A 4JBYA 4TMWA 4DXAA 1QUFA 1FMJA 3VPBA 2QTGA 3ERCA 2OXEA 2HC9A 3UJ8A 4G1CA 2PIAA 1AT1A 1LK0A 2NTEA 2QGNA 2V8OA 2G1UA 3MAJA 1T9BA 4EQ6A 4B4KA 1S3FA 3VH3A 1OT5A 4F91B 2A7QA 1QRDA 2ZSHA 4H7HA 1WCYA 1ZVMA 4CNQA 5KINB 2J5XA 4EF5A 3KAQA 4PYNA 3N2KB 5EHXA 3OTOB 5JLAA 3Q9NA 1NNUA 5IVIA 5ALNA 1KPGA 1PW5A 2VJKA 3FCYA 2XF8A 1D1PA 2YV2A 4TOIA 3FAZA 4XQCA 3LY7A 4Y1EA 4CDNA 1CG6A 3CUSA 1HTBA 3GCZA 4XYEA 5BMOA 5JAHA 1T6YA 2VJLA 4IXTA 5AK6A 4LHYA 2GHIA 4AKGA 4YR9A 2QYTA 2HQOA 3U7QB 1XYGA 4QOJA 3G0OA 2H5EA 4BB6A 1L7MA 1YI0A 2QU7A 4HMOA 5KJ1A 5FR2A 3EXG2 1PQUA 6NULA 1UEIA 1Z0KA 3FMGA 1NJ8A 3S27A 1R0XA 3WGMA 3A9TA 4DCNA 4F5ZA 4LXYA 5DYIA 5K0EA 5DN9A 2C7QA 3K6RA 2CNWD 1RJFA 4KIJA 2XKBA 4GPAA 1N1GA 2IHBA 3REOA 4FE7A 5E3HA 4D8YA 4YCJA 2QUBA 1ZVKA 3LYUA 1E9AA 2H2AA 1NSYA 1MQ8B 3B48A 3EXIA 3NHBA 3PKZA 4LHWA 4YMSA 4F6LA 2C5HA 3EQ9A 1AGPA 1TZCA 5KYUB 1F3OA 4UTPA 3QXHA 2ZKIA 4FOPA 4Q15A 1YJBA 3KQSA 3NLLA 4JXXA 1Y8QA 5FH9A 5JVDF 1J9GA 2H7XA 4LX8A 4Y8VA 4YRSA 1TTQB 3URMA 4C29A 3OEEA 1QVWA 4DR6B 2B6HA 3L07A 3ZDQA 1T2EA 2NACA 2B4RO 4TYWA 3JWJA 4UHBA 2X40A 3PGKA 4U3JA 1AKEA 1R66A 1KBZA 3NV9A 1YZKA 1FYVA 4MVWA 3OLCX 3CBGA 4LJKA 4MJLA 3F5FA 1PSDA 4PC6A 3UMFA 1MIHA 3A9VA 1IZ8A 4H0NA 3AERA 3LKVA 4L4RA 1NI4A 1ZZGA 4GXQA 2QTVB 2P3QA 3UXHA 2JFZA 5IFLA 3QLUC 1EM8A 4K0KB 3H8WA 3JASB 2GVDC 2SICE 2BT4A 4FI3C 1A95A 1V2HE 1N57A 3EZFA 3O8BA 5DBOA 5GOZA 4ZV7A 4CUZA 2FWJA 1X94A 1KYWA 5CK4A 4CQNA 2VT3A 3RIEA 4RZIA 2C9ZA 2Q8QA 1RJEA 4Q4JB 4WH0A 4X1KA 4EY5A 3DE6X 1EGMB 1I5OA 1X7GA 2OM2A 2PL1A 5GTDA 3WL3A 4LBWA 4OP2A 2IPLA 3CPEA 5ECGC 2JHPA 4H4DA 3ZC3A 2GN1A 4IH1A 2XECA 1S01A 3VGJA 1Z74A 3KAPA 5CFQA 1JIVA 3RS7A 3QKTA 2WI8A 3JX9A 4IIGA 3RB8A 1JDSA 3VDQA 4GZMA 2GAJA 3CNQS 2PMFA 3BWEA 5E6RA 5IC5A 4KQEA 1VYVA 1WXGA 3B2EA 3N6XA 3QPWA 3W3AH 5AQ1A 4UBKA 1MW8X 2I4TA 4RPKA 4KV9A 2JKZA 3HFJA 3HXMA 2NXJA 3H2SA 5ENZA 2C95A 3EIFA 3PI6A 5DP1A 4B7AA 4HB2A 2ECQA 4R7GA 5ALHA 3THYA 4V02A 1Z2OX 5F33A 1CQXA 3NHKA 5J5AA 3UANA 4GIBA 1GTRA 4IMJB 1JHRA 2WTNA 1GPYA 3E35A 1OH7A 2D4AA 3K71B 1AHHA 2BZ1A 2DHQA 2FRDA 1YFZA 3PR3A 1T5DX 2GUWA 4IGIA 1NBEA 1BCSA 4ZVRA 3RIMA 1VE3A 3M83A 3QWFA 2XD9A 1TEVA 2QN1A 1TM4E 1D5WA 2B20A 4MX8A 4KOAA 1E0SA 1VSTA 5GIOE 1KMIY 1GQ2A 4ZALA 4P54A 3R20A 3OZFA 2ZS7A 4R9RA 4MKIA 2E9SA 4C22A 3NNDA 1TJNA 4TL8A 3L6CA 1G5IA 1JU4A 1T4CA 3TXAA 1E5VA 2FWMX 3K70D 5FL7D 5KYUA 1QIHA 2ZIVB 5FJJA 2AEEA 4ND4A 1GGJA 4TV9B 2PQ0A 1RRPA 2B82A 5G4KA 3T41A 1G5FA 1NMSA 3I9KA 5HYVA 4IXMA 3SEAA 2C7OA 2JHGA 3O9ZA 1PGPA 2JHFA 2VK2A 1E1CA 1PGJA 1YJAA 5FV7A 3BVPA 1N9ZA 2DY1A 4JLSA 3ZXUB 3SM9A 1BS1A 3FYTA 2ONKA 3E9MA 3DOFA 4IX9A 4Q7JB 2AMYA 1XWIA 5FWYA 3VYTB 4Z49A 3SEFA 4CIYA 4RJIA 2MR6A 2R62A 2R8YA 3GGCA 5DN6A 1MOPA 4DANA 5TRTA 1NYQA 1F2TB 1YRQA 2BD0A 2WSMA 3TOXA 2ECFA 2R7LA 3K0EA 4U6NA 1SC1A 4CQLA 5I8WA 2G76A 3EFOB 1XVUA 4LJ5A 4DMRA 4BQQA 3OVMA 2CHVA 4CCAA 1QDUA 1FY2A 2QVLA 4Q24A 4RD6A 4XPIB 3FPSA 1ABFA 4FYPA 4I4CA 4P80A 3GT3A 1KR5A 4MUAA 4UBMA 5JAZA 1C9EA 5AI6A 4J2TA 1ISGA 3HDJA 3Q12A 3Q41A 5T6MA 3SK0A 3TQOA 2HWYA 4H2DA 3ZHZA 2KJQA 4I36A 3MCWA 1G66A 5A7GA 4UHDA 2EHDA 3W6NA 1PV2A 4YP9A 5J4HA 1C0EA 1OR8A 1UK9A 2VYNA 3OPNA 2D13A 1DSSG 4Y2SA 3IBCA 3SFTA 3MCVA 4RZ3A 1DNPA 1UOEA 1J8DA 4Q02A 1V9LA 2CFRA 1ZGGA 3MXOA 4BV2A 4G0PA 2B83A 5H3CA 4XYLA 1UBUS 2DCMA 3L7CA 4H4EA 3R3YA 5JD3A 3ZDAA 5DBGA 4H1TA 3HCBA 2X42A 4EG6A 3SHWA 5JNLA 3ZJ5A 1I6MA 5AM5A 3N2ZB 1V0JA 2C78A 1LSOA 2VKTA 2Q1UA 4S35A 4RO0A 2G4VA 3GRZA 1CWUA 1VG9B 1ZRMA 3BZUA 1KZHA 1T3LA 2C5BA 3TDKA 3CXRA 3G23A 4W63A 2OUKA 4TV9F 1AHPA 2OQIA 2RGUA 4KQWA 4QUDA 1OKKA 2AXQA 3OIUA 1YSCA 3L84A 3IT1A 3G0GA 4GWGA 4LZWA 4QIHA 4WOBA 3RFTA 5DJ5A 3AUXA 3L46A 4IZHA 1XLUA 2JC3A 1WD5A 2VQDA 4MS1B 3W1WA 1Z25A 1M34A 1Q91A 1NT4A 1W87A 2HY7A 3QWHA 1RWOA 2I9KA 3QFSA 3JWGA 1WY5A 1S2DA 3KZNA 3NEAA 3AEKB 3QSYA 2XKJE 2F9LA 4P84A 2BH2A 1V96A 2CXQA 3R2JA 4YR7A 1D0VA 4A6EA 1GY8A 1FNDA 1M34B 1ZO8A 1QZXA 4G8CA 3F5MA 2DBVO 1DTWA 4JJKA 4L5JA 5DP2A 4WLEA 4F9EA 4CMHA 2HHJA 2A4KA 1JIIA 4BP8A 4D02A 4KRGA 5EZSA 2GO7A 1SU6A 2C1EA 2W2QA 3ELUA 1RRKA 2O5RA 3ESQA 3O3MB 4KUEA 1D5CA 1NX9A 4XVQA 5H8WA 2FFQA 3A14A 5DSXA 2GXAA 3AUJB 2P69A 1QVVA 3HU2A 4V1CA 1HXHA 4XRGA 1MC4A 4Y1FA 5CA0F 5FWYB 4HDQB 4MAMA 1NMEA 3WBKA 1P45A 3ZIUA 2HBYA 3QI2A 3CZAA 4FILA 2CDNA 1JR3D 4DWJA 2CMHA 1GZ5A 5IS2A 1U9YA 1KBOA 4YVFA 5LYYA 3EZGA 2VVTA 1D07A 3V8EA 3AW8A 2CV0A 1BE0A 3Q7QA 1YB7A 1NJSA 3COVA 1YKGA 1M0WA 1CVRA 4WFJA 3R44A 1BGVA 4M0LA 3RVRA 3PNSA 1M0TA 2OILA 5EGSA 5CRIA 5CFMA 4CM8A 2R65A 3N3BC 3P0FA 3SS8A 3DMNA 4WMLA 3EXEB 4YRQA 1A9XB 4WXMA 5FFNA 3TAUA 1MX1A 1FNSA 3FPJA 4JGIA 4L50A 1CEXA 1XD8A 1KAGA 3GJRA 2E4YA 1XZMA 1PNOA 3D4NA 3NV7A 2Q5JA 4PNPA 1HR0B 1WXXA 2WVJA 3FSGD 1AQIA 3PXUA 2BY4A 2HMYB 1JHVA 5LBTA 4Z51A 3RRXA 5A02A 3A1NA 5FO0A 1EFPA 3PJDA 3MS7A 2VPZA 4EG5A 1J9ZA 3FX2A 2UUBB 3K1JA 2XVMA 1LRJA 4Q16A 4MRNA 1CZNA 3FIJA 4NEGA 1UJMA 3EVZA 3K0KA 4FBGA 1UBSB 4D9FA 5HUHA 2HSEA 3OMWA 3OMLA 3A26A 1GPDG 1K92A 3G88A 3MTQA 3NWJA 4M46A 4YJDA 5JMPA 2EX0A 4TQAA 5EMJA 5F7ZA 4E46A 3ZLBA 4L9RA 1YAHA 4YV2A 3OT1A 3D2BA 3JSAA 3L8DA 4NJMB 3JWPA 2UYQA 1Y8AA 3IJRA 2X8LA 3KVVA 4R05A 4ZT4A 4LK3A 3ZLTA 3WYGA 4EL5A 4PPQA 3O73A 1USUA 4XWWA 4DPMA 1DEHA 3BREA 5AK3A 1JALA 1XJQA 2VHQA 4EJFA 1NVUQ 3DMTC 4HDMB 4F4IA 1SEVA 4YJ3F 1BO6A 3ETDA 3CZ9A 1TMKA 1YR2A 3G9UA 4AO7A 4BOYA 5GPBA 2J41A 4BMNA 4MAFA 3K9BA 5LP6F 4MMZB 1OFIA 4QM7A 3F9CA 3IOEA 2KE5A 2NZUG 4PZZA 1WCXA 2IGBA 3QE3A 1E1MA 1T0JB 2D3WA 2L18A 2H5JA 3BGSA 3M9XA 8ABPA 4RF2A 3IQFA 4CDGA 4MHTA 2AUNA 3LQRA 4C4AA 3K92A 4KG7A 2PWYA 3UJ3X 4TTRA 2VHCA 3BFXA 3EIHA 3F97A 2P30A 1EQ2A 4PGGA 5F2EA 3GGJA 3JD1A 4C7OA 5TT1A 4GSYA 2G1AA 3UWKA 3VTKA 2ZR8A 3DKIA 3OM0A 3FTPA 4G0VA 1C81A 1KQ3A 1YQQA 1IJKA 3EVFA 4Q48A 1ZDMA 1TAHA 4ZMBA 3DJFA 4D9KA 4RHEA 1UPAA 1SIWA 2LDXA 5GJVC 4OI4A 2IH2A 1IPEA 2P9TA 2VZLA 3JQ8A 5IAOA 4RY8A 1O3YA 1MRNA 3QUCA 4HH0A 3NBZC 2FPIB 2H0QA 4RL6A 4L78A 4LOKA 4KRXA 1TUBB 3JQCA 3OIVA 1O5IA 1YUNA 2QAIA 4GM0A 4RLQA 1N5JA 4XSHA 4DIUA 3ND6A 5F9MA 3BMXA 3KSRA 5EHIA 4AU1A 1A5BB 2IPOA 4ILKA 4WCFC 2O1WA 4YS6A 1QFXA 2ZJOA 4EECA 2BGMA 3WIEA 3WAKA 4DIMA 2W2LD 3EB9A 2HZBA 2J4FA 2XODA 4FYJA 1CR6A 5L3ZA 3TDNA 3VZRA 2EW2A 3D6TB 4IG9A 3D6AA 3ONWA 4Q7LA 1EFPB 1DRUA 1SH7A 2ROQA 5CJJA 3WLTA 4C2BA 1DAMA 3VBCA 4Z9BA 2ERYA 2ZAMA 3EAFA 2GLXA 3FNHA 4UAGA 3EGXB 4BKRA 4OOFA 3PHGA 5KYWB 1PUIA 1LDMA 2VDWB 3IEMA 2AYXA 4R7TA 1U3WA 3K70C 3EYAA 4LWOA 1JMVA 3HKDB 3NP7A 4JVSB 1YBHA 3LDGA 3GDHA 2CJYA 4B2LA 1K86A 4XCQA 3B5JA 4INJA 5FAXA 3VR1A 4HLNA 4CKWA 1ORIA 2ZYIA 2V7QD 3PPXA 4GXRA 4IO1A 5KTTA 1YA6A 3TD6A 4OQYA 2YYZA 1SWVA 3V1MA 3N2IA 2BL4A 2KMLA 2GZRA 3JWIA 3NRJA 1AS2A 4PAOA 1Z5NA 1JZSA 2Y4NA 4IGKA 4X41A 5E8JA 2HK6A 5D7BA 1BXGA 4V39A 1YIDA 1Y63A 4QM6A 2G63A 4LTMA 1DX4A 1GITA 2L42A 5PNTA 2OXTA 4DQVA 3FPBA 1DVRA 2QZ4A 4P7FA 2FQQA 2Y1OA 5KOJB 1PEAA 2ZE5A 3A7DA 3TW6A 2TMYA 4HT3B 5IRCD 1ZI8A 2REQB 2ZXFA 1P60A 3KOMA 3WYAA 4UFNA 2PIDA 3TR5A 2FZEA 1NN0A 1TKAA 1UADA 2V4UA 4JCCA 4B6JA 1M2OB 4ESHA 4QO7A 4FFLA 3RSSA 1ZA2A 1XEFA 4R1LA 4ZC1A 3T4XA 4DA0A 4PLCA 2A2ZA 3QLUA 3ZZ0A 1IOWA 1LSUA 1PR2A 2P1DA 3KIPA 4O1IA 3AR9A 3L6OO 3IQEA 4N54A 4D5GA 8LDHA 4FS3A 2C3PA 1ZW6A 1ZI6A 4RZHA 3O8OA 5D1NA 3BWMA 2P4UA 4BX0A 4U2EA 1GQQA 3CMMA 4JYMA 2O50A 5FUYA 4I9GA 1LA2A 5FJIA 4RQTA 4O1MA 5BQOA 4LDAA 2DQZA 1C4XA 2P4HX 2XXBA 1UBMS 2O2YA 1JR2A 4NBKA 4R98A 1QTQA 2ZT8A 4HYTA 5C3MA 2VQ3A 2NV6A 4ZCRA 3FMFA 3K05A 2PMEA 1JVBA 3BKXA 4ZA2A 2QZSA 2QTLA 3M5CA 1YZQA 4PICA 5EL0A 3RSHA 3NIBA 1K7FB 2IF2A 1E3WA 1X14A 4K9NA 2P68A 4CM4A 5TMPA 2P2DA 1VIVA 4I3FA 4ENVA 1OE0A 1L4UA 1R5OA 1WZCA 1YQWA 5LL6P 4YV1A 1L4MA 3L43A 5I7WA 1P17A 3VHRA 2QR5A 3TSZA 4DNQA 3AOEA 2ZULA 3HCNA 3I2YX 2OK8A 1I3KA 3HDYA 4QTZA 4BJ1A 3DXYA 4EATA 1FS5A 2QJOA 3ZVLA 5A4JA 2HA0A 1EXMA 3SDSA 3GRAA 2VAVA 1XQYA 3A4TA 4M0KA 4M7RA 3TB6A 1EX7A 1K66A 3LUHA 4E5PA 3IA7A 4PC7A 2ECOA 4JVNA 4P36A 1D2MA 2XDYA 3F46A 3W5SA 1MJFA 2W58A 2C58A 4JZKA 4PVCA 4ZI2A 1V8DA 3OAAD 4I9NA 3R8XA 3U4DA 4AKTA 1U8UA 5JW6A 4YJ2A 1IM2A 1Q0QA 2GKSA 2FXVA 3IH5A 4QXPA 5EJMA 4BQSA 2GD0A 2PH7A 4WINA 5G53C 1I0ZA 3THWB 1AGNA 2OC9A 1XQ9A 3LIIA 4PV7A 4PPGA 5IYZB 1CYEA 4DMLA 4OUDB 3T0GA 3N07A 4CLOB 1W85A 2GD1O 2DFKB 2IQ5A 2ODQA 1EVKA 4AB1A 3ANLA 1TO1E 3OC0A 3CT4A 3L8ZA 1OI4A 1Q22A 4N1AA 1BXGB 4I4NA 3DOEA 5HIMA 4BV3A 2WIJA 1X2EA 2ORVA 2G9NA 3BA6A 2CNBA 3TRFA 4YMVA 3FI9A 4DV7B 2AYYA 4NQRA 1LBEA 3QBDA 421PA 4YA6A 1L1EA 1NTOA 2BGLA 1XJ5A 1F38A 4Y3UA 3DEYX 1NBAA 4O5AA 2JEOA 4H7EA 1PK8A 3LLMA 3AU9A 1V26A 5K0FA 1QTNA 1N8TA 2OXFA 2ZAIA 1B43A 3AI7A 3GH1A 1T1IA 1LUAA 1E3EA 4LV6A 3SN6A 1F3LA 1VDMA 4XWGA 1Z06A 1YZ3A 1ZH0A 2O57A 2YW9A 4TSRA 3H84A 3C7CB 1T8YA 3M1AA 2WPNA 3DAOA 5FTWA 3K31A 1MEOA 2HRBA 4OKSA 2PKQP 3EOZA 1VG0B 5L3QB 1WBJB 1HV8A 2JZCA 4KPUA 3SJCA 3ZIDA 2JD0A 3A3PA 4KXNA 4Y2TA 1S7CA 1TU0A 1K4MA 1SK9A 2MWMA 1CUAA 2ZLBA 5IJ9B 2B1QA 1X7DA 2QN7A 3KR1A 3JAWB 3L92A 2WYVA 4WFQA 1XCMA 3Q72A 3OU2A 1NBMA 3C6ZA 6ABPA 1AN0A 1JKJB 2DBZA 4MV4A 5CIWA 5KJCA 3C3AA 4QGGA 5M2QA 4D82A 3RFUA 1T29A 1H6CA 1EUDB 2D5AA 3TNYA 4UEJA 2AD1A 2JKVA 1YC5A 1QHNA 1XFDA 3OJEA 3PDHA 3I30X 4HATA 4WLUA 3RIXA 2IYYA 4L8VA 4V0ME 1ST3A 3HKBA 4NZYA 1P7VA 4HX5A 1FFWA 3UT5A 1WXQA 2MU1A 3TQFA 3OF5A 3WGZA 1SBIA 4LSZA 2G77B 1FP6A 4QLAA 2W98A 3OU7A 4G89A 4QUIA 3NJ4A 1L5KA 1RRMA 1Y7TA 4MQ6A 3RI3A 3ASYA 1LI4A 1I9GA 4FK8A 1E3TA 3GT0A 3P0RA 5KVQA 4AK9A 2EFCB 1OVMA 3E61A 2NSDA 3RC1A 3C1TA 5FT9A 3BB1A 2WUEA 3LUFA 1JEJA 5FBVB 1Z63A 2R97A 5H80A 2OHVA 1L4NA 4X0EA 2XWSA 5DLPA 3DMHA 2REBA 2IXGA 2XRZA 1ARZA 4I4TA 2YUIA 4WX2B 2RMKA 2E6KA 2G71A 2F3PA 1GZDA 4WRRA 3PFNA 3HB5X 5SYAA 4K86A 3H19A 1VFPA 1Z6XA 1ZK0A 2DQ4A 5TMBA 1W9MA 1A0OA 1GDDA 2CWDA 2GM9A 3EDYA 2GFHA 3CPHA 1K8XB 1K08A 1SU7A 2OYRA 4L75A 1XMJA 3ZQ6A 1FYDA 4AY6A 1YZTA 4G0WA 1W85B 2PGXA 5MN5A 3UFBA 1V6AA 2OGUA 2GK4A 2Q6VA 1S8OA 3GP5A 3DSRA 5E7IA 5SYNA 3D0OA 4F71A 4LYAA 2IBSA 3BQNB 4ETMA 4F2HA 1T6NA 4E88A 4CLRA 5KVCA 1T8UA 1R6BX 5FWAA 3LQFA 1QU2A 1UZLA 1SUIA 4WXPA 2V7UA 4TZTA 1U7WA 3SQDA 2QUIA 1JIQA 1OC2A 3CG0A 4NYIQ 3VZBA 2Q4BA 4NH4A 3T4PA 1MEEA 1QS0A 2C9YA 2E37A 4RWEA 3G1UA 2P8JA 3VA7A 1Y6JA 2MJLA 1O94A 4C0KA 3LV8A 1M6HA 3DLPX 1C7FA 3ELWA 4D4HA 3UJPA 4M1SA 2WMDA 2JK1A 4J90A 1SVLA 1M7BA 2V5AA 4GLJA 5KTKA 5F5NA 1CPYA 1QGED 3C3KA 1PIWA 4RVFA 5FLYA 1GZSA 1V3TA 3HB7A 3ZH9B 4CLEA 2Q2WA 3OE5A 3ODGA 2VR1A 5HUQA 1QE3A 2R2AA 1WABA 2QD4A 3FGOA 3I1FA 3CTPA 3HGTA 2I9PA 2X5OA 1ULBA 5GJWC 4HDRA 5AR1A 1NNLA 1XEXA 1LJUA 1P7YA 1WP9A 2VUSA 5F1PA 1N7IA 4EPVA 5C8YF 5HEKA 2R2GA 1VJGA 4MVJF 2JLWA 3QEAZ 3C4JA 4LQDA 3R5JA 3A6EA 1XNHA 3KK0A 1MO3A 2M1XA 3I0ZA 3AHHA 4G65A 4O2AB 3ZY2A 5KSZA 2FMUA 1ID1A 5DM1A 2WICA 2OKCA 3PVZA 3PTAA 2JAHA 2OY0A 4FT4A 4MYDA 5CR9A 2OO5C 3UXYA 4OL9A 1TTTA 1MA0A 3SWWA 1Z16A 1JE0A 2V6MA 1LLFA 2ACVA 2ZJFA 3HZRA 2OZVA 5BSGA 2HNBA 3GEEA 3QX3A 4EGQA 2YHIA 3OSUA 2RSLA 3PLNA 2OCPA 2PPLA 1GAEO 4MEBA 5AJZA 1O94C 1QH9A 1O7JA 4EVRA 1U8AA 5I47A 2C99A 2SKCA 3CUWA 4D3DA 2XWJI 5C53B 2P9ZA 3G6WA 2QQEA 1NF3A 4II3A 1SAYA 3A3NA 3RJTA 1NU8A 4Q0MA 3LX4A 1J90A 1UPCA 3GJ6A 2JI8A 2F67A 4GI1A 2Z4TA 3HPQA 4K6GA 3LA6A 1ZUHA 2HU5A 3RD5A 1XDDA 1ENOA 2WA2A 4L3VA 3TB4A 4GKKB 1EFKA 3MBKA 4Q21A 1N5MA 3IIIA 3MJRA 3V7NA 5EZQA 2WF8A 1QIEA 5EJ2A 3WDKA 2IXFA 3G13A 3U81A 1QVRA 1GV1A 2YWRA 4RTMA 3GUHA 2QTZA 4KKVA 4X20A 5CUQA 1GPMA 3ZG6A 3GZNB 2QPOA 3MMZA 1PJ8A 4CF3A 1NBOA 1BDIA 1PK9A 4M1MA 1TO6A 2RH9B 3PUWA 5KDDA 2PU5A 4CM5A 3EUEA 1Y81A 1CQJA 1J6UA 3GD7A 4MLCA 1HE4A 2IIQA 4GXNA 5JTTA 5DO9A 3NWBA 5J4KA 2J4CA 5EIAA 5D51S 4IV0A 1P73A 3N3AC 2GYVA 4Q1CA 2O8BB 3OX4A 3AP2A 2IPAB 4JLJA 4EYQA 4S0ZA 1CY2A 4ED9A 2B4YA 2DC1A 2FPRA 4BNTA 1HUQA 3OSZA 4LCBA 3K4PA 4OP1A 1X1TA 3DT9A 1H2XA 2VTBB 4JBIA 4KZPA 2D7DA 4OHYA 4BVJA 5K8JB 3ONFA 1YIAA 4MQMA 2BKXA 3G9ZA 3L77A 4R9UC 2W11A 4XAQA 5ARDA 1GFSA 3RYTC 3T9CA 1Y5MA 1YDWA 1Y7IA 4C2UA 2RGNA 3JW8A 1M2VA 2H0RA 2YUTA 4GKVA 4RTQA 5F9HA 4ZK2A 3HBLA 3OOWA 5IDVA 3DMPA 3FVVA 4PXAA 5JD4A 1WQ3A 3ZDCA 1KMHB 1PP4A 1JEOA 3LGAA 1HL7A 3TQSA 3U3ZA 1B2RA 3MCZA 4ITUA 5G0SA 4QDOA 1VE6A 2OC4A 4ATNA 3K9FC 4WA7A 3T1NA 1OGYA 2HR1A 1YR3A 3EG9B 3RSFA 3IFSA 2N46A 4II7A 3FZQA 4H0FA 1R4MB 3W5VA 1Z12A 3G2KA 2ADFA 3EPJA 3PENA 3E9EA 2FMKA 1VMIA 3E9DA 2P2SA 3A10A 5CA1F 3AEQB 4QC2A 4AECA 1ZBQA 4IHAA 2QQ0A 3PXEA 4X8HA 3GEDA 4LXGA 4C07A 3UA3A 1EJBA 1C4KA 1LPNA 2H7VA 2LTAA 2NO6A 2NTNA 1W4RA 2Z2IA 2QU8A 4GPIB 1XKTA 2DKOA 2EKPA 4MWTA 5EXDA 4RKEA 5FTJA 5KTSA 5CK5A 3AQIA 4UEKA 2A57A 4UAVA 2VZ0A 2FZWA 4MJ3A 1N5LA 2XBLA 3U7IA 3ICQB 1E8MA 1K7YA 1OI2A 1HYEA 1LWNA 1Y4SA 5BSHA 3LCJA 2BKEA 4FMCB 2M1ZA 1NE7A 4G2TA 1G19A 2JI9A 3VR6A 1L4KA 3UVEA 5G2OA 5EXEA 1KP3A 1NRIA 2EFJA 1PUXA 1WTCA 6CHYA 2Z9DA 1OILA 1I1HA 2F3QA 3H9GA 3LY8A 3K15A 3TSYA 4BMZA 2WKRA 2ATIA 1CLEA 1EFTA 3EZ6A 3V00A 4A8JB 4X64B 3F4BA 1CRZA 2CDRA 4WWHA 5KTRA 4N49A 4FMCF 1H2HA 3W5JA 3MMPA 1LBTA 2CGEA 3JQFA 3BK1A 2A0UA 4YP5A 4B3FX 3U80A 1U2DC 1VBFA 4TWBA 1BDHA 4D26A 4ZAVA 5FBRB 4D0LB 3RYHB 3GVCA 3UXMA 1EBFA 1U28C 2G6TA 2F3UA 1CQJB 3CB2A 4HDCA 2BHTA 2PL5A 4NS4A 4HNRA 3OE1A 3SCZA 2H1SA 1AIPA 2DECA 2KM1A 3SKVA 3IIJA 1VA4A 4EG3A 2VA9A 1IATA 1RYFA 3SC2B 4DSUA 4XE5A 3HXOA 3S2FA 1FIUA 2EIHA 3CSDA 4MV3A 3T0FA 2IYTA 1K5DA 4HWOA 5BVGA 2WKSA 5K0LA 1LDGA 5NLLA 2QJTA 4L3WA 1QNFA 3DE2X 5AVSA 4PAWA 4RKQA 1OREA 1SEPA 2XMSA 3D8RA 5DW0A 1RR6A 5E7MA 3W8EA 7ABPA 5INTA 1IHDA 1MN6A 1Q2UA 2Q1TA 3I8XA 3TI7A 4BCCA 2FDRA 1UZAA 2D59A 4TXLA 5AYVA 3S2SA 1XYYA 2PT6A 1ISJA 1V4BA 2QK4A 2GBLA 3O8QB 2CL7X 4LBYA 3W5IA 1JL3A 3BULA 3ADOA 3OCVA 4PIVA 8GPBA 3U44A 1S6YA 4OQNA 3DOIA 3E2MA 1H2YA 3U7QA 3L7IA 3W2TA 3I9LA 1NR1A 3U7HB 1S2OA 1O96A 2BHLA 3ORYA 4QBFA 1EE9A 4RU1A 3P0EA 5A3VA 4BLVA 2QJWA 3U44B 4ZCTA 4WDRA 1Z38A 1JJVA 5IK2A 2O8CB 1FP2A 1JIUA 4HZUA 3FBGA 1YKSA 2DHEA 4RGVA 3TBFA 1KOFA 2NO7A 5CIQA 4LWQA 3SD7A 4CG1A 4EA6A 1MZPA 1W44A 3CCCA 3USES 2CVPA 1OX4B 1NW6A 4J07A 2GKGA 4KJZA 4MWDA 3C6MA 2XY4A 4UM5A 3GO4A 4Q9KA 3AK4A 2VFAA 3ITDA 2VSFA 1T10A 5CNKA 1YVDA 1XPRA 2XUIA 2I66A 2OGZA 4V24A 4R1SA 1MAVA 2GHTA 4L08A 3DEZA 2RIPA 1G8KA 4YXFA 2A92A 3PWZA 4ID3A 4YLGA 1FUUA 1EIWA 3F4KA 5H0IA 2AR9A 3VNUA 1RIFA 4KQIA 1JIKA 2CBGA 4M0PA 3I52A 1ZYUA 2P67A 2XI4A 3RVMA 1P1BA 3PX2A 3VJMA 3JR7A 4QUHA 4RSGA 2YJTD 3QKUA 4QNMA 4XM1A 4UZFA 4YRRA 1OUMA 1Z15A 2QW1A 2ZDGA 3VU8A 1X0XA 3BCSA 3DNFA 4BHTA 4DUYB 5U1PA 5AVOA 1HOXA 2QVZX 5F7XA 2O2IA 5GADl 2CYBA 1CVIA 1MT0A 1U11A 4J3JA 4XYMA 1MENA 2BDEA 5EMMA 2WSSD 3JTMA 1L7RA 1R9MA 4FUQA 5DYWA 2P62A 1CRPA 1GHTA 2HLDD 3NDRA 4JVOA 2QTRA 2O2CA 2QRQA 3FVQA 2R6JA 4GZLA 4HVTA 5IBCA 4IHKA 5A4FS 1J24A 3E5RA 4N40A 3Q5GA 3GLGB 4NAUA 5F5XA 4MR9A 1DL5A 4Z99A 1K4KA 1LJLA 2O7NA 2ZIGA 1OXKB 3IUBA 2FN4A 4ZQFA 3CNOA 1Z88A 1JV2B 2PSEA 3R7WA 1P72A 3K6SB 1Z28A 3GLVA 5C8VA 3E3LA 1VCHA 5KUTA 3IAM1 4YJHB 3P2OA 3PHIA 5DBIA 3TCXB 5C8YB 2YZNA 4RTLA 4M76B 1I4DD 4NXNB 1ZMTA 1M76A 1H2BA 2VAWA 4QARA 3X2SA 1J9EA 1WVMA 3OZ7A 4KXVA 4W5QA 1CULC 2LKDA 2QVCA 4I55F 4HYYA 2IV2X 2IZZA 2O8VA 2CDBA 4YX9A 1EGHA 2F8TA 1ISFA 3FWZA 4ZOLB 5IKPA 4DB2A 4KVFA 1N9KA 5EJFA 5K3FB 4JR2A 3RODA 1QNLA 4Y9TA 4M1EA 3NXSA 5LZ9A 1CR4A 4GGMX 3WQSB 2R11A 2IOYA 1KYVA 3C1UA 1YL6A 3NORA 2AG8A 4N3GA 4RMJA 3BHIA 4NBWA 1QHHA 3Q5DA 5JE8A 1VI5A 2H7YA 4NU5A 1PZMA 5HMMA 4G4JA 3FPFA 2VF7A 4TLMB 2ORWA 4FYXA 2ZYGA 3SR4A 3OZIA 5JAOA 2OOKA 4BQFA 2P77A 2ANBA 2Q5HA 4L9SA 4AS3A 4O02B 3CYFA 3OJOA 1BJTA 1H22A 2GYWA 4MQ5A 4DLZA 3N53A 2REOA 4L15A 4PYQA 2AD5A 3UMMA 1ZP6A 2XGOA 3AV0B 2PD6A 4X90A 3H5RA 1XTKA 5B7PA 2PGJA 3GJTA 4NCHA 3STYA 5T4EA 1HFKA 4X7PA 3GT7A 4WOCA 2QLLA 3VZSA 1D2CA 5TE9A 1YRWA 3HU3A 1ORTA 4XEUA 1DG1G 1V9SA 4K9KA 4WT7A 5E0KB 3UK0A 1ADJA 3QVUA 4EZEA 1E4EA 3NBUA 3ZGOA 4UUNA 1ETHA 1CZRA 5E8RA 3SQMA 4WK6A 1I1NA 1ACMA 3NEJA 4XGIA 3N8KA 4BMYA 4IIJA 2XT0A 4OMCA 2DMRA 3EVTA 1NDHA 2BZSA 3TEJA 3F1KA 2AQ8A 2GXUA 3QHAA 4O4IA 4W1SA 5EC8A 2I3AA 5G1OA 3JALB 2PJDA 3HABA 1TVEA 4FZ5A 2HNAA 4Z7NB 2K87A 3UW3A 5JYDA 1GVNB 4J0DA 4X6UA 2XMZA 4EVSA 1PGNA 2OHOA 3W5BA 3GUZA 4BMVA 1SD1A 4LE1A 4OK5A 5EWJB 5I4KA 1ISSA 4IQ0A 2FW0A 5ALFA 5A5EA 2Q5FA 4J94A 1ISPA 2TRSB 3BD6A 4X62B 5K0CA 5BUSA 4G1BA 1MPXA 2HUPA 2Y0EA 1GAWA 4WFIA 1X1DA 2JI6A 3AKEA 4K28A 5TB5A 3VKWA 4ES6A 4DV5B 4M8LA 3FROA 1IPHA 5I7FA 2D8AA 4D92A 4C7JA 4OXQA 2C9CA 5DHAA 1QK3A 2JFWA 4NP6A 4A4DA 5F23A 3FPGA 1F0KA 3FVWA 1KTVA 2VDKB 3FYHA 3MJTA 2Q5IA 2LD4A 4NYJQ 5EE3A 1BS2A 2CHUA 2ATEA 2Y1FA 2WWXA 5A03A 5JPDA 2CJFA 2UZ0A 2V7PA 3DBVO 4GRDA 4RD2A 2L2QA 5JAIA 1ENYA 1JYEA 1HE3A 1LW7A 4RADA 4NY1A 2VPTA 2HSJA 4ZT7A 4YCLA 1QF9A 2AZXA 3BGWA 1E9EA 3IV7A 5E6UB 1NVFA 3RIGA 5BPHA 1XD2A 221PA 2PS1A 1GTZA 3RSZA 3T7CA 4E4TA 2ZR7A 3KM0A 4LNHA 1VJ1A 4DCCA 5HFNA 2P2GA 5TARA 2JGRA 1OZGA 1BD4A 3R0VA 5DGCA 1NZFA 5DPMA 4CL3A 3EIOA 5I5GA 2WUVA 1QGUA 3KEOA 1C3OA 4M9ZA 3THRA 3O83A 3OCCA 8AT1A 5DLQC 2H3HA 3CGGA 3EFEA 2HHAA 3DNPA 2P7IA 3KZKA 4ZYYA 1G2PA 5HQ3A 2LBPA 2TYSB 3IQDB 4KWCA 1NSFA 2R96A 2ABWA 3QHQA 4OIMA 4KPEC 1JEDA 3TEFA 2FETA 3H0CA 1LLUA 4PHCA 1AH2A 1XZEA 5DCYA 4OAQA 2Y93A 2FPGA 4EABA 2QGFA 4B3SB 4ZZIA 1FDSA 4BWFB 4E4RA 3AF3A 1S3IA 1ZM7A 2JVIA 3QE0A 1H93A 5AKXA 2EWWA 3C6XA 1CVLA 3GPCA 1SQSA 1VL0A 3FNGA 5LN1A 2DG2A 2ID7A 1WMFA 4LOJA 5KDOA 1MO4A 4AAYA 2ZYSA 4FONA 1TYAE 2J5QA 1CNEA 3DO8A 4I1YA 3GHYA 3THXA 3BB4A 4JSYA 3ZY3A 1ODTC 4B44A 2HWXA 3WMXA 4OXIA 2OBLA 4U2GA 1IXZA 4TL6A 3TOCA 1CUIA 3BH7A 1QQ7A 2HIAA 3F3MA 2GEFA 4R40A 5JHGB 2VT2A 1IUOA 1WXWA 1CIJA 1H4SA 2H2WA 1M75A 3GFGA 7YASA 4RTNA 3HL0A 2V7EA 3MRTA 3WYDA 2Y1GA 3RAJA 2XNKA 1WBBA 3MLEA 1SXJB 1XZPA 3VPSA 1OBVA 1UJ5A 3Q8LA 4ZHQA 5B3JC 4I8XA 1Z34A 4JJ8A 4QPCA 3HY3A 2XA9A 1P19A 3I23A 2R1UA 3L7OA 4TV8F 2RI1A 2FWPA 2PJZA 4WN3A 3ZE6A 2H2IA 1TRKA 2QZ9A 1X1CA 3DZ8A 5DI3A 1S2GA 3LW8A 5TPZA 5AUNB 2PLAA 1UEXC 4MQEB 3PICA 2EFEB 1XU4A 1A8UA 3VPDA 1XAHA 3V48A 3UPUA 1X80A 3DLAA 1P2TA 4NBLA 4CCWA 3B53X 5TT0A 2X0DA 2ZB8A 2WWGA 2LW7A 4B8YA 2XT9A 4Z3OA 2HJHA 1GKLA 1I5EA 4B35A 2BBOA 2Q4TA 3GJSA 1YB1A 3OQJA 4HKTA 1X9IA 4URFA 4EVIA 1EPUA 2PBRA 3G2JA 3QKSB 5KKAA 3U40A 4MGIR 2I87A 3WLIA 1PNTA 1Q0HA 4RFVA 1UFOA 2GN6A 2PKEA 2NUTA 2IUYA 4XDHA 3WOVA 1SFRA 2FPPA 1GFIA 3VR4D 2PWPA 2P78A 4G4SO 3KHUA 1TC2A 4RV4A 2B69A 3SE0A 1BMQA 1BGXT 1TQDA 5KX5F 4F8EA 1PCXA 4RVNA 4JUCA 5DLDA 2FSUA 3T06B 5IULC 1E5QA 2OLEA 5AJTA 1PG0A 4J0HA 5F4BA 3TQCA 1XVTA 1SO8A 3HFSA 1RYZA 1VC2A 2XMGA 5IBPA 1C3OB 1K6MA 4PZPA 5F51A 4P3YA 4A2CA 3WOHA 4RIGA 5HTOA 1RJ9A 1SELA 1PNRA 4G86A 4OU4A 4OA8A 4TXMA 1AXRA 4DDMA 3GLFB 3TIIA 1G8JA 1Q7CA 2IH4A 1ZKDA 3EIUA 1OXSC 1GQYA 2AOTB 3L1JA 3MM4A 4ND1A 1I7NA 1IEQA 2IEAA 3T38A 3TG8A 4ZDKA 1A9QA 4Z8XA 1RLTA 3PFWO 5KTNA 2DR0A 2Y1LA 1CUYA 3Q40A 4EI2A 3ETJA 1Z0FA 4ZQIA 2WHQA 5I9LA 4P7BA 1Q21A 2CUTA 4LRWA 2OHHA 3UZUA 1OOEA 2VF8A 4CCSA 3KSBC 2P9FA 3DZFA 1NG9A 6REQA 5JEEA 3FYDA 1QAOA 2AIRA 1SCQA 3K16A 3GRPA 3K4HA 3Q7RA 4ON9A 3IRVA 5KYTA 3IAS1 1NR5A 3AJEA 4TX1A 3M3HA 1CRWG 4RXTA 3TM5A 1IM5A 5I7SA 3OU6A 4OAOA 2N47A 1M2HA 2Q99A 1OBOA 1Q17A 2WZBA 4IKPA 5CCEA 1CJSA 4XX0A 2LIVA 1VJTA 1X70A 2O52A 3P9CA 1RYMA 5TQVA 2AHOA 1XEAA 2W6PA 3LCRA 4S2EA 3W2FA 2OHXA 3ZV6A 2C07A 2PVSA 2WG2A 3TSWA 1HNWB 1ETUA 1M1NB 2GYYA 2AOVA 1Q3HA 3ELBA 3OWHA 3QTLA 4G4IA 4MDYA 2HF7A 3SQOA 3TZHA 1K6IA 3WSWA 5JY1A 1Z26A 5E95A 1UJ2A 2CLEB 4F3TA 3T7RA 3OQ6A 1UH5A 2QE7A 3MGKA 2OBFA 4CL0A 3OE7A 2PE5A 1Z4IA 2H17A 1NP3A 3E5HA 3WLLA 1XX6A 3BE4A 1KP9A 2PZFA 1FNNA 3F3YA 3OETA 4RIEA 4FFBA 2ZJ0A 3STTA 5FHQA 4NENB 1KZ7B 4XQ9A 3SJBA 3V1TC 4DIKA 1GN9A 1WDWB 4RK0A 3I01M 3I1JA 3L6EA 2HF2A 5AK0A 4X6YA 3LKZA 3FCEA 3OZVA 4M55A 3UFXA 1QFMA 4ETNA 3O94A 2A1TR 1QWSA 4PTLA 1Z7EA 2Q3DA 2DQSA 3ABSB 4X84A 5TEVA 1NVEA 4C5AA 3OLQA 3U5TA 2YXPX 3M3DA 5AICA 2M6RA 5EI5A 1EB9A 1EIZA 2QNBA 3U7EB 3ZCSA 2QD5A 3U9TA 3CO5A 5IM4F 1LSSA 5AKLA 2FFBA 3WYCA 4DV2B 2F3RA 2OVBA 3KC2A 1Y6GA 5DYYA 2DSTA 3EJWA 4KLCA 4XJTA 4ZMRA 1E79A 5HKKD 5FTNA 1GG5A 9LDBA 3WNQA 4I1OA 1CJUC 1I13A 2VDWA 4PYRA 3UMBA 4TS9A 4BZZA 4LNUA 2FG5A 4RPLA 4DJFC 3KT3A 4UTNA 2CNDA 3FMVA 4DY6A 4HBGA 5A7FA 1Y34E 1YQ9A 1ZOPA 3OEHA 5KSOA 2AZDA 3MCUA 5GONF 1SVWA 2PL9A 1MNQA 1K2VN 2DWPA 1XG5A 1WEKA 2XYGA 3DF9A 4KE6A 4OBBA 1HNXB 4QUEA 3L7YA 3CLSC 1NVGA 2P2NA 3NUZA 2VZEA 4IF6A 4KNVA 4O1HA 5CDGA 4FGKA 3L1HA 2Q9UA 4JQOA 3ROKA 1OXXK 4ZOAA 4OFBA 1VBKA 2V8BA 2X7XA 3RVLA 2PEYA 4BU1A 1PFUA 2BM9A 1MABA 3ZXSA 2QG4A 2PSJA 3CZMA 4JLMA 4HB4A 4MQ4A 5BP7A 3ONEA 4MP8A 4MUXA 1OIWA 2Z3WA 2RAVA 3QLEA 3U39A 2Y8EA 4EF4A 1C3VA 2ZBEA 3GCDA 4UBLA 4BNLA