1ORHA

Structure of the predominant protein arginine methyltransferase prmt1
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
318
structure length
318
Chain Sequence
FDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYQSMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein arginine N-methyltransferase 1
publication title Structure of the Predominant Protein Arginine Methyltransferase PRMT1 and Analysis of Its Binding to Substrate Peptides
pubmed doi rcsb
source organism Rattus norvegicus
total genus 91
structure length 318
sequence length 318
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2003-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 1orhA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1orhA01
3QOXA 1TW2A 3HM2A 2G1PA 1Q0TA 3NVKI 7MHTA 3GRRA 5EGSA 2H1RA 4B17A 3LCCA 2FHPA 1TPYA 2Q41A 2XVMA 1QAQA 3OZRA 4GOLD 1NV9A 2AN4A 2H00A 3CC8A 1PJZA 2ESRA 4OQDA 5BXYA 2ZCJA 1RI1A 5B1SA 2NXJA 1EIZA 2VZ9A 1U2ZA 3HA5A 3HVIA 5HILA 3SXJA 2C7QA 3TOSA 1ZHFA 1KYZA 3Q87B 3B3FA 2PVCA 5DXJA 2IH2A 1ZGJA 5U4XA 2G71A 3CCFA 3CKKA 1QYRA 1X1CA 3B5IA 1YFLA 1AV6A 4YUXA 3WSTA 3B7PA 5E8JA 2NXNA 5HEKA 2EFJA 3G5TA 4O29A 4EMSA 5KQRA 1X1AA 4P7KA 3HVJA 4FS8A 3KR0A 3KQWA 1NV8A 3NWEA 2ZZNA 3DMGA 3LL7A 4GC9A 2PSSA 3BWMA 1RI3A 4GEKA 3P2IA 4RTPA 5DX8A 1B42A 3P9KA 3HCEA 3DTNA 3GGDA 1O9GA 4GOMD 3I58A 2HV9A 4PYJA 3M33A 5HFJA 2XYQA 5LSAA 4DA4A 1EQAA 2AOTB 4P58A 3TFWA 1D2GA 5LQKA 3PFHA 2C7RA 5K0BA 3P97A 2K4MA 3G88A 1N7JA 1JG1A 4FSDA 2P41A 1XCJA 5F2NA 3BKXA 4IKPA 1NT2A 1EAMA 5LQUA 1AQJA 3BGDA 3P9IA 4OBXA 1QAMA 4XUDA 5FWDA 3PX2A 4YUZA 4R6XA 4E31A 3TLJA 4PIMA 2XBMA 2AOWA 4HH4A 5GIPE 1KXZA 2P8JA 3IEIA 4KRGA 5ICFA 3AWIA 1QAOA 5K0GA 1Z3CA 2OXTA 4RVHA 4WVLA 2JHCA 3CBGA 3HVHA 4FT2A 1FBNA 3HCAA 3NWBA 3R3HA 4AZTA 2YXDA 4GBED 4A6DA 2VS1A 3EEYA 5DLYA 4QQNA 3BGVA 2QM3A 3ELYA 3GRYA 4X60A 4ATNA 5BW4A 3OFKA 5F2OA 4PYQA 2AZTA 1SG9A 4E2WA 4QVKA 4FSXA 1YZ3A 3ME5A 1DUSA 4QTUB 2CWWA 1JQEA 3DLIA 1VL5A 5FHRA 2P35A 5E9QA 4UOEA 5CCBA 3LCVB 3LHDA 3R24A 4MQ4A 5BW5A 5K09A 5GOZA 2ZBPA 5CUQA 5DX0A 4GOOD 5K0EA 1N7IA 3G2QA 3ER9A 1JR4A 2HWKA 5DT2A 2FRXA 1G55A 1JQDA 2IFTA 2UYOA 3SSMA 5KQSA 5EMKA 1XXLA 1YF3A 3KKZA 4OA5A 4OBWA 3SVZA 4BY9E 1FJXA 3BT7A 1ORIA 4HSGA 3MCZA 5EZQA 1VIDA 5DWQA 4E33A 2H11A 2ZTHA 5MHTA 1R00A 2IGTA 4GOND 1WY7A 2PWPA 3X0DA 2KW5A 3ELDA 2AOUB 2AOVA 2YR0A 4H0NA 5EVJA 2ERCA 5FUBA 2UYHA 3KQPA 2PV0A 3TKAA 3P2KA 1F3LA 3KR9A 3FPFA 5GM1A 3DP7A 3FRHA 3LBFA 3OU6A 1G6Q1 3PB3A 2PXXA 1IY9A 5FQOA 1BC5A 5K0JA 3KPVA 1VLMA 2JJQA 4HGZA 5LQRA 3MTIA 3PLAE 4FT4A 1R74A 2PGXA 3GRVA 3KQOA 5E8RA 1KP9A 1XDSA 3DOUA 4YV2A 2ZZMA 5DSXA 3UJ7A 4X63A 3FUUA 3EGVA 5EKUA 1ZKDA 2Z6UA 5K05A 9MHTA 3B3JA 2F8LA 4ER0A 3GXOA 2P7HA 3MTEA 5BP7A 1L9KA 3RW9A 5ICGA 4AZWA 1XCLA 5CIYA 3QOWA 1YZHA 5ERGB 5CD1A 1F38A 4PYOA 2EX4A 3TRKA 3UJ9A 1YUBA 4E2YA 4DKJA 1DCTA 3ELUA 3P2EA 2BM9A 2FK7A 3R6TA 4MTLA 2N47A 5E2BA 2PKWA 3FTCA 4PIPA 3HA3A 1X1BA 1YB2A 3BZBA 3M6WA 4FZVA 1WG8A 4RTOA 3DLCA 3FPHA 3CGGA 3HVKA 4PYMA 4HGYA 3K0BA 2ZFUA 3E7PA 3KQMA 3EGIA 3HCFA 1EG2A 1M6YA 4FR0A 2PX8A 5E1OA 2PX5A 4BLVA 3E8SA 5K0FA 3IV6A 4JXJA 5EG5A 2B25A 2FK8A 2WA2A 4R8SA 3G8BA 3BXOA 2IPXA 1BKYA 2A14A 4Z2YA 2JH8A 3DR5A 2OYRA 3V97A 1V39A 2G72A 3UWPA 2IBSA 4P7JA 5D1NA 3FUTA 5DTQA 5FQNA 5CM2Z 4E2ZA 1M0EA 2YXEA 4PCLA 5GM2A 3SM3A 4RVDA 5FULA 5EMJA 2GH1A 3KPJA 3SX0A 3B3GA 1HMYA 1I4WA 1HNNA 2OB1A 3IHTA 5EPEA 3UA3A 3GNLA 3REOA 3OU2A 2EG5A 4DQ0A 4EKIA 5DTRA 2JHAA 1RI5A 4PWYA 4XUCA 5KYGA 3SSOA 4XUEA 2NYUA 3EVCA 2YUIA 3P8ZA 2PXCA 2IIPA 4WXHA 3DUWA 5EEHA 5DRTA 4RTKA 1L1EA 3P71T 4KVZA 3EVEA 2YVLA 3BWYA 4M7RA 5FADA 4DF3A 1VQ1A 5K0LA 1I1NA 2YTZA 4V0RA 4X1OA 4POOA 1RJFA 4MIKA 5LR6A 2GPYA 2PT9A 2O57A 4R6WA 4RTJA 1X1DA 3UA4A 3EMBA 2ZWAA 1XJ5A 4CKEA 3GJYA 4DZRA 2Z6AA 1R18A 2GAFA 3ELWA 5M5BA 2WA1A 2PXAA 3DXYA 4C04A 5E1BA 1O54A 1JG3A 3FUVA 3HCCA 5FCDA 2ORED 2VP3A 3THSA 3MERA 5G02A 2QE6A 5DM4A 2B9EA 5K8VA 5T64A 3RIEA 4HC4A 2B3TA 4EQZA 5C9ZA 2BH2A 1VP9A 2IP2A 3ID6C 3EVBA 4QTTB 1KR5A 1IM8A 2B2CA 3EGEA 1ZGAA 4QDKA 4CTJA 5LQJA 4QPNA 4MWZA 1WS6A 2WK1A 3TQSA 3MB5A 3KR2A 4PYIA 3KQYA 4M36A 3NTVA 1MHTA 3OPNA 3MAGA 2IBTA 1I9GA 5DRYA 4LECA 2PBFA 3NDIA 2YQZA 4ISCA 4E70A 4PINA 1P1BA 2AOTA 3KU1A 3UBTA 3MHTA 3MGGA 4R05A 2IH5A 2XYVA 2C7PA 4BLUA 1DL5A 5LQAA 3AY0A 1WXXA 1G8AA 5C1IA 1NKVA 1NW8A 1R8XA 4C06A 1KHHA 2ZVJA 3A26A 5D1HA 3UJDA 5JR3A 3EVDA 2XVAA 3BGIA 4HG2A 4DCMA 2DPMA 2JHPA 3P9NA 2AR0A 4AZSA 1P91A 2CMHA 4PONA 5EQJB 4PYLA 5FWAA 4QDJA 2FYTA 1BHJA 5LQCA 4ER5A 3KQTA 1NW5A 3E23A 4EK9A 1JQ3A 2EJUA 2G8NA 5CVJA 1RI2A 3F4KA 3GIWA 3EVZA 2AN5A 3K6RA 1D2CA 1SQFA 5DTMA 2P1DA 2JH9A 10MHA 1KIAA 4LWOA 1KYWA 3FTEA 4G56A 3FTFA 2P40A 3JWJA 1AF7A 2GS9A 4RTMA 4ER6A 2UZ4A 3FRIA 3R9XB 2B78A 2FCAA 1KPGA 3FPJA 2FPOA 2IH4A 2XYRA 3KQVA 2R3SA 5K0NA 5F2KA 3HTXA 4C03A 4AX8A 4KIFA 5DM2A 1RJEA 3EMDA 3GCZA 2ZULA 5T67A 1OR8A 1RJDA 2VDWA 2ZWVA 3M70A 1RI4A 3M6UA 4RX1A 4RV9A 3NVMB 4YV0A 4C4AA 1H1DA 4GF5A 5ICEA 1SKMA 4GC5A 3I5UA 3KHKA 1L3IA 4P7FA 3G7UA 3HP7A 5GWXA 2ZBRA 5HIMA 4HRAA 3FTDA 3VSEA 3A27A 5C0OE 2CMGA 3OFJA 3HCDA 2I9KA 2CL5A 2V74B 2IDJA 3GO4A 2OBFA 1EJ6A 2AOUA 1ZQ9A 2YXLA 1G60A 3HA7A 4YMGA 2QRVB 4XCXA 4RVGA 5EHGA 3DMHA 3PX3A 2NP7A 1KPIA 2GB4A 5HIIA 3Q7EA 2OKCA 2OZVA 1ZG3A 3RODA 4Y30A 3LCUA 4DMGA 3UJAA 3THRA 5DXAA 3GRZA 1WXWA 2BZGA 4M38A 2O0LA 3FZGA 3OZTA 3C3YA 5GP1A 3UJBA 3OE5A 2GA9A 3VC1A 1P39A 4ER7A 1EJ0A 2ONYA 3TPZA 1G38A 2ZIFA 1ORHA 3VC2A 4RWZA 2PJDA 3DULA 2LD4A 1XDZA 3M6VA 5CCXA 2C7OA 5IH3A 2Y1WA 4PGHA 3VYWA 4RYLA 3CJRA 5K01A 5HZMA 1AQIA 2BR3A 3FYDA 5DM0A 3UJCA 3EVGA 1D2HA 3CJQA 3LSTA 5E1DA 2QRVA 2PX4A 4YUYA 3I53A 5GINE 1VBFA 3HCBA 2R6ZA 5K0CA 1NE2A 2ZIGA 3MQ2A 3PVCA 3LPMA 2ONZA 3OCJA 3KR1A 5KS2A 1NW7A 1JG2A 2AVDA 4Y2HA 1UWVA 3DXXA 3KQQA 4A6EA 3KPYA 2AN3A 2ZSUA 2VDUE 3DMFA 3JWHA 5EIWA 4KW7A 5IKMA 5HIJA 2ZZKA 4AUKA 4YUWA 5EEGA 3SMQA 1JTEA 5JUWA 2PLWA 3LKDA 3T7SA 4CWAA 1FPQA 3EEOA 1NBIA 2BR5A 3A4TA 3NW9A 3A7EA 3OE4A 4LG1A 4C07A 1SUSA 2AS0A 4NECA 2O06A 4P7GA 3GDHA 3LKZA 5CVEA 1SQGA 3G2MA 4QVGA 1VE3A 3O31A 3I64A 3L8DA 4M37A 4PNEA 2HR1A 2ADMA 2QYOA 4BP3A 5CVUA 3A25A 2P3LA 3EVFA 1SVUA 4PYKA 3UJ8A 4OX9Y 1MJFA 4YMHA 2Z6QA 4R8RA 2P3OA 3TMAA 4U7PB 3U81A 5T6BA 3LECA 2OO3A 2CKDA 3SSNA 3FPGA 5E1MA 1L3BA 5HOQA 4CTKA 5EKXA 2PT6A 4KWCA 2BR4A 4HTFB 3C6KA 2V7EA 3NMUF 2P3QA 4U7TB 4RTRA 3GWZA 5FHQA 3E05A 1JG4A 1QZZA 2NXEA 2P7IA 5EOVA 1RJGA 2ZBQA 4EKGA 3LDFA 3H2BA 3UFBA 4RTSA 1JSXA 3GU3A 1X19A 3B89A 8MHTA 5DX1A 1R6AA 1IXKA 2DULA 5K03A 2NNWB 3DH0A 3TR6A 3O7WA 5EIFA 1NW3A 3G89A 3TKYA 4C08A 2EJTA 5CVDA 2OB2A 4X41A 1FP2A 2ZW9A 1R8YA 3I9FA 4K6MA 5EMLA 3C6MA 5EC8A 4ZTBA 3ANXA 5DM1A 5E9WA 4BLWA 4ER3A 1JSZA 3FUXA 3C3PA 5EHIA 1INLA 4RTNA 3KQSA 3TM5A 1YFJA 5E2AA 3JWGA 4HTFA 3AJDA 4DM3A 4OA8A 2HMYB 4FGZA 3CVOA 4KDCA 3HNRA 1N2XA 4IV8A 3QV2A 3S68A 2UYCA 3O4FA 3GRUA 1VP3A 4C05A 4DCGA 2ZLBA 1UFKA 4GQBA 2PX2A 3KPWA 4FP9A 4GUAA 1L3CA 4BP1A 1NBHA 4PCAA 1TW3A 3BKWA 1KPHA 4EVIA 2AOXA 2AVNA 3FUWA 4YV1A 3V8VA 5FA8A 1PRYA 3BWBA 5KVAA 2QY6A 1NW6A 3T7TA 1WZNA 3LBYA 4E30A 3UZUA 5GIOE 4YUVA 2UYQA 1O9HA 3LDGA 2O07A 3ER8A 3A7DA 1XDUA 2NXCA 1VPTA 3M4XA 3M6XA 4RVFA 3UJ6A 4E32A 4QPPA 3G2PA 3D2LA 4OQEA 3SGLA 3BWCA 3OU7A 3PTAA 1QANA 5P8WA 5DSTA 4F85A 1SUIA 3PS9A 2PWYA 4IWNA 3KPUA 4PYNA 2OY0A 1G8SA 1XVAA 3HEMA 3PFGA 3G8AA 5ICCA 2HTEA 2IDKA 3LX6A 3NJRA 2JG3A 4F84A 4L7VA 4LWPA 1XTPA 4KDRA 4PGGA 1UIRA 3SR4A 3EPPA 3EVAA 3PT9A 5CVVA 4IV0A 4CXMA 1BOOA 4CKBA 5LQNA 4KIGA 4RTQA 4F86A 2GLUA 1M6EX 5EMMA 3OZSA 2VDVE 3LDUA 5EZSA 4RSRA 3DXZA 2E5WA 2YX1A 3JWIA 2HNKA 1T43A 2I62A 3T7RA 4RTLA 3LGAA 3TM4A 2BM8A 5E9JA 5FA5A 2PY6A 3NDJA 2I7CA 2NP6A 3AXSA 3BUSA 3T0IA 4E2XA 2G70A 2OPBA 5H02A 3G2OA 1Q0SA 3CJTA 1JTFA 3R0QA 3G5LA 3FYCA 2O05A 3MCTA 3ORHA 4MHTA 4X61A 3C0KA 3AXTA 5FTWA 3FPEA 1FP1D 3IYLW 3ERCA 4QQKA 5DPMA 1P1CA 2ZIEA 3P9CA 2I6GA 4V0QA 4AZVA 4CKCA 5HIKA 2Y1XA 1Y8CA
chains in the Genus database with same CATH superfamily
2W2NA 3NVKI 1PDVA 4WBSA 2AX3A 4E3WA 5JT1A 1ECBA 1EBUA 4C4YA 2VR1A 3DWGA 4I9HA 5EZ6B 4TYYA 1K6XA 2LUOA 3NHKA 1U6IA 3VO1A 5DCLA 2ZBDA 1V3QE 2H07A 2NXJA 1U0RA 4J6EA 1U2ZA 5DN6D 2GHQA 5B3JC 2G1KA 1NNUA 3V8EA 3BIOA 3I6QA 2JBAA 4DUGD 1X74A 2VHTA 3BGSA 2WKWA 2FG6C 4R3NA 1DAEA 3MINA 2NVBA 3MMSA 4NARA 1X2BA 3OQMA 2R65A 3HGTA 4LSGA 4NZMA 2R44A 4RS4A 4NL4H 1XRPA 2BFDB 3GJQA 3OZXA 4J1TA 5CK4A 4IJVA 4B0PA 3EC7A 3B1XA 5LU9A 3LKVA 3KTAA 3FFBA 2DTXA 2MR5A 1CEQA 3NFYA 1U0SY 2DVMA 1CUSA 4LXIA 1I6KA 2FX5A 2IZ7A 1CQIB 3C39A 3O95A 1T3ZA 2BMDA 4IEFB 1X77A 1NDUA 1GTVA 3BE4A 3CUVA 3PZRA 5GGYA 5DX8A 3AKDA 1Q92A 2BJHA 3PBKA 5BMOA 1XA4A 3T4EA 4NR0A 5CB6A 2WTMA 3GIDA 4KXQA 3W2IA 4R69A 1TIPA 3BTUA 2XYQA 4DSOA 3BSSA 1OB5A 3F74A 1XRNA 5D3KA 4DA4A 4H4CA 5DLQC 2IS6A 2CXUA 1YQUA 1H1TA 3MNFA 2PE5A 3H2YA 4RD2A 2JCYA 2J48A 2P41A 1XCJA 3OIYA 1CR4A 1KC3A 3FTPA 5D3QA 2I78A 3GLQA 3VO9A 3E9YA 2PQ2A 1TM7E 3HJNA 1Y1QA 5DNAA 5J4LA 4EAQA 3DE0X 3N2KA 4G1FA 4IDBA 3VI3B 1DV2A 1TD9A 2CUNA 3TZEA 5BSTA 2YY5A 4O4JA 1DCFA 1EB9A 4IDAA 2QLJA 1NVDA 2FPUA 5HRAA 4F9FA 4N65A 5FL7A 1LWOA 1PWZA 3WYCA 3ZKWB 3UK1A 5LYYA 3FSJX 4PLVA 3HCAA 2VP0A 4AJ4A 1TU3A 2J1LA 1IBRA 4WNYA 3MRSA 4PAWA 3LRTA 1ZJ4A 3RJTA 3G8CA 4LJSA 2OCLA 1ZK2A 4KRFA 2F8SA 3CKMA 2ZWPA 3H4VA 1R4MA 4TX1A 1E96A 1GQ2A 3MWYW 4PS0A 5AM4A 2BSQA 4YRBA 2PX3A 1TM1E 3H4MA 2QUBA 1JA1A 1UMBB 3C5HA 2EKPA 2XMSA 1RVDA 3QE0A 1T2NA 1ZRNA 3GYGA 1T5IA 5HKOA 2FPRA 4MQFA 1GM5A 3H1GA 4JD5A 5TR9A 5EHQA 4UEWA 3QHPA 3UXMA 3ZCVA 5JXGA 2APJA 1JDUA 4KIJA 4N6GA 4X1YA 1X9IA 1U0FA 4HAOA 3WL3A 4GKKB 3IO3A 1NYLA 1A50B 2IHKA 4K6OA 5JZMA 1AXGA 3FOFC 2XUOA 2ZSBA 4JC4A 3L2OB 2F59A 3UMBA 2OMEA 3ZW9A 5AVRA 1FE8A 4P4SA 1U6KA 3F4BA 2DT8A 1BXZA 4JYPA 4LYEA 5JSHA 4QUGA 2I1WA 3I73A 3RIYA 1G5HA 1UJ2A 5CFRA 2VHCA 2SNIE 1PGOA 4F9EA 4GOND 5KOHB 2AZXA 2WB2A 2AOUB 4R8MA 4EA7A 3IEXA 1NG1A 3W2FA 4FQ7A 3A4NA 1Z37A 4CCYB 4D8UA 1JT2A 2VQDA 1JS1X 2YZ7A 3MOSA 4CV3A 3LBFA 5IPFA 3K20A 1JPVA 2WPDD 5AOBA 2V3WA 3S2UA 4AD8A 1WXGA 1P73A 4KUEA 1CY6A 1OH6A 3TDMA 4UNNA 2HLDD 4V0MA 1QO0D 3B70A 1MD9A 4BEBA 3T52A 1Y6FA 2QLLA 4QX6A 1Q0UA 1J20A 1SWVA 3UMSA 4D5EA 3VDRA 3B20A 2QUKA 3UJ7A 3OQIA 1TCCA 3ITNA 4BCCA 1T0UA 4OQYA 2L2QA 2NVUB 3ZV3A 1F14A 2V59A 3B3JA 1SOMA 2NZJA 2I2AA 2QN3A 1DRJA 1GRNA 2WWXA 1ABEA 2FPKA 3OH8A 5HUHA 1E6UA 1HLFA 1ONOA 1MIHA 1ZIYA 2JHGA 1Y8AA 4MAMA 3R7DA 2D5BA 4Q4HB 3REQB 3MWJA 3ELUA 3UT5A 4DWOA 2HXGA 2ZB3A 5K3EA 2IPMA 4RVSA 3D1JA 4K81B 1RZRD 1Y1PA 3OIGA 3ZX4A 4NG4A 4HEA1 4EY5A 1KWGA 2FXIA 3L4KA 4KITB 3T9FA 1FVHA 3DLCA 4ESEA 1SVLA 5DNVA 4G63A 1ZGGA 1YI0A 1YB6A 2LE0A 2ZRPA 3R7NA 2KLHA 4A2WA 4ZCRA 1F8UA 3ADOA 2P5SA 1XNJA 2CB0A 3DW3X 4F5EA 4B6FA 2CXRA 4R8SA 3M6MD 4F5DA 3SVLA 4LA4A 4HGOA 3IQIX 3ROMA 4BNJA 3JD2A 4XCQA 1EFPA 4ZWNA 3UWPA 1VPVA 1CUZA 2GBLC 4ZOBA 5CGZA 4DA6A 5EMJA 2V7QA 1CKEA 5B5SA 5IXYA 1TCAA 1KEVA 4WECA 4MGIR 3W8RA 5ITZA 3U56A 4YIHA 4XGNA 1YJAA 2I33A 2NW6A 5CM8B 4ZJPA 4TROA 1CUUA 2ETXA 2Q4TA 2VJMB 3UGTA 4XVRA 1CK4A 3E9MA 4G5OA 2UYGA 1L1RA 2V7TA 4GI7A 2HSGA 2IIPA 3ONWA 4GSKA 1KGDA 4PZEA 1JFVA 1ZVKA 3G2IA 5D5PA 1KEEA 3K9QO 3VPFA 3K4PA 2YTZA 3KO8A 4JAVC 1EXWA 1VHDA 2NQ2C 2O4CA 2WJIA 1YOBA 3VSAA 2BJVA 4MRSA 1S4MA 4RDCA 4RELA 4UJ3A 4DZRA 2QBYA 3LXUX 3B6MA 3DB1A 1F0PA 3RIGA 2FQ1A 2I99A 2ORED 4L15A 2Y0BA 4LMAA 1Z73A 1R12A 3FCAA 3AUUA 2R84A 1H2EA 3KLBA 1Z4LA 2J7KA 2NSJA 4H1WA 1ZU4A 3NBQA 1A82A 3A6FA 3LBAA 3N3AC 4FU0A 3Q72A 4G5SA 4RNDB 4F7DA 4RPLA 4QYXA 3G17A 5ED4A 4LF5B 1NATA 3KKMA 4N3NA 4DIFA 2A9OA 3UQYS 2Q1WA 1TU0A 2ZBFA 5EIBC 3UT6A 5J4HA 4M6WA 1P45A 3H5TA 4IDNA 1MHTA 2N1BA 4OHRA 2YQZA 3HACA 3A0UA 3PUZA 2FU5C 1SZCA 5PNTA 1LJ8A 3FFTA 1Q7BA 1DXOA 1P5JA 2QDKA 1N3LA 2LV8A 3ZWMA 1QP4A 1WSDA 3F5SA 4M9UA 2G6BA 1K8RA 3BGOS 4K3VA 4OXYA 4WESB 5IYZF 3SYNA 1EH5A 1SB9A 1GRCA 2JGJA 2XVAA 3U4QA 3GQBA 4OUKX 2QTVA 2VJYA 3P9NA 4GR5A 1PJSA 2OQIA 3EUEA 2QDXA 2VDWB 1PFWA 2FQQA 3ZLBA 5I8PA 4H0FA 1XZEA 1EKXA 4KFUA 4JASB 1EUZA 2VJPA 1WZUA 3EZFA 4Q9DA 1PO7A 2O2GA 2YYYA 1L7VC 3JARB 3F90A 3JD1A 2WIAA 5DO9A 4LSMA 3TR5A 5H59A 1SKYE 4BBPA 5HS4A 4PPGA 3ECSA 2AUNA 2WIFA 1XMPA 1QHHA 1E7YA 1V7CA 3VMMA 2WMDA 4NBRA 3ZDCA 1Z8DA 3R9XB 2D5AA 1OTYA 5TT0A 3B2EA 3DEYX 1LI4A 2BEWA 3FVQA 1NQVA 4Q4DA 5T3UA 2B4KA 2V5AA 3AY3A 1J70A 4MI3A 1JFTA 3RK4A 3U26A 4EPYA 1G20A 1R8JA 2Q3MA 1WD5A 4AX8A 1E60A 4HO1X 1OJ7A 3EMDA 1KORA 1QK3A 1DDIA 1U2DC 1E0JA 4XPIA 2AHRA 3EZ7A 2OBMA 4H1VA 4MB6A 3UWOA 1UKYA 3CX4A 4D2IA 1X9GA 3IMCA 3KEGA 4MVJD 4FONA 4BMYA 1H1DA 1VRWA 3U40A 4N5DA 4BKMA 1MW9X 2GD1O 2O2XA 1AKYA 4INAA 1YCHA 3UCFA 3JASB 3DGEC 4ARUA 5EL0A 1NX9A 1C81A 2I4RA 2WI8A 1EA7A 1WKCA 2Z5VA 2PGDA 3HL4A 4JBNA 2YXLA 3FMGA 3WIDA 3DS8A 4OQPA 2DUJA 4ENQA 1P62B 4NMXB 4RVGA 1U7OA 3SEQA 5DHRA 3WLFA 5E4FA 2Y1CA 4KXVA 3MGAA 3ZDDA 3L1JA 3R40A 2GPAA 3QEOA 3C2QA 4A0HA 1LDNA 3WQHA 2Z3ZA 3VR3D 3PCXA 2ZJ6A 3BGWA 4ALIA 5JRDS 3OE5A 4I1UA 5JAOA 2Y77A 1TUEA 3PVZA 4HRVA 2ONYA 1OQAA 4BJ6A 2C8LA 1YAHA 4J91A 4X1KB 4JT8A 5LZ2A 3GUZA 1QIMA 1D4AA 1DHRA 5HZGA 2G4VA 4IOJA 1I94B 9ATCA 4J7XA 1SXIA 2BR3A 1WCWA 4B7XA 2C88A 1WXQA 4EITA 3OJLA 3CNEA 1PD1A 1Q77A 3IT0A 4NICA 4YUYA 1L5VA 3IDZA 1U5BA 3E9DA 5KTSA 3OZWA 1Q44A 1NXWA 2RBGA 3DDNA 4NJEB 3G9XA 4WNAA 4TTRA 3KZNA 4Y2HA 2ZIVB 3NEPX 4FYPA 4KAXA 2CSUA 4LVCA 4N1AA 1X80A 4HDCA 4OHPA 1WBBA 1E1MA 2C84A 4V38A 5IYZB 1YVUA 5HIJA 1Y5IA 2X9VA 4MMYB 4V2IA 4XGRA 4DQVA 5A02A 4E13A 2Z2IA 1GKLA 4YAUA 4B4DA 5CBKA 2QSJA 3DO5A 1FDOA 4L8VA 5KSZA 5KTYA 4C07A 4X45A 2HK9A 3FA2A 3GLUA 3PNVA 3ZYCA 5MFZA 5F35A 1KE2A 3AUJB 1I3LA 2XMRA 5CCDA 4W63A 1RWPA 1E9BA 5CVUA 5KYXB 1NM5A 4X6UA 1WW3A 3CRRA 4S12A 1XAGA 4BTLA 2VJNA 1D04A 2R7MA 1ODCA 4KSCA 3U81A 5DF1A 4FIDA 4C2AA 4EHHA 5J2TA 2CDBA 4JLJA 1Z17A 4YS6A 2C9DA 4RLHA 3WB9A 3WKDA 2IYTA 3VOAA 5H4GA 4RTRA 1SUWA 2OHJA 1T1GA 2LKDA 1QZZA 3SFTA 2XMGA 3G9QA 4FQ5A 4CQMA 4IV5A 3H2BA 2VT7A 4IJKA 3EXEB 2RAVA 2QLFA 4QFBA 3DH0A 5BSFA 1SXJC 1WB5A 2VZLA 3E9QA 2C83A 3MTAA 3O93A 3TVYA 3R76A 3F5QA 5KKAA 2RJNA 1XMXA 2G04A 1NYQA 1WL8A 4L5YA 1R8YA 3WGMA 2YDYA 3IESA 4CQLA 1CUHA 4PSCA 3PXUA 5ELMA 3EAFA 4JKOA 4MWSA 3WZ2A 2FHSA 4QJIA 1P7YA 2RB4A 2XZTA 4N0MA 2EHDA 3TCKA 3WGUA 5I7WA 4L4SA 3SIXA 2GCIA 4P3YA 1I2MA 2HMYB 1J90A 3D2BA 3DVAB 3HM9A 3GP8A 3N8IA 4IGAA 2FWRA 3C7TA 3EK2A 4AT1A 3R0IA 3BM5A 1NSFA 4C6SA 1YRYE 1NT4A 3GRUA 5HF6A 2W2QA 3Q1KA 2GDJA 1J42A 3CLUD 2C5LA 3AEKB 3MCVA 2YV1A 1YDEA 2HRQA 3NBXX 4GQBA 1H6AA 3ORRA 3WMEA 2CVHA 2DBRA 1ZUWA 1THMA 2Z4TA 5G0SA 2RD2A 4LJ4A 1YHYA 3FGOA 3AHHA 4YMIA 2OM2A 3U7EB 2PD3A 3I23A 1RACA 4FINA 2C97A 1C7FA 4QPJC 5B1DA 5B3AA 3L7DA 1O5OA 2WYOA 3FF1A 3K9WA 1YZQA 2C2GA 2ZUSA 3KLMX 5TX7A 2EQAA 4OOFA 5KHOC 1T36A 4URZR 1U2SA 1QG2A 1X87A 2ZBUA 2ZITA 3UAZA 4DR6B 1BXRB 1EVQA 1YJ8A 2UXDB 2W6CX 2YFQA 2MR6A 4JUIA 4D4LA 2XGMA 5K4GA 2X2OA 4B47A 4TLCA 2FR8C 2OCGA 4O4LA 4X1IA 2BGJA 1F6WA 3B1ZA 5D01A 1XQ9A 4EB6B 5FWXB 5L51A 2P6PA 1AT1A 1SUIA 3UEOA 3UNXA 2PZGA 1P0PA 2GPBA 1OLSA 1LQ2A 2X6RA 3G68A 3LH5A 4A8JA 2ZR0A 5KDLA 4HX9A 4WK4B 1KIMA 4KQHA 3WGNA 5B55A 4M1KA 3X1XA 3K6SB 1I9CA 1JLSA 2FB9A 2ZEJA 1BOOA 4RE6A 3SZ3A 3DTYA 4WHMA 3LP6A 4UVIA 4F38A 4ERXA 1RSZA 1U31A 4I9GA 3W77A 1NFRA 1EUYA 4RADA 1JDNA 2QAGA 2ZVDA 3L92A 3OZSA 4YREA 5FTMA 1S1MA 4C3OB 4CKCB 1N3YA 1RLMA 2ZXFA 3NHBA 4H17A 2X8AA 1S0UA 3T7RA 5AD1A 3KAPA 3WE7A 4CM9A 2GEJA 3RVSA 2UVQA 1Z0UA 1RYYA 4HYEA 3UJ8A 3KXPA 1S89A 1WXIA 5CH3A 1JKFA 3ZR4B 4DA7A 4HNTA 1C1DB 1KO7A 3QUTA 3U3OA 5JWRA 4EUFA 2TSYB 3KNZA 4LPKA 1XFDA 4TQ9A 1HT0A 1O7JA 3GLKA 2BFCA 2HK8A 4B9EA 1UDWA 4HSEA 3IBGA 1IHYA 5E6RA 5IRCD 2I3AA 1UBSB 2I80A 4X61A 4K1LA 5ALXA 3NRBA 1UDCA 5LPNA 2I71A 3O2NA 1GAEO 3DTTA 4AX4A 1QGZA 3ZD7A 1U3WA 3UJNA 2O8EB 5IJ0A 4K2AA 5IC4A 1FMFA 5I9TA 4RPIA 1Y8CA 2E49A 3KJIA 4X00A 4MKRA 4TM8A 2HHHB 4EZEA 4BNWA 3I04M 4I08A 4WFJA 3CA8A 4Z3DA 5AW8A 1AY0A 4IJUA 1RI1A 1AO0A 1DE0A 1Z4IA 6Q21A 4FD2A 4TV9A 3DFIA 5DW0A 4P4UA 4CCWA 2C7QA 1CJCA 3K0AB 1ZHFA 1AQUA 4NY1A 3SIWA 5C5CA 4JLDA 1KI2A 5JNSA 2COKA 4U0KA 4CIDA 1MB2A 3TLAA 3C4VA 3IIKA 5U4XA 3RYFB 1BMFD 1QNFA 1WX1A 2BGKA 4LHEA 4HDSB 4JP1A 3O82A 4CUZA 1QYRA 1HC7A 3URMA 2GD2A 2R62A 2VJBA 4FYMA 5HYVA 1FCJA 4L0QA 5DTEA 4TYQA 3H99A 1PYOA 1Y8QA 1GNSA 2CXTA 3U49A 3KQWA 3NTLA 4MYCA 1SA0A 5F9FA 1G16A 3LL7A 4FDLA 5BV7A 1A4RA 1R9GA 2W4QA 1V1RB 4NONA 2AT1A 4KP7A 3RQSA 1B42A 4Z4FA 2IEYA 3ILYA 3FHJA 4WEOA 1PL7A 3QG1A 3QUSA 4X7MA 3SYMA 1SD1A 2HXYA 3ZDQA 1NVMB 1V48A 1DTEA 4N5MA 3A1TA 4XR9A 1GU1A 1WUJS 1JDPA 1NVWQ 1T9GR 2ACEA 2H9IA 4J1NA 4JOCA 4OK3A 3TW8B 4D9KA 4O2AA 2WF8A 1NJ6A 4PG6A 3S8YA 1E18A 3RS5A 2JEOA 1U2PA 4LMPA 5E7JA 1P0IA 4AZ3B 2JRLA 3INTA 4BASA 4NNOA 4FOSA 2O3RA 5A3RA 3O91A 3OSZA 2D62A 4HZIA 5FWDA 2C07A 1VB3A 4E31A 3EZ6A 3ILHA 5JJ5A 2QMHA 1KYTA 1H0KA 1FNNA 3N8DA 4BQRA 4F6LA 3IEIA 1P4HA 4URXR 5E3HA 3G5UA 4RVHA 3HFJA 3RU3A 1WB6A 4GO1A 4MJ3A 4XGKA 5JCOC 2C82A 2YXDA 1K88A 2TMYA 4OHOA 2JAPA 1YQTA 3V1LA 3COZA 2WP8J 3PCTA 1Y1SA 1AUOA 4FDUA 4WZBB 2VDNB 3DP9A 1SXQA 2IXGA 2O0JA 2P9TA 4HH1A 4TRRA 4XXHA 4M99A 4E2WA 1PEAA 1NN1A 221PA 3RUCA 3ETHA 3LFUA 1KYYA 2ODTX 1QQTA 3JQGB 3NIGB 2R00A 3NUZA 1CT9A 1YS7A 4I4TA 3COPA 3NOXA 1BWSA 1OSNA 4WI1A 1K7SN 2DXIA 4OI2A 2ZBPA 1ACLA 1SIWA 2P79A 3H5OA 3QFCA 1Y3HA 3ZI0A 3N74A 4U9IS 4BN5A 3QVMA 3A4VA 3Q8MA 3L6UA 1FNDA 2IFTA 4K9PA 5IZCC 4C0XA 4OKNA 2XOKD 3REGA 1YF3A 3OCWA 1DU4A 3QA3E 3X1YA 3W8NA 3ZC3A 4BJ3A 4EPWA 1LVHA 2OCIA 3KEFA 5K45A 3DQZA 3BMNA 3THYA 3FGZA 3VHXB 3KLPX 4F4HA 2IGTA 1QUFA 3PA6A 2K2QB 3NANA 3OE7D 4Q1VA 3MQFA 5CP8A 3EF0A 3L7MA 1NIPA 1MTOA 2BEKA 4S1VA 3U5TA 2EBWA 5IC5A 1KHTA 3ICCA 5HBGA 3OIUA 3V55A 1LI5A 5DGIA 1S3FA 1T6NA 2H4WA 2OZLB 3MT7A 4INJA 4RHEA 1K0UA 1KU0A 1DLJA 4JBGA 4YEDA 2NLOA 2PXXA 1XA3A 4JIMA 1MCZA 3OD1A 2BHRA 3CV3A 3AJRA 3EFEA 1WB4A 3PLRA 4HP8A 1LU9A 6PFKA 2XBLA 1KTVA 2VH1A 5JH7F 3WQBA 2QD3A 4N47A 4IGKA 3RVMA 3DVQX 1P2SA 4IF4A 1J99A 1AZSC 1O6ZA 2FE1A 2DBQA 2FUKA 4K05A 4E5NA 3P5SA 2Z2ZA 5FLXA 1ND5A 5JALA 2J9FB 4M9ZA 3K70C 2QW0X 1RQXA 5PGMA 3IKJA 4Q7EA 3U9LA 4JHLA 5G2OA 4DWWA 3LTNC 1YUBA 2FUCA 3FI9A 3LY8A 4QOIA 3WZLA 1KMIY 1F60A 3DOOA 3HZZA 5J23A 2IHZA 5B1HA 4DSUA 2Y1OA 1ZI6A 1TUBA 1W2HA 2JGIA 4ENPA 5KWVA 4YRJA 2Y6VA 3BFKA 3FLAA 2M9MA 2AIRA 5DEOA 2CD9A 4KPFC 3CEHA 1UJMA 3L7BA 4LKOA 4CDGA 4J0HA 2PX8A 4RZSA 2PX5A 4KLNA 4CIAA 1Z0KA 3NGLA 4AF7A 4E1BA 2DECA 5EG5A 2IXEA 1GKKA 3W06A 4UZEA 2FRDA 2R1UA 4L4YA 4AS3A 1FS4A 3FB1A 1U0JA 2H6EA 1E79A 2PJRA 4KQJA 2QT0A 5BN5A 5J4KA 2ZJ7A 5JATA 3GG9A 3RBAA 5HKLA 5H83A 1OLUB 1HMYA 1I4WA 2B1IA 2DQKA 1EVKA 5KB3A 3ZHBA 4DQ0A 3H5VA 4EKIA 2ZDHA 4RJ2A 1KI6A 2ZJ8A 4RO0A 3H5RA 1VKNA 5EJ2A 4ME6A 5F1YA 5CX1B 5AW6A 2YL2A 2XUIA 3PQ8A 1NHWA 3OF3A 1NXVA 2Q49A 3O8DA 4PPQA 3WWOA 3DDZX 3P8ZA 3IOBA 2R2GA 1USVA 2ODPA 3WJ1A 5DLEA 3V3TA 1J33A 1JEQB 2EATA 4AQYB 1JDVA 1DBQA 1BOFA 3ITDA 1JAYA 4GZ6A 3U39A 4DF3A 4IGEA 1Q15A 5K0LA 2J3KA 2CMFA 2NUAB 3UHFA 4FB5A 1I7QB 2XKKA 4KCGA 3UAYA 1ETHA 4ZT4A 4MUMA 1UDAA 4LN1A 4DYVA 4PGMA 3DV9A 4NU0A 2VTBB 5KYUB 1G18A 1OAAA 3PFBA 1HORA 4NOKA 4WVFA 2KSQA 2JPDA 2OBXA 3FHOA 4Z4CA 1M2VA 1W5SA 3UG7A 4IMRA 1U3GA 3N8HA 1MAHA 4G25A 1CVLA 4G9BA 4MEJA 2VBCA 5AVTA 1BROA 1EUQA 4H6XA 1YQDA 4D1YA 1VP9A 2H1VA 1MVNA 2PV7A 5KBYA 1KRWA 4GBMA 4M0DA 1WKBA 1JLHA 2I4TA 3C1UA 1WS6A 2J4FA 3GMTA 4HAVA 4QPNA 5J43A 3HCNA 5C81A 1B2RA 1D1PA 1NP7A 4MAAA 1L4GA 4IOKA 3WLLA 1O95C 4JY7A 3OPNA 3L18A 3QVKA 4OG2A 2XUDA 4FE4A 4LECA 5EZYF 1YE5A 3G0OA 5JHHB 1WSAA 2R7NA 4CUKA 5JH7B 3KU1A 1KAEA 4HNUA 2D3TA 4BNKA 3MHTA 4TL7A 4G0PA 3T3DA 3HUFA 5FORA 5BORA 2HN9A 2ODBA 4OREX 4C06A 4DEVA 2VUSA 1UBTS 4REOA 4MDFA 2BZSA 3IPCA 4O1HA 2NVOA 4EY6A 2QRPA 1CFJA 4Q03A 2HHCA 3KEQA 3EC2A 1KDOA 3DFZA 2CMHA 4PONA 3JY6A 3PFIA 3UENA 4HBZA 2DQYA 1YB7A 4WKBA 2QZSA 5SY4A 1LJUA 1XKXA 1Z4KA 1M1XB 2J9RA 3CW2A 3C7AA 3VR4H 3R20A 1RQ7A 1BAPA 2RGEA 2BMVA 4EK9A 1XLVA 1Z39A 2H4JA 5FYDA 7MDHA 3UOWA 1NA5A 2EEZA 4TLBA 1PUIA 3VPXA 4Y0NA 1K9SA 1SIUA 3CR3C 5I9IA 1Q3TA 1OV6A 2IE8A 3JWJA 1AF7A 2GS9A 2UVPA 3NV9A 4LF7B 1P2UA 4D9FA 2IHVA 3WBKA 3FPJA 4YRZA 1G8FA 3KKQA 2DUMA 3CZ4A 3NZEA 5G0WA 4BKRA 2V7XA 1CIVA 1OC4A 2XZLA 1F5NA 1UINA 5AK5A 2I2CA 3HB7A 1JXAA 4JP2A 4CU5A 4E5KA 5DM2A 5ADHA 3BH7A 5AVZA 4IVPA 4JQZA 2ZULA 2G0AA 2BKEA 2ZB7A 4HDKB 5SYNA 3M6UA 2BCGY 1BXGA 2G76A 2RC6A 4IO1A 2R8EA 5ICEA 2C00A 2PGAA 4WTOA 2JGRA 2G82A 4Q3BA 1GQYA 2OCAA 3VR2A 2X1HA 5LQMA 1ZQ1A 1XAJA 1D2MA 1AV6A 3ETDA 3RKSA 2HU8A 1EJ6A 4NMWA 1IM2A 1T9HA 3H17A 2Q2OA 1EE2A 1XDDA 2W4MA 1QH8B 1RWWA 2HRCA 1QWOA 4RKWA 4RL6A 3DBVO 1AHPA 2OKCA 3GDFA 4DREA 2IHJA 1XTSA 4BRUA 1U1DA 1A04A 3LCUA 4KK4A 4EO4A 2EIHA 5FI0B 1U0HC 3OY2A 2PH1A 3UJBA 3OZTA 1UBUS 5GP1A 3VR6A 2WC1A 3VJKA 1J5XA 1VCIA 4B2PA 3UQZA 2VF5X 3E3MA 3E4CA 3SQLA 4DMUB 2B21A 5BRJA 1P7CA 4KXYA 3QG5A 1PX0A 2FPSA 3OQ1A 4JDUA 4CGYA 1BEZA 3J7AC 3NHSA 2C7OA 2BRUC 3I9NA 3NFRA 4U00A 1GGJA 3CJRA 5HZMA 3PFKA 2HQSA 3OICA 4FI3C 2ZUCA 3IC5A 5MDHA 1GADO 4GLFA 2IUTA 1EA5A 4H4DA 5CBPB 3OCJA 2EL9A 3OEED 5EZYB 4IF6A 4P38A 5AWFC 4BDSA 3GPLA 1OW3B 3HH8A 1KVUA 2ZETA 4OB7A 5HF5A 5K6AA 2H1WA 3C24A 4PNZA 2EBHX 2FPIA 5LD2B 1UPCA 5C7LO 3HWX1 1HDRA 3EGCA 3Q98A 5KSYA 4WIAA 2F55A 2BFPA 4CKWA 1ZH8A 4XM0A 1E7RA 1FPQA 4MVJP 1JA9A 1GGNA 1XCPA 3ICPA 1SUSA 4A73A 5IKXA 2HCJB 4NECA 1E9SA 4HN9A 1UXKA 3HO6A 4IFIA 4M37A 1FQJA 4K9OA 2G83A 2XIQA 3AONB 3PHHA 3L7OA 3UF0A 3L3BA 4L22A 4PSAA 1ZK3A 1QC5B 1I36A 5DNUA 5IG2A 2Z6QA 1BGVA 4HZUB 1YVDA 2OO3A 3LECA 1F6BA 4K86A 4YJ3A 3TLZA 3M9LA 1J2EA 3AUTA 3BSFA 3L7AA 3LC2O 4IDPA 3TX2A 1QS0A 1PYDA 2XWQA 5GAJA 2B30A 2QNBA 1EFUA 4P6VF 2IHNA 3NMUF 3H9UA 3OX2A 1UMCB 1PIWA 3LVRE 2IUFA 3OT5A 3OZ7A 1OWLA 3QY0A 3S2FA 1V2GA 1OE0A 1YQXA 5JNLA 1O5TA 3B89A 3B2QA 4EYGA 2AWOA 2C4NA 1D1QA 2JAWA 5IJZA 2H5JA 1GZ4A 1S3SA 3HU5A 2P5UA 3K8QA 4GBGA 2ONJA 1NSTA 3L4BA 3MJSA 1NQUA 1T8PA 4WK2B 1LDBA 3F67A 4IS2A 5M3BA 2TMDA 3AW9A 4EHDA 5K8CA 2GJAA 2YJ6A 1IIBA 1OT5A 4FNMA 4DSZA 1RM0A 1JR3E 2VO1A 2Y0DA 4GW3A 4DSTA 5JVDA 2XKBA 3ASYA 3FX2A 2JCGA 3TEJA 3RHSA 1Z16A 2Y71A 5ARDA 1TVKB 2C9CA 2X4LA 4F1KA 5KNDD 2IE0A 3GCXA 4DM3A 5F7ZA 4KQMA 4LYYA 1QTIA 3GPDG 4KPGA 4CW7A 4Z0TA 1U80A 4RZ3A 4P80A 4RY0A 4DG5A 1EK0A 2MYNA 1CV2A 1NOIA 1N4AA 3SSAA 4C6RA 4FP9A 4MMZB 2B2NA 3H8SA 3L07A 4ZT2A 3CRW1 2C2YA 4XDHA 4KVFA 3AP2A 2FZ4A 3KT8A 1KETA 1D2AA 1KJQA 1SXJB 1W9HA 2O0KA 2RIPA 3EG5A 1BN6A 4H7FA 4LJ8A 4XDYA 3BWBA 3HPRA 4G5YA 1CUCA 1N6RA 3ENQA 4FKBA 2QG9A 4M0UA 4BNTA 1CJVC 1HUQA 2YFYA 3QLJA 4MVXA 1OJLA 2CYBA 2J3MA 4RE5A 3SU8A 3TSCA 5I7RA 2OHHA 4DRXA 4DA8A 3AB3A 4B09A 1LBIA 3GV0A 5GONF 4YPOA 1DIGA 4NV3A 2OQVA 2IOFA 1SOUA 2OORA 5AI9A 5CAEB 5C52B 4RL4A 4RQTA 3WYNA 5I7VA 1EESA 5JS8A 2R8ZA 2GLTA 1WHTA 3DMNA 3C43A 3ICOA 2ARKA 4ZAZA 2X40A 4IG4A 2YJTD 1O3YA 3QPDA 4ALNA 4UTVA 5BRAA 2J33A 2B8EA 3DBLB 1Q1BA 5JFOA 3KJFA 1XTPA 2QSYA 4JL8A 3EWSA 2J6BA 1ISFA 1UIRA 2MU1A 2PSEA 2Z56A 3G23A 3HP4A 3PT9A 1QTNA 4GX2A 4Q1DA 3WLEA 4CF6A 3WNQA 5AVXA 4R4JA 4WZAA 3TLGA 2IY7A 3A9UA 3FD8A 2A8YA 4YI5A 1A2OA 2GLUA 4XDGA 2W2LD 4C0JA 2H48A 3RR2A 5LMZA 1T3GA 4F2PA 5C53B 3NM4A 4C5BA 5T8KC 4MUXA 3RSFA 2F3RA 1O6BA 2SECE 3EWNA 3IT2A 1KBQA 2W8BB 2ACWA 1DKUA 2Q3BA 2W22A 1AKTA 2HT1A 3QX3A 2J5KA 3DOIA 3FCSB 3NIDB 2NOAA 1CEXA 2QVYX 1JYSA 1XSEA 2I7CA 2OZEA 3AXSA 3DDSA 4IY1A 4RENA 4UCQA 3K2QA 4ZXPA 3DO6A 5DNDA 3H2JA 4D57A 1E1CA 2H2FA 1HZZC 1EX7A 2CE2X 3NWOA 5C3UA 1KQPA 3LS2A 1XQ1A 3T8YA 2B1GA 3NH9A 3IPRA 3OBBA 4DRZA 2P9QA 3H2IA 4JJ6A 5CFLA 5BT8A 5LMNB 2BKVA 1AU9A 2VP6A 3X3HA 3QNUA 5JQGA 1FP1D 4EZBA 4ZOLA 1WXDA 2BZ1A 2BFBA 2ZIEA 1OHHD 2MYPA 4V0QA 1CE8B 4DE5A 4DUGA 5DNEA 1WOYA 5L8VA 3NR2A 4G0YA 1MUUA 5LZ8A 1WXEA 3AKCA 1EVYA 4Y9UA 2H00A 2CXOA 3TCXB 2CLSA 1W85A 4M76B 1PQ4A 4IDFA 3PSAA 1UBJS 2PHZA 3KUUA 5EP4A 1X7ZB 4YY3B 1IBSA 3LRXA 4G2TA 2IH2A 3Q9SA 1MU0A 1QLJA 2ZUVA 3C6ZA 1R6DA 4AJ1A 4QREA 3FZNA 2YWHA 3B82A 1KDPA 2RGCA 4JJFA 1DJLA 1I0LA 1QCZA 4OXNA 4U7WA 5ALIA 1H5NA 3JX9A 5KQRA 3KUCA 1AMOA 4MV0A 3HVJA 1HX7A 3KR0A 1PWXA 1R2QA 2DHCA 1ACMA 2CZGA 4EEZA 5JZBA 1NUQA 4WINA 3OQBA 3OPXA 5GONB 2C20A 4TKMA 1GHTA 4MMXB 2J5RA 2CFOA 2CXPA 3TVTA 3GRKA 3SY8A 2WSIA 4HWKA 4J0QA 5IDYA 3AESA 4P4NA 4UTRA 1U8CB 1JJ7A 1HDIA 3B5JA 4EG3A 3DD1A 2V54A 2J5XA 3H2SA 1K63A 1CCWA 2XOXA 3HUDA 3FIUA 3QF4A 5LSAA 3RTAA 3OUTA 4LGVA 1DT3A 3CT6A 4MQBA 2J3LA 1JEJA 1W4LA 4H2DA 3M1IA 5JRZA 1TXGA 4JNKA 1KI1A 1Z5WA 3LYHA 3W78A 4D3SA 3O94A 3JXEA 2PK3A 3OKCA 3DZKA 1JSLA 1IOWA 3AF0A 1QAMA 3HDGA 1HFKA 1NOJA 4RYDA 4R6XA 5EYPA 3TUIC 4E21A 3F6YA 3PQ2A 1DOHA 4PIMA 4Z9XA 8LDHA 3ESCA 1M2NA 5JYCA 2MSNA 3AF2A 4A6PA 4B3RB 3IPAA 3H11A 3THOA 4WVLA 1TTQB 4GYJA 5AVUA 2WB4A 5EKTA 1QHGA 3GGGA 2Z2XA 4M1TA 3TQTA 1MQSA 1EFTA 5BVHB 3U1BA 2VBFA 3OQ6A 4QDXA 3SK0A 4TQGA 4FB4A 1TTTA 3HU1A 3QVUA 2JGKA 3OLZA 1ZHOA 1PZMA 2P4SA 1GP2A 3PNOA 4ILKA 4ATNA 4BP9A 4HVLA 2EFGA 3NG1A 2FI1A 2C2BA 4BZPA 1XK6A 1SG9A 1CUAA 1E1RD 5BNFA 2IYZA 4RPGA 1R88A 3I37X 1JQEA 4PLHA 1I1QB 2DWPA 1NUUA 4LJLA 1T15A 5TQVA 1MX1A 5GOZA 3TW4A 1PJTA 1G4HA 1Y3IA 2O8VA 3HN7A 3ER9A 4Z86A 2O3UA 3NHFA 4HRYA 4I4CA 2PD6A 1DV1A 1YCDA 4LVOA 4CKYA 1UJ4A 2CY0A 2QB5A 1CS0B 2HLDA 3GVXA 1QO0A 5LBIA 1A9XA 2QTRA 1ESZA 1JJBA 4KO4S 1QKJA 2ZSKA 4MR7A 4DC1A 4J1QA 2H7CA 4GZMA 3SLKA 2P0EA 2AG1A 4KQIA 3WXMA 1N78A 3KYIB 4B4VA 1MO6A 3ZJTA 1A98A 4WFKA 4B4WA 1LPNA 4FGSA 5BN3A 2YWRA 3OX3A 2ZRBA 5A0FA 5FUWA 2WTEA 4OM8A 4YRCA 3ZY5A 2GYVA 3AZQA 4BFTA 5JS6A 1VPLA 3F8SA 3L06A 4IIJA 2JJQA 3PE4A 5F3RA 2ZCUA 1SCBA 4MA5A 4QTXA 4UUAA 5AKKA 5TARA 4GG1A 3I1IA 1RZRA 3WIBA 3DHVA 2CNDA 2MT9A 4DV1B 3PNSA 5LUBA 3EGVA 2A4KA 5D3ZA 2LWIA 1E64A 1VIAA 3GWGA 1JDBC 2FN4A 3SJAA 4K6GA 3AM3A 4OHYA 4ZVTA 3GOHA 2FGKA 1VJ5A 1K97A 2PZMA 2A0XA 3GBSA 1MXFA 4G37A 1KWKA 3E70C 1CNEA 1WLYA 4LQLA 4TWIA 4DG8A 1FDSA 1HRKA 3U7QA 3N07A 4GMKA 3ORQA 4CF4A 4GVXA 4CT4B 2ISSD 4J7UA 3E9RA 3CZ5A 4H1HA 4PIPA 1AV7A 1AZWA 1NBMD 3DC7A 1RXSA 1V47A 2OVFA 3KLNA 1P7PA 1TJ4A 1ZYUA 2IYRA 5BYJA 2WFLB 1K3FA 3TE6A 4BZQA 1FYXA 3HDQA 1EG2A 1YZUA 4OH1A 2PMDA 4FCCA 1EX9A 3W2HA 3E8SA 1H4VB 4PR0A 1C7IA 2WJ4A 3U4DA 2NZXA 5LP6F 1XRMA 3V97A 1DOAA 5GOTA 5BQPA 1EG7A 1RHKA 2I7VA 1V39A 1OYVA 3KJNA 2O5CA 5HQ3B 1GG9A 3K70B 2J9YB 3ZDRA 1FFSA 4OJMX 4DAEA 2OHIA 3MF4A 1I30A 1PSZA 1XNRB 1Z34A 3SX0A 4D9HA 1CRLA 2Q5OA 4RF3A 3TLCA 2VDKB 2WM2A 3L4JA 2VBIA 4DJFC 1WKVA 4JLUA 3VFDA 2DE0X 3RVOA 1GTRA 4L75A 1S2DA 1S6YA 1RI5A 3NAMA 2YZMA 3KVRA 4ETIA 1ZM7A 1CUBA 2Y4OA 5EEHA 3BILA 3U44B 3IB6A 1I0IA 1KC1A 1EINA 1D6JA 3ACCA 4PHHA 2FEKA 4REQA 2GEUA 3LFTA 1MB4A 5F5LA 4MOWA 1M0TA 4NS4A 3KB8A 4CG3A 4KOEC 4L2IA 1HF3A 4LV8B 3RAEC 1XTIA 3V46A 2IV2X 4URHA 3PXXA 3RBZA 1AKVA 1LLFA 3B12A 3HI6A 3PITA 4AIRA 4AS2A 2V9CA 1JEYA 1V5WA 1Z88A 1EVIA 4FBLA 1E6LA 1Z25A 4AO7A 3MMPA 4FLFA 4XVQA 1S9DA 1WO8A 4RA6A 3UPDA 2QA5A 4X90A 4KH1A 4I6EA 3F9CA 1W88B 3RIEA 4D8TA 1JG6A 1J8VA 1G19A 4E4RA 3JAMA 4H3VA 4UXJA 1XEXB 2PEZA 1P9LA 2FSVC 3ID6C 4DFDA 1SCJA 2J6HA 3H65A 3K2EA 1ZGAA 2YJNA 3TTVA 5I5EA 4JU8A 4B46A 1XQ6A 3IJPA 2WD7B 3N2NA 1ZAYA 1ABBA 3MB5A 3VU9B 3FCEA 1Q7GA 1CJKC 3D7NA 4OB6A 4DPKA 1M2GA 1AE1A 4ISCA 4BOYA 4WW0A 2OWEA 4BO2A 3J7TA 4DIEA 1UPXA 2QJOA 2Y1DA 3CH7A 5JW6A 1OZ0A 5KI6A 2Z43A 4O63O 5T4BA 1WXXA 1PEKE 4EPRA 2ZVJA 4PC2A 4B40A 3MTBA 3QEBZ 1IN4A 2R85A 4TWAA 3SNKA 4DV5B 1AIPA 1FJGB 1E99A 1X1SA 1FDRA 2DPMA 4HG2A 4JU9A 3LD9A 4HGRA 2QXYA 3L1IA 4M4SA 4MEBA 1YE8A 4N12A 3RSZA 1IEWA 3UC9A 3GZNB 4CEIA 4WADA 2AZ4A 3T9BA 4ER5A 3DVSX 2HYDA 1XL1A 1Y8RB 2V7BA 3BB1A 3RKUA 1LH0A 3F4KA 3JYHA 2AN5A 4FI3F 5EWLA 4CDMA 2F64A 4XIGS 1HR0B 1WETA 2FWMX 2XAUA 2W83A 3IKMB 4GI3A 3FTEA 3MW8A 5JFGA 1OTHA 2I6TA 4ZAFA 2WWFA 1OXTA 4OFXA 1TMOA 2QKYA 3ZCSA 3FAZA 3PC7A 4IKOA 1M6VA 2HF9A 3P32A 4MO2A 4UE6A 1EHYA 1GJRA 3COWA 5CTAA 4EENA 1Q17A 3DDHA 2CVZA 4PXYA 3SZOA 1B26A 3MXTA 3WA6A 2IELA 3P2MA 2QTTA 4PCUA 4D3FA 4KAJA 5F9MA 1RJDA 5CCEA 3A4LA 2Q1TA 1I1HA 4KDFA 1MO4A 1E4VA 3CPEA 5FB3A 4D0NA 5AM5A 2DPYA 3HP7A 2YYSA 3T1NA 5LB4A 1HG0A 1OA0A 2R1TB 1FTWA 1RRCA 2FVYA 2NU6A 3OQPA 3OT4A 4WH0A 2I9KA 2EOAA 3O8QB 3OCUA 2GUGA 5J40A 5LNK6 2ZYTX 4C88A 2W8ZA 3QTBA 4GXTA 5LLDA 3LX5A 4U3JA 1XJWA 3SBEA 3WRWA 3ILSA 4Q1FA 3EJWA 2PGIA 1V5GA 4GDFA 3CEAA 2GVDC 2Q2VA 1NAHA 1BEUB 1N1MA 5TT1A 5EIBD 4L9AA 3BH0A 3EZXA 1V6SA 4LNUB 4ZREA 2VQFB 1J4AA 4M83A 5B2EA 2C2OA 3BOSA 4RWZA 3JTMA 3RVPA 5A06A 3NM6B 1QMGA 1XDZA 1GNQA 3R3SA 1TOAA 1RDFA 3BCSA 1J0CA 1G4UR 1NBEA 1QFXA 2Q2QA 3QPCA 4I2NA 2WJYA 3FGPA 5CURA 3FYDA 3UW3A 2QAIA 3Q3IA 4L27A 1UJBA 4P86A 3WYEA 1Z6XA 3LSTA 3OIWA 4YMUA 4AZ0B 1RIIA 2ETVA 3ODGA 1Q6ZA 3RYIA 4BZZA 3MRTA 3A2MA 1MX3A 1OVGA 1L5HA 3V2HA 3PVCA 1EK2A 3L84A 5L7YA 4YAKA 5LWQA 2IYYA 3AH8A 5H70A 2OUKA 1LQUA 1NW7A 1WMEA 1M7BA 1QDEA 3KPYA 3OPYA 4G97A 1U9YA 4NCXA 2V3VA 3OOWA 3EIEA 2ZR7A 1JDTA 4MRMB 3HKDA 4BO8A 1F20A 4BQIA 5A6SB 4YUWA 1QOPB 5IKMA 1LRLA 3RB8A 2G1UA 2HK6A 1W25A 2XDWA 2V1XA 4FHDA 5K3DA 1RYHA 4NWIA 2BE7A 3ZQUA 5CCXA 1DJPA 1VJGA 3ZBUA 4P7GA 1QIFA 3VTFA 3GDHA 4MW9A 1TJ5A 5FF9A 3PPIA 2PANA 4IICA 1VE3A 1ZI9A 5CXSA 1FRVA 1QH1B 1WHSA 4PNEA 1VJDA 2L69A 2JFVA 3GCGA 4C4RA 1QGUB 2QWXA 2ZRJA 3KBOA 2R8BA 2QZJA 2XT0A 1IVYA 2DFVA 4GM0A 3A31A 2QTBA 3HFRA 1P3Y1 3IEPA 4MCJA 3TRHA 1L5ZA 3A8TA 3J80A 2PT6A 3E9CA 3HXKA 2QX9A 1Y33E 3QX7A 2GXQA 2VLBA 3MSXA 3UB2A 2P3QA 4EMBA 1VFNA 3DOJA 2NQTA 5F7JA 2OTCA 4GM1A 5F1PA 1A2BA 1NVVQ 1E3WA 1PTJA 3BEDA 4YWHA 1FRNA 1T91A 2J9GA 1GLVA 2RAUA 3B7WA 3IBFA 4NDZA 1BCRB 4H7KA 2C5AA 5F77A 3ROFA 1UM8A 2ATEA 2OD2A 3O9VA 3V2GA 5CB4A 3THWB 2NNWB 2R8RA 3DJYA 5IWCA 3VUFA 4KZKA 4E3ZA 1P8AA 3JATA 3LXXA 1U2GC 1FRQA 1FMJA 1F51E 1GL9B 1OX4B 4DG9A 4R5MA 2KE5A 3LVBA 2ZUUA 3UHJA 2AUTA 2EP7A 1EE1A 2X6QA 3AR4A 1OIVA 3ZE9A 1QIKA 5EXXA 1GNVA 5ALHA 4W9MC 3BE8A 3JWGA 4P7BA 1GOTA 1RHQA 5CA1F 1C2YA 1UKBA 4HMOA 4R9NA 4J94A 2B5WA 1QYVA 4WXRA 5EVCA 4FOLA 2BFFA 4OSOA 1NXTA 2K7ZA 2QRNA 3KOXA 1Z62A 4XM2A 4KR9A 1CUVA 1RPTA 5ARBA 2HBQA 4AKTA 3SOPA 4C0LA 4ZV7A 4K46A 4ZZ0A 3D3EA 1ZO8A 1U11A 3AVUA 3BZUA 1C9YA 1K5HA 2MDTA 4GHWA 2F4VB 1JKJB 4EGSA 4PHCA 1EX1A 2ILTA 2P4HX 1FB5A 4HPXB 1C7QA 4LY9A 2Y99A 2V7PA 2YHIA 5G0VA 1ILEA 4DR5B 3A37A 1ZH2A 3M7IA 1AC5A 1FEZA 5GMOA 5GIOE 2NUPB 1O9HA 1I01A 5A5EA 1YQGA 3HHPA 4KJXA 4BO0A 2GZMA 1NRJB 2E82A 4ITVA 4RANA 3WL4A 5BN1A 2FH5B 4MV9A 1LTQA 2FP4B 2NT4A 2FW9A 2FZEA 2QE7D 3KZMA 4GOJA 4NDAA 4BQNA 2QVZX 1G9SA 3DKVA 2O6LA 1WMBA 3OU7A 2FFRA 4EI9A 4L6CA 5DSTA 3RVJA 3ZGOA 3PWZA 1OYYA 1R5JA 4FXOA 1WJGA 4DDMA 4DILA 4YRAA 2ZE8A 1U2RA 5H4HA 2GTHA 4W5TA 2NV6A 3HPQA 4KI7A 4MKHA 2W90A 3AF5A 4YRTA 3ITKA 4F84A 2ZJBA 2AEFA 1EFRA 1CDZA 1X3SA 2OHOA 3MBKA 3OTHA 4RF5A 4AVYA 2JBWA 3OQOA 2EJCA 5JD5A 3ISTA 5JD3A 5HRUA 2Z1DA 3KZKA 5P21A 5H16A 5HIAA 2Q29A 2XXBA 3JYNA 1RJ9B 4U6NA 1UPBA 2Q6OA 1J5PA 2QTNA 1H8HD 5CDHA 2NU9A 1Z7YA 1OI3A 3AEYA 2E5WA 3E6AA 1Z2AA 3EHEA 3JAKA 5DISB 5I9MA 2EDAA 3Q2IA 1UT6A 3LLVA 1BO6A 1UOOA 3R7SA 3SBDA 2YHAA 2HQBA 3EF1A 9LDBA 3MD9A 1Y7PA 2UUAB 2I3GA 1IEXA 1VLLA 1HE3A 3TLXA 5B7GA 1XYYA 4PZLA 3LT5A 1PR1A 1U8ZA 3WLAA 4EJ2A 3WYBA 2JCXA 3U0VA 2VT6A 4DYHA 4TPKA 1ZCZA 1ZI8A 2OCBA 2OXFA 1P4RA 1Z28A 1QPBA 4KXXA 6REQB 1TKRA 1V16B 1T4DA 5JC8A 2XF8A 3SMVA 5K6RA 2I54A 1XO1A 1YHNA 2GRAA 5ADUS 1W4ZA 3M3DA 3IYLW 2PL9A 4FIZA 4J3FA 4QQKA 1T0PA 4NBVA 4PO1A 5BWNA 3ICEA 2KBFA 1EGQA 2HRZA 3QUAA 1R0ZA 4AZVA 1T2FA 3AHEA 4F5YA 5C4MA 1BMFA 1N0IA 5L3SA 1H4QA 4DOMA 5B7NA 3HM2A 5F1OA 2G1PA 3QW4B 4OGLA 3JWEA 2VDRB 4IIGA 4B45A 1JJIA 1QAQA 2ZCJA 2AN4A 4JL6A 2BI8A 5CA1B 3IELA 3P4UA 2JS7A 3IE2A 4ZRMA 1QRDA 5EHZA 5HILA 5DK4A 3VR5D 1VE1A 4LSWA 1MVOA 4Q4JB 5DXJA 1T9ZA 5HMLA 4ZCPA 1C9NA 3FFWA 3OBIA 3CKKA 3W1WA 5IMSA 5EY5B 2IS2A 4X94A 1Y5RA 3MXOA 3AB7A 4YI3A 5I3ZA 3RRNA 2R4QA 3OJXA 1S8OA 4Y8VA 1SQSA 1G42A 4AY4A 5KO2A 1GAQA 4RPCA 5DZSA 5KDDA 2XMPA 1D6NA 4QECA 4WCFC 2NGRA 3CN9A 3RJMA 4BO9A 2YW2A 1A3CA 1HZJA 3MMXA 3BWMA 3V80A 5FTKA 1GNRA 4UVDA 2DT5A 3I83A 3CHYA 1QZXA 3TUZC 3OMXA 2XODA 3BQ9A 3SF8A 3OMLA 1F2VA 3UPTA 1C1HA 1JFFA 3MUNA 5EIEA 2C2ZA 2RH5A 4KC0A 5CDUA 2WW8A 4D45A 5FFMA 4OVKA 1C7JA 1L0BA 1QR2A 4DPLA 4GPBA 1DOZA 1NY5A 3O8CA 1KEPA 2YJGA 4DCTA 5IMBA 4DZZA 4ZYZA 3COSA 4IH4A 3EISA 4IKPA 3LUCA 1EAMA 1E9VA 2PPLA 521PA 4WUVA 5K3BA 3TEMA 3P9RA 2C4TA 3P9IA 1CQIA 3HXOA 3TLJA 1LPSA 4B6RA 2OGWA 4DM4A 4E15A 5GIPE 1WA5A 3EEQA 1PVVA 4RGBA 2EFHB 3M9XA 4KQFA 4UPDA 5G1NA 3V4SA 4B73A 4EGAA 4YJFA 5K0GA 5KJ1A 2ZUEA 1TB4A 1WCIA 1NE7A 3TSZA 4JODA 1RBYA 3R3WA 5FO1A 4BBAA 4HWRA 3R3HA 3NHPA 1G63A 2FWIA 4GBED 3GA7A 4NZ9A 1E3LA 3FVTA 3DFUA 5BSVA 2IPAB 3BD8A 4RF4A 4PO9A 1PF7E 2B8NA 1UPTA 5F2OA 2ZS8A 1DMRA 1LSUA 1QM5A 1UZLA 2JIOA 2FXVA 4UXIA 3UOAB 2VZEA 3VYTB 3WRYA 2QL6A 3QV1A 4KFSA 3PP8A 1L7EA 3MT0A 1VL5A 3C3WA 4J4BA 5FBZA 3ESXA 1IU9A 3LHDA 1ESNA 1S96A 5C46F 5K8LA 4MS4B 4DTCA 5FBHA 2D7JA 1WMAA 4C0QC 3L8ZA 1D5CA 1ZICA 1L5FA 2P27A 3SEFA 1UMKA 4HWOA 1LLQA 3CPJB 3R6LA 4BNYA 3ZHUA 2WAAA 1PNQA 4L8LA 3TB4A 1QFSA 5I3CA 3F3KA 3O90A 1P18A 1GA6A 1KP3A 3CF2A 4Y9TA 2N46A 5JJIA 3NBKA 2KW5A 1AA9A 4H0NA 1U7HA 1TA9A 3QU9A 2AH5A 3KQPA 4RHCA 4CR7A 1UMBA 3TKAA 1NXSA 3KR9A 5EIOA 5GM1A 3EEIA 4OHZA 4PLGA 1PLLA 1XF1A 2BDTA 4W99A 2F3SA 3Q6NA 2YXPX 3I0MA 4GMXA 2JJ1D 4YCBA 1GKYA 1PVOA 1P2VA 3FZEA 1PFQA 4XX1A 5I5GA 4B6SA 4TYWA 1LDYA 1SEPA 3ONVA 3MTIA 1U7PA 4AB1A 4JUAA 3B6JA 5CD9A 3R23A 2FSFA 1ONNA 3CEPB 2ZRLA 2Q7XA 3TNDA 5KQLA 3PUVA 1B16A 3LTEA 3NAQA 3ZOZA 1SVOA 3JQ7A 4IRMA 4X8MA 4ZD6A 3VH4A 1MPTA 4G5HA 4ZI7F 1MQ8B 1TYCA 5ERGB 3TLEA 4CCYA 1F38A 5C2JB 2F9MA 3FNHA 3I2FA 3KUXA 2FZGA 3TRKA 4EL0A 5K99A 4DDTA 1AURA 1CUIA 1II8A 4J8PA 3M9WA 4OI4A 3GVHA 2XCOA 5KNCD 1UP4A 4KMSA 5E2BA 2YBDA 1ZWLA 1S2LA 2BWJA 3ZY4A 4F6CA 3HLTA 4DVGA 2ODAA 2C42A 3JQ9C 2DGDA 4TMYA 5CXQA 4BGIA 2A30A 4HDNB 4FMDF 1E9DA 1VG0B 4FMCF 3W2GA 4U2FA 1JHMA 4XVHA 2FAXA 2QZPA 2NVUA 5DHQA 1YGPA 2EFDB 2GN1A 3N7TA 2FKNA 2UYCA 2GN9A 5TPZD 1JDBB 3OZIA 4MVJI 4P7JA 5K3AA 1IJBA 2JCVA 2WJ6A 4NEGA 1QYIA 3REQA 4Q4HA 5B3LA 3BMXA 4YAOA 1FJ2A 1BFUA 1NJ8A 1B8OA 3REOA 2OOKA 4NPCA 3ZDXB 2DERA 4G1BA 2L42A 3R4CA 3HI4A 1KOJA 5T4FA 2HSDA 1NASA 1RKXA 3I2YX 4ND8A 1W6UA 3G0CA 2GM3A 1NNEA 5JO9A 5C34B 2AEMA 3K53A 4O3FA 5U1PA 4EY8A 4WXHA 1ML3A 2BTQB 2E7ZA 5JJBA 2ASEA 2K6GA 2IKSA 4G5FA 1DQZA 3L0OA 2WTUA 2WYHA 4FZ5A 1U7UA 4RF2A 2ZG6A 3D8NA 4V0RA 4P3XA 2P3SA 4QT0A 3C6BA 3EWAA 1II9A 1XZGA 1U7DA 4IW3B 3V34A 2ZI5A 3T95A 4FTWA 1OZGA 2OD7A 1VYHA 3CO0S 4Q47A 4QDOA 4RTJA 1E1LA 1QX3A 2NU7B 4HQFA 1K86A 2VYVA 2CLMB 4NCHA 2FNAA 4QQFA 5LZ9A 3QXJA 4ESOA 2WSYB 1VLQA 3IEMA 4PLZA 3M5PA 2IDZA 2HJGA 4RIGA 2H7XA 1GITA 4E22A 4EMTA 5G02A 2VJMA 4Z0HO 4CIWA 1NU8A 3WNVA 1R9JA 2VJOA 1I10A 3EIXA 4L74A 4UBMA 1A9RA 3DBHB 1TZCA 3CIFA 2IP2A 3EVBA 3BEOA 1WEHA 2H4ZA 2BDEA 4A8JC 5I47A 4NP6A 1U4SA 1CUYA 1WABA 1WM1A 4NCBA 1YR7A 1TL7C 4DMFA 3DT6A 2R5NA 1VSTA 4GI1A 4JVOA 1OILA 5AI0A 5MFPA 2IBTA 1L4UA 1RADA 3S1AB 4P3OA 1NNLA 4E70A 3WFIA 1NVBA 3F1KA 2FF5A 4DCSA 4BLUA 5F98A 3O6VA 1HSZA 3TIXB 2QAGC 4OHFA 5LQAA 3X2EA 2I4LA 2VH5R 1NKVA 3BCHA 4BFXA 1SC9A 4MW5A 2GJSA 2A59A 4ZI7B 4WZBE 2VWHA 1M1YE 4XIYA 2AXQA 3DM5A 4BGUA 1EYZA 3OPYI 5BUQA 2B98A 1C9EA 1HTWA 2XDYA 4QHSA 4Y2JA 4C43A 3GYBA 4Q3OA 3QKRB 1C3OA 2VA8A 3A70A 4H7PA 2ZM6B 2X5OA 3RG8A 3NYQA 2E4XA 1JL3A 1CQJB 3EYWA 4RH0A 5F1KA 1SRRA 3PV0A 4A03A 1TC2A 3QE2A 5AW0A 2GR9A 3PR2B 4R0NA 1HNXB 5KVSA 1EQ2A 1CY7A 2UUOA 4FMDB 4GFDA 4FMCB 4V0KA 2GPSA 3W5UA 3L8EA 3OECA 2VA9A 4ZVNA 1N36B 1P74A 1WUHS 1XZMA 3SC6A 3RVLA 2GD6A 4DB2A 2D7CA 3L8MA 4O4JF 3WLIA 4C7MA 1SC1A 3I5YA 5CDSA 4B0OA 4G36A 4D0RA 1MFZA 2H2IA 2QRZA 1VHLA 2GXSA 2RHCA 3C70A 4QPDA 4JB0A 1DMSA 2VDWA 2ZBEA 4MUAA 3EEFA 1V35A 2VKTA 3NVMB 4ZAXA 4DQLA 1Y7LA 3SFZA 1GSHA 4U2BA 3LK7A 4XB2A 4DJJA 3JARA 1L3IA 3G7UA 3M5DA 2C4UA 4NC9A 3NOQA 5T6MA 3HCDA 3UK2A 3KZOA 1JTVA 2ZWMA 4RXTA 5FWYB 2J3QA 2JK0A 3RVQA 2H1OA 3R9XA 2RJ3A 2Y9PB 1G60A 3HA7A 3Q88A 5DOZA 1TCVA 5EHGA 2RHRA 1E3DA 1DDGA 1E2HA 2GB4A 2QT1A 4G8BA 3T54A 3K71B 4BX9A 4CL3A 4C22A 4L0CA 3KDPA 5DXAA 4O33A 5EXTA 3I5AA 3IPYA 1P1HA 2BZGA 3L7KA 1ZGBA 4MWEA 4P84A 2PU5A 5F4BA 1H65A 5DCUA 1DAPA 3COJA 4BB5A 3OEEA 2GA9A 3F5FA 4B2IA 4BPRA 1Y63A 5BV8A 3A3KA 5CFNA 4PQFA 1DC4A 3GAZA 3DAFA 3FR7A 4G65A 1ORHA 2VT3A 3CZRA 3JD3A 1TYBE 3DULA 3JASA 4N0DA 4YLYA 2O4UX 5J4YA 2YWGA 1QUEA 3KVOA 5IH3A 2JA2A 4D26A 3FHLA 4HTAA 3FOCA 3OP4A 1WZ2A 4CLDA 1Y6GA 3KKPA 2QUAA 3R5TA 4E5SA 2PUEA 4OBEA 4O02B 2I6SA 1L9XA 1R0CA 3GZTB 2B6HA 4KGZA 1T9GS 1EVJA 1E58A 2ZT5A 4OHUA 2ZSUA 3DMFA 5J58A 2JI7A 3K73O 4OLAA 3AHIA 3O26A 4X1KA 4XJTA 3NDRA 4MW7A 3WB2A 1YR1A 3KE8A 3LKDA 4V0SA 3S55A 3SBOA 2VP4A 4IHQA 3V8NA 3WK8A 2BR5A 1JQJC 3A4TA 3CG4A 1R8SA 2PUHA 5CLQA 1K06A 3LKZA 1BJKA 4YP7A 4EG0A 4M87A 2IL1A 1SZJG 2W0SA 2XBUA 3L8DA 4WBNB 5K4HA 2HR1A 4HFNA 1DFHA 4NHOA 4QJ5A 3EVFA 1E59A 4RDIA 4NJEA 2VHUA 2O3SA 4U7PB 3UHOA 2VPZA 3DOFA 2C5HA 4RD4A 3AIMA 4YAWA 3K0EA 2ZAYA 4YRPA 5T6BA 4E07A 2PH5A 4J0CA 2R8OA 2GBFA 3TS1A 4K6HA 2CZCA 4G41A 1IM5A 4JOSA 3GGPA 3E05A 4TQAA 2CBXA 2P7IA 5ALUA 1M8FA 5KNDA 4O4JB 4QYSA 3E22A 3LDFA 4LZZA 4IRXA 3UFBA 3T61A 3PQ4A 1X19A 2ROQA 2G1JA 2RGRA 2JLSA 1IXKA 5CW2A 2O8FB 2DULA 2O2IA 4TYMA 3WYGA 1M8PA 1NMXA 1NR7A 1V26A 2QD4A 7REQA 1W35A 3HY4A 4NE7A 3BXPA 3ZKAA 1TX4B 3KQUA 1FP2A 4D9MA 3E8XA 5EMLA 2OGTA 3U37A 3VPAA 5DM1A 1PJAA 1R4MB 1IZZA 4PBSA 3VRHA 3KQSA 1B74A 1IHOA 1KXJA 4P5EA 3WOHA 1K3UB 2XOEA 4YGYA 4MQFB 3RS9A 5TY0A 2VTEA 3PEWA 4TRJA 4DLAA 5G1PA 2BAGA 1RPZA 4X1YB 1E20A 1TKBA 1Z5UA 3O4FA 3N39C 3VNRA 3EQ2A 1FMLA 3EXEA 4UM8B 3DE4X 2D2VA 4DSAA 1DC7A 3ZZ1A 2GYWA 1JPNA 2R5FA 4LDRA 4P4SB 1CY2A 5AJWA 3V33A 4J03A 3RBVA 4BP1A 3AUAA 1MV5A 3PKIA 4OYRA 4DUZB 3F98A 4K0KB 1LS6A 5AUQA 2AR9A 2ZRIA 4N3GA 2DY1A 3FAKA 3I2IA 3LT0A 3E3AA 3KFVA 1IRXA 2BGNA 1XN1A 1KERA 3WS7A 4Y1EA 1PGJA 2EBFX 2IQIA 4M55A 4ZAYA 3GMIA 1YCGA 1IB6A 2QVBA 3E27A 3HYLA 1L7XA 3QEAZ 2SICE 3DVAA 1XDUA 1LW6E 1MKYA 3EDQA 2V7GA 4GLJA 4RK1A 4ROTA 4CU2A 4DIMA 3HSSA 5B1YA 3LPCA 4BLRA 4QPPA 1ATZA 4E32A 1CF9A 1NLZA 1RMTA 4OQEA 4RMHA 1U2EA 2O3TA 2W2LA 1RM4A 2WHEA 1NRWA 3AEKA 1VE7A 1Y7TA 4X7BA 4XM1A 2QRJA 5F3DA 3H7IA 1VMIA 4JSTA 4WXPA 1WMDA 1CPYA 5SYMA 4AUMA 4QUKA 1NI4A 1YRAA 3EPPA 4LVUA 1A5AB 2Q46A 3R5HA 5LN1A 1LBEA 1O6FA 4HMQA 4LOLA 4Z3KA 1WSBA 3ZHZA 1QGED 1AKWA 1GG5A 1W4RA 5TE9A 4A2PA 5C7YA 3GDOA 1BXRA 3CS3A 3WLKX 1OKKD 4OP1A 1CLEA 1Q1AA 3WLRA 4RAQA 1P4JA 3JWIA 1T43A 4RTLA 5FWXA 2EAUA 3MJFA 5FOSA 4EB6A 3L7IA 1JHVA 2CB9A 1JXOA 3DAPA 1EMDA 1OHHA 1EU1A 2JL1A 3MBOA 1VOTA 3TRIA 3ZTTA 5E9JA 3TQHA 4Q9JA 2H08A 2VEDA 3NDJA 1KR2A 1VMDA 4H31A 4E2XA 5AKJA 4KO2S 1Q0PA 1VIMA 1XRJA 2OPBA 4XWTA 4HFMA 3HCOA 4KQKA 2EZTA 1VBNA 2D1QA 4QGGA 4RZXA 4Y6LA 3ZDYB 2JCBA 2CE7A 3K6SA 2KB0A 3D64A 1HTBA 1EFPB 2ADFA 1A4UA 3GMDA 2OWDA 3HJHA 4GMHA 4N18A 5DXFA 1PNTA 2QLMA 3ZZNA 3HYTA 5E4JA 2GYYA 4P3NA 1L2TA 2WABA 1CQXA 2I6GA 1F8GA 3FLBA 4CKCA 2GTIA 3OURA 2F1OA 3PC8C 3EG9A 4ICIA 3UW1A 2FDCA 5FTJA 1FFYA 1QIDA 1UZMA 1AGPA 1H9AA 2WVAA 4TKUA 1NN0A 3ZBTA 4X7RA 1YTUA 4IIHA 1G8JA 1JHQA 3PICA 2JFXA 2OBLA 1KEEB 5F33A 3QX9A 4BMDA 4MZXA 3X1KA 3MQ4A 3U3XA 4PC7A 1PW5A 1V1MB 4G01B 4Y9RA 4Q4LA 1E0SA 5A5GA 1HG1A 1AZLA 2H59A 3OLVA 3R2JA 4AJPA 3DZJA 2AG6A 8ATCA 3HN2A 1XAIA 5ICMA 1DPGA 1DCMA 2QBYB 5B6IA 2O8EA 3EF3A 1YJBA 3H1PA 2NPIA 2IYWA 1A69A 2NXNA 3SKXA 1R0RE 2PQ0A 2UVDA 4WLOA 3AJAA 4HMPA 4P7KA 4YK7A 5FI5A 3M5WA 5HM8A 1W46A 2HNAA 2P8SA 4L6IA 4PQRA 2VZ8A 2RK6A 1EFAA 2B8JA 4IJWA 5JTUA 1UC4B 4JUDX 1F0YA 3DZIA 2OFPA 3DLHA 1CYDA 2WUVA 3S29A 4YRNA 5JV5A 1HYEA 2FLWA 3G1UA 3PXBA 3NHUA 4RC9A 5IDXA 5FA6A 2G8LA 2VTVA 2WWHA 3HEAA 4TUYF 4EH1A 4R3UC 1E1KA 4OCZA 2O8NA 2JGMA 3I58A 1A9YA 1VXRA 3B36A 1B8UA 2AN1A 3A1DA 5AMXA 5HJ2A 4LK3A 4QVIA 4GXRA 3K6KA 5JZ9A 1WV1A 4YTEA 3QBTA 1MJGA 3MN1A 3WRVA 4M89A 1V25A 4G9EA 3JTEA 4KMMA 2QYTA 2XKAA 4QGAA 1N7JA 1XOIA 2XB6A 4DGQA 4QNMA 2CJXA 3BL6A 3NOOA 3U7JA 3R74A 2NADA 2JLBA 2V03A 3DD5A 3ZCUA 2CNBA 3GQBB 2BVNA 1ZZGA 2QTVB 4WCFB 5J1TB 3KKEA 3T7IA 1V1RA 2IEZA 3ABOB 1EK1A 4X64B 4Y18A 3D7LA 2CCKA 1QAOA 5AOAA 3GLVA 2W2KA 1W4BA 3T9EA 1BX3A 3MTJA 4R2WA 1WTAA 4X24A 1DARA 4LYDA 5B3JA 5ERYA 3N2LA 1RBMA 3EEYA 4B74A 3KJZA 4B7ZA 1VKHA 5JEEA 4JZKA 3H75A 1D9XA 3HEBA 4KYUA 5J2TF 3TMYA 3UWKA 3ACBA 1OY1A 3PXDA 1P1KA 2AZTA 2XE6A 2EP8A 2YMLA 2YQ5A 3NEYA 4Q12A 4JC8A 4EHKA 4F8EA 5BY2A 2YWEA 3IIJA 3ME5A 1D0IA 2XDQA 3GJTA 2D2EA 4TSFA 1SXJE 3DLIA 4TL6A 4GRDA 2HQ1A 3T99A 4PHFA 1ODSA 4QC2A 1J6UA 2LZ0A 1TIKA 1VYVA 3ND9A 4QBGB 2IZ1A 5JISA 2IEGA 3L7YA 5K0EA 1FSFA 3IKVA 3G82C 3T9AA 3GGJA 4ERNA 3W04A 3F7NA 3OZCA 3E3LA 2PUVA 2R1ZA 3P9SA 3FNIA 1DQNA 2DWCA 4J0FA 4D8VA 4QGHA 3RTGA 3ZLUA 2XXAB 1JQAA 1MRZA 1Z6AA 2NZYA 4PAOA 4X84A 2O20A 1RABA 3UHPA 4TLAA 2IY8A 1L8LA 5SY6A 4E33A 4IXWA 1IZ0A 4LOHA 5MHTA 4LE0A 4EP1A 4BVGA 1KDYA 4XLLA 1IN5A 5AKYA 2UYHA 2BLLA 2W9XA 4GKVA 2FJ0A 2PV0A 4L9RA 4OP2A 3ROQA 3ZWKA 1E9CA 1Z4NA 3JQGA 3Q0TA 3PNKA 4J9UE 2ET6A 3OU6A 4DVJA 2ZWOA 4OI0A 4EG7A 2P9YA 3RRFA 5K6AC 1DBRA 2IXDA 1W4CA 2D74A 3UBMA 4RIIA 1CY1A 3PGA1 2A94A 2OYSA 3KPVA 3Q8WA 2XT9A 3DOCA 1N6IA 1Y3FE 1QQ6A 3AVOA 1CHNA 1GPNA 1D8TA 1VLJA 3E2PA 4FT4A 4BS9A 5KJ6A 1ZMBA 3KU4A 1NBMA 4HEQA 3BORA 1TEZA 1O1YA 2YHBA 4JJAA 4A91A 2NG1A 2WUEA 1FYEA 1FBTA 3CW8X 4LDPA 4TUYB 1BQEA 4QFDA 3STTA 1N34B 5IT5A 4JXZA 1V4BA 2QQ0A 2ZB2A 3FPBA 1N8NA 2P4QA 3ITEA 3O92A 4KPUA 3X1MA 2CNLA 3RYTC 4AJJA 2BYTA 3TN7A 2OZLA 1Y42X 1ORWA 1EVZA 2R5WA 2UZ0A 4O4LF 3H6GA 4IQGA 5E6SA 4DLNA 3R6TA 5BNIA 3FFAA 2HREA 1KQ3A 3IXLA 1TK3A 3U9TA 1X80B 3KB1A 1UUFA 3H9BA 2QN9A