1ORHA

Structure of the predominant protein arginine methyltransferase prmt1
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
318
structure length
318
Chain Sequence
FDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYQSMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Predominant Protein Arginine Methyltransferase PRMT1 and Analysis of Its Binding to Substrate Peptides
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Protein arginine N-methyltransferase 1
total genus 91
structure length 318
sequence length 318
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2003-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 1orhA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1orhA01
3B3JA 5EIWA 4C07A 1KR5A 3T7TA 4BP1A 2P7HA 5FHRA 4RTKA 2GPYA 1X1AA 3BGVA 4RTSA 2PXXA 4M38A 3G2PA 2I62A 1JQDA 4XUEA 4QTUB 1N2XA 2YVLA 2PXCA 2OXTA 1TW3A 3V8VA 4PIPA 2PSSA 5DT2A 4DMGA 2BH2A 5KYGA 2QM3A 2G72A 4IKPA 4GBED 3RIEA 2B9EA 2Z6AA 3PB3A 1ORIA 2ZLBA 3FUUA 2IBTA 3MHTA 5KQRA 1NW6A 3C6KA 4MWZA 3NJRA 1XDZA 5EQJB 4HSGA 4QDJA 4QDKA 5ICGA 3G89A 2GS9A 4KVZA 1AQIA 1XVAA 1KIAA 3EVZA 2FCAA 3SVZA 5GIPE 3P2EA 4RTPA 2YXDA 2DULA 3G8BA 3MCZA 3O7WA 2FHPA 3QV2A 5FTWA 3UJ6A 5K0JA 2LD4A 1VP9A 3B3FA 5HIIA 3DMGA 2QRVA 4M36A 3P8ZA 3A7DA 3TKAA 5P8WA 2VDUE 1OR8A 5H02A 1VIDA 5EMMA 3B7PA 5HEKA 4AUKA 3MQ2A 3BUSA 3G2QA 3GRUA 3M6WA 5CM2Z 4X1OA 5E1OA 3E23A 3JWJA 3C6MA 4F85A 1G6Q1 1D2CA 3HVIA 2ZCJA 2ZIFA 4FP9A 2KW5A 3SSMA 1AQJA 2WK1A 3BT7A 5HZMA 2I6GA 3BWBA 3MB5A 5FULA 4P7GA 2AOUA 2ZBQA 4PYNA 3SSNA 1JG1A 3HP7A 1IY9A 3KQPA 3GWZA 1QZZA 3UJ8A 1JQEA 4MTLA 4X63A 4XUDA 2Y1WA 1D2HA 2PX2A 3TOSA 1HNNA 2XVMA 3VC1A 3EVBA 3CKKA 5GM1A 5K0CA 2QYOA 1V39A 4WVLA 1IM8A 2UYQA 3R6TA 5CVJA 5FWDA 1RJDA 5DM2A 2O57A 3THSA 3FUWA 3IYLW 4ZTBA 7MHTA 2YQZA 2ZZKA 1WXXA 3E7PA 5JR3A 2V74B 1KHHA 1ZGAA 3T0IA 4R8RA 5ICEA 1NE2A 2OB2A 1NT2A 2NP7A 3G2MA 1TPYA 4FT4A 3FRHA 1VQ1A 3ERCA 3E8SA 3AWIA 2EJTA 2ZIEA 1NW3A 3TQSA 2ZTHA 3OPNA 3QOXA 3KKZA 5DLYA 4PYKA 5CD1A 4E2WA 2XVAA 1HMYA 1R74A 1SQFA 2HMYB 3ANXA 4OX9Y 4YV0A 5EMJA 2NXJA 4RYLA 2B25A 3UA3A 2H11A 3OU7A 5BXYA 3KR2A 4HGZA 3P97A 5CVVA 1KP9A 5MHTA 4ATNA 3DLCA 2JH8A 4KW7A 2HWKA 3LKZA 5EHIA 2HTEA 3SMQA 2ZWAA 3EVCA 3GXOA 3JWHA 2IGTA 4V0QA 9MHTA 5DX0A 3FZGA 4YUYA 2OO3A 1JSXA 1JG3A 1Q0SA 5K0BA 3LSTA 2P1DA 3GU3A 3MTEA 2WA1A 1X1CA 4OA8A 3GRZA 2OY0A 5DTRA 3FPHA 5DRYA 2R6ZA 3O4FA 5K0GA 1WXWA 2P7IA 4DZRA 3DUWA 1YB2A 3HM2A 1YUBA 2JHAA 2AOUB 1WY7A 3S68A 2BM8A 1DCTA 1JSZA 1O9HA 5E8RA 1ZG3A 1KPIA 2DPMA 2OKCA 1NBHA 3IHTA 2VDWA 3LECA 4RV9A 2AVNA 3HCDA 3SX0A 1G55A 3KR0A 2HNKA 4DCGA 5ICCA 1P1CA 3SM3A 5DTQA 5LQKA 1EJ6A 4B17A 4EQZA 3FYCA 2P3QA 3FPJA 4GOMD 4PINA 3MAGA 3ELYA 2AOTB 5CVEA 2AN5A 3LL7A 5K0LA 4YV1A 5IKMA 4E30A 1BHJA 3UJCA 2GB4A 3G2OA 4M7RA 4P58A 3M6XA 1FP1D 3P2KA 3UZUA 2G8NA 2O0LA 2NXCA 3G88A 1L3BA 3GGDA 3KPYA 5CCXA 3DXZA 3NMUF 2AVDA 3UJAA 2P3OA 5K01A 2AOWA 4QPPA 2PJDA 1SUSA 1EQAA 1QAMA 5CUQA 4P7KA 2ONZA 2K4MA 1EAMA 3LCUA 4C05A 4GC9A 3KQTA 4X60A 4DA4A 4HG2A 1UWVA 3G8AA 3CJTA 2PX8A 4IV8A 3MGGA 2AOTA 5GWXA 2E5WA 3VC2A 2ZZMA 3A27A 2PX5A 3H2BA 3TMAA 2G70A 3HA3A 1MJFA 1ZQ9A 5F2KA 3SR4A 4RTLA 1QYRA 4LWOA 5IH3A 1NKVA 3HCCA 5K0FA 3KQWA 1WZNA 5FQNA 3TLJA 5HIKA 1XCJA 3ELUA 4RVGA 5GM2A 2OBFA 2ZWVA 3EEYA 2JHPA 5EZQA 5E9WA 1X1BA 4RX1A 4CXMA 2JH9A 3NTVA 5DSTA 1INLA 2FPOA 3GNLA 3HNRA 1Z3CA 4MIKA 5CCBA 4M37A 2CL5A 1R8YA 5EMKA 5DX8A 1AV6A 1NW7A 4YMHA 4YUWA 3EGVA 5FWAA 3EVAA 2G1PA 3EVGA 3CVOA 1KXZA 3P9KA 1FPQA 2EX4A 3EPPA 3OE5A 5HOQA 3NVKI 2FRXA 5C0OE 2UYCA 5DX1A 3LBFA 1R8XA 1G8AA 1SUIA 3F4KA 3I53A 4O29A 4PYQA 1SG9A 1SQGA 3FPFA 3DP7A 3BWYA 4E31A 4MQ4A 3DULA 3VSEA 2XYRA 4RTOA 3EGEA 5JUWA 2FYTA 4BLWA 4EK9A 1XDSA 3EVEA 1RI1A 3OFKA 2PVCA 2AN4A 4LWPA 3C3YA 3KR1A 5G02A 1Y8CA 3SGLA 3SXJA 5LQAA 3BGDA 1NV9A 3FTDA 1JTFA 4BLVA 2YXLA 4HC4A 1XTPA 2UYHA 1L9KA 2JG3A 1WS6A 3GDHA 2AR0A 4KDRA 2P40A 3KR9A 4YMGA 3B5IA 3G5LA 3KPUA 5T6BA 4NECA 5LR6A 4QQNA 4DKJA 5E2BA 3FTEA 3CGGA 3EVFA 4GOND 3NDJA 4PGHA 4BY9E 1FP2A 4KIFA 1H1DA 1QANA 4KDCA 2PXAA 2ORED 3CJQA 4PYLA 5HFJA 4EVIA 1N7JA 1EIZA 4GQBA 1YZHA 1BC5A 3NW9A 3EMDA 4XCXA 3RODA 3P9CA 4GF5A 2ZVJA 3IEIA 3OZSA 4ER0A 3BXOA 5K03A 1ORHA 1VP3A 1IXKA 3HVHA 3LDFA 3EVDA 3RW9A 1VLMA 5LQNA 4BP3A 4QTTB 3GRRA 5FA8A 2Z6UA 2N47A 3R24A 3FYDA 5EG5A 3ID6C 2CKDA 3T7SA 1P1BA 2YUIA 3MCTA 3MERA 4AZSA 2IDJA 1XXLA 4R05A 2G71A 2CWWA 4PWYA 4RVHA 3O31A 1F38A 2IFTA 3FUTA 4YUVA 4DF3A 4DM3A 3EGIA 5DSXA 5T64A 2GH1A 3OZTA 3KPJA 1NW8A 4PCLA 2QRVB 2UYOA 4YUXA 5E1DA 2XYQA 3B3GA 2IH4A 1PJZA 3L8DA 3ORHA 3I64A 5CIYA 3BWMA 5ICFA 3UJBA 2FK7A 4FR0A 3BWCA 4QVGA 5E9QA 5HIMA 1L1EA 3NVMB 3EEOA 1VBFA 1JTEA 1RI3A 2IPXA 3DMFA 3Q7EA 3OZRA 3TRKA 2NXNA 4POOA 3HVJA 4HTFA 2NXEA 4CKCA 3WSTA 2H1RA 1YZ3A 3ELWA 4HGYA 4RTRA 2ADMA 3A26A 3MTIA 4C04A 1XJ5A 1G8SA 4LG1A 4DQ0A 2C7RA 3A7EA 4OQDA 3PFHA 4FS8A 4E2YA 4IWNA 5E1BA 4EKIA 4HRAA 5F2NA 4C08A 3E05A 1M6EX 4C03A 5LQCA 4RWZA 1YF3A 3ER8A 1P91A 4E33A 5EVJA 2YTZA 3JWIA 2P35A 3G5TA 4KIGA 2QE6A 3DOUA 3GIWA 3UJ7A 2IP2A 5EKXA 4AZWA 4RTJA 3TM5A 1M0EA 2O05A 1DUSA 3DLIA 2EG5A 3B89A 10MHA 3G7UA 4FGZA 5GOZA 3I58A 1VE3A 2YR0A 1YFLA 1NBIA 2CMHA 1XDUA 3HA5A 4ISCA 5DWQA 5FADA 3HCEA 5HILA 5C1IA 2IBSA 4RTQA 2BR5A 3P2IA 3PT9A 5DRTA 3ER9A 2P3LA 1RJEA 4ER6A 1QAQA 2H00A 2OZVA 5M5BA 2FK8A 5EZSA 2C7OA 2EJUA 1R00A 2GLUA 4GOLD 5E8JA 4PCAA 1KPHA 4E2ZA 3KQQA 3PTAA 3R3HA 4RTMA 1RJFA 4QVKA 2ESRA 4BLUA 2C7PA 1NW5A 2IIPA 4RTNA 4V0RA 1I1NA 3HCAA 4OQEA 2F8LA 5D1NA 1O54A 5D1HA 2VDVE 5ERGB 2PWYA 1SKMA 2PY6A 2AS0A 3FUXA 5CVDA 4GEKA 1UFKA 4PYJA 5LQJA 2IH5A 3AY0A 4PYOA 3FPEA 3P9NA 1F3LA 4EKGA 3LGAA 5LQRA 2BZGA 4L7VA 2WA2A 2ZBPA 4HH4A 5CVUA 5KQSA 5EKUA 3LBYA 1SVUA 1O9GA 3AXSA 4C4AA 4X61A 3VYWA 2GAFA 5HIJA 1UIRA 4CKBA 2AOVA 3CJRA 3P9IA 5DM0A 1JQ3A 4A6EA 5GINE 3M70A 5EIFA 3UBTA 5FUBA 3KQSA 2B78A 2YXEA 3M33A 4KWCA 5FQOA 3DXYA 4AX8A 5C9ZA 2ZFUA 1VPTA 2PT9A 5EMLA 1KYWA 1KYZA 2ZIGA 4GUAA 1KPGA 1P39A 1ZKDA 2OPBA 3C0KA 4R6WA 5DM1A 3U81A 3M4XA 2PGXA 1ZHFA 3DTNA 2VZ9A 4FT2A 3A4TA 5EOVA 1N7IA 3BGIA 3LCCA 3M6UA 5DTMA 5EEGA 3LPMA 4RVDA 1RI4A 5FCDA 3REOA 4YUZA 1BKYA 3SSOA 2PT6A 1R18A 3HCBA 1DL5A 1EJ0A 3PFGA 4RVFA 4ER5A 5KVAA 1FJXA 4MHTA 1X19A 3KQMA 4P7FA 4FSDA 2PWPA 4ER3A 2A14A 4U7TB 3R0QA 5EEHA 2ZZNA 3LDUA 4IV0A 1Q0TA 2O06A 2NNWB 4QPNA 4PYMA 5DXJA 5E2AA 5B1SA 5KS2A 4FSXA 3AJDA 5BW5A 2V7EA 4RSRA 1L3CA 2ZSUA 3DR5A 1TW2A 4Y2HA 3HA7A 1WG8A 3GO4A 1B42A 3THRA 4C06A 3KQYA 4U7PB 3UWPA 4EMSA 3M6VA 4KRGA 5K0NA 1D2GA 5K05A 4HTFB 3TR6A 3UJDA 2C7QA 4CTJA 3TFWA 3R9XB 3T7RA 3I9FA 2B2CA 3IV6A 5LQUA 2CMGA 3CBGA 4YV2A 4R8SA 4DCMA 1VL5A 2PBFA 4PGGA 5EHGA 2PX4A 3KQVA 3CC8A 3Q87B 2ERCA 2P41A 3DH0A 2ZULA 4OBXA 5GIOE 5EPEA 5DPMA 2NYUA 4R6XA 3OU2A 2BR3A 2HV9A 3PX2A 1JR4A 5GP1A 3HVKA 3OU6A 3PX3A 2P8JA 4GC5A 4K6MA 1AF7A 3GCZA 3CCFA 1R6AA 3NDIA 3UJ9A 2JJQA 3OCJA 3D2LA 3DXXA 1M6YA 3EMBA 3PS9A 5BP7A 5T67A 3FTFA 4PIMA 3BZBA 4G56A 2OB1A 2O07A 2PV0A 1NV8A 1G60A 2Y1XA 3C3PA 4P7JA 4PNEA 1G38A 1JG2A 3KU1A 4XUCA 2ZW9A 5LSAA 3LHDA 4H0NA 4Z2YA 5K09A 3GRYA 4CKEA 5U4XA 2HR1A 2EFJA 5K0EA 2VP3A 3FRIA 4ER7A 3GRVA 2XBMA 4AZVA 2QY6A 3BKXA 4X41A 3ME5A 3LX6A 3BKWA 3HCFA 1EG2A 4E32A 2XYVA 2NP6A 4QQKA 4JXJA 8MHTA 3OE4A 3DMHA 1RJGA 5DXAA 4Y30A 2R3SA 4F84A 3HEMA 3UFBA 3QOWA 5FHQA 1ZGJA 2IDKA 3LCVB 3PLAE 3I5UA 3KPWA 1YFJA 3FPGA 3KQOA 3P71T 5E9JA 5E1MA 2BM9A 1FBNA 3JWGA 4GOOD 4OA5A 2OYRA 3K0BA 4AZTA 4CWAA 1L3IA 3KHKA 3X0DA 2JHCA 4A6DA 4WXHA 5FA5A 4E2XA 2GA9A 4LECA 5K8VA 3NWBA 2IH2A 3HTXA 3TM4A 3PVCA 2Z6QA 2BR4A 1BOOA 2AN3A 4FZVA 4E70A 3LKDA 1RI5A 3AXTA 4OBWA 3UA4A 1RI2A 4CTKA 2ZBRA 5BW4A 3FTCA 2Q41A 1MHTA 5EC8A 2I9KA 1I4WA 2VS1A 2PLWA 2I7CA 1QAOA 2AZTA 2PKWA 3TPZA 1U2ZA 4UOEA 5EGSA 1JG4A 2ONYA 3FUVA 4PONA 2UZ4A 1I9GA 2AOXA 1X1DA 2YX1A 3NWEA 1PRYA 2B3TA 5DM4A 3LDGA 3TKYA 1XCLA 4PYIA 5F2OA 3GJYA 3A25A 3ELDA 3V97A 4F86A 3OFJA 3KPVA 3K6RA 1T43A
chains in the Genus database with same CATH superfamily
3BWVA 1CJCA 1WY5A 1YDWA 3OUZA 4RW0A 1JWAB 2I2DA 1GSOA 4AJHA 4PPFA 4EYEA 3IE2A 3IEXA 4IDBA 4B43A 2XRFA 2YWRA 4LVCA 1L8AA 5J2UB 4KNWA 4D02A 3A1FA 1T29A 3TINA 4BBAA 2PXXA 4IXMA 2G07A 4JWKA 4S24A 5KKNB 4GLJA 1XRNA 5JAQA 4EKNB 2JI9A 2PMFA 2XDAA 3AEXA 4OQMA 4GH5A 4CV2A 1CY8A 1Y3CE 1HDRA 1QONA 4RHYA 1OFUX 2UVQA 4Q4CA 3V7YA 2RHGB 2EFYA 3SDBA 3C5VA 3CS3A 1BE1A 4HAZA 2D54A 1YVDA 2ZLBA 3IH5A 3N3BC 3C7CB 3QU7A 4QU9A 3ZV6A 1BMFD 1XU4A 1L8LA 1MDBA 2EEPA 1L4HA 2DMRA 2ENWA 5EQJB 3RIHA 3UUFA 5AW2A 1V9CA 2FSVA 2GCOB 3ZV4A 3O4HA 1R4ZA 5ABPA 2Q7OE 3SC3A 3SVZA 4E12A 1PWYE 1L5GB 2NW6A 2HA6A 3OTOB 3TNDA 5IU6A 4OKIA 2FHPA 3UJ6A 5KJFA 1BX1A 3RSLA 4CQLA 5HIIA 4PGMA 4X20A 3F6SA 1MG0A 2JGEA 5E3HA 1B43A 4DYHA 1DIBA 5JNLA 3THYA 4UPDA 1KK1A 1COWA 2G9UA 2YY5A 3D8SA 4AUKA 3M1AA 5FBQB 4L5YA 3CVJA 1UK9A 4Q0MA 3EXEA 5BWBA 1VJ1A 1VBMA 4F85A 2KW5A 2NPIA 1Q50A 4YAWA 3JVDA 1QOPB 1YRWA 5JZSA 3CKMA 1R9NA 3IT3A 1XRLA 4M6WB 1SC9A 1WCYA 1W4BA 3EUAA 3O3OB 3JQAD 4YWJA 4E4RA 2E4ZA 3TQIA 5GM1A 4H7KA 4O59O 1FTGA 1X3LA 1RRPA 1W0JA 2WABA 3W2IA 3WJ7A 3I3SR 3KYIB 3LYHA 2GCPA 3HUUA 3OJLA 4N0DA 4RHTA 4XLZA 5EE5B 3ZWOA 4C4OA 1TO2E 2IEDA 3IYLW 4CKBB 4D82A 3RUHA 4TV8A 1W46A 4HY3A 1BMFA 1VMIA 1NE2A 3VHRA 2JJ1D 5L4SA 6LDHA 1M75A 4H7PA 5BOSA 3H2IA 4BTLA 3BB1A 4QNRA 4DPKA 1P9WA 4FD2A 2XCTB 2YZ7A 3FOEC 3ITDA 5FWYA 1SUAA 4PYKA 3TD2A 4D1YA 5FUQA 2OO5C 2HK7A 1MOQA 3JVVA 2XXJA 1JHDA 2YV2A 4FMPA 5DNUA 1U2PA 3ANXA 1IHUA 2AFRA 4RH0A 4AF8A 4YIKA 3D6JA 5IT4A 3MN1A 4WHMA 1UR5A 1JIUA 2AG1A 1E5LA 4DA6A 3WV4A 5K4HA 1HKUA 1XLUA 2G08A 2VDQB 3AFMA 4Q3LA 1AZLA 1ZK1A 3P9SA 4HNSA 4DCTA 9MHTA 4UC0A 3ZWCA 5JSYA 1JF8A 4TT3D 4XASA 4MUMA 4JLKA 1CB7A 1XYVA 3LSTA 4OQ4A 4FZJA 3L4JA 1R16A 3EVNA 1QV9A 4Q19A 2IHBA 2WI8A 1F1JA 4HDMA 3KQHA 3W1EA 1V3QE 2J5RA 3O4FA 4UMVA 4NWIA 2P7IA 4RVUA 4AUMA 4DZRA 4FMCF 1N0VC 4I3GA 1HE8B 2HN9A 4LFAB 4Q9DA 2AOUB 2ZBFA 3CISA 4L8VA 3IQWA 1S2DA 4DDWA 5E8RA 4AMGA 2DUUA 7ABPA 3JZDA 5A7GA 4N5NA 3USES 2C2MA 4C87A 1MB0A 2XUOA 3G1WA 3CM0A 3LPAA 1WZUA 3GQVA 3HXOA 1I51A 1YQEA 3AUYA 4CM5A 5H5JA 4DT1A 2P3QA 1I3NA 4OFBA 3VXKA 1Y3AA 5AIBA 5CLLA 3KEFA 3S5UA 4WUVA 2Q49A 2VUHB 2CFIA 4N39A 1F2VA 2ODNA 4MMZB 3EPKA 5CYGA 1Z38A 1CDOA 4RGYA 3WGTA 2RG1A 4RQUA 1UL1X 3BE8A 4BJ5A 4HMPA 2ZR8A 4UUBA 3CUEF 3DBOB 4DEVA 4LPSA 4UBNA 3UJAA 2HU8A 4LJLA 3WIOA 3O2QB 1UZUA 1HQKA 3NDPA 1TUBA 3EY4A 4MP3A 1MT0A 1OYVA 2ONZA 3E35A 4EJ6A 1YA8A 3WB9A 4GC9A 4RD2A 4BNGA 3GC6A 1A5TA 2FZCA 4ZD6A 4QGGA 3MAJA 2HHLA 5FF9A 1XAJA 1ZH2A 3A27A 3NBFA 2B34A 1PO7A 3HA3A 4FZRA 1K5DA 4PTYA 5EJIA 3INGA 3LC1O 3MCUA 4KLAA 3HLYA 2AFVA 3BD6A 2L0XA 2F4VB 1DAEA 3D7KA 2PIDA 4J3FA 2XMGA 3CTPA 1E98A 4C2UA 3J7TA 1ZINA 2JHPA 4B82A 1LI7A 5BNZA 4MIKA 1VPWA 5CCBA 1NVEA 1GZ6A 3NYIA 4LVUA 3DTYA 1OLXB 2VRCD 2M6LA 4ZK6A 5IM4A 4BFWA 4YUWA 1MN6A 3HVUA 2VH5R 4YQYA 3SS8A 4DIEA 1R10A 3MWKA 4H60A 4X71A 4TM8A 4GKBA 2ATXA 4XJVA 2PD4A 4BBZA 4C76A 2P69A 2NTEA 2XUPA 4PR3A 2C3MA 3SEAA 4Q00A 1R8XA 3X3HA 3L6RA 1YL5A 2JGLA 2JVKA 2P4EA 4LNHA 1VMKA 2B5OA 1VYHA 3EARA 1E5DA 1TD9A 2DQYA 3OA0A 4UBOA 2X58A 3A3PA 2VYCA 3IEVA 1Z34A 1YS2X 4FFBA 1U0OC 4M60A 3QVVA 3DT8A 1XTVA 3TNFA 3F4BA 4I50F 5FA6A 4EG5A 3X2SA 2IDZA 4MB6A 1Q7EA 2Z56A 4CIDA 1SIBE 3AF1A 4FHDA 4U9HS 3V46A 5A4IS 3F3KA 1E32A 4DARA 5KNBD 5LMNB 4K9QA 1L5RA 1E2FA 5AOAA 1LCIA 2M6RA 1YACA 2ZYTX 4WV3A 2QP9X 3TIXB 2JG3A 4XM2A 1N33B 3G82C 3RSHA 4UZFA 3IDFA 3K5PA 3LA6A 1ES9A 4ICIA 2GM4A 3O75A 3V4VB 2C82A 3RU9A 3B60A 1PTJC 3QVSA 4XX1A 5FFMA 1GPKA 3MS4A 2YOHA 4E46A 3GZNB 4PYLA 5EKDA 2Q8NA 4H7HA 1TO6A 4MW0A 2KM1A 1EIZA 3MELA 2F3UA 3EMDA 1OB2A 2AC2A 3BTSA 3L4SO 1M2FA 4TTIA 3KLOA 3ASZA 4BGVA 4EEXA 4LKOA 1E9SA 3DYVA 2R751 2B0JA 3H1BA 5EIHA 4YUVA 1D6JA 5DHUA 3CRNA 5ESXA 1ZUHA 2H5JA 2R1VB 3L7IA 2CW5A 3JD3A 4HPJB 3IVGA 3OZTA 3HB1A 1IJKA 4W5RA 2H2HA 2PUGA 4Q4JA 3B3GA 4JKYA 3HVRA 5DK4A 5EP4A 4WY8A 2WB2A 3CCCA 5ICFA 2Q1UA 5JI2E 3B70A 4QPJC 2I2WA 3TW8B 3UAXA 4BRZA 4D4KA 1DX4A 1BJRE 1RT9A 3CX3A 3VNSA 3SQWA 2V45A 3AINA 4D44A 3KB8A 2Z08A 1XO1A 1OB5A 5IF9A 1CRWG 3D8NA 4WOBA 2VSFA 1TAUA 1JAZA 1VSVA 4LG1A 1T5OA 1GNTA 3H0KA 3LV8A 2GBLA 1CB0A 3KSDO 1J09A 5IEBA 2C29D 4JDUA 3RIMA 1GKLA 3UH1A 4GPD1 5HQTA 3COJA 3D02A 3JVUA 5LQCA 4OAOA 1FXWA 3TIFA 4AYXA 1C7EA 3ZLVA 2YTZA 4QHYA 2C9BA 3VTKA 3HHPA 3ZY3A 1NM5C 1O94C 2YV5A 3I6BA 4FXOA 4II7A 1X3SA 1ZGZA 4O4LB 5KBYA 3GB9A 3IC5A 3NV9A 1Q20A 3G7UA 1HZZA 2RB4A 3LZ6A 4KQHA 2XCRB 2WSLA 3RVBA 4F56A 1G8KA 3VVMA 4LF6B 2RHLA 5C7OO 1AG9A 2ZSBA 3NKVA 2BR5A 2WYHA 3F4LA 2J6IA 3MXTA 2VG8A 2GYVA 4M88A 2XTMA 5DI3A 2P3LA 3ER9A 3ESXA 3WC4A 3GCDA 4E51A 2PRJA 4H6WA 4FFLA 2J9ZB 2VZLA 2F1JA 3WB2A 1TYEB 1LI4A 4X1YA 5EP1A 1VCMA 1VL2A 2EQAA 3PUXA 2QPTA 5LXTA 4FKZA 5B6PA 3E70C 1C8KA 4PAMA 4N6GA 1JVBA 1DQPA 4IOKA 3EIEA 1GZUA 5CVDA 3VAYA 3WLHA 5JBIA 4UQPA 1F3LA 1ML3A 1R8QA 4OQXA 4P0TA 1C1YA 4P4LA 4YTEA 3TIVA 2C5AA 3ZD8A 1PD0A 1MVNA 1SQ0A 2BHRA 2R6FA 1JZQA 2AZXA 2VNIA 3OT4A 4BLRA 2GERA 5DEIA 5CFLA 3BFKA 1E1RA 3OEWA 4POAA 4Z8XA 4B83A 1Q83A 4S0ZA 4GBMA 3WNVA 4B09A 1Z4MA 3GI1A 1FTQA 5IX8A 1ZD9A 2WD8A 5TC4A 1M2WA 3BJMA 4BVAA 2QAGC 1OWOA 1OBHA 1Z4LA 2PG3A 3CNOA 3ZBUA 2O1XA 4G0NA 1U11A 1X7GA 5AOBA 2ZBGA 4A8TA 5JVDA 4D9MA 2YWEA 4PBTA 3BCHA 4D8VA 1B15A 4N7RA 2PGXA 2TS1A 3LVFO 5GQSA 5CFQA 2QRUA 1BG6A 5IM4F 5DP1A 1PL0A 3RJTA 4S05A 2FEKA 2Q45A 1A9SA 4Q12A 2G4CA 4B3SB 4BEJA 4RM3A 4EARA 3OZGA 2B1RA 1NUTA 3ML1A 5EKTA 2GN1A 2HLDD 1HUQA 2VJCA 1Z83A 2FX2A 2QN8A 5DHQA 5EJFA 3WADA 2WKQA 1VHJA 4ER3A 4AF7A 2C96A 1NSTA 1UINA 4B74A 3MD9A 1L0BA 1WPQA 5IVIA 5C7LO 4L08A 1SMKA 2RGNA 4OM8A 3II6X 3MQ4A 5J59A 3FCYA 2A5YB 4B17A 5GGXA 1N92A 5EESA 4EHHA 4C4ZA 1PS9A 2H2GA 3N07A 4E13A 5JYCA 3QUTA 4NZOA 2R47A 1MHPA 1OGIA 3SE0A 2P9YA 2J48A 5ANRB 4C06A 1F6DA 2QL9A 3UWPA 4Z1MD 4GT1A 8GPBA 5AVWA 3KQKA 1W75A 1K6XA 5FAKA 2GBLC 1RWKA 3B6JA 1WUHS 3T7RA 4B33A 1GSIA 3DDWA 3OPYI 4XQGA 2XVXA 3IIKA 1ID8A 4AJIA 5EYPB 2A9JA 5TQVA 4Z2AA 4DLNA 1WLSA 1HA3A 1II9A 1JFRA 1SCIA 3JQAB 4L4SA 4FZ5A 2GK6A 2DBVO 1RRGA 2REQB 3EZ2A 4YLEA 1WTAA 2EP5A 1P72A 3PXBA 1T8WA 4LCEA 3AHHA 1TD1A 3CH6A 5F4BA 2PEZA 3VI3B 2CJYA 4PHCA 5ITWA 3NDIA 1BX0A 1GZ5A 3GT3A 4PYRA 5F1YA 3WP1B 1HZZC 4K1XA 4DLBA 4J49A 2RG7A 3HB9A 5EE1A 3PS9A 4AP9A 4DLZA 3FGNA 3I6IA 1J6UA 1P5FA 4YAKA 3TUIC 3V4ZA 3WGUA 2GO7A 4MI1A 2Z1NA 3GPIA 4PN7A 1RAEA 3PF8A 1X77A 3CURA 4E08A 1EFUA 2AZDA 1SPXA 1ECCA 2DTDA 3D8TA 2FRDC 4D46A 2X2FA 1RJGA 4W8HA 4Z8YA 2O0KA 2R3SA 2QTTA 2VHYA 2ZSIA 4MAMA 4FMCB 4RMHA 1M9NA 2ZSEA 3PNOA 2YQ4A 2ZJAA 1FBTA 1TFRA 3LCVB 4FWBA 4MB2A 4RAQA 5HFAA 2X4LA 4KPEC 1G8PA 2VWQA 1Z6TA 3TZCA 4FILA 4FDVA 3EOBI 4OLAA 3MD0A 5AK5A 1ZO8A 3SE7A 2EWMA 1NHGA 2JFQA 5K6AA 2IH2A 2L17A 1JPJA 2J31A 4LHYA 1RYHA 2I22A 2X7HA 4N8SA 4W9RA 5IYZA 4LBWA 3L8GA 4DLYA 1E3LA 1CV2A 4FGUA 1Q12A 1LF0A 3F96A 4Q7KA 4RXMA 4XKJA 4HVLA 1GITA 2DGDA 4UCWA 3DAHA 4JFRA 5JO9A 1EM8A 5BXQC 1X1SA 2V55B 4KLCA 4HWPA 2H29A 3O95A 1US8B 4MQUA 4UBIA 1JJIA 3MCVA 5EC8A 1C4OA 3G1UA 1M2HA 4AW9A 2BH9A 3TX6A 1HTBA 4A16A 2NU7B 4UDNA 1GU1A 4ZI7B 3N86A 2OPHA 2OHXA 1CY7A 1ADFA 3TKYA 3ZVMA 1P61B 2CCGA 3GEPA 3NOXA 3K0SA 3GRAA 3IOBA 1R4NB 2D2IA 2V7GA 2JLUA 1I7QB 1DPGA 1OWNA 4EVQA 1MT3A 1UDRA 4BYGA 1MO2A 2X9NA 1FVOA 2XOKA 2FG7C 4C07A 3CWQA 4JT8A 1KR5A 1I0ZA 3L0CA 1UP4A 2P7HA 1NFQA 4ZVUA 3T34A 2EWWA 5JXJA 4ROSA 3T1OA 1U8TA 4JJAA 5FBWB 2O2SA 4XFKA 3QBJA 4XD2A 1N2XA 1KZYC 2P4SA 4BHTA 1BWRA 1G4AE 1LBEA 4LF7B 3U48A 2VRNA 3VSAA 1T5SA 3R6DA 5I4IA 2VYND 4L5CA 3CUVA 4NFYA 1U0NA 4L27A 1E1LA 1QQTA 2J9FA 1ZU4A 2FR8C 1NW6A 3A05A 4CLOB 3MINB 3ZLJA 3FVVA 1H66A 3WGMA 3HQ4O 3FHTA 1WTCA 2H5EA 3T7IA 2Z57A 3W9YA 4WNAA 3RIXA 4IX9A 2JB9A 2QTMA 1FU7A 1MA0A 3P2EA 4KV9A 4N0MA 3TS1A 3PHBE 4CE6A 4OD0A 4UD6A 4C6SA 2GCEA 2MSLA 1P1RA 5HM6A 4CMEC 3EWNA 1GA4A 1Q2UA 4M0LA 1IG3A 1OSNA 5IARA 1ZOPA 1DB3A 4JJ4A 3RYCA 3H1TA 3IPYA 1KO5A 3TTYA 2C57A 3F8WA 4BQQA 3QWAA 1E3WB 2Z98A 5GONA 4AXBA 3DTVA 4KIWA 4RM2A 5ALTA 2V65A 1GZ4A 5KAPA 3DMDA 3WBBA 4YP0A 5DCLA 3LJKA 4MS1A 2JIQA 4JUDX 3FNBA 2E7ZA 3PQ2A 4G0UA 4CEIB 4TTAA 3UWDA 2BFNA 3NBYC 3SSMA 1CUDA 3DW3X 2EBWA 5HZMA 1XLVA 4UMDA 3FFAA 5AR1A 1KHTA 5AVUA 2P0YA 1FX0A 1I1QB 3MTQA 1U5CA 3QJGA 4JYAB 1XTSA 3CPHA 4K9DA 5ALOA 1HSOA 1XMIA 1RRKA 4JEIA 1EWQA 3SG0A 1TU0A 1EVJA 1EMDA 3RVPA 3AJRA 4ALIA 4DJAA 3H2ZA 1UKZA 1M2OB 3EVBA 3G8CA 4DAOA 4CMKA 4Z4EA 3NUZA 3VVLA 1V39A 4LW8A 4ZU6X 1O3YA 3FWHA 3PD0A 1IN4A 3BWEA 5BO5A 4M1ZA 4F6CA 7REQA 1EAYA 3NIBA 2GXQA 2YQZA 3GEIA 3I0MA 2OHVA 2HCJB 5F1OA 5JR3A 1M5RA 2J4DA 1ML4A 1QS0B 3M6IA 2J0QA 2HZBA 3P0EA 4DR1B 4QC2A 4CEIA 1FNCA 2X86A 5CXSA 5DASA 2OGZA 3E8SA 3AWIA 4LXXA 5DM60 1RTKA 5KU1A 5LJLA 1RBMA 4S0XA 2PUCA 2ZTHA 1DOAA 2OT3B 1A9QA 2PT7A 3OX2A 4XQ0A 2PGOA 4KPYA 2WD7A 2IEYA 4E2WA 2GJ9A 4E1VA 1SQFA 3O3MB 1U2EA 3U19A 2R7AA 1CPYA 4G1FA 1WBJB 1WL8A 2I7DA 3UA3A 2VJPA 4WOKA 5T8KA 4I50B 4PHFA 1JYFA 2IYYA 1YGYA 4JXKA 5CVVA 4BCBA 1Y4DE 3A9RA 3MG9A 4CHTA 3K05A 2HBZA 5T57A 2JH8A 2EZ8A 2HWKA 4KW7A 3ZVKA 3FSGA 1D7AA 1E61A 2BV3A 2BEVB 2QQEA 4FDAA 4D9FA 2V8OA 3HBFA 1Z8NA 4ACAA 3G2LA 5FUYA 2JRLA 4YRIA 3S28A 4DSOA 4NXMB 2VEOA 1HXHA 3GU3A 3UUWA 4OJYA 3VYTB 5CA0F 2EZ4A 1O8BA 3GRZA 4BATA 3IUMA 1IVYA 3A37A 4B40A 2E4YA 1H85A 4EL0A 1P2GA 1WXWA 2E4UA 2Z3ZA 4KPUB 3EIQA 1CU1A 1W2HA 2NYRA 3R8CA 4OQFA 3BMQB 1PFYA 5EP2A 4BKMA 3VU9B 1BKDR 1F7VA 2HMSA 3L6CA 3ZK9A 4QPCA 5K3SA 3RRZA 2OD7A 3TDKA 3EGWA 1FUIA 1CVLA 1GOTA 5EWJB 3PHHA 2WJVA 3PQFA 4YXWA 5GONB 3T7DA 2ZUBA 2RE8A 1IH8A 2GBFA 1UMDA 2CDAA 3VOSA 4AJEA 1J2TA 1T5DX 1TJ4A 2DR3A 2EDAA 2VHCA 3E0XA 3ND6A 4JBYA 4UTXA 1JXQA 3WHLA 4DMRA 2VHVA 3QE0A 1N7GA 1Z37A 4N3NA 1TEHA 2EQBA 4WEOA 1DZ3A 3PNPA 1JI0A 3PF9A 1BWPA 3DJFA 1Z5ZA 1PUJA 1KI4A 3GCWA 4WJKB 3GGDA 1NI5A 1V0JA 1WUIS 3PA8A 1MC1A 3O91A 2J33A 4E88A 1OBOA 2I7XA 2R5WA 4MQFA 2HO4A 4NMLA 4WXMA 5C8XA 3QE9Y 4AKIA 1H2YA 4CMEA 2FW7A 1BFUA 3CU5A 1QIIA 3SXPA 4S04A 2VK8A 4UNPA 2GF0A 1ZGGA 3FWZA 2RCNA 2UZ0A 4C05A 1IWOA 1I13A 1ZEMA 4G67A 5JQGA 4Z4QA 4NCAA 1N2CB 1L5MA 1QFYA 2V7WA 4HHEA 3V7FA 4ZHSA 5BMVA 4MYCA 2O50A 2I1VB 1WDWB 4Q16A 5KYYB 5IAJA 1NKVA 5JECA 1E4YA 2AFIA 2PZMA 2WTMA 3KQWA 5F9HA 3OF3A 2E9SA 1ZI8A 1GV1A 2OFWA 1TCCA 4FNAA 3IMFA 2HSGA 3OT1B 2ZQ5A 3P19A 2E48A 1XMQB 3A3YA 4XGRA 1LDYA 2H4YA 1SXGA 1CIPA 4B6PA 1A72A 3EFOA 3HJAA 4HQRA 3IELA 1ZCFA 3A58B 1V7QA 2CE2X 4O63O 2RHWA 3P32A 4EENA 3A9VA 2H9AA 2W6ZA 4MXDA 3EXIA 4FDMA 5I7HA 2EZTA 3NVKI 1GTJ1 2ERYA 2ODBA 1VLHA 2FRXA 4ZPJA 3VUFA 5DX1A 5KX5B 2FV8A 1VG9B 1IPHA 3E9EA 4R2XA 5YASA 5BV8A 1UQRA 1F9EA 3I28A 2XB4A 1FCJA 3NHJA 3RRXA 1NLMA 4DY4A 3EZ6A 3I01M 4KO2S 4AYTA 2NVOA 4EFNA 4RTOA 1NM5A 1LEHA 1O94A 2YIVX 1ULSA 4UUPA 4GSLA 5AVKA 3M81A 4CKCB 2A9FA 3AERA 4L8FA 1X42A 2CNOA 4ZVLA 2G4LA 2V6FA 1RSZA 5KYUA 1V6CA 3AZOA 1P60A 2X42A 4FC7A 1EFTA 4Z0HO 3SGLA 4HT3B 1ZH8A 3DUFB 1NVUQ 2X4GA 1VIMA 1G9SA 2BF4A 3O90A 3ONDA 1I9CA 5KDOA 5KKCA 1F1BA 3LIIA 5ICMA 1I3MA 1NNEA 2J3HA 1O97D 1L9KA 2WT9A 3AGPA 3L6EA 4FYIA 1WS6A 3WWYA 3L7LA 3AL0C 2A0FA 2Z95A 1SN7A 2AHOA 1Z63A 4KR3A 2CNWD 1VPDA 2ZJ5A 3NDJA 4FE7A 5JAOA 2F3TA 3BE6A 3P4XA 2OMEA 2PXAA 2NUTB 2R44A 2Y67A 3PBKA 4G0MA 4RK0A 5HFJA 3WLJA 4CEHA 2V5VA 1M6HA 3NW9A 3RS8A 3P4YA 3CLSD 1DXYA 1LX7A 1RXVA 2ZVJA 1S3FA 5E6RA 5EIXA 1CQJB 1WU8A 3DQZA 1KSHA 6ADHA 4EGQA 2CVOA 4RETA 4WFIA 3VKFA 3A3OA 3T7SA 1P1BA 2OCDA 4O2AA 3UO8B 1FP4B 1GPBA 1HLGA 1N9GA 1OFGA 1ZM7A 4HLNA 1X86B 3ZHOA 5ADWA 4PWYA 2IFTA 4NEGA 5FO1A 2JLZA 2P5YA 4UUAA 3DEFA 1OA1A 1MKYA 5CA1B 4PCLA 1G20B 4BTEA 2IH4A 4Z0TA 2JCSA 3W3AH 2XYQA 3Q2KA 4CM4B 3FOAA 2WT4A 3UJBA 5C8VA 1KBOA 3BMNB 3BWCA 4JL8A 2E89A 3VISA 2VZEA 5DYTA 3OZDA 5DP2A 2OXEA 3NU1A 1ODLA 1Z8FA 2COEA 3CR8A 3DZDA 4ZRNA 1LB1B 1KWGA 3F8SA 1V3TA 4F93B 2C5GA 2ZWIA 2ZYIA 3STTA 3DMYA 1CJBA 4AWAA 4LYGA 4DQ0A 2VWHA 3MJRA 4MI6A 3T5PA 4IZ6A 5K0SA 5CH3A 1D09A 2PRYA 5CT9A 5JDCC 5C8DA 1CR0A 1NPYA 4J7UA 2ZDGA 3ER8A 3I04M 4DWJA 3QKRB 2W58A 1HQCA 5FFNA 1B93A 1G8GA 4ND4A 4CDGA 3COVA 4DREA 3TSYA 3PUYA 1U1CA 1D03A 3OQIA 4JI2B 3FROA 3QU5A 4UFPA 5C81A 5AVQA 3B2EA 4K28A 2CUKA 1T3LA 2CMDA 2D7CA 3KUKA 3NEYA 2HBQA 1LNSA 1D6MA 1OTYA 3KWLA 4M7PA 1XTTA 4OK3A 4QQ8A 5GJVC 3RS2A 5AKIA 4MEAA 1RKXA 3SKYA 4F45A 1E2GA 2JPDA 4ISCA 1KK3A 4B32A 5J1SB 4F8EA 3CLUD 2VPPA 3NHWA 2VA8A 1X8XA 2VH1A 1SHJA 1RACA 4H17A 5ED0A 1FTNA 1DHRA 1QHHA 3CIOA 3Q6NA 4UW9A 3K92A 1H6CA 1RYEA 3VDRA 3WFIA 1YOVB 2ZT5A 2Z43A 3EULA 3EBOA 2C1ZA 2HFJA 3H87A 3MWJA 1EXWA 2G0AA 5PGMA 1NW5A 3MLAA 1N34B 1MAWA 4ZV4A 2A0XA 2PGJA 1I1NA 1TC2A 1O54A 1ZLXA 2OO5A 2JFZA 2P8SA 4WBXC 3IDAA 4R7GA 3RGWS 3FUXA 3ND8A 2O7NA 3NHMA 1XEXB 5DO9A 2IP1A 4O4IF 5K7SA 4NPAA 3SFZA 2VRBA 2YVKA 4GWGA 1EP3B 3T3EA 3MNFA 2V7UA 1I10A 2V4MA 3K2QA 2KQUA 4I55F 2WA2A 3R9KA 5JQGF 3AFOA 4FHCA 5TY0A 3MMSA 5DJ5A 4TMZA 1YDFA 4RSMA 1KQOA 1JPVA 1T1EA 2BDEA 3C8UA 1O87A 4U3JB 3PNBA 1VSQA 5DM0A 1JQ3A 2PO7A 3RSOA 3IUNA 3E9RA 4YUAA 1Q11A 5FUBA 5EE3A 3UENA 3TN7A 4JEUA 3GLHB 5EUMA 4WCDA 1ORDA 1C7ZA 4BFVA 4OQYA 2QVYX 1X7XB 2IYPA 3NRBA 1E4EB 2Z8YM 1M2KA 2N0SA 3KUCA 2JANA 1W44A 3VUEA 4MKFA 4D9KA 3LK6A 4LXGA 3KXKA 5A9SB 5IDYA 4CODB 2QX6A 3OZUA 5JNRA 3Q8WA 5BR7A 4RVFA 1HO3A 4HWRA 4CQMA 5F33A 4MHTA 5KWSA 3KALA 3GDOA 4FSDA 1TC1A 4RPCA 2MSNA 4OJNA 4WJLA 1I7LA 2R1VA 3WLRA 2ZZNA 3LDUA 4Y7DA 4OJKA 1N6HA 1W581 1QU3A 5D3ZA 4DSAA 3WHKA 2BRUC 4QPNA 4D97A 3EBPA 3ETJA 2OBNA 2WYWA 3TYXA 3GN2A 1S8FA 4X7RA 1JWBB 4TQUS 2X23A 5CX1A 2UUCB 1YVRA 1TW2A 4CTNA 2PYDA 1GQYA 2H2WA 4PSUA 2PU7A 4HLUA 2LGJA 2XNJA 1T3ZA 2HIGA 1C9EA 3ZHBA 1XMXA 3LWZA 2M98A 4D5EA 3RVJA 1PFUA 2Q5JA 1O95C 3VNVA 2IPOA 3CO5A 4D6PA 4BRSA 3AESB 3CBGA 2Y71A 3F6RA 3UXMA 3PDUA 3FGPA 1YCGA 3NHUA 4DSTA 5J4VA 3LDAA 2FPUA 3D3QA 1RKUA 1ZKMA 2AZ4A 4Q3AA 3FCAA 2P8JA 5AVRA 5J4YA 5B1HA 4IDGA 1HQYE 1AGPA 3HEAA 3NRCA 2V97A 4LSWA 5CT4A 4DPLA 5HZHA 3KSBC 3MMPA 1M8PA 1EP1B 1M6YA 4PLHA 3ZKAA 2AFHB 5T67A 4GPEA 2ORVA 4KQ9A 5GY7A 2BFBA 4P7JA 2FSUA 1GFZA 3TE6A 2ZW9A 1ZGHA 5K09A 3ZNPA 2EFJA 5B37A 1HK7A 3CH5A 3P0JA 4I6GA 3W2TA 3LTNC 4RS4A 3LUDA 1PZHA 3WLQA 4FSHA 5C51B 2UZ1B 4PWZA 2FPKA 3FMPB 4MI3A 1SUPA 3GN1A 3ODPA 5IDQA 1XKLA 4GBGA 4RF3A 1VXOA 5I4CA 3RBZA 1UXKA 3UFBA 2HQRA 5A2QA 1ISGA 3CUSA 3VRHA 1V37A 3FHLA 3PNQA 2Z2YA 2ORIA 2BM9A 4CWAA 4P5EA 1ZD5A 5IVHA 4JUBA 3TQHA 5FA5A 3FCUB 1DJOA 4LECA 3VMFA 4DOMA 1M1XB 4NR0A 1ZSVA 5FYQA 2HMVA 3RSQA 2Z6QA 1CQJA 3K1YA 1JMYA 1Z8DA 1ZCZA 1O0BA 3FDZB 1HLFA 3ORFA 3E8XA 4TWAA 4KYIB 3H1FA 1GQ2A 3ZU3A 2PZBA 5AVXA 1H23A 1RADA 5ENVA 2P0EA 2ZBRA 1RBYA 4MQEA 4AWXA 4N8DA 3FR8A 5LL6P 1IIRA 2GD1O 1KSJA 3L92A 3EQ7A 2PUWA 3IVRA 4DLRA 3CN9A 4BQIA 3WIBA 3FF4A 3I9V1 4WGFA 2LCQA 2Q27A 2FUCA 5EGSA 4QJBA 2ONYA 2PNJA 4BV2A 4PONA 5I48A 2XMRA 4FE4A 2AOXA 3RUIA 3ADCA 4FFDA 2B3TA 5CLIA 4G23A 2F17A 1VDZA 4F1KA 4P84A 2Q6VA 2UXDB 3ZTTA 1Y82A 3V97A 3AUFA 3TQQA 4XUGB 3VPXA 4B3CA 3GZTB 5JSKA 1JTVA 4FD3A 4II2A 1A4IA 5BRAA 2CSUA 3EA4A 1WHSB 2GK3A 3GLQA 1NBWB 3DLTA 1E0JA 1XQ1A 4ZJYA 3IRUA 3MPOA 3N39C 4NE2A 3OBIA 4B80A 1L4NA 2DQZA 3O6VA 3OVMA 1THZA 3H9GA 4PO1A 1OUMA 2VYNA 4W9NA 4Z9AA 3DL2A 3T95A 4TUYA 3OEEA 5KI6A 3KIPA 2N46A 3QBDA 2IHZA 5JLAA 5AVTA 3AH8A 2AMVA 5FAXA 5BVHA 5IVPA 3HJUA 1ZAYA 2NLOA 3V32A 1FFGA 1ZD3A 1KERA 1H0SA 1MC4A 2JGDB 4LS3A 4LSMA 3W06A 4BE4A 3UMMA 2BH2A 1H8HD 3RUEA 2G5GX 4HLUC 2PL1A 4W7SA 1TCBA 2FGJA 5AI9A 5BSMA 5EPUA 1OV4A 1D7OA 4A26A 4B8ZA 4D8YA 5HTOA 4DV0B 1H2HA 3WB1A 3MHTA 3VH3A 4RPHA 2HBRA 1XDZA 1OX4B 1IZ0A 2IPAB 3C41J 2PZLA 4JJKA 3U3KA 3AHGA 3I2HA 1XI2A 2PRZA 3PXEA 3A4LA 4MWCA 1XVAA 3G5AA 5JZBA 1KIAA 3OIFA 4HNHA 3K1AB 1L4UA 3NAZA 5IFLA 4UE2A 3IAS6 4BGDA 1OF1A 4LOKA 3RUPA 4B3FX 1E3JA 1KYXA 2QVGA 5AM0A 3MWDA 2XWQA 4D2IA 4L7QA 2OM6A 3DMGA 4TTVA 2CLFB 3MRTA 1L5YA 3WX0A 1SHTX 5KNBH 3O7MA 4U2FA 5HJ2A 3L0BA 2BUCA 5TQ0B 4B76A 3G23A 3C7TA 2OCLA 1PEKE 5ITZA 3UMSA 1HEYA 5K8CA 3CB2A 4E5YA 3C6MA 1N2CE 1XZMA 1CTQA 1CP2A 3WB0A 2L42A 3RKUA 3GJ5A 1JAHA 2W6OA 3QKWA 2JEOA 3OWXA 3WMGA 4ALLA 2EARA 5EHNA 5B2FA 2O59A 4LKRA 4PE5B 5JMWA 3B6IA 3H11B 1SQSA 1BAPA 1E69A 2H63A 2VAVA 4WADA 2NZJA 1P8JA 4WVLA 3KZCA 4JHLA 2D4AA 3RC1A 1GPUA 1YB7A 1YBHA 3VDNB 2DKNA 1GQRA 1G63A 4JLAA 1GPDG 3E7PA 4LGMA 4I08A 1Z36A 3OX1A 5DTIA 3VR1A 5DHSA 1K92A 1TJ5A 2ZVQX 4HGNA 1TUGA 1X15A 1MB4A 4H15A 3TD9A 1NF9A 1T9KA 4OIMA 1VQ1A 4IPTA 5LB4A 2GASA 2G1KA 3HDJA 4TMFA 1EI9A 3IIJA 1A5BB 5G4KB 3O8OA 4BP9A 3ZDYB 4DJDC 4QDUA 3L07A 4IUDS 3A6KA 1HMYA 1SXJE 4Q47A 4WLNA 1KH3A 1LNQA 2WU0A 4ZKEA 2X3FA 2NXJA 4NHOA 2B25A 3OU7A 2IHYA 5JFGA 4ZMRA 4JCOA 3GX1A 5AHXA 1FMTA 1GHTA 4YRPA 1LFAA 3KQLA 4EW6A 3K1AA 2D2EA 1WQ4A 3Q85A 4ATNA 3K6SA 1FDIA 4QAJA 1TKAA 1W93A 4ZREA 3THOA 3VHXA 2G7MC 3HN6A 5J47A 4RPGA 2ZITA 3GXOA 2IGTA 5F1PA 4BZQA 3SBEA 2AW3A 1JG3A 1YJ5A 1U1FA 1XF9A 2XCIA 1AU9A 4M8NE 4YJFB 2NUTA 4CEHB 4XX0B 3N7UA 4BE7B 5A5DA 3HM9A 5K0GA 4XIIA 2C4HA 3DUWA 3KAJA 1A9RA 3JQ9A 4P3OA 2IU4A 4WN3A 3TRFA 1U2QA 1RRFA 4LZZA 5KVQA 4E7PA 4DB4A 1G291 2K5UA 4BNVA 2W90A 3I5MA 3U3DA 1ZG3A 2OKCA 3GDFA 3LFUA 2KSQA 2LCFA 1QQ6A 2PAFA 2PJRA 1W5TA 5KEIA 3V8QA 1G2OA 5TVGA 5KWIA 3DV2A 3HNOA 4MVCA 2VSYA 1LQUA 3K8ZA 2ID8A 1QIJA 3C8HA 1K8ZB 1UKVY 2PV7A 2ZXEA 3FPJA 1SXJC 3ZY4A 2JD0A 4EHAA 2AOTB 3ZXYA 3R5TA 3MJTA 1E1RD 2AN5A 2PMDA 1NDQA 3Q8KA 2IZOA 1HOTA 3OHSX 1DC8A 4OJMX 4CQLB 1WRBA 4A36A 4TMKA 3IUSA 3HI6A 1P6XA 3N53A 2HDWA 4BNNA 2WVJA 4BP8A 1RJWA 2RGDA 2RJOA 3N70A 1ANKA 4M7RA 3KUUA 1X6VA 1JJBA 1TEVA 5KC8A 1V8ZA 1LD3A 2AEMA 5CR9A 3CVVA 3RKSA 3DXZA 2P78A 4HEHA 3DWIA 4PM4A 4Q3CA 2AOWA 1S2LA 4E5VA 1W8IA 4O0LA 2R0QC 2QD5A 3H6KA 2POCA 2O8DA 4Y2JA 2XNHA 2GTPA 3D8HA 1EQUA 5K3FB 1XP5A 3KQTA 2R4QA 4PX2A 3EJWA 3ESDA 1FXWF 2QM0A 5EJMA 2AE2A 3NYQA 1N1MA 3LWNA 3COYA 4CL2A 4JNKA 5IBCA 2G1AA 4JXZA 2UKDA 3LK7A 4PZLA 5FR2A 1S4QA 1EUDB 1LWOA 1VKRA 3O8QB 2WHYA 2OBFA 2OMKA 4KN6A 5G0WA 1Y5IA 3SQDA 3W8EA 4ED9A 5AW6A 1XU9A 5KNCH 3RRNA 4RX1A 2G6TA 1NBMD 1S7GA 3NTVA 5BSGA 1RU3A 2NU6A 2XYHA 3DF9A 2AMLA 2BFOA 3R75A 3OMWA 3V4RA 3AM1A 2IPLA 1G4HA 3KAQA 2R66A 4J0FA 4NLLA 3RUDA 4ZV9A 3LPDA 4J0GA 5B3JC 3MJCA 1XMOB 2ATCA 1XCPA 3EDQA 1JGTA 1FP7A 1FPQA 1S3GA 5EWLA 4NS1A 2D7JA 1E3IA 4PEVA 3M3HA 4KYVA 2X1VA 3WMRA 1JLSA 5J23A 2JFBA 2AC4A 3KEGA 1E4EA 4Q9IA 1HNZB 4MVJP 2DY1A 4K03A 1ORWA 3OUUA 1W85A 3ZDDA 3RAFC 3QLVC 5FBZA 8ABPA 4H7FA 1JT9A 2FDRA 4C30A 1IHOA 3N0VA 4KGVA 4EF4A 2J6BA 4MV8A 3HBAA 3A1DA 4F3RA 2P2SA 2WAYA 4LXHA 4CV1A 3ABQB 1IDOA 3GVHA 1V11A 4MV6A 1SU6A 2QBYA 3ZHCA 1ZZEA 1F2DA 1JWLA 1XGKA 1H0HA 4MSUA 4RL4A 2AR7A 4A1OA 2CBGA 1WUYA 5DDIP 3SYKA 3LXUX 1DRVA 3A1NA 4Q39A 4YGYA 5SICE 4D4IA 5KNCA 2JAXA 1EHYA 3G2NA 4LJSA 3R9IA 4RHEA 2RARA 3LUCA 4R9VA 5AT1A 4FMBB 4MKHA 1D6SA 1RC0A 2C4VA 5LPNA 4KZPA 1EUQA 2JJ8A 1H1DA 4KOEC 4AKSA 4QOFA 2ORED 2Z4RA 4NBRA 5SY6A 1P0CA 1AMNA 5EL0A 1HBJA 1OIWA 4YBZA 2ZYWX 3P9CA 3G0HA 2AMYA 2YWFA 4JA0A 2DPYA 2I4OA 3BMOB 3QVLA 1HETA 3AUXA 3HJRA 3MOIA 2Q2WA 1XJWA 1BVYF 2N47A 3F49S 4DM4A 3ID6C 2TSYB 1GKKA 1MVLA 5AM5A 1R2QA 2A88A 4FOOA 4I1PA 5L3QB 1B16A 1RXWA 1COWD 4DM3A 4U2GA 3ZZ1A 5GONF 3W8RA 4QPDA 4DF3A 2PSHA 3M6LA 3MWEB 1DDIA 2YHUA 5MN6A 1SIWA 1OYOA 5BYJA 4CDMA 5E1DA 2P67A 1F3OA 4DUZB 3P9RA 5D86A 3ORHA 3EK2A 5KNCD 2J0SA 3O8BA 2BEUB 4NS4A 2KBEA 1HEUA 1LTHR 2FE1A 1T3TA 1ORVA 2VJLA 5KNDD 5A5GA 4ZQEA 4PS0A 4P92A 4YMLA 2GYUA 1ZC3A 3RAGA 1NXSA 4CT0A 4DC1A 5CA1F 4G8JA 3NV7A 2GFQA 3ZU6A 2VDKB 4BKQA 4CMIB 1W5FA 1QDLB 1Y1RA 5C5EA 3U4HA 1QP4A 4G01B 3FYSA 2OKGA 1DT5A 1JDVA 2JEYA 1OKKD 5AHOA 5AJWA 3WRWA 4FS8A 3SXUA 3KDPA 5G4LA 4IMPA 3M5WA 4IIFA 4MW6A 1K86A 1NMXA 3H8SA 4WD3A 2AW5A 2M6SA 3GOHA 4I46A 3QELB 2Z1MA 3UMVA 5K0TA 1SR8A 1SXJD 2PRIA 5A6SA 3CINA 3W5SA 5CXUA 2IL1A 1B3BA 4AZWA 1N5JA 4JROA 4XIFA 5HKOA 3TVDA 1O5OA 1DTWA 1CG6A 2CKMA 4KRFA 3K0HA 2H3HA 1Z6GA 3HN7A 3D4BA 3CRMA 2OV1A 4BVEA 1XT6A 4WMLA 3GJTA 1Q14A 1QH1B 3L1UA 4V0KA 4NAHA 3CVWA 1YJCA 1E2LA 5H9WA 2E5FA 4AKHA 2HPHA 4YAJA 4OPMA 1E0KA 3LOQA 1ZEJA 1XZGA 4HZGA 4MVJI 2QE7D 1CQWA 1DEKA 4KL8S 4EO7A 2VQSA 4QUHA 2SKCA 3EGDA 5M5BA 1E8DA 2O2XA 3CE6A 3NI2A 3DE7X 1WV0A 2BBWA 4I5EA 3VHXB 1OY1A 4ETNA 2BGGA 4ARCA 3COWA 1SVKA 4OGLA 1PT8A 1U8YA 3I73A 3LHIA 3UHJA 3VR4H 4FCVA 5SZIA 2BY4A 4BO3A 3E03A 3F6YA 1TM7E 5DYNA 3ZLTA 3TL2A 2DQ4A 2RI1A 4LQDA 1OXMA 1SELA 4Z53A 3WO0A 2WWTA 1LNZA 1UFKA 2E4AA 2VQ6A 2WM9B 4BMOB 1AOXA 1HKHA 3BORA 3ENVA 4RDCA 4BEBA 4L0QA 3BF8A 3CPEA 2PX0A 4PSAA 3JQEA 1AKVA 2WWIA 1KVTA 5CVUA 2O14A 2WJWA 2W2TA 1RKBA 4IQGA 4L5BA 4P35A 4R2HA 2Q4TA 3NBKA 3LBYA 3OZCA 1VDMA 1P7CA 3HCNA 3AXSA 3PDJA 1KDVA 2BUBA 1L8QA 3OBBA 2WF7A 4GNRA 4UTOA 3QVKA 4YJGA 3P9ZA 4G8CA 2X76A 4Y2SA 2IWRA 1WVIA 4X94A 3UIEA 3K15A 3OKPA 4Y9DA 3JQ8B 5EIFA 4UE3S 1DOZA 1SKBA 2DE0X 4RLQA 5A05A 4BLOA 1QRDA 4RHXA 2PMEA 1V6AA 5FLYA 1UPTA 3D3WA 4RC9A 3X1KA 1KYWA 1BS1A 2DFTA 1VCOA 3RABA 1JIJA 2I7TA 3M4XA 2IXFA 4WCFB 4FT2A 3RRFA 4NMHA 2H65A 2QE7A 3UQYS 1KZ6A 3PQ6A 1RI4A 4E15A 3GFTA 3M6FA 3GDGA 9LDTA 3EPJA 3RUCA 3IV7A 2QSYA 4Y3UA 1NURA 1P0MA 1XZFA 1N6KA 3OG9A 3OY2A 4XSVA 2AD1A 1K7FB 3KKKA 2PR2A 4KKXB 4Z9XA 3KFXA 4JC4A 1H6DA 3BXZA 2EF1A 3IKJA 1W9HA 1DNPA 3EIUA 3D4IA 5AK0A 2OHIA 1D4AA 3ONWA 4JJGA 5DXJA 1ISRA 2YNMC 4HQNA 4U2DA 1U6JA 3AONB 1UC5B 2Y27A 3CLTD 3CO0S 2ZYUX 3M82A 4FJ1A 4P3YA 4DLVA 5BW5A 4HAVA 1L7QA 4AM8A 1WG8A 1LRKA 4EMSA 3WGNA 1FFHA 5EMNA 4ZARA 3CCBA 1QDUA 4HTFB 1F6WA 16PKA 4RWEA 3DNMA 3KDAA 3HH8A 3M5PA 4C4PA 4KMRA 2I2CA 2RGYA 4MKGA 2AN9A 4PLWA 4F46A 5LQUA 1J2YA 2XDQB 4FOSA 1ZUIA 3S8YA 5JNUA 2FXIA 2C2XA 3L43A 3G49A 3WKAA 2DBRA 2G82A 4H77A 4D4GA 4QT4A 3EDOA 4Q4AA 2GBCA 1GARA 1SKUA 3A4MA 3PYLA 3DH0A 5FTKA 4OBXA 3QPAA 5GIOE 5FUVA 2YL2A 1BDJA 4HUJA 4TUYB 1JHMA 3OU2A 4X24A 3STYA 3ODGA 1N57A 3UATA 4D8XA 3OU6A 2HRZA 3K09A 1W9MA 4M0PA 4HF7A 4FX2A 2F1OA 1CUAA 2QR3A 2QZ4A 2QD4A 2XCUA 4HPWA 3UICA 1ADYA 3QBTA 1DJQA 1GSAA 2EF0A 4GMDA 3UWMA 3VSDA 5EUQB 5E7JA 1TM2A 3C24A 2WAXA 3IP6A 4PO3X 4BKOA 1EKXA 4AJLA 2Q2QA 1XHEA 4HB3A 1C8LA 1DKQA 1PYOA 5TRTA 2V7QD 1L4BA 3WLIA 1OU4A 3MXOA 1QE0A 2OQVA 3RFFA 2W8BB 5GVSA 5AJUA 3V8EA 4Q1BA 5JS7A 2QY6A 2QZPA 1PVVA 1LX6A 2WBLC 3KBBA 1PVOA 5FX2A 3QVGB 3W9BA 4HO1X 4I1YA 2I6FA 1QF6A 3VGPA 4MW9A 5JT1A 3O92A 1UMDB 1LBIA 5AQEA 1SWVA 5L3SA 4OXXA 1RCTE 1VGVA 3QUAA 4N3AA 4UVIA 2QRJA 2PMBA 1C3LA 1CQXA 1T3GA 2EKQA 1YQUA 4FVTA 1KKLA 4OB6A 3N8IA 3AL3A 2ZSJA 4D80A 5E4YA 1E9AA 2ZXUA 1OZ0A 2D3WA 3TXXA 1FMCA 4ACBA 5LOVA 3I1IA 5IUKC 2O2JA 2CUZA 3PC6A 4FZVA 4FB5A 3ESQA 5AW7A 4TYYA 3I1FA 2JARA 2WHPB 3D0QA 3M83A 3U7JA 5A2GA 4GDFA 2PMWB 4E1BA 5AJHA 1MENA 5F51A 2A7XA 4PSDA 2VQ3A 4KQCA 4Y9UA 3GRFA 3QEMB 4IJWA 3KETA 3X44A 5HZKA 1GNSA 2BGJA 4WZAE 2Z5GA 2FPXA 3QPWA 1U2ZA 4J2OA 4D4LA 1A97A 3BZUA 5KZMB 1OVMA 2UVDA 4BO6A 4JBHA 1OI7A 3O8QA 4J1QA 5DM4A 3LDGA 2ODWA 4IHKA 1TEXA 3KOOA 1QDEA 1XA3A 4OXYA 4PY2A 4MW5A 3RVRA 1EDDA 2NZXA 3L8YA 3EGXB 2YBDA 4RCZA 2VYVD 1BE6A 4R51A 1MG5A 3TWOA 2V0GA 3TX2A 3VPGA 4J1TA 3PZBA 5IANA 4MGIR 3P2JA 1F5SA 4GI3A 1U28C 2QTWB 4M22A 5AXBA 3ZU2A 4CF4A 5JSHA 1Y8ZA 4B0OA 1XRJA 3I83A 2OBYA 1NTRA 3BL5A 2YVLA 3P45A 1FNNA 2AUMA 3K6KA 1ISFA 1YQDA 1GTL1 3RV4A 3U61B 2AI1A 5KYGA 1ZIOA 2G72A 1OW3B 2FE4A 1N3BA 3MYYA 3TLGA 3PB3A 1HNWB 1J0DA 4NK4A 2FPWA 5IJAA 4AQDA 2R1UA 1ABFA 2ZDQA 4MKXA 3GRPA 3NJRA 5DK6A 2R60A 4GZ3A 4GZMA 4JB2A 1AC5A 1PGNA 3CPJB 4KPFC 2ZSDA 4JB0A 4ZDJA 2G5PA 2KWIA 5TEWA 2C5LA 2FCAA 3LMKA 4IS3A 2IX9A 4WFKA 5AXAA 3EFHA 1KYVA 1LY1A 1QGDA 1UJ6A 4QWWA 5H7XA 5C52B 4UJ5A 1JMKC 1U8EA 4YPOA 1TPZA 2IXDA 3O9VA 4NPHA 4EB3A 2VJKA 4N5DA 3JW8A 2I87A 2R65A 4G1UC 3HFRA 3QEMA 3QP9A 1J42A 5NULA 1EDOA 3T7KA 1G7RA 4BMSA 1WNFA 3FPAA 4HDNB 1E6LA 4C3UA 2Q21A 3Q9LA 3PRYA 4DRXB 5TGTA 3K70B 1XCBA 2D1TA 3O3CA 2VTEA 2JJMA 1AQJA 5FULA 3SSNA 3SHQA 2KMLA 1NFRA 1HDOA 1J90A 3HKEA 3WQHA 4ZANA 1KFCB 1V3UA 5A03A 4U7FA 2YN4A 2JFGA 1QBKC 3TOSA 1LBHA 1UC9A 3PCRB 2V1XA 1OXBB 2V6MA 4TTPA 4B2LA 4GO1A 1IXSB 5ALQA 2HEGA 2D13A 1KO4A 1IM8A 2BWJA 5T4HA 4ZYTA 1QHSA 5I8WA 1NBAA 2B37A 4X1IB 5DOZA 3QYJA 4EKYA 1U5BB 4IILA 2QTVB 4WE3A 2B8WA 1Q44A 1WXXA 2B1JA 3DEJA 3EAFA 3OEED 2FEMA 2GBIA 4BNDA 2PUHA 4BO8A 4X93A 1P45A 3MWLA 4HI0E 1VJCA 3VOTA 2OCXA 4CM8B 2ZI7A 4FT4A 1Z68A 3QTTA 3SNKA 4KJZA 5CH8A 4BS9A 1NA5A 1WCWA 3N7TA 1WXFA 2VT7A 4AROA 1RWNA 2Y8EA 1F4VA 3N28A 1JVSA 4QHTA 4Q4HB 2AK3A 5DLPA 3AP1A 4OBEA 3OOEA 1RQGA 4L8WB 3KKEA 3H4TA 1FJHA 1T9CA 1XTZA 2CFTA 2P2GA 1UMCB 5JV5A 2J3MA 4ZODA 5EFOA 1Y1TA 3SYMA 2GEUA 4MLDA 2O6HA 1YVPA 1D2AA 1DIHA 3I23A 4BMZA 3K9CA 5ALGA 4JI4B 4MPDA 2GNOA 3DE5X 4XFDA 5CLGA 4KR0A 1YMQA 1WXGA 1C4XA 4W5QA 3GJQA 4R1TA 2WA1A 4DA0A 2A57A 5CHEA 3VKHA 1L8XA 5J43A 3K9HA 1O08A 2P30A 1NVAA 1ONSA 2O54A 1ABEA 3JASA 3EIFA 4PICA 4WXEA 1S3SA 2R6HA 3F1LA 4B73A 1YQ9A 2PJZA 5DYWA 1DCTA 2FSFA 4KQKA 2I29A 4LIPD 5IYZB 5JZVA 3L18A 3TJMA 4U7WA 2AQIA 2GEDA 1VYUA 4Q7JB 4DIKA 3FKJA 3LECA 3PJRA 2R8BA 1JALA 3HCDA 1SHZA 1PZGA 1TAQA 1Z88A 4YT5A 3WNQA 4Q9NA 1JLKA 5CNKA 2W42A 1UMBB 4DCGA 2NUPA 1P1CA 5IKXA 3K9NA 1FEZA 4PHTA 4RY9A 1V1MA 2W48A 3PC8A 3R09A 4GOMD 3MAGA 4P9NA 3ELYA 4NNJA 1FRVA 1ZLYA 2P9JA 4G0XA 4GR5A 4CF7A 4IDNA 4YONB 1P0QA 1L7MA 1Y0BA 4QUDA 3TZ6A 5JAMA 1GCOA 3KXLA 2M6KA 2BGIA 1WZCA 2FG6C 1FP1D 1N6RA 3M6XA 1G16A 2C83A 1AGNA 5KNDH 2NXCA 4F3KA 3ESZA 4RVCA 2J9XB 1LTKA 1R3UA 1QUEA 2HCFA 4DA8A 1IHXA 4TXJA 4LMPA 3KLBA 1R12A 2BKUA 2GAAA 5KPJA 5ESDA 5CBKA 2XYGA 4U1RA 3GLSA 4NK5A 5CFRA 2I71A 1G2QA 1WSAA 2WPDA 4MNTA 4OQQA 2PHZA 3G8AA 1RCFA 2D74A 1Z26A 2E0IA 4NBLA 4EZEA 1JBQA 2E5WA 2B35A 3BXGA 3CA8A 1D1SA 1SXIA 1WE2A 3KWFA 4AAYA 4WZAA 4B6JA 4YMSA 1WZNA 4A23A 1GAJA 4QOJA 4EM6A 5BVGA 2AXNA 4ZDKA 4IJ6A 1TMKA 4IHJA 2C5SA 4DAEA 4L73A 4D4JA 1X7WA 3L1VA 5K8UA 5L4LA 2HHCA 3MT8A 1FYXA 5ED4A 1MX3A 2IKQA 3FJYA 3K20A 2YV4A 1XN4A 4HB2A 1R8YA 2XIJA 4IDHA 5BQ5A 4ECEA 3LUKA 5K3BA 3QEOA 2OZLA 3B6MA 5L3ZA 3EGVA 2X5KO 5FWAA 3HI4A 3M0EA 3SHFA 1QVAA 2QQ0A 3QKRA 3ZJ5A 1FS5A 1MO3A 1RVDA 1L4LA 2DETA 4M83A 1E3DA 3L7YA 3BGWA 4M1EA 3ZN2A 4EJSB 2YMQA 4EPTA 2Q7XA 1Y1QA 2R97A 1ZGBA 4YRDA 3GQBA 4K6GA 2Y0PA 2NZYA 2ZATA 4C7KA 3L9WA 2F3RA 4AJ9A 3OFKA 3HZRA 4ZOLA 2PVCA 5JAHA 3WFZA 2DR2A 3WRXA 1PKEA 4BN5A 1M72A 1Y8CA 3NIGB 3WYBA 3MGAA 4TS1A 3FPLA 1NV9A 4YIHA 4BFLA 2OGSA 1C2TA 1E8MA 3PFCA 4LRQA 3VYVA 5BV0A 1X2BA 2JHGA 3F6EX 2IW1A 1PTJA 1YKGA 5F2EA 2Y3IA 2J09A 2V59A 1JA1A 3C7KA 4E7OA 3ZH2A 3SSAA 4YPVA 5JNSA 4FIDA 1Z0ZA 1U5BA 1P33A 3D6TB 1G64A 2GN9A 3DPSA 3AVXA 3L6OO 2CXUA 4M1KA 1H5UA 1D2MA 2R8ZA 1YKSA 1XAGA 1QANA 3D2AA 4O4LF 1WSWA 3GZJA 3SF8A 5LXTB 5FYDA 2XUAA 4FBGA 4IZHA 2HF7A 3OJCA 2FJPA 4A9AA 2BKAA 2H06A 3ISJA 1ZH4A 2P91A 3T1QA 5CEFA 1XLTC 1X94A 2X13A 4R9SA 1Y9ZA 2P77A 4ZOLF 5K03A 1WHTA 3O82A 1KU0A 1BROA 1FNDA 4GEGA 2C1XA 3KTAA 1BGWA 2IVZA 3I30X 3WGJA 5EJAA 2X9LA 2QN9A 1SBCA 4N4AA 1J21A 4IFBA 1RM0A 1GUYA 3T7EA 4F5DA 5IKPA 4PU0A 1P3JA 4MP8A 2QL7A 2F55A 4QHSA 5T64A 1NBOA 3IALA 3G0DA 5DV9A 5TVKA 1IRXA 4NMMA 2VDOB 2C84A 3FSEA 3F97A 4G5SA 1NG1A 1NUHA 5TPWA 1OLUA 3H8VA 4IJKA 1VPEA 5A9SA 4QXPA 3GLIE 4AP6A 3WTBA 1U0BB 2IPXA 2CJFA 3S1AB 5I8ZA 1QVWA 5LKRA 2OUIA 4B87A 3NHKA 2GM9A 3DV0A 4M1WA 4CKCA 2PH5A 4FXPA 1YZ3A 2GXAA 2RGGA 3OMXA 4US1R 1W87A 2FQ1A 4H3VA 4R1SA 2VJDA 4P6VF 4UAVA 3ZX4A 1OX5A 5H16A 4PCUA 5EJ9A 1IM5A 1SXJA 2Z8YA 4TRNA 5REQB 5WRFA 5I9NA 1U3WA 2J3DA 2H1FA 2O8BA 4CYMA 2RGRA 4URWR 1E1QD 2BLNA 3L7BA 3CNLA 4BWYA 4ZCTA 2ZYGA 2WMNB 1UOQA 4QDTA 3TLEA 4LJ5A 3DOFA 5JCOA 3GGOA 3REQA 4ND1A 3CQ9A 2HTFA 2BFPA 4M0DA 4W63A 4OSEA 3KE8A 2CJWA 3LYLA 10MHA 2X6TA 4UXIA 5AUOB 4IM7A 5IBPA 4IYJA 4E3ZA 1GPAA 1XDUA 2CVZA 5A7FA 2PPLA 3RC3A 5BSTA 1K0FA 2ZUEA 1VGQA 3S0JA 1YDHA 2O3UA 2LVBA 4UTRA 4EB6B 1FC0A 2C7BA 1N0UA 3BZWA 2H00A 4PZAA 4ZGBA 3PIDA 4PLCA 4YEDA 3RASA 4MV4A 5DBOA 1XAHA 2XMDA 4GOLD 3G85A 2C54A 2OQ2A 3PTAA 1J06A 1N2CA 4IO0A 4BX3A 1VHDA 1H1LB 4KKVA 2I3DA 2ZOSA 4INJA 4RTNA 4GLFA 4JLOA 5KSYA 3HCAA 3BXFA 5D1NA 1EFPB 3TK1A 1OZGA 4AUEA 3CY6A 5L95A 2FPPA 3RVKA 3NAQA 4G0PA 3EMKA 1T4GA 4FFNA 4MAAA 3KG2A 4ONEA 4B1FA 5FNVF 3QA9A 2VQDA 2R8XA 2BSAA 3BMXA 2W2VA 1R3DA 3LGAA 1I3CA 1Z12A 5D5HA 1M34E 1REQA 4FX5A 5IK2D 1KRWA 4FDTA 5EKUA 4J3NA 3FA2A 2QBYB 2W7TA 4GX0A 1HDYA 2RKOA 3PU6A 5DIFA 2RHBA 2YC4C 3LNCA 3INRA 2CXTA 3U1VA 3CJRA 4V1CA 4QG7A 5LYJF 4M98A 3RYFA 4MRVA 3GK3A 1EVEA 1S8OA 5JANA 2WWYA 2CF5A 1GPWB 3MUFA 3RADC 5EWLB 2WAAA 2W4IA 3PDWA 4X6UA 3N5KA 1EWYA 4OHCA 1V8BA 4MKRA 4QU0A 5JATA 4QD3A 5EE9A 1WPXA 1DWUA 2OHJA 4PX9A 1Z16A 2JNWA 3N0TA 3DTNA 3ZZ0A 2R8YA 4AJNA 3ABZA 2FZEA 3M6UA 4Q18A 3TRDA 1TQ8A 1W1IA 2QN3A 3LPMA 5T4FA 3TGPA 1BCRA 1N6LA 3GUUA 2XNKA 2O5CA 4CI9A 3A32A 1CY4A 1M0TA 5EA2A 2FLKA 2RAFA 4M1YA 3ICEA 3DBRB 4Q01A 4WQMA 1NU6A 3PFGA 1CEYA 1IU9A 3I6YA 3JQCA 1QHEA 1Y81A 3PR1A 3RB8A 3AR6A 4K5QA 4ND5A 4OXRA 1Q0ZA 2WSBA 2VCEA 2FEWB 2RGNC 1MEJA 3WGQA 5LWHA 4GKKB 1J5XA 1Q3HA 3E3MA 4KO4S 4B4WA 3PDIA 3EUEA 4HH1A 3RWMB 2CJXA 2PTGA 4R2LA 3WYDA 4WLFA 1TKCA 1H22A 2G8LA 2VH2A 2ZIAA 3ZOZA 1E2MA 4JB3A 4RPJA 3WS7A 2BHNA 4LY3A 1AGRA 1DS6A 1G20E 2IZ0A 4FMDF 2HK8A 2NSDA 4DB2A 3L8ZA 1P2FA 4J0EA 3ORQA 1OTXA 4KH1A 3VZPA 4DXAA 3DV9A 5ALXA 3M6VA 2DCMA 2GD6A 3I3OA 4K81B 2LDBA 3TR6A 1AUQA 1OIVA 4IINA 4UATA 1IEVA 4Y6GB 4XJXA 1RLOA 3TOVA 1RYDA 2E18A 2XB8A 2OZLB 1Z45A 3K0AA 4M7WA 2DERA 1JKJB 1S2OA 3AG5A 5JCJD 3AB3A 3CE9A 3EGCA 3GW8A 4ZEXA 2I66A 1CEXA 4IICA 5EQDA 4KO8A 1BGXT 3CYFA 2O3TA 1EHIA 3K6SB 4JU9A 3H3XA 2DQSA 1NIPA 1VBKA 4GC5A 3LWBA 3AI1A 3CPSA 4LWQA 2D6FA 5IBQA 2QM7A 1GD1O 3T38A 2JIZA 2GN4A 1DAFA 4Q66C 2DBZA 2FPLA 2QXTA 4LXQA 4ARVA 5BP7A 3M1IA 3ILXA 3K35A 4JI7B 2O07A 1ZN2A 2Y1XA 2B21A 2ZTUA 5HA5A 3RFXA 4X0EA 1G38A 4TZ0A 4L6IA 3ZWWA 1P75A 2AXEA 1DJNA 5KTKA 3CZQA 3FOCA 3IESA 3Q6MA 3RSFA 4EGJA 5EJ2A 3ME5A 1FDUA 2QVCA 3A1SA 3BKWA 4P98A 1D07A 2DM6A 1KTIA 4JXJA 4M8SA 5EXTA 3W9SA 2HOQA 3HR7A 2XMPA 4IF4A 4XX0A 4NP6A 2H1WA 1QE5A 5ERXA 5AJZA 3WK8A 3OICA 3V00A 1N6NA 1OBCA 2PWAA 1PDOA 1XZAA 4OU4A 1X1EA 3I37X 2NQTA 4BTVA 3ZZUA 2JHFA 4JI6B 4IIXA 4E2XA 1QG6A 1X0XA 3MINA 4FKMA 2WFZA 2BHSA 4M87A 4NOJA 3RCBA 3K9FC 1X38A 2FSGA 1DXHA 4QFBA 4ZMBA 3PL5A 1C1DB 1N0WA 3D54D 3ZVLA 3FZYA 4OHMA 1Z4KA 1J7JA 1C9KA 1MD9A 3WIEA 3JALB 4O4HB 1QYCA 4YMWA 4QEZA 5BMVB 1I4WA 3GLGE 3T5DA 2PLWA 3N74A 4IDQA 4MVWA 4O2BF 4ZVRA 1G6HA 2NT3A 1E79A 1N2ZA 1Z2OX 3DZHA 2RK4A 4UOEA 5KYVA 4MWEA 2YX1A 4AICA 4YMTA 3NWEA 3VI4B 1NONA 1PRYA 4UAJA 4WA7A 4RLFA 2J45A 3EDCA 4M86A 5TX7A 2UYYA 3EYAA 2QZJA 3QU2A 2HQBA 2JEZA 4PYIA 5F2OA 4TT3A 3VO2A 1ZIYA 2HREA 2QUAA 5IHXA 3DFKA 3FWKA 1MCZA 3SFTA 1QH1A 4WIAA 2J5XA 3NJ8A 2XE8A 5JQGB 2NUBA 4KG7A 1SB8A 3DMTA 4LTMA 1IL0A 3T7TA 1USIA 3E5NA 2PQ0A 2XEDA 1QCDA 2NU8A 3H6HA 4RTSA 5CEJA 1IOVA 1JQDA 4IJQA 3JQAA 4JYZA 1QX4A 2A35A 3I9JA 4I1VA 2PXCA 3OIWA 3HCOA 4QE3A 3FLBA 4YRQA 1M1YE 3M6MD 4H31A 2QZZA 4MHOA 3SJBA 2BFFA 2XRYA 3H9QA 1TZKA 4X90A 1HWYA 1WU7A 2I76A 1AD2A 4MWZA 3UPTA 5I51A 5KC9A 5J3JA 1LW6E 3I39X 3AKYA 2J9YB 5L7TA 2AN1A 4PV7A 3VJMA 3GJSA 2GS9A 3L0PA 3M9XA 4WGGA 4B47A 3E7DA 5CFNA 1EJBA 2OENG 5CFMA 2PGIA 2WP0A 2YXDA 3DL7A 4KOAA 3JZFA 3AR9A 4MUAA 4CHGA 2GLTA 2Q9BA 1TEZA 1B41A 1Y1SA 1Y9AA 1NZJA 5E6SB 1NVVQ 4XWOA 4RPKA 2O0HA 1SC3A 4QOGA 1CY1A 1JPUA 3P8ZA 1FTSA 4II3A 1TMOA 2A92A 1FFAA 3OF5A 4JMLA 4NCJA 3BK2A 2YCBA 1DTWB 1WMSA 2RHMA 1D0SA 4M8IA 1L2TA 2VT3A 3Q10A 2Q5HA 5HJ7A 2WP8J 4CLXA 3LXRA 1V48A 4L51A 3FDZA 4MDFA 1HV8A 3ZK7A 2YDXA 4OUDB 1PZXA 4FOTA 4DC9A 2WK1A 3DAYA 4PYNA 1V25A 2DJ5A 3BERA 1Q21A 3PVZA 3FI9A 3QVJA 4ERNA 3IT2A 4ALKA 1IOZA 3WRYA 1ZOSA 2CNNA 2JVIA 1HNNA 4JK3A 5BYBA 3DPIA 2DKFA 2QYOA 1M5UA 3RJZA 2V1UA 3VR3A 5FWDA 3N7AA 4E21A 3G59A 4V1CB 1M6NA 1JQBA 4TMWA 5GZ6A 3R7AA 4BMYA 8AT1A 3UGKA 4XGIA 4NL4H 4C5CA 3UB2A 4ZCMA 2B6HA 2Y1LA 4TQ9A 2Y93A 4W6QA 1KI1A 4HNVA 4IGIA 1NT2A 2XPCA 3G2MA 1R6XA 2OD9A 3F5FA 3WNBA 2NP7A 1QYWA 2OSVA 4EGFA 1GRVA 1QTNA 2ZBDA 2BMAA 2IYUA 1MJNA 3KM0A 4LF4B 4LBZA 1MABA 4KBGA 2BVNA 4CGZA 3OSUA 5BT9A 7AT1A 4IFTA 2MCFA 1MOPA 2JGMA 2GUGA 1R74A 3WYAA 3ZQ6A 3SICE 3N8NA 5L3QA 1LLFA 3EE6A 4N76A 3JSXA 4YHHB 4M7OA 2CHVA 3HMQA 3IKLA 4TLEA 5HFNA 2QROA 3KB1A 1WJGA 2WZCA 5MHTA 3UYLA 4J6FA 2A5GA 3GJ0A 1T3HA 2HTEA 3MFQA 3DC7A 4Y1RB 2GAIA 1KVRA 4LF5B 4BL5A 3O4JA 2HXSA 3HYTA 1D2EA 4LDJA 4F97A 1PS8A 5TIIA 2OXIA 2RHDA 4N3BA 2WM3A 3L7NA 4FN4A 4MS1B 1RPAA 1E99A 2D00A 2JDID 5DFAA 1C9NA 2ANBA 1C3VA 3KZKA 4P3NA 2J8ZA 1GZHB 5GPBA 2BJVA 1QRRA 4LRWA 2Q3JA 3TGLA 2AE1A 2JHAA 1ZJYA 3S68A 4Q21A 5LQDA 2ZRGA 3THWB 1U3TA 3KJZA 2QUIA 2ZIVB 3DKIA 2WSSA 1Y8QA 4DABA 1NDHA 3ZR4B 3HRKA 1DCMA 4EZBA 2C88A 1T1IA 3DT6A 2E1PA 1ST2A 3URMA 3QKTA 1BS2A 4XR4A 1CE8A 2Q6LA 5ERYA 2XEXA 2JKZA 4I1RA 3T3MB 3C3DA 3MJSA 4PINA 5AKLA 2B6NA 1HT2E 5CVEA 3K16A 4GE0A 3QBVA 2Q5QA 2F64A 4L16A 1H4VB 1GWNA 2JLQA 5M3BA 4I14A 4R1MA 4HYEA 4LV6A 4HD8A 2E49A 5L6MB 2PBLA 3FIUA 4FPXA 3UXHA 1ACLA 4JJ7A 1LZLA 2LIPA 4OL0A 5LFAA 2CT8A 1NRXA 3BFPA 1WQ3A 3MSCA 1WXDA 3GEBA 3H5WA 4JFAA 4TLCA 1YZLA 2F3SA 2WT8A 4M99A 1EFCA 5C4GB 1E18A 4OKSA 1ATZA 2PUDA 4HVTA 4Q4JB 1EAMA 1KEZA 1H1LA 1OPXA 3HUEA 2X22A 4KXUA 3K09C 1YB1A 5H9VA 4BECA 5HJ5A 1Y6FA 4X1YB 1CUSA 2UDPA 2AOTA 3JX9A 3PNYA 2CZGA 2Y2VA 1KIFA 2AEEA 4RELA 3TMAA 3QXXA 2ZS9A 1VCNA 3IOYA 3COSA 1GM5A 1CZKA 3RFVA 4BQFA 2VLIA 3MJEA 1XDGA 2RGCA 4JEMA 1GYQA 1AUPA 1KI2A 3DKVA 1L5VA 1YOBA 3EEYA 4KAXA 4DNXA 5EJ8A 3EZXA 5ARDA 3RSSA 5KYWB 3K73O 1EX7A 3DZFA 4CU5A 4IKEA 2CMFA 4LVOA 3V4SA 3WWOA 3H4VA 3IULA 4K8OA 1SZDA 3GGJA 3E82A 4FS3A 3RK4A 4AMBA 4JQYA 2Z5VA 1C1DA 4Q15A 1KXZA 2X4DA 1EGAA 2EFHB 3VNUA 1A9ZA 1DJMA 1HE4A 4DMKA 3MHPA 5C0OE 1QHHB 3X43A 2Y76A