1ORHA

Structure of the predominant protein arginine methyltransferase prmt1
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
318
structure length
318
Chain Sequence
b'FDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYQSMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein arginine N-methyltransferase 1
publication title Structure of the Predominant Protein Arginine Methyltransferase PRMT1 and Analysis of Its Binding to Substrate Peptides
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 91
structure length 318
sequence length 318
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2003-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 1orhA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1orhA01
1PJZA 2YX1A 5GIPE 2NNWB 1R8XA 3EVFA 1JTFA 4RTQA 2I62A 3PLAE 2AOUA 1RJDA 5DM1A 3DXZA 3GRZA 2P40A 3RODA 4YUZA 7MHTA 1JTEA 3ELDA 3AWIA 1NW8A 3CGGA 4RTMA 5T64A 1NW6A 2AN3A 5FA5A 2OPBA 3FUUA 2Y1XA 1KHHA 2H1RA 3ER9A 2GPYA 4GEKA 1VL5A 2C7RA 4WVLA 2UZ4A 5D1HA 5LQCA 1JSZA 4FT2A 4R05A 3NVMB 3PFGA 3CC8A 4Y30A 5GOZA 1QAOA 4QPPA 3FRHA 3THSA 4E2ZA 3G2MA 4HGZA 2VZ9A 5HIMA 4PYNA 3FTDA 5DXAA 3M4XA 1RI5A 4E32A 2IIPA 2NP7A 3MTEA 3OFJA 4CXMA 2FK8A 1NV8A 1DUSA 5K0JA 1G8SA 1D2CA 1UWVA 2OY0A 3E7PA 3L8DA 2FYTA 4BLVA 3CKKA 4E30A 4AUKA 4RTLA 1ZQ9A 5T67A 3BGIA 1X1AA 3C6MA 1AV6A 4EQZA 1QZZA 2ONZA 2PWYA 2PX5A 2DPMA 3PS9A 5ICGA 1KR5A 3GXOA 3UJDA 4ER0A 3B5IA 5ICEA 2BZGA 1NE2A 3BZBA 3CJTA 2C7QA 1VIDA 1FPQA 5C0OE 2PJDA 3HCCA 3T0IA 4BY9E 3DR5A 1ZG3A 2K4MA 5DX8A 4EKGA 1G60A 2VDVE 5HZMA 3C6KA 1VP3A 1SVUA 3TKAA 2BR3A 5BP7A 3EEOA 3KQPA 3T7SA 2ZLBA 1BKYA 3HCAA 4Z2YA 1DCTA 2AVDA 3EVAA 1I9GA 3FPFA 2JG3A 2AOWA 3TM5A 3SGLA 2EFJA 1YZHA 1JG3A 2I9KA 1NV9A 1R6AA 4PONA 1D2GA 1X1BA 4M7RA 5FA8A 4RTPA 4KRGA 3UJ8A 5HIJA 2IFTA 3M6VA 4WXHA 3REOA 3HVHA 2EX4A 5K0CA 3PTAA 2GLUA 3OPNA 5FQOA 4CKBA 2JJQA 2YXDA 3GNLA 5E9WA 1EAMA 1XJ5A 2QYOA 3EPPA 4LECA 2O06A 3OCJA 4PCLA 1TW3A 5GWXA 3FUVA 3ORHA 1YF3A 2YTZA 2R3SA 2IBSA 3DUWA 5CCBA 3ELYA 5DTQA 4M36A 5EKUA 4X63A 3HVIA 3UA3A 2O05A 1UFKA 3GRVA 3R6TA 3HP7A 1VE3A 3P9KA 4PCAA 2BR4A 2AOUB 5BW5A 5CVUA 1EQAA 2HV9A 3LCCA 2G1PA 3SR4A 5EC8A 2EG5A 2IGTA 5EHGA 4YV0A 3UWPA 1O54A 5CVDA 2P35A 3V8VA 1RJGA 3M6WA 2YR0A 2JHAA 3O7WA 1ZGAA 2FPOA 3G8AA 4PYOA 1XXLA 2PBFA 4AZVA 2XBMA 1G38A 3KQYA 5FULA 3EVCA 2Y1WA 1JQEA 3R3HA 3B7PA 4HG2A 2WK1A 3LBFA 4F85A 1FP2A 3G8BA 5E9QA 1JG1A 2ZBPA 2H11A 2PXXA 3HM2A 3OZRA 3G5LA 3SSNA 5DPMA 3I9FA 1VQ1A 3EVBA 3LDUA 1MJFA 1EG2A 2HWKA 5MHTA 3C3PA 1X19A 3NJRA 3NMUF 3R24A 5ICFA 3KQOA 4NECA 5IKMA 3FTEA 2OXTA 5EIFA 2BR5A 4OBXA 3T7TA 1XVAA 3MHTA 3HA5A 4FR0A 3KPWA 4HRAA 4OA8A 5FADA 5DXJA 2H00A 5LR6A 3UJAA 1EJ6A 1QYRA 2P1DA 2P7HA 4RSRA 5HILA 2ZBRA 1KYWA 3FPGA 1G55A 1TW2A 4GOOD 2V7EA 5CVJA 4GOMD 4A6EA 2IDJA 1VP9A 2PT9A 3DP7A 5E1MA 2V74B 3AJDA 2ERCA 1WS6A 3KQWA 3DMFA 1G6Q1 3KQTA 5EEGA 5CUQA 2G70A 2PV0A 3E05A 1F38A 3SMQA 2ZW9A 5K0EA 1KPGA 8MHTA 5K0BA 2QY6A 2CMGA 3LDFA 4PWYA 3LPMA 4JXJA 5DTRA 5E2BA 5E9JA 3OZSA 4MTLA 2QM3A 4U7TB 5FCDA 4E2WA 3PVCA 3TLJA 5KVAA 2PX2A 2ZZNA 5EMKA 4YV2A 1AQIA 4HSGA 4P7JA 4QDKA 3R0QA 3SSOA 4RX1A 1SG9A 4F84A 3GWZA 4QVKA 1XDZA 2OKCA 2PLWA 1H1DA 4RTOA 3BKXA 2OB2A 3P9NA 1MHTA 2WA2A 4AZWA 5K01A 4F86A 5FTWA 4DQ0A 1P91A 4P58A 4PYLA 5GINE 5DX1A 3HCEA 4P7GA 4XUDA 4QTTB 4O29A 4PGHA 3FUXA 3MB5A 4R8SA 5EIWA 1IM8A 1SUSA 4V0RA 2JHCA 3GRYA 3ER8A 2ZFUA 3UZUA 2DULA 3DLCA 4KWCA 3UJ6A 3U81A 2NXJA 3PFHA 5ICCA 3OU6A 4PIPA 3TRKA 2AN4A 3MTIA 2ONYA 4DM3A 4YUXA 3IEIA 3MAGA 3NVKI 2ZTHA 5E1BA 2BH2A 4IKPA 1JG4A 2E5WA 3A4TA 5P8WA 1V39A 3GO4A 4QPNA 1QAQA 3TQSA 3A7EA 5HOQA 5EKXA 1T43A 5GM2A 2O57A 2IDKA 1SQGA 2GAFA 3A27A 2Z6UA 5E1OA 3FRIA 1WXWA 4YUVA 3OE4A 5CM2Z 4GBED 3KQQA 1DL5A 4YMGA 4R6WA 3GRUA 3A7DA 3BGDA 1KPIA 5DX0A 1SUIA 5K03A 2I7CA 3KU1A 5LQKA 4QVGA 4GC5A 4BLUA 2UYHA 3UJ9A 4B17A 5FWDA 4XUCA 3FUWA 1NBHA 3I53A 4QDJA 4G56A 5FWAA 3B3GA 3BWBA 3TFWA 3HEMA 1BHJA 1D2HA 1P1BA 4BP1A 3QOXA 2FHPA 3OU7A 2YUIA 3MERA 3P9IA 5DWQA 5EZSA 2O0LA 4RV9A 1HNNA 4KIFA 3BT7A 2NYUA 3G88A 4KVZA 4GOLD 3NDIA 2IH2A 5D1NA 3K6RA 4HC4A 1Y8CA 4KW7A 1VPTA 4P7FA 3TOSA 5C1IA 5CVVA 4RVDA 5HFJA 5K0NA 2GH1A 3HCBA 5BW4A 1XDSA 2NXEA 3T7RA 1R8YA 2QE6A 4QQNA 1YZ3A 3FPJA 4IWNA 4MWZA 1PRYA 3GJYA 3UJCA 4FZVA 4PINA 3ANXA 3DH0A 4PYJA 1RI1A 4R8RA 2ZBQA 4RVHA 2Q41A 4X41A 4PYIA 1FBNA 3DXXA 3P2KA 4ER7A 2YQZA 1NW7A 4ER6A 5F2KA 2P41A 4C4AA 2QRVA 3G7UA 3FPHA 3CCFA 4EMSA 1JR4A 4YMHA 4CTKA 2OO3A 3V97A 5M5BA 3I58A 3LX6A 5DLYA 4CKCA 3TR6A 4FSXA 5DRYA 1YFLA 5EG5A 4DKJA 4RYLA 1R74A 3D2LA 3DOUA 3BGVA 3M70A 3HNRA 3SVZA 3ELWA 4GQBA 2AN5A 3G5TA 5HIIA 4DF3A 5F2NA 1XCJA 2C7PA 1KP9A 2IH5A 4LG1A 3M33A 2UYOA 4FS8A 5B1SA 3G2OA 3E23A 3LECA 3TMAA 1P39A 3BWCA 1XTPA 3JWHA 3H2BA 3DXYA 3AXTA 2LD4A 1O9GA 2XVMA 3I5UA 1RI2A 2NXNA 2OB1A 3E8SA 2AVNA 1ZHFA 3CJQA 4IV8A 1N2XA 2N47A 3Q87B 3C3YA 3M6UA 3PT9A 5DT2A 1NW3A 3ELUA 3PX2A 3P2EA 2YXEA 4PGGA 1EIZA 2AS0A 2PY6A 3QV2A 4YUYA 1U2ZA 3FYDA 3BWMA 2CWWA 2XVAA 4KDRA 4X1OA 5DM4A 2PT6A 5FHQA 1YUBA 4C08A 2PWPA 2ZIGA 3DTNA 2AOTA 1EJ0A 2YXLA 3LSTA 5EOVA 2XYVA 1QAMA 3EMDA 4PYKA 4OQDA 4X61A 4X60A 3OFKA 4LWOA 1KYZA 4C04A 1B42A 3LBYA 4HTFA 3B3FA 3LDGA 5LQRA 1HMYA 3KPYA 1ZKDA 5GIOE 1RJEA 2ZIEA 4PYMA 1NW5A 2GB4A 3BUSA 5EQJB 2ZCJA 3LKZA 1RI3A 2PSSA 2ZULA 1Z3CA 2ZSUA 4MIKA 3RIEA 4MQ4A 2G71A 4AZTA 4EVIA 5DRTA 4E70A 1WG8A 2AR0A 3P8ZA 3RW9A 3UJBA 1YFJA 3GGDA 2B3TA 4OA5A 2VDUE 5LQNA 1M0EA 2JHPA 3NWBA 4RTKA 3JWGA 3DMGA 1XCLA 1KIAA 3FTCA 4C07A 2GS9A 2FRXA 2WA1A 5EPEA 5EVJA 5KQSA 3P2IA 5KS2A 2XYRA 5K8VA 3CJRA 5GP1A 5EMMA 3JWIA 3KKZA 3NDJA 1WZNA 5K0LA 5LQAA 3BXOA 3MGGA 5KYGA 2UYQA 5K0GA 1P1CA 2ZIFA 4XUEA 3OE5A 4QTUB 2PVCA 2ZWAA 1M6EX 3GDHA 4K6MA 5HIKA 3EMBA 3IHTA 5F2OA 4ISCA 1XDUA 3MCTA 1I1NA 4DCMA 3P71T 4M38A 4RTSA 1RJFA 4QQKA 3NW9A 2IBTA 1OR8A 1JSXA 5DM0A 5JUWA 3HVJA 5G02A 2IPXA 1VBFA 5EMJA 2JH8A 3VSEA 3BWYA 3EGEA 5EZQA 3KR0A 2C7OA 3G2QA 3NTVA 4DCGA 3ID6C 4CWAA 4C06A 1L3CA 1R00A 1YB2A 1X1DA 2KW5A 3ME5A 5E1DA 3EGIA 5FQNA 5U4XA 3CVOA 5DTMA 3SX0A 1INLA 4EK9A 2QRVB 3FTFA 3HTXA 3BKWA 4RWZA 4UOEA 3TPZA 1L1EA 1ORIA 2AOXA 3OU2A 3IV6A 4PNEA 1L3BA 2P8JA 4PIMA 5K05A 2NP6A 2BM9A 3OZTA 1N7JA 3LCUA 4HH4A 2ADMA 5K09A 5FHRA 4Y2HA 1WXXA 2VS1A 1L9KA 3S68A 4CKEA 1FP1D 3EGVA 4L7VA 5JR3A 5CD1A 3X0DA 2GA9A 3LKDA 2YVLA 3UBTA 5EHIA 4YV1A 3M6XA 3FPEA 3ERCA 2CL5A 5H02A 1BC5A 5HEKA 3VC1A 2OZVA 3DMHA 3WSTA 2G72A 3TM4A 3DULA 1X1CA 4C05A 3G89A 3UA4A 4FP9A 3FZGA 3GRRA 4XCXA 3P9CA 4KIGA 3B3JA 4IV0A 4CTJA 2HTEA 3B89A 4U7PB 1AQJA 4HGYA 2EJTA 3MQ2A 5GM1A 3KR1A 2B78A 3KPUA 2VP3A 3PX3A 1G8AA 2FK7A 4ER3A 1BOOA 4ER5A 4OBWA 1FJXA 3THRA 2AOTB 4OQEA 4DMGA 2P3OA 3TKYA 5BXYA 1O9HA 3I64A 5K0FA 4OX9Y 1Q0TA 1RI4A 2B9EA 2CKDA 1ZGJA 3GCZA 4LWPA 3KPVA 2HR1A 4MHTA 4HTFB 3JWJA 3KR2A 3HVKA 3VYWA 2B25A 1TPYA 2PX4A 3UJ7A 3NWEA 2PXAA 1I4WA 3SM3A 4E33A 4C03A 1KXZA 2ZVJA 3A26A 4RVFA 2EJUA 3SXJA 1F3LA 5ERGB 4R6XA 1N7IA 4GUAA 3KQVA 1IXKA 5E8RA 2AOVA 1R18A 3KPJA 3LGAA 2OYRA 3EVGA 3C0KA 4P7KA 4PYQA 4ATNA 3GU3A 1NKVA 3O31A 5CVEA 5LQJA 2ESRA 3AXSA 3GIWA 5DM2A 1VLMA 4H0NA 10MHA 2ZZKA 3HCFA 3LCVB 3LL7A 1Q0SA 3FYCA 2B2CA 3KQMA 2Z6QA 1IY9A 2Z6AA 2HMYB 5IH3A 5LQUA 5FUBA 4FGZA 2VDWA 4FSDA 2O07A 2F8LA 2IP2A 1JG2A 2ORED 3AY0A 3EVEA 5EEHA 1L3IA 3P97A 4RTNA 3EVDA 2A14A 3F4KA 4BLWA 4ZTBA 4POOA 4RTJA 3K0BA 3KQSA 1M6YA 2PXCA 4A6DA 1SKMA 3IYLW 4DZRA 1WY7A 2HNKA 1SQFA 3HA7A 1JQDA 2NXCA 4YUWA 3KR9A 2AZTA 4V0QA 5E2AA 2PKWA 4AX8A 3EVZA 4FT4A 2R6ZA 5DSXA 5DSTA 2P3LA 3SSMA 3UFBA 3CBGA 9MHTA 4M37A 3G2PA 4RVGA 3DLIA 4E2XA 4E31A 5C9ZA 3MCZA 3KHKA 2G8NA 2OBFA 1JQ3A 5E8JA 1ORHA 3A25A 5KQRA 2JH9A 2I6GA 1UIRA 3HA3A 3HCDA 3QOWA 2UYCA 3R9XB 2XYQA 3Q7EA 3LHDA 3PB3A 2CMHA 2P7IA 5CCXA 4RTRA 1NBIA 1AF7A 2ZWVA 5CIYA 3O4FA 5LSAA 2BM8A 4EKIA 2PGXA 2FCAA 3FUTA 4KDCA 1QANA 4GOND 4BP3A 4GC9A 3VC2A 3EEYA 4GF5A 4DA4A 2ZZMA 2PX8A 2IH4A 5T6BA 4E2YA 4AZSA 1KPHA 5EMLA 2P3QA 1NT2A 5EGSA
chains in the Genus database with same CATH superfamily
1X77A 2VI5A 1SG0A 4W8OA 3O38A 3OPMA 5E6UA 4E4RA 1POXA 3PLAE 1WAMA 1UQTA 4RTQA 2EP5A 2RDMA 3T1NA 1PW7A 4UVIA 4G4GA 1DT5A 3SDSA 4CG1A 5C18A 1NMXA 5JW6A 2KI5A 2J46A 2OO5A 5KNBD 2X3YA 2PWZA 2Y1EA 1SVMA 2ZYTX 1HO3A 1V8OA 1CU1A 2XT6A 3FUUA 2EZ4A 1L7DA 2HSWA 3FR8A 4LCEA 3OF3A 2XWBF 4OMUA 3VPCA 2OM6A 3NAZA 3BL5A 4JLUA 2AN1A 1ECGA 3RJ5A 4ZCRA 5K45A 2V7VA 3TTWA 2QGFA 1UBJS 2MSEB 1JSZA 1XD2B 3WYFA 1EK1A 4RS3A 3IOCA 2E4WA 4M9SA 5EP3A 1ISFA 3PEFA 3HUUA 5JVDA 1W36C 3HR8A 3E58A 1HOXA 4ETIA 2ZSFA 1ZRSA 2GVDC 1E9SA 3S1LA 3A6ZA 3RUEA 3ZU3A 2HRDA 1JIVA 4LS3A 5F4BA 5HIMA 3D8TA 1FU4A 1JB1A 2ORWA 1HWYA 4H7HA 1R6XA 1DWOA 3C14C 1CF2O 1H5QA 2GCIA 4NP6A 3P9QA 2IU4A 2Q50A 1JLLB 1U9JA 3E7PA 2FYTA 3W5HA 1W0KD 1W2GA 1ZQ9A 1N2BA 2W2QA 4FM9A 1WV1A 3F49S 4ZEWA 3I39X 3L8HA 4KRYA 4ZO4A 3V1LA 3A6EA 4R8VA 2WWIA 3QOFA 3RC3A 1GU0A 4H1UA 4B43A 2X42A 3CRZA 1OOEA 2PZEA 4IX1A 4JC4A 2HLDA 3MJ4A 1R9MA 4BNDA 1JWBB 2QZZA 3CNOA 4MP8A 4OJTA 1BX3A 1V26A 3KYDB 4RDHA 4FNMA 4JA0A 2QAJA 4IDEA 1EWYA 2E4XA 4MWCA 4PZ0A 5JCOA 3ZU5A 4EKGA 1OXKB 3D4OA 3GUHA 3LLMA 2HSGA 2BFBA 4GRDA 2CBZA 2JD0A 1KARA 1XFAA 3E15A 6LDHA 1QF6A 5AVSA 4Z4HA 1ZNQO 4PTLA 3PENA 2FWRA 2O3TA 4QC2A 3PC6A 4Z2YA 3RVNA 2OXRA 2AVDA 4L28A 1T0HB 3LOPA 4V1CI 3RK1A 4WE3A 5ICSA 4RXUA 3A2LA 1L7BA 1EFAA 4FJ0A 4M7PA 4TX1A 4IIJF 4PQGA 4I1RA 5DKFA 5HFNA 3DAFA 2V8BA 4BX9A 5K3SA 3AFOA 3S2EA 5K0CA 1I30A 3C3WA 1OB5A 5KKCA 1N8KA 5JD4A 1OBFO 1Z63A 1NXWA 1DARA 1K6EA 4FYKA 1LX7A 1I2AA 2WTNA 2QPOA 3BXEA 1UDXA 2QDKA 1TW3A 1JRLA 3DPIA 3ORHA 1UJ5A 5AOAA 1EXDA 1T36A 1CZUA 4X63A 2Q45A 2BI4A 3C74A 4TLCA 2WFZA 1FVXA 3ND9A 4A5SA 4UNRA 1N2GA 1H2FA 2RAPA 4L8LA 3RK0A 4Q3EA 4WESA 3WYGA 2C8JA 4B40A 2HJWA 2NUTB 1PR0A 1G4UR 2WD7B 3A28A 3CBQA 4L1KA 1K92A 3F1LA 1P4JA 4YC7A 2VPIA 3EZ2A 5CVUA 1H2AS 4P86A 4Y2JA 2RC5A 3W0LB 1E2KA 4JI1B 4DLPA 4URVR 4IH1A 2DKNA 4UE6A 4ZYXA 3O7WA 2FPOA 2WHRA 3WNQA 3TOZA 4G9EA 3U60B 4D98A 5CU7A 1XTSA 5CEEA 3T5PA 2ATIA 3X2FA 1E77A 4LCBA 1M2OB 4EUKA 3WK5A 2BISA 2OSBA 4MR9B 1SM4A 2ZIAA 3EMVA 3MFQA 2VSQA 4XVQA 1E3EA 5MHTA 1NN1A 3KWMA 3VTFA 3G1TA 1SUEA 3NCTA 4F5EA 1WOMA 1ICIA 2G25A 4EUNA 3O9ZA 1PFYA 3I01A 1N5KA 5DBOA 3LH5A 2WYHA 4IHQA 3RFXA 1ZOSA 4BO7A 5CA1A 3OM8A 5HM8A 4FEYA 4MW9A 4KAAA 5DLDA 4C4RA 5DLQC 4UDYX 2UYYA 4X7MA 3PFIA 1AGNA 2WUVA 4G1VA 2WAYA 4AUMA 2XVXA 1I7QB 2ERCA 1HYHA 1RTKA 1PR5A 1Z6PA 3DBLB 3IQGX 3DL2A 4AG6A 3JRWA 5JO0A 3WHLA 1V8FA 1ATIA 1U8EA 2WZBA 1O94D 4FHCA 1IEWA 2CLFB 5DTRA 1RRPA 1QH8B 1YJXA 5AW0A 2XKBA 2XGGA 1M2KA 2QM3A 4O2BA 5KVAA 1N32B 1Z73A 5GAJA 1GDDA 3MCWA 3SYTA 1C7FA 5M7EA 2WUGA 5TRTA 3LYUA 4A2WA 3R0QA 1MEJA 1XRLA 4AKSA 3AHCA 1BSVA 2Z58A 3UBMA 2PLNA 4YASA 3GWZA 5A2QA 5GZ1A 3T5GA 2PLWA 3ZEAA 1I2MA 1IN7A 2OB2A 4JSTA 1K7CA 3HADA 4WKPA 3SFTA 4ZYYA 4C2UA 4LNUB 2MU1A 3D0OA 3SQNA 1U0EA 2F3UA 2ZR7A 3T7JA 5A4KA 4LRWA 4W1RA 4UAUA 2D3WA 2VPPA 1VL0A 2WLSA 4ZU3A 2QX8A 1I01A 4EI8A 1BJTA 1XJ0A 1TADA 2HAEA 2P69A 1V95A 1W85B 2E1RA 5BYAA 3OQ6A 3PQ7A 1RM4A 1BXRA 3FNQA 4DYHA 1RWOA 4HLDA 2XW6A 4B5KA 1IM8A 3QXSA 3ADDA 5FTMA 3CRRA 4IXTA 4IDFA 3BFJA 1TXGA 4XDZA 4Y7CA 4MVJD 1P0MA 1H0HA 4R7ZA 2PDAA 4BO1A 3NRBA 2B61A 1FVOA 4YRDA 3RTCA 4DEVA 1Y6GA 3DKKA 1EBFA 2FOIA 1ZGCA 4B3BA 1CEXA 4YUXA 1RWVA 5E1BA 4D57A 4ZEVA 4IKPA 3DVQX 4TKUA 3X1JA 4E5NA 2EARA 4J76A 5CDFE 3A7EA 4GXNA 1RJWA 4L51A 4RPGA 1YONA 4KH0A 1Z0DA 5SICE 3WFIA 2PFSA 4PZPA 2HPHA 4TVOA 2QPTA 3N0RA 1BS9A 2BEWB 2PUHA 3K9GA 3DL0A 4C2AA 4EJ0A 2R7LA 2PSHA 4RHUA 2DC1A 3CH4B 2VYND 1XVUA 5DBHX 4JA2A 2FLWA 4GC5A 4HQNA 2UYHA 1TCBA 2C9YA 4GZLA 2BKLA 2QN8A 3VU1A 5U9CA 3SS7X 2WNSA 3V34A 1OPRA 1JKJB 4FFDA 4E3ZA 3IQFA 4HDSB 1JI3A 3RS9A 1A95A 4BNFA 3IESA 1ZUWA 1EM8B 5LB4A 2VF5X 1T3TA 3KAQA 1E0KA 4IY1A 3E8MA 1Z82A 4GPBA 5FOVA 5KYNA 1D6JA 4ZIRA 4FGUA 4PO3X 4RV9A 4PO9A 3OCVA 4KIFA 3ICEA 4EKYA 2QJFA 3RYCA 3VPGA 4NBKA 2PXHA 5FNVF 1ZCZA 4NV0A 3V7UA 2NIPA 5BSKA 5CJ2A 4OKSA 1Z0IA 2BHTA 5J3JA 5ALGA 1NI3A 1ZZGA 4KW7A 8AT1A 1DIAA 3FLBA 4AB1A 1IJFA 4NY1A 1PS9A 1YDMA 2J9FA 2PGLA 4RVNA 1ZW6A 1ZI6A 4QT0A 4MLCA 2SKDA 1NUPA 3DZCA 3SZ3A 1EFVB 5TY0A 3LRXA 2OHXA 1P5JA 4FZVA 3U3JA 3KZ1E 2X0NA 1CF4A 3ZY2A 5KYVA 2GWHA 1MX1A 3C3XA 3H4IA 1GA6A 1J0XO 2PNFA 5HIAA 2HF7A 1FP6A 3ZCXA 3ORFA 1NUAA 3BGOS 1XZCA 3WGGA 3KBBA 2GZDA 5H4GA 1AB5A 1TF5A 2DHRA 2ZIXA 5A7GA 4DY4A 1Q12A 2VC2B 3IP1A 3ZLBA 4A2PA 2XYPA 1V8BA 3GJ6A 3T5AA 3TTUA 1A9OA 3HNRA 3RS7A 4GO1A 4FIDA 2DXIA 2VJKA 3H5NA 1VL8A 4MRRA 4Y2XA 3IOYA 3DDUA 2VIIA 4LXGA 1ADYA 3BXZA 2FU5C 3JWHA 3OCWA 2Q4TA 4NE2A 4WUVA 4RZ2A 2WE8A 3ZZNA 5AVXA 3MINA 3NJ4A 2RJ3A 5AXBA 3NIGB 4G41A 1NF8A 3SCZA 1WNFA 3A9TA 4E5SA 4RSMA 1HYBA 3C3YA 3OJFA 4GG1A 3V4PB 3QPVA 3N2NA 4Q9KA 4EJSB 4L16A 2WFLB 3W3AH 2E48A 1HORA 5I4IA 2O2EA 4WLEA 2HA3A 1RYMA 4LGMA 1JSRA 5DXFA 2XVAA 4ADSG 1CUYA 2PT6A 3HJNA 5IFKA 3CB2A 4ACAA 4B82A 5I47A 4H9GA 2O23A 5CVCA 5DBEX 5LP6C 3CINA 1QAMA 2ZSDA 3H19A 4LXHA 4DDHA 2FJPA 5L4NA 1QPZA 1OX4A 3ESQA 3QYAA 3S2GA 1US8A 3LDGA 1DFIA 5BW8A 5KYUA 2XXBA 2IS2A 2RGDA 3T99A 4AZ0A 3O93A 4UE3S 2GHTA 2WKQA 3U4IA 2QQGA 4XVCA 3KEFA 1Y8QB 3KKPA 1Q1BA 4MW1A 3M5DA 2OFWA 4H18A 3LUHA 4F5YA 2AR0A 4FN5A 4L5YA 5KCMA 3FCCA 3OPYI 4NZPA 2G88A 4BMXA 2JHPA 2C5BA 3MIIA 4H3HB 3PQ3A 2PKYX 2PEZA 4BNMA 1SA0B 4UNSA 5JISA 3GLFA 5HQ3B 2RGUA 3RSFA 1GXSB 4J3FA 4MINA 4TS4A 2A1UB 2ZIFA 3AHEA 1Y9ZA 1GR1A 4CMHA 2XMGA 2P9QA 3NKFA 4BV8A 2I80A 3JQGB 4B3RB 3IEKA 3EXG1 4BNGA 1JFTA 5HMLA 3K20A 3RHZA 4IHJB 4DCVA 2F1HA 3ANLA 3OG9A 3P2MA 1CQWA 2PVPA 1CE8A 1ILEA 3IAM1 4KAJA 3HJFA 4RVUA 4YBRA 4J7UA 3O8NA 4F04A 4IQ0A 4WZAE 5KNBH 5B6JA 2B8TA 3C16C 3WB2A 3LQRA 4IUYA 2IU3A 4K81B 2A2ZA 3TSAA 3TLCA 2ZTLA 3ACDA 4OHOA 3VU8A 5H0IA 2OO5C 2BD0A 2WUWE 2W6QA 3B6IA 1RBZA 1X86B 4KQHA 4NF2A 2A94A 2Y67A 5CX1B 3WK8A 2NX2A 1L4MA 1TLFA 3ECSA 2J5XA 5BYJA 3RU2A 4F3YA 2EQAA 3QWFA 1GP2A 2VYFA 3D6AA 3NBKA 4N3AA 2CNDA 1WXXA 3GGPA 3GY0A 4N7JA 3QLTA 1A50B 3TLXA 4Q66C 4ND6A 3OQ1A 5JR3A 3ZDZB 1K4YA 1C4KA 3AOGA 3FDJA 3ZG6A 4XIGS 5JJBA 1RZRA 3SM9A 5JXJA 3U81A 5FBKA 3T1OA 3WG9A 3PDIB 2RGBA 1THTA 5AVOA 3W5CA 1UWLA 3W5AA 4CIBA 3U56A 4UUAA 2PTGA 3A8TA 4JELA 5TPZA 4CTJA 1A9XA 1NQAO 1ZK4A 4MA4A 4XIIA 3C48A 2BGGA 5FAKA 1SPBS 2LDBA 1J7KA 2W7TA 2Z1DA 4LGVA 4B0PA 4HNUA 2XR1A 1G7RA 3HJCA 3W8DA 4FCVA 1R0BA 2OESA 2VP3A 3MIZA 3Q3GE 4R1OA 2R6CA 4X3PA 4D6YA 4YPVA 3KQHA 3U44A 3KKMA 3N2GB 4G8DA 3PPYA 4KGDA 1RI4A 1U2SA 1YRQA 4QU5A 1GU7A 1CVIA 1G21B 5K0SA 2VH2A 4A73A 4V3CA 4WFQA 3K0CA 3PPWA 5KUTA 2XTJA 4RH1A 1VE1A 2Q3LA 2H2WA 5EWLA 4UC0A 3TIGA 4KFCA 1IEXA 4RVFA 3SXJA 3GFRA 1GTZA 1EESA 3BMXA 5NULA 3TMYA 1HFWA 1X0VA 2ZYIA 2DBYA 4A8HA 1PFWA 4LHYA 1FS6A 1NASA 4UVDA 1VRWA 4HCJA 2WE7A 4P7KA 1G1AA 5CVEA 2I66A 3MCUA 1VYTA 4MX8A 2R8EA 3GIWA 2Q28A 5JJIA 2VAWA 1NN5A 3BWDD 5DTJA 1NVVQ 3D02A 1VMKA 4DANA 5G3YA 3A37A 2SICE 5FJJA 2G3YA 4E13A 4NE7A 2FPLA 1VGVA 1EPUA 1K88A 2IXGA 3AHFA 4LW8A 2RH9B 5EEHA 5JH7A 1EA7A 5KJ6A 1BVHA 4PNZA 4Q7QA 1MNQA 2A14A 3MJEA 2NU8B 2O54A 1J2RA 2QQEA 1H23A 4HZIA 2QRMA 4MKHA 2PUGA 2B99A 3AC0A 3KQSA 1T3HA 2C2HA 3THYB 3SNHA 5FBRB 3EFOB 4WPGA 5CM9C 4BWYA 1V1MB 2HC9A 4ITVA 4BNNA 2DUJA 1YMUA 4V0QA 1JAIA 4F3TA 3S8YA 1H4QA 3BL6A 1JKMA 1LDBA 2C9MA 3UFBA 1K2VN 3K4PA 3HSKA 2PRSA 3DLIA 2XKKA 1PQYA 4BPRA 1G42A 4HGQA 4N3CA 5BT9A 3L3BA 2DEUA 1NUSA 3ZY4A 5K3EA 5H7XA 5D51S 2H2DA 1I2CA 2ODAA 3PP8A 2CMFA 3CU5A 3ZCQA 2ZT8A 4ZHQB 3IDOA 2W6IA 2C4VA 1OWLA 4KZPA 2ODPA 3GV0A 4JMLA 4RAQA 4XSGA 1CUVA 1WB6A 2R7NA 4BKMA 5C1DA 1IXYA 1F8YA 2J41A 5DIZA 4NDZA 5TF0A 4LSWA 5F21A 3TTTA 3QQPA 1AVTA 4FBMA 3HS3A 5I9SA 2R2GA 4E2YA 1T2VA 2PX6A 1KFBB 1IBSA 4KI0A 4IQFA 4DY6A 1KYVA 4MWEA 5A62A 4URHA 3CZCA 3UXHA 2GRAA 4HKTA 4L3VA 1KI6B 4TXNA 2RSLA 4EO9A 1IG3A 3B9PA 3GGSA 5A4IS 1N5OX 4DSUA 3AERB 1ENOA 1W9MA 2IEYA 3HI6A 3E7FA 4BMVA 4HWOA 4NV3A 1GKKA 2R4QA 2W22A 5JSKA 1A72A 1K2WA 3GZNB 1VPLA 3ZS9A 1K5PA 1V71A 2AEEA 1JV2B 1RC0A 2I7DA 2QP4A 4NARA 3SHTA 3W04A 5U1PA 5EN4A 4P0TA 3A36A 1JEQB 4QAJA 2O9JA 3FWNA 3L79A 5LQCA 3U4QA 5A0VA 4DRZA 1YIAA 5JNUA 5AM2A 1SY7A 3ZHCA 1YR6A 2IJGX 1WTAA 1XVTA 1G2QA 4CNBA 5C7YA 5EHZA 1R9GA 4D9MA 1PZGA 1TJPB 1Y80A 2BFEB 2IIPA 2QAGB 3FHJA 4KN5A 1JXAA 2TMGA 2EJWA 2CNOA 3AHHA 4C7VA 2AC4A 4RTLA 4DQKA 1NI4A 1D03A 3G17A 3DM9B 4L07A 1OXUA 2XRFA 2A1TR 1P2BA 5EPUA 4FC6A 3BK2A 1HY3A 1K0FA 2GVNA 4G36A 4H59A 4QAQA 4UZSA 3NGLA 4G4SO 1XWFA 2GLTA 3B5IA 2BKAA 3KKNA 3RS0A 3UT0A 2HDNB 1KBZA 2DU8A 3MT9A 2D0IA 4W7HA 4YAEA 3DF9A 5ALLA 3C3AA 1RWQA 1XLWA 5LXTF 4BZXA 5HJEA 1OB2A 4A0QA 3TLKA 1DOHA 3G68A 2VDVE 1GNPA 1K7FB 2CC2A 4JGBA 4NXMB 4WLUA 1F8UA 4NYIQ 4ARZA 4REMA 4UTVA 1RFLA 3GELA 3U7EB 1IUPA 5JSYA 3CZPA 4FYHA 3MHPA 3VR0A 5FF9A 4PWZA 4PLYA 3CGWA 4NAUA 4IOMA 5ALFA 1D2AA 2B35A 1Z74A 2QW0X 3SXUB 3U80A 5KNDD 4KRGA 5FOTA 3GLIB 3NIDB 2FFHA 2BV3A 3E48A 3ZY6A 1C0EA 3GP8A 3GNLA 4R2KA 5DYTA 2AC2A 4MDHA 1L5KA 4DUGD 1KK2A 4O4HB 4DZZA 1MAVA 1YF3A 1U7DA 3IV7A 3CLRC 4PM4A 4JT9A 4R8LA 3DUWA 3W6ZA 3D2AA 5CCBA 2Z8ZA 4M0UA 2CXTA 2D1YA 3KCNA 4B6RA 2AGVA 2FZCA 3G13A 5CT9A 1Z29A 2X22A 4V0LA 2HBZA 3RT7A 1YS4A 2BZSA 2J5RA 1I3LA 3I2FA 3E82A 2EBUA 1G9TA 2O8VA 4G6ZA 4AW9A 3O95A 4FYPA 4RD1A 5L8VA 1I51A 3GFPA 2N3ZA 3MWLA 4Y2PA 2ZRLA 2ZITA 2J67A 5EHGA 3SIPA 5FO1A 3QKTA 1DX4A 3AZQA 3FZYA 4P4NA 5I7AA 3TUIC 3V8VA 3DP9A 3OX2A 4RFSA 4AN1A 5KJFA 3Q98A 2O50A 1PUJA 2PTHA 4PYOA 5FDFA 3S1SA 2QN6A 4MIOA 5GJVC 4BVAA 3R3HA 1TYEB 2WHEA 3T9CA 1J00A 3T06B 5DZSA 3RUCA 4X94A 3ZTTA 2I54A 2QLBA 4LRYA 5G41A 3AKDA 2HN9A 3RYHB 5DYYA 2X3FA 2HWKA 3AY3A 5AKIA 2X8LA 2P75A 3UKDA 1IJBA 3GUUA 1E4VA 3FN4A 2Y1KA 4C4OA 1F6BA 2HQOA 2JLQA 2Q29A 4AZ3B 2XD4A 2WVGA 3V2IA 1L5FA 3UMVA 4OM8A 3SYMA 4KJZA 2YWCA 4KB5A 4C0QC 4FR0A 3A2NA 4HAUA 1EHIA 1TUBB 5DXJA 1FS4A 1JR3A 2BJVA 2NUAA 3OP1A 4RSRA 3RF6A 1IHYA 2IQIA 3ZU6A 3EX7C 5AJXA 1Z6YA 5F1KA 1GCGA 1OIVA 1Z6XA 1KMMA 3KQWA 4UUOA 1XT6A 3NANA 3OOJA 4IVQA 5FI0B 1GRVA 2O6HA 2WJVA 5J9FA 4PHHA 1U7UA 2ZT5A 1GG9A 4Z3KA 1EXMA 1KPGA 2G1UA 2XECA 5T8KC 1FJGB 1P17A 1KXJA 3IMFA 1NBEA 3VZDA 3IHWA 1T5IA 3DW3X 4CM8B 4YRKA 5LU9A 4M76B 4E2WA 1SOAA 1JU9A 4QJ4A 3V8PA 3A9RA 1MB2A 2VJCA 1Y1TA 4JT4A 3PFNA 1R8JA 3PHJA 5EZ5A 2ICAA 4S24A 4AURA 4EM6A 5COBA 2O5CA 2VDMB 5KINB 3FKJA 3G0BA 3OJOA 2O14A 2CDAA 2JD2A 1Z16A 2RONA 3ICOA 3MOIA 1B3RA 1TFRA 2ES4A 3HHEA 1A7JA 3BE6A 3N7TA 3PGJA 4IIJA 5DBGA 3VU3A 2RGGA 2X2EA 3BIJA 1L5HA 2O59A 2WJ4A 3QEAZ 3F5SA 3RLFA 4RCVA 2YRFA 4R3WA 2QSYA 1O6FA 3R44A 4MI3A 4G07A 3KNZA 1KQFA 4LF5B 1QGUB 1J9ZA 1FRNA 1Y4ZA 3AF6A 2JGAA 1X42A 4NFLA 1BFKA 4WNIA 4PIVA 2CLEB 1C9MA 2WM2A 3GFTA 4FDUA 1E63A 1W47A 2YHAA 4UD6A 1E2BA 1B6SA 1HDCA 3OU6A 4Q3CA 3LP6A 3TRKA 1MX5A 1OFIA 4ZVLA 1UDBA 1TJ5A 5IT0A 1GKYA 3QVVA 4M86A 1AXRA 1V39A 2WU3A 1LFDB 3VXKA 2J32A 3E1KA 1VJDA 5GM2A 4ZTZB 1VKJA 1T9GR 4H15A 1GQ2A 3GFQA 3CCCA 3PNBA 4UTXA 4F2WA 5JC1A 3AFGA 3NNSA 3HFSA 2NNLD 1I7LA 4FHEA 2JFFA 2IY7A 1CP2A 4M55A 5AW4A 1T35A 4BNUA 3LXRA 3NBFA 1OLUA 1WUJS 2FF7A 2H2HA 2R60A 4DPKA 5DB4A 4QDJA 5JWOA 1NVGA 1UKYA 1TD9A 2OUKA 1NMQA 3O4VA 1S2LA 1NR1A 2WG0A 3PL5A 3L07A 3RFFA 4Z1OA 1BHJA 3J81A 1QIJA 1BFDA 3HZHA 2B2XA 1X9HA 4FMCF 1O8BA 2I78A 3K2BA 2GYVA 4WLFA 5HTKA 2H57A 2HL6A 1DCFA 5IT9A 3V4RA 2QRZA 4MWTA 1W5BA 4HNTA 5EWJA 1S8FA 4DQXA 1F9AA 4ZMBA 1WA5A 1S2OA 2ZSEA 3W1WA 3ZE7A 4PAWA 4UAGA 3W4KA 2XUDA 1U0LA 2V4UA 1R0WA 1XQXA 3PFFA 2JFXA 4BOYA 1UZAA 3KSZO 4HQKA 1PGNA 3R3JA 2FB9A 2XCQA 3TTSA 3UAOA 5AM3A 1QMGA 1XEWY 4J3JA 3V5NA 4DWVA 3NVDA 4QTYA 4ENVA 3OZXA 1TYZA 5KPJA 2ONJA 3S7TA 1MVLA 1E3WB 2Y0PA 3GJYA 2YINC 2J5KA 2LXNA 4IZOA 4LTDA 3H2HA 4PBTA 5DW3A 1CQZA 4WI1A 2RHTA 1PFQA 5TSDA 5AKXA 2GT1A 2JIZA 4ZXFA 1FBNA 4R4JA 3GVXA 3PCXA 3NYRA 1JDZA 4LRTB 2ENWA 1A4RA 3FXAA 4LRQA 1CB0A 2OO3A 3OE7D 4P7BA 3ENQA 1E96A 2YKGA 1V5GA 1A69A 3PQ4A 4RYLA 3K0CC 2IU0A 2C2GA 4BFTA 5ITSA 1W30A 1FU7A 1ZGHA 3HLYA 4N5NA 3V9AA 3JW8A 3VJMA 3HYCA 4P0PB 3LA8A 3UOGA 1SUWA 2LIVA 1HTTA 3QX7A 4V2UA 2GM3A 3DXYA 1HL7A 1ZJ4A 3MWKA 1O9GA 3G0CA 1M1YA 2IPOA 2MSKA 221PA 2XF8A 4RESA 3CW9A 2YC2C 3QI2A 3OT1A 4MR8A 3IRUA 4X90A 2EP7A 2LRHA 2LIPA 4DLRA 2NU7B 4PSAA 3NZEA 5TQ0B 4D6PA 4YRSA 3RUDA 2QRQA 2PY6A 1G21E 7ABPA 1TYDE 1B93A 2A9PA 3U48A 1OH8A 4N5MA 1DHRA 3L92A 3F2IA 3I9OA 3NOVA 3U09A 3BORA 3S2FA 2WEKA 4CZ2A 1U5BA 1T2AA 1H05A 2X1HA 4I5GA 1JMYA 1Z4LA 4D4IA 5BN3A 1EJ0A 2ZROA 3FSGA 4I81A 3CUUA 4UBLA 3KSBC 5LYJB 3KJNA 4UBJA 3MTQA 1CJKC 4LWOA 4HVLA 1JT2A 4MVJE 1Q1QA 1W46A 1M34B 2JARA 4MRAA 3CH6A 3VNAA 1P0CA 4K3VA 3UUEA 2AJBA 4J4TA 4QDZA 4TUYF 3SE7A 3NR2A 4L4XA 4MQ4A 2G71A 4EVIA 5BRJA 1WG8A 5T57A 2E4UA 2H7YA 3Q85A 4G9GA 4GE0A 4ZCIA 3ASYA 4WJKB 1O7JA 1P3JA 1LY1A 4R84A 4LE0A 2BFCB 5K8VA 1IIBA 3NHPA 4HUJA 2C9OA 3EQ8A 4LVCA 4DLLA 2CV0A 1WZNA 3GG9A 5DO9A 4DBVO 1TEZA 1E79D 4XUEA 1XAJA 1PEAA 1YE3A 4MGZR 1OF1A 1WW3A 4MV0A 1FSSA 1CHNA 1E98A 4RANA 3NW9A 2NACA 1LBEA 1V25A 2WIAA 2H4WA 3GCDA 4DQDA 5A2GA 4TV8A 3K2QA 4JQYA 1GTJ1 2MYUA 3L6EA 1TCAA 3GBVA 5EZQA 4BE7B 1T4CA 2C7OA 2BVNA 4IJQA 1JFVA 1EQUA 3EFHA 5DIFA 3IUBA 1ST2A 2J4CA 2QJRA 3DA8A 2ZRFA 3P4UA 1KA9H 2WWFA 2B98A 4J2HA 2YFKA 4MUBA 2Q4BA 3HTXA 4CQMD 2VNIA 1ODLA 7GPBA 2AOXA 4UEQA 1M2EA 4MGIR 4QDOA 3GRFA 4GDMA 3R4VA 4ZVKA 1KWGA 1OYOA 3N9IA 1TZ2A 5BUSA 1UZUA 2D62A 2XWJI 4XYLA 2WFAA 2O8CB 1U2GC 1J0EA 4UNPA 4MRMB 4V3BA 4UHCA 2JK0A 4WERA 1RXVA 4A82A 4CIVA 2VDNB 3NHYA 1RLOA 3GJTA 4EHBA 5KYXA 5E4JA 1MIHA 3K2IA 1QHHA 3FYTA 2C61A 1DV1A 2NW6A 5JS8A 1I13A 2PSDA 1FLVA 5DJ5A 5EIOA 2HWXA 4FP9A 1K8QA 4DUPA 1VPDA 3OOHA 4TQ9A 1YL5A 1PN3A 2I6QA 3L46A 2HJSA 1AKVA 5BVGA 3HKDA 4BLSA 3H0CA 3QNUA 1U0BB 1YUMA 1JA1A 3KETA 2R8XA 4FR2A 3HBFA 3WB0A 1BOOA 3ROPA 2IDZA 4HDCA 2AOTB 1HM5A 2TMYA 1SCJA 4R1PA 3VR6A 4D9KA 2JLVA 3SZUA 4BATA 1MJHA 5M3BA 1YCFA 3HY3A 3KCQA 3JAWA 2XNDA 3T3EA 4CRWB 4F92B 1AKMA 1JEAA 1NVVR 4Q01A 4TZ6A 1JJAA 3MEQA 4RQUA 4S1WA 5JQGF 1RRFA 2VAPA 3CT4A 1OT3A 4YJHB 3TUJC 2FWPA 3DEAA 3PF8A 2QTFA 2BBWA 2PD4A 4HDKB 4OMCA 5JZBA 2QQ5A 5EE3A 3EIWA 4URYR 2HREA 3OLZA 4MWGA 3VKVA 3FOFC 3O83A 3GRPA 2BE9A 2OCBA 4GI2A 1VXRA 3FMOB 4CF3A 3EVGA 3D59A 1XN4A 1YDWA 5LQJA 3OOSA 3T1HB 1A0OA 3TDKA 4IILA 3KM0A 1V47A 3R8FA 4L5AA 1Y3IA 2FPGA 3U5ZB 1R0LA 1SHUX 5I7VA 1IOLA 1Z26A 3ZUGA 1Y3HA 3M5WA 1CRPA 1IOWA 4LZZA 2E5FA 4M83A 1GRCA 4KKVA 2VDWA 4XFKA 8GPBA 3OHSX 4UTNA 4XSVA 1U2EA 4RMNA 1EVYA 4KFRA 3DEFA 1EEHA 2PUVA 3L6UA 1TCUA 1MW9X 1LB1B 3BBLA 3D3NA 1VHTA 2NYVA 3QWBA 3WA7A 4P8RA 3DE2X 4V1CB 5AVUA 4R31A 2J6HA 2W4MA 3B70A 3EH1A 4PG6A 2E37A 3IYLW 2P6NA 2AEJA 2BSAA 3EIEA 4RIEA 4YDHB 4AWAA 3VPSA 2HI0A 2WHPB 2P9CA 2NO6A 4HAOA 3LQ4A 3PHCA 3SZOA 1GNRA 1MORA 3NFRA 5JBIA 3GLIE 2G9ZA 2JCXA 4RMJA 3V42A 4E2XA 5IT4A 2N0SA 3CF2A 4CL3A 1BAPA 4COOA 2JFVA 2OGTA 2Q9UA 2V98A 4RK4A 3QRWA 5EJ9A 2JH9A 2XITA 5BV1A 5KQRA 4ODIA 1XI2A 3LC1O 1VG8A 2CUNA 3EVTA 4ARUA 1XD8A 3O4GA 3IELA 1GY8A 5CXUA 4JYPA 1JDBB 1E3TA 4IBOA 1NJ6A 1TVMA 1Z4MA 4LKOA 5C3MA 4MAMA 2QVYX 3HABA 4XGNA 3ADOA 3PQ2A 3WJ7A 4I66A 3QF7A 2FCAA 4KIWA 3WLSA 4S1NA 2F4VB 3QKIA 2J5QA 1LZLA 2IH4A 3GR6A 2W83A 1M1XB 3UWKA 1U0FA 2JLWA 6GPBA 1VCHA 5F23A 2RBKA 2VHYA 5FL7D 4EGFA 5GIPE 1Y5MA 2CXHA 2WDPA 4OIMA 5LQDA 1LC0A 1NAHA 3L1VA 2Y9MB 3HI4A 1WDKA 2D7DA 5JLAA 4XVUA 4DSTA 2A5YB 1ZD8A 1KDOA 1OBCA 2C3MA 1SHTX 5KTPA 1X7HA 1ZXXA 2AN3A 2D74A 3HJBA 3OEHD 4G86A 5IXSA 3RFVA 3TR0A 4LX0A 2NZWA 1YBHA 3HXOA 3SJZA 1PL8A 2FX3A 1UUFA 3UC9A 1PI3A 3B13B 2OILA 2J87A 3HCPA 2P9FA 5CT4A 2Z2ZA 4ZVTA 2XMPA 4FT2A 2FMUA 3MS7A 3AVXA 4KQCA 1QAOA 4GVXA 5AJTA 4EG8A 4FR5A 1XOIA 4FFBA 4HLQB 1AMOA 2CEAA 1SD1A 1BVYF 2YHIB 2R68A 5FUQA 1D6SA 3WSWA 2VNJA 2ZBEA 1BE8A 4OHVA 1L5VA 4ZDIA 3K0EA 5JCXA 1P29A 3OKFA 3K31A 2HY7A 4MTCA 4TMYA 3TIIA 4KPYA 2V97A 4D8TA 2XF2A 1QZUA 4TN5A 4EPYA 3V46A 3KP1A 4C29A 4LZLA 5JO9A 2Q6VA 1NDQA 2ZJZA 4KBFA 4TTQA 2ETVA 1T0JB 3SBOA 1MT0A 1T13A 2ZR8A 3MWDB 3UJDA 2VPWA 1OAOA 3H8SA 2BOVA 3IO3A 1GVNB 4YJKA 3MLAA 3W5DA 1EP1B 2ENUA 2GPNA 3H8WA 3C6QA 3L8GA 4CI9A 3L7MA 3IAFA 4E88A 2DWQA 5AW3A 2CXOA 2C7QA 1VMIA 3ORYA 2F8SA 3ANNA 2DHDA 1TZJA 1U1GA 4D81A 1GL6A 3RIYA 3ABSB 1VP3A 3JASB 3K15A 3GJ4A 4ZJUA 4MVXA 5REQA 3EEOA 1WUHS 2DR2A 5AFSA 2BHRA 4LZWA 4Z9FA 2ZB3A 1PJ2A 2AOWA 3SKXA 1GAJA 1EDEA 2VUIB 3SC6A 1P7ZA 1NSYA 3MSXA 1KOFA 5E4FA 2UAGA 3ADCA 5EERA 5EKDA 2HRQA 1T1RA 1XJWA 4IHAA 4RK7A 4W9MC 1PTKA 4RY9A 1FCJA 1W5SA 3OPNA 1Q1AA 2JJQA 1A8SA 1IBKB 1EAMA 3AY6A 1KYXA 3IKTA 1Z35A 3EPPA 4QYWA 2Y05A 1YVRA 3UNXA 4KQMA 3UUGA 2AV6A 4FI3F 3OTHA 2FTKE 2B3DA 3AQIA 3B1JA 3BK7A 3DEZA 2Z9CA 3OEWA 3TSZA 1PNRA 2BMAA 5I7UA 1A77A 4CQMB 5K6AA 3UA3A 4EMTA 1R5NA 4M21A 1ZISA 1IQUA 3RAPR 8LDHA 2IZ7A 5BVHA 1UANA 2QN1A 1EQAA 1EM6A 1FA9A 1OAAA 1MGOA 3HDQA 3LRTA 4R68A 2GX6A 2Q3CA 2GM9A 3LLVA 4YV0A 4PCUA 1JGTA 3GG2A 1TX4B 3KOWA 2EKZA 5CVDA 2H29A 2P35A 3G7NA 3HYRA 3NLLA 4PSCA 1XUOA 1IBLB 5A6SB 5CLJA 4Z49A 2IUTA 2BPOA 1DADA 4QXQA 4C5CA 3HUEA 5IKPA 1TCVA 2GZMA 4ES6A 4B8ZA 4IW3B 1X7WB 5FULA 4OHXA 1PL0A 3DWFA 3UXMA 2R1ZA 4KR6A 4JLKA 1W2WB 3LBFA 5E9QA 1E99A 3MILA 4ZC8A 5KJ1A 2C8KA 1G41A 4AP9A 1U7ZA 1XX6A 2ZCVA 1FTNA 1Q1GA 3OZRA 5FYDA 1Z47A 3ZJYA 4RD3A 1J8QA 1G7CA 2Q99A 4MUEA 3WYNA 4XCVA 2GYWA 1JDSA 3U7RA 1XRPA 2IITA 3W3AD 4BNXA 1GQFA 4LVNA 5ALPA 4ZT6A 1PJRA 2NM0A 2FEOA 2XDQA 4NECA 4TL7A 4MB2A 3UXYA 3H9GA 2C1ZA 2YV3A 3GZJA 3HGMA 2O1XA 1JN0A 1E4YA 1I24A 1N5MA 2YV2A 3OLQA 3TLEA 3RSLA 3FROA 4GDFA 1QYRA 3COSA 1R6UA 1KMHA 3G9XA 5COQA 1EUZA 5F52A 3ZZUA 2FW9A 3TQQA 2Z08A 4PLCA 1IY8A 2A9KA 2HU5A 4PC1A 3EZ7A 1NBOA 1RYZA 4ED9A 4ZU6X 1HYEA 1XAHA 4G67A 3STTA 4TQAA 1UP6A 4NPCA 3WGKA 5KQPA 1KY3A 1Y9EA 4WZBA 1OH7A 3PE4A 2EBHX 3CM0A 2QY6A 4B3IA 1QFJA 1N2ZA 4OXXA 4ENUA 3LY8A 5E9JA 5KWEA 2XUJA 1SKQA 3W78A 3N6VA 3Q40A 2P2DA 2ZTMA 4MQ6A 3LVFO 3KSAC 5FWYB 2QU8A 2MSNA 1J09A 2WM9B 1XTIA 1XZIA 3ED1A 3KL4A 4GIBA 4Y1RB 2WF9A 5HBGA 2ZJFA 4AF6A 4GMXA 4CKYA 2WSBA 5LLSA 1HDGO 1WABA 1P2FA 2MT9A 2P1RA 1II9A 3CTPA 3ZYCA 2JZNA 3D4IA 5P21A 1MHTA 5CH5A 4NXNB 3T4UA 1U3DA 4Y18A 2D5BA 2I1LA 3UHAA 1E5TA 4IMIB 1NBAA 4DQ0A 4H7FA 3V6LA 2AF4C 3ZE2B 1JE1A 4ZVMA 4IG4A 1DKNA 1P6XA 3UV3A 1SUSA 2M2IA 3GRYA 1I4DD 4XPIB 3ZBTA 3UZUA 5IVHA 3ER8A 3EQ2A 5BSHA 1C1DB 2YYYA 3ZXYA 2JS7A 2QL6A 2C59A 1M34E 3IFSA 4XJSA 2AN4A 1FX0B 1CUZA 3KB1A 1QYVA 3L7BA 3IEIA 1P5FA 3MAGA 3OA2A 3OM9A 3LU1A 3KZCA 4RGQA 3RUIA 3ZGOA 1IBRA 4JLPA 1N25A 4AJNA 1VSQA 4DJFC 1E9CA 5I48A 3COPA 1WPQA 3SEZA 1J5EB 2ZI5A 2QG4A 5F3DA 1SU4A 2IDKA 2ST1A 4BVHA 3A27A 3HGQA 2Z6UA 2PBZA 1I3MA 5E1OA 2QVZX 2GBCA 3NV9A 1DBRA 4ESOA 1XG5A 4I9FA 4ZDJA 4R6WA 1HPLA 1U7WA 3ONEA 4UFNA 2CVPA 2WHXA 4B0OA 2CW5A 2PN1A 4IJMA 1SUPA 2WF5A 3EOBI 1G7TA 1TQHA 3F6RA 1DB3A 4IVRA 5EY5B 1CF9A 1U8CB 2AJDA 3CWCA 3KOZA 3QKSB 5CH3A 3UB4A 4G56A 1CLUA 1R5BA 3LX5A 5LL6P 3BWBA 4KN8A 3CSSA 4TV9F 3WC4A 4YLYA 3V4VB 3N8KA 1VOTA 1P1BA 2CGEA 5JCJD 2C4UA 1N3YA 1U3VA 4YRLA 5H9WA 2C84A 2RAUA 4MS1B 3BH0A 3CY6A 4GICA 3ZV3A 5K8JB 2RHDA 3Q11A 2XOKD 2A5GA 4WQMA 5AESA 5LQKA 1QP4A 1A98A 2JI8A 3DYIA 2CXUA 2P9HA 3QE4A 2Y68A 4GOLD 3ORQA 3K6RA 2D1RA 1NIPA 3P9SA 2JEOA 4LI3X 1NBWB 4Y2YA 1J1UA 4L22A 3DZFA 1Q1EA 3PJRA 3QE2A 3UW1A 2AFHA 2H5JA 1R1DA 3WAJA 3IIEA 4P98A 5JATA 5K8CA 5HPYB 3A1NA 4D3SA 1XZFA 2P6OA 3DWEX 2NTVA 4LRSB 3O90A 2AUMA 1FMLA 2YFQA 5EMHA 6ADHA 1TJ4A 3LX8A 2I2AA 1PT7A 2P41A 2Q2WA 2P68A 4KNWA 2Z8YA 1V7PC 2GLXA 4ZXPA 1IN8A 1C7JA 1KTVA 4LQLA 1M5TA 2EWWA 3U4HA 5I7WA 5M5BA 1L4UA 2JFQA 2ZR9A 4Y9UA 3LW8A 1RBMA 4ABYA 4WFKA 5DRYA 4XB6B 1MAWA 4N3BA 3DOUA 3EK2A 5ELMA 3VR5A 5LUBA 1KZ4A 4IIXA 5H5JA 2AN5A 4QFDA 2QG9A 2W2LA 5JJLA 2PWBA 1PFVA 5IAEA 3K9FC 1WDLA 1KMQA 2C20A 3T0GA 2RH5A 5B1SA 3STVA 2B2NA 4ALJA 3PD0A 5BMVA 1KZ1A 2C2YA 3GJ8A 3UFXB 5FP0A 1I0LA 1Q2XA 2VO1A 2ZYDA 3PHIA 4UBIA 1ZRNA 5IJWA 1H2BA 2WIFA 2YZ7A 3GVCA 1N2XA 2P2NA 4N6GA 1JS1X 1A9ZA 3PXAA 2PX0A 3PX2A 1EE9A 3E4DA 1MRSA 4RKQA 1UC9A 1Y81A 2AS0A 3QV2A 5ULLA 4F0JA 5FUVA 2QQFA 2CWWA 1F6DA 1YQ9A 3Q9UA 4KXYA 5HSGA 2HX1A 1B0PA 3LTEA 1E0SA 1M0WA 1F2TB 2YOGA 3ET5A 3QKRB 4MYDA 5JWHA 4TKLA 3ZHTA 4PFJA 1TT5A 3F67A 2Y1DA 1SVOA 5JMWA 3ELBA 1XWWA 4HTFA 1XIVA 4PN3A 2PS3A 2W2KA 1P75A 3DCNA 1CZKA 4N0PA 1A3CA 3WLPA 4LF4B 1DAKA 1NW5A 2IK8A 3LKZA 2JJ2D 4MMXB 3NHSA 4LJ4A 1E1LA 2DTDA 4OB8A 1USUA 2CSUA 4WFJA 1YFJA 4XOIA 5ITVA 4AC9A 4BO2A 2PBLA 5LQNA 2ZSJA 4NMMA 3NWBA 4MSUA 3SEQA 2EHDA 1PJLA 2VUUA 1SC3A 1MB4A 3GMIA 3NTOA 4AKEA 4AS3A 3COZA 1QO0A 3PE6A 3ENKA 4CIDA 3EPLA 5FI3A 3JWIA 16PKA 4Z3DA 2QTWB 3RT1A 4YXWA 3VHLB 5FUMA 3MGGA 3UPDA 3KSDO 3I9MA 3LC0A 3NTLA 1M6VA 5K0GA 3QEBZ 4QTUB 4MRVA 1E8DA 4MLZA 3IXMA 4QUGA 3QFRA 1QBGA 5ITWA 2FCRA 1EFUA 3HN2A 2WWYA 2GMWA 3V8EA 4Z4FA 4JYBA 3MB8A 1G5HA 3T3MB 3H2GA 4L2IB 1OR8A 3FSRA 4OYLA 4UQOA 4JB3A 1NZFA 3BEOA 1VBFA 4XGIA 3H3FA 5FTNA 1NDHA 3AESB 5CR9A 2B5WA 3FMVA 3SC4A 4UTRA 2WJ3A 1ZK3A 2VYVA 4W9NA 4PGMA 2JFHA 3LE8A 5A9SA 5JPCA 1DOAA 1RBYA 3T7AA 7AT1A 5J2UA 5BPFA 5MF6A 1H0KA 1G3UA 1GT91 1XTBA 4C0KA 4QBTA 4X1IB 3GN1A 4WBNB 2FKAA 4YRMA 3RWOA 4URWR 1U2TA 3F5FA 4RWZA 3LUBA 1RHMA 1L1EA 1XJQA 1Q3HA 3FFTA 5GJWC 3BCRA 4PGFA 1WB4A 3CA8A 4Q7EA 5CAEA 3IMGA 1KEEB 4JLSA 1UJNA 4PIMA 2JGDA 4K9OA 4JLMA 3NAQA 3UEOA 1MZPA 2NG1A 1OC4A 3D6TB 5LNK1 4U2DA 2R11A 3ZZMA 3LIPA 5JJ5A 3HO1A 1UC8A 4IIBA 1OXBB 1XZDA 4ND3A 5DP2A 1YBFA 2ZEJA 4UD2A 1L5NA 1QKIA 3RS2A 3ZHZA 2ZI6A 1RYHA 1HURA 5HEKA 3AI1A 4ZI7B 3HRHA 4IGIA 3Q6IA 5CIWA 2XGSA 4QG3A 3PUZA 3R76A 1FXSA 1ZIOA 1BEZA 1GQQA 2DUMA 1AHIA 3HEBA 4I55A 4QO8A 1AH2A 1EFHA 2PGIA 4IINA 3FWHA 1OI2A 2XUOA 3DXFA 3ESZA 1EDOA 1NLZA 2HF9A 3OLYA 4L0DA 1E6WA 1PP4A 2OV3A 4Q3KA 5AKKA 2O2ZA 4IMJB 3WV5A 3JVVA 3TPCA 3ISVA 3Q7TA 2C2WA 1GL7A 2QN7A 1SC9A 3PHHA 4C43A 1ND6A 1DAEA 4TS3A 4DMGA 4L78A 1FSFA 5KVQA 2QTLA 5K0FA 2B9EA 2CKDA 2V4MA 4EF6A 1XALA 2DKFA 1OAOC 3E5RA 4M1ZA 5TQ2B 2R8YA 3Q88A 4M1MA 4TTJA 1ZN2A 4FTWA 2R1TB 3KSRA 1ILWA 2YMQA 3BJZA 3DZGA 3URKA 1NBMA 1PG5A 4F96A 1XAIA 4TUYA 5BUCA 4YCDA 2ZIZA 2QMHA 4J91A 5K3DA 1GLNA 1G59A 1V8ZA 2OCDA 2UUBB 2DAPA 3COJA 5ERYA 1QYCA 1RWPA 3AG5A 3ZNQA 1C41A 7MDHA 1RXCA 4RF3A 4W6ZA 4BO4A 4KH1A 4IWXA 4LY6A 4OI4A 4ATNA 1F1BA 4ZEOA 2PMDA 3BXGA 4Q9IA 1IAQA 3X44A 4GKJB 3M1IA 4I1YA 1YS6A 1UPFA 2VJDA 3O26A 4NZZA 4TWJA 3T9EA 4LXQA 1Q0SA 2BGNA 2X41A 3KOOA 2RK6A 1XQYA 4JJEA 1D2NA 4UM7A 5JADA 1OGIA 1P33A 1M1ZA 3MQFA 1QG2A 4GKKB 5K3FB 3V3KA 3DOCA 2IP2A 3TOXA 4BKPA 3ESRA 4OMDA 5GV7A 3AJEA 1C4WA 4PLWA 1B6GA 4Q02A 4WCDA 5IANA 4P35A 1WEKA 4R8KA 4DIMA 3JQ8B 1QM5A 3DZDA 3H1AA 2YHBA 1LXCA 3GFOA 3BEDA 1Q50A 4G89A 5IJAA 3UAXA 2W2OA 4MVJG 5DP1A 5HP4A 1QF7A 3SIXA 2NV6A 4UASA 1GG2A 1E0AA 1OWMA 3RRZA 4RK0A 3QEJA 4YRTA 1RAGA 3MCZA 3C7AA 2B0JA 3W8RA 2B7LA 4NX2A 1JQ3A 1GAWA 3AIMA 4BNLA 4YLGA 4YJ2B 1G19A 1T2EA 1IHOA 3R7AA 4EARA 3TLAA 3TD6A 3LHDA 1U2PA 5AKHA 4OGFA 3HMKA 3HJUA 1M2VA 1JPUA 1LLFA 2E89A 3IA7A 4R8MA 1OHHA 1TKAA 2GUWA 5ADVA 2FW0A 2VP9A 4ALIA 1C9YA 2EBWA 1YC2A 4HGOA 4L15A 4DA4A 4XQGA 3EEYA 1DI0A 1A04A 1VDMA 4ZYWA 4TLEA 5L3QA 4R2MA 3BRWD 2QL5A 4NEHB 4OBEA 2R66A 4GMHA 1FUIA 1NQ5A 2ZUTA 4CCYA 1ONNA 4CM4A 4GZMA 1ZRHA 4ZVRA 3EXHB 4EYKA 4BMYA 1HE4A 4ZO8A 3BIWA 5L3QB 1IDOA 2FI1A 4FCCA 1NAIA 3W06A 3TQTA 3NGMA 4RD2A 5DTEA 3EJ6A 1NW8A 1BS1A 1OLOA 3PI6A 3VVBA 5T64A 5BSVA 5KYKA 2KWIA 1YFZA 2XWQA 2W48A 3RC2A 5A4MS 2GPYA 3N6RA 4RZXA 1RIFA 4HXFB 4JR1A 1T6XA 7ADHA 3R41A 4RADA 4MQEA 1TVCA 3WHPA 3REQA 4D96A 5JQGA 5EJEA 4DZTA 1E89A 1XAGA 3F7OA 5G1PA 1M2FA 5I8WA 3P0FA 3TX6A 2GCNA 4UHFA 2RHCA 3B12A 2BEJA 2N46A 4G1CA 5ELXA 4TWRA 2P6UA 1L5ZA 5FI5A 3WI7A 4RJJA 4FCTA 3T9DA 4OCZA 3ZY5A 1CJTC 1OXTA 2WAXA 3Q8WA 2I65A 3LZ6A 3E1SA 3DHEA 3DFIA 2QQ0A 3IEPA 2I1VB 4ZJPA 1Z4JA 2DVMA 5K0JA 1SBZA 3I9V1 3SZLA 4AUKA 1YZFA 2WJ6A 5GGXA 1KYQA 3V9PA 5LJLA 1CJSA 2QLMA 2VVTA 2H59A 3C8DA 5F7XA 3M4ZA 3B78A 1B00A 1V16B 4X7PA 3SLGA 3RBVA 4AG3A 3BIOA 1OIXA 2B20A 4XVRA 4B85A 5HRCA 1COWD 3KJZA 4LFBB 2PD6A 3I2HA 1L8AA 4GLJA 1TKCA 1R66A 3TE7A 2DBQA 1Q0HA 2PGDA 3CTMA 3NHLA 2IXDA 2ZQ5A 2R8ZA 3CB4A 1KRWA 3FNRA 3P94A 5C53B 4FHGA 1FRVA 4OG2A 1HE2A 3RD5A 2FNAA 2QIPA 2Y3IA 4IDAA 2VSXA 3OQIA 2C4WA 1VDZA 2ID4A 5EUCA 4DHEA 1DCTA 1QFXA 4D44A 3F7NA 3A6LA 1BMFA 4QEZA 3ZDFA 4BEWA 2ECFA 1S7GA 4INJA 3R7FA 3VHXA 1FYVA 2JA2A 3S55A 2HMVA 1JH8A 1Q17A 3KT8A 2G4VA 3AEUB 1A2OA 1G8PA 1KFCB 2WHYA 1A9PA 2YYZA 1I3KA 1Z5NA 3CPJB 4FOLA 4GX5A 1Y3CE 2EL9A 4U1RA 2Y9PB 2X8JA 4KUEA 3SI7A 2QUAA 2H4HA 2NU6A 2OOKA 3G79A 4M36A 2IEIA 3CPEA 1PUXA 1UM8A 1MNAA 1Z07A 1P5ZB 4YCSA 1XB2A 1DRWA 1C7ZA 1OU4A 1TM7E 4JYCA 1W1WA 4O33A 4ARBA 1XCPA 2VDKB 3H97A 4MS4A 4MVYA 2HJRA 5I9TA 3RVSA 5BW5A 2BFDB 4GL2A 1PTJA 4PQFA 3CNLA 5E3HA 1DZIA 4B3DA 2P67A 2PSJA 3K73O 1BMQA 2QG6A 4LDPA 5JT1A 3HUTA 4JYMA 2Y92A 5MGBA 2FDCA 3LT4A 2H5EA 1AUXA 4AZVA 4LXTA 2WWXA 1ZICA 4PC3A 3QUTA 3IQIX 1CUDA 2H3HA 3FBTA 2RI6A 2GBLA 3E18A 4JIGA 4RD4A 1GL3A 5ALXA 2X15A 5DMXA 1ZI9A 2VYQA 2XYHA 3JYPA 4W8GA 4B9AA 5D3MB 1V1RA 4NZOA 3N2KA 4GGPA 4WOCA 3SJAA 3ZNOA 5BMOA 4F3CA 4MPPA 1MO2A 4Q7KA 4YDRA 2R6AA 3EPRA 5A1TA 3HYTA 4J8PA 3R24A 3FFXA 1EWRA 3BMQB 1COZA 2QAGC 4RLFA 1D1PA 1YWGO 3KBOA 3T12A 4WRRA 4DSZA 5FPQA 1B15A 4K9PA 2NSHA 5HCNA 4ZC1A 3F3SA 4R3NA 3EEFA 3QJ5A 2IYWA 5CRIA 1LRLA 2BFAA 2V96A 4FVTA 4FFRA 1Z13A 1AY0A 2HXYA 3A4VA 1DC7A 2GCEA 2L42A 1C7IA 1UJBA 1UM9A 3M0EA 4GOOD 1YQDA 2ZRGA 1MFPA 2GF9A 2YJ3A 3I5MA 3CG4A 3IQZA 2QI9F 1TQDA 1LNZA 3NKLA 2ZRKA 4KYVA 4CE6A 5KYYB 4LOHA 3WKCA 4JBWA 4GEGA 3QX8A 4XFJA 3M7IA 1EKXA 2F1OA 4JXZA 2NPOA 4C0BA 5HUJA 3CVYA 3Q5GA 5E4YA 4CT5A 4M49A 4CM1A 1Y7IA 5JRZA 2VP4A 1RRGA 2TMKA 4MEJA 1TQ8A 1ESNA 4NU6A 1CHDA 5JHHB 4TYYA 4MYRA 1T2FA 1NZJA 3GAFA 4F6RA 3BKXA 3QMMA 4LRUA 1VFPA 4CMIB 3X43A 4XTRA 3RVRA 4V39A 2B83A 2I7TA 3HB9A 4D1YA 1HGXA 1P91A 1XMSA 2IP1A 3THOA 3VU9B 2J6BA 3T38A 1HV8A 2ATEA 2VK1A 3MD0A 4K6HA 4ZWNA 4C14A 1ICEA 1L1RA 1CR0A 1WB9A 3ISTA 2ACWA 4B5LA 3E9NA 2LW7A 5DE3A 1U0SY 3C45A 1O89A 5JFGA 3QWIA 1NVUQ 3V4OA 3H9CA 2GEBA 4NICA 4NZNA 3T1VA 4HPJB 1JDTA 3RI3A 3I09A 3MRSA 4PTZA 2O48X 2JZCA 3WNDA 4C9BA 3V55A 1QCYA 1H1LA 2OVBA 2DMRA 1MPXA 1KVSA 1QSGA 4OSOA 1PNVA 2Y77A 5IK2D 4C2BA 1K7XB 1CQIA 2GGSA 1P0FA 4CDMA 1RWMA 2V3WA 4KSCA 2P6RA 3VNUA 4YALA 2JGFA 4GBED 2X6QA 4OXYA 1Y3AA 4LC9A 2DKOA 3GRUA 1GTG1 1N6PA 1XKTA 3A7DA 3N6XA 3H86A 1RRMA 2C31A 2COKA 2VATA 3EF3A 3FKSA 1U3UA 4NSNA 4UAVA 4BO9A 4WKCA 3JQRA 5BURA 2O6LA 4X1KA 5DNAA 2DTXA 1WL8A 1OTYA 3ZDEA 3TFWA 4FGJA 3ZTYA 3TUZC 4RA9A 3BIXA 2FHPA 4PNHA 1OJ7A 1FFEA 1QFYA 3KLOA 1BWQA 4J4HA 4O59O 3P9IA 4R9UC 3NGXA 3FF4A 3FGZA 1G291 2FP4A 2W37A 3T3HA 3E1GA 4GW3A 2NYUA 2WKWA 4C5BA 2ECQA 2PS9A 3FHTA 4J90A 2VEDA 5KOIA 4MJ3A 4D9NA 4YPFA 5K0NA 2OG1A 3QG1A 2JFPA 1GZDA 1XDSA 3ISJA 3PNSA 4CEHA 1HZZA 4QQNA 3DJFA 2GAJA 3LYHA 1SBCA 4DIOA 5IU6A 1QU3A 2CHUA 3PZBA 1ECBA 2AKAB 2KLBA 3DH0A 1WW2A 1RVV1 3QBVA 3CIOA 3ONFA 3AEQA 4J7AA 2HCRA 3ZZ0A 3L5KA 4DLNA 5FH9A 4RVHA 4ZT3A 3OFSA 1NW7A 4FZJA 5TVKA 4UUMA 3G7UA 2FKNA 5JAOA 3F73A 4EMSA 5H9VA 2P5UA 2DLNA 3I76A 4II3A 3RV4A 1TCCA 4KG7A 3TW8B 4NOJA 3U49A 3A06A 1IZYA 1G2PA 5EG5A 5EIEA 2W90A 3H84A 3IEMA 1L7AA 4PLFA 2X40A 3I8OA 1SN7A 5BV2P 1GA4A 1PJAA 2KLHA 3OO1A 4RDCA 2F4NA 3DBRA 4GXQA 1Y3FE 3P19A 5BWNA 4RJTA 1FOEB 3F4BA 4P5EA 4Q4DA 1QUFA 4DJ5X 4Q4AA 2WMDA 3DLTA 1P1RA 3CW2A 4EPTA 3WHKA 2DLCX 4F4DA 3PUYA 3JARA 1QYXA 5ER6A 1TO2E 4MWSA 1TYAE 2CYAA 1ZHFA 3E4CA 3QLEA 4RM3A 2ZXFA 3T7EA 2VLIA 1K3TA 1IZZA 4LDNA 1Y1PA 2BTQB 1AZTA 1I0IA 3UMMA 4JJIA 2O8BA 2FEKA 1WV0A 1FJ2A 1SK8A 1QO7A 4IPTA 2HHCA 4G01B 5K8TA 1GZUA 4IHJF 3JZAA 3KDPA 1LTKA 4LC1A 4CCAA 3FTPA 4IIDA 1YKSA 4M99A 2BEUB 5CW2A 1F12A 1KAGA 3AYZB 2CXSA 2DP4E 2ILTA 3T5TA 3VO9A 1BWRA 1RDFA 2VRNA 2WLTA 3WSVA 3E2IA 3ZN2A 1GITA 1S2DA 2QORA 2ZIEA 3OF2A 3O9VA 5C52B 1RZUA 2CEKA 4D56A 1ZHOA 2BGJA 5CG1A 1A97A 5CM8B 2PSSA 2ZULA 1F0NA 4O3FA 2H51A 2OV4A 3OC6A 2NAFA 1PHPA 2PYDA 3AEKB 1QUEA 1E61A 5CVTA 3KYCA 1J8YF 2KPOA 2V6IA 2RIPA 1DAHA 4TV9A 3TEJA 4BEVA 5CNKA 2FEXA 1UR5A 1VMDA 2WF7A 1EX7A 2XYRA 2XNCA 3QUQA 2JBWA 3GDFA 3WZMA 3GN2A 3MTGA 2CT8A 3BGWA 4N9WA 4RA6B 5J58A 1SCDA 4FFLA 4DYDA 1QK3A 2EF1A 2JFUA 1YULA 2K5UA 1TI7A 1UFOA 3L4BA 3URMA 1NXTA 1YIOA 5CFMA 1CT9A 5LQSA 4M9CA 3SMVA 4JOBA 5CB4B 1H4VB 1H8ED 3DLHA 2HIGA 3JD0A 1QKJA 3W3ZB 5AQ1A 2F2TA 3M5PA 1H42A 3W7BA 3UF0A 5KJEA 1DJNA 1KIMA 1E7SA 1AS0A 1RRKA 3C1TA 3QHAA 5A05A 3S4YA 1Y8ZA 3VSCA 3DAOA 3OJLA 1WR8A 4CWAA 3K1JA 2CJPA 5KX5B 1JJFA 5IAAA 3ZH2A 5DTMA 2FG7C 2YYAA 5D5PA 1WNTA 1YE5A 1EDBA 1CQJB 3BN3A 4XAQA 3RRMA 1HE8B 1ULUA 2Z6VA 3BXPA 4LQ4A 2H2GA 5JNWA 5M34A 4JMPA 1VPWA 1QH0A 6ABPA 1JJIA 3G5UA 5FHRA 2PH1A 2VDLB 4W7SA 1K98A 3SYLA 5LZ4A 4AQ7A 4PLVA 4IRXA 2E9SA 3LKDA 3W7VA 5FPYA 4K5QA 3I3OA 2GCGA 2P78A 1MMFB 4CM6A 4Q9AA 4QYTA 5H02A 3GJSA 2BMFA 2Q7XA 4UHHA 2F43A 3FYSA 3KTAB 3T7IA 4GOXA 3QSYA 4CEIB 3L05A 1PJ8A 3N53A 3BFKA 3VM6A 3OJEA 1QK5A 2AFIB 2AUTA 1Q5PA 1ZD4A 3T61A 3UN1A 4AJPA 3RS8A 2VTBA 5ECDA 2NO4A 1DO8A 3NEJA 3EYWA 3FAKA 3QBTA 1UWKA 4IV0A 4RSGA 4E5PA 3E2MA 2ZSHA 2RHHA 3N5CA 4RGBA 4UVHA 4ALKA 2YIVX 2VP5A 2C9ZA 4O2AB 4OKIA 1M5RA 3UT5A 2XTNA 4F8JA 2X5XA 4KGXA 1XA4A 4ZT4A 2C1XA 3ZKWB 3IP6A 4TYNA 3NPMA 1FUEA 2WIDA 2R87A 3O03A 1PFGA 4DG9A 5J4HA 3CVUA 1Q0TA 2FEWB 2ZYRA 1UPBA 1Y42X 1QF9A 3NWPA 4QBGB 1U2DA 1KGDA 5DNEA 1Q84A 1L5GB 3ETLA 2AIRA 2B25A 2X5KO 3R5KA 1L8OA 1ZCFA 3EUAA 3NWEA 3LV8A 4MMZB 4WUTA 2DPXA 3C5WP 4E33A 1TZMA 4KR0A 4CV2A 2B5VA 1KE2A 2ZSBA 1K7EB 3CZRA 2CV2A 5DHSA 3GFVA 2JJYA 3QXHA 4QNMA 1YOVB 1GUDA 4GP7A 4H4EA 1PLLA 1T5BA 1ZJJA 2L17A 3KPJA 3HMQA 1N0IA 2GVZC 3S44A 1XVIA 4UMDA 3DJYA 4TGLA 4PXYA 4BFCA 3ONWA 3OOWA 4Q1BA 4ON9A 4ZHQF 2KMLA 3RKSA 4TMVA 3A4NA 1DCMA 2G09A 3EZGA 3GPIA 4EUHA 4EJ2A 2OCLA 1TA4A 1JKIA 5LM3A 4FC7A 3GMTA 3P9RA 5D84A 3ASZA 1BU8A 1IXZA 1E2GA 2Q2QA 3MGKA 4IQ8A 2B6NA 1TB4A 2IXEA 2ZWOA 1SQ0A 1NX6A 1E1MA 1PK9A 1OGYA 1C9EA 3DSRA 4OATA 2IV7A 4LY9A 1DG1G 3TG8A 3P97A 3M3PA 2BKEA 3TB4A 4RTJA 1SGWA 1XPJA 4GYKA 5BN4B 1N2CB 3BIFA 1TZBA 1WQ3A 3BMOA 3BM5A 3QEMA 3TNDA 3V1UA 2HDHA 3LK7A 3V4FA 1JYSA 3DOJA 3PQEA 1WY7A 1DXHA 4PNPA 4TTSA 4XFDA 1TLLA 3DBHA 2OLJA 1C9KA 9MHTA 2CXQA 3UG6A 5C9ZA 5AHOA 4NWIA 2RI1A 4DADA 3KHSA 1ZCAA 2A6PA 1LJUA 2FZ4A 3F9RA 2NVUA 4FUQA 4V24A 5DGXA 2NV2B 3SHWA 4EFDA 4TT3A 4UBNA 5J4KA 1J4AA 5LMCA 2GBLC 2W0MA 3OT4A 2WI8A 1B2LA 3ZHVA 3WNBA 1X3LA 1DO2A 3AB3A 5DF1A 3T94A 4BJ6A 1BDIA 2AI2A 1V35A 3RHTA 1NBIA 3ZHXA 1MJGA 3FPLA 3DEHA 3ZK9A 1GSHA 1W6RA 2IXFA 4YCLA 4UZEA 1KS9A 1GAXA 2G17A 3H1EA 3IDQA 4Q1CA 2Y1CA 3DEJA 4C1BA 4DMUB 3BSSA 5I5EA 4BRZA 3VTAA 3WX0A 2EGUA 4HGRA 2QYTA 1GPNA 2QVGA 5D87A 3EVFA 4JC0A 2I62A 5L45A 5CLLA 3EISA 3IKMB 5FOUA 5JOQA 1YSCA 1HT1E 1I2DA 3L7OA 5BYBA 4QOGA 1BWSA 4LJKA 4C4PA 1JTEA 1I1HA 1ULBA 3PYLA 5KWIA 4H7IA 2C4HA 5DU2A 5HOEA 3I28A 5FA5A 3DCJA 1VSVA 4LTMA 4WY8A 4DLYA 3MWEA 2O20A 3ER9A 3O9MA 4YTEA 4YJDA 3ZIDA 2IYPA 4Z4IA 4BVGA 3KJHA 1GIAA 4NMXB 3DNMA 4QSHA 3BE8A 2G5GX 1UOPA 3PQ6A 1BU5A 1UMBA 2JVIA 3C87A 4R05A 4KE8A 2YJ5A 3QWHA 5KAPA 3BK1A 4NJEB 4TLAA 4Y0NA 1C9DB 1EP9A 3D3WA 4D82A 3F8TA 5FO0A 4CTMA 2XCLA 4AJ4A 1HT2E 1XEXB 1KDZA 1RP7A 1A8UA 1G66A 3AFHA 3EIHA 4KUHA 4LZAA 4NDAA 4HS9A 3M4XA 4UEWA 2F00A 2JVKA 3ABOB 3CV3A 3GMDA 3PEUA 4P3PA 4QRDA 3RK4A 4FMDB 4NH0A 1LEHA 1YR1A 2FK8A 2H4FA 4TRRA 4LSGA 2ZPTX 1UWVA 3WDKA 3K8YA 2CK3D 5FKJA 3V8MA 2R62A 2XUZA 4MO9A 5EFZA 5FPKA 3BDIA 2FP3A 5CX4A 1RVDA 1ZK1A 3FDFA 3NC4A 3K5IA 1AGPA 3ND8A 4IX9A 3LZCA 5EXPA 5TT0A 1FFXA 1HA3A 1VZ3A 3BOSA 3P5BA 2Z04A 1UT5A 4DXAA 1UAGA 3RJZA 2WKPA 2GBFA 2P77A 1Q1NA 3DO6A 4Q5IA 4K87A 5DCWA 1LLQA 3VJLA 4EATA 3CNHA 1MXFA 4MPJA 5JD6A 3T0IA 2EAUA 5A7HA 1HNXB 3CX3A 1ZG3A 3OAAA 3HV2A 2NUPA 2OAGA 2H7CA 3MT7A 3B5JA 2SNIE 3E9CA 3K0KA 5K8UA 5FUXA 2PUEA 1T3LA 5AHWA 5ITZB 1EXWA 3HCAA 1SB8A 4EY7A 5BQ3A 5CT6A 4JYAB 3I62A 4F2PA 3HSYA 2KX7A 4LSZA 5KCZA 4AI6A 3E7XA 4G63A 3W4JA 4X62B 2QAIA 1OUMA 1GAQA 2Q2OA 3GUCA 4AJ1A 2PRKA 4WL0A 1PGQA 2O2HA 4OL0A 2GD6A 4K03A 1W5TA 2OHJA 2OEPA 5AO9A 1DVRA 1M8FA 3R9XA 1KMCA 1YGYA 3H4MA 3MFYA 5G0VA 4LJ9A 1JJVA 1HRDA 4JROA 1XJ5A 3U4AA 3DDZX 5GWXA 3FUVA 2WWTA 2CCJA 4NBUA 5CLIA 1MDFA 2IBSA 3KKKA 1LWNA 4YGYA 5HR5A 4BCDA 3RWBA 4YCBA 1PFKA 3CNEA 2QRLA 1BRTA 2AOUB 1B8OA 2ODNA 3FVVA 2B8EA 4JDPA 5INTA 2UU9B 1I1OA 2FWJA 2X6TA 2WJGA 1ISHA 3Q1KA 2ZVPX 2O2IA 3A3OA 3NO4A 3NHFA 5HHTA 2Z3WA 3RYIB 1JB9A 3OX4A 4N1AA 3RBZA 3ZHUA 3RVKA 2BGIA 1ZMRA 3DV2A 3OCXA 1FDWA 1XK7A 4MKZA 4QQ8A 5CNIA 2VQFB 2ZUBA 2GO7A 1DU4A 3ETDA 2A1TS 2BCGY 4YROA 3MS2A 2GR9A 2A9OA 3DNPA 1RE0A 1OVMA 2WQ6A 2Q3FA 1RM0A 3LVBA 4GRAA 1PZXA 1U11A 3G5LA 4OBBA 1QC5A 1S6YA 3I9FA 1JBEA 3EVBA 3TQRA 1F2DA 1QZ3A 4GR5A 1FF9A 1Z0UA 3OUUA 3NMUF 1DBVO 1VJRA 2O3RA 5IN4A 5LOVA 2PANA 3CZ4A 2W43A 1CXZA 4RLQA 1BZYA 4X8OA 2ORYA 2F62A 1IY2A 2D2IA 5E9AA 3WYAA 3KB6A 3OSZA 4FW9A 4JL8A 4NIMA 4EFLA 3RADC 4H7EA 4XYEA 3ZU4A 4B48A 3R6LA 5LMZA 1BW9B 2ZRPA 1MAHA 1PVVA 1VMEA 1G5TA 2FJ0A 5EIHA 4QFMA 3NTXA 5DN9A 2I2DA 3K70C 3TTXA 1N8NA 1YA4A 3DOOA 1VL6A 3II6X 3GAAA 4G81A 1YB5A 3BICA 4C7JA 3IODA 5C8YA 2ZW9A 2GF2A 3DZHA 3L49A 8MHTA 4I0WB 5AW1A 4N03A 2C95A 3K0HA 1SC6A 2WD7A 2WSSA 4PWYA 5E2BA 5C51B 1IN5A 4I1VA 5HZGA 1ZI8A 2GF0A 1FRQA 2BKUA 2EKDA 2FETA 2WF6A 4NZYA 4DSOA 5BN5A 5I7OA 1O95A 3B8EA 3KTOA 4DOMA 3TECE 2E4VA 3HLTA 4DV4B 4RX1A 2BHSA 3LHKA 1H8HD 1TLTA 1XDZA 4P4LA 2H1WA 4L4UA 4JBGA 1LDNA 3W5UA 5K4GA 2PQ2A 3IQWA 2APJA 2YOFA 3GCGA 5IMBA 3AYXB 4AZWA 3HXQA 4D41A 3VOSA 1IPHA 1I2ZA 2SCUA 5K01A 4E6EA 4L3WA 2AG1A 3ZV6A 4ENQA 3VYVA 3QHQA 3TAHA 2DUWA 5DN6D 3TFOA 1D4FA 1FZTA 5U4QA 3LGSA 4QTTB 4PGHA 5HK8A 4I8DA 4QL3A 2YJTD 3RUAA 10MHA 1HX7A 1NPYA 4MYHA 1TVEA