4D9EA

D-cysteine desulfhydrase from salmonella typhimurium complexed with l-cycloserine (lcs)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
328
structure length
328
Chain Sequence
MPLHHLTRFPRLEFIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNKLRKLEFLVADALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQCEEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAGQLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGISQKRFNDDGPILFIHTGGAPALFAYHPHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-Cysteine desulfhydrase
publication title Structural and Mutational Studies on Substrate Specificity and Catalysis of Salmonella typhimurium D-Cysteine Desulfhydrase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 116
structure length 328
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.15: D-cysteine desulfhydrase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9eA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9eA02
3PR2B 4HO1X 1KFEB 4LMBA 5EY5B 4HPJB 3V7NA 4NU8X 1OASA 2CLOB 2ECQA 5HBGA 5I7AA 1TYZA 5B1HA 5B3AA 2D1FA 5E0KB 3SS9X 2DH5A 5DVZA 1UIMA 3PC3A 4D8WA 4F4FA 2ECOA 5T6MA 3DWIA 3VBEA 4D8UA 1VE1A 4COOA 1O58A 5J5VA 5KINB 5I7HA 1C9DB 2EGUA 3R0XA 4QYSA 1CX9B 1FCJA 5J43A 5CGQB 2O2JA 5IXJA 1D6SA 3T4PA 5I7OA 1C29B 2CLMB 2J9ZB 4IL5A 4D9IA 3L6BA 1A5SB 5D86A 4D97A 2CLIB 4ZU6X 3SS7X 3PC2A 3VC3A 2TYSB 3IQIX 2CLKB 1FUYB 5IWCA 5BW6B 2RKBA 3R0ZA 5C3UA 4D99A 2WSYB 2ZR8A 2RHGB 2ZSJA 1A5BB 4D9BA 4HPXB 4I1YA 1K8ZB 1VE5A 4D9FA 2O2EA 5CVCA 3HMKA 4L28A 2BHTA 1K3UB 3IQHX 1V7CA 1K8XB 2GN2A 2Q3BA 4L0DA 4OREX 3VSCA 5B36A 4D9NA 2CLFB 2BHSA 1KL7A 1Z7WA 5D84A 1J0EA 2DH6A 4D9EA 1K7XB 1QOPB 1KFJB 1UINA 4D9CA 4D9MA 1BEUB 4AECA 4Y6GB 4JBNA 4L27A 1KFBB 2EFYA 1BKSB 1TZKA 1CW2B 1V71A 5IW8A 1C8VB 2PQMA 4L3VA 2TRSB 4D96A 4PCUA 1Y7LA 1K7EB 4JBLA 5D87A 3X44A 4D9GA 5DBEX 1V8ZA 1J0DA 1Z7YA 1JBQA 2RH9B 4LI3X 4HT3B 2GN0A 1E5XA 5DBHX 1KFCB 2C2GA 1TTPB 2V03A 1J0AA 3VSDA 5DW3A 5I7WA 1WBJB 3RR2A 4KKXB 1A50B 3L6CA 4XUGB 1TDJA 1RQXA 4WX2B 4AIRA 5DW0A 2CLHB 3IAUA 4LMAA 1WTCA 2JC3A 5JJCA 4H27A 5B53A 1X1QA 5B1IA 1QOQB 1VB3A 2TSYB 3IQGX 4ZQCB 3L6RA 2J9YB 1UBSB 1KFKB 4OFXA 2CLEB 3AEXA 1TZ2A 4HN4B 4ZU1X 5KZMB 3AEYA 3CEPB 1M54A 3DWGA 3TBHA 2GN1A 4D92A 5JISA 1J0CA 1PWHA 1TTQB 3ZEIA 2ZPUA 3FCAA 3VSAA 1PWEA 5I7RA 3BM5A 5D85A 2C2BA 5I6DA 1K8YB 3PC4A 4D8TA 2Q3DA 1A5AB 1TZMA 2CLLB 1WKVA 2Q3CA 1F2DA 5B55A 4D9KA 1TZJA 3DKIA 1K7FB 2ISQA 1TJPB 3X43A 2J9XB 4NEGA 1J0BA 1WDWB 3FGPA 1P5JA 3SPXA
chains in the Genus database with same CATH superfamily
1XVVA 2R66A 2CV1A 3IH5A 3TB4A 4DC9A 4B2PA 4QULA 2NPOA 1AM4D 1V2GA 3RB8A 1GPMA 3WB1A 4BQOA 3DNFA 2XMRA 1FFHA 3VDMA 4E30A 2OFWA 3GLIB 4MULA 1VBKA 1AS3A 3VYRB 1Z5VA 2QYSA 4XM1A 3I01A 5KBYA 1KZ6A 2YZ2A 3JQGA 1WZ2A 2PSDA 4ZV9A 4F4UA 4HDRA 4EBBA 3HXQA 3L6OO 4O2BB 1G7CA 1E2DA 1R0XA 3H05A 2B2CA 3QFHA 3N74A 4WW0A 2FEOA 2FV8A 3SF0A 4CL3A 1I33A 1SKAA 1XZLA 2JJ8A 1C4XA 2CF6A 3VYVA 3KOMA 1HG0A 3R3UA 1O0BA 2HK6A 2CXRA 2WSSA 4X90A 1WXQA 5C35A 3UT5A 3QU7A 4A6XA 3ZV5A 3QVUA 1HZZA 1RAHA 3HKDB 2WD8A 3QELA 2C3MA 4OGGA 4PHTA 5DP1A 5EXEA 3O4JA 2IOFA 3ZHVA 1T5SA 5AXBA 4QAJA 5B57C 2IZOA 3T94A 2I2CA 4G85A 4IKOA 2BMDA 1XL1A 1IIRA 1XPOA 4WADA 1JQKA 1U2PA 3NT4A 3LRPA 4LZLA 2Z8YA 4OJTA 1K3UB 2BHLA 3CE6A 3SX0A 2EBFX 1KYZA 4JIMA 4F60A 5KTKA 4C6HA 1OBFO 1OXMA 1EP2B 2E18A 1SURA 3OWHA 4J76A 4LBZA 4QJ4A 1FMCA 3ED1A 4X45A 1FSFA 3BL6A 3RC7A 3VJRA 3K35A 3O47A 4JC8A 4H7JA 4YCBA 4PFJA 5JPCA 1SBYA 3JAWA 1KPGA 2EATA 1BEUB 2BUBA 4WZAA 4AO8A 4BE4A 1ZL2A 5TDHA 3DBHA 1B6RA 1E1DA 2FZKA 2XTJA 3KUUA 3U7IA 4ZIRA 5KPDA 1D4FA 4JDPA 4P38A 4X41A 3T0IA 4CQLA 3N0RA 1O9BA 4RA6B 1XTKA 2FY8A 1DVRA 2WPNA 3VNSA 3OM0A 3LX4A 2Q2WA 2B1IA 1O95D 3NHJA 2A1TS 2XWSA 4HRYA 1H9CA 3ZGXA 4UEKA 3GDFA 3GUVA 1UBCA 2WZBA 3H7AA 5JCOA 2BGMA 3VSDA 4WBXC 7MHTA 2Y99A 1CE8A 1UKAA 1C2TA 3TEFA 2N9UA 2H4XA 4KO4S 4S1TA 4AX4A 2H2IA 2PLAA 5I7EA 5CG1A 1T3GA 3TD6A 4MLPA 3WDKA 2WEKA 5I8WA 3DBIA 4PYMA 4DV3B 2D2FA 3I28A 4QFDA 3R8FA 2Q4OA 3CUTA 3KBBA 2QROA 3EG5A 4XQ0A 4PZYA 3UJ9A 4AS2A 4A7PA 3B6IA 1A72A 5IJAA 4MQ6A 4EYGA 3ZE6A 4F3NA 5ALPA 2BAGA 3HKCA 2XSZD 5DYWA 2AFHA 2WHQA 3EC1A 4N39A 4B82A 3N9IA 3B38A 3M1YA 1FW8A 1L4FA 2DY0A 2VVTA 1L7BA 4DLUA 2WNIA 2X2OA 5DHUA 5KYKA 3DMYA 2QNBA 3U7HB 1WVMA 1YWGO 3H9EO 1C7IA 1ZM4A 3Q7QA 4E3ZA 4XWWA 4HLDA 4GMFA 4JFRA 4JJIA 1XK6A 3BQ9A 1PEKE 1L5NA 1D0SA 3DKIA 4J90A 4ZN6A 2A84A 1ZK4A 1EX7A 4QUKA 3AKEA 1U1FA 1FYXA 4KCGA 7MDHA 3UENA 1V8BA 4R83A 1OKKD 1KQGA 3D31A 2BSXA 4PLGA 5ALQA 1P1FA 3EIOA 1WXGA 3PTAA 1A4IA 5ALIA 1DIBA 2YNMC 3JYPA 1O94C 3RRXA 2FW7A 4WJKB 5LQMA 1J20A 1UIMA 4NJMA 2D1SA 2DPLA 1JAIA 2P41A 5HIMA 4EPRA 3E5MA 2C5EA 1PCXA 1UDWA 4UHEA 3NWEA 3ZGOA 4WACA 2H1HA 1HL3A 4RUKA 4CN8A 2Y2VA 4R0MA 2OD7A 3M6LA 1TCCA 5BVHA 5IT0A 4EZIA 7ABPA 4MCIA 2DAPA 3JCZA 4IVNA 1JSCA 1E5DA 1P81A 1EFPB 3F67A 3H6HA 3Q7RA 2WF9A 2Z4SA 4E5MA 2O8CB 1M2VB 1XOIA 1E4EB 3DR3A 4XUDA 2P2CA 1XAIA 5IJXA 3NYIA 2R4TA 5IBPA 5GV8A 5TQJA 4FJ0A 5EYPA 2UVPB 3AG6A 3PX2A 3SX4A 5EWMA 3K7EA 1PFVA 5CT5A 4P4SB 2YL2A 2Y6UA 3HDJA 4HWTA 4C2AA 5AVOA 2DLCX 3PE4A 1IPEA 4E2FA 1U1CA 5L45A 2MHCA 3S81A 2IYUA 3OM1A 3F4BA 2OFXA 1II9A 3OLCX 1HNZB 3JQ8A 4GYKA 4EJ2A 1UFQA 5GGYA 1KI8A 3RHSA 3VGJA 6NULA 2XD9A 3B8HA 4MP6A 3UOGA 4I4TF 1ST3A 5F98A 5EQJB 2H1SA 4XFKA 3GH3A 4AURA 1VE7A 1JU4A 1M9NA 4D7AA 5CCXA 3F73A 3I9FA 3UKOA 4CM4A 3ANYB 1JR2A 4ZYVA 1K6EA 2HAEA 2PR7A 3KJXA 3PXEA 1C8VB 1P61B 3ACDA 3R23A 2RGNC 1Z4NA 3F7TA 4DM4A 3AV0B 2ZATA 1U99A 4RHUA 3SFZA 2M32A 2EJUA 3T1NA 4ES6A 4BKPA 3SXUB 4B9EA 4KXUA 1Z6QA 4MLDA 1GRVA 1V1MB 4RLFA 3IT0A 2WZCA 4KNWA 1YR7A 2JD1A 2Q3JA 4LIPD 1ECGA 3QLTA 3KD3A 4FDTA 2XUQA 2DGDA 4RF2A 4BNXA 4DQXA 3EQ8A 4GYYA 1WULS 3NYQA 1QE5A 4M0UA 1G6Q1 2ZBVA 2RK4A 4RZSA 4EPYA 1GV0A 1RWKA 1DBIA 2H7VA 4BC0A 1XKLA 4Q7MB 4AZVA 1F8XA 2HF2A 3UAOA 2VIIA 3IP3A 1KY5A 1CB7A 2JCSA 3L2OB 1QH8A 1D8AA 4N8DA 3RYFB 3KSDO 3VX4A 3ZV6A 3LY5A 4TKUA 3BIOA 3GFQA 1EVQA 5EXXA 4QT4A 2Q07A 5F4BA 5BWBA 3WMGA 3Q0EA 1Q7BA 2GD0A 2X9QA 4UEWA 5B7PA 4Y6SA 2O8FB 1T2VA 3TBHA 3QLJA 4DJTA 3WLOA 1W30A 4MGZR 3ADBA 2A57A 5KYXA 2E6UX 2Q5EA 2G1PA 1M7HA 3EDCA 2I5PO 1H66A 4CEJA 1O0CA 3G1UA 3KHTA 3PPWA 4YAFA 3VUEA 2AEFA 1LBEA 2VJBA 5K8VA 1GQOA 2AI2A 5JZMA 1A5AB 2JK0A 3AUXA 4N40A 3V48A 3VHXA 5LP6C 3L1UA 1WKVA 1YCHA 4D82A 4ZVVA 1YFKA 1VJDA 5JZSA 4X6XA 4ZVUA 2I62A 4G23A 3T54A 1RPTA 3TTVA 3VQTA 1J2RA 1U90A 2CL7X 1RJ9A 1ZM3A 5CVVA 3IURA 4B17A 3F78A 3WMRA 4YMLA 4GOMD 1JHMA 4FEEA 1HQCA 2OOKA 3CC8A 3FLBA 3H9BA 5BNWA 4AKTA 3FMPB 4WCFC 1HO3A 1O95A 3UICA 5KC8A 2ODEA 4FZVA 1E32A 3AVXA 3N0TA 3WG9A 3WV4A 4Y9TA 4D0RA 3AZPA 3Q6NA 5KOHB 2R47A 1SCDA 2Z08A 1RI1A 2NQ8A 2LCQA 3UW1A 4DLBA 3ZY5A 1X8XA 4M9RA 3K9NA 4IJ6A 3KJNA 4X91A 1AQYA 3M6FA 2I03A 1UK6A 2FVYA 3I23A 3DVRX 3DE2X 3ZY2A 4B84A 4H18A 1QO9A 4LRQA 4NHEA 3EXHB 1OFIA 3EG9A 1OCEA 2ZYHA 5NULA 1WHTA 3NHWA 1MUUA 1Z2CA 5HR5A 4FD2A 3ZY3A 4JGBA 3SLRA 4G9GA 4NIMA 3UK2A 5DN9A 5DYYA 2XSZA 3QHQA 4N47A 1TT5B 2C4WA 4YRRA 4MV7A 2GYUA 4MV6A 3BGIA 2YJ3A 4K86A 4P54A 1SUPA 5IVDA 3TOSA 2J7PD 4DJ5X 4CBVA 5GAJA 1SJ9A 4KWEA 3WWYA 3D3NA 3FKJA 1MJGM 3PQ4A 3LJKA 4FFRA 3BJEA 4BNGA 4RTRA 1VECA 5BQ3A 2I34A 4A8JB 1HBJA 3PQ6A 1TMYA 2BL4A 1KKLA 2QP3A 3HV0A 4H4CA 4YH1A 4MA5A 3MELA 3BWBA 2HU8A 3BCUA 3OICA 4IV8A 2J0SA 4YAKA 1PR2A 1HE3A 1JJAA 4U6SA 4L57A 4BO4A 2REBA 3KB1A 4NX2A 1OKKA 5LZ9A 2JGJA 5HVNA 2QRUA 1WZEA 4J9VA 3NRJA 2XT9A 3VNAA 1R5NA 4UTOA 4I9UA 1DZ3A 2G25A 2V7PA 4JVLA 1B43A 2OBMA 1GAEO 1W36B 3Q3JB 3S1AA 1DAGA 4Q3KA 1HYHA 3A2MA 5LIPA 2CFOA 5BV2P 1Z0FA 2R8OA 3N7TA 1J0DA 2A8YA 4JEIA 5JYEA 3PSAA 1DQNA 3QOYA 5BP7A 1IZZA 2VHVA 1SB8A 2QX7A 4BCDA 1E6CA 5I7WA 5JVDF 2Q6TA 4K2AA 2OO7A 2GO7A 1DIRA 3FMGA 3HNRA 3O4GA 4I5IA 4YCDA 2FJUA 3IAUA 2WDPA 2WSLA 1IM5A 3DLBA 2MYNA 3FGNA 5BMVA 3NDBB 1P0QA 2LNDA 3AVUA 1K7CA 3DDHA 3UT0A 1RHKA 1MA0A 2G72A 2PV7A 2XDAA 4P0TA 4AG5A 4XVCA 2ZS7A 4O4HF 4OQXA 4ZU1X 1P9WA 1ABFA 3AEYA 1I1OA 3FCYA 1QCCA 3CURA 3NAQA 3OOYA 2BF7A 3BSYA 2LXNA 4DLAA 2QSUA 3NP9A 1YZFA 4GPZA 4HH3C 3W4KA 1ZNYA 2VJDA 3E9RA 3BXPA 4MIYA 1ULBA 2WHYA 5AJWA 1GL7A 4HAIA 2WM8A 3GBVA 1U4SA 4HYYA 4MVJM 3TB6A 5JXJA 5JZ9A 4FM9A 3PC4A 4D8TA 2GR9A 4RFSB 4C5AA 4ZKDA 1MEEA 2DWQA 1ODJA 4TZKA 4CXMA 2ZUDA 3PTLA 2RHWA 4DEYA 2ZYAA 3UWSA 4CCSA 2R4QA 3KXKA 5FI3A 1M2EA 5BNTA 3HZOA 3HCCA 2IL1A 4ZTZB 2I9KA 4LYAA 5DSZA 5CXUA 4DRXA 3P1JA 4R1QA 1K27A 4CZ2A 5DHRA 1YNSA 5EAIA 1UOPA 4D6PA 5DXAA 4LYEA 1K5GA 1XD9A 1JV2B 2PJZA 2TS1A 1GPDG 3PBKA 4AUMA 2UUOA 2I6SA 4LCJA 4BASA 5FPQA 3VTAA 4Q39A 1ADFA 1RFGE 3GRVA 5HBGA 1SVOA 4IMIB 2MU1A 2PJRA 4AJNA 4UUPA 2F64A 4XM0A 2DBYA 1WRBA 3KWFA 1DAHA 3NNSA 5LWHA 3EFHA 5E8RA 2HXSA 4YAEA 4L5JA 1R5OA 2C29D 3L7BA 3UPTA 3G79A 3P0EA 5BN1A 1KBOA 1FA9A 1LCIA 2VSOA 3QEMA 2DQSA 1YV9A 4PFKA 4WERA 1E94E 5DI3B 2GMWA 1A5SB 3L82B 4XDZA 1WB6A 3QU2A 1T6NA 1H9BA 2MR5A 2NW6A 4AMZA 1S2MA 3ACBA 1QZZA 1QCYA 1FFCA 4N0EA 3DD1A 4R3NA 3IIJA 4MYDA 2BC9A 3AHEA 5A3JA 1U63A 1RWOA 3CEMA 3KKQA 4I9NA 1MAUA 2W2NA 4IVPA 4JP5A 3GUHA 2O5EA 1IATA 4EO7A 2NG1A 1NN3A 4Q3AA 3FETA 2X77A 1T9BA 1MENA 3W8EA 1T9AA 3PDCA 3FPLA 3MC1A 4RMIA 3WAKA 2JD2A 2P1RA 1VPLA 1UWLA 3IQEA 4XJSA 1X3LA 2O3QA 3DXZA 1CUIA 1J9EA 4KXYA 3HA2A 5ALXA 5ALHA 2NTEA 4HAWA 1ODTC 3IUSA 5HK8A 1XAJA 1Z7EA 4MWDA 3WRVA 2Q0HA 5K8IA 4MR9A 1KDVA 1PR6A 1SIBE 2I1WA 3IQDB 4I1RA 3TXAA 5EE0A 3W1VA 2QWXA 4J1QA 1W5SA 2GBCA 4Z0TA 5HXAA 4CM8A 4XIGS 4NBVA 3PEWA 2O8NA 2NO9A 2WVAA 3AVPA 4Y2RA 5KTMA 5C5EA 2OBFA 1NVVR 2VK2A 3KOUA 4D96A 4G2NA 1KH1A 1YK0A 2HNAA 3O2JA 3V4SA 4LDZA 3VR1A 4A6DA 3O9MA 1AQLA 4UEJA 1ZUHA 2FSVA 3FOAA 3ZE7A 4U5QA 4B4WA 1XQ6A 5CNMA 4L16A 5D01A 5I47A 1N6OA 3JYNA 1UMCB 5IANA 1TYEB 2C0CA 1NRWA 3GWGA 3DWFA 5FR2A 2A5YB 1HYEA 3WLEA 3Q9UA 1FBTA 5KTOA 3DZGA 3HBFA 1AX9A 1LDMA 3GV0A 5DWDA 5E2AA 1BKYA 3ZLUA 5BRJA 4MMZB 3AHIA 4LOJA 4UVGA 2YTZA 3Q8MA 1J9GA 5EWJA 1U7HA 3HJTA 2OUIA 3AMVA 4MOWA 3QE2A 1SNYA 4XPIB 3H0KA 3HXPA 2CLSA 1KORA 4DNPA 1JQEA 3EPHA 3FUXA 3OHMA 3U4DA 3MT9A 4Y2XA 2H1LA 1BCSA 1SOWA 4DC1A 2J7PA 1JPJA 4QJ3A 5AW7A 1N25A 3HJCA 3QNMA 1U3DA 5C8VA 1DINA 1IG3A 2X1LA 2ZJ3A 2WBLC 3G5AA 3S99A 3G6WA 2G6BA 2ZJ7A 3CZAA 3F71A 2QE7A 2J3DA 3COJA 2FTKE 4JLPA 2MDTA 4L5IA 2PZJA 3AB3A 1QPZA 1N6HA 2GS9A 5AKZA 3RS8A 5CK5A 3C14C 1IOVA 4IEEA 1XQ9A 1SQ5A 4RAQA 3UMGA 4HQFA 5JD4A 3GJ6A 4RTPA 4BV9A 3O4RA 3M89A 4ZT7A 1E9AA 1EZ4A 1XTRA 2J48A 4M4SA 4MS4B 3UYLA 1JPUA 1RFLA 4XWTA 3K5PA 3B60A 4JL5A 3HVIA 1Y1SA 3GFPA 3SLKA 4A27A 3VH3A 2FDXA 3FLAA 2VHQA 3OY7A 4WEQA 5J47A 4WUTA 4Y9RA 4CKEA 2C96A 4LG1A 4ZVSA 3SEQA 1UJMA 4MITA 4WOKA 3SE0A 4EUSA 2HI0A 3IKJA 2F9FA 4Q4JB 3GBPA 2IXTA 2A5GA 2BP7B 3IMFA 4H6PA 1AA9A 3WGIA 2HSGA 4L6AA 3T7JA 4PFSA 3TJMA 3FTPA 1FS4A 2DVMA 1IQUA 2O6HA 3NASA 3PNLA 1L4NA 1ULAA 4GVPA 4PC3A 1A2QA 4N18A 1NNSA 1P5HA 5IF3A 5CLHA 1XTJA 4IF6A 2XMBA 1P8AA 3DTNA 3N0VA 4II3A 3BWXA 3E2IA 3E48A 3LQ4A 5J5CA 3VO9A 3KU4A 2YWGA 4WKPA 4QBFA 2UZ1A 1P3Y1 2ZTLA 3HLKA 3NC1C 2CLKB 3PQ7A 1FUYB 1WMEA 5ADUS 1TQ8A 3TLAA 1T0UA 3BXHA 2GB4A 3M6IA 3R0VA 4PHHA 1F2TA 3ZQUA 1C4KA 5L51A 3HY6A 3V2HA 1YO6A 4CM9D 1GZ5A 5C7YA 2BW0A 2AOVA 4TX1A 2MINA 4CMGA 2DF8A 3DOHA 4Y7CA 2ZSKA 5K20A 3C3KA 5JWRA 5I51A 4W8OA 1V47A 5G4LA 5U1PA 5ICMA 2VLBA 3QWFA 1JIXA 5KJCA 1JHPA 2OGSA 3EIHA 3GEMA 4RPGA 4UDNA 3VOBA 5EERA 5FWNA 4QL3A 1PUJA 4IIYA 5IBRA 4AZ0B 4YUZA 1DTWA 4GZMA 4RABA 1A76A 2PS3A 1GA1A 2XLCA 1TMGE 4TLAA 3RV4A 3ZYCA 4YLGA 2QGFA 3ER9A 4JZKA 3A9WA 3TRKA 1K75A 1GPKA 3GOQA 2XNCA 2NZXA 3M9WA 2I8CA 4F5DA 5LKAA 4YRTA 2QRLA 2QTTA 3KV3O 1U8UA 2F6RA 2Y0DA 3GIDA 3HEMA 1IZYA 1JDPA 2X7HA 4AXBA 3A25A 2JGDB 2IPOA 3ZXSA 4QTXA 4XCVA 4IO1A 2TECE 4R7ZA 3EIXA 2E4YA 3FPAA 1TE2A 1ECBA 3SSAA 1U02A 2DPXA 1Y9ZA 1MIHA 2VK4A 3WGVA 1Z25A 1RKXA 1ZRMA 4IJVA 4QJBA 1AKMA 4NMXB 5F1OA 4CMIA 4WK0B 4A73A 4AY4A 3F5QA 3U3JA 1PTKA 2R8BA 3T9BA 3N1UA 2C2XA 1N9KA 1TC2A 1PFWA 1UBSB 2EJBA 2QVZX 4J9UE 5DOZA 3RROA 4YYEA 2ACEA 2D3WA 3NHUA 5CB4F 1M33A 1TM4E 1YOVA 4DY4A 1BX0A 3WJAA 4LXXA 3JQGB 4Z2YA 4MGYR 2IQIA 2PMEA 4TTTS 4BVBA 2VSFA 2EEPA 3VI4B 4IFBA 3EQZA 3FYDA 1AMOA 4JK3A 4K9NA 3W79A 1TRKA 2FSPA 4M6WB 5LA6B 2W6ZA 3LLMA 4FEYA 4LPSA 4EF6A 5AI5A 4XYLA 3RWMB 3H84A 3KSAC 1WV1A 3WMXA 3PWKA 4P98A 4Q18A 1NY5A 2YIDA 2G07A 1ISGA 2YFKA 4X20B 5B1SA 4ID3A 2YJTD 1SKMA 1UAYA 2FWNA 4JJEA 3H5NA 5EMHA 2OQ2A 3Q9SA 3SQWA 2HV9A 2W9XA 4JMLA 1YTUA 1HGXA 4KE9A 4YPFA 1DDOA 4IDGA 2DJ5A 2HHJA 1WDLA 3B1VA 5ECDA 4ZDIA 3BMCA 1ZA2A 3VR6D 3BEOA 3BJZA 3C85A 5EJ6A 1JG6A 3AVVA 4M9XA 1GDHA 2GJ9A 1OIXA 3TDNA 2CMGA 1K63A 2ECOA 2QDXA 3ZDEA 1K4KA 3URKA 4LWZA 3AETB 2Q3LA 4COOA 2GI4A 3N28A 4QLOA 4WZAB 1KE1A 5KJFA 5CT4A 4J1SA 3FR8A 3A58B 3CWQA 1DCTA 1FLNA 4TXLA 2F1KA 3BIXA 3IBSA 3ISJA 4C03A 4C0AC 2ZAIA 2E49A 4M8SA 4LXUA 3ODPA 3U3RA 1DFGA 2ZGVA 3TTXA 3VZCA 3BFXA 2WJYA 4BC1A 1O57A 1RIIA 4KWIA 1G2QA 2DFTA 3RVSA 4DW8A 5JS1A 2PZEA 3M6XA 1A4RA 1P77A 1TT7A 5JQGF 3L41A 4WNAA 1EHCA 3CE9A 5FWYA 3NAZA 4A2QA 3BIWA 1V11B 5LC1A 4E4RA 221PA 3EY9A 3Q41A 2GPNA 4PCVA 4YC7A 3LAWA 2OG1A 3RWOA 1CCWA 2C0PA 3A1CA 1TUGA 3P9YA 2ZYSA 4NPAA 1V5IA 1W0JD 1R4NB 1M72A 2GPTA 5FI5A 3H42B 3HDGA 3PF8A 1XTZA 5D3MB 3FDZB 1YB1A 4I3HA 5DK4A 1Y6JA 1VI5A 2ZXUA 3A6HA 8ATCA 5J2UF 4DJJA 1YUNA 1Z5UA 2BFNA 1X7DA 1YIDA 3NIFB 3JPYA 3OJXA 5FYQA 3H5WA 4WCDA 1YZLA 4FOTA 1AF4A 1KDYA 4BWFB 5FH9A 3ABSB 3HN6A 4M21A 4AKIA 2IGBA 1CNFA 1IFXA 5TF0A 2ZWVA 1VJGA 2C82A 3FUWA 4D9GA 2VCYA 4BP1A 1JTVA 4X1IA 4ZOAA 1M2JA 3C7CB 5K3CA 3TLGA 3UKDA 5C2JB 3O03A 1C4WA 3DYVA 3IT2A 1YJXA 4V02A 4F3RA 5KYWA 3I6QA 2JGFA 4MVJF 1XJQA 2WJWA 4MW4A 1DUSA 3M4XA 3ZWXA 5DHTA 4IPTA 4MRAA 3AJ9A 5D6NA 1UBTS 3AB7A 3KKOA 2R0QC 2RB5A 1RPAA 3RPEA 1R5JA 1J70A 5F23A 1P7ZA 3KKPA 2EBHX 3KD2A 4LJYA 4NSNA 3CVOA 5DKFA 1P18A 3D3WB 4QXMA 3ZWMA 5BWCA 4LFAB 2HJ9A 3E9YA 1MV5A 3AJDA 4WZBB 1PT7A 2P9HA 4CKXA 4NJMB 1JVNA 3LC1O 2BFBA 4UASA 1WNTA 3PIDA 1LDEA 1XA0A 1J0CA 2W2VA 1FXUA 4HF7A 4V1CB 2F1JA 2PM8A 2QD1A 1FTYA 1F17A 5J4KA 3DHNA 1RAAA 3DV0B 4D0SA 1U7OA 2EDAA 4LK3A 1B8UA 3FI0A 1GFZA 3WKAA 1XEXA 2MYUA 1TAGA 4EFNA 1V7ZA 3T34A 3CT6A 4UHCA 3H5LA 2FN9A 16PKA 4UATA 4Q3DA 4WRRA 3P26A 5K99A 2R96A 1LZLA 4L5CA 5T5QA 5L53A 4CT0A 1KARA 4YJHA 3T7KA 2TMKA 3UHAA 1YA6A 1X0VA 1R37A 1RC0A 4X60A 4LS3A 4CUJA 4H15A 1FIUA 2H9IA 4Q82A 2ZM5A 1WXEA 1U28A 4MR7B 2PZ8A 2XRFA 3EH1A 3GPLA 4LJ9A 4IHAA 1KO1A 4H60A 3TR5A 5BSFA 3AERB 3E9NA 1P72A 2QUHA 4Q3EA 1KMCA 3SK0A 4IIUA 1LRJA 3W5JA 2OCIA 3NM6B 5DH9A 1NLUA 1SZJG 3MJDA 3IAHA 4IXWA 3C48A 1VSTA 4WH0A 2B21A 1A1SA 2FX2A 2PR2A 3WGQA 2JFFA 2CUKA 3KWMA 5JNWA 1UPUA 3DFUA 3L06A 4NV3A 1T29A 2X4DA 1BN6A 1XN4A 3LUFA 3L92A 5I9SA 2QRGA 4E31A 5C1IA 1J42A 1JDZA 2EEZA 4FI3F 4DLYA 4ESOA 5JEDA 2JS7A 2YW2A 3P9IA 2CY0A 4RSHA 3R4VA 3GC6A 1MTZA 4OHKA 2ZWAA 2QLNA 1NVGA 1GXSB 3IVMA 1T2EA 3O93A 4KRXA 2P9ZA 4Q4AB 3ROPA 3UB2A 4U7PB 1QU3A 3U3MA 3EGDA 4MDHA 5AOVA 3M6AA 4FFWA 3INYA 1OILA 3S70A 1Q1EA 2H16A 4GC5A 4YJFA 1JEQB 1Z4IA 3HJHA 3IOCA 5AWFC 4DB2A 2H57A 1RW4A 1UINA 1TF5A 3JRXA 4UFNA 4JX8A 2PUTA 4C04A 4C7MA 3NI2A 2CHQA 2PH1A 3EXAA 5TIIA 3HZRA 3VR6A 1A1VA 1R0ZA 1D2RA 2Y4NA 2Z6VA 1FJXA 1EK6A 4E32A 1F0YA 4G5GA 3TW6A 2Y2UA 4L74A 3A2NA 2QEQA 4DDMA 1LQUA 2PG3A 3AL3A 2H5JA 3UVEA 3G1TA 4V0ME 3U16A 1ZVMA 2VAWA 2X3YA 3AP2A 4J0DA 1KJJA 2KE5A 3EFOA 4JJ4A 3I5MA 1W85A 1CTQA 4L02A 4MWEA 4WKBA 5AP9A 3RVRA 5ES4B 4UDOA 4YT8A 3M6WA 1KZHA 2EERA 4WA7A 4EHJA 3S5JA 4Z7OB 3FBWA 5IUKC 4IUBS 2WM3A 1G60A 3MB8A 5EEHA 1XLTA 1XZJA 3L1KA 5HCIA 3WL5A 2D0DA 3AI1A 4TTRA 1SWWA 2P8JA 3HJBA 2I8LA 3P52A 4HLQB 2I4NA 3QLVA 3GRPA 4RK7A 3G23A 4QLBA 3ZWKA 5BR1A 1MAWA 4GLLA 5FBHA 1TEXA 3KUKA 4FGJA 4BKMA 5CDFE 3V7UA 3L7CA 4WN9B 1RRPA 1YL7A 1R18A 3EH2A 4IOKA 4U9IS 2BDUA 4BKOA 2VN8A 5SICE 1I4TD 2E1RA 3AR6A 3A10A 1VCNA 1Z3CA 4M8LA 2HHLA 1GPNA 1Y37A 1MJNA 3FCAA 1W96A 3HFJA 3O3MB 4Q6BA 1W0JA 3KKEA 3FNEA 4RIIA 3WGLA 3ONNA 2ZT6A 1L1FA 1SD1A 3E7PA 3O4IA 5AVUA 1QHHB 4MQ4A 2RAVA 3AZOA 4MVCA 2YICA 1EMDA 3UFXA 3ZHCA 3HDVA 4NE7A 3E22A 1ONNA 2Z1NA 2QQEA 1KRWA 1Q83A 1G3RA 4AJLA 1Y8QB 2GZSA 2IKQA 3KKMA 1GUFA 3LKZA 4LRXA 4TS3A 4FYPA 4NI5A 4QGBA 1KS9A 5L9AA 1ZC3A 5K01A 1BDBA 1AUQA 1GLVA 2BTQA 5L7WA 1I7PA 3WAGA 1HFJA 1P5JA 5LLTA 5KJ1A 2C5BA 1L5RA 1O96A 1AXEA 3NPAA 1JAYA 1NN1A 5DGIA 4QO7A 5DK6A 2PUCA 2H4YA 1ZWLA 3A0UA 3RSQA 1ZI9A 1VFNA 1SC9A 3AHDA 3BXEA 5LJIA 3D3QA 1JG7A 1PZEA 1XEAA 5HILA 1A2BA 2XVZA 3KM0A 2Y68A 1RT9A 4CQNA 1TL7C 1EQAA 3A06A 1ZJ4A 3MWFA 1Y6RA 2CHEA 3NDPA 2I7TA 4ZKEA 4CLDA 4QVIA 1PHPA 1Y33E 1QOZA 4QU8A 4XWAA 5EE3A 5F5LA 3VVLA 3NX4A 4QDOA 4TV9A 1YS1X 3A31A 4TVKA 4E5VA 3IAEA 2PHZA 3H9UA 4M9SA 5B1YA 3EPJA 4ZOCA 4KQIA 4B3BA 1KK2A 3AOEA 1F38A 3S1AB 3DFZA 1DMRA 4KDCA 1XDSA 3DJFA 1RZUA 2XCIA 3V2GA 3VTFA 1R0CA 2CE7A 3TLKA 4J0QA 2JATA 4CIXA 3NHKA 3ESYA 2W43A 1BE0A 3A1TA 1XVTA 2V74B 1N0HA 4B85A 1GPH1 4DUZB 1JZSA 1K7YA 1N0WA 4F6LA 1R3DA 1Y4AE 3IPYA 2YY5A 2KM1A 1G3IA 4RJKA 1V1RA 5C8YF 3I52A 1WO8A 3OZIA 1K1EA 2P9YA 3NCTA 1ZCBA 4QU5A 5GGXA 3RANA 4JI0B 1ZXXA 3CNHA 2P9CA 3X1WA 5AW9A 5LQCA 3JALA 2X8LA 4BZWA 4FYHA 5ISMA 1Q7TA 4RIHA 5K3BA 1UIRA 3EXIA 1P4JA 4DANA 4S35A 1R0WA 2Q2NA 1ZKMA 4MKIA 2EQAA 1NU6A 2E4WA 3A6JA 4L9AA 3EUFA 3SIXA 1C3LA 1SIOA 2AI1A 2JA2A 2OBBA 3C87A 3F74A 3JD1A 1W9HA 3M3PA 1XZKA 3OWXA 4TRNA 5JMTA 4RTSA 2W6MA 5F3DA 2ZYRA 3SYTA 2NX2A 1A98A 4WLNA 2BM1A 4FOOA 1NJ6A 2G8NA 5HYVA 1S7GA 1NI4B 1N4DA 1GKKA 1Z8NA 4Q37A 3KQLA 3RBZA 3VR5H 2NO0A 2BEJA 5HIKA 4IIHA 2DXIA 5DW0A 5CIWA 4EHLA 2BBOA 3KB2A 4DKJA 5B53A 2J9GA 1KY4A 2BM9A 5KYTA 3QWAA 1TM1E 4DR6B 4RVFA 1R0SA 4R5MA 3K70B 2WVJA 1T2NA 1U8AA 5B6IA 4NDZA 1U2QA 1G0OA 3HS3A 3OJEA 5EJAA 2WYWA 1XPUA 3FFTA 1T8TA 5GONB 3V3KA 4HMQA 5KDOA 2C84A 1QK3A 1RYEA 5FAXA 4BDSA 4E15A 1RYZA 4HGRA 1N9ZA 1FU7A 1UQRA 1X1RA 2RGAA 5JV5A 2CJWB 4TMXA 2CLLB 2XNJA 2ZSDA 3IJEB 1V41E 5B7GA 3MILA 4EATA 2B7BA 2F1HA 2JAWA 3IA7A 5BWOA 1E7YA 3X1YA 3FNHA 5GY7A 1LNSA 3W9BA 2IIQA 4F6RB 3P0FA 3B5IA 4UJ3A 4B8ZA 3UYKA 2VP0A 4MR8B 2QI9F 3HWRA 5EWLB 3CSUA 4YXWD 1T5OA 1YK1A 3DZBA 1PFGA 1Z8DA 3WNZA 1D2MA 4FLFA 3TVDA 3SKVA 2BKUA 1PN3A 5EPEA 1IXYA 4BVJA 2QMUA 3OCXA 1Q11A 2CNWD 5G0WA 2B92A 2ZKIA 3KL2A 4P58A 4YR7A 4P3KA 1S2LA 2R1TA 4XQCA 3WBFA 2EG9A 3G0OA 4PNEA 5KINB 2OBXA 4I6GA 3FLEA 2CHFA 1KDPA 2VNIA 4H1TA 1S8FA 4CM8B 4FYYA 2GNOA 2IP2A 5B1EA 1KDTA 2C5LA 1DQSA 1Q1GA 1Y5NA 2ZWMA 1C3VA 2ZTMA 1NYTA 1K7SN 3IPXA 2J5QA 3BYZA 2AJCA 2ZSHA 3FHJA 2RI1A 4XXHA 5IVPA 3E9CA 3QPAA 4XQ9A 2OVBA 2QX4A 5E3HA 3Q1LA 1DHTA 1QC5B 3FRJA 3FTQA 2O0LA 3VYSB 1RJDA 4G4IA 5EQFA 1SQ0A 3KVRA 2CMKA 4XX0A 3CISA 4IHJF 3DOOA 3G9UA 5L7YA 2A9KA 4N5HX 4PFQA 2Q3BA 2QENA 4GQBA 3GLKA 1RLTA 2I6GA 3QVGA 2P6PA 1JILA 4QODA 2Y77A 1NBME 2DY1A 4JODA 4O08A 4RVGA 1H85A 3AZQA 1A9PA 1EKXA 2YXBA 3C3BA 5PGMA 5TPWA 1X80A 1MAHA 1Z2OX 3BC1A 3IQFA 4OD0A 5SYAA 1ZIDA 1BKSB 2POCA 1RM3A 3LY8A 4AZSA 4F7DA 5HM6A 3E3OA 4H0FA 4JLKA 1DKUA 4LX0A 3PEYA 2I6FA 2WWTA 3GHHA 1XVAA 3BMNB 2IZ0A 3Q4GA 3I04M 4M8KA 4ZO4A 1IN4A 2GM9A 3SIWA 1J2EA 2N3ZA 3LUAA 4RD6A 3E2MA 2E82A 5E6UA 2QTCA 2JCBA 2A9JA 5K0JA 1KC3A 4M8NE 1PLJA 3MJVA 1MO6A 3G82C 4JL8A 1U9CA 2IH5A 3BZBA 1TTPB 1NZFA 4TSFD 4O63O 4UHKA 2AIRA 1TKRA 3K4HA 2YWHA 4ZHQB 3H4IA 4MCAA 4WXEA 2DR3A 3KCNA 4KWHA 5AQ1A 4AW9A 2EL9A 5CTAA 3G0GA 3JZFA 4IWXA 1W48A 1Y8CA 3A8TA 3BDAA 1G8JA 1HFEL 1QGED 3FNRA 4H7EA 3E9ZA 4DZRA 3LHIA 5AVZA 3R9XA 1BHJA 4LPKA 5AT1A 1QR6A 1HLGA 3GLGE 3KQVA 3RD5A 2RC6A 4RO0A 2X9LA 4HWSA 4MQBA 4YTEA 5E2BA 1PL0A 2XF2A 3OZDA 4GE3A 4HUQA 1TXGA 3CGWA 4WKOA 4I8IA 4D4KA 1Y5LA 1I7DA 3R5HA 1R4MA 3FFXA 4MJLA 3C1AA 1JZQA 3ZS9A 1JVBA 4WNYA 1KAMA 1NR1A 5T3YA 3SE7A 4L76A 3H13A 3VC1A 2IYQA 3GEBA 4Y1FA 1A82A 5IEBA 3LXUX 3U40A 3ZZ1A 2QRHA 3AIIA 3PXBA 2QXTA 4EY4A 2Q1WA 3P96A 4UHHA 2O0KA 3I5UA 4MVJP 1LNZA 4UDXX 1YZTA 5LQSA 4RIFA 4B4VA 1GSOA 3O73A 2H5EA 2C1ZA 1F2TB 1ZGJA 3PC8A 1YAJA 1ONPA 2R1VB 1LLUA 3CHYA 3AU9A 5F21A 3ILYA 2AKEA 5CM9C 2PSHA 3ZWQA 3PICA 1Z63A 2MINB 1XMSA 4OP2A 1CHDA 2AR7A 1QB7A 2WUGA 1ZN8A 3MINA 4BZZA 2DHEA 3L40A 1Q6ZA 1MKYA 2IUFA 2WKQA 5DLPA 3RV3A 2QN2A 3WLSA 1KJQA 4K9RA 3IAM1 7AT1A 3E61A 3KV1A 3NP7A 4HX9A 3WWZA 4MS1B 2I33A 4EHNA 1CR1A 2AGVA 1U81A 5AM5A 2QPLA 3PUHA 4W5QA 2A0YA 2EGUA 1C81A 2GLXA 3O8QB 4DB4A 3QJGA 1GYPA 4J75A 3A9CA 1YHNA 1XVIA 2ZRJA 2RHCA 3AI3A 3GEHA 3M8KA 1R66A 3WV5A 1OTXA 4UVDA 3EEBA 3L6BA 2DP4E 2H2DA 1T9KA 1CRLA 3HEAA 3PNMA 3QPBA 4EG6A 1DV1A 5FP0A 4ND6A 3WIUA 1A04A 3CVYA 5LDHA 2AMVA 1CNEA 1BDIA 1E6MA 1TO6A 1LI7A 1X7YB 2HSJA 1G21B 5JNUA 1C8BA 2X40A 1TLLA 2ZYDA 4RS4A 5ALFA 5A7GA 1KOGA 3DE0X 1HLFA 1X87A 2EWMA 2OP1A 1XXHE 1B0AA 1C7EA 4NPHA 4V3BA 5A71A 2AYYA 2RAPA 1NFQA 2XHZA 1GA4A 1PJ4A 1WHSB 4A0FA 4FXPA 1QYCA 3ABRB 3X1ZA 4D8XA 1P33A 4E21A 4MGKR 5BO5A 1JFVA 2ONZA 4KMSA 3UMSA 2GGSA 2ODNA 4U8GA 1QUEA 4BP3A 1FYWA 4ANFA 5ER6A 1DDGA 2GUGA 5CVUA 1RXSA 4EVQA 4YHBA 3U7QB 2KWIA 5KU7A 5DHFA 2H9YA 1N5JA 1YOVB 3NHBA 4YXWA 3QQPA 2PKWA 2VT7A 3C6ZA 1QFMA 1UMBA 4UHFA 4G0VA 4UNIA 4N3BA 5A03A 1HQYE 1ORHA 4AJEA 4JOBA 4GP7A 3ZDXB 2ZSUA 1IWBB 1H2BA 5TY0A 3OT5A 3FIUA 2AJBA 3MWLA 4PZAA 1MVOA 2QNIA 3CO5A 3HU5A 3PCTA 2WE8A 2HPZA 4AZ3B 1GUZA 1MB0A 4M7RA 2GVDC 3CW2A 5DHPA 2OXIA 1E5XA 4OV6B 3B12A 3TOCA 3LZ6A 4Q7LA 3PGKA 3KTAA 5EZYA 2CEKA 3OOEA 3WWPA 5FV4A 5KYGA 4IZHA 2PWBA 3PNQA 4KYTA 1N6RA 1COZA 1WTCA 4RHEA 4OQMA 4X54A 3ZIDA 4N0DA 4FNOA 3DE4X 2M1XA 3NTQA 1ENPA 2FW1A 4J94A 1GGNA 4YUYA 3L0IB 2DWPA 4UC0A 2QYTA 1F6DA 2WNHA 2ZRCA 5CPBA 1TZ2A 3IS3A 3OF2A 3PFFA 3AF4A 1V4BA 4IV0A 4ZV7A 1EUYA 1BGWA 5AVWA 1X2EA 4XR4A 1HT3A 1K4YA 1UT5A 2AN1A 2RHRA 2VDRB 4K03A 5H3HA 1G2PA 1S3FA 2Y0BA 1TTTA 1QIGA 2CNKA 4TWJA 3SQMA 1H1DA 3UJ6A 2PBFA 3NHFA 5C8ZA 4DABA 4HDSA 1J9ZA 5J4LA 2YKGA 1XRNA 3VDQA 1NG9A 1RU3A 4IDNA 3QLUC 5CVDA 3EEYA 4JOSA 5I7FA 5JAMA 5K4HA 4RVCA 3P0IA 3AJEA 2P9FA 1R6AA 5JSHA 1PJCA 1NVEA 2H5IA 2WAXA 1JYFA 1R50A 4CKYA 1WPQA 4FB4A 2W22A 3HJFA 2EBUA 3TQQA 1WE2A 1WA5A 3TG2A 1U9IC 3DLCA 4ZQBA 3ZZUA 1T3LA 3PNKA 4HZUA 3RS3A 3T9AA 1SXHA 3EYWA 4X7BA 5HP4A 1U9JA 1K5HA 2XE8A 4DRYA 2WQ6A 3DLAA 4XFDA 4I55F 4AMGA 4QGHA 3HYRA 1XVLA 2UXDB 1L7MA 2VWGA 1XDUA 2XUPA 4TSFA 4JI7B 5E0KB 5GWXA 3HXTA 1SH7A 4E12A 3H0EA 3NIDB 4L0MA 3I58A 2RJ3A 5DT2A 2ZI4A 4CV0A 1JQ5A 2WU0A 3DWIA 4QECA 4DLXA 3R0XA 2R5FA 1EZZA 3GFOA 3OZRA 4CG2A 3ZWBA 2GVNA 5D00A 3W5UA 4D0GA 2BFEA 3AC0A 2VNSA 1E61A 4R0VA 2ID7A 3GH1A 2C2HA 3DAOA 3NT5A 1ZD4A 1IK6A 2RK6A 3GDGA 4X1IB 2P6OA 5I9BA 3RVLA 3TZLA 3TLGB 3WGZA 1KMMA 5JNVA 1ZUNB 3GIWA 1FP6A 2G8LA 3QTLA 3PUIA 4OAPA 2NIPA 4X8HA 4OG2A 4UM9B 1QF6A 1Y89A 2C78A 4QQRA 2PD3A 5GV7A 1XTIA 1UBNA 3DXYA 4IX1A 2XNSA 4LRYA 4F8YA 2GEKA 5B7NA 4LKOA 3AUTA 2D2IA 2BBTA 1CQJB 2YWFA 2XNDD 721PA 4KVZA 3ZE2B 4XVUA 2XYVA 3GLUA 4IJMA 3RCBA 2P2SA 3QIVA 5FWYB 1W1UA 2QQGA 3B6ZA 1Q17A 3EAQA 3KB6A 3PLRA 1JA0A 4LBVA 4O4JB 3ADCA 3NDIA 4DQDA 4AJIA 2H4HA 1MNQA 4ZI2A 2B83A 4B4DA 1FFAA 2QUZA 4FT2A 1F9AA 1OROA 3UOAB 1RI2A 3NANA 1NQTA 4Q9NA 1Z6XA 3WLAA 1G4AE 2AE2A 2ZJ6A 1LQTA 2ZETA 4GBGA 2W2XA 1SG0A 1GPYA 1R4ZA 1B6GA 2C9ZA 3FYUA 3UCEA 4BNYA 3H2HA 1ATIA 1AGRA 1HA3A 3MWJA 2DKNA 2QI9C 4M1MA 2OBYA 2AI3A 1XEXB 4UHBA 4G0PA 1SMKA 3W1EA 3F90A 1QU2A 2IS6A 2OB2A 3U9LA 1KQPA 2WG2A 4BGIA 4KE7A 4EEXA 5L3QB 1ORTA 3PX7A 1E2MA 3OBBA 4NC9A 5MFZA 2IHKA 4KK4A 4E70A 3IE1A 1UKZA 3MGCA 1HMPA 4BLOA 3DDUA 3CM0A 5I4CA 4ZTUB 1FUUA 2W6CX 4MUBA 3PE6A 3TTWA 1ZS9A 2QLBA 1GIAA 4KYVA 1E3SA 1NLYA 3VX3A 3HRHA 1T5HX 1U3CA 2B1GA 1Q1QA 5GJVC 1N2CE 1Z2PX 2X9NA 3BG5A 4KQCA 1FNNA 3OX2A 1URPA 4ZAVA 1MO5A 3DZIA 2C3UA 3FAZA 3GAAA 3NDRA 4R1SA 3NXKA 2SKDA 4OK3A 3W4JA 4GUAA 3U49A 4INZA 3GFFA 1IAVA 1Z56C 4N9QA 5DIZA 1F2UB 5E1BA 4LBWA 3HRIA 1RQNA 5F7OA 2X3UA 4EO9A 5MFPA 1Z16A 2R7LA 3GA5A 3T35A 2ANBA 4MV8A 5AKYA 4J0HA 4NXNB 5FO0A 4G97A 4PQGA 3WGKA 1TZMA 5EJ2A 821PA 3A4YA 1VSBA 1NJGA 2P91A 2XI4A 3V1KA 3T7DA 4BJ6A 2JD0A 1XRMA 4FNMA 4FZJA 3G7UA 3N2LA 3PQCA 4GOOD 4B5LA 1CK4A 2XCQA 3S29A 3EGXA 1SUIA 4LNAA 5FB3A 1OXSC 4BLSA 1YZYA 4KFUA 4P7KA 1TECE 4ZAGA 2J07A 4GMKA 521PA 2PNJA 4WN3A 4J7XA 4A2PA 2GAIA 1O94D 2DUWA 3BF8A 2JLBA 3A6PC 2O2GA 2ODAA 4FHDA 3RUFA 4K6CA 5FLYA 4CM1A 1ZOOA 4X7RA 4B6EA 1P9NA 2B6HA 4RW0A 4R2KA 3LPLA 5AIAA 3KYCB 4O2AB 4YJFB 3SWWA 4RZUA 5FBWB 1NTRA 1I4EB 1ESNA 1ZWKA 3BWEA 1NE7A 2UUPA 2V45A 2JIPA 3RT7A 3VBEA 2XWPA 4O4IA 2FMIA 3TSAA 4F5WA 3MJCA 1Y7HA 3K32A 2ZIWB 3FCXA 4LGCA 5DNWA 1KHHA 2L0XA 2H3HA 1DRVA 3HLYA 2PK3A 3GVPA 3IJPA 3LXMA 4CIDA 3ZY6A 2WAOA 1VQ1A 2I4RA 2QTVB 2HH9A 3R8XA 1GTJ1 3FG9A 5MN6A 1H69A 1VHLA 2HKIA 4Z9BA 1LDYA 1E58A 2EIXA 1SUSA 3A05A 2RKBA 4WK4B 2A58A 5KNBD 3LYUA 3EFOB 2Y76A 4BNKA 1ZIXA 1W85B 3T5PA 1OA1A 1I6WA 1B6SA 3U4IA 1USWA 1AUXA 5DTJA 2O2CA 5GADl 4HQLA 3JY6A 1ENZA 1P62B 1WZNA 1V48A 1J56A 5C0OE 4DYDA 3UWDA 1OOEA 2IOQA 2OTCA 3MFYA 4MCJA 1NVTA 5T7BA 2C5AA 3HUFA 5CFRA 3KVYA 2R6GA 1E1LA 5HKKD 4NJEA 2PGXA 1ABEA 1M6NA 2DHCA 5J63A 2IUSA 5F52A 4D9EA 4B4OA 4DADA 4XFJA 5ALYA 1GZUA 4X85A 1YZKA 2I54A 4U0JA 3ZGZA 3SFTA 4KPYA 2G80A 1KP9A 1NBWB 2W0MA 2YZMA 2BFCA 2FZEA 2R6DA 4BFZA 3C0KA 3D6TB 3LVRE 4QM6A 2GCOB 2YVKA 1KY3A 3AJ8A 4U1RA 1N1DA 2AG8A 1SQSA 1GZVA 1WDMA 2Z83A 3QBVA 2E4XA 4PZZA 3UFXB 4UTZA 2A9OA 2UV8A 4HS4A 4M7PA 5K0GA 4H31A 1OT3A 1J0AA 2Q7XA 2WKPA 4MIKA 1UEJA 3F6CA 4KR9A 1IXRC 3EF0A 1CQXA 4B4KA 1ISMA 4EGSA 1ND5A 2Q5CA 1UBGA 3HJRA 4M98A 3DE3X 5GZ6A 3DCYA 4ZEXA 3A7EA 3EPKA 4ZI7F 5E95A 5IXSA 3MUNA 2ZS9A 2HIGA 2OSBA 3OZAA 1ZSVA 1O87A 2CNLA 3I2HA 3L6RA 3QSGA 4OCZA 4F6CA 1PDWA 5M5BA 4K9OA 4AL4A 4N41A 1QDEA 2YJ4A 2XNKA 4HNHA 4YMVA 4BMXA 5C5DA 4ND4A 4QNNA 2H1CA 3YASA 1FDRA 1Y1QA 5A4KA 2XNDA 3MLBA 3UATA 1YFJA 3MTDA 4TZTA 3A1SA 2OV1A 4TV8A 1HK7A 4F21A 2WW8A 2ZKLA 3P2KA 4L73A 2CHVA 2XDQA 4I3GA 4PAOA 4QLAA 1C3JA 5D5QA 1IBCA 5FQNA 3UM9A 2XXAA 4RDXA 4BN5A 5HKAA 1OQAA 4BX8A 3KYJB 4JNKA 1DC8A 1JXOA 2OHIA 3D8TA 4ZQFA 2NU8A 3WHIA 1VGVA 3I9NA 4BYMA 2IYNA 5C1DA 5JSKA 4F84A 2COUA 3IT3A 3N5KA 3PL1A 4O4LA 4HSEA 1T9GR 5A4MS 4HPJB 3OETA 3CKKA 2Q6OA 3AEQB 4QPZA 5DBGA 1SK8A 1N2JA 4LDQA 5FOWA 2D3TA 2FP4B 4YV1A 1L1QA 1E9FA 2B4QA 1P6QA 5JJKA 1EQUA 4NBSA 4C3VA 3SYKA 2EP7A 2NSDA 2EQBA 2R87A 4QYSA 3V33A 1R9MA 3C2QA 1D6SA 1T4DA 2VTEA 3GAZA 3FPSA 2HMWA 4ZK2A 3QEAZ 4EJ0A 1YCDA 3KQKA 1BS2A 2L18A 5EVJA 1E79D 3ICCA 5T4BA 4L4RA 2FEXA 3WHPA 4L15A 3PYMA 1HDEA 1Y7TA 1HDOA 1K97A 2V7WA 3SHFA 4B3JA 2R5NA 5I5EA 4RHTA 3ZE1B 1TAUA 3C6BA 4G5SA 1OI3A 2DFDA 1BH6A 3DAPA 1GEEA 3M5PA 1F20A 1PT8A 1N75A 1SVMA 4U7WA 3V55A 3A3NA 4DWJA 3U6BA 3DOCA 4MO2A 2QL5A 2IPNA 4UAVA 3TJRA 2ZI3A 5A4AA 2CZCA 4ZGGA 2QNRA 1E7WA 3NB0A 3EGEA 4KAXA 2W2LD 5EUBA 1MORA 3B9QA 3ZTYA 1FJHA 1H8HD 2QLTA 3U7RA 4UREA 2SCUA 3L9WA 1M1XB 1MU0A 2FN8A 4BEJA 1JLLA 1O94A 2O20A 2ZT8A 4Q1DA 5IM5A 1U7TA 3ML1A 3HACA 3EUWA 1BVYF 1QLJA 2O3TA 1XT6A 3TGLA 1ULHA 4C14A 2JFOA 4I1VA 5EIEA 3WE7A 2R44A 2ATCA 1NVMB 2IHJA 3RTAA 2ZIUB 5IP5A 1NPTO 1ZD5A 2F3TA 3TE7A 4C05A 3L7YA 3L93A 1UXGA 2G6TA 4J3JA 4DXHA 3V8BA 2OAQ1 4ZU3A 1I9GA 4KPUB 4OM7A 4C7KA 3MXTA 2OEPA 3B7WA 3OH8A 4URXR 3RLIA 1DBPA 2PWYA 2UYOA 3DAYA 4CLRA 4OP3A 3IEUA 5IJ0B 2VDWB 4IO0A 3GDHA 4KJXA 5E7IA 3ROKA 1ZDMA 3T7AA 3WFIA 4ONEA 5DMHA 4FZ5A 4NLLA 1G7TA 4K8OA 4R2JA 2Z5VA 5A05A 3SN6A 3C41J 3KOXA 3TI7A 2PT6A 5HF6A 3B48A 2PMBA 2BLLA 5LLSA 2QD5A 2WP0A 1QZ3A 4N6OA 5LIRA 1KI9A 2AQ8A 3HDTA 2F17A 3U3OA 4MARA 2YMQA 5FL3A 5LB4A 3GT3A 4A1OA 1TM2A 1M34A 3WK6A 4LF4B 3V1YA 3A1NA 5HRUA 4LMRA 5F2EA 4AU1A 4AMYA 4H16A 1QVWA 5HKKA 4YIKA 3OAAD 4BAUA 5JFTA 2IS2A 3LQYA 1SXJB 4DBVO 3GFGA 1C9YA 3OZEA 4BNNA 5IN4A 2Y0CA 4KWTA 4S0XA 4DLSA 2RGNA 1Y3IA 4YACA 3CZMA 3QNWA 3RWBA 1ZU5A 5FUWA 4PLZA 4EITA 3WK9A 1JSRA 3C5VA 1NM5C 4PM4A 1ZGAA 2HRZA 1NP3A 4QBHA 1EG2A 1ZIYA 3I2FA 1T1JA 4LC9A 4XJXA 2BFFB 3EXFB 1ODIA 5LA6F 2E89A 1Z0KA 5CAEB 4C7JA 4EUKA 1RQPA 5LKRA 4Y2HA 5HUJA 3PRHA 2O07A 3U17A 4UJ5A 3USZA 4J3NA 4AAYA 3ZNPA 5H02A 3LI2A 3MCVA 1ZUD1 4YO7A 4YDQA 5JW6A 1BXRB 3LDFA 2PH5A 2XYGA 3ZCXA 2PU5A 1EWQA 1LF0A 1UL1X 2BFDA 4OK5A 3ZU5A 4GXNA 2QD3A 3JQ7A 4LK2A 4A36A 4V0NA 3P2EA 1SZDA 4IS2A 3HP7A 2GFHA 3C3EA 3ULKA 4ZT6A 3I4CA 4JP1A 4RBNA 3WDMA 1C0LA 3O5AA 2VYVD 4QGAA 1N57A 1IEXA 3C3JA 4IIJB 1JFFA 2H1RA 2WHRA 4GG1A 2C59A 1EBBA 5AHXA 4YUWA 1CZLA 1XQXA 1JT9A 5AW6A 4GI1A 2ZUSA 2HA4A 2K4MA 2VUTA 4KX5A 2Q9AA 4LOLA 1MC8A 4P4UA 3SHWA 3TFQA 4DZZA 5DX8A 3HXLA 1BS1A 1ZMXA 3PGLA 2ORYA 2XJ9A 3FCEA 4MW9A 2HPHA 3GZTB 3PEVA 5JY6A 1V39A 4TWZA 3TN7A 2DPMA 1PJLA 3V1LA 2PT5A 1XD2B 2JKZA 1JDBC 1W1IA 2Y4OA 2ZJOA 2O0MA 1XGKA 2PRZA 3Q98A 5AM1A 1QGOA 2XB9A 1M8JA 4TMFA 4XUEA 5E6SA 1S4MA 1Z9BA 4HB2A 1ACMA 2AX3A 1Y3DE 2IYLD 2W4MA 1JL3A 2BBSA 3KPWA 3EFEA 5CUQA 4EFMA 2OM6A 3MWEB 2FLWA 3VOTA 4MW6A 3U13A 1POXA 3UXYA 4HUQB 1P0PA 2ZP1A 2GZMA 3MXOA 3UHFA 3H19A 1MJFA 1YE5A 1TU0A 1ZY2A 2RKOA 3NLLA 5TQ0A 5IM4A 3NUGA 3BA6A 1Y9EA 4BFLA 4K9SA 1Y1KE 3L6UA 3UHPA 2GFIA 3EIUA 1R9NA 1UC4B 1ZSNA 5T4HA 4RXUA 3KKNA 4FCWA 4H4EA 1I3KA 3R0IA 3TW8A 4CDMA 1PTJA 1O77A 1EGAA 1PG5A 3WK8A 4KEAA 3P4YA 3ITEA 3KUXA 2JGNA 3ET4A 4MB2A 4FB5A 1ITZA 1RYHA 2BR4A 3DMTA 1U7UA 5DTQA 1SIUA 4J16C 1E79A 4M1WA 3VISA 5JRDS 2J85A 4DNQA 1GCIA 2ALJA 5CFNA 1YI8A 2MSCB 1KXJA 1D04A 1DAOA 2P68A 3CBGA 2C42A 2WIBA 1CFJA 3N8GA 5B1IA 2DETA 1L8XA 1QQ7A 1O6CA 5HE8A 3QHAA 4QEDA 2KS6A 2Q9UA 5DXJA 1V1JA 1P75A 3A4NA 3P45A 2XY4A 2CV2A 2PFKA 1C1YA 4EGQA 1NY6A 1WLSA 1G8FA 3L4KA 4GPTA 4JUAA 4C6SA 2JAPA 3KUDA 5EN4A 5H16A 2W2LA 8GPBA 5DXFA 1H8HA 4BB5A 1N3YA 4BMZA 1B15A 2IXAA 1ULUA 2A9PA 1INLA 4R5HA 5H4HA 2QLFA 2XUFA 3WL3A 4EY8A 2IH2A 3B6KA 3DBRA 3L46A 2B8WA 2YVUA 1T3ZA 1V8OA 1MIOB 4JYPA 2X7XA 3LECA 2RIRA 2GNPA 5FLXA 1EU1A 2WHEA 4UD6A 1L9KA 3T1HB 3B53X 1ICEA 2HCRA 1SU7A 3HJAA 3JASB 4HWOA 5ALSA 3L8YA 3RU7A 4PNPA 1LRKA 3QP9A 3TQFA 5B12A 4XSVA 4MUHA 1BYIA 1UP6A 4MUKA 2YV4A 4B83A 2JGRA 3BIJA 5CEFA 2BFWA 1YVUA 3UF0A 3I0NA 2OPHA 4D6XA 4TMWA 1ZR2A 3W5HA 2AK3A 1IVNA 1Z37A 1XRLA 3O94A 3IHWA 4ZREA 5B4TA 3DOUA 2BE9A 2I22A 3OA0A 3DTVD 1DWUA 3SFVA 1X0XA 1QGAA 3ZE0B 3NM4A 1E3MA 3UN1A 2VBGA 1B76A 5I7HA 2HWXA 2HRQA 1MCZA 2W6ID 2GLUA 3JAMA 4GZ3A 2C8JA 3W5SA 1L7OA 1DT3A 1GGJA 3S40A 4CHTA 2J32A 3VH2A 3OKFA 3CX6A 4A8PA 2RGDA 3F6YA 1J5PA 5I7SA 2QJWA 4E5NA 4YRNA 2FJ0A 4B76A 4MRMB 3KDAA 5HFNA 1WXXA 5BW6B 5EZSA 3NTUA 1YRQA 4R1UA 4G1FA 4FYJA 2F7SA 3OAAA 4EG1A 1P74A 4PC1A 4ARIA 3HBNA 1LI4A 5EKDA 3H5VA 3KZVA 5AI8A 4ZCRA 2AFIA 1U7XA 2EW2A 1SBIA 1UBRS 1C9KA 2CCGA 2DLDA 3FY4A 4ND1A 5EGNA 3SIPA 3UJCA 4QEZA 3ZK9A 4INPA 5BNIA 3Q8LA 5P21A 3WIOA 1R8YA 2VHJA 2C8LA 4R05A 2N0SA 4PX5A 3ELYA 3KHSA 4J07A 3G0IA 4REQA 1N8TA 1XROA 3QVKA 2Z3WA 4JI4B 1PK7A 4H3HB 3VBCA 3MCTA 3A14A 1XF9A 3IVRA 3AF1A 4UHDA 2JCXA 1PV2A 5KO2A 1KYXA 1UKCA 3NBAA 2J0UB 2XECA 5EE1A 1T1GA 3RSLA 1N5OX 1NP6A 2CDBA 4ZT5A 3TKLA 2R84A 2E2WA 2FZCA 1N6KA 4Q4DA 3VR4H 4RA9A 3RBXA 4B3HA 1ODSA 4HADA 2GKSA 4LDPA 1W76A 1JBQA 1NV8A 2AWOA 1YR6A 2Q27A 2J6IA 2XBUA 2IZ7A 1QO7A 3G3EA 3OLYA 1P0IA 2A0UA 2VYVA 4MWOA 4XGNA 3U0BA 2WB2A 2C4MA 4YXFA 4BO5A 3HYLA 1W0KD 1QG0A 2GHQA 5A6SA 4GOND 5IH7A 1T36A 5H82A 2AMJA 4QHTA 4ENQA 3TQOA 2ZJ8A 3EGCA 4HXEB 2VTVA 3PVCA 4WUVA 1L7VC 4P80A 3E7FA 4YRKA 1SUBA 2WF7A 3I9MA 2ZDQA 4U2FA 5ER9A 3W5IA 2CBGA 2Z95A 4OFXA 1I4WA 1UJ5A 3DL2A 4TXNA 2WD7A 4YCCA 5TNXA 1FUIA 2HZBA 2PX2A 4FDLA 2NAPA 4GGMX 4Z3DA 2DPGA 3H2IA 3TRFA 1EDDA 3JWGA 4IJUA 2CWWA 4OAOA 3TM5A 4DXAA 4FC7A 1CJKC 4Q02A 1ORWA 2CLCX 4EPVA 1A7KA 1N2OA 2H2GA 3REGA 4PYJA 3AEUB 4KO1S 4J49A 4XX1A 2GCGA 1JS1X 5T4EA 3MBOA 4HUJA 5A1JA 3LCRA 4O33A 2L17A 4RSRA 3UUGA 3BB3A 4D81A 1W8IA 2CCKA 4ZDWA 1LPNA 5E0OA 1I24A 4B3CA 5HM8A 4NCAA 1YS6A 3DHVA 3WNVA 1FX0A 3PPYA 1DL5A 1L4KA 5EVCA 1CY2A 2BGJA 3CRNA 1KMHA 3HWWA 1QH1A 3E35A 3R3ZA 2O1XA 1XDBA 3DOIA 3ED5A 4G1MB 4M0LA 4WIAA 3O2NA 5KNLA 4I1SA 2O23A 3IBGA 5IHXA 5A3QA 1FNCA 3HNOA 1BVUA 2C98A 3BXGA 1KU6A 4A5OA 5IVIA 3U81A 4MS3B 4G2TA 4QBIA 3B89A 4MB0A 1X42A 5D2CA 1PEAA 1V3TA 2R65A 2XE7A 4N7RA 5SY6A 3ENNA 5CLFA 3E7WA 4W5HA 4IWYA 4RKQA 3W8NA 3GNSA 1ZRHA 2RJNA 5CFPA 2K7FA 1US8A 3MMNA 2V1UA 1LV7A 2XUHA 4EJSA 1WQ3A 4E33A 4OY3A 2FPPA 1WCIB 2J9ZB 4ROTA 2NXEA 1H6DA 3FYUB 2JCYA 3VHQA 3OEYA 8AT1A 2XWQA 4FMDB 3F3YA 4FEGA 1BW9A 3R0ZA 4FX5A 1W2HA 3VMFA 2PIAA 2C4VA 1EWTA 3P2YA 4XZ3A 1O9HA 2W6QA 4DMFA 4KIFA 5ARBA 2PA3A 3CF2A 3KQHA 4P0QB 4PPNA 3PD0A 1W2GA 2FJPA 2JRCA 4JEUA 2G1KA 2VRCD 3R9IA 1FRNA 3R7AA 4O29A 4I4TA 2DWOA 2HL6A 1P0MA 2OFOA 1OVGA 3PPXA 2H6EA 1NQOA 3GNTA 1VIYA 1UANA 2IEBA 4H0CA 3ZV7A 4RVNA 3O8LA 4G4SO 3FTCA 1YZGA 4PZDA 4CTJA 5ECWA 2LE0A 2XWBF 3UJ7A 4DHWA 1FJ2A 1Q7EA 4NEHB 2W2OA 1RP1A 2O8VA 2Q9CA 3ZGVA 1NZDA 3N6RA 2A1UA 1VSUA 4IIXA 2RD2A 3GT4A 4ZGWA 2YV3A 1GSHA 2JGLA 1MQ8B 2YV1A 4GP9A 4UXHA 3DTVA 1BE8A 5CYOA 5AKIA 1W73A 3TNDA 1MAAA 1K7EB 2QTLA 3DMHA 4XPZA 1EBUA 1KBQA 2P6MA 4ER5A 4MYSA 3QVSA 1CUDA 3SM9A 2W6IA 3KDSE 3MVEA 3DZDA 4YK7A 4DUGD 4RWZA 4KN9S 4W9NA 3SJBA 5A6VA 4UU7A 2AB0A 4NU5A 5D3QA 3WK5A 1FFWA 3ZZTA 2C4NA 4M87A 3HMQA 2CJYA 2HSDA 5EKTA 1IHYA 2VHEA 3OSUA 4J0KA 2ZITA 2ZJYA 2P62A 2QRQA 3QITA 1W0CA 2PGDA 4KX3A 3ZG6A 3KZKA 2UVDA 3QUAA 4UVIA 3T3HA 4C08A 5I7UA 2PKRA 1Z6AA 3MRXA 5ALLA 2AJDA 4IGFA 3J7AC 1GPLA 3NV7A 2JFHA 4URYR 2V0CA 4Y8VA 5DO9A 3ZHYA 4DLKA 3WGYA 3DM9B 4YJ3B 1ZVKA 1I6MA 3ZCPA 3D0RA 1G5TA 1CG6A 2F43A 2GSWA 2QTAA 4Q1AA 2XA2A 5EIBC 4HNVA 2ZTHA 2QVXX 5H80A 5LJLA 3OE4A 4DR4B 3D4BA 2IYXA 4YMIA 5DV9A 2MYPA 5C80A 4OBBA 2WI8A 4YV2A 2IXBA 1HR0B 3CZPA 1Z6GA 4CMJA 2PNFA 1WMFA 2C4UA 4RMJA 4EYOA 1CP2A 2J41A 2CHGA 3OVMA 2BFMA 2FDRA 2Q7DA 1S2NA 2ERCA 3MZ0A 4ZYLA 1RXWA 5C5IA 4YI3A 3QUSA 4DNOA 3WGOA 2QAGA 3EZNA 1YFZA 5CHYA 5GONF 4AROA 2ZSEA 5FPHA 4D41A 2W7TA 3ZXXA 3LE8A 4YP9A 5K8LA 1Z6YA 2MIIA 3WLTA 3RKUA 5FDFA 3T1YB 3AVWA 3UK7A 2XUDA 5JTUA 1JKFA 1QHIA 1KS2A 2ZRAA 3U7FB 3MG9A 1DAKA 2P11A 2D1FA 1W0KA 2YS6A 5JANA 2UUCB 1ETUA 3PGJA 2XRYA 4OAQA 2D5IA 2FFQA 1HTBA 4F3KA 1NJ2A 1QANA 4DIUA 3O8BA 3NGLA 3P0HA 4MAFA 4EL0A 1J8FA 4U39A 2QG6A 1NVUQ 3L04A 4NYIQ 3LBHA 3VUFA 4WBNB 1OYYA 4ZZ3A 3GWZA 1FU8A 2VYFA 3CVJA 3ZHSA 5D86A 2ZRLA 3ITDA 3USES 4Z0HO 3UT6A 4AI6A 1OYOA 1HDZA 3A9TA 2FQWA 5J2TF 4CKWB 2PX0A 4KH1A 3K09C 5CX1A 4YMWA 1E7MA 2D7JA 2ZANA 3I1YA 1C1DA 3QEOA 5AHOA 3AHJA 1M2OA 2RHMA 1XD8A 4DCJA 5HPYB 1MO2A 1YRLA 4Y1RB 3ZR4B 2FF7A 4TS9A 5KREA 4L28A 3VZPA 1Y8RB 5IUNC 1GDDA 4N8SA 3UMJA 2GCIA 3T15A 4YB8A 1YVRA 4I2VA 1E9SA 1QUFA 3HZZA 5JH7B 3GGDA 2AVNA 3R7NA 4UFPA 1XZFA 4REMA 3GLIE 4Q16A 1DKQA 1B2RA 4QXPA 2YXLA 4XDYA 3C8HA 2WJIA 3ZDZB 4ER7A 3RTDA 1YS7A 4LQLA 3STHA 1PGOA 1N5KA 4EKEA 7REQA 3GUYA 4L6IA 3A6ZA 4KQHA 4OHZA 4Y67A 3A4IA 2Q21A 4EENA 4OKNA 4FS3A 1CR4A 3MS4A 2IUUA 5JVDA 3BXOA 3BOSA 1AKQA 1NDQA 3QF7A 2XDQB 3OCWA 2XXAB 1MC1A 4H08A 2ZCJA 4KR3A 2WFLB 5AW0A 1QVVA 2QM8A 3RR2A 4Q05A 1JFTA 3T5BA 1UDAA 4A3SA 2DCUA 2CLHB 1J2UA 2YQ4A 4PSUA 4YS6A 1E62A 5TLSA 3FDIA 4O4HA 1BZYA 2R8YA 4FGSA 3OPMA 4TL7A 3D02A 4DREA 3O38A 2BMAA 4ICIA 4C78A 1GY8A 1TC1A 3ZCSA 3U7EB 5KNBH 1RAEA 3MRVA 4O5OA 5EMMA 1W8DA 1Z4QA 1HXHA 4AQDA 1DOHA 5CB8A 4LC1A 1G2IA 3UAXA 4G1CA 1O97C 3G68A 3WWOA 4WD3A 4W4TA 4CMBA 4KOAA 1O3YA 4IH4A 2XD4A 3BCSA 1HI9A 2HEIA 3JQAD 4G4JA 5EOVA 4DN6A 2IHNA 1BJKA 2E4ZA 2ZJZA 3BE4A 3RFVA 4CI0B 5AVKA 4WBSA 4G84A 3AF0A 3OPYA 2ONJA 3SEAA 3FB4A 1VL2A 2WYHA 1VCMA 3PQ2A 1E89A 3UGTA 2QSYA 4O8ZA 1F14A 2LUOA 3HCAA 3RK1A 2IIVA 2REXB 3ROGA 2O0JA 3DJYA 3OT4A 1N7JA 2OXTA 3HYTA 5DCUA 1TUIA 3HH8A 2AMFA 5KCZA 4JLJA 3W8FA 5K0BA 1CRQA 4IHQA 3G0CA 1T3HA 4FFLA 1H2EA 3DFFA 4NEGA 3RSHA 1GGKA 1QHGA 3HLTA 4QDTA 2IUTA 2H0AA 2OM2A 2PLWA 4L0CA 2JLWA 3WSWA 1XCGB 2HF8A 3F5MA 3CB4A 2BRUA 5AHWA 3S7TA 3JVVA 3V7NA 4X64B 4DUGA 5JDIA 3TFOA 1TJ5A 1T8SA 2BZ0A 4CW7A 2RH8A 4QTTB 4W5JA 3G8BA 4U2KA 3Q7IA 4D3FA 1IEQA 2DH5A 3C4JA 2DM6A 2ZYWX 5DT9A 1X7HA 4LOIA 4D8WA 1UDCA 2NO7A 5BPHA 5J3JA 3TH5A 1WUHS 1Z5OA 3GR6A 1QONA 3HGQA 1GR1A 2IS1A 2VHUA 4ND7A 3WIEA 4WJLA 3G5TA 4LE1A 1YH3A 3TVTA 2GVZC 4IJ5A 3P5SA 2EW8A 1CLEA 4ZYYA 2Q0QA 1G8PA 3A11A 1E7QA 2ESRA 8MHTA 3OHPA 1XZEA 3H11A 2TYSB 4JWTA 4LXGA 3HR7A 2EFDB 3Q12A 5CYPA 1UKBA 5ESXA 5ICCA 2F3SA 2NUTB 2FSGA 3I2JA 3JARA 3LCCA 4QC2A 4BTLA 4QNRA 3TKYA 3REQA 1M8GA 4RKWA 1RLMA 2RHGB 2OE2A 3GI1A 5CT6A 3SOZA 2OHXA 1M6EX 3I9LA 2VZ8A 1U11A 4RY9A 4ZT3A 5JXIA 2Q4DA 5KQLA 2RGXA 1QV9A 2OV8A 4PPQA 1E2KA 1CQPA 1U0SY 2CKDA 3JQFC 5AVJA 2P4SA 1OX4B 2FPMA 2VQDA 3ZJTA 3SDZA 2YBDA 2JHFA 4B6RA 1VJCA 3OC0A 3OO0A 3HCEA 3WOHA 5CDHA 3KYDB 1L5HA 5LFAA 1PWXA 4HFJA 4JOCA 2QVCA 3TRDA 4AT1A 3T1VA 2Y1WA 4LZZA 4DT1A 1ECLA 4RKYA 3EIFA 4F46A 2FZ4A 3NR2A 5G0UA 2RG7A 1XKQA 4J43A 2XTMA 1XHLA 2B8EA 2YJZA 1KK1A 2Z9DA 1RVDA 1I0ZA 4TTAA 5ITWA 1E98A 1T0IA 4CKCB 2W8BA 4Q3LA 3ZU6A 1TVKA 3UAWA 3P94A 4D44A 4P22A 3RAJA 3U4QB 3TLZA 4I1PA 3E4DA 1TKCA 3ZHXA 4LRTB 3EIWA 2GARA 3D6NB 4OFBA 5J5AA 4NRDA 3N8DA 2KW5A 3FPCA 4BNWA 5LMZA 4XUCA 1KQNA 1OR8A 3GD5A 3ZDRA 3SQDA 4G5HA 4BLVA 2J3LA 3L05A 3ZVMA 5GMOA 2CDCA 2R6AA 3KBOA 4FPXA 4KITB 4KRFA 4G8CA 5EFOA 3NETA 1T8UA 2IV7A 2QTFA 1WMDA 3FPFA 1GTMA 1FPQA 1E6UA 1IHOA 2GCPA 1ZVQA 3PDIA 3IVCA 4CG0A 5THQA 3JQ7B 1G20B 1QJCA 5DGCA 5HFAA 4PGGA 3OIDA 4FGUA 1K88A 2HQSA 2B20A 3U60B 4CM5A 3THWA 2FMKA 3TTTA 1H3FA 5C9ZA 5JNTA 1GSAA 4LXIA 5DM1A 1P1IA 2I2WA 4EG4A 1JFFB 1T5DX 1U0OC 2Q3DA 4HDKA 4TL8A 5FRDA 1DHRA 2FQYA 2I78A 1GG8A 4JSRA 1AA6A 4A1FA 5FI1B 4ALMA 4TQ9A 2B5VA 3H2SA 5JXWA 4GR4A 1DB3A 1AQ6A 2QW1A 4BNZA 1ZFNA 2HWUA 2QY6A 5G4KA 1XMPA 2EFEB 4AWXA 3A3YA 3DBLA 4EA9A 5LP6B 1AO0A 1IB6A 1WVIA 2AOTB 4D25A 1ZD8A 2JI4A 3SP1A 4KDEA 4HFRA 3KFVA 3ADDA 1AH2A 1LUAA 2WSMA 3QKIA 1XMIA 1DO8A 4MRNA 3JVUA 4ENWA 1XHEA 2W11A 2EF1A 3Q7PA 1UC9A 5T3UA 4XB1A 4BMOB 5WRFA 4F93B 4MVJD 4KAFA 2OAEA 4LX8A 1GKYA 3H1FA 1PZMA 3IYLW 4GOXA 3V80A 4PR0A 4M83A 2EJCA 1GZ4A 2YVLA 5F64A 3CNOA 4HHEA 4YWHA 3UMMA 4R1LA 5MF6A 1JLKA 4GXRA 1AQIA 1C30A 1U8EA 2GX6A 3CINA 4LY0A 4OQYA 2P69A 2ZBUA 1DXOA 3AGQA 3NTLA 4ZAWA 3RIEA 5BW8A 2ODWA 1FYVA 1ZR4A 1B8NA 2P79A 3OIYA 3KDPA 3TZKA 4P82A 1VKOA 5DM60 3MGGA 3G2OA 3DE6X 1F51E 2PRIA 4Q66C 2VPYA 4Z9YA 3R76A 3JQAA 3TW8B 3VZBA 3HU2A 3RC1A 1F2VA 2VZ9A 3ZWAA 1MX3A 3IP1A 1JYEA 2NP6A 1U31A 4WLEA 2GPWA 4DWOA 3PJFA 1UOQA 2A1TR 4Q4LA 3QVXA 3IXLA 3U31A 4ZHSA 1PS9A 1OV4A 2VTBB 1AZWA 4ZAZA 1MHTA 1UXOA 3ZHBA 5BORA 5CH8A 1I9CA 1L4UA 1N2IA 1Z7WA 3FWKA 4R98A 1KWKA 4MO9A 3OOHA 1T5LA 2FE4A 3VJMA 3P20A 4G1UC 3FTDA 3K70C 5EIHA 4Q9LA 2DX7A 5BV0A 1E1YA 1M6YA 2CYBA 1R8JA 4OBEA 4UCFA 3TUJC 3KQWA 1ZN2A 5C52B 2AUNA 4JT2A 4N0QA 1RE0A 3BXZA 1UZNA 3QTTA 5ES3A 4ETIA 5LDDC 3EULA 4NYJR 4XYMA 1IDOA 1ZNZA 2QN1A 4O4JF 1NBAA 2I2FA 4XWOA 3PNOA 4OUDB 1IZ0A 1NXXA 4OHPA 4BIMA 2LV8A 1DAPA 1VPEA 2ZVJA 1NHGA 2P9QA 3JWJA 3L0CA 1ULZA 4X6YA 4XOUA 4A10A 1L1RA 3QXHA 5HE9A 1D2AA 1NVBA 4YLEA 4EJFA 1Z7BA 4J0JA 3K0SA 2WD9A 1TDJA 3KR1A 4TYQA 5K3SA 1KOFA 5EJFA 2GO1A 2GYVA 1QRSA 2QTMA 3OESA 3PHHA 2O7NA 4EHBA 3VR3D 5CB4A 2GWRA 4IIGA 1HX7A 3GJ8A 1DC6A 4X44A 3ON5A 1N2ZA 1NURA 2GK7A 1L7AA 1HYQA 1DLIA 4TYNA 5FBRB 3EXEB 3P9KA 4CM7A 3OUUA 3I6BA 3EARA 3GK3A 1GKUB 4AY6A 4OI0A 3HU1A 1RYMA 2R6CA 4GL4A 3UA4A 1SUEA 3R7BA 3B2EA 4KJZA 1YJ8A 4C6TA 1C7FA 4FWIB 4U2EA 3VPSA 3ZE9A 3RFUA 1U2EA 4JKIA 2CT8A 3SX2A 3LGSA 2Y8EA 4ZOLF 3ESRA 4Y6PA 2I3GA 5ICSA 1QGZA 3CTPA 3QKTA 5JADA 4IILA 3EPRA 3H86A 3WX0A 5CITA 1A9XA 1HFWA 2BR5A 4L4YA 4YI5A 4HDMB 5HNKA 5I9MA 1CEEA 4BNVA 2ZJAA 3DWEX 3KJQA 1CUYA 3D6JA 3K5IA 4JH0A 2OO5C 1SXIA 2VP5A 3CLRD 3GLFA 2O8BA 4EMSA 1MOZA 4N7MA 2IHVA 4IDBA 5KTYA 4DUPA 2ZYUX 2HXGA 3LP8A 1MJGA 5LP1A 4LWQA 3KR2A 4JI5B 4F4FA 2YJGA 2QR2A 3VNBA 1U2GA 3THYB 4M1YA 5JAZA 3I64A 3T4UA 1O58A 2NGRA 1NC3A 4JY7A 5A9SB 2D5BA 3UAGA 1RKUA 4G5OA 1R6XA 4LVOA 5KPJA 1GTRA 2AL7A 3E4CA 1MJ5A 4QRIA 1R88A 3S44A 3V4FA 1MN6A 3Q85A 5JQGA 1QP8A 2ATIA 4K9DA 2CLDX 1HDCA 1JKJA 4RA9B 3NJ8A 4L78A 5F3RA 4LOHA 1LW7A 3SYLA 1NULA 3IEIA 3D7SA 3DB1A 3W5BA 4X8LA 1WW8A 3EAFA 4CCYB 2Y1FA 3K0BA 5ALTA 1OZFA 2Z1DA 1P9OA 3WGNA 1A5BB 2AJTA 5LWQA 1NHWA 2X41A 2GBLC 1E4YA 1QFZA 2VQ6A 2J3QA 2SKEA 3N7AA 3OQIA 1GNLA 4EJ6A 1SVIA 4L0DA 2NXNA 1GNVA 4R8KA 3RREA 5IRCD 5J2UA 5JSZB 1CQZA 1KAOA 1SC4A 2B8JA 3GVXA 3O91A 2NSYA 4LZOA 4YRDA 3I30X 1OYWA 3L6DA 3QX8A 5KMGB 4KP7A 4UPDA 2WJAA 3AFOA 2G9RA 2CJPA 1NLZA 3LVQE 3Q3IA 4HVTA 1E2UA 4CLEA 5KEIA 1EE9A 2IIPA 2C9DA 1BXGA 1GPBA 4JUDX 1REQB 3R5JA 5CB6A 4AQYB 4PHFA 4AULA 5T4FA 4C4ZA 3FLMA 1LV8A 2ZDGA 3D6HA 4ZCQA 2P2YA 2PDAA 3D6MA 3BMQA 4MVJA 5IDYA 4R51A 3H1BA 5IDQA 2UXCB 1VL6A 3LL7A 1NX9A 1WCWA 4CGYA 1V2HE 2NU7A 3BTUA 4DARA 1DAIA 4Z7NB 2XIJA 4NEQA 2IK8A 2AC2A 3FVQA 1ELOA 3EXG2 2GBIA 4EW3A 1I51A 3FZEA 1X70A 4RY2A 4AICA 2BKLA 4LJ8A 3KWJA 1NMEA 4RNCA 4ALIA 6LDHA 5JAIA 3WMEA 4W6ZA 5CLQA 2ARKA 4JENA 3MWGA 5GM2A 4YRGA 1N6IA 2AYXA 3O9VA 1M1YB 2QIOA 3NBQA 1MG0A 4BX2A 1A95A 2PL5A 1OBOA 3JS5A 4HYQA 3CN9A 1EXNA 1PWYE 2BLNA 1FFXA 3TNFA 4AJOA 4DGQA 1NVDA 3MWYW 4CMEA 3NPMA 4KFCA 1UM9A 2G9UA 2GPBA 3RYIB 1XPJA 1US8B 2HCJB 2VTDA 1IN8A 4DA0A 5BQXA 1OBHA 4GSYA 2A2ZA 1HLDA 1G291 2AZDA 2OHOA 4TWIA 1N8NA 1QYWA 3VOAA 1H05A 1XX6A 1Z68A 4RXMA 4B80A 1MFZA 2VRBA 3E1KA 4NMLA 1IVSA 1PQWA 1U0FA 3ENWA 3NKLA 1AKNA 1LPMA 3BK7A 2HQBA 4P7JA 1L3BA 2WINI 1RAIA 3PQFA 5GP1A 1LS6A 2IEYA 3C5EA 3KQQA 1KEEB 2ZSIA 4ZARA 1OTYA 3E5HA 3Q8XB 4I4TB 3X0DA 2J59A 2HSEA 4LCEA 3FMOB 1Z39A 3QKRA 4OKIA 5EY5B 3LXXA 1P5ZB 5CM2Z 3C8UA 5TR9A 4XLLA 1QFSA 3R8CA 5BPFA 3NOVA 3RUDA 3ICVA 1SOMA 1BWQA 2AN3A 2IPLA 4Y9UA 1KI1A 4BNHA 1ZEMA 3RK0A 1CUUA 2I7VA 2KBFA 4WHMA 3VR3A 4JXXA 2BHNA 5ITVA 2BH2A 2EFJA 2A1UB 1DEXA 1I2DA 1DDIA 3B1WA 3PQ5A 4NV1A 4U7HA 3OQOA 3L4BA 2PMKA 1FC0A 3ZKAA 4BVGA 4ZT4A 3FPJA 1SG6A 3KLMX 4TTPA 5FLKA 3EC2A 5AVXA 2A4KA 5HA5A 3IAM6 3WJ2A 4R81A 5DNUA 2H07A 2HUPA 3DEIA 1O4WA 1R4AA 4JAVC 2JAOA 3ICWA 3QZUA 2PBRA 1MO4A 4ZQHA 1MOQA 3AKDA 2EJWA 3OPVA 4RZXA 1KERA 2GK4A 1P8JA 4OA5A 3EWNA 4TRRA 5HEKA