4EO7A

Crystal structure of the tir domain of human myeloid differentiation primary response protein 88.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
144
structure length
142
Chain Sequence
GGVDMPERFDAFICYCPDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPTKSWFWTRLAKALSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Myeloid differentiation primary response protein MyD88
publication title Molecular mechanisms for the subversion of MyD88 signaling by TcpC from virulent uropathogenic Escherichia coli.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 142
sequence length 144
ec nomenclature
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01582 TIR TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4eo7A01
5FORA 4LZPA 4W8GA 3JRNA 3UB3A 4LQCA 4LQDA 1FYVA 3UB4A 4C6SA 2JS7A 3H16A 2Z5VA 5KU7A 3UB2A 4C7MA 4C6TA 2J67A 1O77A 5H3CA 3OZIA 4C6RA 4C6TB 4EO7A 2Y92A 2M1XA 1FYWA 4DOMA 4FZ5A 1FYXA 1T3GA 4W8HA 4OM7A
chains in the Genus database with same CATH superfamily
1P7WA 3LVRE 2QTBA 4JZYA 4BO5A 5CDTA 4CLEA 3P9IA 2FETA 1T1JA 2OCKA 4D6PA 1M72A 5E1OA 3WRXA 3TW0A 2CNKA 2ZIUB 2EW2A 3PUXA 1ZK3A 3TH5A 4WT7A 4DLLA 3EF3A 3TINA 4GRDA 1CY1A 2GCNA 1QP7A 3FCAA 4MR9A 5DX1A 5ADVA 4XEHA 1S8OA 2D2IA 3CNQS 1DOHA 3KJNA 2GSWA 3GLGE 3KOUA 2NPOA 3UXHA 3VPBA 5K8VA 4RTRA 4EECA 3WGGA 3K5IA 4MGZR 4H18A 3O8LA 4C08A 3VYSB 5BWOA 4G0UA 1H2WA 3KT3A 4CL8A 4YP7A 1HYGA 3NXSA 4W99A 2IP2A 5KVQA 2J1LA 3P71T 3KPJA 1MB0A 3EZ7A 3K0HA 4ZPJA 3JWJA 5HF5A 5A9SA 1FVFA 4WZ6A 1VE6A 2AJDA 3SLRA 1KIMA 4CTMA 1BDMA 4EHAA 3EZFA 3OU6A 2X0FA 3RS5A 4D3FA 5ALEA 4Q47A 3MN1A 2VHEA 1H4TA 3BE4A 4P3PA 4EG7A 2XMQA 5FO0A 3DV0B 3L5OA 3FTFA 1QE3A 1ILWA 4JODA 2IYWA 2GJAA 1KERA 1UPTA 2RHMA 1NF9A 1ETHA 1NM5A 4P3NA 2YHIA 3F4BA 1AGXA 4Z3DA 5J58A 4M87A 1XPRA 5AW6A 1Y37A 2P8SA 4K9NA 4RD4A 3RTCA 4GUAA 1R16A 3AT1A 4C6RA 4KXUA 4UBMA 4ZEWA 3WL7A 5JXIA 5TQJA 3WP0A 3AY7A 4UHHA 1XD9A 1UXJA 1WUJS 3CY6A 1Z0FA 3MFQA 2Z9CA 2AZTA 1M2VA 2F00A 5EZSA 3A11A 4HDNB 2AYXA 1WW8A 4Z8YA 3AUSA 3LPMA 4GOXA 4D41A 3BHNA 3QYFA 2AJBA 4DSUA 2CNNA 3VOBA 3L92A 5KTPA 5A7FA 1JIVA 3TEJA 4MMXB 5L95A 2GKGA 5CXXA 1AHNA 1NONA 1OWNA 2VSNA 2V3VA 2XR1A 3U56A 1AD2A 3A0RB 4K3VA 1VBMA 3RYIA 4CF7A 1XMOB 1Q84A 2ZYHA 5H80A 5DLPA 3QV2A 3WHIA 4C0HA 3G0CA 3ZCSA 3F8SA 4RTKA 4ZCIA 4XYLA 1K7XB 4JU9A 4Z2YA 1ESEA 4C4YA 3D5TA 2IKSA 3BWCA 3QX8A 1M2OA 1LPOA 1FJXA 1IZ7A 5DGDA 2QSZA 3GDGA 5E7JA 4RQTA 1J9EA 2G9NA 3KB2A 1GT6A 2P2GA 1J49A 1I8TA 4NBNA 1RZRD 4EJ0A 2RONA 3OKPA 1LWNA 1CQIA 4J0GA 1C3VA 3FDZA 2J5QA 3NASA 5B7NA 5DTMA 3FSJX 2CMGA 2QTVB 2Y6VA 3WKEA 4EMUA 3KXPA 4N3CA 3ZY5A 1KJNA 1HPLA 2HK6A 1SUCA 3CJQA 4F97A 4R2IA 5LU8A 2GRUA 3I8OA 1ZY2A 4CQMA 3G6KA 4CCWA 1KWGA 1UBOS 4LSMA 4WL0A 1KBQA 4O3MA 5B12A 3CBGA 4Q9JA 5BR4A 1YS9A 1JH9A 2ZRLA 3FJ1A 4IOMA 1ADGA 2OV2A 3FMVA 4QEDA 3UMSA 3TUZC 2ZATA 2F9FA 2NZUG 5DTEA 1DCTA 4M89A 3IT1A 3HJAA 1XMJA 2BMVA 3DTVD 2G5TA 4FYKA 2CLHB 1CC1S 3MTAA 5FPPA 1UBCA 1QHEA 2DRIA 1XCLA 1XMXA 5BQOA 4UM9D 5KHAA 4KO1S 3O9ZA 3PVSA 5HQTA 2QRGA 3MLBA 1ZJJA 5CGZA 4FI3C 1DI0A 3DE2X 1IZYA 4FK8A 2PGXA 2PSDA 3G23A 4WKBA 3JD4A 4ZO9A 5I9BA 4F45A 4E22A 1KEKA 4JBIA 1ZN8A 3CR7A 1NRWA 4XAQA 1QGED 3HR7A 1MV5A 2ES4A 5DEOA 2AG8A 4TXLA 1CDEA 2NW6A 3K53A 2WDPA 3DWGA 1C81A 2AIRA 2HGSA 2OAGA 4ALIA 5BRNA 4QAJA 1IFXA 3QKRA 4JJKA 1T9AA 2E9SA 4TVOA 2QIOA 3PFCA 4BCDA 4DQKA 2CNWD 3W5JA 2YZGA 3O3NB 2XJ9A 2SKCA 3N2EA 4C87A 4Q3AA 4UEWA 4KR3A 1HE4A 1TE2A 2PZMA 3G59A 3K0EA 2FUKA 1L4NA 1SA0A 1KH2A 2PCLA 5DJ5A 1K5GA 2WB2A 1XZKA 4QC2A 4GAEA 1W5BA 5SZIA 1A7KA 3GHYA 1XCOA 5JJIA 1GR1A 4RLQA 3FNHA 3VZDA 2X3YA 3A9SA 4MUNA 3GOQA 3EVDA 4ZT7A 3HXTA 2GFQA 4Z0PA 1ODJA 4RO0A 2ID4A 4BNIA 2IC5A 2IV7A 1W96A 1QGUA 1F0YA 3GWGA 3NM4A 5DFAA 4R3NA 5KVVA 2C7GA 2WJJA 3JVDA 4RTSA 1JXAA 2AS0A 2X7HA 4KFTA 3NBMA 1ZITA 4GBED 4BO1A 3PITA 4AKSA 3KZMA 5AKJA 3KM0A 4FGUA 1T9KA 4OSOA 5FOWA 1H3FA 2JG3A 1MGOA 2F7SA 3BSYA 3EC1A 2SBTA 3D3QA 2CV1A 3ZVLA 3K1JA 3K1AA 5PNTA 5K0GA 3U3OA 2LR0A 3JSAA 5AKLA 2X22A 1R8QA 4X84A 3BIXA 4YJFB 3U19A 5I51A 4F85A 3KQQA 4HWKA 4IUCS 3RG8A 4AMGA 1X8LA 4PRZA 1GG5A 1KK1A 5H82A 3X1KA 1N1EA 5B37A 4UVIA 1Y42X 2E4VA 4MINA 3AL0C 3CVOA 3H9JA 5T3UA 3UGJA 1JG4A 4R2XA 2R86A 4BIMA 1NJ2A 3BQMB 4Z2AA 1G66A 2OCPA 1I2ZA 2PU7A 4QRDA 3L4JA 3ZGXA 4CM1A 4GXRA 4O4HF 1HQKA 1SQ0A 1TC2A 2PPVA 3LA8A 3GG2A 3J81k 4JAVC 1GG9A 3D3KA 5EQFA 4B48A 5HIJA 4CFYA 1HDEA 2VSOA 3DZJA 2HF7A 2O8CA 2C8JA 2DY0A 1E5DA 2GARA 3CZ5A 3RANA 4BGIA 2FRXA 1PR9A 3TSZA 2YBDA 1JVBA 1XMPA 3VISA 4Q19A 3RHFA 2C82A 4NEGA 3VKVA 1LV8A 4B3DA 3TEMA 2X8BA 4ZZ3A 4A15A 3SBDA 4U9IS 1FSFA 1WF6A 3KAJA 1FC0A 3KEOA 2DF8A 1REQA 4ZVNA 4R68A 2DAPA 1XTZA 3CH7A 4HVLA 3L0DA 3IPAA 2E4YA 2EZ8A 3K31A 2C31A 1E6UA 3B5IA 2AZ4A 4TM7A 1JIIA 4TSKA 1X92A 1V26A 4HAVA 1QHHB 4B7AA 5JY1A 4N5HX 4IF4A 2VJMB 3WL4A 5EZQA 2AUMA 4F2DA 1WUTA 2X7JA 3G49A 3VR4A 4YJGB 4D4IA 4RTMA 4FM9A 1X3SA 4WFIA 4Y3UA 3JQFC 4N12A 4EWLA 1G1MA 2E4XA 2QMUA 4ZYXA 2PZLA 1TX4B 4OL0A 5GV7A 3ZK7A 4RYDA 3OE5A 1ZO8A 2GAOA 1WUIS 2VSQA 1GPBA 2ZBGA 3MZ0A 4FINA 2B0CA 4QGFA 1WDTA 2RHHA 3C0KA 4YAOA 4DR6B 3S1AB 1SY7A 2AQHA 1JI3A 1QKJA 3JX9A 3OQOA 2J5KA 3B51X 4M7PA 1ZLYA 2C8LA 1HNXB 4QXQA 2GMWA 2VP5A 4O4LA 1NYLA 5AVTA 1DJNA 4TS1A 3N74A 3L0OA 4JXJA 3WA6A 3KIPA 3LKDA 1OU4A 3UGKA 2GYVA 4A5SA 3BB1A 1ZGZA 1JEOA 4N48A 2JAUA 2HZBA 1HO3A 2QTMA 2SECE 3UN1A 3L49A 4Z9FA 3CLRD 4G3XA 5HA5A 1SRQA 2X14A 3C41J 3VAYA 4HQNA 2G9VA 5AM2A 3PIRA 1NI5A 1NGSA 5CFPA 4LJKA 1ND6A 1OIWA 2P65A 3JWGA 3S28A 1JL3A 1PJ8A 2EEZA 5K09A 2PGOA 3ZWWA 5L3SA 2QD1A 1IN4A 1G9XA 2VJQA 3O2SB 2WZQA 3HK2A 4ND7A 2JCGA 4MQ5A 4E6PA 1GCIA 2IIBA 3TLCA 4UOZA 2QVXX 1BE6A 1PR5A 1FRQA 3N8HA 4BQNA 1OGIA 4JI4B 1RU3A 3S2EA 4IJQA 5A1TA 3HB0A 5BSTA 3UEOA 3I05A 3I6MA 4FYIA 3IXMA 4K9MA 3ZCVA 1PP4A 1WB5A 1U0SY 4IX1A 1BD3A 1T1IA 1ZA1A 1OWPA 1Z6TA 3G2QA 3OF3A 3R3XA 5CFQA 1XR3A 3ETEA 2H63A 2FWJA 3RSSA 4HLUC 1KQNA 3ZLBA 4LRQA 4OHOA 4L1KA 4KP7A 4WCFC 1XKQA 3FYSA 2F6RA 5ADWA 2WIGA 1D6SA 4II7A 2R25B 4UHKA 4JQSA 5K0JA 3ABIA 4MS4A 5EIOA 3R8CA 3R9XA 2IHUA 3TRHA 5K4AA 5KYYA 4PXSA 3TBKA 4DQUA 2IYVA 3VU9B 1P33A 3T7AA 4WBNF 1U90A 2E85A 5IKEA 2BT4A 1Q12A 4P58A 3R3YA 1PG5A 1GPH1 1ZK0A 2HJVA 1Q1QA 2IW3A 5KQMA 5TGDA 5FL3A 5ALZA 1GQ2A 3ZY4A 2QLTA 4YUAA 2X42A 4RMJA 4U8HA 1G6KA 2FMTA 5DEIA 1WPXA 1QANA 1CZKA 2FW9A 2QG4A 4JC8A 2YVLA 1QQAA 2H4XA 5BO5A 3ESCA 3BXEA 2IIVA 5KX5B 1C0PA 1EGQA 1R6BX 4AZ0B 4DUGA 2PWZA 5AHWA 2D0OB 3FTQA 3C7TA 3FZGA 3WE7A 4CW7A 5AKZA 1H3EA 2IS2A 4UOEA 5LYJB 1LPAB 4J0CA 4QT0A 3JRWA 4PRLA 3NT2A 2ZB2A 4S2EA 3ZW9A 4S1VA 2JBAB 1SKMA 4ESOA 1XTBA 4FMDF 2DYKA 4CWAA 3WZLA 2QTWB 3KQMA 3A1CA 2PQ6A 5HW0A 2UZ1A 2ZRPA 3OQ6A 4J90A 1T36A 5I7OA 2AQKA 5F7OA 4D3SA 1GZUA 1MA0A 1H0RA 3WKBA 5SICE 1W6RA 4YJHB 1T2NA 2WQ7A 3DDSA 3DE5X 3ENQA 1DEAA 2NZWA 5DNAA 4HDSA 4RTJA 3I62A 4A23A 4U4AA 1MJGM 3OQIB 2NSLA 3EWAA 3LKZA 5TGTA 4MYDA 3BXPA 2KQUA 2YWRA 3I73A 4G0NA 3I2HA 2ISCA 5I7WA 3KFVA 1QS0B 3QXCA 3PYXA 4D46A 3RAGA 4IDHA 4UXIA 4F21A 1SZCA 2CKMA 2WWWA 2A57A 3BJZA 3IV7A 5GONB 3QOWA 1ZGBA 2FW8A 2HI0A 4OLBA 4GMGA 3WC4A 1RRFA 3ZWQA 4EYEA 1E1CB 2AEJA 2SKEA 3K70B 3CLVA 2WMDA 1RQGA 2PKQP 3PVCA 4HX5A 4JIGA 2WHQA 4AJEA 4EHLA 2OUKA 5DE3A 5JNSA 3L7OA 2Q3MA 1T9DA 1WXDA 2R2GA 3DVRX 4IFTA 4M0DA 1IPFA 4LZPA 4ZDWA 4J3NA 1FRFS 1RMTA 4KSBA 4EHBA 1L5LA 3IKLA 4P92A 1AY0A 4JLBA 2A59A 4ZK6A 2B2XA 2QD2A 3IV9A 3P97A 4BAZA 1D8AA 4V1CB 2GA8A 2QUAA 4J1SA 4KDCA 4DDWA 5ED0A 3N2ZB 2NXWA 1E18A 3DVAB 3F2VA 3OT1A 3F8WA 4L4RA 2QW1A 2VXOA 1NR1A 1GUAA 2AFRA 2WINI 4R2HA 5A6VA 4DUYB 3VGPA 3ZE1B 1H1LB 5AKGA 4CJXA 4TQAA 3IQDB 5CT5A 4EVQA 1I3MA 5JFOA 1T2EA 1GN8A 1ZD1A 1ZW1A 1MOPA 1Y9EA 2J87A 1RJGA 2NU6B 1YACA 5DTJA 1FDVA 5REQA 2A9RA 4U00A 5J4HA 1M1ZA 4HXYA 1U5BA 1CUHA 1FFWA 3S2YA 4IX9A 3QELB 1R0SA 1FL9A 3QYJA 1DEKA 3Q1KA 1CY4A 3ZJUA 5ESXA 3SHVA 1OKKD 4F0JA 4YJ2B 1CUYA 4NBWA 2HRBA 4TRMA 4B34A 2JIZD 1UWCA 1JDNA 2CFOA 4MIYA 4O4IA 2CF6A 2D3WA 4CLRB 4ENUA 3ZN2A 5JYEA 4NCBA 5CYFA 5K0EA 4RZ3A 2QG9A 4W7HA 1JG2A 1UM9B 4DCGA 3HM2A 5T41A 4YT5A 5C5EA 1IE3A 4ZXFA 2VSFA 3QE0A 5LYJF 3A58B 1ONPA 1RJDA 3D1VA 5EY5B 1D7AA 3AM1A 1RJ9A 3WHLA 4DV5B 3HCFA 4R0VA 1A4IA 1X13A 1FYWA 1V5EA 4ZCPA 3UG7A 1C9JA 2QNIA 1U0EA 3A6KA 4EGAA 5A4KA 1XZQA 1IHPA 3CZAA 1J22A 5AK3A 4LQ4A 3F6SA 4MWGA 5GZ1A 1X42A 1JYSA 3DKKA 2HRQA 3Q7IA 1Z0UA 3L4EA 4MGEA 3CEPB 4C04A 4EGCB 2ZSIA 1KEVA 1QPBA 2QXYA 2DHRA 5GTDA 3GT0A 1RP7A 1TFUA 3S99A 3SY8A 3BVPA 4YT8A 4JGIA 2DPXA 4L57A 1JWBB 1U1GA 1R6VA 4X1KB 4EY8A 2ZBQA 3P0HA 4HB4A 3HZOA 2BYTA 2VF8A 2ZOSA 3LOQA 4ZGWA 1GPYA 1P5HA 2W6MA 1LDYA 2X76A 4UM8B 3W5SA 1FNCA 4IXDA 2ODPA 3H5IA 3K0CC 4BJ6A 2ONKA 3OZWA 4Y6PA 3NDIA 3IHKA 1TO2E 3EH1A 3QW4B 2IEIA 3SZ3A 4DCUA 3A3KA 1WQ4A 2VK2A 3NORA 1V1MB 4PQYA 1C14A 2WJ6A 5CFRA 4D9MA 5FH9A 1GQFA 5JDCA 3HB9A 4F93B 4B84A 2IOFK 1GAXA 1XTJA 1KRWA 3EG5A 2PUAA 1E89A 1GL9B 4R0MA 1E1RA 4NCAA 1IBSA 2PMEA 1OHHD 2XUGA 4QASA 1A1VA 2Q0HA 4KK3A 4RIEA 4FEGA 5EA2A 3NP9A 1Z8DA 1SG6A 5IM5A 2ROQA 1KYQA 3THYB 3BT7A 3C1TA 2Z95A 1M5UA 1NN5A 3AHCA 5ES4B 4F2GA 1PSZA 3NEAA 4P9NA 1CZHA 4Q1BA 1EQAA 5K1ZA 4P3XA 5D1NA 5HKKA 2XCTB 3PA8A 4TVBA 4XD7D 1V45E 5B3AA 4OJTA 5ETJA 3WMFA 2JLXA 5F5NA 3FCOA 1A9RA 2OGTA 2Y8EA 2H0RA 3JTMA 3K09C 3BB3A 4OHPA 4WE3A 3SIXA 3WGHA 2OPBA 5CTAA 3SICE 1J1ZA 2B1RA 4MR8B 1NBAA 3EH2A 4KVGA 4PRYA 1YU6A 1E1QD 3QLUC 3R24A 4JP3A 4PAGA 3UKOA 4RHCA 4D2IA 5DLQC 5FEUA 4DARA 1AKMA 3QGMA 4R71A 2FSUA 4YJ2F 4QWWA 3LK7A 2WWGA 3HA7A 3WZ2A 2RGAA 3BGVA 1P4JA 4LW8A 2NX2A 1SHLA 3ETCA 2JLAA 2W98A 3WWDA 4C43A 2QRJA 2W2KB 3LTEA 4HFNA 2JRLA 1NJFA 5NLLA 3STVA 3KLNA 3AETB 4XGNA 1AOXA 2I8AA 3M6AA 4KQ1A 1Z88A 2JI4A 2QMEA 4P53A 1SOMA 3OM0A 4BMYA 4E08A 1ZM7A 3QE9Y 1X7ZA 3S8YA 4H7FA 2B9VA 3R5KA 1H3NA 4AXXA 3NGLA 3OZRA 3U62A 4EHIA 3CF4G 2X9VA 1UOOA 1WTCA 3GPCA 4MVJE 2YHSA 5IAJA 2OHFA 2W71A 3VGJA 4B75A 2JFNA 3HM9A 4KHPB 3WQSB 4LMBA 4E4RA 4RDHA 1KC3A 3ELBA 2HHCA 2W4MA 4FCCA 4B74A 2B99A 1PAUA 1OYVA 1X1QA 1T8WA 2PAFA 1L0BA 1ZC3A 3EEOA 1G5TA 5IK2D 2IU3A 4NMHA 1U3UA 3JAWB 4TTIA 1F8FA 4WK4B 3LUJA 4HQ0A 4JLAA 4BVGA 4LOJA 4YMLA 3KQUA 3AF0A 5LA6A 4CIYA 3V8QA 1QP4A 4FYWA 2BFDA 3A32A 2B8WA 3V46A 2BELA 3DTTA 1PU2A 2I54A 4UTVA 4KW7A 1M1YB 1VECA 2DH5A 4URXR 5EEHA 4QECA 2ZRHA 1YMQA 3HKCB 3EODA 4MV7A 5F52A 3RSLA 3D3WB 3W5UA 1R27A 1SXJD 3Q7EA 1HORA 1X2EA 1H8HD 2H2GA 2QRVA 2X5NA 3GUUA 4IWXA 3DEZA 3GCDA 4HR7A 2WUEA 3VPGA 5CVDA 1JU4A 2IYYA 1T8PA 3H7AA 1H5NA 1JDBB 1KOJA 1L7EA 1WQ1R 1I01A 2P9GA 3FUUA 4PO1A 5C1OA 2BZ1A 1NN3A 2GGSA 5DBGA 2A0XA 3WYBA 1NMYA 2B6NA 3OEHA 3N7UA 4WZAE 4AMZA 1DQNA 5M3BA 3TGPA 2KX7A 4I5EA 4QREA 3LUKA 1WLSA 3FGNA 2R7MA 5DSZA 3BTSA 3K9LA 1T8RA 2O1SA 3VKWA 4LF4B 4YP1A 3ZHBA 1JG1A 4Y2HA 1IUPA 2M9MA 2NQ2C 1TQHA 3GB9A 4IEFB 4CU2A 4INPA 2O2DA 1SKYE 4TMYA 3Q7RA 1ZMRA 2OO3A 1YXMA 3AP1A 1UC5B 3V7NA 2DEUA 1YHYA 2ZUCA 5KTYA 1Q19A 4B32A 1RI4A 2CFRA 4Q5IA 2QPOA 4B6GA 1YNSA 4PBSA 3GD5A 4QQFA 1DXQA 3AEKB 4LY3A 5KTSA 1C4KA 3UAVA 1FMFA 3CFYA 1J9ZA 5BQPA 4IBOA 1E5QA 8GPBA 5KTMA 1FUIA 3PXUA 3NRJA 1Q3TA 1WMAA 3A6HA 3EIWA 3HBMA 4PHFA 4QFMA 1G8AA 2C5GA 2ET6A 2YWDA 5E9JA 4AG5A 1GGMA 3KBBA 3PXDA 1EFTA 2GNAA 4MV4A 1YAHA 3D8RA 3RSFA 4OB6A 1ZW6A 4LHZA 4MKXA 5HCUA 3ETHA 1UBJS 3HP1A 3DUWA 3BIOA 1DBVO 4COOA 1PEAA 4EDFA 3CZQA 3KKPA 3NUQA 1M75A 4ETIA 1SWWA 3ET5A 3AHDA 3M2TA 3H2IA 3HV0A 3SIPA 3GCZA 4XQ0A 4EM6A 5L4NA 2OCDA 3OO1A 1AA6A 2HDOA 3AEUB 1CWUA 5JVDB 4Y0NA 1I32A 3QWHA 1FSGA 1QVWA 3NYQA 3QX7A 5E4TA 1ICEA 4LN1A 1TW2A 2BEUA 4HTFA 1J8MF 1ZVVA 2LTAA 1IHDA 3VV2A 1JKFA 3EIUA 3G5LA 3GAFA 4R3UC 1RC1A 1DKMA 1VLQA 4PLZA 4Q4AA 2M6LA 4ZZ0A 4QUHA 3H9BA 2I1QA 2PYIA 2I6SA 4MX8A 3GFFA 4FSHA 1HOTA 1SU7A 3H83A 5K2MA 1M1NA 2Q29A 4OTZA 1HEYA 1ZS9A 2PKRA 4U5XA 3LYHA 4XM2A 1DG1G 2VT2A 3LWDA 4PZPA 3R7WA 2EDCA 4X65B 1P2FA 1E61A 2JHCA 2AMLA 2ZSBA 2FPRA 1O08A 3OPYA 4HB0A 1FXSA 1L5HB 1S01A 3LT5A 4EUNA 3OZEA 4D6YA 5B58T 2XT6A 1IN6A 5CD1A 5EWMA 4R6XA 4EIWA 1DE0A 2BI8A 2ZJAA 2OZVA 3K9QO 5AOVA 1F0PA 1XRPA 1RDFA 1Y34E 4PAWA 2X13A 4BNDA 1CUUA 5EMJA 2WWRA 2C58A 1N0HA 3TNYA 7MHTA 3B53X 4ZT4A 1TMOA 2H2DA 3KDSE 1PKEA 2B34A 2Z5FA 3GPDG 3K9HA 2WJZB 4P7BA 5E9AA 3H6HA 2XUHA 4LVOA 3ZGOA 1T9HA 1OXVA 4N0EA 5DHTA 5DGCA 5EUMA 1A8HA 4DV1B 1EFRA 1N8TA 1NZJA 1N5DA 1QGOA 2ZCUA 1N75A 3BL6A 2J5BA 3CN7A 3JZMA 4PFJA 4B6SA 5ERYA 1Z5NA 5IZCC 3THXA 4KRYA 2I91A 3NHZA 4FWTA 2LCIA 2Z3ZA 3WO0A 2ZUWA 3LP6A 5FLXA 3GLRA 4PG4A 4YMIA 2FR1A 1VP3A 1U0FA 2WNSA 2GBLA 3QVKA 2IKQA 2IS4A 1UZLA 5KYWA 1A27A 4LNUB 1JP7A 4MGIR 1AT1A 4HNRA 3B48A 4L0QA 4B83A 4CRWB 3T5PA 3AY6A 4R4JA 3U9TA 1NBME 2VDPB 5A6SA 2BKLA 1II8A 2AHOA 2WTNA 4LX8A 1KO4A 4RMHA 3SHWA 4DUPA 1YOVA 4ROTA 5ALIA 4O5OA 1KSJA 3T41A 1UXOA 3B70A 3SBEA 4L95C 4K9DA 4IJ6A 1DAMA 2EW1A 2K7ZA 3R1IA 3H84A 1BW9B 1F8XA 3PD1A 3NVMB 4D4HA 4D98A 1PJZA 3IAEA 4WECA 1Y1RA 5BORA 1QUEA 2PBRA 2Q5IA 2JNWA 2BR3A 3QKWA 5GGXA 5JTUA 1FUYB 1BS1A 2HEGA 1AA9A 5JVDF 1YGPA 5FOTA 4S1PA 4V0KA 4MNTA 3BREA 3TNJA 1U28C 4ZO4A 2JCXA 2WWIA 3UMVA 4CDNA 4F3TA 4IIJB 5JYDA 4X0EA 1YS6A 3ZH9B 1GZ4A 2JEZA 3AHFA 1AZTA 4W7IA 1BJTA 5JI3E 1NNSA 2PX5A 1Y4AE 3B8EA 3M5PA 4JLDA 4MRRA 1ZJWA 4I55A 4QVKA 3UQYS 1DZ3A 3T7IA 1N6IA 4RS3A 3GA5A 1ZGHA 2HSJA 3B6IA 3TSAA 3V8MA 3AIMA 3E84A 3MCVA 4EL0A 1QH1A 1UZMA 2I71A 4A8JB 4DIKA 4FYYA 3L84A 4DXAA 1QU2A 3E9MA 5F3RA 2POCA 5B3KA 3MJHA 4E31A 2P2CA 4PWZA 3CBQA 3MS7A 2NXCA 5IHPA 3CISA 3DAFA 3R5HA 3B5EA 3TBFA 3GHHA 3PQ6A 2C7VA 3GMIA 3IAXA 5JSKA 3GW8A 1C7JA 4FFOA 4UQLA 7REQB 2DHCA 1DC6A 2UUPA 2C2XA 1D1SA 3AEQA 2B98A 2ZJ0A 3ZQUA 1USUA 5KSOA 2DC1A 4N5IX 1KYWA 2KLHA 3MOGA 1FLDA 5ALTA 2LKDA 4GNKA 2HRZA 3N2NA 1MO5A 1VG1A 3PXAA 4GBMA 5EIHA 4DLPA 1RLUA 3RBVA 1NSYA 1YJAA 2VJKA 3I42A 3MD9A 1YH3A 2Q7DA 2WZCA 4CXMA 1JT2A 1WJGA 3SXPA 2RBEA 3EFEA 4C3VA 4QWMA 2QQ0A 2XSZD 1KBOA 4H60A 5T7BA 3DCYA 2WF7A 4NU0A 1B6TA 1JHRA 1TJ4A 1UJ4A 4XQCA 1G6OA 1CIJA 2JFWA 4Z4EA 4R9VA 4JMPA 4HEJA 1CULC 5FKJA 1ABBA 3ICEA 4JLOA 1OYOA 4CMIB 1KOGA 3LVFO 4YCJA 5JD5A 2IYZA 2VPZA 2X0JA 1PEDA 2GJSA 4Y1RB 4PC6A 4PIMA 3HXQA 4IDFA 1ODIA 1YQ9A 3LX5A 2B83A 4MWZA 1F5SA 2AFIB 1JLHA 1ADBA 1M2JA 4TS3A 1Z5GA 1S2DA 1UDCA 2HV8A 3CRQA 3KFXA 1Y7PA 5CCXA 1DAOA 1PWXA 2A9VA 2O8BB 5JNUA 3D7MA 2ZRNA 3L04A 3O5AA 4HX2A 4B0OA 5ICEA 1YFLA 1J2TA 2X77A 4YA6A 2HJHA 1Y9DA 3K6RA 3GFTA 5AOCA 1KE2A 3PNKA 3S1LA 4M8LA 3U49A 3ZU5A 1UDBA 1ORVA 2ZBVA 4DANA 4ETNA 2P5SA 1XA3A 1ONOA 1T1GA 1E20A 5C4IA 5DHQA 2WKSA 3IPLA 2W6OA 5F5LA 2CV2A 1HZZA 5EXSA 1KJZA 2BZGA 1FA9A 3I9NA 4IIJF 4YIKA 3UJCA 5E6RB 1YWGO 3EARA 5ITSA 4CM5A 1B0PA 3HGTA 5EYPB 3RAPR 5IPFA 2PR7A 4MVJA 3I0NA 5DH9A 5BN3A 1XZEA 4G86A 5KB3A 1RQXA 1DO8A 3EGWA 3KXDA 4JKIA 4YK7A 1YQUA 2D2VA 3KJEA 3O4HA 5KNCD 3PNLA 4YIHA 4ZOCA 3VOAA 3N3AC 3OPYI 1E0DA 3U7EB 5DWDA 1J99A 1SOVA 1TKAA 3JZFA 2B25A 1T2VA 2QX8A 1QQ5A 3OX4A 2IUSA 2HHLA 4YJ3B 5ELMA 5KSYA 3KQNA 1JLMA 4L07A 3WLOA 3O31A 1T15A 1HR0B 3W7VA 2O8DB 1KI9A 3NLLA 2BZSA 4N3BA 2YIMA 4OIFA 3BA6A 4URHA 2R1VB 4G1BA 1VSVA 5B2ZA 4YCCA 4PYQA 4QGAA 2PV0A 1QONA 1FLVA 4EB0A 2G1PA 2GHIA 2NADA 2UUOA 3E7WA 2W43A 3KKEA 4J7CA 4RHTA 1P4SA 1R0WA 2IODA 2TMGA 4BNTA 5AUNB 3K96A 4HZGA 3FPCA 4QEZA 1V8FA 4I4TA 4AY4A 1QFSA 1IK4A 1Y5RA 2F8SA 3MRSA 5IWCA 1Z26A 3I2KA 1TA9A 4WZAA 4AO7A 4UHDA 3R75A 3VI4B 2A4KA 3H2YA 3OHSX 1V43A 5THXA 5CX1B 4ZO7A 3H04A 4BFCA 1OIXA 4C29A 3RTGA 2YJ3A 1W59A 1FDOA 1PJSA 4B7XA 1KK2A 1L5VA 3BMNB 2P9FA 2Q0SA 1QTNA 1XT6A 1KMQA 2OR3A 2VHWA 3DOIA 3IC5A 4IIXA 5ELLA 3SKXA 3WLMA 5KO2A 5KJEA 5GGYA 4D3DA 1D1TA 1E6KA 5BR7A 1BA3A 3OD1A 3PQDA 1G8KA 1F17A 3HSYA 3M4XA 2W2PA 2RAVA 1P75A 4FOSA 2VP3A 4JWKA 2OYCA 4ARZA 3NHAA 4YR7A 3W6PA 5IT9A 4P0TA 1YU9A 3F78A 2PT9A 3QUSA 5KBYA 2H5EA 3EQ9A 2OESA 3MMSA 2OAP1 3RNLA 4NJOA 4Q7JB 4HJRA 1VLLA 2JAPA 4Q4HA 1DKOA 2OD2A 4W9RA 1J0XO 1E2HA 2W0MA 1NUAA 3G2IA 1P7VA 3HCBA 2CL6X 1H8EA 2UVPB 3OE1A 3VYRB 5BYBA 1E9DA 2IHVA 5C5IA 2XKBA 4ZU3A 3IVGA 4RESA 1AKQA 3V1UA 2VAVA 4ALNA 4BC1A 4MS1A 3F5DA 5A0FA 1EE9A 4KREA 2DBQA 2X8WA 2CVQA 3DF9A 4FBLA 2YV4A 2CHGA 1WP4A 2BF7A 2SCUA 4XM0A 2BH2A 1XQXA 3TN7A 1L4YA 1E5TA 1Z7GA 1EDZA 1I3CA 3HU3A 3OM9A 5DGTA 3UMMA 5F98A 4ZJYA 3MGGA 1KZYC 3I6ZA 3Q11A 2BN4A 1P19A 3IURA 4L5YA 2A30A 1OGYA 3ZVKA 1X38A 1CQXA 4TKVA 5A2GA 1NOJA 4U6QA 2VDOB 1PGQA 4XQGA 1A5BB 1NM5C 5IKXA 3PGLA 4TQUS 4S1TA 1HT2E 2OCGA 4S1WA 5FB3A 4PC2A 1P61B 4MR7A 3AFOA 3TTYA 2WTEA 3P0JA 4X6XA 2CJYA 3NHBA 3EEQA 2BM8A 3P9RA 3ETJA 4R1NA 4AJKA 2F43B 3L0ZA 4G0XA 2WWFA 1NP3A 2ODAA 1TVKA 4LE1A 1O3YA 2J33A 4GP9A 4E5MA 4PZLA 3DMNA 1LDEA 1ODCA 4WGFA 3WLNA 1FFEA 1KYTA 1ND5A 5IC5A 3QF7A 5A0VA 4D97A 2YC4C 4B40A 1VQ1A 3T3PB 3NEYA 4Q03A 4AC9A 1E6MA 1J2RA 2X8AA 3TVTA 1BWSA 1OLUB 1E0AA 3EBLA 1FDWA 3CX3A 5AJXA 4C7OB 3SJZA 3MWDA 3JARB 1RPNA 2ESRA 4J16A 1JF8A 2I2CA 2OC9A 1EIZA 2VJAA 3FLBA 3M34A 1U8FO 2E1RA 3P2JA 4QTTB 4NJEB 3CX7A 4XCQA 3VPHA 5IH7A 5CHYA 2VCEA 4O8CA 2J9FB 4KOAA 4G41A 2IY9A 3GDWA 5CBPB 3Q98A 2WKPA 2I2AA 1E3SA 3IEXA 5CVEA 3EISA 3AF4A 4L27A 5EZ6B 1C1XB 1JDJA 3E4CA 2CK3D 4Z9AA 4PSCA 3OSUA 2BFOA 5MGNA 3WMXA 1JBKA 1IHUA 1KOFA 3R6LA 2E48A 4CLOA 4QARA 1JQDA 4BNWA 5IASA 4LCJA 4OFBA 1VJ1A 4WD3A 1E9BA 4XYGA 4BTEA 3CLSC 3VSCA 5C7LO 2BFBB 1Q91A 1X1BA 4MV9A 2PRYA 2ZAYA 3BBLA 2C4MA 2LDBA 2V7UA 3OUZA 3HO8A 5LU9A 2ATCA 1SEVA 1SPXA 5BVHA 3FAKA 2KSQA 1NBMA 2CN1A 3CF6R 3BXOA 3EFOB 4JDUA 1UK7A 1I0IA 1ZL2A 1TTQB 2C9CA 1KDOA 1K8QA 7YASA 3P4UA 3I45A 1BMFD 2Z30A 2HK9A 2EFCB 2IPMA 4UPDA 4EEZA 2FX3A 3SAJA 1I1OA 4XVHA 3R7NA 5ER6A 1G16A 1ZNYA 3HBAA 5LKRA 5M5BA 4GGPA 2PZBA 4C0LA 2WD7B 2JGAA 821PA 3M6IA 2OC4A 3ETDA 5JD3A 5LZ9A 5AVXA 1LJUA 5C8VA 2QG6A 2R68A 2VJPA 4OIMA 2G67A 2ZRFA 3UUFA 2X2PA 4B73A 2B0JA 1KDRA 1NY6A 2DTDA 3L6RA 3C85A 2OCLA 4Q7KA 1OA1A 4M0UA 3PDWA 2I7TA 3I83A 4FE3A 2EIHA 3TE6A 2Y76A 3GI1A 3QW2A 4ABYA 5BOSA 5K20A 5HE9A 3GYBA 2ODQA 1NW8A 2A35A 4AROA 3U5TA 4O2AA 2A0UA 3P26A 3W0LB 3DOEA 4B47A 4DNFA 1GPNA 1RNLA 3MGCA 2Q9UA 1N7GA 3N0XA 2Q2WA 1L4EA 4M38A 3E5MA 3DTYA 3FVVA 3STHA 5DM60 2R7AA 2V5VA 2GEKA 1T3ZA 3CRMA 3HWX1 3IDZA 2RH4A 3OJOA 1D5CA 1GQQA 2X5XA 1Q0UA 1TM7E 2L17A 3GIWA 3M6VA 2C2GA 3GLSA 3KCQA 4GEKA 3E7DA 5GZ6A 2IEDA 2IGBA 5KJ1A 1H66A 2IBSA 3DP9A 1GZHB 5LQUA 2WW8A 4MWTA 1E2QA 1FU8A 3G0IA 3ZTTA 1KYXA 4M0KA 1TLLA 1L2TA 1QJCA 1L7PA 2OLJA 4QDXA 2QVCA 1W0JD 4JVLA 1FTYA 1H85A 2VHUA 1MG5A 1GTVA 4FCTA 3AC0A 1TYDE 3ER6A 4H27A 3SIRA 4FGZA 4I36A 3FCXA 3FF4A 4OA5A 5IBPA 3KOWA 4HAUA 3KPUA 1MNAA 1Y3AA 3NHSA 3C3XA 2Q0XA 2VA8A 2Q7XA 3E03A 2XCQA 2ZR0A 5I45A 1Y7LA 3OBBA 3QJYA 2QL5A 4LRXA 4Y30A 3ZZUA 5D86A 1EJ0A 2WJ4A 1EFPB 1RVV1 1A97A 1TCAA 1VJGA 2K87A 2O23A 2RMKA 3GLVA 1MVNA 1R0RE 5CK5A 1NW9B 2XAAA 4KDRA 4J0JA 5IUNC 1JWAB 3IXQA 2G04A 2VJYA 4QVGA 3RVBA 1D0SA 1V96A 2ZJFA 2A9OA 4BNLA 5BWNA 4S0XA 1G7CA 2P2NA 3K9GA 4AJ9A 3LLCA 1SKQA 4BGEA 1QVVA 3V3TA 3WGIA 1NMXA 4D9FA 3EBOA 2OM6A 3ZJTA 1L1EA 1R74A 1BOFA 1XZGA 3A3YA 3IOYA 4QL3A 1DRKA 3E6AA 1EUCA 5FADA 3D54D 2XYVA 1U9YA 3HADA 3DLPX 1H4VB 2Q99A 3WDLA 4D79A 3LCCA 4LHWA 3S27A 4Y9UA 2I62A 3LA6A 4TYYA 5LIPA 1AZWA 2A2ZA 2CJXA 3PPVA 1NBHA 2YNMD 4I5DA 5CIQA 3U3KA 3UXYA 4P4TA 1JJFA 4BMSA 1EWQA 5EQJB 4XXHA 1ODFA 1ODTC 5DI3B 5THKA 4B6FA 4RTPA 4PTZA 3DAGA 3CW8X 4PZCA 4MARA 3N5CA 1HE1C 1NIJA 3V4LA 3KJGA 1UAGA 3G5AA 2OCYC 2O3RA 1UMKA 4BX8A 4EO9A 2MYTA 4II2A 4U63A 3AHJA 2FE4A 1Y3BE 3IBFA 1E4EA 3BD8A 1K0UA 2ODWA 1LKZA 2ZB8A 3WL8A 3K4QA 2DJIA 1QZUA 4MWBA 4MP8A 4U02A 3WXMA 1ATZA 3C3YA 4FDTA 4NVRA 1VIVA 4QXAA 2XRYA 2Z2JA 4IVPA 4H9GA 4XPIB 1ZCAA 3ID6C 2D8AA 2HB6A 1LNSA 4WMLA 2BFEB 2BMAA 4G5GA 1SBNE 2XXAA 1MQ9A 2Q27A 3AH8A 3DO6A 3KTOA 2XIJA 4LZWA 4U2KA 1GPAA 4WDQA 4CNBA 2EOAA 2B21A 3HMKA 4DLVA 4LZLA 2IZ5A 4C0KA 2VDQB 3KBOA 4P5PA 3E0XA 1PV2A 1NFQA 1XZ8A 1IOZA 4KXXA 1XCMA 3MPOA 3W4KA 3DFKA 4W9NA 5FLYA 4YHBA 5HZHA 1A2BA 3KB8A 2WT4A 3RUHA 1CZLA 2HH9A 1ULHA 2QP4A 3B9BA 5IVIA 5TF4A 5EERA 1X80A 4K9OA 1DC7A 2AOVA 3CCCA 1ZA2A 3K2EA 5CLGA 1QOQB 3IMGA 3MXTA 3SVTA 1V39A 4BLQA 1E64A 2Q3FA 5DB4A 4EB3A 4QOGA 2C5SA 3A6PC 2HXYA 3L0YA 4YDSA 4EVSA 4KGVA 3KAKA 3B6JA 3TECE 4ZALA 3WJAA 5EJIA 2BC9A 4F8YA 3RRYA 4EBFA 2YHBA 4CTKA 1A7JA 3R09A 2CFIA 1XFAA 1AM4D 2RH9B 3PHLA 1X19A 1U2TA 1R4NB 2WDZA 2F62A 4YDRA 1HMPA 2TRSB 1GZDA 1KXJA 2WT9A 2YUTA 3E1KA 2UYYA 4K87A 4OBXA 4H31A 4BNFA 4ESHA 5JSZA 3KK0A 2ECKA 4HF7A 2ZUSA 4GYJA 1CRWG 4TLEA 4CGYA 3DMGA 4UBLA 5A3QA 2ATEA 5CD9A 3ERCA 3ZZ0A 3Q4GA 2IIPA 3UQZA 2C5EA 5A3JA 3HL0A 3W5AA 4FT2A 1SQGA 5BVGB 2DETA 4BCBA 3RQIA 2VDKB 5DMXA 5DNUA 3M6WA 2FEKA 4H3VA 4BLSA 3PUKA 5FTJA 3W1EA 2CVZA 1N2ZA 1LTQA 2B3DA 2IQIA 4IDOA 3UH0A 3K94A 2E4AA 1GR0A 4Q9DA 3IH5A 4BC0A 3H0CA 2V55B 3VUFA 3I1FA 1K9SA 1VPEA 1IHOA 2FEXA 3NV7A 4N01A 1JQAA 1XDSA 2WD8A 2Y92A 4YMGA 1EE1A 5IXJA 3S2UA 4HN2A 2CYBA 5ALRA 5KTTA 3I2IA 3SEAA 5BT8A 1XDDA 1E3WB 1B3BA 2A1TS 3AF3A 4F5ZA 1O95C 1VRWA 4MULA 4H6XA 4E5KA 2IEZA 1ZRNA 1TA0A 1FFXA 1K5DA 3L7YA 4OHMA 4I14A 1L8OA 1NJ1A 2FHSA 3K0KA 1G8SA 3COZA 4OQFA 2GM3A 4RXMA 2VAPA 2Y0CA 3GBPA 4UNIA 5GWXA 3SSMA 1HI9A 3HQ4O 1PJ2A 1GKLA 1NQXA 2VVTA 1NVVQ 1Q0HA 1VJCA 3EGDA 2Z2KA 1E2MA 3VYUB 1S8AA 4DLKA 4K6FA 1N5LA 4PQGA 5HQ3B 2RGRA 3GL9A 3PWZA 4P36A 5IBCA 4KLNA 5B3LA 3BS4A 4JJGA 3UUEA 5BV2P 3RBAA 3T7KA 1FDIA 1JJ7A 1C9YA 1YVRA 3FPGA 4MIEA 5C5CA 5H8WA 5JCPA 1ZIYA 4EG3A 1WDLA 1IZ9A 1UBGA 2BGRA 4FZ3A 3U7RA 3SP1A 1LFDB 3U7QA 2GF2A 2GK4A 3TRJA 1HTBA 3GQBA 4TRNA 2V6GA 2J3MA 3ZJ5A 4F11A 4MRPA 1PEYA 1RZRA 2WWVD 1VMEA 2JCBA 3CZ9A 1Z18A 1D07A 2HO5A 3NHUA 3PFFA 4N9QA 4BL5A 1E1LA 1I1QB 3H5LA 5I47A 1RQPA 4KQIA 2MJLA 2WTBA 2XYPA 4KAJA 1C3OB 5GINE 2WZDA 5J5VA 3DPSA 3DXZA 1UP6A 6GPBA 1IQ0A 1BH6A 2D5CA 4G2TA 1D2EA 1I5EA 4YPVA 2DWCA 2O3QA 2YS7A 1Y7TA 3EHDA 4YMHA 1XL0A 3HKDB 5EE0A 2G9UA 4JLVA 1F14A 4XR4A 5J4VA 4C5AA 4QM6A 4EF6A 2IYRA 3GJXC 2FQWA 1VMIA 4EJSC 3ZBUA 3N2IA 5AOAA 2H2WA 1QQ6A 4AZ3B 5FF9A 1M34A 2Q6OA 1GLNA 2QQ5A 3RB8A 1ZJ6A 1TEVA 2J3JA 2XY4A 3A1VA 1FRNA 3ZLTA 5BP7A 3DTVA 1RC8A 4Y9SA 1HF3A 1L4GA 3RFXA 4D4KA 3MPUA 3FPHA 3QE3A 1CUZA 3LT1A 4ZDJA 4LFAB 3QEOA 1NWHA 4JP2A 4ZV7A 3THOA 2P79A 4P4UA 2D1QA 1T1SA 1XQ6A 3AR4A 3ILHA 4ARSA 2V4MA 2BR5A 2F1IA 2QLNA 4A5OA 3QX3A 2CJFA 5ARDA 5F51A 1G5RA 4LZOA 4N8EA 1YJBA 2PQMA 1T4MA 3OWXA 1NQUA 5CFOA 4P1ZA 3C5HA 4Z4CA 1XX6A 4TVSA 4EA8A 1JKIA 1AXEA 2E2WA 2VYCA 1YDEA 3EUFA 1NNI1 3OCWA 5AW0A 5KJ6A 4Z53A 3A7EA 1YZGA 4LYYA 4TWZA 3QEAZ 1Z9BA 3JWEA 1F9AA 1O6GA 4GXQA 1OASA 4E2FA 3KWLA 1SPBS 1QV6A 2NSJA 1UEJA 2XXBA 2XA1A 1V8BA 3GJRA 3LRXA 4B3TB 3LY5A 5DBHX 2YIJA 4LC1A 3RARA 4C03A 4KNYA 3F7NA 4NMMA 1WSAA 3CNEA 3QUAA 1K6MA 1ZRHA 4ZAWA 5KTOA 1E99A 3EJWA 4UNSA 4EYSA 2ZRMA 3TUJC 2HDWA 1SUIA 1AUVA 1LSUA 2R7KA 2XYHA 4URZR 3I3OA 3GGGA 4OFWA 5B55A 3WLEA 3Q1LA 2QXUA 1VXOA 1H23A 4L28A 4KIJA 1S3SA 3P9SA 1V71A 2O5RA 4K3UA 3GEEA 5A4MS 1GVNB 3IUEA 1HE3A 2I3DA 1EEXB 2OLKA 2WC1A 4ENWA 4DF3A 4RNDB 2QD3A 3JYPA 5LXTA 1VZ2A 1U31A 1GD1O 3CKLA 4P2GA 1CP3A 2H06A 3RRNA 5CFZA 5E6UB 3ZJ4A 4L0CA 4A16A 3KDAA 5ENVA 4CKCB 2ZIWB 2BEJA 1ZISA 4LXGA 3UUGA 1LS6A 2JFBA 4ZYYA 3JASA 4LX0A 5FP0A 1VZ3A 4BAUA 2I78A 3A6FA 4J8PA 4EUKA 3RVKA 1GGEA 3T52A 3HR4A 1P77A 3BD6A 4AURA 1NE2A 4OFZA 5JDCC 3FCUB 4GR4A 3ZHXA 2IWRA 2A1UA 2PSHA 1MQ8B 1R66A 1WUHS 1AN9A 3N2KB 4FFSA 2RGWA 3DMFA 3R2JA 4EMBA 3TZEA 1C30B 1L5ZA 1TU4A 2QHXA 1KZ1A 4RABA 1D2MA 1ZESA 1Z33A 5DCLA 1FDTA 2JLCA 2Q8PA 5EIBC 1XZNA 1GN9A 2CXPA 2ZVQX 4B2PA 1ZHOA 2CMDA 2XDWA 1RKUA 4RJLA 4U7FA 1T3TA 5IUJC 1FTSA 4ITUA 3B1JA 3EPHA 4E30A 5K7SA 4IFBA 4I1YA 4AXBA 8ADHA 5KQRA 1JX6A 1L4BA 3NPAA 4XSGA 4OI1A 4R2MA 3KLOA 3ES9A 4GUDA 5TS2A 4ZZIA 2RDMA 3IHLA 2RD2A 4F6CA 2GEUA 5BW4A 2UZ3A 3WWEA 5G0WA 1VLHA 2BUCA 4MQEB 2C7QA 3C5EA 4NYJQ 1C8VB 3DMDA 2V03A 1YTLA 2O52A 1DL5A 1O6ZA 2UUBB 4PIPA 2IOQA 1GSOA 3PCRB 1IWPB 4RHEA 3RSGA 3K9WA 2NVWA 4B76A 2C2BA 3F98A 4M9ZA 5EKDA 4W1QA 3EFHA 5CNJA 2HLDD 5FBLB 2EKDA 4KG7A 4GPEA 4DCSA 5JZBA 5LB2A 1SQ6A 2XODA 1X0XA 2F48A 3EOAI 4HYTA 1FFBA 1NQVA 5L6LB 1MPXA 2RHLA 5SY4A 2J9RA 3D64A 3K4HA 3QWAA 4NBTA 3HDHA 3TR6A 3G2MA 4G4IA 1UBKS 2VQ3A 4M22A 4RJKA 4E3WA 1V5WA 1CUDA 4G2NA 1C1YA 1H4QA 1OXBB 4Q39A 1C9EA 2C1XA 3UJPA 3D4BA 3O1LA 4HVAA 2RKBA 3LU1A 4IQGA 4REQB 2HOQA 4OYRA 4JYBA 1VKJA 4DFDA 1U9CA 4Q9AA 4GKVA 2WWYA 4F5EA 4EO4A 4I1VA 1YB2A 4E4TA 4D5EA 1C8LA 1NVDA 4MIKA 4YUVA 3PUWA 4MWSA 1X39A 3FCYA 5JMPA 1QZXA 3AGPA 1JSZA 2JIBA 4BN0A 5T64A 5K45A 1TGYA 3MJVA 3BH7A 4K9LA 4OMUA 3CA8A 2WJHA 1SXJE 3OURA 4O0LA 4RDCA 2DFPA 4TLCA 4MUGA 3ZI4A 3G2HA 1C1DB 1XDGA 3MWYW 2A5DA 4E21A 1L4UA 4OPMA 3ONFA 1QO7A 1B43A 3I1IA 1AS0A 5C1BA 3JALA 4C21A 1OX6A 1F4PA 1G2IA 1T9ZA 3NATA 4MAFA 2IH2A 2VXBA 3DBHB 3D31A 3N86A 3Q12A 3TJRA 2FSHA 3DEIA 3LX8A 4DEVA 2HBQA 4MWOA 4Z0HO 1TW3A 5FWXB 1XAJA 1OZAA 1WKBA 3M49A 3PBKA 1F4LA 3LFHA 3KD2A 4MUYA 5ER9A 3MTGA 2C4UA 3A1NA 4WNIA 3ZD8A 2F8TA 2KYRA 1MBZA 2X4DA 3BX1A 4P98A 5CFLA 10MHA 3BRSA 1OBFO 2V7VA 1XKLA 2AFHE 4I1IA 1P9LA 4B80A 4TXJA 5B4UA 3T06B 5GM1A 3E3OA 4X1IB 4QLAA 2D5IA 3QPVA 3ZDZB 2VFAA 1Z17A 1CHDA 2CD7A 4M49A 1XLTA 3IMEA 3K4PA 4QFCA 3W5BA 1QYVA 2ERYA 1ENYA 3N59A 1E62A 2FKNA 4FILA 4IHKA 2PX0A 2XUZA 3IQWA 3BMOA 5DTIA 1N1MA 2F3UA 1DG9A 4W8OA 5LBTA 1GGVA 2OAQ1 5GVSA 1ACLA 4RA9B 5LQDA 2XGJA 2ZSUA 3H86A 4OJNA 4ZV9A 3VHXA 3ZJYA 5KWJA 4X97A 3QQ5A 4HEHA 1AS2A 1DJLA 4LYFA 2ZR9A 2AG0A 1ISGA 4X90A 1RWQA 3R7FA 3TG2A 5BUQA 1J2YA 1YCHA 2CCGA 3T5CA 4IV0A 4AZWA 4ZEXA 1XQ1A 4U0KA 3HA3A 4UMEA 3SX0A 4BY9E 3MGKA 2HXGA 6ABPA 4FBMA 4MK4A 2DTEA 5JC8A 2OXRA 4EO7A 1I0LA 1RE1A 2I7DA 3OY2A 3CQ9A 4R1TA 4TUYA 2OOKA 2P5YA 4QYWA 5BSVA 3IQGX 1Y1QA 1S7CA 2HIGA 4OKIA 1CRPA 2PZFA 3GRVA 5ALJA 5DWQA 1ITZA 1SJ9A 4U2BA 4KR6A 2IQ5A 4KMOA 1MU0A 3TX6A 4KYTA 3AKDA 3OG9A 3M4NA 3BDIA 2W70A 1MG0A 2CFTA 4OLJA 4YUZA 1QH9A 1NXQA 3C4VA 2BP7B 1BDBA 1V47A 4TV9A 4MJLA 4V3CA 5HM6A 2JB9A 3ADKA 4ITVA 2XKKA 3T9DA 2YRXA 5C8YA 3ASZA 3JQBA 3D6TB 2XB9A 3VNSA 3AXTA 1LJ8A 2O07A 1RTKA 4FW8A 4DBVO 5TQ2B 1V11B 3P5SA 4RTLA 4XFJA 1KA9H 2D1FA 4X1YB 5U4QA 1S4QA 1Y63A 4NZMA 2JCSA 4PC7A 1WVGA 4G65A 3NTLA 3F73A 1NXOA 3DAYA 4BNYA 1B16A 3OCVA 4RH0A 4JCCA 3KYCA 4IYJA 4ALKA 2L19A 5B2FA 4X60A 1XEXB 4JK3A 4YXWD 1K7FB 3I9OA 1ZN7A 4TXNA 2BTQB 2GN2A 1U7UA 3DZKA 4WY5A 5H3HA 2XT9A 3H5WA 1CFJA 1K0FA 4K6GA 4NEHB 3G9XA 3PG5A 3QLVA 4FHCA 4UDNA 3JVEA 3T5GA 1HDZA 1P7ZA 5BW8A 3EVBA 2GBLC 3QP9A 2TMDA 4OSPA 3AVOA 2PBLA 3AKCA 3C24A 4RVFA 3RU3A 4CG3A 3ZGZA 1JHYA 2IUYA 2DOKA 2VTBA 2QRUA 2A0FA 2DWOA 2MOKA 2ZJ8A 3WL3A 2C00A 2F8MA 3DZHA 3GA0A 1P1RA 4HUJA 1GNLA 2BGUA 2JDID 3M3HA 1YI8A 3HN2A 3A1WA 5JFGA 3E18A 2IPAB 4FOOA 4NYMR 2YJ4A 4BE9A 2HPVA 4LVNA 3NR2A 1BRMA 1W34A 2UDPA 4ECEA 2Y6UA 1IUKA 3ETGA 1ZP6A 5BWBA 3D7NA 3T94A 1NIPA 3EYWA 1FDUA 1OKKA 3NH6A 3OIDA 4H16A 4FKBA 2D5LA 3HMQA 4JC4A 4PNZA 2JIZA 3TPZA 2HYIC 4JR1A 1CE8A 2CBXA 4JI7B 3V4FA 4JJAA 1VLVA 1VA4A 3RD5A 2NTYC 4OSEA 1Y3DE 4X8HA 3AUYA 2DHEA 4Q02A 4HATA 2JF0A 3GP8A 3GMDA 1VB3A 3R9WA 2FMXA 4PX3A 1QGZA 4P2BA 2ZI6A 3PQCA 1PS8A 3I5XA 2FP4B 3NZEA 2I3ZA 4PYOA 5EJ8A 3EUAA 3FHTA 2WF6A 1IDOA 1IQPA 5HS6A 4L78A 3QXHA 3O4GA 2XKJE 4XASA 4BX0A 5C5DA 4JV5B 3VU0A 1JIUA 4ZREA 1WB9A 4DSAA 4JA2A 3WOVA 4O4JB 3O75A 3QLTA 1OLXB 1C3JA 3I9MA 4QXRA 1U8TA 5T6BA 1CHNA 2C2HA 5CIWA 1R9GA 3KSMA 2P1ZA 2JAOA 2JFPA 3K2IA 3USZA 2ERXA 1LW7A 1YS2X 3BQ9A 5EJMA 2WUFA 1B73A 2Q2QA 1PX2A 5LP6A 3TF5A 5J43A 3BK7A 3O3OB 2O0LA 2ZU0C 1FBTA 4ZODA 4GM4A 5IMBA 2WYHA 3TIFA 3PFBA 3VO9A 5F77A 3QEJA 3H4IA 2ZI4A 4HMOA 3GJ5A 1QIKA 3G7UA 1G20B 1V7CA 3H5VA 3BWDD 5FL7D 1UK8A 4J0EA 2X2OA 2CMHA 4RPCA 5HG0A 3TFWA 1IG3A 2JI9A 4CKBA 2GXSA 3G2KA 3K8YA 3P4XA 2Z5GA 2MU1A 5ALPA 1GU1A 2OFOA 4Q3KA 4JXXA 3QFHA 3SJCA 3KO8A 1K92A 3X2FA 2XAUA 2ONCA 3LPNA 4MGYR 3L1IA 2UUCB 3VJMA 5CJPA 3LM8A 1CSEE 2M6SA 3BN3A 4GVXA 3H11A 3ISVA 4DOMA 4Q05A 2HV9A 5H59A 3GJ6A 4CKXA 1GSAA 3CH6A 4NENB 2YV3A 4XD7A 3SF8A 1Z7WA 2QTCA 3P9KA 5CAEB 3E48A 8MHTA 2JZCA 2JD2A 3EWSA 4IIYA 3Q9NA 1V1RB 3HEAA 5T3YA 2H1OA 2CWWA 2VSXA 2NWQA 3QVJA 1Z2NX 4IILA 3U61B 3LYLA 3HN7A 1RWMA 2HZ7A 3JQAB 1E1QA 1Z0JA 2CW5A 2PXHA 3FWZA 3QFCA 4MP3A 3ZHOA 4CDMA 4Z7NB 1KWKA 4Z49A 2H48A 5FWAA 2HNKA 1G21B 4HTAA 4NICA 4O8ZA 3MB8A 3RC1A 1EVEA 5DMHA 3V00A 1ZNQO 5JDIC 1TB4A 4Q4CA 1O97D 3CH4B 1LBIA 3RFVA 5AKKA 3L06A 4BFYA 1VC2A 2LIVA 1TIBA 2PL1A 4HQOA 2AXPA 1UWVA 4Y9RA 1QK3A 2Z56A 3H97A 3NCHA 3HI4A 2FN4A 1GZVA 3D8NA 4UNNA 2XCOA 2QTLA 2Q2NA 1UPBA 2AUNA 2DFDA 1PW7A 2FSPA 3L8ZA 3IMKA 2FUG1 4KK4A 5ESRA 5TB5A 2EX0A 3ED1A 2CHEA 2C2YA 3S29A 1FP4A 2EQ5A 3IHTA 3WFZA 5JXHA 3L1VA 4I1OA 2C42A 4INAA 3QFTA 1CDZA 5FPTA 2VAXA 5AW2A 2N47A 3QYAA 1QCDA 1Z7YA 2JEOA 3BXFA 5IK2A 4HC4A 5BN1A 1JDPA 3A0UA 3DGFC 3B52X 1W9HA 4HB3A 3QTTA 1TL7C 3L18A 2BW0A 5JQWA 3IUMA 3K32A 4EYKA 4M9UA 2XUOA 1E96A 1M8PA 1P6QA 2A14A 2DWPA 1MDFA 3M9WA 4MRMA 4WKOA 4HN4B 3U3RA 3VH2A 1XI2A 4HNVA 2ZUVA 1QIGA 3OU2A 3GRPA 1Z25A 4P4SB 4D26A 3WL6A 1MQAA 4A3SA 1SXJA 2CCJA 3T7TA 2PXXA 1H8HA 1UKCA 5EVJA 1XZBA 4ND6A 3U17A 2CMFA 3UAXA 3PYLA 3WK7A 3ZZ1A 1LS1A 3KSBC 1BC5A 2IU6A 3AR3A 2PUTA 4KLZA 2FR8A 4EHHA 3EEIA 4HDRA 4NMWA 4M36A 2UVDA 2Y2UA 4CMCA 3RU2A 2C9OA 2CDNA 1AUXA 2HWKA 3O8BA 4KKXB 2FCAA 2UZAA 3WRVA 1KQGA 3N3BC 3CE9A 2FJUA 4A0QA 4WXPA 3LH5A 2GK3A 4HDCA 3DE7X 3PA6A 5KAPA 1DJMA 2E37A 3TRDA 1AXRA 3EGOA 2GN8A 3ZI7A 1FEZA 1SIOA 2PT6A 2QRZA 2Q5EA 2XADA 1EX7A 3T61A 2AFHA 2XUAA 4IHJA 3UMRA 1HDXA 1CNMA 1S1CA 2R2AA 1IAQA 4BLRA 1D1QA 2D06A 1UMDB 1TM4E 2CSUA 1UXGA 2GZMA 2O8NA 2V98A 1YS1X 1JEYB 5CXQA 3GUYA 3O8QA 1YQGA 4L85A 4F9FA 4KV9A 5F4BA 2VRNA 1D9XA 5KQSA 3MCTA 3N2GB 4MROA 5DM2A 3ZS8A 2VR1A 1EYZA 4ZRDA 1XFDA 3I76A 2IS1A 2ZIFA 2PJZA 5F5XA 3QVWA 2AOUB 2H31A 3W9SA 3JAMA 5BOVA 4FEEA 3TMKA 5JS2A 1U4SA 3WQRA 4CEJA 1CUGA 4XQ9A 1KGSA 2C92A 3HU5A 2DLCX 4BIIA 5C1DA 2B4AA 1ZGAA 3KPYA 4DJDC 2QTTA 1T3GA 4IDBA 5KKCA 1WR8A 1VHTA 2FW0A 3Q9LA 3LUAA 1F3OA 3UMCA 3D6AA 4AUNA 2XCSB 3ZX4A 2KWIA 5AFSA 1XVUA 5BNFA 3QKSA 4HN9A 1YR9A 5A0TA 3V8EA 2AMFA 3BE8A 3DL7A 4Z9YA 1L5NA 1ZR2A 4QBGB 1KL7A 1RADA 5EG5A 4FDAA 5EJ9A 2VAMA 5CYOA 2CUZA 1VG0B 1MJFA 3LQ4A 3B1YA 3EVTA 4WEOA 4X24A 5G4KA 5IARA 5IJAA 4EYQA 5KWIA 4Q21A 5DVZA 2XCIA 3GLFE 1A69A 1WXWA 3EDQA 3GFBA 3CO5A 4R54A 3W6ZA 2D1YA 4Q7QA 1MW8X 3P2YA 5TGZA 3L46A 3EJ6A 3NBKA 4GQBA 2Q3BA 2YCLA 4OP3A 1NVEA 1E94E 1X1RA 3OP1A 2C9YA 4Q0MA 2IXBA 2FLKA 3IIKA 4DDHA 5HRAA 2ONZA 1P0CA 3GD7A 4YASA 4K2HA 3VH4A 2WKRA 3X2SA 5AVVA 5DTRA 1ZU5A 5LP1A 2PS0A 4UFOA 1QDUA 2H2HA 4QDTA 1IQRA 9LDTA 4ZEVA 2PJDA 1BSVA 5J2UA 2EKZA 3VX3A 1QC5B 5CA1F 4RF5A 1LBHA 3BKWA 5CT9A 3U16A 3PGKA 3H8JA 2DBRA 3LPCA 5TT1A 1P9RA 3GU3A 3TQIA 1NA5A 1NI4A 2HHJA 4DCJA 4J16C 2FZCA 2G1AA 3IAFA 1X7YA 1POXA 2HYDA 4YFVA 4E4YA 4A0HA 2F9MA 3SMQA 1Y6FA 1NSTA 2PUVA 4LPKA 2Q45A 2EXXA 2QUBA 4MQBA 4EB8A 3EQ7A 3EXHA 1VJ5A 1RACA 1L4FA 1JHMA 1EK6A 1R6XA 1O4WA 1E60A 2WJPA 3COYA 3DL0A 3EK2A 1ZN2A 1T43A 4RK7A 4LMRA 5CBKA 4PGFA 3KKQA 1RJWA 2V0NA 5K3OA 2RAPA 4L51A 1HDYA 1UODA 2OHIA 5ADUS 1VYTA 1JH8A 1MQSA 1KEEB 3PICA 4L8VA 4TWBA 4OYLA 3ZG6A 4OK6A 5BMOA 1UBRS 1T5SA 2VYVD 1EA5A 1RM5A 2Z2ZA 2VHJA 5K4HA 2QZ9A 1MIOB 3ZV6A 3HFGA 2H7VA 3R0QA 1X7WB 1WKVA 3ADOA 1LK7A 1Q7CA 1SK9A 4OHFA 4Z4QA 3IP7A 3VQTA 1XE3A 3QTLA 2RGCA 2GNOA 4JYZA 3ACDA 3EW7A 3NAMA 2YTZA 1JEAA 1FS5A 1UC9A 2JIMA 1KRHA 2VJBA 2D0PB 2FV8A 4NMLA 3NHWA 1NFRA 1P72A 1FP2A 2ZLBA 1S4MA 3GRRA 4M99A 4PS1A 4EARA 1AGYA 2FF7A 2V6FA 1E7WA 1OOEA 2IT1A 4HPXB 3UCEA 3E8MA 2CLKB 1RXCA 2Q1UA 4UDYX 1T29A 1VE7A 1ZUNA 3DKIA 1SUFA 1WHSA 1RTTA 2HJRA 3SDSA 4EA6A 3F8TA 3AYZB 4PYLA 4FXPA 2CLDX 2P1RA 4N3GA 3BIJA 1FUEA 3M4ZA 4GXTA 4ZVUA 1PGPA 1EPUA 2VK4A 2X0KA 4JYMA 4M98A 4IS3A 3V2UA 3UOWA 1MH9A 1RS0A 3SYLA 1UDAA 1T2UA 1D0VA 3CSUA 3RAFC 3W2EA 1VKOA 3OE7D 2GM5A 2NMVA 2QRKA 5FBQB 3UT5B 1JAIA 1JAXA 3DR5A 1A5SB 4E1BA 5BR1A 1Z4PX 2H7XA 1JEEA 2KM1A 3LY7A 1I4EB 3IIEA 4OH7A 1BVRA 2NZ8A 1QVZA 3D7KA 2H65A 5BN5B 3RR2A 3V48A 5JCZA 4EA7A 3WYDA 1WABA 4ND5A 3FFXA 4AQDA 3MILA 4E03A 1RR6A 3BK2A 3LBFA 2HF2A 2YH2A 2Z8XA 3BERA 4EJFA 1SULA 4KMMA 5JUWA 4R1QA 3ZHTA 4CTOA 4RTNA 3MERA 4MV3A 3D7SA 4LI0A 3O8CA 1ACJA 1QIMA 1ZMOA 4JN6B 3S44A 5IM4F 4NNPA 1TZMA 1DJPA 2EWWA 3GX1A 3NOXA 4RWEA 1LK5A 4FDVA 1EUDA 3UXMA 4D4MA 1SFRA 1T1RA 2HLHA 5BV1A 5KOHB 3OJLA 5FR2A 5IEBA 2W90A 3P0IA 1SZPA 1N1GA 4MQ6A 4PG6A 1DQYA 4TTTS 5SY6A 1HSOA 4BLUA 1N36B 2NGRA 2C8KA 2NP6A 3IQHX 4F04A 3GVXA 4DBLE 4C7KA 1HQYE 1T9CA 1EFVB 3H1PA 1U7WA 1FNMA 1GUZA 2BUBA 3O47A 2B1JA 4IWYA 4XUEA 1BN7A 3U4HA 2V74B 4XW2A 2GM4A 4AWBA 3LCVB 1W4ZA 1Y9JA 2K2QB 4Q9LA 1RI5A 5E0KB 5GJVC 1SCKA 3P45A 1IH8A 1Q1AA 1TPZA 3DOCA 3OFSA 4C1BA 1RZVA 4B3FX 3BF8A 1NU8A 3LQ1A 2J0QA 2OBXA 2QKYA 3MINB 4YRRA 1B2RA 2WSIA 4CF4A 3O8OB 2ORWA 1MFZA 3VBCA 5B58C 4KQ6A 3FZEA 2I2FA 1CF9A 3B9PA 3KAPA 5TPWB 1WSBA 3WNZA 2BFCB 1SCIA 2B4RO 1E1KA 2RHBA 2ZR8A 3II6X 1U0LA 3IPCA 3L07A 4FIZA 1D6MA 3D1LA 3GBSA 2H08A 3LP8A 1DUVG 5HFAA 3KOZA 3TD2A 3WNVA 4DCVA 1EFAA 1NSFA 4GI5A 4HDKA 1BXGB 1S6YA 3N6XA 4FGWA 4PZYA 2Y68A 4X20B 1C4OA 3V7YA 1VHJA 1B0ZA 2D2FA 3WFIA 4MUJA 1NNEA 4IYRA 3B78A 3O7WA 4HSGA 2JGIA 4QU5A 3S3TA 1OSNA 2GK6A 1B8VA 3GGJA 4RAOA 1NP7A 4Q1VA 1W73A 3KEMA 4TSFD 4XJTA 3TZHA 2BGWA 3GFGA 1NAHA 5DK6A 3I0MA 2P68A 4IMIB 3CVWA 4U6SA 3DAPA 4QDZA 3FRHA 3JZDA 1H2HA 2B61A 3C98A 4IV8A 1EQUA 3GCWA 3UJ6A 1YGYA 2I5PO 4BO3A 5KNCA 3PSHA 4RM3A 1G64A 5T8KA 2IGTA 1S9HA 1XD2A 4QHTA 1OAOC 1LX7A 2HIMA 2AD5A 2NVOA 2W4QA 4NCIA 3SN6A 4PF1A 4RKFA 4OXIA 4GPD1 4R1SA 3JQGA 2O2XA 3D6HA 3LC0A 3LBHA 4YALA 2CC2A 3BXZA 4RZQA 1JAZA 3PS9A 4FFRA 1VMAA 1VYHA 2RH5A 3GFOA 2QX7A 3BSSA 4IVRA 3U6KA 5ALYA 4LSZA 4X8MA 1AMOA 3GN2A 4EB6B 1E6LA 1KI7A 4A4DA 4QYXA 1U2DA 1E7QA 3AW9A 1FVHA 3IEUA 4HRVA 4JEUA 2GJ9A 4GYWA 4JOQA 1WHTA 2GH1A 3IVCA 1RE0A 3DCJA 4LDNA 5CNMA 5CP8A 3RVPA 4EGFA 4IGAA 4LEIA 4EX6A 2EX4A 2APJA 2MSEB 1SUBA 3EG9A 2XNJA 3IDQA 3LBAA 1P2UA 1Q17A 3HFRA 2PYZA 4L76A 2PRIA 3TLKA 3TO5A 4B4VA 5JISA 1NTRA 3OQBA 4E2YA 3IPRA 3NETA 1ZYUA 1E4OA 2BBTA 2PKQO 2WK1A 2VP9A 2OGWA 5JMWA 1MJ5A 4HWSA 1EM6A 2V97A 4BATA 3STUA 4O33A 2H1FA 4BX9A 1Z6ZA 5C32A 4HYQA 5JD6A 2QV7A 1T13A 3LI2A 3PENA 2IZZA 2X8JB 2P2SA 1QZ3A 1RRPA 3PGA1 4N8DA 4UHBA 5E1DA 1FP1D 4KMRA 1TC1A 5F4ZA 2XGSA 5ECYA 5FAXA 4BO0A 4Y2JA 1JKJB 1A8SA 2YN4A 4J1TC 2PY6A 3HVUA 2QUIA 2FUG6 3KTAA 4MRNA 4MI6A 4B8ZA 3V1NA 1YZNA 3F6YA 3P96A 5TNXA 2VDRB 2DPMA 1OIVA 1GSHA 4QO8A 3DTNA 4OM7A 5FBWB 4DAEA 2BM1A 4LECA 1IUNA 3A9UA 1W1UA 1RQLA 5CT8A 3ZZTA 5D7BA 2OCIA 5EESA 5KDLA 1XLVA 2OGZA 1QF9A 1RYMA 4IY1A 3OJWA 5GP1A 1GTSA 1PFYA 1Z2PX 4QDKA 5B4VA 3EXFA 5LLDA 1CD5A 1NXXA 2WHYA 2OFPA 3I8SA 1I2BA 3LPAA 4R8SA 5HHTA 1FPMA 4LGYA 3UV7A 5JJKA 3W2HA 3FWHA 3VR0A 5EQDA 2FVXA 3ZEAA 4OHXA 1N6LA 1A8IA 1VMDA 5FIUA 2VXCA 1VKZA 2EFEB 2BSXA 1GZSA 4DTCA 2Q9BA 4US1R 4DV2B 3GLFA 1HZJA 2HTEA 1DHTA 2VQFB 1YJ8A 1NHGA 2J3EA 3O9MA 4QLOA 2VH1A 1Z4MA 4KU4A 4YRQA 4P81A 2VYFA 3TQHA 3PQ4A 3DWIA 3GMSA 4F9GA 3L5KA 1PV1A 4LBYA 2W6NA 1F2TA 1QGDA 4K9PA 4NY1A 4YP5A 1WETA 5A7GA 2I55A 4CM8B 1AXGA 2B7BA 2P5TB 4IXTA 3QXXA 4X63A 1X6VA 2GD2A 1NVBA 2FQQA 3THWA 1GA4A 5F1YA 2AJLI 2EJUA 1EG2A 1FSPA 4CQLB 2ORYA 4MVJP 2W00A 1U3VA 3BHIA 3OLYA 1NKTA 1WE2A 2ZKLA 2Z6AA 1R5OA 2VTEA 4XD2A 4RK0A 4U3JA 2O05A 2XOEA 2DTXA 1C9DB 1YF3A 1GAQA 4AIRA 2PZEA 4BVHA 1IMOA 1V16A 5FFFA 3A3PA 2R60A 4LYJA 5KVSA 3JZIA 2V5AA 2ADMA 1DBSA 1K66A 1PQUA 2CK3A 3AB8A 3I9LA 2B1GA 1NJ8A 3H9CA 1P1CA 2O1WA 3NTRA 3L02A 4RAQA 2E6UX 3VKGA 4LJ5A 3OJEA 2IYLD 4Z51A 1WXQA 2R3SA 5AVJA 2FCRA 2UZ0A 3FSRA 4LJ4A 1Q3HA 2V3CC 1W49A 2XI4A 2WZBA 1PFVA 4KWEA 4K9SA 4D9GA 1L5YA 5JAOA 1U2SA 2AHRA 2ZSJA 1K27A 3IP9A 3ISTA 4JT4A 3IQEA 5I7SA 1YT5A 3K9NA 1MX1A 3K6JA 4RSMA 3IXLA 3W90A 2GZDA 3ITDA 4JUIA 4HP8A 4QYIB 5FPSA 3RYFB 3ZHVA 4EUFA 1ML4A 1G8MA 1KFKB 2GEDA 4PLYA 4H7HA 2M1XA 2V58A 5HE8A 4LF9B 4CCAA 1BMFA 2GN1A 1PJTA 1P9WA 3HKBA 4RCVA 1KRXA 4NAVA 1G291 3R41A 1EHCA 2HMSA 3V3KA 3VZCA 3WGOA 1ZR4A 3WLSA 2I4IA 1CK4A 4JL8A 1GQOA 3DMRA 3SJBA 1NR7A 4KFSA 3TEFA 1SKBA 3FD8A 5DNCA 1TU3A 5AIAA 1P5RA 1GEEA 1UXHA 3OIWA 4CT4B 1QE5A 2W4IA 4YC7A 1ZM4A 3GJ8A 1JJVA 4MI1A 4JGGA 3VNVA 1ZH4A 4F3KA 5K3CA 3WLPA 4BNVA 3C5CA 1YSCA 4GPZA 2OV8A 5FJJA 3RRJA 3QH4A 3NJ4A 2FWPA 1CETA 3JQ7A 1MLDA 2VUTA 2PYDA 2YRWA 3PC2A 1DLIA 1FLAA 1ZOOA 3V1TC 3HJUA 1O2DA 4R8LA 3W5IA 1SBZA 4HLNA 4MQFB 4UZEA 5JO9A 4Q12A 4M0EA 1WZIA 5KYUB 1DIBA 1EB8A 1ORHA 4HNGA 4KV7A 4MUMA 2QJWA 4JASB 3WI7A 2Q46A 3QVVA 1QTQA 3UKJA 3TM4A 5D5HA 2RB5A 5BWLA 2I22A 3QIAA 2OXCA 2PA0A 4FD3A 3ZWKA 4B82A 2BBWA 3UAOA 1R64A 3BC1A 3TAXA 2HPHA 3D0RA 4MGHA 2Y1EA 4MEBA 3BGDA 1UMBA 4WLEA 3G85A 1EHYA 1T3HA 4XYBA 4BQFA 2YY5A 3MXOA 3DLTA 5IAOA 1XDUA 2ANBA 4CM4A 3KSAC 4U2CA 1RRVA 1NW4A 1N7JA 2WF8A 4IVNA 4UNPA 3P9CA 1C5KA 2CDBA 4D99A 4CCSA 2JLUA 1OXMA 2PK3A 3IE1A 1W0JA 2J41A 1WY5A 1JB1A 3C39A 4Q18A 4I3HA 3E53A 2C07A 1TIKA 4MPTA 1TO6A 3D6UA 4IDEA 1K7EB 2WABA 3NTUA 5E3IA 1Q20A 3R76A 2O8FB 1SC6A 2OQ2A 5AQEA 2YR0A 3DZDA 2HIAA 3A9VA 3MYYA 3DLCA 4PG5A 9ATCA 3JQQA 2C84A 3EOBI 2WRZA 3H1EA 1CPYA 1N9GB 3TKAA 4LK2A 2AWOA 5I7FA 1SQSA 1GLGA 5JH7B 1QHGA 3ODGA 3UTCA 1NJ5A 4BGUA 1K8ZB 3AHIA 2XIQA 4CCYA 3DBRB 2Q1YA 5DM1A 4BNHA 1TI7A 2HWYA 2C61A 1U63A 2N1BA 5AP9A 5LB4A 1EUQA 4QDOA 3KZCA 4JLKA 2FPMA 4RANA 1L7OA 5DZSA 1ZIXA 4J2OA 2XQGA 2P9CA 2Q1SA 5CM8B 2ZDQA 5DIZA 3TZCA 2W42A 3KHUA 4TV8F 1HL3A 1WXXA 1GM5A 5EWJB 2PH1A 3U48A 5AM4A 4MKHA 1KAEA 1ZOIA 3HB5X 5CBPA 3E82A 2GVDC 3PL1A 5COQA 4YT2A 2XE6A 3QE4A 4YI3A 1W0KD 3D0QA 4N9WA 5KQLA 1SHZA 1W2HA 2EYUA 3L7CA 3RS0A 1JUDA 3T7JA 4LKRA 1MOSA 3ZXSA 4CTJA 1O58A 4I2NA 5HK8A 1J7JA 2YNMA 3IAS6 3PP8A 1SB8A 4LPSA 5JCXA 3P2IA 3KLPX 2C0CA 1P17A 5GM2A 3DJFA 5F2EA 1Y3FE 2REQB 1DIGA 3HXPA 3KJHA 1T0BA 2INGX 5ECWA 2H92A 1GUDA 3A9WA 3NVDA 3LD9A 3PF9A 4GOLD 2ACEA 4XRGA 1JILA 1AJEA 4K86A 3GFPA 3L7IA 3R0XA 8ABPA 1U7DA 3G9TA 3OPVA 1NW7A 5A9SB 2QX6A 3BXHA 1YB5A 1A9ZA 3K30A 1LZKA 1ZVJA 1ILEA 1UFQA 1UZUA 1KO7A 4D74A 2PKCA 3UCXA 4INZA 5CA0B 4G0QA 3F5SA 4KO4S 4BRUA 2VH5R 1P18A 1U1FA 4KBFA 3FRIA 3CUWA 4RZXA 3KUUA 1PJ4A 1OD6A 4DS3A 4BLOA 4EJ6A 1QH8B 2DFTA 1L1FA 2KHZA 3BULA 5JYCA 1NOIA 1YB1A 3OCXA 1MRZA 2WM8A 3DDNA 2WTAA 3HU1A 4KIUA 5H4GA 4N76A 1YVDA 1ZK4A 1ECCA 2YHIB 4GC9A 2P5UA 2QDKA 4S3MA 1EVKA 3MJFA 4A9AA 4IUDS 3PDHA 3QJ5A 3IE0A 3K6SA 1KJYA 1XO1A 3DKRA 3FOAA 3DBOB 3R0IA 1M2VB 1YONA 3DV0A 3BFKA 5B7GA 3PR3A 4YAKA 4RXTA 1UPAA 2WAYA 4KH1A 3KWJA 1JRLA 1VI6A 3IIMA 4UEKA 5DP1A 4HK4A 4KLAA 4FZVA 3FTNA 1BWPA 3IJRA 1KS9A 2WLSA 5C1IA 3G2LA 3W2GA 3U4CA 4LF5B 5HFNA 2OYSA 1Y33E 4HGNA 4I7EA 4DNOA 1X9HA 1EWTA 1OBOA 5FBRB 1CF2O 2J4FA 3HDJA 4M8SA 4XWKA 3IP3A 3LECA 3VR6D 4KCGA 2QN9A 3PHHA 4QJBA 2OV4A 4NDNE 4WK2B 5G41A 5SZHB 5KQPA 5LQCA 1GPKA 1IM8A 5HJ2A 2IYOA 4ESEA 1DKPA 1M2OB 1CNEA 2HT6A 1EFCA 2WD9A 4FS8A 4BMDA 1WBDA 5DT9A 4RZIA 2ZSAA 3EMKA 5A4IS 2KLBA 1GNQA 2MHCA 3ZPXA 2ZWOA 4ID3A 4BKOA 2CLSA 3TXYA 2QX4A 1G60A 1G8HA 1WXEA 1XXLA 2PZAA 3FDZB 2I33A 3R3VA 4GNRA 4IMPA 4PYIA 2PX2A 1VRVA 3RDPA 2YWJA 1VL8A 1ZXXA 2Z98A 1VBNA 3BUSA 2O4CA 3H5AA 4JJ6A 2FXIA 3CNOA 3GLTA 5T4HA 1SM4A 2BTOA 3VOSA 1R8XA 2AX3A 4QTXA 4OD0A 4I1RA 3HI6A 5M7EA 1GSIA 1ZVKA 3DVSX 3E1SA 1JV2B 1EFKA 4IIDA 4F3NA 2CHFA 4GX1A 2JGMA 3IHWA 2OFXA 1UR5A 3DLBA 5TC4A 1OPRA 3MCWA 3ZWXA 3HCAA 3MAAC 4FEAA 4L9SA 4DM3A 3E5RA 3HLKA 1Q0SA 4F3CA 3Q8MA 1ZJ5A 3A27A 3C5WP 5LMCA 1S9DA 1SCNE 2B8NA 2H52A 1SG9A 4GI3A 1SO8A 4ID9A 4L50A 4MTCA 1KDVA 3NDPA 4L8GA 2WY2D 3FVRA 1S89A 1CUAA 3TYXA 3IT3A 4TL6A 1JB9A 5HBGA 3DHEA 5CA0F 4EZIA 1NQ5A 1WVMA 4E5NA 3EQ8A 3EIFA 2G0TA 4ZC1A 3WG9A 4BNZA 3N53A 2EVWX 4UATA 5TEVA 1NC1A 4HNUA 3Q6MA 4LRSB 5LWHA 1VL6A 5DBIA 3IT0A 1ZKDA 4TT3D 1BZYA 1T5IA 4QE3A 4UZFA 2I8CA 1TK2A 5AMXA 1PGOA 1QHYA 2ZUDA 2FPOA 4O4HA 4PAMA 4L3WA 1TEHA 1ZD8A 5J63A 1CEXA 1IEWA 3KC2A 4OHKA 3GFRA 2WTUA 3QKRB 4F1JA 4TL9A 4Q15A 1Z38A 1ZZEA 1MNQA 2HX1A 1YZFA 1NQAO 2ZTLA 3O73A 1P4HA 4JSTA 2H11A 2V59A 3COJA 2HNBA 2ACVA 2C9DA 4M1OA 5FOXA 5JROA 2Z43A 2IWHA 1LXCA 2GJ8A 4Q3OA 4O2LA 4M9XA 3DXFA 3B9QA 2YX1A 3DMTC 1EJ6A 2BRUA 4G1EB 3WLQA 4NH4A 4OAPA 4PAOA 1MX5A 5LCXA 2O7QA 2IYUA 2ID8A 3GEMA 4URWR 2NOAA 1ZM9A 2K5UA 3M1YA 3ELUA 4COKA 4DVGA 3B1FA 4O1HA 3BICA 2B8TA 1YO6A 2EF1A 2JLSA 3JQBC 4FYPA 1CUWA 1O95D 4AUEA 1ZU4A 2ZT7A 4R7TA 3GWZA 1P80A 2BKVA 2J59A 4FOPA 4KSYA 2VJDA 4MVJH 4YBRA 1PUXA 3MM4A 4PZAA 5KIAA 1QGUB 5IFKA 4EPVA 2IPXA 4PCVA 4CLXA 4R51A 1R18A 4FONA 1J8FA 4NXMB 1ORDA 3A1DA 2KI5A 3FFWA 2JJQA 3CMCO 4AJHA 1KQOA 4JKOA 1DAKA 2HJSA 3LY9A 1IU9A 2CY0A 3DXYA 4J49A 3SD7A 1JR4A 2A78A 2J46A 2TYSB 4MA0A 1JZQA 2XUFA 3K1AB 5FLEX 1YMVA 2C1EA 5U9CA 3G9ZA 1OMOA 1UM8A 2RJOA 3IA7A 3NYRA 4POOA 2C88A 4DR7B 3V80A 1ZIDA 2P4HX 4H7IA 1MENA 2DCMA 3VDQA 5F7XA 2XB2A 4WZBE 1R4AA 1O8BA 1XK6A 1LLDA 8LDHA 5AJTA 3O94A 5LLTA 3G0BA 3FYUC 1TZBA 1Q7GA 1EP1B 2XWPA 3Q3CA 3WWPA 3C4QA 4G9GA 3IBCA 3UAWA 1EZZA 1P2DA 3ENZA 5SZKB 1AHPA 2PKYX 4O59O 3ZGLA 5M04A 2R6FA 1KNQA 4WK0B 1J2JA 4XLTA 1DMRA 4GECA 5FWYA 1ZQ1A 2GASA 4JFRA 4YJFA 3DMPA 5IN4A 1ZD3A 4EJSA 1EE2A 2FEAA 2XB6A 2ZANA 3AR5A 2NU7A 3PE4A 4C88A 2QL7A 5KDDA 1WS6A 1YC5A 2QAGC 3E23A 1JN0A 3JQRA 2QE6A 4OF4A 5JAMA 3R5JA 5KMGB 4AS1A 1EVQA 2EL9A 3RSHA 4C2UA 3Q8LA 1U98A 2VNKA 1HOXA 1GKYA 1WO8A 5AW8A 2VHTA 2X1VA 2Q7OE 1PZGA 2O3JA 1R7RA 4RVSA 1G7TA 3VPXA 3DONA 3L0BA 2CZGA 2J6CA 4FFLA 3RUIA 3UV3A 2A58A 1REQB 1HT0A 2QM7A 2DPGA 2V8OA 4NOMA 5JADA 1B3RA 3WRYC 2ZBFA 2Q5FA 2E3JA 1YE5A 1K08A 4D8WA 5FWDA 3ZU3A 1DAIA 3UENA 1Z6AA 2CHVA 1ORTA 2DLDA 4WKGA 1D6NA 1O0CA 1Y6QA 4EUHA 3MUEA 4PIVA 3JQ8A 3BTVA 1WXFA 2ZRQA 3T95A 3UMBA 3TLMA 4DC9A 2K7FA 1AB5A 2TMKA 4GE0A 4JNKA 1LUAA 3ZQKA 1NRXA 1UKZA 2A9QA 2J4CA 4AKTA 4WBNA 1MAVA 4R05A 3TWOA 1LH0A 3ZCUA 4UVHA 2I9KA 1N6OA 5LP6C 1H2YA 3QXSA 2PVCA 3PKZA 3K9BA