4EO7A

Crystal structure of the tir domain of human myeloid differentiation primary response protein 88.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
144
structure length
142
Chain Sequence
b'GGVDMPERFDAFICYCPDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPTKSWFWTRLAKALSLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myeloid differentiation primary response protein MyD88
molecule tags Protein binding
source organism Homo sapiens
publication title Molecular mechanisms for the subversion of MyD88 signaling by TcpC from virulent uropathogenic Escherichia coli.
pubmed doi rcsb
total genus 49
structure length 142
sequence length 144
ec nomenclature
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01582 TIR TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4eo7A01
3UB2A 3OZIA 3JRNA 1FYVA 2JS7A 1O77A 2M1XA 3UB3A 4W8HA 1FYXA 4W8GA 5H3CA 4C7MA 4LQDA 4DOMA 3UB4A 4LQCA 4OM7A 4C6SA 4FZ5A 2Z5VA 2J67A 2Y92A 4C6TA 5KU7A 4EO7A 4C6RA 1FYWA 4C6TB 4LZPA 5FORA 1T3GA 3H16A
chains in the Genus database with same CATH superfamily
2AI2A 4HB3A 3WLSA 1OYWA 2Q5FA 2AOUB 1H4TA 4WKPA 2OAP1 4KO3S 4HDSB 4HNTA 4O08A 2YBDA 3PHBE 4JDPA 5DK6A 2HDHA 5E9JA 2CC2A 1BQEA 2FSVC 2FCRA 1L3BA 1XNHA 2IQIA 2XAAA 2DUWA 2B83A 3QUTA 4DV2B 3JQGB 1TA4A 4DR2B 4EG8A 3K35A 4Q4DA 2AXPA 1V6CA 1CR1A 4M88A 3TMKA 1WTAA 3UFXB 1MBZA 3L7YA 4BY9E 2UXCB 4P5DA 2X13A 3KZKA 2QVBA 4EO7A 2IITA 5E2BA 4TUYB 2UVPB 3CM0A 4DV3B 1DRUA 1NW7A 4EF5A 2IYVA 2XT6A 5A5GA 3X44A 1DKOA 1KJQA 5DULA 1BVRA 3LT0A 3TCNA 4UMDA 5JRJA 2QIOA 3DT6A 2WJYA 1H42A 3BMNB 5B1IA 4GMXA 1Q92A 4E94A 1ZSNA 2QX6A 4XX0A 4BOYA 4HNUA 2VK4A 3AFHA 2M1XA 3F6SA 3PLAE 3FSGD 4GC9A 1TW3A 5I9SA 2KS6A 3CUEF 3C6YA 3V8MA 4D79A 4DNFA 1E2KA 4WXHA 1OGIA 2C9CA 3CN7A 4MWOA 3I64A 4HB0A 5LZ7A 3HGQA 3P5SA 3WISA 3Q5GA 2C82A 4A0QA 3AP3A 5GONB 2CVPA 3GNSA 3TINA 3WGVA 3L7BA 3B70A 5DYTA 4RTRA 2PLAA 1BHO1 3NT2A 4P08A 1VPWA 2VDMB 2AR9A 4O2AB 1G2OA 4MVJH 5K6AA 3DZ8A 4V02A 1NN1A 1QYXA 3ED1A 3KQHA 4QJIA 2CNKA 3FUCA 2QW1A 3HU2A 1YDGA 3IQWA 2WU8A 3COZA 5TGTA 1XHFA 3OJXA 5HZHA 1LPNA 2P6PA 2Q5HA 2JFYA 4MH0R 3UMBA 1P5ZB 2I4RA 3LA8A 3U4HA 3WLHA 3UF0A 3OO1A 4L6IA 3KKOA 3IH5A 4QATA 4QL3A 4B44A 2NW6A 1FVFA 3MGAA 3N0XA 4UDNA 3DDWA 2DJIA 3CW2A 3B3FA 2QAGA 3ZE6A 4NL4H 5C3MA 3I62A 3VGPA 3G2IA 1ZIOA 1MB9A 2ZANA 2GBGA 1T15A 4DPLA 3L8MA 2PLWA 2IL1A 4XA8A 3WGOA 5JHHB 2YXDA 2XVYA 2OG1A 1Q74A 4DYVA 4UD6A 2X4IA 1G21E 4M46A 2FJPA 3EW9A 2ZAIA 2FMIA 3WGLA 4E33A 5FA5A 3NKFA 4R83A 5K9ZA 3KOUA 4U2CA 4BC1A 4HGRA 1KVQA 1QHHB 1C7QA 1Q1ZA 3P9PA 4N5NA 2NUAB 7AT1A 5B30A 3UAOA 2VQSA 2WM8A 3M2TA 1ZR2A 2RGRA 3S68A 5IZCC 3P9CA 4P92A 1Q7TA 1QP7A 4BNFA 1PGNA 1YS2X 5A3RA 2XT0A 1WXWA 2WJJA 4W8HA 2E6KA 1WCIB 3CGWA 2A5JA 4KI7A 2EFYA 4LRUA 1Y33E 4XSHA 4EG5A 2W6PA 1FTGA 4RTSA 1RHJA 2GK7A 3V4RA 2A8YA 2NPIA 4DV1B 3CR8A 4UTNA 2OLKA 1KDPA 3IVAA 1P4GA 1TJPB 3OWOA 5JNVA 1MCZA 1DJPA 3RC1A 1LLCA 1NIPA 1HFKA 5D87A 1QX4A 1P9OA 2VLBA 5LXTF 2W6ID 3FSRA 1QYWA 4UTPA 1M1ZA 1JDBB 5FO1A 1E9VA 1G98A 1F8GA 2F3TA 2AN9A 2H00A 1EVLA 2I3GA 1RYMA 2LIPA 3ISTA 1MAHA 4G5XA 1AS0A 3JQFA 3R7AA 5CURA 4AN4A 5AVWA 3PX7A 1WZCA 2FSPA 2OHXA 3Q3HA 3ZE2B 1W88B 4B46A 2CCJA 1B3BA 1NUTA 2MINB 4ER0A 4OXNA 1MNAA 4W5WA 1GAXA 3GEIA 4HDMB 3PDJA 2WQ7A 5KBYA 5AVXA 3HKEB 3LU1A 1P91A 3W06A 1DCTA 2ZJ7A 3F90A 5JPCA 1M1YB 1TNDA 4EZBA 5LP6F 4KFCA 2R7KA 2PQ6A 3FRJA 1GNRA 4C5AA 1HDXA 2H2AA 4I50A 3VJRA 1NNSA 4BQFA 2K6GA 2G9RA 1Y8AA 3VZPA 3SZGA 3WK5A 3EUWA 1H6AA 1N0WA 5JFGA 4RSMA 2P62A 3SICE 1CKEA 1DFGA 1VCNA 3EUAA 3WJAA 4Z53A 1L5FA 3D2BA 2BBOA 2H63A 3QKRA 1F4VA 2QHXA 3B8EA 4U02A 1A9TA 1U63A 1RKBA 4BMPB 3TECE 1UANA 1P3DA 4RCVA 3VZBA 4AO7A 1WNFA 1TM2A 2FSVA 4KXFB 3PJEA 1AK9A 1YQDA 3TIFA 4G97A 3PC6A 4PBSA 3R7WA 3SBDA 1M2KA 5EVJA 1KR5A 3QSYA 1X7WB 2ZK7A 3FMVA 5EIWA 5U4QA 5BYAA 1Z0FA 3HXMA 1IQRA 2E4VA 4EUKA 4LK2A 1CJMA 2AZMA 1ZRNA 2F90A 5HS6A 2AHOA 3U37A 1NVXQ 1X14A 3DFKA 3QEMB 1DFHA 1MQSA 1TPZA 3K30A 2W4IA 4UCXA 4CRWB 2ZETA 1M6NA 1CY4A 2O0LA 2W6JA 3D02A 1B00A 1PIWA 4MK4A 2ET6A 3RSGA 4CIYA 4X94A 3MUNA 4DXAA 4JL8A 5DBGA 5THXA 4AUEA 5GIPE 1QZUA 1H85A 2CSXA 4RE5A 3T1VA 3EGCA 5DM60 2XGSA 2GVNA 1T9CA 1NYTA 3L6OO 3QRWA 1JPNA 2CUTA 4WW0A 3WLLA 1UDCA 2CNBA 3QV2A 2A0XA 1RKVA 4QHSA 4O4IB 1CDZA 1R6BX 5CDTA 3OTHA 3GYGA 4H3HB 5HXAA 1RYFA 3CMCO 4DMGA 2J0QA 3RGWS 4ITUA 4IG4A 4URYR 1HOTA 1I2AA 1LH0A 1Q1GA 2XE6A 3QJ5A 2EW8A 3NUGA 5KAPA 3ETGA 4CCYA 4BGDA 3THXA 2QRKA 1KDZA 1Z4MA 2ZIVB 3PGMA 1SKQA 2CXHA 1YS6A 3KVNA 3UCXA 2I03A 4WY5A 1UAGA 1O0BA 4V0OA 1W85A 2Q5CA 4ZA2A 4PG7A 3FNFA 1P7ZA 3Q40A 1F8FA 1ISIA 2GJKA 1GILA 1MDBA 1IY0A 4X8HA 1XEXA 4F2PA 1MVNA 2WUVA 3O4FA 4UEQA 2ZRKA 3B1FA 3W3ZB 2XNCA 5IJZA 3F6CA 3KJFA 1HFWA 1U2ZA 4NHEA 4RZ3A 3RS9A 5ESXA 4US1R 1JLSA 4KX5A 2G4CA 4CODB 1TZBA 3P5BA 4CLRB 1G59A 1U2GC 2X5KO 3DFUA 4WX2B 3JU3A 1LY1A 4M9CA 3RAGA 3ZHYA 3NHAA 3AHJA 4ZHQB 2FPPA 4H59A 4JR2A 2REXB 1Z0ZA 5AHOA 5LU9A 1E4YA 2WC1A 3U31A 2C00A 1J09A 5E7MA 3V9PA 3EEBA 4HF7A 3PE6A 3R77A 5I51A 3V4SA 2CVOA 3RVRA 3U19A 1JECA 4MR7A 3K70B 2GA9A 2OM2A 5ARCA 4KNYA 1T8WA 3A0UA 3IP1A 2X6QA 1B42A 1YZYA 2OHOA 5JANA 1FJXA 4HLCA 3L1VA 2Z6QA 2ZROA 4NDAA 4IKPA 5E3JA 4JB8A 5ALTA 3O2JA 4D0GA 4CLRA 2OGTA 3ZK7A 5LP6C 2Y2UA 1MUUA 4IG9A 4HH0A 5FBZA 4JFAA 4UNPA 4E2YA 3U6BA 5JAZA 4DCGA 1CRZA 1M76A 2I8LA 2KLHA 3GGJA 4PBRA 3Q88A 1ZKDA 1LPSA 1IZ0A 1V1MB 2HMYB 3VJKA 3UTCA 1MD9A 2AXNA 2COKA 2O2XA 2ZBPA 2ODEA 1UXJA 5HCIA 4ZO6A 3ZDAA 1M6VA 3FCXA 1ES9A 5DJ5A 2C2MA 2GCOB 3V1NA 3BK7A 3JZMA 1C3JA 2LDBA 3DVLA 2Y0CA 4H6VA 1I1OA 3L0PA 3OZUA 1CF2O 4B4KA 2O5CA 1K5HA 4OQQA 2A0FA 1DT5A 1CWUA 4WJKB 2HCRA 1U9JA 4HZUB 1WXQA 2VRCA 2HHCA 3BVPA 1CUJA 3PGKA 1QH1B 3U61B 5FBLB 3C70A 1TPYA 4YQEA 2IOFK 2PCJA 4RVFA 4IYRA 2QW0X 2Z5GA 4MW1A 2VPWA 1FRVA 3HU1A 1XTZA 2YMMA 3P0HA 3QOYA 1YS4A 1ZA1A 1AKRA 4DNOA 4ZAFA 3RTBA 2JGDB 4EMBA 2JH9A 6YASA 1ADGA 2ZXUA 1C4XA 1ONNA 3V1UA 1ILEA 1BXGB 3NX4A 3LDHA 3LUGA 4E2FA 1RPJA 3EFHA 1D03A 1KYVA 1W4AA 3I0NA 4PNHA 4R4JA 1A9ZA 4S0ZA 1KI8A 2ZVQX 3BKXA 3ZBTA 2D3WA 1UZLA 5A7HA 1F2TB 2OMKA 1ACJA 5EP3A 4OYLA 1DIBA 2F9FA 4G56A 4FU0A 1EP2B 1ISFA 1UPUA 4QQ8A 4H1VA 4R8KA 4DCTA 1WBDA 4ZGWA 2I4IA 2V96A 4PNPA 4F97A 3I01A 3QNUA 3RVOA 5EHIA 4WLFA 4EMUA 1KZ1A 2PLFA 1CQJB 1UJ4A 1PNOA 4M8IA 2FZ5A 1IQUA 1M2GA 4GFDA 4HS9A 2GGSA 2O07A 4RY9A 4JXJA 5AMXA 1GT6A 2J9RA 3FA2A 4EDFA 5T67A 2AHRA 2W9XA 3B1WA 1JHYA 3M6MD 3GD7A 5LP6B 3OM0A 4BVKA 2J0UA 3T41A 2KWIA 5IAAA 4J0FA 1TJ5A 1P9NA 2V97A 1W93A 3M4JA 1UK9A 3CLSC 5DXFA 4BO6A 1EVKA 3HLKA 3PHCA 2AA3A 5LSAA 4LI0A 3QSGA 3KCQA 4HAWA 2VHQA 4LDNA 3NWPA 3LK6A 1HYEA 5DV9A 2Z2JA 5CA0F 3KVOA 1YR9A 3H5NA 4R2WA 2P75A 2TMKA 3GLUA 3O9ZA 5TNXA 1NC1A 1T9AA 4AJLA 1OAAA 1RRVA 1CV2A 3VU9B 4LIPD 3RE1A 5CFMA 1TRKA 4WHMA 4PXAA 2ZRNA 4Z9XA 3LOUA 4S0XA 3T8YA 2JAHA 3ESDA 3JQCA 3UY4A 4B85A 1I1HA 4RSHA 2ZQYA 3OJWA 5EWLA 5EMNA 4BU1A 5J47A 1YRLA 3TSWA 2PGNA 1JNYA 1H05A 2ZPTX 4JC4A 5F3RA 5AW1A 1JYFA 2IA5A 3RBAA 1Y7LA 2GPNA 1R4NA 1ZKMA 2D06A 1PT6A 2H1HA 3GPCA 3I12A 3IAAA 5E1MA 3TN7A 2BLLA 2VXCA 4RF2A 4H7JA 2I6XA 1WHTB 2FK8A 3DCNA 2PGIA 1Z7GA 5AK6A 3L7LA 5LB2A 2IWRA 5C18A 1QSGA 1EJ6A 2IUSA 3BTOA 3OE1A 3EPHA 2QRLA 3AU9A 4F7DA 3V8RA 5IARA 4Z9YA 4ZCLA 1KZHA 1RAHA 3KJIA 1Y7IA 2NUPA 3BWDD 3LKDA 2WWIA 1BWRA 2X76A 3E8MA 1Z2PX 3KQTA 2QUHA 1OYOA 3MA0A 4OH7A 5HX7A 2O3UA 1TLFA 3K5WA 5BQOA 3C8ZA 3NHYA 2JBAA 2HR1A 1YU9A 5DM70 3NVKI 4DZZA 1Q1QA 4RDXA 1OSNA 4E1BA 1PI3A 1QF6A 3IBSA 3ZKWB 1VMIA 1F60A 6LDHA 2NZWA 4COKA 4QWMA 2QPLA 2J31A 3HSSA 1ZN2A 3LH5A 4JJGA 5AW8A 4IMRA 5JNUA 1ECPA 3ZNQA 4LFAB 3FOCA 1FDSA 1UBFA 221PA 3CR3C 1QFYA 3JD4A 3QUQA 1J97A 4OX9B 4MWGA 3ELUA 1N2IA 2VG8A 3DOHA 3HXKA 3MCTA 5EL0A 5LBIA 4EOGA 5JI2E 4GKJB 1R74A 5J43A 1B8OA 5BVHB 2I55A 4KPYA 3SQXA 1R0CA 3EY4A 3IP8A 3ZWDA 1EDDA 2N42A 4QTUB 3RK1A 4FSHA 4UTVA 1KVSA 2C84A 2WYOA 4RTQA 4I4IA 5K8JB 4YJFB 2ZJOA 3SQWA 3I4CA 1C9DB 4MGYR 1XTJA 1C30A 2X40A 5G2OA 1UMCB 4IW3B 2AC7A 2C03A 5AXDA 5TXGA 1IOWA 1OILA 1RRPA 1W1WA 2G04A 1E3IA 1C2TA 1SC1A 2HJSA 2PFKA 3EXHA 4L9WA 4M60A 4DR7B 1CB0A 4EHNA 3OPNA 1KI9A 1PF7E 1RC1A 4JBYA 4BZQA 4S1NA 1ABBA 2BBWA 2D0DA 4LRYA 4TLBA 1OIVA 5F1YA 5TEVA 2X2OA 1RVV1 1XROA 2Y92A 1W76A 4GPIB 5EUQB 3IT0A 4PZYA 3JARB 4OXIA 1IZZA 1JB1A 1L7XA 3EH1A 3R5SA 3UJ8A 4TKVB 3X1MA 4HNAB 1SJ9A 1TI7A 1T13A 3BIXA 1JLHA 4IOMA 3UB2A 4IHJA 1FK8A 5CVDA 4R1UA 5H70A 1B23P 1HRDA 3WAKA 3ZD7A 1F7VA 1OLUB 2OQIA 3OLYA 4FGWA 4TZ6A 2PU7A 1BSVA 4JCOA 3MCZA 3IUEA 3WNBA 3HY4A 3NKVA 2IYEA 3AETB 5C7IO 1H2WA 3OEHA 1HE5A 3N53A 1MR3F 1OHHD 5C8YB 5KNLA 1AMNA 4G0YA 2XCOA 3RASA 3PUVA 3W8NA 3KEQA 4PAGA 1FLDA 1F06A 3S4YA 3JSXA 4FFOA 2UUBB 1MQ9A 5D86A 2JC3A 3D6AA 4Y2GA 1XPRA 3W8RA 2WT4A 4QT4A 1T9ZA 2NO9A 4BL5A 4F3TA 3RBZA 5EE5B 4LSMA 1YAJA 2FZLA 1YTLA 1J23A 2RAFA 4PPYA 5ERGB 4HHEA 4ZAVA 1QQAA 4JSRA 2QORA 2GXUA 4W7IA 1U9IC 5C5EA 4FSDA 3QY0A 3QA9A 4QU5A 4IILA 1YJXA 1I4OA 2G36A 2WTAA 3MYYA 5JCOC 2H4FA 2Q1UA 2W0SA 2GAIA 4Y2TA 1OFTA 3DCJA 5HFAA 1N0VC 3WLAA 3ZHZA 1TT7A 2UVDA 4MJ7A 4OOEA 3KR9A 5H59A 1AZWA 1JJAA 2O3SA 4FDTA 2XRYA 4FEGA 2GYVA 4GR9A 2RC5A 2YJNA 2GN1A 4Y6PA 1UBKS 1ZJ5A 1EUCA 2J0EA 1QCCA 1B2LA 2NUTB 3LPLA 4RIHA 4MUEA 4WY2A 1FFWA 1RMQA 3LQQA 4Y2JA 3U4AA 4WLEA 5DIZA 3TIIA 3DCIA 4PGHA 2PSSA 4LHWA 2JLUA 1ADCA 3LBNA 1PL6A 2NO7A 5I9BA 4NYJR 5C81A 4EUSA 1X38A 4B6PA 1WPGA 4DB2A 3SMQA 4X7BA 4CDRA 5J4KA 1NRIA 5JH7B 1AF7A 4JLMA 4M9XA 1Z2AA 1PR9A 5K6TA 1HNNA 1PBTA 1UXIA 3SM3A 1V8BA 2VVTA 2ZRQA 3LL4A 4EG1A 1R8SA 1Y6ZA 3E22B 2EL9A 3G88A 1JAIA 4V0ME 4ECAA 2G1KA 2JLSA 4LF4B 4YJGB 4NCAA 3P2YA 3LHSA 4ER7A 2EBUA 3Q11A 3RLIA 1EM8B 4ZT3A 5CDSA 4Q16A 1K6IA 1EYZA 1UJBA 3AEZA 421PA 5A62A 1N34B 5J23A 1YVPA 4LDAA 4BNLA 2B61A 1DKQA 1DLIA 1T4DA 3L5KA 3DXYA 4XDYA 1M6YA 3SYTA 3NS7A 5G3YA 3HBNA 5BMVA 1DC7A 4LOLA 2OAGA 3O94A 2WWVD 3BRWD 2JKVA 3HJBA 3ESCA 4OI1A 1KI7A 3DBVO 2ZZMA 1XEAA 3OM8A 1PLJA 3H65A 1XLTA 4KXUA 3H2JA 4TTAA 3VU8A 2P9HA 4HGOA 3UJPA 4F3YA 4P7KA 3MQ4A 3TBKA 1GNVA 3LC1O 1T4CB 4ALIA 4D9IA 4F8JA 3OESA 3OOJA 3K16A 2PSDA 1G8YA 2EVWX 2WBLC 3QPCA 4PQYA 2PUEA 8ATCA 5JASA 3IEPA 4FTWA 3MS7A 2DE0X 2PZJA 1BEUB 2JG3A 4NOKA 3VR5A 4DA6A 4DNQA 3VSEA 5KQGA 3O8OB 3JQ8B 2PUGA 1KOLA 1NLUA 5DEIA 5CD9A 2OQVA 1TE2A 2QD3A 3PUYA 1AGPA 2ZBQA 4KV7A 4WKBA 2C7PA 3DOOA 1R0KA 2AZ4A 1L8QA 2ZCUA 1UKAA 4F5ZA 4RS4A 1GLNA 4QPNA 3EGXB 4IZ6A 4AJHA 1ZMTA 2P6MA 4XASA 4MVJI 3OBBA 3FGZA 5G02A 3V3KA 3AFNA 3W77A 3ZJ4A 3A4TA 4HWPA 4ASUA 4IGEA 2VCHA 1LFDB 1WP4A 4QOSA 4X3OA 2LR0A 3TR5A 4YMUA 1HG1A 2FQYA 1RABA 1NY6A 2QMEA 1VHJA 3KE9A 1CZRA 1JHPA 4OHBA 2Q9CA 4ZQGA 1UAAA 3L79A 3EZ7A 3Q3GE 4LZZA 1U6JA 4LJSA 2HMVA 1QG4A 3P4UA 2I7VA 3L18A 2PX6A 2IYXA 4L9AA 1U3DA 2SKCA 5KKCA 5HIJA 1JWBB 3TAHA 4R54A 5DXAA 3TFQA 2O8CA 2E0IA 4KDFA 2G40A 3KKMA 5GGXA 2A58A 5JMOA 1ZIPA 1UC4B 1K7EB 4M83A 4W99A 1IU9A 4MVJF 2ODTX 4W7SA 3ZDFA 4CQMA 2F3RA 2GM4A 2I7TA 3CG0A 3ORQA 4ZI2A 3QUAA 2VXOA 3UJNA 3STWA 4XI9A 4ACAA 3IIMA 4B5LA 1ZK0A 2ZZNA 1EWRA 4HDNA 3NOVA 2BR4A 3IEVA 1VKZA 1YKGA 2GJ4A 2ISQA 4OMCA 2CVFA 5BQ5A 2AQIA 3OMWA 3P2OA 4ZCPA 1P2DA 1KOJA 4AZ0B 4BFLA 3P4XA 5B1SA 1CY1A 2FUEA 2JIPA 1T2CA 1V8PA 4BMVA 4P0TA 3FBWA 1GNQA 2AJLI 3O93A 4Q21A 5AW3A 4FQ5A 2R8ZA 5TB5A 1TGYA 2AG0A 4MP3A 3VO9A 5L7WA 2XB2A 3KJNA 2NYRA 3FG9A 4X97A 5KVQA 1KRWA 2X41A 5B57C 4DOMA 3JZAA 5AOAA 3WB2A 4WOKA 5KEIA 4U6SA 4UCFA 2VSNA 1KK1A 2A9FA 1OB2A 5P8WA 4XIFA 4II3A 4WBNF 3LNCA 3UAYA 3BMCA 4JX9A 2P1ZA 2CHQA 4OUKX 4QVKA 1MT3A 1XTRA 1BX1A 2ZUCA 3PLRA 2B4YA 2ZJ0A 3GCZA 2RJNA 3IKLA 1NAIA 4GGOA 5DI3B 5IW8A 1STOA 4DBVO 4GOJA 3RU2A 2R84A 5K2MA 4EUFA 1JR3A 2LNDA 1HYBA 5IT4A 3IDFA 3TW8B 3AF1A 3QY9A 3UA4A 3BYZA 4F5DA 4BEJA 1FLAA 3OG9A 3L04A 4AWBA 4MCAA 1L5MA 5IS2A 2IV3A 3K6KA 4XB6B 1O58A 2QAGB 2WHEA 4AULA 2A5FA 2BOVA 2GJ8A 5LYJA 3S5JA 3WLMA 1ESMA 1Y9DA 4MDHA 4WLNA 5BSTA 5HKKA 4Y1RA 2R8XA 4CIVA 4YRDA 5FTLA 2CLDX 2E55A 4HYEA 3R7BA 5ALXA 1NVKA 1RWOA 1VIDA 5C37A 2QZPA 4CKEB 5B2FA 1ORWA 1P2BA 3FN4A 3K9LA 2GNOA 1HGXA 3LUAA 3EVNA 3U0BA 2DHQA 1NMXA 2ZI7A 5HUHA 4H6PA 3JPYA 3ZU2A 2FG7C 3N6RA 3ZH9B 1MEEA 4MYSA 2GVZC 2MCFA 3WGJA 1I36A 1VLHA 2HA3A 3ZQJA 4JEIA 4E5SA 4F9FA 1FIUA 4JUIA 5KKNB 3NC4A 1P7PA 3IMCA 5FUVA 3TUJC 4CKBB 1AKVA 1EDZA 2XVZA 2W2KA 3FTPA 3WNZA 5EKXA 3AVVA 1PVOA 4UEWA 4XX0B 2BTOA 2G77B 1D6SA 1C8LA 2OM6A 1N5LA 2O7NA 5KQRA 1WMFA 5ELMA 1VLJA 1Q0PA 4ZALA 4XVUA 1ONSA 5HVNA 4YDQA 3K1AA 3EVEA 3Q8WA 3FTFA 1NMYA 4KQMA 4KAAA 1CSEE 5IULC 1M1NA 1JVBA 4WN9B 2J4CA 1KH2A 3B82A 5JS8A 2W4QA 2X23A 1ODCA 1E62A 4K46A 3UMRA 1Z7BA 3LHDA 3S3TA 2O8BA 4UBKA 1TCUA 2OAQ1 4NZMA 2MTBA 3EZ9A 2GN8A 1CB7A 3ZXSA 2GXAA 3QK7A 4M1KA 4P3KA 2YFHA 2HK8A 3UMSA 4AQDA 4HQNA 2Z4SA 3LGAA 3STHA 2JIQA 1VBNA 4YRPA 5BUQA 4DWJA 2Z1MA 1H94A 4BX0A 4DZRA 4JP3A 1NW5A 4BPBA 1J6UA 1JDNA 3B89A 3L6EA 3FBTA 1T3GA 4ZVSA 4DLKA 5JJCA 4ZOAA 2JGLA 3NANA 2QG9A 3ESAA 2YV5A 3NIDB 5EZ5A 2V55B 2DHCA 3S1AB 2PKYX 4TMTA 1CJTC 1VJ5A 3CX8A 2J5RA 1WY5A 4W8OA 2GBCA 5CH8A 3HRKA 4JOSA 4N3CA 3A25A 1UBLS 4GPAA 3PZBA 4NV0A 3W2EA 3RFFA 3NW9A 1U3UA 2P6NA 1A4RA 4DREA 4OOFA 1U0SY 4KP7A 3TLYA 3RG2A 4C20A 1TCCA 1VLZA 1R4ZA 1GO2A 5FYQA 5DGIA 4R0NA 1ZAYA 1U8FO 4UDOA 4MLPA 4LX0A 1Z13A 3WGZA 1E3QA 5EJIA 3F5SA 4A6XA 4Z7JA 3AB7A 2GYUA 1K4KA 1PHPA 5EXEA 2OFFA 4PZZA 5LMZA 3AVWA 3A9UA 4K5QA 4JBNA 1WZIA 2C5HA 2NV6A 1V1JA 4L02A 4M98A 4A03A 2HJVA 1SOVA 4A8JA 5B4TA 3DWIA 2BFFB 3MBOA 2FQWA 4P80A 4X1OA 3DBRA 4RJLA 2O8FA 3EEYA 3ZI4A 3D0KA 3KXLA 5J59A 1YONA 4NQRA 4K9OA 1Q19A 1QGUB 3K4HA 1V47A 2DBRA 4OHRA 3TZQA 4F4FA 4MYDA 4I50F 2Q0SA 4J0IA 1KYQA 1FSZA 4PF1A 5CLGA 1SXPA 2OP1A 1Z2OX 2QENA 4TN1A 3PX2A 2E5LB 1J25A 9MHTA 1RWBA 4MQ4A 3WRWA 1OHHA 1E4EA 1Z08A 4JUAA 3HEBA 2B8WA 4O4HB 2H1CA 2PKWA 2QTGA 3GP5A 2WTUA 1TEVA 1XRLA 3EF1A 2LGJA 1FEZA 2FWBA 1S0UA 4HYYA 5JZSA 2VDKB 5ECDA 2AFIA 1D0IA 3M70A 4OGLA 4ECEA 3NBFA 1YCHA 2XDQA 2PL3A 1CLEA 2O7QA 4F2GA 4IIGA 5JS6A 3OX1A 3G8AA 3IKJA 4MWBA 1BU8A 2TRSB 3KOZA 2M6RA 4UW9A 2QVGA 1KSHA 3R9KA 1E0KA 2H4JA 3D4OA 2EBFX 3WS7A 4QVGA 1COZA 3C8HA 4B76A 4N41A 1E3TA 3M9WA 1OLXB 3WE7A 3TVDA 4EJ2A 1IK4A 2HPAA 3GZNB 1TZMA 2JHAA 1NJ6A 4ZYZA 3M1AA 1QQ6A 3BMCB 3PYXA 4E15A 2IZ6A 2JAWA 3FNQA 4HAVA 3A28A 1QHIA 1R88A 2XXJA 2ZRMA 3QENA 1YL6A 3L8GA 1N4AA 5BWOA 5K8IA 2O2ZA 5HZGA 2D1RA 1NM5A 1L3IA 2RDMA 4X8MA 2B4KA 3H8VA 1RXWA 1ZEJA 4R7ZA 1ABFA 5JAIA 4H18A 3ZTWA 1QUFA 4YCBA 1LPOA 5ENVA 5CCBA 3AM1A 5IKXA 1J00A 1KJYA 3K9WA 3NQ41 3CYFA 2QPTA 4MV6A 5ARDA 2VYND 3QXXA 4QYXA 3AYZB 4HRXA 4OXKA 2ACEA 3NNDA 4IQ4A 4B87A 3SF8B 1H0RA 1M2OB 3W0LB 1QR6A 2W48A 4RIEA 1N1DA 1Z4KA 4OGWA 4TS9A 3AF4A 3AV3A 5F5LA 3JALA 4I6EA 2WF8A 4F21A 2WIJA 2B5WA 5LOVF 1AK1A 3KAKA 2I99A 4CIWA 1H8EA 2DYKA 1A2BA 2JD1A 1GFIA 2ENUA 2GUGA 1SBIA 5BSHA 1QHEA 3I6YA 5EPEA 4BNKA 1ZH4A 1W49A 1ZUD1 3WYGA 4UEJA 3G02A 5E2AA 1E1KA 4EFNA 1T6YA 2HQRA 5DT9A 2UZAA 3KKKA 2YRXA 1MB0A 4EYEA 1RWXA 1LLUA 2C2BA 3DTNA 3EGDA 4YP9A 4P34A 2YXPX 4CDNA 4I5FA 2PZ8A 2QF7A 2JIDA 3AHDA 3Q5DA 3K31A 4ZIRB 1VIVA 3ETJA 2QD5A 4IJ5A 2OV6A 1W1IA 3D6UA 2WFZA 3PYLA 4Y6OA 3ZW8A 4J7AA 2PMWB 1LSSA 1Q83A 5JXHA 1YKSA 5JSUA 5JU6A 1P60A 1G63A 2WJPA 2R79A 3HUDA 3U7RA 2R8YA 4ON9A 5JYBA 4YJHB 2B34A 4N3BA 1E2PA 1VPVA 1N9GA 2OORA 3ETDA 4UU1A 1R6XA 1SUIA 2PEYA 2BEKA 3D9QX 1T43A 1U0OC 2FP3A 2OCKA 1D0VA 2JPDA 3BJRA 1X7ZA 1KHHA 2CK3D 1E3SA 1JLLB 3JQ8A 4NE9A 1I80A 3AHGA 5DNDA 2EFJA 2B99A 3T4PA 3ELWA 2Y2VA 5TQVA 2UUCB 1FX0B 1X1EA 4IMPA 1LCIA 1JGTA 1G5PA 1XTUA 2G3YA 2Q1TA 1N2SA 2R00A 2VYVD 2YZ2A 1NVAA 1GRCA 3KWLA 4J0EA 4JVNA 2O7SA 1VXRA 1LRKA 3DDCA 3F4LA 3PX3A 5B7PA 4MEJA 4GX5A 2CKDA 1U7HA 3THRA 3WWZA 5IMSA 4BVGA 1TDJA 2A9JA 1NATA 3OTIA 2EFEB 1PK8A 3K8YA 4HT3B 1NOJA 3D1JA 3D7MA 5ELLA 2QUIA 4EA9A 3GRZA 4KRFA 3PNPA 1KPHA 1TVEA 3WZLA 4OFBA 4YPOA 4Z54A 5T5QA 2ZTHA 3F49S 1G8JA 9GPBA 1M7BA 5A4IS 1OH7A 1T2EA 2W6CX 3KX2A 1ELOA 1NN0A 1P2VA 4ZK2A 3V8NA 1ZJJA 2FWJA 2QJFA 2IYNA 3PNBA 1Y4DE 5JAMA 5K3OA 3M34A 3C3YA 3I34X 4PRLA 5JARA 4BN0A 1FYWA 2CXUA 1L4EA 4D0RA 3C3DA 4X61A 3H5VA 2X42A 1WZNA 4K03A 1I7NA 1KGSA 3IR6A 3TPZA 4RAQA 4D02A 3U3KA 4D80A 3HNRA 2RKWA 4DAEA 2B4RO 4OXXA 1FX1A 2GCNA 3UHAA 3VPFA 1PE0A 1DAEA 3IBGA 4NPAA 5L95A 1GFWA 1U7OA 2FSSA 1CK4A 2HXYA 1H6BA 3GFRA 3T5CA 5D84A 4XE5A 5TQ0A 4MINA 4U5QA 3LBHA 3FX2A 3P9YA 1BS1A 5DTEA 3QLJA 1S01A 2D7CA 3CX3A 4REQB 2GS9A 2BEUB 3EXIB 3UA3A 4X63A 1L8AA 3HLTA 1C1XA 3BA1A 3U80A 1E7YA 2GILA 2O8EB 3RVKA 3WGQA 1FMCA 1IJBA 4QXAA 2P79A 4TMKA 1GEGA 1OYVA 2HXSA 2J3IA 2Q9UA 3ZYZA 5FWNA 2I2AA 5JWHA 2V6MA 4EHJA 2VA9A 3I9V6 2UYGA 3NETA 1XCGB 1VECA 2R4UA 3UHOA 1QBGA 1DU4A 3S2FA 2Q5QA 5TMDA 3AR3A 1Z5GA 2AK2A 4FXOA 4I1SA 2J5BA 3ZIUA 1GUBA 1BMQA 3GY0A 5FNVB 4PX5A 1FA9A 5CIWA 1PT5A 1XQ6A 1YJ5A 3AHFA 1DRWA 2WF6A 3NAZA 4JLJA 5B1EA 4US2R 2XIQA 4J0DA 4DT1A 4ZCIA 3Q12A 1Y6JA 4OP3A 5IVHA 2P9FA 4MGKR 2OO7A 1TGVA 1N2HA 1KE2A 4Z9BA 1RM4A 2QLTA 4J90A 2HQOA 4BVHA 2XUGA 2H8KA 3V7FA 4A92A 4G1FA 2J09A 3PLNA 2BGKA 4KN9S 4LTMA 2HU7A 4P4UA 4Q4HA 3CG4A 2E48A 4DIUA 3DAYA 4MWZA 5C1IA 2XEDA 2PMCA 3HP4A 3GEGA 4IHJF 1QVRA 4QDOA 3UJDA 4EI7A 1QAQA 4I4LA 3T4EA 4EG7A 2HXGA 3VAZA 5AI5A 5FBWB 1QNLA 4MDEA 2OCDA 4ETWA 3D7LA 2VQFB 4FCTA 3L0SA 1JN0A 3FGNA 3JASB 2ACVA 4KODA 1QVAA 1SXHA 2G4LA 1T4MA 2ATIA 4JX8A 1G4HA 2QRNA 2VTDA 4LHEA 3AEQA 1Z5PA 4MHTA 4WKCA 1CUVA 4G1MB 5BYKA 3A58B 4N76A 2G6TA 1RWMA 1OI7A 1CT9A 1YC5A 2E4AA 2VRWA 1IN4A 2VTKA 4KIJA 4R1LA 3GUZA 3SC2B 3MSCA 1S8AA 5IYZA 5K03A 2C42A 4D6YA 1GNLA 4GBED 2BBSA 5E6UB 2OR3A 1RI4A 3G7UA 4GRIA 1RRMA 1SD5A 4NKRA 4R31A 3UMFA 2ZSFA 4MIOA 3PCTA 2C2XA 2YOFA 1RJGA 1C1DB 2DQSA 2HWXA 3EULA 4HMQA 4L5IA 2PMEA 4BFXA 5HUQA 1E6EA 3VDNB 2G1PA 4EP1A 2I2FA 2Z3WA 3EZGA 3HY6A 4N0PA 3HRHA 3CKLA 5KTPA 1JEOA 1WABA 1K3UB 1ZUNB 1Z62A 2WICA 4AZSA 1N3BA 4LXGA 2ZU6A 1EXVA 4JI2B 4P35A 5H81A 1N3LA 5H4GA 1YB6A 4IDCA 4CF4A 3DKPA 2PA0A 4DRXA 2NADA 3P2JA 2C5FA 3UN1A 1V96A 3CT6A 4L22A 5IPFA 1X80B 3D3WB 3BIOA 3SI7A 5FL7D 1Q7CA 2C5AA 2VPZA 4V39A 4AROA 1G7RA 1RFLA 3FUXA 3HPRA 1LLFA 3ZHXA 2KJQA 4AJ4A 3EXHB 1OBVA 1XFAA 3HADA 4GE3A 3ECSA 4DC0A 1W75A 4X71A 4KQFA 1JHQA 4C3UA 3E4DA 1UT5A 1ACMA 4XARA 4IF6A 4F8EA 3JYQA 2FQXA 3H1BA 4NS4A 3SJBA 3A27A 4A26A 3ABRB 2H7YA 1R0BA 1R9NA 3L06A 1G9XA 3IALA 4KRXA 5FWYB 3RRZA 2CBGA 3SQDA 1WOMA 3GVPA 2GA8A 2GCPA 4NOMA 3W4JA 4CM7A 8MHTA 4I3FA 1GL3A 2OTCA 1M2FA 5UKDA 4B8YA 1OH6A 4L3WA 1I0ZA 2OMEA 4OIFA 1GPDG 1IJFA 1K6MA 1KPGA 4FZ5A 3FFBA 5LKAA 1TIPA 5CGZA 3IKTA 5IXYA 3OVMA 1PYGA 3T0IA 4D46A 3P27A 4U7FA 3D8TA 1Y48E 5KHOC 1ZHHA 1IBKB 4LXHA 1Y4ZA 4UBNA 1UC9A 4R16A 1GPMA 1NMZA 1UKZA 2WZDA 2X5OA 2XW6A 2ZFUA 3E9QA 4KJXA 3SZ3A 5JD4A 1QDUA 2V7UA 1U04A 1BC5A 4C87A 2X1VA 2YV4A 3V7YA 3VVLA 5KUTA 3N58A 1KDOA 1CNFA 4X84A 3T9BA 1XE3A 4NCJA 4EJ0A 2AX4A 2PL5A 3FKSA 4S12A 1I0LA 1IY9A 2FZGA 5IJWA 1VMKA 3MWFA 3CEMA 1UFKA 5KSYA 1PR4A 2XMPA 1Z22A 2OZEA 4JI4B 4JJAA 3JQDA 3AL2A 4JGGA 2RAVA 2D8MA 2IUYA 3GDHA 1V4NA 1X8LA 4EHLA 4D92A 1QZXA 2CNNA 5DSXA 4XZ3A 4GP6A 5SY9A 1I8TA 1F0YA 4JVOA 2IHKA 4RORA 3ADCA 3ROZA 1RM5A 3B1XA 4O4JB 1A1VA 4HZIA 2AQ8A 4LWPA 2NNLD 1OWLA 2QJTA 2H2GA 3KJGA 5DK4A 1WM1A 3SSAA 4DLUA 1RCFA 5CVEA 2I9KA 3ZE1B 3T3GA 4Q12A 1GADO 3T7CA 2X1LA 3LTNC 3GAZA 2Q4OA 5B6PA 1CETA 3KYCB 3NPMA 3AI2A 2PWPA 2D1YA 1IVSA 5EXDA 2EX4A 1O6ZA 3N2KB 3EZYA 1C9EA 4YDSA 3DUFA 3UB4A 1Q77A 2Q3BA 3TI7A 3T9EA 4CT4B 4EI2A 3NBKA 1C9YA 1E2HA 5KB3A 3KR2A 1P33A 1KBOA 2ZOSA 2F3PA 3R6LA 2P5TB 5FUMA 3NDIA 3OE7A 5IXSA 4ZO9A 1JJFA 2MR5A 3C43A 1ND5A 1Y6RA 5HHTA 3BHMA 3HKBB 3N2EA 1VA4A 2WWXA 2L42A 3C16C 4G81A 2JATA 4L7QA 4ZO8A 5DGHA 4E1VA 2XYQA 4EX6A 3HDGA 3BK2A 4MO9A 1SVOA 4E70A 5HE8A 3KLNA 3AO0B 4JIGA 3DVSX 1DRVA 4NMLA 4LOHA 2DCUA 2LPMA 4BLVA 5I7EA 1U4OA 4R5HA 1XZLA 1UT8A 4MQUA 5LQRA 1FZTA 1CR6A 2IXFA 3S81A 3OIDA 2CLSA 3IOCA 4MPPA 3U4GA 1K7CA 3PQCA 5CYFA 1UADA 3KXDA 4JT8A 4Y98A 2F8TA 1T91A 4G63A 3EDQA 1TZCA 5LB4A 4E4YA 4H1TA 4D6PA 2D7DA 1RI2A 4L8YA 5CVCA 5KAMA 1N32B 1EWKA 2PN1A 4HGZA 4KQKA 3WRXC 3S70A 4DXHA 1BZYA 4PC2A 1JEYA 4B6OA 4I55B 2C99A 4YUXA 1VE3A 4PC7A 4ZICA 1AIPA 1QHXA 4EJMA 3A2LA 2NTEA 2Y0DA 3NOQA 5LBTA 1O94C 4G4IA 2IHUA 2QNRA 2QV0A 2WVGA 1WCYA 1S02A 3LQ1A 2Y99A 2ZYRA 1I1NA 3VDXA 4EPYA 4JBIA 4QG7A 5H9VA 1R2QA 3LCJA 1EU1A 4QE3A 1UM9A 2XXBA 4RMIA 4HXFB 2PO7A 5ISMA 3THWB 3LT5A 4UE6A 2G5GX 3GGPA 5J2TF 1LSUA 2RH5A 2V03A 2YFQA 1EIZA 4GGPA 4KGDA 3D54D 1CUBA 4HDOB 3ZGNA 4BQEA 4GRAA 2CNWD 4E0BA 4IDDA 2WR8A 2FMTA 2HMAA 4EABA 2F59A 3DMHA 1CYEA 4DIOA 4B3TB 2OL4A 2JGEA 4OLHA 1D5CA 4FN4A 3WIBA 2GHQA 2W11A 2BM1A 4KFUA 4N82A 3EHEA 3Q9UA 3GRKA 1MV5A 2XCIA 3DEFA 1SKUA 5JAOA 1SPXA 3ETHA 2R1TA 3CEAA 3RSFA 3F0TA 1GNSA 4HEA1 4HEQA 3EVDA 1TIBA 3TLKA 4LYDA 1VP3A 1UBTS 1NUAA 5JD5A 5K2OA 3ZZ1A 1EA5A 1GRNA 4OQNA 3VC7A 5CFNA 4I66A 2QL5A 5A3SA 3JWJA 3GPLA 1MW8X 3MPOA 1H9AA 1IHDA 3D4NA 4NJEB 4EY4A 2YJ4A 3GI1A 2DFNA 4HQKA 4CG1A 4IAOA 2BGUA 2RIRA 1VE1A 3AM5A 3IGFA 3MGGA 4IDNA 4AS3A 2XADA 3HCNA 4KXWA 2BFBB 4LJLA 5KYXB 1NKTA 2DWQA 2EDCA 2O3JA 4HNRA 5DHAA 4B73A 2GHRA 5I7SA 5BW6B 4L74A 4GPEA 3AB3A 2EEPA 4F93B 1RYHA 2W2XA 4NJMA 1PO7A 2JRCA 2V6GA 4LSZA 1B76A 2OCGA 5IAOA 1EDEA 1N0IA 2IFTA 4OAPA 3SC3A 4TQGA 5FLYA 1RHUA 3A04A 3Q4GA 1Z34A 2JJ2A 3PFBA 3TDKA 5BOVA 3R8CA 3SS9X 1ESZA 3QLUC 1QC5A 3A8TA 3Q0EA 5JSZA 2LUOA 3AESA 5EJ6A 5IX8A 5JS1A 2W5UA 3IPXA 3GLKA 2QMYA 5ESWA 1OXXK 2I6FA 4TKZA 3THSA 4DIMA 5GAJA 1C1XB 2Z2IA 5ALEA 1YZHA 4Q3DA 4MGZR 4ER3A 5EJ9A 1HZZC 3S5UA 3PEVA 1BKDR 5GZ6A 1WQ3A 2VZLA 3ROXA 2X7XA 5LBUA 5KQSA 1PSWA 4F1JA 1Y1KE 4Z0NA 4BLSA 1GZSA 1DNPA 2IPOA 2BBTA 4EB6B 4HNHA 5I7VA 1A8IA 1A97A 2J5KA 4IJKA 1WP9A 5F7ZA 1QO0A 4YUVA 2HPHA 1MC1A 3WHPA 4G5FA 4YJ3F 3UHFA 1VCIA 3V4PB 4ZZIA 2CY0A 1ETUA 1OFGA 4G8DA 4R8MA 2MYNA 5FHRA 4MR9B 4HH1A 4YJDA 5SYNA 4RD1A 1TC1A 1NZDA 4K9KA 3SPXA 5LQNA 1SHKA 1W5FA 1P0PA 3KZCA 5G0VA 1QHYA 4NXNB 3AM3A 3HFRA 3IOEA 1UKCA 2XYHA 1VIYA 4IXWA 4PSDA 4WECA 3Q10A 2GK3A 3IV6A 2QV7A 4Q9IA 1A04A 1ZCAA 3SC4A 1HL7A 2XV1A 3WIOA 1BXRA 3AKEA 3C3KA 3IP6A 4WK0B 4E32A 2O57A 1TK3A 3OT1B 5K0SA 4PWZA 4JJZA 1XT6A 3H18A 4W7HA 1YSCA 2A9KA 5ER6A 3WLKX 3ER6A 5DOVA 1ESNA 3N0VA 1Q0HA 1I24A 4JL5A 3OLZA 2FWPA 4KBYA 3V4VB 2EFDB 3HKEA 2VJLA 2VJMB 3EXEB 3G8DA 1YQUA 3L84A 5GJWC 1N57A 4URZR 3ZKWA 2NGRA 3O84A 2Q5EA 1HT0A 1S9HA 2JBAB 5G0SA 4JB2A 1ODSA 3UT5B 4RZIA 5DCYA 3RV3A 4DEYA 1XF9A 5JBNA 1GTSA 2SNIE 1AGNA 4R81A 2V7QD 1DRJA 2E37A 3A4LA 4ZO7A 4NCBA 2ILTA 3EIFA 3IIEA 2EX1A 4BNDB 2IU4A 1EP9A 3O31A 1R3DA 3KELA 3M89A 1JEDA 3LG2A 3PXXA 4RF4A 1CULC 3F67A 3QG1A 3MT9A 2Q8NA 4U9HS 4N0EA 3R5XA 2D5IA 4CL0A 1XLWA 1DBQA 5KNCH 4UTRA 4FNAA 2FW6A 2CEAA 3BA6A 4M6WB 3RADC 4HD8A 3ILVA 3MFYA 5M7EA 3BN3A 4OU5A 1PVDA 2MYPA 1ISMA 2F3UA 2OY0A 1H3FA 4PQEA 5SY4A 5LQKA 2IZZA 3GOHA 1ONOA 1US8A 3CE9A 5CFZA 1Z07A 1QTRA 4ZQCB 4LZPA 1SU7A 5JVDB 4ZRDA 1Y89A 5KHAA 3MIIA 1QZTA 3R4VA 2RAPA 3L0ZA 3PPVA 2GEUA 2ZIXA 3I9V1 4O3FA 2QM7A 2DP4E 2JIZA 4N6NA 4QLAA 3QVGB 4F6LA 5ES4B 4PFJA 3WGTA 4DDTA 4MPJA 5HBGA 1AX9A 1J1IA 4ZJPA 1MGOA 4L8FA 4YACA 3SS7X 2WPDD 4DIFA 1JI3A 5LYJF 4N18A 5C2JB 1N4DA 1HT1E 2V0GA 3DZHA 1JBEA 2O52A 2UYHA 2F4NA 3BGOS 1BNCA 1DXHA 5KYWB 4FQ7A 2Q2OA 1I3CA 2TMYA 4NSNA 2ORWA 1P2FA 4PYJA 3ONWA 3A11A 3FSGA 2BFNA 4E22A 4FD2A 1E6WA 2XDWA 1GPWB 5H0IA 5M04A 2PKCA 4MA4A 2WHRA 2WYIA 1XMSA 1X74A 1XNJA 4HPJB 2WIAA 5CP8A 3TJZA 5B4VA 2BUCA 3WAJA 4CQMB 3BKWA 1F38A 4DV5B 4LG1A 2CD7A 2FSHA 2MSNA 1O97C 2H1VA 4FX2A 4M21A 3CZ5A 4JP2A 1RXIA 2WFLB 1GZ5A 2BONA 5C3UA 4JYBA 2PZEA 5HIIA 5BSFA 5BWBA 1PNRA 2JKYA 1XDZA 1JHAA 1PWZA 3GROA 4WT7A 4TSRA 4V3BA 2EGUA 3VJLA 1UC8A 3HZOA 2H2IA 5AI0A 4GWKA 3WO0A 1FF9A 3FCUB 2QSZA 1PS0A 1L4MA 2H3EA 3TXXA 5KTOA 3RIXA 3G6KA 4FC6A 3ECAA 4X20A 3T7KA 4JGIA 5I8ZA 4CEJB 2WYWA 3BCSA 4XQGA 4OO3A 4NU5A 3KTFA 4GP7A 5BNWA 4MMYB 3KO8A 1LDYA 3VR2D 3ZZUA 3AEUA 3IUNA 3NNSA 3R3HA 3F78A 3PGLA 4IVRA 1M5RA 4MHSA 1IC6A 3M3DA 1ODTC 3GFQA 4Z99A 3F71A 4L07A 2HBRA 4NATA 4PHCA 5HOQA 4MPRA 4LNAA 4EELA 1QRSA 1E4EB 3M4NA 3H9JA 4R2IA 3AL3A 3I2YX 2ZSKA 4R1PA 3RFTA 2GLTA 3AIIA 2KBEA 1NI3A 4LY6A 1OI3A 3ASYA 4WLOA 2WFAA 3FHCB 5FO0A 2B20A 2Y4OA 3ABIA 4FS8A 1TQHA 3ULKA 1G5QA 5BN4B 1W30A 2BMFA 2YTZA 4Z1MD 2CZCA 1WETA 1H6DA 1W36D 4O33A 2HZBA 3JS5A 1EX1A 1FUUA 4I1IA 3KQPA 4LXTA 3RJ5A 3EIHA 3UW3A 2NU7A 5B6JA 5C5CA 4JT4A 4P93A 5H4HA 5HF8A 2DY1A 3DO6A 5T4HA 5KX5A 4L0MA 3I0MA 2G1JA 2XAUA 4KXQA 3Q5EA 3BJEA 5HKKD 1P8AA 2GJSA 2EQAA 4BN4A 3QPUA 2NVWA 2GFIA 4FYIA 5I9MA 1M9NA 1P0FA 1XCMA 2FPIB 3EQ9A 5EC8A 5T4BA 4FK8A 2HLDD 1I2ZA 5I4IA 4P5EA 1AQLA 1UEXC 3CNOA 1LDNA 2H4ZA 4JLPA 1EM8A 4C0LA 1BCRA 2GSWA 1VBFA 3S0JA 3WMGA 4JROA 4EB6A 2FU5C 1NFFA 1WOYA 1XJ5A 4LCBA 1YQQA 4RPHA 2BI4A 2QLMA 1EEHA 2R65A 1IBLB 2Y9PB 1V11A 4WLVA 3DO5A 3RFXA 3AZOA 3STTA 3FYCA 3QBDA 2KB0A 5LKRA 4EFDA 3PT5A 3EPKA 1GITA 1G55A 2IEGA 4LV8B 2IPMA 4MW2A 2P3SA 1WW8A 4O4HF 4R2XA 1L5YA 3HNPA 4TS1A 1XGKA 1FYXA 1I4TD 1J8VA 2OUIA 1Q12A 2ZRCA 3DZGA 1GSIA 4H4EA 1QAOA 4MO2A 1I5RA 1KK2A 4MVJG 5JNSA 1FMJA 2C1XA 3H17A 3L0IB 3SVLA 2ATXA 1FTNA 1KAMA 1KETA 3GL9A 4L4UA 3MWJA 1V3UA 2GPSA 4R2JA 4G4GA 4RGVA 2W90A 3U56A 1YIOA 1KAQA 3Q9LA 5HUJA 4KR7A 1XPOA 3H8SA 2ZM5A 4PGAA 2PVCA 1BOOA 1O4WA 3A6GA 2IU0A 5KNDA 4BP9A 5HW0A 2I9PA 3BCHA 4LE2A 3W5VA 2G0TA 4RJTA 3EBOA 1U5CA 1SIOA 4DSOA 4IV5A 2XTNA 3ER8A 1K7YA 4NF2A 1MJ5A 4GPBA 4DV6B 4M1YA 3VC2A 1LD3A 3LLVA 5KO2A 1A5TA 2B9EA 4Y0AA 4K6OA 4GVXA 4R9VA 4A1OA 1ZGCA 2XECA 4XB1A 4GYKA 5AVOA 3PICA 2Q3DA 4MVXA 2B0JA 4INAA 1TFUA 4BO2A 1FRFS 5LDHA 4LISA 5AW5A 4YH1A 4AK9A 2I91A 1PQYA 4TWIA 3R76A 3KETA 1RJ9B 4U7WA 5CT5A 1C0KA 2JIOA 2PSEA 3QEMA 2VZEA 3ZHTA 4JI7B 1XQWA 4LY3A 1O95A 4LOAA 4A8JC 3A05A 4EJSA 5J3JA 1TAGA 3E3AA 1BMDA 3PEFA 5CVUA 4Q24A 3GP3A 3ON5A 1FDIA 1Q11A 3PIDA 2X5JO 3ZCXA 4KKVA 4CKEA 3ZS9A 4LJYA 1C9KA 1K0UA 4G0PA 2QTRA 2ZKIA 5D6NA 1ESCA 2YZ7A 3RB8A 1TZKA 3KP1A 2HV9A 1LPMA 2RHJA 3CJQA 2Q4BA 4FNGA 4PE5B 3OZRA 2P78A 1OWOA 3KD2A 4I1VA 4I8DA 3S55A 4QM7A 3QM1A 2A1UB 2CFRA 4A9AA 3IURA 1AUVA 4UE2A 2OCIA 2QT9A 5JO0A 2V7PA 1VPLA 1A98A 3IKMB 1KNXA 1V37A 5AK3A 4IQGA 1AOXA 1KP2A 4RPJA 3PTLA 4R5MA 3PF9A 4TN5A 5K8TA 2D2IA 4BLWA 1THMA 4ZJYA 3WICA 1SQFA 4G8JA 1ZZEA 2RK3A 4MKZA 5IAEA 1YE8A 2H17A 3QNMA 2FUNB 4M0LA 1OBCA 1UPFA 2EJBA 4JQSA 4UHBA 4WFIA 1QH0A 3HJGA 1IM8A 1SZDA 3NYRA 2D7JA 4C14A 1E9FA 3CWCA 5AUPB 1SKMA 2YQ4A 3HHPA 1QGED 1TU4A 2ZSIA 5DYYA 4ES6A 4AXBA 1RQ7A 2WUFA 3H5OA 2ZJ6A 4QLOA 1J22A 4ZANA 5LQSA 1DGQA 3CNBA 4G09A 2VJCA 2QMHA 1TF5A 4X5OA 1S9DA 4ZZ1A 1EVYA 3DKRA 2NTYC 1CF9A 3WLTA 2QSJA 3N8KA 5F4BA 4ZYUA 2DLCX 5FPQA 2OXEA 1MA0A 2BKVA 3CNQS 1UP6A 4QHYA 4RL4A 1FBNA 4EQ6A 2BZGA 2CLKB 2IZOA 1XJCA 4PG6A 4IQ0A 1ZZGA 4LZJA 3MFQA 5KIAA 3NEAA 3LUFA 3KOWA 4OLFA 2QQ0A 4GUAA 1UBEA 3KKZA 3WFIA 4XFKA 1ECGA 3CX6A 4YUWA 1P9RA 5MN4A 2REQB 1GQRA 1SXGA 1BROA 3KUXA 5A06A 2OOKA 2BKXA 4PSVA 3ZHOA 1I6WA 3UJAA 4QJ3A 3G3EA 4CT0A 4BRUA 1Q7RA 4FP9A 2MIIA 3ABZA 1QH9A 4PC1A 1QOQB 1YOVB 1A77A 4OI2A 1SUEA 4A2CA 3VYWA 4CFYA 1DCKA 2WE8A 2IOFA 1LBEA 1PNTA 3E9EA 4MWDA 3K2QA 4PR0A 5JI3E 1FZQA 4F0JA 4OCZA 1A9RA 2ZRLA 2AEEA 4LF6B 1JFLA 1XSEA 4MTCA 1Z73A 4HQFA 1KQOA 3LL7A 5CM8B 4HAIA 1IK6A 3CWZA 4S1VA 2Y1FA 2ZBDA 1Y0BA 4MRAA 3W3AA 3K0FB 4KE8A 4UQPA 1QFJA 1I3MA 5EIXA 1P2UA 4NS1A 3O4JA 2W2LA 1JHXA 1GFZA 4TTIA 2NTJA 2R6JA 4KBFA 1FW6A 1P1FA 1W0KD 3CUKA 1V71A 4QNRA 1T4BA 2W58A 2ZJ1A 3L1KA 3GMDA 2B8NA 4IX1A 1CUCA 1PL0A 2GAFA 1C2YA 3EXFB 4FR2A 3PHIA 4V1CI 2IEBA 3OQNA 2Y05A 1D07A 1KYWA 2R1VB 2EERA 1YD7A 1VHDA 3OT1A 2H48A 4UAVA 3AHEA 1BMTA 1CZNA 4P7GA 2RBEA 4U63A 3H9CA 2CEKA 2Y8EA 5LP6A 5AVTA 2HT1A 1KORA 1WMDA 1ZGHA 5K3AA 4B9AA 2AVNA 5ILOA 1E5DA 2MSWA 1Z0UA 2CDCA 1DDGA 1N5JA 1RZUA 2AK3A 1TU0A 1VGRA 1ZFNA 1JG4A 5BXYA 3AY3A 4GT1A 5AD1A 3GJ0A 4IGAA 1DPFA 1RXYA 4D4KA 4BX8A 3O9MA 2G9ZA 3R44A 4D98A 1NDQA 2PUCA 2VHYA 3CVWA 4U4AA 3PVZA 1PV1A 3QU9A 2PUVA 1BD4A 1E9CA 2HA5A 2NYAA 2Q99A 2REOA 1OBHA 2XUAA 4DXDA 4OLAA 5ALLA 4YECA 1QG2A 2W22A 1FRZA 1NR1A 2BCGY 2WSSA 4C6TB 3HU3A 1GL9B 2F8LA 3ZH2A 2ZVJA 1PZEA 1DBRA 2COUA 5E6RB 3OX4A 3WBBA 4C0KA 1XEWX 1H3NA 1Z06A 2XNHA 3L4JA 2JHFA 3VBCA 1PV2A 3TXYA 4GDMA 3GQBB 1VJGA 1SQSA 3ANNA 1XB2A 3G68A 4D0LB 2VZ9A 3BXOA 3VISA 2YN2A 3H04A 3D5EA 5JPDA 3A1EA 3IE1A 1ZXLA 5CAEA 2IYFA 2ZJ4A 4NZZA 5F2KA 3RC3A 2L0XA 1BQ3A 4KPUB 4XM2A 2NO1A 3U9SA 3GRYA 5LQMA 1ZVQA 4YMIA 4XWAA 1J5EB 3CPHA 3DZIA 1PG0A 5TE9A 3MWLA 1USIA 2Q3CA 1T36A 3DWFA 2UUOA 4R69A 5B2ZA 3G0OA 4PLGA 5IHXA 4WAUA 3ZGOA 3RKSA 1RRCA 5F5NA 3NRCA 2OILA 4IIUA 7ADHA 3FZYA 4EYOA 1SQGA 4XUDA 4GYWA 4Q9JA 5LD2C 4FT4A 3NUQA 1F14A 2IHBA 3HCWA 4PLWA 2I4MA 2ETVA 2Q2WA 2ORVA 2GM9A 2V59A 3I92A 4H6XA 1S1MA 3QWAA 3GJYA 4RDIA 1NXSA 4WVLA 4OMUA 5D7BA 1NT4A 3IBTA 4F71A 5IFKA 1FYDA 3A6DA 4NR0A 1QHGA 2VDRB 2ZIUB 4TTSA 1WXIA 2GYWA 2GNAA 1HZZA 1FUYB 3GEHA 4Y9RA 2ZR9A 4FFBA 5DLPA 1HOXA 1RFGE 2ZYDA 5LMNB 1RPNA 2P4QA 2ZIAA 5BN1A 3FVQA 4CLEA 3OJEA 3IDZA 1XCPA 1XZIA 4PG4A 1J9ZA 4DARA 2PTHA 2X9GA 3SC2A 5A6SB 3RQSA 2ODBA 4LXIA 4DUYB 2D4HA 4EATA 4P86A 4XR4A 4LHYA 1WXGA 3DT8A 2VDQB 1A50B 1QYRA 3UK7A 2QBYB 1FDUA 2AG1A 2QS9A 3D59A 3SSOA 1ZWKA 3CNHA 5GADl 1ESDA 2ZP1A 4KQGA 4MIYA 1U8UA 2WAYA 5JIBA 4PRKA 3F4KA 4I4NA 3SS8A 5IH7A 4CGZA 1D5WA 5C8XA 1CIJA 1MW9X 1U65A 4UXHA 3U48A 2GM5A 4OAOA 1E4VA 3WKEA 3ENKA 1PS8A 1TMOA 3L8FA 1K2WA 4OKNA 3ADBA 1R0SA 1E5QA 1L1EA 1T36B 2XB6A 2PUFA 3COVA 3GPDG 4O59O 5DYNA 5FLKA 3TLJA 4D0SA 3CUTA 2ID9A 1TJ4A 1Q0RA 2WG2A 3DEZA 3LYLA 1TJNA 2ZPAA 3P71T 2JGIA 3H9UA 4V0QA 4QUKA 3VI4B 1DBIA 4IZOA 4BO9A 4YAIA 5LNK1 2IX3A 1L3CA 2SICE 4J76A 1LDMA 4RNDB 2H5JA 1DIHA 1ECCA 3D6HA 3WQHA 4Q3OA 4CUKA 3KQVA 2YWCA 4UNSA 1RVDA 5JCOA 2O2DA 1V5EA 3F4BA 3ABOB 4N9WA 3BSYA 4NENA 1QQ5A 2WSIA 4QXRA 3ZVMA 3R0VA 4I7EA 4XDGA 4XGKA 1QK3A 4QU0A 5EJAA 3KXKA 4XYMA 4F3CA 3AWIA 5E4JA 3HVHA 5F1PA 1CY8A 1J8MF 7REQB 4ND8A 2C2WA 2NPOA 2NU9A 3WYEA 4X9XA 4KVZA 4DTCA 2PD3A 2X0RA 4BO8A 1YRQA 2KW5A 4KXVA 1QIMA 3NHMA 1CVRA 3AVQA 4ZDWA 5AOCA 4BHTA 4TTQA 2VHXA 4ZP1A 4P3XA 1U0GA 5JQWA 3HM9A 2I76A 1EZ1A 2NVUB 3W7BA 2P9TA 1GGJA 3IPAA 1QHNA 2WIBA 3TLEA 3MAJA 2BFMA 3I6MA 3GIWA 1L8LA 4ROSA 1OKKA 2GHIA 2P65A 2ZYGA 4HRVA 5CX1B 2GX6A 1TTHA 1A82A 1ZJ4A 2HK7A 3AEKB 1R12A 3BMXA 3PR3A 3QBTA 2UV8A 4O5OA 1WW2A 1VE9A 2IHYA 3HKCA 4YWJA 1KU0A 2XCRB 1ZESA 1W96A 1HBJA 1YHYA 1RLTA 3CH5A 3IVXA 3MWDA 4FFPA 4F5WA 5H1YA 4DUGD 4N7MA 4JUDX 2GZ1A 2QKYA 2Q2NA 3QPVA 3CSDA 3VHLB 3UAXA 1U99A 5L8VA 3AUUA 3KSMA 1PWHA 2CW5A 2VO1A 5CGQB 3V6MA 5KJFA 5CR9A 3EQ7A 1JFFB 1H65A 3E35A 3L2OB 3LW8A 2QTNA 3OI7A 4H1WA 4KRGA 2PPLA 1E66A 4JENA 1WW3A 3TEJA 3CURA 3VR2A 3JATB 4PM4A 3SJZA 2VQ3A 5CFOA 1ZJWA 1H8HA 2EZUA 1ZD5A 4JHLA 1ZC3A 3MOSA 3OPVA 5T3UA 2HD4A 2VOJA 1KO4A 1N6LA 3C3AA 3ONDA 3EPJA 5EKDA 5KTTA 4U0JA 4QHTA 1SHTX 2Q45A 4UUPA 3LA6A 5JDIA 5KOIA 3H7IA 2Q1YA 3NHJA 1OBFO 4KI0A 9ABPA 3IS3A 2C61A 1H2FA 4JUBA 2GESA 1ND6A 1L1QA 1XZKA 4YP0A 4DNPA 3PWKA 3O3OB 2PFGA 3DF7A 5EESA 5A5DA 3GA7A 3BWCA 3C1UA 1GGMA 2QMUA 3MILA 1Q84A 2I3AA 2R66A 2BR5A 1S6YA 3AYXB 5F2EA 2ONJA 4CM4A 4ZOQI 3K1YA 3ZCVA 1JV2B 3O6VA 1U8ZA 3R74A 3RHTA 2F17A 2BSAA 1NXPA 1X3SA 3RQIA 1KP3A 1YK0A 1ZM4A 2UDPA 3NUZA 5DHSA 4D6XA 4PPFA 2WIGA 3KB2A 5EA2A 1P1RA 2GKOA 2P0AA 4A82A 1ZGBA 3ZK9A 2P3QA 1LTQA 1UJNA 2EX0A 4LHZA 1WBBA 4BTLA 2A57A 1IPFA 1H1LA 1QHSA 3QQ5A 4H27A 3TQRA 3A4YA 5F7XA 1Q1AA 2WZCA 1E6MA 1HORA 1ZR4A 4JBWA 3I28A 5LUBA 3L40A 1MJHA 3MD9A 1YZTA 3ZDXB 3H3JA 2C83A 1SCJA 3NEYA 1FJ2A 2Z2ZA 3KQQA 4FBMA 4FDLA 4PC3A 5CIQA 5AICA 2PBRA 5E6SA 2JGAA 2SCUA 4K0RA 3C3BA 4RKQA 1O95C 2W2TA 1IEXA 5DBIA 4AL4A 4EJSC 1KDVA 4NNPA 5FNVF 4Z1MA 2ZLBA 4D44A 4DM4A 1YZ3A 2E85A 4PZCA 3WB9A 2JA1A 5FWXB 3IEXA 1NP7A 2FMKA 5HKAA 2W93A 3CRRA 1NWCA 1VYHA 3JVVA 1KC1A 2XQGA 3C1TA 3MK31 2DOKA 1WXFA 2YXLA 1NLMA 4LC1A 4MRNA 3QTBA 4ND2A 1E1QD 4FOOA 2QBYA 3GLFB 4XYGA 1ECJA 3PF8A 2FPGA 3CLRC 2I4OA 5HDQA 3RVNA 1Z25A 4R9NA 1KWKA 1G9SA 1BFUA 1I0IA 3RRFA 5TF0A 4Y6QA 3V6LA 4QBFA 2NU8A 3D2LA 1NVVQ 2C77A 4YALA 4QUAA 1HQDA 5F23A 4YP1A 2QJWA 3Q1KA 2DT5A 1LI5A 5D3ZA 4YDRA 1N6HA 4LQDA 5KDLA 1M33A 4H6WA 1XZNA 1N2CB 1PFWA 5IBRA 4D42A 4RK0A 5BVGB 5L3SB 2CLMB 1O7JA 2QN3A 4LS3A 2V6FA 1X13A 3U40A 3GZNA 4UATA 4CW7A 2DERA 1VHLA 2V9PA 1I4DD 3TOSA 3IXLA 4PSAA 2PH7A 2Q27A 1JKIA 2C9ZA 2HO5A 4IJMA 3ZLVA 4DLVA 1Y6FA 3VPAA 4B09A 1Z15A 1CQWA 2P5YA 4HMPA 2VNHA 4EO9A 3O4GA 3LS2A 3N2GA 4YI5A 1BX3A 3VXKA 1HEIA 1NBEA 1Y9AA 4ZODA 3T4XA 3EGWA 4MNTA 2OOSA 4GPD1 3SNHA 4A8JB 1PYDA 3W5AA 2E1PA 3HYNA 3H0CA 3I1FA 2BAGA 1CUXA 3DQQA 3L8EA 4Q4AB 2MR6A 5G1NA 1E3WA 1WPQA 2O2EA 1TO1E 3H5RA 1LBSA 2M6LA 3ZLTA 2CL6X 2JCYA 2VHJA 4RHXA 1ZMOA 2J1LA 1UJ6A 4CV2A 2XBMA 3LFUA 4H0CA 2VJYA 4A0SA 1NI5A 1E6UA 2NYUA 3TF5A 4MRRA 1W4RA 5CVTA 2JKZA 4TWRA 3RT7A 3DP9A 3THYB 1E9DA 1P9WA 3IBFA 1PDOA 2AOWA 5BT9A 3WAGA 4IOKA 4CMKA 1PBNA 5T6MA 3ZWKA 4BQNA 4PCVA 3TLXA 3OKCA 4D96A 2HEIA 4NAVA 4D74A 2GO1A 2PEZA 1LLQA 4HWSA 4TQ9A 1NBHA 1N3YA 2YIJA 3Q2KA 5AW6A 3DBRB 3IB6A 2XXAB 2M32A 4Z0PA 4OU4A 4AKEA 4CMBA 3GNQA 3ZI0A 1N2XA 4Z86A 2CF5A 3EB9A 2FV8A 2CF6A 4LJ4A 3GXOA 3H9EO 1M7GA 3ADKA 3KPUA 5GONF 3PQ2A 2BY4A 1YR2A 3R7LA 3H6GA 1M1XB 3NP9A 4DYHA 1A8UA 2HYDA 4KPUA 1HFJA 4U7HA 4HAXA 2YC2C 4EA7A 3L05A 3HC7A 2ZAYA 3MWKA 1I3NA 1SVUA 2P40A 3OBIA 1EX9A 3OLQA 2QSYA 3P9IA 1GARA 2DF8A 1P4AA 3PPWA 2O8BB 4ISCA 5KYTA 3AEYA 3DPIA 4FYVA 2X5NA 4FWBA 5I47A 3HNOA 4HWKA 4RKRA 3KAJA 1UOEA 2O4CA 1PZNA 1YCDA 4AN0A 4ESHA 2ZYVX 2H9IA 3I1JA 4KLCA 1U1EA 3ZV7A 3MT8A 3I05A 3A6HA 1WXHA 4TZKA 5JMWA 2ID4A 1RADA 2LP4Y 1C8BA 3UK1A 1YI1A 1M6EX 5FBHA 2VBIA 4E5YA 3QEKA 4K9LA 4ZOEA 4YMLA 1MMFB 1GFSA 1UFOA 2ZWVA 4E13A 3WYBA 4EECA 2BL4A 5AUOB 1I5EA 3NHFA 1ANKA 2G5TA 3TYXA 1F6BA 1VJCA 4QX6A 4HQ6A 4MAFA 2YJ6A 4X65B 2UYYA 2BELA 1X7XB 2R8BA 2ZYAA 2RKOA 3OFKA 4E12A 2Q5JA 3K7EA 4ARAA 1PJCA 4XM1A 1I01A 2JHCA 2W8BB 3EVTA 3I2KA 1TRHA 5T3YA 3WX0A 2C0PA 3MGCA 4ATNA 3ZLUA 4KPFC 2FFAA 2G82A 4BQSA 4JQCA 1T5TA 2QTZA 1YDWA 1K08A 4L4SA 3QELA 2K2WA 4B3XA 4BP1A 5DMXA 2IC5A 3H5WA 1OASA 2IOYA 3AT1A 4BVFA 2GVDC 4ESOA 1QRUA 1OVGA 2RHMA 4OSOA 1FP2A 2OHVA 3EAGA 3MTEA 4XDZA 2HOQA 4DTIA 1ZX1A 1Q7GA 2FFQA 2DKFA 1VJ0A 2PFSA 1WUIS 3DMTC 3E3NA 3UK6A 3E6AA 4MKHA 1YZNA 4B8ZA 4UM9D 1MTOA 1DOAA 1PJSA 4AC9A 1DPGA 2J5QA 3K6SB 3RYFB 2AOXA 3O1JC 4WKOA 1NQAO 1U3CA 3GEMA 1F2VA 2GRUA 2DAPA 5JXJA 1WTCA 2WFLA 2Z2KA 5K1ZA 4EW2A 2HY7A 4RLSA 3UENA 4F1KA 3M2PA 1AN0A 2O6LA 2ZB3A 3GBSA 4MPTA 5C1DA 1DMSA 4N8DA 1NRXA 2A92A 2PDAA 1U5AA 5IDVA 1GKLA 4DN6A 5AVZA 1ZOLA 4PTYA 1YHNA 4LECA 2VF5X 2HLPA 2H1SA 2WAMA 4G9GA 1CHNA 4D41A 4DKJA 3OZTA 1A3CA 3C6QA 1KFCB 2EP5A 3M1LA 3ZHRA 2FY8A 1P1CA 2Y67A 5AH0A 5E9AA 1VZ2A 4Y0VA 1Z6QA 5LNK6 4KXNA 4F1WA 4MQLA 3O8NA 2GNPA 1KY3A 3ICPA 1BA3A 1Y8CA 4G84A 1LI7A 4OBWA 1EBUA 4LYYA 1E58A 1KSGA 1UWCA 4Q3BA 5I3ZA 1JKXA 1BN7A 2V45A 2VS1A 5T4FA 1SQ0A 2XUFA 4E14A 2ACWA 3GPIA 3UH0A 1PNVA 4DABA 4B3IA 3R3UA 1HQCA 4N8EA 2AN3A 3MB8A 3PGXA 4Y30A 5EIAA 2TSYB 3BERA 2XWSA 1KKUA 5CNKA 3BMOA 1TMGE 1OLSA 1OXSC 1J21A 3I76A 2KSQA 3GK3A 4GSYA 3W05A 4F84A 5GY7A 5LIRA 2BF4A 3R6WA 3HR8A 4Y9TA 3VDMA 3I3SR 1IHOA 4QBKA 2NQ2C 5K0ZA 1BHJA 3FR8A 5DLEA 1RI5A 3LBIA 5DN6A 1W73A 2QK4A 1LC3A 5FPTA 1GAQA 4CR7A 3VSDA 2BP7A 4EJSB 2QLFA 4W5OA 1Y98A 2GEJA 3H1FA 3KV1A 1KMHA 1YFKA 2RI1A 3T15A 2F8SA 1RJ9A 2AR0A 4B7UA 1J06A 4CMEC 4AQYB 4IUCS 2ZDQA 3IEUA 4LX8A 1ADFA 1MZVA 4UU8A 4IXDA 3MT7A 1A7KA 3VU0A 3DHVA 3LC0A 1R8JA 3JATA 2HLHA 4PLPA 4QC2A 5EHQA 2WD8A 3DHWC 2OFXA 3IHKA 3A2KA 2XF8A 1CRWG 4OVKA 1ZOPA 3PXAA 1N3IA 2D5BA 1QM5A 5AXBA 1M0WA 3C6XA 3UBMA 2PCLA 5E7JA 4UNRA 2YVLA 3ZIDA 5C35A 2OD2A 2W0MA 1ODJA 1T1RA 2O05A 1ZVVA 3QE9Y 4B0OA 4ITRC 1M2HA 3UUFA 1VPDA 2R25B 4BV9A 4H2DA 4XLLA 3HCOA 4FGZA 2QE7D 4OBXA 1CQXA 1ZIXA 3FMGA 4FVTA 2Q7XA 1EP3B 3CIOA 3NWEA 3V2HA 1CQZA 1ETHA 5TPZA 5TQJA 2NTVA 1DKPA 5KYUB 2D5CA 5E3IA 2I1VB 4YRZA 3KHKA 2ZUDA 4V3CA 3UJ6A 3M9LA 1PGJA 1IXRC 1U7XA 3JV7A 3NORA 4WH0A 5JDCC 1I7SB 2FPSA 1WB6A 3IFSA 2GPJA 3KT6A 3LFTA 1XYYA 2H18A 3ZY4A 1KE1A 4ZHSA 1XP8A 4JYMA 1PVVA 1MFZA 1JIKA 1YVEI 1E89A 4EY3A 4ZQFA 3C39A 3TAXA 3IQDB 3LUCA 1JDSA 1J5PA 2UUPA 3D0QA 4KN6A 3V33A 1OMOA 3OECA 3TTYA 4XD7D 2BHRA 4H7EA 6ADHA 4WA8A 1X2EA 1RLIA 3O03A 5D6OA 3A06A 4RETA 2VDPB 1Z5OA 1E1YA 3HDVA 3OCVA 1D7OA 1XYVA 4MP6A 1W2HA 2JHPA 5TSDA 4Z6KA 1NUUA 5LDDC 4BNYA 2RGNC 1CZUA 2AFRA 2CJWA 4JLKA 2EWVA 2R6DA 4LBVA 1E2DA 3ND8A 1XCJA 2QP3A 3LX6A 4KQIA 4OATA 1BCSA 3WNQA 4E1AA 2ZE7A 3EUEA 4DMCA 2WWYA 2OCXA 4TVBA 1JQEA 1P4JA 2H4XA 3I32A 4BMZA 4AXXA 3CC8A 1KIAA 3K32A 4M9QA 3TL2A 4DDWA 1IVYA 2IW1A 4HVTA 4QKQA 3NP7A 3GLQA 3E5NA 3I09A 3U4QA 5KHLB 1QFMA 2JBHA 3U4CA 3BPSA 1ZGZA 3OT4A 2WZBA 4PLCA 4BASA 3E18A 3PC8A 3THXB 2V5AA 5HP4A 4AS2A 4QU9A 1ZW1A 3HMKA 3QHAA 3HLYA 1GL7A 1PK7A 1U9YA 5E2IA 3SX0A 1H2BA 2VHTA 3KC2A 1XZHA 4O2AF 5CB4F 2KMLA 5SICE 4M8SA 5I5EA 4HL6A 4Z9FA 2BH2A 5CXXA 3O82A 3WLIA 5FUBA 5JH7A 1FXSA 1SO8A 3I9JA 3MT0A 1XTBA 5CLHA 4FMCF 3S7ZA 2DQYA 1D09A 5ER9A 1D3AA 4KPEC 1S4QA 3AEUB 3C97A 2EZ4A 1KR2A 5EZYA 3Q3VA 3TLAA 1YR8A 3D7KA 4RFSB 4Q7JB 4EVSA 1PJZA 1W9MA 2NUTA 1YZQA 5KVCA 2BEWB 3DR3A 3EPPA 4AZWA 4HVCA 3ZJ5A 3TEMA 4CLHA 2DWOA 2JFZA 3B51X 3JQFC 1Z47A 3D31A 4I6JA 1YS7A 2ZI5A 3B36A 4RGYA 2H29A 4RKWA 4RWEA 2CJYA 3PHGA 3U6KA 4QXOA 2NO0A 5EWJB 3HB1A 4Z0HO 4TVKA 1YB5A 4UTZA 2PH5A 1CY6A 2XB4A 2BFEB 3PRYA 4JWKA 1YMUA 3JARA 5JCJA 4C89A 1X7DA 2QN1A 3CH6A 5FEMA 4WXMA 3HDQA 2D74A 4L3VA 1Z3CA 3K9FC 1WKVA 1UOPA 4G5QA 1TYBE 3SQOA 1TEZA 2C5LA 2UKDA 2AFHA 5EEGA 4DLBA 5EQJB 2JZCA 1JWAB 1SN7A 3OWXA 1E63A 4PSKA 1K8ZB 3GAMA 3L7AA 4BVJA 5IUJC 1QVVA 5ICEA 3AF5A 3ELDA 4BUZA 3REFA 2FDXA 4CM5A 2CVHA 1GA1A 2AKAB 2IY9A 2BM9A 1UQRA 4IX9A 2VT3A 3W5DA 8ADHA 1P7CA 4GDFA 2ODAA 3V34A 1Q0UA 1GGFA 1NW4A 5BO5A 3EIXA 3P26A 3BJMA 3CLRD 4EFMA 2Y6VA 2GEBA 2DRIA 1RM3A 1RZ3A 4MQBA 4PO1A 4PONA 5FOQA 1Q0LA 3E4CA 3FLBA 1Q22A 4GBMA 2JJQA 4GLLA 3KJZA 4C22A 5K4GA 1SCUA 1OAOA 5DBHX 4URHA 1C29B 1G0OA 2ZT8A 3GUUA 1DXYA 3CCBA 3EJ6A 3WDKA 4DDKA 3BWBA 3FPAA 4IH1A 4ZGGA 2PHZA 5C8VA 3FVVA 2ZAOA 5G3ZA 1O94D 1R66A 3F46A 1Y7HA 1SUCA 5BSRA 3ZW9A 2AOTA 1AM4D 5HEKA 4MQMA 3LQYA 5ALVA 4YJFA 4J7XA 4NP6A 2W2PA 2FE4A 3DLPX 4KDRA 5GM1A 2FN4A 4YV1A 3D8NA 3HCAA 3NWOA 3U17A 2VDVE 2GRJA 1V48A 1X86B 1YRHA 3NT5A 4FKZA 3IBCA 1AF4A 4MV3A 3C74A 3SQLA 1GPH1 1OI4A 2FUKA 3JQAB 2QU7A 3GFGA 5TDHA 1B26A 1AMOA 4FCWA 4B45A 1KZ4A 2XCUA 3MTBA 4U9IS 3TPCA 1M54A 1SWWA 3PFGA 3P97A 1CQIA 1CBUA 1XD2B 2RARA 5AW7A 1FS6A 3KWJA 2WUWE 3NZEA 1I7DA 1DKLA 2YY7A 2IK8A 1IZYA 3DBIA 2UVQA 1THZA 4GXRA 1G66A 2MHCA 2DTEA 5K7SA 1W87A 3OX3A 1E96A 4OTZA 1RYEA 1JJIA 5EUBA 3HV2A 1US8B 3GH3A 3TNDA 5D01A 4KSBA 2VL7A 4WPGA 5E4TA 1RTKA 1BVUA 2VJMA 2XE8A 3EXEA 4FGSA 5GGYA 3USZA 4AMBA 4YXFA 1QYCA 3EMDA 2AT1A 2EFHB 3PWZA 4V0RA 1XCBA 3QMMA 4BFUA 4U7JA 3M1IA 4B80A 4URUR 5H9WA 5JV5A 1P74A 1KMMA 2C4WA 2X6RA 5K3FB 3WLQA 3TQFA 3EGXA 3AI3A 3LQFA 5C1BA 3ZGZA 2NAPA 1HEUA 5KOJA 2EU8A 2YZGA 3IUBA 4JJ6A 5A3VA 3T5MA 5JY6A 3D1VA 4BC0A 3MTJA 1TCAA 3OZIA 3U9TA 4EW3A 3GO4A 3E2MA 5BOSA 4YGXB 3LGSA 1JKFA 1KBZA 4OY3A 3L1HA 4KQ9A 3AZQA 3JX9A 4ZI5A 4FYKA 4CF6A 3QU2A 3X1YA 5REQB 1CQJA 3LQ2A 3VFDA 5B1HA 3I04A 1Y1SA 4DMHA 3PSHA 1T5SA 3GVXA 3PQ5A 3VR3D 3SCZA 3WBKA 2D0OB 1BFDA 1KS9A 1LNQA 3L7CA 2X9VA 4UMEA 3KJHA 1EWTA 2MMGA 3OD5A 1H5QA 1LS1A 2FZVA 3KQUA 3MXTA 2YHUA 4B17A 3GVCA 3WYFA 2P6UA 3GN2A 4YJ2F 2V1XA 1EFLA 1T24A 4JQOA 1F2UA 3MJDA 5F78A 1DC6A 3B8HA 3OQ1A 3IT3A 5HZKA 4OL0A 4G1CA 2JRLA 1Z6YA 4TWJA 2XBUA 2XCTB 3GJ6A 2DBVO 1U2QA 2QZZA 1D4ZA 1I30A 1RWWA 1T6BY 1F3OA 1POWA 1QZZA 1XL0A 2GEVA 3K1JA 2H4WA 3WG9A 4ZVNA 4Q4LA 4CFSA 2G71A 1ZONA 5EFZA 1FVHA 4YCMA 1PZFA 1VL2A 2ICAA 2QVXX 3COSA 5AK5A 1XVUA 3RS4A 2C92A 3FNBA 1JKJA 1IXYA 3K3PA 2HX1A 3CZPA 2PZFA 3LCMA 4IH9A 3IJRA 2ZJFA 4LXYA 4ZOBA 5IMBA 4A0FA 1NG1A 4DL9A 4E08A 1DOZA 1ISSA 2Q6TA 2X2EA 3GFVA 2OECA 1O08A 1TM3E 2VYNA 4H7DA 3SHWA 3K70C 5IDQA 3TLBA 4PAQA 4Z4IA 1CIVA 2E89A 3VR4H 1ZNQO 5DLQC 1HETA 4MRVA 1S1CA 1MPTA 2FRDC 1K8XB 2OZKA 3QA3E 1PR0A 1Z6GA 1ARZA 2VAVA 2ERYA 2ZRBA 1I10A 3L8ZA 1F0PA 5D3KA 3RUHA 1GYQA 1KI2A 2VPTA 3NLLA 4BZXA 3GMTA 1MPXA 3CH4B 3U7QB 4CQLB 4EMSA 5HM6A 2G8LA 2G67A 2QB5A 3DC2A 3H87A 1KQGA 1OREA 1HDYA 2HI0A 2YZKA 2I5PO 3LJKA 1U1GA 3FTCA 4FUQA 4LPSA 5HMLA 3TLZA 4ND6A 1SIBE 3GJXC 1M2NA 1BE8A 1M2VA 2C0CA 3GDWA 3UOWA 4QREA 4LK3A 3T1OA 1B3RA 4M4SA 4ZYVA 1V35A 3E05A 3I6QA 1ZM7A 2EBWA 3OD1A 5EZYB 4RTJA 1Q14A 1RW4A 1Z63A 1D2MA 2ZQ5A 3C15C 4R51A 2PX3A 5K0JA 2JFNA 5CB8A 1BW9B 1C80A 2D2EA 3HCCA 3UHJA 2V7GA 2IUEA 5LZ9A 1LU9A 3LQRA 1W36B 1EQAA 3H1EA 4KXMA 5FPHA 3EEOA 1YH3A 3ORYA 4EVQA 3IMGA 4BATA 1BH6A 2FQ1A 3ROFA 3SHOA 1EB8A 4WKNA 1OXMA 3BH0A 3T3DA 2XTZA 1GCOA 1D1SA 4BWVA 5ED4A 3QE2A 2HV8A 2HCFA 5E1DA 4KUGA 4KDCA 4O8ZA 3S2YA 4R2LA 1BWSA 2R2AA 3QBEA 4YT8A 4JA2A 3ZD6A 2II6A 4MVCA 3W8FA 2DG2A 4C6RA 2V6BA 5HGXA 2A3NA 2P9QA 1FFYA 5AM4A 1GZ7A 1YUNA 2PV0A 4AP9A 1W44A 3AZPA 1DEOA 2YWRA 3HS3A 5CX4A 1X1BA 2PR2A 3SEQA 5JC1A 3L0DA 4DY6A 1NY5A 3LVQE 3OHPA 4MJXA 3HZZA 2JGRA 2C3MA 1KI4A 4P4LA 1U1FA 2HK9A 1DJLA 1FDTA 1A9QA 2OQRA 3CKMA 3F9IA 1XKTA 3MMPA 4JOQA 4NOLA 1J0XO 4WBNA 5FBVB 2IY7A 3NC1C 4CLXA 2H57A 1JDBC 1TMYA 4BCBA 4ZT6A 2W6ZA 1IMOA 1P0IA 1KAOA 3NTRA 4W8GA 1U81A 1R4MA 1W94A 2I78A 2B82A 1DAKA 3AXTA 4OM7A 4PXYA 5D3QA 3VNAA 5M5BA 2EQ5A 2HF9A 3H2GA 4UHHA 2DSNA 3TL6A 1I2DA 1KZYC 4WZAA 1DQPA 1BCRB 5ULLA 1R6VA 1JYEA 2ZEJA 1HE2A 5BV2P 1LZKA 2GFHA 2I6QA 5HILA 4N47A 4CMJA 3N5KA 4UFOA 1CUFA 3GQBA 3K94A 3WI7A 1N7IA 5JJLA 1RJDA 3DZCA 3S2IA 4B4WA 2AJDA 4M76B 1A9SA 1CG6A 1GSOA 4E2XA 4DDHA 3R09A 4FSXA 5SZKB 3VO1A 3BRWA 1YQXA 3AUTA 3V2UA 5KNDD 3OZSA 3ME5A 3A3YA 4K6FA 1HPLA 5ICSA 3RC2A 3HJHA 5EJ5A 3QOXA 4ALNA 5L3VA 1CTQA 4U7DA 4PAOA 2OWEA 3DHYA