4EO7A

Crystal structure of the tir domain of human myeloid differentiation primary response protein 88.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
144
structure length
142
Chain Sequence
GGVDMPERFDAFICYCPDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPTKSWFWTRLAKALSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myeloid differentiation primary response protein MyD88
publication title Molecular mechanisms for the subversion of MyD88 signaling by TcpC from virulent uropathogenic Escherichia coli.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 49
structure length 142
sequence length 144
ec nomenclature
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01582 TIR TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4eo7A01
2Y92A 4C6RA 2Z5VA 1O77A 5FORA 4C6SA 4LQCA 5H3CA 3OZIA 3UB4A 2JS7A 3JRNA 1T3GA 1FYXA 4DOMA 4C6TB 4LZPA 2J67A 1FYVA 3UB3A 1FYWA 3H16A 4FZ5A 4C7MA 4OM7A 4W8GA 2M1XA 4C6TA 4LQDA 4W8HA 4EO7A 3UB2A 5KU7A
chains in the Genus database with same CATH superfamily
1KP2A 3H75A 4M1ZA 1XA0A 2O23A 4Y6RA 1QWOA 4KQ6A 1CG6A 1ECPA 3PHGA 3DPSA 3GG2A 3HVIA 1CS4C 4RZHA 221PA 5LQRA 1YQQA 2P2SA 4LZZA 4NG4A 2QYSA 3UV6A 2IW1A 5K3DA 2GD1O 3IBYA 4IFEA 3CRMA 1JW9B 3OT4A 2JIZD 1A7JA 1EJBA 1A77A 1QKIA 1UBFA 1UR5A 3C6ZA 2ZIWB 3I9KA 4DNPA 3QF7A 1JQEA 1Z8FA 2NUAA 4KI7A 4IKOA 5AUOB 5DMHA 4QO7A 1QRDA 1EK0A 2CHQA 5BWBA 3B53X 2Z1MA 4KFCA 1I6MA 2O3RA 3GEMA 1IM8A 4B71A 1GLVA 3VR5A 1AH2A 1Q1AA 3LX5A 3UMJA 4HYEA 4R9VA 4DBLE 2A6PA 2FW9A 3S0JA 4J43A 2R44A 4BLVA 1XMOB 2LDBA 4MHTA 3GFBA 1KIAA 2OXRA 3GPLA 1NOJA 1BYUA 4EGAA 3JQDA 5K45A 1ORVA 1TM2A 4MO9A 1NY5A 5CTJA 5H80A 4JLJA 4EKDA 1JEQB 1XNHA 3A7EA 3IODA 3A7DA 4YTEA 4C5CA 2NVOA 4KQ1A 4PSVA 3RGGA 2JHPA 3WKAA 5C1BA 4JJEA 5CVTA 1KJJA 4K46A 2GJ9A 4WKPA 3SM3A 3WMFA 2FN7A 2CMGA 4CHGA 4XM2A 4IQ8A 1MQSA 4IG9A 3E3OA 4JT9A 5AYVA 4ZI7A 2EBUA 1KDOA 1WXDA 3F5QA 4JR2A 4O2LA 6PFKA 2YWJA 1QE5A 4Y6GB 1AURA 1P3JA 4IIJA 1DHTA 1J8YF 3PEYA 4EW3A 2WFLA 2AG8A 4B0PA 4DM3A 1XYVA 2ZWVA 3L7CA 1X1RA 2XV1A 4LYHA 5E9QA 5TMDA 3U5TA 2QNBA 1Y4ZA 3CE9A 3N5CA 3C4VA 3I32A 2GN4A 4RIFA 4L3WA 1H1TA 5AVKA 2VAVA 2R86A 3K8ZA 1R1DA 1SM4A 4OHCA 1W47A 3P9PA 1UWKA 2EW2A 3EVGA 2RH4A 4MQBA 5CCEA 2HW8A 4QECA 2ZJ3A 3OPVA 1U3UA 5C32A 2QTFA 3IX7A 3LHDA 4TGLA 2XBLA 4ZQGA 4ZC1A 4E03A 3MS2A 3BZUA 3UJDA 4BRWA 2Z5FA 4YAIA 4GYKA 2EFGA 4JJGA 3IQGX 1WMSA 5TQ2A 1OXXK 3CUSA 4JZYA 1J0BA 3QVGA 4LHXA 5GP1A 4DARA 3C5VA 1P5HA 3DQQA 4JVLA 3A1WA 3L01A 5A6VA 2Z8XA 1T24A 4MTCA 4EF4A 3K53A 3WK8A 1T5IA 1NBMA 1IH8A 3DE6X 2C83A 2I78A 1NW4A 3ROPA 1TUEA 1RM5A 4GMHA 3UUWA 1U6JA 3HWSA 2AZ4A 2I80A 3WKBA 3CLKA 3BFPA 4P4NA 5LZ7A 5JTTA 1J0EA 3W9YA 2QD3A 4CKWA 2QUKA 2V7WA 2ZJFA 2CUNA 1SWVA 5ITZA 3VI4B 3OOHA 5KTKA 1DXHA 4UPDA 5CGQB 4N7RA 4IMRA 2PGNA 3W05A 3NBYC 3UY4A 1JDZA 1QIGA 3ICPA 4GOLD 3SAJA 3AGPA 3VISA 3DOCA 3KOOA 2WDPA 2CMHA 3ND9A 4ND5A 3RRBA 1W1WA 3V7YA 4N4AA 4XVUA 4S0ZA 1MRNA 1UKEA 3MTDA 4TV8B 1A98A 3QEMB 4C6SA 2GM3A 3DHWC 3OQ1A 1HR0B 2HSWA 4RW0A 1S2OA 2K2WA 3IELA 2D5LA 2FMUA 2ENUA 3L0SA 3NBUA 5LXTB 3IAXA 1WVIA 3K8QA 5H83A 1XEFA 3U7RA 3LQQA 3CLUC 1KJIA 4G4GA 2YNMD 4BLTA 3MHTA 1TVEA 1ONPA 3AEUB 3IS3A 1EQ2A 2EZTA 3FFWA 3L1UA 1I14A 3OZFA 4RD0A 3FHOA 2JH9A 1WU8A 1FNNA 4UMEA 2YJTD 3T54A 3UGJA 2Z6UA 1EFTA 1R5OA 1T4BA 1OQAA 1W2WB 2RK4A 4TV8F 1NL3A 3H3JA 1N1MA 1V0JA 1J1IA 5T6BA 4NFHA 3FLMA 4PFJA 2NYRA 2D1SA 1PJLA 2NXJA 3FB1A 1Z7GA 5LXTF 1TZJA 1C1HA 2PIDA 5THKA 5CCDA 3PNMA 2C04A 4TVSA 3FHTA 4F3KA 5ALTA 1W5FA 3AERB 1QHFA 3WZ2A 5CEFA 3I53A 1W4BA 1D5WA 1GU1A 1EUDB 3B7GA 3NWOA 5KEIA 3A6JA 1YXMA 4KMRA 3NDRA 4CFSA 1XLUA 3FZEA 1O0BA 2PT9A 2FMFA 1VL1A 1T5DX 3CZCA 3Q8XB 2DULA 4NS4A 3RRYA 3UUFA 4A6EA 4OQ4A 3GVIA 1KOJA 2AZXA 1NXSA 1ZN9A 3A6LA 4M1WA 2Q62A 4GD3Q 2Z5LA 4MA4A 4UVEA 1YVPA 3DBRB 4YJGB 5IHPA 4TLLB 4Q7LA 4PN3A 3A4YA 2BFCA 2VS1A 1OBOA 2BCEA 2PYZA 3EW7A 1QOQB 5AOAA 1RS0A 4U7JA 2P4EA 3SNHA 3T95A 1BWQA 1M2NA 1SOUA 2BGRA 4GOMD 1PL0A 4ASUD 4DQ0A 5AVZA 3VUFA 2FRXA 1ZG3A 2P4QA 2VAXA 4FMPA 2FWRA 1E89A 4ED9A 3ZHTA 1YMQA 3EZGA 4GBED 3MD9A 4IVNA 2EKQA 4KXWA 3LDGA 4RNDB 1JJAA 2ZTUA 5KVVA 4X8MA 3PRHA 4INOA 1M74A 1RRGA 2IY9A 1DNPA 2I3GA 4OH1A 4PZPA 5J4HA 1NZDA 1NYLA 2HLHA 2QTTA 5BWLA 2FEPA 1P2SA 3MXOA 4GSYA 1DT3A 1WU7A 2J3JA 3AKEA 4M7RA 2W4QA 5CYOA 4DL9A 3IEVA 2B36A 2KJQA 3HNRA 3KHKA 4GC9A 4QEDA 1NI5A 5C9ZA 1P91A 2JAWA 4C4AA 2AEJA 2ODBA 3HBAA 1TF5A 3OI7A 4DLBA 1C8KA 3R8FA 3DZDA 4W99A 5TQ0B 1BS2A 1D09A 1XNGA 2VNIA 2QTHA 3FG9A 3GMIA 2NXEA 1YA8A 4BMXA 1MX9A 3NIDB 4JLVA 4CF7A 1B0UA 4DADA 1SCNE 1ZM7A 4GMDA 1WLSA 4CJXA 4BNXA 1C9MA 1E98A 3PNBA 3ZY4A 2DZDA 5C80A 3ZJ4A 3L4JA 4M9ZA 1TE2A 1HE3A 3ECSA 4LQLA 1G4HA 1PJBA 1MW8X 5IJ0B 1UINA 3HB9A 1BFDA 1TF2A 4BLPA 3FYDA 2Q1YA 3BXXA 3CWZA 2XMGA 1TYBE 2FG7C 5C8VA 3QI2A 4AWXA 2IKSA 3IPRA 5E8JA 3UFXB 1YBAA 1TFUA 2L42A 3OM1A 3QK7A 2WIBA 1H05A 2H7YA 4QFBA 3ZU4A 4FN4A 3BAZA 4OJNA 4P36A 1CQPA 3JXEA 1FU8A 2VF5X 3P9ZA 1YQ9A 2AQ8A 3C41J 4N6OA 4F0JA 1XHFA 1ZL2A 3BE5A 2D0IA 2PG3A 1DWQA 3VTFA 3AY0A 4LNHA 4PX3A 2CNWD 5JQGB 4PNPA 3VJKA 1XRSB 4XQGA 5CK4A 5L3SA 1U3GA 1LVHA 2AUTA 3U1TA 1YR9A 3HADA 2LDXA 4Y2GA 4E3ZA 2WWRA 4CT4B 4E88A 1MEJA 3VBEA 3OWOA 3R6WA 2VPPA 5F5LA 4RHEA 3PPIA 3RODA 1GN9A 3F3KA 4KPUB 5DYNA 5H0IA 3ZE7A 4BO6A 2DEUA 5JAZA 2VH5R 2E18A 3L6CA 1NXQA 4EFLA 2CHUA 5EKUA 4I55B 2R6AA 2FXIA 2P9FA 5H9WA 5JQGF 1H23A 5EXEA 2VHJA 2OHFA 4DLTA 1KO1A 4TMTA 5HRCA 3ZCUA 3K0AB 4D8TA 1BEUB 4HN2A 4PAQA 5CXXA 1UM9A 1EGQA 1GTJ1 1C1XB 2PGAA 3GX1A 3D4LA 4KGVA 4LNUA 2AYYA 2BL4A 1R0LA 4TVBA 4RTSA 1TZKA 1JKXA 2BFWA 2NXWA 1XELA 3WFZA 4P84A 1KETA 3VFDA 3F8TA 3KCNA 4PCVA 4Y2PA 1EVQA 4I55F 3KG2A 4CKXA 1E0AA 2C3MA 2QAGC 1P29A 3U61B 2ACKA 4AC9A 1KC3A 3PC8A 2IWRA 1TCBA 1TFRA 1H5NA 2YZNA 3RS3A 1SULA 3L43A 2ACEA 2AG0A 2WFAA 3KJZA 3ZWQA 2R66A 5BPHA 4ZAFA 1U8UA 3NCTA 3RYIB 1E3IA 2JJ1D 2C7GA 3JPWA 4MGHA 3QU9A 5F5XA 2E85A 2DY1A 4I99A 1OLXA 2N1BA 3S70A 3AVQA 5DI9A 2B99A 2TECE 4UDXX 1QS0A 5FOTA 1CUSA 2DP4E 5CLHA 5A04A 2VYND 3UHPA 3G9ZA 4U7FA 3ILXA 4GLFA 3CC8A 3ZDQA 4YT4A 3OWXA 5C52B 1SAYA 4B1FA 2V6JA 3N76A 4BIIA 4Y2UA 4CLEA 4AS3A 5BV1A 3Q12A 3V4ZA 1MDFA 3AVUA 3DXZA 3K15A 3FWKA 5A0FA 3T8YA 4YCBA 3B6IA 4Q34A 3STYA 3PNVA 3M2PA 1BG6A 3NBQA 1O96B 4HX5A 3G5LA 1COZA 2FSVA 1V45E 2V6FA 2UKDA 1KMCA 1U1EA 2XODA 4Q5IA 2PZAA 4FHGA 2QVXX 2L69A 4TYPA 5LCXA 3RQIA 5DTEA 4FDVA 4KO2S 1NN3A 4HHEA 3SJZA 1QQBA 5DNVA 3CIFA 1R6TA 3ZX5A 1NI4B 3EMKA 1K7YA 4LOKA 1G7TA 4ZT2A 3SX2A 3VKFA 4G0WA 4IVQA 4REMA 4WLOA 5SY4A 2IFTA 2AEEA 2DFDA 2Q07A 3PICA 1T9GS 2OCDA 4IXDA 4P3XA 5B30A 5E0OA 2CBZA 3DMRA 4J29A 4TOIA 1DUVG 4JT8A 2HJHA 3CZ5A 2FZ5A 5ES3A 4DYHA 1YR3A 3V5NA 3PQ8A 1HMPA 1JQJC 2BM0A 1H4QA 2F3SA 3E18A 2V54A 3RC9A 5SYAA 3A4LA 1U7WA 4JC8A 1XZIA 4NE9A 4V3BA 3WISA 5JVDB 1WKBA 2B37A 1TYZA 2OBYA 5C3MA 2C2HA 4W8HA 1OR8A 2FW8A 4GP9A 1N2SA 4XSVA 2C98A 1JALA 3A37A 3KYBA 5ITSA 3L2OB 3KUUA 4FB4A 5ENDA 5I9IA 3BIJA 3C45A 3P4UA 4RK7A 1KAMA 4UUMA 4JV5B 5IKXA 4CV3A 3MILA 1UOPA 2AF4C 3JAKB 5K20A 1KDZA 2GT1A 2OXFA 3ZYZA 5AK0A 2BF7A 4G5YA 2XECA 3DW3X 1GRQA 5DTJA 4HQ6A 3SYLA 3OOSA 2JBHA 3R3WA 3ZQKA 4XCQA 4LJ9A 3WBKA 1RJWA 1CF9A 3LH5A 3TTTA 4O4HB 4OUKX 2HI0A 3KOYA 1ADYA 4ZANA 5JNSA 3MD0A 3I37X 2PRZA 2R1VA 3HCOA 4POAA 2D13A 4UASA 2VF2A 1K88A 3M5WA 3RWMB 3K73O 1MAVA 4Q37A 5CG2A 3ICCA 1S2IA 1TRKA 2BFEB 1Z5VA 5GQSA 2D59A 3T7RA 2CWWA 1OX4A 3VU9A 3FI0A 3FWYA 1B0ZA 4P93A 1A8QA 1N78A 2OWDA 1B4DA 1UP4A 2C4NA 3FF4A 1ZIDA 1PFUA 4KH0A 3VU3A 1QRTA 4O4HF 4IL5A 1N2EA 5H5JA 4DG9A 4EFMA 1VFPA 3TGLA 4P5EA 3ZI4A 5K3OA 1TB4A 5KINB 3JALB 4OKNA 3JWIA 4PZ9A 3H9UA 3S4YA 1W6RA 3DJYA 2ZRDA 5HTOA 1DC4A 1V6CA 3E7WA 1UXKA 2Y1EA 2GARA 3KS9A 4LSMA 5DHRA 1TU3A 3LQYA 1OC4A 2IOYA 3JAMA 1NF8A 4EPRA 5BN5B 4KDEA 4UBKA 3B6JA 1ITZA 1AU9A 2IEZA 3N87A 4JOQA 1H4SA 2ZCVA 3IEUA 3SIWA 3G0CA 3ZXSA 2B8WA 1WB4A 1KQ3A 1Q7BA 2P91A 2WKPA 3C14C 1PNVA 3TB4A 4D6PA 1N2JA 5G41A 1QGUB 1NBAA 4HL6A 1OFVA 2AMVA 1GPH1 4OPMA 4JX8A 2G40A 3SYMA 4MRNA 1WTAA 4HB0A 3UPDA 2X2FA 3MELA 2P27A 1KDRA 2WJAA 4J7XA 1O9BA 3J7TA 2ACVA 2QG4A 1I7DA 2BGUA 4PAMA 5GONB 1DQSA 1KO4A 4OBWA 4XRGA 3DR3A 5L45A 4HEA6 1U0NA 1MB2A 3G8CA 1XL1A 4YDHB 3LL7A 3FUCA 4LBYA 1QCZA 4XYGA 1TRHA 4YJFB 5AOCA 3RVPA 4B3IA 4BNWA 4D42A 2ZSBA 3BDVA 3OJLA 4CMHA 2EZ4A 1EBBA 4ZAZA 1ETHA 4BNDB 1R9GA 1WD7A 1ZVKA 2QU8A 4MW2A 4BVGA 5GVRA 3JQ7A 2FI1A 2IE0A 2VEDA 2QENA 3E2MA 3CVXA 1NURA 4DIEA 2D6FA 1UC9A 2PL9A 2IZ7A 3ONVA 4S3MA 1PT9A 2J0UB 5GONF 1WNFA 4L1KA 2VH2A 3SK0A 2DHEA 1FJXA 2RGCA 1JYSA 2XF8A 4GGMX 3D9QX 3HGTA 4TTPA 3LTEA 4A9AA 5LLSA 4CIDA 1RXWA 1WULS 4DOMA 1IN4A 4B7CA 1OVGA 4G5QA 1IBRA 3RYHA 5B7NA 4OU4A 5EQTA 5LNK1 3FLEA 3NUQA 4WK6A 1FDVA 2XGMA 1G20B 2YH2A 1RLOA 3CF4G 5MFPA 1VBNA 2YBEA 2GEBA 4UUAA 5J2TF 2F9FA 1DKNA 1RXIA 1GPKA 1U5CA 3ABZA 3OE5A 4IV0A 1T9CA 4RY8A 4AICA 1QO0A 4UM9D 2QL7A 5FH9A 4UVGA 1ZHHA 3Q7IA 5C8XA 1RJGA 2AN1A 1FC0A 5FL7A 1P4SA 2HH9A 4MWSA 1UK9A 2O0MA 4L28A 3OWHA 3LMKA 4INPA 3SFZA 5TS2A 4U63A 2ZUSA 1XJCA 1M2EA 1T9ZA 3K1YA 1YQXA 4A2CA 1VPTA 4HPJB 5ERYA 2JEZA 4LRWA 3AUKA 1RM0A 5DF1A 5C46F 1LJLA 5DGIA 1DARA 4PQYA 4FQ7A 4GWGA 5KNCA 4X1YA 5JI3E 2DTEA 2BDTA 2R11A 4ONEA 5D3MA 4KAFA 4O1IA 4KIWA 4JA2A 4MPJA 1MX1A 2PS1A 2H52A 1MR3F 3R8XA 3LCCA 3QFCA 4HWOA 1HLDA 4O0LA 4MJXA 4U4AA 4YRAA 3IT0A 3G1TA 1FDIA 1PG5A 4NU5A 3Q3IA 5DBGA 3IDOA 4OOEA 4RVDA 4YRKA 1FP1D 3U17A 2Y1CA 4J90A 1Y8RA 3KV1A 1ODCA 4HNAA 4DCNA 4LHSA 5IANA 4X7PA 4EFKA 1ODJA 4HDSB 3WGLA 4DPMA 1J8VA 4C2UA 1J2TA 7AT1A 1UEJA 3F8WA 2BH9A 3F6YA 2BIFA 2ERCA 2J9RA 1NYQA 4GKBA 5A6SA 3N58A 1XRLA 3OECA 4Y9UA 4KRFA 3TRFA 4ARAA 4FD3A 4GVPA 1CCWA 2ILTA 3O4FA 2E89A 2OFOA 4FWIB 2A58A 4JA0A 1KBZA 4BX3A 2CXHA 2VP4A 4ZU1X 4YHHB 1UJ4A 5DTRA 1H3EA 3H86A 1M3SA 3KLMX 4N7JA 3PXDA 4A10A 1ZOIA 5LQNA 1NA5A 2GZAA 2GLTA 3C24A 2ZRIA 4QQFA 2PZBA 3Q6NA 4KMOA 4DY4A 5ITVA 2J7PA 2NU7B 1T9DA 2O06A 3DAPA 4ZI3A 3MVEA 3C3AA 1Q91A 1FZQA 3M83A 2ZEJA 3VR6D 2JCXA 5HKKA 2FN4A 3VR0A 2DFKB 2YKGA 2QU7A 1CS0B 2MOKA 4D9KA 1BSVA 2PFKA 1BWPA 1HFWA 2R87A 5AIAA 4NG5A 2R6ZA 4EFNA 1GDDA 4FDLA 2HSDA 5CA1A 2X6TA 1HKHA 3GFFA 3W6ZA 5NLLA 3U31A 3O8BA 1E2GA 5CVVA 3B7PA 3JPYA 2HZ7A 4HNGA 1MVLA 4JLAA 2UUAB 5BRAA 5AW4A 1I4LD 5JS8A 4KKVA 2C4TA 1TPYA 3MB5A 3BK1A 2FP3A 3AL0C 2N75A 1QYXA 2HADA 2PUHA 3P9XA 2C99A 1C3OA 2PMFA 3AVOA 2M32A 1SCIA 5H4HA 3D0QA 4DMCA 4JCCA 4D81A 5BV0A 5E6UA 3G2PA 1LS6A 1Z06A 4PSKA 1BDIA 1WZ2A 1P7YA 2OBMA 1ZL0A 1KPGA 2G9QA 2EHDA 4Y3UA 5CYGA 1IBSA 1B7GO 5IM5A 2AMLA 1OLSB 1L5RA 5SYNA 1PLJA 4MUXA 3RIYA 5F9HA 4XX1A 3NOOA 3SJ7A 4LY9A 2O8FB 3HTXA 3R5XA 3HDTA 3R3VA 3VJRA 4AP6A 1PEAA 1SC1A 1X8XA 2PZ8A 1ZGZA 4HDMA 1Y4UA 5AVUA 1JHPA 1H8EA 1GZ6A 3QNUA 3JVDA 3CGGA 5IN5A 5DYGA 4L76A 2V7GA 2WYVA 3H2IA 3SC3A 1JG2A 3PPVA 4GQIA 4OQNA 1ISFA 4UM8B 2QJFA 3AF5A 1DTSA 3AHGA 3EY4A 4PFKA 4I6JA 1JE1A 1L4UA 1N2XA 1A50B 5KMGB 1LDNA 4TKVB 5CIYA 3PJRA 5LWHA 4IILA 1UQUA 4C43A 3WB0A 4Z6KA 3STUA 3BBLA 2P9TA 3P2OA 3ZNQA 4B6OA 4CKCA 2XEDA 5EAIA 2H1LA 3TINA 3JYOA 5AOBA 3QFFA 1USWA 4B8WA 4EA8A 4EHHA 2WKQA 1NN5A 4ZTUB 3C8HA 4YC7A 3WADA 5HOQA 3O74A 3PUWA 1IJEA 2PFGA 3A58B 3Q9SA 4YRPA 1KAOA 5JZMA 3AX6A 4A82A 5KJCA 1I13A 2C54A 4YROA 2R00A 1JNYA 4QXMA 3ZHZA 4C6RA 3OCCA 4ETNA 2ZRMA 1MFZA 2BD0A 4R1NA 4Q00A 5CH8A 3F7TA 2YV5A 4II2A 4UBMA 2OCYC 1ZU5A 2Q6LA 4QUKA 2Q8QA 1W9HA 3FCEA 1ZK4A 3LNTA 2O57A 1TUBA 1EM8B 1SQSA 3EJWA 3QKWA 3CTMA 1L5OA 1RQ2A 3L1IA 4AZ3A 5BUCA 2Q4TA 1YZUA 2WSMA 4ZIRB 2WZQA 5CB6A 3U5ZB 3S2ZA 4N9QA 4HGNA 4EKEA 1DBWA 3L02A 1E63A 1SB9A 2I5PO 2NM0A 3UAVA 3E0QA 1RWNA 3DPUA 2P0AA 2C0PA 3EXIA 4LV5B 1JIQA 2BEKA 1UBUS 3JQ8A 4PSCA 2EKBA 5AW6A 4QWMA 2F8LA 5ALLA 1PIWA 2E4XA 3QVOA 4MR9B 2RC6A 4BMVA 2R85A 1N7GA 1M6EX 3MPOA 3NT5A 1E3LA 5LYYA 1CRWG 3AUJB 4G07A 1PD1A 1WF3A 1YT5A 2O3UA 2PQMA 3PEEA 1GJRA 1YIAA 1V8BA 3GI1A 1UWVA 4X65B 3GRUA 2JLUA 2XH8A 3DVAB 3JQAD 4H7KA 3ZW8A 1PKEA 2B0JA 2EP7A 2JFFA 2GN2A 1HXHA 4KG7A 4UD2A 5L3RA 4UMFA 3RQSA 3TQOA 1IXRC 5EC8A 4PBTA 3LSYA 1FU4A 4YIKA 1DG1G 3WGJA 1IVNA 4F3NA 3THYB 2W70A 4F9FA 3DBIA 3R5HA 1J4AA 3IMGA 5EMNA 4ETIA 5LD2B 1JEYA 3RVRA 4BMDA 1SBNE 4C6TA 1F4PA 3CBGA 3JVIA 3L4BA 2WTEA 4M4SA 4LK3A 1SBIA 3GZNA 3U62A 1ONBA 2OENG 3DKRA 2W71A 1NVGA 2SNIE 1KPHA 5FI1B 1X1DA 1JYEA 4DA4A 3TZQA 3I52A 2ISCA 2PD3A 2G9UA 1HF3A 4UNNA 1Z8NA 2A35A 4N82A 2GF2A 4ZQIA 5G3ZA 3V1YA 4Q9NA 5AVYA 2HJGA 1P7CA 2GHIA 3FIUA 2O2CA 3WLKX 2REQB 4XYLA 3F90A 3GJYA 3YASA 5K01A 4F4JA 4BX8A 5I8WA 4NJEB 1WCWA 2ETXA 4RPGA 1ES9A 2PMCA 3UK7A 4DLLA 3KL4A 2PE5A 3QWFA 2JIOA 4TZTA 1JRLA 3ZXXA 2QM8A 5C8DA 2YN0A 4NU0A 4Q4AB 2PPVA 2OXEA 3AEKA 5J2UB 4M8IA 4RQBA 3FZGA 3RVBA 4KN9S 4CIXA 1SXHA 2PBZA 4US1R 4UUOA 1V26A 3N8NA 4DJFC 2W2KA 1R0XA 5L3VA 3D2CA 3F8SA 2FPOA 4R3NA 5K0EA 2X9GA 4CQNA 3HLTA 1UH5A 4KVGA 5IMBA 4PWZA 3R9XA 3NV9A 2ETVA 5ABPA 1GKYA 1GYPA 5I51A 4NHEA 3I5YA 3Q5GA 3ZKWA 1JR6A 4OIFA 2G9VA 1KJ8A 3ZWMA 5J2UF 3TRDA 3BKXA 2VJCA 3E4CA 5HBGA 2HMVA 3M3PA 3VU0A 3Q2IA 4BB9A 1XDUA 3LPLA 2GPJA 4HNVA 4MQLA 2JGIA 3O83A 2BV3A 3CPHA 2JLXA 3FWPA 5BNTA 3ICQB 2ZJ6A 1KJQA 4QUDA 4Q9IA 3VR4H 2XYGA 3WL6A 4NMHA 2W00A 4DZRA 1BX3A 3FCXA 3AQIA 4RZXA 2FNAA 1YJAA 3OHSX 4MROA 1JDJA 1XQYA 2OSBA 4LGYA 4X20B 5AK4A 3VPGA 4CMAA 1OGJA 4EHJA 5HZGA 1NF2A 2OK7A 1EVEA 3OFKA 1XAIA 4KOEC 3L82B 2C1ZA 3UUGA 4B87A 1T13A 3PUYA 2QAJA 5GGYA 4CDGA 1OB2A 4RD3A 1NT2A 1VE6A 2YRWA 4I4TA 4JI1B 2BEJA 3EHDA 4FINA 4OM8A 1XAGA 2B9VA 4NV1A 4DMHA 5KQLA 4WZAB 1UAAA 3K5IA 4L51A 3ELYA 1GUFA 1SCUB 4K5QA 4NRDA 3ZDCA 2VG8A 3ELDA 4F71A 2NZYA 3LFHA 3O0DA 1K4KA 1S02A 2GJAA 2ZULA 2PMEA 1DAIA 1CUYA 4FXPA 4M1QA 3U7QB 4HYYA 1E6CA 1B0AA 5DI3A 1KK2A 1R0ZA 1DIHA 3F6BX 3SZOA 3O26A 2C95A 1T9KA 1LH0A 4HATA 3GUYA 4Q0MA 1F0KA 4XQCA 4BFXA 3HK2A 3B9QA 1DINA 3QKSB 3GGOA 2ONJA 4ARCA 2ECFA 3ZD6A 4D8WA 5DM4A 2JLZA 3NPAA 1OAAA 3JWHA 3M6MD 3KL2A 2HHCA 3E48A 3R77A 1QMPA 2NU6B 4XM1A 3TSZA 3C16C 3H1TA 3BJMA 5DWDA 4ZT4A 5CBPA 1R18A 3BBPA 4FUTA 1UT8A 3R4CA 2YOGA 2ZB8A 4BNIA 1REQA 2V0CA 4A6PA 3IMCA 1NUPA 4EW1A 1G8AA 4HP8A 1J0AA 1VA4A 5TMBA 4QYWA 1QVAA 4PO9A 5BRNA 1XXHA 2M98A 1MJNA 1LVUA 1VE7A 4N5HX 1EGAA 4B3HA 2IYVA 1AHNA 4EQZA 4PNZA 2HO4A 4MQUA 3E7FA 4WXYB 4O2AA 3HRKA 3G82C 3OLQA 4K9RA 4N5DA 4ZOLA 1XPOA 1VJDA 3PEFA 1OYVA 1UBJS 1KSGA 4LVUA 2A0XA 1P6UA 2PRIA 4WL0A 1ZOOA 1Q7GA 2GJ8A 3KKKA 5HKOA 4MV8A 3DTTA 3HB0A 5DMXA 2ZWOA 4CM8A 1X3SA 1YONA 3CX4A 4PC2A 5FUYA 1N6IA 2QYHA 4RJIA 1II0A 1HX7A 1X1CA 1V39A 2W8BA 4KPFC 3D6UA 4ZYUA 2J8ZA 4TXJA 1HQCA 4NJMA 1PL6A 1GYQA 3B82A 3PEWA 3ZD7A 1ESZA 2AZDA 5CDYA 1OXTA 2WQ6A 4QU9A 4YO8A 2I9PA 3TRHA 4YV2A 2YNMC 2RI0A 4NYIR 3ZXIA 3U9LA 4ALIA 3RYCB 1E1KA 1JIIA 1GNRA 2GNPA 1GCUA 4UUQA 1GPBA 3ZDEA 4URWR 3S44A 1R00A 2WWXA 2WAAA 2XYPA 4R98A 4LHEA 2FE1A 2X8JB 3FDZA 3IUQA 2WZBA 3B2QA 2OZLA 4ON9A 3CZ4A 1YZQA 2GGSA 3NM6B 5B5SA 1AS2A 3GJZA 3BVPA 4PG8A 5CEEA 2C92A 3ZCTA 3AF2A 3NH9A 4GP6A 4AO7A 1TX4B 3TK1A 1J39A 2YWHA 3WLHA 4A0SA 4X00A 4YY3B 2CL6X 3W6OA 3UH0A 3OJFA 3E23A 4UM9B 4IRUB 2EP8A 1JS1X 2VATA 3KE9A 1X1AA 4FLFA 5HFNA 3B1VA 2CHVA 1IBLB 4EAAA 3PQDA 1DPGA 3IPYA 4GX1A 1K8QA 1CZRA 2BDEA 2I7VA 2MCFA 4F2WA 3U1BA 4U39A 4X92A 2PVSA 3PKIA 1Z2OX 2FTKE 4M46A 5DO9A 1IEQA 5THQA 2A14A 2FR8A 4NH4A 4ZCRA 5CFNA 1RAFA 3OG9A 3VR2D 4D5EA 1FLDA 1SRRA 3ZK9A 3PDIA 1A5BB 1X1EA 3BERA 4RJJA 3CVJA 2E3JA 1M2VA 3A25A 5AM2A 4IDFA 4CFYA 1AUQA 3QE9Y 4EW6A 3WYCA 1FYVA 5LA6A 3K31A 3ONWA 4OUDA 2PKQO 4AZTA 1QTQA 4JXZA 5LM3A 4F3YA 4H7IA 3LVFO 3W2TA 2AVNA 4ZQHA 2BMFA 5KKAA 4QU0A 2B7BA 5EQDA 2OM6A 4FCWA 4UUBA 3U7IA 4KX3A 3BFJA 4MHSA 1P1CA 2QIOA 1UMDA 3JYNA 3ORQA 3ZVKA 2AXPA 3WMEA 4CG3A 5D7BA 1BXRB 4C87A 3GVXA 1SEPA 4FFDA 2PWPA 1PJ4A 4IDOA 3K6SA 1RRVA 3S3TA 5JDCA 2O6LA 3C7TA 1UMBB 5EN4A 3SLKA 4CKBA 1L7AA 4QNNA 2XOEA 1AK2A 4UDNA 1JSCA 1BMDA 4KB5A 3FGOA 4TZ6A 1RYDA 2G04A 2HXSA 2PT7A 3QWAA 1CHNA 2IXEA 4WPGA 1GPUA 4L15A 4Q24A 4K6OA 4Y8VA 4C2BA 1W46A 3U09A 1EWYA 5CG1A 4AJ1A 1TDJA 2CDBA 2X86A 1WCXA 3UWOA 2FUKA 1G5TA 4EX7A 4URYR 2V97A 2FZGA 2FEKA 4AD8A 3DCJA 3KC2A 1RPTA 4WKOA 1CNMA 4AUEA 2L0XA 1Y6JA 4DLRA 3OKAA 3LLVA 1SUEA 1F3OA 1Z35A 5B36A 4DDMA 4C08A 5BP7A 3SZ3A 1VYVA 3BWBA 1U7XA 4OLAA 3ETJA 3H17A 5CB8A 1QQAA 5DGTA 1UWLA 3WLOA 1QYIA 3NRCA 4AO6A 1JKJB 4N3GA 2W22A 3HFJA 1NATA 1KEEB 1PX0A 1U11A 4QX6A 1L5NA 3EVFA 2YVQA 2ZYTX 1EFCA 1QHHB 5BXQC 1MFPA 3EWNA 1VL6A 5EUCA 4CNQA 1BJKA 4O4LB 3EEYA 3HKEA 4ZCTA 3AWIA 4HTFB 3HP7A 4NBLA 4NMLA 5ETJA 3I9MA 3FOCA 4QGHA 2E6KA 5J3JA 1AC5A 2BRUA 4WJKB 4YRQA 4OFBA 2NP6A 3AKZA 2QZ9A 3EPLA 3DZCA 4R2JA 4AZ0B 1QYDA 2J1LA 3D3KA 4JXXA 3IUBA 3CN9A 1GR1A 3ZXYA 5JFGA 2VPZA 1RABA 5T4BA 3UTDA 2K7FA 3H87A 2IUEA 5EPUA 4JHLA 1SHLA 4RM3A 2VQ3A 3DP7A 1K2WA 2AN4A 1W29A 2BEVA 2Q5LA 1DEOA 5A5DA 2RHMA 1B6GA 1VC2A 1YOVA 4I8XA 4O4LF 2GD0A 4EPVA 1TAQA 1B1CA 4QDTA 4QELA 4NPAA 1GR0A 2W2VA 2CLOB 3ANTA 1A8SA 4ZOEA 1YS2X 1ZSYA 4P6VF 2VBCA 3EFBA 2XE6A 3DB1A 3K0CA 5AKXA 4HNSA 2VT7A 1NYRA 1KI9A 1PR4A 2E6UX 4HEQA 1VCIA 2Q0XA 3HWX1 5JSYA 4AYWA 4F11A 1EFVB 2OGTA 2GM5A 4I9UA 2JCBA 3RG8A 3LXMA 2CDRA 5JPIA 1IQ0A 3RT9A 3UIEA 3Q1KA 4DA7A 5K6AA 2B1JA 5LD2C 4X61A 1E6EA 1JZTA 4NBVA 2OYCA 4HNHA 2QRQA 1U2SA 4PLPA 3SICE 4JZKA 4WLEA 2WI8A 5ELMA 4EA6A 4XJSA 2E7ZA 1JPJA 1M8FA 4M9XA 2J5RA 4C2TA 5IAAA 3AHIA 1KBQA 1CBUA 4UBLA 3MJVA 2COKA 3LUCA 4FFSA 4O02B 3VKGA 3O90A 2Q6VA 1VRWA 4IDGA 4KWHA 1VJTA 3IYLW 2NADA 3GJ3A 5AM1A 3PFIA 4LZOA 2YWRA 1N2IA 1Z07A 1YJ8A 2A5GA 3L49A 4M0MA 3GXOA 3MWEB 5EQFA 4YRZA 4N5LA 3L6OO 1PHPA 3QELA 4ZAWA 3RRJA 1AIPA 3H2SA 7GPBA 3L8CA 1KBOA 3FPKA 2XPCA 5BR1A 1HDZA 4WN9B 5IMSA 2PUVA 3RVSA 1XZPA 2Y77A 3C2QA 3MZ0A 4FCCA 1FFXA 1FYEA 3KZ1E 3AGQA 2PRYA 3VYRB 4DKXA 5CB4B 1QCCA 3NR2A 4TKUB 3DYBA 3NDJA 1EFKA 2XTAA 3PR1A 1NTRA 3RSSA 3S2SA 4G85A 3R0ZA 2Q99A 2WIJA 2XWSA 1RC1A 4UZEA 4CCSA 5BPFA 4NFYA 5BSEA 1FIUA 1K86A 2JBAA 3ETDA 3F46A 4WXRA 4YMSA 4AYXA 3R6TA 3C5CA 3TJZA 3VOSA 2X23A 5AHKA 3RU3A 2NVBA 4KXXA 2GVNA 3K3PA 2HV8A 3DDNA 4UAJA 1BS9A 2QRJA 3PJDA 2NO9A 2GYWA 3KQPA 4G9EA 4MIOA 3UXHA 5CB4F 5K8LA 3ZJVA 1NN1A 1DCKA 2DWUA 2OPHA 1BH6A 3QVVA 2WF8A 1M6VA 3MT7A 5E9WA 4BGDA 1W4RA 3PC7A 3VNRA 4ZQCB 5CYFA 2XUDA 2AUNA 3SF8B 3TAHA 1B00A 3DWGA 5JADA 3URMA 1BN6A 3PFKA 2J09A 3OFSA 3TLXA 1W0JD 2VJBA 1NTOA 1HRDA 5IK2A 2QTRA 4LDPA 4R84A 1F2TB 2XNCA 4TTSA 3DAHA 3DYIA 4X93A 3LGAA 2Z6AA 1XI2A 1Q0RA 4EKGA 1Y9EA 5K0ZA 1XZCA 4FDUA 2PXCA 3O1LA 4P92A 3VYSB 4Q02A 3CEJA 5GJCA 4CN9A 3P4YA 2HXYA 1CYDA 1DP4A 3FAKA 4ZAYA 4DXAA 2H2HA 3H2YA 4W9NA 1KVUA 4IBOA 1JFTA 4AIIA 3LZDA 4B6QA 1EFRD 1XTJA 4RK1A 1SOWA 3G2HA 4OI2A 4RMNA 1ZJ6A 3LS2A 1E1CB 4N5IX 2HJRA 2D5BA 1KZ1A 1PLKA 2PGDA 4FFRA 1PDVA 4KPEC 1ZRHA 2ZRAA 1HQKA 2PJZA 4PCUA 3UQYS 3UXYA 3AV3A 2NO1A 1BMFA 3LNCA 5B6IA 3O9ZA 1KRXA 1DEAA 2ZT8A 4TSFA 1R4ZA 3L0ZA 4IOJA 1M5UA 3HSSA 4OQYA 3UMSA 5KTYA 2JCYA 5L7WA 3D8NA 3M6LA 2QGNA 3BH6A 1NUSA 5AR1A 3CRRA 3QLVC 4OF4A 1ID1A 3PF9A 1THZA 2OCLA 4EDHA 3WB9A 1Y5LA 3HMKA 4HEA1 4IVRA 2PUBA 1U0LA 3HJTA 5KYVA 1YS4A 1P5RA 2NUAB 3WA6A 2X5OA 3I9JA 3FHCB 3CUEF 3O6VA 4R83A 5IBCA 4OG2A 1PGJA 4QARA 1OV4A 1S3GA 2AB0A 2JRLA 4PPQA 3V4FA 3H11A 4QTUB 1BGXT 1K8YB 3EIHA 1KVQA 2V58A 3MIIA 4N03A 3G5TA 3S1AA 4CQMA 3U80A 4O8CA 4J8PA 1Q2UA 1DAMA 1P1IA 3MJHA 5PGMA 2HUNA 3PHLA 2IBTA 2J4FA 2FLWA 5I7OA 1AZSC 3S2EA 1JLLB 2X0IA 4QTXA 721PA 3DT8A 4M98A 1WSWA 2H3HA 4MUGA 1JV2B 1D2EA 3SHVA 2IOFK 4NENA 1TW3A 2XTJA 1SUFA 2F8MA 2H65A 2R4QA 2WF5A 4WAUA 1XTPA 4ZOAA 5TGDA 4HLQB 4B48A 4FOSA 2CL5A 3WC4A 2DLNA 4OBBA 3WBBA 3UK2A 1Y34E 1D4OA 1CLEA 1PZNA 1V16B 2CK3D 1QBKC 2QN2A 3PI7A 2ZS9A 5DW0A 5E7JA 3KDPA 4R7GA 1CUGA 2KLHA 2H5IA 2X4IA 2HBYA 5KWSA 1EWKA 1AB6A 4DNOA 4NCBA 3DC2A 2P6MA 3OJCA 1VLQA 2P6NA 3FPLA 1OOEA 4CG1A 5JSZB 1CU1A 4RVOA 3F4LA 3OBIA 2J46A 4Z2YA 5CVJA 5IJWA 1YRLA 5I3ZA 1T1GA 2CSUA 2RIPA 1Z0AA 4CGYA 3E9YA 3QVTA 4XYBA 2V8BA 4MCHA 2JKYA 4CKZA 4IIJB 4OD0A 1SG0A 2REBA 3F96A 2EL7A 4L2IB 2Q4DA 1S9DA 3U13A 4LYJA 2YWBA 1ZNWA 4HVAA 1YBMA 3IR6A 3O8OA 3L0IB 2ODTX 4Y2RA 1MJFA 3H05A 4HQFA 1P0CA 4JOSA 1GZ3A 3OF5A 4ZVPA 1XVAA 4UM7A 1XCPA 1JA1A 4PU0A 3Q0EA 4NECA 5D8DA 4QA9A 4DIMA 5JAOA 1NUQA 4PVCA 3WNBA 4II7A 5ARDA 1E2EA 2CJWB 3V4RA 2Q3LA 1E8MA 5IKEA 2XUKA 3K96A 3KCQA 4IIJF 1I7PA 3PENA 4EY5A 4D7AA 2WG1A 2Z08A 2AT1A 3LF2A 1US8B 2ERXA 2FR1A 3JASA 2XKKA 1U98A 5ECWA 4Z1OA 5IWAB 1Z75A 2KB0A 5K0TA 3IP5A 4BB0A 1ZD4A 3U60B 4H1TA 4AY5A 4OHXA 1ZN8A 1MNQA 4LFBB 1TJ5A 4KQKA 2GQ0A 3K05A 2B20A 4DNFA 4MA5A 2I33A 2DLCX 2NV6A 1QORA 2IY7A 1ADGA 4K81B 4P31A 1HT1E 3O8QA 2W2MA 4UCWA 1YC2A 4WH0A 2XMPA 3CXUA 5I9MA 1RP1A 2IITA 1QHYA 1QZZA 1OIVA 4AK9A 1LRJA 2O1SA 3G8BA 1Z5PA 4UE3S 1ZSNA 4Q9JA 1R9MA 1ZIPA 3ROQA 3UW3A 3DCNA 4IMPA 1ZNYA 4LSZA 2QV0A 3BREA 3LHKA 3MCUA 1NNUA 3QVUA 4A5SA 5L4LA 1AQJA 2KI5A 4UDYX 3SJUA 4HLNA 1TM3E 1Y8QB 3OEYA 4UXJA 3FKQA 2DWCA 3GAAA 3IE0A 3VV2A 4QBGB 1P6QA 4KUHA 2RONA 3SEZA 3A0RB 3LHFA 3A26A 3AP3A 1DRWA 4PQRA 1A7AA 1OT3A 3GYGA 3TZLA 1WBJB 2VJDA 1H2XA 5FORA 4AP5A 3A1TA 4EI9A 1M0EA 2HBQA 2YV4A 3IEXA 4IICA 4QYIB 4C89A 3K16A 4XDGA 1P72A 4PANA 1SUIA 1XVLA 3B8HA 3T12A 4MRRA 1DXOA 2L18A 3DD1A 3FVQA 4HEHA 3UAXA 5GJWC 2GBPA 1U31A 3CZQA 5AKLA 1YASA 3CF2A 2JEOA 3Q9NA 4QL3A 1WPQA 2GUWA 4Q9DA 1NBIA 4BQIA 2SKEA 4BXOB 4DA0A 3PFBA 1B26A 3RB8A 3HACA 3ONDA 4H7EA 3ZWPA 5LBIA 4FZRA 4U8HA 3DOOA 2EFJA 5EKXA 3RJZA 3ZWBA 3T9DA 1SB8A 1UKYA 1IAVA 1GOTA 4QICA 1R5JA 2TMGA 4IKPA 5FV7A 4Q3CA 2H3EA 4OHRA 1FY2A 4DR6B 3HJUA 1DLJA 5T8KC 5D3ZA 2A7QA 3P9NA 3UZUA 1T26A 4HQNA 3FCUB 3R24A 3PNSA 5B3KA 3MSCA 2Y9MB 2HJVA 4IYJA 1T36A 4WW0A 3OD1A 2YHSA 1SCBA 4PAWA 4R2LA 5D2CA 1FMJA 1NJ8A 2SCUA 3GEGA 3LDAA 4GVXA 1Q0HA 3RU7A 2HU2A 3CNOA 4ER7A 2OV2A 2ZYRA 3VV3A 3GUZA 2ZI9A 3PTAA 5H02A 3L7LA 5TEWA 3CLTD 1JG6A 4XQ0A 2DAPA 4Q4HA 2NQ8A 3B9PA 1TD1A 2ZSAA 5BN4A 3MGKA 3JQFC 4C07A 1CUUA 1RI3A 4B3FX 1O94D 1K75A 1VRVA 2IGBA 2FPGA 1N8KA 4LDNA 2OHHA 3LO8A 3D81A 4BNHA 3RS7A 2PZLA 4I5IA 4AXXA 2B1QA 4YALA 1XTVA 1JMKC 3TO5A 2YINC 5F7XA 1P60A 4KGDA 4KN6A 1R2QA 4WKGA 1C9KA 2X7XA 4NCKA 2GB4A 1W85B 1V8DA 2A1UB 2CDAA 3NBXX 4N5NA 3RVMA 4ZZ3A 3VKHA 1QC5A 4Y2QA 1DCMA 2NO4A 4CKYA 4NC9A 2PTHA 4R71A 1PG0A 2I54A 1WNTA 3BD8A 1KSJA 1PJ8A 3D5QA 1H4TA 1T0JB 3OE1A 4ZTBA 5KYWB 1NKTA 1T5HX 2P6PA 1ZBDA 1S3IA 2X0KA 1N9GB 3VDQA 3QF4A 4OKSA 3OEEA 5JWOA 1MABA 1PGPA 1LSJA 3RDPA 4KNYA 4BO9A 2HA4A 2JLRA 2O7QA 2MSWA 5AJVB 3PJFA 1L5ZA 3VNAA 4C7MA 2WAXA 5JBQA 4R1QA 5KTNA 2PZGA 4HWKA 4G1FA 3KUKA 1MJ5A 5L3SB 1DBVO 2XZOA 1AS3A 1T2AA 1ADCA 3JVEA 5AHOA 1U7OA 2PX3A 5TGZA 1J8MF 3KQMA 4ALLA 4P81A 3FD8A 1KPIA 1Q5PA 4RGBA 5B4VA 3TMAA 3SBOA 4BZQA 1DX6A 4KWEA 3WHLA 1VJGA 1U1GA 2JI8A 1USUA 1WXQA 3O9MA 1W8DA 3QOYA 5TE9A 1IAQA 3PNLA 4PYIA 3ORRA 2AFHE 6REQA 1Z8DA 5KYYB 1U6IA 5T3YA 3ZVNA 5ICFA 2AOTB 2PKRA 1SHTX 1PCXA 2HPAA 2MU1A 1KAHA 3F74A 2GLXA 2R5WA 3FFBA 2JAXA 4MIKA 2PNJA 4ZDJA 4MUEA 2WHPA 5EIOA 3BC1A 5BT8A 5J47A 5B1SA 4Z7JA 1NHGA 2QT0A 3GCZA 3FUWA 2F48A 1I2ZA 2B4YA 3H4TA 3I2GA 4HUQB 5FTKA 2XSZA 2YJGA 5HFAA 1NSYA 3DE7X 4QBKA 1TQ4A 2BGLA 4OYRA 4CMKA 1N2ZA 4K6CA 4WKNA 3EAFA 2CVZA 2WSSA 3HR8A 1OTXA 4LF7B 3B1XA 2QTVA 3HYSA 2AZMA 4H4DA 1PJTA 1WHTB 4OMCA 3FSEA 3EVCA 4WV3A 5JEDA 1X92A 4OXKA 4DEVA 2ZXEA 5IDWA 2JZNA 2BTQA 3KJIA 1GU7A 2H1SA 1U8AA 4K26A 4TYWA 4JB8A 3CH5A 4KYVA 4Q3NA 4V3CA 3T1VA 3KJNA 1Q20A 3LWBA 1Z34A 5K5EA 1ECCA 3G2IA 4RF4A 5JS6A 4B44A 2Z9CA 2FX3A 1Y48E 3OZCA 4H3SA 3TLGA 3G9QA 1D1SA 4TQGA 4B3MB 1P5ZB 2G82A 2ZJ1A 3JRWA 3VR3D 5B57C 4BE4A 4CIAA 5JPDA 2JGJA 3PUIA 2FFHA 4HRVA 2FEOA 4CV2A 1PFYA 3C3KA 4XWKA 3ZE0B 4ZVTA 5TF4A 2MSCB 1RVDA 4BFYA 1IOWA 2PH1A 3C85A 3KSUA 3VTKA 1LK5A 3G02A 3ZI0A 1MQ8B 3G79A 1WTCA 1EKXA 3IFSA 1NSTA 4RK0A 4WE3A 5F77A 1RCFA 1XJ5A 3A36A 3KJFA 5ALHA 4AW9A 3JD4A 4I0WB 4Y2HA 1JKMA 4BU1A 7REQB 2P6UA 1MDBA 3LPNA 1L7PA 1Z0DA 2ID8A 4TM8A 4OEHA 3RHZA 4CM5A 3DWIA 1CJBA 2MMCA 3E9QA 1XMJA 5DHAA 3MRXA 1ZUNA 5FHQA 5B3LA 3SE7A 4KQHA 4B80A 4RAQA 4MW6A 4YMUA 1RMTA 2VPXA 5REQA 3ROFA 4BNUA 2ECKA 4BB5A 4MWEA 1A97A 2O2SA 2WWYA 4DIBA 4GPBA 1GKKA 4U2DA 2DHDA 3BGVA 1AA9A 5JWHA 2PWBA 3AG6A 1Z6AA 4CMBA 1HLFA 3S2UA 3BKWA 4BVEA 4DCPA 2V7QD 2DUMA 5I45A 4IGKA 1G3QA 1BXGA 4MARA 3AEZA 3MN1A 3RHSA 3UC9A 1NLZA 2PV0A 4RF5A 1Y8ZA 1JLHA 2CYAA 2DFPA 2C9MA 2I6QA 2Y66A 3DT9A 3T4UA 1ODKA 4CM3A 4D4HA 1ODIA 2HSEA 3HDYA 4DLWA 1OGIA 4BL5A 1KMNA 2YZGA 5EZYA 2DPMA 2H17A 2F55A 4YP6A 1W0KD 2ATXA 5GOTA 5KDDA 3W9UA 1A2BA 2G1AA 2O8VA 3DSRA 3L06A 3M4XA 3LPMA 3G68A 1YJBA 5IEJA 4ZDKA 2DC1A 1GIAA 3ND6A 4URXR 1EWRA 3TG2A 5LZ8A 2HPZA 5DGHA 5EIBD 3BXGA 3WK4A 1YDMA 1HDEA 1DAFA 2NSJA 3AHJA 4JLSA 2GZ3A 1E9VA 2I1VB 3A6KA 3IAAA 4UHFA 1P17A 3I3SR 1DB3A 3MJ4A 4QEZA 1T34A 1NMQA 2HU5A 3AINA 3QE4A 3SVZA 4AM8A 5H16A 2QP4A 3D0KA 2JCVA 1N5OX 5FBQB 1NVFA 3W8NA 3QE2A 3WSTA 2B4TO 1LBEA 3FKSD 2IZ5A 1J09A 3UATA 1LPPA 1SUWA 3I64A 3I58A 3IAUA 1Z3IX 4E70A 4BKMA 4OAQA 5JRZA 5KYTA 2LV8A 1BS1A 3R3XA 421PA 2AKYA 2CXXA 2VBFA 4XR4A 2GPWA 2FP4B 2JHCA 2VXBA 1EP1B 5GIOE 4KMSA 1G8MA 4D8YA 1ZONA 3OZAA 4K87A 4FFMA 1EDZA 4E5VA 3CY6A 3SHTA 1VG8A 1OFTA 5EIEA 1ZIXA 2F3UA 3ZBQA 4GEGA 3PZBA 4EBBA 4K9LA 1IOZA 3KQWA 2PANA 4L4YA 3L4EA 4MICA 2H1OA 3NHBA 4WDRA 5B3AA 3KOZA 5A9SB 3AUYA 3A3OA 1VI6A 4I19A 1A7KA 1Z2DA 2AV6A 2IIBA 2V74B 3L9XA 3QITA 4P80A 4DQDA 5A3RA 4Z53A 3EGEA 3BHIA 4G24A 4H6PA 1EJ2A 2XX3A 3H2GA 4RE6A 4OJQA 2QR2A 5TJ9A 3TL2A 3EQZA 2AFHA 2QSJA 1XKLA 2WSBA 3FBTA 4F86A 4KUEA 1TC2A 1YK0A 2QPLA 1NZFA 5E2IA 1GG2A 1U3WA 2QR3A 2G80A 1JQKA 2H07A 2ZSUA 3BMXA 3PC3A 5DBEX 4BDSA 2O6HA 1BVYF 4BMPB 2WQ7A 1FVXA 5KOJA 4JI4B 3WL3A 4BJHB 1TK3A 2FJUA 3K9CA 4EKYA 4C78A 4H4EA 4OATA 2W9XA 2Y8EA 4NFLA 1SKAA 5KQPA 3COPA 1E9BA 4BY9E 5LQDA 1T8WA 1LDEA 4D6XA 1VJ5A 4NZZA 4DC1A 2QZPA 4XA8A 3WOVA 2EGGA 1SVOA 1PK9A 1XYYA 2GJSA 1UFVA 2RKOA 5K0LA 5CP8A 1U3TA 1GHTA 5KPJA 4FFPA 1ULUA 1JG7A 1N6RA 5H82A 4KVZA 1B8PA 4YRIA 5FAKA 3WQHA 4LDAA 3N0XA 2C5BA 3ZN2A 3JQ7B 1ZRMA 2JANA 3IRVA 5COBA 1ZM3A 1OI3A 3ZG6A 4BZWA 4PSDA 2M9MA 5KC8A 5IT4A 2ZK7A 4TTJA 5CITA 2QPTA 5F64A 4HDOB 1F6WA 2NNLD 4W63A 4ZU6X 1N7HA 1JHUA 1ILWA 1P1KA 4DCJA 4DJ5X 2GSDA 3ZLBA 1WZIA 4EUSA 5H9VA 4ARZB 5BMVB 2PH7A 4HH3C 2Z09A 3RYHB 2B78A 3SSMA 5AUNB 1JTVA 1WZCA 4ZCPA 1YZYA 2Z6VA 2GYVA 3CZ9A 1C8BA 2FEAA 2OQIA 2RJNA 4I1SA 5IC6A 2ZBGA 1DS6A 5HW0A 3N28A 4NESA 2NPFA 1G98A 1H65A 2KSQA 3M81A 1TT5A 3EDRA 1TM4E 3RRMA 1RJ9A 1J7JA 4W1RA 1LX7A 2EG9A 3AETA 4F4DA 4UNPA 1RZ3A 4YAJA 2X7HA 1PVOA 1FPQA 5B2EA 4GUDA 3O82A 3OJWA 3NAQA 1S8FA 3G5UA 4L0QA 4K9PA 5BMVF 2YQ5A 3A28A 4UUPA 2QUIA 4UOZA 1C8LA 4MVJI 1OJLA 1VQ1A 2H48A 5AI6A 1EX7A 1KR5A 1ODSA 1S2MA 3BL5A 3OHPA 1MB3A 1HZJA 3EBLA 2ONCA 4ZZ2A 1LX6A 2YWFA 3FMOB 4GR5A 5ER6A 3V42A 2R6DA 2UZ3A 1J42A 3K92A 4BIMA 4JQZA 3TR5A 4NCJA 1UFKA 2C84A 3H6HA 1JAIA 1E2FA 2QORA 3OESA 1CZUA 3B1YA 4G0MA 4HH0A 2IU0A 5I48A 1Y7LA 4DWOA 2CKDA 2DBVO 4JYBA 2WT4A 3M9WA 2PBFA 4MB2A 1ZNXA 3HYCA 1D2RA 5JZSA 1GV1A 3U44A 1EP9A 2W6NA 2J5BA 4KH1A 4Z3OA 4IIBA 2PH5A 4YUYA 1ANKA 2BM8A 3CMMA 1BVRA 1DAEA 3HU1A 4ZQFA 4CGZA 2X8WA 3V8QA 5LLTA 3IV7A 1KDPA 3W3AA 2A7XA 4XPIA 1E4VA 1WUIS 1DBPA 3LC7O 4EJSA 3BMNA 1OH8A 4CDNA 1AKWA 1JDSA 1W19A 4JP1A 4IQFA 4DLSA 3IJRA 4JNCA 1HKUA 2EC5A 2OK8A 1BQ3A 1PQYA 4DA9A 4AVYA 2VT2A 4HWTA 2V5VA 2VYFA 5FFNA 5IDVA 4EUFA 2PS3A 3NMUF 1XFDA 4K0RA 3IA7A 2JC3A 1T4MA 3WGTA 2IDJA 3ULKA 1N3BA 2C4UA 1YWGO 3TLYA 3PQ3A 2V4MA 3ZTWA 1TJYA 4G8BA 4N18A 1H6CA 2GCEA 1U1FA 5LZ9A 1A8HA 4ER0A 1CRZA 4IIYA 2ZWAA 3MS4A 4Q3AA 3I0NA 2H85A 3ZGVA 1K92A 3O84A 4C7XA 3VKVA 3R6DA 1R0RE 2VSNA 4CM6A 3O73A 1PUJA 4DIFA 1P44A 4GOJA 1DLIA 3A9SA 1Y5IA 3P0RA 3DNFA 3KKQA 4G9GA 3SC2B 1OAKA 4DRZA 3R7SA 4D02A 1RQLA 3NOQA 5CIQA 4ZTZB 1JU4A 3H4VA 1KE1A 1Y1QA 2C1EA 1EH5A 1HEUA 2IU6A 1RYMA 3MWKA 4RKQA 1AO3A 4M2LA 5L7TA 4QTYA 3ZZ1A 2IHYA 1E94E 1N5KA 5JSQA 2EZUA 2PHZA 2FSGA 4GW3A 4ZOBA 4J2HA 3ZC3A 4D9HA 4Z7OB 3KETA 3TIGA 3ZJTA 3Q0TA 2OVFA 3P2KA 2O14A 1GG8A 2RE8A 1EK6A 4FE7A 3ZLUA 3L7AA 3U48A 1KH2A 3LRTA 3DEZA 2XOKD 2XCUA 1X7YB 2RGBA 1H1DA 1GZSA 3SXUA 1DKPA 3LE8A 3P71T 3QPWA 4GO1A 3HSKA 3PLRA 4JD5A 2DX7A 3C8ZA 3MQFA 4KWIA 4C6HA 3ZUPA 1SKMA 1NRWA 1TADA 1UUFA 4FJ0A 4D26A 3ENQA 1ISSA 2FJPA 5FT9A 3W78A 4YJ2A 4R4JA 5BWMA 1V3VA 1MGPA 1PEYA 1ZHFA 3OA2A 3CR7A 1XMPA 4L5CA 1N5LA 1Y5MA 2XCSB 3M0EA 2QD5A 1O6ZA 4KBYA 3BHMA 3PG5A 2CVPA 1F9AA 3UPUA 4H16A 3VSDA 3QPAA 4IJVA 3EDMA 1JYFA 3VNBA 4C1NA 3AV0B 3H5OA 1LNSA 1XCOA 1RXCA 2HN9A 3LUKA 3OM9A 1TIPA 1NVTA 4HDMB 2I6XA 5FUXA 3BH0A 2NSHA 4S0XA 3V7FA 2HF8A 1MBZA 2A92A 3ZLTA 1CUVA 3CRNA 1GGJA 1FNMA 3EGXA 3HVHA 1U0SY 3SG0A 2UVPB 3R0VA 2QK4A 1XIVA 2XR1A 1GRCA 1VMAA 2C2KA 4K2HA 5FPYA 4AMBA 4PZZA 5JXGA 3BRWA 4QPZA 2OCAA 3R44A 4MIEA 4KQEA 3DBLB 1E5DA 1N1EA 3GDWA 1AZLA 1H1LA 1MAUA 3QFHA 2HK6A 1RKUA 3ER6A 3LG2A 1YTLA 4WJZA 4AZVA 4FS3A 1ZAYA 3VYTB 2VDKB 3O1IC 4FD2A 5DV9A 5JXHA 3F7NA 1LTQA 1D7AA 4YT8A 4K9SA 1EVIA 1T25A 2JW5A 4AJJA 2Q0HA 1SD1A 4XVRA 3JV7A 3EMDA 2M6LA 5LP1A 1NONA 3V00A 5KHOC 2IDZA 2VSOA 4BE7B 1J07A 3WLFA 2EDAA 1LEHA 5I01A 2X14A 4RO0A 1XF1A 1DJLA 5ERGB 5JAMA 1RKVA 3NTXA 4RJTA 4MP8A 2EL9A 4H35A 3EXG2 3DR5A 4NMMA 1XC7A 5E1DA 3A3NA 2ADMA 1HDOA 2ODQA 5KNDH 4NV0A 1BX0A 5F78A 2XUAA 3KP1A 5K0NA 1RBZA 4AZSA 1EMDA 1GU0A 4EUKA 4EY6A 2P69A 4DYDA 3PXXA 4U7HA 1NBOA 2F17A 4IEIA 3RTGA 2VNAA 1FTYA 2DPHA 2ZYUX 5IPFA 4EG1A 2QJTA 4NMXB 5CW2A 3C5WP 1A9OA 4OTZA 5ALGA 3LKDA 4KQ2A 2JASA 4PEVA 5DX1A 3V8RA 3H6KA 3MT9A 4ZCMA 5HJ7A 3U56A 3MRSA 1WE2A 2GTIA 4YCNA 3ICVA 1XEWX 2HY7A 2O4UX 4FZVA 2HV9A 5BVHA 4M36A 3QEAZ 3CONA 1SKBA 1K7XB 1N2CE 1TJ3A 1U2PA 4HQRA 4OBXA 4BP1A 5SICE 3V6MA 1GFIA 1DIGA 1XJ0A 5A9RA 1EFHA 4YJHB 2F00A 3HDVA 4F4HA 3KXLA 4QJ4A 5I9BA 1I1QB 3CKKA 5FUMA 3LWNA 3KQLA 2WJIA 1E1RD 1HEIA 3CUUA 1QKJA 2JDID 3GZNB 2XQFA 1M6NA 3PKZA 4OOFA 5D00A 1T4CA 3AU8A 1MTZA 2AFRA 4AWAA 3DFMA 3EVNA 1Q11A 3QWBA 4U2BA 4ZZIA 4D0SA 4RV9A 5A1TA 1I32A 2AQHA 4O5AA 4UBNA 1OZHA 1DOAA 5J59A 1SU8A 1BDMA 1K08A 4BLSA 3FCSB 1FLNA 4XOIA 2F9LA 2HSJA 5T3UA 1F60A 2I4OA 2P0YA 5IVDA 2ZAYA 2ZR0A 1KYIA 2Q6IA 4EEKA 2QQ0A 3CT4A 2VZ9A 3BHNA 1TMOA 3AEKB 1O7JA 1PT7A 2RGNC 2HFJA 4M9CA 1E5LA 4LBVA 1FCJA 5AICA 5HKAA 1NNEA 3CJTA 4EVQA 3HJCA 4BWYA 1XDSA 3WWOA 2ZU0C 3HP4A 3CN7A 5FB3A 5BSTA 4J3NA 4YUWA 4F7DA 5JXJA 1DGQA 3KPWA 3HE3A 4Z9XA 5F3DA 3EGDA 1Q44A 4LXYA 1QH0A 2FLKA 2I76A 1IQPA 4E5SA 2YY7A 3O5AA 3C15C 3SPXA 3ELWA 8ATCA 3UOWA 4DIDA 4CLRA 4EHNA 2G4CA 2VDMB 3RUAA 1N2HA 3OF2A 1NXPA 3IIMA 3TSAA 1L8QA 3BE4A 2JFHA 5D6OA 4YXWA 3BMOB 1A1VA 2HLNA 5CLIA 1YHYA 2HA7A 3B6ZA 4LY0A 1ENYA 1Z36A 2WJZB 3OFNA 2VP2A 4FIZA 4R1UA 4AURA 2Z1DA 3HCEA 2OY0A 1CY1A 2AXEA 2BUBA 4G5GA 3BE6A 3AVPA 4EPTA 5AJWA 1X3LA 3NU1A 4G9BA 4M7OA 2XGOA 3MTJA 4LYGA 4MGIR 5AI0A 5EJ5A 3WVNA 4BKOA 3M9XA 3CSUA 4TX1A 4QREA 3HXPA 4DV6B 5C7IO 1DG9A 4IDCA 1Z25A 1FTQA 3P32A 5AW8A 1U0RA 3SS7X 4GX5A 1CJTC 5JWRA 5K0FA 4RTKA 2CFTA 4D4JA 5MN6A 4I4TB 1E2LA 2G4VA 1NWCA 4COKA 2NMVA 1IVSA 4I9GA 4MV5A 3MWJA 3K1TA 3B1KA 1JIUA 1GQRA 2CLFB 3AM5A 4M0DA 4A5OA 1WSDA 1Q2XA 3A3PA 3N0WA 4JJ4A 4P3NA 4XM0A 1VPEA 3WZLA 2ZIXB 4CMGA 4RAOA 2WPNA 1SA0B 1UXOA 3F5FA 3EOAI 1HDCA 4ZO7A 3VZPA 4E5DA 1GQOA 4E2FA 4B4VA 3A0UA 5K8CA 4CV0A 3OKPA 4A2QA 1JEAA 4HDRA 4B6RA 5EZ6B 3AJ8A 1HTBA 1TVKB 5A4KA 1OXSC 4I4TF 5KDLA 3D3WA 2QY6A 4X1IA 2GAOA 1R4MA 3IOMA 4GE3A 3ZTTA 1TZCA 1CJVC 2QL6A 1WW8A 4B81A 1Q22A 4G4SO 1NR1A 4UHJA 4L6IA 5CLQA 1A9YA 3HKDA 1HEYA 3CW2A 4OIMA 3U37A 4CIVA 4Q4CA 5CBPB 1D8TA 2Q27A 2WJJA 5G0WA 4RQUA 4TQ9A 2O19A 4NZMA 2NU8B 3WWDA 1FU7A 3AEQB 2HJSA 2JJ2D 4C21A 1Z16A 3KZMA 4RZIA 4S12A 5U4XA 4P0QB 4AX4A 1XXHB 4EG6A 1T3ZA 3NYIA 3BMQA 1YDFA 1RQPA 3QPDA 2ZAGA 1K8RA 4D82A 3ONNA 3AQ4A 2XWQA 3QYFA 2AFIA 4KJXA 2QW1A 2GVZC 1A4UA 1RQRA 3DULA 3GUVA 2WWVD 2ZJ8A 1W94A 1N2GA 2IXGA 2Z43A 3I8XA 1MENA 5ECDA 1JVSA 4B3JA 3KO8A 3KXDA 3ZHOA 1HG0A 4NKRA 5IUJC 4CT0A 1QCDA 1SY7A 3MGAA 5IHXA 2WEKA 2J3EA 1MX5A 2UYOA 2OVBA 5KJFA 3MW8A 5JSUA 5B7QA 1X7ZA 3U4DA 1BNCA 4IIHA 1N2CA 1OU0A 2W8BB 3N2NA 2VP5A 4PICA 4NPHA 1J23A 3HI6A 1PZXA 3KJGA 4BKPA 5KOIA 4L22A 2G5TA 3GVPA 5KPDA 3RBVA 3AFNA 4TWJA 3MTEA 1KVSA 1VSTA 4JMPA 4R1SA 3KEQA 1KL7A 3EQ6A 2JHAA 3L4SO 3ODGA 4MITA 3UOAB 1O4VA 2BGMA 1X19A 2I7TA 3FCCA 3TW8B 2I66A 2JATA 4RGQA 1KQNA 3TLMA 3EA5A 1IJFA 2WA1A 2Z04A 5AMXA 1MW9X 3X3HA 2YJ3A 1KYVA 1CUEA 3OX3A 4BVAA 4NSNA 4RIIA 4M9UA 3WLMA 1T5TA 4YBZA 4EGJA 4DXDA 1WABA 2EAUA 3ROGA 3LIPA 3WRYC 1C3LA 4OXYA 2WP8J 3JVUA 4LJYA 1AXRA 4RUKA 2WOOA 4XEUA 5DCYA 2HR1A 3GJ0A 1G7CA 2HJ9A 2IYPA 2RAVA 5I4KA 1E60A 2C42A 3U49A 1PJCA 1C30A 2CB0A 2PO7A 1JA9A 2TS1A 2BKLA 4MNTA 2R1TA 4UW9A 4B09A 2BJHA 3DC7A 5JJBA 3PFCA 1P31A 3UHFA 4EJMA 4RH3A 2G09A 1RTKA 3I12A 1XDZA 4GEKA 5FBRB 4PN7A 2XQVA 1L5WA 1DMSA 1OI4A 2KQUA 4MDHA 5EERA 3T94A 3L8GA 4DCSA 1RFLA 3A4NA 4BCCA 2G6TA 3AF6A 4KXYA 1KKLA 3LXUX 1PQWA 1M66A 2AW3A 3UWKA 2C8JA 1K7SN 2ZRKA 2HA2A 3GY0A 2RAUA 3L5KA 3LLSA 3QYJA 1P18A 4PQFA 1BHJA 5I3CA 3CLTC 3EG9B 5LA6B 1MIOB 3GV0A 2IHTA 3NM5A 4L50A 3CUKA 4MLDA 2X41A 3EIXA 1JHZA 3GU3A 2C7RA 1KERA 2IYSA 1WD5A 5FX2A 3QWIA 4D3ZA 4X66B 1O94C 2B34A 2ADFA 1KS2A 1SCAA 3ILYA 4OJTA 1UMDB 3VAZA 1ZJYA 3TECE 1K6IA 3DAFA 3MEQA 5IJAA 5I4CA 2YUIA 1YB1A 1DZ3A 2BEUA 2VJAA 1N9KA 1QYRA 4CHTA 4KOAA 3B3AA 4IDDA 3ENKA 4PYOA 1V4VA 2K7ZA 1J24A 1NRJB 3SP1A 2JHFA 3S99A 5LA6F 4C76A 2Y92A 4FC6A 2XHZA 3GRPA 5B2FA 2J9XB 3BMCB 3PGMA 1F1BA 1AUPA 3F3SA 3IEKA 3ZGZA 1YZNA 1TK2A 2QX8A 1HYBA 4UEOA 3LOUA 1KI7A 1LNZA 5DEIA 4TV9A 4X7BA 4QPJC 3C87A 5DM60 3G6WA 4M0LA 2RB5A 3HUFA 1IUOA 1J70A 2Z9DA 2Y68A 5EIAA 4AJLA 1GNQA 1FFHA 3H1BA 3WJAA 1PZHA 1RDFA 1DJOA 3LC1O 4NEQA 3RFUA 3T9EA 5HX7A 3GGCA 3WLIA 2FOXA 5JE8A 3EXHC 2VA9A 1GEEA 2Y1DA 4MWOA 2RC5A 4DDWA 1CIPA 2X40A 4Q9AA 1MORA 5IUNC 3HJFA 3WL7A 5IXSA 1BKSB 1Z5OA 5FADA 1BZYA 2P79A 2O50A 1BCSA 1UM8A 1QP4A 1KJ9A 3D6TB 5BYJA 5KKCA 2JFZA 4B82A 2C5LA 1TMGE 2HZBA 5KNLA 2DOKA 1KHTA 4ZVLA 5KTPA 1Y8AA 1LQTA 2G6BA 1GPDG 2GBLA 2XTMA 4TMKA 3NEJA 4XYMA 5DB4A 3ZCRA 3ZBTA 3NVKI 3PHJA 3CH4B 2CEKA 1FQJA 4A8TA 1Y4DE 2YXDA 1L3CA 3SE0A 1O54A 3F71A 3FYTA 4YP9A 1S8OA 4OHWA 1LC0A 4WCFA 3IUNA 4MDYA 4B40A 3H83A 4LRQA 3W0LB 1U2DA 1DQYA 4IS3A 1K6JA 3NEPX 4QUJA 1R15A 4UBIA 1RWKA 1S2DA 3ZHQA 1IULA 3Q8WA 4Q48A 4H3KB 1WF6A 1FB5A 2OXCA 6CHYA 4QLBA 1ML3A 5H3CA 3PUKA 3T0IA 3CZPA 3WYNA 3LP8A 3RSCA 4BUCA 4GDMA 3IDAA 1A5SB 1E5QA 4TMZA 3ENZA 3SKXA 5HWSA 1XTBA 2O8NA 3CLRD 2GN9A 4Y1EA 3T3EA 4BP8A 4G8CA 4LNAA 3AJAA 4A0QA 1HSOA 4BO1A 1FDWA 1XBTA 1Y6ZA 1NGSA 3FN4A 4UREA 2UYCA 1KDTA 2X5NA 1KIMA 1RYHA 3N6XA 2AC7A 3DB2A 2QRGA 3ADDA 1X7HA 2HA5A 3QX9A 3ZE6A 2W8ZA 1YIOA 1CEEA 4PLFA 3CRVA 3V97A 2XKBA 1E18A 1RBYA 2C2BA 2GPAA 2XKJE 3S7ZA 3T5BA 3D8TA 2NN3C 3M1AA 4Y6PA 2X8BA 3D4BA 4X45A 1CPYA 1Q21A 2W2NA 3BQ9A 2ORVA 1R8XA 2X9LA 4X3PA 3UAYA 1EDEA 1PTKA 4OL0A 2P90A 1NF9A 3PLNA 1YA4A 4EF6A 2P6OA 1SC3A 4DDVA 4CIWA 4QJ5A 4OH7A 5JY1A 4KIFA 2Q5IA 3V8VA 4J49A 2NO5A 3N0RA 4BTEA 2QZZA 3EMVA 5IC5A 3ZWNA 2WV9A 1RHQA 4WLNA 4E07A 3HC7A 3PGKA 4H60A 1X0XA 5I4BA 4UDOA 2B4AA 3FOBA 1G59A 2HMAA 4WA7A 1XEWY 1U0EA 1G21B 2W6PA 1H9BA 2YV1A 3OP4A 2O8CB 4TT3D 3P9SA 2EQ5A 1K7FB 2WTUA 2E9SA 3ET5A 3W2GA 1YI0A 2HMSA 1KSFX 1RXEA 3U40A 1HFEL 2WUWE 4O0MA 4PQEA 3GELA 4CM7A 3AO0B 3ESCA 4E09A 1YVRA 3ZIDA 1GITA 4AROA 1GZHB 1SUBA 1H85A 2QX9A 2VJLA 3LU1A 3T7CA 4BFCA 3AL3A 3GRRA 1X2EA 4OXRA 4E08A 5CDGA 4JJFA 1ORIA 2QTAA 1W88A 5EWLA 3QXXA 1LUAA 5CW1A 3ZLJA 3VI3B 4CTKA 4YCJA 2XZDA 5E4JA 3V8BA 3GJSA 1GSHA 4MVYA 2ZIUB 3BE8A 4IV5A 3F2IA 3EVEA 4Q1AA 5EIBC 3E1SA 1E7WA 1XP8A 3SVLA 3MBOA 2GD2A 4RHYA 2OGUA 4J07A 5EE3A 1RHRA 2OBFA 3KB8A 4EJ6A 1FX1A 2W6JD 1RJEA 3TUJC 4EX6A 3AESB 1AXGA 5JD5A 3OTOB 1VYUA 2IYRA 2YIJA 3LDHA 4QYXA 2QUHA 1RRMA 3M6FA 3G9UA 1O6GA 1SXPA 1FFGA 3UJBA 5I7FA 2O54A 1XF9A 2JK0A 3FNHA 2WD7A 3VXKA 5E6SA 5EP4A 4ENUA 1QTRA 3SN6A 4BQFA 3PNPA 4YLEA 4S05A 1G1MA 1KE2A 1U0OC 2JA1A 3KQUA 3URKA 5L4SA 1QAMA 2XD4A 1WPGA 4QU5A 1VBKA 4OHZA 3ZE1B 1YRAA 4AG3A 4M1KA 2EFEB 2PWAA 2QJRA 3EASA 2FEXA 3GLQA 5B1HA 3OPQA 4FFBB 5T4EA 2H4JA 3RWBA 4DWVA 1LBQA 4XUGB 3AOEA 3CV3A 3LT5A 2ZRCA 3R9KA 3C3CA 1HG1A 3ZD9A 1BROA 3UJNA 4PM4A 3I9OA 3UJHA 3GN2A 3GJQA 3FSRA 5B1YA 1WB6A 4QDUA 1JXMA 1GLGA 5BSKA 2AA3A 1S4QA 3DNPA 4YLYA 5I7WA 2XT6A 5DX0A 5DLQC 3J7AC 1D0IA 4YRLA 1F5SA 3HHEA 3CG0A 1IN8A 2DGDA 2GRUA 2HPVA 3HHPA 3HY6A 1MO2A 1T15A 3JD0A 5C7LO 1XPJA 4Z49A 1M67A 1YTUA 3IKMB 1SCDA 1WZEA 1SC9A 4IM7A 4KO3S 5BSMA 4QUIA 3Q8KA 1VIYA 1OPXA 1W4LA 2MSNA 3C7DB 2XOKA 4J1NA 3EUFA 3S1AB 3X1ZA 1DC6A 2JAHA 4IH4A 3H65A 3K2EA 1X94A 3ZU2A 2YXNA 5F52A 2CY0A 2HA3A 5INTA 1JF8A 4RQTA 4G0VA 1P1JA 4RPIA 3F1KA 2JD2A 3Q3EA 4C0AC 4EFDA 3GF4A 4D6YA 4ARUA 4I2NA 3DTVD 4HZUA 4JB2A 1FFDA 4M0EA 4CT5A 2ZZNA 1OLOA 3OQNA 1BQ4A 1GRRA 1M1YB 4ZVSA 2BELA 3CB2A 3G0DA 3H04A 2R1UA 2DJ5A 1EESA 3M1LA 5G4KA 1JLKA 4B3CA 3LBFA 2JIBA 3GEEA 4C2AA 4TWRA 4UAUA 1GAWA 3JATA 5EEHA 3WS7A 5DYTA 1DWUA 3ZE9A 1T6YA 5HZMA 5ALFA 4C0WA 3FXAA 5I4IA 3TGPA 4GWLA 4DY6A 4IFIA 2YQ4A 3H7AA 4BOYA 2PRKA 3WAGA 4ND8B 1N6OA 3H2HA 4GFDA 4GPZA 1RI2A 1HSZA 4ZEVA 6AT1A 5F4ZA 1VE3A 4BP9A 1XL0A 2DUNA 5KBYA 4U7WA 4DRXB 5FLYA 2UU9B 2I2CA 1JE0A 1ESCA 1FF9A 1MB0A 4RKYA 1CDZA 1JQAA 2GMWA 2BCJQ 3HLKA 3P9CA 3PR2B 4I1RA 4A36A 3O3OB 2Q6KA 1FUKA 5D7NA 3ZE2B 4YAOA 5JDIC 2XGSA 1D2AA 1YQEA 2AFVA 3R7WB 1XK6A 4G26A 2EATA 5FEMA 1TF7A 3KQOA 4G86A 2VTVA 1RYEA 4YDRA 3T3MB 5IYZB 5K8UA 5ESDA 2YJZA 3AW9A 5T64A 2OQRA 2PUFA 2QMEA 3A1VA 2CJYA 4ND1A 1YAHA 2X4DA 4UU7A 2ZM6B 1FRFS 1U6KA 3VSBA 2HUPA 3L92A 5K3SA 3NHKA 3ST7A 4II3A 3VHXA 1UAYA 3PE4A 2J31A 5AJHA 1T8UA 4CF3A 3TFOA 4NBRA 1T3TA 2D54A 4QBFA 5MGNA 1Q0UA 4O4IB 4Q7MB 4DLKA 4HWGA 3P9QA 4NCNA 5IYZF 3SHQA 4A03A 1O97D 1X1BA 2BVNA 3W2EA 2XB2A 1E3WB 3VR4D 4UTRA 2GKOA 2OECA 1QV6A 1CC1S 4PC3A 2OD9A 4ZHQB 4JSTA 2WWWA 3RTBA 2HO5A 3KT3A 3ER9A 1E59A 4L5JA 1SVKA 5TXGA 4DDHA 1RP7A 3OTWA 1D6SA 2OZPA 2NTJA 2WLTA 5F7ZA 1L4EA 4G6ZA 2WNHA 1S96A 1SO8A 4O4IF 2IDMA 3FPAA 4US2R 3LZCA 1B0PA 4YGYA 5BN3A 2JS7A 5K8VA 1XPUA 4OQPA 3QV2A 3G0IA 1R4NB 2P3OA 1HZZA 1GQSA 1KFBB 2C7VA 3B5IA 3I62A 1PBTA 4RA6A 4PNEA 4PLGA 1VP9A 2X9VA 3O8NA 1MJGA 1U3VA 2QN9A 3K1ZA 5D86A 1T3HA 3A04A 3QBTA 4JYMA 4FNOA 4OXIA 4CM9D 4AN0A 3Q87B 3FI9A 1JHMA 2NZUG 2FAXA 4I7EA 1QIEA 4P7GA 3P0IA 3AR8A 4V1CB 2AUMA 4Q21A 2NUTA 3DDWA 3M82A 3T1TA 5IARA 1SGWA 3D3NA 4MIYA 2NZVG 4XB2A 5FBLB 2P78A 2WJVA 5L9AA 1NV8A 4FZ3A 3RF6A 4DLXA 3KKNA 1NAHA 4F4IA 3TCXB 4RVNA 5EUMA 3ZHSA 4RIGA 5F33A 1U5AA 5BRJA 3ZHYA 2XGJA 1SXGA 1WM1A 3G59A 3GG9A 3NI2A 3TLAA 3TOXA 4PHCA 4LGVA 4CMEA 1Y5RA 1P0MA 5JZOA 3RREA 1E92A 3Q7EA 2YMLA 5EE9A 3JAWA 4J1QA 5KSWB 1WEHA 4OL9A 2NU9A 5ALDA 2FX2A 3OETA 3TPZA 2ZZKA 3PXUA 3PCTA 3BWXA 3E9NA 1AGNA 4PG7A 3VDMA 4ZYXA 5C5CA 1AKQA 4M1SA 4DCOA 5JNLA 3TE6A 2ZE7A 3MWLA 4RVHA 5EE1A 4E11A 5I8ZA 1YVDA 3JQGA 4RYLA 5AI8A 5DXJA 2XMDA 3AFHA 4X91A 4YGXB 4AJEA 1KYYA 4WERA 1SHUX 1V11A 1M2OA 1Y3AA 3V1LA 4RULA 1ORTA 3C1TA 4JBNA 3F7MA 1M8JA 4C3UA 5I7RA 3AI2A 2GVDC 5HRUA 1PR1A 1E2UA 2FZ4A 3OQPA 4Q4HB 5HP4A 4HQLA 4BQNA 2OZVA 4DCGA 2CLEB 1P0FA 2H5EA 2AK2A 5DNAA 2C2GA 2C9DA 1ZPDA 4MGZR 4WGGA 4RK5A 5ES4B 3VR5H 1ABFA 3KOMA 1B3RA 4PYLA 5AHXA 3NHYA 1ZWKA 3L3BA 3USCS 3F9IA 4EI2A 2FPGB 4L07A 1UP6A 3QUQA 1N77A 4IOLA 3TAXA 2NPIA 1NNSA 3I61A 4QPCA 1SELA 2V0GA 4MH0R 1JLRA 3NEAA 2BGJA 4FR0A 4QDOA 1RACA 4NZYA 3TW0A 2AXNA 3QSGA 1NQ5A 2AJ8A 5AVOA 1CE8B 1IHYA 3AKCA 3FNGA 4E5NA 1GNTA 5EP2A 5EIXA 3PV0A 4L5YA 1JVNA 2Y2UA 3MPUA 3Q10A 3NAZA 2I4LA 1SUSA 2E4AA 2Q3EA 1D04A 4XSGA 5K6RA 5IVHA 5DRTA 2FDRA 4DHWA 1RYNA 4TTVA 4C20A 1SZJG 4OQEA 5CK5A 1MHPA 3NW9A 2CF5A 4X6YA 4TS4A 3VH1A 2RHOA 1AGXA 2NNWB 3NONA 3DZIA 3FDJA 5BWOA 3AM3A 5AVTA 1Y7IA 2BGTA 2AR7A 1JXOA 5DE3A 4LF8B 1H93A 3I4FA 4LC1A 1RZVA 3L41A 4BO2A 4DC9A 1K6XA 4IQ0A 4MQEA 1DUSA 4Y1RB 2G76A 4ER6A 4UCQA 2JPDA 4J3JA 1EI9A 4MZDA 5IZCA 4PLCA 3KSBC 2X2OA 4FMDB 2BC9A 3GK3A 2MYNA 1BE8A 1QP7A 1CZKA 1K9VF 1YL5A 4P7BA 4D9NA 3UANA 2BGNA 3FY4A 4S1VA 2ZYDA 4FYXA 2DETA 2I34A 3HNPA 3UGQA 2WMNB 1IHDA 2OEPA 1SVNA 1GA1A 2ZUBA 3WKEA 2HQSA 4DJEC 5KYXA 1Y5NA 2NXNA 4XW2A 1N33B 3MOSA 4V0MA 4HB4A 4XX0B 2J9ZB 3H99A 4Q4DA 3QX7A 2HCBA 2FFAA 1C4WA 4KQIA 3WO0A 3AZPA 4ME6A 4FMDF 1JKFA 1R7RA 4FW8A 1JDUA 1HTTA 5BV8A 2VRCD 1JAXA 3DUWA 3GDGA 4R69A 2ZJBA 1X14A 2O0HA 1X7DA 2Z2YA 3BK7A 5JC8A 2C3PA 1K5GA 1Z62A 2JHGA 2QP3A 2QXUA 3PUXA 4J1SA 4RS3A 5TPZA 3D7NA 4CLHA 2P9HA 4YMHA 2VHQA 5KWEA 1TT7A 2LD4A 1XEAA 3OEHD 3P2MA 2ZB7A 1JDVA 1RLUA 1XV5A 2XD9A 1Z73A 3H9BA 4FYYA 5CDUA 3KDSE 4D0NA 4MQFA 1C9DB 4PLYA 4QGSA 1TL7C 4DLYA 3E82A 3THWB 3OPMA 1KMQA 2JRCA 3DVSX 3VZSA 5KB3A 1I6KA 1UC4B 1PTJA 2QTMA 5EYPA 3TLGB 4U0KA 2YC2C 2WABA 4NBWA 2I3BA 4WOKA 5DHTA 1BRMA 1S2NA 4AP9A 4FLEA 1ZCAA 1T5OA 4JP5A 3UV7A 3CCFA 1TYCA 2OO5A 1NXWA 1ORDA 1Z6YA 3REQA 1F2DA 4WZZA 5BVGB 5CB0A 5DN6D 5ALNA 1TEZA 3JZFA 2CWDA 2BMEA 2IPNA 1KZYC 1Z0SA 1I2DA 3BEOA 1UPFA 4KTTE 1SBCA 2J0VA 4CLOA 5EI5A 2RJOA 2WUGA 4QVKA 2J9FB 3T5MA 1XYGA 3FLAA 4B4OA 1LA2A 5AVWA 3VVCA 5LU9A 3DMDA 1RWPA 3LLUA 5B4UA 4P33A 3TSYA 4EI7A 4MVJG 4LE1A 2W90A 2I8LA 3Q15C 4I50B 4KYIB 4KIGA 2W6IA 2GO7A 4HDQB 2IS1A 3LOQA 2FKNA 3OTHA 5ALYA 1NUUA 2V7EA 2IZ0A 1XSEA 1V7ZA 4PZAA 4FNAA 1E7RA 1JJ7A 2CLKB 3PA8A 3W8EA 4C7BA 1AX9A 5AVSA 5C31A 2DPLA 2H0AA 1DIRA 2ZREA 1QFXA 2NAFA 2PKWA 2Q3CA 2HDNB 2LRHA 2EV9A 2GZRA 2WHYA 3I45A 3IB6A 3O0TA 3SD7A 1TZBA 2N47A 2P2DA 4Z1MD 5ADWA 4FOPA 4I50F 3UAGA 1OI7A 2QW8A 3EGIA 5GVSA 1O6BA 4HY3A 3ENVA 2QYTA 1A8IA 3KLPX 1NG1A 4NE2A 5FOXA 5EZYB 4IX1A 3ZNPA 1YB4A 3KTAB 5A05A 1NP3A 2ZRLA 5B7GA 3M3HA 2B92A 4GR9A 3U7FB 1Z08A 3E4DA 1JSXA 3GO4A 3NRBA 3M4JA 2B2NA 4OFXA 1YJXA 4P4TA 5JFOA 1OAOC 2N46A 2JI7A 3KUDA 4LHZA 4PLZA 3EVTA 1NU6A 3BF8A 3D1LA 3EA0A 3MTIA 5TGTA