5B1EA

Crystal structure of proteinase k from engyodontium album
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
molecule tags Hydrolase
source organism Engyodontium album
publication title Crystal structure of proteinase K from Engyodontium album
rcsb
total genus 102
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5b1eA00
4CFYA 2WUVA 1Y9ZA 1SCAA 1GA4A 1TMGE 1IAVA 1MEEA 1AVTA 3SQOA 1WMEA 4CFZA 3A3OA 4DZTA 4JP8A 1BFKA 2PQ2A 1BH6A 1Y1KE 5ARBA 3GT4A 2X8JB 1ZVJA 1SIBE 1THMA 2ZRQA 3DE1X 4CG0A 2Z2ZA 3WHIA 2PWBA 1SPBS 1VSBA 1A2QA 1EA7A 4MZDA 3BPSA 2B6NA 3A3NA 4B5LA 3GCWA 3VYVA 3UNXA 4Z2AA 1GA1A 1WVMA 1SBIA 2SNIE 3DE0X 1C9NA 5AMXA 1BE6A 2W2NA 1Y34E 3BX1A 1SBHA 1Y48E 2IY9A 5JMOA 1MPTA 4M1ZA 1SUAA 1CNMA 1SCNE 4OMCA 4DWWA 5CW1A 3I30X 1C9MA 3I2YX 4LVOA 1P7WA 2WUWE 4LVNA 3VV3A 3DDZX 1SELA 2XTJA 1KDVA 4NE9A 4I0WB 1TM7E 2Z56A 1S02A 2W2MA 1AF4A 1V6CA 3DE7X 1GNVA 2SECE 4HX2A 5AQEA 1KE1A 1GTJ1 1R0RE 1SBCA 2PWAA 3DE6X 3DVQX 2X8JA 1CSEE 1GTL1 2ZWOA 1SIOA 5FFNA 2HPZA 3OSZA 1T1EA 1Y3BE 2W2QA 5JXIA 3SICE 2XRMA 1GTG1 1AK9A 1NDQA 1OT5A 3A3PA 1KDZA 3VV2A 4K8RB 3ZXXA 5JXGA 1AQNA 3LPDA 1ST2A 4KG7A 2ID4A 1UBNA 2P4EA 3DW3X 4C3UA 5B1EA 2W2OA 1TM4E 1Y3FE 2QTWB 1IC6A 4KPGA 4WOCA 3GCXA 3ZXYA 1T1IA 1SN7A 1TM3E 1NDUA 4J94A 4AKSA 1TECE 1JEAA 1TM1E 4ZOQI 1R6VA 2SBTA 1XF1A 1LW6E 1SUCA 2Z2YA 1PJ8A 3CNQS 1C3LA 1HT3A 2WV7A 3DE2X 3DVRX 1SCBA 3DYBA 3H42B 1AU9A 3LPCA 1C9JA 1R64A 3HJRA 4FONA 4YN3A 4BWGA 2Z2XA 3DWEX 2Z30A 3TECE 1PFGA 1SVNA 1T1GA 3EIFA 1GNSA 1SBTA 4GI3A 4H6VA 5ARDA 2PYZA 1S2NA 2SICE 3T41A 1SUDA 4ZARA 1EGQA 3F49S 5SICE 4C3VA 3AJ8A 1YU6A 2PKCA 3VHQA 1AV7A 2Z58A 3L1KA 1GCIA 1Y4AE 2G4VA 1P7VA 1SH7A 4OV6B 1GT91 1P8JA 1TO2E 3QFHA 1YJCA 2PMWB 4WOBA 2PRKA 4DJ5X 3VSBA 1SIUA 2W2PA 3DW1X 3DE4X 1OYOA 1NLUA 2IXTA 1SUBA 2Z57A 1TK2A 3DE5X 1AH2A 2ZWPA 3EE6A 2DUJA 2HD4A 1BFUA 3I37X 1YJAA 3I34X 3QMPA 4H6WA 3DE3X 1OYVA 4RYDA 4OMDA 5I9SA 3TI7A 4KB5A 2E1PA 1ZVKA 1SUPA 1TM5E 3PRKE 3BGOS 3QTLA 1WSDA 1KE2A 4HVLA 3WIUA 1BJRE 1GA6A 3Q40A 5JXJA 1BE8A 2GKOA 2TECE 3LPAA 3GT3A 2ID8A 4NMXB 1Y33E 1SCJA 1SUEA 3D9QX 5K7SA 1Y3DE 5FAXA 3WIVA 2ST1A 3AFGA 3D43A 2WWTA 3EDYA 1PEKE 3TI9A 4AKTA 1YJBA 2V8BA 3Q5GA 5AVKA 1Y4DE 3DVSX 3F7OA 3AJ9A 5B1DA 1DUIA 1Q5PA 4H6XA 5FBZA 3WQBA 1WMDA 5JXHA 1TO1E 3F7MA 1DBIA 1KDYA 4NE7A 2DQKA 3CO0S 5ARCA 5AVJA 1S01A 1V5IA 1ST3A 2DP4E 3PTLA 3VTAA 3P5BA 1WMFA 1PTKA 1SCDA 1SBNE 3LXUX 1Y3CE
chains in the Genus database with same CATH superfamily
2O2CA 4FW9A 2IQIA 1Z2DA 4MV8A 1C1YA 2VPYA 2G9VA 3PQ5A 2YUTA 4NENB 3BL8A 3S40A 1PSZA 3KAJA 1GSHA 4A6PA 3GN2A 2ZAIA 1J8DA 4D9KA 1H0HA 1Q0SA 4TTSA 4FKBA 3DR3A 5A0FA 3OOHA 3AFIA 3E18A 2TRSB 3Q5EA 3DTNA 3WDMA 3WYCA 5AM4A 5ABPA 2PV7A 2PAAA 4CL3A 3SM9A 3CR8A 5HF6A 5SY6A 1M1YB 1BFDA 1P3Y1 5AOAA 3NDRA 2R5WA 2I71A 4L8WB 2B1RA 1CF2O 4BNDB 1P18A 2QF7A 2YXLA 4YH1A 4YFYA 4HQOA 3RYFA 1QH1B 3RYCA 4GC9A 3RC2A 3GLIA 1PKEA 4L5BA 2QSYA 1E1RA 4Q24A 1R12A 2XXAA 2Z83A 2JNWA 5G3ZA 1PJSA 1U7WA 1W0JD 3OA2A 4HDKA 2H29A 3WKEA 5H1YA 2ID9A 2XAAA 4G1FA 1VHJA 4CCAA 3CKMA 2O2XA 3IVAA 5ALXA 2FMXA 1PZHA 1TK3A 2VYNA 4FUTA 5DM2A 2UXBB 5DF1A 2C5HA 2BFEB 2HDWA 4GEKA 2ZATA 1IL0A 1XTKA 4IJVA 3U49A 4BYMA 4BCDA 4CKBB 3DLCA 3JRWA 3OP4A 2H07A 2VDPB 3P52A 3QVWA 4GGPA 4TYYA 2HGSA 4L2IB 2FG6C 2EZTA 2VDMB 1XXHA 2ZAGA 4BNIA 1U4SA 2ZM5A 3P96A 1QDEA 3AP3A 4WZBB 3L84A 1SN7A 3KTAB 1AB6A 4WZBA 4JYPA 4AZVA 4XSGA 3V7NA 1Z39A 5EHXA 1VHDA 4PXYA 5C8XA 4HUTA 1YBVA 1Z9BA 4I66A 3EMVA 3GQBA 2XB8A 4MQ5A 3AI1A 3OJOA 5ISMA 3OQJA 1MC1A 1R0ZA 1UJBA 2H2FA 2ZROA 3HDVA 4L3VA 4R1PA 4YQYA 1FS6A 1NVTA 5DBFA 1FP1D 1FXUA 1XKLA 3L7IA 5K2MA 5B3LA 4ZO7A 3WL3A 2JLXA 3SS9X 1HSZA 1UADA 5LZ7A 1B8UA 4TL6A 3KHUA 5TJHA 2BIFA 4UVIA 2I54A 1Q0QA 1RIFA 4NQRA 5BV7A 1RFLA 1P81A 4BXOB 2Z5GA 1JX6A 1CULC 3TLXA 3C87A 1MFZA 1NAIA 3JQ7B 1A9YA 3EDRA 1C81A 4PPQA 5NULA 4KQWA 3ZYCA 3ZI0A 1WU8A 4OBWA 2D5LA 2I8AA 2AD1A 2GLUA 2I55A 1CQXA 4XTRA 3NFRA 3RYFB 3D3JA 1T6YA 2YL2A 1AO3A 3ND6A 4XI9A 1SZDA 2CDCA 2Q4TA 3GD7A 4F3YA 3SC3A 2DKFA 1PUJA 1ULUA 4R0NA 4ND8B 2OQVA 4ZGBA 4CDNA 1KU6A 1E6WA 1ADCA 4JA0A 3BMNB 3K9LA 3LNTA 2G63A 3ICPA 3NHYA 3O9VA 3P2KA 4GP6A 4C7OA 1QH8B 1QXSA 1W88B 2EERA 2M6SA 3F7OA 1YS6A 2H7VA 2P9JA 4BNXA 5LDDC 1R0LA 3ABZA 4XRGA 3DQPA 1JNXX 2HBRA 1TCCA 3BYZA 3KUKA 5F76A 4LY0A 3WL4A 3UH1A 4CWAA 1R00A 1XMQB 5ANRB 4ZZ3A 3QOFA 3DTVA 1BOOA 4DNQA 4DREA 4X62B 1L4YA 1UBEA 1T1JA 3R5XA 3GG9A 3E81A 4M0UA 4WN9A 4A6XA 1NF3A 4I4CA 3DMTA 1NVKA 2JGKA 4PPGA 1V4NA 4U6NA 5CFMA 5JECA 3LVBA 2IXEA 1R4MA 2HJSA 2WU4A 3P9QA 3G2HA 4LOJA 4CQNA 3A36A 4YY3B 2ORVA 3RARA 1GO2A 1RLUA 3R6DA 3ROQA 2XXJA 3MCZA 2OBYA 4RX1A 4W7HA 2VP4A 1VMAA 2YWCA 2AL7A 4XFDA 2C77A 1ZR4A 1OTXA 1Z2AA 1AZLA 1S96A 5JT1A 1E7SA 4PR3A 4R8SA 4H27A 2R68A 2PFSA 2E49A 1P9WA 3AI7A 4KQEA 1IZ9A 1JTVA 1S2MA 3DAHA 1PR2A 2B4KA 2IY9A 2UYQA 4QFBA 1ZD3A 1KQOA 2PUBA 3LCRA 5IFLA 2R6GA 5M29A 4ZTZB 5TT0A 1LB1B 1N2CE 1VHTA 1W1WA 1ZJ4A 2RH5A 4ARZB 3W5CA 1SVSA 3I5XA 1HMYA 3TNJA 1BSVA 5C32A 5IG2A 3SC2B 1PJRA 1J99A 1QYWA 2XW6A 5K6AA 1C4WA 1E9FA 3OZWA 1PEDA 5IJAA 4W9NA 2C9YA 1U0FA 3TZHA 3ZHOA 1XN1A 2YWJA 1OD6A 1IIBA 3MTDA 3OEWA 1AKUA 3R40A 2MTBA 2B4RO 3OZXA 2QRHA 1QP0A 3JQQA 4GI7A 1DIGA 3AVYA 1FMCA 2DFDA 1UPBA 3LE8A 5ICEA 3LOUA 4Y9TA 4CV3A 3FWHA 3UK2A 3QVXA 2GYUA 1FFWA 2DT5A 2JAPA 1EEXB 2ID4A 2JLQA 2BKLA 3BMOB 3ITKA 2QTVB 3NIFB 5J5CA 1Z2PX 4ZA2A 1FRNA 2O4UX 3CNBA 2TS1A 1ITZA 3JWEA 2YH2A 1U1EA 4NYJR 5DN6A 4ER5A 5GVSA 2H1CA 4L02A 3PJDA 3OZBA 3G9TA 4Q9IA 2QZ4A 1WF6A 1WXGA 4B6OA 5BV1A 4URYR 4IYJA 2Z2XA 2DX7A 2HJVA 2BEUA 1E4OA 1MVOA 3RUDA 3LQKA 1HDIA 3JQRA 2OCKA 3AV3A 3BB3A 1XL1A 3NH6A 2VHWA 4HLCA 4WKPA 5DBHX 3BB4A 5E7QA 1EFDN 2EWMA 3SNKA 3VHQA 5KVCA 4KSYA 1SOUA 2IXAA 5EJIA 3R7DA 1WF3A 2AXPA 4BFSA 2FA9A 4P7GA 3UCXA 1XWWA 1ONBA 2FUCA 1A0OA 1E2EA 3T4EA 1H1TA 4UPDA 1NTRA 1QGZA 2YV1A 3MJDA 3WDKA 5KJFA 4B32A 1DG3A 4REOA 2FEOA 5D2CA 1NMQA 1SHJA 4I5GA 2VA8A 1EWTA 2X3UA 3LF1A 5I9SA 2IITA 3C7DB 3L7OA 3PFWO 4J0DA 3G3EA 3HSYA 3TZ6A 4F72A 1ESZA 3E8XA 1L5WA 1PVOA 1TMOA 1T0HB 3A14A 3DBLB 4U8HA 3CSDA 1GA6A 3BFPA 2X9GA 3HYRA 2OAGA 2ZRNA 3CCCA 3A37A 3C3WA 2BL4A 4FMBB 4BB6A 1WDWB 1RI3A 3D64A 4O8ZA 3T99A 1KI4A 3EZ7A 3ZHVA 1N6PA 1QU3A 1KO1A 3DMHA 4KGDA 5FTMA 2PUDA 4P3KA 3LXMA 4FOTA 3TTTA 2JAWA 2QAGC 1UZNA 1U3TA 5GWXA 1LS1A 4WBNA 2W00A 5TGTA 5C81A 1U6KA 4JBLA 4H18A 4PYLA 4RANA 1J42A 1LSJA 4PHHA 2QZJA 5U1PA 5C46F 5EIEA 4W5RA 1ODJA 4I4TA 3U56A 1CETA 4RPGA 4D25A 4AZ0A 2AUMA 3BWBA 4UNQA 4LJKA 2YXEA 3EXHC 2DRIA 3CZMA 2HTEA 3D8BA 2WI8A 3W2EA 4LDRA 2PRIA 1CNFA 1G20A 3TEFA 1TYBE 4Y6RA 1FY2A 2QLBA 4XDYA 2WHPB 2Y05A 3W04A 4NWIA 4UOEA 2VEOA 4LQ4A 1SXIA 4KLCA 3VH1A 3HABA 4CMEA 1MIOA 3UT6A 4RPCA 2VTBA 4QXAA 4JYAB 2BGNA 3ICWA 4OAPA 4QG3A 4E13A 1CNMA 1UKEA 4BMCA 3MPUA 2I4IA 1BC5A 1DAOA 1Z0UA 1V1MA 2ZB4A 1LWNA 4LVOA 4HQ0A 4QGBA 4DAOA 2XVMA 2C7VA 4MVJD 2WYOA 2QJTA 3KQVA 2G1AA 1HG0A 5C3MA 2GN4A 3RRXA 1XF9A 2IV3A 1M73E 3CLHA 4D79A 5A6VA 5DNDA 1CSEE 5BMOA 3CC8A 4FFLA 4BAZA 1JHYA 3RS4A 3WKAA 5JXIA 5C7LO 2PBLA 4RQTA 4PGFA 2FWBA 5FIUA 4LV8B 5ICMA 1XEFA 1ISIA 1CZRA 1M2EA 2Z5LA 3D0QA 3IUSA 3OJCA 4H16A 4CQMB 1MJNA 2FUG6 3IVGA 2R66A 4BRSA 1Y8QB 1NPDA 2FZEA 4CM7A 3HPQA 4Q7EA 2V5AA 3Q9UA 4Q5IA 3BA6A 3ETCA 4KPGA 4WOCA 3OQ6A 2D2XA 1ZK0A 1WW8A 4TTVA 3OCJA 3X0DA 1XB2A 4EX7A 1AG9A 4TV8B 5DYTA 1ZCJA 3HS3A 1NVUQ 1MZPA 4RSHA 2Q3JA 3ZR4B 2FK8A 4IGIA 1E4EB 3BMNA 1PSDA 1UZAA 2EFCB 1JDBC 3GA0A 5GJVC 1R9NA 4L76A 1PWXA 2C1ZA 4KOEC 4D0GA 5UKDA 1DU4A 4QFDA 1K92A 5JPCA 2QVXX 4JV5B 2WG1A 2BZSA 4DV0B 4EQZA 4MULA 3NBMA 4DANA 1E1LA 2IZ0A 2JRLA 2P6NA 4DCOA 3V8RA 5BN3A 3URMA 3UMYA 3TQFA 2Y2VA 4D4HA 4G36A 3ZWVA 4TLEA 3ZVRA 5IXJA 2YWEA 1W36D 3MTEA 4B8ZA 2J41A 2YW9A 4XLLA 4X65B 3DAOA 3B3JA 4G0OA 3BCUA 1AGNA 1J33A 4O08A 2V0GA 2W70A 2WMYA 4KMMA 5FNVA 3LZCA 4NABA 1AQIA 4ZXFA 2HLHA 4JAVC 3ZI4A 4D41A 1X87A 1N2HA 5A7GA 4HVLA 2C7QA 2MT9A 2FEPA 2PVSA 3CZRA 2XB6A 3DR5A 3NHJA 5E6UA 4EJ6A 2J6IA 1AURA 4L4UA 1PNOA 1VXOA 3L6RA 3QVJA 3E9MA 2NQ8A 2VJMB 3F47A 4R9RA 1BEZA 1X7YA 1QGOA 1CUJA 1HE3A 3GQBB 1ETHA 1JHQA 5IW8A 3TNFA 4P0TA 3NGMA 2GJKA 1F4PA 5T7BA 4FN4A 1OWNA 1ISRA 1Y8CA 3C74A 3O1JC 3QX9A 5AJXA 1O9GA 1T2EA 4GHWA 3HV2A 3VX3A 5CFLA 1CUGA 2F9FA 2C4MA 2XHEA 4WX2B 1IBLB 4YTEA 1L5GB 4OA8A 1PQPA 2K5UA 2K2WA 3BIFA 3W5SA 3OQNA 5HKKA 3PC8A 3S0JA 1Y8ZA 1YRAA 2ZR9A 4JI5B 5G0TA 4PXAA 1TMGE 4Q3NA 3OKFA 1TEHA 2CFRA 4C29A 1XUOA 4AJ1A 2WYWA 1XQXA 5E9QA 1ZNXA 3JQBA 3QV2A 5JBQA 2M1ZA 1UC9A 1AA9A 4LCEA 4WLOA 1JXMA 1A04A 1USGA 3PL5A 3PU6A 4CM8A 2I2XB 4ND8A 1OLXA 4PX3A 3QBDA 4ZANA 4ZAVA 4YAIA 4HB4A 2QLFA 2GH1A 4MUYA 1E6MA 1T4DA 1JIKA 1B2RA 2OY0A 1ZZGA 3PWSA 1OE0A 3O92A 2Q6LA 2Q6OA 5BQOA 1LDGA 1OJLA 4J16A 4XGQA 4LMBA 5EEHA 3F5MA 1R7RA 1WUJS 1TVCA 1VG0B 1MAHA 4YBZA 2GTPA 1JDSA 5AK0A 2SKEA 3S2IA 1SXJD 4TWZA 1TI7A 2AVNA 3V2UA 1CJUC 1RBMA 3V8MA 4PRZA 3WP0A 1JEOA 1XU4A 3A1EA 5T4EA 1VYHA 5K0SA 2DYKA 4PEVA 4OQEA 3CRRA 2FPGA 1FXWF 4W99A 4K26A 4RHEA 4DXAA 3FOEC 4G0WA 3WBFA 3W5HA 3PQ6A 4B17A 2QU8A 3JXEA 3NV7A 2CVZA 1P3JA 2G4CA 4D96A 2W43A 3ND8A 2YIMA 2F1RA 5EJMA 3TJMA 4A8JC 4Q66C 4OXRA 2VBCA 2WTBA 4P3XA 5GIPE 4AKIA 1RI1A 3LVQE 4M1OA 2QBYA 3ZTTA 1GPWB 2VT7A 2CXHA 3O4VA 1CEEA 1V47A 4TV9A 3AXSA 2FDXA 1GGNA 2NP7A 2UXCB 3LYLA 1T2FA 1XALA 3FLAA 1U2PA 2BONA 3G02A 1V39A 4B3XA 1I4OA 1NVWQ 4LDZA 4QPDA 2A35A 1C7EA 4FHCA 4BFCA 2R7KA 2VHCA 2NU6B 4WSOA 5T67A 1UBCA 3NASA 1C2YA 5FBRB 2AE2A 1E6KA 3U7JA 1J9ZA 2IXDA 1YR6A 2GCIA 1JG6A 4JR0A 4BJ5A 5CYOA 2W0MA 3GC6A 1DV2A 2W98A 5LKRA 3KQHA 3A7DA 1N6HA 4NLLA 2XUQA 1JG7A 3C7KA 3X1YA 4LY6A 4PG7A 1TCAA 4EH1A 3C6QA 4JA2A 4B40A 3IESA 4GP9A 4Y6SA 3DLBA 3TW8B 1MGOA 1Q12A 3G2LA 4DBZA 3VVMA 5EEGA 1ZJJA 2GT1A 1MA3A 3X44A 1PK7A 2C5EA 4GUAA 3HGTA 3OI7A 4MCHA 2IDKA 5LP6B 2VDWB 2WG0A 3BICA 3BWXA 4NNJA 5HIMA 3U4MA 2XEDA 1PV2A 3EDMA 2BVNA 1QORA 3EDCA 2JF0A 3K92A 4V0KA 2AG1A 3QH4A 4DSAA 4JQZA 5CB4F 4LTMA 5C52B 4U2FA 4NAHA 1M34B 2WMNB 6YASA 4PGGA 1TK9A 1P33A 4UFPA 2ATXA 1OZHA 2VP9A 3KAQA 3KHTA 3CT4A 4FFVA 4NDAA 2CXPA 5ER9A 4QECA 3WGNA 4ZEMA 1NDHA 3OURA 3WYAA 4N48A 2B69A 2QY6A 4DZTA 3SY8A 2ZQ5A 3MBKA 4E5MA 3BIOA 1PL7A 4HH4A 4IIJA 3ILXA 4XLZA 1N5KA 2PX8A 3KWMA 1N6OA 1XZHA 4R68A 2FMKA 3UZUA 5FOSA 3ORRA 1BH6A 4L27A 4TTIA 4ALLA 2DG2A 4GKJB 1E2GA 4KNYA 1U5BA 2DFPA 1C9YA 4I5FA 2WUEA 3FR8A 1P1CA 3DT8A 3BFJA 4X7RA 3OWHA 1IZ0A 2I6GA 4Y6GB 1W34A 4IY1A 3ZGVA 2R48A 2JIBA 3AFMA 4B3SB 1XOIA 3RRJA 2W93A 1CUHA 1IB6A 1CYDA 2J6HA 4BTLA 2VQ6A 5K6TA 4OCZA 4URUR 4G81A 3VV3A 4O4IA 4M88A 1MVNA 4NE9A 3PNVA 4BV3A 4HYQA 1OHHD 5GIOE 3KKQA 2YXPX 1K66A 1XU9A 4NCAA 1XROA 3UM9A 4PC2A 3P9PA 2WJPA 1G20B 5FWAA 3B9QA 1KZ4A 4ZYXA 2G1PA 4BNJA 5IYZA 2R7NA 1J2TA 3LU1A 3GUZA 4GMFA 4YRDA 1THZA 1X8JA 3QVMA 5JH7F 2BF7A 3IMCA 4M6WA 3WWOA 5I9IA 1F4LA 1DPFA 4IIXA 1O9HA 2DR3A 4J3FA 2CD9A 5IJ0A 5C51B 4NAVA 4P1ZA 4BQPA 3TGWA 1SXGA 3P94A 3PVSA 4LXUA 2HR1A 3L6EA 2F67A 2BFNA 2Q5OA 4H35A 5BSKA 3R24A 1I3MA 1YVDA 2CJXA 3R5SA 4V03A 5DP1A 4F3CA 5BUSA 5K20A 1I2AA 3FOAA 4A27A 3OE7D 3NTRA 3MUFA 5A5VA 4Y1RA 2HB6A 4UVHA 3RRYA 4J1SA 3IPCA 5GOTA 2B98A 1IWOA 3K96A 1WUTA 4RTQA 1EFPB 4LC9A 3Q7IA 4IVRA 5E4FA 1ZXXA 1C0PA 3G8AA 2NPIA 3QM1A 5KYUA 2NV2B 5KDOA 3HBJA 2EV9A 2W58A 3GRVA 2LCFA 3Q0EA 2Q2OA 1E4YA 4NH4A 2I4LA 3M3HA 2GDJA 1TK2A 4JXJA 4Y9SA 1T26A 3E9NA 3DMDA 1IN7A 4FC7A 4HAXA 4BKMA 2EIXA 5JAZA 1QX4A 4IIEA 4NBVA 5TF4A 3AX6A 2XUDA 2DOKA 2AF4C 3IDFA 2I1WA 5DX0A 4BO3A 2JD0A 2LE0A 4X1OA 4X66B 3KLMX 2UUOA 4JC8A 4MEJA 4PF1A 1IJFA 1M2GA 3TAHA 3PEFA 1WULS 2YN2A 1K9SA 3GLVA 2QYSA 3C5WP 2EEZA 5DBGA 4D9NA 7REQB 3AI2A 1N77A 1N32B 1G16A 2KBEA 5TNXA 1DX9A 3AEKA 3FVQA 1XVUA 3E2IA 2PL5A 4IWYA 1AKWA 2IEAA 5EWMA 3MUOA 2XCOA 5E1MA 1RP1A 3Q6MA 1YR1A 3D5QA 2PPVA 5INTA 2X3FA 3IX7A 2IBMA 2X77A 5JCJA 5JSQA 3VC1A 1NBIA 3L3BA 4JL8A 4GBGA 3PJRA 3BA1A 2X15A 2C2YA 3PL1A 4HLUA 4F2DA 5FXMA 3GRFA 5P8WA 1FQOA 5KVSA 4PO3X 4PG6A 3N2ZB 2RAFA 2XCQA 3BJMA 4IOJA 3SKXA 4PHTA 5A5GA 3H2GA 2G9QA 3A2LA 3Q7PA 4KHZA 3PNYA 1WXHA 2Z4RA 4OJKA 4OYHA 2XKBA 2Q4DA 2ZM6B 1UAAA 3ZE7A 1QV9A 1KDTA 3FNGA 2GJAA 1EK5A 4DLSA 2FWNA 1LF5A 1B6TA 2Q1SA 3OFSA 1U6IA 3PI7A 3MN1A 5TEWA 5AJYA 3EZGA 5D51S 3SSMA 3VR5D 1JE0A 4DJJA 1LQ2A 3PR1A 4Q4LA 3UJDA 2J3HA 4XYMA 4A10A 4ZAXA 2RH9B 1GCGA 3FCYA 5FLXA 1OH6A 4Q7LA 2R7MA 2VXCA 3HN2A 1DEXA 5IZ4A 1H1LB 3HU2A 1VYUA 2OYCA 3WYEA 3PRHA 4ACBA 1RAAA 2AV6A 5KTTA 3GDOA 3L06A 4QA9A 3ZIAD 1R8SA 1RC1A 1XTQA 4UUBA 4LVNA 3IS3A 2J6CA 4LX8A 1MRSA 1BG6A 1UXGA 3I39X 3M9WA 4LQLA 3MD9A 4LXQA 4DRYA 4EJSC 2WE7A 1IEQA 3A8TA 1HRKA 2NZJA 1U1DA 5DM1A 1S7GA 2ZGVA 3HO8A 4BC1A 3PGKA 2R9VA 3SWWA 4AN1A 1H93A 5I3CA 5DWDA 3PDIA 4DSZA 3QLTA 3GJSA 1FQJA 1KJJA 4MQMA 2R60A 2XZOA 1KERA 2V9CA 2JFFA 1GN9A 4JC0A 2N3ZA 4RFSB 3I2GA 3NG1A 3TVTA 4YDQA 1EP3B 1QHIA 1U99A 2FV8A 1ZVQA 3QJGA 1U0LA 3KXPA 3MJEA 1JEDA 4WZAA 1SXHA 2HV9A 2FRVA 4OATA 3LSYA 4OA5A 3VR4A 2ONZA 5JRDS 1KJ8A 4DFDA 1X15A 4DB4A 5AI4A 3JASA 3A1TA 3LUGA 3W2GA 3PD1A 4BJ1A 4KQ6A 3OM9A 4JNCA 2ZSKA 3F9IA 2BCEA 1W19A 3JAWB 3CSUA 4LHYA 3W1VA 1K3UB 4NTZA 1JH8A 3EVBA 4F12A 4JX9A 1SBTA 4PC6A 1XDBA 1FP4A 1AKRA 1RCUA 3BHMA 2FPGB 1R37A 2RGAA 3DMRA 1B8OA 2G9ZA 3H2IA 2HV8A 4Q4JA 1CX9B 5AXDA 2EIHA 4KXFB 1VG1A 1Z6TA 4UE2A 1LK0A 4X44A 3AOGA 2BTOA 2JIRA 1PFVA 1OF1A 2W2PA 3U4CA 1RAFA 1ZXBA 4Z99A 5TT1A 4E3WA 1ZBQA 2XUHA 1YASA 3A7EA 2ZWPA 1BIFA 5AW5A 3ZLTA 3E22A 4O5AA 4EOGA 3AF4A 4MQLA 4LXYA 3E70C 3WMEA 3KXDA 1LUAA 3G0OA 2AZ4A 4Y0NA 3U16A 1LA2A 2ZCVA 1NFRA 2GDZA 1SD2A 3HLYA 3ULKA 2NYUA 2QZZA 4UQOA 5HRUA 1XRJA 4S12A 3TOXA 4URVR 2AX3A 4MRSA 1RJ9B 4WLUA 1MOZA 2AN3A 2W2XA 5B37A 4C03A 2P67A 1RLJA 4TT8A 2FJ0A 2FR8C 1L6IA 4MR8A 1ELOA 5DIZA 1QPGA 1DT5A 3BERA 3DT6A 3THWB 3QLVC 4BZQA 3U44A 3JQAB 4ZEWA 2O05A 5CIQA 2VXOA 1H8ED 3I5UA 3IQHX 1UDXA 4OB7A 3T1VA 2OBNA 3O7WA 1HKUA 2H1RA 5AM0A 3GIWA 3TB4A 1JHXA 3JTEA 2VJDA 4L5JA 1Q22A 2ODBA 4D8WA 2WSMA 4LXGA 2F8SA 3VDXA 4HZGA 4PSKA 2DQKA 4MDYA 4MVJF 4YB8A 2Y2UA 1WUHS 3AFNA 1RACA 1XYYA 1E7YA 1QS0B 3VTAA 1PW5A 2PWYA 1T6ZA 2XB2A 2CK3A 1YVUA 2VOJA 1TX4B 1GCAA 3MVEA 4G0QA 4M89A 4MQEB 4CZ2A 1HNXB 1SJ9A 3NQ41 4NZ9A 1T4BA 4GRIA 1KPGA 4BGUA 3GP8A 3ZJUA 2JHGA 4G5RA 5EI5A 4DMUB 5BR7A 5J2TB 1PZMA 3ADCA 4R5MA 2V0CA 2AFIB 1QRAA 2FF7A 4LJ7A 2I6TA 4TT3D 3QKSB 5JDCC 4UDXX 4JP3A 2OPHA 2VP2A 5B6IA 1UDBA 2QMYA 3OIFA 3N2EA 3OICA 4JD5A 1RHKA 2OZEA 4G84A 4TKUB 4UDNA 4X3CA 1OZAA 2LCIA 3CHYA 3W4KA 4YAUA 3OCXA 3WMFA 3PIRA 1M0TA 5HQ3A 1F7UA 3I1FA 4K0KB 2QU7A 4AP9A 2G08A 1EGHA 3ILVA 1BHSA 2LPMA 3K9CA 4RXUA 2I3AA 4DMKA 1KTIA 2GJ8A 1LJ8A 1JXOA 2WM8A 4IIBA 2OXFA 3GF4A 5ECYA 3PEUA 1G2QA 4O2BA 1X77A 3SZGA 2W2MA 1WQ4A 3EUAA 3TD9A 5G1PA 3BCSA 3DE6X 2OL4A 4CGYA 1UMCB 4MR7B 2HPAA 4XARA 4Q1CA 4GZ5A 5AOCA 1T8TA 4A8JA 2WVJA 3C97A 4QJIA 2PU7A 3PUIA 3OIUA 1BWQA 3IUJA 5JQGF 3V00A 3MNFA 4OH7A 5MFPA 3EGCA 5IAEA 4FS3A 4WK4B 4AF8A 2ADFA 1WAMA 4AY5A 3P71T 3UT5A 3L77A 1Z5UA 2ZJYA 3NEYA 2MYTA 4LRTB 2P40A 5EJ6A 2JAQA 2QBYB 1SFRA 4Z49A 1G6Q1 3B51X 1K5GA 1E0SA 5ITWA 1DNPA 2IF2A 3RDPA 3W4JA 1XCMA 1XXLA 2H3HA 3ZE2B 4YJHA 4DXDA 1WUIS 1I7DA 3QXXA 5LLDA 4EBBA 1GPBA 4B2PA 4EHNA 3V4FA 2FSPA 4DCSA 1NVAA 1E3WA 1KJZA 4H1WA 1DJOA 1RXIA 2J3JA 2QRGA 5F7ZA 2CUNA 2Y0EA 3EF3A 5LQMA 3KFXA 4EA6A 1G8SA 3JYQA 4HWRA 3OCZA 1D2CA 3MWGA 3IERA 4C0AC 4LZWA 5CU7A 2OFOA 4NYIQ 2P2GA 4Q16A 5CCDA 5ALSA 1UOPA 1XPJA 3NHSA 3U1TA 2PKRA 1QHFA 4OEHA 2PGIA 4NPHA 1E2LA 1ECLA 5CPBA 1N3LA 4EG3A 1W1IA 3AJRA 1G66A 4LVCA 2H1FA 3O8LA 4G0PA 1M10A 1ZONA 1IRIA 3I37X 3R0QA 1LNSA 4RKRA 5AJZA 3SMVA 2PLAA 2BDTA 4BVLA 1JT9A 3CLTC 1U2DC 4MVWA 3RU3A 5EPOA 3D5EA 5MN4A 4C6HA 4EUHA 2ZIVB 4MO9A 2C42A 4W5TA 3KO8A 3QNMA 4BO8A 1O6ZA 2AOTA 4P3OA 3THXB 5FAXA 3TG8A 1FSZA 1KK0A 2C88A 3NWPA 4HAZA 3W1WA 5KYTA 3C8ZA 2PO7A 4Y1RB 3FPAA 1GZ6A 1SU6A 2YYSA 1DV1A 1N1GA 3K73O 1V2GA 2Q3EA 3DOEA 3JYOA 3V1TC 5IKXA 1MT0A 1UZMA 4MS4B 1S4QA 5JXHA 1PHPA 1BCSB 4K05A 2G6BA 3ONDA 3PQ8A 3GJ0A 3ZU6A 2NGRA 3ONEA 3MWJA 2ZI4A 5HNKA 4IM7A 4Q7MB 3BGIA 1SUFA 2XNKA 4YDSA 1BE0A 2PNFA 1D2RA 4PG8A 1IFXA 2R6JA 1GFZA 3WWPA 2NXWA 4JYCA 4DR1B 4X45A 5K0TA 3U19A 3QHAA 1GKUB 3EYAA 3RVNA 3HTXA 1WB5A 3QXSA 1T9GS 3PC2A 5IABA 1GOTA 3P9KA 2F64A 1DO2A 1SXPA 1KF0A 4ZQIA 1F06A 4ZCTA 1SIBE 4Q48A 2R8RA 4OH1A 4UNRA 5I7EA 4HXGA 1G5QA 1W4RA 4C08A 4RMHA 5CITA 2YDXA 3AZPA 1UPTA 3DKVA 3FYUB 4MGYR 3S7TA 2B25A 4XIGS 2IFTA 3B8EA 4EQ6A 4AJPA 3FH0A 1C0KA 3GFSA 3UQZA 1UBRS 1W2GA 3A4VA 4D98A 1FNMA 2YN4A 4JI1B 2VNSA 4DG5A 3DM9B 1QANA 1Z6YA 3KQMA 1NPYA 3G7UA 1KEVA 3Q15C 1LLFA 4JNKA 4OF4A 1ZD4A 2RHMA 1I36A 421PA 2DGDA 4L57A 2IHNA 2AQ8A 4KR9A 2V7XA 2HMUA 3H9JA 4UM8B 2GBPA 4XYGA 2GPYA 3RROA 5BN3B 5TPZA 3ODGA 4DT1A 3GJZA 2NUTB 3HUDA 1KSJA 5EYPB 3FROA 3OC6A 3ITEA 4G5FA 4UKDA 2DWUA 4HEA6 4TGLA 1T13A 1ACLA 5FFNA 3BH6A 5HRCA 3IR7A 4KR2A 1X74A 3W7AA 3EJWA 2FRDC 1AK9A 5K9ZA 3A3PA 5DRTA 5JXGA 5HMLA 2ZVJA 5DTRA 5IDYA 2Y93A 4LIPD 3SAJA 1R6AA 4HRXA 4KAFA 1PJZA 3GLUA 4AU1A 1UWVA 1ZAKA 4BEVA 1YBMA 3HJCA 2NO0A 5T4HA 1QVWA 4PG4A 4I14A 2GCPA 4BP9A 1Z25A 4QEDA 4P7JA 5H3LA 1J2RA 4MRMB 4LE1A 1GL3A 4LQCA 1ZAYA 4H6PA 4YV2A 4OX9B 4M46A 4HH0A 2XZLA 2VSXA 4RU1A 2OCAA 1FU7A 1W5AA 1IXRC 3BXZA 3Q10A 5EXSA 3BVPA 4D92A 1I1OA 1M1YE 2OUKA 5EE9A 4E5PA 2PXAA 3KHSA 4TVBA 2IGBA 2AW5A 5D8DA 2DFKB 1G38A 4OQQA 1ARZA 3IE1A 1R74A 2NO4A 3CWQA 1E2QA 5DCYA 3I6BA 4MWZA 2HZ7A 1W48A 1T5OA 2QAGA 3BK2A 3KEQA 5C4IA 1D5WA 5LLTA 5DV9A 2D06A 4DSUA 1ZOPA 1SVIA 1DEAA 4EHLA 2EKPA 3HCWA 5KOIA 5BQ5A 3V4OA 1MO5A 1EX9A 1RCTE 2H5LA 5LU8A 2QTFA 2B8NA 2E4XA 3GFBA 1DZIA 1TFUA 4NV1A 5IDQA 3OZFA 3TW4A 1PS8A 3AY6A 1BJRE 1CUCA 3IQGX 3RT1A 5I4KA 4EFKA 2IXBA 1C0IA 1L2TA 2IIPA 1Y5MA 2VP6A 4A73A 5BQFA 1VM6A 1JRLA 3B6ZA 3JQ8A 3FIUA 4EUNA 1G8KA 1GR1A 3UB2A 1J90A 2G8NA 2QD5A 3FDZB 3DLIA 1E69A 5EMJA 3TTYA 3GLTA 1M74A 2J0UB 4LC1A 1E18A 1EZ1A 3WFIA 3FOFC 1E79D 2CJYA 3S99A 4BLSA 2IUEA 2JGLA 1RYYA 2PL1A 3FJYA 3B52X 3KKMA 3HXOA 5B1IA 3HJFA 1NW9B 3W34A 2ZYHA 3S1LA 4YO8A 3TBHA 3WGQA 1JXQA 2FZGA 3FI9A 4JJKA 2IYPA 1JEQA 1EFVB 1ZKDA 2BJWA 1HBJA 1OXSC 4N7BA 3OE5A 1BNCA 5FNVF 5E8RA 4Q39A 6AT1A 5FUQA 3EFBA 5JTUA 1H23A 3LUJA 2WJZB 3KOMA 4Y2RA 3C45A 3LBHA 4JP8A 2GILA 3EPLA 3IJ5A 1UJ4A 3SJZA 4HQ6A 3NEJA 3K1AB 1AJEA 1YRYE 1THMA 2IUUA 1ZD2P 4M2LA 3SVTA 5C1PA 4ER6A 3LAWA 5NLLA 2WAAA 4KAXA 4DA6A 1M7GA 1ZMBA 2ZJ3A 5EG5A 1KY3A 4JBXA 4YMLA 2DJIA 1M2HA 2XMRA 1F3LA 1GPAA 1MPXA 5EAIA 2R0QC 5KTNA 1GZ5A 1P4AA 2WE8A 3F90A 4NBTA 3WAJA 2VT6A 3CWZA 3E9RA 8MHTA 1PJQA 2PX0A 2O8VA 3FLEA 1ZM4A 5FBVB 3LQ1A 1GNTA 4B3GA 4ZKEA 1BDHA 2ZRDA 3HZHA 4JZKA 3FVVA 3Q7TA 3KKKA 3U7EB 5JDCA 4P58A 4LSZA 4X1YA 3WLQA 5E7JA 5KNBA 3D2CA 3DT9A 4IBOA 1U94A 1K98A 1Y3BE 5EKUA 4H1UA 4DCUA 4HN4B 3EGEA 4PNEA 3PD0A 5K8LA 4RS4A 4ZALA 4R98A 2FW6A 3OBBA 4HZUB 4YCNA 4RLHA 1PKXA 4YCMA 1B76A 1W4AA 3RF7A 3IALA 6ADHA 4IKEA 3TKLA 1XRNA 2VYVD 3JZAA 4RVSA 3WQQA 5ALTA 1U0JA 2DR2A 2QT1A 1OTYA 3AUTA 3EOBI 5E4TA 1UFVA 3H3XA 2I1VB 3UA3A 2AR0A 1BE1A 4WLFA 1SCBA 4YP0A 5A7HA 3SDZA 1TW3A 3NHWA 5I7UA 1FDOA 1KEEA 2O4CA 3RADC 5JAUA 4IIUA 2UVDA 4R2MA 4BZWA 3QMVA 1G8JA 4A8JB 1U04A 3BCRA 3U3MA 3SGLA 4LYYA 2OORA 1QUEA 3SX4A 5C18A 1I0IA 2NAPA 3QFHA 2WTAA 1L4KA 1XJWA 4CR8A 3VSBA 1KK2A 2DQSA 3O9ZA 2QR2A 1H2HA 4FE4A 4BVAA 2NO7A 2YIDA 3CVJA 1FUIA 2EKZA 2C3UA 2Z2KA 3CQ9A 1GPH1 3L7DA 1PX0A 1UOEA 2DUJA 2JJ8A 3AUKA 3IA2A 3ITNA 4FZ5A 5F3DA 1T8PA 1YIAA 1ZH2A 4OU5A 2CXNA 3TE6A 4AZ3B 3OH8A 3UXMA 4NPCA 2CLFB 5JC1A 4QQ8A 5DM4A 5BYAA 2NU6A 5L7WA 3VNUA 5JG7A 4M1MA 3D6NB 4RVCA 4DIDA 4QHYA 5JY6A 2BD0A 1MJFA 1KQNA 3MOIA 3SYTA 2O1SA 1EFRA 2ZJAA 4OXKA 5E9AA 1U0OC 2OXEA 1NE7A 4J3JA 1MO3A 1ULTA 4PZCA 4V3BA 4B31A 2F8MA 3UMVA 2DUWA 2X22A 4FYIA 3FPFA 1JEEA 1ZXLA 1C7QA 4MPPA 4UTVA 1E2FA 1E2NA 4JP5A 1COWA 1NVGA 3B3FA 3QXHA 2V7PA 3QWBA 3OQ1A 4IDEA 3EW9A 1FYEA 3W3AD 4A2WA 3PNQA 4MQEA 1QRUA 4NFSA 1V2HE 2D1QA 3DNMA 2VZ8A 2RGWA 3PJGA 3PC6A 2HQSA 4W82A 4D80A 4FGWA 4XQCA 1Q11A 2AOVA 2BFAA 3R1IA 4EHKA 1NATA 3JYHA 4DCPA 4CF6A 3B5EA 4EO4A 4QM7A 4DZRA 4ZICA 3WKCA 3FF4A 2A4MA 1WOYA 2AEMA 3KXKA 1GFIA 1NBHA 3OLCX 1NMEA 2CJFA 3T7RA 3VISA 3WOVA 2I76A 2C8LA 3CLRD 3D3WB 2FN9A 5IARA 4BLTA 1DC4A 4LZJA 2GARA 2VHQA 2VAVA 5E3JA 2VNAA 3QVUA 4OHMA 4KVFA 5EQFA 5EXPA 5F3WB 2VT2A 2WF8A 3T5DA 1SULA 3G88A 4FGSA 4E51A 1VBNA 3EODA 1X13A 4EUSA 3IBCA 2CE2X 1MP0A 1M6WA 3DD5A 1CZKA 5ES3A 1P7PA 3L0SA 1ZO8A 4Y2GA 1MAUA 3RHZA 4E4YA 4ZI3A 4J3NA 4J03A 1V6CA 2P2SA 4CYMA 1JIXA 1FFDA 3IAM1 4NJOA 3HCPA 4ETWA 2I6UA 3IT3A 2AK2A 1OFTA 4W5NA 4Y7CA 2H2HA 3SBEA 4GRDA 2IY7A 3A32A 4ZQCB 2DJ5A 3FTEA 2KWIA 3WTBA 4MDHA 3CE9A 1RZRD 1E4EA 3IE2A 1ZNYA 1OLSB 3L82B 1A8UA 3GLIE 3ET4A 2X1HA 3RODA 1WB9A 3F6PA 3I9OA 4BWFB 1J09A 4CETA 2C82A 1HTBA 1GG8A 3IMFA 3KE9A 1BHQ1 1XF1A 4GYWA 3REQA 1CVIA 1VA5A 2VWQA 1N7GA 1VZ2A 3IDQA 3OHMA 5ELLA 4CE6A 1HY3A 3M4XA 4QUHA 1OX4B 2QNBA 1Q2XA 3LYAA 4J7UA 2QTCA 4PGAA 4WEQA 3U0BA 4DPMA 4KCGA 5L3VA 1SVOA 2IUFA 1ABFA 2VNKA 1A96A 2CMHA 1RWMA 3EXEB 4KGVA 3IIMA 3FDXA 2ECOA 4IOKA 1QZZA 2EJWA 3FXAA 1RAGA 4RHXA 4CIAA 1QVZA 2O7QA 3QU2A 2QG4A 1XXHE 2Y4NA 3LLVA 1YNSA 3BD9A 1KVRA 4GX5A 5HQTA 1F1JA 3ROFA 2IYVA 3V1LA 2HSJA 3G1UA 4HGNA 4ZT6A 1I4LD 5KSWB 2WG2A 3G9ZA 2GZ3A 5DEIA 4NH0A 1QIMA 4HDSB 1YC2A 1RZVA 2DSTA 2W11A 3QRWA 4R2XA 1LCIA 1H1LA 3D6UA 4RVUA 5GZ6A 3U60B 2XLBA 1FQKA 1FCJA 2HA5A 1G18A 1NU6A 5FBLB 3VYTB 5KYUB 1XTTA 1LV7A 2L69A 4YRCA 5EUQB 3EZXA 4UAJA 1BRMA 4NHEA 5IAOA 3VKHA 4EFDA 3TAXA 5KC9A 1X19A 4J1TC 1Z29A 4KXNA 1XL0A 3TZKA 4HAOA 1QIKA 4NJMA 4YCBA 2R4UA 4JN6B 3V97A 3EVFA 2RHCA 1RLTA 2HF7A 3AC0A 3T15A 1ANKA 4CKEA 4AROA 4B8YA 4KFSA 1YZGA 4TXMA 2ASVA 3EVNA 1EB8A 4KN9S 4NOMA 2OESA 5HPYB 1X70A 3E8MA 3PTLA 4TTAA 3D6TB 3PGJA 4BGEA 4X95A 3ENQA 4FBMA 3I2HA 1HEUA 4WBNB 3ITDA 4CKEB 5K4AA 2QAIA 1YE3A 2R8OA 5KX5F 1JT2A 1XRSB 5EJFA 4JITA 1W0KD 3KUXA 1A2OA 2P4HX 3FGPA 1EFKA 3GLKA 1G5HA 3SLGA 5FD8A 3V80A 2MINA 3LFHA 1PS0A 3VZQA 3WHIA 1KNQA 2OT3B 3ZZ1A 2OEPA 1ZA1A 1JQKA 2GXSA 5CH8A 1B0AA 4NYJQ 4YNBA 4KN5A 5JAPA 4F06A 2EFYA 4UBKA 2I4RA 3NYRA 4OPMA 2HOQA 3EPKA 1CUWA 2C58A 4Q7QA 2OR3A 1JMVA 5WRFA 1A97A 4O59O 4DTIA 4Q3OA 5T8KA 3VDMA 5ESWA 5FUVA 5DHTA 3L8MA 4PYMA 1JSCA 1HEYA 4PZPA 4QPZA 3ICQB 4XUGB 2VP3A 1P7WA 2Y1GA 4B7UA 3EMDA 1MIOB 1UQRA 1J49A 3GDGA 1TDJA 2WVGA 1LX6A 4FW8A 5DSTA 3EVDA 1Z8HA 1AF4A 2FEXA 2QT0A 5IN4A 4CDRA 4A15A 3GVCA 4U7WA 4JCCA 2XUJA 3VA7A 2CGEA 2YVQA 1L7MA 4WJZA 1P4SA 2C9OA 1TTHA 3PYMA 2FX5A 4X6LA 3TOSA 3WLAA 1U63A 1LVUA 3N2YA 4PYIA 4G37A 4JFAA 3WICA 2NLOA 1E0JA 5DTJA 4E5KA 1B74A 4B2IA 2QN7A 5LPNA 1RM5A 1UXKA 5B58T 1OYYA 2BGKA 3THRA 2GSDA 3SF0A 2IVFA 5DN9A 4WMLA 2ZQYA 3PV0A 5AKGA 5F23A 5KQSA 1MB0A 3L8GA 5H4GA 1QHGA 2GPJA 3NVDA 5EIBD 4PRYA 5FFMA 3SC4A 5HUQA 4PHGA 4UU0A 2OFWA 3QIVA 3GPBA 2W4MA 3HYLA 3T5BA 1ZH4A 1M76A 3FZYA 2R6CA 4U0JA 3UWPA 4TWRA 5AFSA 2WUFA 3FCCA 3C8DA 5TS2A 1M1NB 3PB3A 5B58C 2CLKB 2DMRA 3ZDCA 1AKQA 1C4KA 1MOPA 3OHSX 1G60A 1A8HA 3ZUPA 3OJFA 5T3YA 3ROTA 3T3GA 4IXTA 3Q12A 8AT1A 1QG4A 3J7TA 2J9FA 4K9LA 3RUHA 4CODB 1FDUA 1IIRA 1AQYA 2O8NA 1Z7WA 2LVBA 5KDDA 1E6CA 5KO2A 1CS0A 3IKMB 4UTZA 3I01M 3HNOA 5HSGA 1Y5NA 3U0VA 1EU1A 1KGSA 1DE0A 1JAXA 4YAJA 3ZGOA 3EGOA 4RIGA 4RELA 1DBSA 2HC9A 3CM0A 5CNKA 4ENRA 3WL6A 1ZGJA 3UFXB 3OZIA 3N8KA 4KFCA 1Z83A 2F4VB 3QKSA 2PX2A 4II3A 5BWBA 2AI3A 1E9CA 2VQEB 3TEJA 1FDTA 1RAEA 4HMOA 1IM5A 2OCGA 4IF4A 1O54A 5B1DA 1H4TA 4GPAA 4PRLA 3IOMA 4UEJA 3WQBA 3G2IA 1VIDA 4GKBA 1G3UA 1FZTA 2Z5FA 2OV4A 2QW0X 3R3XA 1TFRA 1DXHA 1COZA 1P7YA 3JY6A 2UUBB 5EKTA 2Y9MB 3PWTA 4WDRA 2A14A 2WKRA 3M5PA 1M5UA 2YV2A 4XB1A 4EEXA 2IUYA 1VPWA 5AKEA 3RC9A 1YCGA 1ZEJA 3AUJB 1T0JB 2VTKA 2W8BB 3NTVA 2BJHA 4H7EA 2JG3A 2G28A 4JLWA 1DJLA 4MR7A 4R1MA 5FQNA 4DM3A 3ST7A 4RKQA 1XD9A 1NBEA 1P74A 3T4PA 1D04A 3S8EA 2YICA 4GE3A 1A4XA 4O63O 3RVOA 5CVCA 2C4UA 2IHTA 2JIZA 4O2AB 5J9FA 4C4SA 1WTCA 3R74A 1YZHA 4XDGA 3R7AA 3A4YA 5KWEA 3TDNA 4FN5A 2X0EA 3SNHA 5B2EA 2NXEA 1T6XA 1NI4A 1NJGA 1WPQA 1U7DA 2OLKA 1KAMA 1V9LA 3LUHA 3NS7A 3DBHB 4GPBA 1DIHA 2XKAA 4EW2A 1OA1A 1UWCA 2Z9DA 1I2DA 1G7RA 2C96A 1V7CA 3GU3A 1I3LA 4OLJA 2OGWA 3ZW9A 3MZ0A 1G20E 3MRXA 3FUXA 2ZE6A 3LT0A 1P2TA 3ONVA 3TTWA 1IOVA 1QYRA 4UMFA 4KVZA 1ZN2A 4Y2QA 3AHGA 5H02A 1ZITA 5E1DA 2OBFA 2LD4A 1PWYE 2BISA 3CNHA 3KLNA 1C8VB 4G0NA 4B74A 4GOKA 2B3TA 3SJCA 2ATIA 4I6EA 1BCRA 4REQB 2BUAA 3EA0A 1YB6A 1B43A 1L4FA 2Y71A 4WN9B 4KPFC 2WPNA 4EM6A 3K4PA 1Z4QA 2Y0CA 4M0PA 3PQEA 5ECGC 1XAIA 4HWKA 3USCS 5BT8A 2Z98A 5EIAA 1KI6A 1T1IA 1C14A 1TYCA 3MD0A 4I3GA 4N40A 4RIFA 4JR2A 4WUTA 1XPOA 2ICAA 3MK31 3TRDA 1B73A 1LW6E 2V6MA 2Z2YA 4RSMA 3K09C 1NN0A 2D3WA 2R47A 3F0TA 3HY6A 1A95A 3NEPX 1DT3A 3ZCVA 1R0XA 3HE3A 3T4UA 5AVRA 1N5MA 4AMGA 1T1GA 3PUZA 4RK0A 2P0EA 1RVV1 1OFUX 2ZPUA 3EEIA 1EGQA 3ESDA 3PC4A 3RG8A 4MV5A 3DOUA 2XUPA 2GXAA 3FYDA 3G8BA 3CONA 2QUAA 2G5TA 1DKPA 4KRXA 3ANSA 1SA0A 4G09A 5FTNA 3ADOA 3FB4A 1H6BA 3E5HA 2FRDA 2Y3IA 4HDMA 4KQ2A 4OXNA 3DW1X 4L5YA 4WUVA 3T12A 4BMPB 4JQSA 4Z54A 5ICSA 4HS9A 2DWQA 3HA5A 1XTZA 4PYKA 1XC7A 2RJOA 2V7VA 5H3CA 4EECA 3KQPA 3SCZA 5CBKA 3PXAA 3KVRA 1CJSA 1RXCA 1BS9A 3SFZA 3T7SA 1HRDA 3ZIDA 3R2JA 4A8PA 2MR6A 2PLWA 2VZ0A 3AKDA 3I05A 2I3ZA 2ISCA 2HF8A 1LFDB 1UF9A 2UYCA 2WR8A 4IDOA 4G0UA 1L3IA 1ENYA 2F3TA 3QNWA 1ZCZA 3AFGA 1ZLYA 5DXJA 1ZGZA 4G1EB 4TRNA 4BNMA 3WRWA 2RGUA 5BNTA 3IP1A 4XWOA 5K45A 4XR4A 1KAEA 2BHRA 2XA1A 4GKAA 1BOFA 3M6LA 2H1LA 3LGXA 2A78A 3FSRA 1NXQA 4M8IA 1Y4UA 3PVZA 5H68A 5HKOA 2UZ4A 2OD7A 4HKTA 3OLQA 1UBFA 4LRQA 1G7SA 2O2JA 3OJWA 1XZKA 4HB2A 4WA7A 4MUHA 3QHQA 1T8WA 4L5CA 4CFYA 1T4CB 5JY1A 1HNNA 3JZMA 4XIYA 2VUIB 5EESA 2V74B 4PLYA 4CPDA 1U2GC 1Q50A 2PGXA 1U7UA 1QHYA 3PPWA 2Y1CA 5DBIA 4C4TA 4XYLA 3ZDBA 5C8YB 5JSHA 4EY3A 1XDDA 2BFFA 1QAMA 1CCWA 1Y9JA 3E9QA 4ENUA 2O8CA 5CURA 2I3DA 4LOLA 3U3OA 3D6AA 4XGKA 1LBEA 4ZI7A 4CKWA 4E88A 3IIEA 1QR6A 1GQRA 3TMKA 2JIQA 2Q4RA 4A92A 1CQJA 1YKGA 3F4BA 3FYTA 3MGGA 5A9SB 4CIBA 3FCUB 4PC1A 2IU0A 4D7AA 4FGJA 2ECKA 4D8XA 2B1JA 1NPTO 4PWYA 4YCJA 5I01A 1WBJB 4H4EA 4PTZA 3F8SA 1S6YA 4UQPA 1GG9A 1WCIB 4B3TB 3O82A 1V11A 2NNWB 3L9XA 5HCNA 3MAAC 1ZK2A 2GMWA 3GELA 5FB3A 3AVPA 2A58A 4L3OA 4O2RA 4EO7A 1QVAA 5AQEA 1KE1A 1E92A 2QAGB 4O2AF 2G0AA 4JS0A 3K0EA 4NXMB 2W22A 4LJLA 4HRYA 4DA9A 3DXZA 2I99A 3K9GA 4IS3A 1ULBA 1SXJC 4XPIA 3OMXA 3H6GA 1KZHA 1NLYA 4KG7A 4X1KB 1RPNA 4QUBA 1JHMA 5BO5A 3SIPA 3ILHA 4FMDB 3U9SA 4OQLA 5SY4A 1DKRA 1MKYA 1NJFA 2R6AA 4M76B 4MS3B 4MOWA 3ECSA 3FZGA 4G9GA 2GD1O 4PTYA 1O95D 5F2EA 1NT4A 2H63A 4XIIA 1YRWA 5FUYA 4EHFA 3LO5A 4W9MC 4O4IF 3WZLA 4CCWA 3T5PA 5IJ0B 1YI0A 3K72B 4O4LB 5A4DA 4PYJA 4HWTA 2JGFA 3HHPA 4K9RA 2H08A 3SKVA 3N6VA 2W6JA 3BE6A 2TYSB 3KELA 2BI8A 4HTFA 2EX0A 2JD2A 1AV7A 2VJLA 1USUA 2Y1EA 3GRUA 1X86B 1SH7A 3N8HA 3OX3A 4BIIA 4DT1B 4EITA 5AM2A 1WSBA 3NRBA 4EGAA 1I7LA 4WFIA 4B4WA 5HW0A 1JUDA 3P0HA 2HTFA 5JSKA 2IP1A 5I8WA 4H7JA 3A0UA 1U8AA 4D3DA 2HCFA 4RTRA 4DCTA 4WACA 2HBQA 2ZSEA 1WCIA 2AMVA 2IYWA 4JKIA 2FF5A 1UQUA 3N9IA 1A9TA 4WKBA 4OYRA 1YT5A 1GGEA 3IVRA 3JQAD 4ZAZA 3LXRA 1V5GA 5HKAA 2W6OA 5GZ1A 1FJGB 1XNJA 3ZU4A 2CHVA 2J46A 4N3GA 4D0SA 5B4UA 4IH1A 5F73A 1QOQB 1GITA 5KKAA 3KTFA 4ARSA 1VL5A 2QX7A 2C4TA 3CZCA 4P4UA 1G64A 3HCFA 4LY3A 1E3TA 2C78A 4HQNA 2ZVQX 3QPCA 4G56A 5JYEA 4IMRA 3DBVO 2XA2A 3VPAA 2ZBVA 3FPCA 4YRGA 3ACBA 3HZRA 3WQHA 2PKWA 3RLIA 3SHTA 3BMXA 1YV9A 4B6JA 1H4SA 2Q6TA 2NVOA 1E77A 3CF4A 3T5CA 3ME5A 4CEJB 3HFJA 2X2FA 2C0PA 2YHAA 4B3CA 1Q1NA 3D7SA 3KYCB 1M0EA 2B36A 1RKVA 4Y2YA 4DLWA 4W63A 3AR9A 4QATA 4YALA 4P3PA 4M21A 1JYFA 3NIGB 5EYPA 2NUTA 3S29A 1PFKA 2P6UA 3L93A 3I8SA 1WY7A 1FUEA 4NCIA 3RTGA 1KMHA 1YQTA 4P86A 4B5LA 4BNUA 4QBHA 1ZSVA 4MA4A 5E6SA 5K3BA 1VTKA 4KXQA 1JLMA 2IOQA 4LNAA 4TMWA 3HG7A 1RHQA 4WGGA 3FDJA 5CXUA 3U7FB 3R9WA 1FX0B 1US8A 2OGUA 1Y0BA 3R3HA 4GOMD 3SXUA 4C2AA 4E1AA 4QYWA 5A5FA 4W5JA 1CJTC 2Q2NA 1ZHOA 2V4UA 2WUWE 1L5QA 4R9UC 4ZV9A 2D1SA 4BE7B 5KVAA 3MJ4A 2NWQA 5HEKA 5FPQA 1QFXA 5AHXA 3UJ7A 4B73A 1RP7A 1PJTA 4ND6A 1SZCA 2Y0PA 1P5ZB 3DHNA 4QTZA 3K8OE 1EFUA 3QF4A 1F6BA 2QL9A 1Y1SA 4M7WA 5D5HA 1Z0DA 2H0QA 3C8UA 2HUNA 3KOOA 4W9RA 1OT5A 1D0VA 3CE6A 3F3SA 4MPJA 4YC7A 1E3WB 2ANCA 4LBZA 3R7SA 2AJTA 1YQQA 3QMWA 5AESA 1ZCAA 2I6SA 5DTMA 2WF6A 3DW3X 2RGNC 3BWYA 5CYPA 2Z8ZA 4PQEA 5A4IS 1QK5A 2H4WA 1E98A 3ER6A 1VI6A 4BYGA 3IP3A 3AR5A 2JD1A 1L5RA 2D2IA 2I2DA 4IO0A 4YK7A 2R8BA 3TX2A 4C1BA 2HPVA 5AVUA 4EO9A 2CZQA 4DMHA 4GMKA 3R8XA 3DE2X 3DYBA 5EY5B 2FWIA 2C3YA 2I1QA 2H9YA 2EZUA 2X0NA 3BMOA 5AP9A 3M49A 2QYHA 1QG6A 1Z6ZA 2MU1A 3UTCA 4D1YA 4DVGA 2FP4B 2QTNA 4Z4EA 4TX1A 2DLCX 3FNHA 1CDEA 1DCKA 3W9BA 5FJJA 4N0MA 2RGDA 3R3YA 2RDMA 1YXMA 3S5JA 4IDPA 4TTTS 2OYSA 3EDOA 4RMGA 2IWRA 3RVSA 4LDNA 1HDYA 5J23A 1TYAE 3AVOA 2BE7A 2IPNA 1VBMA 3PQDA 4QD3A 1VJ0A 4QWWA 5EJ4A 2YX1A 4QDXA 5T6BA 1QYVA 2GZRA 2P75A 3VSEA 3C4QA 2QUKA 4BHTA 3NFYA 3FUWA 3H86A 3QV1A 3MJVA 4DOMA 4Z3OA 3SU8A 1E3SA 4IIGA 4EELA 4UE3S 5G1OA 4JYZA 5BOSB 4A1FA 3P0EA 4YA6A 2DEUA 3PHJA 1CQZA 4EHHA 4NF2A 3UUFA 3EIXA 2EZ9A 2P68A 2JFPA 4NZNA 2IPXA 2SHKA 1M9NA 2VF2A 3DDCA 3S8MA 3EVCA 4FZ3A 4W6QA 5BWNA 2O8CB 5FTKA 3ECAA 2QP9X 4BC0A 1U6JA 3JQ9A 3LHDA 4IAOA 4WY2A 1Y6JA 5EZYF 2XNCA 4H6XA 4L9WA 1WMDA 2WWIA 4RW0A 1CE8B 4NL4H 4DMRA 2BZ0A 4D99A 4JXZA 2XMPA 2OBXA 1TTQB 1EB9A 1D2GA 4K0RA 3W9UA 3TLGB 5CFOA 3PEEA 2JZOA 1CBUA 2FUKA 2OM6A 1JDTA 3IKJA 1F8FA 4X8MA 4ZC8A 4MW2A 3HPRA 4GF5A 4BX9A 1JKMA 3FR7A 3G8DA 4HX5A 2VVTA 3UICA 3L43A 2YIVX 3ZZMA 5FORA 2GEDA 2JEYA 4F8EA 3L7JA 1UPCA 3A2NA 3RTEA 1KPHA 2VP5A 2QTGA 3GRZA 2MYUA 2W4IA 2O7VA 1QQBA 2LIVA 4IFEA 1PF7E 3IUQA 3A9CA 3GAZA 1U11A 4QTUB 2OV1A 3OEEA 4BKQA 4TQUS 4WNAA 5K4HA 4FX2A 1EMDA 1VL2A 3IYLW 3ZKAA 1QBKC 3G6WA 1S2LA 2ACVA 1NZDA 2P6MA 5H8WA 2MJLA 1WJGA 4AQDA 1USKA 2VJBA 2BRUA 3ZI7A 3H2KA 3AWDA 1DMRA 4XWYA 2PUJA 3I0ZA 4R7GA 2H31A 4H59A 1LPNA 4NONA 2OGZA 2DECA 2PH7A 5EIHA 4HX9A 5ITZA 1GNVA 2YY5A 3WZMA 1K27A 3GW8A 4ZQBA 1Y9DA 2P3QA 3W8NA 4JK3A 1XSEA 4OHZA 2XF2A 4JBHA 3RSQA 4IJ6A 3AEUB 3WP1B 2VJYA 3TQCA 4DADA 1B15A 4DXHA 4F9GA 3SQNA 4P92A 1LI7A 5LCXA 1KDZA 1Q3KA 1GZSA 3M3DA 3USES 121PA 3ZNNA 1A9ZA 1VKHA 2GBLC 2G9UA 4UXJA 1WU7A 4LFCB 5BVHB 2L17A 4UVGA 4ZI7F 3MBIA 4A9AA 5KDLA 1ZQ1A 4Z0NA 1QZ3A 3DGEC 3GCXA 5ERYA 3CBQA 3ZPXA 2JFUA 3W06A 2C57A 1TECE 3H2HA 1T0PA 4RD0A 3H6KA 3H9EO 3BTSA 4BNFA 3L5OA 2ZKLA 2XOXA 4KXMA 4TMKA 4WT7A 3I92A 1QRTA 1ZM3A 4BUCA 2HA6A 2HJ9A 1H2EA 3COWA 1IK4A 1WCWA 2X7XA 4DIFA 2JCYA 1I51A 1U28A 5L9AA 4ID3A 2H5IA 4XCXA 1EVIA 4IDAA 1GCIA 3FPGA 3KBBA 1QRDA 3O0TA 4ECEA 4TWJA 2F9MA 3EJ6A 1QSGA 4BZXA 4WZAE 3TF5A 2VSNA 4G2NA 5DLDA 1KGDA 4KV7A 2YZKA 4LWPA 1EUCA 3HCBA 5F5NA 4AFNA 1Z0AA 3LPNA 1FE8A 3HB4X 3LY8A 3ZY3A 2O8DA 3VPHA 2X0IA 5E95A 3TXXA 1VPTA 1NMXA 1QTIA 4JJAA 2P2YA 1SCQA 3G0GA 2VYVA 1DUSA 1ZVKA 3Q9SA 1IN4A 3DKKA 4N0EA 4B79A 3LTNC 5F7OA 3QX3A 4C0SA 3AMVA 4K9PA 1SCUB 2GPSA 4YJGA 2Q62A 1GP2A 5KNLA 3GY0A 4NRDA 5K8VA 2JFHA 1MDFA 1Y81A 2KW5A 2VKTA 4FX5A 1WZ2A 2LRHA 4RM2A 3HB9A 3Q88A 4F6LA 4R0VA 5T6MA 5EGSA 2GRJA 4DHEA 3JAWA 5J63A 1Z8DA 4NHOA 5J40A 3F3YA 4EWLA 4ID9A 4QRHA 5ICGA 4DIKA 2PMEA 1J56A 2XOEA 5JBNA 1I32A 3K15A 3KVNA 1T0BA 2ACKA 5THXA 4F84A 2AQIA 1G4AE 4RF3A 2R1UA 5F9FA 3HHEA 1C3JA 3WFZA 4QKQA 5AQ1A 4O4HF 5I7WA 2I8LA 1HYHA 5H9VA 3QEAZ 2PRYA 3DCYA 1PGQA 1MOQA 4ND1A 3Q72A 1EDEA 1Y7PA 2B0JA 3F46A 1YHNA 2IU3A 5KHAA 3BWEA 4C7XA 1Z13A 4F45A 2IXGA 1ZL2A 1J9GA 1ZZEA 3A1SA 4UUOA 3VDNB 3LY5A 2QIOA 2J1LA 1SKMA 2FWMX 4W5WA 4Z51A 1JLLA 1ZVMA 2YOGA 5LNK1 1ZIXA 4MAFA 2FZ4A 4WKNA 2CUTA 3OTGA 1K7XB 4EB3A 1KJIA 4RHFA 3V6MA 2JLCA 1XEXA 1X1RA 4KQHA 4PW0A 3BH0A 4B75A 1M2WA 3JARA 2D7JA 1N9KA 3VRHA 4W5QA 2O8FA 4K1LA 1Q14A 2X7JA 1IHOA 3UJ6A 2WABA 4RESA 3WMXA 1GDTA 4DBVO 4WK2B 1M2JA 3VZDA 2XWJI 4S2EA 3GV0A 1E79A 3QA9A 5IJXA 2C9MA 4RNDB 4F11A 4TN5A 4CEIA 1ZI8A 2RHHA 4GOLD 3ZWDA 2BM1A 5LZ8A 4RGQA 1KH1A 5FLKA 1ESCA 3AEQA 3BHJA 3JAKA 3G9XA 3LYUA 2I6XA 5JROA 5IT9A 1KA9H 4JU8A 3WNDA 2C3OA 2V54A 3GJ7A 5HKLA 2XITA 5JSZB 2I65A 2EG5A 3GH1A 3TGPA 1PE0A 2BGIA 2HSGA 3IDZA 3KM0A 4IDDA 4EKIA 1Q0PA 1J5PA 1E0AA 2GOYA 2O2SA 1XZQA 4L1KA 3EIHA 1QP7A 1XU7A 1W4CA 5B3JC 5L3SB 2P41A 2XIJA 5JS2A 2VTDA 1CJMA 2HQBA 2IY8A 1D1PA 3J7AC 3CLTD 1NW6A 3HJTA 4ILKA 1KAQA 1K8QA 5CP8A 4ZQEA 1XELA 5JAIA 1JHDA 2Y9PB 5ALRA 5KCZA 1E2BA 3FUCA 4F1WA 1UKCA 3R20A 4ZCQA 1I3CA 4LF7B 1T2CA 1YZLA 3QY9A 3UANA 4CLDA 3V7YA 5LVAA 1PL8A 1T3SA 1YZQA 4AUEA 3ZG6A 4BX3A 5LL6P 2Q1XA 4DR7B 1NL3A 5B4TA 2XNDD 3T7JA 4LMRA 2SCUB 4IDCA 1QKJA 2YFYA 1RU3A 2PQ0A 1JEYA 1J97A 1ZRHA 3HUEA 3CSSA 3K2QA 4Y1FA 5BUCA 1OYVA 2CUZA 4HDNA 3OUUA 1JH9A 4LHSA 2J3EA 3KPUA 4ZEVA 2JFVA 4NK4A 3OT4A 3ZDXB 4NCKA 2B5VA 2RARA 1GPLA 4HGQA 1X7WA 4LQDA 4TRJA 4BGIA 4F91B 1ZGGA 3IKLA 1JG1A 4D3ZA 4KITB 5KWJA 3I83A 4CF7A 1GV1A 3CISA 4TMYA 2DHEA 3SZUA 1BWPA 1YJBA 4OLAA 2WWRA 4UBOA 4JI4B 3CX4A 3QU9A 4JUAA 1FFSA 3KQNA 5K0BA 4XUCA 1HI9A 2WEKA 2P9FA 2P9HA 1OH5A 1E7MA 2YVLA 2NU7A 3CCBA 1YZNA 1OCEA 5EGNA 1AA6A 4E30A 3F71A 3NKVA 1RNLA 4J75A 4WPGA 3GJXC 3ZZNA 1ORIA 3PLNA 1DFHA 1SWVA 1VPDA 1NUUA 2WINI 1PQWA 3P5BA 5JS7A 1N5LA 4GPTA 4TZ0A 1XTUA 1P7ZA 3LH5A 4JLJA 3SJBA 2ISSD 1R5NA 3PG5A 3S8YA 3E0QA 4CIDA 1SHTX 2ENWA 2ZB8A 5EL0A 4AF6A 8ABPA 1II9A 3P0FA 3GK3A 5C31A 1JAHA 1LPPA 2BFWA 2VK8A 1AMNA 1Q7CA 3FCXA 4CI9A 1G291 2DPXA 5HE9A 2X4IA 1YL7A 3TZCA 1NR5A 3ABRB 4KNVA 2O2IA 1RTKA 2AOTB 4LTDA 3DE0X 1C7FA 1JDJA 3DZBA 4Z9AA 1FP6A 2EDAA 4MV4A 1ESMA 5ALEA 4QJ3A 4WXEA 2ODAA 4D3SA 5KNDH 4DCGA 3DBOB 4MA0A 1QOPB 4OHFA 1TAUA 2QLNA 1P1JA 3UK7A 1E59A 4ND3A 3MWDB 2FR1A 3EPRA 4YUXA 2Z6AA 2XOKA 3I9V1 2AKYA 4D9BA 4GOXA 3G1WA 1DXYA 2IHJA 3EXIB 4ZT5A 1HT1E 4FYVA 5IEBA 3O2JA 4A4DA 5JFTA 5JAOA 4ZAGA 4KSCA 1OU0A 4HUQA 1QPZA 3O8NA 1Z68A 1NOIA 1M2KA 3TIVA 3WGJA 1ATIA 2HPZA 1DX6A 2H0AA 3WVNA 4CLRB 1CEYA 4N4AA 3IB6A 1Y3HA 4RIEA 1TB4A 1Y7IA 3HWX1 4XUDA 4H7IA 5HFAA 5ICFA 3DV0B 3EC7A 4I6JA 3ZC3A 1XMXA 3HN6A 4KKVA 1NXWA 2G8LA 2P4EA 3HCDA 4RF4A 3VNBA 4BLVA 4YJHB 3T7EA 3WL5A 1Z3CA 3TLZA 4A5SA 1HEIA 4ZDKA 5C7OO 5DCLA 3PGVA 5HBGA 4AG5A 2FPRA 2EYQA 3E2MA 1JA0A 3QWHA 2IH5A 1VDZA 1GZHB 2GYYA 3D0OA 4EY4A 3CNQS 5CLQA 1LZLA 1TC2A 2VWHA 3RWBA 4LOKA 3MELA 4BWGA 2NQTA 1GSAA 5AICA 5I47A 3W5DA 2IS2A 3Q8MA 1NW5A 1U3DA 4ZTUB 5BQ3A 1DRJA 1U3VA 3UFXA 3RYIB 3RNOA 3B7GA 1Z4LA 2BMFA 2B4TO 1COWD 3WGTA 1SC9A 1UMCA 4TWAA 5B1SA 1BX1A 3K6RA 3VHRA 3ZK8A 2UYGA 1FBTA 1RHMA 4EVSA 5CA1F 1DQRA 2PGDA 3A1CA 1NTOA 3H99A 3PP8A 4G41A 4V0RA 1ZUD1 2NSLA 4L0CA 1ZD9A 2IXTA 3B9BA 2JATA 3QIAA 3SSNA 4BB9A 1Q7EA 2P5YA 4YIHA 4HFNA 3OUZA 5E7MA 4EYEA 2KI5A 2DH6A 1L4UA 2JBWA 3EXFA 3L7CA 1LI4A 2IRWA 1AZWA 4HP8A 1V71A 5CX1A 4ZKDA 1MVLA 2G67A 4CBVA 2HA7A 3BB1A 2F17A 1F17A 3ZCXA 5L4SA 1M1YA 2ZSDA 5CCBA 3IPXA 4EGJA 2JAHA 1AT1A 3BM5A 1NZJA 1WLSA 3QG5A 4P98A 1WV1A 4I5EA 3DHYA 5DSZA 2WAXA 4RTMA 1GM5A 1JV2B 2RI1A 1XTRA 3OOSA 4LVUA 1VMEA 1OREA 3KT8A 4F9FA 2WJJA 4F96A 1ZUWA 3N7AA 4MSUA 4B2LA 2FG5A 3AHIA 3FPEA 2WA2A 4FE3A 3RS9A 3E7XA 1CY2A 3CRQA 3V8EA 2FP3A 3ICCA 3DB1A 3I9MA 1QK3A 4S1NA 2Q9AA 1X7DA 3HUUA 2IYZA 1PR1A 1SXJB 3R3SA 3OFJA 2ZBRA 2A0WA 1HURA 3GOHA 1FMLA 4WZAB 1DQPA 2NYRA 3QLJA 1AM4D 2GNOA 1SQFA 4ZCSA 5HILA 2XMDA 3EWAA 3T5MA 3TO5A 3MCAA 3WXBA 4CV0A 1BD4A 5LQUA 2ESRA 1AX9A 3D7MA 3LI2A 2J3LA 3TPCA 1SY7A 2G0NA 2BFEA 2J0UA 2ZYWX 3HXKA 2IVZA 5KNDD 2Y66A 1T25A 4IEEA 1IHPA 1VLVA 2E4UA 3D3EA 3QE3A 4WLNA 4IPTA 4XD2A 2XDWA 1PR9A 3PKJA 3RPEA 4UAUA 4J0HA 2CHGA 1E2DA 4E15A 2AXQA 3IPAA 5FH9A 1O8CA 3SJUA 2H4YA 3GH3A 4DQ0A 1NUPA 2PLNA 4RABA 3UEOA 1Z5WA 5TGDA 4WNAB 3UWDA 4COKA 3ZE1B 1I1HA 4Z0HO 3WJ2A 5CVVA 1O97D 3VI3B 1KWGA 4MP6A 4DYHA 1HQYE 3PDUA 4PNHA 2ZTSA 4J0JA 4MQ4A 4Q0MA 5HZGA 3QTTA 2NN3C 1PR0A 1E1QA 1JNYA 1WZEA 2HCBA 4J29A 2NZUG 2DSNA 1FYWA 3KZCA 3O3CA 4RPHA 2PYIA 4N3NA 4K8OA 4MKFA 3LQYA 3ZHUA 3D8RA 1T1EA 4ILEA 1EDDA 2AUNA 4LF9B 1SQGA 3F6YA 3IBTA 4YYZA 2JGEA 1FEZA 5TV2A 3HVIA 4BQFA 4MO2A 4G4SP 3UMGA 3FWPA 1OBCA 2OCXA 3WBJA 4N6NA 3O2QB 2BKUA 4CUZA 1PDWA 1YDMA 3LRTA 3ZKWA 2C9CA 4ZRNA 1DHRA 2OZLB 1CFZA 1LC0A 1IC6A 2I7DA 4N8DA 4V1CA 3UA4A 3GN1A 5CYFA 2HBYA 2KM1A 3K05A 3O3MB 5GOZA 5HK8A 3VOBA 3DQQA 1GG2A 1FYXA 5IXSA 1EZZA 1P1KA 2A1TR 1V5WA 5CM2Z 1SC3A 1S1MA 4ZCRA 221PA 1JBQA 3WNVA 3UK6A 2QQ0A 3B38A 3ELUA 2C8JA 1Q1AA 3DQZA 3MTBA 1XCOA 2FWRA 5DYNA 3NJRA 1WHSA 2YMMA 2A5YB 2ZYDA 1EUDA 1KMIY 3BJIC 3EC1A 3I42A 3KFLA 3QWAA 4CEIB 3UJ8A 2HSZA 4BN4A 5CXQA 5FLYA 2CJPA 4IUBS 3P1JA 3W77A 3N28A 4CV2A 3PLRA 5J43A 3U9LA 4WXPA 2QS9A 3X3HA 3SSOA 2CNOA 2ZB7A 1W0KA 3I4FA 3O5AA 3TSAA 5CTAA 1U81A 3LUPA 4UPEA 1ZHFA 1JDNA 1KYZA 3DO8A 4C4AA 1L7NA 2R751 5K8IA 4P35A 1MJ5A 5ED4A 1LLQA 4TLBA 4C76A 2YKGA 3DKPA 1LSSA 1NP3A 1H3NA 1RYEA 1V5FA 3K71B 1J8VA 3H7AA 3U4QB 1QV6A 1DUIA 1UZLA 2BFMA 1YVEI 2XMBA 1GAWA 2RHBA 3OTIA 1Z7BA 4XTCS 5F5XA 1K6IA 1HT2E 1RFGE 5F4BA 3H6HA 3F73A 2RJNA 4L5IA 3M9LA 3DOIA 5DX8A 3GLHA 5JHHB 1ZU5A 2PH3A 3U9TA 4B7ZA 4CQMA 4QOJA 1Z5ZA 1MXFA 4G5OA 1OV4A 5IN5A 3OQPA 1UMBB 2CHFA 5TQVA 3ZVNA 4UARA 2ZLBA 2EFDB 2UXDB 5G3YA 4KQGA 1Y3AA 2O0HA 1ZVVA 4WL0A 3SYRA 1P61B 3HCRA 3O0DA 4FWIB 3S44A 1B26A 1W85A 4C6TA 4R69A 1GKIA 1TQHA 4JENA 1P6QA 1SB9A 3R3UA 1N3YA 2H11A 4TMTA 1ZUIA 4JIGA 1TD9A 4I5DA 1HK7A 4C0KA 2ZUTA 4E07A 3DGFC 1FRZA 2XR1A 2ROQA 3GCGA 4MVYA 5G0WA 4BECA 1K7YA 5JNRA 4FYWA 1RABA 2OCPA 1GRRA 3VPDA 4B4DA 4EHJA 3EG5A 1KJNA 4HGRA 3PQ7A 3D6VA 5JSFA 1IK6A 3WMWA 2FCRA 3THYA 1ZCBA 1OFIA 2D8MA 1C9MA 3C70A 3FA2A 3BK7A 3JVEA 4QARA 3RBVA 2FEKA 4TKZA 2ODNA 4V0NA 3VZBA 3LHSA 3DD1A 3THWA 1R0CA 2C3MA 3IIJA 3TGLA 1S02A 1DS6A 2DPGA 2PKQO 5I3ZA 2RGRA 3WWCA 3UHPA 3RIGA 2G09A 1JFTA 4RGYA 4GSLA 4RENA 2H1WA 4HTFB 5FHRA 4CLOB 2C7OA 5AK4A 2AN9A 4NYMQ 4CKYA 4G4IA 2GCEA 3V46A 4MGKR 2R4TA 3G2QA 4Q7JB 1TJPB 2UVPA 1QCZA 4P4TA 2WWVD 1BX3A 1DOZA 1PT8A 5IM4A 1IJBA 2AG0A 4EJ0A 2HHCA 1Z18A 5L3SA 3E3MA 4TQ9A 5EINA 3L0CA 3DFIA 1FUKA 1GUBA 3GGPA 4O4JB 4QBIA 4FJ1A 2P5UA 4RZ3A 2HKIA 3HGMA 1E2PA 1FFXB 1Q1EA 4TXNA 5EKSA 3RFVA 1DTSA 3UTDA 3VR6A 1RBYA 4DLXA 4DIOA 1PFGA 1P0QA 5B3JA 3K5PA 3UFBA 4HLNA 5AXAA 3NBQA 1M6VB 4G6ZA 2NU8A 2FDCA 2E5WA 2Q7DA 1BWRA 2AOXA 2RAVA 3D7NA 4FSHA 1CPYA 1K8XB 4PAGA 2BC9A 2YNMA 4ZV4A 5IHXA 3ZE0B 1UBJS 3U3JA 5GM1A 4WBNF 5LB2A 3TLEA 3ZNPA 4A3SA 2PSHA 1LDEA 3D8UA 4ZQFA 4HGZA 1Q0LA 3SFTA 2Q0QA 2XWPA 3DEAA 4DSTA 5KTOA 1X1AA 4CTOA 1I94B 3ZY5A 4JOCA 4GFDA 1GPYA 4LK2A 4TTPA 1FYDA 3SR3A 1DOHA 4Q1BA 3VKFA 5IXYA 4JI7B 2A88A 1RBZA 2BV3A 1PD0A 2VYCA 5AKXA 1JFFB 3JPYA 4DA7A 2O2ZA 1J2UA 2C5BA 3UHJA 1Q1ZA 2FVYA 3UJ9A 2FFQA 3FZNA 3HNPA 4JI8B 3GD5A 4JB0A 1MD9A 3RYIA 3KJIA 1NN5A 2H4XA 4JROA 3EDYA 3RSOA 1J0XO 3Q5GA 4PGHA 4AC9A 5FX2A 3RU9A 5LJIA 4RVHA 4ZD6A 1EHYA 3BMQA 4IVQA 1J8QA 1R6DA 4JJ7A 1RQ2A 2I3GA 1W5BA 3VMFA 5I7AA 3DZJA 3PGLA 4RIHA 2ZJOA 3IC5A 2CVHA 5AHKA 5DMXA 2GPAA 4GWLA 4F2PA 1PV1A 3PD7A 4BFWA 3C1UA 1IG3A 2XUIA 5LBTA 4UHHA 1Y3CE 2KX7A 2VATA 2ZZKA 3RFUA 1XP5A 4QYXA 1UPXA 3IHKA 2XGGA 2P5SA 4FXPA 1A7UA 1D6SA 3UQYS 1WMEA 3KOYA 1JPVA 2QVZX 3PUHA 1RPAA 2FLVA 1GSIA 4MWCA 4LWQA 3VZPA 4NG4A 3QI7A 5A05A 1E63A 4E11A 4RORA 4Q1EA 2WFLA 1CDDA 4U2GA 5LC1A 3W8FA 4GAEA 1V3TA 4QBGB 2AEFA 3CG0A 1ZOLA 3M33A 2JH8A 4U3JA 2UZ1B 1MBZA 3EH2A 1YULA 2ZXEA 1UH5A 3X1KA 5JJ5A 2R97A 2W2TA 5EP4A 1DKUA 1GGVA 1D2NA 1OTHA 1DC6A 1YUMA 2IC5A 3EZLA 3L7BA 1I2ZA 3TIFA 3TZQA 4A7PA 4CMHA 5DTQA 3AJEA 2GCGA 1JJIA 2C7BA 4ZHQF 2ZJ1A 4WBXC 2H2GA 2ORWA 4MKRA 5ALNA 5DBEX 4RZSA 1AS0A 1IXYA 1O0SA 2D54A 2NUPA 2OMKA 3PDCA 5D6OA 5JQWA 2EGUA 4MQUA 3HM9A 4KPUB 4CM4A 1MABB 2OBLA 1YACA 4F6RB 4NMWA 3NYQA 2F00A 2WK1A 3RB8A 1YS9A 2PWAA 3OQHA 6GPBA 3H5VA 3FHJA 4AK9A 3TD2A 3L4EA 1DDIA 3ESYA 4YCAA 4OP3A 1II0A 3BT7A 5EC8A 1RZ3A 3B6KA 3RI3A 3TZEA 3HV0A 3ZWQA 1F14A 2A0UA 2G40A 4IV0A 1OC4A 3A9WA 3AIMA 2GN0A 3DF9A 1KFKB 4XWTA 4Q3KA 3ZV3A 3RC1A 1GGHA 2QRUA 1XDGA 5B1EA 1MMFB 3HDHA 3IHWA 3Q2OA 3QBTA 1V0JA 4IZHA 4BNLA 1OH7A 2R6FA 4ODIA 2HH9A 4FCVA 4ZXPA 3VO1A 3K8ZA 1MH1A 1QIEA 1VLMA 3EUEA 3VAZA 3VPBA 4INJA 1NKSA 1V7QA 2Q5QA 2X6TA 3H42B 3LL7A 4B3FX 1D03A 4KRYA 3HWRA 4LYGA 4CI0B 2VJMA 2WIBA 3VR5H 2WU1A 1TCBA 1IY1A 5A4JA 5EHGA 1LDBA 2QN3A 3BD7A 2AR9A 3GFRA 3QKRA 4O3FA 2ZZNA 3LBNA 2WYUA 1ENPA 1Z4KA 3DAGA 1E5TA 2FQYA 2GZHA 2X6RA 1E0DA 2OK8A 3FYSA 2Q2WA 1R2QA 3GJTA 2L82A 3T5TA 2NXNA 3VKUA 3JATA 3OPXA 2WU0A 3EAFA 3SI7A 3TTSA 2A1UA 3RRZA 3PR3A 1HXHA 1VL1A 4I08A 4MYUA 2NSJA 2ZIXA 1YCHA 3AR2A 4KBFA 4FINA 5D00A 2H18A 1E8MA 5EJAA 3C2QA 1QIHA 2RHLA 3IAEA 2JCSA 5I51A 4RHYA 3GJRA 3LHFA 3OD1A 3OX4A 4BNDA 1YU9A 2DLNA 3K0KA 2WB4A 4OOFA 5F2NA 3Q40A 5JXJA 1Z63A 1ETUA 4CXMA 3ORQA 1NVFA 1WZIA 2YJGA 4JDPA 4J4BA 3GIDA 3MQ2A 4OK3A 4JXKA 5FOTA 3AM1A 3KQSA 3VSAA 1C9DB 1IY8A 4K5QA 2XY4A 1ULHA 1RIIA 4L9RA 2R44A 3ENWA 3PCRB 5C2JB 1XAHA 4MLZA 4MVXA 3TKYA 2X4GA 4BB5A 3C43A 2JI6A 4B9EA 4A0SA 3DH0A 2WAMA 1BW9A 3CO0S 1PYGA 2Q3MA 4GPEA 5CDHA 1DOAA 2B8WA 3I53A 2XUZA 4IZOA 3R76A 3K6SA 1L4LA 4FB5A 2UAGA 4G86A 2ZRKA 2QUJA 3LC1O 1YJXA 3KYBA 1UKBA 2BFBB 3E7PA 4MMYB 4Z1MA 2A9QA 2AMJA 4IFIA 3QWFA 7MHTA 4K6MA 3ZWMA 1Z5PA 4U0KA 1KJYA 3NDJA 2ZRJA 3FNRA 2PFKA 1FTSA 1X7YB 3HP1A 3H97A 4G3XA 5EE1A 1H65A 3L6UA 2FGJA 3GBPA 4HWSA 3A3NA 4YUAA 3VYVA 1VGQA 4LOIA</