5B1EA

Crystal structure of proteinase k from engyodontium album
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of proteinase K from Engyodontium album
rcsb
source organism Engyodontium album
molecule tags Hydrolase
molecule keywords Proteinase K
total genus 102
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5b1eA00
3PRKE 4DWWA 2DP4E 2V8BA 2WWTA 1AU9A 1IC6A 3ZXXA 2Z57A 1TECE 4DZTA 1BFKA 3A3NA 1SUEA 1SBIA 1AF4A 1TM5E 3DE7X 1UBNA 1SUAA 1BJRE 1Y1KE 1Y33E 5JXIA 2XRMA 5FFNA 4C3VA 2PKCA 3ZXYA 3QMPA 1Y4DE 2G4VA 4M1ZA 2W2PA 3CO0S 1OT5A 3EE6A 1WMFA 4H6XA 3TI9A 1EA7A 1SBTA 1ST2A 1ST3A 1Y9ZA 3Q40A 1PTKA 2PYZA 4WOCA 5JXGA 2IXTA 1AV7A 3L1KA 3LPDA 5FAXA 2ID8A 2W2OA 3WIUA 1SUBA 4FONA 3A3OA 2WUVA 3DVQX 4KG7A 1SCAA 4CFYA 4WOBA 1TMGE 4NE7A 3WHIA 5B1EA 1WMDA 1YU6A 3QFHA 4K8RB 2PWBA 2HD4A 1KE2A 3T41A 2Z58A 3A3PA 3BX1A 1V5IA 2PMWB 5ARCA 4KB5A 5ARDA 1NDUA 4AKTA 3DE1X 3AJ9A 2IY9A 5AMXA 3OSZA 1GA1A 3WQBA 1SCDA 1JEAA 4OMCA 1GA4A 4RYDA 4ZOQI 4OMDA 1ZVJA 5I9SA 2Z2YA 2XTJA 2SECE 2ZWOA 5AVJA 1C3LA 1MEEA 1AVTA 1BFUA 1WVMA 1P8JA 4DJ5X 1TO2E 1OYOA 1R6VA 2ID4A 1C9NA 4H6VA 4MZDA 3VV2A 2WV7A 4Z2AA 5SICE 3I2YX 1SIBE 3LXUX 3GT3A 5FBZA 1KDVA 4AKSA 1WSDA 1CNMA 1TO1E 1SIUA 3DE0X 3VV3A 4H6WA 1DBIA 2ST1A 1S01A 3DE5X 4BWGA 3DE4X 1SPBS 3F7OA 3CNQS 1YJAA 5ARBA 2B6NA 3DW1X 1SUCA 5AQEA 4B5LA 1EGQA 1SCJA 1V6CA 1PFGA 1NLUA 4OV6B 1SUPA 1AK9A 1SVNA 1BE6A 4LVNA 1GTL1 2PWAA 1C9MA 2SICE 3AFGA 1R0RE 1TM7E 1WMEA 1GTJ1 4YN3A 3QTLA 5JMOA 1SBHA 1SUDA 3VHQA 3EIFA 3DDZX 3DYBA 3HJRA 3LPAA 1Y3CE 5AVKA 2SBTA 5JXHA 1SH7A 2E1PA 2HPZA 3P5BA 1SBNE 1SN7A 1SCBA 1GCIA 3I37X 2TECE 1T1IA 1S2NA 1GTG1 3DE6X 3AJ8A 4KPGA 4CFZA 1AQNA 2P4EA 1SBCA 1OYVA 1GA6A 1Q5PA 4I0WB 4HVLA 1GNVA 3BGOS 3DW3X 3TI7A 1T1GA 5JXJA 5K7SA 1BE8A 1GNSA 1SCNE 1IAVA 2DQKA 1DUIA 3DWEX 1PEKE 3F7MA 3H42B 3GT4A 4GI3A 3VSBA 1YJBA 1Y48E 2ZRQA 3DVRX 1PJ8A 1R64A 2Z30A 4JP8A 3PTLA 1Y3DE 2QTWB 1KDZA 1XF1A 1BH6A 3GCWA 2GKOA 1VSBA 1P7WA 2W2QA 3DE3X 1A2QA 2ZWPA 2Z2ZA 1GT91 3I34X 2W2MA 3WIVA 4CG0A 3TECE 1AH2A 1TM3E 4C3UA 1Y4AE 1NDQA 3UNXA 1MPTA 1SELA 3D43A 4LVOA 3SQOA 1T1EA 2X8JB 3BPSA 4ZARA 2WUWE 1Y3BE 1ZVKA 1HT3A 1YJCA 3D9QX 4HX2A 1Y34E 3VTAA 2PQ2A 2X8JA 4NMXB 1TK2A 2SNIE 3DVSX 1TM4E 3F49S 2PRKA 2Z2XA 3I30X 3Q5GA 4J94A 3EDYA 3SICE 1TM1E 1THMA 1SIOA 2Z56A 1C9JA 1LW6E 1S02A 1Y3FE 2DUJA 2W2NA 3GCXA 5CW1A 3DE2X 1KE1A 3LPCA 5B1DA 3VYVA 1KDYA 1CSEE 1P7VA 4NE9A
chains in the Genus database with same CATH superfamily
1QQAA 2Q41A 4KIJA 1YZKA 2ZBQA 1II8B 3SVZA 2CNDA 2GETA 4GO1A 2NTYC 3EZYA 4K86A 4DCJA 4EI8A 2Q3CA 2Z5GA 1G19A 1X70A 2DY0A 4HLQB 3RG8A 2GZRA 3JQFA 1T9GR 3I1YA 5JR3A 3AUAA 2A14A 2VDJA 1XLTC 2BHNA 2I1QA 2MT9A 3TRHA 2AVDA 2PUTA 1C0KA 4MCJA 4DT1A 2OG2A 5BSGA 5HKKD 1FDVA 3DD5A 1LBSA 3KT3A 3C74A 3U1VA 3L92A 1LTKA 1PEAA 4BWFB 1U63A 3FCXA 3TX2A 1FU8A 4F56A 1DS6A 2NV6A 5AXDA 2P62A 3JSXA 4C3OB 2AE1A 5ER9A 1YO6A 3QSGA 5DFAA 3P94A 3RKUA 1C3JA 2IVFA 4JI3B 3BX1A 1LBHA 1ZAKA 2FK7A 1W5FA 4NICA 1JP7A 4PLTA 5HDBB 3RH0A 1JR6A 3DE1X 4YPFA 3I01M 2NSLA 1RZVA 2Z3VA 4RULA 1WMBA 2Y1OA 5EJ9A 2YHIB 1JBKA 3HWSA 1INLA 2QQGA 2AEJA 2J9FB 2XNKA 5L51A 2H52A 1BFUA 2WSIA 5CVVA 2GPYA 1A8UA 1B1CA 4BMPB 3VA7A 4HKTA 1CZHA 1L4EA 4QRDA 1OROA 2WTBA 1Y6GA 2WQZA 2TMDA 4EI2A 4M7RA 3S2IA 5KKCA 1AV6A 3DLTA 5G1OA 3F5MA 1J99A 2B99A 2AOUB 4A27A 1QXSA 4HDKA 1BU8A 5KEIA 4BP9A 2K5UA 2QXYA 3H8VA 1HE5A 1V6CA 1CZLA 3QLJA 1OXSC 3HZRA 1DBWA 1UWVA 3FYHA 1FTWA 2DH5A 4EYEA 4AJNA 3V46A 2DR2A 3QXHA 1C9KA 4TMVA 2VTDA 5U4QA 3Q1LA 1U8XX 4REOA 2O7NA 3ZLTA 1PR5A 1L8AA 1R4MB 1KI6A 1JRLA 1LBEA 2PQ6A 3IDZA 2JZOA 3CMCO 4LVCA 4C0AC 4O8ZA 2BJHA 1BQ3A 2QTBA 2VYCA 3AGPA 4RBNA 5A05A 2VR1A 3BWEA 3OSUA 5CLHA 5EIAA 5I9LA 1NL3A 1RM5A 4CLEA 1SXJB 4PG7A 1G7TA 4MWEA 4N3CA 4CN8A 5JZOA 4CR7A 2W6MA 5TVKA 5JJBA 1MKYA 2QLJA 2JI7A 4BNJA 1VQ1A 3L1JA 3EF3A 2O2ZA 5JAIA 3NBKA 3GLHA 4MWCA 4IWNA 4PHGA 4AJHA 4Q4JB 3DZ8A 4BGUA 1Z4LA 4ZKDA 3U3JA 5KOHA 4MV5A 4S1OA 1U3DA 4AJKA 4GD3Q 4TMKA 1P7WA 5B1HA 2XWBF 3VH2A 3BTVA 4AP5A 3NI2A 4LHZA 4TTSA 3C3KA 5DF1A 2W42A 4LF5B 2FH5B 1XR3A 3ENVA 4PTYA 5C7IO 4MR9B 3NGMA 1G8MA 3BDAA 3UGKA 1PQWA 5IBCA 2AHRA 2FUCA 4JI1B 3S3TA 2GT1A 3V4SA 1AA6A 3RASA 5HUQA 3R74A 4EUSA 1NRWA 4DLRA 4FDTA 1E4EB 3FLMA 3W5BA 4ARCA 2ZIAA 3RUHA 3TZ6A 4BNYA 4NECA 5IDWA 4YJHA 2QR5A 2FVYA 4K6GA 2O8DA 4GMDA 2Q6OA 1UWKA 1GUDA 3IDSA 1IRXA 5AVQA 4BMYA 2IW1A 5KSOA 1NMSA 2Q2VA 4FR0A 4Q3BA 1XRNA 4O4IA 3OCWA 1Q7EA 1YDEA 1XNJA 1BFDA 4ANFA 4CJXA 2CMKA 3R4CA 4ZVVA 1YNSA 3AGQA 4WNIA 4N40A 1BXGA 1LRLA 4ZOCA 2VO1A 2H5JA 3BMOA 4WNAA 3A9CA 2PRSA 3ELYA 5EMJA 4B4DA 3KQSA 3DOHA 3GLHE 2HJGA 3CM0A 3P19A 3WIUA 4DLNA 1DAHA 2ZR9A 2AKYA 1EHYA 4LGVA 3IDQA 4Z0TA 4DR5B 1L4YA 1N2BA 1SXJC 1XMVA 1XRQA 3P2KA 4LN1A 4PPFA 1MVOA 1W96A 4JMPA 4Z3KA 4D9IA 3F67A 2WB2A 2P5TB 3EBOA 5FWAA 4HFNA 4A0FA 1ETHA 3K8QA 4ZCTA 1MH9A 3EVDA 3PFIA 4JHLA 4ZDKA 1ZOSA 1IXSB 2ETVA 1NJ6A 3JQQA 1BROA 4TGLA 4GC9A 5G4KA 3G89A 4Q03A 3QKRA 1A8HA 1G6KA 2YVKA 3UBTA 2E5LB 4JP1A 5A7HA 5JMWA 4DC1A 4RKFA 5KUTA 1E7SA 3EIOA 3H16A 3NBMA 2R8RA 3FLBA 5H83A 2JBHA 3B9PA 3H9UA 1VPWA 2MYPA 2YR0A 2WYOA 3IVGA 5THXA 2CXSA 2PSFA 3KX2A 3ZWXA 4H7PA 3CKMA 1A4RA 4GPEA 4F3KA 5LYYA 4LY0A 3H84A 4GKKB 4YDHB 2CMFA 3VU0A 4F6RB 4YHBA 3ZGLA 2ZWMA 2XT9A 1W76A 2WSYB 3GD7A 1T5SA 3VO8A 3N07A 4B47A 1MXFA 1NBMA 1HY3A 2HF2A 4QQFA 3G0DA 5IJAA 2XRFA 3GLKA 2OFOA 4BU1A 1V5EA 2JCYA 4IFBA 3DLPX 1EWKA 1QVAA 3LXXA 5CM2Z 3QXJA 1L1QA 5HIKA 3LQQA 1CYDA 4MUJA 2O6HA 2HGSA 2X8BA 4OGWA 5WRFA 1Y6ZA 4EBFA 1HR0B 1M2OB 2AUNA 4P38A 3QWIA 3IXMA 4MARA 1PS9A 1G9TA 3K8OE 1WHSB 1G18A 4GLBA 4Z0HO 5JATA 2QMOA 3KYDB 4NEQA 2CUKA 4MKHA 4BO8A 1JJVA 1H4SA 2H00A 4I9UA 1XWFA 3PXBA 2OCGA 5DYTA 5CFZA 4PM4A 4MLDA 3QHAA 4LYYA 4DJEC 2IZZA 2OBMA 4RK6A 2H1WA 4HY3A 5ERGB 4AXBA 4CIBA 1KZHA 3WYNA 2VWHA 2C9BA 1XD2A 2PK3A 4OREX 4MGEA 4G09A 4W7SA 5IBRA 4YRGA 3Q8XB 4MPJA 2BGUA 4UE3S 2HRDA 1M72A 4LC0A 1DEKA 2NWQA 3FH0A 3R44A 4P86A 4EMUA 1QPZA 3W8RA 3C41J 3GBPA 2BHSA 2BISA 4W1RA 2O8DB 1MV5A 2HJRA 2QG6A 3LP6A 1D2HA 2YQ5A 3MAJA 4HT3B 5JYDA 3NMUF 3A9WA 4F21A 1YVUA 1ZA1A 2F8SA 3KKLA 5I7EA 4F9FA 2WU1A 4Y98A 1CY4A 4L3OA 1RWVA 4LXYA 5K8LA 4LDZA 3KSAC 4HPJB 2NUTA 1CERA 2HWXA 3I8XA 4CMEC 4JJ6A 121PA 3O1IC 3HABA 1ZY2A 4GLFA 4TS3A 2OCAA 2WDZA 1GNRA 3EGXA 3UUFA 4RD2A 3HN2A 1UJ4A 3VQTA 3REGA 3GVCA 3OZDA 4DZTA 1N5OX 1F2UB 4MA0A 3HBJA 4OEHA 5KWJA 1U0SY 3QVWA 4XQ0A 3D8TA 3NT4A 1TZMA 5H9WA 4I5DA 1WETA 3A27A 1XZBA 3TLXA 4ZYUA 5L6MB 2Y1KA 3X0DA 2YW2A 1YZVA 2WILA 2VDMB 1OQAA 4S2UA 4OIMA 1P60A 2ATIA 4K40A 1PJQA 1I4TD 2G5TA 1XI2A 4Y6LA 1Q7RA 5C5IA 3VKHA 1WD5A 2VJMA 4D41A 3KHSA 1N3IA 2B7BA 1FMJA 3WHIA 4IRMA 1OKKD 4QUAA 1Y8QA 3B1XA 4A2QA 2FZCA 1AKTA 2W90A 3NQ41 3R8XA 2R751 4HBZA 4M87A 4DIEA 4I55B 3OSZA 3LCRA 4J1QA 5AICA 1JB1A 1PJRA 3COSA 3VYTB 2FLVA 4U8GA 3G9XA 1BMQA 1L5RA 4LRYA 4NJEA 3R7BA 3WQSB 4TVBA 2NO5A 4ZZ1A 4F45A 5B7GA 1JLKA 3EQ2A 1CRQA 4LCEA 3WNBA 5BURA 1C3OA 1A8QA 3VUFA 2FR8C 2ZJ3A 1FE8A 1SBYA 2A9JA 4KXVA 1KQ3A 3L0BA 1QHHA 4EO9A 2ODAA 2OENG 1QF6A 1FS5A 2O9JA 4BLUA 3L40A 4ZT4A 1OUMA 2B30A 1X1QA 2Y6VA 4R69A 3V4PB 1WKCA 1ZITA 4ITRC 4X92A 3S1AA 1HZZC 2FW7A 3LBIA 2IUTA 3KQTA 4IV8A 3AR8A 1WUHS 4N0EA 5A3QA 3GFOA 3MJEA 1UJ5A 2J9FA 3G6WA 2Z9DA 1QQTA 4A82A 1E2PA 1EAYA 1QWSA 5EMKA 3CJRA 2HMYB 3QP9A 2GZ2A 4MJLA 4HDSA 5T8KA 4ZTZB 1YGPA 4V0SA 1VHTA 4P2BA 4WKPA 1TM7E 2GWRA 2ZVDA 1X8KA 1EUCB 1EG2A 2C5FA 3DP7A 4I6EA 1WB6A 2B21A 3QVKA 5EJFA 5KTPA 1UEIA 2VBFA 2VUSA 4ZAFA 1E5TA 1G66A 1SKAA 4MVJH 1QE5A 1GFIA 3RE1A 2ZZNA 2OMKA 2CLKB 3AI1A 1PU2A 1RQ7A 3F6CA 3JWPA 3LQ1A 2ONCA 3JARA 3L41A 4CG2A 5B4TA 2I8CA 3TO5A 2OPBA 3GJSA 4N5MA 2G0AA 5A03A 3FGOA 1COZA 3FFAA 3OJFA 1IN1A 4EFKA 4QGAA 2Q29A 4RTKA 1FMCA 3Q7RA 3D3NA 4WOPA 5BMVB 1RI1A 2A0FA 1GZ6A 3IP6A 3VZSA 2C0PA 1UOEA 4RK1A 2GERA 2I33A 3SOZA 2PS3A 4ZU1X 2GPTA 3D8BA 2RG1A 5JQGA 4PYIA 2WC1A 2QUJA 4D57A 3AIIA 3CN9A 1RJWA 3FNHA 3WLFA 1AZLA 1E2KA 2CCGA 4E6EA 4WLUA 4DR2B 5F9FA 3QA9A 1NX9A 4JT8A 2Z8YA 1RS0A 5I8WA 2Q5EA 5C80A 4ETMA 1GXSA 2GJ4A 1O95C 2H57A 4BL5A 1W36B 2EFHB 4EABA 1VE3A 2JRLA 5EQDA 5HGJA 5BPHA 1ZM4A 1Y6FA 3GMSA 3VR4H 2JLZA 4HXEB 2WM3A 1V1RA 1MB4A 2RAVA 1R5BA 3D0RA 1PZNA 3G2IA 3LX5A 1E2HA 5D2CA 4Z9AA 3SLRA 5CP8A 4ZCQA 3W1WA 2YJ4A 3T5BA 3ZDZB 3HCRA 3ZU3A 4BMCA 2FTKE 3OOHA 4RFSB 1T13A 4CM1A 1H9BA 2VJMB 3NXSA 1ADYA 2LCIA 3DQQA 4CLRA 2C42A 1XDWA 5GTDA 7MHTA 1KQFA 3K6RA 2IEZA 2P2DA 4KC0A 3IMCA 4LJ5A 4OXNA 4FHDA 3IDFA 4L5CA 4BLTA 4C0KA 1A8IA 3QWFA 4RESA 1FMTA 3E05A 1WP4A 2QN1A 4ETIA 1K8RA 4W5QA 3B85A 3GT0A 4Q9JA 3NWBA 5AI9A 2VXYA 2N3ZA 2X7JA 2O4UX 2WF5A 1V95A 1UBSB 1EVZA 1H1TA 1T9ZA 3SSNA 1G21A 1Z6AA 2HMWA 4K8RB 4Q9HA 2QM0A 4MR7A 1YCFA 3FYUC 1JWAB 1VI2A 4G8CA 1YB2A 3SDBA 2IQ5A 1GPJA 2RBGA 4HGYA 5EWLA 3R0IA 3UEOA 2V0NA 2I1VB 5A0VA 3CEPB 1B0ZA 4B6OA 3L77A 3HP4A 2HYDA 4M8KA 1S9DA 5L7TA 4L02A 2E37A 3NPAA 4KLAA 1SZPA 1OXTA 5IT5A 3GELA 4OUKX 3WMFA 3ZJ5A 5JFGA 1PR2A 1O54A 3VV2A 3C3MA 2WIGA 3WIDA 3ZQKA 2I8LA 3N9IA 4CN9A 4OKIA 4Q02A 3W5VA 2WJZB 4TLBA 5CD9A 2QVXX 3S28A 3WFZA 1TJPB 1UK9A 1KQNA 1KU0A 2N46A 1KOLA 5MFPA 1JMKC 1S8NA 3PVZA 4DMRA 1E2BA 1U5BA 1TMKA 4AN0A 3VU8A 3DCIA 4QICA 4YRCA 4J0QA 3OJXA 5CM9C 2EKZA 3QU5A 3V7WA 3RGWS 1ZOIA 1MF7A 5BSVA 2CFIA 1Z37A 1QH9A 3AZQA 3A25A 2HRQA 3QLVA 3CE9A 3RADC 2YXNA 2KBEA 4F91B 1NI4A 3G2OA 4DJTA 3O9MA 1RKUA 3RRFA 4RLSA 1KJ8A 4OU5A 3TYXA 3AM4A 3RAPR 2IPLA 1S7GA 4OI1A 3ZWOA 5E7IA 2FQYA 4LSZA 1QU2A 1G7SA 2EFCB 4RXMA 3H0KA 3HI4A 2ODQA 3AONB 4RX1A 5HCNA 3WRYA 1JEYA 4FOOA 1TAHA 1B0AA 3QUAA 4ZVSA 1G17A 1F51E 1E9DA 4B6FA 2GNAA 3BIJA 2A57A 1UBKS 1U0TA 3AUTA 1ZM9A 1GCUA 4X84A 3TEFA 4AD8A 1KYXA 4OI2A 3KWFA 3G1TA 3PHJA 4GBJA 4KBYA 3C16C 2F3RA 3UT5B 1Z6PA 3B1KA 4LFBB 2J3KA 4JWKA 3SC2A 3U81A 2JFVA 2XLBA 4PWYA 3KLMX 5DISB 4HEA1 1QP0A 3OJLA 3FMVA 3THYA 3U40A 4LF6B 3GHHA 2IIVA 5BN3A 5L3SB 3MT8A 1JPJA 2OM6A 5EYPA 4FNMA 3ER9A 1B23P 1EGAA 1DG3A 4J6EA 4BVKA 4H7EA 2R44A 2EKDA 2F9FA 4QJBA 5K0BA 3OBBA 3K31A 5C52B 4KK4A 1JWBB 2DUWA 4EQZA 1FJHA 1R0BA 2RAPA 5AKXA 2H29A 1TM5E 3ZHCA 5IT4A 4MQMA 4HEJA 1GFWA 2IYLD 5TRTA 3PJRA 2Y1GA 4PSKA 4ZYXA 1NJFA 3NIDB 1X8LA 2H7YA 3LKBA 3P96A 2YXLA 4PLYA 4ZQBA 5G0TA 2J59A 4MK4A 2RHBA 3ZEAA 1FLAA 1SD1A 1CJUC 4UOZA 2B8JA 1I4DD 4I1VA 2CUNA 4CFSA 1EX9A 2ZBFA 3AHHA 4GPIB 2O1EA 3DXYA 4KLRA 3TLGB 4B4KA 1SCAA 2NU6A 2XUQA 5BYBA 1DAKA 4KQ6A 5KYUB 3BBLA 4YAWA 3ZS8A 4ECAA 4D9BA 3N6RA 2V7PA 1GPLA 1AS2A 3O74A 4QFBA 1TCAA 3DEKA 4UOEA 3PWKA 4KB5A 1OXUA 3NTUA 1AGNA 1Y7IA 1TF2A 1SXPA 1MMFB 1ZM7A 1Y5RA 1MT3A 2WYWA 1MO2A 1VJ0A 2ZB8A 4NIMA 4ND6A 5D87A 4LEIA 5GOTA 5HFAA 4E5MA 1VYUA 4ZC1A 5AXBA 5KYVA 5C9ZA 3ICQB 4WZAE 4CQMD 1H2AS 4W9NA 4OXYA 3ASYA 5TSDA 1A5AB 2A5JA 2FW0A 3EQ8A 3KUDA 4K9MA 4RCVA 1LPSA 8MHTA 3A10A 3K20A 4ZAYA 1CQJB 4Q7LA 1XIVA 2IW3A 2OBFA 3PC4A 4A8JC 1QO0D 3DS8A 1RAGA 1HPLA 2QNIA 2QT9A 3HP7A 3RNLA 3P2JA 3MK31 2GWHA 1QC5A 2BFFA 2WLSA 1HBJA 4P2GA 4CKCA 1YS6A 1E62A 3E3NA 3FFXA 2FF5A 5KB3A 2H1FA 4E11A 4Y2QA 1QKIA 4C2BA 4BQQA 1E3SA 5CT8A 4EX6A 1ZN2A 2IF2A 1YVPA 2VZEA 5T5QA 1N36B 2EL9A 1RXIA 1I7SB 2Q1SA 1IIRA 2OV4A 2A7XA 3ICCA 5AXAA 3EA4A 4YMHA 1DAFA 3QI7A 2NZ8A 3JR3A 3B2EA 1L7BA 1DMSA 4BKQA 2ZJ7A 1U0NA 2X42A 4LJRA 1Q1BA 3TINA 4JU8A 3O3OB 4EG5A 1EVKA 1VCNA 4DRYA 3SZUA 2RGYA 4HYTA 2RSLA 5CA1A 1KVQA 3LU1A 4Z8XA 4REMA 1CUFA 4JR1A 4WASA 3TZBA 3U09A 1ZD8A 3H9QA 1LLCA 4HUTA 1ZH2A 4CWAA 4H7FA 3HH8A 3R24A 4BNWA 4LJLA 4IFIA 3ODGA 2JEZA 2YN2A 3L7IA 4II3A 5IASA 4I6GA 1PHRA 1V7CA 3D59A 1XF1A 1OHHA 2C2ZA 4WZAA 3TOSA 1CP2A 1XYGA 3QEBZ 2FUG1 5FJJA 2Q2WA 5JPDA 3T52A 1KSHA 3K4QA 4AJ4A 3V80A 3ZI7A 3A1VA 1L1RA 1XP8A 3NUZA 3ZNOA 2I22A 4C9BA 1IDOA 1TYDE 3ISTA 2V6JA 1E18A 1TM4E 2DJIA 1XU9A 2H11A 2WRZA 1K5HA 4FDMA 4N5NA 4Y2RA 1Y42X 1NP6A 4EB6A 5E6SB 2VBCA 3L82B 4LZOA 1QTNA 5J4YA 2A84A 4I2VA 3MB5A 1HRDA 4KVAA 4P36A 2PBLA 2ZAOA 4WY2A 4YFYA 1LPMA 5JAOA 4JBHA 2DSNA 3FMPB 3U4AA 2QAGC 1NLYA 6REQA 1L0BA 4XR4A 1P5HA 4MRRA 3II6X 5AH0A 2GZAA 2XBLA 3CT6A 3UMRA 3W2TA 1SQ5A 2C5EA 3HBMA 3EGOA 2DWPA 3BH6A 1A3CA 4O59O 4XOUA 3E3OA 4JROA 4N18A 1AUQA 1WLYA 3KKOA 3DYIA 1ZJ5A 3NOQA 1WV1A 5K2MA 4QWMA 1OH7A 5FWNA 3Q9UA 3TXXA 2WIFA 3JVVA 1F4PA 2XUDA 2AA3A 4MDEA 2Q9CA 2O8FA 2EFDB 4GZLA 3WQRA 3C2QA 2ZTMA 3AZPA 3R3HA 4RK7A 2H16A 3F6BX 4PQEA 4DFDA 1EBFA 1N6IA 4FFNA 5HK8A 2FX5A 5MGNA 1CBUA 4NY1A 4XWYA 5BWCA 1UEXC 2QNRA 3HHEA 1CQZA 4YMGA 3CU5A 3NBUA 2R6GA 3G2HA 1C3LA 3BD9A 1XPUA 3JD0A 1QHHB 4M9SA 5K1ZA 2ID4A 4B2IA 2LIPA 1E63A 2ENUA 4QTUB 1E1RD 1T2VA 4E21A 4C78A 5FUQA 2VK1A 1QLJA 3D4IA 4OQYA 1T9HA 3H87A 3QOFA 3DBIA 1X9HA 4YFVA 2VAPA 4EGSA 1DC5A 4QPDA 1DIRA 1U5CA 1V8FA 4IUCS 4X97A 4PQYA 3IO5A 1PLJA 3WGOA 3IQHX 3CY6A 1RHUA 3KPWA 1PWXA 3KL2A 4KH0A 5FR2A 1NUAA 1SOVA 4I8DA 1UPCA 4HTAA 5CURA 2HUNA 2YCLA 4KDRA 4J9UE 2HCBA 4RZ3A 1L5WA 6ABPA 2I1WA 2ZSJA 2J09A 2WSMA 2VZLA 3AESA 3D4NA 3KKPA 4WK6A 4O1MA 2C2HA 1XAHA 4HI0E 3CIOA 2H5LA 1MC4A 3BM5A 5DHPA 1N2ZA 1VC2A 2IIPA 3LHDA 1KDPA 3PUHA 2P1ZA 2VUIB 1L4GA 4PC6A 4PPYA 1Z47A 4X7PA 1LY1A 2XDAA 1X7ZB 1ULZA 3MJRA 2YINC 2GD0A 2ZQZA 3AQ4A 4ALLA 2WUEA 4Q3OA 5A7GA 5CXUA 3O7MA 2QU7A 3KB2A 4KFRA 4RNDB 3GWGA 1Z13A 4G5GA 3B3JA 1U9CA 1WQ4A 2C59A 3PPYA 4N41A 4FOSA 1F4VA 2GA8A 1NPDA 1WV0A 2R86A 2J3IA 2JL1A 3D6AA 2VNIA 1ULUA 2DWQA 2XVZA 2EQAA 4NG5A 1UIMA 5AOAA 2GEUA 1R0YA 1HKHA 4M0KA 4I5IA 5CUQA 1CD5A 2X2FA 4EVRA 2VJLA 4B87A 3INRA 3N74A 1RTKA 2V58A 5BQPA 4YMVA 2DHQA 1YIAA 3GAFA 1ZCJA 2AUMA 1RQ2A 3FBWA 4KEAA 2VTBB 2X1VA 3RSGA 1PV1A 1M10A 2TMYA 1RHQA 2WVAA 3EC7A 4UQLA 3AVUA 3ABSB 4OQMA 4L9AA 4U02A 1P18A 4WRRA 1A9TA 3W7VA 3ONDA 2A0UA 2J5RA 3MWYW 2Q5LA 1QR2A 5C5DA 1P4SA 3AHGA 3MA0A 4DM3A 3A3NA 2IYPA 2GPSA 4R2IA 4MYUA 3KTDA 1UKYA 2AZXA 2JDID 2XUGA 2EERA 1VJTA 2W6JD 1W94A 3G8BA 3NIBA 4V02A 2W2PA 5ILOA 2DXIA 5DCYA 1UCFA 4LI0A 1E0SA 1HLPA 2I99A 2XMPA 4DA9A 2O06A 1JPNA 1A88A 4P22A 1M6VA 2B8WA 2VEOA 3E2IA 3ZIDA 4COOA 1A4IA 2CNBA 4DNQA 1UEJA 4RFVA 5EXSA 3NIFB 1X1DA 4F9GA 3E03A 3UANA 3D6MA 3V34A 4Q1VA 2LBPA 4R3WA 1CUIA 1U2QA 4IGAA 1QZZA 1U6JA 3H6GA 1P45A 3E7PA 3BC1A 1PR1A 1QKJA 3E1SA 1BYIA 4M60A 1BVYF 1TUGA 2OGWA 4N3AA 1NUPA 5BSWA 4PZCA 1JTFA 3SQWA 4DPMA 3R7SA 1QLHA 3ZUPA 3O93A 4JHXA 3KDAA 4RYDA 3ASVA 1DAIA 1N2CA 4YS6A 1T2AA 2QMYA 3ET5A 4HYQA 4KPUA 2R7LA 3PFWO 4FKBA 4UJ5A 3H9BA 3W04A 1H23A 4PXSA 4ES6A 1ZZGA 2QX4A 4HNUA 1XPRA 4U8HA 1MAWA 4HG2A 4LRWA 3MJCA 4H6WA 1XU4A 2AOVA 4GSKA 2JBAB 5PNTA 3AESB 4B73A 1QBKC 2AI1A 3ZZ1A 4CM4A 1SKMA 1S1CA 1L7AA 3CKKA 1GVHA 3I53A 5J63A 3RREA 5K45A 2GDJA 4FX5A 4ZOLF 1N5LA 1R66A 4GRIA 1KYTA 4A4DA 2RG7A 3ELUA 3QITA 5CXQA 3I8SA 4EUHA 4ZCLA 3KQYA 2EZ4A 3O92A 2XODA 4XD7A 2FDXA 4S3MA 2YRWA 1JI0A 2IY7A 3AFGA 1YKGA 1K68A 4FKZA 4HRYA 2RK4A 2NMVA 1UP6A 1VDZA 3HUTA 1QVVA 5D3MA 5SY6A 3UH0A 3DDZX 2O2XA 3WDSA 2GNOA 4QPNA 3G0IA 1NYQA 1N6RA 2FWJA 4X6XA 3U7EB 1EVYA 1DC7A 2H4WA 3HR4A 1ZW1A 1EBBA 3Q88A 2XNJA 1J9ZA 2ZE6A 2IT1A 1KKMA 1F0NA 2YN0A 1GTG1 4HFRA 2ZSAA 4BGDA 4TS1A 4QGHA 2XOKD 3GRVA 2YXPX 3RUFA 4A0GA 1JS1X 3R7NA 5AW0A 1W6UA 3HL4A 1PK7A 1THGA 5A5GA 1YJ5A 2VJYA 1M66A 3G1UA 3C5HA 1WCV1 4TQ9A 1MVNA 2K4MA 3K0HA 3QBVA 3KSMA 4IIJF 3I34X 1UFRA 2PZKA 2FU5C 1P1KA 1E8NA 1NXXA 2PRJA 3AUXA 1BO6A 4FT2A 1BGVA 2DG2A 1MPTA 1J5XA 3FOCA 1Y81A 3FUWA 4XLZA 3H8JA 3AI3A 4UFOA 1NW8A 2YW9A 4GYYA 4NR0A 3BQNB 1GQOA 3DMHA 3R2JA 3TR5A 3DDNA 1P6XA 3P4YA 4J94A 4TWRA 2YC4C 1RWXA 2QXTA 4RS4A 5LIRA 4QATA 1SUSA 2AYYA 2NNWB 2CHQA 1GL7A 3H04A 1VHJA 4Z7OB 4EDFA 2BONA 3I58A 3HNRA 1SQ0A 4BE9A 5IMSA 2C7RA 3GVIA 1HLFA 1MCZA 1YHYA 2Z6VA 3K2EA 4NE9A 2GHQA 4X3OA 4JC5A 2ABWA 4X7RA 3RBZA 5IHPA 4DV0B 5MHTA 1KO1A 2G6BA 4ZIRB 2V4ZA 2DT8A 3HQ4O 4DKXA 4HUJA 5AM1A 3IERA 2C5SA 2V74B 4DR4B 4AY2A 3ZX4A 1GRQA 3BH7A 1VL1A 2YOGA 2A9OA 5K0CA 5EZ6B 4OHXA 1PTKA 5F21A 4FPXA 1DVRA 1K66A 2Q27A 4V0OA 5TPWB 3PNVA 4R6WA 1K5GA 1Y5MA 4QXMA 1YZFA 3ZC3A 2GK4A 1M6NA 2DC1A 2GHTA 5K4AA 1U7WA 1LDEA 1MNQA 2JGJA 3AU9A 2LVBA 1MJFA 3C7KA 2XUAA 1Q19A 1O97D 1Q0PA 3WLIA 2M32A 2RH9B 3CWQA 1RT9A 3FCCA 4CHGA 4QFMA 2AOUA 3W78A 4O1IA 4QLOA 1S4QA 4KO1S 4UHJA 1PTJA 3OZCA 2VTEA 4EM6A 1F1BA 4KXUA 3R7AA 3HVRA 5G3YA 2W6IA 1JKJA 3K96A 1OBCA 4OD0A 2RBEA 3PJGA 2CDRA 4W99A 1FPQA 1CEYA 1QIIA 3F6RA 5BVHB 1PF7E 4YJHB 2MYTA 2NXJA 2J6CA 4YJ2B 1F17A 2JASA 2UZ0A 2X76A 2PIDA 3A70A 1N6HA 3NV7A 1D1PA 1RIIA 1TVKB 2I2BA 3C7TA 1H6CA 1XGKA 4GGPA 4XPZA 2Q50A 4PU0A 4KOEC 2PNFA 4G0MA 2RGDA 3I9OA 2X77A 4PQRA 1CW2B 5IVDA 1H4VB 4OCZA 2GQ0A 4XDHA 3ZCPA 4LGMA 3QG1A 3B5JA 2YWEA 3IX7A 4AZ0B 1SUPA 2IUSA 1HL7A 3RTDA 3NTLA 3ZDCA 4AJ2A 1MIHA 2EJBA 4RFLA 4RYLA 5F52A 4YN3A 4C6RA 2CCKA 2B36A 3O4JA 2IP4A 3DBRB 3ER8A 2HSEA 1EU1A 3S2FA 3MGBA 2Q6KA 4TSFA 1VJ1A 2VQFB 3T3MB 2CXTA 1XQ6A 2VCHA 3B3GA 4C22A 4U9HS 5FOQA 3UATA 3PUIA 1L5FA 2HN9A 1VPTA 1CCWA 1QHEA 2AWOA 2J6BA 2PLWA 1N0UA 2HCJB 3FTDA 4RL4A 8ABPA 4HAOA 4OQNA 5J5CA 4B0OA 3O8RA 5G40A 3OOEA 1H3EA 1L5ZA 4MMYB 4TTAA 3SMVA 1WU8A 1IAVA 4U6SA 4GI3A 3G13A 2VP6A 4DREA 3NT2A 4K46A 4FB4A 3JW8A 1R64A 1JDNA 2EV9A 1FLNA 3ZOZA 3BXOA 4MIKA 3FW1A 2WYHA 3K5PA 2YZMA 4TQUS 2AOWA 5GZ3A 2E89A 4N7JA 2BRUC 2HY7A 4EP1A 3DLIA 3QVUA 3X1DA 1OBHA 5TGTA 4ZI2A 4MHTA 2O8CA 3TTUA 4G9GA 3VU3A 1ZJJA 1NVWQ 2AMYA 4KQGA 1GDDA 2GJ8A 4QTTB 1JDZA 4MLCA 1JJFA 3GJ3A 3DBHA 4NBTA 2ZKIA 1RMQA 2FKAA 4IIDA 3VU1A 3AMVA 4KYUA 2IEDA 2NUAA 2Z56A 4IVRA 3FB4A 4CQLA 5J2TB 2IBSA 1OIVA 1VSVA 5TIIA 2JGDB 5HQJA 1NR5A 4B34A 3GPCA 4GYKA 3ZCQA 1IUPA 4BJHB 4D4LA 1THTA 4N5DA 1ZC3A 4Z7JA 1A7JA 3VR6A 2ZGVA 2KWIA 2IPMA 3FWPA 3QK7A 4GRDA 2XD4A 1UKBA 2CKDA 3D6VA 3H2ZA 4QJ5A 3ZHTA 1XRLA 1JDBB 2DAPA 2WT8A 3W5DA 4HH0A 2HT6A 5F2OA 5GAJA 1MTZA 4QIHA 1GPMA 1GPNA 4WH0A 4MWDA 1Q16A 1M8GA 1SOAA 1J0AA 1VP3A 3CLUD 5KYYB 3V8VA 1JHMA 1YB4A 1Y37A 4GP9A 5BV0A 2PYIA 2IPOA 2GBLC 3LX6A 4OQPA 1RXCA 3V32A 2I7XA 2VPWA 4BFYA 1KR5A 3AO0B 3KVVA 3PEVA 5KSYA 2UXDB 2FJ0A 1I3MA 3OOJA 2MIIA 2JIQA 4HHEA 1ORTA 4LTDA 5LQCA 4BE7B 3D3KA 3O8LA 3KJXA 2EL7A 4H9GA 2NAPA 2JK0A 3HZZA 2M6LA 1ETUA 4IJKA 1UM8A 4TLCA 4RLHA 1ORDA 2KB0A 3H11B 2NZVG 3VTKA 2OHIA 1U94A 4ZAWA 4LYJA 2P65A 2E4VA 1O6GA 1SKQA 3Q3CA 4Z4QA 2P40A 1QGYA 2GASA 2HJSA 2SECE 4W8GA 1BYUA 1V11B 2NACA 4NAHA 1JAXA 2JGDA 4TTQA 2DUNA 3I3SR 3NR2A 4CU5A 3L8MA 1OZ0A 2EVWX 5D6NA 3IKVA 3B20A 4IIHA 3IAUA 3P2IA 1H2WA 4HGOA 4LCJA 4MOWA 2PUEA 3LX4A 4QX6A 2WY2D 4FJ0A 1FC0A 4G67A 1S3GA 5KMGA 1YRQA 4URHA 4CEIA 1KA9H 4QT4A 3LRXA 1WDMA 3OFKA 4BO5A 4PZLA 2D2FA 3ICOA 5TJHA 4X20B 2HRZA 4URYR 1EIWA 1URPA 4KAFA 1EUCA 1X74A 1I1NA 1V1MA 2XKJE 4W5WA 2PPLA 5ESRA 5KCZA 2R00C 1F9AA 2ZPUA 3I9V6 5DGCA 1TYCA 2RONA 5B3JA 1IE3A 1ISGA 1FSGA 4WIAA 4HWRA 1K8YB 4H1VA 4RLQA 1YAJA 3ANNA 5TLSA 1Y98A 3NHWA 2DU8A 2J46A 3HLTA 4R8MA 4PFKA 3E9QA 2WVHA 4PS0A 5HF9A 4PAMA 3DW3X 5LP6C 4B76A 1GRNA 3AJEA 2E48A 4NBLA 3LRPA 5K6RA 5HUHA 3PFNA 1H6DA 4UDYX 2HNAA 4KI7A 4HD8A 4U2DA 5KBYA 1B1AA 3M6LA 2C3PA 2CXXA 3GCWA 1IUKA 1QIDA 3HU5A 1ZIOA 1WMAA 1KHHA 2ZATA 4WERA 1HETA 2H65A 3OTWA 3Q3VA 5H70A 4JCOA 5CTJA 2AEMA 3I28A 1YAHA 5EEGA 2IUEA 2GCOA 3NHFA 3UN1A 5LU9A 1T1EA 2YWRA 3OETA 4FEYA 1XZHA 5TQ2B 1W7AA 4FFLA 1T8PA 3RAGA 3ZZUA 3PL1A 4NMXB 2ZBVA 4JR2A 2JIZD 4PGHA 1NAHA 5CLLA 4DLSA 1ZKDA 3OUTA 1YB7A 3EYWA 4OLAA 3T9AA 4YUAA 4XVQA 3G5AA 1R5JA 5A0FA 2FRDA 4ZDIA 1Q7BA 3ZQUA 3W8NA 2HV8A 4ME6A 4JT9A 1PT9A 2Q1YA 1M34A 3NXKA 1IC6A 5EHNA 4GKBA 4MRVA 4O4JB 3TSAA 4OL0A 1WUIS 4ENQA 3DE7X 4UM9D 2QTLA 1GDHA 2HSWA 2JVIA 3PJFA 1BIFA 2IE0A 2OV3A 4M0CA 4QSMA 3T7RA 4E5PA 2PKCA 4I3FA 5AHXA 2BWJA 4OSOA 2IZ6A 1ZCFA 1N4DA 5KWIA 4LX8A 3SD7A 3MM4A 1G20B 3LC2O 2FEWB 3D31A 1SOMA 5E3IA 4XIGS 5E0OA 4B3IA 6NULA 2R96A 1QYWA 3AV3A 2NUPB 1KVRA 3KJQA 3UT6A 2WJ4A 3B9QA 2CW5A 4WN9A 4LPSA 3EWSA 1R27A 3HKEA 4ZOAA 5FOTA 3HVUA 1O77A 2Z58A 1BEEA 3CF6R 4HAUA 2JLUA 4JLKA 4GL2A 1HDXA 4XFDA 5D7NA 4HWGA 1E7MA 2RJ3A 4M3NA 2PR7A 2GD2A 3V3TA 2JIBA 2O8EA 1WUTA 3C48A 2FEOA 1DC3A 1ZDMA 3G2JA 4LZWA 4LXXA 3WMRA 5HYVA 3SJAA 3QA3E 2NM0A 4W6QA 2LTAA 3L05A 4MRSA 1F20A 3F98A 3SSMA 5C35A 2ZCJA 3PT9A 3KVYA 2GF9A 2CXPA 1PDWA 5EUQB 4MP8A 1U0RA 1JHPA 4HDKB 4CI0B 3FNGA 3EQZA 2QJOA 3TDKA 2ZAGA 1FVFA 3PNLA 5K8IA 3I6BA 4DA7A 1HZZA 1RC1A 1SA0B 3HCEA 4LWOA 4NMMA 2R6JA 1IM8A 1O3YA 5ALTA 5LXTF 4WZ6A 5B1SA 3SZGA 4D3DA 3U4QB 1G5FA 1PP4A 2X0FA 2AZTA 2NVOA 1I2BA 3TBKA 1F9EA 1JT2A 1U0HC 2OBYA 3ZHBA 1ZVQA 2RGBA 2VG8A 5TV2A 4LHEA 2UVPA 2ZCVA 4TWBA 3RVNA 1NURA 5K09A 2QPTA 3CLUC 3FKQA 5FWDA 3QFTA 2W6OA 2D0PB 5BMVA 4X62B 3AI7A 1Q7GA 2ZIZA 3LBFA 5LQUA 3AJAA 3JAWA 2GVZC 3N76A 4DWVA 4TLMB 2I6GA 1Q0UA 4YY3B 4XGQA 3AVVA 4B3JA 1BMTA 2XZPA 3PBKA 3NM6B 3W4IA 3B1ZA 1ANKA 1WCXA 5KYWA 2WMOB 1QLWA 3FMFA 1DAPA 1I9GA 1PW5A 3OM8A 3MVEA 2WI8A 3C24A 3OJ0A 3NAZA 4B6PA 5I45A 3EXIB 3TS1A 3V8MA 1QG6A 4URXR 3LT1A 4Y9UA 4WJLA 1DT3A 4DSUA 1C7ZA 1E2QA 2CLLB 2I9KA 3P8ZA 1TO6A 1VI5A 2HK6A 2W2QA 4XQEA 5I3ZA 3CV3A 1EFPB 4NFHA 5LYJB 1C1HA 3QEMA 3U9SA 1NBMD 1XJQA 2Q1XA 1K06A 4YBRA 1RHKA 4H7JA 1IBRA 2KQUA 2Z9CA 5ALOA 4J4BA 1LLUA 1DEAA 5P8WA 4RQUA 3PKIA 4CLRB 2I87A 1UBTS 2IGTA 2P8JA 2ILVA 2Y1LA 3T3OA 3ON5A 5D3QA 1HYEA 1FVHA 1HTWA 1R4MA 1UMBA 2UKDA 3EVFA 4OQZA 5B1DA 1DRUA 1EVJA 3ML1A 2NG1A 2XSZA 2D5CA 4JXJA 4I8IA 4QO7A 4IDAA 4K1XA 4AUKA 3H05A 4B84A 3WL5A 1FLVA 4R31A 5DN6D 1FDTA 3R20A 3T9CA 3VR3D 2CLFB 2ZJFA 1ONOA 4B74A 2QRGA 1O4VA 5I9TA 5LJIA 4BQNA 1HXHA 1DBRA 1LDGA 4P3XA 4E1AA 4V2UA 3W9BA 3IKTA 1YMVA 3CO0S 4L78A 1WD7A 3WK4A 4TMFA 5A7FA 1KAEA 3HBFA 1R8XA 2GYWA 1L7PA 2AN1A 1OBFO 2CJFA 2VNHA 5I5EA 3M4JA 2OQRA 5IEBA 3B48A 3IPRA 3LY7A 2IYAA 1V2HE 2Q4OA 2Q5OA 3G8DA 3IBSA 1DV1A 3PU6A 4O29A 5KNCD 1QYXA 3VJRA 3IKJA 4Z7NB 2OGUA 3SXJA 1KNXA 4CLXA 5EXEA 1U9JA 1XDSA 3GLRA 3H2JA 1VDMA 3SQDA 1XKTA 2YOFA 2A9RA 1AKWA 2UZ1A 2VA8A 3D4LA 1PUXA 2ZG6A 3LI2A 4QUBA 1YA8A 3IO3A 1R7RA 1V3QE 3LUHA 2HLDD 3OEYA 4HDMB 5TGDA 1KKUA 5I4KA 2G1PA 3EPLA 4M0UA 3FTFA 1Q74A 4INZA 3CUWA 3FRHA 3ZVKA 2Y6UA 4DC0A 3ENQA 1C5KA 3IBYA 4MRMB 4E4TA 3R9XB 1TX4B 1F48A 5H68A 4ZI7A 2WF6A 3I9NA 4JJ7A 3OD1A 3ZH2A 1P2GA 1UPAA 3QIAA 3DEYX 1XU7A 2ORYA 2I76A 3VKVA 3KALA 1O2DA 3E9EA 4WXHA 3BMQB 3KETA 4LZAA 1FK8A 3DE0X 1TE2A 1OGIA 4EF5A 1PYDA 2ZYUX 3QKWA 4HXGA 2FWBA 4UHEA 3L8CA 3W3AA 4C4SA 1NQWA 3OT5A 2OVBA 4TQAA 4YXWD 4IG9A 1CUAA 2OHVA 5D3KA 4EA9A 3LUKA 4KJZA 5AO9A 1FLDA 2GN9A 5TC4A 3ZR4B 4LOLA 2WTUA 3MHPA 4WCDA 5DI3A 4HN9A 4RHFA 3RRXA 1Q21A 3LWZA 4TMWA 1CY6A 2C88A 2FQXA 2IF0A 2QRJA 3HMKA 3DXFA 3JTMA 3IAEA 3EVZA 5G1NA 3HZHA 2UYYA 2VCYA 1PD1A 2NU6B 1FNSA 3O31A 4US2R 3VPBA 1Z6YA 3ZHUA 2CNOA 1ZJWA 5TE9A 3ZV4A 3T5AA 5TT1A 1GP2A 4HDMA 7ABPA 1HORA 4RPIA 1YUBA 3FYCA 1JYSA 4O2AA 1OGJA 5GM2A 1Y9EA 2E0IA 4W82A 2W70A 3R8CA 3ROZA 3UMVA 1T2FA 3RRMA 1MEOA 2XQKA 4EB0A 1KJIA 1Z0AA 2XTAA 2I1LA 4NVRA 3N53A 1V41E 1GEGA 1DCMA 3TAHA 1CR6A 1HURA 1X15A 1J00A 2WWRA 2XECA 4ZAVA 5AT1A 1W0JA 1LK5A 2DPHA 2HFJA 1CQIB 2V7XA 2VDPB 1Y6QA 4FOLA 4Y6SA 3ZTYA 3GUZA 3G68A 3BA6A 1D1TA 3SAJA 1NKVA 4ZO8A 3U3DA 3UGQA 4K1LA 3K7EA 4RADA 1Z2NX 4BN5A 4FYYA 4EJSA 3FTQA 1LUAA 1C8BA 5U4XA 1JLLB 5TY0A 3IB6A 3IUYA 4UPDA 3SHWA 1XVIA 3UV6A 1M5RA 1QK4A 1IN4A 3MJVA 3RVDA 5KC9A 3MFYA 3RFFA 3ZWDA 4DEVA 4Z1OA 2ZZMA 2YDYA 1S3SA 4BTLA 3EWNA 3BRWA 3LE8A 1YHNA 1IG3A 4ZVOA 4S1VA 5GV7A 3AUFA 4E15A 3CKLA 2FE4A 2I67A 1ILWA 1GL9B 3U3KA 1GGVA 3KQMA 1RHJA 1XZQA 4AS3A 3L0SA 3OI7A 2YH2A 4L8YA 4DMLA 2NU9A 2EBUA 2B3DA 4EFLA 1RABA 2V59A 2M1ZA 2PA3A 3EMDA 1G4HA 1BD4A 3GF4A 3PQEA 5GMOA 5K3FB 1WXWA 3B5IA 3WGZA 2CLEB 1SU8A 4RORA 4Y0NA 5EOVA 4AC9A 4K9SA 5K8JB 4HMQA 2DY1A 2R62A 3SQNA 1BVHA 4WXEA 1N5DA 4GIBA 3PFBA 5EP2A 2PZMA 3ELDA 2OORA 1TQ8A 2QVLA 1TAUA 2FMFA 2GKSA 3WYBA 4IQ8A 5A9SB 1CUXA 1QZXA 1SHLA 2DPYA 4RKWA 4V0RA 3EQ9A 2HB6A 3FPAA 4CIWA 2BZ1A 1S8OA 1PNTA 5IKXA 1YBVA 3RT1A 3UCXA 3HKDA 2O7RA 1Z3CA 2O59A 1WDWB 2AYXA 2BHRA 4JGBA 2V54A 2V0GA 4BRUA 1QBGA 2WWGA 3NC4A 3INGA 2RC5A 2B1QA 2ZYHA 2HZ7A 5E6SA 1RTTA 4G0XA 4FM9A 3AILA 1ZO8A 5C1BA 4IHQA 2H8KA 2GN1A 4B2LA 4RVNA 1IMOA 4QOEA 3OJOA 2P6UA 1FQKA 1WXDA 4IPTA 4MQ6A 3UB4A 1IDN1 4D9GA 3MOGA 5EERA 2D7DA 1R9NA 1PN3A 3BSWA 4PG8A 1DUSA 1DQRA 4N12A 2IGBA 5TXGA 4WXMA 4CTJA 5L4NA 1BKSB 1G8YA 5FOSA 4HLUA 2VUHB 4QOGA 3PGKA 2NV2B 4NOJA 4UATA 3W6NA 3WK8A 4TOIA 1WUJS 4ESOA 4UBMA 5JNUA 1B2LA 1RW4A 4ARZA 3H86A 1ISHA 1PFYA 1JYEA 3ITKA 2SICE 4Q3NA 4N49A 3GN1A 2RKWA 1YWGO 3EOZA 1H2BA 3VJLA 1LEHA 3E0QA 5DCWA 5B2EA 3ZXSA 4I8XA 5ESXA 5BMVF 5CA0B 4TZKA 3OURA 4CDGA 1KBQA 4L4XA 4CKYA 3JQ9A 1P9NA 4OAQA 2PGOA 5HIIA 1GAEO 4WLNA 1ODIA 4B4WA 4BX8A 4QDUA 1UP7A 1Z62A 2ZTUA 3A37A 2EX4A 3D7NA 4C4PA 3EW7A 4KWHA 4TXLA 1Q7TA 3IMGA 4RENA 1MFZA 2MDTA 4IF4A 4N0PA 1V6AA 5CLQA 3MGAA 1X2BA 1WXQA 3RWBA 4MA4A 1VG1A 3GO4A 5CPFA 5CVDA 5CR9A 4AG6A 2NUAB 4AUNA 1Z34A 4JR0A 3JD3A 3GLIA 4L15A 1VSBA 1HT1E 2Q28A 3AM5A 1KAOA 3HA2A 4EGQA 5C8ZA 2FWRA 1EVEA 4H4DA 1I94B 3C6MA 2WEKA 4UUAA 1GYQA 5B2FA 1Z56C 3UNXA 1YOVB 2Z8XA 3SQOA 3OQIA 1OAKA 4OHPA 3O8OB 2Y68A 3HK2A 1R8YA 5DYIA 3EEYA 5MGBA 2XJ9A 4UTOA 3F5QA 3TH5A 5ALMA 4ACAA 1CJVC 4UNPA 3THXA 5CB4A 4B3BA 5K6AC 5CDSA 2JRCA 1Z39A 1DINA 2J8ZA 2JVKA 2Q5HA 3AL2A 3HDHA 4I5GA 4OL9A 3WB9A 2IWRA 1K63A 1ECLA 4R01A 2CNWD 2JLVA 2BFPA 2OAGA 3I76A 2Z04A 4ENRA 2G1AA 2NO1A 2ZRFA 3FG9A 1WVGA 3D8NA 3DV2A 2QTTA 2VDKB 2Y05A 3DPUA 3GY0A 4QO8A 4AJ9A 1ZISA 3T6KA 1RLOA 1JILA 4ZVNA 2W2TA 3E3MA 2V3WA 3GGCA 3ORHA 3SYKA 2VYVA 5DHFA 2A4KA 2DBVO 2DTDA 5HIMA 4B1FA 5JASA 2MTBA 4J4TA 2VJCA 1CDOA 4JITA 3RS8A 3NHKA 3DC7A 1CC1S 4R9NA 1G20A 1LKZA 3WIEA 5LXTA 4R9RA 2WNHA 2WM8A 3N2KB 4ZT7A 3IFSA 1FNNA 2QX8A 2BMFA 1JB9A 4Y2GA 4YQEA 1ECPA 1VMKA 1US8A 3OE7D 3GP3A 2ZBGA 5ALKA 4ZVMA 4AZ3B 2SCUB 1G21B 2VYQA 5LKAA 3KUUA 4JVSB 4RKEA 4FZJA 4OXIA 4YR7A 1FY2A 4D26A 4IUYA 4MV9A 3RUPA 3RJZA 1G3IA 3DOUA 1V8OA 2GUWA 4Z4GA 1ID1A 3R0QA 5CNMA 3IAM6 2Z1MA 4QODA 4RZIA 1M1YA 4F38A 1TD9A 3OPMA 1B76A 3AJ9A 1IOVA 1N0WA 3MBIA 3TIVA 4D80A 1SCDA 2H2GA 4MQFB 3LDHA 2ZT7A 4RMIA 1Z4QA 4E12A 1KSJA 1T8WA 2JJQA 2ZWOA 1VMIA 4DIKA 3KZNA 3TE6A 1U3TA 3KFLA 3RRBA 4DBVO 5AM2A 4HOYA 3F5DA 5JAHA 1MUUA 1R6VA 4JBYA 3AEZA 5CDFA 3VR4A 2AOTA 1MORA 1UBJS 4HEA6 4XAQA 3GPDG 2B69A 3JD2A 1UKVY 3ZD9A 4Y1EA 2I5PO 3N39C 4P4GA 1EGHA 2X9GA 3IALA 1L4LA 4AX8A 5CA0A 3L4SO 1M6YA 3ORSA 4JJFA 5ULLA 4F4CA 3HJTA 3FROA 2F4NA 4G1BA 4UVIA 4OQQA 3J7AC 3R9XA 2BMVA 4L6IA 2VAWA 1LX7A 1EBUA 1EJ6A 4PLHA 1SC1A 4OFWA 3VXKA 2O1WA 3SYNA 2PZEA 5T4EA 2AKEA 2RGUA 1U8EA 3F7TA 2ZLBA 1JBQA 3EDQA 1GTJ1 1OX5A 1OYWA 4QYSA 3RIXA 3V7UA 4EIWA 3CN7A 1VHQA 4P81A 4QUGA 2QX9A 3RRYA 1SXJA 1XG5A 3I6ZA 3B8EA 4FC6A 5BR7A 1Z6GA 4N54A 1DBQA 1GNPA 5A5DA 1UDWA 5BUQA 1I4LD 4MI1A 1FOEB 2HXGA 1D7OA 1ZP6A 4TS9A 4YJDA 2YBDA 1PL6A 4BNMA 4U2GA 1ESMA 1XLTA 3KXLA 1G55A 4AECA 8GPBA 3ZW8A 3QNUA 4RTMA 1MX1A 1E0KA 1U7DA 2YYSA 2RAFA 3OLQA 4IJ5A 2JK1A 4TMTA 5CPBA 3CB2A 4Y3UA 2WA2A 3LZCA 4PR0A 3W5UA 1RSZA 1SVWA 1LPPA 5BUCA 1ZVMA 2FQWA 2DFLA 3H5OA 3VZBA 1KK3A 5HS6A 2H2DA 3ROPA 2IYTA 1YDHA 3BWVA 3VX3A 1LSJA 2WZDA 5CLIA 1BKYA 3MWFA 5F23A 1UKZA 5TARA 4JI8B 1XPJA 5ECWA 3I6MA 1IPFA 1J8YF 1Y6RA 3KKMA 4J1SA 1G6HA 1GGNA 1U7XA 3V9PA 4XDGA 3IJPA 4Q9IA 1K86A 3G88A 4V1CA 2D0IA 1MDBA 1YRAA 3OKCA 4ZMRA 1EZ4A 2PIAA 4P3PA 3ZZTA 1E0DA 2HMTA 1ZSYA 3DUFA 4HFJA 3K0BA 2XEDA 4LE2A 1LW6E 4MR8A 2P90A 4WDQA 3ETLA 1AQLA 3CLRC 4RHCA 1M6VB 3OQNA 2G76A 4YDQA 4FINA 4J43A 4RH0A 4L8VA 3V3KA 2DP4E 1CEXA 1SXGA 1E2LA 2VNKA 3UH1A 1G6Q1 1Y5NA 4U2EA 1U5AA 1Z5ZA 1FMLA 4X54A 3TLEA 4C4XA 2ZRAA 5CB0A 2WJJA 1B8VA 3FBGA 3FR7A 3G2MA 3U6KA 1QFSA 1XZCA 4OVKA 3OE4A 3VR6D 2ZUTA 1D5CA 4JVLA 4KNWA 4M1ZA 4AN1A 2YYAA 2GD1O 4UDOA 1NC3A 5E7QA 4CCSA 2X5NA 2YZ7A 1J70A 3HVKA 1J8FA 1FX1A 1E3EA 3KB6A 5LP6F 4JV5B 2JLAA 1NLMA 1NF2A 2W0MA 3ZZMA 1I30A 3AHDA 2ZYGA 3W4KA 2Q2NA 2DZDA 2RI0A 4IO1A 3KT0A 3RS4A 3V97A 4EGAA 4NXNB 2LNDA 1TMGE 1LVGA 4WKOA 5KQGA 5M2QA 1II8A 5ERYA 2CY0A 4JEIA 2CB0A 3T41A 3HFSA 4KK3A 4NABA 4BNLA 1A9YA 3JAKB 2PLNA 4C4YA 1DHTA 3N0WA 2FXVA 1ENPA 4D92A 2R4TA 1MC8A 1QQBA 4GFDA 2YWJA 3GRZA 5L3SA 3CLSD 2BCJQ 2FN7A 1FW8A 4HUQA 1DZIA 1KI6B 1VCIA 4LYFA 4B9EA 1TO2E 1NRJB 4QD3A 1KH3A 5ADVA 1COWA 3EAGA 1FP7A 4P9NA 2AT1A 3FZNA 1DKLA 2PBFA 2R5NA 4D8YA 1H05A 3IQEA 4AP6A 4KODA 1KQPA 2ANBA 2HWYA 3QV1A 4NBUA 3RYIB 5ALIA 4CM8B 1QPGA 1VMDA 4FE4A 4GXQA 4IZHA 1W36D 2XUIA 5AQEA 4F2PA 2Z6QA 3E3AA 4KXXA 2G9NA 3ONWA 3MGGA 4JQCA 1IH8A 2QRVA 4JUCA 4QUHA 1LC0A 3D1VA 5BRNA 2IUUA 1T2NA 1U6IA 2VS1A 1P91A 4LTNA 1Z22A 2IOFK 2JNWA 1QH1A 2VQDA 3IAFA 1SWWA 4ZKEA 3U0BA 1W5SA 2GZ1A 5F78A 1FYFA 2BHTA 1RZRD 2J85A 5D7BA 5E6RA 5TMEA 4UXHA 1L5YA 1N9ZA 1R9JA 1RBMA 5AI6A 2D06A 2NAFA 2R48A 3HWRA 3L84A 4B3DA 5JD6A 5JI2E 4B3GA 1HG0A 4PZAA 1RBZA 2A59A 4QTXA 1IAQA 4BBJA 2I6QA 4DXHA 5EIOA 4HQRA 2YN4A 1T1RA 1DDGA 4MYRA 2VP0A 3IUEA 3MJ4A 3K1TA 2ZRGA 4MS4B 4AULA 3Q8MA 1RBQA 1IHOA 1R6BX 1W8DA 2LZ0A 3H4MA 4BNDB 4MRMA 1V8ZA 4N82A 5I6DA 5GV8A 1S6YA 2Z5VA 4N0DA 1M2WA 4QL3A 2FDRA 1T25A 4R1QA 3QKTA 4YAFA 3SC6A 2W2LD 2UUBB 1Q1GA 2HIGA 2HR1A 2X6TA 4LRTB 2QRZA 1L2TA 4HWSA 4ZVLA 1TVKA 4C1NA 4KLZA 5B4UA 1LNQA 1SHZA 4BVFA 1LBQA 1NDHA 4BYGA 1S2DA 1KJWA 3L0YA 5H02A 1N33B 4KR3A 4NP6A 3WV4A 3OPYA 1U2ZA 3PUYA 2C4UA 1M2VA 1IEWA 3L1IA 4I50A 5CW1A 2F9MA 2NGRA 5DIFA 4CV0A 3DE2X 1L7MA 3MOIA 5T8KC 3JAMA 4XYGA 3QTTA 1CSEE 2F1RA 2QTRA 1EFKA 3HDGA 5F4ZA 4LYHA 1JQKA 2PSDA 2V7VA 5JW6A 5C81A 1JHDA 3IP7A 3OQIB 4WXRA 3PWSA 1TZ2A 1HT0A 4LMPA 1NRIA 1DPGA 2VHJA 4JZYA 4KN9S 1CG6A 4FBMA 3TSCA 3UT5A 4DLVA 5TQVA 5K01A 1UQRA 2UZ1B 3VISA 3PEYA 2PMCA 1ZD9A 3WR5A 2E21A 1XTTA 1PL8A 4MUAA 4G1UC 5FUWA 1Q0SA 3BGVA 3T3IA 1H93A 5IPFA 2GPJA 4B17A 3PNSA 4NZYA 5CAEB 3KQQA 2C20A 1CJKC 2YZKA 5JFTA 2WUVA 1MOQA 5EPUA 1QOZA 3O26A 3DF7A 4HXYA 4CF4A 5BNWA 1I5RA 4LV6A 4ATNA 1KEWA 2BD0A 3DMYA 4NWIA 2YWDA 1X7XA 3FRJA 1IQ0A 3FJ1A 3IHWA 3EHDA 3CUUA 3WRVA 4BVHA 5BV1A 3H9GA 1IU9A 3EVNA 3EQ7A 1DXOA 3ILHA 3RYIA 3TM5A 2J3JA 3T3PB 3FVRA 1TUBA 4C1BA 1QB8A 1O95A 1JYFA 1RPJA 4EFDA 2QGNA 5DK4A 1DMRA 3BQ9A 3MEQA 3IRUA 1V1JA 3TDMA 2H4JA 1ODTC 3V8EA 5JQWA 1T3ZA 1V2GA 1Y4UA 3L7DA 3P9QA 3O73A 4R0VA 1W0KD 5HSGA 2ZUUA 5A3VA 3WWYA 1SUCA 3BSSA 4QXRA 1NLUA 3M6XA 3QE0A 2GZDA 4P0QB 3AT1A 4QBFA 1P81A 4OQXA 4E46A 3UAVA 1U8FO 2VHWA 4M86A 5A4KA 1BE6A 2FX2A 4KQCA 2ZRPA 1ZOPA 1DQYA 4NSNA 1I3OA 2JGEA 2JGLA 3F7NA 3IELA 3KJIA 3HBNA 4QNMA 3KSDO 2DBZA 1EFVA 2IDKA 1N2CE 2XD9A 3MT9A 3R23A 1VMEA 2FSSA 4PEVA 4RPCA 1GCIA 1N6KA 5BWMA 5KHLB 1QIMA 2FLKA 1JHRA 1YQUA 2BFNA 1FB5A 3JVDA 1U4NA 4BN4A 2HL6A 2PS0A 5LUAA 3JATA 4Y18A 2Q3BA 3O75A 5LZ8A 4ACBA 4CT0A 4DF3A 2QN8A 1NSTA 1O95D 3OEHA 4XVUA 3ZD6A 4DQLA 4GM0A 1DDIA 1AX9A 1MQSA 1Z4PX 1Y48E 4GE3A 2OHHA 3NORA 5EP4A 3FZYA 1U0FA 3RANA 2F43A 2W2LA 4D3YA 3H2KA 1W6RA 2HH9A 3P20A 4LZNA 1VCOA 4Y2TA 1MJGM 3GH3A 3LHSA 3N2NA 3QXGA 3TKYA 5TQ2A 4XYLA 4FFPA 2R9VA 4P0PB 1PEYA 2VT7A 1CY0A 3BK7A 4RAQA 3T99A 3WDMA 1TZJA 1MB9A 3PICA 2RBKA 1NLFA 4HWTA 3I4FA 5AVTA 3LP5A 4PSUA 4V24A 5CB4B 3SQMA 5KMGB 4ZVRA 1O6FA 4W5JA 4ARAA 2ZIVB 1QE0A 1ZIYA 4CU2A 5DHRA 3C8DA 5A9TA 1ZD3A 1N6OA 4AX4A 1ECJA 2VSYA 3NGLA 3QLVC 1VOTA 5EZYA 1J8VA 3MWJA 1AU9A 2B2NA 3IVCA 1Y8QB 2DKFA 2YWXA 2Z57A 3OZTA 2NZ2A 4MS3B 1S4MA 5JH7A 2CWDA 5ICCA 3MINA 1F8UA 1GM5A 4BVJA 3R3WA 4CMBA 5NLLA 4G23A 4LKRA 4M9ZA 1P2DA 3ZVNA 2AF3C 5DM4A 3LD9A 4MW6A 5SY9A 1WMFA 5IYZA 3MCTA 5EXPA 3DA8A 3GRUA 3K9NA 3F97A 5FUBA 1CLUA 4XTRA 3VSEA 2VF4X 4RUKA 1WM1A 3V4VB 2GBLA 4HNRA 2ID8A 3HCBA 4ZZ2A 2H1OA 2QDXA 1GOTA 3SS7X 1GPYA 1TU0A 1WCWA 3KJNA 4LJ4A 1VYTA 2EEZA 4PYRA 4Y67A 3NS7A 2DWUA 2QLFA 3VKGA 3DT8A 1BGXT 4WJKB 2NT3A 3PKJA 4JLPA 4XIYA 1WZIA 1W2WB 2GAJA 2ZTSA 3E7FA 3K0AA 1AB5A 4FW9A 2V6GA 4RZUA 1N5RA 2JI8A 4C4TA 1JF8A 4F5WA 2FCRA 1E5VA 2GZSA 2H5IA 1L4BA 3A32A 4BFTA 5C1PA 5L8VA 3GG2A 5JYEA 3C3YA 1OH5A 4BY9E 4HDSB 4BLVA 1T9KA 2HHCA 4H3SA 3UWDA 1WVMA 4M0LA 4URFA 4BKOA 1G2PA 1LDBA 1VPVA 4MW1A 1W0KA 5JSQA 1J42A 3LS2A 3T54A 3OQPA 6ADHA 2PKRA 4RVCA 3VPCA 1OV4A 3ANTA 3DDUA 3PQCA 4OJMX 4A3SA 3H1FA 1EVQA 5ES4B 5IZCC 2I4MA 4YASA 4OQDA 1VB3A 3CWCA 4QYMA 4Q1BA 1KEEA 3NAMA 2GM3A 1KRWA 4W63A 3E7WA 1NLZA 4QM7A 4Z6KA 3NGXA 4GEKA 4HNGA 4HWKA 4YIKA 4DLYA 4ASUD 3AF6A 2Q7DA 1PUJA 3T38A 4CHTA 4KQ2A 2HA2A 5IXSA 2WSSA 5IFLA 1I2AA 2IHZA 4M38A 5ECDA 1YCDA 2OR3A 4JEHA 4WLOA 2OUIA 3ZX5A 4CDNA 2NNLD 4KR7A 1QRUA 3DHWC 5E1BA 4KNYA 2GFIA 5JS7A 3M4XA 2Y71A 2TMGA 1WXIA 1LDNA 1DX9A 2XITA 3TLJA 821PA 3HJRA 5FX2A 3TG2A 4JUFA 2WVGA 1UZNA 3OBIA 5T4FA 4BX0A 3M1AA 5L4SA 4F5ZA 3ZBTA 3DAGA 2W6ID 3NNDA 5EJ8A 3I1FA 1QB7A 1RRMA 1VHDA 1VIVA 3BWYA 2AYZA 3OIVA 4PIPA 2CZQA 3D1LA 3EPHA 1RP7A 3MYYA 4QWWA 3HE3A 3PL5A 3B3AA 3IH5A 3JPYA 4FFRA 4AJOA 3KLOA 4BQEA 4KGDA 5A71A 4MYTA 4GZ3A 3WK7A 5LP6A 1IZZA 2CVQA 4BPBA 2AFHA 1T5IA 3B7WA 3HKCB 4IIUA 2X8WA 3I9KA 4P92A 1IEQA 5DB4A 2WW8A 4DILA 4REQA 2DFVA 5IBQA 3WIVA 4YLGA 3FSRA 3FYUA 5F4BA 4A8JA 5DBFA 3TL3A 3ADPA 4Y2XA 2XKKA 4GX1A 1B3BA 2YJ6A 3RIGA 4B09A 2EKQA 3QOXA 4R4JA 4BNDA 2WWVD 3IE2A 1GZHB 3HA5A 4FYJA 1B8NA 3J81A 3DSRA 4KO4S 5FWXA 3GIDA 3W34A 1JJAA 1RRGA 3LAWA 4X95A 3NHJA 3EY9A 5JD4A 2F62A 3ESXA 2MMGA 4UDNA 3O03A 3ZCVA 3PYMA 1A98A 1NBEA 4WECA 3G0OA 3EAFA 2PANA 4RMGA 2J0UA 7MDHA 1PE0A 1U98A 4DE5A 3JZIA 5CH3A 4A0QA 3PKZA 3KAPA 3TBFA 3A2NA 2PQ0A 3W7BA 2X7HA 3EAQA 3CH5A 4BFXA 2DERA 1NX6A 1EXDA 3K4HA 3TGWA 3PFKA 5CX1A 1DL5A 3WYDA 4M1WA 5JXGA 1RAEA 1JAIA 3D3EA 3SLKA 1I1QB 1UBHS 1NQTA 2C31A 4RD3A 2JIRA 1YFLA 2WJPA 4D5GA 3JQGB 3OZVA 2GXAA 4C6TA 2ZUBA 4GZ5A 4JSRA 4BO9A 2XYHA 3HN6A 1T8RA 4CLHA 5FDFA 3VZQA 2G67A 4N5HX 2WD7B 1G5PA 2QP3A 5J4KA 5SZHB 3I4CA 4YGYA 4FI3F 3TD2A 5LQMA 1KEEB 1NRXA 2C0CA 4X6YA 5C5CA 5DHUA 1CRPA 1DI0A 5K8VA 2Z2YA 1T8TA 2X9NA 1CZOA 1S8FA 3CRZA 3ED5A 3H2GA 4OJYA 4NPCA 3U4QA 3ZBQA 2G08A 4M55A 2K6GA 3PNQA 4NK5A 4CTMA 2Q9UA 4KLCA 3DEJA 5DGDA 4GEGA 2KM1A 3LTNC 3QMMA 1LJ8A 2BM1A 3AY7A 1J6UA 4CKCB 4CZ2A 4MR7B 2HZBA 5T64A 1GFZA 1IB6A 4LF9B 1JJBA 2Q6VA 4V0LA 4AO7A 4FVTA 4P5EA 4TVSA 5LSAA 3PYXA 4R2HA 2AOXA 4J1NA 3RS2A 3W2GA 4KAAA 1AKVA 3VNSA 4J16C 2FUNB 4DG5A 3GUCA 3ABZA 4BUJA 1EDOA 4MGKR 3CSUA 4A5SA 1MABB 2WYVA 1DTWA 4LBVA 2EF1A 4XUEA 4XIIA 4BP3A 1VFPA 3CUYA 3DE6X 3EIWA 5L6LB 1HEIA 4MZXA 4G1EB 2GO7A 3BQMB 1K6EA 5EFZA 3WL6A 1G7RA 3EW9A 3TI7A 1IY2A 4BMOB 3MQFA 1XYVA 3IQGX 3TQQA 3ROXA 3I45A 4LDPA 5FRDA 5ITWA 4P3OA 3SG0A 2CV1A 3ENNA 3WB2A 3WXMA 3KEQA 2Z30A 4LSWA 2JIMA 4OOFA 4MAAA 3DPIA 4LV5B 3HBAA 4UCQA 4BLRA 3GLGE 1EFVB 1G38A 1MAHA 1CKEA 4W5NA 1I6WA 2PGDA 3OTQA 4E3WA 2GLXA 1N77A 2CC2A 4QHYA 1KVSA 1SG6A 1TTPB 4L5YA 1CEQA 1N5IA 2X58A 3C4VA 3CPHA 5DWVA 4BNUA 1WA5A 1FL9A 2WYIA 3HNOA 1CHNA 4BMNA 2VH5R 5AM3A 2ZYWX 4S1WA 3L7BA 4MRAA 1XRMA 2PQ2A 1YE3A 3B7GA 1M1NB 2C4TA 3U7IA 4BZZA 5KNBH 1F8XA 1NBIA 2PH5A 3GD5A 4W6ZA 3IODA 4AY3A 4W9NC 1N3YA 3ZW7A 5EN4A 2XYPA 2ZJ4A 2XGMA 1XVTA 1ZGBA 1DWQA 2CBXA 3H5VA 2GD6A 3I32A 2ZDQA 2BUBA 4G85A 4HRAA 2DPGA 2ZOSA 3L7MA 4FDLA 1SUAA 2W9XA 1FUKA 4ZGGA 2BGJA 3M70A 1A4XA 1BVUA 3P0IA 1MENA 3WK9A 4M8IA 4EYSA 4EA7A 4OB8A 3NJRA 5A6VA 1P31A 4KN6A 4XEUA 8OHMA 4DIMA 2X14A 721PA 3LPDA 3RSHA 3WA6A 2ZEJA 2Y27A 1JZTA 3WIBA 5A4JA 1L8OA 2EBWA 2I4IA 2VUTA 2C2XA 2QLMA 1RRPA 3CX7A 4CM9D 4FWTA 4YCLA 1RVDA 4ND3A 5EUBA 4CF3A 4EO7A 1WKVA 3G5LA 4POAA 3VAZA 4RIHA 1XSEA 1T5OA 3BE5A 2C2OA 5AM5A 2W93A 3A3PA 5ARCA 1IBLB 2OCXA 3WWZA 1KPIA 3B7PA 4PX5A 3HACA 4CM8A 4JY7A 2QY6A 4DMHA 2QYHA 4TL8A 3S40A 4H1WA 1BJKA 4NCAA 4NL4H 1GAXA 4KNVA 1AVTA 2FW1A 5DSTA 2DECA 5EMMA 1DXYA 2VPQA 3THSA 4QLAA 1AKQA 1GSOA 3KRTA 4PW0A 2PO7A 3MJFA 1O03A 1X3LA 3NALA 4KO8A 1PWZA 4PXAA 1ODSA 1SB8A 2FSFA 2NZUG 3JYQA 3I2FA 4UHFA 5IAKA 1M0EA 3KYDA 5IDVA 2W2VA 2CD9A 3BSYA 2P9YA 1YJAA 3FOWA 4XM2A 3RFCA 1WZ2A 3ISVA 5T3UA 1I32A 1JZSA 1PFGA 2C92A 3IAS1 4KXNA 3H8SA 3UMBA 3EISA 4A1OA 4IGFA 4R05A 4C05A 2XBUA 2XVXA 4GWGA 3WSVA 2AG1A 2C2MA 4AY4A 5C7YA 3KP1A 3KQHA 1UFQA 3A6ZA 3CGWA 4IIVA 4KCGA 1QMGA 1QIGA 4ZT6A 2NW6A 4M9QA 1Y7PA 3BG5A 2HMSA 1UF9A 3IV7A 1FRVA 2V5UA 4OH7A 1B6SA 3F3KA 2R68A 2WOJA 1SH7A 1Z07A 5JSHA 3C98A 2WIKA 3GW8A 3ILSA 2VDWA 3G49A 2FXIA 2V3CC 3D7SA 5CLJA 2W0SA 1Z0KA 2G40A 3U62A 4OGFA 4OO3A 2A0KA 1Q0TA 1W30A 1N2GA 2PT5A 4RTNA 2YIJA 4JXZA 4URWR 5KDOA 4YT4A 3ZZ0A 4L0MA 4RA9B 1G8HA 2WTAA 4CMJA 2OHFA 2AMLA 1Y1SA 3UIEA 3HUEA 2C0QA 3TVYA 4H17A 2XUKA 5HMMA 3R8FA 4LAFA 1LRJA 3L0PA 1LZLA 3B6IA 1PG5A 4TRNA 2FGKA 1A2QA 4KR6A 4PO1A 1NBAA 3L8DA 5JMTA 3A3KA 3A6EA 3N2EA 1XQ1A 3N8KA 3QQPA 1GCGA 4C3UA 1M1UA 3A26A 3ICWA 3BSFA 4GOLD 1MVLA 3JRWA 4UVGA 3I52A 3OHPA 3EBLA 5E7MA 5IM4A 4ZYTA 1UODA 5AVXA 3OICA 4H18A 4WOJA 3I83A 5FL7A 1Q0ZA 1F12A 1OWLA 3DVSX 2NU9B 1WB5A 1T9GS 5ES3A 5CB4F 1U7PA 3RROA 6CHYA 3KOWA 4G97A 1NQAO 4FI3C 3PWZA 4X41A 4X20A 5AK3A 1E6KA 2W2NA 1I2DA 3UKDA 5IAEA 4PCAA 3OZ7A 3IT2A 5ADUS 4QUEA 3D7KA 2J3DA 2QD1A 4N48A 4C0HA 4DMCA 2D7JA 4CIXA 1KFEB 1TYEB 1KIFA 4OA5A 1GG5A 1O5IA 2OK8A 1XTZA 3E22B 3GDFA 3L02A 3TXYA 4D6XA 1JIIA 2AK3A 4Q34A 4C2AA 4KR9A 1IIBA 2OHGA 2POQX 2GO1A 5I48A 1Y89A 2XWJI 3GFPA 3ZWBA 7REQB 3NNSA 2XUJA 3KTAA 3PI7A 1KAMA 3RSLA 2FMTA 3QPUA 1KXZA 1G6OA 2IXTA 3U4GA 3D6TB 1GZUA 4M9UA 1JHAA 4EEXA 3JQ8A 1RLUA 3FCEA 3MN1A 4FMPA 1NXSA 5LA6A 1K0FA 2W37A 1ECGA 3TLZA 1HE3A 4XFJA 1PLKA 1XDGA 4CM9A 3ICVA 2JD2A 2QI9C 3WKAA 2PJZA 2IPXA 4G5QA 5DULA 1QG2A 4X8MA 1F6BA 3RBAA 4MQ4A 4JI0B 1FDIA 3EG9B 2WVJA 4L9RA 2J3MA 2L69A 2FWPA 2IY9A 3RVOA 4BZWA 3F47A 1HLGA 3IQFA 1E4YA 3AKCA 4KPUB 1FU4A 1R4NA 4N01A 2VRNA 3QVGA 1GIAA 2ZWIA 1DX4A 3X1WA 1PR0A 4M49A 1JAYA 2XWQA 4CKEA 3M3PA 4DYDA 3Q0IA 4JUAA 1ZL2A 4D8UA 4S12A 1LLDA 3HB1A 4MVJI 4C7BA 5EG5A 1M34B 4MUGA 1YZUA 3I05A 3HFGA 5AUOB 5LQAA 1DEXA 1FNDA 3QWAA 4QOJA 1RI5A 4TLAA 3F7OA 1VG0B 2VSOA 1AUVA 3GQBA 3R3XA 5DBEX 4UUPA 3EYAA 2P9EA 2OXEA 2V7QA 2QMEA 3FM9A 3FVVA 2VDVE 5C8VA 3ELWA 4U7TB 2V1UA 2FP3A 5JO0A 3AXTA 4Z3OA 2ZS8A 3OWHA 1SK8A 2QDKA 3QX8A 3O0TA 3OKPA 1KC3A 1BJTA 1TI7A 4OXXA 5JPIA 4EBBA 3PPVA 3TIFA 1P5JA 2VHYA 2CMGA 3DAPA 4PC1A 3T0IA 5E38A 1DJPA 4HLDA 1E77A 3L49A 5LZ7A 5BT8A 2OQ2A 1W2GA 1ISFA 3DHYA 1M2NA 1NVGA 3D7LA 1OPRA 3RUAA 1LI5A 5LN1A 2VTBA 1EEXB 3RBXA 3VRHA 4C14A 2XZOA 1TFRA 1BE8A 2OWDA 3AZOA 5CXSA 1OC4A 2REOA 2AFHB 3A11A 4J0JA 3W0LB 5ELXA 1BQ4A 3DVRX 4MQ5A 3C14C 5A62A 1TEHA 3P32A 4IGKA 1DIGA 1E2JA 2CLDX 2PGLA 2PT7A 3M1LA 1XQ9A 2D1RA 3QFFA 5E3HA 2FMXA 4HAXA 4BNVA 1JDSA 1R88A 3NDPA 4RFSA 3ZNQA 4RTJA 4Z4IA 3K0SA 1GG2A 4M98A 4WK2B 3VGPA 3PA6A 1GQFA 1HX7A 1OZAA 1PT5A 1VTKA 5C3UA 5FWXB 1G8SA 3D2LA 2AXEA 2FKNA 3I9JA 4RELA 2JCSA 1RAFA 1YI8A 2CHGA 1PO7A 2RCYA 4J3JA 4YP7A 1KO4A 3RVRA 3V8RA 4C5AA 4D43A 1XC7A 3ORQA 5DX1A 1UPTA 2HSZA 3N7AA 3QJGA 2BKLA 3T5PA 1HM5A 4QEZA 1ODKA 3LUDA 3SF0A 1JG6A 3FB1A 1C1DA 2ZKLA 1XMQB 2XQIA 4LA4A 2QV0A 4RO0A 1T6YA 1Y9JA 4IH1A 2WWFA 1UDXA 3HWWA 3RDPA 5D84A 3WP1B 2JHAA 4PX9A 4AK9A 2Q8QA 1A9OA 1J20A 1AMUA 1V25A 3A04A 3VO1A 4R2WA 5FFNA 3NTVA 1WZCA 4C4ZA 3MELA 5DM70 1QFJA 3EUWA 4H27A 4YCCA 4C7XA 3DR3A 2WIJA 2ZVQX 4RS3A 5JJLA 4M76B 3N87A 4BCCA 5EZQA 5FOUA 5BSUA 5EY5B 4BVEA 2WF7A 4HPXB 5JSZA 3PC8A 1P1JA 5J3JA 5DNYB 4QGGA 3CRRA 4JFAA 4ZV7A 5IJ0A 1MIOA 5JUWA 4Q1CA 1IYZA 1PGQA 2DQZA 3MS4A 2FPOA 1G1AA 3LA6A 3EVAA 2XF8A 2PCLA 4O4JF 1O1YA 1TJ3A 4TM7A 2BGLA 2IV3A 1D8TA 3GEDA 3OJEA 4WK0B 1GYRA 1XHFA 3BRWD 1A1VA 4GXNA 1R2QA 2Q1UA 2V7BA 3VH3A 4RK0A 2ID9A 1OH8A 1WEHA 1J8MF 1TMOA 3LMKA 3S2SA 3QX9A 1JIKA 2VEDA 4ZPXA 5AM0A 1DWUA 2YJ3A 3EFBA 3HS3A 5HKBA 4H1TA 1JVSA 1XZGA 1G2QA 2HHLA 1TADA 3G8AA 1OYOA 1MO6A 3LC1O 3QELA 2WWYA 1IPEA 4KQMA 4MZDA 3ADBA 2O0HA 1JEOA 2WV7A 3P0FA 1BA3A 2WMDA 3LT4A 3A9UA 1YI0A 2RH8A 3VC1A 1KMHA 3OTGA 4YI5A 4TYNA 2Y1CA 1HSZA 4L5AA 5IK2A 3T7DA 3TBHA 1C80A 2C2WA 3WGVA 3OTHA 1BA2A 5EGSA 2ZT5A 5DHSA 5KX5B 2I9PA 4XRGA 1IBKB 1SU4A 3PQ3A 1U7TA 2OLKA 2DF8A 3LVRE 5KJCA 3IVMA 3NBXX 4XGKA 5F64A 2X4IA 1TZKA 4QE3A 1GTL1 2GVDC 1H5UA 3LQRA 4YIHA 1KI1A 1IZ7A 3EWIA 2QMHA 4JA2A 2EX1A 4PPGA 2QTMA 1UC8A 3T1YB 3DCJA 3H3FA 3WGKA 3W6ZA 4BZXA 1W581 3FGPA 1K08A 3GCGA 4KZPA 5EHQA 3DZDA 4BQRA 5F35A 2XVYA 2IPNA 2XYQA 1GGFA 2EJCA 2X4DA 1ZIPA 2CB9A 1LW7A 3KWLA 3OU6A 1T9CA 4FQ7A 4B7AA 3E8MA 4BVBA 5LMCA 4OFZA 1FSZA 3QUTA 1U31A 5E3JA 3WOVA 3CTMA 1BXRA 1XWWA 2VAVA 3B2QA 3K72B 2FAXA 3OY7A 3SEQA 3T61A 4KBFA 3P2EA 3UXHA 2NO4A 2IYQA 1KS2A 2BN4A 2B8TA 4BVGA 1BS1A 4LGYA 4LMBA 4PAQA 2PKQP 3OQVA 4PONA 3WLSA 4B7CA 4CIDA 4EY7A 1G2OA 3LJKA 1KTIA 1E1MA 3PJDA 3LSYA 4JKIA 3FMOB 3C5CA 1LQUA 1VL5A 2JFGA 4LJ7A 2ZRLA 1GEEA 4KRGA 1QHFA 1DNPA 1VFNA 1YJ8A 2KX7A 1G8PA 2GJSA 1TM3E 1GLNA 4C0SA 1T1SA 2YWGA 4Y9SA 5I7HA 1TOAA 2PV7A 3GFTA 1Z7YA 2LR0A 3U31A 5KDDA 1P1FA 3GLFA 221PA 1CR0A 5B58T 1NKSA 1P9RA 5LD2C 2IYFA 2P5UA 4QXPA 3SKXA 5C4MA 1V8DA 1CT9A 3GV0A 4K9NA 1I7DA 1ZSNA 5ALUA 3PPXA 2BZ0A 3H1BA 2C04A 2IE8A 2MSLA 3ELBA 1FXWF 3DBLB 3A1UA 4Q00A 3DAHA 4QBHA 1KBZA 1WEKA 3LUJA 1TLFA 5C8DA 2AK2A 2JIOA 2ZB3A 1OVGA 2QD5A 3UYKA 4DARA 5CG2A 4RV5A 3EULA 5CIWA 4ZXFA 4MVJG 1RKVA 3NHMA 4NJMA 4HQ0A 5J23A 2IKSA 1KF0A 2OD7A 2QUKA 4IM7A 4K28A 3WAJA 1V35A 2FZLA 3M4ZA 4C06A 4PIVA 3JXEA 5LR6A 3RS0A 3DFIA 2AJCA 3GPBA 4TYQA 4QU8A 1W4ZA 3PGVA 4RMJA 5AKIA 1JHOA 1VG8A 2CSUA 2J6IA 1KHTA 2OCBA 3ANXA 1SVUA 2GJ9A 3M1IA 3PCXA 4NF2A 5C8YB 5AFSA 5DMXA 1OWOA 1SUWA 4R2XA 4BASA 4MO9A 5G3ZA 1Z2DA 2ANCA 1W36C 2GCIA 1EB9A