5B1EA

Crystal structure of proteinase k from engyodontium album
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proteinase K
publication title Crystal structure of proteinase K from Engyodontium album
rcsb
source organism Engyodontium album
total genus 102
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5b1eA00
1SUAA 5JMOA 2PKCA 3GCWA 3HJRA 1R64A 1S01A 5ARBA 1PJ8A 2SNIE 3LPDA 4RYDA 1SUDA 1Y3CE 3A3PA 1YJBA 1SUBA 1Y4AE 1SELA 1BJRE 1Y4DE 3QTLA 1AH2A 1DBIA 4HX2A 4CFYA 3BPSA 3CO0S 1P7VA 3Q40A 3I34X 1KDVA 3VHQA 4OMCA 3BGOS 3DVSX 1TM4E 1SBIA 2ZWOA 1TK2A 4KPGA 4HVLA 2X8JB 2HPZA 5SICE 2G4VA 3VV2A 3DE5X 3LPCA 1SPBS 3DE2X 3DE3X 4C3UA 2SBTA 3A3OA 1SCNE 3DW1X 1PTKA 1SCJA 1WSDA 1Y3FE 1AQNA 1C3LA 2E1PA 1BFKA 1LW6E 4I0WB 2DUJA 2B6NA 3I2YX 1SUPA 1GNVA 1C9JA 3WIUA 3WHIA 1SCAA 3DE1X 1Y48E 5JXGA 1OYVA 1AVTA 3I30X 4KG7A 4DZTA 4GI3A 2DQKA 3P5BA 4LVNA 4FONA 3PRKE 1P8JA 2Z30A 1DUIA 2ZWPA 4DJ5X 1OYOA 1TO2E 2ST1A 2ID4A 2W2NA 2WWTA 1KDZA 3QFHA 1A2QA 3CNQS 3Q5GA 1C9NA 3ZXYA 4DWWA 1Q5PA 2SICE 3AFGA 3A3NA 2PRKA 1AV7A 5JXJA 3EE6A 1Y3DE 1SVNA 1MPTA 2IXTA 1GNSA 1TMGE 3LXUX 1ST3A 1TM7E 4H6VA 3L1KA 1SUEA 5K7SA 1PFGA 4ZOQI 1T1EA 2TECE 2Z2XA 1SBNE 3DWEX 3WIVA 1TECE 1BE6A 2Z57A 1WMEA 3WQBA 3DDZX 4WOCA 1Y1KE 1GT91 1T1IA 1V6CA 1WVMA 2Z2ZA 3TECE 2Z2YA 1SBTA 5I9SA 4YN3A 3I37X 4NMXB 4J94A 4CG0A 1IC6A 5FBZA 1EA7A 1TM5E 1AU9A 3GT3A 1THMA 4AKTA 2V8BA 1GTL1 3BX1A 1S2NA 1SH7A 4MZDA 5AVKA 1MEEA 1KDYA 1JEAA 2QTWB 5B1DA 2GKOA 2ZRQA 4B5LA 1Y33E 3DE6X 3DE0X 3LPAA 2P4EA 1S02A 2Z56A 1CNMA 2W2PA 5AMXA 1IAVA 4NE7A 5ARCA 1NDUA 1PEKE 2DP4E 3D9QX 4M1ZA 1V5IA 3UNXA 1WMFA 4H6XA 4AKSA 1BE8A 3AJ9A 3VYVA 2PYZA 2Z58A 1UBNA 3H42B 1GTJ1 5ARDA 3F49S 1GA6A 3GCXA 1AF4A 3VSBA 3DVQX 3VV3A 2PMWB 1C9MA 3EIFA 3GT4A 3PTLA 3DE4X 5AVJA 2PWAA 2W2MA 3DYBA 1SBCA 4C3VA 5CW1A 4KB5A 2XRMA 1GCIA 5JXIA 1SCDA 2ID8A 4LVOA 1NLUA 1SBHA 1AK9A 4ZARA 5FFNA 1Y34E 1VSBA 1SIOA 2HD4A 3TI9A 2PWBA 4OV6B 4OMDA 1SCBA 2X8JA 4CFZA 3SICE 1YJCA 2SECE 1GTG1 1SUCA 1NDQA 3F7OA 1ST2A 1R0RE 1BFUA 1SN7A 4H6WA 1WMDA 3DVRX 3SQOA 3T41A 1R6VA 2W2QA 5JXHA 2XTJA 4JP8A 3EDYA 1P7WA 1GA4A 1ZVKA 2W2OA 5B1EA 1Y9ZA 1CSEE 2IY9A 1TM1E 1EGQA 3TI7A 1GA1A 1KE1A 3VTAA 3D43A 1T1GA 4NE9A 1YJAA 1ZVJA 1OT5A 1TO1E 2WUWE 4BWGA 3OSZA 4Z2AA 1TM3E 2PQ2A 5FAXA 2WV7A 1XF1A 3AJ8A 1Y3BE 3DE7X 1KE2A 3F7MA 3QMPA 2WUVA 3ZXXA 1SIUA 1SIBE 1YU6A 4K8RB 4WOBA 3DW3X 1BH6A 1HT3A 5AQEA
chains in the Genus database with same CATH superfamily
2NVUB 3OPVA 3HADA 2G0AA 1DJOA 2G1AA 3HDJA 3O94A 1HE1C 2C2HA 4ZVSA 4KQ9A 1VB3A 2D5IA 2PKCA 1E8DA 3HJRA 1OU4A 3HHPA 5DWQA 3VX3A 1U1EA 3HP1A 1JB1A 4XKJA 1CNFA 3M6VA 4FZVA 3H5NA 4R8RA 2FPKA 1NXXA 2O2JA 4GR5A 1R4MB 1Q17A 2VWPA 2WKSA 4PBSA 4C01A 4XEHA 5AKIA 4DEYA 1MZPA 4J0HA 1IN6A 1SUBA 5KX5B 1BGXT 2FE1A 1EFDN 4INPA 2WINI 3RYCB 2CSUA 3PQDA 1H8EA 5IH3A 4EQZA 4MPPA 5BXYA 1V8DA 4NQZA 2ZYHA 3L1JA 4HUQB 2IGTA 3KLPX 3ROEA 5K6RA 3AJEA 1D1SA 4YFYA 3U81A 5C8YF 1K63A 4MCJA 1YFZA 4XWGA 3OQIB 2WEKA 3HN7A 4CW7A 3OCZA 3CO0S 4URUR 2HJHA 3ROQA 1ZCJA 3RFTA 3TD2A 1XVTA 3V6MA 1SHTX 3I5YA 4AZ3A 2X0RA 4QRDA 3WZLA 4EJFA 2KJQA 1XC7A 3DKKA 2Y1CA 4ZAGA 2FPGA 5G2OA 1YZGA 2HLHA 3NHFA 4J29A 2CV0A 4U6SA 3QBEA 1V16A 1TK2A 2ZBDA 2O7NA 4Q05A 4TSRA 4HVLA 5B64A 3T8YA 2HPZA 2Y67A 3TMKA 1XAGA 3UXYA 1JT9A 1V4NA 5DSZA 1VL2A 4F2PA 2GBFA 2IPLA 3JQCA 4WNAB 1ETUA 2QRUA 1LDGA 1P0FA 3C87A 3F3KA 2PLAA 3K16A 1B0AA 1IXSB 1ITZA 3NJRA 1TGYA 2F3UA 1SPBS 4G26A 1M3SA 5DK4A 2W2LA 4DG8A 3BMQB 3PVSA 4AO7A 1GZSA 5IUJC 4ZALA 4FOPA 1YR3A 3ESYA 3RU3A 3WGUA 4FDUA 4PSCA 4X1YA 4RKWA 5KNBD 4PS0A 2OG2A 3ZU4A 3I8XA 1BFDA 1W581 2EFEB 2RI6A 3ACDA 4K26A 3GFSA 4M8LA 4OK6A 3WOHA 1O94A 4EHAA 2ZTVA 3E48A 1SXJC 3QEJA 4JOQA 1RD4A 3EJ6A 3RUCA 3VU9A 1IQPA 2NXJA 5AH0A 3UHFA 4BVKA 3HYLA 5B3KA 5C7IO 1QGED 2EQAA 3ASVA 3KVRA 1ZJ5A 4RUKA 3DFZA 1DQRA 1R6XA 1Y4SA 2B0JA 2WM3A 3BRQA 4GG1A 1S3GA 1R8SA 2IYRA 1ML4A 2IVFA 2A7QA 2BTOA 4G81A 2ZAIA 3QVJA 2WUEA 4ZJPA 3EIHA 2P9JA 1R50A 1B1AA 1TIPA 3JALB 4G86A 2WTNA 3S0JA 4LI3X 3MGCA 2E9SA 4GXQA 3I5UA 3OZFA 1JHXA 1DRWA 1MX1A 1X7DA 3UGJA 4QM6A 1MAVA 2PKXA 4DDTA 2E4YA 4A2PA 3S81A 2FEXA 4MLDA 1FDVA 1JBQA 1QG0A 3DZHA 1KJWA 1XZKA 3N8NA 4L4XA 4EY4A 5IN4A 4LE0A 4U2CA 2XQGA 3KQMA 4LV6A 4O4HB 1J2JA 2XMQA 1RMQA 2XXAA 3JQ6A 4RGVA 3S2YA 3DR3A 4J4HA 5ECGC 4EUNA 3EISA 4QO7A 4ZFNA 4Y2HA 2E1RA 3U49A 2YRWA 3FDZB 5KWEA 4KFRA 1T25A 1UR5A 2H2IA 4XM2A 1ZK2A 2QG4A 4O02B 4R1UA 5IC5A 4EB8A 1L3IA 3R9XA 3T1QA 4DJ5X 2OM2A 4XQ9A 4KE7A 1WXXA 2Z3ZA 4FZRA 1MGOA 1MR3F 2PAFA 3KELA 4KSYA 3M81A 1TEVA 2QYTA 3MQFA 3TD9A 1QFMA 3DZFA 3O31A 4ZOLA 4G5GA 3WA7A 1X8XA 2Y0DA 2WWTA 5JDIA 3VOTA 5BYBA 3IPRA 4GKBA 1NJGA 2JIOA 3LSYA 1XL1A 4FGWA 4XX0B 3LKDA 3Q8LA 3ILXA 4DJEC 1JDUA 1Y9EA 3O1IC 1MRSA 1L7VC 4CCYB 4EFKA 4YRZA 5KVQA 3HM9A 1EAMA 2X3YA 3BF8A 2GN1A 1J56A 1XD2A 4J16C 2WJWA 4NWIA 3FG9A 3E15A 3ZHQA 1CUEA 3I2GA 4DV3B 1SD5A 1P7CA 3O8QB 2G9QA 4HAUA 3HVIA 2CL6X 4OHFA 5F3RA 3CUYA 2Q07A 2WM2A 3NP7A 3PCXA 2BE9A 1MQ8B 2CHFA 2I8CA 2UZ1A 1L5ZA 3JR3A 1GG8A 1YDHA 3O91A 4UATA 4MWOA 1JE1A 4RXTA 4Z1MA 5AW1A 5FWXB 1S9DA 2IUSA 5AESA 1RQNA 3EPJA 4KE8A 1I33A 4OYRA 3AHDA 3VR2A 4G0MA 4TRRA 5EIBC 2YWFA 3UGQA 1ID1A 4WY5A 3WRVA 2MSWA 1MG0A 2O2CA 4ZT3A 5IKMA 2UYHA 5HS6A 2R65A 3VQTA 1G5TA 1KJ9A 2PUWA 4EZBA 3OLCX 1B8OA 2VAVA 3TFOA 2EBUA 1TRHA 1XQWA 2AKYA 4J9VA 4KPUB 4WKBA 5T8KA 3TOXA 2IX3A 2HRRA 1L4KA 3ZX5A 3Q7PA 2A92A 3IE0A 1KEWA 4OYLA 5I8WA 4OXKA 2A5LA 3H4VA 5JATA 3YASA 4TLBA 4N5MA 3LZ6A 2R47A 3H87A 2IITA 4FLMA 4Q4AB 4DGQA 1MG5A 3ONNA 3EVBA 1VFPA 3SZLA 3M9WA 2GNOA 3KBOA 2ZB8A 3NFRA 4D9NA 3CRZA 3B9QA 1ZR4A 3UBMA 3IFSA 2C9YA 4JFAA 4JP3A 4LDZA 2HK8A 2ONYA 1C7ZA 2G6BA 2WAYA 5DEOA 4BZZA 4LZOA 4URXR 3UN1A 1TT7A 3AKEA 3L1VA 2VK4A 3DLTA 3TK1A 3DDHA 4RPLA 1X38A 4YP5A 5JD5A 4AJOA 1OVGA 1YQDA 2FN4A 2JFUA 4NCJA 1R8QA 5IAGA 5LDGA 4AD8A 5LNK1 2ORVA 1JDBC 3H1BA 3WRYA 3CNOA 1ULTA 3MJTA 2A1UB 2CV1A 4DSAA 1E66A 1DO8A 1EGHA 1FP4A 1ZIXA 2AA3A 2Q3FA 5CB4F 1ZWLA 4RHXA 4AUNA 5BW5A 1C8LA 1PJAA 1CG6A 4CF4A 1E3WB 3L4SO 1I4WA 1E8NA 4UU8A 5B1HA 1MA3A 3EZNA 1V3QE 3NBAA 1E2BA 2OLEA 4INZA 4G24A 3E4CA 4IXNA 4WJLA 5K0JA 1AHPA 5HWSA 4IINA 3QWAA 2R8YA 3QOWA 4ZKEA 4BASA 2QX7A 2ZQZA 4IPTA 5I9IA 5B30A 2R84A 1Z29A 2GK6A 2HX1A 1G8FA 1P9WA 2ZYWX 3IJ5A 3ZHVA 4ZI7F 4WKOA 1EWYA 3KWMA 2O7RA 3R9WA 5L7YA 2GHQA 2FZKA 3RSZA 2VZ0A 5C80A 3CUWA 1NC3A 1JA9A 1OQAA 3W78A 4LY3A 4MKIA 3Q1KA 3HWWA 3L6UA 4Q4CA 4LBVA 1XIVA 2WMNB 3KB6A 1LI7A 4W7IA 4WD3A 4E03A 4YT2A 4WY2A 2B1RA 2C9OA 4X65B 1L5VA 4F96A 4NULA 3W4JA 1EFVB 4P32A 4MJLA 4G63A 1N6RA 2ODAA 2NPFA 4PLWA 1YB6A 4BO4A 2HEGA 2QXUA 1SH7A 3LZCA 4TSKA 1YZ3A 4MR9A 1OJ7A 3KZXA 3SBOA 1NJ8A 1HEUA 4DC1A 1KMMA 3DFIA 4E33A 3Q3IA 2VF2A 1FLDA 2VDWB 1UWCA 1Y7HA 3AHIA 1WSWA 3GJQA 4BWYA 4XM1A 4LSZA 2CB0A 1UKBA 4R01A 3GBSA 5BRJA 2XH8A 1FP1D 2AEJA 3EQ7A 1NN5A 1LGYA 1VC2A 1A4RA 3DOJA 3S1AB 3ORYA 4L50A 2UYQA 2VYVA 4YREA 2LDXA 4DMMA 2AWOA 4UDYX 2NZWA 4O2LA 3E5HA 1GSOA 4B5LA 1DJLA 2G40A 2IQ5A 4O1MA 1Y33E 3G0GA 2WQ7A 3ADBA 1RFLA 2PV0A 4DJTA 2W6NA 4XGQA 1JJIA 4LHXA 4Z4QA 3JRNA 2FN7A 4KRYA 3LY9A 1LRJA 3NG1A 5MF6A 2F43B 4U7DA 1FZTA 5FOXA 2IU0A 4QFBA 4XGKA 1P6QA 2IDJA 3H2JA 3Q72A 1M2VB 4G9BA 4MDHA 3RWOA 2C83A 4D2IA 1QK5A 5M5BA 2JFFA 3CRNA 3ZE7A 7YASA 5JZSA 2XOEA 1SWWA 3UHAA 3P9CA 3RFCA 1G98A 2IEIA 2X5NA 2PM8A 2PGAA 3LJKA 4Q7LA 5JYEA 3P2YA 3PFIA 3H1GA 4HD8A 5F7JA 4KWEA 1XTRA 1KSFX 4IVPA 1C50A 3D9QX 3WB1A 3NORA 2NUAA 3QSYA 2P5SA 3SF8B 1UBEA 4U39A 1XHEA 1U0FA 3L6CA 3ND6A 3IIKA 2PH7A 3ZR4B 3TRFA 3K70B 3R7NA 4H6XA 1Q50A 2PKYX 2VHUA 3EIEA 4A5OA 4TXHA 2HHCA 4L02A 5AKZA 3DV0A 4L6CA 3I92A 1GKYA 2X76A 2WYOA 1F2TB 3PJRA 3UUGA 1HNWB 4GPTA 4PRLA 2PAAA 1YJ5A 2A0FA 4PYKA 4TV8F 1E0KA 3OO0A 1E9RA 2ZRGA 3RSLA 1C1DA 2X77A 3G0BA 4COKA 3O1LA 3ROXA 1AF4A 2HC9A 2DFDA 4LX8A 3DVQX 2IEBA 1JHPA 4WXMA 3GLQA 1XCJA 2XQJA 2ZW9A 3GT4A 3EOAI 3FTQA 1F12A 4H3HB 4QTUB 3ELBA 4O5AA 4BO5A 3KS9A 4J3FA 1ZKDA 2ZAGA 3TUIC 3MCAA 1PVVA 2C5EA 2Z5VA 3QFTA 3LCRA 3SCZA 4F2GA 1Z5ZA 3QBJA 4C3VA 4DAOA 3JRXA 2CYCA 3PJGA 4XEUA 2J7PD 5EJMA 1KMHA 3RS0A 3RAEC 1RZ3A 2JDID 5F77A 3I73A 3RYFA 1BXKA 1UWLA 2RHTA 4K28A 2FR8A 4F4CA 3OOWA 1C8BA 1DLJA 2GCGA 1KAGA 1N9GA 4EQ6A 4EHNA 1SVIA 2E55A 2CDCA 2FWMX 2JLQA 3BRWD 3R8CA 3NHKA 3EYWA 4S1OA 1AK9A 2O54A 5CB0A 1L5LA 1B8PA 1GGKA 4MA0A 4P6VF 3C5CA 4ERNA 4DSZA 3FNHA 1VB5A 2CUTA 3FB4A 4HRXA 2X7JA 4DMHA 1ODJA 5G0VA 4DF3A 2AXNA 2H08A 5EMMA 5CDGA 4IY1A 3K70D 3Q3CA 1E2IA 2G28A 4GNKA 4DA7A 4FHGA 1QDUA 4C5BA 3IL2A 2QEQA 1CDOA 3DBVO 4O2AB 4TTVA 4AJKA 5KOYA 4ZPJA 3IDAA 5CUQA 3FLBA 2BSAA 1F5SA 1LK7A 3FFBA 2D0IA 2HRDA 2NTYC 5KTRA 3AUAA 2QZ4A 3O1HB 4RTMA 5K0CA 4M8NE 3HC7A 3D81A 4FDAA 3ZQ4A 1PV2A 2HPVA 3ZI4A 3ZWCA 1H8HD 3SY8A 1QYIA 5CNJA 4TL8A 2QYHA 2HGSA 5EJFA 2JCSA 3RSCA 2I2WA 1RKUA 4CUZA 2C07A 4FYHA 1CEQA 3WWPA 1VL0A 5ALMA 4O08A 2FE4A 3C3CA 4YK7A 5LD2B 3EBOA 2CMHA 1J0XO 1JSXA 1BHO1 2PO5A 3L0BA 1JZQA 5IDVA 5A2QA 2YVQA 4TS1A 4ZYWA 2HKIA 3CHYA 2JGRA 4KXUA 2EZTA 3T3GA 4HVTA 1U7TA 1Z7BA 1X13A 1D0VA 4RVHA 1Z62A 3DFMA 4R68A 4KQIA 5DM60 4Z7NB 1CJTC 4IIFA 4IIBA 1FFSA 2AC7A 1RQPA 3DVRX 1FTQA 3UJNA 3R0JA 3VGJA 1M2JA 2JD2A 5CX4A 4A4DA 1NFFA 2O1EA 1A8HA 3PS9A 1YONA 5SV2A 7AT1A 4M3NA 5DH9A 3IR7A 3B9PA 3D0RA 1VLQA 3HBLA 3FPLA 5AUQA 4DNPA 4HH0A 3KTFA 3G68A 1KSJA 3EDMA 4LQCA 5LP1A 3UT5B 1D2MA 5HW0A 2H16A 4O8CA 4I4TF 4KITB 3OLWA 3IELA 4LC0A 2B78A 4US0R 2BC9A 2AXQA 1R0XA 1P5FA 1V1MA 1XU4A 1TM1E 3DL2A 3JWHA 5COBA 3RYHA 4C1BA 3I2IA 3E3OA 1MQAA 3MA0A 2SKCA 3I6QA 2WIAA 3BUSA 3MS2A 2GHRA 2PMBA 4Q82A 5JAIA 1NN1A 5I5GA 3ZYZA 2X0FA 3WWZA 2EKBA 3KPWA 4TQGA 3AI2A 4UM5A 4UHKA 2V0NA 10MHA 4CEJA 1HQCA 3U09A 2E4VA 4XPIB 1RPAA 1AKNA 2ZBVA 4BRSA 1XKQA 4Q4JA 1NW3A 1OGYA 4FHFA 5EWLB 3P4XA 1OKKA 3O3NB 2WUWE 4UM9B 3AWIA 1NMSA 3OCCA 3ZIUA 1NJ6A 1L4HA 4BTEA 3QXCA 1D4FA 4XZ3A 1TYEB 2PQ2A 2ZDGA 3PX7A 1N6IA 1NV9A 2ZVPX 3AW9A 4CR8A 2DEUA 4NCHA 2CHUA 1L5QA 4TRMA 1V47A 2R6ZA 1VHQA 1A82A 4EHFA 3UJ9A 3GUVA 1SB9A 2YDYA 4ZT4A 3VKWA 5HJ7A 1EDDA 2IL1A 2QROA 3EDQA 4EAQA 5BYJA 1D5WA 1NRWA 3P8ZA 2FK7A 4BFZA 5L3SA 4ECAA 4P4SA 1L5RA 1GDDA 2GPBA 3C0KA 4V2IA 1NUHA 3D7RA 2FSVC 1YTUA 1C3JA 3N7UA 4TQAA 1B0ZA 2A88A 3QVSA 5CIQA 4HBZA 4RK5A 4CIYA 3ZN2A 2V1UA 2QN7A 3DHVA 4KO3S 4GU5A 3ECAA 1XTPA 1OJLA 2XLCA 1X19A 3C74A 1V1JA 3G2LA 5G4LA 1WD5A 2RHMA 4D9GA 5KQMA 5NULA 1SCUA 2AG5A 3Q4GA 4JLDA 5TQ0A 3OPXA 3PQFA 1UPCA 1R64A 3OZAA 5D6OA 1PUIA 5ARBA 2XT6A 3ZDYB 1JLRA 3DOUA 4HGRA 5A4DA 1WLYA 1RJFA 3Q2OA 2JJ2D 2I03A 2OOKA 3BXEA 5CLIA 4PG8A 1Y3CE 5BNWA 2V3CC 2ZRMA 4RS3A 3KEFA 1A4UA 4HTFB 5EJ4A 2JLRA 1ISFA 4HADA 3HG7A 3NC4A 4UE3S 5BMOA 3QI7A 1Y4DE 2LKDA 4H7EA 4UM9D 3LLUA 1R4ZA 2E6KA 2RG1A 4RTRA 3JQ7B 2M1ZA 2X0EA 2X23A 4NBRA 1WF3A 3N2GB 1SURA 4N03A 4OUKX 3P9PA 1YAHA 3TB4A 1W76A 1DIHA 3UB2A 3QMWA 1U63A 4KRGA 3FR8A 5IHPA 1RC0A 4U5XA 3V80A 3BMCB 3UICA 4PNHA 4ZO6A 1Y8QA 1NR7A 2D2FA 4WX2B 5G0TA 3M1IA 3ZVLA 3A9UA 1G42A 2I7VA 2XCIA 1C1YA 3RBAA 3H8VA 3SF0A 4KQFA 4L07A 4B4DA 3OP1A 4LMAA 3N5KA 4JITA 1FMJA 3W6PA 1BN7A 2UYGA 3FHCB 2G1UA 2GF2A 2OAQ1 3O8DA 4BVBA 4P2GA 4ER6A 5CXQA 4EGSA 4NLLA 3QNMA 3KPUA 3CKKA 3UCXA 3WYAA 2WZQA 3VV2A 4BX2A 1U0EA 5DLYA 3GXBA 2GD1O 4DXHA 4UDNA 1JZSA 2WW8A 1WMAA 4BP3A 3KJQA 1ZR2A 5EINA 3QPWA 3B38A 2FH5B 3DE2X 3LUBA 4IR7A 4QOEA 5ELXA 3EXHA 1NXTA 3LFUA 5B3JA 4I6JA 5DO9A 3PXGA 3KDSE 1J2YA 1MW9X 1CCWA 3W7AA 3GLHA 2PJZA 4N0DA 3VH2A 4OH7A 1CR1A 2W4IA 3FVQA 3MRVA 3PHGA 3UMSA 2PZEA 2GPAA 3ICPA 1IULA 1RACA 3REOA 3WGVA 1KQFA 3HKEB 3DFFA 2G07A 3KDPA 4FR2A 1RXVA 3V3TA 4TMVA 3KV1A 4NBLA 4Q7KA 2WJGA 3U4AA 2YMLA 1YNSA 5DYWA 1Z68A 3ADCA 1RWBA 4GT1A 4YY3B 3ABOB 1UMDA 1CJCA 3AOEC 3LYUA 4C7VA 3ZY2A 2FYTA 2H1FA 3CLUD 4YT5A 4MWTA 3SDSA 5DMXA 1T5OA 1YZUA 3L6DA 3QK7A 4ICIA 5TQ2B 4G9GA 3WIUA 5AKKA 2Q2WA 4BLSA 2ORYA 3DBHB 4CLOA 1CVLA 2XWQA 3IHTA 5D3ZA 4X62B 1ZIOA 3RYTC 1CRLA 1Y48E 2XQFA 1ABEA 4MDYA 3DDCA 2Q5JA 5JNVA 2HA6A 4OG2A 4DFDA 3O4JA 2VUHB 4B6EA 4JKOA 5DX1A 3GLIA 4KG7A 3TTYA 1TJ5A 1VBMA 4KX3A 2GEBA 4HEJA 4V03A 4ZGWA 1NVGA 4HS4A 3H5VA 1N8NA 5DHTA 1QMGA 1UBMS 2PIAA 5AI4A 3VKFA 1KJZA 1XRJA 3BJIC 1Z0KA 3GZ4A 5U9CA 4YO8A 3K9NA 4H7FA 4X90A 5C5DA 2VDRB 3NHLA 1WW8A 4TRJA 1A8UA 3SQWA 1TU3A 2P6UA 3SJUA 2WWRA 1PT7A 3O90A 3TLJA 4BGDA 1G20B 2QUAA 4L3VA 1JDVA 1PEDA 2PKWA 2Y2VA 3ANTA 3UHOA 2XKBA 5KINB 2ID4A 3L92A 3QF4A 3TM4A 3L79A 1JWAB 3AXSA 2Z1MA 2Z0MA 5L53A 4DSNA 3UFXA 1YVPA 4ZANA 2Y4OA 5BMVB 3Q5GA 3ZDAA 1OAKA 3PUHA 5J59A 3WK6A 2MSKA 1N6OA 2FW7A 3ZXYA 5CDFA 2WKQA 4JJ8A 4QOJA 3UCEA 2O9JA 4CKXA 3N6RA 5HSGA 5JBNA 4CDNA 3NVMB 3QLVA 2YIVX 1CVIA 4D0SA 2F59A 3A2NA 4XYBA 3CVXA 3SZMA 3RLIA 5IULC 1YS1X 4F71A 2P11A 2DSNA 2GHIA 2NZYA 2VTDA 2JFGA 4J7XA 4CKEB 4FMBB 2INGX 2A1TR 1CUSA 2JRCA 2QR3A 4FWBA 5KAMA 1RC8A 4B2IA 5HKAA 1P3JA 5GIOE 1MXHA 5IDXA 2B25A 4PPYA 1JEQB 1HLDA 3CVJA 3SAJA 4P53A 4NSNA 5KMGA 3HK2A 1G6KA 3PDCA 4UMEA 1M9NA 4XSHA 3W34A 5IF3A 4RE6A 5KBYA 2X9LA 3CLTC 3EW9A 1T5IA 3CH6A 2ONKA 1ST3A 3ZIAD 5EQJB 1AKEA 3E05A 2JRLA 3BGIA 1QH1B 2XUJA 1BAPA 1VE7A 3L1KA 4HH1A 4BV2A 1Q1BA 2JFXA 2H17A 3S29A 3ETGA 4XWOA 1OB2A 1PFGA 5JBQA 1BDIA 4DQKA 3UATA 4EMTA 2Q5EA 1E8MA 1IY0A 4B3GA 2BMAA 5CFZA 3BWVA 2C96A 1XJCA 4HFMA 1NQXA 2DKFA 4XPZA 4Y6QA 2QOEA 3MG9A 5FWYB 3SC4A 4CKWB 4EHLA 1FDTA 4G25A 4AN4A 2MINA 3LC7O 2HIMA 3IVMA 2AB0A 2VKTA 4OHCA 1VOTA 3WXBA 3KETA 3QX7A 1VI5A 4CRWB 3FBTA 3ZUGA 3ONVA 1JB9A 3NDPA 4RZUA 3USCS 3VR6H 6REQA 1J33A 2LBPA 3CZ5A 1JKJB 1OA0A 3TSWA 3I23A 3Q98A 1OX5A 2QT0A 3WQBA 4LFAB 5HF8A 2GNAA 4JYZA 4Y2SA 4F0JA 2EARA 3UYKA 4MULA 1LU9A 1TDJA 3WJ2A 1S4MA 2UUCB 3A9TA 1YULA 3NIBA 5H3HA 1K2WA 3V4VB 4J1QA 3TKLA 4FYJA 4PFJA 2RGNA 3I28A 2Q5QA 3MW8A 4IF6A 1D2EA 1IHDA 4U02A 5DKFA 5LQSA 3REQA 5HPYB 5DNWA 4CBVA 5CFQA 2A14A 2WIDA 3WOVA 1KF0A 4CLDA 1Z0JA 5EJ9A 4IEIA 2Z04A 3NTRA 2Y71A 5FYQA 4Z7OB 3GZNB 1TKRA 3GVPA 5KYGA 5JH7B 3FROA 2VIIA 2C84A 1QKKA 2XB8A 2YXPX 2HLDD 2XDWA 4WOKA 2P8JA 2BWJA 1FFYA 2P2SA 5IRCD 4GZ6A 3GT7A 3U0VA 3SJ7A 1AU9A 2IYAA 4KH1A 3D6AA 1VCHA 4A6EA 1MEOA 1X1DA 2HSGA 3Q3HA 4YJHA 2GCNA 2O59A 1NU8A 4IHJB 2VPIA 3KOUA 3SHTA 1XDZA 3GIWA 5EIEA 4HAZA 1BQEA 4P84A 3CX8A 1T8YA 2ZUBA 3KL4A 4Q9IA 3AUFA 2VBGA 1H2EA 3NBUA 4UVDA 2WF9A 1JL3A 3AIIA 5HIAA 5KJCA 2QL6A 1YBAA 1TT5B 2C00A 2A8YA 5K3CA 1KEZA 5I8PA 1RI2A 1XT6A 5CITA 1PS9A 1E2DA 3IUEA 3MTIA 3NV9A 3UOAB 5AW6A 1E3DA 4E5MA 2CD7A 2YW9A 3IYLW 5K6TA 1KPGA 3C5VA 4D79A 4UZEA 1RNLA 3BSFA 1GTZA 4DMCA 4EFNA 1N3BA 4JL5A 1E6KA 1TTQB 1SU7A 4DS3A 4UFPA 1N5IA 4S3MA 1VGQA 1WHTA 2WMDA 4L74A 2GCOA 3OICA 4EY5A 5TB5A 5BN3B 1N34B 2ISSD 1HM5A 2L2QA 3Q6IA 1SC6A 3UKOA 1VIAA 3A1WA 1T5SA 3EA5A 2QKYA 4F91B 4NU8X 4XYLA 1Z83A 4HB2A 1DBSA 1AKRA 3WL7A 2GETA 3OURA 5K6AA 5FNVF 1K27A 1Z0ZA 1H4VB 2ODTX 2DX7A 1FLAA 3A4TA 4LI0A 3S3TA 2GESA 1JDZA 1L6RA 4JNCA 4M88A 4ND8B 1K8ZB 4UBIA 3IKVA 3GLHE 3MSXA 4XOIA 4A8HA 3ECSA 3SXUB 4JI1B 1L7QA 1RBQA 2PGJA 3VBCA 3VR4A 1L4MA 3AZQA 3OECA 1UBTS 4PX2A 5E4FA 1NT4A 4AF8A 3NBYC 3ESZA 3UNXA 5A9RA 4N8DA 2V6MA 4HDNA 2XCSB 1WMFA 1E98A 2DH5A 3R3HA 4GOLD 2Q99A 3U31A 1NVEA 2IYEA 3KKEA 4DILA 2GN4A 1RWWA 1H0SA 1CEXA 2GN6A 3FBGA 3HI4A 3ZJYA 4YCSA 5CBPB 5KOHA 4O4LF 5EMHA 2I3GA 2D2XA 1LX7A 4M9XA 5G0UA 4LF6B 1DKRA 2W93A 4ZQFA 1DOAA 4RF5A 1UFRA 3LBIA 1ZD8A 5DHFA 1H1DA 5J5CA 4F5EA 3VSBA 2DBZA 1NVDA 2PDAA 2J0UA 3DB2A 4JBGA 4AYTA 3L04A 1AMNA 1SEPA 5IEBA 1XZQA 3PA8A 5A3QA 4FKMA 5KNCD 3VA7A 2DKNA 1M76A 2FPIA 2QBYA 1Z8NA 3HRKA 4FYIA 5B4UA 3RUIA 3DE4X 2C9CA 4DDWA 1IH8A 1ISMA 5E7JA 1E61A 4BV3A 2BUBA 1QGDA 4KBYA 1RWPA 4A27A 1NUSA 1ZWKA 2VT7A 4B48A 1PUXA 1CUHA 2IYNA 4D6YA 1K5GA 3HXMA 3C6BA 2B7LA 2W00A 3CCCA 3JD1A 4NEGA 3T99A 4F3KA 1B0PA 4L73A 4G8CA 5GTDA 1S2MA 3K8YA 4IUBS 1QRTA 2G9NA 3VR1A 1LRLA 3DD5A 3KJIA 5BSEA 1SCDA 3SOPA 1SUSA 1P2BA 1R8XA 2C2OA 2LXNA 3FPJA 4G2NA 4LSGA 3C1TA 2YHUA 4PZDA 4PTZA 4XARA 1U5CA 1GGFA 3GFPA 2FSGA 3JASB 3DMRA 1EXWA 1GJRA 3I01A 4LNUB 3BJRA 3VYTB 1FQWA 3SC3A 3RKSA 1P7PA 3E7FA 2RG7A 1O4WA 2FSUA 1DUSA 4X9XA 3FNFA 1IL0A 1ONOA 3INNA 5BQXA 3OD5A 3EY9A 3TNYA 3LYAA 3FNBA 4HRAA 3RIGA 1YIAA 3FWHA 1P74A 1U7XA 4K9PA 3KKKA 3ZE0B 2R8XA 4QICA 3PI6A 3C3JA 2R7NA 3P9XA 2CEKA 4Q1VA 1QP8A 4OJNA 1PZGA 2ZSUA 4MUAA 4AN0A 4GMXA 1ZH4A 1MO2A 3BHMA 4UJ5A 4V3BA 4DZRA 2QQ0A 2IFTA 3EZ2A 3H5WA 3EFEA 2E89A 4ZQBA 2CLOB 4FE4A 4JWTA 2JC3A 2G3YA 3A2LA 3RTEA 5B2FA 2BM9A 1Z6XA 3QIVA 1T9ZA 3RC1A 3TGWA 3H5LA 4EIWA 5SZJA 1PF7E 1P2VA 3CGGA 4Q1BA 4X92A 1GU0A 3FKQA 4GBGA 4AG6A 4C0BA 1V1RA 4ONEA 4KMRA 1JQJC 4X1KB 5K3AA 3IA2A 5DW0A 2QYSA 4KN5A 3URKA 4BFSA 2WA2A 5IDWA 5BW6B 2JCGA 3A9SA 1CB0A 2FPPB 2D5AA 5L3ZA 2ZRIA 1J00A 2WJ6A 3IIMA 5CU7A 1US8B 4KWCA 1PSWA 3EVCA 3C5WP 2G83A 2HUNA 1GPJA 3EVFA 3OF5A 5NLLA 4CTNA 1RYZA 2BFEA 2NGRA 1R6VA 3FAKA 1NULA 3L6EA 5EYPA 3WSVA 1GARA 3DT8A 2HMVA 2JLBA 1OXXK 2KS6A 2ETVA 4DA4A 1G60A 1D6JA 3FFAA 2F3RA 2X42A 3F6YA 4B0PA 4ZHQB 5HGXA 1EX7A 1USVA 3MK31 3QQPA 4FIDA 4K88A 3BSWA 2QM7A 4JEMA 4XD2A 3GMIA 1P7WA 5L3QA 1U2GC 1CJKC 2XNHA 3C1AA 4HMQA 3THWB 4DLRA 2JJYA 1VHLA 1GPWB 2P2GA 2BCEA 3OFND 3DLAA 2EL7A 3STUA 2CHVA 2IDMA 4CMAA 3ZS8A 1KE1A 2O2IA 4Y9UA 5JZBA 5LVAA 4TN1A 1E7WA 4UMDA 3THOA 3VC3A 3QBDA 2GQ0A 4CF6A 3AI1A 3ANLA 4BPRA 2IS2A 4RA6B 1WHSB 2D54A 2Y0CA 5FA6A 1CD5A 4PZ9A 3UJBA 3NXKA 3HXOA 3EXAA 2P6PA 4MGHA 3EMBA 4MS3A 4U2BA 2Q21A 1YQEA 4D0LB 3I9LA 4EB0A 1E4EA 5I45A 2YNMD 1MDFA 4FGUA 5AVYA 5E4JA 4TZKA 2ZB4A 2MR5A 3LDHA 5EUBA 3JAKA 3ID6C 3PI7A 1Y3HA 2O19A 1R0WA 3GDHA 3Q0EA 3S8YA 1AS3A 3BCUA 4Q7JB 3AEQB 2WV7A 5IVKA 3ZKAA 3GVXA 4LG1A 1KEUA 3WBBA 3HL0A 2RGWA 5K3DA 1Q83A 2IYSA 4BY9E 1FX0B 2VHZA 2OV2A 1RYNA 3AP1A 3MELA 4HYEA 2ZR0A 5KYWB 1JPNA 2QD3A 1JHRA 1PWEA 3VHXA 1DARA 1JV2B 1CR2A 1EE1A 3LQFA 1HXHA 2LWIA 4D9HA 3H5AA 2QRZA 3BWEA 1I7QB 3VU1A 4HDOB 4WCFC 2YN2A 3ZCTA 2YVLA 3CH7A 4R69A 4JJZA 4BX9A 5CFOA 1KH3A 2ZE6A 3BIWA 4FFWA 1Q16A 2A58A 4IDAA 1VLLA 2ACEA 4UVIA 3X2FA 1ISPA 4EEZA 5CIWA 1OZGA 4NJMA 3D7NA 1C7JA 2WMYA 1IPFA 1Q74A 2I1LA 1EVLA 1Z6QA 4C7OA 1P80A 4LK3A 4E1VA 4G1EB 4QPJC 5L4NA 1ULZA 4PLHA 1EINA 1BIFA 4U0JA 4LFBB 1MJNA 4ENWA 3GEHA 1AH2A 1L4BA 4UM8B 4JUAA 4PBTA 1XR3A 3KYBA 4TQUS 1XRPA 1BOOA 3ODGA 3HGMA 1XJ5A 3K7EA 1J4AA 2YL2A 3ZC3A 3VVBA 1DRUA 2DC1A 5KJ6A 5JAQA 4JVNA 4M37A 4MKHA 4UASA 4OHYA 2QUKA 2FRDA 4XAQA 5C53B 1QRUA 4F3NA 4HWPA 5KVAA 5KYKA 2VJDA 1DC5A 2H1RA 2VJAA 1N2EA 2RBEA 3R6WA 4JLOA 3TBKA 1KC3A 1TM4E 4ZP1A 5DYGA 4M1KA 1YVDA 2ZWOA 4U9UA 3WMEA 1M6VB 2JGFA 4RCVA 1GIAA 3A27A 5G02A 2OQVA 1N33B 4E5VA 1SK9A 4N49A 3TF5A 3LS2A 1JEEA 1DWPA 1HT2E 3C7CB 3H13A 2CHQA 2D1QA 5JAMA 3DE5X 1DXQA 2J0SA 5IZCA 1ADJA 4Y2VA 2ZIVB 3B6JA 3JQEA 2RB4A 2WU0A 1IXKA 3KO8A 1GPAA 4KCGA 5KHOC 1HO3A 5KTPA 2CLMB 3EXEA 1XZCA 4UD6A 2Z5LA 3FWPA 4ASUD 1BMTA 4RTPA 1FQKA 3I0NA 3KEOA 4CMGA 5HYVA 2GR9A 4MAMA 2FRXA 4KLZA 2QX9A 1R15A 3CO5A 1NPTO 1OBCA 3LI2A 2GBLA 4QWWA 1IUPA 1Y3FE 1FBNA 2R79A 3OFVA 2CDRA 3HNOA 1RWOA 3GUCA 3DP9A 3OTQA 3CEPB 1QXSA 2EIHA 2RI1A 3FYDA 3D3NA 1T9BA 4MQFB 1NUPA 1PQWA 1QCDA 1ZAKA 2H57A 3TZEA 3V4SA 1KJIA 3QEMA 4WZBB 4BQQA 2OCYC 5EIHA 2QR5A 3PLAE 2VRCA 2I2BA 3I2YX 3SSOA 2NUPB 3R3JA 4H3KB 1Q0PA 3PGA1 1QO7A 3KJZA 3RRXA 1QV9A 4EP1A 5TPWB 1ZLYA 2RGDA 1P1RA 3CZAA 1F3OA 2FWNA 4W9NA 1T24A 2VT2A 3F5MA 3GGPA 4YAKA 3Q88A 5JJKA 1WCXA 3KQWA 4PY2A 1HK7A 3OX2A 2ZVDA 4NZNA 1Q95A 4BNIA 4PHTA 1L4UA 4C87A 3WB2A 1I2BA 2A35A 1WXEA 3CPSA 4QREA 3DUFA 1KOJA 7GPBA 5KSOA 1GPMA 1GCUA 3R75A 1ANKA 3CJQA 5ALZA 2R6R1 4LW8A 4EG6A 4CG3A 5FO0A 5DGCA 3EIOA 1JSLA 2EWVA 1OUMA 2CLFB 4DNQA 4F97A 2H63A 4BQIA 3R9IA 3BIFA 4C08A 2QD4A 4L85A 2OV1A 2R7MA 4TTQA 2BHNA 1EX1A 3SMVA 2G5CA 2RH4A 3HVRA 2QSZA 1DUIA 2WJAA 2DPHA 4DXDA 2EERA 3BE8A 3DF7A 4A6DA 2B2XA 2X3FA 2ZJZA 3ZHYA 2NLOA 2REXB 2WNSA 4C4TA 2IBMA 1L6IA 2ANCA 4MQ6A 2O06A 4YP7A 4GMFA 1KI9A 3GJ4A 4ZCMA 2KLBA 3CRVA 5EWMA 1KOGA 5CT4A 5DX0A 3W5BA 4G0ZA 3D2LA 3G0OA 5IJZA 5E6UA 4YRGA 1ZSNA 2IHKA 3UAXA 3S44A 1YQ9A 4D3SA 4DM4A 1WB4A 3IBGA 1OAAA 2P5UA 5CK5A 4YH1A 4EDFA 2N42A 3FIJA 3GCGA 4MP8A 1T6NA 4XSGA 3CZRA 1JYFA 4PZUA 1NF9A 5D3QA 3GRUA 1RWMA 1T1JA 3PGLA 2PRKA 2C8KA 3VZPA 3Q9UA 1G8YA 1EQAA 1CF9A 1TUBB 1XEXA 3N74A 4M22A 1OX4B 3JAMA 1MZVA 3AB8A 3IGFA 4GR9A 4W1PA 3EE6A 4PAWA 5DLQC 3JARB 3I76A 3PENA 3WLSA 3ZU3A 1PEAA 1WUYA 3OIFA 4NNJA 1O97C 3DOOA 3QVTA 5IK2A 2QXTA 4G4SO 3HPQA 5I9MA 1QCZA 2IRWA 2X3UA 2XCRB 3ZXUB 1W5TA 1Z45A 1DEKA 4AY2A 4BB6A 1MOZA 4BVLA 1NW7A 1CUZA 2VAPA 3KKMA 3OUUA 1OH7A 4R3WA 3AYXB 1H93A 1NLYA 3DEYX 3KQNA 4MMYB 3RV4A 3QW2A 4KXVA 1CQJB 2J3EA 5FB3A 3FNIA 1OBVA 4E5NA 3R0VA 1SBNE 5KPDA 4ZT7A 1ZNWA 1CFJA 1N7JA 3LUJA 5TF0A 4MW2A 3U62A 3HWSA 3O8OA 3N2EA 3RKRA 2P6RA 4L4RA 1H65A 1Y1PA 4RL6A 4LWQA 3T1OA 4AX4A 5JY1A 2D00A 2EFCB 3LH5A 1ZGCA 1ZOPA 5BNZA 4EY8A 1WMEA 5AUNB 1GD1O 3BRSA 1ZRSA 4EB6A 2Z9BA 2X4IA 3TMAA 4AURA 5INTA 3WTBA 2E0IA 3OX3A 4GFDA 1YA4A 1O95D 4DLBA 4ANFA 1KOFA 4KE6A 2M6RA 4TV9F 3O7MA 1MAUA 3AF0A 5A03A 3A1SA 2WHQA 3ZZUA 1RRKA 2YV4A 2XCOA 2QJFA 3P2IA 3U9LA 4HSGA 1DOHA 4YCBA 4KMSA 1HETA 1OU0A 4ZU3A 3E4DA 3HP4A 1UWKA 3UG7A 3BMOB 2AW3A 1V11A 3T34A 2YN4A 1E2NA 1Z2NX 3CJRA 2QGZA 4DWVA 4QM7A 2DJIA 4ZCLA 2WNHA 3BXXA 2OKCA 3NM6B 1T5LA 2FWRA 3DTYA 2ZI9A 1DB3A 1QGUB 3PJEA 2GXSA 4B85A 3ZPXA 4R2XA 1Y98A 1FFWA 2R7LA 1W30A 3CXUA 2C1ZA 5AK5A 1IC6A 2WTEA 2RC6A 4HDSB 5DGIA 2EF1A 5IG2A 5TMEA 1FDOA 2QQEA 1CUFA 3A6JA 2WJVA 2WV9A 4IRUB 5ENZA 2BGUA 1XTJA 5IXYA 2GD2A 3ITKA 1KY3A 3VO8A 3K8OE 3KEMA 3OEHA 1SHUX 3CTMA 4XIJA 1NW9B 1TAQA 2X0JA 4D92A 3NUGA 3U7EB 1P9LA 2V8BA 2PS0A 5AKJA 1XAHA 4U2GA 4C0KA 1W4LA 1ZH8A 2RHCA 3QOFA 4F2DA 2ZB2A 2HK7A 1BGWA 1T34A 2NO9A 4PONA 3COJA 1QQ6A 4Q3CA 4B71A 3EQ2A 3INRA 2XWBF 2B36A 4PCLA 1MEEA 4MQFA 1CYDA 3UUFA 4B3HA 4UNPA 4DRXB 2BMFA 5B36A 4XUCA 5CR9A 2PQMA 3CPEA 2CHGA 5H4HA 4D4HA 3EJWA 3RAGA 2ERCA 3FOEC 4OQ4A 1MTOA 3ZCSA 4L9SA 2QTWB 1R18A 4K6CA 5KAPA 1G2IA 5A4AA 4Q93A 1NY6A 4TMKA 2OYRA 5BP7A 2ZRQA 2G82A 4LJSA 1U0HC 1YQGA 2P2CA 3CF4G 3M6MD 1MXFA 2A67A 4HNSA 3SNHA 2MCFA 3RHFA 4FB5A 3RUFA 1GZUA 3HXKA 1KQGA 2ACWA 3FCYA 3W5JA 1OILA 1U2PA 2POCA 4HJXA 4EL0A 2IP2A 2AX3A 3HBAA 3F5QA 2B4AA 2VP4A 2YFQA 4UQPA 5E6RA 4E30A 1HQKA 1GRVA 4EZIA 4QU5A 3ZQJA 4UEOA 3RRNA 1RYDA 1VJTA 4GOOD 1MH9A 1NASA 3L49A 4J7UA 4EI7A 3IEMA 1W29A 2HDWA 3W2TA 2XZTA 4H0CA 4ND3A 2G1PA 1BMFD 3L4BC 3STWA 4D0NA 1G5QA 5LMNB 4PIMA 1Y7IA 3N8KA 3PD7A 2VPYA 1EK0A 4NDZA 1WA5A 1PSDA 3PNBA 1ZJ4A 1CFZA 2OBBA 2DP4E 2Q0SA 3G49A 2JGDA 2CNWA 3BFVA 5IBPA 3IHKA 4MP3A 2JARA 3OU2A 2QLJA 1T8SA 2WPNA 1U7ZA 4QDZA 4A03A 3D2CA 2EDCA 4LF5B 3SEZA 4AYXA 3DZDA 1DU4A 1ZMOA 3HXPA 3MT7A 2ZFUA 4GMDA 4HDMA 4AKSA 1BE8A 3KQVA 4C7KA 1UWVA 2OCBA 2OAEA 3N6XA 4PRKA 4QXPA 1QYWA 4MIEA 2YHIB 4JLMA 3V8BA 4LDNA 1QFJA 4YHHB 2WSYB 1OLUB 3PV0A 5J4KA 2R85A 5EFZA 4MV7A 1NVVQ 2DQZA 1NUTA 2XA9A 3DKRA 1Y5RA 3H9CA 2UV8A 4WFJA 4XQEA 3HR7A 4CM5A 4NMWA 2HDHA 3HMKA 1OXVA 5GV8A 3RE1A 4F3TA 5KTTA 2I3BA 2O7SA 2V5AA 2XX3A 4XE5A 5JCOA 4OHOA 1JIXA 3SYTA 3ZVNA 4U6NA 3TN7A 3U13A 5ILQA 3TL2A 2VHVA 3ZNQA 2EBWA 1ZA1A 3V4ZA 1X8JA 3R40A 2JLYA 4IX1A 4RZSA 5MN4A 5HILA 2DERA 1O5OA 3BK2A 1AUPA 4K0RA 4X44A 3ZEIA 1W1WA 4BWFB 3U44B 3GD5A 5F1KA 3VR3A 4BMYA 4BVJA 4QTZA 4TUYA 1YCFA 5TXGA 4YBRA 2LV8A 1SXJB 1ZQ9A 1KMCA 1WDKA 2OORC 1REQB 4JR2A 3G85A 4E94A 2KQUA 4P33A 3PR3A 4MWBA 5BWBA 5E9QA 3EEIA 1EE2A 3H86A 5JDCA 3FPBA 2LW7A 4I9GA 4QU9A 2LPMA 4QOGA 4X8MA 3RD5A 2Q4TA 1G0NA 1IRIA 2C7GA 3I6BA 3L0IB 2QTMA 2W8BA 1ZYUA 5LNK6 3ORSA 3PNQA 3TQRA 2G8LA 1IOZA 1LSUA 1Z4QA 2DFTA 2OBXA 2FZCA 3DMPA 3IODA 2QRNA 3NR2A 4V24A 2QTHA 2G4CA 3H97A 5KEIA 1Q20A 3T3NA 1U80A 4Q7QA 2WZBA 2VCHA 1SCBA 3MAJA 2NXNA 3O4HA 4RXUA 4OP1A 5JD3A 1SOMA 2JZNA 4M1TA 2JBAB 5TPZD 3SQMA 1P4RA 2W6QA 3RHSA 3U1TA 2WIBA 1USGA 1DIRA 4KIUA 3H4TA 2XKAA 3NTVA 3KTAA 2OVFA 1EIWA 3AIOA 3SS7X 9MHTA 4YJ3B 1T4MA 4FLFA 3U80A 2QDXA 4MPJA 2OTCA 2IZ6A 3PXEA 3DXZA 721PA 2RAVA 5K8JB 2NP7A 1F20A 1S9HA 4D81A 2O2XA 4P7KA 1Z22A 1BS9A 1E1QD 2FEMA 1M34A 3LRPA 1JXOA 2WD7B 3OKAA 2QVYX 4DMGA 4BNVA 5SZHB 2ZUSA 1KZGB 4EFMA 5G1OA 4HNUA 5TVKA 4JOCA 2GJKA 4MVJD 1JJFA 2H7CA 3ORHA 1R0RE 2JB9A 4CTOA 4WK2B 2XBLA 3B82A 1ADCA 1G3UA 3H8WA 4JVOA 4XYEA 3WVNA 2PUBA 2J33A 4BO2A 1G5RA 2E2WA 3TE6A 4BP1A 4E7PA 1I36A 2VH5R 2JFZA 4NDAA 1SXJD 3VTFA 2IUYA 4E5SA 1RM3A 2W4QA 3KUDA 2IYXA 3LHDA 4QTYA 1E99A 2PFSA 3K6KA 2PXHA 4DBZA 3KJHA 3OTGA 4ZQHA 1A5SB 5HZMA 1GPH1 1KY2A 2D06A 4AULA 1YTLA 4O63O 2PEZA 3ETJA 4WKPA 3T41A 4NFLA 3MWEB 2BZGA 2GF0A 2W2QA 3OCUA 3OJ0A 3TTVA 1NKSA 4IIJA 1N32B 3IXMA 3LT2A 2CY0A 4JP8A 1XL0A 1UK9A 5F33A 3I4FA 1HYEA 1I01A 1L7RA 2A9FA 2ZUCA 1JA1A 4KZKA 2IYOA 3URMA 3ZKWB 4D4GA 3E8MA 2WFLB 3DLCA 3J7TA 4K05A 2B1IA 2FXVA 2GBGA 2NNWB 3NC0C 4HLUA 4FMDF 4H2DA 3E7WA 4WK4B 2RE8A 1M0TA 1GNQA 3OIGA 4YJGA 1BZYA 4CM3A 3PNYA 4JSTA 4IVNA 1UK8A 4F4FA 3B3FA 5KS2A 1WTCA 4S2EA 1GA1A 2ES4A 4BLPA 3F9RA 5EZYA 3RVKA 4XGRA 1T1GA 2P90A 2VWHA 2VJKA 4FUTA 3DVAB 821PA 1P0PA 2BEWB 2PYIA 4MJXA 4J0CA 5L40A 5JEDA 2GFHA 5GWXA 1NLFA 1UBUS 2P0EA 2RFLA 3DV2A 5FADA 1AHNA 3F3SA 3R7FA 4RHTA 5IFKA 4DYHA 1ZNXA 4JQCA 1JJAA 1AGNA 1TK9A 2B82A 3FUVA 4CKBB 4HVCA 2WM8A 3TTWA 4MWEA 1OW3B 4GRAA 1CP2A 1E5QA 2H52A 3ABSB 3ND8A 4NQRA 4BQEA 1JA0A 1W0KD 2ZRKA 1Y3BE 3UJ7A 1JHQA 3DNMA 3HO1A 2HZBA 2XMGA 5HQTA 1OH6A 4Q02A 3C6ZA 1M0WA 2O0HA 3L0ZA 1MAAA 4J0KA 3GGSA 5J5AA 4C05A 2QJTA 2V7TA 5J2UF 4UTPA 3ZLBA 1N5DA 2YBDA 4RABA 1H2XA 5AI6A 4JD5A 3DW3X 4QUBA 2PX6A 4OAOA 4G09A 3B9BA 3ZWQA 1OIWA 2I78A 4ZV4A 3KALA 3B13B 3FOAA 3AX6A 4BFWA 1JDBB 1OC4A 1PNTA 3OVMA 4L08A 4ZC1A 3REFA 2VQEB 4HEQA 3T3DA 3AVXA 5KNBA 2ZR8A 1N1GA 4D4LA 5CX1B 2PT9A 4BLUA 5JSHA 3H11B 1L1QA 3AF6A 3FTNA 5ALTA 2BEUB 2C78A 3L06A 1VGRA 2ODEA 1ZOOA 3A1NA 3GXOA 4GC9A 4PC7A 2WTBA 5J63A 4V0OA 4YMSA 4WZAA 2BFDB 1FUYB 1QG4A 4FNOA 1IEQA 1DAHA 3QOXA 3ZY4A 3KYDB 5IPFA 2N47A 3MSCA 4W5WA 3SQNA 4HX2A 1SB8A 2OECA 5BSMA 1PYDA 2QLTA 4K9QA 1UAGA 5CTJA 2Q3CA 2OC9A 1P7VA 3VZCA 4UREA 3Q40A 5AXAA 4EGFA 4UPEA 5IWAB 4K9MA 4W1QA 3DB1A 3O92A 3QOYA 5KO2A 2RH5A 4EO9A 5TMBA 1O1YA 1N2XA 1H22A 4P4TA 5C9ZA 4L9RA 3THXB 1IG3A 5M34A 5K0TA 1IEXA 3N2KA 3ROKA 1K0UA 3IBFA 2AFHA 4M36A 1RYFA 1ATZA 2A2ZA 4TMTA 4CIVA 4MGZR 3MLEA 2B3TA 3W4KA 1T4DA 1Z4NA 1E5TA 4O33A 3VAYA 5LL6P 1G2PA 4MEBA 2HPHA 2REOA 2ZJ6A 4WEOA 3AM4A 1PG0A 2E85A 3PGMA 3D6NB 4HLDA 1ZS9A 1CR0A 5CVVA 3EEBA 4QXQA 3O4RA 2NU7B 1KK2A 4DCVA 3I6YA 3OJWA 2I54A 1UM9B 1CJBA 2GM5A 4NS1A 2AQHA 2DRIA 5ESDA 3UW1A 3W8NA 4AO6A 4BO8A 3QX8A 4A7PA 4CKCA 4DLVA 5DBHX 1LFDB 3PKZA 1Q0SA 1RAEA 2W2KA 3WV5A 2K5UA 4YCAA 1HH4A 2SKEA 4QPCA 3AZOA 3JYNA 16PKA 1O08A 1U04A 1V3UA 3LPNA 4N41A 4F8EA 2P65A 1NLZA 2ZETA 1RJ9A 4JOSA 1N2OA 3ZHUA 3P0IA 4YMHA 4QJ3A 2VATA 3EPRA 3P96A 4IFBA 1OBFO 3ZE2B 4XFJA 1NVTA 3D6JA 2PUVA 5JC8A 1FE8A 1OFUX 3HDVA 4MB2A 1ZW6A 3F2IA 4GE3A 1U0NA 3T7CA 3ED1A 4RZIA 4PXYA 3RVRA 4ZDKA 4OA8A 2BR3A 1JG6A 4OATA 4R2KA 4EL5A 2HUPA 1LX6A 1X9IA 3NTOA 3I72A 1H6AA 4Q6WA 2JI6A 1H9AA 2NSLA 3P4YA 4KIFA 4WADA 3CF4A 4ZC8A 4YDSA 5JUWA 1QO0D 1WXWA 1ELOA 4YR9A 4YQYA 3FGOA 4B7CA 4RGBA 2XCLA 4QGGA 1TJNA 4X1IB 2EZUA 2NN3C 2OD7A 2PANA 4I50B 5DTRA 3UM9A 4BBZA 3G8AA 2I34A 1SBYA 2WUGA 1DEAA 1K3TA 3B36A 4BKUA 4EKNB 1ZIPA 3F6SA 4BQFA 1RPJA 1IK6A 4MQ4A 2Z98A 4TWJA 4WV3A 3FYUA 4LSMA 1D2RA 2PGNA 3FUUA 3LP8A 3P5BA 4N6NA 3NWOA 3WX0A 4FONA 3C8DA 4BKMA 4CEHB 3R7AA 3ZD9A 4MAFA 1BXGB 1X2EA 3E53A 1JXAA 3GLSA 3KWJA 5FYDA 1H4SA 2MSNA 4GZ5A 2OL4A 3MTDA 1ACMA 4JJ6A 4EMBA 1QAOA 1NG9A 2Y1XA 1OFGA 4Z4HA 1WUKS 1XEFA 2IZ0A 4I1SA 3AFHA 1W49A 3ETHA 1M1YA 1OPRA 2LNDA 2VNAA 1NNLA 1S2OA 2VJMA 3EG9A 2NQ8A 3PDJA 3QU2A 4UBOA 3ETDA 1KEVA 4YLEA 3TQOA 1RABA 1BW9A 4LYGA 3CUSA 3A11A 1YB2A 4M1OA 1M34E 3UXMA 1WPXA 5HXAA 3WR5A 1X77A 3OCXA 2W6MA 3N0RA 4H1HA 5AK0A 3RIMA 2H31A 4P0TA 2HWUA 5KYYB 3RIEA 4ZRMA 1FMLA 2J9FB 4DUYB 1INLA 4BX8A 1ENYA 2GYYA 3S5UA 1O6CA 3GIDA 5AHXA 2YHBA 3DZCA 4I4CA 2R8OA 2PQ0A 3MOGA 3R3YA 2H48A 3AXTA 5HDQA 4JJAA 4MW7A 1L3CA 1D6NA 3QVXA 4CKBA 2OCIA 1Y8RA 3RS8A 1A2OA 1QZ3A 3WK4A 4OQFA 4BAUA 4O4JB 3TJRA 5DFAA 3ZBUA 2X5KO 3K2QA 3WFIA 1UC8A 3TSYA 1AXEA 3ZLUA 1PCXA 5ED4A 1P5HA 5F35A 1VGVA 5KREA 2GRUA 4UVHA 1V41E 4U00A 4LKOA 4N6GA 1G9XA 2EEPA 3OJOA 2JAHA 4ZEWA 1TMGE 1M10A 3ZCPA 4BYGA 1WSBA 2ORIA 1QE5A 3SN6A 3BQMB 1JH9A 4B45A 1IHXA 1G8AA 4L5YA 1J06A 2OPBA 3PQ4A 4M8IA 1MO5A 4O5OA 4TWBA 1U2TA 2YFHA 1EFHA 2R97A 3O2NA 5FOWA 2ZSBA 1YOVB 2FTKE 1LWOA 2RH8A 1NZDA 3MILA 4A0GA 1LRKA 4BKPA 4XVUA 5IMBA 2L69A 4MCAA 3NHRA 5KTOA 2H0AA 3RARA 1OASA 1U0JA 2LCIA 1IB6A 1K75A 2AD1A 2DCMA 2QD1A 3CZ9A 3M2TA 5KX5F 5JIBA 1XRNA 3JR7A 4IKEA 2PXCA 4R1TA 2Q5LA 1UPFA 5ADWA 4GKKB 4Q47A 1PR4A 5JCPA 5C4GB 1Q57A 2D0DA 1V5GA 1VCOA 1Z2PX 3PFBA 5JRJA 1U7HA 3QJ5A 4IZOA 4IDBA 2W0SA 1GHTA 3TBFA 1VYVA 5EHIA 2VTVA 3B48A 3NQ41 4QYIA 4B2YA 2B34A 1F9EA 4C6TA 1FYFA 4LMRA 5CVEA 2X5XA 4WKGA 1QIMA 2V5UA 1T8UA 3GPLA 4R2WA 3ZV5A 1NP7A 4P92A 4QYMA 5IWCA 1ZJWA 2BGGA 2B8EA 1UFQA 1EJ6A 4L8FA 4QDOA 5JJIA 1JHAA 1UXIA 1WVMA 5L9AA 1JQ3A 1O6BA 3HXTA 4RCZA 2XRYA 1GEEA 3VKVA 1N0UA 4PGGA 3R7WA 2XBUA 3V1LA 5GAJA 3NUQA 2PS9A 3I37X 4GECA 3LP6A 1YH3A 4YFVA 4D80A 2OEPA 4C43A 4RF2A 4U8GA 4YUWA 5JRZA 3H5RA 1ZD9A 2V7XA 4WXYB 4CN8A 5FQOA 8ATCA 3MTEA 5IASA 2NU7A 1VJ1A 3NGLA 4WESA 5FBZA 3T12A 4WN3A 5DM2A 3T3PB 1GRRA 4TL9A 4D82A 1C0LA 1ZZGA 3L0PA 4M46A 2VO1A 1ESCA 2O8DA 4H15A 3U39A 2AMJA 4IGEA 3PJDA 5B6PA 2AS0A 5JROA 1YZNA 4ZAZA 3R76A 4UAGA 3MTBA 4C4XA 5C7YA 3FNGA 2W2XA 3TEFA 1W9MA 3NOVA 4BFVA 3VR0A 2YHSA 1YRLA 2BT4A 2RJNA 2Y99A 2C4NA 2H11A 3QVUA 5ENVA 3SSAA 1YL7A 3FETA 3AHHA 5AVKA 5AR1A 1JFSA 3OKCA 1JFRA 1SD1A 4MGKR 3RO7A 3K5IA 4AZWA 1IXZA 2IUEA 2EU8A 2I5PO 2JHPA 2KM1A 3DHNA 4GWGA 4HZIA 3IKTA 1Z06A 2F1RA 4U7WA 2RGGA 4HDRB 4EWLA 4L4SA 1XDWA 1G7SA 5I9NA 3FJOA 1V9SA 4PZAA 4RK1A 3Q8XB 2Z3VA 3N3BC 3UMYA 3H0KA 4NZPA 4ERXA 2OAP1 4Q12A 5AVZA 3T6KA 5HG0A 1P7ZA 2IZ7A 2PZLA 3ON5A 2GKOA 2DBQA 2AFHE 2OHHA 3JQGA 4Q3EA 1C2TA 1DKNA 2H3EA 4FU0A 4BE7B 1K7EB 1UBCA 3VDNB 4O4HF 2IKQA 5ICMA 3FOWA 4OI2A 3GJ7A 1FX1A 3GJ6A 1NWHA 1XI2A 1KHHA 1XRSB 2QAGA 3AR7A 4FILA 1P60A 3GFRA 5GY7A 2PO7A 4AMVA 3D0OA 5K05A 1RCTE 1A1SA 1QRRA 2P4EA 3CNEA 1R16A 1I6KA 3R44A 2QN1A 2PD4A 4JUCA 4LBZA 2PBRA 4OJKA 5IMSA 4E5PA 1QGZA 2JDIA 4BEJA 2AR0A 4UOZA 2FPUA 4TWIA 2AW5A 5DGHA 5F9MA 1E1RA 3CUEF 3CSSA 1ESEA 3H9BA 1GZ7A 2QTTA 4DQDA 4HX5A 5HUJA 2NU9A 3H75A 1NDUA 2B5VA 2WYVA 4MGEA 3U6KA 8AT1A 4XVRA 4FJ0A 4MYUA 3W2EA 2JGEA 1X3SA 1Z0AA 3WNZA 3AEYA 1BGVA 1N5RA 1EK5A 2DUWA 3NJ4A 4M1ZA 3I8SA 1Z47A 3F8TA 1XNJA 1ZRHA 3IEKA 4PWZA 4ROSA 4YTEA 1YMVA 4OL0A 1Q0TA 3E9ZA 1R0SA 1Z0DA 5AI5A 2D13A 3WIOA 2Z43A 5EEHA 1JHMA 1FU7A 1Q15A 1X7WB 2J9FA 1VYTA 2REBA 3DTNA 4IGAA 3E22B 4MVXA 3WLQA 5BT8A 1TVKA 2I3AA 2AWNA 3OZRA 4Q4HA 2Z9DA 1UKZA 3EVAA 5JSUA 1Y89A 3QVOA 1BWPA 2ACVA 3FMPB 1VMKA 1ZY2A 1R6UA 3MMZA 1KMIY 3S2EA 4EY3A 1XXHB 5TIIA 4K6OA 3K6RA 1U5BA 5IZ4A 4CNQA 3KSBC 2PLNA 3O9VA 1H8HA 3GFQA 2JFOA 3O95A 2XF2A 3LGXA 3UK0A 1T6BY 3UUEA 5JS6A 3QKUA 3MRSA 2F3QA 4K9SA 2OCPA 1NNI1 4WTOA 2Z8YM 4IJVA 2QZJA 2VCYA 3KVYA 5E1DA 3UJHA 4BVEA 5FAKA 3AHGA 4UNIA 5DTQA 5JPIA 4ENTA 1YASA 4NBVA 5D2CA 3PC4A 2HF9A 5HRCA 1LTQA 2OK7A 4RMHA 1E9BA 2UXDB 1R6TA 3UTDA 5C5EA 1OA1A 2DUUA 1LC0A 2XAAA 2XRMA 2XNDD 3B5IA 4FIZA 3KQOA 4J0IA 4LKRA 3ZNNA 1JAXA 1NRJB 3R8XA 1YOVA 4EUHA 1Y6JA 1MUUA 3V1MA 2IZZA 1X7HA 1NBMD 1S8OA 1Z7YA 3BG5A 3BMXA 2B4TO 3HU2A 5THQA 3WSTA 1Y63A 1U7WA 1IUKA 5T6BA 1H2ZA 2ZQ5A 4KQ2A 2XXJA 4RLHA 3KYCA 4G4IA 3IV6A 3IIEA 4LRWA 3TIFA 3N7TA 4MDEA 2DFKB 3ASZA 3TSAA 2ZUTA 2WICA 3LC0A 5AW8A 3BBPA 3OOEA 1UC5B 1QX3A 2V7GA 3M6WA 5K3EA 3G02A 3NIFB 2GARA 3NCHA 4FFLA 1E2HA 1CV2A 4DADA 5BVGA 4P22A 1TF5A 4N7MA 4LCEA 4B82A 1IB0A 5EXPA 3DA8A 1LSOA 4F46A 3IILA 1NGSA 3NH6A 3TZ6A 2BM8A 2GF9A 4R8LA 2ZWMA 3IDZA 5KVSA 1Q7GA 2G7MC 4EI9A 3T4XA 1RFGE 3HCRA 1OYWA 4N5HX 4Y6PA 3VNQA 4QLOA 1GQOA 3A31A 3ORFA 5FWAA 1AOXA 1N92A 2DG2A 2FWJA 3BH7A 3M82A 4DLAA 1T3SA 1ZICA 5IVIA 1XD8A 2P79A 3OZBA 3GOHA 1T4CA 1CY8A 2FZEA 1MAHA 3OOSA 4N40A 4AJEA 1DCTA 2OBYA 3KWFA 3HXQA 2VF4X 2H9AA 4MKXA 5CLQA 5A5DA 4N7JA 5JQGB 3QSGA 4M54A 1KDRA 3IESA 5F2EA 4YXWA 1WV1A 1DCFA 3EIWA 2G25A 1CJVC 1FFAA 4BE4A 2F2TA 1XTKA 5EXXA 2GN2A 4D8XA 4RKYA 1Q3KA 3HCWA 4XCVA 3ZJUA 3V7NA 3R09A 5K09A 2HOQA 4P3XA 3VOSA 3WFZA 4EEXA 3H2ZA 2P2NA 2G04A 3QIAA 4HB4A 4MB0A 5LWHA 4XYMA 1TJPB 3PZBA 5DNUA 3FMFA 2A5YB 3OPMA 5F5LA 5DOVA 4PG7A 2Q3EA 3FLMA 1LVUA 4KVZA 2A7XA 3LVFO 4NJEA 3SHOA 3UWOA 1N1MA 3E7XA 3RVQA 3ZW7A 1JDPA 1Y6GA 1PS0A 1USWA 4MV6A 4JLPA 1NG1A 2CK3D 2UAGA 5D86A 1O94C 3N39C 4BP9A 2JJ2A 3SC2B 2EZ9A 4B32A 2V7UA 1JMVA 2JA1A 4GDFA 1R74A 2M1XA 4E4RA 3EWNA 1OV6A 2MIIA 3VJKA 3OQOA 1KU0A 2FSVA 4I4NA 1ULBA 4MYCA 3V4LA 4NENB 2ZULA 2QGNA 2VVTA 3EY4A 5IT0A 2PL3A 1NOIA 3L7KA 2IKSA 4OIFA 1SHLA 2FPMA 4F8JA 4IH1A 4EYQA 2NU8A 3I1IA 4MAAA 4IDQA 2HA4A 5EWJB 2JAXA 4URVR 1I1NA 1NU6A 4OQNA 2G1KA 3KK0A 5AJTA 1KZ6A 2VAXA 3K6SA 3H1AA 1P61B 1CY2A 1JFFA 1ZG3A 3VC2A 4F5YA 1TNDA 2WP8J 4ZVMA 4N48A 1PJTA 1EI9A 4OKNA 3GRAA 1TYAE 3QPBA 3K4QA 2FPWA 3D2BA 3CWQA 4BKQA 4JEUA 4RA9A 5E7IA 4F9FA 1AK2A 1PJCA 3QKRB 1OWMA 3QMPA 2JEZA 3FD8A 4R5MA 1WEKA 4Y1RB 3NXSA 8OHMA 3T5CA 4EW3A 2JZOA 2ZJ4A 3L9WA 1CZLA 1B6GA 2A3RA 2ET6A 1Z4JA 2PUAA 4BQOA 1R3DA 4O4IA 1E2GA 4Z6KA 5K3OA 3UK2A 3KSAC 4P4NA 2B4YA 2W70A 5GQSA 6LDHA 1TW3A 3MWLA 1N7GA 3T4UA 3FGNA 3T38A 1PDOA 4C07A 1X14A 4PX5A 3U48A 4F1JA 1KQOA 5HCIA 5T7BA 5D5QA 1M7BA 2AKAB 5GONB 3KOXA 3ESAA 3LPDA 4B40A 3RADC 1SUDA 3D5QA 5EPOA 1IZ0A 1DCKA 1RRVA 2ISQA 3R4CA 5A9SA 1DQYA 2C8JA 4JLWA 3HZRA 3GWZA 4MS1B 2GGSA 4FKZA 3U7RA 4E32A 4G8DA 1E3QA 1V71A 5JADA 5AK4A 2H5EA 1BWRA 2R87A 3CX7A 1E1YA 5HF9A 3RS7A 1ZO8A 2EC5A 3G9XA 4DV0B 3T5DA 2W4MA 4OFWA 2AIRA 3DAOA 4F9GA 3ZEAA 4IM7A 4MIOA 4AF6A 3PRYA 2EFDB 1RJEA 1E2EA 3PU6A 2B9EA 4GC5A 1F48A 4WFKA 4Y6SA 3I34X 4BGIA 2NAFA 1ZHFA 4DPLA 3T1NA 1PT9A 1E9CA 1L0BA 2HL6A 3CIFA 2BI8A 3IKMB 3DVSX 3OMWA 2IHVA 3MCZA 1NJ1A 7REQA 2VDOB 1HPLA 3U3OA 2XQKA 1B23P 4F9EA 2UVPB 5CD9A 1EHCA 2Q5OA 1GGHA 4AICA 4O2AF 3HA3A 5FQNA 2CL7X 2KB0A 1ZONA 1N25A 3A6FA 3KQLA 5T8KC 2AJDA 1U11A 4P9NA 1X1QA 3WLPA 4TMZA 1D3AA 3WLJA 1YA6A 3RK1A 2J4FA 3QXSA 2FKAA 3GUZA 4PXSA 1JJ7A 5DM70 2IGBA 4E11A 3EG5A 4MZXA 4NU6A 1VJDA 1YJXA 4Q18A 2WJYA 5FPTA 4KVGA 1B4DA 1WF6A 4GBJA 5FUBA 3GLGB 1J8DA 5IC6A 3BL8A 2YVAA 1PD0A 1E3IA 1KS9A 4ZZ0A 3WISA 3EXG1 3BD7A 3D8SA 4BZWA 2PZJA 3LSTA 2JLVA 3AF5A 1BSVA 1VPVA 1VSVA 3BZBA 1Q0UA 1XDBA 1EE9A 1YB1A 2JLZA 1JTEA 5MDHA 5EJGA 1ZUIA 4AI6A 2V03A 1RQXA 3M33A 3PC7A 1N3LA 5EI5A 1XEWY 4K87A 4HDKA 1XCGB 3WRYC 3GGJA 1Z63A 2ZI4A 4REQA 1FVFA 3KSZO 3BXPA 4Q48A 1WBBA 2P9FA 4BRWA 4M86A 4NS4A 5HUQA 3B1FA 2AT1A 3I8OA 3E1KA 1NQVA 1ORTA 3U1BA 1MABA 3HV2A 4IS2A 3E81A 1BVUA 4PZ0A 3IUNA 3JAWA 3P9RA 4A3SA 1VJRA 4A82A 3MJHA 2YC4C 4S0ZA 2CNOA 4G1BA 1BJKA 4Y2TA 3MGBA 2X6TA 4PQFA 1HFEL 1ZVQA 4JXKA 1QS0B 4BLRA 1IZ8A 2WWGA 4O3FA 2DBVO 2LVBA 3DCNA 4DY6A 1SU8A 2O8CA 4L6AA 3RYIB 1VPWA 1R12A 1IU9A 1GR0A 1UEXC 3PJFA 4JYBA 3KE8A 5J4LA 3LXXA 2CL5A 2IHJA 2X41A 5BOVA 3RVDA 5ICSA 3D0KA 1IK4A 5DCWA 2P0YA 2HMSA 2O4UX 1XZPA 3D7MA 3M0EA 3WNBA 3WSWA 2EP8A 1OIVA 3GG2A 1EK2A 1NBOA 1SUIA 2R66A 4A2WA 1BVYF 2AF4C 2QTCA 2Z4SA 4JAVC 1KZ7B 2AI3A 3OQNA 4CHGA 1XPJA 3HXLA 2VF7A 1DWQA 4IZIA 4P80A 4KQGA 5J4VA 5K2OA 4QBFA 3ANYB 2A84A 2UZ0A 4HRYA 5D5HA 1L7NA 3JVIA 5AXCA 5JNUA 3IP9A 3PNMA 1V95A 5CG2A 3B1JA 1RADA 4AZTA 1PJBA 1KJ8A 3EFOB 3ZWBA 1XROA 2AK2A 1HDYA 3RBZA 2CLHB 3DHWC 4HSEA 1L3BA 2CXOA 4LQ4A 3EB9A 2V7EA 3VPSA 4HXYA 2EGUA 1JG4A 2ZWIA 1SZPA 3HO8A 3W6UA 1AV7A 3O26A 4G8JA 3T0IA 4RTJA 2ZRFA 2GM3A 2BSXA 4PCAA 3V8NA 2J5KA 3NT5A 3NANA 4GSYA 5BSTA 3ZDQA 1DCMA 2C2GA 1XJ0A 2F00A 4IIEA 1CPYA 1NVBA 5AM1A 1GFZA 2J5XA 3AGPA 4V0LA 1JHVA 1Z4IA 4JN6B 3X2SA 2N3ZA 1T8TA 3SSNA 5IYZB 4CMJA 2HLDA 3Q6MA 4MH0R 1KQ3A 4NEQA 3GP5A 2CE7A 4NV0A 3X3HA 1Y1QA 4YASA 3MYRA 3BWCA 1GPDG 2ZATA 3A9RA 4Q3AA 1X7YB 3QX9A 3UV3A 2ZM6B 1J49A 3FKJA 1WOYA 1OLSB 4QBIA 5BO5A 2EQBA 2PU7A 3OC6A 4J1TC 2FWBA 4KLNA 5SYMA 1PR3A 2Z2XA 4JBXA 1JHYA 2YMMA 5FI0B 3U3DA 1OH8A 3IULA 4QHSA 3PC8A 1Q7EA 1V7PC 3FSGD 2J6IA 2GDJA 3MWFA 4JMPA 4X93A 5FD8A 3RVLA 4A1OA 5BURA 1MVNA 1WBJB 2PLRA 4CM8A 2O2GA 4HP8A 2OHFA 1C41A 2IP1A 2FHPA 4GI5A 3GYGA 5AQ1A 2OQ2A 2YUIA 2EW1A 2V9CA 4M2LA 3SQDA 1RP1A 5BQFA 4L0DA 2EL9A 1MORA 1SHKA 4HUJA 3N2NA 4IDEA 5DI3A 1S8NA 4OXIA 3LQ2A 4YPFA 2IV2X 5ITZB 3ZXSA 1J21A 3X0DA 3M4NA 4IDCA 4W5TA 3EXIB 4CM4B 2IV7A 2Y1FA 4OXYA 5HVNA 1PYGA 1ZNZA 5FUMA 1ENZA 4TRNA 3MBKA 2PSSA 3TJZA 4O3MA 4NYMQ 3FFWA 4HN9A 1J8VA 3U3ZA 2P4QA 3UZUA 3Q8MA 3T7AA 3DNPA 3EFBA 1M0SA 1OR8A 1DRVA 4PFKA 5G4KB 1JDJA 2ZYSA 3ROGA 1W35A 4G56A 1HGXA 5D3KA 4MLCA 1KR5A 1WMBA 2ORED 3TSZA 4LDPA 4XSVA 4EZEA 3C97A 3GFVA 1FUKA 2BELA 2PGDA 2OQRA 2ZAYA 1TVMA 1JEYA 2FR8C 2VQSA 4ALMA 5A7FA 5JJLA 5I51A 3RASA 4PLTA 5DCLA 1NFQA 4PIVA 3ZWAA 4F72A 1P72A 5JSQA 4EPRA 3PHIA 1HE8B 1L8XA 2KX7A 2JIBA 5EQTA 2DGDA 5HZGA 2MSDB 1KOLA 4C5AA 1QVZA 4MUYA 3F5SA 4D74A 3EF3A 1AGXA 1Z5UA 2H0QA 3JQQA 4R7ZA 5HIIA 3NIWA 2QTAA 3RJ9A 1W87A 3U3KA 5ICGA 1EX6A 3BE4A 2DR3A 2QL7A 1CQIB 4I36A 4U2EA 5JI3E 4PX9A 1MFPA 2A4MA 4RF4A 3V33A 1NX9A 1QHYA 4DIDA 3NYIA 1Z7WA 5IAOA 3SBXA 2DWOA 1HTBA 5T3UA 1JHZA 2J4CA 1ESZA 3FRHA 2J09A 2RGBA 1QHFA 2J5RA 1UZUA 1ECJA 2Q4DA 1JU4A 2F48A 3NGXA 3I04A 5F4BA 1CIVA 3CIOA 4CQJA 1UZMA 3N58A 3D8BA 4LF9B 3LX8A 2O8EA 5KNCA 3OBBA 4C4AA 3MXTA 4KV9A 4MQ5A 4BCBA 4LJKA 4B73A 1RRCA 3RDPA 1Y8AA 4R9SA 1GQ2A 3P1JA 3M34A 2VK2A 1JQLB 4WCFB 1VHJA 3GRKA 3GZJA 4CQMB 3FCAA 3GJZA 3G2PA 1PQ4A 3I39X 1WULS 4XDZA 3GJXC 5TRTA 1CB7A 1Z75A 3WDKA 4DLLA 1ZUD1 1E63A 1QQTA 2X2PA 4R1NA 5ITVA 1LLUA 3CLKA 4G1UC 1RWKA 1WQ3A 2CD9A 3BA6A 4XIGS 1K6EA 3WE7A 4BV8A 3IEVA 3KXIA 3VC7A 3LUPA 5F1PA 3TAUA 1A5TA 5FIUA 1EP1B 4YUZA 2KWIA 1GNPA 5AHRA 4HZUA 4RMJA 1VTKA 3OCWA 4RKEA 4XWAA 1RYMA 2ID9A 2IWRA 5B6JA 5K99A 1RWNA 3QKSA 3I4CA 5BMVF 2QRLA 3QYFA 5JVDA 3HQ4O 4QOSA 4FFSA 1DRJA 3S2UA 1OC2A 1YU9A 3PF9A 3PUZA 3LYLA 4LBYA 2HQSA 1ZLXA 4CGYA 2P68A 4I19A 3CH4B 5IM4F 1SCQA 2PYZA 4XD7A 1LKZA 1T0PA 1YE3A 1ZBDA 1SVUA 2QWXA 4P86A 2DECA 4WCDA 3TE7A 2Z6AA 3L84A 1XN1A 4B31A 3IDFA 3H42B 3T7JA 1E2LA 1Z0IA 2CMDA 2ZYAA 3NIGB 4E15A 2VK8A 5CEEA 5J4YA 1DE0A 1GUDA 1G59A 2IE8A 5BSUA 2NO5A 5HM8A 2QSYA 5BOSA 4DV4B 2P1RA 3MHTA 4L2IB 3DLBA 2OZLB 3MWDB 3QU9A 1HEIA 3OM8A 1P2SA 1GT6A 4Q9LA 2FZVA 2Z6VA 4RMIA 3MMSA 2X15A 3CR8A 4TL7A 1NXPA 1W0JD 5AK6A 1DTSA 5BNFA 4LXTA 1G2QA 4D0RA 5ALIA 4JGGA 3CZQA 4Q34A 1E6EA 3ZI0A 5DN6D 2QTZA 5GM1A 2WYIA 3ZU5A 2CMFA 2LZ0A 4BUJA 4ETMA 5LLTA 4KOAA 4GBMA 1CS0B 2Y92A 4LVOA 4P81A 5AVRA 4R41A 1TUIA 3WL8A 3BB4A 3I62A 1U9ZA 2PZ8A 2ZQYA 3K71B 5LC1A 2BH2A 3AG6A 4NAVA 1VQ1A 2NUTA 3VC1A 3I9JA 3W9BA 2EJCA 3H2BA 3JYHA 1WTAA 1WD7A 2R68A 5FWNA 4TZTA 3D3EA 1HE5A 2B3DA 4Y18A 5E4TA 2WVHA 2TMDA 3RVPA 3OQ1A 1NJ2A 4U7TB 4OV6B 1ISJA 3Q6NA 2JI4A 5A4FS 4RQAA 1ACJA 2CNBA 3L46A 3ENQA 3L1UA 2OHOA 2EP7A 4YYZA 4OU5A 3VYRB 2CLSA 2C59A 1UT6A 2I71A 3IVCA 3QMVA 3EW7A 2FUKA 2RHHA 2DBRA 2E4WA 3PDIB 2EWWA 2RK3A 2WHPA 4URZR 4XIIA 5E0OA 3IEPA 4KFTA 1G6Q1 1XMJA 2SHKA 4MO9A 2WF8A 2XDQB 1QHNA 1UDXA 4BMDA 4Z9FA 3IX7A 5L95A 1NQWA 3SVTA 5KYVA 3GL9A 5JNLA 4B34A 2AXEA 3FKSA 3VO9A 1PBTA 4XWYA 2RGCA 2SECE 4IOLA 2C4TA 4I3GA 4Q66C 2UYYA 3VR5H 4G0WA 1XXLA 4KAJA 3BQ9A 4QGHA 2A86A 5CEFA 3PTAA 1L7XA 1SOAA 3EF0A 3N2YA 4O8ZA 3DDWA 5J9FA 3CW8X 5JH7F 3PICA 1U2GA 2FX5A 3FPSA 3FZGA 3P52A 4Y7CA 2NVWA 4PQGA 4HS9A 3MTGA 1XG5A 2CUKA 3SPXA 3UMFA 1JQEA 2GRAA 3I83A 5I48A 1DHTA 1C2YA 2D2EA 3R74A 3G2HA 1KJQA 1ODFA 4K86A 1X3LA 2W6JD 4B9AA 1JLLB 3O2QB 4DR3B 2CJYA 3D3WA 5ER6A 1UUFA 3AM5A 2NZVG 4IHJF 1BVHA 1QFSA 3PGKA 1CRZA 3T9EA 2XF8A 2XKKA 1FTNA 1Z3CA 2EJWA 3NS7A 4JL8A 5DNDA 3ROZA 5A5VA 1EKXA 2UZIR 3N5CA 1CUCA 1L5OA 1IQUA 2I6SA 2PGOA 5EUMA 3U4QB 2XB2A 3GVHA 1BN6A 3NX4A 1J9ZA 5BQ5A 5JXHA 4RTLA 3TRHA 4KAAA 3I52A 4CR6A 4NCIA 1GG2A 3D8NA 3EDYA 4M6WA 5GVRA 2Y4NA 4L16A 4NCXA 3EVGA 2VTEA 3EXHC 4FUQA 5J2TB 3GZTB 2F1OA 2OHIA 5DTJA 5FNZA 4B09A 4DCPA 5B3JC 1XBTA 1P81A 5DW3A 1V45E 2QI9F 4P54A 5D01A 5L4SA 2IY9A 3FSJX 1J97A 3T9FA 3EZ6A 3V00A 4A16A 1U6JA 4Y2UA 5LBUA 5A02A 5HX7A 1JKFA 5EKDA 4DDUA 1GTVA 2I7DA 3IQXA 2Q3JA 3D02A 3ZGNA 3AR3A 3IPXA 1OIXA 4IXMA 4DVGA 2N1BA 1FC0A 3V46A 4PM4A 1SQFA 2GYUA 5COAA 6GPBA 1ZVJA 1Z0SA 2A5GA 3C45A 4KQMA 5F7ZA 5KQSA 1LB1B 1HSOA 5EIWA 4OQYA 4QQKA 4BX3A 3OLQA 4ETNA 5C18A 3OPNA 2X40A 2XY4A 4W5NA 2RBKA 3MT9A 4BNTA 1OXMA 2Y1LA 1J24A 4KR3A 1D2CA 1T4BA 3DYVA 2XQVA 4K8OA 4PW0A 1GGEA 1LLQA 4UD2A 1V25A 3K9QO 3WGZA 1DKQA 3F4BA 5JOQA 3B1VA 3AONB 2YTZA 3AJ8A 5A1TA 3A3YA 3IKLA 4MX8A 3I5MA 1N5LA 4F56A 3NFYA 5FT9A 3VVMA 4DUGD 3R3SA 2BP7A 3NKLA 1Y37A 4FGZA 3FWYA 3QE9Y 3SKYA 4BFTA 4AKHA 3F4KA 1K0FA 5FXMA 1SXHA 5I6DA 2CCGA 4Y67A 3D8TA 3OEED 4HNRA 2I66A 3UT0A 3VR4H 4DNXA 1OPXA 1IQ0A 2PG3A 3WKCA 2VP2A 3ML1A 4QULA 4TM7A 4XR9A 4ASUA 2ZYTX 1E79D 5JMOA 1BYIA 1QO9A 1GFIA 4F12A 3EPLA 1EDOA 3GCWA 4EJSB 4CIBA 3ZDCA 2DFLA 2I99A 1XTTA 4G97A 3IAS1 4NOJA 5F3DA 1S01A 3V97A 4AJPA 5BVHA 1P1IA 1RJGA 1N2SA 3KOOA 2H92A 4BEWA 4FI3F 5EL0A 1O0SA 3FYSA 2AC2A 3FFXA 3TCKA 4UXIA 5F5XA 1T9CA 1GZ6A 1PZXA 2BHTA 1KAMA