5B1EA

Crystal structure of proteinase k from engyodontium album
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Crystal structure of proteinase K from Engyodontium album
rcsb
source organism Engyodontium album
molecule tags Hydrolase
total genus 102
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5b1eA00
4I0WB 3H42B 2SECE 4OV6B 1PFGA 1C9JA 3DE6X 2Z58A 1BJRE 5AMXA 1C9MA 1SBHA 1T1GA 1SCNE 2PRKA 3BGOS 1Y9ZA 1SCAA 3AJ9A 2PKCA 1HT3A 1A2QA 1SUEA 2XRMA 1SBTA 3GCWA 2ID4A 1NLUA 1ST2A 4WOBA 5K7SA 3DVSX 1SBNE 2Z56A 4WOCA 1ST3A 3WHIA 1SBCA 3I37X 1AVTA 2IXTA 4KB5A 1YJBA 3D43A 4CFYA 2DUJA 2X8JB 4LVNA 3VYVA 4ZARA 3WIUA 2SNIE 2XTJA 3VHQA 3F7OA 2TECE 2B6NA 1R0RE 1GTL1 1GTG1 3F49S 5I9SA 1V5IA 1R64A 5JXJA 4GI3A 1KDVA 1SUDA 2ZRQA 1XF1A 5AQEA 3VV3A 2ST1A 2P4EA 3I2YX 1NDQA 5FAXA 4C3VA 3TI9A 3I30X 3DVRX 2X8JA 3DE4X 4LVOA 3LPCA 1P7VA 3SQOA 3DE0X 3SICE 3P5BA 1TO2E 3DW1X 3DVQX 1SCDA 3VV2A 3GT3A 4DZTA 3LPAA 5AVKA 5FBZA 2ZWOA 4NE9A 1AU9A 1SUPA 3PRKE 2W2PA 1AV7A 1Y48E 2PWBA 4CG0A 3LXUX 1BE8A 1PTKA 3Q40A 1Q5PA 1OYOA 1SUCA 1SCBA 1ZVJA 3GT4A 1P7WA 2PYZA 1SUAA 2Z2YA 2PQ2A 3Q5GA 5ARBA 3DDZX 1AQNA 1MEEA 1T1IA 3DE3X 3EDYA 1C3LA 1WVMA 3T41A 1Y4DE 1SIUA 3L1KA 3VTAA 1KE1A 4KG7A 1SIBE 4J94A 1KE2A 2G4VA 2HPZA 1Y1KE 3A3NA 1C9NA 3AJ8A 1R6VA 2WUWE 1KDYA 1SN7A 1SUBA 2WUVA 1GA6A 1PJ8A 3EIFA 2QTWB 2DQKA 5JMOA 3BX1A 1AH2A 3DWEX 3UNXA 1TMGE 4FONA 4ZOQI 1WMEA 3AFGA 4CFZA 4NE7A 1UBNA 2W2NA 3DE1X 1S2NA 5ARDA 3BPSA 2Z2ZA 1IC6A 2IY9A 1TK2A 3DE5X 1WMDA 4M1ZA 5JXHA 1S01A 1GA1A 1TM7E 3VSBA 4AKTA 2SBTA 1NDUA 1GA4A 2WWTA 1MPTA 3ZXXA 1GNSA 5JXGA 5ARCA 4H6WA 2ID8A 1V6CA 1TM1E 5CW1A 5B1DA 4DJ5X 1SBIA 2Z2XA 3A3PA 3LPDA 3HJRA 5B1EA 2Z30A 4H6VA 4K8RB 1EGQA 4KPGA 2DP4E 3QMPA 2ZWPA 4OMDA 3ZXYA 5AVJA 3F7MA 1TECE 3PTLA 1SVNA 4JP8A 4OMCA 3EE6A 2PMWB 1BE6A 1YU6A 1GT91 1Y33E 2SICE 1THMA 1AF4A 5JXIA 1Y3DE 1TM5E 1WSDA 1LW6E 1SPBS 1Y34E 2W2OA 2E1PA 1PEKE 1VSBA 2WV7A 2V8BA 4AKSA 3GCXA 1T1EA 3D9QX 1S02A 2W2MA 1JEAA 1TO1E 1Y3CE 3DE2X 3QTLA 1BH6A 1TM3E 3TI7A 1YJCA 2W2QA 1ZVKA 1EA7A 1GCIA 4HX2A 4H6XA 4MZDA 3A3OA 1BFUA 5FFNA 3CO0S 4NMXB 4RYDA 1P8JA 4B5LA 1SIOA 3DE7X 1IAVA 1GTJ1 1Y3BE 4DWWA 1BFKA 4C3UA 1KDZA 3WIVA 1DUIA 2PWAA 4BWGA 1CSEE 5SICE 1OT5A 1TM4E 1SCJA 3DW3X 1OYVA 3CNQS 3TECE 4HVLA 1Y3FE 1Y4AE 4Z2AA 3I34X 2HD4A 1CNMA 1YJAA 1AK9A 3DYBA 3OSZA 1SH7A 1SELA 1WMFA 1GNVA 2GKOA 2Z57A 1DBIA 3QFHA 4YN3A 3WQBA
chains in the Genus database with same CATH superfamily
4KQ2A 1I80A 1P3DA 4DEVA 4H08A 4OHWA 4EPVA 5ELLA 1UMCB 4XGIA 1I3OA 2KS6A 5ECDA 3DEJA 1EFHA 1GITA 2C7VA 1V7QA 1G5TA 1T2NA 4G5HA 1NVGA 3VPGA 1SCKA 2W37A 2WJWA 1Z8NA 2NAPA 3DLBA 3U3DA 5I48A 3RK0A 4JFRA 4D99A 4U2DA 5J2UB 3RK1A 3FSEA 4KLZA 3IT2A 1UXJA 3IHWA 2O23A 2ID9A 4WSOA 2D7DA 2HK6A 2ZBEA 4Q03A 4AKEA 3R9WA 1KMHA 2AT1A 4J07A 4RHTA 1HKHA 2KM1A 4Z9FA 5FP0A 4HB0A 4O4JF 4HNAB 3WLMA 5C7OO 2PKEA 1A2QA 3D6UA 1PZHA 1SC6A 2H16A 1QM5A 2G67A 3C7KA 3HA5A 3PC6A 4V0SA 3RE1A 2H1OA 3KD3A 1GZ6A 1CYEA 1ZO8A 1JFFB 3FCEA 1O89A 2Q8PA 1R4ZA 3FZNA 2CHQA 3QFCA 4C4OA 1PG0A 5HG0A 5HKBA 4RIEA 4LIPD 2AYYA 4DQVA 3H5WA 3URKA 1CFZA 1MT3A 2VTVA 3RRNA 1Z4IA 4HKTA 1DKUA 4DSNA 3EVBA 4NU0A 5FUQA 5DEOA 5FORA 2YKGA 4RLHA 1GTRA 2HREA 4YI3A 1OXKB 2GSWA 2K2QB 1Y7PA 3BXOA 1YRAA 3EC2A 5IN5A 2JAPA 1QQ6A 3B60A 4G4GA 1B00A 4LCJA 2HBZA 2JIPA 2RJ3A 3PSAA 4TLDA 5FNVB 3WK5A 2CHUA 1XJ0A 2YS7A 1RQPA 4CLRB 4DDTA 4IIEA 1Z8FA 3F98A 1N5MA 3OF5A 1JAYA 1JUDA 4KMRA 4WCFB 3N1UA 1HKUA 2GERA 3I32A 3ENNA 4RGYA 4U2BA 4B79A 4MUEA 1V7PC 2AX3A 2NZUG 1R9NA 2IXTA 1S9HA 3BHJA 2JCXA 4Y6SA 1UT8A 4DCVA 3HV2A 1JA0A 2X77A 1PEYA 3DMGA 3INGA 3H2BA 3RVOA 5H68A 1X8XA 1L4GA 1G20E 2B7LA 4ZCQA 4MTLA 1DIRA 3N75A 1K6XA 3AIMA 2HSDA 5F5LA 3QXCA 5JD5A 5HE9A 2AJDA 2PZJA 5LQKA 2OGTA 1TFRA 2ZRDA 4OVKA 3W3AD 3PD0A 1YI0A 2Q2WA 2H4ZA 4M9RA 2C9ZA 4GAEA 1ZMRA 4WNAB 1N5LA 2A9JA 4QJBA 4YCBA 2R00A 1P7YA 3L9XA 1C4OA 3S1AA 3SYMA 4EHLA 2RKOA 3MLAA 3CUEF 2RHOA 2WQ7A 3MCUA 1ODCA 1E92A 5M3BA 5AUNB 2QSYA 2XQFA 3OG9A 4DANA 2P2CA 4GVXA 5BQXA 2YWDA 3L7KA 1HLPA 3LUGA 5K6RA 3MBKA 4C1BA 1LEHA 3ZHXA 4X1IB 2XTAA 1ZVQA 4OATA 3GWGA 4BMXA 1HY3A 2W6NA 1KJQA 4W9MC 2Z1NA 4INAA 3JQFC 3SZOA 5A3JA 1LSUA 4DJAA 1AB5A 4F45A 4D41A 1YDWA 5DNWA 1CUGA 4WL0A 4D9IA 4QARA 4HNUA 4PHFA 4E94A 1N57A 1D04A 3MGBA 1NDQA 2ODTX 2FPGB 1PJ2A 4RTMA 1F17A 1ZD2P 3GEBA 3OE4A 1F12A 1I14A 4PHCA 1EM8A 5BWMA 2P68A 1R8SA 5KNBH 4A15A 1QKJA 3WGMA 4LXYA 5T4FA 3SQOA 4KQKA 3AR4A 5IJWA 5T5QA 9LDBA 2YS6A 4YP0A 4X24A 2EHJA 5LYJF 3I4CA 2ONJA 1PL6A 4JCCA 1O95C 4S1NA 1ELOA 4XGQA 5HZGA 2XKAA 1U8CB 4ND8A 3NIGB 1U1DA 4P5PA 5FOUA 3M3DA 2W7TA 1HF3A 3NRBA 3OZGA 4X7PA 3K73O 4MDYA 1M1NA 1R88A 3TM4A 3VKVA 5DGHA 3IMEA 1MH9A 4EMTA 2FSFA 1BWSA 2GBGA 5TSDA 2B8EA 1YXMA 4P5DA 3TOCA 2M32A 3MINB 3ESXA 1WUJS 4TYPA 1Z82A 1AU9A 2C2GA 2DY0A 3KSRA 3ZBQA 4MB6A 1F5NA 3GMSA 5AI6A 2YXPX 3TMKA 5H7XA 1SU4A 3IEPA 5JMWA 2ZM5A 2REQA 4LJ8A 3S55A 3GLHB 5L6LB 2P9QA 2ZUCA 3QHQA 2VYCA 3BJMA 1Y9JA 4V39A 5DNAA 2ZPUA 4NU5A 1V39A 4B6JA 4BUJA 3O73A 2WHQA 4X95A 1OIVA 3EZ9A 3L8ZA 1XEWX 5DZSA 1IHPA 2C83A 3NT5A 1QCDA 2VJOA 1DKLA 4FB4A 2FPWA 4UHCA 2OBLA 3P9NA 4BLRA 4EBBA 1VMEA 3KZKA 1E2UA 1NUQA 2CFRA 1HC7A 3P9QA 1HFEL 3BMNB 4RESA 5K3FB 4F4IA 3E4CA 2W48A 3T34A 2H2GA 2Z2YA 2CFCA 3PCRB 4OJYA 2YV5A 1JHRA 5EXEA 1TT5B 1KK3A 2PQ2A 4M1TA 3KO8A 2BBSA 4IX1A 1ORWA 2P69A 2ZUDA 4TTIA 2M1XA 1DXQA 4KWHA 1XJCA 5BSMA 3C3KA 4BWYA 4IH9A 2LNDA 3EC1A 4EI2A 2JIRA 3VU8A 3G82C 3IPAA 5DM2A 3SBOA 4F6CA 1O4VA 3AI3A 2C95A 4OHCA 5LP6B 1KS2A 1FRQA 2BFAA 2N9UA 2PX4A 4XJXA 2B1QA 1RABA 1RWXA 4RV5A 4V2UA 1V5GA 4ZRDA 5HBRA 5LZ8A 2JCGA 4MXDA 3F8WA 4PCUA 1QS0B 1QQAA 3SXJA 1SBZA 1XDDA 1L4KA 1CEEA 3DKPA 3FOFC 2Y99A 3W5CA 3ORSA 4ZRNA 4E12A 5KX5F 1WZ2A 4C0BA 4J1TC 4A4DA 1LWNA 4BV3A 2QUBA 1FSFA 4NCIA 4BU0A 1NASA 4DV3B 4A27A 4ZV4A 2IA5A 3EIUA 3P9SA 1H2EA 2EL9A 4ZVSA 3WK7A 4YAGA 4QVGA 4CL0A 4LJ6A 1SHTX 1EWRA 3UC9A 3G0GA 2YFYA 4NCHA 1UC5B 2R1VB 3ICVA 2WUVA 1OI2A 1RXCA 3E3OA 2PH1A 2CNWA 3AG6A 3NYRA 4ONEA 2I34A 3CURA 4RM2A 2YRFA 3IXQA 4B80A 4GEGA 4Y2XA 1D2GA 3AF2A 1GCAA 4B6QA 4Z4QA 3MXTA 5B3JA 2E89A 4WXRA 2V4ZA 3D8SA 3ZWBA 2ZRMA 4RVFA 4F4CA 4HH1A 3L93A 3EQ7A 2GYVA 2EKZA 2ISQA 3QBEA 1UAAA 3CINA 5G3YA 1W48A 4TKZA 4DUGD 3CZMA 3KL2A 4EENA 2RGGA 3IMKA 1V8FA 4Q1AA 1Y6FA 4AI6A 1HNNA 1Q17A 1OI7A 1PJTA 2EF0A 2JA2A 5GAJA 1UJ6A 5A0FA 2ZIUB 4R54A 3RIGA 1YE5A 4JEUA 1Q0QA 4JJEA 4LOJA 4JI6B 4J0KA 4P7KA 5DB4A 2AG8A 5JXHA 1F4PA 1E2JA 3AK4A 4N47A 1E9FA 1FUUA 4JU9A 4PO9A 3AR2A 4D3DA 5COAA 4D81A 5J2UF 3EIWA 4HDKB 1QIMA 3OIDA 4FN5A 3ZXXA 3AVQA 4I9HA 4HEHA 4IH1A 4X94A 1AQUA 3S5UA 1H9BA 3HHPA 1O6ZA 2VCHA 3MUFA 1Z0FA 3KWFA 3KLNA 3D1JA 4KTVE 3LX6A 3NBXX 1D6NA 1QVWA 3JATA 4NONA 5DGIA 3V7UA 3VVMA 6GPBA 2PT6A 1X80A 1BQ3A 2QLLA 3HWRA 4X1OA 1DMSA 5CT9A 1X94A 2AG6A 2DFNA 2BY4A 3EGWA 3KBBA 1VB5A 5KNCH 4NS1A 1NJ8A 1YDGA 4J0HA 4OQ4A 1WCV1 4HATA 3KBOA 1HG1A 1R0CA 2YNMD 1CPYA 2F62A 4FJ0A 1YVRA 3SHWA 1PYOA 3JSAA 4FWBA 3NFYA 4KIUA 1OWLA 2CXXA 1ISMA 4MQEB 2HCRA 5L4SA 3W5VA 3ZC3A 5B4VA 1IY8A 1X7XA 2YJ6A 4AWXA 1E32A 5GJVC 2OBMA 3OQIA 4X1YA 1GGNA 3JQBA 4GMDA 5P21A 1KFKB 4FVTA 1YBVA 1MO3A 3FSGD 4FQ5A 5FNVF 4X7RA 1A71A 1SBIA 2VSOA 4M38A 1PP4A 4B8YA 3WGNA 2Z6AA 3ZGOA 1KOJA 2QD2A 1HEIA 3INNA 2J9YB 3IC5A 2ZJ6A 2X9VA 1L6IA 1TJYA 4IIYA 5CK4A 3T3DA 3KALA 1ECCA 1T29A 2CVPA 4DARA 1KYWA 3R09A 4ZAZA 3W34A 2V6IA 2F59A 4NKRA 5AJYA 4YHHB 1JDTA 1CR6A 2G1KA 3QPAA 4NI5A 1O8CA 1BXRB 2EW1A 1XRNA 4MS4A 3FHLA 4RPGA 4PLCA 4ARVA 2RD2A 4TM7A 4CEHB 3DPUA 3NHPA 1G0NA 2XMZA 4M54A 3O2SB 4L50A 3OTHA 10MHA 1ZINA 5CLJA 1DAOA 4YUAA 1V7CA 1Y8QB 2LKDA 2Z5GA 3PFWO 3T5AA 2OCYC 3CUYA 3L0DA 4NYJR 2FP4A 1OLUA 4NENA 3UJAA 2JHGA 4OFWA 3W9BA 3BRQA 5FR1A 3PX3A 3ZCRA 4B3XA 4ABTA 1ZR2A 3H4VA 2MOKA 2HIHA 5J58A 3AFIA 3C5WP 4NMLA 1L8OA 2WB4A 4W8GA 5CJJA 3LLMA 1YIDA 5KYUB 4OHUA 2PS9A 5EG5A 2GLUA 3ZHZA 1QGOA 3HVJA 4LEIA 1O6FA 5HCIA 3A1WA 2GTHA 2HLPA 1UBHS 1OXBB 3PPXA 4MTCA 1KYVA 1Z3IX 2C5SA 3Q2KA 4HZGA 4LXQA 1Q3HA 2JEOA 4BEJA 2B83A 3QKTA 4EW3A 1GQRA 3WKBA 3QBTA 2JH8A 3D81A 3AGQA 1HMYA 5BNIA 2JLQA 3GXBA 4FHDA 4DIFA 5REQB 4LF5B 1SPBS 4ALNA 1IB0A 2B4AA 2E4UA 4MCJA 5K03A 2W2OA 4EUNA 4HDQB 2DWUA 3VZCA 2BGLA 3BJIC 1GKIA 4I1RA 5CFRA 5ITVA 2OWEA 4EAQA 3PDCA 3VOBA 4W5NA 1MXFA 4O29A 3QA9A 1LXCA 2VYND 1SMKA 3QKUA 4HN4B 4K1LA 3H6HA 5KDOA 4KXUA 3JR7A 3KC2A 4JI1B 3DA8A 6PFKA 2BKUA 4G5XA 4L5IA 5T6BA 2R7MA 1YZGA 5HX7A 2HWUA 2W2KA 5C8XA 3H7AA 1GZ5A 1Y3CE 1DE0A 1E6WA 2EDCA 3JWEA 4JBGA 5DWVA 5T8KA 4RK5A 3BORA 4EJSA 4NXNB 3F4BA 2HDNB 1XR3A 1BH6A 3EISA 4KN6A 1L5LA 1KC3A 2AWNA 1V4NA 1EK6A 3ROGA 4EL0A 2WG2A 4Y9TA 4DLBA 4LI3X 5AOBA 1SD5A 1X1SA 3DTTA 3P32A 3T3HA 4QU0A 5E9JA 3WL6A 1V1RB 2GD0A 5G3ZA 1GZDA 4ZALA 1C3VA 1KR2A 2P1RA 4Q01A 2WR8A 2R6GA 1I5RA 2C2WA 2VDQB 4FS8A 2AKEA 4J1NA 3A27A 2IEBA 2WHPB 2DFVA 3EXIA 2OHOA 3I6BA 4INPA 2WINI 4OGGA 3A3OA 1J97A 4MCIA 4MUXA 4DM4A 1EVKA 4MPTA 2C5GA 3KKOA 3ZE9A 4EA8A 1IHYA 4OB8A 1P1RA 1GDHA 4LS3A 3AG5A 3ETJA 1UCFA 1UK7A 4JASB 4RYDA 3DEYX 1K97A 1P8JA 2DFDA 2XYGA 1FX1A 5CURA 1Y1LA 1E18A 1YA4A 3IEUA 1QFXA 3OZAA 1DHRA 1Z4PX 1P4RA 3ER8A 4I4LA 4IUCS 2IOHA 1IAVA 2HJHA 2PY6A 3GFTA 3FMGA 4MWGA 3UJ7A 5F21A 2QRQA 2KYRA 1T1SA 1V25A 1W4ZA 4OKIA 3B85A 4R1PA 1U9IA 5C81A 2WIGA 3D7KA 4LHYA 4ZMSA 3FOWA 4EITA 1GGKA 4OXYA 2H48A 4YUZA 2GZRA 1DUIA 1WJGA 4NJOA 3MJ4A 3QWBA 2CLHB 1ID1A 4D7AA 1JDBC 3CH6A 3VH4A 4ZO4A 4BDSA 4RS4A 4IDDA 1R9GA 4MDEA 1XXLA 1ZL2A 4BJ5A 2VSXA 4BATA 2ZU0C 3TCKA 3DHNA 1RPJA 1WXEA 2OL4A 3ETCA 5LP6F 1AHNA 1K06A 2Q49A 4JB2A 4X90A 4A8HA 1C0KA 4PXAA 5ALSA 3DC7A 5K4AA 3RS0A 4LWOA 3GT0A 1LLUA 2FPXA 4K26A 3JARA 4JLOA 5TGDA 3TIFA 4D9EA 2OFPA 5JASA 2HSWA 5CDUA 3O5AA 1RLMA 2O5VA 1GQOA 3M6LA 1T35A 3HB0A 3O91A 5MF6A 1GFWA 2OK7A 1ODKA 3RLFA 5C32A 2F64A 4F46A 4RTOA 3BB3A 4H2DA 2BC9A 2Z1DA 3G1TA 4R1MA 5ES4B 4Q3BA 1SKAA 1FU4A 2H5LA 2VPXA 4GZ3A 4AJKA 3VUEA 2X9GA 1T8WA 3DYBA 3KXIA 3QUQA 3VR5A 1GPJA 3BC1A 1FP4A 2PL3A 3U7QA 4DZRA 2BFFA 1KY5A 2WFZA 4GC5A 1K5PA 3SIRA 1U0LA 4DNFA 1QB7A 3D0QA 3A4MA 1YQ9A 3UV6A 1BMQA 3HV0A 4Q7MB 3UJ6A 3I5MA 3PHHA 4G63A 3FPCA 3A1TA 2QUJA 4N5IX 4RA6B 1H2WA 2HFKA 1TZBA 1ZJZA 5HSGA 2Y1EA 2Z57A 3B70A 4JH0A 3PITA 3I9NA 4I5GA 3F5FA 1E1KA 5JCPA 1N34B 1L5NA 4QYMA 3WLOA 1TLTA 1CIJA 3R3ZA 1RI1A 1J2EA 3ZV7A 4CMGA 1J8YF 5C0OE 1TU0A 1ETHA 4KO1S 3KV1A 4KYTA 2WWRA 3QEMB 3ZY3A 3DBLA 4BN0A 2YVUA 3E58A 4O2BA 4C5AA 5K4GA 1L5HB 1TA4A 2WT9A 4DR2B 3PT5A 4G97A 1H6DA 4G5FA 4WLEA 1TVEA 2XX3A 3OIYA 5EUCA 3OZSA 5IFLA 3THWB 3GVPA 3HO1A 5IU6A 1C7EA 3WJAA 1C9MA 1A8QA 1GLVA 1NC3A 1VCMA 4FD3A 1NBAA 4BJ3A 3CXRA 2PUGA 5CFPA 5LZ4A 2B8JA 2FX3A 1WPGA 4C0HA 4FB5A 5KHAA 3G0HA 4MQFB 5ALTA 4BUCA 1C4WA 3DF7A 1MRSA 2F1KA 2A0FA 1MJFA 1IVSA 4UMVA 1Z4JA 4J2OA 1A5ZA 4HO1X 4FGUA 4GX0A 3TLJA 2NO6A 1XCLA 2GZ2A 4HLDA 2ZI3A 2CSXA 1QH9A 3QVVA 4OL9A 3FWHA 1ITZA 2BFBB 1T9AA 3BXZA 3AW9A 3DPSA 4GKVA 2I2DA 3TXYA 3Q3CA 5TQ0A 2AUTA 4EHFA 3U7HB 4BZQA 4OJQA 2Q2NA 2GCPA 3P71T 4HSGA 2PVPA 1Q7GA 5EVJA 2GT1A 4NFSA 3IHLA 4S24A 1N0IA 1P0FA 3EVZA 2KWIA 4G1MB 3UCXA 6Q21A 2JKZA 3MHTA 5HZKA 1C8KA 4FGJA 2C7RA 2WUDA 2A5LA 1RM0A 3UJDA 2XIQA 3LA8A 4WOCA 1F2UA 1OX6A 4DSZA 5A1TA 1DXYA 1HURA 4B74A 4R2WA 1I2MA 5IS2A 3JZMA 5ALQA 1POWA 4KXLA 1V16A 2AK2A 4G01B 3CIFA 2C2XA 1TAUA 3V6LA 1M2VB 5CEEA 1N7IA 2RFLA 1E1RD 3HNRA 1HX7A 3WGTA 3CF4A 3PKIA 2JPDA 2X0DA 3ZU3A 4XX0B 5AVQA 4HGYA 4CIWA 5IPFA 2R1TA 1EFCA 4UHDA 3KFVA 3OLQA 2W2TA 2ZDQA 5IP5A 5KS2A 2JIZD 3EVDA 2EL7A 4BRSA 4KFTA 3ZVMA 1T3TA 3Q3IA 2WC1A 1SUWA 1V8OA 2G06A 4MUKA 3D8NA 3OF2A 3KOYA 1LQ2A 2Z4TA 4G89A 1SVUA 1GPYA 2BCEA 3DVAB 4XWAA 5ELMA 3IH5A 3TTYA 2C7GA 4EHKA 4KITB 5CFZA 3IBFA 3IE1A 4XFJA 2BP7B 3N2EA 3KEFA 4K03A 4Q9LA 2WFLB 2JZOA 4RBNA 2EJBA 5B7PA 3RFVA 4URXR 1PL8A 2ZDHA 4KJZA 4B5KA 1I0IA 2OQVA 1RJEA 3GWZA 1TF7A 2NVOA 1D1QA 3NAMA 4M22A 4TN5A 2WKQA 1C1XB 4KU4A 4ZCPA 1REQB 3GUVA 5DWDA 4KN9S 4RIIA 4DPKA 5DM4A 3SJCA 2J3KA 4GI3A 1JSCA 2EFCB 2H9AA 3H2IA 2VEDA 3HFSA 3NCHA 5CDHA 4OFXA 3VAAA 4RTQA 1XF1A 3HU3A 2XUHA 1AKMA 3DYVA 1LJUA 2WIJA 2YVQA 2MSEB 1VZ2A 2PA3A 4MK4A 4EI8A 4Q4HB 4U8HA 3BERA 2CCJA 2PX3A 2QP3A 3ELUA 3E5RA 5BW4A 3KXLA 4PHGA 3JS5A 5A5DA 4Z0TA 5JADA 1FFSA 2X8JA 4CTNA 4Q9JA 5EWJA 4U7HA 1WU8A 1DP4A 2MIIA 4E33A 2YMQA 2QENA 4DA8A 4EHBA 2XDQB 7ADHA 2YINC 4MR8B 1TW2A 4Q9KA 4KQ1A 3P5BA 2XB2A 5ADWA 4K9SA 3FAKA 4AQYB 2A7XA 2WD8A 5KYKA 4XDZA 5L40A 1VRCA 5MFZA 1Q2UA 2OKGA 1CUCA 1I3KA 2WFMA 3T06B 3S1SA 5IDVA 3R9XA 2DKNA 4QTZA 3TOXA 4U2GA 4FFLA 4PFKA 4WA7A 5EZYA 1XRMA 3HCOA 1Y9DA 4WCDA 4EGQA 1A3CA 1WX1A 3ETHA 1L5GB 4PFQA 5JS7A 2OK8A 3WLLA 3K1JA 5F33A 4YJ3B 3CY6A 5AHOA 4A8JC 2Z2JA 3QNUA 1LS1A 2W2PA 3TLAA 4YB8A 3O3NB 3PFHA 5DBEX 4V2IA 1HMPA 2GJ4A 5C1OA 4H0CA 721PA 3SNKA 2BMWA 4CG0A 3BH6A 2JD0A 1YS9A 1EBUA 4JV5B 3MQ2A 5LYYA 4BJHB 3RWBA 4F2PA 1Y4UA 1JLLA 2WAAA 3UK0A 1XMPA 2MINB 4HRXA 4EZEA 5D3MB 1QH1A 1ZCZA 3DMPA 3HU2A 2FFBA 1KO5A 1TYAE 4N5NA 2PX6A 1PV1A 1MJ5A 1POXA 1ZVJA 2NYRA 2YXEA 1N6PA 2VT2A 1P7ZA 4JP2A 4PSCA 4KPFC 5G41A 1IZYA 1GSIA 3TK1A 5JAMA 2H29A 1VKZA 4KBGA 1Y0BA 5JO0A 4ESVA 1U2QA 3CMMA 1K9VF 2VF4X 4QHTA 4KV7A 4DT1B 2ZCVA 4NECA 2N0SA 2YMLA 4MOWA 2AJCA 4WZBB 4YP7A 2XUJA 3W8EA 1QYXA 1OT3A 3WXBA 4BIMA 5MN4A 3AGPA 4GUDA 4EUFA 1VB3A 3A6DA 3DE3X 3VR5H 3TXAA 4OP3A 3K6RA 5J40A 4LHSA 4NAVA 1ND5A 1VC2A 4ZO8A 1FYDA 2UZ3A 1X8LA 4KG7A 4YPVA 5LN1A 1O95D 2G1AA 2PMDA 2RCNA 1Q3TA 2G09A 2KB0A 3QXGA 4EY4A 2X2PA 4O4IA 1U0BB 1RE0A 3AB8A 1IL0A 1FLAA 2JFVA 3HVIA 3RV3A 4V1CB 3G9TA 5A9SB 1RD4A 2G4CA 5C51B 3WRYA 2XECA 1KDYA 2PV7A 3R7WB 3V6MA 2Q6KA 2XVAA 1SN7A 3TW0A 1BDIA 4C0AC 5ITWA 4KVGA 4C4XA 2WLSA 4X61A 2O7RA 4FR0A 3TIGA 2YFQA 5KTRA 2V0GA 3SLRA 1VCHA 2YHBA 3PNBA 2QM0A 4HLUA 4MVJD 2FZGA 2O8BA 5BT9A 2J9FA 3LDFA 1P72A 3HJFA 1QMGA 3BWDD 1TMGE 3AI7A 3VJRA 4KAJA 1AV6A 3NGLA 4IBOA 3MWYW 3T7JA 4AZ3B 4CM4B 1B26A 1UBNA 4TVSA 1GUDA 2OZVA 2RGAA 4U5XA 3PHIA 3AKYA 4DMUB 1Y89A 2WTMA 4R1UA 1N0VC 3C39A 2QX8A 1VE7A 2GILA 5A4IS 2FCRA 4KR3A 1QG2A 1ZWLA 1SU6A 3GVHA 3EXAA 4M87A 3EWSA 3ASYA 4RTLA 1YZUA 1ZCAA 3DHWC 3F3SA 2WKPA 2PLAA 3GX1A 5AW2A 2YDYA 4HVTA 2B9VA 3ZDXB 4CIXA 1PBTA 1AMOA 2B4KA 1NR5A 1ISSA 4JYAB 3TSAA 4WXHA 1ZD3A 1OZ0A 2PJUA 3GFPA 3V4VB 4OSOA 1MPTA 3CUTA 1ZD1A 1V3TA 3E1GA 3L6DA 4YASA 4B34A 1SCUB 4MV9A 2F2TA 2QDKA 1JIQA 4BO6A 2C98A 3AMVA 3MK31 2IH4A 4MVJF 1OA0A 3WFIA 4CKXA 1C0LA 4D6PA 3FTFA 1NNEA 1IJFA 1VIVA 4BQNA 1LKZA 1B74A 5JDCA 4LE1A 2I67A 1UKCA 2PUTA 4XSHA 1OAAA 3QX8A 3WMGA 2VK2A 4AY6A 2JARA 3K9HA 4OYLA 4ZVPA 4DR1B 4Q1FA 2VJCA 1N0WA 4W8HA 1J0AA 2GZSA 2OP1A 2ZSHA 1XQVA 3DOOA 1V71A 4H0NA 4LE2A 1IY2A 4REMA 4YAJA 1IZ0A 4MRPA 2QP9X 4P34A 3E9EA 5C8YB 4K46A 3BREA 4TUYA 2F8LA 3FLBA 1Z28A 2Z2XA 3QITA 2JIQA 5LBTA 3HMKA 4KJXA 3RNOA 4MYUA 3OQJA 3OU6A 2VUUA 4LYEA 1CXZA 3PGXA 2VFAA 3FE2A 3LQFA 1O1YA 3C87A 3SN6A 4UM9B 1AHPA 1A8SA 1V48A 2Y9MB 3QUTA 4PANA 2V7BA 3PQ2A 4EH1A 1KMHB 4MWZA 2VSQA 4L74A 3BIOA 2BJWA 2SKCA 5SZKB 4M46A 2HBRA 3FOCA 4QBTA 4IHKA 5IABA 1M8KA 4OMDA 4RORA 2JATA 1JFLA 1OBHA 2H1HA 4KIWA 3ZCPA 3U0VA 2PN1A 3LP8A 3W8RA 4C4YA 1RXSA 3DONA 3F71A 1CY7A 4L2IA 1C8VB 3NDPA 3R6WA 4MARA 1G21E 1GR1A 3MPUA 2OYRA 3D6NB 3C98A 2QQFA 4LE0A 2Q99A 3NGXA 4K9NA 5ICFA 1WULS 3ZTTA 5BV2P 3LGAA 4RTPA 5AO9A 1XI2A 1BXGA 1GNQA 2I6GA 2PH7A 4U7JA 5FTKA 1Z0ZA 3C0KA 3BXHA 3GNLA 3JPWA 4N01A 1F0NA 4YIKA 4ZU6X 3VR4D 4DMMA 1H1LA 2BFDA 4IIGA 1YIAA 2QSJA 2H2WA 2XCOA 4JP8A 4O2AB 3FDZB 4MVXA 3K5HA 1G3QA 4K8OA 4NL4H 4WKBA 4BFCA 5CB4A 2JJYA 5EJ5A 1RKXA 5DHFA 1DFIA 1Y33E 3CVJA 2JI9A 4B40A 2FV8A 3W8FA 3O8BA 4MR7A 4YUXA 2CYCA 2VL7A 3WWOA 1OJLA 2ZYHA 3RVLA 2QI9F 3M2PA 3K1AA 4UTNA 3FHCB 4YRQA 2DJIA 1NUSA 3P9ZA 4CU5A 3R5FA 1T6NA 1XZBA 2GTIA 2JFFA 2Z43A 1R9MA 3WXMA 4U9IS 1AQJA 3GLIE 1S8AA 3BTVA 5J1TB 1DRJA 5L3SA 1T34A 4EZIA 1DADA 2WV7A 4PAOA 4AZ0A 3HK2A 4IUYA 3K70C 5I7HA 1V9LA 1K89A 1H05A 1NVVQ 2D8AA 3EDMA 4HWTA 3Q0TA 1DKQA 5THKA 5DLYA 2NPIA 3BICA 2TMYA 3ESRA 1JEAA 4H4CA 1K0FA 4FCCA 1TDJA 2P4HX 3GR6A 4UBNA 3S1AB 5JVDA 5KWJA 1FIUA 3ERCA 1KYXA 2H8GA 3B6IA 1PDOA 3DGFC 3ZDCA 2XOKD 4TWIA 2W2QA 3N0XA 4DMHA 3I01A 1VXRA 3T3GA 3E05A 3LSYA 3TKYA 5LWQA 4IVPA 2HNBA 4RGQA 3PU6A 2L0XA 2UYOA 1GHTA 1MD9A 3EODA 4UFOA 3U1TA 4AS3A 4PNEA 5DPMA 3FLEA 4FYMA 2JJ8A 4QUDA 4TOIA 4ZDIA 1AHIA 3JYNA 2E0IA 5E0KB 2HF9A 2NXJA 3CVOA 2Q45A 1MTOA 1UAYA 3VZDA 4Q3AA 4M8IA 4YJ3F 2GVDC 3N0WA 3W5SA 2O0HA 2XCLA 3G85A 3MQFA 4P3OA 2JFZA 1G5QA 2MT9A 1M76A 3GDFA 1SVWA 3S2ZA 4Q9NA 2XCSB 1E0DA 1I7PA 4MV6A 4NK4A 3L0ZA 3C4QA 1EM8B 2VZ9A 2D3TA 4U9UA 4LV5B 3KYJB 1SIOA 1EJ2A 1D6SA 2F1IA 2GN9A 2AOUA 3HA7A 3CR3C 4OBEA 1NMXA 3BMOB 2H4HA 4N1AA 4LAFA 4WFJA 4DNQA 1H4SA 4H18A 3JSXA 4BNUA 4C3UA 3S81A 2CFIA 3HI6A 1K7CA 2AMYA 3SJAA 4ND8B 1X3LA 1GR0A 2QPOA 1M5UA 5DHAA 5GVRA 2IDZA 4FLFA 1S3FA 4PYOA 5K3SA 1KDZA 1RE1A 1B41A 1NQXA 4WK6A 1M1NB 5HF5A 1DI0A 5ALFA 4YRPA 4B33A 4BWVA 1WQ4A 2YJ4A 3ZW9A 2EP7A 1OH8A 2OT3B 1C7QA 3TEMA 1T8TA 1CUZA 2HCFA 4BNYA 3N8HA 2C4UA 1W93A 2Q2VA 4ND4A 3BSWA 4P84A 5AW4A 1PJCA 2CUNA 3I1FA 3B52X 3I1IA 4HS9A 1E2HA 4XYBA 3WTBA 3CW2A 1WAMA 4MUFA 4PEVA 4IQ4A 1ZJWA 4N9QA 3KVVA 1Z4QA 3E27A 4D6YA 1XD8A 4QHYA 3UICA 5CA0F 3COPA 1ZJ4A 4NSNA 3RKUA 2OXIA 5JYCA 3GZTB 5I5EA 2FDRA 3FOAA 2JVJA 5AHXA 4Y9DA 3QI7A 2PZMA 3PFGA 3I9FA 2QNRA 3GJTA 4NDNE 3V8QA 5JISA 5BOVA 3KEOA 3IQGX 1MRZA 2H1CA 3LCMA 1NBOA 3MNFA 4YRZA 4HAIA 5KYGA 1A5TA 1DBVO 3UYLA 1CZHA 1GL6A 1SH7A 2JHAA 3OE5A 3T94A 5CX1A 1ORDA 3VPCA 3CRMA 4QOSA 2CXUA 3LRXA 3MS7A 1FNSA 2EWMA 1UFVA 1ZMTA 3KKPA 4MI6A 3GLGE 5AQ1A 2XNCA 3CIOA 3P19A 1I5EA 4R84A 4GE3A 1D6MA 1DX4A 3I52A 3W5JA 2B0JA 1JHUA 4HLCA 3W06A 2XWBF 3HP4A 3PUVA 1XRJA 4U7PB 5IM5A 5BVGB 7MDHA 3ZLBA 1E4VA 1S5PA 3RAEC 1SCAA 4NLLA 3OU2A 4CLHA 2GPWA 2DHCA 1NJGA 3H42B 3K31A 2JIDA 5KYVA 3SCZA 2OAEA 3BEDA 3IAAA 2ATEA 4X41A 1D09A 2QUIA 4EX6A 5EIBC 4RMJA 3RU3A 5EMHA 1Y7LA 1RYDA 1Q7BA 4J8PA 2ZAOA 5BYBA 4DXAA 2GBPA 1KVTA 1D0IA 1E60A 3FX2A 4GZMA 3B1ZA 5SY4A 5JI3E 1DZ3A 2VP5A 3H75A 5ESDA 2BD0A 5BWOA 4MQUA 2W93A 5AYVA 3X2FA 4Q34A 3Q9UA 2FKAA 4KE8A 5E4YA 1WTCA 1G60A 2ZI7A 3GGGA 1I24A 1Z5ZA 3FVQA 2JLZA 4S04A 4Q00A 3MERA 4ROSA 1MUUA 2MHCA 2ZJ8A 5IJ9A 3Q2IA 3L2OB 1IOLA 1U81A 3HN7A 5H83A 5K3BA 1DC4A 3KG2A 4NDZA 2VDJA 2VPWA 4Y2PA 5EFZA 3BRWA 1R12A 1NPYA 1NYLA 4PLZA 4F1WA 3Q7SA 3UJBA 2QQEA 1O96B 3QY9A 4I1YA 5I9MA 1ZUWA 1AXEA 3UGTA 4ODIA 1KRHA 1PVVA 1X2BA 2ECPA 1U0JA 4M8SA 9ABPA 4EK9A 2PUCA 1UKVY 2O0MA 4M60A 4ND3A 5C3MA 3BSFA 3SG0A 4CT0A 2HQRA 4LGMA 1M6NA 4RH1A 2J9ZB 1W0JD 3LS2A 2C29D 3CLKA 3T1NA 3FGOA 5DLEA 4A7PA 3UKOA 4NZNA 1DFHA 1GLNA 2JH9A 1T25A 4KUGA 4QQFA 5JV5A 1XTJA 3S2IA 2BV3A 3AHEA 3MAGA 4K9QA 4V24A 4UCFA 5C8YF 1UJBA 1GN8A 3OPXA 3ZVKA 1LNZA 4BFZA 5I7VA 4C7JA 2VWGA 1VMDA 2ZKIA 3D7SA 5KNCD 1HETA 1LF0A 2V96A 3A4NA 4DM7A 1EX7A 1AQLA 2Q0SA 2GAJA 4EBFA 3A31A 1RLIA 3QUCA 3C6YA 2CVQA 2C8LA 4M37A 5CR9A 3VDXA 4WXYB 4QPCA 4AXBA 4NG5A 4MYRA 4BECA 3EX7C 5EYPA 5HXAA 2EYQA 4RZHA 3W2TA 3PI7A 4F4HA 3NHMA 3DUWA 1J39A 1X80B 2J6BA 2FPMA 3OA2A 4A2QA 1SEPA 5FL7A 1N9GB 5BV8A 1DBSA 5G0WA 1USWA 3OM8A 4FK8A 3STXA 4W5RA 4LKOA 2GRUA 3QE4A 4R81A 3GN2A 1R6DA 2FY8A 2K7ZA 2QJFA 3OFSA 5ICCA 3LT5A 1IN7A 1BVUA 1T3ZA 3ABQB 2OECA 2C5AA 2JJ1D 1YL7A 5DJ5A 1ZESA 4P98A 1UPFA 2NNWB 4GKBA 4LBZA 1EE9A 1F1BA 1I0LA 3OQIB 5EE9A 4WFIA 1XAHA 5EWLA 4XD7A 3ZYZA 2H1IA 3NFRA 4M0DA 2ZVQX 3ZX5A 3OQHA 5KVCA 4A2CA 1PS0A 3EDRA 5AQEA 4BNDA 2QX9A 3D6VA 4CMKA 3LXMA 1UIMA 4TMWA 4OK5A 3WQQA 2ZIVB 1B3BA 5KJ6A 2IXAA 5B7GA 2ZYSA 2GWHA 2GESA 4IGEA 1YTLA 5IYZA 1VPWA 1MOPA 2EG9A 1ZA1A 1MG0A 2G5CA 4ENSA 1I7QB 1BX1A 2BT4A 2VRCD 2Y76A 4IKEA 5E6SA 3W6ZA 4HZUB 2EKBA 4I1VA 3GJSA 1EWTA 4ZOLA 3PC2A 3WWDA 4D0RA 1BS9A 4S2UA 3KWJA 1RKBA 4RZ3A 4F6RA 5A6SB 1RWBA 1ZMBA 1FP2A 1G8FA 3ER6A 4CL2A 4CEIA 3FF1A 3QPWA 3EA0A 1SOUA 3I9V1 4UDNA 3CNLA 2FP4B 1OLUB 2BE9A 3FNIA 3JQGB 1SUSA 4R5MA 2R79A 3IIKA 4GUAA 4WMLA 4R8RA 2CMHA 4TQGA 5EVCA 2JLYA 3G8BA 2IH2A 1DJMA 1IK6A 1M7GA 4Z9YA 3T4EA 1Z4OA 1MB3A 4ALLA 1VKNA 3I23A 2AZTA 3FB1A 1JG6A 4Q3EA 1EFAA 1AKWA 3LF1A 1J0CA 2R60A 4X6UA 2AMFA 2FSSA 2IIBA 2FRXA 5E4TA 4GW3A 1FOEB 1Z6GA 1UMKA 2IF0A 3SLKA 3GP3A 1RLUA 3LYAA 4O4LA 3ZHQA 4L8FA 1FYEA 2Z4SA 5KWSA 3GBVA 4DG9A 1VHTA 2JCSA 5JPIA 4TWRA 4PPYA 1HQYE 1ONPA 2YJZA 4MKIA 5FLKA 4RY9A 4ISBA 3AO0B 3QIVA 4TV8B 3UG6A 2QLTA 3MB8A 4GOOD 4K6CA 1JKMA 2IUEA 3U16A 3ND6A 1QV7A 4QEZA 1UBRS 4N7RA 4P93A 1OX5A 2CLSA 2Q29A 1P7WA 4F3TA 1SUAA 5B1SA 5FNZA 1KI4A 1QR6A 1E9BA 4QOEA 1K63A 1KPHA 2B9EA 3FTCA 4UUAA 1M6VB 2BF4A 3VNRA 4DBVO 1NYRA 2Q1XA 3ELWA 1KZYC 3K0BA 3AJRA 3RUDA 1RP7A 4N0QA 3ZV4A 2ZJ1A 2AFHE 1G2PA 3WLEA 1XWFA 4OHYA 1QO9A 3WL4A 4JVMA 1XLVA 3HCWA 5KREA 1R5OA 2EGHA 4J0DA 2PSSA 2DF8A 1M75A 4HBZA 5JRJA 4H1VA 4FIDA 1I9CA 1PSDA 4I4TB 4OU4A 1Y4DE 3EXIB 4R7TA 3GUZA 1MJGM 2RCYA 5LBIA 5FAKA 2HHHB 4DJFC 2OHHA 2JFWA 4W9RA 4Q37A 4WZAB 1QIDA 5FWDA 2R4TA 5BNFA 1CY1A 1OHHA 3J7TA 4L5BA 4F7DA 1IN5A 1YH3A 4K6KA 1NHGA 1Q0SA 1L7XA 2D7JA 2QR3A 3PQDA 2D00A 4FZ3A 4QA9A 1MCZA 2B92A 1T24A 1E6UA 1Y1KE 3IDOA 3K0EA 3MS2A 4RQBA 5LMNB 2OHXA 2V54A 4RENA 4CM1A 3NCTA 4JL8A 4C21A 5HKKA 4ISCA 3QQ5A 3USZA 1BEZA 2Y93A 3PE4A 1DEXA 2Q1SA 4IG9A 4QT0A 3LOQA 5GY7A 1DCTA 4IH4A 4NJEA 5FHRA 4HAXA 4FCTA 2I4LA 2ALJA 2MYPA 521PA 1P19A 2WMNB 2PJDA 4QFDA 5GM1A 3IPYA 1XVIA 4DY4A 2QYTA 1JQDA 1UBLS 1AH2A 4M7OA 3T7DA 1KDPA 2V58A 4AKGA 1G20A 2APJA 2R62A 3LOPA 3DOIA 4KQEA 2QN9A 3RG8A 4CFSA 4COKA 4J4HA 4EEKA 2EFGA 2DAPA 1V1JA 2FWPA 2OEPA 1IQRA 2NV0A 4O8CA 5ARDA 3ND9A 1NW9B 1VBFA 3OPNA 4TQAA 5EHQA 2I03A 3JARB 3ZE6A 4CKWB 2HUPA 4UUMA 2NUBA 1NRJB 5A4JA 1E3JA 5FPTA 1CU1A 3QNWA 4JIMA 3RIHA 5IK2D 1TK2A 3QWHA 5B57C 4YT5A 3EXEA 3GAMA 4KBYA 3OTOB 1TAQA 5J1SB 3RJMA 5DT2A 2XWQA 1K8XB 2IUYA 2Q3BA 2SBTA 3ME5A 5DNEA 2CL5A 4X91A 5F52A 5B4TA 4BQPA 4FBLA 2WA2A 3U7QB 5KSZA 2BFFB 3PVSA 3ILHA 2H2HA 4E5DA 5HEKA 3C6MA 3VKWA 1Z4KA 5BV1A 1LBEA 2QRVB 4F1KA 1XQ6A 4FC7A 5JXGA 3GEGA 2WJYA 3M9XA 4JI0B 1PCXA 3NALA 3R5XA 3PK0A 1HE2A 3E22B 5J9FA 4LRUA 5FTMA 3T5TA 4QYIA 1KEWA 1PJAA 2WU0A 3IVMA 5WRFA 1NBMA 4DMLA 1KRWA 5A7HA 1G19A 1V6AA 4NV3A 2FF7A 4KUEA 3K7EA 4XARA 2UZ0A 2EIXA 2ORVA 1Z6YA 1RXVA 5KJEA 1ZN7A 5AI9A 3W5IA 5C80A 2NO1A 3O1JC 2I4TA 4RE6A 2WQZA 4GBJA 3CH4B 4M6WB 3Q7IA 5BT8A 5TMEA 4KCGA 2X9NA 1NN0A 2PFGA 3GELA 1QHHA 3ITEA 4H60A 2HKIA 1BWRA 2OHVA 4H6VA 4LJAA 4EIWA 5EWMA 2CE7A 4Z9AA 4BASA 4YX9A 1E79A 1O94A 1A9PA 1ZISA 3BG5A 5L45A 3KLOA 4NNPA 2X7XA 2ZBFA 4KPGA 3MSXA 4TKMA 3KFLA 1P7PA 1A7AA 1FZQA 1A04A 3KXPA 5LQNA 1K7SN 2QU8A 4QRDA 1QMPA 4AYWA 3CN7A 3O8NA 4ZEOA 1QCYA 2ZT7A 4A2PA 4ARUA 3Q6IA 5TQ0B 1W4BA 4EGAA 1YB6A 4D9FA 1ZNWA 2E7ZA 4L6AA 2FQQA 2AN9A 1KP9A 4P3KA 3CKYA 1EZ1A 5IW8A 4ESHA 3OQOA 3OHMA 4L3VA 1SVNA 4TQ9A 2XXAB 4JN6B 5F35A 3X1ZA 1ZBQA 3DQZA 4YJFA 4A0QA 1HM5A 3BUSA 3BYZA 1SKQA 4FT4A 4BEWA 3OZUA 1NV8A 1OB2A 1NKVA 1XZPA 2PMWB 2QS9A 1PLJA 2YZMA 3H84A 3UC5A 4COOA 2WSIA 3V34A 1FRVA 1ZVMA 4L7VA 4HJRA 5LNK1 3CLUC 4OHVA 4AJEA 1FW8A 1I1HA 2H1FA 4KP7A 3WLSA 4BWFB 2Z6UA 2ODWA 7AT1A 1OKKA 4Z4EA 2UU9B 2NYAA 3GEIA 1RLJA 3GOQA 1RRMA 3V8VA 4ZFNA 5A03A 3PEEA 1QF6A 3LX5A 3KQQA 4GPBA 2R1TB 1NJ6A 2FLWA 4HB4A 5TT1A 4FI3C 4J6EA 3IV6A 3ZU5A 1VSBA 3HR8A 1XVLA 4AM8A 4MPJA 1KSFX 3I42A 5C53B 2Y0EA 1M54A 3BB1A 1F0PA 1OFUA 3D0OA 3OTGA 4YO8A 2QXUA 1X38A 2XADA 2QMHA 1E2DA 3JD4A 4FNAA 1G4HA 5L3ZA 3NXSA 3RTAA 1EVEA 3TKAA 1IXYA 2HWKA 1PYDA 1YCHA 1VG8A 1XNJA 3RSCA 2XSZA 2HZ7A 1NE7A 3L7CA 1GTVA 3MJSA 4IXDA 5T3YA 1KY2A 2WAMA 3I04M 4LQDA 4TYMA 3A6GA 3T1HB 4RHEA 1XTKA 1ZC4A 4JP3A 1TEZA 1ZVKA 1J9ZA 2BDUA 3PQCA 2XUGA 3T3PB 2DQYA 2NG1A 1IRXA 1UMDB 4IYJA 4JBXA 1I7LA 3VZPA 1ADJA 1II0A 1I3LA 3DHYA 1JH9A 2PTHA 1KBQA 2VF5X 2XE4A 3FMIA 1NZFA 3VYTB 3WB1A 5G0UA 3WA7A 2DBYA 3OJWA 3L1VA 3DSRA 3ORYA 1I2DA 4OUDB 5DX8A 1ULBA 4IW3B 4DCUA 1AGRA 2O57A 1LZLA 1IVYA 1C1YA 5EEHA 3IELA 3QVWA 4UZEA 5KWIA 2C1ZA 1OYWA 5H8WA 2VDMB 4PSUA 1PNVA 1APBA 2FU5C 1QF7A 1PLKA 1JZTA 3WYAA 2UXCB 1ATZA 3TW4A 1ESDA 1EJ6A 4LZLA 4ZIRA 3V2HA 1ZH8A 2RGWA 2XWPA 3BZWA 2Q5CA 3IP6A 1PYGA 5A9TA 2G0AA 4M1KA 1J21A 4PAGA 4B35A 1DIBA 3RTEA 2K2WA 2Z6VA 3DB2A 1GILA 4GX2A 3NBUA 2RMKA 3OKAA 4MI3A 1Z06A 2R84A 1ZD5A 1CF2O 2P0EA 3L77A 5EJ2A 1P0QA 2AKYA 2A5FA 3WKDA 4DREA 3QU5A 4IZIA 2E1RA 5EZYB 5IDXA 4BWGA 1CVLA 4IFTA 3EY4A 3K8OE 2WZQA 1S96A 4HTFA 4BUZA 5SICE 2NZ8A 1J0BA 5C5DA 1CDOA 5JHGB 3K70D 4MMXB 5BO5A 5U1PA 1DMRA 1Z75A 1S4QA 2FMIA 2RH5A 2OXCA 1DC7A 5ALZA 5JZOA 5FLEX 5K8IA 3GOHA 2ZTVA 1ENOA 1LNSA 2PA0A 3LI2A 5DHPA 4BNWA 3DBRA 1Q14A 2VBCA 3G23A 3NBFA 3Q5DA 3QELA 1FFBA 1M74A 4H3SA 3ER9A 2ZPTX 2F48A 3ONVA 4YV2A 1S3GA 3QVJA 1EWKA 5THXA 3SY8A 1JE1A 1VECA 3VKUA 4LSMA 3ZVLA 4ZI7A 2HPVA 4OQLA 1FFEA 1MOQA 3V1KA 3TEJA 1YJAA 1DAPA 2PT7A 3DM9B 3ELBA 4QPNA 2CV1A 2C4TA 4FEYA 3LVRE 2VQ3A 3PGJA 3VPHA 4DHWA 4L0CA 1B43A 3I9LA 4GLJA 4OSPA 4PHTA 2VAWA 5ALXA 3MD0A 1JR3D 1Q0HA 5IC4A 1UL1X 1PK8A 1WZNA 2A57A 2V6JA 1QHXA 3JRNA 3R0XA 4KDCA 1KFEB 3JZDA 3FWPA 4C6RA 1JDPA 2HLDA 2H52A 5K05A 4E22A 3I8SA 3ZJVA 4CKEA 2C0CA 4DR5B 3NHLA 2NVWA 4DA0A 3CCCA 1UXGA 4JLBA 4Q3NA 5ULLA 5FBHA 4YN3A 4C7XA 4P31A 4L73A 2ZSJA 4W5QA 3QVSA 1W29A 4P80A 5BMVB 3HADA 5DOZA 2JK1A 4HNQA 3HZHA 3ISTA 1U2GC 1NTOA 2AI1A 4GR9A 4KOAA 4FMPA 3S70A 3ZDDA 4MEAA 2XA1A 1NVBA 3I0MA 3K8YA 3ZXSA 4O4IB 3FPBA 5E9AA 4Y1RB 5BR4A 5GMOA 4OP2A 1NI5A 5TPWA 2ZUSA 4ZEWA 1I4TD 2F3PA 5ENZA 4HUJA 4FDUA 1KAMA 2FPRA 3PI6A 4X8OA 3F8SA 1P0IA 3WK4A 3AHGA 3J80A 3LO5A 3HCCA 5K5EA 1T2UA 2HWYA 2IEIA 1QKIA 2C00A 3MOIA 4FGLA 3IVAA 4EGFA 4DIKA 2BYTA 4GL4A 2O8BB 2BHRA 2BIFA 4ZVOA 4PWZA 3U7IA 2J9FB 4RQUA 1TZ2A 4I1IA 2WF6A 4DLKA 2GB4A 2P2DA 3IO5A 3W7BA 1DGQA 1CEXA 2OHJA 4NXMB 1E0AA 2B7CA 13PKA 4N54A 4LZWA 4HEJA 2VPTA 4HPJB 1ZRSA 5KAPA 3QX9A 3SJZA 4LRYA 3NEPX 3KSMA 1BDBA 4EF6A 2XOXA 3I5AA 4TX1A 4XYGA 3U0BA 1JZQA 4ENRA 1ZMXA 3AV0B 3ED1A 5EE1A 4Q1CA 1Y8RB 2P6NA 3A6LA 3F2IA 3F3KA 1JXQA 1BQ4A 2NTNA 2Q0HA 4HQ0A 2ZR0A 4FOOA 4MKHA 5JAIA 5B58T 1SCQA 4YXFA 4YMHA 4GGMX 3HY3A 1Z0KA 2ZJBA 2FAXA 5DHTA 1ZM9A 4PYQA 1WSWA 4YMSA 1TM2A 2IC5A 1XTRA 4CMJA 2CGEA 2Q3DA 3DQPA 3HVHA 2AOVA 2QV7A 4UBKA 1KXZA 1ZAKA 4RO0A 1AVTA 4KB5A 5I3ZA 4OLJA 2NMVA 5AJXA 2JRLA 2VIIA 3UGJA 2FSVA 2J3DA 4F8JA 4UTOA 4L4RA 4D8YA 3NMUF 1X87A 3K15A 1Q92A 3U40A 4TN1A 5E7IA 4X44A 2PR7A 5GZ3A 2K6GA 4TXLA 2YWJA 4LVNA 3EB9A 5EIBD 4C43A 2LVBA 1E0KA 1Y1PA 2J3HA 1VIYA 2WD7A 1KZGB 2VLIA 1JT2A 3LV8A 3OX2A 1YBMA 4B8ZA 1TW3A 3B6JA 3TOSA 1G38A 3WL5A 4ECEA 3JYHA 5GJBA 4HCJA 1S1CA 3DZIA 2R6FA 4S3MA 1UKAA 2RHHA 2ZQYA 1X1EA 3ADOA 2ZZNA 4JC0A 1HYQA 1FJXA 3SSMA 3AY0A 5IDQA 3FJOA 1CUDA 1A96A 3QUBA 4QHSA 1T6BY 3U6KA 2W00A 1UBFA 5TS2A 4AC9A 5A2GA 5D86A 4GE0A 2ZJZA 4A1OA 4NE2A 3UUFA 3PNQA 1KO7A 4ZOEA 5ALJA 4D8TA 4W5WA 1KJ9A 4H17A 4YRDA 3RJ5A 2HRBA 3BGSA 1ODFA 3IT1A 4TUYB 2NUTA 2I1WA 3ET5A 5FOVA 3BGIA 3E53A 3P9KA 1P62B 4FDVA 4JZYA 3SYLA 4BNFA 1FP1D 3N28A 4QXOA 3IA7A 5FKJA 5LDHA 3SS7X 5TIIA 5DK6A 2WJGA 4PZ0A 2C88A 4XOIA 1M1YB 4K2HA 5F7ZA 5JEDA 1DOAA 1EP9A 1F9EA 2R1UA 3P2EA 5ALEA 5EMKA 3RU9A 1QPBA 2IQIA 3AEYA 3H5VA 4M0EA 3RARA 5JWRA 3ZPXA 3I30X 3DVRX 3H0KA 4M9SA 3PV0A 1BD3A 1ZXBA 2A8YA 2CLLB 3UMRA 2XB9A 3SMVA 4C29A 4CM3A 4B3HA 4QDXA 4NZZA 3BDIA 2C57A 5BR1A 4L2IB 3IEVA 1PQYA 2CSUA 2E18A 1UBCA 4PN7A 3R9KA 3RHZA 1Q1AA 1OMOA 1AZWA 3NP7A 3Q0EA 3UAGA 2XGJA 1U6IA 3MOGA 2XUPA 3P94A 4RY0A 1SCDA 4BFXA 3G59A 1BXGB 4RXTA 1NZJA 3VV2A 1WY5A 1U2PA 1D1SA 4BMYA 1JI3A 3L7IA 1H1LB 2BFDB 2NUPA 3S2YA 2TMKA 3L4BA 4O08A 4YGYA 2OXEA 4RZSA 4MLZA 2C2BA 3RTCA 2VTKA 1GYQA 2FRVA 3Q7PA 3D6HA 4Q19A 3BTOA 5H3HA 5A5VA 5JJLA 4C4SA 4WI1A 3CKLA 4ITRC 3WNDA 2RBKA 3PC8A 4NEGA 2ZRBA 1H8ED 4C78A 4KL8S 5DN9A 1XDSA 3W1EA 2XYHA 5FV7A 1IZ8A 4XJTA 3K9WA 2FR8A 3DV2A 3E9YA 1FSGA 1Q1NA 1FW6A 2B78A 2WKSA 5AIAA 3GARA 1VMKA 2HNAA 3H4TA 3O0DA 2P0AA 1XXHA 5L3SB 1KR5A 3B1FA 4BFUA 4DC9A 2HF7A 1GRNA 2VQEB 4LC1A 4L28A 2NXEA 3FHOA 2DPMA 4NEQA 3UMBA 4C4ZA 3IBTA 1KEEA 1OZFA 3BD8A 1JPJA 2PV0A 1GT6A 5F64A 2GLXA 2O4CA 1MO2A 1R7RA 4UQOA 4MGZR 1RADA 3E15A 2IX3A 1NM5A 1B0AA 1V43A 4I1UA 5J59A 5JVDB 4XVUA 4J0FA 5JCJD 2B1IA 4UMEA 5ARBA 2GEVA 4LC0A 1TJ4A 3LU1A 1MAUA 4QL3A 2IUUA 3TRIA 4Q66C 4HXEB 4EG6A 3MJCA 3R40A 4GPD1 4EKYA 5BMOA 2IJGX 3JX9A 6ADHA 4NARA 1J2YA 1YFKA 2FW8A 3A7EA 1DU4A 4KQHA 5AVYA 4P2GA 5EZYF 3GJ3A 1US8A 2QT9A 3ZJTA 5H0IA 4PVDA 4OHZA 1TI7A 4L6IA 1IM5A 3TTTA 2GFHA 3B1WA 5ENVA 2WJVA 1MF7A 2V7EA 2QAIA 1YKGA 2WP8J 4C2UA 1GQFA 1TGYA 2CW5A 4MQBA 3C5VA 3G2QA 3Q12A 3OCUA 1CX9B 1KE1A 1PJRA 2CDAA 5HF9A 4UTRA 4RABA 3U4DA 2A5YB 4EPTA 1W0KD 4KGVA 5CLLA 3WLQA 5IANA 2FZKA 2JA1A 3OEHD 1R4MA 3UK6A 1JHOA 3JYLA 1RVDA 1V35A 2IHBA 3B9PA 3IAFA 6YASA 1BOOA 1R8JA 2RK4A 3H8WA 4W9NC 5DCWA 3I3SR 3GA7A 3TD6A 4BGIA 1NRIA 4YJDA 1ECFA 2X3UA 4O0LA 3T8YA 4QATA 3HE3A 4KACA 1IOVA 4PZCA 4M1OA 2A9RA 2OGUA 4B0PA 1KI6A 4NX2A 2WF8A 1IE3A 2NVUA 5HMMA 2ZAIA 1MN6A 1EFUA 2IPMA 2WZBA 5B3AA 1AA6A 4K9LA 4TWZA 3W1VA 4AUMA 2C3PA 5CA1A 4KNVA 1ZIYA 1XZ8A 3P0EA 4M0KA 3SC2B 3ROKA 2ENUA 3LYUA 3IRUA 1EGAA 4HYYA 2IYTA 1CFJA 4JLJA 4GNRA 4OO3A 5TQ2B 2QX4A 5U4QA 4DIOA 1E1DA 1T15A 4NBVA 4CFZA 3FHJA 1CRWG 3ESBA 1G8YA 4V0ME 4RDXA 3DAPA 4JSTA 3VAZA 3HBLA 4DV2B 1W4CA 4PHHA 2WIFA 1USIA 2QNBA 4BLTA 2FE4A 2V6BA 3BPSA 4ECAA 1BVRA 1NW5A 1PL0A 2HJ9A 5COBA 4CM9A 5JS1A 1I6KA 2ZR9A 3E61A 3DD1A 3O31A 1FX0A 2R7LA 3OX1A 2GCIA 1Q12A 5G0SA 2FWBA 3U7RA 1ENYA 1JWBB 1SQ5A 3MILA 1MLDA 4O4IF 1TE2A 2PWZA 4Y3UA 1CP2A 2HBYA 4RH3A 4BMOB 5K3DA 1PZFA 2B2XA 2YVLA 5FI5A 4Y0AA 5FUXA 3S68A 4DLPA 1SVKA 1IBLB 4EELA 1W47A 4HWSA 1K2VN 1HFKA 3C8HA 3K5IA 4LGYA 5F5XA 2V98A 3K9BA 4WLVA 1YQGA 2HK9A 5CX1B 3RC7A 1KMNA 2BI8A 1GG5A 1Z0DA 3SJ7A 4NS4A 3U3KA 2EJVA 1AUQA 1OWNA 4ZXPA 2DH5A 4Z99A 2W6IA 4PTYA 3MWJA 1HE1C 1E2FA 4RU1A 5FOQA 4DCTA 4JELA 3LT4A 4H7KA 4YMWA 2JW5A 1W5BA 4LNAA 3ZGVA 4ZI3A 4D80A 1ZL0A 3TMYA 1M10A 2YR0A 4OKNA 4G1VA 1N5KA 4ZREA 3ZDBA 1FUIA 3LECA 3W5BA 5JATA 2I91A 1VIDA 3I9V6 3FH0A 4R69A 5CCDA 1OILA 3LUFA 1QLHA 4KVAA 3HPRA 4MWDA 2P3OA 1JSZA 4C14A 1CETA 1J00A 1PJBA 3BWCA 1IY0A 4I2NA 2ZGVA 2CLKB 3AF1A 4JK3A 3PG5A 4HDRA 1I94B 1JAIA 3WWEA 2PCJA 2J67A 3HLKA 4Q4JB 4LV8B 4JUCA 1RKVA 3L8YA 1V1MA 3HJRA 2Q0QA 3A0UA 3VRHA 4IRMA 4R71A 3HB4X 5JS6A 1ZOOA 2CLCX 2FKNA 3FUWA 4N5HX 2Q4TA 3HSSA 2R48A 4JUFA 2Y0BA 5FTJA 3THRA 3UJ8A 2D2XA 4ZVKA 3UCEA 4RK6A 1QZXA 1VRWA 4EW1A 1LK5A 1EVLA 1N6HA 2ON6A 3IT0A 5I7FA 4WXPA 3WOHA 4EFLA 1VZ3A 3DEKA 1EFPA 4HAZA 3RRZA 5JD4A 4M0LA 1EFVB 4C3ZA 3UGQA 5IXJA 4JLKA 4RFSB 1SHLA 3BTSA 1FDSA 1U9CA 5JNTA 1GCUA 3T7KA 1TECE 1J22A 4BLOA 1BCSA 4GOXA 1JSRA 1C30A 5HYVA 4FCVA 1GKKA 5EEGA 5JSYA 2JFHA 3T5CA 1E96A 2OCXA 4NICA 1U6KA 5LZ2A 1ODTC 5ALOA 3G17A 1UBSB 1OAKA 2I3GA 1JIKA 3CRRA 1RXIA 3L1JA 3WRXA 5I45A 1EGHA 1YU6A 1TA0A 1QO0A 3L49A 4R05A 1EP2B 4UXIA 2BW0A 4TUYF 4HQKA 5HIKA 2CHVA 1LV8A 1R3UA 4K6GA 5HRAA 1MAWA 1Q77A 1YAHA 2JDID 2PSEA 2RH4A 4HWPA 2C3MA 5A5GA 5K0JA 1OLXA 3RODA 2Q4DA 2DTEA 2P6PA 4HV4A 4J0GA 2QL9A 3NIWA 3AKDA 4DDVA 2XCRB 1A8UA 2RDMA 1H94A 4RV9A 3C70A 4TSFD 4BCBA 4YUWA 2PVSA 3GZ4A 3IODA 4UASA 5DLDA 4BFWA 4AUEA 4G85A 3P8ZA 2X5XA 5EYPB 3VU9A 3UMMA 4OFZA 4UNQA 3IJ5A 3M89A 3ZK7A 1T13A 3KDAA 3O3OB 3CV3A 2PGNA 2NPOA 4FZ5A 4JLPA 3C3JA 4TLMB 1UM8A 5IAJA 3IUSA 5C3UA 1YOVA 1E59A 4PBRA 2IOFA 3I2JA 1H23A 3WGVA 3NI2A 2OAGA 4BC1A 3A36A 4GGPA 5DXAA 1SZPA 2RI6A 2QHXA 5AH0A 5DCYA 1LH0A 2Y0PA 3AZOA 1CZKA 3DT9A 3PF9A 4IXNA 3DCYA 4KC0A 1ODLA 4DIDA 2I7VA 2J59A 4F3NA 2GYUA 4L9WA 4CKBA 3H17A 3V32A 1XCGB 3OFVA 4TT3A 1BS2A 4IJQA 4MW5A 5EWLB 4BFVA 4AQDA 5JBNA 4Q1VA 3L6CA 3N2GA 4X92A 3GPLA 1JB1A 3DV9A 2DBQA 1CR0A 2FWRA 3OZVA 1FUKA 2HDWA 4MVJE 2OZKA 3SF0A 2HRZA 2N1MA 3MTGA 3EF1A 4BNDB 1Q6YA 1DG9A 1FFGA 2PXXA 3A9RA 3M82A 2BHLA 4NBSA 4XYLA 2BMVA 2JLAA 2VDOB 3HJGA 3ZG6A 1MT0A 1RSZA 2HSJA 4N76A 3QP9A 3F78A 3U7JA 3WKCA 3A1VA 3ZTWA 3W4JA 4A82A 3PQ5A 4CL8A 5TRTA 4LXGA 3RH0A 3N2ZB 4EW6A 2CDNA 1S9DA 1T5LA 2OHFA 1AG9A 3ICOA 4JP5A 2QRKA 3FNBA 5E6SB 4F0JA 2HMVA 3DFZA 1LVHA 4TVKA 2ZJOA 4WV3A 3L43A 1JDSA 1MMFB 1A50B 4OYYA 5DCUA 3IJPA 4ZO9A 2UXBB 5LC1A 1OF1A 2BEWA 3CLUD 3EDQA 1WEHA 3PA6A 3ZWOA 3C3CA 1X7GA 3ZZNA 5JVDF 3G89A 4ZJPA 2X1HA 4H7PA 1OREA 2M1ZA 4JBHA 4PAWA 5AJTA 2GO7A 3OMXA 2IU3A 5LZ7A 5L3QB 2O7QA 1G2QA 4JQSA 3PF8A 2R6AA 3HJAA 1OA1A 3K8QA 2SCUA 5BSFA 3DXZA 2X6QA 4YCLA 5IVHA 1P1BA 1WZEA 1NBIA 1GGMA 3CLVA 4BNZA 3PPYA 3RPEA 4YRIA 1Y5MA 2OORC 1USKA 3EGOA 1PNQA 1GPAA 5B6PA 1NIJA 1Z6AA 3IP3A 3FUVA 4G5OA 1E3DA 1N7JA 2ZWMA 3CNQS 3L7OA 3O92A 4L85A 5CG2A 1F8FA 3HVUA 1FMLA 2X41A 1TYCA 3LUJA 3AL3A 1AC5A 1PX2A 2BE7A 4HFMA 4KGDA 3U31A 2RE8A 2VHEA 2IS1A 1EXMA 4KE9A 2DETA 2FPIA 4JBLA 3B5EA 4QRHA 2UZ4A 1KVRA 1XFAA 2HD4A 3F7NA 1W94A 3FKJA 3U4HA 4FDLA 3VJKA 3SHVA 2HBQA 1UBMS 1ZP6A 4QBKA 2N47A 1IONA 3OFKA 4Z49A 2XE7A 5DI3A 3I72A 2G83A 3QYJA 4WJLA 2ZP1A 2XUKA 1FLDA 3E18A 3JYPA 2GK6A 3H86A 3G7NA 1XCBA 3OETA 1WOMA 5JXWA 1L7NA 4UW9A 2ZI9A 2HCBA 5TF0A 4QBHA 4U00A 5JDIC 4DLVA 2A1UA 1AGXA 1T2CA 1Q11A 3AUXA 3N5KA 5B2FA 2IYVA 2BRUC 4E31A 1IMOA 2XUAA 2C1XA 2JGIA 2EWVA 3VH2A 2P2NA 4Z9XA 3VPSA 1GPNA 1TCVA 3OPQA 4UD2A 1H2HA 4LDJA 3SE0A 1G64A 4QOGA 1G21A 4RLQA 3UMCA 5BNTA 1NMYA 5TGZA 3T9AA 1NPDA 1D0SA 3N8GA 5UKDA 2NU8A 4B44A 2WWXA 1ONOA 4WVLA 4F04A 2YIMA 4HDOB 1C1HA 1PDWA 4JFAA 2OMEA 1WEKA 3BD7A 4LISA 1I3CA 4J0JA 3C74A 2CUZA 3RVKA 5LNK6 1Q91A 3QOXA 4K9PA 2P75A 2P9BA 1WUYA 1X3SA 1BKYA 4MPPA 3EAFA 3ASVA 1WBJB 4LYJA 4W63A 2ZIZA 3TTXA 3P4XA 1JNXX 2J07A 4NJEB 2JAWA 2ORWA 2ZBVA 3OLYA 4WY8A 3W3ZB 1P4AA 2VXBA 5F2NA 4DIBA 3AEUA 2P2ZA 2OC4A 5E38A 1NLYA 1JMVA 1SUEA 3LF2A 4X45A 4E88A 4A16A 3NPAA 1WVGA 2NV6A 2ID4A 4GR5A 5BYAA 1AS2A 2G5GX 3BWEA 5FO0A 1Z68A 4K9DA 3VJMA 3CO5A 1ZK4A 4NCJA 1JYEA 1C7ZA 2VHYA 2IHKA 1QDUA 5HMLA 3RU2A 5KTOA 2CYBA 4WFKA 4ZRMA 2VPYA 3KSBC 2E6KA 3RF7A 3HUDA 1ORIA 2FXVA 1MABB 3WNZA 4ZCMA 2DRIA 3PXDA 5ICMA 2IVZA 3WNQA 1X7DA 3GPBA 2VUSA 4CU2A 1J24A 5BN4A 5ICGA 4RMHA 1HE5A 1GUFA 1Z6TA 4G5YA 3V4FA 1JVBA 1A0OA 3NQ41 4XW2A 1NUUA 5DXJA 3KTFA 3FOEC 3W6PA 1ZH4A 3EXEB 3HKCB 1FMJA 1T4CB 2BEJA 3L7AA 2Q7DA 2PRJA 3O83A 4B7UA 3F3YA 1T2DA 2JJ2D 3LDAA 5JALA 2B6HA 5A3QA 5JNUA 4RTRA 4FYHA 3FZEA 1RQ2A 4REQA 3T3MB 4BQSA 1N6IA 1YJBA 2A9VA 1HH4A 3AUJB 3JVVA 4HQOA 4WZBE 5A6VA 5K8VA 2P1ZA 3JQAA 2D74A 2B1JA 1GWNA 2RH8A 3L4BC 3WYGA 4Q39A 3ZE0B 5LQDA 3JAMA 4F12A 1A8HA 5DTJA 4AYXA 4BB5A 3VYVA 4R0MA 2ZBRA 2P3QA 1XYGA 3KNZA 2G04A 2HJRA 5EXXA 3DH0A 3MCAA 5CITA 1ZGJA 3IHKA 1JYSA 1EZZA 2HEIA 1NAHA 2QORA 4PCLA 2A30A 3O3CA 3E3MA 5IWAB 4GM4A 2FR1A 2YJTD 3F7OA 2TECE 3OP4A 4LMBA 1RYBA 3LKDA 5K0SA 3EIEA 2VJMA 4LECA 5E3JA 2FPPA 1OIXA 3EUAA 2X42A 3FWKA 3M83A 4LYDA 5H9WA 2J7KA 3A2LA 1O5IA 2P9TA 2ZSEA 4YCCA 2AUNA 2OFFA 1GTL1 2JCVA 2JLRA 3LUKA 4LGVA 3BXGA 4NBTA 3RCBA 3RG2A 4EQ6B 2CY0A 2P35A 4L4ZA 1Y4ZA 2PZKA 2Q5OA 1WHSA 4GZ6A 3I5XA 2UZIR 1F8YA 1XEXB 1AGNA 2NO4A 3MFQA 4MRSA 5ISMA 3QXJA 2VNIA 2C4NA 1NFQA 2C61A 3M6IA 4E1VA 1CRPA 3GGSA 2HU2A 4ZO6A 2ST1A 4JSRA 2YC4C 4FFBA 5EWMB 5ELXA 3HEAA 1FDRA 1P75A 1ZGZA 3JQ6A 4QUIA 2Y3IA 4ED9A 3A6PC 2D4HA 5AVXA 1Q0RA 4BO2A 1LWOA 2NLOA 2QY6A 3CUKA 4MULA 1XMJA 2XF8A 5AKZA 3CR7A 4K6HA 3TG8A 1UJ4A 3DE4X 3EXFA 2WT4A 4FE3A 1NSYA 2BGWA 2P4QA 1PGQA 4DY6A 4YO7A 1P4JA 4QXRA 5AKGA 2X40A 1SVOA 4FKMA 4KAXA 3X0DA 4BLVA 1X14A 2F1RA 2ZYWX 1WCYA 2WEKA 3IVRA 4EO4A 3QBJA 1XYYA 4ER3A 4PYNA 4K88A 1PJZA 3ROXA 1LX6A 3WGGA 2XEDA 2QNIA 4HMOA 4F4UA 1Z2DA 1R8XA 4KDFA 3ZIDA 1Z8HA 2GHRA 3ZI7A 5FOTA 2CLIB 1E7RA 3O95A 1Q50A 4EG1A 2Z6QA 1VYVA 1EA5A 3OZ7A 3B3GA 1J5XA 2O50A 4B46A 3GG9A 3CLTD 1LW7A 3I9MA 2ZTHA 4Q47A 3JWJA 4WOJA 3NDBB 5CAEA 1W35A 1BW9B 3IMCA 3OU7A 3GLGA 4HY3A 4MGYR 4PG6A 2ZG6A 1OFHA 3KOUA 3Q1KA 1FBTA 4HPXB 3A1UA 3ISVA 4ZANA 3UFXA 4ABYA 2XZDA 3S1LA 3T3EA 1VPLA 3L0CA 1YZYA 3L6EA 5CB8A 4UU8A 1SIWA 2IOQA 4PS1A 2IZ5A 2QRNA 1YQEA 4QNMA 1RKUA 4UHFA 1Q95A 4UM8B 3LUBA 4Z53A 3B53X 3IHTA 1HSZA 4PR3A 2OLKA 4AP6A 3GAFA 2CFTA 5JO9A 4UAGA 4E07A 3SDBA 1ETUA 3MM4A 3V1TC 5BN5A 2GVNA 1JA9A 1Q5PA 2HM7A 3IKLA 4REOA 5BW8A 3O9MA 1ZIXA 1CY4A 3D4LA 4ZJYA 3RREA 3B3FA 1TL7C 1IHUA 1FL9A 3I6QA 5EKUA 2WP0A 3MMSA 2QVXX 3TXXA 1GZ4A 3M4YA 3SF8B 1DO2A 3U9TA 4LF6B 2A92A 2B69A 5EZ5A 4XTCS 2QW8A 3WO0A 2DKFA 2EDAA 4AIIA 2ZXUA 3P2JA 1UP4A 4NVRA 4BVGA 2ZFUA 2XUFA 2KW5A 3D6FA 5CNIA 3ZWXA 3L5KA 3PPWA 3OECA 2CZCA 2Q6VA 5FUBA 1WVMA 4ARAA 4P6VF 4R83A 4RULA 4EDHA 1CJKC 2O48X 2IHYA 2QE6A 4KPUA 2QVBA 2F1OA 3QKSA 3SC3A 4G9BA 5H59A 4ZDJA 3H5AA 2X8WA 4MVCA 4AJOA 4GX5A 1N2HA 1TCBA 5EHGA 3UKJA 4KQ9A 4LHVA 2J4FA 2MJLA 3D5EA 2DCUA 3TAUA 3KTAB 2PGLA 2ZJFA 3GFOA 2QN8A 4R3UC 2WV9A 2GPYA 2JEZA 4MPDA 3WKEA 3H7IA 3NM5A 4ZIRB 2PSFA 1OCEA 3AF6A 2OLJA 3JZAA 4X6LA 1I6LA 2HHJA 1BS1A 5GOZA 2PX0A 4L57A 1MB2A 4CIDA 4RSGA 1DTSA 5DISB 4BO9A 2WF5A 3AFHA 2V3WA 4DQXA 4TRNA 3EIFA 1XU7A 3LOUA 1A9ZA 5AVWA 3RS9A 2ONYA 4OG2A 3SYRA 3FPJA 2IXDA 3CRQA 3CVXA 2J5KA 3O8CA 1NRXA 5AJWA 5CB6A 1QWSA 3HGMA 5CXSA 4EG4A 4LX0A 4QNRA 3TBHA 3GMTA 5EINA 5L7YA 1E8MA 1OPXA 4INOA 3HXKA 1AQYA 4NE7A 5F12A 2JVIA 4RKQA 5JHHB 3DFFA 5B2ZA 1BMTA 4UHHA 3ESDA 1IQ0A 1XAIA 4NBRA 1H9AA 1YO6A 3LGSA 3DDHA 2NT3A 3GVCA 1IN1A 3IQZA 5G4LA 5I47A 4PX3A 4A26A 5EI5A 1N4DA 3HJCA 4OQFA 5E9QA 3EHEA 3WY9A 4CM6A 1QRRA 4O5AA 1EK2A 4I6JA 4KAAA 2VUIB 4C89A 4G36A 1P2BA 3RW9A 3C3YA 1GADO 3REOA 1TUBB 3W2IA 4Z8YA 1JAXA 1Z13A 2F67A 3BL8A 3HU5A 3V3TA 4ZI7B 5HCUA 1HXHA 4YDRA 1B23P 4RGVA 1PZEA 4XM0A 4D8XA 1NDUA 2K5UA 2PGDA 2RGXA 1KAHA 2GEBA 5DP1A 2CXOA 4YNBA 2XZTA 2ZE5A 4FYIA 1WXIA 1CHNA 2MU1A 1WSBA 2VYFA 3CNHA 2UUBB 3BGWA 1H65A 4C2TA 2PMEA 2IZ0A 2JLCA 3MWEA 3QW2A 1COZA 2W6JA 2D8MA 3G0BA 1FMCA 4HQFA 1XZFA 1LDEA 3KEGA 4M7WA 4M53A 1QG6A 4MV3A 4RWEA 4EGSA 1RI2A 3AKZA 5MHTA 5FX2A 2XTNA 3FTQA 4OQPA 3ZU2A 1UEIA 2QOEA 2F3TA 3RASA 4WN9A 3RFCA 4ENVA 4GDFA 1U0RA 2A59A 2VAMA 4DBZA 3H6GA 2ESRA 4YP6A 3SBXA 1KIMA 4DTCA 1FDWA 1NBMD 4UEWA 1JAZA 3R7BA 2PUFA 3RKSA 3RIYA 3PX7A 2Q5IA 4BLQA 5K0GA 4PAMA 1TPZA 2XHZA 2BMDA 2CK3A 2R65A 2EQAA 3U81A 2AB0A 2OBFA 2BLLA 3GT7A 3RFXA 2BI4A 3KAKA 3PLAE 1JFRA 3IGFA 4R1TA 1YQTA 3JYOA 3G7SA 3MUNA 4I5FA 3F9IA 2B5OA 4ID9A 5TPWB 2REOA 1GQQA 1I8TA 4C03A 4K8RB 4O2LA 1XV5A 3BTUA 4O33A 4DR3B 5KYWA 4ALIA 2RHDA 2XA9A 1SRRA 3MWDB 4ON9A 4WXEA 3QPBA 4RD2A 2ANCA 1OH5A 3I28A 3QXSA 1P91A 3JAKB 3TZCA 4ASUD 1Q3KA 3QU2A 4AMVA 1J2JA 3ZXIA 1LA2A 3FBWA 3VNAA 2OUKA 3E5NA 1QTQA 3T6KA 1ZZEA 1YA6A 2IOYA 2WJAA 4PC2A 3RM3A 3TDNA 1I3NA 2FSUA 5FPQA 1SXJC 2AD5A 3OE7D 2DKOA 1NDHA 2DVMA 5GONB 5JMPA 3VVCA 5E1OA 3UWOA 4ZO7A 4QG3A 2IUSA 1BX3A 1W581 3NX4A 1MTZA 4ZCIA 3EVTA 2ABWA 3JD1A 2VT6A 1X9GA 3KJNA 1N6LA 1GT91 1ZOSA 1P4GA 4G5GA 5DBGA 2R8RA 2J0SA 1GARA 3K0AA 4JVLA 4L0MA 4LOIA 3GK3A 5HKAA 2B98A 3TW6A 5HW0A 3EGEA 1N5DA 3KX2A 2ZRKA 1GYPA 3EMVA 1E2LA 5B1IA 1RTTA 2BPOA 1V8PA 3B51X 2MYTA 1QCCA 3UA4A 1I36A 2FPUA 3HRIA 3NATA 2A4MA 3PICA 4GBED 1O57A 4P9NA 4EG8A 2WD7B 5EN4A 1TLLA 1GP2A 2OZEA 3D31A 4ICIA 5DM70 1JHZA 3TCXB 2BISA 4NYMR 1OBOA 1H4QA 2Q6IA 1VBNA 3JPYA 3F7TA 3L7LA 4TVBA 2PTGA 3U9LA 3GRFA 1EDDA 4LMPA 2PRIA 4JQOA 4P4UA 1RWMA 1B8PA 5EUBA 1W2GA 1CJTC 3KJZA 4H7JA 3PQFA 1DBRA 2ROQA 5ILQA 4KWEA 4CKZA 1JJAA 2Z8ZA 5JNWA 1JHQA 1ZOPA 2HA5A 2QXYA 1VM6A 1Q0LA 2WJPA 3V2IA 1ZK2A 2NUTB 4I36A 4MUBA 3RJZA 4A5SA 2NU9A 5BN3A 1JU3A 3HFRA 4DL9A 4HHEA 4P54A 1QDEA 4JYPA 4OD0A 1GY8A 1VCIA 4MZDA 1VGVA 1NV9A 1E3LA 2YJ5A 2ZYTX 3AEQA 4F4DA 1K6MA 6ABPA 1GGHA 3LK6A 1F5SA 4JWTA 4LOKA 2GF9A 2HYIC 4U2CA 4LJ9A 3BIXA 2ADOA 4BN5A 5J4KA 1U3DA 1DTWA 3W3AA 4LY6A 4OM8A 3GDOA 2WJHA 3H4IA 3LLVA 2FH5B 2RBGA 4LYAA 3X2EA 2QG9A 3DKRA 4EFDA 4RF5A 5LYJA 1X13A 4BS9A 5IAAA 1GTSA 2P7HA 4WA8A 2AYXA 2E4VA 2GNPA 3JZIA 1IFXA 1HZZA 4CR8A 3TL3A 1RWVA 4IXTA 4Q4AB 2ECFA 1IVNA 2O2DA 2HXYA 4ESOA 2XDYA 1W25A 5BOSA 4C4TA 4YMTA 1A5SB 4JNCA 3ZKWA 2V7WA 5CVEA 1HFWA 5EP3A 4ALKA 3HZRA 5AUPB 4Y18A 4CIBA 1U7OA 1N33B 2NUPB 2PNJA 4OHRA 2IYQA 1T9GS 2V55B 4DR7B 2WI8A 2Y77A 4LSZA 3MGKA 3OHPA 1QGZA 2ZW9A 4S1OA 3REQA 3ZWQA 2CNBA 4IF6A 5TQVA 4YT2A 3S27A 2ES4A 1VTKA 3BSSA 4HB2A 5ES3A 2QTBA 1CK4A 1CUEA 4B6SA 4LBYA 1U7TA 2HQBA 2HXSA 1JEYA 1WCIB 4XLLA 5EOVA 3FW1A 5DE3A 1N3YA 4JGIA 1OFTA 4K6OA 5JIBA 4UARA 1Z4NA 5AP9A 4S1WA 2GJ8A 1M83A 2XRFA 1Q16A 3A1DA 1XXHB 1Y3FE 4GSLA 3LY7A 3RC3A 1KNXA 1YU9A 4OAPA 2CUKA 3SSAA 4GU5A 4Z2AA 3O7MA 4WINA 1T9CA 2XGMA 4W1PA 3QE9Y 2X7JA 4E5MA 2HA0A 5IXYA 3GU3A 2CMKA 2JEYA 5F77A 2FEPA 4GIBA 5KAMA 1J42A 3VMMA 4WGGA 1LC0A 1LJLA 4O1HA 4UZFA 2BMJA 1N0UA 4MEBA 5AW0A 1PAUA 3IP9A 4WAUA 3EGXA 2BKVA 3A4VA 4HFJA 5GVSA 1U6JA 4P0QB 3UB4A 1SELA 1SZDA 2R7NA 2OLEA 3UO8B 1PD0A 2XF2A 1JZSA 3OA0A 2FX5A 4PQEA 1GNLA 1T0UA 4ML3A 4FNMA 2QG4A 2Z08A 3UXEA 1PZXA 1JQAA 1LZKA 1E2EA 1KH1A 1US8B 2QF7A 4E5NA 3A9SA 3I01M 2Q3LA 3KJFA 3IFSA 3MBOA 3M4XA 1T3LA 4QD3A 3PGA1 5FWAA 4DPMA 1IN8A 3T4PA 4LF9B 5AM1A 5CX4A 3UTCA 5LU9A 2QRHA 1IAQA 1DAGA 1ENPA 3F8TA 3IAM1 1QF9A 4D25A 1EEHA 4IFBA 4BEBA 2VYVD 3GLIA 4ZT3A 4MCAA 4P3YA 3VH3A 1PFGA 4CV1A 1B16A 1EX6A 3NLLA 5A4AA 4UUPA 4N6NA 4N65A 5AMXA 1NA5A 4LTDA 3ZWMA 4IG4A 2HHCA 5TF4A 3L1UA 5CEJA 1P9LA 4LFBB 1QX3A 2IEZA 5C1IA 3H3JA 3T1YB 1RHJA 3I6MA 4FUTA 4H77A 3IPLA 4MLPA 4DLZA 2H3HA 4U0KA 2VHWA <